2ETEA

Recombinant oxalate oxidase in complex with glycolate
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
201
structure length
201
Chain Sequence
b'SDPDPLQDFCVADLDGKAVSVNGHTCKPMSEAGDDFLFSSKLTKAGNTSTPNGSAVTELDVAEWPGTNTLGVSMNRVDFAPGGTNPPHIHPRATEIGMVMKGELLVGILGSLDSGNKLYSRVVRAGETFVIPRGLMHFQFNVGKTEAYMVVSFNSQNPGIVFVPLTLFGSDPPIPTPVLTKALRVEAGVVELLKSKFAGGS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Oxalate oxidase 1
publication title Structural and spectroscopic studies shed light on the mechanism of oxalate oxidase
pubmed doi rcsb
source organism Hordeum vulgare
molecule tags Oxidoreductase
total genus 47
structure length 201
sequence length 201
chains with identical sequence B
ec nomenclature ec 1.2.3.4: Oxalate oxidase.
pdb deposition date 2005-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00190 Cupin_1 Cupin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2eteA00
2ETEA 2GH2A 1RL3A 4L11A 1DGRA 4LTAA 3E5XA 1ZZBA 3CEWA 1IPKA 4X6RB 4IEPA 5BXXA 4YRDA 1QWRA 2ATFA 1YWKA 4HLTA 1OMIA 3IWZA 1YFUA 4XFFA 2UYBA 1UCXA 3KGZA 1I5ZA 3PNAA 3RZZA 3H3ZA 4KWJA 1ZZ7A 2H6CA 4EV0A 5FQ0B 2FMYA 2XKOA 4NVPA 1LR5A 2B8MA 5JAXA 2IXIA 2D5HA 1X8MA 1QXRA 2D5FA 5HI0A 1WGPA 4WVZA 3KGLA 2WFPA 3WW4A 1CGPA 3D0JA 1UIKA 4IEWA 4BHPA 1HW5A 2EVXA 4I02A 5FQ0A 4F7ZA 5FCCA 3DN7A 4YARA 4XF1A 4MUVA 1YLLA 4LLOA 5EFUA 2PAMA 3KSCA 4E2QA 3ACLA 3RDIA 3OTFA 1ZRDA 2BYVE 2VECA 1IPJA 3I54A 3RYKA 1SQ4A 4IEOA 5LRSA 3E5UA 1Q43A 3FFQA 4LUMA 3UKTA 1ZZ6A 2PHLA 3NJZA 1O3RA 4I3PA 4ZU5A 5CU1A 4FAHA 3H1WA 4I01A 4E2GA 3D82A 5KHGA 1RUOA 4XETA 3RNSA 3TNPB 4Z82A 3IBMA 4PIXA 3B02A 3SCHA 3QOPA 3U0ZA 4XFHA 2O1QA 3TNQA 5I0RA 2OPKA 3NVCA 4PJYA 1ZRFA 2N7GA 4QM9A 4JTNA 5LRRA 4R52A 1O3TA 2HKXA 2XLGA 3E5QA 5KHHA 4P9GA 1EP0A 1VR3A 3OF1A 4O9GA 2K0GA 5K8SA 4MGIE 4I0AA 1CX4A 2O8QA 1ZZ8A 4J1WA 2MPFA 2Y0OA 1VJ2A 5I0SA 2PTMA 3H1YA 4JV4A 1J59A 1O5UA 3UKNA 3ST7A 3WW3A 4Q0UA 3GBFA 2VQAA 3BCWA 3DKWA 4MZUA 1O4TA 2EAAA 4FBFA 3NL1A 5D1IA 5C6CA 4KU8A 1X82A 5JSOA 5EZWA 1UPIA 4A2UA 4B29A 4MGKE 4QGLA 5I8SA 3HT1A 2H0VA 5KHKA 3S0MA 5I91A 2PHDA 4FAGA 1YFWA 3H7JA 4QGNA 1PM7A 3CJXA 4IEVA 1O5LA 3L2HA 3SHRA 1OI6A 1RC6A 3E6CC 4H7LA 2BNMA 1WLTA 3FZ3A 5I0TA 4EROA 1YUDA 4OLLA 4XF3A 1FT9A 1J3RA 1UD1A 1NXMA 2PQQA 4HSJA 3LA2A 3ROUA 1FXZA 3I7DA 3BALA 2V09A 2PAKA 2EA7A 3E6DA 3LWCA 4PIZA 5CADA 4DINB 4LA3A 4Z07A 3MYXA 4IEQA 4AXOA 2K9ZA 3UKVA 3G7DA 3E97A 3IIAA 5KHJA 1DGWA 1X7NA 4IEZA 1UW8A 1ZZ9A 1J58A 4N9IA 5BV6A 3NKTA 2WC2A 2CAVA 4AVCA 4AQ2A 4HVQA 3MZHA 2CGPA 2GZWA 1V70A 4HZFA 5KHIA 2XGXA 4IESA 2PAEA 2HJIA 5FPZA 4XEZA 4ORFA 5T3NA 4BH9A 1DZTA 5JSRA 5BY5A 2QCSB 3LOIA 3QACA 4HN1A 1YFXA 2QJVA 2ZKLA 4J1XA 3BB6A 1WA4A 3FJSA 2OYZA 1YHFA 3ELNA 3H7YA 1GQHA 1ZRCA 4Q0QA 1Q5OA 3M3IA 1I6XA 1LB2A 3CL1A 1CAVB 3SMHA 4LEJA 4AQ6A 5AVPA 2GU9A 2XHKA 4LUKA 1PMIA 1L3JA 1H1IA 3EJKA 4FT8A 5FLJA 4XFIA 3EBRA 2KXLA 2GAUA 3OCPA 2XL9A 2Z2SB 1CAVA 3OD0A 4I09A 2Q4SA 1EPZA 4YYOA 1J3QA 2UYAA 2IC1A 3PVBB 4XF4A 4EWEA 5BUVA 2IXCA 5I0UA 1O3QA 3U10A 4YNIA 3N4MA 2ZCWA 4LULA 3RYPA 1Q3EA 4HMZA 4XFCA 1ZZCA 2GC0A 1ZX5A 5F1RA 4MV2A 4XFBA 2OZ6A 3NW4A 2B9UA 3GYDA 1Y3TA 4EWAA 3LAGA 5E16A 2GC2A 4I0BA 1ZRRA 3NSTA 2OA2A 4XFGA 2IXHA 1CAWB 3RPQA 3KMHA 1O7FA 3EO6A 4F8AA 5KBFA 3EQEA 3H3UA 3ZDSA 4HVRA 4UBHA 4K8FA 1YFYA 4X6QB 4KWLA 2CV6A 2IXLA 2Z69A 5I93A 1SEFA 4KWKA 1LRHA 3S7IA 5CVRA 2H6BA 3FHIB 4QX5A 1CAWA 4HBNA 2XLAA 4BYYA 4XF0A 4AVBA 5LEKA 2BNNA 3VHRA 3DL3A 1H1MA 3FE5A 5J48A 1QY4A 3RYRA 3S7EA 4CYDA 4R8HA 1RTVA 4QGMA 3WW1A 5J3UA 5I8TA 1U12A 1XE8A 3LA7A 1EY2A 4IEUA 3CLPA 1OD5A 5FPXA 1SFNA 3BU7A 1ZREA 1XE7A 2E9QA 3I59B 1O3SA 5FLIA 5J7MA 3E6BA 3H8UA 4BIFA 5I8YA 3HIFA 4L2NA 2BGCA 3H50A 4WZCA 4XFAA 4TLFA 2ET7A 2Q1ZB 2B5HA 4XF9A 3HQXA 5E1RA 2PFWA 3I59A 4Q29A 3FX3A 4OFGA 1NZCA 1DZRA 3ES1A 1ZNPA 3M70A 3USSA 4Q0SA 4ZU4A 2I45A 4QMAA 1ZVFA 1J3PA 4LA2A 3H1MA 4PIYA 1OFNA 4WBBA 1CAXB 2ET1A 3IDCB 2VPVA 3IDBB 4AVAA 4GULA 4IETA 2MHFA 2PYTA 2DCTA 3LZZA 3CO2A 4KU7A 2QDRA 3C3VA 2QVSB 4JTOA 2QNKA 2MNGA 2CAUA 4D7SA 1XRUA 4N9HA 4JVAA 4UBGA 4MH0E 1J1LA 3DV8A 4Q0VA 1CAXA 1CAUB 1UIJA 2BNOA 2IXJA 2Q30A 3SXWA 1G6NA 3CF6E 2D93A 4UXAA 1JUHA 3ETQA 5JR7B 4MGZE 4ZU7A 5JCTA 3HT2A 4IEXA 2XLFA 4RD7A 4O9EA 2OZJA 3LA3A 2GC3A 4KL1A 3PLQA 2D40A 3EHKA 1QXJA 1CAUA 3R6SA 2IXKA 1NE6A 4ONUA 3WW2A 1RGSA 5C8WA 4HVOA 1EYBA 3OGJA 5LEJA 2P17A 4EWDA 4HSLA 5BPXA 3SCGA 4IERA 1LKNA 4MX3A 3O14A 1NYWA 2XKPA 4HN0A 4YSFA 3U11A 2FQPA 1GQGA 4E2SA 3JZVA 2PA7A 2C0ZA 3FWEA 1TQ5A 3BPZA 2BEOA 2UY8A 4Q0PA 2XL7A 5FLHA 3H9AA 3KCCA 3ES4A 4MGYE 4QXKA 4META 1X8EA 4QM8A 4D7TA 1FI2A 4IEYA 4I2OA 1RUNA 5JSPA 1Y9QA 3D0SA 3MPBA 5FDBA 3SCFA 2F4PA 1VP6A 2UY9A 1NE4A 2Q0AA 3MDPA 2GC1A
chains in the Genus database with same CATH superfamily
