3CJIB

Structure of seneca valley virus-001
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
238
structure length
238
Chain Sequence
GPIPTAPRENSLMFLSTLPDDTVPAYGNVRTPPVNYLPGEITDLLQLARIPTLMAFERVPEPVPASDTYVPYVAVPTQFDDRPLISFPITLSDPVYQNTLVGAISSNFANYRGCIQITLTFCGPMMARGKFLLSYSPPNGTQPQTLSEAMQCTYSIWDIGLNSSWTFVVPYISPSDYRETRAITNSVYSADGWFSLHKLTKITLPPDCPQSPCILFFASAGEDYTLRLPVDCNPSYVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords Polyprotein
publication title Structure of Seneca Valley Virus-001: an oncolytic picornavirus representing a new genus
pubmed doi rcsb
total genus 44
structure length 238
sequence length 238
ec nomenclature
pdb deposition date 2008-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3cjiB00
5ABJB 1AR63 2R062 2HWC2 3S6PA 5A32A 5C9AA 4RS5B 5BNNC 1HRI3 1NCQC 4N53C 2WZR1 1NA1C 4GH4C 1NOVA 1M06G 3DPRB 1D4M1 4CDQC 1K5MB 4Q4X1 1VBD1 2FZ2A 4N43B 1EAH3 1RMU1 3JD72 1R091 5BNPB 3ZFGB 5CFCA 5D8AC 1Z7S1 4Z92B 3TN93 2HWD1 1X33A 3VDDC 1IHMA 1AUYA 3ZFEA 1ASJ3 4Q4V1 1V9U1 1TME1 3JB4C 1VRH3 1HRV2 2WWSA 1RUF1 3VBSB 1R082 5JZGA 1FPN2 1ZBE1 1PO22 1BMV2 4FTBA 2DF7A 5BNNB 4Q4Y3 1VBA2 1RUG1 1BBT2 1NCQB 4N53B 2RS11 1NA1B 1RUI3 4GH4B 4RHV1 4WM7A 2HWD3 2ZTNA 1ND3A 4JGYA 4WM8A 1PO11 3ZFEC 1EAH2 2HWB1 2BUKA 4CDQB 1QJU3 1F8VA 1TME3 5AC93 4EJRA 5JZGC 2HWF3 1VBC3 2BFUL 3VBUC 4QPGC 5D8AB 3VBRA 3VDDB 1AYN2 3M8LA 1EV12 5DDJ1 4YVSA 4RQPA 1RUJ3 1SMVA 5ACA2 4RR3C 1AL22 2HWC1 1QJX1 1AR83 3VBFC 4WM8C 1PO13 3VBHC 2WFF3 1ND2A 4YVWC 1VB2A 5CFDA 4BCUA 1AR71 2MEV2 4CEYA 2WLPA 1FOD3 3JD71 4YVSC 4RQPC 1R1A2 5J98B 4Y5Z0 3ZFEB 1AYM3 2RS51 1QJZA 1QQP3 1HRV1 2RR12 5JZGB 1RUJ2 2HWE3 4QPGB 3VBUB 1PO21 2VQ0A 1RUH3 3CJIC 3JBG2 4CDUC 2WS92 2ZZQA 2RMU2 1BMV1 4IV1C 5C4WC 2R073 1PVC2 1VBE1 4NWVA 4RR3B 1RHI3 5FMOL 4CEYC 1AR73 1NCRC 1RUE3 1MQTA 2R041 1RUD3 2WFF2 4GB32 1VBA1 3ZFFC 1BBT1 3VBFB 3NAPA 1RUC1 4WM8B 1PIV2 3VBHB 5C8CA 4GMP3 4LLFA 1COV3 1MEC3 2RS53 1ZBA2 1C8M3 1HXS2 3J8F3 4YVWB 2RS33 1PGL2 1A6CA 1OHFA 3VBOA 1QJY2 1PGW2 5A33A 2XBO3 4YVSB 4RQPB 1AYN1 1QQP2 