2JXAA

Mouse latrophilin-1 gpcr gal_lectin domain in complex with rhamnose
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
106
structure length
106
Chain Sequence
GLPFGLMRRELACEGYPIELRCPGSDVIMVENANYGRTDDKICDADPFQMENVQCYLPDAFKIMSQRCNNRTQCVVVAGSDAFPDPCPGTYKYLEVQYDCVPYKVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion, signaling protein
molecule keywords Latrophilin 1
publication title Solution structure and sugar-binding mechanism of mouse Latrophilin-1 RBL: a novel 7TM receptor-attached lectin-like domain.
rcsb
source organism Mus musculus
total genus 15
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2007-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02140 Gal_Lectin Galactose binding lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.740 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2jxaA00
2ZX4A 2ZX0A 2ZX3A 2JXAA 2ZX2A 5AFBA 5FTTC 2JX9A 2ZX1A
chains in the Genus database with same CATH superfamily
1UAIA 1UN1A 2HWE3 2FDIA 1XB9A 3M8LA 2TBVA 4COZA 4YVSB 2GU9A 2RHPA 1STMA 3JXSA 3MV01 3PUHA 3C7GA 4NHKA 4UWDA 4P9WA 2PAKA 4RL7A 3V56A 4M0NA 4N43C 2HWB1 2AACA 4QMAA 3ACIA 1O8PA 2E32A 2C4XA 3CDZB 4XC9A 3FHAA 4XDQA 5A3NA 1RUJ3 4ZU5A 2W1QA 2W08A 1NY71 1Q8VA 3D3AA 1XNDA 3N9PA 3SEPA 1UZVA 1BHGA 1PZ8A 2HLEA 5F3EA 1SCRA 1ZRRA 1RXGA 2BEOA 4BMBA 1LEDA 1M4WA 1ULCA 3APBA 3K77A 1YEWA 3VD5A 1OOPB 1QJX2 1HRI1 4L92A 1WBLA 5A32B 1DQ4A 1FPN2 1JHJA 1K3IA 1POV0 1XNAA 2WFF2 4FT8A 3BTXA 3LDKA 4G4FA 4HK8A 1BK1A 1JH5A 4EN6B 1C8M2 3OUHA 2A6XA 1DP0A 1HRV3 1KFUL 3O0WA 2BNNA 3V0AB 4NUBA 2VVDA 1WWYA 2B9UA 1RUF3 2WKKA 1AR72 1C4RA 1RUH3 3ASIA 3B02A 2FDJA 2V4VA 4CDXB 4EWAA 4Q0VA 3GBGA 4Q4Y2 1PGL2 5LATA 1FNZA 4MGSA 1JUHA 3LSEA 1HLCA 2VQ0A 4LBNA 3LQCA 4XBLA 3RMXA 5FO8B 1GSLA 2YC4A 4M4PA 1ZZ6A 5SV5A 3ACLA 1G9DA 4LA3A 1D7PM 5FZAA 4LQRA 4P00B 3PUQA 4HG6B 3DPRC 5J37A 3C7OA 1PNGA 5FLJA 2RE9A 4PHZA 4JGZC 3ZYFA 1SLIA 2WABA 3V64A 4EN7B 1YJKA 2RR13 1ZBE3 1W6QB 4MGYE 4IE7A 5JVVA 5JDBA 5HXMA 1QOTA 1QJU2 1XXNA 4GJYA 5FOJB 4BQWA 2WIIB 4IUGA 5EZWA 4JQRA 2B7YA 3AYAA 4CA9A 4HFSA 4AI3A 3JCIA 5CG9A 4Z8BA 4ES8A 1OVSA 2Q1MA 3JB4C 1G9FA 1Z7S1 3ZFEA 1EY2A 1Q8SA 4BU2A 5DZFA 2JG9C 5HCFA 4D0QA 1NZCA 1VJ2A 2Q1FA 3NV1A 1RUD1 1CX1A 3ZDSA 4Q0PA 1UY0A 3RG0A 4CCCA 1YFWA 2VZOA 1G86A 3MF9A 3MIGA 4OHYA 2W2IA 1S0GA 2ZEWA 4LA2A 2QQVA 3A21A 5E16A 4QKBA 3ZOIA 1O3RA 1GANA 2QNKA 3P1IA 5ACA1 3DCQA 4QGMA 3DGTA 2JDUA 3WF1A 5AC91 4OUSA 4PT6A 1W05A 3HT1A 5D2AA 5HV0A 4H7MA 4AF9A 3AJYA 3LEKA 1K42A 3RJRA 1V9U2 3BOWA 3VKOA 5JOXA 2QQNA 5FZDA 3SITA 3VV1A 1O3QA 2QQPA 3O1VA 4UBHA 3KS7A 1FNYA 3D8CA 5LASA 1VALA 2PHUA 3L2HA 1EUTA 3CEWA 4NR1A 5CKQA 5ABJB 1R082 3WG3A 4D8MA 5EP9A 4IEUA 4JX0A 2YBPA 3GCXA 3UYJA 5JZGA 4JGYB 4XHXA 4GULA 4MXVA 3ZN6B 1ND3C 4MXWB 1QJY3 3MUZ1 4HONA 1GP5A 5I0RA 4MVTA 2WO7A 2GMMA 3OB8A 1KRIA 5EQUA 3V0BB 3RYKA 4NPRA 1J3PA 5FZKA 1EAH1 4LE3A 5B4NA 5C6CA 1FYUA 4BOWA 1CAVB 3PVEA 5FCCA 3QOPA 1BKZA 1XYPA 1ZYBA 4X6RB 1YIFA 2A71A 4BWOA 5CKNA 2A7AA 4XBQA 1LU1A 1E5IA 1MEC2 4SBVA 3CJIC 2HWE1 4NMIA 1XNBA 3HAGA 2XVLA 2BFUS 1LHNA 4QHOA 3T08A 2DTWA 1NLSA 5FREA 3H7YA 4FFHA 1WZXA 1K5MC 3AMPA 4EZHA 2DBIA 3ZPOA 1IPSA 3D4KA 1UY1A 2VXRA 1RUJ1 2D6KA 3I7DA 3BI3A 3DUIA 1GOFA 4EWEA 1V70A 1YO8A 4P5YA 1S2KA 2VY0A 1CVNA 2WDBA 4UF0A 4UW6A 1CWPA 4QPGB 1OH4A 3OJBA 2YV8A 2J1EA 3RZMA 1H1IA 1OFSA 1TNFA 3QACA 1W3VA 4XE9A 3P3NA 3CF6E 2HWC3 4NPLA 1OVPA 4JKMA 4J25A 2HWD2 3B69A 4GH4A 3VDDC 3ZX7A 2W95A 2XWJB 2VECA 2MNGA 3ORJA 4LR4A 1UXZA 2JG8A 1OBNA 2E9QA 1C8NA 5APAA 2ZBJA 3NAPC 2ZTNA 1W8FA 3ZKYA 2V5DA 3ABZA 1QQP3 1HRV1 2WQZC 1KITA 4DXZA 1RUI3 4TWTA 3DL3A 1QY4A 4KBBA 4U2AA 1RUH1 3L2YA 1HXS1 2R073 2PHXA 1RJ7A 4QX1A 3ZFFB 5FYHA 5C8CA 1NQDA 4BHPA 5A6QA 4MGQA 1AR63 1COV3 2A6WA 5FJHA 1MPXA 5GM0A 2EALA 1LGNA 2YY1A 3ECQA 5IFPA 3WQ0A 1R092 1LKNA 1S1AA 4AI9A 1WCKA 3VHOA 2ZMNA 1OPOA 1Y9GA 4LOTA 3JBG2 2GAUA 1J84A 3IDEA 4DXTA 2GNMA 2VZQA 2ZCWA 2IC1A 3H3ZA 3N9LA 1NE4A 1FOD2 1LOFA 2ZPXA 4OUEA 5DPNA 3DXTA 1OXCA 2R16A 2HBTA 2RR11 1ZBE1 2VQAA 2XQRA 4IGOA 1DG6A 4IE5A 4Q0UA 2MEV2 4RHV2 4ITCA 1IQAA 3U75A 4PF5A 2YBKA 4LO5B 3RRDA 1OD5A 3USUA 4EYUA 5FMOS 1DGRA 1TE1B 2YC2A 4XBNA 4ZZ8A 4DY3A 4N53A 4ARYA 3UKVA 3NNGA 4NOTA 2YYOA 5FZFA 4MV2A 1UYZA 3Q8FA 4WM8A 2UY9A 4K6BA 1YLLA 1W6MB 2VD7A 4JZRA 4N7UA 5FBJA 1GR3A 4Z07A 3OOXA 5G04L 2BFUL 2G4IA 3KCYA 1QH7A 1VP6A 2DCJA 4WZFA 4NRPA 5FUNA 1YHFA 2XR4A 4IEPA 4WVMA 1W6NA 3WCRA 4GWIA 1D0HA 1Q8PA 1T2XA 1DGLA 2JWPA 4I09A 1JU3A 1F15A 1JZ6A 4XJUA 2XDVA 5FP7A 4B8EA 1RUG2 4U36A 4BJ0A 3DYMA 4H2AA 4XAAA 1D4M2 3IMMA 5H9QA 1UF2C 1BBT3 5A7PA 4IE4A 5FMBA 3A4UA 3SLIA 1WMXA 2R0HA 3VKNA 5JOZA 2XPJA 4B4QA 2XQXA 1YUDA 5LY2A 2ZMLA 1AYM3 5GKAC 2YG0A 1W6PB 3RWNA 4S2DA 3KM5A 4WM7A 3BIWE 3VBOB 4I0WB 3T09A 2IXCA 2IXLA 5LCWL 2WRAA 2WN2A 1PK6B 3VBUC 1DLCA 3VKLA 1PO12 2F4LA 5BNNB 1MQTA 3PU8A 1IGOA 1IKPA 4NROA 3SKVA 2D3SA 4YSFA 1QJY1 1TVGA 4Y3OA 5T5OA 2NMOA 4RR3A 4G3YC 3R05A 4XTMA 1HIXA 4RS5B 5FP4A 1W90A 1AL23 3I2OA 4AVAA 4LE4A 4AL9A 2BBVA 4DOUA 1FXZA 2EICA 1URXA 2ARCA 2VUDA 2PA7A 3JU9A 4Y24A 4QX0A 4YG6A 2JIGA 3HJRA 5LBFA 3ZVXA 5I0TA 4D6SA 1ENSA 1MZ5A 2WNOA 4P9JA 2OA2A 