3CJIB

Structure of seneca valley virus-001
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
238
structure length
238
Chain Sequence
b'GPIPTAPRENSLMFLSTLPDDTVPAYGNVRTPPVNYLPGEITDLLQLARIPTLMAFERVPEPVPASDTYVPYVAVPTQFDDRPLISFPITLSDPVYQNTLVGAISSNFANYRGCIQITLTFCGPMMARGKFLLSYSPPNGTQPQTLSEAMQCTYSIWDIGLNSSWTFVVPYISPSDYRETRAITNSVYSADGWFSLHKLTKITLPPDCPQSPCILFFASAGEDYTLRLPVDCNPSYVF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polyprotein
publication title Structure of Seneca Valley Virus-001: an oncolytic picornavirus representing a new genus
pubmed doi rcsb
molecule tags Virus
total genus 44
structure length 238
sequence length 238
ec nomenclature
pdb deposition date 2008-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3cjiB00
2WS93 2WZR2 1RUH2 1QQP3 3VBRB 4GB31 1NA1B 2HWE3 1RUD2 2MEV3 1ZBA3 1AR92 1QJZA 1F2NA 1PGW2 1PO22 2BFUL 1HXS3 1VBC2 4RS5B 3VBFB 4WM7A 3VBSA 2QQPA 1ND2B 1RUC3 4AEDA 1SMVA 2RMU3 4N43B 1RVF3 4QPGC 5ACA3 1HRI1 4Y5Z0 1TME2 3VBRC 5FOJB 1NA1C 1VAKA 5FMOS 2PLV3 4Q4V1 3VBHA 4Z92B 1V9U2 3VBOA 4SBVA 5LK7B 4IV1C 1AL22 4NWVA 1FOD3 4RHV3 4WM8B 1F8VA 1OOPC 5L7OA 1EV12 1FPN3 1ND2C 3VDDC 1X36A 3M8LA 4N43C 4YVWC 3DPRA 3JD73 1DDLA 4CDXA 2WFF3 1C8M3 1R1A3 4N53C 4CDQB 5DDJ3 5BNOB 5K0UB 2WZR3 1QJU1 1RUH3 2XBO1 1HRI2 1POV3 4JGZB 1RUG1 4RQPB 1AR93 2FZ2A 1COV1 3TN93 1PO23 2RM22 1E57A 4WM8C 1QQP2 1VBC3 5ABJB 4GMP1 2HWD3 4CDWB 1K5MB 4QPGA 2R071 4BCUA 5BNOC 4IV3B 1TME3 1VB2A 4GH4B 3VBRA 1NA1A 2RMU2 4FSJA 4Q4Y1 2BFUS 2RS53 4JGZC 1MQTB 4RQPC 5AC91 5BNNB 2XBO2 1H8TB 4IV1A 1AYM1 1RUI1 1OOPA 5BNPB 1RUG2 1ND2A 2Y26A 3VDDA 1COV2 4N43A 4YVWA 1QJX1 1AUYA 2VQ0A 4CDWC 2BPA2 3S6PA 1X33A 1FOD2 1RHI1 4N53A 4CDUB 2X5IB 4GH4C 3ZFFC 2R072 3J8F1 1R091 3JD72 1HRV1 4JGYB 4NWWA 1HRI3 2WFF2 1A6CA 1R1A2 2ZTNA 5BNNC 3JBG1 1H8TC 1NY71 5CFCB 2BUKA 2RM23 4WM8A 4CEYB 5BNPC 2RS11 1PO11 4Q4V3 3VBUC 3ZFGB 1TMF1 1R081 1AYM2 1EAH1 1RUI2 4LLFA 5A33B 3TN92 5BNOA 3IDEA 2X5IC 4JGYC 1RHI2 2HWD2 4QPIC 2R041 4JGZA 1ND3B 4RQPA 1B35B 4CEWB 1R092 2HWB1 2XBO3 2HWC1 5J96B 5C4WB 1RUG3 3LOBA 1NY72 2RS52 3CJIB 1BMV1 2GSYA 1COV3 2WWSA 4CDWA 4GB32 2R061 1PO12 4RS5C 3ZXAC 5C8CB 5GKAC 2FZ1A 1TMF2 1R082 3VBFC 3ZFEB 5D8AB 4GMP3 1RUF1 1NCQB 1QJY1 4GH4A 3ZFFA 2R073 4EJRA 1PVC1 5A32B 2DF7A 1B35C 4CEWC 5BNNA 1ASJ1 2HWF1 1H8TA 1OHFA 2TBVA 3NAPB 4Q4Y3 1VBD1 5C4WC 5BNPA 3CJIC 1RMU1 2HWB2 3VBUA 1AYM3 5C9AB 2XPJA 1RUI3 5C8CC 1Z7S1 1AR81 5D8AC 1BMV2 4CDUA 2X5IA 2BBVA 4Q4V2 3JB4C 1QJX3 2RS31 1HQNA 4JGYA 1RHI3 4FTBA 1VBE1 4QPIA 1QJY2 4AEDB 4CDQC 5CFDB 3J8F3 5K0UC 1R093 2GH8A 1PVC2 1RUE1 3JB8A 1HRV3 1VBA1 1AR61 3JBG3 1ASJ2 2HWF2 1RUJ1 4YVSB 5C9AC 1VBD2 5A33A 1QJU2 3FBMA 4GB33 2RS13 1RMU2 4RS5A 1PO13 3VBHB 3VBFA 1TMF3 1R083 3VBOB 1D4M1 5ABJC 4Q4X1 1Z7S2 5L7OB 1AYN1 1K5MC 5CFDC 1VBB1 1B35A 4CEWA 2RS32 3DPRB 1PIV1 4IV3C 2RR11 1VBE2 1RUD1 5C4WA 3CJIA 4YVSC 1MQTC 2WLPA 1AR91 2HWB3 1RUE2 2HWC3 1VBA2 1NCRB 5C8CA 4Q4Y2 1AR62 3HAGA 5D8AA 1BEV1 5AC92 1ZBE1 2R063 1M06G 2ZZQA 1D4M2 5A32A 4FTSA 1CD3G 1QJY3 4CDQA 1FMD1 4CDUC 3NAPA 5K0UA 1QJX2 1AR71 1AYN2 4QPGB 1PVC3 1BBT1 1PIV2 1ASJ3 2HWF3 4Q4W1 1V9U1 2RR12 5C9AA 1MEC1 1PGL1 3J8F2 1NCRC 1VBD3 5CFCC 1AL21 1QJU3 1HRV2 4RR3B 4CEYC 1EV11 1RMU3 3JBG2 1POV0 5ABJA 3ZFGC 4IV1B 1Z7S3 1OOPB 1AR83 4Y4YA 4FTEA 1K5MA 4PDWB 1BEV2 2RS12 3VDDB 5CFDA 1ZBE2 4YVWB 2RS33 1EAH2 4IV3A 2IZWA 2ZAHA 1IHMA 1VBE3 1CJDA 4N53B 1VRH1 1FMD2 4YVSA 1MQTA 1ND3C 1AR72 1RUE3 2WS91 2RM21 4RR3C 1QQP1 1VBA3 5JZGB 1C8NA 1BBT2 1AR63 2HWE1 2R042 1RUJ3 4Q4W2 2MEV1 1ZBA1 1MEC2 1PGL2 1WCDJ 5AC93 1NG0A 2HWC2 4PDWC 5J98B 1HXS1 1D4M3 3ZFEC 1RUC1 4Q4X3 1NCQC 1AL0G 2RMU1 1RB8G 1AYN3 2R062 1RVF1 1VBB3 1W39A 4WM7B 3VBSB 1RUF2 1PIV3 5ACA1 2RR13 1RUD3 1OPOA 3NAPC 1NCRA 5JZGC 1VRH2 5CFCA 4CEYA 2PLV1 1VB4A 2WS92 3ZFGA 2HWE2 2MEV2 1ZBA2 1FOD1 4RHV1 1BEV3 1FPN1 1ZBE3 5FMOL 1EAH3 1HXS2 3JD71 4WM7C 3VBSC 2WFF1 1AR82 1C8M1 1R1A1 1FMD3 1RUC2 5DDJ1 3ZFFB 4AEDC 1ND3A 1AR73 1RVF2 2WZR1 1RUH1 4RR3A 4CDXB 1BBT3 5ACA2 1POV1 2R043 4Q4W3 1V9U3 1MEC3 1AL23 3TN91 1PGW1 1EV13 1PO21 4PDWA 2PLV2 1VBC1 3VBUB 3VBHC 1NOVA 3ZFEA 1RUJ2 3VBOC 1NCQA 4RHV2 2HWD1 5L7OC 1FPN2 1RUF3 3DPRC 1TME1 4Q4X2 4GMP0 4CDXC 5JZGA 1GFF2 1C8M2 1VRH3 4QPIB 5DDJ2 1HX6A 4RFT0 1VBB2 2RS51
chains in the Genus database with same CATH superfamily
4XFFA 4R9DA 4XW3A 2D6LX 3OGRA 1VMJA 1DGRN 3WCRA 1JOJA 3H3ZA 3VBRB 5A70A 5A6QA 3VHOA 1X50A 3KLSA 2Z69A 1Q8SA 2KA3A 4AQSA 5JAXA 1AR92 3AYEA 3LCPA 4MXWA 1PO22 4XUPA 2FDJA 2W52A 4CPBA 2IXIA 5IUQA 2FMYA 1FV3A 2QQPA 1YNAA 5A7NA 1XRUA 4XFIA 1N3OA 3THPA 1S2KA 1SMVA 2CDOA 1QDCA 4UW5A 5L9BA 1Y7BA 4A7YA 5J3UA 5FCCA 5FV3A 2W94A 1F35A 1U12A 4YGCA 4PBOA 1SBDA 4JRAA 4LKSA 3IMMA 4YGBA 4BMEA 4YZ2A 4LIVA 3FJSA 2UWAA 4A4AA 3CIHA 4Y5Z0 1TME2 1QU0A 2WAOA 4BWOA 4P9XA 3VDAA 5FY4A 3D0SA 1LOAA 2D6PA 1UOGA 2ZGMA 4OHVA 3S57A 2J1RA 4RYDA 3HMYA 2BP6A 3VBHA 3ZIXA 3ACLA 1V9U2 1YC61 4SBVA 3M7AA 4JC1A 1OD5A 1S1AA 3BI3A 1ZVFA 5JOXA 1DFQA 1DLLA 5C71A 1UZZA 4IEZA 1OOPC 1GR3A 3WF1A 5JOWA 3NJYA 1UZYA 5GLZA 5IT6A 4ARXA 1X7NA 4DXZA 2WR9A 1LOCA 1NUKA 4QQ2A 4XUOA 1UY3A 1C8M3 1R1A3 2WFF3 4RGKA 4Z2WA 