5L7OC 1EV11 1AR92 2X5IC 2GSYA 1RVF3 1FMD2 5ACA1 4IV3A 2Y26A 5C9AC 1AL21 1VBB2 2R043 3JB8A 3NAPC 1BEV1 2PLV1 5FMOS 2FZ1A 2WZR3 3CJIB 1AR62 4CDUB 1DDLA 4Q4W1 1WCDJ 1C8NA 4IV1B 5C4WB 1TMF1 1D4M3 1HRI2 4CEYB 1NCRB 4Q4X3 1VBD3 3ZFFB 2RM21 1RMU3 5CFCC 1B35A 1R093 3J8F2 2RS32 4AEDA 1Z7S3 1R1A1 2ZAHA 4Q4V3 1V9U3 3TN92 2RR11 3HAGA 1RUF3 2IZWA 1F2NA 1ASJ2 4Q4W3 5L7OB 1ZBE3 3JBG1 5ABJA 2WS91 1VRH2 2X5IB 2RMU1 1TMF3 4RS5A 2XPJA 1OOPA 1PVC1 5A32B 5C9AB 2R061 3NAPB 4GB31 1B35C 1RUG3 4AEDC 1POV0 4WM7C 2RS13 4RHV3 1PIV1 1ND3C 1VBD2 4JGYC 1K5MA 4Q4Y2 1RMU2 2HWB3 1ZBA1 1HXS1 4N43A 1RUI2 1PGL1 2HWD2 5CFCB 3VBRC 1QJY1 1PGW1 4FSJA 4GMP0 1QJU2 1TME2 5AC92 1AR91 1OOPC 5DDJ3 4Y4YA 4CDXA 1FMD1 1VBC2 2HWF2 2TBVA 4CEWA 1POV1 2HWC3 3VBSA 1VBB1 1QJX3 1W39A 4CDWA 1R081 1RVF1 1AR61 4RFT0 1OPOA 1FPN1 2BPA2 5LK7B 1AR82 1ND2C 5CFDC 4RHV2 1NA1A 1B35B 1PO12 4AEDB 4WM7B 3JD73 1HX6A 1ND3B 1VAKA 4JGYB 1NG0A 4CDXC 4CDQA 4CEWC 1EAH1 1FOD2 5FOJB 3TN91 4CDWC 1HRV3 5D8AA 1AYM2 3VDDA 3VBRB 1R083 1ASJ1 1FPN3 1PO23 1QJX2 1OOPB 1VRH1 4JGZA 2HWE2 1VBE3 1H8TA 1HQNA 1MQTC 1RUH2 1VBA3 1BBT3 2R072 1RUC3 1RHI2 1AR72 5BNOA 5C8CC 1RUE2 5K0UA 1ND2B 1RUD2 4Q4Y1 3IDEA 5CFDB 1RUI1 3VBOC 2MEV1 1GFF2 1COV2 1MEC2 2RS52 1C8M2 1QJU1 4PDWA 4CDXB 4JGZC 1AYN3 5AC91 4CEWB 1EV13 4QPIA 1H8TC 1NY72 4IV3C 2HWF1 1VBC1 5ACA3 1AL23 2XBO2 3VBUA 4QPGA 4CDWB 1RUJ1 1BEV3 1RVF2 1VBE2 2PLV3 5BNOC 5K0UC 5J96B 4RR3A 2R042 1AR81 1AL0G 1RUC2 1MQTB 2WZR2 3VBFA 2MEV3 2WFF1 2RM23 1CD3G 4PDWC 3VBHA 1D4M2 3DPRA 4SBVA 4QPIC 5C8CB 3LOBA 1E57A 1R1A3 4Q4X2 4YVWA 1CJDA 1FOD1 1R092 4FTEA 1RB8G 3VBOB 1Z7S2 4NWWA 2RR13 5BNPA 3ZFGA 1AYM1 5A33B 2BBVA 4JGZB 5ABJC 3JBG3 1V9U2 4Q4V2 2QQPA 1QQP1 2WS93 1H8TB 4RS5C 4IV3B 2RMU3 1BEV2 1RUF2 2PLV2 2HWE1 1PVC3 3ZXAC 4Q4W2 2R063 1RUH1 1ZBE2 4GB33 3CJIA 4CDUA 3DPRC 2GH8A 1TMF2 5BNOB 2R071 5K0UB 4IV1A 1RHI1 1PIV3 5C4WA 1K5MC 1RUE1 1NCRA 1RUD1 5GKAC 2RM22 1RUG2 1VB4A 4N43C 5BNNA 1ZBA3 3ZFFA 1HXS3 1HRI1 2RS12 5BNPC 3ZFGC 1NCQA 4N53A 4GMP1 2BFUS 4GH4A 4PDWB 1COV1 1MEC1 1QJY3 2HWB2 4FTSA 4QPIB 1C8M1 3J8F1 3FBMA 2RS31 1AR93 1NY71 1FMD3 3VBSC 2XBO1 1POV3 1VBB3 5DDJ2 5L7OA 1X36A 2X5IA
