2ETEA

Recombinant oxalate oxidase in complex with glycolate
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
201
structure length
201
Chain Sequence
SDPDPLQDFCVADLDGKAVSVNGHTCKPMSEAGDDFLFSSKLTKAGNTSTPNGSAVTELDVAEWPGTNTLGVSMNRVDFAPGGTNPPHIHPRATEIGMVMKGELLVGILGSLDSGNKLYSRVVRAGETFVIPRGLMHFQFNVGKTEAYMVVSFNSQNPGIVFVPLTLFGSDPPIPTPVLTKALRVEAGVVELLKSKFAGGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Oxalate oxidase 1
publication title Structural and spectroscopic studies shed light on the mechanism of oxalate oxidase
pubmed doi rcsb
source organism Hordeum vulgare
total genus 47
structure length 201
sequence length 201
chains with identical sequence B
ec nomenclature ec 1.2.3.4: Oxalate oxidase.
pdb deposition date 2005-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00190 Cupin_1 Cupin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2eteA00
2HKXA 2IXHA 4BHPA 2BNMA 2B9UA 4YYOA 1HW5A 5FPZA 4IERA 5KHHA 3H9AA 1QY4A 2GZWA 4P9GA 4LLOA 1YHFA 3I59B 4MV2A 3BALA 1VR3A 4Z07A 1LR5A 4QGLA 4TLFA 4MX3A 5I0RA 4MGKE 2XHKA 5D1IA 4EWDA 1O4TA 3I7DA 4JV4A 1EYBA 1NXMA 3U10A 1FT9A 2H6BA 3BU7A 3LWCA 3NW4A 1LRHA 1PM7A 1LKNA 3O14A 2E9QA 1Q3EA 3L2HA 2BEOA 4PIYA 4XF4A 3DV8A 1ZRDA 2PA7A 1PMIA 4EWEA 2UYAA 2PAKA 4FAHA 4XF9A 1JUHA 3H7JA 5BV6A 4JVAA 3SCHA 3GYDA 4Q0VA 3IBMA 1VJ2A 4HVOA 1CAXA 5LEKA 2PFWA 4AVBA 4QX5A 4Q29A 1SQ4A 1QWRA 4KWJA 3UKVA 4LA3A 3E6CC 4YNIA 4WVZA 1X8EA 1SEFA 3CEWA 2KXLA 3FE5A 3DN7A 3LA2A 4LTAA 2PAMA 1ZRRA 3D0JA 5CU1A 1UD1A 3C3VA 2IXCA 4IEZA 5FLHA 1GQHA 3ROUA 4FT8A 4JTNA 4QMAA 3E6BA 1IPJA 2Q1ZB 4KWKA 4N9IA 4IESA 4IEQA 4I3PA 4DINB 4IEWA 3RYKA 3PVBB 3E5XA 2Q30A 3CJXA 4D7SA 2GU9A 3FWEA 4KWLA 3LA7A 3U0ZA 2D5HA 5K8SA 4FBFA 3UKTA 4X6RB 4IEUA 1J3QA 1EY2A 1X7NA 3I54A 4E2SA 2O1QA 1QXJA 1QXRA 1FXZA 1CX4A 1RTVA 5KBFA 3G7DA 3ES1A 1ZRCA 3LAGA 4I0BA 1WLTA 5KHKA 4X6QB 3FX3A 2ET7A 4MZUA 4CYDA 3S0MA 4I02A 1J3RA 2ET1A 2VPVA 5FLJA 3BCWA 1Y3TA 3WW3A 1DZTA 1O3RA 1LB2A 3H1WA 4A2UA 2ZCWA 1ZZ9A 3OCPA 4LA2A 2OA2A 1U12A 3ACLA 1I6XA 4WZCA 2IXLA 3H8UA 4RD7A 2C0ZA 2EA7A 3DL3A 4HVQA 5CADA 1ZREA 3EJKA 3MYXA 4KL1A 5JSRA 1Y9QA 4IEVA 5I0TA 3IDCB 3R6SA 3SXWA 4META 2O8QA 4O9GA 1YFWA 3FZ3A 1CAXB 1RL3A 2UYBA 4HMZA 1RC6A 2GC3A 3FJSA 3QACA 3RYRA 4PJYA 3E5UA 3E6DA 2FQPA 4JTOA 4HSJA 3FFQA 4XETA 2PAEA 1OMIA 3KCCA 3EO6A 2HJIA 4HN0A 1ZZCA 2GC0A 4ORFA 3EBRA 4AVAA 1WA4A 5FPXA 3IIAA 1Q43A 4ONUA 3MPBA 1ZZ6A 4EWAA 4BYYA 4UBHA 4Q0SA 4B29A 3NKTA 2DCTA 4QXKA 1OI6A 1X8MA 3H1YA 2VQAA 4XFGA 1H1IA 4XFIA 5F1RA 3SCGA 3H3ZA 4HN1A 4IEPA 3NSTA 4MUVA 3TNPB 4QM8A 3RYPA 3CO2A 4Q0UA 5T3NA 3WW1A 2QVSB 4I2OA 1ZRFA 2V09A 4I0AA 3IWZA 1ZZ8A 4H7LA 4D7TA 1ZX5A 4XFHA 3RPQA 3WW2A 1YFXA 2F4PA 3RNSA 1UIJA 2OZJA 1FI2A 1O5LA 3JZVA 5J48A 2GH2A 1EPZA 4QGNA 4XEZA 1NYWA 1XRUA 4ZU7A 5I8YA 2GAUA 2BYVE 2XLGA 4Q0QA 4AQ2A 5I8SA 2MNGA 3U11A 1NZCA 3KMHA 4LEJA 1EP0A 4NVPA 3FHIB 4MGIE 2ETEA 2PQQA 3ZDSA 5KHGA 1O3SA 4J1WA 5JSOA 3CF6E 3NVCA 3H7YA 4FAGA 4XF1A 5FQ0A 3NL1A 2K0GA 4IEXA 2XKPA 5FCCA 1YWKA 1YFUA 2VECA 1L3JA 1ZZBA 4QM9A 4KU7A 4I01A 3EQEA 2XLAA 1X82A 4MGYE 1DGRA 2I45A 3N4MA 2D40A 2D5FA 3SHRA 1UCXA 2OZ6A 3M70A 1SFNA 2FMYA 1CAWA 3KGLA 3HQXA 3LZZA 1OFNA 4EV0A 2CV6A 3KSCA 1O5UA 3MDPA 3KGZA 2XL9A 4AQ6A 2Y0OA 4L11A 2EVXA 2QJVA 4AVCA 2N7GA 5BY5A 1Q5OA 1UIKA 1CAVA 4HBNA 1CAUA 1XE8A 1NE4A 2B8MA 4IEYA 3BPZA 5JSPA 3D82A 4PIXA 4AXOA 1ZVFA 4HLTA 4PIZA 2EAAA 5LRSA 2Q4SA 5I8TA 5HI0A 2OPKA 5C8WA 1NE6A 2MPFA 2B5HA 4UBGA 1J1LA 4HSLA 4OLLA 1RGSA 4E2QA 3CLPA 5I0SA 3PNAA 5JR7B 2K9ZA 2WC2A 5I93A 1IPKA 1I5ZA 1WGPA 3DKWA 4YRDA 5JCTA 2Z69A 3ES4A 4WBBA 3GBFA 4EROA 5LEJA 1J59A 4R8HA 5BUVA 4F7ZA 3UKNA 2IXJA 4BH9A 2UY8A 1UPIA 3OGJA 4GULA 5BXXA 4HVRA 1J3PA 3USSA 2XL7A 1ZNPA 3S7IA 3I59A 4XFFA 4BIFA 1DZRA 3ELNA 1RUNA 3E97A 5FDBA 3LA3A 3CL1A 4XFAA 2PHDA 1V70A 4ZU4A 2BGCA 5LRRA 3ETQA 5C6CA 4YSFA 5FQ0B 3M3IA 2D93A 4Q0PA 3PLQA 3TNQA 4XFCA 4K8FA 3QOPA 4KU8A 2ZKLA 5E16A 5I0UA 2ATFA 3H3UA 2WFPA 1TQ5A 2H6CA 5J7MA 4J1XA 4I09A 1H1MA 4MH0E 3S7EA 4LUKA 3D0SA 1DGWA 4F8AA 5EFUA 3H50A 3EHKA 4LUMA 3LOIA 4QGMA 4UXAA 4HZFA 1CAWB 2CAUA 4XF0A 4YARA 2PYTA 4Z82A 3WW4A 1RUOA 4O9EA 1O3TA 5CVRA 2PTMA 4XFBA 5BPXA 2CGPA 3ST7A 2P17A 3MZHA 1GQGA 1OD5A 1UW8A 2GC1A 3H1MA 3RDIA 1CGPA 5KHJA 2OYZA 2IXIA 1CAVB 3B02A 3HT1A 1CAUB 4N9HA 1YUDA 3E5QA 4OFGA 3SCFA 5AVPA 1VP6A 2H0VA 2IXKA 2BNOA 2QCSB 4MGZE 5KHIA 1G6NA 2PHLA 3OF1A 4XF3A 4R52A 4E2GA 2Z2SB 3BB6A 1XE7A 5FLIA 1O3QA 5EZWA 3IDBB 5J3UA 3OD0A 1ZZ7A 2XGXA 2MHFA 3RZZA 2QNKA 4IETA 5E1RA 4LULA 3VHRA 5I91A 4IEOA 3HIFA 2BNNA 2IC1A 3NJZA 1YLLA 1O7FA 3HT2A 2Q0AA 4L2NA 2XLFA 2GC2A 4ZU5A 5JAXA 1J58A 2CAVA 3SMHA 2XKOA 2UY9A 1YFYA 2QDRA 3OTFA
chains in the Genus database with same CATH superfamily