2Y26A 3C2UA 3WP5A 4YGDA 4L11A 2JDUA 5J36A 2ZPXA 4CVUA 4YWAA 2PLV3 4IEPA 2VZOA 1PGW2 4EN9B 4W6YA 3WF3A 3VBSA 4FOQA 4BJ0A 5DG2A 2XG3A 2J1EA 2ZGUA 2Z4FA 4S2GA 4U36A 4EZHA 3ZYHA 4P5YA 1SPPB 1I9RA 2R0FA 4XFFA 3B9CA 3T2OA 1QJU3 1DGWX 3O1UA 5K0UA 1QNYA 3PNAA 4EJRA 5C9AC 4Y1XA 3OGSA 5BNPA 4UAPA 2XHNA 4L0PA 3NKGA 2VW1A 2DUOA 3IIIA 2C9KA 4QWNA 5GJ6A 2J1VA 4XBLA 1QF3A 4NPRA 1IKPA 4ZZ8A 4OCTA 5DUVA 4D6RA 1RUI3 1CD3G 1LR5A 3MHZA 2ZGSA 2DCJA 1KFUL 4JZRA 4TN7A 3IKWA 4Y1UA 5JAXA 2UWCA 2WKKA 2CY6A 1ULFA 2IXIA 2VOVA 3O1PA 2D44A 2GN7A 4DUVA 3KGLA 3O1SA 2FDIA 2DWRA 4PLMA 3TN91 1AJKA 3D0JA 3VBFB 3ZYIB 1PGL2 3FHAA 1HQWA 2Z5WA 2DUQA 1W8NA 2ZGRA 3V64A 5JIUA 2F4LA 5FCCA 4LITA 1TEIA 4QPIA 2ZEZA 4MUVA 2ZS6B 3THTA 2PAMA 4Q8KA 1OVSA 4GMP1 2W68A 3ZR5A 4CRQA 5CG9A 1SACA 2PHUA 1SQ4A 2CDOA 4Q26A 2XJVA 4CPBD 3E5UA 2V4AA 3FFQA 5T5OA 3ZPYA 5LWBA 2JICA 4BXFA 3JD72 1UX6A 2VBBA 3U4SA 3UKTA 4C0BA 2DTYA 1KDKA 2ZTNA 2PHLA 3NJZA 5FBJA 4H2AA 3ZYFA 4KWUA 4I3PA 2R041 3OBZA 3OB8A 4YLZA 4QB2A 5FZDA 1BMV2 5A33B 1MQTC 2AH2A 1WCSA 2QQJA 5KHGA 4YFWA 1RUOA 2B4KA 3DEMA 2QFEA 4XETA 4YM1A 5IK5A 2JG8C 1JTZX 1S0IA 2Y33A 2HEYF 3IBMA 2JWPA 5FV3A 3U37A 2ZA9A 1JYXA 1GKBA 3B02A 3QOPA 4QDQA 5I0RA 2W1SA 1BYHA 1RUE2 3FBMA 4YM3A 4IL7A 1HB4A 4QM9A 4JTNA 4ZZ5A 4R52A 4NO4A 1O3TA 2HKXA 5ABJB 2VCAA 3AFKA 3E5QA 3BN6A 4EN8B 2VZRA 3HPNA 1ENRA 1F15A 1VR3A 4O9GA 4Q1PA 4AGRA 2JG9A 3KV9A 2ZX0A 5IUQA 5B4NA 4CZSA 1MZ5A 4MGIE 3FLTA 2DF7A 2VY0A 1W8HA 1RUJ2 1ZZ8A 3TN93 1QJX2 1ULGA 1W6PB 1AYN2 2MPFA 2VUJA 3QH6A 4N53B 3CJIA 5FP3A 1WD4A 1RHI1 2ARXA 1S0DA 3AKTA 1VJ2A 1LULA 3ACHA 1GWMA 1JBCA 1YJKA 2CL2A 4AEMA 3W5NA 1YQCA 4GMP3 4AGGA 3ZFGB 2PXJA 2Y0IA 3R4SA 3WW3A 1JZ8A 1RUH1 1QQP1 5J98B 4Q4X2 2XONA 4Q0UA 4CP9A 1LAJA 4O61A 1AHSA 2VQAA 4DY3A 3WDTA 1JYCA 1PVC1 5D1IA 2JENA 4OHWA 4CTEA 2C4XA 5C6CA 3I49A 5DN2A 1R081 2C9AA 2O14A 1O4YA 2AUYA 2R043 4A6SA 1MPXA 1W6MA 1XC6A 4UW6A 1BXHA 1VBE1 4QGLA 3HT1A 1MR5A 3QD6A 4MSVA 4GB32 4RGKA 5KHKA 5F7UA 4E27A 3UESA 4BPZA 2JKBA 2XJTA 1D0HA 4JKLA 1XNDA 4CCMA 3O1VA 2Y60A 1HXS1 3AMNA 3MV11 4QGNA 5G05L 4M00A 4RR3A 4AI3A 2R1DA 3DPRC 3MIGA 3VGIA 1NG0A 1ND2A 2QUOA 4LBQB 1VBA2 5FYSA 3AP9A 1COV1 3SHRA 3WG3A 1E5SA 1SFPA 3WZ1A 5IVCA 1DP0A 3A23A 1R1A1 4IDZA 5FP7A 4C8DA 1SDDB 4CDXC 2WNVC 3B7MA 2DVAA 2P3JA 1OH3A 1UD1A 5JOZA 1LENA 2PQQA 1BBT2 5JDBA 1OFSA 3I7DA 5FWEA 4FTSA 4FTEA 2FZ1A 3QH7A 2BRTA 2X5IC 3H8RA 1GV9A 1OUSA 1NA1C 1RHI3 4UFIA 4LHKA 1K3IA 4KGGA 3WXPA 2BFUL 2WS92 1IQAA 4DXZA 3OJBA 5TSWA 3WINE 1YO8A 4CDWC 4DINB 3KF3A 4JGYB 4OI1A 3O1MA 3K4DA 2HLEA 2R072 4XDOA 5LBCA 1KQRA 3PUAA 4HKWA 2Q8EA 1RUH3 2WFF2 1QQP3 3MIBA 2IVJA 5FZEA 1UOFA 4CEWA 1YJLA 2W46A 1MS0A 4IEZA 4BQ3A 4XJZA 1J58A 2WO3A 4NJ4A 4XW3A 4YVWC 1PVC3 3HR9A 4OULA 1E5IA 1VRBA 4XOGA 3ZN6B 1R083 4UWDA 1HN0A 1OKOA 2CU5A 4Q8LA 2B7YA 2C24A 5A3MA 1RUG1 4G9SB 2GZWA 3OUHA 1VBE3 2EAKA 3I3QA 5DDJ2 3I2OA 4M0HA 5KHIA 2B42B 1EV11 3RJRA 1JMUB 2HJIA 4ORFA 1DZTA 5GLVA 5HV0A 5HPOA 3LOIA 1LODA 2QJVA 1NCRB 1HXS3 1RMU2 4H14A 4J1XA 2VZ1A 2G4IA 4LBMA 4OMCA 1COV3 2V5YA 2BU9A 1R1A3 1CAVB 2Y6JA 4Y3OA 2GU9A 1CJPA 4CUAA 5FYBA 1XNTA 2E7AA 4AI2A 1A34A 1NY71 1GZTA 4MGSA 2XJUA 2BWAA 1N1VA 4UW5A 3S5QA 1H1IA 2YU1A 4FPYA 4V1PA 4QHOA 2P34A 3O0VA 2PMWB 3AMPA 2WZ8A 4YPJA 4CUBA 5IW0A 3NNMA 2E63A 4NIIA 4CUGA 1C5IA 3QBQA 3ZYBA 4GA9A 4BCUA 3NO8A 2WYSA 2EIDA 5A33A 1D4VB 2BQPA 4XBNA 5C3QA 2R7EB 2IC1A 2RDNA 1N3OA 2YB7A 5CG8A 4Q27A 2D98A 2HWE2 3VUOA 5A6XA 3PIGA 5FP4A 1TME1 3LSDA 4Y20B 1JZ2A 3KQ4B 1O3QA 1OOPB 4MYEA 3T0BA 2P6CA 1RUG3 4QX2A 2W39A 4LULA 4QPGB 3T2PA 5CEHA 5ABJA 4QXHA 4CXYA 4C90A 5B2GB 3IAPA 4XFCA 2GC0A 3ZXAC 1EV13 2XMLA 1AL0G 4OZOA 4AF9A 1AR62 2A75A 4RYDA 3WNXA 1DYOA 3SLIA 3KF5A 1LESA 3M4FA 4CCOA 2R061 3S30A 1Y3TA 2DCYA 1OLMA 2V4VA 1W6PA 3JQXA 4YVSC 1VLNA 2Q8OA 3J8F1 1LU2A 3UJOA 4BA6A 1NCQA 5E16A 1NOVA 4RFRB 4WVWA 4EZ4A 4I0BA 1PO22 2J7MA 3NSTA 3S57A 1S4CA 2OA2A 2RS11 1MZFA 2IXHA 4NRPA 3RPQA 1AR92 3ZFGA 4BDVB 3EO6A 2WA4A 4DOUA 2GMEA 2XVLA 2JIJA 3HD8B 3WG1A 1G9AA 4AAXA 2YGMA 4X6QB 2EF6A 5FYZA 2X09A 2A71A 1GUIA 2W92A 2Q8CA 2ZGNA 4CDUB 3AK0A 4QU2A 5M0TA 1WLWA 1LHWA 2W1WA 1BVVA 5IHRA 1E57A 1LRHA 1PNGA 4AHZA 1IG3A 1LOGA 2SLIA 3GZTB 3PJYA 2ZMNA 5FZ9A 2DVDA 1RXGA 2JDKA 3KLSA 4QX5A 3TEYA 1H8TC 2XLAA 5A70A 2VZPA 4XF0A 1WD3A 4XTPA 4W50A 1JOBA 5FZ4A 4QD2A 3FLRA 1G8WA 1SG3A 1MVEA 2BNNA 4FOWA 3VHRA 5FRAA 1DIWA 1TME3 1QY4A 1T6BX 1HN1A 5JPNB 1B35B 1AL22 1Q8VA 1DLLA 3BKZA 1IZ3A 2YBKA 1RTVA 4IV3B 4XURA 3TOJA 3DXUA 5J3UA 2QQMA 1XE8A 4LK6A 1EY2A 4IEUA 4BQ1A 3K4AA 2HWB2 5L7OC 1JZ6A 5LB6A 2VO5A 3BU7A 1ASJ2 2WLQA 3T0AA 3UGFA 4AI8A 1HQLA 5JVVA 3BOWA 4N7IA 5CB7A 4P02B 1LNSA 2R063 1OH4A 5FLIA 4AYUA 4DUWA 2ARAA 3H8UA 2GNTA 1BEV1 1V0AA 4AVVA 3J8F3 4NHKA 4B7EA 3H50A 4GWJA 4LO4B 1A8DA 2ET7A 2QZ2A 1SBFA 4IW3A 5DAPA 4XXAA 2RS13 1HDKA 4BLIA 1XU2A 2B5HA 2DFCA 4HL0A 3ZN4A 5C3OA 4LE3A 1O59A 4ZPIA 2VMFA 1LECA 3ON7A 1UYYA 4QX0A 4ZS3A 1DDLA 5E1RA 2PFWA 3ACGA 4Q29A 2GNMA 4IE6A 4M4RA 2YHJA 4XJ9A 5H9RA 3WV6A 4UFMA 2XQXA 2LS6A 3AYDA 4FFHA 5J1XA 2JG8A 2VMHA 2HWF2 1I5PA 1CX1A 1J84A 4WBBA 1GZCA 1V9U2 5FZ0A 1GFF2 3RI9A 3NV3A 4GULA 2MHFA 1HRI2 3K2OA 1C3HA 2DCTA 3AMMA 2QQOA 3LZZA 5HV4A 4RHV1 2QDRA 5LBBA 2VTXA 2W94A 5LW9A 2HEWF 3MIEA 2XH6A 4R9AA 4AZZA 3HNMA 3WY6A 5FY7A 3AM2A 4G3YC 4Y24A 5APAA 3T1LA 4BQ2A 5I0DA 3W9AA 5BNOC 4G4FA 2C1FA 1CAUB 1NKGA 3R0RA 3ME2A 3WQ7A 2Q30A 1UQXA 5D8AC 3SXWA 5FYTA 1I1EA 4Q4Y2 5L73A 4UXAA 4QQHA 3ETQA 1DHKB 5GLZA 1Z0HA 4YZ4A 3KVAA 5CNAA 1BEV3 2LW8A 4EYUA 2ZGTA 2YC4A 3SKVA 2BZDA 4RD7A 3J7NA 2OX0A 4O9EA 