chains in the Genus database with same CATH superfamily
4LMFA 1E5HA 3DXUA 1UX7A 2VU9A 2JB4A 4R9AA 4S2FA 2WA4A 4AR2A 3Q8CA 5A32A 4BLIA 2CGNA 2G9FA 4META 3J4UH 2D6LX 5G05L 5T5OA 5H9QA 1JW6A 4DXSA 2JDZA 1NCQC 3B5LB 4FO9A 1ZRRA 3IDBB 3OJBA 4N53C 4WBBA 3TBDA 3L9JT 3BU7A 1OBNA 4PIZA 1A8MA 4H3WA 3AZZA 4CDQC 2XJSA 1AXYA 5DG2A 3ZMOA 3ZN6B 3WP6A 3WNLA 5EPAA 4UBHA 5DXDA 3GZEA 3ZSKA 4Q1RA 3WQ7A 3JD72 1RJ8A 2ZABA 1BHGA 1RTVA 1SCSA 2D97A 3HJRA 2G9ZA 5D8AC 1Z7S1 2VOVA 5CA6A 2P3IA 3I2JA 3UKTA 3VGIA 3OBRA 1LB2A 2WUHA 2FQPA 1S0DA 4M0NA 1CAUB 4N7IA 2VXJA 4LA2A 4Q29A 4BMEA 1F15A 1VRH3 2DU1A 4LBJA 1YHFA 1AX2A 4K8RB 1O3SA 2BTVC 2NM1A 1SBDA 2CWSA 2C9KA 1YI9A 2K0GA 2ZPXA 4W50A 2LM3A 1OQEA 4LORA 1HQWA 3CL1A 1W0OA 1BMV2 2RV9A 3MIHA 1GR3A 4Y3OA 4FTBA 2JWPA 1UY0A 3WDUA 4AAPA 3KT1A 1UXZA 2DF7A 1LOFA 2ERFA 2NPIA 5BNNB 1NLRA 4LKDA 3B69A 2BYVE 3PIJA 4L8QA 5FP9A 3AMQA 3AZXA 1BBT2 2FBEA 4AVBA 5FZMA 4MGZE 4IEPA 1U0AA 1D7PM 5FLJA 1BKZA 4AG4A 3SKVA 4AZZA 4JGYA 3TB0A 4OHXA 2C9AA 2HEVF 5FY7A 1G9BA 4WVWA 1WD4A 1QJU3 3HBKA 5A7NA 1TME3 4LE4A 5FP4A 1OD5A 2VY0A 3MPPG 4BK4A 3PJYA 4XYXA 2HWF3 1VBC3 2BFUL 5DZGA 3GGLA 5IFTA 5FQ0B 2VCBA 4QPGC 1I1EA 3VBRA 1N47A 2P34A 3TNPB 2CU5A 2ZAAA 3OYWA 3WG2A 3WNKA 1AYN2 1Y3TA 5CISA 1XNBA 2IVIB 5I0SA 1RUJ3 2HEWF 2HH9A 4XABA 4BHPA 4MSVA 4GWIA 1ULFA 3ACIA 1ODNA 3POEA 1PK6B 4YWAA 2HWC1 4S2HA 5FOBB 3PNAA 1NAEA 1QJX1 2YBKA 2TUNA 3PUSA 4C91A 3LPFA 2AACA 2BDRA 3K4AA 4ISRA 3SMHA 3OGSA 3ZKYA 4FAHA 4L11A 5FPXA 3WHTA 4M3CF 4AVAA 1ZZCA 1GNHA 3LZZA 4KWLA 1G6NA 4LBLA 3HNYM 2XKOA 2C6SA 2YDEA 5K4LA 3VN4A 4E4ZA 1AR71 2VUJA 2ARCA 5JMOA 1W2TA 3BN6A 4J6GA 5ERLA 4TZDA 2DYCA 1KQRA 4NIAA 1C1FA 4RA0A 2W1SA 3NNMA 1JZ5A 2JX9A 5J98B 3ZVXA 3K48A 1WW5A 1VPHA 2XJVA 5JXHA 3UKVA 5HI0A 4I30A 2OA2A 5SV5A 3RWNA 3VLBB 2F17A 4AWDA 3AJZA 1HRV1 1LTEA 2JE7A 4E8CA 1S2EA 1RUJ2 4OYUA 4LOSA 3B01A 2WO1A 2B42B 3O0VA 3LA2A 3VZJA 1DLLA 1Y9QA 1RUH3 2JD4A 2VQ0A 4MGIE 1AJOA 5EYYA 4BM8A 1WBLA 3FLRA 4NHLA 