1F35A 1UY0A 2IXHA 1C8NA 5CKMA 5C3RA 3I2IA 3KVBA 5KHHA 5JOWA 1QY4A 4QDRA 1ULCA 2GZWA 2RMU3 1COV2 2ZGNA 4HPKB 1NCQB 1RUD3 3MLLA 3JB4C 4KBBA 2WO1A 4EN8B 3ZFEB 4OYUA 4AHWA 4MX3A 1K5MB 2XJUA 2Y6GA 2W3JA 3C2UA 2XHKA 4P08A 1JZ7A 3QBQA 5FY0A 4KI5M 4RR3C 1R083 2G9GA 3O1OA 2IVJA 1YQ5A 4UFKA 4GH4A 3MIDA 2WZR1 1ASJ2 1C5HA 2X09A 3BTXA 5DUVA 5FFOC 3WINE 2UWAA 3PHMA 1PO23 4YGBA 3Q8BA 2WO2A 2Y8KA 3WDUA 1ZRDA 3FL7A 5LA1A 3VBFC 1MR5A 3ILNA 3QH6A 4FO9A 2UURA 1DIWA 4P9IA 4IV1C 3JD72 3RZGA 2YV8A 1VRH2 5IK4A 1YJLA 4FAHA 4CDXB 3AL6A 2AUYA 1PIV2 5FKBA 4XF9A 2JB4A 4M01A 3UETA 2WQ4A 1VBD3 2ZEZA 5C4WA 5L9BA 3VBHC 3B5LB 3BTAA 4EN6B 3TEWA 1BMV2 1VBE2 1LOFC 3N36A 1Y9MA 2XVKA 5F5IA 5JR2A 4FSJA 4AVTA 3W59A 1VJ2A 1W6NA 4NHLA 3W58A 2R061 5A32A 3ZDVA 2X8KA 1CQ9A 4HVOA 1K12A 4YG0A 5LEKA 4QHOA 4OI4A 2JDUA 2PFWA 4AVBA 3AK0A 4QX5A 1GNYA 1PGW1 4GMP1 2J7MA 2DFBA 2XVGA 4XURA 3NJVA 3I3MA 3OJBA 5FOJB 1FNZA 3M4FA 1COV3 1QMJA 4BB3A 5CFDA 4CP0A 4LA3A 4E8DA 2VQ0A 1X8EA 3KV4A 3CEWA 5JOYA 4IUGA 2NMOA 3DN7A 4LOTA 4LTAA 3PDQA 3BPSA 1W6OA 3D0JA 4XAEA 5CU1A 3C3VA 3ZVXA 2IXCA 5BNNA 2J1AA 3VN4A 4A6OA 4AAXA 4AG4A 1LOAA 4ES8A 1OH4A 3UESA 4JTNA 1ASJ3 5FY9A 1XC6A 3GHMA 2W1QA 3LEMA 1IPJA 4LO7A 2JE9A 4XJ8A 4DXSA 4OUMA 3IN9A 5GZCA 4NHMA 2ZGTA 4N9IA 1RYYA 2DUQA 1HB1A 2JXAA 1UO9A 4CVUA 2Y38A 4DINB 1LECA 2VMHA 2IWGB 1N1SA 3E5XA 2Q30A 1TVGA 2WZEA 3JD73 4JGYB 1VRH3 4UF0B 1RITA 1K3IA 1NCQC 5JDBA 5GZEA 4D7SA 5FYVA 4OHVA 1ACCA 1OLMA 1PIV3 1BBT2 2VOTA 1MVEA 1CZSA 3ACFA 3C7EA 3ZFEC 3FWEA 1WW7A 1K5MC 2DYCA 4W8JA 1VBE3 4KWLA 1HDKA 4XC9A 1OPOA 2D5HA 2RJKA 5FP7A 4ZY9A 2AR6A 3NNFA 2YYOA 4DB5A 2VW1A 1F4AA 5CAZA 5B2GB 4ZONA 1J3QA 4OI1A 4CCLA 1IKQA 1BCXA 3JXSA 4MOAA 5DQ0A 1QXJA 1ZBA2 4ZS3A 1OC1A 5GLWA 2YB7A 4BLIA 1IZ3A 4P02B 1RUE1 2DCKA 1AXZA 5ABJA 3G7DA 5FUNA 1X33A 1XNTA 5LK5A 1XNBA 4QHZA 4YFWA 4XOGA 5FUPA 3WXPA 3LAGA 4I0BA 2TEPA 3AP5A 4AFCA 1N47A 1Y4WA 3WCSA 4CEYB 4CDXC 1ND2A 2SLIA 1M06G 4X6QB 2ET7A 4GZ9A 3THPA 1UY2A 3OD4A 3OY8A 5A1AA 3S0MA 4YVWA 2CHHA 2ET1A 1HQNA 4KGGA 1FYUA 5FLJA 5F37A 1Y3TA 2YXSA 1DZTA 4IDZA 4Q5OA 1NY71 2HBTA 4NOTA 3B93A 4XW3A 4RFT0 5DABA 1ND3B 1XNCA 1D7PM 3P6BA 1GLHA 2ID4A 4LMFA 5FZMA 4G9SB 3UGGA 3WSOA 4XCAA 2J1VA 4OZXA 4UOJA 1W03A 4BXSV 1KS4A 3Q8FA 3WQ0A 1YI7A 1BBT3 3DL3A 1GR3A 3A4UA 5E8AA 4UW6A 2VNRA 4EN7B 3NKGA 4KL1A 3A21A 2VNGA 3U1XA 4CXWA 5A33B 5JSRA 3PURA 3PIJA 3K77A 3R6SA 3RWNA 2OIIA 2R072 1H2KA 2VTFA 4R4XA 1ZBA3 1YFWA 1SBFA 2X5IB 3AYDA 1W2OA 1GOGA 3WNLA 4PF1A 2UYBA 2V4AA 3A23A 1RC6A 4GA9A 4Z2WA 3OYWB 2C24A 3DEMA 3ON7A 2XWJB 4GIQA 4JGYC 5FJHA 1SLAA 1EV12 4RA0A 3VKLA 3RYRA 1JTZX 3CQOA 1E5SA 1V9U1 2FCTA 3PVOA 1VPHA 1RUJ2 2OX0A 1UWWA 2YU2A 3J26N 3GZUC 1IS5A 1JBCA 1VRBA 5FO7B 1F2NA 3DUIA 3VKMA 5IUQA 4XMAA 4FVVA 5F5CA 1HRV1 4PT6A 4QKFA 4XTMA 4OHXA 4EN9B 3EBRA 4AVAA 5FO8B 5FPXA 3V0AA 2Y6FA 3IIAA 1Q43A 4E4SA 5IVCA 2FCVA 2B4KA 5F32A 1C1LA 1P8JA 3I3DA 4S2DA 4K1ZA 2ZGMA 2WNUA 4B29A 5LASA 2GN3A 1UPSA 4Q27A 1QJY3 4COZA 1LEMA 5JXHA 3H1YA 4X8NA 3RQ0A 1UZ0A 1ZA7A 2ZMLA 3OGVA 2YHJA 3PUSA 5CNAA 3RMXA 3AXEA 3NNGA 2AGSA 1S1AA 3NSTA 2DCJA 1W2AX 4CA9A 4CEYC 3CO2A 3D4KA 1VMJA 1R091 3UYJA 5IVJA 4M00A 4JQTA 4CUGA 2R073 1ZRFA 3OGGA 4HFSA 3UGFA 3LGRA 4RHV2 1REEA 4MXWA 4UT5A 4ZZ8A 2RJ2A 1BKZA 1L7RA 3PUHA 5T5OA 4DXTA 4GD4A 4D7TA 1ZX5A 3VUOA 2PN5A 2VNOA 1YCIA 3LCPA 1QIQA 4AI0A 1AR61 2F4PA 5E6HA 1BZWA 1ND3C 1UIJA 3WF1A 3NWKA 1EV13 2CNAA 1FI2A 2TBVA 3BODA 4TSVA 1O5LA 4Q4X1 1ONAA 1JS9A 1RUJ3 4YZ1A 4FPCA 1SCSA 3JQWA 3U78A 3TEXA 2LUWA 2Y34A 3HOBA 4Q0QA 2P3JA 4AQ2A 4R4ZA 3FMGA 1JYCA 1REDA 4CCDA 4GKYA 1G9CA 1PK6B 4QXBA 3H3LA 3ZYFA 1OUSA 2R041 3H8RA 1WW6A 4CCOA 5JI9A 2WA4A 5DZEA 1N3OA 2IFWA 2IVIB 5A7OA 3O1TA 3LEKA 2K0GA 3NNLA 4FP3A 4C8DA 1PZ7A 3ACHA 1QQP2 4IGOA 1L3JA 1ZZBA 3N9LA 4LBNA 2VZOA 4DEVA 4KU7A 3VD9A 4AI8A 2JDPA 1AZDA 1MS1A 1KFXL 3WOGA 5F8PA 5EJZB 1UY1A 1NX9A 3KCYA 4YWAA 2ZX4A 2J1SA 3I4IA 4LJHA 1NAEA 4MGYE 4P00B 4RHV3 1A6CA 2D40A 2YC4A 2D5FA 2JDKA 4CCJA 3HNMA 2VBPA 4RR3A 1S2EA 1LCLA 1WMXA 2L9LA 1SFNA 4NHKA 1CAWA 3CJIB 4XQWA 4Q26A 1J83A 3VHOA 3AP7A 3MIEA 3HQXA 3MIHA 2CV6A 3HMYA 3AMHA 2V4VA 3BTYA 1O5UA 3WF3A 1S0FA 1XNAA 3HVDA 4ZXEA 3OPWA 1GV9A 1Q56A 2Y0OA 1W8OA 4QU1A 3VBFA 3AMPA 1SFPA 3UL2A 4IV1A 1C5IA 2Z42A 5FYSA 1PO11 2RDSA 2X53S 1QHDA 2RE9A 5J09A 4NROA 2QUOA 4I0WB 1OOPB 4K9SA 1D4M1 2WZR2 4HBNA 3VBHA 1CR7A 1DQ1A 2VXJA 1KRIA 4LHNA 1LOFA 3TEYA 2EF6A 3WDWA 3L9JT 3ZYJB 1NT0A 3O1MA 1NOVA 1E5IA 1W3XA 3J7MA 1QQP3 3VLBB 4L99A 3VHPA 1AF9A 5H9RA 1JW6A 2B7YA 2TUNA 1POV3 2ZS6B 5FMDA 4ITCA 5LRSA 5HI0A 2OPKA 5EXOA 4C0BA 3DCQA 1YJKA 5FZAA 5C8WA 1YNAA 4M4RA 4OVEA 3V56A 2GH8A 5FZBA 1QOTA 2VTXJ 3QLQA 1JHNA 1SMVA 4HSLA 4LK6A 3JCIA 3O1SA 4Z1VA 4LBMA 1V6KA 3B9CA 4OLLA 4AE2A 1PZ9A 1RGSA 3CLPA 4UWDA 3PNAA 5I0SA 3HAGA 1PK6C 1LU1A 1Q8VA 2B45X 2HEWF 3FN9A 3NV2A 5HXVA 3GCWA 1IPKA 5IK5A 2R062 1WGPA 3DKWA 3ZYHA 2D44A 3WDXA 4CP9A 4RQPB 4WBBA 2K46A 4UFIA 3BKZA 3MUZ1 2Q1FA 3N9NA 1PGW2 2KD7A 4BE3A 2R0HA 5JXIA 5LEJA 1CPMA 3ZN6A 1J59A 1MS0A 3H8XA 1LGNA 3N3HA 3GJAA 5A3OA 1GQPA 1RB8G 3MFCA 5BNPC 5FZCA 3IPVB 4GULA 4XUOA 4A44A 4CEWB 2KM2A 3N9OA 1Q8QA 4HPKA 1NCQA 3S7IA 4BIFA 1H6XA 1SLBA 2WT1A 2EIBA 1RUNA 5FDBA 3TOJA 2WZR3 3ZFEA 1PMJX 4HKWA 1K5MA 4XFAA 3POWA 1W9SA 1V70A 3FUQA 5DAPA 2WNVB 2BGCA 3K51A 2Y60A 4NMIA 3TBDA 4FTEA 3WG3A 4Q4W2 1QH6A 3MBWA 1VAMA 3CJIC 3M3IA 1L7LA 4AK3A 2ARAA 3PLQA 4XFCA 3ZKYA 5ERLA 1W06A 2H0BA 5FYZA 4AHZA 3N9MA 3HQRA 1GANA 2HBUA 4XABA 3ZXAC 3M2MA 4FXKB 4FOVA 1TQ5A 2MEV2 2H6CA 3ZXEA 4B4RA 3R4DB 4ARXA 4I09A 5J36A 3K48A 5GALA 1FAYA 4YGEA 4NIAA 3S7EA 4CDXA 