5F8PA 4K8FA 4CDQB 3ZYIB 4A3XA 4JHTA 5BNOB 4NROA 3H42B 5FKBA 3MV11 1YI7A 2Y6JA 1QJU1 2XH6A 1U5IA 1CQ9A 2WO3A 1E5SA 4DEVA 3A21A 3BVCA 1KDMA 4QT6A 4TWTA 4DXRA 1H2MA 4HK8A 3T0DA 5JXIA 4XC9A 5E8AA 4NHKA 1GNYA 1AR93 2OIIA 4Q29A 4HVQA 5FYVA 1WCSA 2EICA 1PO23 3VKNA 4PJYA 1GP6A 2A71A 4ASKA 3I3DA 3ZVXA 2Y0OA 2BZDA 4LHNA 5CVRA 5LA2A 3NQHA 5DAVA 3BODA 1GSLA 5AFEA 3ILRA 3NVCA 4UFHA 1AVBA 1GNZA 1PZ8A 2JG9B 3GYDA 1N1TA 4DRVA 1ZYBA 4OHZA 2DU1A 1SCSA 1JZ7A 4LE4A 5APAA 4H14A 4XETA 4AQ2A 4NIGA 5JI9A 2V09A 4HPKB 1TME3 1VB2A 2XHNA 4FSJA 2LM3A 3VHPA 1LAJA 2Y8KA 2RS53 3PTRB 1MQTB 2EIGA 2G1MA 4M0NA 4RQPC 1KFUL 2ARXA 4Y22B 5AC91 4WVZA 3LEMA 1WD4A 3OY8A 4GZ9A 4NVPA 4ZU5A 1HB4A 5FK8A 4WZCA 1OQDA 3AYDA 2VR4A 1XQNA 2VXJA 2A1XA 5JIAA 3WD5A 1OOPA 2D43A 2Y33A 4Y1YA 5BNPB 2VCBA 3UNPA 2VNOA 3EJKA 3ETQA 2XVGA 4IL7A 2VOWA 1OA3A 2OZJA 4QHBA 1VMFA 4W6XA 1WCQA 4YGDA 2WNVB 4A45A 2VVDA 5HI0A 1SBEA 3BGAA 3O1UA 2LTNA 1FOD2 4JQRA 2YFUA 3KF3A 4QAWA 3TAYA 1NLRA 3OGJA 4D6RA 3NWKA 3TEWA 4MXVA 2ET7A 2QVSB 3ZFFC 2ZOEB 4YFZA 1ZREA 5F32A 2YY1A 1MS4A 2OS2A 3JD72 3JZVA 2DVAA 3ME2A 4JGYB 5JXHA 1RUNA 4CU7A 4CU9A 3U4XA 3DN7A 4BISA 4I09A 2C26A 4ARYA 2W2IA 2H0VA 4I02A 4ZY9A 2BUKA 5IFPA 5SV5A 4CCKA 4DZGA 4E4SA 4O7XA 4Z8BA 5FPZA 1XXNA 4S2DA 1F4AA 1PK6C 5KXCA 1O4TA 3ZFGB 2ZHNA 3NJXA 3WHUA 2ZEZA 4V2WA 2YC0A 1EAH1 1KITA 3L2HA 2GMMA 4CA9A 4LLFA 2QUOA 3NJZA 4FBFA 1WMDA 2YZ4A 3TN92 4KGGA 3HQUA 2WYSA 5C3QA 2DFCA 3K4ZA 2X5IC 2XJPA 3ZDVA 3BPZA 1JW6A 1QNYA 1S0DA 3O0WA 2EVXA 4GAZA 3RMYA 2EAKA 3H8UA 1OT5A 2H6BA 4Q27A 4M4PA 4XXPA 3A0KA 3N35A 1UKGA 1C1FA 4RQPA 5EXOA 3C2UA 3E6BA 3MF6A 4XF9A 4YZ3A 3RMXA 5JMCA 2B9VA 2K2SA 4MGTA 2AGSA 3KHBA 5EJ3A 5FZGA 4GULA 3WQ7A 1HDKA 3HNYM 3OBRA 4DXSA 1DGWX 5JOZA 4UFJA 5FLIA 3KHCA 2GSYA 2JJ6A 3SEPA 3AJZA 5AVPA 2O8QA 4OCTA 3GDBA 1XYPA 4FP3A 4XJWA 2YFZA 5I0UA 3IAQA 3ZXAC 2PHRA 2FZ1A 4MOAA 2GALA 5GKAC 1YQCA 2EAAA 3OJBA 2J1AA 4BK4A 1NCQB 4HETA 4P08A 2GC3A 4XE9A 4DS0A 3ZFFA 4IE4A 2CWMA 1Q8VA 2ADDA 4JDNA 1SDWA 4TYSA 4Z82A 3RWNA 1ALYA 2NZ9A 3QLQA 3SITA 2VZTA 4MX3A 5LA9A 4MGIE 3CL1A 3KGZA 3B93A 1B35C 3AP4A 3W5MA 5FZOB 4B1LA 1V6NA 3PMEA 1D0GA 5C4WC 4D94A 3THDA 2GC0A 1PK6A 1RMU1 3KB5A 3R4SA 5SV8A 1YIPA 3CZUA 4AGRA 4DIQA 2YC4A 1YUDA 1DF0A 2XPJA 1F15A 1W04A 5L19A 3CBNA 1HQWA 3I59A 3O7OA 4Y26A 3H3UA 4HVOA 4BIOA 3I7DA 2E33A 3B9CA 2X5IA 1S0GA 2BYVE 2ARBA 1PZ7A 4Q4V2 3I3MA 2EXKA 2Y6LA 4LBJA 3HBZA 1JS9A 2EXJA 2VMDA 3WW3A 5K8SA 3LAGA 1KD7A 2OA2A 3IKWA 1BYHA 4NHLA 4FPOB 2BOJA 3ZYFA 4JKKA 4AEDB 1IZ3A 3HR9A 2Y60A 4CDQC 5CFDB 4UFKA 4PI0A 2GH8A 4GJZA 4LBMA 1OLME 2LRPA 3FFZA 4HXCA 4B29A 1HLCA 4LKDA 1CWPA 4UYBA 5FK7A 4BPZA 1W9SA 2ERFA 4LHSA 5C9AC 3QBQA 1FNZA 5DZEA 3FBMA 3MZHA 3Q8AA 3DL3A 2A6ZA 1RMU2 1S0JA 5JWPA 3RQ0A 3A7QA 3IZOA 4PF1A 1RC6A 1ULGA 3Q8CA 1IKQA 1CZVA 1XYOA 4QB6A 3VD5A 1KFXL 3ZXKA 3RZKA 1MS9A 4IUGA 4IESA 2IXJA 2WNUC 4XAEA 2JG9C 1H9PA 5FZ9A 1O3QA 2RE9A 4M3CE 4AHYA 4E4DX 1SACA 1F5FA 1CESA 2BOIA 1GLHA 3J7MA 1AZDA 1B35A 1US3A 3EYPA 3I2IA 1OF3A 2J1EA 5IWFA 2R1DA 2J1SA 1W03A 3VKLA 2RR11 3TRSB 1U5YA 2P6HA 3ZO0B 2V72A 5I93A 5C4WA 3EMRA 4QM8A 5EHDA 3URFA 3SNMA 4UT5A 1MQTC 2A7AA 2AR6A 2I45A 2VNRA 2WLPA 3J7HA 4XBQA 2OKXA 1IS5A 5IVVA 1JZ8A 2XJTA 5T52A 2FD8A 4ZZ5A 4JCKA 1EY2A 5FP9A 1NCRB 4MV2A 4OHWA 1N1SA 1QH7A 3LPGA 3KM5A 5FZ3A 4LXLA 2OYZA 2YB7A 3WVJA 1WZXA 1TG7A 3ACIA 1D7PM 3M3QA 4RSUA 4KG8A 2WNVC 3T3YA 4BB3A 1JU4A 4CXWA 4NIDA 3IM0A 1QH6A 3AKPA 1CD3G 4G9SB 1UL9A 4CDQA 1V6IA 1K12A 3FMGA 2ORXA 3N9QA 3NAPA 1ENXA 5H9RA 1JZ3A 1AR71 1XNBA 2OUHA 5KXEA 5A1AA 5BY5A 4FXKB 4UF0B 3CLPA 4OQ9A 1PNGA 4V2VA 4CP9B 1Y9GA 1PX4A 2RR12 4E4HA 5C9AA 4FAGA 1MEC1 3OBAA 5CEHA 3MIGA 2VQTA 1EV11 1RMU3 4AGGA 1UYPA 3WDTA 2RVAA 4Y1XA 5LA0A 3KCCA 1SG3A 2P1BA 3BB6A 1POV0 2YYOA 3CU7A 3ZFGC 1S2BA 2JWPA 3BU7A 4X6QB 3N9PA 1NLSA 5FQ0B 1UNBA 3DEMA 2WNUA 2JG9A 1X9PA 4HANA 4Y4YA 3ZXLA 2XOMA 3MFCA 2ZX0A 4UXAA 1TEIA 5LATA 4E2GA 2PYTA 3QACA 3VDDB 5ERLA 2RJLA 4IERA 1C28A 4OMDA 4YVWB 4BLIA 1UQXA 2VM9A 2Q1MA 5EYYA 4F8AA 4MLOA 3P3PA 1GANA 2P3YA 2KM2A 1FX5A 4LE3A 1VRH1 1JBCA 1MQTA 3HJRA 1AR72 3WNXA 2WS91 1AJOA 4Y20B 4TN7A 4RR3C 2VAUA 3GM8A 3NMBA 4BDVB 2VNGA 5FO9B 1PHMA 2HWE1 1KGYA 3U0ZA 1AXKA 4HKWA 2JDPA 1O3SA 4AYUA 1MEC2 1UKRA 1ZZ7A 3VDCA 3PJQA 1XB9A 2HWC2 4XCAA 4Z2AA 1X82A 2C0ZA 2WNVA 4K1ZA 3AJYA 4PDWC 1ZRIA 1HXS1 4NMIA 1ZZ8A 4P9YA 4X8PA 5FZAA 4NHYA 3WHTA 4XTMA 4FOQA 5CZKA 2QQWA 4LUKA 4S2FA 5DUWA 3T1MA 2WC2A 1NCQC 1FV2A 3ZPYA 2IWGB 1AL0G 2RMU1 1RB8G 4PLOA 3I49A 4FPYA 2R062 3AP9A 4BHPA 4MGKE 1TZOA 2UYBA 4COZA 2ZJCA 1RUF2 3RJRA 4HMZA 4U2AA 5ACA1 3O1VA 1BLZA 4TLFA 1RINA 1W2AX 3OSDA 2RR13 3B3QE 3UV9A 2P3JA 3ZPOA 1APNA 2F17A 1OPOA 1VRH2 1W6QA 4IGPA 3W20A 3PVOA 5IK7A 4YW5A 4IEWA 3RFRA 1W3VA 1JZ4A 2AC1A 2Z42A 4ATFA 2PLV1 1O5LA 2WS92 2XQXA 2DU0A 4CCNA 3T0AA 3ZFGA 4YGEA 4F7ZA 1RL3A 2HWE2 3WW4A 2VVFA 3ZKUA 2A75A 1LOEA 2QQLA 2P37A 2WWUA 4YG3A 2I2SA 1O4YA 4YG6A 1MS1A 3ZX7A 4A6OA 3WZ1A 4D6QA 4A6SA 4F3JA 4CP0A 2OXBA 1XJAA 1IPSA 1HXS2 1GZTA 2XKOA 5IVEA 1WW7A 5LBFA 4RA0A 4IGQA 2YPDA 4AEDC 5F6LB 4QWNA 1AR73 1OFNA 4MGZE 2CAVA 3P6BA 5A6ZA 1V00A 3OTFA 1LJ7A 1RUH1 4RR3A 4CCDA 1GOGA 1H2KA 