3J7LA 3ETPA 4O9GA 2WSUA 1G9DA 5C4WC 1PVC2 4AHXA 5FMOL 4YGBA 1FNYA 2ORZA 4EN9B 4WVVA 2CDOA 3PMSA 1MQTA 2R041 1N1SA 4QU2A 5JOXA 4DO0A 2A1XA 1UU5A 2WINB 2D5FA 5IUQA 3MHZA 2HKXA 4RGGA 2JDAA 4WM8B 4OI1A 1D4VB 3NV1A 3VBHB 1QJFA 4GMP3 1KGYA 5F8PA 5C8CA 5C33A 5M0TA 3CZUA 3NKTA 1TNFA 1HXS2 3J8F3 4Z07A 4AQ2A 1I6XA 2PHLA 3OUJA 1XSQA 3NJVA 1ENXA 4LHKA 2DFCA 5FXXA 4CPBA 4JHTA 5F2SA 2RG4A 3MF9A 1OT5A 5GLZA 4LUKA 1W6PA 2XBO3 4PLMA 4DNYA 4RYDA 1T2XA 1KS5A 3J7HA 3LEKA 3OSDA 3AFKA 5FP8A 5CKNA 1EV11 2AENA 1YRZA 2DFBA 2X5IC 3O12A 2GSYA 3M2MA 1GBGA 3EBRA 3OCPA 5T5JA 5JXJA 3VDAA 5LA0A 3O1SA 1MPXA 4EYUA 5IHRA 1UO9A 3MV01 5C9AC 4J25A 1W8FA 5LZ6A 1OLQA 4FFGA 4Y33A 4MGTA 4XFGA 2R0FA 2JDUA 4LBNA 3C7FA 2E7TA 5FY8A 3ZX7A 2VD7A 2VOXA 2VW2A 1EY2A 2WT0A 3OY8B 2A75A 3ZSJA 3O0XA 4Q4W1 4YZ4A 1WCSA 3HVDA 5J7MA 3H3UA 2V4AA 5B4NA 5CAZA 1HRI2 4IEXA 4URTA 1XSRA 2ZX0A 1BK0A 4YZ2A 3S30A 2QQVA 1VBD3 4Q4X3 2PQQA 1GP5A 2YFZA 4HPKA 5FZOA 3RNSA 5KR7A 2A3WA 3J8F2 4YNIA 4CP9B 5IK5A 2J1VA 4KG0A 1GNZA 2QQWA 4P9IA 2BNNA 4JRAA 2W95A 4RGAA 2ATFA 4BMBA 3FFZA 2RR11 4QWNA 3HAGA 1HN1A 2CHHA 5FY5A 2YMZA 1RUF3 5HBAA 4YPJA 5L9VA 4AAXA 2ZGKA 2OX0A 2R0HA 1DYKA 3NSTA 4QDQA 5JIUA 1ASJ2 1CGPA 1YWKA 3JBG1 4XF9A 3NL1A 3BIWE 4AF9A 1IG3A 2OIIA 1W6OB 2P1BA 1H2NA 1QNYA 1TMF3 3R0RA 3ZXFA 1MVEA 4QPWA 5A6QA 1JBCA 1KJLA 3MF6A 1W2OA 4FPHA 5FXZA 3SCFA 2Z2SB 2YC0A 4XJ8A 4R8HA 5J36A 3P6BA 3ZXJA 5JSPA 1OLMA 1YCIA 2Q8OA 1NXD1 1LCLA 4WM7C 2H6CA 2RS13 1QDOA 2VR4A 2Q1MA 4JQTA 1VBD2 3KT7A 3MLJA 2JG8A 1YO8A 2ZMLA 4RL7A 3ZMNA 3ZN6A 2HWB3 2VZTA 2W91A 5IYYA 2VXRA 3LFMA 2BRTA 2C24A 3UNPA 3ACHA 4QM8A 3U07A 3KV5A 2ADEA 2GNMA 3GBWA 4IE4A 1YC61 4NIDA 4ZU7A 4YGDA 1PGW1 3VD3A 1E5SA 4FSJA 4GMP0 4QU1A 5DQ0A 1CAUA 4KG8A 1BXHA 5AC92 1ZX5A 1AR91 2JG9B 3E5XA 3CO2A 4Y4YA 4DUXA 3D8CA 1YQCA 5LY1A 1EPWA 3N36A 3AYAA 4MG2A 2P4EA 2JB8A 3HN1A 1VBB1 2XLAA 3I2FA 3K2OA 2PYTA 3ZSEA 5FR3A 5TSWA 1GMMA 2QQKA 3R6SA 4XQDA 2GMMA 4KGGA 3CDZB 3Q8FA 2JG8C 3PVEA 4Q27A 4RFT0 1SFNA 1STMA 2C1FA 2QE3A 5F1RA 1JTZX 5DZFA 2BPA2 3AC0A 1O5UA 3UJOA 3IMMA 4IDZA 1SBFA 