4LUKA 4NRQA 2R063 1OOPC 4NE9A 5EFUA 2PHTA 2HWC2 3OY8B 5GLUA 1OXCA 4H14A 2BV4A 4GMP3 1BK1A 3VL8A 2ARCA 4ASMB 1K5JA 3PU3A 5IVYA 4HZFA 4KQ7A 2FZ2A 1RUE2 5FYMA 1W2UA 2J42A 2VM9A 1LULA 3OPTA 1OKOA 3CIHA 4W6XA 1UX7A 1FMD1 1XXNA 4MLOA 1FPN2 3POJA 5KC6A 3DYMA 3MI8A 1IS3A 3U14A 4NHYA 4GXLA 3A7QA 1BJQA 1HJFA 1BLZA 2JDHA 3MZHA 1GQGA 4FFGA 5FYCA 3KB5A 1CGPA 4XCBA 5KHJA 2D6OX 2NQYA 2JD9A 2VMFA 3ZLIA 3DXTA 4ATEA 4GWJA 3I3BA 1CAVB 1UXXX 4Q4W3 3BI3A 4QD2A 4AW7A 1NY72 4LIVA 2H0VA 4RQPC 1W6QB 1AYM2 2IXKA 4MGZE 5LZ6A 4Q4V1 1G6NA 3WCRA 3CHXA 4JHZA 4DUWA 1RVF1 4EZHA 5HCFA 3AZVA 1QJZA 2Z2SB 4JX0A 5BYNA 2J1UA 3PJQA 3AFGA 1QOSA 3IDBB 3OD0A 1PVXA 4CEWC 2MEV3 2XBO2 4JGYA 4UF0A 1GZWB 3RZZA 2QNKA 1UYXA 1GUIA 1NZIA 4K20A 1K42A 1RUC1 1EAH1 4FPEA 4XHBA 1GNHA 3CDZB 1S0GA 2ORZA 3EXUA 3JQXA 5I91A 2IZWA 2ZGLA 1E57A 2HWC3 4MG2A 2IC1A 1O91A 2WO7A 2WNVC 1QXPA 1U5IA 3V0AB 1SG3A 3GGLA 1WLDA 3O1PA 1RUE3 2XOMA 3HT2A 4L2NA 5D21A 2GC2A 2BGPA 1V6NA 1NCRB 4DS0A 2R16A 3UV9A 3BOWA 3MIGA 5GZGA 5FOBB 1FPN3 2QQNA 2HKXA 1MS8A 2C6SA 3L2YA 1V9U2 2JECA 4BHPA 3AFKA 4YYOA 1BEV1 4FOQA 1OA2A 2FCUA 2G9FA 2WNOA 3OBRA 4XQDA 3ZFFB 1SLLA 2WWJA 4FOYA 1YHFA 5C5UA 4MV2A 1OFSA 3ZSKA 4Z07A 1HRV2 3AZXA 1LR5A 2CYFA 4QGLA 2AYHA 1PNFA 4IGPA 4BJ0A 4CEYA 1G9BA 2FDKA 1DQ6A 4NN0A 5A3TA 4MGKE 4QU2A 1GYKA 4EWDA 1AYM3 2YPJA 4HONA 3ZKUA 4JV4A 1EYBA 1NXMA 4JQRA 1DGRN 1FT9A 3CMGA 4NHXA 1WBLA 3H42B 3SQOA 3ZR6A 3UK9A 2BUKA 1LRHA 1PM7A 4LO6B 5CFCB 3VKNA 1Q3EA 4HG6B 3ZXFA 3LFIA 2ZACA 1ND3A 2BEOA 1QJU1 2G1MA 3DV8A 4O65A 2XBO3 2HLEA 2B39A 3VBRB 2FMDA 2TNFA 1R092 2GN7A 3IT8A 1UOBA 1DQ2A 1FATA 2P34A 2BWAA 2PAKA 1X9TA 3KF3A 2BW8A 5A33A 3K46A 2NP0A 4BZ4A 5FWJA 2NLRA 1S0CA 4CDWC 2Y6JA 1DF0A 3H7JA 5BV6A 1XYOA 3GNEA 2LROA 2QFEA 1AR62 1ULDA 1LJ7A 1SACA 3Q8EA 5HV4A 2WUHA 3IBMA 1H9PA 4JRAA 2WDBA 4FFIA 3ZYGA 2WT2A 3WUCA 1LOBA 1V9U3 4Q4X2 4WM7B 5G05L 1NQJA 1SQ4A 1QWRA 3AP9A 4QPGB 1IS4A 2ZEYA 2GMEA 4OUEA 3OYWA 4KWJA 2OQ7A 1V6JA 3GM8A 1W0PA 1F9KA 2A6ZA 3T0BA 1Y43B 3E6CC 4YNIA 1HRV3 5FPBA 4L97A 3LFMA 3MF6A 4XUQA 2RDRA 2R042 1RXFA 2XQXA 1N1VA 1LOEA 3LA2A 1ZRRA 3PU8A 4XBLA 5L9RA 5DN2A 4AFDA 1G9DA 1UD1A 3MV11 1W2TA 4BQXA 4IEZA 1WCUA 2Y64A 3GCXA 1GKBA 3LEGA 4D3WA 2RS51 4AEKA 1NCRC 1AR91 3M7AA 3ZIXA 3ZYBA 1GWMA 1JZ6A 2DCYA 4K1YA 1DQ0A 4XUTA 5FRAA 4IEQA 5C70A 2PHFA 2W46A 2ZXQA 1R093 4YW1A 3ZFFC 3D8CA 3T1MA 4QWNA 2QTWB 1LTEA 4AZZA 2EAKA 4E8CA 3CJXA 3VBFB 1E5HA 4ES9A 1VAVA 3TWIA 2DVBA 1UZVA 1LGBA 2ADEA 1MZ6A 1WBFA 1WD4A 1AR63 1BQPA 4I3GA 4A45A 4X8PA 4YZ3A 4FBFA 4Y1UA 5K8SA 3O1VA 1NLRA 4LE4A 1VB4A 1UKRA 1EY2A 2ZABA 4GAZA 4Q4X3 2O1QA 5CFCC 1CIWA 5B4XA 3N7JA 2FDHA 2K2SA 1QXRA 4N43B 5FBJA 1W8NA 1CX4A 1RTVA 5A80A 4QPYA 1XOYA 5KBFA 2HWE1 2J22A 2WSUA 3GJBA 4AVSA 3KLSA 3VBRC 1VAKA 3ES1A 4XILA 5LA9A 1PO12 3AYAA 4XQ4A 2RJLA 4QB1A 3TN91 2R043 2A3XA 1J84A 3UJQA 3ACGA 4YFZA 2VOXA 3I2GA 1UU4A 1D4M2 4OMCA 5LBBA 3RFRA 2ZAAA 1TZOA 4IXLA 1PZ8A 1EPWA 4CUBA 3APBA 3ME2A 1PK6A 4TYSA 1SLCA 3WF2A 4A7YA 2VMGA 5A6YA 4GWIA 1J3RA 1MZEA 3AL5A 5J1XA 4FXGB 3ECQA 3FHQA 5IATA 3BCWA 4DRRA 5CKNA 5JMOA 1JN2P 4OMDA 1CONA 1GU3A 1VB2A 3H1WA 3RGBA 4A2UA 2A7AA 2EICA 5A7QA 3F95A 4WM7C 3PL0A 3OCPA 1REFA 2OA2A 3RI8A 3V65A 4CU6A 4QPGC 4EZ4A 2JX9A 4IE7A 3LDKA 4AEJA 5ACA1 5BNPA 1U12A 3ACLA 1MQTB 4CZSA 3HNYM 3D6EA 4HOOA 5F3IA 1IHMA 2IXLA 3GDBA 3P3NA 2KA3A 4RD7A 2XXZA 3CNAA 3VBOB 4CU9A 2Q5TA 1ZREA 3U75A 4OI2A 3VDBA 2AC1A 5I0TA 2D6MA 2A6YA 5K4LA 3SXWA 1OVSA 1AR71 3IMNA 3VDDB 3MF9A 2ZZJA 2O8QA 2ZMNA 3C7HA 1OLME 3FZ3A 1CAXB 4Z92B 2ZMKA 1RL3A 2G4IA 2Y33A 3CJIA 3SC7X 3T3YA 1H2LA 2R30A 1MEC1 1PO13 1S0DA 2A73B 2CSGA 3Q8CA 2VCAA 4HK8A 3MEPA 3LQCA 5IVVA 3E5UA 2A70A 1D4M3 2FQPA 3R4SA 4XMIA 5FO9B 2RS11 3ZPYA 4BOWA 5FPUA 5GLTA 4AGVA 4COWA 4IGQA 4Y4YA 5FYBA 1ZZCA 1OOPA 2PHXA 4QPWA 4ORFA 2D3SA 4NWVA 1PM4A 1WA4A 2W39A 3IDAA 1MS5A 2VOWA 5IVBA 2HEVF 1N1TA 4ONUA 1ENRA 4P9LA 4BCUA 3WP5A 4YM3A 5DAXA 4EWAA 1H4HA 4N43C 2UWBA 4PBOA 3VD5A 3NKTA 2A3WA 3VZNA 4BQYA 3PUIA 1OI6A 1X8MA 2GNBA 1W6MB 2VQAA 3VHNA 1DGWX 5C33A 3H3ZA 4HN1A 5F5QA 2ZX2A 1WCSA 4MUVA 4OULA 4QXHA 3TNPB 4QM8A 3RYPA 1RHI1 2JIJA 5T3NA 3OEBA 3WW1A 3PTRB 4LHLA 2RS31 3O7OA 5EWSA 4CCNA 4WM8C 3KWVA 4ISQA 4AEMA 4Y33A 3IWZA 1JZ5A 1ZZ8A 4H7LA 4D0QA 2VNVA 4RQPA 2VZ3A 2ZKNA 1FMD2 3WW2A 1YFXA 1HV1A 4AOCA 1OA3A 1OQDA 2PHWA 1MACA 5K9YA 2V5DA 2BDRA 2DCZA 1GZ9A 2WN3A 3IPVA 4NAMA 5FUIA 1MQTC 3VL9A 3VZMA 1QGLA 3JUUA 3JZVA 2GH2A 4XEZA 2QDNA 4XXAA 1NYWA 1RUG2 4ZU7A 4CEWA 2DVAA 3VBOC 5C71A 2OVUA 5GZFA 2BYVE 4UFJA 4UFHA 5DXDA 1RJ7A 5APAA 1XB9A 2MNGA 1W8UA 2GSYA 1NZCA 3AJZA 3KMHA 2VH9A 1EP0A 2NN8A 2YDEA 4K6BA 4D8MA 5LW9A 3POFA 3OUJA 4Q4V2 3VDDC 1W28A 4CU7A 2WNVA 1AR81 3KM5A 2WAOA 1RVF2 3HEIA 5JPNB 2DVGA 3NVCA 5FK8A 4FAGA 2JB8A 3M3QA 3ASIA 3QD6A 2D97A 4IEXA 1F5JA 4M3CB 2VECA 1M4WA 3B9IA 3WG4A 2D43A 4B4QA 2ERFA 2YFUA 1RUC2 1EAH2 1Y9GA 2W95A 4M3CF 5CG9A 4INDA 1AUYA 4I01A 2P37A 1OUXA 1HJGA 2BGOA 2CDOA 4SLIA 5FZIA 2BOJA 3DGTA 3QCWA 2D6LX 4PF5A 2IFRA 2WR9A 1KITA 2DU0A 3PMEA 4LKDA 1JYWA 1H2MA 3FBMA 5L7OC 3BIWE 1MZFA 1DGRA 2AH2A 2XUEA 1BVVA 1QJX1 3N4MA 1PHMA 1GOHA 3NV3A 2W91A 2WQ8A 3SHRA 2BBAA 1JXNA 3G6JB 3KT7A 1FMD3 