2IFRA 2JB4A 5LA1A 5LBCA 5LK7B 4HKLA 3POBA 1XRUA 3RMYA 2OX0A 1G8WA 2LM3A 3NJYA 2RV9A 1LESA 3AVRA 4CCKA 5LA0A 1D2QA 1V6KA 2RDNA 3OGGA 1I5ZA 2ZX3A 5FFOC 5F6KA 1QKQA 3FHQA 3UKNA 5FMOL 1XSQA 5I8SA 4HKWA 4P9YA 3GZEA 4CDQB 4GWJA 2NZ9A 3VB9A 2WNUB 3HOBA 3Q8AA 4S2GA 3ILRA 5FXVA 3AJZA 1UNBA 1KFXL 1LULA 5FUPA 3VL9A 2Y6FA 1X9TA 3ON7A 4GWMA 3AM2A 4LKSA 3WSOA 2VG9A 3LIGA 4QHZA 3HBZA 2PLV3 2Y64A 3NSTA 3J8F3 2HWC1 1PO22 3HQXA 2QQKA 4Q4V3 4F7ZA 4FOVA 4E4DX 2EAAA 2G9GA 5CISA 1GZCA 4Q0SA 4V2VA 1AXYA 2P3YA 5AVPA 1H8VA 3GJBA 1OFNA 4HANA 4HBNA 3G6JB 4O61A 4RQPA 4UW3A 5GLUA 4NHMA 1S0FA 3HBKA 1RUNA 2QVSB 2Q1ZB 3N7KA 2GMPA 5FZHA 3VKMA 3ZFEC 3PVNA 1UZ0A 1A6CA 1QQP1 4ATFA 5C33A 1RUI1 1PGSA 4LULA 3D0JA 2JE8A 5K0UA 4EJRA 4META 2BWAA 2R071 1LOGA 1YXWA 5FZ4A 1W0OA 1XBFA 2ORXA 2RM22 3AKQA 3ES1A 4K21A 4PIYA 4HVOA 1AR61 4AVSA 2NMNA 1QXJA 2DU0A 2P3JA 2WINB 5B2GB 1K12A 1XC6A 2FBEA 1GKBA 4IEWA 3I4IA 2VZRA 2ET7A 4LEJA 5BNPB 4GQ7A 2Y0OA 4DXRA 1CGPA 4AEDA 4NAOA 3FJSA 3KCXA 5HPOA 2V09A 3ACHA 2ILMA 2AC1A 2R49A 3IKWA 3MUY1 2E6VA 1UOFA 1W2UA 1DFQA 4YW4A 3VDAA 1YQ6A 1FATA 1JU4A 1C28A 1S0IA 3T4VA 3JD72 5JSRA 1LR5A 5K8SA 5H9RA 1F4HA 1TME1 3H9AA 5CZKA 3BALA 4D7SA 2GN3A 2DUQA 2H0VA 1XOYA 3VBSB 4CEYC 4EROA 5L19A 2W52A 1HRV2 4CEWC 1WMDA 2CSGA 2P2KA 3R4DB 2OVUA 1X36A 5BUVA 1GZWB 1RUF2 3RYRA 1UX6A 4Q5OA 1NCRA 4QXCA 1ULFA 1UOJA 4XOGA 2C9AA 3R4SA 3IBMA 2DTYA 3VLBB 3M4FA 3LDBA 4H3WA 1JW6A 1Y43B 4XUOA 1G9BA 2DU1A 1V6NA 1QOOA 1O4ZA 3B9CA 4J1XA 4OMCA 3TN92 3UGFA 3WD5A 5A6ZA 2UY8A 4RGKA 1UD1A 1J3QA 2O14A 2UWAA 4DEQA 3VBHB 4Q0QA 3C7FA 4A2UA 1UIKA 2B5HA 5FO9B 3POFA 5FZOA 3LIHA 5L73A 3UL2A 4BH9A 4LBQB 5C7GA 2JKBA 2XBO3 3LA3A 1CZTA 5DUWA 5LY1A 5CFCA 4GZ9A 5KHKA 1O6UA 2QQMA 3FE5A 4EN8B 1WW6A 2C5DA 2RMU2 3G7DA 4KBZA 5A7QA 1VE0A 4NHLA 2VOVA 2RJ2A 4XFGA 3UESA 2ZEXA 3PTYA 4HN0A 1RVF3 1S0JA 3I2GA 3NNMA 1AYM1 1YQ8A 2D40A 3WDTA 3E5XA 1GWKA 1XNCA 4N43B 4OCTA 3I97A 5D8AC 5JI9A 3OY8B 4RGAA 3WVJA 5FKBA 3T1LA 1W8UA 5GZCA 1FT9A 2BUKA 4M3CB 4BLIA 5CFDA 4NHYA 3UJQA 3NO8A 4RYDA 4ZS2A 1B35A 2V5YA 3TWIA 3W9AA 3WF4A 3KQRA 1XE8A 1QXRA 4XYXA 3HNBM 1UPIA 4GH4C 2A73B 1W8TA 2R063 1DZRA 1ZA4A 3EBRA 3TNQA 1FAYA 1JYCA 4R52A 3N9NA 3H1MA 2D7FA 3LGRA 4QGLA 3ZSEA 2JG8C 5A3TA 4MADA 1AL21 3H8UA 2IWGB 5FZIA 1YNAA 2VJXA 5JSOA 3VL8A 2XJTA 2UYAA 4AOCA 2DCZA 1RYYA 4XFIA 4MZUA 4JHTA 2DCTA 1RUC2 3EMRA 4H7LA 2OIIA 3D0SA 4LO8A 4XJ8A 4MYEA 3RS6A 3VGIA 1NG0A 3PDQA 3SKJE 4AFAA 1VMJA 2WN3A 2DVDA 4XJZA 5A7NA 2KM2A 3WF3A 4XFAA 2GNTA 2QQJA 1MS9A 1ZX5A 2AH2A 5FP9A 3CZJA 4YZ4A 1GQPA 1JI6A 1O5LA 4FPCA 5E89A 4ASKA 5KBFA 2LALA 4BYYA 4M4RA 3OGSA 5IAXA 2XJVA 4XJWA 4FAGA 3BUCA 1DGWX 1LOFC 3MZHA 1PMJX 5C9AC 4Q29A 2FZ1A 1UZZA 3LEIA 4W6YA 3WINE 3SH3A 3ZFGC 2GP3A 3DPRB 3GBFA 5KXDA 4KWJA 3AVSA 2GN7A 3B00A 1XPWA 1SBEA 2JD4A 1CQ9A 1SLLA 1VAMA 4JGZB 4KGQA 4XILA 2EVXA 3J8F1 3VBRB 4ASLA 4Q4V1 4LKDA 1AJKA 1SLCA 1SBFA 2ZGTA 4PBOA 1LEMA 3VBFC 5A7SA 4YZ3A 3FFQA 2ET1A 4ES9A 4NO4A 2YB7A 1CZVA 5FUIA 1VB2A 3WP4A 3LOIA 4AAPA 5I8TA 2YZ4A 4YRDA 1JZ5A 1OPMA 2A75A 2SBAA 3ZXDA 1N47A 1ASJ2 5F32A 4ZZ5A 4DY5A 3RDIA 1VBE1 3ZN4A 3C2UA 4EV0A 1XNTA 5DAXA 4Q4X2 2PAEA 1V0AA 2I74A 2W91A 2JG9B 2RS32 2WNVA 2Y6LA 4IEQA 5E88A 1CAXB 1E57A 1K5JA 3M1HA 2I07B 2Y6JA 2HJIA 3PMSA 4QDSA 1NA1A 1OKQA 5CYYA 1VBA2 1WLDA 3N36A 3ZYIB 1CZSA 3MDPA 3AMNA 4YNIA 1VRH1 5KXEA 1VBC3 2ZABA 1ULDA 3A22A 3H7JA 4OI1A 1HB2A 3LEMA 4QXHA 1HV1A 4QM9A 4D3WA 4YZ1A 1CAUA 3I59A 2YHJA 4TLFA 5FYUA 3ZYGA 1AL0G 1JOJA 3T2OA 4Z2AA 1EPWA 3QLQA 2BZDA 4A6OA 3KMHA 4OI0A 4CCOA 2ZHNA 5FY4A 1PM7A 2DVGA 1DBNA 2RVAA 2VZ1A 3HMYA 4AFBA 2JDMA 5L7OA 2ADEA 4HPKA 4JVAA 5DG2A 1UZYA 4QWNA 2VQTA 2OKXA 4V1PA 4DUVA 1BEV2 1GU3A 2JX9A 3LDRA 4C0HA 1COV2 1GV9A 1WCUA 2BOIA 3IDAA 1ND3B 4M01A 4GWNA 4LOSA 4UFIA 2C24A 5DAPA 2Q8DA 2W68A 3VDCA 1JYWA 2WO2A 1RUE3 5DDJ2 1ULGA 4IV1A 4FQ4A 5EJZB 5BNOC 4XXPA 5LB6A 4HXCA 1PM4A 3KT1A 1JHNA 4IL7A 1OT5A 3POJA 2P6CA 2I45A 3MHZA 4W4ZA 3WDXA 1H2KA 4CRQA 1Y7BA 4YVSA 1F4AA 2WNEA 4AK3A 1QGLA 2W1UA 2AEYA 2J1UA 1VBB2 3LD8A 5FPLA 4QX3A 5HXVA 2GH8A 1DLLA 2BU9A 2QDRA 3N7MA 3O12A 2WAOA 3T0DA 3CJIB 1HKDA 2OS2A 4AGVA 2VE1A 4LJHA 5A1FA 4CDUA 2IXIA 1JZ8A 1BJQA 4ZU7A 3I3QA 1S0EA 1RVF1 3WDUA 1D0GA 1K5MB 1R1ZA 2PQSA 5C3SA 4Q4W2 4LPLA 2WQ4A 2VCMA 5J3UA 4F3JA 2WL1A 2BGPA 4S2HA 2YFZA 1DGWA 1PIV2 1US2A 4AZZA 1S0BA 5A32A 2YC0A 5A3MA 4XZPA 3ZR5A 5DG1A 4KWKA 1NXD1 2R061 5F39A 4RFRB 5IVCA 2BYVE 2LUWA 4RQPC 4RSUA 1PGW1 4CCLA 5C8WA 5KC6A 3NJVA 4IETA 1GNYA 3WQBA 3A7QA 4LHKA 3TB0A 4BQ5A 1OUSA 3H42B 3VDDB 5FZEA 3V0AA 3C7EA 1VB4A 2Y8KA 3B5LB 5FIXA 2RDSA 2X29A 1MS8A 3UT0A 3WQ7A 3X29B 2WBKA 1HB3A 1W6OB 2VNOA 1BBT2 4CDXA 1L7RA 2NYYA 5K0UC 1US3A 3M7AA 3NAPB 4FFGA 4HN1A 1OI6A 4RA0A 5FPXA 4DINB 5JMOA 4GD4A 1NX9A 4IGQA 4K20A 2XB6C 4CCEA 2AUYA 3AXEA 1WGPA 5JIAA 4YLZA 4YW6A 4AGGA 2AZ5A 4LK7A 4XFHA 2FCUA 2J42A 3DEMA 1OURA 2W92A 4AW7A 4LKEA 4GMP1 4A41A 2Y60A 2ZAHA 1DGRN 1X9PA 2VZPA 3HNYM 1UU5A 1PVC2 3ETPA 1R1A1 3M3QA 5DXDA 1W6QA 3WNPA 4CCMA 5A6XA 5C4WC 5F1RA 2BPA2 4XVHA 3CBNA 1YQ5A 2VVFA 1Q56A 3OYWB 5B4XA 2D43A 4XJ9A 1JUIA 3PIGA 1AX2A 4MHUA 2WZR2 1IZ3A 5K7PA 4AVTA 1NAEA 3OD0A 4B3NA 1UU6A 3KZ4C 4JDNA 