1UF2C 2AACA 4H7LA 3N7JA 4OZXA 4PIXA 4QU1A 2WNOA 1POV1 3LSDA 4Q0VA 5ACA2 2RDRA 5F9TA 3AFKA 1MEC3 2W68A 3KV6A 2F4LA 3AMPA 5DZGA 3V64A 1PGW1 1EV13 4LO6B 5LCWL 1A8DA 4PDWA 4L2NA 2PLV2 1VBC1 2W47A 5LBCA 3UKNA 4ET7A 1K42A 1NOVA 1RUJ2 4F83A 1X8MA 3WEZA 4AFCA 1OA4A 2Z5WA 1NCQA 3RSJA 1O6UA 1EUUA 4KU8A 5FXWA 2JE8A 4QPYA 3WX5A 2JXAA 5HCHA 3I3QA 1F4HA 4PIZA 1RUF3 4Y33A 3ZXFA 2JX9A 4KQ7A 4W8JA 3MIHA 2WBKA 1FAYA 2Q1ZB 3N7LA 1FT9A 1U0AA 3IIIA 1JZ2A 1VRH3 4QPIB 2DCKA 1B09A 2DUPA 3P1IA 4FQ4A 1REDA 5DABA 1HX6A 2JDAA 4P9GA 4RFT0 2FCVA 1VBB2 2XWBB 3U14A 1HN0A 5JSRA 2WS93 1ULDA 1RUH2 4GB31 2HWE3 4UFMA 1RUD2 2DTYA 1IQAA 1E5HA 3KVAA 2XLGA 3ES1A 4NJ4A 4CVUA 4OUEA 3I2OA 1UU4A 3MUZ1 4HONA 4CXYA 3OY8B 1PGW2 3RI9A 2GN3A 1HXS3 1VBC2 4RS5B 2ZX4A 2I07B 3VBFB 4QDSA 3AP7A 1BZWA 2ZA9A 4X6RB 3KSCA 5FJKA 4YW2A 5FZIA 3I97A 4AEDA 2RMU3 1Y3TA 1XNAA 5FXVA 1GQPA 4GWIA 4NHXA 5FZFA 3WP3A 1V70A 3TWIA 1ST8A 3NV1A 3PHMA 5ACA3 1HRI1 3W59A 2W92A 1XU2A 1NA1C 4DNYA 4YLZA 2ZGKA 3ENRA 3WDWA 1OPMA 4QHOA 1CZSA 2PLV3 3R05A 4PT6A 4Z92B 4XF0A 1URXA 4BH9A 3D6EA 2ATFA 3EBRA 4IE5A 2VMHA 4HLTA 4M00A 2EXIA 5T55A 2E31A 3VDDC 1X36A 1WBLA 1N3QA 3P3NA 4N43C 4N90A 4XJAA 4YVWC 5FYHA 1DDLA 5ANNA 4MZUA 5GM0A 3W21A 5A7QA 2Q4SA 1BVVA 2WT1A 4NAOA 2VTXA 5I8YA 2B46X 3HN3A 4Y3OA 1EPZA 1RUH3 2NMNA 3GF6A 3U37A 3W58A 1HRI2 1POV3 3MI8A 5F5IA 1TVGA 1NLQA 2PTMA 4LBLA 4AI8A 2TUNA 1JN2P 3OD4A 4Q2FA 2VOVA 4RQPB 2VVEA 4LBKA 4Y1ZA 4A7KA 5BPXA 3VD4A 1COV1 4CCMA 2RM22 3PIJA 4WM8C 4Q0UA 3NJVA 1SFNA 1VBC3 4XF3A 4XQDA 4CU6A 1DP0A 4M3CF 4IE0A 4B1MA 1H0BA 5GJ6A 4ATEA 5CYYA 2AREA 2Z79A 3IWZA 1DBNA 4YM3A 5DG2A 1UMIA 2R0FA 4W6WA 4KL1A 1WWYA 1K5MB 3I2HA 2R071 2PAMA 3NKGA 3OPTA 3K4AA 1AF9A 2QJVA 2IXCA 2Y38A 4AEMA 3LZZA 4CP9A 1MS5A 4LPLA 3FLTA 1NA1A 4IEPA 4BQ4A 2HEYF 4Q4Y1 2Y0IA 3EHKA 2BFUS 4JGZC 3ZDSA 4MADA 4Q26A 3HEIA 2QZ2A 3S5QA 3USUA 1O3RA 5B4XA 3QH6A 2JE7A 3SLIA 2HEVF 5H9SA 1RUI1 3GXUA 1JTZX 4ASLA 3VHRA 2IFRA 1AX1A 1G9AA 1XNDA 3KV4A 2PHUA 3POSA 3SQOA 3VDDA 1COV2 4G4FA 4N43A 4O9EA 4YVWA 5CKNA 1VJ2A 5F37A 4S2HA 3RPQA 4CU8A 4I0BA 3HBKA 1Q56A 4J25A 4XHXA 5CNAA 5FZLA 3VKFC 4P00B 3CZJA 4E9KA 3VN4A 2VTFA 1YQ5A 2X5IB 3ZMNA 1QXPA 3U07A 2R072 3J8F1 1UCXA 4HBNA 5DAPA 3WQ1A 1HRV1 3GNEA 3AK0A 4N8MA 4NWWA 1HRI3 2B39A 1ZA7A 1R1A2 2WFF2 5E89A 4CRQA 2ZTNA 3C7FA 4BIFA 5BNNC 2R1BA 3TEXA 3BTYA 4JX0A 3G7DA 3J7NA 3EO6A 3MBWA 5CFCB 2R16A 4UBHA 2RM23 4WM8A 3RZHA 4K9SA 4K7JA 1EP0A 2RS11 1N1VA 1NZIA 1ZX5A 2MHFA 5FPVA 3WP4A 1UX6A 2YMZA 2JDHA 3SXWA 3E1F1 1RUI2 4IEUA 5T3NA 2IXHA 3WV6A 4AF9A 2RHPA 4G3YC 5H9PA 3D82A 1BVP1 1H2NA 4QMAA 4ZXKA 1BHGA 1L3JA 3SEEA 4P5HA 4XZPA 4JKLA 5FY5A 2E63A 4NPMA 2FDIA 4YYOA 1XE8A 4L8QA 4LR4A 5D21A 3WDVA 4AI3A 4OUMA 3ZYRA 4QPIC 4YZ1A 3NKTA 1WLTA 1SFPA 2VL4A 2ZS6B 3OGVA 4JGZA 5A80A 1YFYA 1B35B 3DYPA 4LMFA 4YW6A 2R0HA 4AWDA 3KVBA 5DQ0A 1IS3A 3ZXDA 5J96B 2GNMA 1C1LA 1XNKA 3GJBA 4EV0A 2QQOA 5C4WB 2WN3A 3AP5A 2RS52 5FBJA 1HN1A 4JV4A 4ZU7A 1COV3 2BGOA 2W91A 5FP8A 3F95A 4DINB 4XFBA 1OH4A 2WWSA 3PUIA 1D2QA 2JD4A 4HG6B 4RS5C 4XPVA 1OH3A 2WLQA 4TLGA 1OXCA 3POFA 3VBFC 4XVHA 2C9AA 3T2OA 5JLVA 2NQYA 3BU0A 1JXNA 5FIXA 3ZMOA 1N3PA 1YQ2A 2UURA 3H1WA 1AHSA 5LBEA 4GALA 5J09A 1FATA 1CPNA 2R073 2VQAA 4RGGA 4EJRA 3D5OA 4NAMA 1STMA 2ZGTA 3VDBA 4HL0A 3LD8A 3MW4A 2PAKA 2DF7A 2N7GA 4CEWC 5BNNA 2JDUA 4PLMA 3LE0A 3NAPB 3SKVA 4Q4Y3 2CL2A 2WYFA 4KBBA 1YEWA 4FOVA 1DYPA 1NX9A 2W1WA 4LLOA 5FAXA 5CADA 5DAQA 3LGRA 4ES8A 4GWJA 3L2YA 3OPWA 3SCGA 4FO9A 5C9AB 1RUI3 4QGLA 3TOJA 2LS6A 5DXDA 5C8CC 5EYXA 4AQTA 4Q0QA 1AR81 4XUQA 5D8AC 1TNFA 5DN2A 1JYVA 4ORFA 2BBVA 1DQ5A 3OB8A 4XAAA 4OI0A 2QBXA 2BGPA 1V6MA 4A7ZA 2UWBA 2WNUB 3N36A 2BEOA 4YARA 1E5IA 2R32A 1LGBA 4QPIA 1GUIA 5DAWA 4IGOA 4LQRA 4PF5A 4ISRA 5T54A 2OT7A 2YU2A 4KGQA 3UGFA 3VB9A 5FZKA 4OHYA 3J8F3 1U5ZA 2O0OA 3H3LA 3JB8A 1RUE1 3QH7A 1HRV3 1W9WA 4MGSA 1HV1A 3TNPB 4P9JA 1XYNA 1UU6A 3V0BB 2K9ZA 5L9VA 3RWKX 4P5YA 3AKTA 1AR61 5A3LA 3LDRA 4BXSV 3PVBB 3BN6A 3LF7A 1QJU2 2PN5A 5FR3A 3WF3A 1LEMA 5FWJA 2RS13 1MR5A 4RS5A 2DUQA 3VBFA 1PMHX 1L7QA 1D4M1 1MZ5A 5I0TA 4WBBA 1LECA 2JB4A 3E5QA 4EN6B 3THTA 4KU7A 3H8XA 2Q30A 5J37A 3S30A 1YO8A 1W06A 2ZHKA 3SCHA 1AYN1 1K5MC 2V4VA 5FMDA 2JECA 5JOYA 4YWAA 3FZ3A 1YI9A 3CMGA 3K2OA 4ISQA 4CEWA 1J3RA 2E26A 2LALA 2JB8A 2WO1A 3LDBA 3LDKA 1GP5A 3RZMA 4DY5A 1C5IA 4JTOA 4MSVA 4QX7A 4WVMA 4Y5SA 3O1SA 1Y9QA 1LHWA 1LHUA 4XABA 4YVSC 4AVAA 4XTPA 1Z0HA 1RUE2 2YV8A 4HK9A 5J1XA 3IPVA 3FBYA 5A7WB 1RJ8A 5C8CA 1W6QB 1AR62 3GZUC 4K20A 2XJVA 3SKJE 2WT0A 3MO4A 4B4QA 4EWEA 5D8AA 1W8OA 2JE9A 3R0RA 1BEV1 5AC92 5FPAA 4TXWA 4DUXA 4QQPA 5K4LA 2YBSA 1EUTA 4COWA 1M06G 2ZZQA 3I2KA 3UKTA 1H2LA 2AENA 4AOCA 2GP5A 1D4M2 2DWRA 3D3AA 5K7PA 3DKWA 1ZRDA 4FTSA 5GLUA 2H6CA 3POBA 4PHZA 3T2QA 5IFTA 1XSQA 2LUWA 4UOJA 1AYN2 2XQRA 4R52A 1RTVA 4I2OA 1H9WA 4ZS2A 1J3QA 1WUVA 2GC1A 5GLTA 1J83A 3LFIA 3NNJA 3H1YA 5A7SA 5FZMA 4JQTA 3WLUA 4BYYA 3FLRA 5CFCC 1AL21 1AXZA 1QJU3 3AMQA 5AVAA 2DYCA 4RR3B 1DHKB 1SZBA 2VULA 3IDAA 1W8UA 2QQUA 2X05A 3B9IA 1OD3A 2GMEA 4CCOA 3MLLA 3B5LB 2WN2A 5JI7A 1YQ8A 2YBPA 3BOWA 5HBAA 1OURA 1AR83 3POIA 1K5MA 4PDWB 1BEV2 5FYCA 2RDNA 2J7MA 5FZDA 2WDBA 