1ULCA 4CP1A 1OPOA 1N47A 3PVEA 3EHKA 1KRIA 4R4XA 1NQDA 1QIQA 2YFZA 4XIOA 3P3PA 3R6SA 2IXKA 1NE6A 4IE4A 4ONUA 5T5JA 3VBOC 2PLV2 3WW2A 4JQTA 1RGSA 2VUDA 2VL4A 4N43A 3OD4A 4LO8A 3OGJA 2DUPA 3NAPB 4Y1VA 4GZ9A 4DNYA 2WN2A 5K7PA 5FK8A 2VNRA 1VAMA 1UOJA 4Y22A 4K9SA 1PMJX 3SCGA 4IERA 4QPGA 4LIVA 4TZDA 3DUIA 1LKNA 2JDMA 2YFUA 1NYWA 5BNNB 2YUEA 3WVJA 1SLIA 3GDBA 4LHLA 4W6WA 5DMYA 3DPRA 2PA7A 3FWEA 5F3CA 2XVGA 1W2AX 3X29B 4JKKA 4AI0A 1WCDJ 4RS5C 4RHV3 1GNYA 1W39A 4L99A 1LOFA 2JDAA 5FLHA 3THDA 3IMMA 3I2JA 1W05A 1RUI2 2A1XA 1WZXA 1DYKA 4DO0A 5D2AA 3ZSJA 3AYEA 1H9WA 1JU3A 1FI2A 5FZ1A 4I2OA 4YM2A 5ANNA 3T4VA 2C26A 1Y9QA 3Q8FA 3WT3A 2W08A 5EYYA 1TG7A 4FVVA 3ZR6A 4PLNA 3SCFA 3VBSB 5FDBA 2J22A 2WSUA 4NAMA 3ACFA 4AFAA 1SFYA 2X5IA 2VOTA 1NA1A 1U0AA 1UZ0A 1RVF1 4TXWA 2VBDA 3HQRA 3Q8EA 5DUUA 1XYPA 5F6LB 3VDDC 5A3UA 2GH2A 1RL3A 3OGGA 3CZUA 4NPLA 4FPJA 4Q4W2 4QHZA 5K0UB 1R091 3OEAA 1BZWA 1LTEA 4N90A 5JXIA 2VULA 3VV1A 5BNPB 3CHXA 3UK9A 3K3NA 2DTWA 3BTXA 1LGBA 2DCZA 4GWIA 4HLTA 4JKMA 2VQUA 2A3YA 4YVWA 3UYJA 3WDUA 4GMP0 2D97A 4OHXA 3WG2A 5AFEA 1JH5A 1OMIA 2ZX3A 4HETA 4N8MA 3WF4A 1X33A 2RR11 3N35A 3PURA 3FBYA 4ARYA 3UL2A 1UU6A 1OVPA 5LZ6A 1UCXA 2W0XA 4FPKA 4NIHA 2Y6KA 4E4SA 3SC7X 2HWC1 4AEKA 3VBHA 2AEYA 5KC5A 1VE0A 4MG2A 2KR2A 3DKQA 3HN3A 4EV0A 4WM7C 5FZ7A 5LBEA 3JUUA 1HLCA 3MIHA 5G04L 4K7JA 2FMYA 5GZEA 2XKOA 4NVPA 4QPIB 2JEMA 3GZUC 5FZKA 3LKJA 5T52A 5C5UA 1JZ4A 1CONA 1SLLA 3VD4A 4IGQA 4L97A 4Y5Z0 5EYXA 1X8MA 1RXFA 1XSQA 1WGPA 4WVZA 5F5QA 2EXKA 1CGPA 4JHTA 5FKCA 4BHPA 4EE2A 4HT1T 2EVXA 2EXHA 4AEJA 3KHBA 1AR72 1W8UA 4XUOA 3T4HB 3QCWA 3VD9A 4IV1C 1JW6A 3LFMA 4OMDA 3RMYA 3TN92 5ACA1 1YLLA 2BDRA 4LLOA 1UY2A 1W9WA 2D43A 3KSCA 1RVF3 3ACLA 4O7XA 4PQQA 5FYHA 1MZEA 2BYVE 2VECA 4NWWA 4XC9A 4XVHA 4KG8A 1NX9A 4MADA 1DQ5A 5F2WA 4CUCA 1R093 2P3KA 1UWWA 1YEWA 4YW5A 3T3YA 3RWKX 1K5MA 2JE9A 1QJFA 1ZZ6A 1L7QA 1VB4A 2QQUA 4IXLA 3ILFA 3RZKA 1PZ8A 2DVFA 4Y5TA 3TWIA 1ND3A 5DAVA 1FV2A 3VKNA 1XE0A 3ALQA 4S2FA 5AFBA 2MEV1 1I3HA 1GQPA 1ZRIA 4I01A 2XDVA 4TSVA 4QB6A 1YQ6A 1YRZA 2RR13 1JZ5A 4LBOA 2XBO1 3RNSA 3TNPB 4Z82A 1WCKA 3HAGA 2AEZA 4COVA 2W5FA 3N7KA 2PQSA 2HWC3 2WL1A 3SCHA 4CDQC 4LT5A 2BERA 1KS4A 3W59A 3AFGA 2VM9A 3CJIB 5A7QA 5CKMA 2Y6LA 2N7GA 3ZXDA 4JCKA 3B00A 4HXCA 2YG0A 2YMZA 3VKFC 3GCWA 3WCSA 3N9PA 1O8PA 3J4UH 4LO6B 4YVSA 3USUA 3TRSB 5JI7A 3U75A 4C1WA 1PO11 4XUTA 1MS8A 1V6OA 2GALA 2K0GA 3VBFC 4LJHA 3GM8A 2JE7A 4CP9B 4XMAA 3ZFEC 5FZ8A 2RS31 5IVFA 1X9TA 1GP6A 3VBRC 1CX4A 3GALA 2B45X 2VW0A 2WT0A 2O8QA 3N7LA 4GH4A 4CCCA 3K4ZA 1DU3D 1RUC1 2Y0OA 2WO1A 1FATA 2LROA 1OF3A 4EN0A 2PTMA 1BVP1 1LEDA 2AGSA 2CHHA 1GP4A 1V00A 3D5OA 3GBGA 4JV4A 5ACA3 4OI0A 3KHCA 3LF7A 1J59A 3UKNA 4UT5A 1RHI2 3J7LA 1XYOA 3MBWA 3NAPA 1ZBA1 1JUIA 1GZ9A 5A32B 3LIGA 4MZUA 3A0NA 1O4TA 2EAAA 1AX1A 2NYYA 3FN9A 3NL1A 2ZHMA 3M8LA 4RR3B 5L9RA 4ASMB 1RUH2 1ULDA 1IS6A 1QQP2 1X82A 2WYFA 3HBZA 1ND2B 1YI7A 4IE5A 2QE3A 4LE4A 4BQXA 5CISA 5JSOA 2HWD2 3IPVA 4D6QA 3ZVXA 2MEV3 3LQCA 4MGKE 1PVC2 2DYCA 4BQYA 1PMHX 3JB8A 4DB5A 2YYOA 1RIRA 2H0VA 1H0BA 1QEXA 2VZTA 4FPEA 2XBO3 3M3CA 5DAXA 1AXYA 3S0MA 4ZKTB 3WDYA 4QX7A 4Z1VA 1VBE2 3RZLA 4FAGA 4Q1RA 3H7JA 5L7OA 1CIYA 1J1TA 1AUYA 2VNOA 5B4XA 2BW8A 3GJAA 4MO3M 3L2HA 3PL0A 4LBQD 4ATEA 5CFCA 1AJOA 1OI6A 1W6NB 3ZFFB 1CR7A 1W8WA 4H7LA 5IT6A 1REFA 2YPJA 1OQEA 2RE9A 4P14A 1JU4A 4UF0A 1IGOA 2TEPA 5FZOB 3D8CA 5J09A 1PO13 4RSUA 1IS5A 1YUDA 3PVNA 4LK7A 4OLLA 5CKQA 4N53C 5CBLA 2ZEXA 1MS5A 1O4ZA 3K77A 2RS33 3MV01 4CEWB 1W8OA 1FXZA 3BALA 3E6DA 4RGGA 1RUC3 1RJ7A 4EQVA 4PIZA 1GWKA 2WABA 1YI9A 2VMCA 5T55A 5JI9A 3KZ4C 3MYXA 3WX5A 4AXOA 3O7OA 2K9ZA 2DU1A 3G7DA 1LHNA 2NMNA 3GCXA 1ZBA3 4KBBA 4P9LA 4A4AA 3FL7A 1QJY1 1X7NA 4YW3A 1DLCA 1QHDA 1TMF1 4WM8C 2RMU1 4X8PA 1NLQA 3NKTA 4LKEA 3MUY1 2WC2A 2EIGA 3ZXLA 2FDJA 3MZHA 5JOXA 3ZYRA 5LBFA 3ITQA 4LPLA 2VNGA 5IAVA 2BUKA 2CYFA 1UYPA 4J25A 1HQNA 1V70A 1S55A 4HZFA 1W06A 3AKPA 5FMDA 4IESA 4M3CB 3ZYPA 3H0OA 3QLQA 2LALA 1ZBE1 3ENRA 4M4PA 1RUG2 4KGQA 4XEZA 5KWRA 5JSRA 1PVXA 5BY5A 4MHRA 2ZGKA 4NHMA 4DEVA 5BNOA 2ZKLA 4TLGA 3BB6A 4HOOA 2OYZA 3FJSA 1IG0A 1OLQA 3H7YA 3KM5A 1DGRN 5EIYB 1F8VA 1VBC2 4Q0QA 4NWVA 4AE2A 2VW2A 1SBEA 4A42A 1I6XA 2ZGLA 4DXTA 4LEJA 4AQ6A 1UZWA 2ILMA 3PIJA 3VB9A 3WHUA 4KI5M 2IZWA 1J83A 1Z7S1 5LATA 3BIEA 1RUF1 4CP0A 3CNAA 1R64A 4XDPA 3G6JB 2L9LA 3VBOA 4ITCA 1NY72 1AXZA 3AZVA 1VBD1 1DFQA 2XOMA 3GZEA 3ECQA 3OGRA 3A22A 4IGPA 4QHBA 4MGTA 2GAUA 1LOEA 2NMOA 2A6VA 3N36A 2QTWB 2Q8DA 3LE0A 3OD0A 2HYKA 1GU3A 1EPZA 4CEYA 2D7FA 1J3QA 2UYAA 4FOYA 3NJXA 3AZWA 3PU8A 5E88A 1QJY3 1GSLA 4I30A 4P08A 1MEC1 4AEDC 1TMF3 1X9PA 5GALA 2RMU3 5BUVA 5L9VA 4CU7A 1UU5A 2JDYA 5FK7A 3M1HA 5IVEA 2C6SA 4FFGA 4AOCA 3VL9A 3NNFA 1NCQB 3N4MA 1Q8QA 3RYPA 4CU6A 2WQZC 3W58A 5F5CA 1FV3A 1WUVA 3EMRA 4A7YA 1NCRC 1ZYBA 4UW4A 4BQ5A 4ES8A 2RS51 4LKDA 1DQ1A 2FDFA 1ZBE3 5FY0A 4IGOA 3VKMA 3J9SA 2WZR1 1MACA 1WMXA 1W3XA 2FDKA 2W3JA 1SLBA 4EWAA 4RL7A 3H8XA 3POGA 3BTAA 5C7GA 2WT1A 1CZVA 3CMGA 5E89A 3I2KA 1PIV1 1W99A 3ZLIA 1LOAA 1ACCA 5FP8A 5A3NA 2P4EA 2WLPA 2VOXA 4QQ2A 2WWSA 1O7FA 1XQNA 2R6QA 3I97A 3RS6A 3ZDSA 3ZMOA 1GZWA 1Z7S3 5FY1A 4UBHA 1RUF3 5A32A 4FP3A 