4ORFA 1OVSA 2XVKA 4XQ4A 3WF1A 4AFAA 5E8AA 1UKRA 1XC6A 1PO12 3HOBA 4BXFA 4AGVA 5FPUA 1JHNA 1YFYA 2Y6JA 1ND3B 1NG0A 1WMEA 3F95A 4E2QA 3B9IA 1OLME 4JDNA 2C0ZA 4OZOA 5EP9A 3FLTA 3ATGA 1GP4A 5FOJB 2D6KA 1WUVA 3MIBA 1WBFA 4Q0SA 3S5QA 5GZEA 3VHOA 3GALA 3I3DA 3UYJA 2ADDA 4EWAA 5FREA 4XZPA 1R083 1FT9A 2XL9A 1XB9A 1FPN3 2BGCA 1ZZ9A 3USSA 1XE0A 1K12A 1NZCA 4QXKA 2W39A 1VRH1 3THPA 4DXZA 1PK6A 3B3QE 2Y6GA 4UBGA 3VKLA 4AOCA 1VBE3 2Z42A 3SXWA 3V0AB 1HQNA 5FYZA 4B8EA 2GNBA 5I93A 4BLJA 1AX1A 4UFHA 4O65A 2A6ZA 1FAYA 4CUCA 5F3GA 5FYIA 2FDJA 2NMOA 2R072 4X6QB 4YW1A 2OZ6A 5JI7A 3VHPA 4KNCA 3WUDA 1QXPA 4NN0A 3NJZA 4AHZA 3H50A 4AVSA 1ND2B 4UW6A 4I01A 1W6NB 2RDRA 5FZ9A 1C4RA 1QKQA 3IDEA 2QNKA 4JX0A 2Y6HA 3S5AA 2ZGUA 1S0CA 3V65A 2RJLA 3HQUA 3VBOC 5K8SA 3LA7A 4HK8A 1PZ7A 2GC1A 4Z8BA 3RZKA 1YQ2A 1DQ0A 3MIEA 1MEC2 2RS52 3WNXA 4ZZ5A 2F4PA 2WO7A 1MS8A 3B02A 1QXJA 1QJU1 3AZYA 1F31A 4CDXB 5JSRA 5KXEA 1IKQA 1SCRA 2IXLA 3POJA 4XUTA 4YYOA 4GULA 5FFOC 2HWF1 1VBC1 4ZZ8A 5HCBA 1VE0A 3HNBM 3VD9A 2Y6LA 2DVGA 4ZXKA 2XLGA 4YZ1A 3BVCA 2GN3A 2VMCA 4LUMA 2LW8A 4V2VA 5CYYA 2WL1A 1DQ1A 3VZLA 3U75A 3IKWA 1RUJ1 1BEV3 1RVF2 5EXOA 1UYXA 1VBE2 4D7SA 1WCUA 1ULGA 1WW4A 2N7GA 2D5HA 1MS5A 3I59B 4LKSA 3ZYIB 1SPPB 3FBYA 5FP7A 3WQ1A 3RZMA 3N9LA 5AFBA 2L9LA 2VCMA 5L19A 5IJRA 1JYWA 4K20A 2R7EB 5JSOA 3C7OA 4EN0A 3RZZA 4DB5A 1DQ5A 3WG4A 1CPMA 5IVJA 4NUBA 1MS3A 4CCJA 3VBHA 1MS9A 3B93A 4ASLA 3POBA 5FUPA 2DWRA 1U5YA 3LOBA 1E57A 1L7QA 3T2PA 4AEMA 5IVVA 4ASKA 1QGLA 1L7RA 4Q0PA 3T30A 5IK4A 5AVAA 4X8NA 5F2WA 1Z7S2 3OEBA 4NWWA 2JICA 5BNPA 1H2LA 2EICA 3PL0A 1M4WA 2BBVA 3FX3A 1BVVA 4GAZA 3NV2A 4YGEA 5FK8A 4NMIA 1OA4A 1DYPA 2WS93 3JU9A 3BIEA 3AMPA 4RS5C 4IV3B 3KMHA 4NOTA 1W9WA 1BEV2 2RMU3 4D7TA 2B39A 2YFUA 2OPKA 3RJ2X 3ZXAC 2WLQA 2WNUA 2WRAA 5LBEA 3VZKA 4ZKTB 1OQDA 1RUH1 2R063 4FFHA 4QB2A 1SFYA 1KDMA 3OY8A 4XF3A 4COZA 4BPZA 3P5BA 5BNOB 2IFWA 1CR7A 2WAOA 3C7GA 4XVHA 5K0UB 1CN1A 2VZSA 2VBBA 2WBKA 2J1TA 2QZ3A 5FO8B 5FZ1A 1ZNPA 2FCTA 1VB4A 3M1HA 4N43C 4PQQA 4A6SA 1CAVB 1ZBA3 1HRI1 5F9TA 4Y24A 2JDHA 4XIOA 