2VZ3A 5F2SA 3IDCB 1EAH2 1F31A 1R1ZA 2ZAHA 2C5DA 4XF1A 4B7KA 1VMHA 3PMSA 1UZVA 5F5QA 4N53B 2OQ7A 4M0HA 3ABZA 4D0QA 3UGHA 4YVSA 5GZEA 4QXCA 3ASIA 5DUXA 1LU2A 1RUE3 3GALA 3ST7A 4FFGA 1QQP1 2QKDA 5IVBA 5JCTA 3O1MA 1UPIA 1C8NA 1AR63 2DV9A 3M3OA 2Y6HA 3LIGA 1BCXA 4GJYA 2HBUA 1ZBA1 1V6OA 3ZIWA 5AC93 3WNPA 5LWBA 2ZGPA 2ZKLA 1BK0A 3KT1A 3HQRA 5LRRA 1U5XA 1D4M3 1PM7A 1S4CA 5FXZA 4HKOA 2VUCA 4I3GA 3ETPA 1CAUB 4QKFA 2IUWA 4C8DA 4PBPA 1AYN3 5FYYA 4CYDA 2JIJA 1RVF1 4FFHA 2QQJA 2ZHMA 1W39A 4OUSA 4R9CA 5FJHA 1UIKA 1LOGA 3AYAA 1C4RA 2XXZA 3IN9A 3ORJA 4Q1PA 1XSRA 4R8HA 2E53A 2WZ8A 3OUHA 4OI2A 5EIYB 3NAPC 4HKLA 1JOBA 1G7YA 1REFA 2D7FA 5CFCA 5J36A 5JZGC 2CDPA 3O1OA 2D97A 1LB2A 3CF6E 1ULOA 2PAEA 2EIDA 1JHJA 1GQGA 1S2EA 2ARCA 5A3OA 4A3ZA 4L0PA 2DDUA 4URAA 2B42B 2Y6KA 5EJ1B 3WNKA 1Q8OA 2XJUA 4IW3A 1T2XA 5F3GA 3UK9A 1OUSA 4LUMA 4QD2A 1ZBA2 4RHV1 2E6VA 4LBQD 1BEV3 1YFXA 5FP3A 3HOBA 2CU5A 5ANQA 4XDPA 2D6OX 4EYUA 4XJUA 1EAH3 1JZ6A 1UU5A 4YG0A 4QKNA 1QHDA 1M4WA 1DQ6A 1K5JA 1S55A 4MUVA 5FZHA 5LBBA 4AG4A 2E51A 5D1IA 5IK4A 4JDOA 4R9BA 1IKPA 1N1YA 1GQHA 1RITA 1RVF2 2WZR1 2D5HA 4LHKA 5JXJA 4E8DA 1GWMA 2YGLA 2UU8A 4GWNA 2VW1A 3MGUA 3POJA 4O65A 3LB9A 4INDA 2BJSA 4OULA 4DXTA 4YM0A 3H0OA 4GD4A 3BALA 1AL23 1SQ4A 2RDQA 4OHXA 4U36A 1ZM1A 2WWJA 5T5LA 3K51A 1OFSA 3KMHA 5B4NA 3WSOA 3VBUB 3GZAA 1YCIA 4QDQA 1Q43A 4OYUA 5ISLA 4OQ8A 2YBKA 1V6KA 4I30A 4QU2A 3ZYHA 1DIWA 3GHNA 3MIFA 2C24A 4RHV2 3WDYA 2HWD1 2VUDA 5C7GA 1OSGA 3AYCA 1DGLA 2DBIA 4Q1RA 4YW1A 2YDEA 3UT0A 5GZGA 1G9FA 1LHOA 4IE7A 1WLDA 4MG2A 4GMP0 4CDXC 1A34A 4L99A 3TB0A 1GFF2 1SPPB 1W6PB 4XUTA 2WIIB 5JZGA 1NKGA 4META 2ILMA 3TNQA 5IYYA 5K9YA 1G86A 5I8SA 5LEJA 1UOBA 3B69A 1DGWA 2WZR2 2YC2A 4LULA 1QQP3 3DXUA 4UFLA 2PMWB 4KWJA 2WO7A 4JRLA 1JH5A 1NA1B 5FUPA 5FZ1A 2VZUA 2G9GA 4OLLA 5C5UA 4QKBA 1ZBA3 2D44A 4MHRA 4QB1A 3DYMA 1ZZCA 1ULPA 3NV2A 3USUB 3CNAA 1H4HA 4BQWA 2GAUA 5FZ4A 2ZGOA 3R6SA 2BFUL 3WNLA 3E6CC 2HYXA 3WNMA 1LESA 5GZCA 3ATGA 3IDBB 2C4XA 5IW0A 3D4KA 2J22A 1TQ5A 4IEYA 2Q8EA 3RDIA 2MPFA 4CXXA 3ZYJB 4N43B 2ZMNA 3FL7A 2VW2A 5EP9A 2WO2A 1X9TA 1RVF3 2NMOA 4P9IA 3SC7X 1YJKA 2IC1A 4LT5A 2AEYA 1YJLA 3V0BA 4GWMA 3J4UH 3BIWE 5DUUA 2XB6C 3WQBA 5JSOA 5KXDA 4FI9A 4YW4A 3VLBB 2ENRA 3AXEA 5J7MA 4YFWA 5FMOS 5FPXA 4XACA 4JKMA 2IVJA 3VUOA 3M2MA 4P02B 2ZX1A 5CB7A 3AZZA 3TEYA 4Q5OA 4Y24A 3E5UA 3PURA 5LK7B 3VL8A 1REEA 1SLLA 1H4GA 1KS5A 4LIUA 5CIRA 4RHV3 4WM8B 1F8VA 1A78A 1EV12 4K6BA 1ND2C 1RYYA 1T6GC 1UXXX 1YFUA 2WQZC 3UESA 1JYTA 3M8LA 2WQ8A 3E5XA 3KS7A 2DTWA 3FLPA 4NE9A 4XXAA 5KHHA 4CDXA 3KD4A 1KQRA 2UY9A 1J1LA 4WVWA 1UY0A 2XDVA 5FLHA 4N53C 3ZN4A 5F5CA 5JXGA 4Q0PA 5FBZA 2XJQA 2FCTA 5K0UB 3KT4A 5IAXA 3QCWA 3AKRA 2WZR3 3CDZB 5IHRA 2CNAA 2XBO1 5E88A 2WAAA 5A7WA 2NYYA 2VXRA 4W65A 3ZXGA 4BOWA 1OMIA 4ZONA 1QOOA 5T5PA 4JGZB 1RUG1 4YRDA 3PVEA 4XDQA 4AQ6A 1MZFA 1LTEA 2UYAA 1I3HA 4LO7A 4B7EA 2R7EB 3LEGA 5JIUA 4A2UA 3AL6A 3GHMA 2WUHA 4CUAA 4L92A 3KV5A 3LFMA 4WZFA 1XNTA 5ABJB 2DUOA 2JICA 2VCCA 2A6YA 2WKKA 1ZZBA 3GBFA 4GMP1 5A7PA 2ZEWA 4XJ9A 4CP1A 5C70A 3O1PA 2AUYA 3HNBM 3U78A 2HWD3 1US2A 2DCYA 5E1RA 3WG2A 5IJRA 1KS4A 4HSJA 5A3NA 5JMOA 3POYA 5CAZA 2QQVA 1ZA4A 2RMU2 1DQ2A 3IIAA 4ZZ8A 3BPSA 3K3NA 5FZ8A 5HCFA 2FDKA 4R4ZA 2QE3A 2VZVA 1NE4A 4AGVA 2RJKA 3MUY1 4NRMA 4XJZA 4YW7A 3AZXA 5FY8A 5FOBB 1NT0A 5BNNB 2JDMA 2XBO2 1QY4A 3K48A 1AYM1 4QX3A 4J1WA 5FY9A 4CP2A 2X53S 4RGAA 2WFPA 3ZM8A 1FNYA 4LA2A 1RUG2 2VZSA 1ND2A 4K1YA 3O0VA 4Q0SA 4UAPA 1W6NA 3BTAA 1QJX1 2O1QA 2QQMA 3N9OA 4FFFA 4COVA 2VQ0A 1NQDA 4CDWC 2P3IA 5GZFA 1HQLA 1GKBA 2D6MA 3WXPA 1QGLA 1G9CA 3JQWA 4N53A 2EIBA 3I2JA 1A3KA 1DU3D 4GH4C 2BRTA 4RD7A 4WV8A 1RIRA 3ZSKA 5A1FA 2R49A 2GDFA 1R091 1IPJA 1AJKA 3C7EA 1O3TA 2TNFA 1LENA 1RXFA 2C9KA 3NO8A 4CCEA 1HB1A 1A6CA 3AL5A 4MHUA 4ES9A 1J59A 1BJQA 4FFIA 1JYCA 3JBG1 3PTYA 4Y5TA 2WNEA 1H8TC 3PUSA 1MACA 5GALA 2QQNA 1LGCA 1PX3A 5KHGA 1IOAA 3BUCA 2V5YA 2VZPA 3AZWA 3VBUC 3N7KA 1TMF1 1R081 1IS6A 1AYM2 1LRHA 3A23A 1CAUA 5IVFA 3BCWA 1XNCA 3SISA 2BERA 4D3WA 3ZSEA 4AVSA 2E7TA 3JXSA 2E9QA 5GZDA 4KH9A 4AHXA 2C1FA 1SBFA 3IDEA 4FQZA 4LBQA 3WNNA 4XQ4A 3OCPA 3TEZA 4PCRA 1LU1A 2QDNA 2VOKA 3AVRA 3VD3A 4ZU4A 1LR5A 2W1QA 3C3VA 5M0TA 2JG8C 5LK5A 4X8NA 2VPVA 4AI9A 2R041 2D98A 3AKQA 1S0CA 2CSGA 1NZCA 4LK7A 4XEZA 4XUNA 3ZN5A 1ND3B 1ULFA 2ZHLA 3OGSA 3BTXA 4CEWB 1R092 2XVKA 3Q8FA 2XBO3 2CV6A 5L9RA 2ZKNA 4N7IA 1W9YA 3M3CA 1OLRA 3M1HA 1BK1A 4WVMB 2YHJA 1RUG3 4XFAA 1GOFA 3LOBA 1YXWA 5BUVA 5FZ6A 5C33A 1LCLA 3IPVB 4OI1A 4FP2A 3OPZA 4CDWA 4GB32 2WZEA 2P34A 1NXMA 1OF4A 4EN0A 3MLKA 2VUJA 5C8CB 2L9LA 1TMF2 1R082 4LBNA 3ZFEB 1WCUA 5D8AB 4GMP3 1W8FA 5JPNB 1EPWA 1QJY1 4GH4A 1UN1A 4NR1A 4B8EA 2RV9A 5FMCA 3VZKA 4MYEA 4PIYA 1PVC1 1Y43B 3K3OA 2QNKA 2W87A 2HYKA 4UW4A 2D5FA 4IQPA 5A3MA 2P5BA 4NN0A 1ASJ1 2BVVA 2HWF1 1OA2A 1UPSA 1H8TA 5T50A 3ZYGA 2TBVA 5C3PA 5JR2A 1I5ZA 1MPXA 4CE8A 2PA7A 2ZGNA 4YNIA 4D6SA 3I3EA 1D2SA 3CJIC 2WL1A 2YU1A 3AZYA 3RJ2X 3VBUA 2OX0A 1WA6X 1AYM3 2IFWA 2VY0A 1UD1A 1XE0A 1CJPA 2X10A 4GKXA 1H30A 5KC6A 5F1RA 3IAPA 4R4XA 1H6YA 3VKOA 1Z7S1 3OUIA 3WDXA 1L7LA 4NO4A 2P3KA 4CDUA 1KJLA 1OLMA 4OZOA 4XCBA 1N47A 1QJX3 5LY1A 3O1RA 