4RQPA 1JOJA 3M3QA 4KWLA 1F5JA 1ULOA 3ZKUA 3I3DA 2EICA 2IXLA 2Z69A 5I93A 1OKQA 5EV7A 4AG4A 4A7ZA 1VBD3 1SEFA 5AC91 1FX5A 4M0NA 1PX4A 4AWDA 3AXEA 5CVRA 5J96B 1S0CA 2Y6FA 3MUZ1 1IS3A 1CPMA 1N3PA 1MS3A 3OYWA 5SV8A 5KXDA 1CAWA 1YQ2A 2VNVA 4HBNA 5CYYA 2X29A 4JGZA 2K2SA 1NLSA 2YROA 4YW1A 3LOBA 1HV1A 4AVBA 4IE0A 3TYJA 5LEKA 4ZS2A 1MEC3 1JODA 5JOWA 1U5IA 5GLWA 1FAYA 3EYPA 1SBDA 5A80A 4CYDA 5LA1A 3Q8CA 3KV6A 4DFSA 4NAOA 3O0WA 4HFSA 1W6NA 3ZFFA 5L36A 1OF4A 2RV9A 3WDWA 2RS53 3JBG1 2ZEYA 5FZOA 3CLPA 2FBEA 5A6QA 4A3ZA 2YC0A 3WP4A 3OG2A 1N3QA 1SFNA 1X36A 4E8CA 2DV9A 1WBFA 2QZ3A 2WZR3 3R4UA 4P5HA 4QPYA 5A3WA 1WA6X 3RJ2X 1VRH2 2D3RA 4Y5SA 1WMFA 2WQ4A 3E6BA 4JQRA 3TB0A 2OVUA 4IV1A 2CWSA 1GNHA 1OA4A 3HIFA 1FYUA 5EHDA 1JS9A 2WUHA 1PIV3 4AHYA 1JOPA 4WZCA 4L8QA 4XFAA 2JG8B 1SDWA 4KNCA 3C8XA 4URTA 3B01A 1BEV2 1PZ7A 4YFZA 4CDUC 1LEMA 3JCIA 4XBQA 4XF9A 2VZVA 3HQXA 3I4IA 3HJRA 1H4GA 4B7KA 4B4PA 5IK8A 2XWBB 2FHRA 3TEXA 2G9FA 3FX3A 3POFA 4OI4A 1EAH2 1FNYA 2OT7A 4ISRA 5FY5A 1PGL1 3ATGA 4PF5A 5AC93 2HBTA 5FZGA 5K4LA 3INAA 4ES9A 4E9KA 1V6KA 1QU0A 2VVDA 5CA6A 3N9NA 4V2VA 1AYM1 3AL6A 1CESA 4HKLA 2ET1A 4M3CA 4CDQA 3ZXEA 2F17A 1ST8A 2AZ5A 2Q1FA 2PYTA 1IS4A 4PBOA 4IV3C 3JD71 3PUQA 3C3VA 2Z79A 1W8ZA 3FHQA 2QNKA 2VJXA 3MO4A 1H1AA 4UFJA 4RHV2 4N9HA 4JVAA 2BVBA 4MH0E 4MGQA 1YCIA 3ZFEA 2CNAA 1CAXA 3JBG3 3KQRA 1SLCA 2VCBA 5C8CC 1QH6A 1G6NA 1UZYA 3DECA 5FMOS 2QQLA 4N43B 2GMMA 4ZXEA 1AVBA 3RVHA 4YM0A 5C3RA 4QXCA 4GD4A 1HKDA 2OS2A 3WQBA 1RUE1 3VBUC 1AR81 3AVSA 3FUOA 3LDRA 1GNZA 4ASKA 3PUSA 5JCTA 4IEXA 1JYVA 4HANA 4Y22B 4BZ4A 3LA3A 2GC3A 5KC6A 3UNPA 5A1FA 4JC1A 5A6ZA 3PLQA 3LB9A 4AFDA 5EXOA 2WWUA 1IOAA 1FOD1 2BBAA 3P3NA 3OY8A 3AYCA 3MLJA 4AI1A 5C8WA 3DPRB 2ZEWA 3UGHA 2Y6HA 5FMCA 1HX6A 1RUJ1 1VPHA 2ADEA 1QJX1 1AYN1 4QKBA 1QDOA 5HCFA 1IKQA 4IE7A 1WMEA 3JXSA 1SCSA 2A3WA 2WNVB 2VQTA 2BOJA 1JHJA 3ILNA 5F39A 4MX3A 1AYM3 4GQ7A 4YSFA 3U11A 5L19A 4BQ4A 1WW7A 4L9BA 4Q4X1 1HV0A 4E2SA 3JZVA 4DXSA 1G9DA 3GBWA 1TQ5A 3K48A 4Y33A 3WSOA 4MXWA 2X5IB 3JD73 1UXZA 1NA1B 3POWA 3KWVA 3RGBA 3HVDA 1FPN2 3KCCA 2YV8A 1O91A 5JR2A 1IHMA 4BLJA 4QXKA 1HJGA 2Y8KA 2ES3A 1DQ2A 1X8EA 3OBRA 4META 5FWJA 5JWPA 1RUD2 4IEYA 4B8EA 1WCQA 4GB31 1V6IA 3LEMA 3PDQA 3TAYA 3MPBA 1RUNA 5C9AA 1VB2A 2F4PA 4WVVA 4YVWB 5IK4A 2UY9A 1NE4A 1S0BA 3LFIA 4XDQA 4E4HA 4DY5A 5A7WA 1RUE3 2NP0A 1AR83 2YY1A 3LD8A 4LTAA 1BHGA 1FMD1 1ZZBA 3E5XA 4QKFA 2EALA 2E7TA 1F2NA 5BXXA 3VBHB 5E6HA 4FFIA 1PK6C 4BWOA 4ASLA 1FOD3 5CAZA 5IK7A 1R092 4JDOA 1OC1A 3N9MA 3WCRA 2ZKNA 5CFDC 1BBT1 2WDBA 2DVBA 4LR4A 1LGNA 2ERFA 2CDPA 3IWZA 1RUJ3 2DBIA 4LLFA 1DCSA 1QJX3 1AYN3 3AP4A 3E1F1 1YFUA 1UL9A 1GBGA 1PM4A 4C1XA 1AZDA 4KG0A 1LOCA 1XNKA 3T09A 3VZLA 2DCKA 4QU1A 2FCUA 3APBA 2RR12 3H3ZA 5FUIA 4KWJA 5HCBA 1US2A 2H6CA 1UKGA 2R071 2WFF1 5F8PA 4Q4X3 2BWCA 2HWC2 2HH9A 2Y34A 4B1LA 5LCWL 2AR6A 5JMCA 5FPUA 1P8JA 2J1UA 4XUQA 2UURA 4D8MA 2B8MA 1T2XA 5DAQA 4DEQA 2AREA 2FCTA 4Y4RA 1G9CA 3ILRA 1HRV2 2D5FA 1JYIA 3VBSC 5HI0A 1MQTA 3MLKA 3AP6A 4NHXA 1K5MB 5GLTA 5DDJ1 3RFRA 3D4KA 3NRUA 4DQAA 4IEWA 5A3PA 1H6XA 1DQ4A 1VMFA 3F95A 1HW5A 4GB33 4I02A 4P9JA 4OHYA 5FQ0A 1ND3B 5FZ6A 1KDMA 3GHNA 1JYNA 5K0UC 3DN7A 3JU9A 4PDWC 4YARA 5GM0A 2BP6A 2FZ2A 4U2AA 1W90A 2BVVA 2DFBA 3NNLA 3OTFA 5A7PA 2O0OA 1ZRDA 4COYA 1IPJA 3JB4C 4QDSA 1JYWA 1IPSA 2E26A 3POSA 5ACA2 2A5ZA 1FMD3 4R4ZA 1Q43A 1VBB1 2R49A 2RJKA 4AGVA 5AVAA 1S0JA 1ONAA 1GOFA 3RZMA 5H9QA 3KV5A 4LXLA 1O3RA 4OUMA 2XJQA 4Z2AA 4MVTA 4AEDA 5CU1A 1BBT3 1QOTA 4FAHA 3H1WA 4A41A 3USUB 4OYUA 4YVSB 5FFOC 3T2TA 1L7LA 5ANQA 3WQ0A 4CPBA 1RINA 4CXXA 2CSGA 3HNYM 3V0BA 4GH4B 4A45A 4QPIC 3ZXFA 2XBO2 4XFHA 2O1QA 2GSYA 1UMZA 2R073 2OPKA 4W8JA 2GP3A 2WFF3 3FFZA 1XXNA 3MF9A 4FPFA 5FYMA 5LA2A 5LRRA 2HWE1 1W2OA 2J1AA 4UFKA 2A6WA 3VKLA 5GZGA 3J7MA 1WLCA 5KHHA 2ZHKA 1EP0A 3OF1A 4P9GA 3PMSA 4YW2A 5A6YA 3KB5A 5C4WC 5K8SA 4XPVA 3RQ0A 1PHMA 3LPFA 1S0GA 1HB2A 4D94A 1XPWA 2VD7A 5H9SA 1LOBA 1CJDA 4LO5B 1K42A 1PO12 5FO8B 2J1SA 5DDJ3 4J1WA 1OT5A 4XHXA 4QQOA 2WNUC 4GWNA 5D21A 2BGOA 2GNDA 1QJU2 5CZKA 1AR61 3IPVB 4MOAA 4UYBA 1BJQA 3H1YA 1S0FA 2VR4A 1WLDA 2TUNA 3MW3A 4PQ9A 2ADDA 4HK9A 1PZ9A 1A78A 1HIXA 1RUC2 2D6LX 5T54A 1WW5A 2JD9A 3T2QA 3GBFA 3DKWA 3BCWA 1VBB3 3VZJA 4CDXA 4FBFA 5L7OB 2WNVA 1H6YA 4LKSA 1V6MA 1ZBA2 2JD4A 3K3OA 4I3GA 1AR91 3CIHA 2Q5TA 4KU8A 2OUHA 4Y26A 5EZWA 5CFCB 3J7HA 4UW3A 2JG9C 3ZN5A 1CZTA 1CQ9A 2IFWA 1YNAA 3W20A 5I8SA 4UF0B 5A1AA 3NV1A 4XJ8A 2TNFA 1UY3A 3V56A 3AXDA 3CJIC 1BQPA 4WVMA 2OQ7A 5I91A 4CDWA 3I2FA 5FBZA 4R9DA 5JZGC 1PM7A 1JYTA 3CJXA 1W2NA 1VAVA 2SBAA 1O5LA 5FY9A 2JDPA 2VVEA 2VVFA 3AZYA 3HNBM 1RC6A 2ARCA 4LBKA 2HWE3 2E6VA 4YW7A 2BNMA 2JECA 3B93A 2XJRA 3FZ3A 4XABA 4LOTA 4EROA 3P5BA 5EJ3A 4XF3A 4NUBA 3VD5A 4Y4YA 4CP2A 4AFMA 3LA2A 4E4DX 4NROA 2RG4A 2Y64A 2V09A 2PAKA 1C1LA 4GJZA 3P1IA 2EA7A 2HWB1 3DYOA 2EIEA 3LWCA 5FZHA 1AR63 1QXPA 1ASJ1 5CADA 3U4XA 4JAAA 4LA3A 2VH9A 1GOHA 4M3CF 2RJ2A 4Q4V1 1UAIA 1D2SA 3M3EA 5FYUA 4Z07A 4OHZA 2CWMA 3MICA 2XVKA 1UW8A 1ZZ9A 2KD7A 5BNOB 4INDA 2BFUS 2H0BA 5FY8A 5IVYA 3DF0A 4N9IA 3SEPA 5BV6A 3ZIXA 5HXMA 3LEKA 2CAVA 1AR93 2YZ4A 5LY2A 5KXBA 1ODMA 3LPGA 5FP9A 4HVQA 3AKQA 3C7HA 