1UCXA 1G86A 1NXD1 2VC9A 5F7UA 2A6XA 3KT4A 3M70A 4PLOA 4QT6A 5A3MA 2VY0A 1BEV2 3LZZA 5A7PA 2WRAA 3KSCA 5CBLA 3MUY1 1RUG3 5IFTA 2E7TA 3MDPA 2XL9A 5FZ4A 4BDVB 1KFUL 3X29B 2ARBA 2C5DA 2QQPA 1W8ZA 2Y6HA 3ZXGA 3WP6A 4AVCA 3WEZA 3JBG1 3I3QA 3LDRA 4PI0A 4LK7A 1S2KA 2OPWA 2RVAA 5FZ3A 4PQ9A 2QQIA 3SEEA 3CKHA 1TMF1 3LF7A 1RINA 4MADA 1Q5OA 3EYPA 2ZHKA 5FY7A 2JD4A 4J25A 4J6GA 4Q4V3 1DU3D 3ZYPA 3F2ZA 1OLRA 1CAVA 1RVF3 3CZJA 1XNKA 1GICA 2NYYA 3VBSB 2B8MA 1QNYA 3BPZA 3POGA 3GALA 1W6QA 3THTA 4PIXA 5CZKA 3SLIA 1QJU2 4TZDA 1D0GA 1TNFA 2YPDA 4BM8A 2QQMA 2W0XA 1O8SA 1RUC3 1EAH3 1ST8A 1VBB1 2JWPA 4JGZB 5CISA 2ZEXA 4BK4A 1H9WA 5A3PA 3GZAA 3ZO0B 3JB8A 1KS5A 1Z0HA 5KWRA 1GZWA 1S0JA 3LSEA 4YGDA 5IAVA 1O6UA 4QX3A 2CDPA 5KC5A 3S5AA 4E2QA 1DZQA 5LATA 1UYZA 4DNYA 4WZFA 3VKFC 1I5ZA 2JE7A 1JYNA 3T1LA 3QH7A 4YRDA 5DAWA 3ES4A 2C26A 1SLIA 2BPA2 2HWB1 4EROA 1STMA 1NCRA 2LTNA 4ZPIA 3AMQA 5BUVA 2ZX1A 3RI9A 3MPPG 1UPIA 1V00A 4BQ3A 3H8OA 1N1YA 3C7OA 4AFBA 1BK0A 4LHKA 4L9BA 1GFF2 1OT5A 4WVMB 5F6KA 3USSA 3ZFFA 3AMMA 3W5NA 3OEAA 1ULGA 5JMCA 4UFLA 5FWEA 1DZRA 2J1EA 3THDA 1JH5A 4R9BA 5FIXA 1AXKA 5IK8A 1PVC1 4PQQA 4QX2A 2RS52 5FP3A 2PHDA 4XJWA 1AR92 1UOFA 4JHTA 4AGRA 4LBKA 1KQRA 3NMBA 4ZU4A 5A7NA 2DFCA 5T52A 2Q8DA 3WHUA 1QJU3 5C6CA 3SITA 4TTGA 5J37A 3WNPA 4GKXA 1ULEA 5FQ0B 2D93A 2D6KA 4ET7A 3TNQA 5CFCA 2LM3A 2Y6LA 1GBGA 3HD8B 4WV8A 1KD7A 2W94A 4URTA 1W2NA 2Y26A 3PTYA 1WLCA 1WMEA 5E16A 4CPBD 1OA4A 3VBRA 1F5FA 2VUCA 2YBSA 3H3UA 2R32A 4D6QA 5J7MA 3ZXDA 5IHRA 2JKXA 4N53C 4ASLA 2AACA 4XJZA 3OBZA 1F31A 1ULFA 2D7FA 1W9FA 3VBUC 5E88A 4F8AA 1H0BA 1SHWB 4BIOA 1JUIA 1TNRA 1KDKA 1C28A 3VBSC 3MGUA 5LK7B 4LUMA 1JYVA 4FPOB 4QGMA 4XPVA 5F9TA 5IW0A 1D2QA 4XHXA 3SKVA 2BVVA 2DUOA 2E26A 2HWE2 3IZOA 4P14A 4XF0A 5JI7A 4FFFA 4B1MA 1V6LA 5KXCA 2YC0A 5A6QA 1EUTA 4WM7A 4JGZC 4LBQD 1BYHA 2E53A 4YG3A 3V0BB 1RUOA 3DPRB 3TN92 3WDVA 3WNOA 4QPGA 1H6YA 5FREA 5BNPB 3WVJA 1NA1B 1OVPA 2CWMA 4RL7A 3ST7A 2XONA 4KNCA 1OD5A 1UW8A 5DDJ1 3ENRA 1HV0A 1OBNA 1B09A 2ZGRA 2E51A 2FHRA 2RS53 3NO8A 1AR93 2IXIA 1V0AA 4JAAA 4CCCA 5E89A 4DPNA 3T2OA 3HT1A 1CAUB 4XBNA 1N3PA 3SCFA 2AZ5A 5L73A 4DFSA 4CDWB 4N7IA 3N7LA 1SDWA 5KHIA 2EXJA 2WLQA 3IAQA 2XJVA 5FY5A 5CG8A 2DU1A 1RUF1 5ACA2 3ACIA 4MSVA 5C3SA 4AL9A 1H8TC 1Q8OA 4E2GA 5JPMB 5FY4A 4W6YA 3RZLA 2BWCA 3J8F1 1GWKA 1JOJA 2ZTNA 2YC2A 4FPJA 4KH9A 4XVHA 1C57A 5F2SA 5FZLA 3URFA 1UMZA 3PJYA 4A6SA 5FZOB 1HN0A 3OG2A 4B1LA 1VE0A 5G04L 4NPLA 5LA0A 1GSLA 2R49A 1S4CA 2PMWB 3J7NA 2VZSA 1QU0A 1AR72 5A1LA 1UMIA 2W08A 5IVEA 2YU1A 5K0UB 3NJZA 4LHSA 3AYEA 1H2NA 1APNA 2VMDA 1ZM1A 4NIDA 1O7FA 3AKRA 4K7JA 5A1FA 4Q4Y1 2HWE3 2XPJA 5JAXA 2RHPA 2Q8CA 2WAAA 2CAVA 2PELA 1MEC2 1UNBA 1YFYA 1R081 2IUWA 2ZA9A 4N43A 1MPXA 3OTFA 3POYA 3TN93 4V1PA 1S0EA 4RGGA 2B9UA 4A4AA 5HCAA 3RZKA 1ZA4A 4IERA 4NIGA 1ZRIA 2RS12 5DUUA 4CCMA 3U4XA 1KGYA 1CPNA 4FCAA 1AL21 1JZ3A 3MLKA 3ILFA 3KZ4C 5EJ3A 4YW5A 2GNTA 1UU6A 5I0RA 3TYJA 5D1IA 1CX1A 3RS6A 2HWF1 2GDFA 5A7WB 1O4TA 2JDMA 2WINB 3I7DA 1DBNA 3U07A 5DZGA 4UAPA 3U10A 2H6BA 2ZGUA 5ACA3 5C3OA 4D69A 5C8CB 4RYDA 5F3GA 2DWRA 5FYHA 5FZ0A 4QQHA 1T6GC 2W1SA 3L2HA 3TB0A 3DPRC 4Y22B 4Y5Z0 2WKKA 1NA1C 4V2WA 2ZX3A 1MQTA 1RHI2 5JXJA 3N9QA 1PMIA 2VULA 2RS32 3VBOA 2UYAA 1AR73 4EWEA 4Y1YA 1ZBE1 3WV6A 4BXFA 2VZTA 4QX8A 3Q8AA 1CESA 4GMP0 4K8RB 2FDJA 2QKDA 1JUHA 1DLCA 2RDNA 2DVFA 3OBAA 3AZZA 4JVAA 3SCHA 1W8HA 3GYDA 1UZZA 4Q0VA 1LHUA 2A3YA 4I30A 5FMOL 1MEC3 3FLTA 3TAYA 3VDDA 3VD3A 1AVBA 3VZLA 5BNOB 2R1DA 3AB0A 1AX2A 1POQA 1CAXA 3FLRA 3OGRA 4CDUB 4FP2A 4Q29A 2JG8B 3RZMA 3LKJA 2RS13 4D6RA 4GB31 4QAWA 5DG2A 4P5YA 2KR2A 3UKVA 4C91A 1D2SA 3AZWA 5JIUA 1CZVA 1MVQA 4DY3A 4LOSA 3ABZA 3FE5A 3JD71 2PAMA 4Y24A 3TEZA 1VRH1 1AR82 1SBEA 5T5JA 5L7OA 1OF4A 2F4LA 2HYKA 5K0UC 1VBA1 3ROUA 2VTXA 4QMAA 2BU9A 4AI3A 5C3PA 2ZAHA 3E6BA 4FPYA 4P9WA 2Q1ZB 3KQ4B 4W65A 1LENA 2HH9A 2ZGPA 3DXUA 5IWFA 4E27A 3BUCA 2ZHMA 3Q9OA 5FZ7A 5LY1A 1RHI3 3WX5A 4IEWA 1W6MA 2WIIB 1AHSA 4AVVA 2RS33 1YIPA 3I2DA 2LRPA 4LT5A 4YG6A 5FY8A 3BOPA 1TME1 1QJX2 2J1RA 2GU9A 5HXMA 4DOUA 3C7GA 5H9QA 1DG6A 2XWBB 1U5ZA 3UKTA 4QHBA 5CEHA 4K3UA 4UW3A 1JZ8A 1VBC1 1TG7A 2J1TA 1H1AA 4DUVA 5C8CC 1UY4A 1LOGA 4OHZA 3U37A 5F5AA 3K3NA 4PLMA 5B4NA 3S57A 3O12A 4W4ZA 5JUVA 4LKSA 4CXYA 1LAJA 1ZRCA 1TMF2 3B00A 1WLTA 3AKPA 1ALYA 2P6HA 3O0XA 5AC91 5HPOA 5KHKA 1NLQA 2ZJCA 1UY3A 3FX3A 3VZKA 4MZUA 2A71A 1IS6A 3ITQA 2ZEWA 4QDSA 4A7ZA 4YM2A 3K4ZA 5LWBA 3ZYRA 3VD4A 1AJKA 2VPVA 2YMZA 2FBEA 4PI2A 2VZQA 5BNOC 4ZHNA 1DQ5A 1VBB2 3W5MA 1LB2A 5H9SA 1GNZA 5SV5A 2XMLA 4CDUC 1RUH1 3WY6A 4CSWA 2ZCWA 4LA2A 2JG8C 1F8VA 4BMBA 4M3CA 1UAIA 5LB6A 3T4VA 2YG0A 1CWPA 4M0NA 3LD8A 5FJKA 2GMPA 1I6XA 2FDGA 4NR1A 1WKYA 1KJLA 3POBA 1F4HA 1QJX3 2VGDA 3H8UA 1HX6A 4FOWA 1HQLA 2WL1A 4AR2A 1W90A 3MYXA 3KV6A 1Y9QA 4BQ2A 2XUMA 4JZRA 1W0NA 4TWTA 3IDCB 1QDOA 2HWB2 1JYIA 3C8XA 4META 2OT7A 2AEYA 5EYYA 2Q8OA 2D3PA 2JICA 2X10A 4KMQA 2HWD1 4YGCA 2R6QA 3LE0A 5FP9A 3WG2A 3NJXA 5DG1A 2DDUA 2NZ9A 4U2AA 4DY5A 4AEDB 4LBLA 1OKQA 4HMZA 3HBZA 5DUXA 1UZWA 4G4FA 4XUNA 5JXGA 1TMF3 3MW4A 4LR4A 2PXJA 4COVA 3QACA 4QPIB 1DQ4A 3GF6A 4W50A 1WD3A 1QJY1 2SBAA 3LSDA 4JTOA 4CCKA 1PVC2 3HR9A 