1QNWA 4NUBA 2SLIA 2BGCA 2CY6A 4MH0E 3ZR6A 1DCSA 5HV0A 3T08A 1QKQA 2NN8A 2JG8A 4JZRA 1SPPA 1W6PA 4I0WB 1VBE1 1CGPA 5C5TA 1HJGA 1QJY2 3A4UA 2A6XA 4AE2A 4LJHA 4DY3A 3PU3A 5K0UC 2YROA 1R093 1SFYA 5KR7A 1PVC2 1W0PA 4AK3A 3SH5A 3FHAA 1NQJA 1VBA1 2A5ZA 3KQRA 1LHNA 4AFMA 5I91A 3JBG3 1ASJ2 2HWF2 1PGSA 3NSTA 4HSLA 4YW3A 5FREA 5FYBA 2GC2A 4YVSB 1CAWB 4M3CA 2B5HA 4XYXA 2HBTA 5A33A 3TYJA 3M70A 2I74A 2V5DA 3HN1A 4GB33 2AZ5A 3T0BA 4L9BA 3OEAA 2ARAA 5CKMA 2G19A 1TMF3 1MVQA 1R083 3VBOB 3HVDA 3RVHA 5ABJC 2KR2A 5L36A 1VE0A 5FXXA 1O5UA 2GP3A 4Q4X1 3OEBA 1Z7S2 3ZKYA 2RDSA 5L7OB 3V0AB 4FPKA 3RZGA 1NYWA 4Z1VA 2BNNA 3H8OA 3DPRB 5HV4A 1UYYA 3LPFA 1RXGA 2PHDA 1JHNA 3ZSJA 1VBE2 2SBAA 3MICA 1YIFA 4IEVA 2UY8A 1DQ0A 2LW8A 3CJIA 5FKCA 5JSPA 2OUJA 3AX4A 1AR91 5C6CA 4YM2A 4BQ3A 3LA3A 3BIEA 1VBA2 4NPLA 1O8PA 4QKDA 2VG9A 3B7MA 3RI8A 2B8MA 4Q4Y2 1QOTA 3MFAA 4FPFA 5FYUA 1LGNA 1JUIA 5FY1A 3WG4A 3H8RA 2W95A 5GLWA 2XLFA 1LKNA 5KBFA 1GV9A 1ZBE1 4AVVA 4FPCA 1AX2A 3MW2A 3ZN6B 3GGLA 4QM9A 3V0AA 3ROUA 1WW4A 5F39A 1HW5A 1UOFA 4XBLA 5A32A 1MZ6A 1QOSA 2GNDA 1QJY3 1GP4A 4CUCA 1FMD1 4FVVA 4CZSA 1Y9MA 5EZWA 1E5RA 1S0BA 5K0UA 2WSUA 3PLQA 2P17A 1WD3A 2ZPXA 3OYWA 4QPGB 1PVC3 3MHZA 1PVXA 2Q1FA 4EN8B 2J1UA 4BZ4A 2WA4A 4K21A 4AZZA 3PL0A 2GZWA 1ASJ3 2HWF3 4Q4W1 1D4VB 1V9U1 2P4EA 3NNLA 4LO8A 4BXFA 1YQ6A 3J8F2 3I54A 4LHLA 3VGIA 4C90A 3CO2A 1YHFA 1H1AA 1HRV2 3J7LA 4KBZA 4HOOA 3U75A 2WINB 3PJYA 4QGNA 4AL9A 1GNHA 4IV1B 4J6GA 5ABJA 2YXSA 5DAXA 1OVPA 1YFWA 1Z7S3 3DECA 2PFWA 1GZCA 3NV4A 4NOTA 4P9LA 3WF2A 2RS12 1SLTA 4M01A 1ZBE2 4YPJA 4DOUA 5A3TA 4BQ1A 3NNGA 2Z2SB 1CONA 1W8HA 2IZWA 1DZQA 1VBE3 1CJDA 1NXD1 5FUIA 1FMD2 3HQXA 1CAVB 1ND3C 2AEZA 1WMFA 2VMGA 3ALQA 3MDPA 3R4DB 4EN9B 1VBA3 1QDOA 4DO0A 3C7OA 3WG3A 5HXVA 5JZGB 1CVNA 3WQ0A 2O14A 1EYBA 4DEQA 4HT1T 5DMYA 4Q4W2 2G9FA 2MEV1 2Y64A 3VHNA 1WCDJ 2VMFA 3NV3A 3T4VA 2J42A 2BQPA 3WUCA 3OGGA 5EV7A 2FMDA 4QGMA 5FY0A 5IK8A 4LKEA 1UZ0A 2CAUA 4XURA 5C3OA 5J98B 4TZDA 4XIOA 3VZJA 4EZ4A 2ZGSA 5FPLA 1LHVA 4O61A 2A70A 3ZFEC 3BKZA 1LOBA 1RUC1 3ACFA 3KQ4B 4HN0A 4Q4X3 1GZWB 2XJRA 3O0XA 2VO5A 1W8ZA 4FPLA 5F3CA 5FFOC 3MLJA 2JKBA 4QXKA 3FUQA 2DBNA 3PDQA 3O5SA 2W1UA 4LA3A 5KXBA 1J58A 5G04L 2ID4A 3MW3A 2FCUA 2ZACA 5D2AA 1QWRA 1OBNA 3OBZA 2VCMA 4LNVA 5FP4A 4B4PA 5FWEA 4KNCA 1YYNA 3MPBA 3ON7A 4ONUA 5BYNA 1MS8A 2A6WA 1G8WA 2ZEYA 3RRDA 2AH2A 1JU3A 5I0SA 1JYXA 5FYSA 2OQ6A 2LROA 3N9LA 3PNAA 4GKYA 2MEV2 3WW1A 3JQXA 1AXYA 1FOD1 1NE6A 3KCYA 4FAHA 3W5NA 5IAVA 1XOYA 1FPN1 2D6KA 2WQ4A 4D7TA 5F3EA 1ZBE3 2B9UA 3FUOA 5FMOL 1H1MA 2VMEA 2ET1A 2FDGA 3I8TA 3PUQA 2QQKA 3VZNA 1OLQA 3JD71 3ZYBA 3C7HA 1Q5OA 4WM7C 3VBSC 1MVEA 5FPUA 2QQIA 1AR82 1OQ1A 4ZXEA 1FMD3 1RUC2 5DDJ1 1ND3A 1WCKA 3ZXJA 1W6MB 1D0HA 1XE7A 3S7EA 3T30A 1SCRA 5FYTA 4EWAA 5LY2A 2EXHA 1SLBA 2ZX3A 4CDXB 3LIHA 5LZ6A 2MNGA 4IEQA 3NL1A 5GLVA 5IK5A 2P2KA 4Q4W3 1V9U3 2A3YA 3RZLA 1Y4WA 2XL7A 1DQ4A 3C7GA 3O14A 3R4UA 5FLJA 4AW7A 5FP7A 5KHIA 1JOPA 1VP6A 1YWKA 2ZMKA 4BU2A 4EQVA 3TN91 4AHWA 2WT2A 3OF1A 2J1VA 2EALA 2FQPA 3ECQA 5FZCA 3UKVA 3VZOA 4AI1A 5BV6A 4LK6A 2VBDA 1CZTA 3ZFEA 4ZHNA 3VBOC 1C57A 3GZEA 1S0IA 2B4KA 2PHXA 2WSVA 4KI5M 3ELNA 3HT1A 2GNTA 1W90A 4AVTA 5L7OC 1FPN2 2BU9A 4GIQA 4COUA 4AAXA 1W3XA 4MO3M 4EE2A 1CX1A 2PHLA 2X29A 3UETA 1UWWA 3DPRC 1W6OA 3UL2A 5JDBA 1QF3A 2CGPA 2YPJA 2W0XA 1I1EA 2B7YA 2VW0A 4BQ5A 5DDJ2 2D40A 3V65A 1X8EA 5BXXA 2WABA 4Y1VA 2BW8A 3F2ZA 3MIBA 1C5HA 4PQ9A 2BDRA 4QXBA 5FZBA 5A7OA 1UYZA 2RG4A 3N9NA 1GOHA 3ACGA 4LTAA 2KD7A 2QFEA 2GH2A 2MEV3 4H3WA 3LA2A 5FUNA 3RG0A 5LASA 1UY1A 4H7MA 4XQWA 1QJZA 4UW3A 4KWKA 1F2NA 4QQLA 5CA6A 4KG0A 1VLNA 2VU9A 5FZ0A 3VL9A 3H7JA 5IVYA 3IT8A 2ZGQA 1GZ9A 2V4AA 4WM7A 3IMNA 1ZNPA 3VBSA 1C3HA 1LEDA 1K45A 5LB6A 1ND2B 1RUC3 4IEXA 3ZLIA 5EQUA 1W6NB 3WUDA 1UY2A 4YZ5A 2A6VA 1Q3EA 1DG6A 4YM1A 2XLAA 4QPGC 2G4IA 4NIAA 3M3EA 1G9DA 3Q9OA 1ZRCA 3ILFA 5FYZA 1AX0A 4MVTA 1CX4A 5JR7B 3HNMA 1HV0A 3I4IA 3VBRC 5A6XA 5C8WA 5FOJB 1CAWA 1CAXA 1VAKA 4BK5A 2XMLA 1WMXA 1QXRA 2PHWA 5T5JA 4XMAA 5H9QA 1JMUB 4A42A 5EFUA 1ENQA 1WMEA 5EJZB 3MYXA 3RZZA 3LSEA 4Q4V1 4URTA 3VBOA 2FHRA 3Q8BA 5DUVA 3WF4A 2BWCA 2F4PA 4IV1C 4QXHA 4L11A 5KC5A 1FXZA 1O91A 1AL22 4NWVA 4QB2A 1FOD3 2NP0A 4OI4A 2ORZA 5L7OA 1SEFA 2ZZJA 1UOJA 1FPN3 2HH9A 2W3JA 3A22A 1Q8QA 3B01A 1W2OA 4PLNA 4QHZA 3WOGA 3O1TA 5LEKA 3WINE 1ODMA 3KT7A 3PIGA 4DFSA 3DPRA 1H1IA 3D8CA 3JD73 3WNOA 2GU9A 4P9WA 4MGQA 3VZMA 5DDJ3 4XMIA 5E6HA 4LBQB 2ZGLA 4D69A 4GQ7A 1CN1A 4AI0A 3M4FA 4A44A 2W9XA 2DCTA 1LNSA 1IQDC 5KWRA 1O59A 2HJIA 2IXKA 1SLCA 5L73A 3WP6A 3FWEA 2FZ2A 4N9IA 3MEPA 3TN93 1O7FA 2XJSA 1E57A 1GYKA 1QQP2 2W39A 3POGA 3U4SA 2CYFA 3DYOA 3ZOIA 3ZN6A 1OUXA 4WVVA 2D3PA 3ZSMA 4KWUA 2ZBJA 1W8WA 1VR3A 4QPWA 2QZ3A 4UI9L 1GWKA 3LEIA 4QX0A 1GWLA 2GNBA 2JD9A 3MV01 3HWJA 4FOWA 5CG9A 4CDWB 4QPGA 4BCUA 2DURA 4I01A 1J1TA 1Z78A 1GBGA 5BNOC 3AB0A 2Y34A 2OPWA 4Y1UA 4IV3B 1UMHA 4GH4B 3ACHA 3VBRA 4O9GA 2HLEA 2D3RA 1OI6A 1HKDA 3FHIB 2ETEA 3I3BA 3L9JT 5LW9A 2GMPA 2XVLA 5LA1A 2VQUA 3LA7A 1GU3A 1QEXA 4QX1A 4D7SA 1VPHA 1YRZA 2YUEA 4XHBA 3DCQA 3KGLA 1H8TB 4IV1A 3DF0A 4OVEA 3OOXA 5EWSA 2XHKA 3PVNA 3THCA 1W8TA 2V73A 4QDRA 4N9HA 2Y26A 