2QBXA 5BNPC 3FFQA 4G3YC 2Q1ZB 1Q3EA 3UETA 4U2AA 1QEXA 1SACA 4LO6B 4DOUA 1J3RA 2PAMA 4GMP1 1QOSA 1W8TA 4HANA 4C0BA 4COYA 3AKSA 2PTMA 3MLLA 4FTSA 4RGKA 5BY5A 1S1AA 3J8F1 3FBMA 4HN0A 1QHDA 4KWKA 3Q8AA 4HFSA 4LR4A 4CTEA 4L92A 4YW6A 4LO5B 2LALA 3CLPA 1NY71 3T08A 2A73B 2WNVA 2WNUC 3KZ4C 1H2KA 4M01A 1IS6A 1FMD3 1SLTA 4KU7A 4GJYA 4MUVA 3WNOA 2XBO1 2DVAA 1GU3A 3RQ0A 2JE9A 3GZUC 1X36A 4Y5Z0 4D7YA 5CVRA 3UGFA 5ABJB 2ARAA 4GJZA 3MV11 2R062 2HWC2 5F3CA 5IK8A 3OGRA 4LE3A 3LSEA 4L2NA 2V5YA 1DHKB 4XMIA 4WVMB 4XJUA 3ZYFA 3BODA 2NP0A 2ZX4A 3Q9OA 1H1IA 4M4PA 1JS9A 2H6BA 3DPRB 3QOPA 4GD4A 3BOPA 4I02A 1GICA 1UWWA 3ACLA 3VZMA 4A41A 4ZHNA 4D94A 3WVJA 4XFIA 4NPMA 4QQHA 1K5MB 3I3QA 5FYCA 4TXWA 4Q4X1 1VBD1 2WNVC 3OG2A 4LIVA 4CZSA 3N9OA 1PHMA 4NRPA 4OCTA 5EIYB 3IAPA 4E4SA 4L0PA 2W1WA 1YI7A 2G19A 4BH9A 4C8DA 1XYOA 3RGBA 3TN93 5GZFA 4Y1ZA 4UFMA 3K75B 1X33A 3VDDC 3V0BB 1LOBA 1V6OA 3ZYJB 2JG9A 1CIYA 4XDQA 2C5DA 1GLHA 1RINA 1HB1A 1WLDA 3EMRA 2VVFA 5SV8A 4Q26A 2LRPA 2FMYA 1HRV2 4XF1A 1RUF1 1XU2A 5I0UA 1EUUA 3POSA 2GC3A 2JDNA 3JUUA 4KBBA 1Y4WA 2VW0A 3NNLA 4JC1A 3N7JA 5FBZA 4KQ7A 1SZBA 1U5XA 1YYNA 5JWPA 3URFA 1HIXA 3T4HB 2KA3A 3ZN5A 1WLTA 2A6WA 4GA9A 1DFQA 2XL7A 1IGOA 4N9HA 4Q4Y3 2VG9A 1A3KA 4IESA 4YG6A 4FQZA 2C4XA 2JIJA 1NA1B 1RUI3 2RS11 2VZ3A 4GH4B 4PIYA 3SH5A 3AKQA 1I5PA 2HWD3 2ZTNA 2GC0A 1S0JA 2QQJA 1ND3A 4UI9L 4XFAA 4YM2A 3SH3A 1ZRFA 3NRUA 1PO11 1K45A 1GWMA 5A6YA 4NIHA 3NKGA 2HWB1 2E31A 3GBFA 3LEGA 2R49A 3R4SA 1ZZ8A 3ME2A 3ROUA 1QOOA 4BQ1A 5T5LA 3ZYHA 3LDRA 4W6WA 3K51A 1OSGA 4MGSA 3FUOA 3PURA 3ZXGA 1S2BA 4E9KA 3GHMA 3CIHA 1EV12 1WD3A 4YVSA 3IIAA 4LT5A 2QQOA 4RQPA 5KHHA 1ZM1A 1ENSA 2BOIA 4I0WB 3T3YA 5JOYA 1K5JA 2DUPA 2QKDA 4J1WA 3HNMA 1EUTA 4QD2A 2QDRA 1SBEA 3DEMA 3THDA 4CUBA 1HB3A 5J3UA 1J58A 1U5IA 4Y20B 3L2YA 3VBFC 5B4XA 4GALA 4K21A 1UYPA 2ZGOA 5LEKA 2XG3A 4NE9A 5GM0A 3D0SA 4FPKA 2VQTA 4P08A 5LK5A 4UWDA 3SHRA 1UZYA 1GZTA 1GWLA 1ND2A 1W6NA 4YVWC 1VB2A 3S7EA 2YPJA 1VP6A 4DUWA 1OF3A 2MEV2 5FY1A 5IVBA 4U36A 3E6CC 1DG6A 5AVPA 4EV0A 5LEJA 4E4HA 1FOD3 4CXYA 3HPNA 