2DVBA 4HZFA 3N7JA 4W6WA 5C3QA 5LW9A 4L8QA 1JZ3A 2D5FA 2QQOA 2RS12 2PHDA 1DHKB 2JENA 2WLQA 2Z79A 1S0CA 1IQDC 1C57A 2NLRA 2WZEA 3PURA 1HXS3 4Z82A 3AL6A 4ISQA 5EHDA 5FQ0B 5T3NA 4COVA 3JQXA 3ITQA 2BERA 4IV3C 2AYHA 2IXJA 3FLPA 4KI5M 4Y5TA 5GALA 4INDA 2E7AA 1LCLA 3CJXA 3RZGA 3MLKA 3PVBB 1GQGA 3OGRA 3LA7A 4E9KA 3INAA 2W39A 1CJPA 5FYTA 5L9BA 3TRSB 1AJOA 2GC2A 1MVQA 1MS4A 2J7MA 2QQUA 2VMDA 4K7JA 4XF9A 4YW1A 3RGBA 2R043 4FPJA 3FBMA 1W8NA 3PJYA 1W3XA 4AVBA 5A33B 1LHVA 1IG0A 3K48A 1KJRA 1ZRIA 1ZRDA 5EIYB 3HQUA 5CFCC 3LAGA 2PLV2 1AR82 2Q8OA 1XYNA 4L11A 3ZYHA 3GHMA 4GA9A 1QHDA 1VBC1 4LK6A 5FZ3A 1Y9QA 1PX4A 4FPEA 5ABJA 4FPHA 3AP4A 1UL9A 5T5PA 2JICA 1C3HA 2BDRA 3H50A 4XFFA 4R9CA 5EJ1B 2Y6HA 5FXZA 3WT3A 5IFTA 4GB33 2RS53 3AKPA 3WX5A 4OZXA 1XE0A 3CMGA 3UGGA 3ZN6A 4B7EA 4E2QA 1Y4WA 2B39A 5F5QA 1BVP1 4MXWA 5GLVA 3RPQA 2VW1A 3T2PA 3NKGA 1J3RA 1W9YA 1YRZA 3FLTA 3VZKA 1JYIA 5EYXA 2WQ8A 2IXHA 2GC0A 1GNHA 3RQ0A 3V0BA 3VBUB 3IN9A 3V65A 4EE2A 1KJLA 4YGDA 1CAVA 4BQXA 2WO3A 1H8TC 1RITA 5JR2A 1ZBA2 2A70A 1LOCA 4IQPA 1RUE1 1OA4A 1HQWA 4TLGA 3VDDA 3H3UA 4QPWA 3ES4A 3ACFA 4FI9A 2YPDA 4PQ9A 3J26N 4LORA 4AI8A 4B29A 1AHSA 4XQ4A 5CAZA 4E2SA 3ZIXA 5HBAA 5IK8A 3MPBA 4PLNA 1DF0A 4BXSV 5JOYA 4FP3A 4Y22A 4Q1RA 2DVFA 3VZLA 3KLSA 4YM1A 2H0BA 4BA6A 1QOSA 2XVGA 1NCQC 4BM8A 5FY9A 1CIYA 3KHBA 4YM0A 4YW7A 4QPYA 4YGEA 1SFNA 2QDNA 4MO3M 3PNAA 4O65A 2VBDA 2O8OA 4AVVA 4CUCA 4XCBA 3ELNA 1ZZ9A 3I2KA 5F3GA 2ZGRA 4S2FA 4XIOA 4D6QA 4RN5A 2XLFA 4RD7A 4MSVA 2PAMA 2XL9A 4LHLA 5E8AA 4D7YA 1W9FA 2NPIA 3TNPB 5LEJA 1ULOA 4E8CA 2CV6A 4WZCA 3VZMA 1F2NA 1PZ9A 1RXFA 2WUHA 3O0XA 3KF5A 3BTAA 2VNRA 3E97A 4CXYA 1VPHA 2CYFA 4FPFA 5JMCA 1CX4A 1Q8QA 1ZZCA 4QDQA 4TYSA 1ZRCA 3WNXA 2PMWB 4HVRA 5IVYA 1YIPA 3ZFFA 2XBO2 4XIKA 3MICA 5DAVA 4OHVA 3WF2A 3Q8BA 4I02A 1V6JA 4XQDA 4D6RA 1BXHA 2VZTA 3LF7A 3ZFEB 2OQ6A 1UZWA 3HN1A 1UXXX 4CTEA 2WNVC 2BV4A 5FY1A 5BYNA 2EXIA 3H3LA 1IHMA 4EZ4A 2QZ3A 3HIFA 2ZGOA 1N1VA 2CWSA 1WCQA 3M3EA 5ANNA 5FZBA 1J58A 3MLJA 2JDZA 3SCFA 2EIEA 3U1XA 1BMV2 1YFUA 2JJ6A 4QKDA 3GJAA 1ZZ7A 2B46X 4UFKA 1VAKA 1LHOA 1WKYA 2R6QA 4CDWC 1SLAA 5DAWA 4MH0E 1OMIA 3A0KA 3VHPA 1SFYA 3MEPA 2PXJA 1AYN2 5JR7B 4CU8A 3M2MA 5FY7A 4YM2A 2VMIA 5GZFA 4JQTA 3PUSA 3FWEA 3POWA 5FZMA 1W9TA 5LA9A 2BQPA 3L9JT 4Y5SA 3LFMA 1ENRA 1RMU3 2GSYA 3AXDA 5L7OC 3MFAA 2YU2A 3NV2A 5DUUA 1W8OA 4CEYB 2KA3A 2VM9A 2VR4A 1KS5A 3KT7A 1UMIA 2E26A 3FMGA 4CEWB 4X8PA 3ZYPA 4DUXA 2O0OA 5FPZA 4NHXA 1BQPA 1HB1A 2HWB2 4GMP0 1GZTA 4YWAA 5KHHA 2Y26A 3QH6A 3THCA 1ACCA 2VVEA 4LMFA 1YI9A 1NY72 2X5IB 1ULEA 3T2QA 3W58A 1UKGA 3GGLA 3IB3A 3GALA 5IVJA 5A3PA 4A45A 1LB2A 1OC1A 2R041 3FL7A 3IWZA 3ME2A 2WWSA 3OGVA 4P5HA 1OLRA 1FX5A 4LXLA 1HRI2 4E4HA 4Y1YA 1TME3 3B01A 4NRQA 1SCSA 3OUJA 1IS3A 5HV4A 4CDUC 2ZGPA 3KVAA 2DV9A 1IPKA 3VBOA 1E5SA 4AHZA 2ARXA 3O1SA 3TOJA 2N7GA 3MBWA 4D94A 4YZ2A 2XKPA 4GB31 2RS51 5BNNA 1I6XA 3WW2A 3TEYA 1FMD3 1WW7A 2HWF3 5FYIA 3OBAA 5IUQA 1LJ7A 2R1DA 5ISLA 3OUIA 4EN0A 2WWJA 3T0AA 4QQLA 1CESA 5D8AB 3CU7A 1QJEA 1RHI3 4Y1XA 4YW3A 1ND2C 1UQXA 4R9DA 3AYDA 4QPIC 5F7UA 4A4AA 4ZXEA 4GH4B 5I0SA 3RZZA 2D6OX 4P9LA 3T1MA 1HW5A 3LA2A 4E4SA 3ZN5A 1PVXA 3MO4A 2W3JA 2VW0A 1KQRA 3FBYA 5A6YA 2ZGUA 2W1SA 4ORFA 4J1WA 5EPAA 4E4ZA 4GJZA 4QHBA 1TMF3 2EA7A 1LODA 2HKXA 5BPXA 4XUTA 4DNYA 5CBLA 5DUVA 4NVPA 3NJXA 4KH9A 5I91A 3U4SA 1W03A 3HT2A 3ILFA 4HSJA 4LITA 3ZM8A 4SLIA 2CDOA 4DFSA 2JECA 4OHWA 4QXBA 1MS3A 1XSRA 2WNUA 4X8NA 3ZXJA 1Z7S2 4FPYA 4YVWA 3ZIWA 2D5HA 4A7YA 4PI0A 3ZKUA 1HQLA 1ENXA 1RUD2 1AR93 3H1YA 1O4YA 3NV4A 2CGOA 4MGZE 5FTTC 1F8VA 1R64A 4QGNA 1OQDA 3E5UA 1MACA 1LAJA 3K75B 5C9AB 1WLWA 1S2EA 1AX0A 3ZFGB 4YFZA 2ZKLA 2GP5A 3QD6A 1OUXA 5ACA2 1G7YA 4XDPA 1W06A 2A3WA 5GZDA 3RVHA 1GP6A 4IDZA 3BPZA 1W04A 1GUIA 3UGHA 3URFA 5AC92 3BYWA 2R1BA 2ZZQA 4JDOA 3GZAA 2D98A 4UW4A 3IT8A 3DN7A 4QQOA 4NRMA 3T30A 5FWEA 3USUB 3MFCA 4FVVA 4C0BA 4Y1VA 3VBFB 5KR7A 2VZSA 3NW4A 4OULA 2XL7A 2VZ3A 3WDWA 4JTNA 3R6SA 3VHRA 2NM1A 4C8DA 1QJX3 4ZU4A 2G9ZA 1UWWA 4NIIA 5A7WB 1ENQA 1FPN3 3J4UH 1W39A 4FOQA 3VD7A 1G9CA 5IK5A 1L3JA 5KC5A 3AKRA 2D6NA 4Q8KA 1W6NB 2ZGMA 2PHLA 3F95A 2WS91 3T3YA 5J96B 1VRBA 2VZVA 2VW2A 3Q9OA 4Q8LA 1W2TA 3AYEA 1PMHX 4IERA 1LOAA 1MS1A 1U12A 1NUKA 1WBFA 4AFMA 4YARA 1EAH2 5I8YA 2ZZJA 5DUXA 3RZLA 4QT6A 4QX5A 4XF4A 4UFLA 3VBSA 3KV9A 4N7IA 4Q26A 1LOBA 2NN8A 5A3LA 3W5MA 3I3DA 2WJSA 3AZVA 2ZS6B 3LB9A 1NKGA 1RMU1 2HWE2 3BPSA 3ROUA 4MG2A 5KHIA 4A3XA 5C3OA 1VBE3 1A78A 4IEVA 1W28A 3B94A 4QKFA 3MF6A 2HEWF 3POSA 1WMEA 3VHNA 4F83A 4N90A 1KDMA 3MV11 1QJU3 4PIZA 1RUJ2 5FYZA 1LRHA 3VBHA 1UX7A 1ODNA 2C1FA 4COWA 4NWVA 3J7MA 4KL1A 3U4XA 3EXUA 4YYOA 2QBXA 4URAA 1VRH3 2ERFA 2JDPA 4C1XA 4JRAA 4M00A 4COUA 1O4TA 2DF7A 5BNOB 3A23A 4YGCA 4OQ8A 2FZ2A 1AX1A 3MIDA 5IWFA 3U78A 3VKFC 2VOWA 5EJ3A 3LKJA 4XMIA 5FPAA 1JBCA 5HCBA 4XETA 1SQ4A 1APNA 1W0NA 3IM0A 3CO2A 1H4HA 1WD3A 4L2NA 4N43A 4NAMA 5GLWA 1HX6A 5FYYA 4LLFA 5JZGC 2BW8A 2V72A 4M3CA 5CIRA 3POEA 2WZPP 3WW1A 4I01A 2ZHLA 3ZXFA 4COYA 3N35A 4AI2A 5F5IA 1RUH2 1HXS2 1UMHA 1FMD1 2R7EB 2RJLA 3NRUA 3VN4A 2HWF1 3HD8B 5E6HA 4OLLA 4AYUA 1O59A 1V9U3 4Z2WA 3K4DA 5FDBA 3TEXA 2VH9A 3ZYBA 1RHI1 3VDBA 1S55A 2E7QA 