2IXLA 2R6QA 3K77A 3LQCA 3K46A 5KHJA 4CCJA 1AUYA 4JDMA 2E7QA 4A41A 2BPA2 4XBNA 2RJ2A 3S6PA 1WBFA 2JIGA 1X33A 3N7MA 2G9ZA 4W6YA 2NPIA 3CEWA 1RHI1 2DVGA 3H1MA 3P5BA 4H55A 4CDUB 2QCSB 5C3RA 4DB5A 1CAVA 3C8XA 1VRBA 2Q5TA 3PUAA 3VKMA 2ZABA 3BYWA 5LRSA 3VV1A 4FPJA 4ZS3A 1ENSA 2VMCA 3UYJA 2JG8B 4UFIA 1WW5A 1W2TA 3H50A 4DRRA 2CTVA 3AFGA 3POEA 1DYOA 1NY71 2OPKA 1W0OA 2ZAAA 2B45X 4RN5A 1ENRA 1W2UA 3N3HA 4CEYB 5BNPC 1IGOA 1KXGA 3AM2A 2Q8CA 4EWDA 5HCBA 5CG8A 1ULCA 1RGSA 1PO11 2QTWB 4Q4V3 4E2SA 3DGTA 2XUMA 1W28A 2ZMLA 5KHKA 2VZQA 4YZ4A 4COYA 4M3CB 1XC6A 3T1LA 1GICA 1V0AA 4M4RA 1PMIA 5FZEA 3A0NA 5A3WA 1GZWA 3SH4A 2VOTA 4LORA 5A33B 1KRIA 4AVBA 2CHHA 2VECA 2PXJA 3LOIA 2O8OA 1TE1B 3AKSA 5BNOA 2QDRA 5FMBA 4HZFA 1HIXA 1OQEA 4JGYC 2DFBA 4XFCA 2JDNA 3SCFA 1RHI2 3KZ4C 2HWD2 3ZXEA 3QOPA 4E2QA 5A3UA 3HT2A 2WJSA 4RFRB 5HCAA 4W50A 1W05A 4FPHA 1IPKA 3CQOA 4BQXA 2HWB1 2EA7A 3RS6A 3U1XA 2HWC1 4BQYA 5CBLA 4C91A 1F5JA 4QX8A 5FYMA 4EZHA 2XG3A 1YLLA 2VZ1A 4HN1A 4UBGA 3UGGA 2XR4A 4DUWA 4QQHA 4QX2A 2ZCWA 5E16A 4FPGA 1NY72 3CJIB 3WP5A 3WY6A 2JDZA 3X29B 1BMV1 5DG1A 5FRAA 3KF5A 4S2GA 3RYKA 3CJXA 3GBGA 1GMMA 2JDYA 3CKHA 2TEPA 2R061 5CU1A 3D0JA 1PO12 3VD9A 1CIYA 1ZRFA 1OKQA 2ZGRA 5F3IA 1RUF1 2W1SA 4HPKA 1DLCA 3ES4A 1TNRA 3AVSA 4AAPA 3CHXA 1W6MA 3WF0A 5I0RA 1UZWA 1LODA 4Y22A 1POQA 4E27A 5A32B 1SHWB 4DUVA 2OW4A 1ACCA 3ILNA 4AFAA 4I3PA 1OHFA 1UO9A 4B3NA 2ZX2A 2BNOA 3OYWB 4NRPA 4W4ZA 1LOFC 1VBD1 3FFQA 1W8NA 3I2DA 5BNPA 4LEJA 1V6JA 4IE6A 4XILA 2HWB2 3SMHA 3EB7A 3NNFA 4K3UA 1HB2A 2VBPA 3M3IA 4HFSA 5AFBA 3T09A 4LOTA 3QD6A 1OVSA 2GN7A 1J84A 4OMCA 5DPNA 5FDBA 3AMHA 1W9TA 1LULA 3KCXA 1DYKA 4BJ0A 3S5AA 1BMV2 4GXLA 4K40A 1A8MA 5A1LA 2WA3A 2W46A 5HXMA 4JTNA 3EQEA 3JB4C 1KDKA 2VZOA 2DVFA 4MXWB 4TSVA 4QX5A 2RS31 1QJFA 4AHZA 1HQNA 1VAMA 4JGYA 1XU1A 4Q8LA 4CCCA 3GCXA 1MS3A 1RHI3 4FTBA 4FXGB 4FCAA 2WZPP 2DVDA 2VJXA 3FE5A 2NLRA 2DCJA 4RL7A 4BQ2A 4V1PA 2XL9A 3FX3A 1WKYA 3E6DA 3LEKA 3WDUA 3AC0A 2PQSA 5FY7A 2DCZA 5CKQA 1RUJ1 3B00A 4LBOA 4LO5B 3WG1A 2Q8DA 1DQ1A 3UJOA 1VBD2 4CPBD 4KMQA 4NPRA 1IS4A 5T5OA 5FTTC 1MZEA 3NRUA 1FI2A 3N4MA 3VD7A 2C6SA 1PO13 1JYNA 1WLWA 2JENA 2W5FA 3O12A 3VBHB 1PM4A 3I2GA 2XKPA 3DKQA 3V56A 2FDFA 1MS0A 4SLIA 5FYIA 3T2TA 1G6NA 4XZUG 5JPMB 5CFDC 1VBB1 2A3XA 2F6BA 4LOSA 3PUHA 2RS32 4D8MA 1W99A 3DUIA 1PIV1 5A6YA 4IV3C 4NHMA 4BE3A 3EXUA 1I6XA 1S0FA 4C1XA 4CSWA 2VNVA 2OVUA 1RUD1 3IBMA 1LOFA 2EF6A 1CIWA 1IG3A 3J26N 3PU8A 4XF4A 3KV9A 2BBAA 2VD7A 2XWJB 5F7UA 5JUVA 2HWB3 1JZ5A 3NW4A 2HWC3 1G9BA 4ZPIA 5F2WA 5I0DA 4H2AA 5IVCA 2E7AA 1W2NA 3JUUA 3AZVA 3HAGA 4C0BA 2VUAA 2JKXA 3WR0A 4AXOA 1CPMA 1KJRA 2PQQA 4AFDA 1BQPA 4ASMB 1ZZ9A 2CGOA 2Q8OA 1IG0A 2BV4A 3NNMA 2R063 1BXHA 5F5AA 3POWA 1S0EA 3G6JB 2VMIA 3SH3A 2BNMA 4XFGA 3T2PA 4NIIA 1UXZA 4CDUC 5FZOA 3BOPA 1I9RA 3H7YA 5C3SA 1QJX2 1QXJA 2ZGUA 4IEOA 2VC9A 2D6NA 5IVJA 4NIHA 3N9MA 4OFGA 3ITQA 1HJFA 1QJEA 4IXLA 3FC0A 1NAEA 3IB3A 1BBT1 1PIV2 5DZFA 2VOXA 1PZ9A 4AEKA 1SLIA 1UY4A 3GBWA 1VIWB 5CISA 1PGL1 1KEXA 3WCSA 1NCRC 1F9KA 1VBD3 1BKZA 1PMJX 3APBA 1QIQA 4CEYC 3S0MA 1W9FA 2VE1A 1DGRA 4CUGA 1DZTA 1FYUA 1UYXA 4AI2A 4XFHA 3JBG2 1WGPA 3TBDA 3BTZA 2JEMA 3DXTA 1H6XA 4JHZA 4Q8KA 1V6LA 2ADEA 1OOPB 2WRAA 3RZJA 3Q8EA 4FTEA 4I0AA 1XPWA 5CFDA 2ES3A 1ODNA 2RS33 2X09A 3RYRA 3WW2A 4IV3A 5J48A 2R30A 3MF9A 1IHMA 4BMBA 2VBBA 3INAA 3K4DA 4FT8A 3ZR5A 5BNQA 3AMNA 2PELA 2P6CA 3GJAA 1R64A 4K8RB 4XDOA 4BA6A 2UWCA 4C1WA 3RYPA 1O4ZA 2EIEA 1W6OB 5JVVA 2RM21 3B02A 2VTXJ 4AVCA 1W0NA 1BBT2 1RUOA 2R042 1RUJ3 3FN9A 1ONAA 3HD8B 5FPBA 4Y4RA 2VH9A 1PGL2 1L7RA 3J9SA 1QMJA 4QQOA 2YGMA 4B4RA 1NG0A 5TSWA 3UJQA 4DMIA 1CR7A 3H9AA 3AXDA 2HKXA 3LWCA 3SHRA 4NRQA 3KWVA 5FZ7A 5IATA 3AP6A 3ZYPA 4E4ZA 4XIKA 1WA4A 2CGNA 2AYHA 4ZKTB 4UWDA 2ZEXA 4DQAA 1SDDB 1VBB3 2JDKA 4WM7B 5A3PA 3VBSB 4IDZA 1JODA 2BTVC 1RJ7A 1PIV3 1I5PA 1SLAA 2PHFA 1UW8A 2BWAA 4DPNA 3U11A 1RUD3 2E32A 1NCRA 1P8JA 3GCWA 2XGXA 2J1TA 2VGDA 4CEYA 2CWSA 4MGYE 4C0HA 1WW6A 4JAAA 1VB4A 1OC1A 2Y6FA 1H8VA 1CAXB 1Q8PA 2KXLA 4ITCA 3ZSLA 4E8CA 4TTGA 1OKOA 2BVBA 2H0BA 2FDHA 4AR2A 1UIJA 4P14A 4D7YA 4FPEA 3LKJA 5EPAA 1XBFA 2FBEA 3OUJA 4XJ8A 3RNSA 4LITA 4J1XA 4PI2A 1T6BX 1ULEA 3GZTB 3MIEA 3DV8A 2W08A 4UF0A 5FO8B 3RGBA 5I8TA 4AFBA 5HPOA 3T4HB 2WFF1 1C8M1 1R1A1 1UAIA 5FO7B 4JVAA 3USSA 1O8SA 4AEJA 2NM1A 3ZFFB 2VZRA 4EROA 1PNFA 2D93A 5B2GB 2A3WA 4LKFA 3WT3A 1HB3A 2XONA 1JYWA 4N7UA 3MIDA 1BBT3 1WLCA 2R043 4LO4B 1ZZ6A 2Y6GA 4R9AA 3VZLA 3FHQA 3JCIA 2Q0AA 3B94A 2X8KA 2PHTA 2K0GA 1VALA 2XUEA 3OBTA 3OG2A 4CUBA 5FQ0A 3S7IA 4Z07A 1PO21 1JYIA 3AMMA 4XOGA 2HEWF 4UW6A 4CCLA 1PK6B 4IETA 5G05L 4EN7B 2A73B 1UX7A 4YSFA 3VBHC 3HPNA 1K3IA 1UMZA 4PQQA 4CTEA 3MPPG 5F6KA 3I59B 4BM8A 1ZRRA 1DZRA 2OZ6A 3E97A 2YG0A 3OD0A 4BLJA 1JUHA 1JI6A 1VAVA 3HIFA 4KWLA 4Y20A 1J3PA 4HVRA 3U10A 2D3SA 1TME1 4Q4X2 2Z4FA 3I2FA 4FOYA 1C8M2 2DVBA 2ZXQA 3W9AA 2IVIB 2K46A 4L97A 2VCAA 3JU9A 3K75B 4GA9A 2RS51
chains in the Genus database with same CATH topology