4JDMA 3VHNA 1UD1A 3U37A 4YVSC 2J42A 2VECA 3I4IA 3MFAA 4RQPC 3ZFEB 1C1LA 3CNAA 3AMMA 5A3MA 4AVTA 3IIIA 2NZ9A 1C5IA 2RS51 4BA6A 3OUIA 2Z4FA 1LOAA 2HEYF 2K9ZA 2RR12 5JZGB 1E5RA 1YFWA 2EALA 5IVEA 4QMAA 2HWE3 3VBUB 4J1XA 4AE2A 3LWCA 2QTWB 3HR9A 1UMHA 5KC5A 2IC1A 3CJIC 3JBG2 4XUOA 4QKFA 4CDUC 2UY8A 5DAQA 3AYDA 3I59A 1SPPA 1VBE1 4RR3B 1W8ZA 5C3SA 1XXNA 2VQAA 1HJFA 2EXKA 3GZTB 4B4RA 3CBNA 2EVXA 3MO4A 4Y5SA 3LB9A 3SLIA 5A6XA 3PU8A 3ZFFC 2YU1A 5CZKA 1ZREA 4BIFA 5FK7A 5LY2A 1DZRA 2EAAA 4UFJA 5JR7B 5C5UA 1UCXA 3RMXA 3RI8A 4ITCA 4A7KA 2G9GA 1JI6A 1YNAA 1LHVA 2UURA 1COV3 2BERA 2JJ6A 4QB1A 3M3OA 4KL1A 3SEPA 5ANQA 2D3SA 2RS33 3BB6A 4O61A 1H30A 2R1BA 3SQOA 1A6CA 1OHFA 3IDAA 5FZLA 2Z79A 3ZR5A 3VDBA 2GN7A 4A3XA 2DDUA 1PGW2 2O0OA 4IEZA 2JDYA 1OC1A 1HV0A 1OKOA 2B45X 1AR92 2RJKA 4R4ZA 4P9YA 3NNGA 5FIXA 4AL9A 1MZ5A 1CAWB 1XNCA 3PU3A 1GZWA 1OH4A 4IGOA 2JECA 4IV3A 2IXIA 3H1MA 3HBZA 1AZDA 3GYDA 1RITA 3D6EA 5EJ1B 1GANA 1VBB2 3AL5A 3NV3A 4KGQA 1CAXB 2B4KA 2EF6A 3H0OA 3ZIXA 3CHXA 4ZONA 4CU6A 1BEV1 5C3RA 4DS0A 4CXXA 1XU1A 2NN8A 4HK9A 2FZ1A 2WZR3 1DDLA 2C26A 2XWBB 3RSJA 3W5MA 1WCDJ 4ET7A 2WWJA 4IV1B 4BYYA 1LJ7A 1Q8PA 3N9QA 4ATFA 2ZHNA 2BWCA 3WNPA 4COWA 4CXWA 3WP5A 4AHWA 4CEYB 4MVTA 1NCRB 1W6MB 1CAVA 2JDPA 3RS6A 4FPEA 4HL0A 2Y64A 1V6MA 1RL3A 3QH7A 1WW6A 3T1MA 4CP2A 1JUIA 1B35A 1R093 4QX2A 1QOTA 2B46X 2DU0A 2RS32 4AEDA 4EQVA 2Q8DA 3WP3A 3T09A 3ZSLA 5D2AA 1YJKA 1C3HA 4MYEA 5IK7A 4PI0A 5IVCA 2GNDA 4FT8A 2XWJB 2CAVA 1V9U3 2W2IA 3VKFC 4BWOA 3KVAA 5FUNA 2EA7A 5A3LA 2VMGA 4JHZA 4GZ9A 2D6NA 3V56A 3WDWA 2IZWA 5FDBA 2FDIA 2CDPA 1LOCA 2ENRA 2ID4A 4QM9A 1N1TA 2B7YA 4FCAA 4QQ2A 1ZBE3 2GP3A 4C90A 1LODA 5L7OB 1YFUA 5ABJA 2WS91 1VRH2 3DF0A 4Q0QA 1ZRDA 1MZEA 1JN2P 2RMU1 2Z69A 4K6BA 1V6KA 5FZ7A 1OOPA 3MBWA 2OUHA 1G9CA 1LOFC 3FHIB 4ISQA 3FZ3A 2QQLA 4WVMA 2R061 4XBLA 3EQEA 3FL7A 2PXJA 2BGPA 3NAPB 4XAAA 3THCA 1B35C 3NJYA 1YEWA 4AEDC 5FYBA 4AW7A 1OMIA 4BDVB 1T6BX 4LNVA 1KFXL 4XMAA 1O3TA 3CJXA 4AXOA 3KHCA 4JGYC 2XJRA 1FV2A 2JDMA 4QGMA 4XBNA 1K5MA 3H7JA 1MVQA 2BNMA 4AFBA 2OVUA 5BXXA 1Z78A 