1F5JA 2QKDA 2ZX4A 3GNEA 3UKTA 2BNMA 2WZ8A 1KS4A 3AZXA 2P4EA 3E5QA 2W87A 2FDFA 2WC2A 1R083 2D3PA 2D6PA 1I5PA 3AZWA 3FN9A 5F5CA 4RQPB 5FYCA 2NQYA 4CU9A 5FZ7A 1X7NA 4JKKA 5K4LA 3RSJA 2RR12 1ZBE2 3I3EA 1Q5OA 3OG2A 5FK8A 1KXGA 5F37A 2C0ZA 2IZWA 1TMF1 1CONA 4FXKB 4A44A 1JZ4A 3O7OA 2JB8A 1DQ6A 2HEVF 4IE0A 5K0UB 1GOHA 5T50A 1O5UA 1UCXA 5KHGA 4K8FA 3JUUA 1CAWA 2BNOA 2EAKA 4MUVA 1H9PA 3NNJA 4A7ZA 4XUQA 4DB5A 4XQWA 1GNZA 4L9BA 3BOPA 4QQ2A 1Z78A 3ENRA 1W8WA 2NP0A 1EP0A 1LECA 1AVBA 2JDNA 2XG3A 1AR91 2F4PA 5F9TA 4NIHA 1Y3TA 3VBRA 3J7HA 1HN0A 5C4WB 1V6IA 2PHTA 4TN7A 2YGMA 3RZHA 3BN6A 1Q3EA 2ATFA 1DIWA 1UOBA 2X09A 4KGGA 4B7KA 5IVEA 2E63A 1GOGA 4QX8A 5JPMB 5JUVA 4AAXA 3OCPA 4KNCA 4HL0A 5T52A 4XF0A 5KXCA 4UFHA 1H1AA 5C8CC 1I1EA 2EIGA 1LTEA 2K46A 5TSWA 3SXWA 3PLQA 1N3QA 1WLCA 3WNNA 5AFEA 2VBPA 4Y4RA 1U5ZA 1PHMA 5EYYA 4DUWA 2FDKA 3B9IA 4PF1A 2FD8A 1O3TA 4AHWA 4IV3B 1QJX1 2YGLA 1SPPA 2E53A 3AYCA 4GMP3 4LBOA 4MGIE 4Y26A 4YW5A 1MZEA 1P8JA 2XLAA 3POGA 1FPN1 2VMFA 4O9EA 1VMFA 2WFF1 3BTZA 1OSGA 1R1A3 2VXJA 3FZ3A 2ID4A 4H14A 4I3GA 5JXHA 1HN1A 5F5AA 4OVEA 1QJY2 2I2SA 1S0DA 4GXLA 2VO5A 5FZOB 1K45A 2DUPA 4XTPA 2Z2SB 2JDYA 3AMMA 1AR71 4CP9A 4JTOA 3TAYA 3AZZA 4GKXA 3BU0A 5CFCB 2RJKA 3RJ2X 4DPNA 3S6PA 4B4RA 4Q4Y1 1PGL1 3QCWA 3VD4A 4D69A 4N53C 4AQSA 1B09A 1R093 4FOWA 4AE2A 5BNNC 1JXNA 3RI8A 4WM8C 4EWDA 2KD7A 2XJRA 2ZGQA 4AI1A 4CE8A 3JBG3 3B93A 1HJGA 3CHXA 4Q27A 5I93A 3NNFA 2D6MA 2GH2A 3UNPA 3W5NA 1FOD3 1QF3A 3K2OA 1ND3A 3AKSA 3HR9A 4CXWA 4WVZA 3WW3A 2G9FA 1BCXA 4HOOA 4AWDA 1MS0A 1RINA 3K3OA 4XF1A 2MEV3 1QJU1 3SCHA 4A6SA 3B3QE 2VMCA 2ORZA 4NIAA 2BGOA 1IS6A 3LZZA 4E8DA 1T6GC 3POIA 3WG4A 4MGTA 4FTSA 2CU5A 4QKNA 1H8TB 3D82A 1NQJA 3U11A 2ZJCA 2ZGLA 4K40A 5E1RA 4YPJA 3GM8A 5FWJA 2UU8A 2HWC2 2Y6GA 2WSVA 1U5XA 3FFZA 3LPFA 3DV8A 5LWBA 1N1TA 1IS4A 1YFXA 3CJIA 3FUOA 4FPGA 3WP5A 5F3CA 4ZS3A 1LHUA 3Q8CA 1U5IA 1RGSA 2B8MA 3A0NA 4PDWA 4DRRA 3QH7A 4FFFA 4BK5A 2Z4FA 3OEBA 1K5MA 2VAUA 2WWUA 4WM7C 3DF0A 2XKOA 3NWKA 1ZZBA 5D21A 4YVWC 3O1UA 1QQP2 1IOAA 2R0FA 1NCQB 1RUI2 3E6BA 2A5ZA 5F3IA 1MQTC 2A6VA 1RUG3 5FBZA 3H8XA 2R072 1D4M3 3HN3A 4IESA 3WZ1A 4UFJA 4RR3C 5JAXA 3N4MA 1AR62 2IUWA 1OLMA 4I30A 3R0RA 3EHKA 1V9U1 4LHSA 4C90A 4Q1PA 4XXAA 4B1MA 1MZ6A 1YYNA 4FXGB 4YGBA 1ALYA 4C1WA 1HDKA 2JE9A 1S2BA 2YUEA 4XPVA 5FO7B 1GZ9A 1NE6A 3AFKA 4OI2A 2DCKA 3LWCA 5FYBA 4LIVA 4EQVA 1IKQA 1W6OA 2ZA9A 4R9BA 1R081 1YJLA 5LBBA 5HI0A 5JIUA 2ZXQA 2LROA 4PI2A 2H6CA 3PMEA 3KVBA 1REFA 1TME2 3S0MA 2GC1A 5K9YA 1PO13 1X82A 4GAZA 1OQEA 5LRRA 4DQAA 4BQ2A 1BZWA 2EXKA 2XMLA 1ZM1A 2PHWA 4GIQA 3BODA 3BB6A 2WA4A 2OZJA 1A34A 1L7QA 3PL0A 4M3CE 1DQ1A 4UFMA 5FLIA 4G9SB 4LO4B 5DQ0A 2CTVA 1Q8OA 2WNVB 4AEKA 5DZEA 1DYPA 2VGDA 1JMUB 3KD4A 3W20A 4W8JA 2EIBA 5L36A 1KD7A 1IG3A 4WVWA 1DZTA 2JIJA 2Y38A 4CVUA 1OOPA 2VTXA 2UWBA 3AMHA 5LRSA 4HETA 3D6EA 2Q5TA 3N3HA 4FPLA 2K0GA 3I2FA 1GMMA 1MEC1 1SZBA 4QU1A 4CDWB 2XVKA 4DIQA 3LCPA 4BMEA 3Q8EA 3S5QA 1AR92 2P3KA 2DUOA 4IE6A 5JXIA 1EV13 4QB1A 1QH6A 1CAUB 2E33A 3I59B 5AFBA 1C1LA 4KMQA 3BIEA 2UWCA 5C5TA 5FQ0A 2Q4SA 2Y34A 1X8EA 4OFGA 3DECA 3THPA 3AK0A 5DAQA 5EV7A 2CNAA 5L7OB 1U5YA 3E6DA 3CL1A 5FK7A 3TBDA 3S30A 5KXBA 5IK4A 2W1WA 2YMZA 1GBGA 1REEA 1AYM2 3CNAA 3EYPA 5GLTA 1EUUA 2H6BA 4LBQD 2HWD1 4A7KA 2KXLA 1WA6X 4BDVB 2CL2A 3VD9A 5ERLA 1YFYA 2W47A 4AEDC 4Y20B 2XONA 2VBBA 2FMYA 2BVVA 5A33A 4BCUA 3WNMA 2A6ZA 3CZUA 5I0UA 5J1XA 4K1ZA 4JDMA 1DZQA 4Z92B 2FCVA 3RI9A 5DMYA 4I2OA 1AXZA 2D3RA 5LK5A 4XZUG 3O1RA 4W6XA 2PQQA 1AL22 3AP6A 4BQYA 3NKTA 5BV6A 1LHWA 5ANQA 2P17A 2RM23 5IATA 3ZSKA 5C70A 2VUJA 4QX2A 5CU1A 4CCDA 1R091 3ZXLA 4CDUB 3W59A 2ARBA 3WR0A 5F2WA 1NCRC 2C6SA 2GNDA 5CKMA 4A42A 3JBG1 3VBUA 5SV8A 4DO0A 5FKCA 3MIEA 1FOD1 3JD73 4QB6A 3S7IA 3LPGA 4CU6A 2VMGA 1HB4A 1G6NA 1OF4A 2Z69A 3J7LA 1QDOA 3O0VA 4RHV1 2QUOA 1AUYA 2MEV1 4P02B 4CCJA 1ND2B 2X05A 1LU2A 2Y33A 3IPVB 4MLOA 5BNQA 4QPIB 5FJKA 1BLZA 2ARAA 5HCHA 4H55A 1LOEA 3OGJA 1MZFA 1RB8G 2ZX1A 4CYDA 2WAAA 3NVCA 3J8F2 4ET7A 4Y4YA 1AF9A 4ZXKA 4Q4V2 1UW8A 1H2NA 2ETEA 3AP7A 1GYKA 5D1IA 2ADDA 4OUMA 3T4HB 1JOBA 1JODA 3TN93 2F17A 2ZMKA 4YM3A 4JGYA 1O91A 2V73A 1T6BX 4CP0A 1DQ5A 3BGAA 4OHZA 3WHUA 4L0PA 4CUGA 4HLTA 5CFDC 2HYKA 2B45X 1H4GA 1NLQA 1B35C 1TQ5A 1VAVA 2G1MA 1XU1A 4FBFA 1RJ8A 1VBE2 1RUG1 3GDBA 4ARXA 3D5OA 3VBRC 4WV8A 5A1AA 3MLLA 1D4M1 3FLRA 3HEIA 2HBUA 3EO6A 5IJRA 5HCAA 1XQNA 3EB7A 4M3CF 2RMU3 4AXOA 2P6HA 4M0HA 4YG0A 1S4CA 3USSA 3WXPA 4AG4A 1ULPA 2WFPA 3K4ZA 5FP8A 3IAPA 4DRVA 1OA2A 2HEYF 2J1TA 4FOYA 2F6BA 1VRH2 2P37A 3O1OA 1QMJA 1PZ7A 2ZACA 5FOBB 2OUHA 2XUMA 2Y0IA 4TXWA 1Y9MA 2A3XA 2WYSA 4XMAA 3OPWA 1PO11 4R4ZA 2CAUA 2WSUA 5JXGA 1C5IA 5T5LA 1CD3G 1SDDB 1QXPA 4TZDA 1CIWA 1WCSA 3HQRA 5T5JA 4R4XA 4LTAA 4P9IA 1ONAA 3I2HA 3KSCA 3PVOA 3IIIA 4QPGA 4HK9A 5LBEA 4L99A 4ZPIA 4XACA 4XHBA 3DXUA 4NIDA 2W9XA 4JRLA 3ALQA 1OLME 2ZX2A 5J7MA 3BCWA 1KGYA 1RUC3 4OMDA 2DURA 1DYOA 1YQ2A 1I3HA 1NLRA 2XUEA 4I0BA 4AHYA 3POYA 2ZEYA 3OF1A 3P5BA 3GYDA 4UXAA 3PU3A 4XF3A 3VZOA 3BKZA 2ZKNA 1GICA 1EV11 1O7FA 3K46A 4Y5Z0 1GWMA 2XGXA 2VTXJ 4CEYA 5A3UA 4ZKTB 1ZRFA 2FMDA 2EIDA 3BU7A 4QD2A 4AQTA 3HPNA 4CEWA 4HVQA 1ODMA 3BVCA 3IMNA 3K4AA 