3FFQA 4MGSA 3M3OA 4DMIA 4EQVA 1OHFA 1MS4A 4OZOA 2VVEA 3J9SA 1ENSA 3R0RA 5J98B 3TRSB 4BQ5A 4Y20B 5KR7A 2V73A 3WNKA 3BIEA 2AENA 5F3CA 2HJIA 2RDQA 3USUA 1HXS1 2E32A 2GC0A 2VMEA 2XHNA 3RZHA 1VBB3 3AM2A 5FMOS 3SH3A 3VBSA 2JG9B 3GXUA 1LODA 1C1FA 3WT3A 1I9RA 2LW8A 1CN1A 2Z79A 4RS5B 4YM1A 4BYYA 1JHJA 4QQPA 4B3NA 3LDBA 1D0HA 2DCTA 4QXKA 1X36A 4JGZA 4XFGA 3I2JA 3ZPOA 2C9AA 3ZN5A 1UQXA 2FZ1A 2P5BA 2WLPA 5EQUA 3AKSA 2VD7A 4KBZA 4D6SA 4NIHA 1CJPA 1L7QA 2D3RA 5L36A 3DYOA 4LO5B 4Q0UA 3O1UA 2QVSB 2HWB3 1NQDA 3K75B 3RJRA 5SV8A 2BFUL 1JZ4A 1ZYBA 2V09A 3THCA 4CDQC 4U36A 4AI9A 2JDAA 3ZSLA 2W68A 3INAA 3AC0A 3AYCA 4XFHA 2B46X 1W99A 3ZMOA 1LEDA 3FFZA 1VMFA 2EIEA 3KVAA 4NRPA 1H8TA 2BBVA 1IG3A 3T2TA 2VOKA 2YBKA 4IV3B 2XDVA 2OZJA 4LIUA 3BYWA 3I2HA 5DDJ2 1RIRA 4H7MA 1O8PA 3MIFA 1EPZA 4QGNA 5J48A 1PVC3 1XRUA 1IOAA 2BTVC 4WVMA 3WNXA 1A8DA 4Y1ZA 2VW2A 1QEXA 2DTWA 3B94A 1Q8SA 2GAUA 2XQRA 2EIDA 2JIGA 2W52A 4LLFA 5GM0A 5C9AB 1LHOA 1U5YA 5I8SA 1X9PA 3R4UA 4QX0A 4AYUA 1RJ8A 4HT1T 3U11A 3RZJA 2WSVA 4LEJA 4H55A 4NVPA 3FHIB 4XDQA 4MGIE 1UF2C 3OPZA 1RUF2 3I2FA 3NRUA 3CZUA 3PMSA 3H7YA 1EUUA 3J8F2 1T2XA 5FQ0A 3WG1A 3KCXA 4UI9L 4AEDC 5A7SA 4W6WA 2XJRA 2XKPA 5FCCA 1YWKA 1I5PA 1YFUA 2DV9A 1SPPB 2QQKA 3KT1A 3MO4A 3OBTA 4M0HA 5LBFA 5T54A 3SEPA 5CA6A 1PX3A 3PUQA 5HCHA 5A6ZA 4QPIC 2V72A 3RRDA 1RUI1 5FZKA 2XLAA 2BRTA 4XIOA 4NIIA 3J7HA 1W6PA 3OUHA 1MS9A 3BU0A 4Q4Y2 4XACA 2I45A 4WM8B 4TXWA 4UW4A 3T30A 1LHNA 2JG9C 5IVFA 1UN1A 5AFEA 4RS5C 1DDLA 3T0DA 3KGLA 1FX5A 3R05A 4QQ2A 3RWKX 2I74A 1ENQA 5DDJ3 2GP5A 4CXXA 1AL22 3V0BA 2VBBA 2E7AA 1DP0A 3VV1A 3DPRA 4XE9A 2WZ8A 2GNDA 3EMRA 3KGZA 1VALA 2Q8EA 4NJ4A 2FDFA 1V6IA 1NA1A 2EVXA 2QJVA 1DFQA 1CVNA 4O7XA 5L19A 1MS3A 2YFZA 3AZYA 4HKOA 5BY5A 2HWF2 2VZ1A 1ULPA 2DF7A 1UIKA 1UOGA 4BK5A 4LXLA 4CU8A 1RUF3 1KXGA 2XJQA 3MICA 1CAUA 4S2FA 4ARYA 4AWDA 1JYTA 1NE4A 2CU5A 5C5TA 3NQHA 5IK7A 2VU9A 3DECA 3J8F3 2WQZC 1HB4A 2WA3A 3KF5A 4IEYA 4CDWA 4OI0A 1W8WA 1Z78A 4LKEA 4AXOA 2GP3A 1ZVFA 3O0VA 1YRZA 1AYN1 4DIQA 2VO5A 2WWSA 4IV3C 2BQPA 4PDWB 1ZBE2 3JU9A 1FOD1 5EJ1B 5FZOA 4FTSA 4XXPA 1J1LA 1U5XA 3J7LA 3NJYA 3ZMNA 5C9AC 2BJSA 1PMHX 3GBGA 1LOCA 1OH3A 4Q4Y3 3HJRA 2WO3A 5JR7B 2K9ZA 5L7OB 5H9PA 5I93A 1AJOA 5K0UA 5JCTA 5GLZA 4TLGA 2WFF1 3B3QE 4Y5SA 5FZGA 4BA6A 1IPSA 1HIXA 3KV5A 2NPIA 4YM0A 2ZPXA 4GB32 4JDOA 4QXCA 3WHTA 1DHKB 2ILMA 2UWCA 3UKNA 2IXJA 5A6XA 1AL23 5FP8A 4LNVA 3OGJA 1VIWB 3ATGA 5FPLA 1BVP1 1I1EA 3IM0A 2CTVA 2VE1A 2Y0IA 3ILRA 4LQRA 3ZM8A 2XL7A 1ZNPA 2XVLA 3S6PA 2HWF3 3KQRA 4QKDA 2EALA 4XFFA 3VD7A 1UXZA 3A0KA 2VZUA 1VBA2 3ELNA 5EPAA 3E97A 2WJSA 3AMNA 1ODMA 2BFUS 1R1A1 2QQVA 3CL1A 3LA3A 4JCKA 2A1XA 3OB8A 5FXWA 1UYYA 4M4PA 3VZOA 4IE0A 3CBNA 1SBDA 4Q1RA 2DBIA 5A7WA 1A34A 3EB7A 3RJ2X 5A3NA 2NM1A 1SCRA 2CY6A 3WDTA 5FZDA 5KXDA 1F15A 1GP5A 1Y7BA 3MW3A 5FPVA 5C8CA 5JZGB 5J96B 5DAQA 4K8FA 5T5PA 1WZXA 1QOOA 1ZBE3 4Y22A 4KU8A 1HRI1 2ZKLA 1TME2 2DUPA 1XYNA 5I0UA 2DVDA 2ATFA 4BMEA 2WFPA 1WMDA 2JE8A 3M3CA 5FYTA 3HNBM 4DXZA 3OOXA 3ZFGB 3D0SA 1JOPA 1VBC2 5LA2A 3H50A 3W20A 5C7GA 3RG0A 1YI9A 2XJTA 3ZSEA 3MW2A 2YZ4A 3LOIA 3NV1A 4GB33 2QZ2A 4UXAA 2XG3A 4AGGA 5BNOA 2R7EB 3K3OA 2CAUA 3NAPC 3C7FA 4Q4W1 3SH5A 3KHBA 1W9WA 1AX1A 1O4YA 4XZUG 4CDUA 4O9EA 1O3TA 2QQWA 3P1IA 4XJUA 5CVRA 2JG8A 4PDWC 5AC92 4LO8A 3AP6A 4YW2A 5D8AB 2DURA 4XFBA 2BERA 3O0WA 1QDCA 5M0TA 2P17A 1VBA3 3H1MA 4Y1VA 1FNYA 1I3HA 2ADDA 4CUCA 2MEV1 2ZGQA 1O4ZA 2VR4A 4ZZ5A 5JWPA 2I07B 3KHCA 4LBQB 1Z7S1 4YVSB 3ZN4A 3UT0A 4D94A 1YQCA 4N9HA 5JVVA 3ZX7A 1VP6A 4OHWA 3AKTA 2A75A 1RUH2 4URAA 2HWC1 5FZ8A 2AREA 3MV01 1WUVA 2PHLA 3OF1A 2VCCA 1HLCA 3KS7A 1JZ2A 3PIGA 5FYYA 2JDYA 4BLJA 1O3QA 1LHWA 1TME3 1UKGA 4QKBA 4E4HA 5EZWA 4LE3A 5J3UA 5FMBA 2ARXA 1UX6A 4CRQA 2WWUA 2BOIA 2LALA 2WYSA 2MHFA 2XGXA 1FPN1 1XPWA 3DYPA 1X50A 2YGLA 4H3WA 4S2HA 4C1XA 4CP2A 2XJPA 3GZTB 3VHRA 4MVTA 3FBYA 5GLVA 1VBC3 4N53B 2PLV1 1WWYA 3PVEA 3MHZA 3HIFA 2HWD2 4ZXKA 3VBUB 2C4XA 3AP4A 3USUB 2WYFA 1WLWA 1YLLA 4HETA 1HQWA 1WMFA 4WVWA 2Q0AA 1N3QA 2XLFA 4ZU5A 2VQTA 1OQEA 4YZ5A 3IDEA 5JZGC 4F3JA 2XKOA 1AXYA 1AYM1 2UY9A 2C1FA 3LPGA 1TEIA 5AC93 5JIAA 5A3WA 4B8EA 5JLVA 3I49A 3SKJE 1QJY2 2BNMA 2O0OA 3GZEA 3J4UH 2ES3A 4COYA 2W92A 1HW5A 5FPZA 1WCDJ 3OGSA 1AL0G 2O8OA 3H9AA 4QQOA 2B42B 4F83A 4YLZA 4P9GA 4LLOA 1R1ZA 3I59B 3RVHA 2XBO1 3BALA 1VR3A 1HXS2 5DAVA 4JDNA 1W0OA 1UMHA 4TLFA 4L8QA 5I0DA 3ZFGC 2LS6A 3AXDA 4KGQA 5FMCA 4P9JA 4MGTA 2OKXA 1RUH3 4YZ2A 1O59A 5AFBA 2QQJA 3POSA 1RXGA 4CDQA 5KXEA 3BU7A 3LWCA 3NW4A 4Y5TA 5ANNA 4AFMA 4ZKTB 3LEIA 1IQAA 1BEV3 1LKNA 3I97A 3O14A 1OQ1A 2E9QA 4MHRA 3ORJA 5FZEA 1JMUB 2VMCA 1H8TB 1V6MA 4PIYA 4XF4A 3WQBA 5A3LA 2W9XA 5D8AC 1YO8A 2VUJA 4CP1A 2PA7A 4RSUA 5DPNA 5IFPA 2RV9A 2RR11 2EIGA 1QNWA 3KV9A 4EJRA 4DQAA 2Z5WA 3NNJA 3U4SA 3ZXJA 2HWD3 4CCEA 4QX7A 4YW3A 1XSQA 4BPZA 2JEMA 4YVSC 1XU1A 4JDMA 4A3XA 5FYIA 1GWLA 2RM21 3SNMA 4CE8A 5F3EA 4QX1A 4AEDA 4QKNA 1HB2A 4AI2A 4C0HA 4HXCA 1GP6A 1WCQA 5CKQA 2EXHA 1IQDC 3M8LA 4QPIA 1HXS3 2VCBA 1DGLA 2W87A 1YEWA 4FPGA 4WVZA 5LBEA 5C3QA 3BTZA 1SEFA 2KXLA 4S2GA 1W6PB 4Y20A 4Z2AA 2JENA 1W3VA 5FLHA 3S30A 1GQHA 4OQ8A 3S5QA 2EXIA 5IYYA 2VL4A 5F2WA 4A3ZA 1B35B 