4FPLA 4XZUG 1TMF2 5C5TA 2P37A 2VMEA 2RMU2 3EXUA 2JDHA 3WD5A 1VMHA 5DZFA 1D7PM 2VBPA 3KS7A 4CU8A 4ET7A 1D4M1 1APNA 5FPZA 1OURA 5FYYA 2XPJA 4LOSA 2A6YA 4SBVA 3I2IA 1YFXA 1OSGA 3B5LB 4XQ4A 1X50A 3KCYA 2HWF1 5KXEA 3MPPG 1WA4A 2PHFA 5A1LA 1YHFA 4R9BA 1ZBE2 1GQHA 3VDBA 3VBOB 3RWNA 1V9U1 4DS0A 1W6OA 1UF2C 1Q5OA 2NM1A 5BNQA 1CN1A 1HRI1 3WOGA 3WEZA 2DDUA 1LB2A 1F4AA 2ZZQA 3F2ZA 3VBUA 4AI9A 1S2EA 3CL1A 1SHWB 4QT6A 2BGPA 3SMHA 3AB0A 1G7YA 4W6XA 2RVAA 3VD3A 4L92A 3B69A 3AYAA 4CEYB 5CKNA 3AX4A 2XHKA 2R042 3GF6A 1WW4A 1W2TA 1L3JA 2BTVC 1SMVA 3BGAA 3LEGA 4IQPA 5FKBA 5FOBB 5GLUA 1VIWB 1ZA7A 3AKRA 1Z7S2 2HWB3 2QQNA 3EBRA 1RUF2 4QDRA 1W04A 1ZA4A 1UKRA 2KXLA 4Q4Y1 1ASJ3 2XL9A 3OCPA 2R30A 5T5LA 4NIDA 3WUDA 4Q4V3 1DYPA 2Q4SA 3N7MA 2CTVA 4QQLA 2F6BA 3WP3A 3SH4A 4P9XA 5IWFA 2V5DA 3FUQA 2VOWA 2VZQA 1M4WA 2WO7A 2WZEA 4XHBA 3ZX7A 4E2QA 5FXWA 3PVBB 5FO9B 4EWEA 3ACIA 1URXA 2IXCA 1GYKA 3POEA 2RDRA 1GANA 2BPA2 4HK8A 3U10A 2VTXJ 2VMDA 2VE1A 1MEC2 4YNIA 2ZCWA 4LKFA 2JX9A 5DUWA 1GR3A 4HMZA 4YZ2A 4OUSA 4B1MA 4COZA 1KXGA 1D4M3 1AF9A 1NQJA 4MV2A 1GZWB 5FXXA 4QQPA 1DBNA 4RQPB 4OHVA 2HWF3 4LBJA 2RS52 3GYDA 1H8TA 3P6BA 4RA0A 5IAXA 3PU3A 1V9U3 3LAGA 3JQWA 2WZR2 4PBPA 1HRI3 2GC2A 5IVJA 4XAAA 4Y1YA 2WT2A 2P6HA 4PCRA 4W4ZA 3IM0A 4XFGA 3OYWB 2PN5A 1B09A 1H2MA 2W87A 1CAWB 4FXKB 2UWBA 4JGZB 1R082 1PIV2 2XUEA 4RN5A 3EQEA 4HVRA 4NN0A 4K8FA 1PK6A 3FMGA 3WNNA 2RM21 4WM7B 4M01A 2LTNA 5ABJC 1A3KA 2NLRA 3M7AA 5F2SA 3S7IA 4KWKA 1W9SA 2UWAA 3RZGA 4A44A 3POJA 1WBLA 2QDNA 3LDKA 1LJ7A 3LGRA 4KMQA 4Q4Y3 1UZZA 5IFTA 3H8OA 5A7OA 3UT0A 1HXS2 3FHIB 1S2BA 1UN1A 1AX0A 4OZXA 1QJEA 1RITA 5FYIA 4BYYA 1COV2 3LCPA 3BODA 4Q4W1 3AP7A 4AK3A 1ENQA 1NCQC 4CCJA 3DL3A 4FTBA 2AC1A 1H1MA 1R1A2 3NJYA 3T30A 4FXGB 3RYRA 4XYXA 2D6KA 1QNWA 4IV1B 2W1QA 2TBVA 1NUKA 1XYNA 3ZFGC 3HN1A 4R8HA 5I8TA 1U12A 3BI3A 3VLBB 4ZY9A 2WBKA 5GZCA 3T1MA 1KD7A 1W6QA 5KR7A 3ZYGA 2ID4A 5FPXA 5A3TA 3D3AA 2JB4A 5JIAA 1ZREA 2YU2A 3D6EA 3MF6A 1O3SA 1S2KA 1Y9MA 3JBG2 1S0EA 2Z42A 3DGTA 2J1TA 2WA3A 4PDWA 3VHPA 4BIFA 1C8NA 1JZ3A 4L2NA 5FMBA 3WDVA 2W1UA 3WDXA 5HCAA 2Q1ZB 2ZX1A 3ZM8A 4D7YA 1CPNA 5LK7B 3LEIA 4CDQB 5HXVA 2WRAA 1SCRA 1U5ZA 3VDAA 3I59A 2RM23 2YPDA 5CIRA 1NZCA 4NE9A 5EP9A 1EV12 5IVVA 5D8AA 1ZNPA 3USSA 4OQ8A 4QKDA 4Q0SA 5E8AA 4GJYA 1AR71 1H2KA 4GXLA 3VL8A 1W2UA 2I45A 3K51A 4CCNA 4QMAA 1ZVFA 1J3PA 2PHXA 4NPMA 3H1MA 4N7UA 4AHXA 4Z92B 4PIYA 2VCMA 3ZFEB 1CAXB 1UXXX 1QDCA 5LK5A 3VBRB 3IDBB 4BMBA 4P9YA 4Q4W3 1DZQA 3ABZA 5EQUA 1BKZA 2D6PA 2GN3A 2ZGPA 2VMGA 5F37A 4NRMA 2VZ3A 1YC61 1AYM2 3C7FA 4KU7A 5F5AA 4BIOA 3C7EA 4JTOA 2BV4A 4JGYC 1W28A 4GKYA 1HJFA 1MZ6A 5C4WA 1UX7A 1XRUA 4JHZA 2G1MA 1OA3A 5GZDA 1UIJA 1FNZA 3OY8B 5FOJB 3IZOA 3CF6E 1G86A 5FXVA 4FPHA 2E31A 4B4RA 3OUJA 3T08A 2WNUA 2NZ9A 4XILA 2OIIA 3A7QA 4C91A 3DYMA 5JR7B 1W8TA 2ZGOA 4D69A 2OXBA 2E33A 5FJKA 3O1RA 2WWJA 3KCXA 2ORXA 3HT2A 3TEZA 4KL1A 4RS5A 4XUNA 3HMYA 1CVNA 3OEBA 4HPKB 4BMEA 1TME2 2B46X 1AR82 1C28A 1C8M1 1UNBA 2ENRA 3WP6A 3WNPA 1NZIA 4TYSA 3LSEA 3WUCA 1W8FA 1KJLA 4OI2A 4LNVA 2HYXA 3ZSKA 2ZXQA 4HVOA 3B94A 4MXWB 1EYBA 1FOD2 5LEJA 1UYZA 2O8OA 2CGNA 3H42B 4NR1A 1AR73 3IDEA 4XCBA 4FCAA 2IVIB 1UMIA 3CU7A 4XTMA 5F3EA 1KEXA 1LU1A 2JDNA 3BYWA 4QXBA 5A3OA 1UY0A 2R062 5FPLA 4P00B 3VDDA 1LCLA 2FMDA 3O14A 3SQOA 4COWA 2FDHA 3EB7A 1UPSA 2FD8A 1H8VA 1XB9A 3J8F2 3WR0A 4FO9A 5JZGA 1GQGA 5C9AB 4AHWA 5KXCA 2C0ZA 4QX1A 1OBNA 4CCDA 1QGLA 1UZVA 3RMXA 4Q0PA 4AFBA 2RS12 2Y38A 4S2DA 1E5HA 1K5JA 1GWLA 2XL7A 4PI2A 5A7WB 3H9AA 1N1TA 3RSJA 3AKSA 2HWD1 1YXWA 2XXZA 2DU0A 1QMJA 3ES4A 3L9JT 4QM8A 4N43C 1YIPA 1RB8G 2LM3A 1Y7BA 2LUWA 4XJWA 2J1RA 3O5SA 4Z8BA 5JUVA 5JSPA 2FDGA 2JB8A 3SEEA 4URAA 4YW4A 4WM8B 3VDCA 2R16A 1OOPC 3GNEA 3LIHA 4WZFA 2FCVA 2VTFA 4QPGC 4WM7A 1MS9A 2MNGA 2Q0AA 3MDPA 2PHTA 4IUGA 2VC9A 5FJHA 4A3XA 3V0AA 2ETEA 2LRPA 5SV5A 4A7KA 1DGRA 1PGW1 3CEWA 4QKNA 5ISLA 1IPKA 3AVRA 4X6RB 1ULPA 4YRDA 2ZOEB 2ZJCA 1C8M3 1QWRA 3PUHA 2ATFA 1FMD2 1YWKA 2NN8A 1LOFC 4OQ9A 4D6SA 3FLPA 3SKJE 2QQKA 3VZKA 1KITA 4PHZA 1QH7A 2RJLA 3GXUA 2W91A 2I2SA 2P3YA 3HWJA 1C4RA 4ATFA 2QQPA 3VZMA 2WNEA 2UYBA 4LHSA 4BXSV 3KGZA 1I5ZA 3PUIA 4E4ZA 2WINB 4CXWA 3RZZA 2PHWA 1UYXA 2B39A 1MQTB 1H2LA 1ZZ7A 2W2IA 5EJZB 1POV0 2ZBJA 3CKHA 3R4DB 4JDNA 5FQ0B 2YBPA 1MS4A 3PJQA 2GMPA 2GP5A 1GP5A 3J26N 5DPNA 3SNMA 5EWSA 2EIBA 2VU9A 4YGEA 1SPPA 1XNBA 3VN4A 3I8TA 3OBAA 3OOXA 1Y9GA 2D5HA 2HWD3 3MW4A 2A6XA 4KQ7A 1QXRA 2WJSA 3UGGA 3PHMA 1LHUA 1OHFA 4AQTA 2WFPA 3WW4A 1UIKA 4LBNA 5FZ3A 3AJZA 4HKOA 4F7ZA 4AEDB 1B35C 3N7JA 4XF1A 4AAPA 1YIFA 1H9PA 3AZXA 5EFUA 4CCKA 3VBHC 3RDIA 1YYNA 4GWMA 2G9GA 1VBC1 5GZFA 3I54A 4K1YA 2I74A 4OUEA 2XUMA 2HBUA 4QB1A 4XCAA 3RYKA 4IEOA 1BCXA 4S2HA 2XWJB 5FZLA 3MIDA 3URFA 3ZXJA 4LUMA 5LRSA 1CWPA 3V0BB 4TWTA 3VBFA 2A7AA 1BMV1 4YGBA 4GALA 4JRAA 3S6PA 4ZU5A 5F32A 1VBB2 3UJQA 1UO9A 3VBRA 2JJ6A 1UOBA 1SLAA 3N9LA 5LA9A 5LASA 3VD7A 4TTGA 2KA3A 5JXJA 5GKAC 4ZHNA 4QX8A 2OW4A 2EXIA 3AP5A 3D82A 4QAWA 3WNKA 4E2GA 1GOGA 4Q5OA 4COUA 3BTZA 3WF1A 5FZFA 3ZSEA 4FSJA 4PIXA 3U0ZA 5JMOA 1S1AA 4K21A 5FZMA 3TNQA 1F9KA 4MHUA 4B3NA 1ZRFA 3NVCA 4PJYA 1V6NA 4GAZA 3GHMA 4FOVA 4P9IA 3V65A 2ZACA 3MGUA 3VZOA 