1MR5A 4DMIA 2A1XA 3I54A 1WA4A 2X5IA 1YC61 2OW4A 2XJSA 2TEPA 4AQ2A 2X8KA 3LEGA 2PHFA 3ZSLA 1RVF2 2VU9A 5CEHA 1PO21 1UOGA 1LENA 1NA1C 4TSVA 1UY2A 2WS93 2JD9A 5IVVA 1C1FA 2BWCA 4B4PA 4I3PA 2DDUA 2VNGA 4MHRA 3MGUA 4QU2A 4EN9B 3F2ZA 4I0AA 2BVBA 4QXKA 5IK7A 1CPNA 2R062 4O7XA 3WY6A 1ASJ3 1PGW2 1NZIA 2ZHKA 2G19A 1VBD3 4K3UA 3M3OA 4PDWC 5FPVA 5A3OA 3AX4A 4Q4X3 2Q30A 3R4UA 4Y22B 1A3KA 1F35A 3SNMA 2RS33 2RM21 3MW4A 4BISA 1WUVA 2VOKA 3GZTB 5FRAA 1SEFA 5IT6A 2LW8A 3AC0A 1OQ1A 1W6MA 4JC1A 5D8AA 4ZHNA 1VBA3 5IAVA 1UYYA 3ZXAC 5JZGB 2IVIB 4URTA 1CR7A 2XJPA 1D4VB 3N9MA 1E5HA 1TG7A 3KCCA 3OD4A 5A3WA 2QCSB 2UYBA 2W5FA 3JD71 2VCCA 2P3IA 3CLPA 4AEJA 4BXFA 1F31A 4IV1C 4Q2FA 2VPVA 3ILNA 3U07A 1R1A2 1W8ZA 3FX3A 4P9XA 5GLZA 2ENRA 2OYZA 4YVSC 3U10A 2E7TA 1DU3D 4P14A 3DYOA 3HVDA 2VTFA 3OBRA 3OPTA 5FV3A 4KWUA 2DVAA 5FPUA 3ZLIA 3WUCA 3ZYRA 1RUF1 2XLGA 1FI2A 1NXMA 4MGKE 2J22A 2PFWA 1BEV3 3PUAA 3NMBA 4P9GA 3MIFA 4HMZA 1W6PA 4A3ZA 4CCNA 1H9WA 4QAWA 5GZGA 4JCKA 4GKYA 2DFCA 3OEAA 4V2WA 4YFWA 5FZLA 3TN91 5DDJ3 4O9GA 1PK6A 4ZONA 3RWKX 5LEKA 3U14A 2QZ2A 1RUOA 4CUAA 1OOPC 2Y6KA 1H6XA 2TNFA 4UF0B 2PTMA 2W46A 1WD4A 2QQLA 3UJOA 5C9AA 4RS5A 5JWPA 3ZFGA 1VBB3 2PN5A 3JQWA 4XW3A 5FY0A 4JAAA 1JTZX 4FQZA 4RFT0 3PHMA 1LNSA 1UIJA 4XABA 5CADA 1SFPA 1FV3A 2OT7A 4PBPA 3WG1A 2VL4A 3O1MA 1XJAA 3KQ4B 2RMU1 1TNRA 3WDVA 2RDRA 4GALA 4R9AA 3ATGA 1WMFA 1CPMA 3VBFA 1W9SA 3B7MA 2JG8B 3OTFA 4IEZA 2MHFA 2GDFA 4CDXC 3TEZA 4FTBA 2EF6A 4NWWA 4Q4W3 1H2MA 4FCAA 4KU8A 1VBC2 4IEOA 2BRTA 3SEEA 2WA3A 5C3RA 1PIV3 2PYTA 3ACGA 2JKXA 5A7WA 3ZYJB 3S7EA 1GWLA 2VOXA 5C8CB 3M3CA 4CDQA 4CUBA 4FSJA 2J1RA 3O14A 1HQNA 3T2TA 3WOGA 5FAXA 5JSPA 1V6OA 4FFIA 3WEZA 3ZDVA 2VULA 3E1F1 3WCSA 3C7HA 2VMEA 5FZ6A 1FV2A 4KWLA 3U37A 4D7TA 1RUC1 4QQHA 4LKFA 5T55A 3WV6A 4CP1A 3ZMNA 2GNBA 2DBNA 3O5SA 3THTA 5CA6A 2IVJA 2CHHA 2VCAA 2ZX0A 1DQ0A 3WW4A 1RUE2 2XHKA 5I0DA 1HV0A 2RDQA 2VNVA 2WYFA 4LUMA 1DQ2A 1XE7A 2X53S 3KF3A 3WNOA 2QTWB 1TZOA 4K9SA 2WR9A 1ST8A 5IVFA 4BIFA 2E51A 3NV3A 1NYWA 1PVC3 3CQOA 1UY4A 4N53B 3P3PA 3SH4A 3I49A 4XFBA 2K2SA 1X8MA 4WM8B 3WNKA 2L9LA 2JXAA 4AR2A 1VMHA 4PLOA 4WBBA 1GFF2 3WQ1A 3H1WA 5C3PA 3MI8A 4CPBA 1UYXA 2ZGSA 4XCAA 2WZR3 1E5RA 2WFF3 4R8HA 5BNPA 1YCIA 2B42B 3FUQA 4JV4A 4WVMB 2P5BA 2CGNA 3EQEA 4CZSA 1C8M3 4XAEA 1POV3 2JDHA 5IHRA 4YG3A 1C5HA 1W2AX 4NPMA 3RYPA 4AFDA 5BNOA 1QU0A 2RS13 5GZEA 2X10A 2YFUA 1X33A 3C3VA 1Q43A 5FZ9A 1AR73 5JXJA 4ONUA 1A8DA 1OKOA 5ABJC 3H0OA 1W2OA 2YBSA 1U0AA 1W9WA 5FMDA 4Q4Y3 1ASJ1 3T0BA 2VUAA 3MIBA 1EV12 1VBD1 3HWJA 2PHRA 5BY5A 1NOVA 1RL3A 3PIJA 4JGYC 4Q4X1 1H30A 1IPJA 2SLIA 4RGGA 2RS31 4PJYA 1GZWA 5FMCA 1QNWA 3SC7X 4OQ9A 2D93A 4UOJA 2P34A 1BYHA 2DYCA 4AHXA 4C91A 4WM7B 2PELA 3WP6A 1W99A 2XWBB 5KWRA 4UBGA 4NE9A 4YVWB 1VBA1 1WLTA 5FY8A 3H8RA 1RTVA 3N7LA 1GP4A 1MQTB 4WVVA 2XH6A 1AR83 5F6LB 5FP3A 4CU7A 5F8PA 2CGPA 3LE0A 1WW4A 2Q8CA 5AVAA 5LZ6A 4RR3B 5FPBA 4QM8A 3I3MA 1QJZA 3SHRA 4CP2A 4PCRA 4LBLA 3THDA 4DZGA 4LBQA 2C26A 1JYXA 2VZUA 2ZOEB 1F5FA 2IFWA 3I3BA 2QQWA 1J1TA 3PUIA 2W0XA 1QDCA 4JKLA 1JOPA 3W21A 1SHWB 1ZVFA 1UY3A 4AQ6A 1O3SA 3NNLA 1IS5A 2DFBA 3AKTA 2ES3A 4BE3A 1UO9A 1BEV1 1JYVA 2WLPA 3IZOA 1MS5A 2QJVA 2Z42A 4N8MA 1COV1 4MX3A 2P1BA 3MW2A 4QPGC 3SH5A 3OY8A 2YU1A 1JZ2A 1ZBA3 4XEZA 3KGZA 2MPFA 4KG0A 3LFIA 4OHXA 5DDJ1 3OBTA 2HYXA 2JDAA 1ZREA 1RIRA 2YROA 1SMVA 2Q8EA 2FQPA 5C4WA 4Y1ZA 1QJFA 4N9IA 2C9KA 3WNLA 4XJAA 3E6CC 5H9PA 3SQOA 2V4AA 1N3OA 1VBB1 1W2NA 1V6LA 1JN2P 2AENA 2AEZA 2D97A 5FR3A 3MIHA 3O1PA 3GHNA 3KV5A 2ZGKA 3VZNA 2FHRA 5IW0A 3LOBA 2DWRA 2R042 4FTEA 1OLQA 3WP3A 1OF3A 3NJZA 1RC6A 3ZXKA 5FY5A 5FYMA 3ZFFC 1O8SA 2BP6A 3ZXEA 3U0ZA 4AVCA 4F8AA 1J1LA 2YDEA 4BK4A 4DS0A 3H8OA 4Q4W1 4ASMB 2X5IC 4AFCA 4LBKA 1GQHA 4LNVA 4DXSA 4HKOA 4BB3A 4IV3A 1DCSA 3KGLA 3I2IA 5A80A 1PIV1 2K9ZA 4BIOA 4QB2A 3SMHA 1YQCA 4GB32 2RS52 5FZCA 4PLMA 2LTNA 1V00A 5C71A 1CN1A 4E27A 3K3NA 4XUNA 5DZGA 1BK0A 1UYPA 3DPRA 4FO9A 3DYPA 4BZ4A 1UPSA 2YXSA 4AEDB 5JPNB 4B1LA 4JGZA 5H9SA 1MEC3 3GCWA 4XUPA 4UI9L 1SLTA 1BBT1 3VD3A 1EYBA 1PNFA 3I2DA 5C5UA 4LIUA 3BTYA 2WT0A 2CY6A 3GXUA 4K1YA 1JS9A 2OUJA 1QNYA 2Z5WA 3NL1A 4ISRA 5DABA 3FC0A 5CVRA 5FZGA 1UMZA 5BXXA 2XOMA 3PJQA 4ATEA 5T54A 1XYOA 4LUKA 4AEMA 4W50A 2VMHA 1PVC1 3UETA 3S5AA 3WLUA 1PX3A 4PIXA 1NCRB 2JG9A 3EJKA 4ZY9A 2VQUA 1AYN3 1CAXA 2R30A 3FHIB 5FYVA 3DKQA 4LT5A 2HWD3 4KG8A 5F2SA 1SBDA 1NT0A 5GJ6A 5J48A 5CNAA 1J59A 4LLOA 1JYTA 1SG3A 3MPPG 4NN0A 2WZR1 4KU7A 1H8TA 2J1VA 2RG4A 2AGSA 1POQA 1W0PA 2AREA 4AGRA 1C8M1 1POV1 2XXZA 1ZZ8A 5IVBA 2LRPA 1KEXA 2RS11 3NQHA 4LBMA 3M3IA 2VUCA 1Z0HA 3SISA 1VLNA 1X50A 4IEXA 2HWB3 2Q0AA 1M06G 3VBOC 1A8MA 2FDHA 1D2SA 3RZKA 3KB5A 2DCYA 1N3PA 1PK6C 1NCQA 3WF0A 2VC9A 2QQIA 2WT2A 2VCBA 3KT4A 4PQQA 3AB0A 5KHJA 5EXOA 5A1LA 1CAWB 1WCDJ 3LSDA 4RS5C 2UURA 3UV9A 1OH3A 3CIHA 4BQ1A 3GZUC 4IW3A 1HRI3 3WHTA 5CFDB 1B35B 1UKRA 3IDCB 2PLV1 1AR81 3AZYA 3JZVA 2WO1A 4RHV3 5CB7A 5J09A 1OHFA 1JZ7A 2ZGNA 2WS92 4K8RB 4HT1T 1H0BA 2AR6A 1ZA7A 5JI7A 3N9OA 3C8XA 4BLJA 5J98B 3ZPYA 2GC3A 4UAPA 1CJDA 1H6YA 1J83A 2XJQA 1W8HA 2BOJA 3O1TA 2EXJA 1VBD2 4LBJA 4XDOA 5JOWA 3OSDA 1LGCA 2JEMA 3OBZA 4AI0A 1VIWB 4CDQC 1GLHA 2WNUC 