4FT8A 3FHAA 1PNGA 2JG9A 4FPFA 3LIHA 1W9YA 4KWKA 1G9AA 1OURA 1QH7A 2R0FA 4RS5A 4IESA 1JYXA 1YYNA 4JKLA 2XR4A 1RUI2 4I3PA 1C8M1 1YXWA 1VLNA 4XJAA 3PVBB 3RYKA 3UNPA 2E7QA 3WQ1A 3O5SA 2C9KA 4GJZA 1TE1B 3GHNA 4NPMA 1H8VA 1RMU1 4TN7A 3U0ZA 3LA7A 4H2AA 4XDPA 3N7KA 4FPHA 3N35A 5DZFA 4X6RB 2X5IC 4Z8BA 4IEUA 3I54A 1X7NA 4XBQA 4ASKA 1XE0A 2E6VA 1POV0 4COUA 4E2SA 1QF3A 3M1HA 4KG8A 1FV3A 4UFMA 1FXZA 3SISA 1S0BA 3WUDA 4FQ4A 4A41A 2P6CA 1UYPA 1JI6A 2WS91 4IV3A 3T2PA 5KXBA 3I8TA 4QB6A 3ZXKA 1K45A 4MHUA 1LESA 3MIBA 1YQ6A 1OSGA 2D6PA 2A5ZA 5C9AA 5LCWL 2DBNA 5DUWA 1C3HA 3BN6A 2RMU1 1H4GA 2YROA 2QQLA 4AHXA 4CYDA 2GNMA 2ORXA 1RUD1 4XTPA 4I02A 4MXVA 2WNEA 3LPFA 4GH4B 3WW3A 1AYN2 4NUBA 4DEQA 2FD8A 2ZOEB 3D3AA 1O3RA 4QDQA 3HPNA 1PGL1 4ZS2A 1RUI3 5L9VA 3WP3A 4BU2A 1IG0A 1H30A 2ENRA 1ZZ9A 4YW6A 1FOD2 2ZX0A 3WZ1A 1SPPA 4C90A 2ZGSA 1XSRA 5IJRA 5ANQA 5A3UA 4WZCA 3T0AA 4BISA 2Z4FA 4BQ1A 2C0ZA 2EA7A 4HVQA 5CADA 1PO21 4HL0A 4YW7A 3V64A 2OXBA 3EJKA 5JOXA 5FK7A 5C4WB 4IEVA 4YW4A 2WFF2 2VBDA 3HN1A 2CL2A 3HWJA 2VCMA 1A3KA 2Y6KA 4SBVA 3OUIA 5GJ6A 4N7UA 1B35C 4WM8A 4LBOA 1W6NB 1XBFA 3MLJA 5A32B 4O9GA 4XUPA 2CGOA 2VUDA 4XYXA 3HQUA 5FR3A 1VBD1 2OW4A 3D5OA 1GMMA 1OF3A 3P5BA 3WNNA 2WBKA 4B7EA 1CJDA 1QKQA 4YPJA 5EP9A 2ZGOA 1WCKA 2VZPA 3IKWA 3K2OA 5FBZA 2GC3A 3LOBA 3FJSA 5CFDB 4FTBA 2JJ6A 4OUSA 3ZR5A 1WA6X 4PJYA 3UGHA 5HCBA 1D4VB 3E6DA 1R1A2 4HSJA 4XETA 4MYEA 2W5FA 2PAEA 5FZ1A 4C1WA 5FKCA 5EYXA 3BGAA 1OMIA 1LU2A 1W6OB 3W21A 1COV1 3KCCA 2FDIA 5BNNB 3EO6A 4PHZA 2XB6C 4HN0A 2RG4A 4EN0A 3ETPA 5FXZA 4ATFA 4NRMA 5FV3A 1AYN3 1UZYA 5TSWA 1W8FA 3MPBA 5F39A 2QE3A 1ZZ6A 1KJRA 1XJAA 2B9VA 2W2IA 1FOD3 4UBHA 3NAPA 4FFHA 1HRI2 2D98A 3NV4A 4Q0SA 1US3A 4L0PA 5FP4A 1ENXA 5FZ6A 5GZDA 5IT6A 1ASJ1 3O1RA 1UOJA 2E31A 2E63A 4UW5A 1H1IA 2EXKA 4XFIA 4PDWA 4B7KA 5F1RA 3SCGA 3WNMA 1J1TA 4IEPA 1FV2A 3VB9A 2YUEA 1MZ5A 2E33A 1GOFA 2G9ZA 4I2OA 2WFF3 4M3CE 5AVAA 3WDYA 1S55A 2V5YA 3RMYA 4K40A 4JKMA 4I0AA 1C4RA 5FZHA 1PIV1 5FXVA 1UU5A 4GH4C 1BMV1 3ALQA 3RPQA 1VBE1 4NO4A 3RNSA 2OUHA 4LO4B 4Q2FA 5ABJB 3ZIWA 1W9TA 2F17A 2QZ3A 3VGIA 2YGMA 4RGKA 5D2AA 1R1A3 1W8TA 2WT0A 4Y3OA 3PVNA 1BXHA 3IB3A 3T4HB 2JKBA 5I8YA 1W39A 2XLGA 2ZBJA 1Z7S2 4MGQA 3MFAA 1ND2B 3A22A 1VMHA 4IW3A 5C4WC 3HBKA 5A70A 1IGOA 5FZ9A 3IIIA 3B01A 2PHUA 1LHVA 2QQUA 1DCSA 3DKQA 2ETEA 4YVWB 2PQQA 2XJSA 3ZDSA 5KHGA 1ODNA 4A42A 1O3SA 4J1WA 4HK9A 3BVCA 4PCRA 3CF6E 5JSOA 3AVSA 1WW5A 2HYXA 4XF1A 1HRI3 1XNDA 3NL1A 2F6BA 1ULOA 5T50A 4EYUA 5JZGA 3FUOA 1XYPA 3N9PA 4P9XA 1YIFA 4QM9A 2Q1MA 3JBG2 5CFDC 4FPKA 2O14A 3EQEA 2PLV2 3GBWA 4IE5A 4XZPA 3POIA 2VJXA 1CD3G 1RUG1 3T09A 1NLSA 1AR83 1CIYA 1JU4A 1X82A 4GQ7A 4LITA 5T55A 5BNNC 1T6BX 3A0NA 3ZFGA 1DYOA 1BBT1 3ZOIA 5JOZA 3ZYIB 4L92A 1PGSA 1YQ2A 4CPBA 3DF0A 2AEZA 2P4EA 2R1BA 4AQSA 4CDQB 2GALA 2OZ6A 4FPLA 4GJYA 2FMYA 3UJOA 3PUAA 2CGNA 3I2KA 1HB3A 5T5LA 3ZXLA 5LY2A 4FQZA 1OFNA 4UYBA 4EV0A 1ZBA1 2P1BA 2VG9A 4NPRA 4AQ6A 5D8AA 2ZZQA 4L11A 1Z7S3 5LBCA 4AFAA 4DUXA 2N7GA 3H0OA 1IKPA 5FPAA 1US2A 2G19A 4A7KA 1NUKA 4P9YA 2X05A 1QJEA 4GWMA 4XDOA 4LBQA 2BZDA 4MO3M 4PLNA 4YVSA 1XE8A 2W47A 4NAOA 5CB7A 4LORA 5JSPA 3AJYA 3D82A 5IAXA 3WF4A 4EE2A 2VW0A 2WNUB 3HN3A 1GZTA 4DXRA 1WW4A 4HLTA 4Y26A 4IQPA 1SFYA 2EAAA 4PIZA 4BWOA 5ABJC 2YBPA 2RR12 2Q4SA 3JBG3 1YQ8A 1LGCA 2BVBA 2VMIA 4KG0A 5I8TA 1XU2A 4IE6A 2PLV3 5FZFA 1NE6A 2MPFA 2B5HA 5GKAC 1JU3A 2NMNA 3FLPA 3P3PA 4RGAA 4UBGA 5HV0A 3K4DA 1ND2C 3WQ7A 2HEYF 4GWNA 3ZSJA 4QB2A 2PQSA 4N53A 4R9DA 1GP4A 4R9AA 4YVWC 1E5RA 2JDNA 2RM22 2WC2A 4NWWA 4R9CA 4MXWB 4P5HA 5EHDA 3VBUA 2X29A 2BP6A 3AKQA 3KD4A 4LPLA 1BHGA 1SLTA 2Z69A 2JDZA 3GBFA 1LNSA 1SDDB 4OHYA 2DTYA 2VXRA 1U0AA 1G9FA 2R071 4K21A 4R8HA 4IE4A 3ZSMA 4F7ZA 4BH9A 2UY8A 2I2SA 3CU7A 4DRVA 1UL9A 4Y1XA 4E4ZA 4YZ4A 5BXXA 4HANA 4HVRA 1OLQA 2ZGKA 1J3PA 4N8MA 4BQWA 1URXA 4JC1A 2VZRA 3SH4A 1G7YA 4RN5A 4XAAA 4CUAA 3I59A 2A6WA 1EV11 5K7PA 3I2OA 4AHYA 3WD5A 2D6NA 1OD3A 4JKKA 5FAXA 1RUJ1 1CZTA 1KEXA 3I3EA 1DYPA 5EV7A 2P3KA 4Q8KA 4GALA 4KWUA 5LRRA 5ISLA 2P2KA 3ETQA 4YSFA 5EIYB 2VVFA 2X5IA 3WF0A 3AVRA 4BQ4A 1C8M2 4XIKA 2YY1A 4Q0PA 4DZGA 1KDMA 2OQ6A 5FXXA 1W05A 2RR13 3IAPA 3QOPA 3WLUA 2VQUA 3E1F1 2WZPP 4Q8LA 5FYUA 1HKDA 4AAPA 3B7MA 1V6OA 1GZCA 1RMU2 2VVDA 4J1XA 4HKLA 3WR0A 5CYYA 5BNQA 4O61A 4AQTA 1H1MA 2QQOA 1SZBA 4MH0E 3VDAA 2RM23 1DGWA 5CIRA 2VUAA 2VZVA 4E4DX 2OS2A 2WABA 3EHKA 1A8MA 1OPMA 3T2QA 3VDCA 3B69A 4RR3B 2XH6A 4Y4RA 5HBAA 4CTEA 4V2VA 1CAWB 4RHV1 3OSDA 2WNUC 4QQLA 1XQNA 2WS92 4YARA 2WN2A 1AX0A 2PYTA 3FC0A 4Z82A 1DYKA 3N7MA 3WW4A 3VZJA 4ISRA 3LB9A 4IL7A 4N90A 1DLLA 3W9AA 2PTMA 4XJ9A 4JRLA 5BPXA 2CGPA 2GMMA 1YC61 2CWSA 2VOVA 2P3IA 4OCTA 3POEA 2ZHNA 4IV1B 5FY1A 2GC1A 3RDIA 2RMU2 4Q1PA 1QJFA 1RUD2 2OYZA 3VKOA 4LBJA 4AF9A 3B02A 1JOBA 3VBHB 4RFRB 1YUDA 1JODA 1NG0A 3E5QA 3LIGA 4G3YC 4OFGA 5AVPA 1PGL2 1G8WA 1B35A 1C8M3 1R082 2BNOA 2QCSB 2VAUA 2UU8A 2PHRA 4E9KA 3IMMA 4XF3A 4R52A 3AX4A 4B4PA 1W04A 2W1WA 2W1UA 3BB6A 1HN1A 1XE7A 5FLIA 1R64A 1S0IA 2P3YA 2QBXA 5F6LB 1PO22 1S2BA 1RMU3 1ZZ7A 4D7YA 1NKGA 1A78A 1QQP1 3T08A 4IETA 5FTTC 4DO0A 5E1RA 5DMYA 4LULA 3RSJA 4PBPA 4LKFA 1POV1 4IEOA 4FI9A 2OUJA 4OQ9A 4WVVA 2BNNA 3NNMA 1Q8PA 1PX4A 4CP9B 1VBD2 4AI1A 2ZHLA 3M3EA 2WS93 3WP4A 1J58A 3ZN6B 2A6VA 3K4AA 3SMHA 2QDRA 3NAPB