5FREA 2XLGA 5FZCA 1K5MC 5FPVA 2IFRA 4BM8A 4FQZA 3C7OA 4YG6A 4I0AA 1ND3C 3KV4A 2J42A 1W0NA 1HB1A 3MI8A 5C70A 4CDXB 3B3QE 4BQWA 4HPKA 2VUAA 2VCCA 1DQ6A 1N1SA 5FUNA 3N3HA 2E53A 1QJZA 3NV4A 5I0SA 1C1FA 1GICA 3MIFA 4KH9A 2JIGA 5HCHA 2NQYA 4XZPA 1MS1A 4EN7B 1O5UA 3BTYA 1DF0A 3ST7A 4ZONA 1VBC3 1OA2A 3K75B 4WVMB 5DAWA 5H9PA 2I07B 3CBNA 3SH3A 3TEWA 3WQ1A 3S5AA 4CDWB 5DQ0A 3ZMNA 4FQ4A 3ETPA 1F5FA 1H2NA 4LHNA 4DPNA 1BK1A 4N53A 4XAEA 3OSDA 1V6JA 1UPIA 2YDEA 4K3UA 2R0HA 2C5DA 2KM2A 3KD4A 4A2UA 3W5MA 4B29A 4XACA 4YZ3A 2DBNA 4GH4C 3ZOIA 3IN9A 2A73B 1D0GA 3U78A 4BISA 1OUXA 2ZMKA 1VBA1 2PHDA 2VMIA 3ZPOA 2A6ZA 5FO7B 3NQHA 2JE8A 1YFWA 5DXDA 3OPWA 3POIA 4IEVA 1RVF2 5HBAA 2GNBA 4XJAA 3NAPC 1Z78A 5F6KA 3E6CC 1V6LA 4WM8A 1WLTA 4XQWA 1WKYA 5I0TA 1Y43B 1UMHA 3THPA 2ARBA 1FT9A 1LGCA 1J3RA 1NXMA 4E8DA 5BNNC 3BUCA 4HSJA 1AX2A 2Y6GA 2ZZJA 4CE8A 2WS91 3ROUA 3DYPA 4DMIA 3BU0A 3RI8A 2G9ZA 4AR2A 4LBQA 2VZUA 3ZIWA 4K1ZA 5C33A 2VOKA 4LQRA 3U14A 2BJSA 5DG1A 1KS5A 2WQ8A 4NIGA 1TE1B 1D2QA 1UY4A 4K20A 2VG9A 4NHLA 3NJVA 5DZEA 1VRH1 2HEVF 3R05A 2D6NA 4IEQA 4BE3A 3UKVA 3E97A 3IIAA 1LHVA 5KHJA 1DGWA 3KT7A 1QKQA 3BOPA 5CFCC 1M06G 3A4UA 4Q4V2 1OQ1A 1PGSA 4YW6A 3GGLA 2W47A 3M3OA 5C8CB 2DVGA 5IYYA 1ENSA 5FIXA 4AVCA 1W6OB 4AQ2A 3IMNA 3H3LA 3MW2A 4M3CE 3RRDA 4K8RB 2CGPA 1WW6A 2WAOA 4NOTA 4PT6A 2G19A 3VBUB 5IVBA 4JGYA 1EAH1 2OPWA 1NAEA 1RMU1 2XB6C 2XGXA 3AMHA 3CDZB 2WAAA 5BNPC 2PAEA 2WR9A 5FZBA 5C3SA 1R1ZA 5T3NA 1WCUA 4BH9A 1VBA3 4XJUA 4F83A 1H30A 3LDBA 2QCSB 3QACA 4HN1A 1O8SA 3WLUA 4BB3A 1K45A 1TZOA 1D4M2 3ELNA 2W95A 2AACA 1ZRCA 2XQRA 3ZN6A 3U1XA 3NNJA 3M3IA 3ZSLA 1E5RA 2D3SA 4P9WA 5DUXA 2E51A 3OPZA 3KT4A 4AL9A 1POV1 4LIUA 4AVSA 1SLTA 2VXRA 1YQ8A 5T50A 1PX3A 5AVPA 3O1OA 4NRQA 1XBFA 4D3WA 1U5XA 3IDAA 4LUKA 4V2WA 1PMIA 3UETA 3WNOA 3ZYJB 2MEV2 5F5IA 4XMIA 1NCRA 2WS93 2PHRA 3EJKA 4FT8A 4DIQA 4LBLA 5FLJA 4LORA 3I3BA 4XFIA 2ZGMA 5FYVA 3ZSMA 2OKXA 4ARXA 2Z2SB 3VZNA 1CAVA 4FFFA 1VRH3 3ASIA 4I09A 2YXSA 2D3PA 4YYOA 5L9BA 2E32A 3ZXGA 2P1BA 2E7QA 5A3LA 1G9FA 1OLME 1OQDA 4HG6B 4OVEA 3THCA 1YQ5A 2V72A 1REEA 2K46A 3NV2A 4LMFA 4XF4A 2Q1MA 2ZAAA 1H8TB 2ZABA 4EN6B 5I0UA 3O0XA 1SZBA 3PTRB 1OD3A 5A7SA 4D0QA 4DZGA 3IAQA 3I3MA 1ODNA 1W0PA 1W9FA 2RS32 5IJRA 1KJRA 1DGLA 2ZHLA 3I2GA 1Q3EA 3WNMA 1STMA 1EAH3 5LA0A 4MLOA 4AFCA 1RMU3 1ZZCA 1ZX5A 5F1RA 4UI9L 1ALYA 4I0WB 4NIAA 4XFBA 2OZ6A 3NW4A 1PK6B 2B9UA 4BU2A 1EUTA 5FZAA 1XU1A 1PO21 1ULEA 3A21A 4Y20A 4H55A 5CFDB 2VAUA 1OOPA 2YGLA 1WWYA 2WIIB 4CEYC 4CA9A 2A3XA 2IWGB 5FR3A 3CQOA 5IATA 5F3IA 5FXZA 1ZRRA 3AMQA 2IUWA 3O1TA 3T0DA 1POV3 1C57A 1MVQA 4JX0A 2ZGQA 1FPN1 1L7RA 2VUCA 1ENXA 3KMHA 3ZXKA 4F8AA 2AENA 5K9YA 5KBFA 3H3UA 5FPBA 1QOOA 3WHTA 2RHPA 1YFYA 3Q8BA 3U07A 4DXRA 1RUD1 1TVGA 1LHOA 2QQWA 2W52A 4WV8A 4CSWA 2CV6A 3SH5A 4CU9A 2X53S 3MLLA 3DXTA 2X10A 1WMDA 4LO7A 1EPWA 5FTTC 2AYHA 2RM22 1Q8OA 2VGDA 5FAXA 1DQ0A 4X8NA 4UOJA 2H6BA 1W6QB 5FPAA 5DABA 3RZJA 1XJAA 1F35A 3PMEA 4XQDA 1AL21 2GH8A 4C0HA 3HEIA 4QPWA 5FZIA 4DRVA 1EUUA 1JXNA 1Y4WA 1Q8SA 3HQUA 2X8KA 2ORZA 2R1BA 3FE5A 5J48A 4CDUA 3VHNA 1RJ8A 3S7EA 3WNLA 3Q8AA 4PDWB 4FI9A 4QGMA 5LY1A 2BBVA 4RFT0 1OLRA 4MXVA 3WW1A 5BYNA 5JXHA 4RQPC 3LA7A 3NNGA 1G9BA 2OQ6A 2VQ0A 1REDA 4YGCA 4XUPA 1N1YA 1GLHA 2ZMLA 3OPTA 1OD5A 3OUIA 2XJPA 2JXAA 4RR3C 3AZZA 3SISA 3NMBA 1W9TA 2ZX2A 1ND2C 1JZ7A 1XE7A 2E9QA 2XJSA 3I59B 3N9QA 4RGAA 5ERLA 3A0KA 1PO23 2P5BA 5J7MA 1CZSA 1B35A 2P3IA 3AJYA 4FPCA 5D8AB 5FY4A 5I8YA 3RZHA 2PELA 3HBKA 4JGZC 2BGCA 2D6MA 4IV3A 1QJY2 1PNFA 4GIQA 2YC2A 4ISQA 3POYA 4TLFA 3GJBA 2VZSA 4JDMA 4B4QA 3N9OA 2A70A 2VXJA 4O65A 1FPN3 1O6UA 1VALA 1HRV1 5C71A 4HONA 1XSRA 4CCLA 4FPOB 3PVOA 4Q2FA 3BPSA 1RUD3 3BIWE 4OFGA 3WF2A 1DZRA 2WSVA 3ZFFC 1A6CA 5DZGA 5C8CA 1F31A 3ES1A 3M70A 3DCQA 3WG4A 4QX3A 4AQSA 4ZU4A 1NT0A 1POQA 5T5PA 4UFHA 5C4WB 4LA2A 4CEWC 4PF1A 3OGVA 3MEPA 1DG6A 1OFNA 2W9XA 4XXPA 2EXJA 2VPVA 1BK0A 3IDCB 4AVAA 1A8MA 4IETA 2WZPP 1AL23 1Q56A 5A7NA 1AXKA 2R32A 3I3EA 5JXGA 1XNCA 2WNUB 3CO2A 3VKOA 1W03A 3CZJA 4ZXKA 1GMMA 2QVSB 4BOWA 5FMOL 4K6BA 3SITA 1W3VA 2WN3A 3PTYA 4XIKA 5EJ1B 3VHOA 1BLZA 3RG0A 2CAUA 4J6GA 3ZO0B 4D7SA 3B9IA 4RS5B 5F3GA 1TNRA 5JPMB 4UBGA 3C7GA 2YBSA 4XE9A 1J1LA 3DV8A 4Q0VA 4H3WA 4KBZA 1VBD2 2BNOA 2IXJA 4FPGA 3NWKA 1W0OA 1W9YA 2UU8A 4PI0A 2D93A 1JN2P 1H4HA 5FYCA 1JUHA 1NXD1 2WNOA 3O12A 1CIWA 4CCEA 4YZ1A 4R9CA 3L2YA 3HOBA 2JDZA 2JG9B 4MGZE 4Y1ZA 2P2KA 4ZU7A 5IFPA 2X05A 1U5YA 3M2MA 3Q9OA 3AL5A 2OUJA 2XLFA 2RDSA 2V73A 2OZJA 2PLV1 5C3PA 3MFCA 2D40A 4A6OA 1QXJA 2QKDA 3I2HA 4NHYA 1CAUA 3VDDB 4YZ5A 4AW7A 3IB3A 2CGOA 2RDQA 1HRV3 5JOYA 1JI6A 5JZGB 3ZKYA 3OBTA 1F4HA 1C8M2 2BOIA 4F3JA 4Z2WA 4FP2A 1UOGA 2QQIA 2P17A 1XOYA 2D6OX 2JKXA 4AVTA 4EWDA 1QJU1 5FUPA 4DUXA 4HSLA 5F9TA 5BPXA 2XR4A 4YG0A 1KFXL 2B9VA 3I2DA 1KGYA 2ZX4A 1NLRA 4JRLA 3W21A 1XNAA 1ZM1A 1K12A 2XKPA 2ZAHA 3KVBA 1VAKA 4HN0A 2FQPA 3TBDA 5J37A 3BVCA 1W6MB 4PLOA 3GZAA 1UU4A 1HB3A 1RUI1 1US3A 4BK5A 3BPZA 2QQVA 2BEOA 2UY8A 3WF0A 2ZHNA 3IT8A 3MFAA 3K46A 1OPMA 3V0AB 5CFDA 3UV9A 4SLIA 1Q8PA 4MGYE 2QBXA 1RYYA 5EPAA 1VMJA 4D7TA 3KT1A 1IQDC 3FC0A 3ZDVA 1C5HA 4BK4A 3POBA 5BNNA 1OXCA 4GKXA 5JLVA 3D0SA 2DURA 5AC92 4H7MA 3AC0A 4YG3A 1QOSA 1TNFA 4UFLA 1VP6A 4NMIA 1UY1A 1T6GC 2WO2A 4W65A 1JHNA 3ORJA 4K40A 4DRRA 2GDFA 2NPIA 2GC1A