3GBWA 2BGCA 4KQ7A 1TEIA 3AP5A 1RMU2 1PMIA 1N1YA 3IAQA 3S57A 3WDYA 1SLBA 2JDKA 1SPPB 4E2GA 4L97A 1ZBA1 5IYYA 4NJ4A 5FZ1A 5FLHA 2GZWA 3OPZA 3RFRA 3IDBB 3AL5A 3ZR6A 1G9AA 2J1SA 3CKHA 2GMEA 4OI4A 3VZJA 4CDWA 3MYXA 3RZJA 2D44A 3QBQA 2A6YA 5J36A 1H1MA 5FZ8A 3J7NA 2B9VA 2QFEA 2W94A 2E31A 2ZAAA 3SCGA 5JCTA 1JYNA 4LHNA 4UW5A 4N9HA 2WT1A 3TYJA 3UK9A 4CP9B 4CSWA 1N1SA 2ZHMA 4JHZA 3ZSJA 4HSLA 1REDA 2CWMA 5G05L 4Y1UA 3I2JA 3NAPA 3J9SA 3JB8A 3KHCA 5JLVA 1V6MA 1Z7S3 1QIQA 3M70A 3PTRB 3RNSA 3K51A 4LO7A 4P08A 2OPKA 4CPBD 1RUD3 3ZXGA 5A70A 2FDGA 1WW5A 2CAVA 5DN2A 3KWVA 5L9RA 2KR2A 5FXWA 3GF6A 5BNPC 2IXKA 2GALA 2O1QA 3ETQA 3IIAA 4Y20A 3TEWA 3AP9A 4LO6B 5EFUA 5ACA3 5FZ0A 1YWKA 3AFGA 3KV4A 3N9QA 4TTGA 2BBAA 5AC93 3KV6A 2A3YA 4BQ3A 1FMD2 4X6QB 2HWF2 2BJSA 3WUDA 4CXXA 4Z1VA 4YZ5A 2B4KA 2XJUA 1NA1B 2HH9A 3OYWA 2OPWA 3ZO0B 5M0TA 2BTVC 4IEYA 1OA3A 1RHI2 1BVVA 2TUNA 5EWSA 4UYBA 4BPZA 1SDWA 2VOTA 4W65A 2XBO1 5CG8A 3VBSC 1ZNPA 1DYKA 1UU4A 2J1AA 5L9VA 2CDPA 1XNKA 4UT5A 4FPOB 5FYSA 2O8QA 3ZSMA 4FAHA 3P6BA 3VUOA 1DDLA 4J6GA 3DKWA 1L7LA 4PDWB 4Y33A 3AMQA 4FP2A 4NIGA 4DEVA 4IGPA 1I9RA 1XU2A 2YPJA 1LGBA 2OQ7A 1OD3A 4MOAA 4FPKA 2FCTA 1HJFA 1TMF2 1QEXA 1VR3A 2XHNA 4XFCA 5FXXA 1BMV1 1F9KA 4QX7A 2QE3A 1KDKA 4HPKB 4QDRA 4XURA 1AZDA 2OXBA 3VBHC 1EAH3 1AYN1 3MW3A 4IXLA 1PO23 4OYUA 1EPZA 1ND2A 1AXKA 2ZEZA 4YW2A 2D6LX 2R32A 4BQ4A 3IPVA 3I8TA 2JE7A 3WG2A 5A7OA 4QPIA 4QQPA 3ST7A 3HNMA 5LA2A 1SACA 1QWRA 2LS6A 1MVEA 2EXHA 4IV1B 1H2LA 3ZMOA 1YI7A 2OZ6A 4OZOA
chains in the Genus database with same CATH topology
1UAIA 1UN1A 2HWE3 3M8LA 2TBVA 4COZA 4YVSB 2GU9A 2RHPA 3V56A 4NHKA 4P9WA 2PAKA 4RL7A 4M0NA 4N43C 2HWB1 4QMAA 4XDQA 1RUJ3 4ZU5A 2W08A 1NY71 1Q8VA 1XNDA 1PZ8A 1SCRA 1ZRRA 2BEOA 4BMBA 1LEDA 1M4WA 1ULCA 3APBA 1OOPB 1QJX2 1HRI1 4L92A 1WBLA 5A32B 1DQ4A 1FPN2 1POV0 2WFF2 4FT8A 4G4FA 4HK8A 1BK1A 1JH5A 4EN6B 1C8M2 2A6XA 1HRV3 1KFUL 3O0WA 2BNNA 3V0AB 2VVDA 2B9UA 1RUF3 2WKKA 1AR72 1C4RA 1RUH3 3ASIA 3B02A 4CDXB 4EWAA 4Q0VA 3GBGA 4Q4Y2 1PGL2 1FNZA 1JUHA 3LSEA 1HLCA 2VQ0A 4LBNA 4XBLA 3RMXA 5FO8B 1GSLA 1ZZ6A 5SV5A 3ACLA 1G9DA 4LA3A 3DPRC 5J37A 1PNGA 5FLJA 2RE9A 4JGZC 1SLIA 3V64A 4EN7B 1YJKA 2RR13 1ZBE3 1W6QB 4MGYE 5JVVA 1QOTA 1QJU2 1XXNA 5FOJB 2WIIB 5EZWA 4JQRA 2B7YA 3AYAA 4HFSA 4AI3A 3JCIA 5CG9A 4Z8BA 4ES8A 2Q1MA 3JB4C 1G9FA 1Z7S1 3ZFEA 1EY2A 1Q8SA 5DZFA 2JG9C 5HCFA 1NZCA 1VJ2A 3NV1A 1RUD1 3ZDSA 4Q0PA 3RG0A 1YFWA 4OHYA 1G86A 3MF9A 3MIGA 1S0GA 4LA2A 5E16A 1O3RA 1GANA 2QNKA 5ACA1 4QGMA 3DGTA 5AC91 4OUSA 3HT1A 4H7MA 4AF9A 3AJYA 3RJRA 1V9U2 3BOWA 3VKOA 5JOXA 3SITA 3VV1A 1O3QA 2QQPA 4UBHA 3KS7A 1FNYA 3D8CA 1VALA 2PHUA 3L2HA 3CEWA 4NR1A 5ABJB 1R082 3WG3A 4IEUA 5JZGA 4JGYB 4XHXA 4GULA 4MXVA 3ZN6B 1ND3C 4MXWB 1QJY3 5I0RA 4MVTA 2GMMA 1KRIA 3V0BB 3RYKA 4NPRA 1J3PA 1EAH1 4LE3A 5C6CA 1FYUA 4BOWA 1CAVB 3PVEA 5FCCA 3QOPA 1BKZA 1XYPA 1ZYBA 4X6RB 1YIFA 2A71A 4BWOA 2A7AA 4XBQA 1LU1A 1MEC2 4SBVA 3CJIC 2HWE1 1XNBA 3HAGA 2XVLA 2BFUS 1LHNA 2DTWA 1NLSA 5FREA 3H7YA 1K5MC 3AMPA 3D4KA 2VXRA 3I7DA 1RUJ1 2D6KA 3DUIA 4EWEA 1V70A 1YO8A 1S2KA 2VY0A 1CVNA 4UW6A 4QPGB 3OJBA 2YV8A 1H1IA 1OFSA 1TNFA 3QACA 4XE9A 3P3NA 3CF6E 2HWC3 2HWD2 3B69A 4GH4A 3VDDC 3ZX7A 2XWJB 2VECA 2MNGA 4LR4A 2JG8A 2E9QA 1C8NA 2ZBJA 3NAPC 2ZTNA 1QQP3 1HRV1 2WQZC 1KITA 4DXZA 1RUI3 4TWTA 3DL3A 1QY4A 4KBBA 4U2AA 1RUH1 3L2YA 1HXS1 2R073 2PHXA 1RJ7A 3ZFFB 5C8CA 1NQDA 4BHPA 1AR63 1COV3 2A6WA 5GM0A 2EALA 1LGNA 2YY1A 3ECQA 3WQ0A 1R092 1LKNA 1S1AA 1WCKA 3VHOA 2ZMNA 1OPOA 3JBG2 2GAUA 3IDEA 2GNMA 2ZCWA 2IC1A 3H3ZA 1NE4A 1FOD2 1LOFA 2ZPXA 2R16A 2RR11 1ZBE1 2VQAA 1DG6A 4RHV2 4Q0UA 2MEV2 4ITCA 1IQAA 4PF5A 4LO5B 3RRDA 1OD5A 3USUA 5FMOS 1DGRA 1TE1B 4XBNA 4DY3A 4N53A 3UKVA 4NOTA 2YYOA 4MV2A 4WM8A 2UY9A 4K6BA 1YLLA 1W6MB 4N7UA 1GR3A 4Z07A 2BFUL 2G4IA 3KCYA 1QH7A 1VP6A 2DCJA 4WZFA 1YHFA 4IEPA 4WVMA 1W6NA 3WCRA 1D0HA 1Q8PA 1DGLA 4I09A 4XJUA 4B8EA 1RUG2 4U36A 1D4M2 5H9QA 1UF2C 1BBT3 3SLIA 3A4UA 2R0HA 3VKNA 5JOZA 2XPJA 4B4QA 1YUDA 2ZMLA 1AYM3 5GKAC 1W6PB 3RWNA 4S2DA 3KM5A 4WM7A 3BIWE 3VBOB 4I0WB 2IXCA 2IXLA 1PK6B 3VBUC 3VKLA 1PO12 5BNNB 1MQTA 1IGOA 1IKPA 2D3SA 4YSFA 1QJY1 5T5OA 2NMOA 4RR3A 4G3YC 3R05A 4XTMA 1HIXA 4RS5B 1AL23 4AVAA 4LE4A 2BBVA 4DOUA 1FXZA 1URXA 4Y24A 3ZVXA 2PA7A 3JU9A 4YG6A 5I0TA 1ENSA 1MZ5A 4P9JA 2OA2A 2IFRA 5LK7B 4HKLA 3RMYA 1XRUA 1G8WA 2LM3A 1LESA 1D2QA 1V6KA 3OGGA 1I5ZA 2ZX3A 5FFOC 5F6KA 1QKQA 3UKNA 5FMOL 5I8SA 4HKWA 4P9YA 4CDQB 2NZ9A 2WNUB 4S2GA 3ILRA 3AJZA 1KFXL 1LULA 3VL9A 4GWMA 3AM2A 2VG9A 3HBZA 2PLV3 3NSTA 3J8F3 2HWC1 1PO22 3HQXA 4Q4V3 4F7ZA 4FOVA 4E4DX 2EAAA 2G9GA 1GZCA 4Q0SA 5AVPA 1AXYA 1H8VA 4HANA 1OFNA 4RQPA 4HBNA 3G6JB 4UW3A 5GLUA 4NHMA 1S0FA 1RUNA 2QVSB 2Q1ZB 3N7KA 2GMPA 3VKMA 3ZFEC 3PVNA 1A6CA 1QQP1 4ATFA 5C33A 1RUI1 1PGSA 4LULA 3D0JA 5K0UA 4EJRA 4META 2BWAA 2R071 1LOGA 1YXWA 1W0OA 2RM22 3AKQA 3ES1A 4K21A 4PIYA 4HVOA 1AR61 4AVSA 2NMNA 1QXJA 2WINB 2DU0A 2P3JA 5B2GB 2FBEA 1GKBA 4IEWA 3I4IA 2ET7A 4LEJA 5BNPB 4GQ7A 2Y0OA 1CGPA 4AEDA 3FJSA 3KCXA 2V09A 2ILMA 2R49A 3IKWA 2E6VA 4YW4A 1W2UA 1DFQA 1FATA 1C28A 1S0IA 3JD72 5JSRA 1LR5A 5K8SA 5H9RA 1TME1 3H9AA 3BALA 4D7SA 2GN3A 2DUQA 2H0VA 3VBSB 