4XFFA 4R9DA 4XW3A 2D6LX 1DGRN 3WCRA 1JOJA 3H3ZA 3VBRB 3VHOA 1X50A 3KLSA 2Z69A 1Q8SA 2KA3A 4AQSA 5JAXA 1AR92 3AYEA 3LCPA 4MXWA 1PO22 2W52A 2IXIA 5IUQA 2FMYA 1FV3A 2QQPA 1YNAA 1XRUA 4XFIA 1N3OA 3THPA 1S2KA 1SMVA 4A7YA 1QDCA 4UW5A 5J3UA 1Y7BA 5FCCA 1U12A 4YGCA 4PBOA 1SBDA 4JRAA 4YGBA 4BMEA 4YZ2A 3FJSA 2UWAA 4Y5Z0 1TME2 1QU0A 4BWOA 4P9XA 3D0SA 1LOAA 2D6PA 2ZGMA 4OHVA 3HMYA 3VBHA 3ZIXA 3ACLA 1V9U2 4SBVA 3M7AA 4JC1A 1OD5A 1S1AA 1ZVFA 5JOXA 1DFQA 1DLLA 1UZZA 4IEZA 1OOPC 1GR3A 5JOWA 1UZYA 5GLZA 5IT6A 1X7NA 4DXZA 1LOCA 4QQ2A 2WFF3 1C8M3 1R1A3 4Z2WA 4K8FA 4CDQB 3ZYIB 4A3XA 5BNOB 1YI7A 1QJU1 2XH6A 1U5IA 1CQ9A 1KDMA 4QT6A 4TWTA 1H2MA 4HK8A 5E8AA 4NHKA 4HVQA 1AR93 2OIIA 4Q29A 1WCSA 1PO23 3VKNA 4PJYA 2A71A 3ZVXA 2Y0OA 4LHNA 5CVRA 3BODA 1GSLA 5AFEA 3ILRA 3NVCA 1AVBA 1GNZA 1PZ8A 2JG9B 3GYDA 1N1TA 4DRVA 1ZYBA 4OHZA 2DU1A 1SCSA 4LE4A 4H14A 4XETA 4AQ2A 5JI9A 2V09A 4HPKB 1TME3 1VB2A 4FSJA 2LM3A 3VHPA 2RS53 1MQTB 2EIGA 4M0NA 4RQPC 4Y22B 1KFUL 2ARXA 5AC91 4WVZA 1WD4A 3OY8A 4NVPA 4ZU5A 4WZCA 1OQDA 3AYDA 1XQNA 5JIAA 3WD5A 1OOPA 2D43A 4Y1YA 5BNPB 2VNOA 3EJKA 3ETQA 2XVGA 4IL7A 2VOWA 1OA3A 2OZJA 4QHBA 4W6XA 4YGDA 5HI0A 2WNVB 2VVDA 1SBEA 2LTNA 1FOD2 4JQRA 3TAYA 1NLRA 3OGJA 3NWKA 4MXVA 2ET7A 2QVSB 3ZFFC 2ZOEB 4YFZA 1ZREA 2YY1A 1MS4A 3JD72 3ME2A 3JZVA 2DVAA 4JGYB 1RUNA 3DN7A 4I09A 2H0VA 4I02A 2BUKA 5SV5A 4DZGA 4E4SA 4Z8BA 5FPZA 1XXNA 4S2DA 1PK6C 5KXCA 1O4TA 3ZFGB 2ZHNA 3WHUA 2YC0A 1EAH1 1KITA 3L2HA 2GMMA 4FBFA 4LLFA 2QUOA 3NJZA 1WMDA 2YZ4A 3TN92 4KGGA 2DFCA 2X5IC 2XJPA 3BPZA 1JW6A 1QNYA 1S0DA 3O0WA 2EVXA 3RMYA 2EAKA 3H8UA 2H6BA 4Q27A 4XXPA 3A0KA 3N35A 1UKGA 1C1FA 4RQPA 5EXOA 3C2UA 3E6BA 3MF6A 4XF9A 4YZ3A 3RMXA 5JMCA 2K2SA 2AGSA 5EJ3A 4GULA 3WQ7A 1HDKA 3OBRA 1DGWX 5JOZA 5FLIA 2GSYA 2JJ6A 3AJZA 5AVPA 2O8QA 1XYPA 4FP3A 4XJWA 3ZXAC 5I0UA 2PHRA 2FZ1A 5GKAC 2GALA 2EAAA 3OJBA 1NCQB 4HETA 4XE9A 2GC3A 4DS0A 3ZFFA 2CWMA 1Q8VA 4JDNA 4TYSA 1SDWA 4Z82A 3RWNA 1ALYA 2NZ9A 3QLQA 3SITA 4MX3A 4MGIE 3CL1A 3KGZA 3B93A 1B35C 3AP4A 1V6NA 3PMEA 1D0GA 5C4WC 4D94A 2GC0A 1PK6A 1RMU1 3KB5A 3R4SA 5SV8A 1YIPA 4AGRA 1YUDA 1DF0A 2XPJA 5L19A 1HQWA 3I59A 3O7OA 4Y26A 3H3UA 4HVOA 4BIOA 3I7DA 3B9CA 2X5IA 1S0GA 2BYVE 2ARBA 1PZ7A 4Q4V2 2EXKA 4LBJA 3HBZA 2EXJA 3WW3A 5K8SA 3LAGA 1KD7A 2OA2A 3IKWA 1BYHA 4NHLA 4FPOB 4AEDB 4CDQC 1IZ3A 3HR9A 5CFDB 2GH8A 4LBMA 4B29A 3FFZA 1HLCA 4BPZA 2ERFA 5C9AC 3QBQA 1FNZA 5DZEA 3FBMA 3MZHA 3DL3A 2A6ZA 1RMU2 1S0JA 5JWPA 3RQ0A 1RC6A 1ULGA 1IKQA 1XYOA 1KFXL 3ZXKA 1MS9A 4IESA 2IXJA 2WNUC 2JG9C 1H9PA 1O3QA 2RE9A 4M3CE 4AHYA 4E4DX 1SACA 1F5FA 1CESA 4KQ7A 1GLHA 1AZDA 1B35A 2R1DA 3VKLA 2RR11 3TRSB 1U5YA 3ZO0B 5I93A 5C4WA 3URFA 4QM8A 3SNMA 1MQTC 2A7AA 2AR6A 2I45A 2VNRA 2WLPA 4XBQA 1IS5A 2XJTA 5T52A 4JCKA 1EY2A 1NCRB 4MV2A 4OHWA 1N1SA 1QH7A 3KM5A 2OYZA 3WVJA 3M3QA 4RSUA 4KG8A 2WNVC 3IM0A 1QH6A 3AKPA 1CD3G 4G9SB 1UL9A 4CDQA 1V6IA 3FMGA 5H9RA 3NAPA 1ENXA 1AR71 1XNBA 2OUHA 5KXEA 5BY5A 4FXKB 3CLPA 1PNGA 2RR12 5C9AA 4FAGA 1MEC1 3MIGA 1EV11 1RMU3 4AGGA 3WDTA 4Y1XA 3KCCA 3BB6A 1POV0 2YYOA 3CU7A 3ZFGC 1S2BA 3BU7A 4X6QB 1NLSA 5FQ0B 2WNUA 2JG9A 4HANA 4Y4YA 3ZXLA 3MFCA 2ZX0A 4UXAA 1TEIA 4LT5A 4E2GA 2PYTA 3QACA 3VDDB 2RJLA 4IERA 1C28A 4YVWB 4BLIA 4F8AA 2Q1MA 5EYYA 4MLOA 3P3PA 1GANA 2KM2A 1FX5A 4LE3A 1VRH1 1JBCA 1MQTA 1AR72 3WNXA 2WS91 1AJOA 4Y20B 4RR3C 5FO9B 2VNGA 1PHMA 2HWE1 3U0ZA 1AXKA 4HKWA 1O3SA 4AYUA 1MEC2 1UKRA 1ZZ7A 3PJQA 2HWC2 1X82A 2C0ZA 2WNVA 4K1ZA 3AJYA 4PDWC 1HXS1 1ZZ8A 4P9YA 4X8PA 3WHTA 4XTMA 4FOQA 4LUKA 4S2FA 5DUWA 3T1MA 2WC2A 1NCQC 1FV2A 3ZPYA 2IWGB 1AL0G 2RMU1 1RB8G 4PLOA 4FPYA 2R062 3AP9A 4BHPA 4MGKE 2UYBA 4COZA 2ZJCA 1RUF2 3RJRA 4HMZA 4U2AA 5ACA1 4TLFA 1RINA 2RR13 3B3QE 3UV9A 2P3JA 1APNA 1OPOA 1VRH2 1W6QA 3PVOA 5IK7A 4YW5A 4IEWA 2Z42A 4ATFA 2PLV1 1O5LA 2WS92 2DU0A 3ZFGA 4YGEA 4F7ZA 1RL3A 2HWE2 3WW4A 2VVFA 2A75A 1LOEA 2P37A 4YG3A 2I2SA 1O4YA 4YG6A 1MS1A 3ZX7A 4F3JA 3WZ1A 4CP0A 1HXS2 2XKOA 1WW7A 4RA0A 4AEDC 5F6LB 1AR73 1OFNA 4MGZE 2CAVA 1V00A 3OTFA 1LJ7A 1RUH1 4RR3A 1H2KA 1UF2C 4H7LA 4OZXA 4PIXA 3N7JA 5F1RA 5ACA2 1POV1 3LSDA 4Q0VA 5F9TA 3AFKA 1MEC3 2W68A 5DZGA 3AMPA 3V64A 1PGW1 1EV13 4LO6B 1A8DA 4PDWA 4L2NA 2PLV2 1VBC1 3UKNA 1NOVA 1RUJ2 4F83A 1X8MA 4AFCA 1OA4A 2Z5WA 1NCQA 3RSJA 4KU8A 4QPYA 3WX5A 2JXAA 3ZXFA 4PIZA 1RUF3 2JX9A 3MIHA 1FAYA 2Q1ZB 3N7LA 1FT9A 1U0AA 1VRH3 4QPIB 2DCKA 1B09A 2DUPA 4FQ4A 1REDA 1HX6A 4P9GA 4RFT0 2XWBB 1VBB2 5JSRA 2WS93 1ULDA 1RUH2 4GB31 2HWE3 1RUD2 2DTYA 1IQAA 2XLGA 3ES1A 1UU4A 3OY8B 1PGW2 3RI9A 2GN3A 1HXS3 1VBC2 4RS5B 2ZX4A 2I07B 3VBFB 3AP7A 1BZWA 2ZA9A 4X6RB 3KSCA 4YW2A 4AEDA 2RMU3 1Y3TA 3WP3A 1V70A 3TWIA 3NV1A 3PHMA 5ACA3 1HRI1 3W59A 1XU2A 1NA1C 4DNYA 4YLZA 2ZGKA 3ENRA 3WDWA 1OPMA 2PLV3 3R05A 4Z92B 4XF0A 1URXA 4BH9A 3D6EA 2ATFA 3EBRA 2VMHA 4HLTA 4M00A 2EXIA 5T55A 3VDDC 1X36A 1WBLA 1N3QA 3P3NA 4N43C 4N90A 4XJAA 4YVWC 1DDLA 4MZUA 5GM0A 2Q4SA 1BVVA 2WT1A 5I8YA 2B46X 1EPZA 1RUH3 2NMNA 3GF6A 3W58A 1HRI2 1POV3 3MI8A 2PTMA 4LBLA 4AI8A 2TUNA 1JN2P 3OD4A 4Q2FA 2VOVA 4RQPB 2VVEA 4LBKA 4Y1ZA 4A7KA 5BPXA 1COV1 2RM22 4WM8C 4Q0UA 4XF3A 1SFNA 1VBC3 4XQDA 4M3CF 1H0BA 5GJ6A 4ATEA 2AREA 2Z79A 3IWZA 1DBNA 4YM3A 5DG2A 2R0FA 4W6WA 4KL1A 1K5MB 2R071 2PAMA 3NKGA 1AF9A 2QJVA 2IXCA 2Y38A 4AEMA 3LZZA 1MS5A 3FLTA 1NA1A 4IEPA 2HEYF 4Q4Y1 2Y0IA 3EHKA 2BFUS 4JGZC 3ZDSA 4Q26A 