chains in the Genus database with same CATH topology
2Y26A 3C2UA 3WP5A 4YGDA 4L11A 5J36A 2ZPXA 2PLV3 4IEPA 1PGW2 4EN9B 4W6YA 3VBSA 4FOQA 5DG2A 2XG3A 2ZGUA 4S2GA 4U36A 1I9RA 2R0FA 4XFFA 3B9CA 1QJU3 1DGWX 5K0UA 1QNYA 3PNAA 4EJRA 5C9AC 4Y1XA 5BNPA 3NKGA 2VW1A 2DUOA 5GJ6A 4XBLA 1QF3A 4NPRA 1IKPA 5DUVA 1RUI3 1CD3G 1LR5A 2ZGSA 2DCJA 1KFUL 3IKWA 4Y1UA 5JAXA 2UWCA 2WKKA 2CY6A 1ULFA 2IXIA 2VOVA 2D44A 2GN7A 3KGLA 2DWRA 4PLMA 3TN91 1AJKA 3D0JA 3VBFB 3ZYIB 1PGL2 1HQWA 2Z5WA 2DUQA 2ZGRA 3V64A 5JIUA 5FCCA 1TEIA 4QPIA 4MUVA 2ZS6B 3THTA 2PAMA 4Q8KA 4GMP1 2W68A 4CRQA 5CG9A 1SACA 2PHUA 1SQ4A 4Q26A 2XJVA 3E5UA 3FFQA 5T5OA 3ZPYA 2JICA 3JD72 1UX6A 3UKTA 4C0BA 2DTYA 1KDKA 2ZTNA 2PHLA 3NJZA 4I3PA 2R041 4YLZA 1BMV2 5A33B 1MQTC 2AH2A 1WCSA 5KHGA 1RUOA 4YFWA 4XETA 4YM1A 2QFEA 5IK5A 2JG8C 1JTZX 1S0IA 2HEYF 3IBMA 2ZA9A 1GKBA 3B02A 3QOPA 5I0RA 1BYHA 1RUE2 3FBMA 4YM3A 4IL7A 4QM9A 4JTNA 4R52A 4NO4A 1O3TA 2HKXA 5ABJB 3AFKA 3E5QA 4EN8B 1ENRA 1VR3A 4O9GA 4AGRA 4Q1PA 2JG9A 5IUQA 2ZX0A 4CZSA 1MZ5A 4MGIE 3FLTA 2DF7A 2VY0A 1RUJ2 1ZZ8A 3TN93 1QJX2 1ULGA 1W6PB 1AYN2 2MPFA 2VUJA 3QH6A 4N53B 3CJIA 1WD4A 1RHI1 2ARXA 1S0DA 3AKTA 1VJ2A 1LULA 1JBCA 1YJKA 2CL2A 4AEMA 4GMP3 4AGGA 3ZFGB 2Y0IA 3R4SA 3WW3A 1RUH1 1QQP1 5J98B 4Q4X2 4Q0UA 1AHSA 2VQAA 4DY3A 3WDTA 1JYCA 1PVC1 5D1IA 2JENA 4OHWA 4CTEA 5C6CA 1R081 2C9AA 1O4YA 2AUYA 2R043 1W6MA 4UW6A 1BXHA 1VBE1 4QGLA 3HT1A 1MR5A 3QD6A 4MSVA 4GB32 5KHKA 4E27A 4BPZA 2JKBA 2XJTA 1D0HA 1XNDA 1HXS1 3AMNA 4QGNA 4M00A 4RR3A 4AI3A 2R1DA 3DPRC 3MIGA 3VGIA 1NG0A 1ND2A 2QUOA 4LBQB 1VBA2 3WG3A 3AP9A 1COV1 3SHRA 3WZ1A 1R1A1 4CDXC 2WNVC 3B7MA 2DVAA 2P3JA 1UD1A 5JOZA 1LENA 2PQQA 1BBT2 5JDBA 1OFSA 3I7DA 4FTSA 4FTEA 2FZ1A 3QH7A 2X5IC 1GV9A 1RHI3 1NA1C 4LHKA 3WXPA 4KGGA 2BFUL 2WS92 1IQAA 4DXZA 3OJBA 5TSWA 3WINE 1YO8A 4CDWC 4DINB 4JGYB 4OI1A 2R072 1KQRA 4HKWA 1RUH3 2WFF2 1QQP3 3MIBA 4CEWA 1YJLA 4IEZA 1MS0A 4XJZA 1J58A 4XW3A 4YVWC 1PVC3 3HR9A 4OULA 4XOGA 3ZN6B 1R083 4Q8LA 2B7YA 5A3MA 1RUG1 4G9SB 2GZWA 1VBE3 2EAKA 5DDJ2 4M0HA 5KHIA 2B42B 1EV11 3RJRA 2HJIA 4ORFA 1DZTA 5GLVA 3LOIA 1LODA 2QJVA 1NCRB 1HXS3 1RMU2 4H14A 4J1XA 2G4IA 4LBMA 1COV3 2V5YA 1R1A3 1CAVB 2GU9A 1CJPA 2E7AA 4AI2A 1NY71 2XJUA 2BWAA 1N1VA 4UW5A 1H1IA 4FPYA 4V1PA 2P34A 3O0VA 3AMPA 2E63A 1C5IA 3QBQA 4GA9A 4BCUA 3NO8A 5A33A 1D4VB 2BQPA 4XBNA 2IC1A 1N3OA 5CG8A 4Q27A 2D98A 2HWE2 3VUOA 1TME1 3LSDA 4Y20B 1O3QA 1OOPB 4MYEA 1RUG3 2W39A 4LULA 4QPGB 5ABJA 4C90A 5B2GB 4XFCA 2GC0A 3ZXAC 1EV13 1AL0G 4AF9A 1AR62 2A75A 3WNXA 3SLIA 3M4FA 1LESA 2R061 3S30A 1Y3TA 2DCYA 1W6PA 3JQXA 4YVSC 1VLNA 2Q8OA 3J8F1 1LU2A 3UJOA 4BA6A 1NCQA 5E16A 1NOVA 4WVWA 4I0BA 1PO22 3NSTA 2OA2A 2RS11 1MZFA 2IXHA 3RPQA 1AR92 3ZFGA 3EO6A 2WA4A 4DOUA 2GMEA 2XVLA 3HD8B 3WG1A 1G9AA 2YGMA 4X6QB 2EF6A 2A71A 4CDUB 2ZGNA 3AK0A 4QU2A 1WLWA 1LHWA 1BVVA 1E57A 1LRHA 1PNGA 4AHZA 1LOGA 2SLIA 3GZTB 3PJYA 2ZMNA 2DVDA 3KLSA 4QX5A 1H8TC 2XLAA 4XF0A 1WD3A 4XTPA 4QD2A 3FLRA 1G8WA 1MVEA 2BNNA 4FOWA 3VHRA 5FRAA 1DIWA 1TME3 1QY4A 5JPNB 1B35B 1AL22 1Q8VA 1DLLA 1IZ3A 1RTVA 4IV3B 3TOJA 5J3UA 1XE8A 1EY2A 4IEUA 4BQ1A 2HWB2 5L7OC 3BU7A 1ASJ2 2WLQA 4AI8A 1HQLA 5JVVA 3BOWA 4N7IA 5CB7A 2R063 5FLIA 4AYUA 3H8UA 2GNTA 1BEV1 4AVVA 3J8F3 4NHKA 4B7EA 3H50A 4LO4B 1A8DA 2ET7A 2QZ2A 1SBFA 4XXAA 2RS13 1HDKA 4BLIA 1XU2A 2B5HA 2DFCA 4HL0A 3ZN4A 4LE3A 1LECA 1DDLA 5E1RA 2PFWA 4Q29A 2GNMA 2YHJA 4XJ9A 5H9RA 3WV6A 3AYDA 2JG8A 2VMHA 2HWF2 4WBBA 1GZCA 1V9U2 1GFF2 3RI9A 3NV3A 4GULA 2MHFA 1HRI2 1C3HA 2DCTA 3AMMA 3LZZA 4RHV1 2QDRA 2HEWF 3MIEA 2XH6A 4R9AA 3WY6A 3AM2A 4G3YC 4Y24A 3T1LA 3W9AA 5BNOC 4G4FA 2C1FA 1CAUB 3R0RA 3ME2A 3WQ7A 2Q30A 5D8AC 3SXWA 1I1EA 4Q4Y2 5L73A 4UXAA 4QQHA 3ETQA 1DHKB 5GLZA 1Z0HA 4YZ4A 5CNAA 1BEV3 2ZGTA 4RD7A 4O9EA 1ULCA 4CP1A 1OPOA 1N47A 3PVEA 3EHKA 1KRIA 4R4XA 1NQDA 4XIOA 3P3PA 3R6SA 2IXKA 1NE6A 4ONUA 5T5JA 3VBOC 2PLV2 3WW2A 4N43A 1RGSA 3OD4A 4LO8A 3OGJA 2DUPA 3NAPB 4Y1VA 4DNYA 5K7PA 2VNRA 1VAMA 4Y22A 4K9SA 3SCGA 4IERA 4QPGA 4TZDA 3DUIA 1LKNA 1NYWA 5BNNB 2YUEA 3WVJA 1SLIA 4LHLA 4W6WA 3DPRA 2PA7A 3FWEA 2XVGA 3X29B 4AI0A 1WCDJ 4RS5C 4RHV3 1W39A 4L99A 1LOFA 5FLHA 1RUI2 1DYKA 3ZSJA 3AYEA 1H9WA 1FI2A 4I2OA 4YM2A 1Y9QA 3WT3A 2W08A 5EYYA 4FVVA 5FDBA 4PLNA 3SCFA 3VBSB 2WSUA 4AFAA 1SFYA 2X5IA 1NA1A 1U0AA 1RVF1 5DUUA 5F6LB 1XYPA 3VDDC 2GH2A 1RL3A 3OGGA 4Q4W2 4FPJA 5K0UB 1R091 4N90A 1BZWA 1LTEA 2VULA 3VV1A 5BNPB 3UK9A 2DTWA 1LGBA 2DCZA 4HLTA 2A3YA 4YVWA 3WDUA 4GMP0 2D97A 4OHXA 3WG2A 5AFEA 1JH5A 1OMIA 2ZX3A 4HETA 1X33A 2RR11 3N35A 3FBYA 3UL2A 1UU6A 1UCXA 2W0XA 4FPKA 4E4SA 2HWC1 4AEKA 3VBHA 5KC5A 4EV0A 4WM7C 3JUUA 1HLCA 3MIHA 4K7JA 2FMYA 5GZEA 2XKOA 4NVPA 4QPIB 2JEMA 3GZUC 3LKJA 5T52A 1CONA 1SLLA 4L97A 4Y5Z0 5EYXA 1X8MA 1WGPA 4WVZA 5F5QA 2EXKA 1CGPA 4BHPA 4HT1T 2EVXA 2EXHA 4AEJA 1AR72 3QCWA 4IV1C 1JW6A 3RMYA 3TN92 5ACA1 1YLLA 4LLOA 3KSCA 2D43A 4E2QA 1RVF3 3ACLA 1MZEA 2BYVE 2VECA 4NWWA 4KG8A 1DQ5A 1R093 2P3KA 4YW5A 1K5MA 2JE9A 4IXLA 1ZZ6A 1VB4A 3ILFA 1PZ8A 2DVFA 3TWIA 1ND3A 1FV2A 3VKNA 4S2FA 3ALQA 5AFBA 2MEV1 1I3HA 4I01A 