4CEYC 4EROA 5L19A 2W52A 1HRV2 4CEWC 1WMDA 2P2KA 3R4DB 2OVUA 1X36A 5BUVA 1GZWB 1RUF2 3RYRA 1UX6A 1NCRA 1ULFA 4XOGA 2C9AA 3R4SA 3IBMA 2DTYA 3VLBB 3M4FA 4H3WA 1JW6A 1Y43B 1G9BA 2DU1A 1V6NA 1QOOA 1O4ZA 3B9CA 4J1XA 3TN92 3WD5A 2UY8A 1UD1A 1J3QA 2UWAA 3VBHB 4Q0QA 4A2UA 1UIKA 2B5HA 5FO9B 5L73A 3UL2A 4BH9A 4LBQB 2JKBA 2XBO3 3LA3A 5DUWA 5CFCA 5KHKA 3FE5A 4EN8B 1WW6A 2C5DA 2RMU2 3G7DA 4NHLA 2VOVA 4XFGA 3PTYA 4HN0A 1RVF3 1S0JA 1AYM1 2D40A 3WDTA 3E5XA 1XNCA 4N43B 5D8AC 5JI9A 3OY8B 4RGAA 3WVJA 3T1LA 5GZCA 1FT9A 2BUKA 4M3CB 4BLIA 5CFDA 3UJQA 3NO8A 3TWIA 1B35A 2V5YA 3W9AA 3KQRA 1XE8A 1QXRA 4XYXA 4GH4C 1UPIA 2A73B 2R063 1DZRA 1ZA4A 3EBRA 3TNQA 1FAYA 1JYCA 4R52A 3H1MA 2D7FA 3LGRA 4QGLA 3ZSEA 2JG8C 1AL21 3H8UA 2IWGB 1YNAA 5JSOA 3VL8A 2XJTA 2UYAA 2DCZA 4XFIA 4MZUA 2DCTA 1RUC2 4H7LA 4LO8A 2OIIA 3D0SA 3RS6A 4XJ8A 4MYEA 3VGIA 1NG0A 4AFAA 2DVDA 4XJZA 2KM2A 4XFAA 2GNTA 1MS9A 1ZX5A 2AH2A 4YZ4A 1O5LA 4FPCA 5KBFA 5E89A 2LALA 4BYYA 2XJVA 4XJWA 4FAGA 1DGWX 1LOFC 3MZHA 5C9AC 4Q29A 2FZ1A 1UZZA 4W6YA 3WINE 3ZFGC 3SH3A 3DPRB 3GBFA 5KXDA 4KWJA 3B00A 2GN7A 5JDBA 1SBEA 2JD4A 1CQ9A 1SLLA 1VAMA 4JGZB 4KGQA 4XILA 2EVXA 3J8F1 3VBRB 4ASLA 4Q4V1 1AJKA 1SLCA 1SBFA 2ZGTA 4PBOA 1LEMA 3VBFC 4YZ3A 3FFQA 2ET1A 4ES9A 4NO4A 1VB2A 3WP4A 3LOIA 5I8TA 2YZ4A 4YRDA 1OPMA 2A75A 2SBAA 3ZXDA 1N47A 1ASJ2 4DY5A 3RDIA 1VBE1 3ZN4A 3C2UA 4EV0A 4Q4X2 2PAEA 2I74A 2JG9B 2RS32 2WNVA 4IEQA 5E88A 1CAXB 1E57A 3M1HA 2I07B 3PMSA 2HJIA 1NA1A 1OKQA 1VBA2 1WLDA 3N36A 3ZYIB 3MDPA 3AMNA 4YNIA 1VRH1 5KXEA 1VBC3 2ZABA 1ULDA 3H7JA 4OI1A 1HV1A 4QM9A 4D3WA 4YZ1A 1CAUA 3I59A 2YHJA 4TLFA 3ZYGA 1AL0G 1JOJA 1EPWA 3QLQA 3KMHA 4OI0A 2ZHNA 1PM7A 2DVGA 1DBNA 3HMYA 4AFBA 5L7OA 4HPKA 4JVAA 5DG2A 1UZYA 4V1PA 1BEV2 4C0HA 2JX9A 1COV2 1GV9A 1ND3B 4M01A 4GWNA 2W68A 1RUE3 5DDJ2 1ULGA 4IV1A 4FQ4A 5BNOC 4XXPA 3KT1A 4IL7A 1JHNA 2I45A 3WDXA 1H2KA 4CRQA 1Y7BA 4YVSA 2WNEA 4AK3A 1QGLA 5HXVA 1VBB2 2GH8A 1DLLA 2QDRA 3N7MA 3O12A 3CJIB 1HKDA 4AGVA 4CDUA 2IXIA 1BJQA 4ZU7A 1S0EA 1RVF1 3WDUA 1D0GA 1K5MB 1R1ZA 4Q4W2 2WQ4A 5J3UA 4F3JA 2WL1A 4S2HA 5A3MA 1DGWA 1PIV2 5A32A 1S0BA 2YC0A 4XZPA 5DG1A 4KWKA 1NXD1 2R061 2BYVE 2LUWA 4RQPC 4RSUA 1PGW1 5C8WA 5KC6A 4IETA 4LHKA 3TB0A 3VDDB 3V0AA 1VB4A 3WQ7A 3B5LB 3X29B 2X29A 1MS8A 1W6OB 2VNOA 1BBT2 4CDXA 2NYYA 5K0UC 3M7AA 3NAPB 4HN1A 1OI6A 4RA0A 5FPXA 4DINB 4K20A 2XB6C 2AUYA 3AXEA 1WGPA 5JIAA 4YLZA 4AGGA 2AZ5A 4XFHA 4AW7A 4GMP1 2ZAHA 1DGRN 1UU5A 1PVC2 3M3QA 1R1A1 5DXDA 1W6QA 5F1RA 5C4WC 2BPA2 2VVFA 1Q56A 3OYWB 2D43A 4XJ9A 1JUIA 1AX2A 2WZR2 1IZ3A 5K7PA 4AVTA 3OD0A 4B3NA 1UU6A 3KZ4C 4JDNA 2DVBA 4HZFA 3N7JA 4W6WA 4L8QA 2D5FA 2RS12 2PHDA 1DHKB 2JENA 2WLQA 2Z79A 1S0CA 1C57A 2NLRA 5FQ0B 5T3NA 4Z82A 1HXS3 4COVA 4ISQA 3JQXA 4IV3C 2AYHA 2IXJA 3FLPA 5GALA 4INDA 2E7AA 1LCLA 3CJXA 3MLKA 3PVBB 1GQGA 3LA7A 4E9KA 3INAA 2W39A 1CJPA 3TRSB 1AJOA 2GC2A 1MVQA 1MS4A 4XF9A 4YW1A 4K7JA 2R043 4FPJA 3FBMA 3PJYA 4AVBA 5A33B 1LHVA 3K48A 1KJRA 1ZRDA 5CFCC 3LAGA 2PLV2 1AR82 2Q8OA 1XYNA 4L11A 3GHMA 4GA9A 1QHDA 1VBC1 1Y9QA 4FPEA 5ABJA 4FPHA 3AP4A 1UL9A 5T5PA 2JICA 1C3HA 3H50A 4XFFA 4R9CA 3WT3A 4GB33 2RS53 3AKPA 3WX5A 4OZXA 4B7EA 3ZN6A 4E2QA 2B39A 5F5QA 5GLVA 1BVP1 4MXWA 3RPQA 2VW1A 3NKGA 1J3RA 1YRZA 3FLTA 3VZKA 1JYIA 5EYXA 2IXHA 2GC0A 1GNHA 3RQ0A 3V0BA 3VBUB 3IN9A 3V65A 1KJLA 4YGDA 1CAVA 1H8TC 1RITA 1ZBA2 2A70A 1LOCA 4IQPA 1RUE1 1OA4A 1HQWA 3VDDA 3H3UA 3ES4A 4PQ9A 3J26N 4AI8A 4B29A 1AHSA 4XQ4A 5CAZA 4E2SA 3ZIXA 5HBAA 5IK8A 3MPBA 4PLNA 1DF0A 5JOYA 4FP3A 4Y22A 4Q1RA 2DVFA 3VZLA 3KLSA 4YM1A 2H0BA 4BA6A 1QOSA 2XVGA 1NCQC 4BM8A 4YM0A 4QPYA 4YGEA 1SFNA 2QDNA 3PNAA 2O8OA 4AVVA 3ELNA 1ZZ9A 2ZGRA 4S2FA 4XIOA 2XLFA 4RD7A 4MSVA 2PAMA 2XL9A 4LHLA 5E8AA 4D7YA 3TNPB 2NPIA 5LEJA 2CV6A 4WZCA 3VZMA 1F2NA 1PZ9A 3O0XA 3BTAA 2VNRA 3E97A 2CYFA 4FPFA 5JMCA 1CX4A 1Q8QA 1ZZCA 4TYSA 1ZRCA 3WNXA 4HVRA 1YIPA 3ZFFA 2XBO2 4XIKA 3MICA 4OHVA 4I02A 1V6JA 4XQDA 1BXHA 3ZFEB 3HN1A 4CTEA 2WNVC 5BYNA 2EXIA 1IHMA 2QZ3A 3HIFA 2ZGOA 1N1VA 2CWSA 3M3EA 1J58A 3MLJA 2JDZA 3SCFA 1BMV2 1YFUA 2JJ6A 1ZZ7A 2B46X 1VAKA 1LHOA 2R6QA 4CDWC 1SLAA 4MH0E 1OMIA 3A0KA 3VHPA 1SFYA 3MEPA 5JR7B 1AYN2 3M2MA 4YM2A 2VMIA 5GZFA 3FWEA 3POWA 2BQPA 3L9JT 1ENRA 1RMU3 2GSYA 3AXDA 5L7OC 3MFAA 3NV2A 5DUUA 4CEYB 2KA3A 1KS5A 3KT7A 3FMGA 4CEWB 4X8PA 3ZYPA 2O0OA 5FPZA 1BQPA 2HWB2 4GMP0 5KHHA 2Y26A 3QH6A 2VVEA 1YI9A 1NY72 2X5IB 1ULEA 3W58A 1UKGA 3GALA 1LB2A 2R041 3IWZA 3ME2A 4P5HA 2WWSA 1OLRA 1FX5A 1HRI2 4Y1YA 1TME3 3B01A 1SCSA 1IS3A 4CDUC 2ZGPA 2DV9A 1IPKA 3VBOA 4AHZA 2ARXA 3TOJA 2N7GA 4D94A 4YZ2A 2XKPA 4GB31 2RS51 5BNNA 1I6XA 3WW2A 1FMD3 1WW7A 2HWF3 5IUQA 1LJ7A 2R1DA 4EN0A 4QQLA 1CESA 5D8AB 3CU7A 1RHI3 4Y1XA 4YW3A 1ND2C 4R9DA 3AYDA 4QPIC 4GH4B 5I0SA 3RZZA 2D6OX 4P9LA 3T1MA 1HW5A 3LA2A 4E4SA 3ZN5A 1PVXA 3FBYA 2VW0A 1KQRA 2ZGUA 4ORFA 4J1WA 4E4ZA 4QHBA 1TMF3 2EA7A 1LODA 2HKXA 5BPXA 4DNYA 5CBLA 5DUVA 4NVPA 4KH9A 5I91A 4HSJA 3HT2A 3ILFA 4SLIA 4DFSA 2JECA 4OHWA 1MS3A 2WNUA 4X8NA 3ZXJA 1Z7S2 4FPYA 4YVWA 3ZIWA 2D5HA 4A7YA 1HQLA 1ENXA 1RUD2 1AR93 3H1YA 1O4YA 3NV4A 2CGOA 4MGZE 5FTTC 1F8VA 4QGNA 1OQDA 3E5UA 1MACA 5C9AB 1WLWA 4YFZA 1AX0A 3ZFGB 2ZKLA 3QD6A 5ACA2 1G7YA 