chains in the Genus database with same CATH topology
2IXHA 1C8NA 5KHHA 5JOWA 1QY4A 1ULCA 2GZWA 2RMU3 1COV2 2ZGNA 4HPKB 1NCQB 1RUD3 3MLLA 3JB4C 4KBBA 4EN8B 3ZFEB 4AHWA 4MX3A 1K5MB 2XJUA 3C2UA 2XHKA 3QBQA 4RR3C 1R083 2G9GA 4GH4A 3MIDA 2WZR1 1ASJ2 1C5HA 5DUVA 5FFOC 3WINE 2UWAA 3PHMA 1PO23 4YGBA 3WDUA 1ZRDA 3VBFC 1MR5A 3ILNA 3QH6A 4FO9A 2UURA 1DIWA 4P9IA 4IV1C 3JD72 2YV8A 1VRH2 5IK4A 1YJLA 4FAHA 4CDXB 2AUYA 1PIV2 4XF9A 4M01A 2WQ4A 1VBD3 5C4WA 3VBHC 3B5LB 3BTAA 4EN6B 1BMV2 1VBE2 1LOFC 3N36A 2XVKA 4FSJA 4AVTA 3W59A 1VJ2A 1W6NA 4NHLA 3W58A 2R061 5A32A 2X8KA 1CQ9A 4HVOA 4YG0A 5LEKA 4OI4A 2PFWA 4AVBA 3AK0A 4QX5A 1PGW1 4GMP1 2DFBA 2XVGA 3OJBA 5FOJB 1FNZA 3M4FA 1COV3 1QMJA 4CP0A 5CFDA 4LA3A 2VQ0A 1X8EA 3CEWA 5JOYA 2NMOA 3DN7A 4LTAA 1W6OA 3D0JA 5CU1A 3ZVXA 3C3VA 2IXCA 5BNNA 3VN4A 4AG4A 1LOAA 4ES8A 4JTNA 1ASJ3 3GHMA 4LO7A 1IPJA 2JE9A 4XJ8A 4OUMA 3IN9A 5GZCA 4NHMA 2ZGTA 4N9IA 2DUQA 2JXAA 2Y38A 4DINB 1LECA 2VMHA 2IWGB 1N1SA 3E5XA 2Q30A 3JD73 4JGYB 4KQ7A 3TAYA 1VRH3 1RITA 1NCQC 5JDBA 5GZEA 4D7SA 4OHVA 1PIV3 1BBT2 1MVEA 3ZFEC 3FWEA 1WW7A 1K5MC 2DYCA 1VBE3 4KWLA 1HDKA 1OPOA 2D5HA 2RJKA 2AR6A 2YYOA 4DB5A 2VW1A 5CAZA 5B2GB 1J3QA 4OI1A 1IKQA 1BCXA 1QXJA 1ZBA2 5GLWA 4BLIA 1IZ3A 1RUE1 2DCKA 1AXZA 5ABJA 3G7DA 1X33A 5LK5A 1XNBA 4YFWA 4XOGA 3WXPA 3LAGA 4I0BA 2TEPA 3AP5A 4AFCA 1N47A 3WCSA 4CEYB 4CDXC 1ND2A 2SLIA 1M06G 4X6QB 2ET7A 3THPA 3OD4A 3OY8A 3S0MA 4YVWA 2ET1A 1HQNA 4KGGA 1FYUA 5FLJA 1Y3TA 2YXSA 1DZTA 1NY71 4NOTA 3B93A 4XW3A 4RFT0 1ND3B 1XNCA 1GLHA 4G9SB 4OZXA 1KS4A 3WQ0A 1YI7A 1BBT3 3DL3A 1GR3A 3A4UA 5E8AA 4UW6A 2VNRA 4EN7B 3NKGA 4KL1A 2VNGA 5A33B 5JSRA 3R6SA 3RWNA 2OIIA 2R072 1H2KA 4R4XA 1ZBA3 1YFWA 1SBFA 2X5IB 3AYDA 2UYBA 1RC6A 4GA9A 4Z2WA 3OYWB 4GIQA 2XWJB 4JGYC 1SLAA 1EV12 4RA0A 3VKLA 3RYRA 1JTZX 1V9U1 3PVOA 1RUJ2 3J26N 3GZUC 1IS5A 1JBCA 5FO7B 3VKMA 1F2NA 3DUIA 5IUQA 4XMAA 4FVVA 1HRV1 4XTMA 4OHXA 4EN9B 3EBRA 4AVAA 3V0AA 5FPXA 3IIAA 1Q43A 4E4SA 1C1LA 4S2DA 4K1ZA 2ZGMA 2WNUA 4B29A 2GN3A 1UPSA 4Q27A 1QJY3 4COZA 1LEMA 3H1YA 4X8NA 3RQ0A 5CNAA 2ZMLA 2YHJA 3RMXA 3AXEA 2AGSA 1S1AA 3NSTA 2DCJA 4CEYC 3CO2A 3D4KA 1R091 4M00A 2R073 1ZRFA 3OGGA 4HFSA 3LGRA 4RHV2 1REEA 4MXWA 1BKZA 5T5OA 4D7TA 1ZX5A 3VUOA 2PN5A 2VNOA 1YCIA 3LCPA 4AI0A 1AR61 2F4PA 1BZWA 1ND3C 1UIJA 3NWKA 1EV13 2CNAA 1FI2A 2TBVA 3BODA 4TSVA 1O5LA 4Q4X1 1ONAA 1RUJ3 4YZ1A 4FPCA 1SCSA 3JQWA 2LUWA 4Q0QA 2P3JA 4AQ2A 4R4ZA 3FMGA 1JYCA 1REDA 4GKYA 1PK6B 2R041 1WW6A 5JI9A 2WA4A 5DZEA 1N3OA 2IFWA 2K0GA 4FP3A 1PZ7A 1QQP2 1L3JA 1ZZBA 4LBNA 4KU7A 1AZDA 1MS1A 1KFXL 3WOGA 3KCYA 2ZX4A 3I4IA 4MGYE 4RHV3 1A6CA 2D40A 2D5FA 4RR3A 1LCLA 4NHKA 1SFNA 1CAWA 3CJIB 4XQWA 4Q26A 3VHOA 3AP7A 3MIEA 3HQXA 3MIHA 2CV6A 3HMYA 3AMHA 1O5UA 1S0FA 2Y0OA 1GV9A 1Q56A 3VBFA 3AMPA 3UL2A 4IV1A 1C5IA 2Z42A 1PO11 2X53S 1QHDA 2RE9A 5J09A 2QUOA 4I0WB 1OOPB 4K9SA 1D4M1 2WZR2 4HBNA 3VBHA 1CR7A 1DQ1A 1KRIA 4LHNA 1LOFA 2EF6A 3WDWA 3L9JT 3ZYJB 1NOVA 1QQP3 3VLBB 4L99A 3VHPA 1AF9A 5H9RA 1JW6A 2B7YA 2TUNA 1POV3 2ZS6B 5LRSA 4ITCA 5HI0A 2OPKA 5EXOA 4C0BA 1YJKA 5C8WA 1YNAA 3V56A 4OVEA 2GH8A 1QOTA 3QLQA 1JHNA 1SMVA 4HSLA 3JCIA 4Z1VA 4LBMA 1V6KA 3B9CA 4OLLA 4AE2A 1PZ9A 1RGSA 3CLPA 5I0SA 3PNAA 3HAGA 1PK6C 1LU1A 1Q8VA 2B45X 2HEWF 3NV2A 5HXVA 1IPKA 5IK5A 2R062 1WGPA 3DKWA 2D44A 3WDXA 4RQPB 4WBBA 4BE3A 1PGW2 2R0HA 5LEJA 1J59A 1CPMA 3ZN6A 1MS0A 1LGNA 3N3HA 1RB8G 3MFCA 5BNPC 3IPVB 4GULA 4CEWB 2KM2A 1Q8QA 4HPKA 1NCQA 3S7IA 4BIFA 2WT1A 1SLBA 1RUNA 5FDBA 3TOJA 2WZR3 3ZFEA 4HKWA 1K5MA 4XFAA 3POWA 3FUQA 1V70A 2WNVB 2BGCA 3K51A 3TBDA 4FTEA 3WG3A 4Q4W2 1QH6A 1VAMA 3CJIC 3M3IA 4AK3A 3PLQA 4XFCA 4AHZA 2H0BA 1GANA 3ZXAC 3M2MA 4FXKB 4FOVA 1TQ5A 2MEV2 2H6CA 3ZXEA 4B4RA 3R4DB 5J36A 4I09A 3K48A 5GALA 1FAYA 4YGEA 3S7EA 4CDXA 4LUKA 2R063 1OOPC 5EFUA 2PHTA 2HWC2 3OY8B 5GLUA 4H14A 4GMP3 1BK1A 3VL8A 4ASMB 4HZFA 2FZ2A 1RUE2 1W2UA 1LULA 4W6XA 1FMD1 1XXNA 4MLOA 1FPN2 5KC6A 3MI8A 1IS3A 4GXLA 1BJQA 3MZHA 1GQGA 3KB5A 1CGPA 5KHJA 2D6OX 2NQYA 4ATEA 1CAVB 4Q4W3 4QD2A 4AW7A 1NY72 4RQPC 2H0VA 1W6QB 1AYM2 2IXKA 4MGZE 4Q4V1 1G6NA 3WCRA 1RVF1 5HCFA 3AZVA 1QJZA 2Z2SB 5BYNA 3PJQA 3AFGA 1QOSA 3IDBB 3OD0A 1PVXA 4CEWC 2MEV3 2XBO2 4JGYA 1GZWB 3RZZA 2QNKA 4K20A 1RUC1 1EAH1 4FPEA 4XHBA 1GNHA 1S0GA 3EXUA 5I91A 3JQXA 2IZWA 2ZGLA 1E57A 2HWC3 2IC1A 1O91A 2WNVC 1QXPA 1U5IA 3V0AB 1WLDA 1RUE3 3HT2A 4L2NA 2GC2A 1V6NA 1NCRB 4DS0A 2R16A 3UV9A 3BOWA 3MIGA 5GZGA 5FOBB 1FPN3 2HKXA 1MS8A 3L2YA 1V9U2 2JECA 4BHPA 3AFKA 4YYOA 1BEV1 4FOQA 1OA2A 2G9FA 3OBRA 4XQDA 3ZFFB 1SLLA 4FOYA 1YHFA 4MV2A 1OFSA 3ZSKA 4Z07A 1HRV2 3AZXA 1LR5A 2CYFA 4QGLA 2AYHA 1PNFA 4CEYA 1G9BA 1DQ6A 4NN0A 4MGKE 4QU2A 1GYKA 4EWDA 1AYM3 2YPJA 4JV4A 1EYBA 1NXMA 4JQRA 1DGRN 1FT9A 1WBLA 3UK9A 2BUKA 1LRHA 1PM7A 4LO6B 5CFCB 3VKNA 1Q3EA 3ZXFA 2ZACA 1ND3A 2BEOA 1QJU1 3DV8A 2XBO3 2B39A 3VBRB 2FMDA 2TNFA 1R092 2GN7A 3IT8A 1DQ2A 1FATA 2P34A 2BWAA 2PAKA 2BW8A 5A33A 2NP0A 4BZ4A 2NLRA 1S0CA 4CDWC 3H7JA 1DF0A 5BV6A 1XYOA 3GNEA 2QFEA 1AR62 1ULDA 1LJ7A 1SACA 3IBMA 1H9PA 4JRAA 3ZYGA 2WT2A 3WUCA 1LOBA 1V9U3 