1O3RA 2QZ2A 3USUA 3QH6A 2JE7A 3SLIA 2HEVF 5H9SA 1RUI1 1JTZX 4ASLA 3VHRA 2IFRA 1AX1A 1G9AA 1XNDA 2PHUA 3POSA 3VDDA 1COV2 4G4FA 4N43A 4O9EA 4YVWA 1VJ2A 4S2HA 3RPQA 4I0BA 1Q56A 4XHXA 5CNAA 3VKFC 4E9KA 3VN4A 2X5IB 3ZMNA 1QXPA 3U07A 2R072 3J8F1 1UCXA 4HBNA 3WQ1A 1HRV1 3GNEA 3AK0A 4NWWA 1HRI3 2B39A 2WFF2 1R1A2 5E89A 4CRQA 2ZTNA 4BIFA 5BNNC 2R1BA 3G7DA 3EO6A 5CFCB 2R16A 4UBHA 2RM23 4WM8A 4K9SA 4K7JA 1EP0A 2RS11 1N1VA 1ZX5A 2MHFA 3WP4A 1UX6A 2YMZA 3SXWA 1RUI2 4IEUA 5T3NA 2IXHA 3WV6A 4AF9A 2RHPA 4G3YC 5H9PA 3D82A 1BVP1 1H2NA 4QMAA 4ZXKA 1L3JA 4P5HA 4XZPA 2E63A 4YYOA 1XE8A 4L8QA 4LR4A 3WDVA 4AI3A 4OUMA 3ZYRA 4QPIC 4YZ1A 3NKTA 1WLTA 2ZS6B 4JGZA 1YFYA 1B35B 4AWDA 2R0HA 1IS3A 3ZXDA 5J96B 2GNMA 1C1LA 1XNKA 4EV0A 5C4WB 3AP5A 2RS52 4JV4A 4ZU7A 1COV3 4DINB 4XFBA 2WWSA 1D2QA 2JD4A 4XPVA 4RS5C 2WLQA 3VBFC 2C9AA 5JLVA 2NQYA 1JXNA 3ZMOA 1N3PA 2UURA 3H1WA 1AHSA 4GALA 5J09A 1FATA 1CPNA 2R073 2VQAA 4RGGA 4EJRA 3D5OA 2ZGTA 4HL0A 3MW4A 2PAKA 2DF7A 2N7GA 4CEWC 5BNNA 4PLMA 3NAPB 4Q4Y3 2CL2A 4KBBA 5CADA 4FOVA 4LLOA 1DYPA 5FAXA 3LGRA 4ES8A 3L2YA 3SCGA 4FO9A 5C9AB 1RUI3 4QGLA 3TOJA 5DXDA 5C8CC 5EYXA 4AQTA 4Q0QA 1AR81 5D8AC 1TNFA 4ORFA 2BBVA 1DQ5A 4OI0A 4A7ZA 1V6MA 2UWBA 2WNUB 3N36A 2BEOA 4YARA 2R32A 1LGBA 4QPIA 4PF5A 5T54A 4ISRA 4OHYA 4KGQA 3J8F3 1U5ZA 2O0OA 3JB8A 1RUE1 3QH7A 1HRV3 3TNPB 1HV1A 4P9JA 1XYNA 1UU6A 3V0BB 2K9ZA 3AKTA 1AR61 5A3LA 3PVBB 1QJU2 2PN5A 1LEMA 2RS13 1MR5A 4RS5A 2DUQA 3VBFA 1D4M1 1MZ5A 5I0TA 4WBBA 1LECA 3E5QA 4EN6B 3THTA 4KU7A 2Q30A 5J37A 3S30A 1YO8A 2ZHKA 3SCHA 1AYN1 1K5MC 2JECA 5JOYA 3FZ3A 1YI9A 4ISQA 4CEWA 1J3RA 2LALA 4DY5A 1C5IA 4JTOA 4MSVA 4WVMA 1Y9QA 1LHWA 1LHUA 4YVSC 4AVAA 4XTPA 1Z0HA 1RUE2 2YV8A 4HK9A 3IPVA 3FBYA 1RJ8A 5C8CA 1W6QB 1AR62 3GZUC 4K20A 2XJVA 4EWEA 2WT0A 4B4QA 5D8AA 2JE9A 3R0RA 1BEV1 5AC92 4QQPA 4COWA 1M06G 2ZZQA 3UKTA 1H2LA 2AENA 1D4M2 2DWRA 5K7PA 4FTSA 3DKWA 1ZRDA 5GLUA 2H6CA 2LUWA 1AYN2 4R52A 1RTVA 4I2OA 1H9WA 1J3QA 1WUVA 2GC1A 5GLTA 3H1YA 3WLUA 4BYYA 3FLRA 5CFCC 1AL21 1AXZA 1QJU3 3AMQA 5AVAA 2DYCA 4RR3B 1DHKB 2VULA 3B9IA 2GMEA 3MLLA 3B5LB 5JI7A 3BOWA 5HBAA 1AR83 1K5MA 4PDWB 1BEV2 3IDCB 1EAH2 1F31A 1R1ZA 2ZAHA 2C5DA 4XF1A 4B7KA 3PMSA 5F5QA 4N53B 4M0HA 4YVSA 5GZEA 5DUXA 3ASIA 1LU2A 1RUE3 3GALA 3ST7A 1QQP1 2QKDA 5JCTA 1UPIA 1C8NA 1AR63 2DV9A 3M3OA 1BCXA 1ZBA1 1V6OA 3ZIWA 5AC93 2ZGPA 2ZKLA 3KT1A 5LRRA 1U5XA 1D4M3 1PM7A 4HKOA 4I3GA 1CAUB 4PBPA 1AYN3 4CYDA 1RVF1 2ZHMA 1W39A 4OUSA 4R9CA 1UIKA 1LOGA 3AYAA 1C4RA 3IN9A 4Q1PA 4R8HA 2E53A 4OI2A 5J36A 3NAPC 4HKLA 1G7YA 1REFA 2D7FA 5CFCA 5JZGC 1LB2A 2D97A 3CF6E 2PAEA 1GQGA 2B42B 1Q8OA 2XJUA 3UK9A 4LUMA 4QD2A 1ZBA2 4RHV1 2E6VA 4LBQD 1BEV3 1YFXA 2D6OX 4XJUA 1EAH3 1UU5A 4YG0A 1QHDA 1M4WA 1DQ6A 4MUVA 1S55A 4AG4A 2E51A 5D1IA 5IK4A 4JDOA 4R9BA 1IKPA 1N1YA 1GQHA 1RITA 1RVF2 2WZR1 2D5HA 4LHKA 2YGLA 2UU8A 4GWNA 2VW1A 3MGUA 3LB9A 4INDA 4OULA 4YM0A 3H0OA 3BALA 1AL23 1SQ4A 4OHXA 4U36A 1ZM1A 5T5LA 3K51A 1OFSA 3KMHA 3VBUB 3GZAA 1YCIA 1Q43A 1V6KA 4I30A 4QU2A 1DIWA 3GHNA 3MIFA 4RHV2 3WDYA 2HWD1 1OSGA 3AYCA 1DGLA 4Q1RA 4YW1A 2YDEA 5GZGA 1G9FA 1LHOA 1WLDA 4GMP0 4CDXC 4L99A 3TB0A 1GFF2 1W6PB 5JZGA 2WIIB 4META 2ILMA 3TNQA 5K9YA 1G86A 5I8SA 5LEJA 3B69A 1DGWA 2WZR2 4LULA 1QQP3 4KWJA 4JRLA 1JH5A 1NA1B 2G9GA 4OLLA 1ZBA3 2D44A 1ZZCA 3NV2A 3USUB 3CNAA 1H4HA 2GAUA 2ZGOA 3R6SA 2BFUL 3E6CC 1LESA 5GZCA 3ATGA 3IDBB 3D4KA 1TQ5A 4IEYA 3RDIA 2MPFA 3ZYJB 4N43B 2ZMNA 2VW2A 1RVF3 2NMOA 4P9IA 1YJKA 2IC1A 1YJLA 3V0BA 4GWMA 3J4UH 3BIWE 5DUUA 2XB6C 5JSOA 5KXDA 4YW4A 3VLBB 2ENRA 3AXEA 5J7MA 4YFWA 5FMOS 5FPXA 3M2MA 2ZX1A 5CB7A 3AZZA 4Y24A 3E5UA 5LK7B 3VL8A 1REEA 1SLLA 1H4GA 1KS5A 5CIRA 4RHV3 4WM8B 1F8VA 1A78A 1EV12 4K6BA 1ND2C 1T6GC 1YFUA 2WQZC 3M8LA 3E5XA 3KS7A 2DTWA 3FLPA 4XXAA 5KHHA 4CDXA 3KD4A 1KQRA 2UY9A 1J1LA 4WVWA 5FLHA 4N53C 3ZN4A 4Q0PA 5FBZA 2XJQA 5K0UB 3KT4A 3QCWA 3AKRA 2WZR3 2CNAA 2XBO1 5E88A 2NYYA 2VXRA 4W65A 3ZXGA 4BOWA 1OMIA 1QOOA 5T5PA 4JGZB 1RUG1 4YRDA 3PVEA 4XDQA 4AQ6A 1MZFA 1LTEA 2UYAA 1I3HA 4LO7A 4B7EA 5JIUA 4A2UA 3GHMA 4L92A 4WZFA 5ABJB 2DUOA 2JICA 2WKKA 2A6YA 1ZZBA 3GBFA 4GMP1 4XJ9A 4CP1A 2AUYA 2HWD3 2DCYA 5E1RA 3WG2A 1KS4A 4HSJA 3POYA 5CAZA 1ZA4A 2RMU2 1DQ2A 3IIAA 5HCFA 4R4ZA 2QE3A 1NE4A 4AGVA 2RJKA 4XJZA 3AZXA 5FOBB 5BNNB 2XBO2 1QY4A 3K48A 1AYM1 4CP2A 4J1WA 2X53S 4RGAA 2WFPA 1FNYA 4LA2A 1RUG2 1ND2A 4K1YA 3O0VA 4Q0SA 1W6NA 3BTAA 1QJX1 2O1QA 4COVA 2VQ0A 1NQDA 4CDWC 2P3IA 5GZFA 1HQLA 1GKBA 2D6MA 3WXPA 1QGLA 1G9CA 3JQWA 4N53A 1A3KA 1DU3D 4GH4C 4RD7A 4WV8A 1RIRA 3ZSKA 2R49A 2GDFA 1R091 1IPJA 1AJKA 1O3TA 2TNFA 1LENA 3NO8A 1A6CA 1J59A 4ES9A 1BJQA 1JYCA 3JBG1 3PTYA 2WNEA 1H8TC 5GALA 1MACA 1LGCA 5KHGA 1IOAA 2V5YA 3AZWA 3VBUC 3N7KA 1TMF1 1R081 1IS6A 1AYM2 1LRHA 1CAUA 3BCWA 1XNCA 3SISA 4D3WA 3ZSEA 4AVSA 2E7TA 2E9QA 5GZDA 4KH9A 4AHXA 2C1FA 1SBFA 3IDEA 4FQZA 4LBQA 4XQ4A 3OCPA 4PCRA 1LU1A 2QDNA 2VOKA 4ZU4A 1LR5A 3C3VA 2JG8C 5LK5A 4X8NA 2VPVA 2R041 2D98A 3AKQA 1S0CA 4XEZA 1NZCA 3ZN5A 1ND3B 1ULFA 2ZHLA 4CEWB 1R092 2XVKA 2XBO3 2CV6A 2ZKNA 4N7IA 3M3CA 1OLRA 3M1HA 1BK1A 4WVMB 2YHJA 1RUG3 4XFAA 3LOBA 1YXWA 5BUVA 5C33A 1LCLA 3IPVB 4OI1A 4FP2A 3OPZA 4CDWA