4TSVA 1YRZA 2RR13 4LBOA 2XBO1 3RNSA 3TNPB 4Z82A 1WCKA 3HAGA 4COVA 3N7KA 2WL1A 2HWC3 3SCHA 4CDQC 4LT5A 1KS4A 3W59A 3AFGA 3CJIB 2N7GA 3ZXDA 4JCKA 3B00A 2YMZA 3VKFC 3WCSA 3J4UH 4LO6B 4YVSA 3USUA 3TRSB 5JI7A 4C1WA 1PO11 1MS8A 1V6OA 2GALA 2K0GA 3VBFC 2JE7A 4XMAA 3ZFEC 2RS31 3VBRC 1CX4A 3GALA 2B45X 2VW0A 2WT0A 2O8QA 3N7LA 4GH4A 1DU3D 1RUC1 2Y0OA 1FATA 4EN0A 2PTMA 1BVP1 1LEDA 2AGSA 3GBGA 1V00A 3D5OA 5ACA3 4JV4A 4OI0A 1J59A 3UKNA 1RHI2 1XYOA 3NAPA 1ZBA1 1JUIA 1GZ9A 5A32B 4MZUA 3A0NA 1O4TA 2EAAA 1AX1A 2NYYA 3NL1A 2ZHMA 3M8LA 4RR3B 4ASMB 1RUH2 1ULDA 1IS6A 1QQP2 1X82A 3HBZA 4LE4A 1ND2B 1YI7A 5JSOA 2QE3A 2HWD2 3IPVA 3ZVXA 2MEV3 4MGKE 1PVC2 2DYCA 3JB8A 4DB5A 2YYOA 1RIRA 2H0VA 1H0BA 4FPEA 2XBO3 3M3CA 1AXYA 3S0MA 4ZKTB 3WDYA 4Z1VA 1VBE2 4FAGA 4Q1RA 3H7JA 5L7OA 1J1TA 1AUYA 2VNOA 2BW8A 3L2HA 5CFCA 4LBQD 4ATEA 1AJOA 1OI6A 1W6NB 3ZFFB 1CR7A 4H7LA 5IT6A 1REFA 2YPJA 1OQEA 2RE9A 4P14A 1IGOA 2TEPA 5J09A 3D8CA 1PO13 4RSUA 1IS5A 1YUDA 3PVNA 4OLLA 4N53C 5CBLA 1MS5A 1O4ZA 4CEWB 2RS33 1FXZA 3BALA 3E6DA 4RGGA 1RUC3 1RJ7A 4PIZA 1YI9A 5T55A 5JI9A 3KZ4C 3MYXA 3WX5A 4AXOA 3O7OA 2K9ZA 2DU1A 3G7DA 1LHNA 2NMNA 4KBBA 1ZBA3 4P9LA 1QJY1 1X7NA 4YW3A 1QHDA 1TMF1 4WM8C 2RMU1 4X8PA 3NKTA 2WC2A 2EIGA 3ZXLA 3MZHA 5JOXA 3ZYRA 2VNGA 2BUKA 2CYFA 1HQNA 1V70A 1S55A 4HZFA 3AKPA 3ZYPA 4IESA 4M3CB 3H0OA 3QLQA 2LALA 1ZBE1 3ENRA 4XEZA 1RUG2 4KGQA 5KWRA 5JSRA 1PVXA 5BY5A 4NHMA 2ZGKA 5BNOA 2ZKLA 3BB6A 2OYZA 3FJSA 1OLQA 3H7YA 3KM5A 1DGRN 1F8VA 1VBC2 4Q0QA 4NWVA 4AE2A 2VW2A 1SBEA 1I6XA 2ZGLA 4LEJA 4AQ6A 2ILMA 3WHUA 2IZWA 1Z7S1 1RUF1 4CP0A 3CNAA 3G6JB 3VBOA 4ITCA 1NY72 1AXZA 3AZVA 1VBD1 1DFQA 3ECQA 4QHBA 2GAUA 1LOEA 2NMOA 2A6VA 3N36A 3OD0A 2HYKA 1EPZA 4CEYA 2D7FA 1J3QA 2UYAA 4FOYA 3AZWA 5E88A 1QJY3 1GSLA 4I30A 1MEC1 4AEDC 1TMF3 5GALA 2RMU3 5BUVA 1UU5A 3M1HA 3VL9A 1NCQB 3N4MA 1Q8QA 3RYPA 2WQZC 3W58A 1FV3A 1WUVA 4A7YA 1NCRC 1ZYBA 4UW4A 4ES8A 2RS51 1DQ1A 1ZBE3 3VKMA 3J9SA 2WZR1 1MACA 1SLBA 4EWAA 4RL7A 3BTAA 2WT1A 5E89A 1PIV1 1LOAA 2WLPA 2VOXA 4QQ2A 2WWSA 1O7FA 1XQNA 2R6QA 3RS6A 3ZDSA 3ZMOA 1GZWA 1Z7S3 4UBHA 1RUF3 5A32A 4FP3A 4RQPA 1JOJA 3M3QA 4KWLA 1F5JA 2IXLA 2Z69A 5I93A 1OKQA 5EV7A 4AG4A 4A7ZA 1VBD3 1SEFA 5AC91 1FX5A 4M0NA 4AWDA 5J96B 3AXEA 5CVRA 1S0CA 1IS3A 1CPMA 1N3PA 1MS3A 3OYWA 5SV8A 5KXDA 1CAWA 4HBNA 2X29A 4JGZA 2K2SA 1NLSA 2YROA 4YW1A 3LOBA 1HV1A 4AVBA 3TYJA 5LEKA 1MEC3 5JOWA 1U5IA 5GLWA 1FAYA 1SBDA 4CYDA 4DFSA 3O0WA 4HFSA 1W6NA 3ZFFA 5L36A 3WDWA 2RS53 3JBG1 3CLPA 2FBEA 2YC0A 3WP4A 1N3QA 1SFNA 1X36A 2DV9A 1WBFA 2QZ3A 2WZR3 3R4UA 4P5HA 4QPYA 3RJ2X 1VRH2 2D3RA 1WMFA 2WQ4A 3E6BA 4JQRA 3TB0A 2OVUA 4IV1A 2CWSA 1GNHA 1OA4A 3HIFA 1FYUA 1PIV3 4AHYA 4WZCA 4L8QA 4XFAA 2JG8B 1SDWA 4KNCA 4URTA 3B01A 1BEV2 1PZ7A 4YFZA 4CDUC 1LEMA 3JCIA 4XBQA 4XF9A 3I4IA 3HQXA 1H4GA 4B7KA 4B4PA 5IK8A 2XWBB 2FHRA 2G9FA 3FX3A 4OI4A 1EAH2 1FNYA 4ISRA 1PGL1 3ATGA 4PF5A 5AC93 3INAA 4ES9A 4E9KA 1V6KA 1QU0A 2VVDA 5CA6A 1AYM1 1CESA 4HKLA 2ET1A 4M3CA 4CDQA 3ZXEA 2AZ5A 2PYTA 1IS4A 4PBOA 4IV3C 3JD71 3C3VA 2Z79A 2QNKA 1H1AA 4RHV2 4N9HA 4JVAA 2BVBA 4MH0E 1YCIA 3ZFEA 2CNAA 1CAXA 3JBG3 3KQRA 1SLCA 5C8CC 1QH6A 1G6NA 1UZYA 5FMOS 4N43B 2GMMA 1AVBA 4YM0A 1HKDA 1RUE1 3VBUC 1AR81 3FUOA 1GNZA 5JCTA 4IEXA 4HANA 4Y22B 4BZ4A 3LA3A 2GC3A 5KC6A 4JC1A 3PLQA 3LB9A 4AFDA 5EXOA 1IOAA 1FOD1 3P3NA 3OY8A 3AYCA 3MLJA 4AI1A 5C8WA 3DPRB 1HX6A 1RUJ1 1QJX1 1AYN1 1QDOA 5HCFA 1IKQA 1WMEA 1SCSA 2A3WA 2WNVB 3ILNA 4MX3A 1AYM3 4GQ7A 4YSFA 3U11A 5L19A 1WW7A 4L9BA 4Q4X1 1HV0A 4E2SA 3JZVA 1G9DA 3GBWA 1TQ5A 3K48A 4MXWA 2X5IB 3JD73 1NA1B 3POWA 1FPN2 3KCCA 2YV8A 1O91A 1IHMA 4BLJA 4QXKA 5JWPA 2ES3A 1DQ2A 1X8EA 3OBRA 4META 1RUD2 4IEYA 4B8EA 1RUNA 4GB31 1V6IA 3TAYA 3MPBA 5C9AA 1VB2A 2F4PA 4WVVA 4YVWB 5IK4A 2UY9A 1NE4A 1S0BA 4XDQA 4DY5A 1RUE3 2NP0A 1AR83 2YY1A 4LTAA 1FMD1 3E5XA 1ZZBA 2EALA 2E7TA 1F2NA 5BXXA 3VBHB 4BWOA 1PK6C 5CAZA 4ASLA 1FOD3 5IK7A 1R092 4JDOA 3WCRA 2ZKNA 5CFDC 1BBT1 2DVBA 4LR4A 1LGNA 2ERFA 3IWZA 1RUJ3 4LLFA 1QJX3 1AYN3 3AP4A 1YFUA 1UL9A 1GBGA 4C1XA 1AZDA 4KG0A 1LOCA 1XNKA 3VZLA 2DCKA 3APBA 2RR12 3H3ZA 5HCBA 4KWJA 2H6CA 2R071 1UKGA 2WFF1 4Q4X3 2BWCA 2HWC2 2AR6A 5JMCA 2UURA 2B8MA 2AREA 1G9CA 3ILRA 1HRV2 2D5FA 1JYIA 3VBSC 5HI0A 1MQTA 3MLKA 3AP6A 1K5MB 5GLTA 5DDJ1 3D4KA 4DQAA 4IEWA 1DQ4A 4P9JA 4GB33 1HW5A 4I02A 4OHYA 5FQ0A 1ND3B 1KDMA 3GHNA 5K0UC 3DN7A 3JU9A 4PDWC 4YARA 5GM0A 2FZ2A 4U2AA 2BVVA 2DFBA 3OTFA 2O0OA 1ZRDA 4COYA 1IPJA 3JB4C 3POSA 5ACA2 2A5ZA 1FMD3 4R4ZA 1Q43A 1VBB1 2R49A 2RJKA 4AGVA 5AVAA 1S0JA 1ONAA 5H9QA 1O3RA 4OUMA 2XJQA 4MVTA 4AEDA 5CU1A 1BBT3 1QOTA 4FAHA 3H1WA 3USUB 4YVSB 5FFOC 3T2TA 3WQ0A 1RINA 3V0BA 4GH4B 4QPIC 3ZXFA 2XBO2 4XFHA 2O1QA 2GSYA 1UMZA 2R073 2OPKA 2WFF3 3FFZA 1XXNA 3MF9A 4FPFA 5LRRA 2HWE1 2A6WA 3VKLA 5GZGA 1WLCA 5KHHA 2ZHKA 1EP0A 3OF1A 4P9GA 3PMSA 4YW2A 5C4WC 3KB5A 5K8SA 4XPVA 3RQ0A 1PHMA 1S0GA 4D94A 5H9SA 1LOBA 1CJDA 4LO5B 1PO12 5FO8B 5DDJ3 4J1WA 4XHXA 4QQOA 2WNUC 4GWNA 2GNDA 1QJU2 1AR61 3IPVB 1BJQA 3H1YA 1S0FA 1WLDA 2TUNA 3MW3A 4PQ9A 4HK9A 1PZ9A 1A78A 1HIXA 1RUC2 2D6LX 5T54A 1WW5A 3GBFA 3DKWA 3BCWA 1VBB3 3VZJA 4CDXA 4FBFA 5L7OB 2WNVA 1V6MA 2JD4A 1ZBA2 4I3GA 4KU8A 1AR91