4Q4X2 4WM7B 1NQJA 1SQ4A 1QWRA 3AP9A 4QPGB 1IS4A 2GMEA 3OYWA 4KWJA 1V6JA 1W0PA 1F9KA 2A6ZA 1Y43B 3E6CC 4YNIA 1HRV3 4L97A 3MF6A 2R042 3LA2A 1N1VA 1LOEA 4XBLA 1ZRRA 4AFDA 1G9DA 1UD1A 4IEZA 1GKBA 4D3WA 2RS51 4AEKA 1NCRC 1AR91 3M7AA 3ZIXA 2DCYA 4K1YA 1DQ0A 5FRAA 4IEQA 2PHFA 1R093 4YW1A 3ZFFC 3D8CA 3T1MA 1LTEA 2EAKA 3CJXA 3VBFB 4ES9A 1VAVA 3TWIA 2DVBA 1LGBA 1MZ6A 1WBFA 1WD4A 1AR63 1BQPA 4I3GA 4FBFA 4X8PA 4YZ3A 5K8SA 4Y1UA 1NLRA 4LE4A 1VB4A 1UKRA 1EY2A 2ZABA 4Q4X3 5CFCC 2O1QA 1CIWA 3N7JA 2K2SA 1QXRA 4N43B 1CX4A 1RTVA 4QPYA 5KBFA 2HWE1 2WSUA 4AVSA 3KLSA 3VBRC 1VAKA 3ES1A 4XILA 1PO12 3AYAA 4XQ4A 2RJLA 3TN91 2R043 2A3XA 3UJQA 4YFZA 2VOXA 1UU4A 1D4M2 2ZAAA 4IXLA 1PZ8A 1EPWA 3APBA 3ME2A 1PK6A 4TYSA 1SLCA 4A7YA 2VMGA 1J3RA 1MZEA 4FXGB 3ECQA 3BCWA 4DRRA 1JN2P 1CONA 1VB2A 3H1WA 4A2UA 2A7AA 4WM7C 3OCPA 1REFA 2OA2A 3RI8A 3V65A 4QPGC 2JX9A 4AEJA 5ACA1 5BNPA 1U12A 3ACLA 1MQTB 4CZSA 3D6EA 1IHMA 2IXLA 3P3NA 4RD7A 2KA3A 3VBOB 3CNAA 2Q5TA 1ZREA 4OI2A 5I0TA 2D6MA 2A6YA 3SXWA 1AR71 3IMNA 3VDDB 3MF9A 2ZZJA 2O8QA 2ZMNA 3FZ3A 1CAXB 4Z92B 2ZMKA 1RL3A 2G4IA 3CJIA 1H2LA 2R30A 1MEC1 1PO13 1S0DA 2A73B 4HK8A 3MEPA 3E5UA 2A70A 1D4M3 2FQPA 3R4SA 4XMIA 5FO9B 2RS11 3ZPYA 4BOWA 5GLTA 4AGVA 4COWA 4Y4YA 1ZZCA 1OOPA 2PHXA 4ORFA 2D3SA 4NWVA 1WA4A 2W39A 1MS5A 2VOWA 2HEVF 1N1TA 4ONUA 1ENRA 4P9LA 4BCUA 3WP5A 4YM3A 4EWAA 1H4HA 4N43C 2UWBA 4PBOA 3NKTA 2A3WA 3VZNA 1OI6A 1X8MA 2GNBA 1W6MB 2VQAA 3VHNA 1DGWX 5C33A 3H3ZA 4HN1A 5F5QA 2ZX2A 1WCSA 4MUVA 4OULA 3TNPB 4QM8A 3RYPA 1RHI1 5T3NA 3WW1A 4LHLA 2RS31 3O7OA 5EWSA 4WM8C 4ISQA 4AEMA 3IWZA 1ZZ8A 4H7LA 4RQPA 2ZKNA 1FMD2 3WW2A 1YFXA 1HV1A 1OA3A 1OQDA 2PHWA 1MACA 5K9YA 2DCZA 1GZ9A 3IPVA 3VZMA 4AI8A 1MQTC 3VL9A 1QGLA 3JUUA 3JZVA 2GH2A 4XEZA 2QDNA 4XXAA 1NYWA 1RUG2 4ZU7A 4CEWA 2DVAA 3VBOC 2OVUA 5GZFA 2BYVE 5DXDA 1RJ7A 2MNGA 2GSYA 1NZCA 3AJZA 3KMHA 2VH9A 1EP0A 2NN8A 2YDEA 4K6BA 4Q4V2 3VDDC 2WNVA 1AR81 3KM5A 1RVF2 5JPNB 2DVGA 3NVCA 4FAGA 3M3QA 3ASIA 3QD6A 2D97A 4IEXA 1F5JA 4M3CB 2VECA 1M4WA 3B9IA 3WG4A 2D43A 4B4QA 2ERFA 4M3CF 1RUC2 1EAH2 5CG9A 4INDA 1AUYA 4I01A 2P37A 4SLIA 3DGTA 3QCWA 2D6LX 4PF5A 2IFRA 1KITA 2DU0A 3PMEA 1H2MA 3FBMA 5L7OC 3BIWE 1MZFA 1DGRA 2AH2A 1BVVA 1QJX1 3N4MA 1PHMA 3NV3A 3SHRA 1JXNA 3G6JB 3KT7A 1FMD3 1UCXA 1G86A 1NXD1 2A6XA 3KT4A 3M70A 4PLOA 4QT6A 5A3MA 2VY0A 1BEV2 3LZZA 3KSCA 5CBLA 1RUG3 2E7TA 3MDPA 2XL9A 2QQPA 1KFUL 3X29B 2ARBA 2C5DA 3ZXGA 4AVCA 3WP6A 3JBG1 1S2KA 4PQ9A 1TMF1 1RINA 1Q5OA 2ZHKA 2JD4A 4J6GA 4Q4V3 1DU3D 3ZYPA 1OLRA 1CAVA 1RVF3 1XNKA 1GICA 2NYYA 3VBSB 2B8MA 1QNYA 3BPZA 3THTA 3GALA 1W6QA 4PIXA 3SLIA 4TZDA 1QJU2 1D0GA 1TNFA 4BM8A 2W0XA 1RUC3 1EAH3 1VBB1 4JGZB 1H9WA 3GZAA 3ZO0B 3JB8A 1KS5A 1Z0HA 5KWRA 1GZWA 1S0JA 3LSEA 4YGDA 5KC5A 4E2QA 1DZQA 4DNYA 4WZFA 3VKFC 1I5ZA 2JE7A 3T1LA 3QH7A 4YRDA 3ES4A 1SLIA 2BPA2 2HWB1 4EROA 1NCRA 2LTNA 5BUVA 3AMQA 2ZX1A 3RI9A 3MPPG 1UPIA 1V00A 1N1YA 4AFBA 5F6KA 4LHKA 4L9BA 1GFF2 4WVMB 3USSA 3ZFFA 3AMMA 1ULGA 5JMCA 1DZRA 1JH5A 4R9BA 5IK8A 1AXKA 1PVC1 2RS52 2PHDA 4XJWA 1AR92 4AGRA 4LBKA 1KQRA 4ZU4A 5T52A 3WHUA 2DFCA 1QJU3 5C6CA 3SITA 5J37A 4GKXA 1ULEA 5FQ0B 2D93A 2D6KA 5CFCA 3TNQA 2LM3A 1GBGA 3HD8B 4WV8A 1KD7A 4URTA 3PTYA 2Y26A 1WLCA 1WMEA 5E16A 1OA4A 3VBRA 1F5FA 3H3UA 2R32A 5J7MA 3ZXDA 4N53C 4ASLA 4XJZA 1F31A 1ULFA 2D7FA 3VBUC 5E88A 4F8AA 1H0BA 4BIOA 1JUIA 1TNRA 1KDKA 1C28A 3VBSC 3MGUA 5LK7B 4LUMA 4FPOB 4QGMA 4XPVA 5F9TA 1D2QA 4XHXA 2BVVA 2DUOA 2HWE2 4XF0A 4P14A 5JI7A 1V6LA 5KXCA 2YC0A 4WM7A 4YG3A 4JGZC 4LBQD 1BYHA 2E53A 3V0BB 1RUOA 3DPRB 3TN92 3WDVA 5BNPB 4QPGA 5FREA 3WVJA 1NA1B 2CWMA 4RL7A 3ST7A 4KNCA 1OD5A 1UW8A 5DDJ1 3ENRA 1HV0A 1B09A 2ZGRA 2E51A 2FHRA 2RS53 3NO8A 1AR93 2IXIA 4JAAA 4DPNA 5E89A 3HT1A 1CAUB 4XBNA 1N3PA 3SCFA 2AZ5A 5L73A 4DFSA 4CDWB 4N7IA 3N7LA 1SDWA 5KHIA 2WLQA 2EXJA 2XJVA 5CG8A 2DU1A 1RUF1 5ACA2 4MSVA 1H8TC 1Q8OA 4E2GA 5JPMB 4W6YA 2BWCA 3J8F1 4FPJA 1JOJA 2ZTNA 4KH9A 3URFA 1C57A 1UMZA 3PJYA 1GSLA 2R49A 1QU0A 1AR72 2W08A 5K0UB 3NJZA 3AYEA 1H2NA 1APNA 1ZM1A 1O7FA 3AKRA 4K7JA 4Q4Y1 2HWE3 2XPJA 5JAXA 2RHPA 2CAVA 2PELA 1MEC2 1YFYA 1R081 2ZA9A 4N43A 3OTFA 3POYA 3TN93 4V1PA 1S0EA 4RGGA 2B9UA 5HCAA 1ZA4A 4IERA 2RS12 3U4XA 5DUUA 1CPNA 4FCAA 1AL21 3MLKA 3ILFA 3KZ4C 5EJ3A 4YW5A 2GNTA 1UU6A 5I0RA 3TYJA 5D1IA 3RS6A 2HWF1 2GDFA 1O4TA 2WINB 3I7DA 1DBNA 3U07A 5DZGA 3U10A 2H6BA 2ZGUA 5ACA3 4D69A 5C8CB 2DWRA 4QQHA 1T6GC 3L2HA 3TB0A 3DPRC 4Y22B 4Y5Z0 2WKKA 1NA1C 2ZX3A 1MQTA 1RHI2 1PMIA 2VULA 2RS32 3VBOA 2UYAA 1AR73 4EWEA 4Y1YA 1ZBE1 3WV6A 1CESA 4GMP0 2QKDA 1JUHA 2DVFA 3AZZA 4JVAA 3SCHA 3GYDA 1UZZA 4Q0VA 1LHUA 2A3YA 4I30A 5FMOL 1MEC3 3FLTA 3VDDA 3VZLA 5BNOB 1AVBA 2R1DA 3AB0A 1AX2A 1CAXA 3FLRA 4CDUB 4FP2A 4Q29A 2JG8B 3LKJA 2RS13 4GB31 5DG2A 3UKVA 4C91A 1D2SA 3AZWA 5JIUA 1MVQA 4DY3A 3FE5A 3JD71 2PAMA 4Y24A 1VRH1 1AR82 1SBEA 5T5JA 5L7OA 2HYKA 5K0UC 1VBA1 3ROUA 4QMAA 4AI3A 2ZAHA 3E6BA 4FPYA 4P9WA 2Q1ZB 4W65A 1LENA 2ZGPA 4E27A 2ZHMA 3Q9OA 1RHI3 3WX5A 4IEWA 1W6MA 2WIIB 1AHSA 4AVVA 2RS33 1YIPA 3I2DA 4LT5A 4YG6A 3BOPA 1TME1 1QJX2 2GU9A 4DOUA 5H9QA 1DG6A 2XWBB 1U5ZA 3UKTA 4QHBA 4K3UA 4UW3A 1VBC1 1H1AA 5C8CC 4OHZA 1LOGA 4PLMA 3O12A 1ZRCA