2A3WA 5GZDA 3URFA 3BPZA 5AC92 2R1BA 2ZZQA 4JDOA 3GZAA 2D98A 4UW4A 3IT8A 3DN7A 4QQOA 3USUB 3MFCA 4FVVA 4C0BA 4Y1VA 3VBFB 3NW4A 4OULA 2XL7A 3WDWA 4JTNA 3R6SA 3VHRA 2NM1A 1QJX3 4ZU4A 1ENQA 1FPN3 3J4UH 1W39A 4FOQA 1G9CA 5IK5A 1L3JA 5KC5A 3AKRA 2D6NA 4Q8KA 1W6NB 2ZGMA 2PHLA 2WS91 5J96B 2VW2A 3Q9OA 4Q8LA 3AYEA 4IERA 1LOAA 1MS1A 1U12A 1WBFA 4AFMA 4YARA 1EAH2 5I8YA 2ZZJA 5DUXA 4QT6A 4QX5A 4XF4A 3VBSA 4N7IA 4Q26A 1LOBA 2NN8A 5A3LA 2WJSA 3AZVA 2ZS6B 3LB9A 1RMU1 2HWE2 3ROUA 5KHIA 4A3XA 1VBE3 1A78A 4IEVA 3B94A 3MF6A 2HEWF 3POSA 1WMEA 3VHNA 4F83A 4N90A 1KDMA 4PIZA 1QJU3 1RUJ2 1LRHA 3VBHA 4COWA 2C1FA 4NWVA 4KL1A 3U4XA 3EXUA 4YYOA 1VRH3 2ERFA 4C1XA 4JRAA 4M00A 4COUA 1O4TA 2DF7A 5BNOB 4YGCA 2FZ2A 1AX1A 3MIDA 3VKFC 2VOWA 5EJ3A 3LKJA 4XMIA 1JBCA 5HCBA 4XETA 1SQ4A 1APNA 3IM0A 3CO2A 1H4HA 1WD3A 4L2NA 4N43A 5GLWA 1HX6A 4LLFA 5JZGC 2BW8A 4M3CA 5CIRA 2WZPP 3WW1A 3ZXFA 4I01A 2ZHLA 4COYA 3N35A 4AI2A 1RUH2 1HXS2 2RJLA 1FMD1 3VN4A 2HWF1 3HD8B 4OLLA 4AYUA 5FDBA 1V9U3 4Z2WA 2VH9A 1RHI1 1S55A 2E7QA 1F5JA 2QKDA 2ZX4A 3GNEA 3UKTA 2BNMA 1KS4A 3AZXA 3E5QA 2WC2A 1R083 2D3PA 2D6PA 3AZWA 4RQPB 2NQYA 1X7NA 3RSJA 2RR12 1ZBE2 1Q5OA 1KXGA 2C0ZA 2IZWA 1TMF1 1CONA 4FXKB 3O7OA 1DQ6A 2HEVF 5K0UB 5T50A 1O5UA 1UCXA 5KHGA 4K8FA 3JUUA 1CAWA 2BNOA 2EAKA 4MUVA 1H9PA 4A7ZA 4DB5A 4XQWA 1GNZA 4L9BA 3BOPA 4QQ2A 1Z78A 3ENRA 2NP0A 1EP0A 1LECA 1AVBA 2XG3A 1AR91 2F4PA 5F9TA 1Y3TA 3VBRA 5C4WB 1V6IA 2PHTA 2YGMA 1Q3EA 2ATFA 1DIWA 4KGGA 4B7KA 2E63A 5JPMB 3OCPA 4KNCA 4HL0A 5T52A 4XF0A 5KXCA 1H1AA 5C8CC 1I1EA 2EIGA 1LTEA 5TSWA 5AFEA 3SXWA 3PLQA 1N3QA 1WLCA 1U5ZA 1PHMA 5EYYA 3B9IA 1O3TA 4AHWA 4IV3B 1QJX1 2YGLA 4MGIE 2E53A 3AYCA 4GMP3 4LBOA 4Y26A 4YW5A 1MZEA 2XLAA 1FPN1 4O9EA 2WFF1 1OSGA 1R1A3 4I3GA 3FZ3A 4H14A 4OVEA 1QJY2 2I2SA 1S0DA 4GXLA 2DUPA 4XTPA 2Z2SB 3AMMA 1AR71 4JTOA 3TAYA 3AZZA 4GKXA 5CFCB 2RJKA 3RJ2X 4DPNA 3S6PA 4B4RA 4Q4Y1 1PGL1 3QCWA 4D69A 4N53C 4AQSA 1B09A 1R093 4FOWA 4AE2A 5BNNC 1JXNA 3RI8A 4WM8C 4EWDA 2ZGQA 2XJRA 4AI1A 3JBG3 3B93A 4Q27A 5I93A 2D6MA 2GH2A 1FOD3 1QF3A 1ND3A 3AKSA 3HR9A 4WVZA 3WW3A 2G9FA 1BCXA 4AWDA 1MS0A 1RINA 4XF1A 2MEV3 1QJU1 3SCHA 3B3QE 3LZZA 1IS6A 1T6GC 3WG4A 4FTSA 1H8TB 3D82A 1NQJA 3U11A 2ZJCA 2ZGLA 4K40A 5E1RA 2UU8A 2HWC2 3FFZA 2WSVA 1U5XA 3DV8A 1N1TA 1IS4A 1YFXA 3CJIA 3FUOA 4FPGA 3WP5A 1LHUA 1U5IA 1RGSA 2B8MA 3A0NA 4PDWA 4DRRA 3QH7A 1K5MA 4WM7C 3DF0A 2XKOA 3NWKA 1ZZBA 4YVWC 1QQP2 1IOAA 2R0FA 1NCQB 1RUI2 3E6BA 2A5ZA 1MQTC 2A6VA 1RUG3 5FBZA 2R072 1D4M3 4IESA 3WZ1A 4RR3C 5JAXA 3N4MA 1AR62 4I30A 3R0RA 3EHKA 1V9U1 4C90A 4Q1PA 4XXAA 4C1WA 1MZ6A 1YYNA 4FXGB 4YGBA 1ALYA 1HDKA 2JE9A 1S2BA 2YUEA 4XPVA 5FO7B 1GZ9A 1NE6A 3AFKA 4OI2A 2DCKA 3LWCA 1IKQA 1W6OA 2ZA9A 4R9BA 1R081 1YJLA 5HI0A 5JIUA 2H6CA 3PMEA 1REFA 1TME2 3S0MA 2GC1A 5K9YA 1PO13 1X82A 1OQEA 5LRRA 4DQAA 1BZWA 2EXKA 4GIQA 1ZM1A 2PHWA 3BODA 3BB6A 2WA4A 2OZJA 4M3CE 1DQ1A 5FLIA 4G9SB 4LO4B 4AEKA 2CTVA 1Q8OA 2WNVB 5DZEA 1DYPA 2VGDA 3KD4A 5L36A 1KD7A 4WVWA 1DZTA 2Y38A 1OOPA 3AMHA 2UWBA 5LRSA 4HETA 3D6EA 2Q5TA 3N3HA 4FPLA 2K0GA 1MEC1 4CDWB 2XVKA 3LCPA 4BMEA 2P3KA 1AR92 2DUOA 1EV13 1QH6A 1CAUB 3I59B 5AFBA 1C1LA 2UWCA 5FQ0A 2Q4SA 3THPA 1X8EA 4OFGA 3AK0A 5EV7A 2CNAA 5L7OB 1U5YA 3E6DA 3CL1A 3TBDA 3S30A 5KXBA 5IK4A 2YMZA 1GBGA 1REEA 1AYM2 3CNAA 5GLTA 2H6BA 4LBQD 2HWD1 4A7KA 2KXLA 2CL2A 1YFYA 4AEDC 4Y20B 5A33A 2FMYA 2BVVA 4BCUA 2A6ZA 5I0UA 4K1ZA 4JDMA 1DZQA 4Z92B 3RI9A 4I2OA 1AXZA 2D3RA 5LK5A 4W6XA 2PQQA 1AL22 3AP6A 5BV6A 3NKTA 1LHWA 2P17A 2RM23 3ZSKA 2VUJA 5CU1A 1R091 3ZXLA 4CDUB 3W59A 2ARBA 3WR0A 1NCRC 2GNDA 3JBG1 3VBUA 5SV8A 3MIEA 1FOD1 3JD73 3S7IA 2VMGA 1G6NA 2Z69A 1QDOA 3O0VA 4RHV1 2QUOA 1AUYA 2MEV1 1ND2B 1LU2A 3IPVB 4MLOA 5BNQA 4QPIB 4H55A 1LOEA 3OGJA 1MZFA 1RB8G 2ZX1A 4CYDA 3NVCA 3J8F2 4Y4YA 1AF9A 4ZXKA 4Q4V2 1UW8A 1H2NA 2ETEA 3AP7A 1GYKA 5D1IA 4OUMA 3TN93 2ZMKA 4YM3A 4JGYA 1O91A 2V73A 4CP0A 1DQ5A 4OHZA 3WHUA 4HLTA 5CFDC 2HYKA 2B45X 1H4GA 1B35C 1TQ5A 1VAVA 1XU1A 4FBFA 1RJ8A 1VBE2 1RUG1 3D5OA 3VBRC 4WV8A 3MLLA 1D4M1 3FLRA 3EO6A 5HCAA 1XQNA 4M3CF 4AXOA 2RMU3 4M0HA 4YG0A 3WXPA 3USSA 4AG4A 2WFPA 4DRVA 1OA2A 2HEYF 4FOYA 2F6BA 2P37A 1VRH2 1QMJA 1PZ7A 2ZACA 5FOBB 2OUHA 2XUMA 2Y0IA 2A3XA 4XMAA 4R4ZA 1PO11 2CAUA 2WSUA 1C5IA 5T5LA 1CD3G 4TZDA 1QXPA 1CIWA 1WCSA 5T5JA 4R4XA 4LTAA 4P9IA 1ONAA 3KSCA 3PVOA 4QPGA 4HK9A 4L99A 4XHBA 4JRLA 3ALQA 2ZX2A 5J7MA 3BCWA 1RUC3 2DURA 1I3HA 1NLRA 4I0BA 4AHYA 3POYA 3OF1A 3GYDA 4UXAA 4XF3A 3VZOA 2ZKNA 1GICA 1EV11 1O7FA 4Y5Z0 1ZRFA 2XGXA 4ZKTB 4CEYA 2FMDA 3BU7A 4QD2A 4AQTA 4CEWA 4HVQA 3IMNA 1MR5A 4DMIA 3I54A 1WA4A 2X5IA 2OW4A 2XJSA 2TEPA 4AQ2A 2X8KA 3ZSLA 2PHFA 1RVF2 2VU9A 1PO21 1LENA 1NA1C 4TSVA 2WS93 1C1FA 2BWCA 4B4PA 4I3PA 2VNGA 3MGUA 4QU2A 4EN9B 4I0AA 2BVBA 4QXKA 5IK7A 1CPNA 2R062 3WY6A 1ASJ3 1PGW2 2ZHKA 1VBD3 4K3UA 3M3OA 4PDWC 3AX4A 4Q4X3 2Q30A 3R4UA 4Y22B 1A3KA 3SNMA 2RS33 2RM21 3MW4A 1WUVA 2VOKA 3GZTB 5FRAA 1SEFA 5IT6A 1OQ1A 1W6MA 4JC1A 5D8AA 1VBA3 3ZXAC 5JZGB 4URTA 1CR7A 2XJPA 1D4VB 3KCCA 3OD4A 2QCSB 2UYBA 3JD71 2P3IA 3CLPA 4AEJA 1F31A 4IV1C 4Q2FA 2VPVA 3ILNA 3U07A 1R1A2 3FX3A 4P9XA 5GLZA 2ENRA 2OYZA 4YVSC 3U10A 2E7TA 1DU3D 4P14A 3OBRA