1ZBA1 3VB9A 2O8QA 3D4KA 1PGL1 2WC2A 4MZUA 5GLUA 1ZZ7A 4C1XA 3QD6A 1JYCA 2Y0IA 1LHOA 3V0BA 5CFCB 3MFCA 2PFWA 5F5QA 3VBRC 1CIWA 2NMNA 3RZLA 1QJU2 2BVVA 1SFPA 1OA2A 1TME2 1WA6X 3AZVA 3M3EA 4Y4RA 5DAXA 5DDJ3 1OOPC 5FYHA 3OB8A 4FI9A 4EN7B 1XJAA 4FPOB 1FMD1 1VBC2 2HWF2 3RWKX 1H6XA 3WHUA 1ULCA 1D2QA 1UYYA 3ECQA 1REFA 1I3HA 1VAVA 3I2IA 5CU1A 4Z2WA 2JKXA 3C8XA 3POIA 4GXLA 2UYAA 5EQUA 4CDWA 1IS3A 1G8WA 3P3NA 3VD4A 3TRSB 2QFEA 2ZOEB 1QIQA 2GU9A 5HV4A 2XB6C 2A70A 1DZQA 1CZSA 2CSGA 3UL2A 1JZ8A 4QXCA 3AM2A 3WQ0A 4UF0A 2GAUA 1GZ9A 4DZGA 2A6XA 5A70A 2VJXA 4UT5A 4IEYA 1O8PA 1LECA 4IETA 3MIGA 4LK6A 1NA1A 2DUQA 1ODMA 1LHNA 3WG1A 2VMHA 4D6SA 5KXCA 3IWZA 4Z1VA 1NLQA 1W8UA 4AI8A 2E26A 5FLHA 1QJEA 4YGCA 4FOVA 5I8SA 2CTVA 4PLOA 2GC2A 1W99A 2I74A 1Y9MA 2YC2A 5FZ8A 4QPYA 4LO4B 1W2AX 2D7FA 2VZPA 3TN91 2CL2A 4AFDA 4CDWC 4AYUA 4QHZA 2X10A 2QDNA 3ON7A 2A6YA 3NWKA 1JZ2A 1Q8OA 3NJXA 4YW3A 3KQRA 1PO23 1U5ZA 3FUQA 3K3OA 4IE5A 3SKJE 1UZZA 5KHKA 5L36A 1JOJA 1BVP1 1JXNA 1DGWX 1O91A 3HN3A 4LHSA 5F39A 2DCJA 2SLIA 2EXIA 2XUMA 1H8TA 3VV1A 5A3WA 4Y20A 2PN5A 2TNFA 4OHVA 1MQTC 2FDFA 1MR5A 1RUH2 5ANNA 5CG8A 3B9CA 1UY3A 2F6BA 1VBA3 4XE9A 3MW4A 3PJQA 3WZ1A 1CX1A 1VAMA 2Z5WA 4XZUG 5DAWA 5C8CC 2BQPA 3INAA 2YROA 3K46A 4D6QA 2YBPA 1FXZA 5JUVA 4Q4Y1 4UFLA 5J37A 3WW1A 5CFDB 2BV4A 3ZKUA 1RUI1 1H9WA 2FCVA 2B9VA 2V09A 4COVA 4NRQA 5KHGA 2JE8A 4K40A 4OHZA 1TE1B 2MEV1 4MOAA 2ZGMA 1WGPA 1GFF2 4UW3A 5IVFA 1RGSA 5LA1A 5FRAA 3B00A 4DXTA 1PGSA 4XJAA 1KFUL 3OPWA 3T0BA 3D3AA 4CEWB 1BYHA 1IPKA 1H8TC 1NY72 1XNTA 4LLOA 2XVGA 4Z2AA 1NT0A 5ACA3 3OTFA 1AL23 2XBO2 2XMLA 3VBUA 1OQ1A 1I5ZA 2VOWA 4QX1A 4QX8A 4DFSA 4UW5A 2Q5TA 5FLIA 3LFIA 3T2OA 1W28A 2K46A 4KBZA 4RR3A 2ZJCA 3U4SA 4BQWA 2Q8CA 2E7AA 2WDBA 4LIUA 4P5HA 1S0EA 3AMHA 1KEXA 5EZWA 4I3PA 4RD7A 1HB2A 5F5CA 1AF9A 5A7WB 5EJ3A 4YZ5A 5I8YA 5KHIA 2RM23 1IS5A 2VVDA 2FDKA 5FZIA 1JYVA 3EJKA 2GALA 4SBVA 5FXVA 4DINB 4JDOA 5JOWA 3ZM8A 1R1A3 4Q4X2 3UKNA 1X9PA 4I0BA 4A4AA 5FPAA 3HMYA 1ST8A 1BK1A 3MLKA 1FOD1 2UWAA 1A34A 1O5LA 5KXDA 4LXLA 2DCYA 4QKBA 3WG3A 4FTEA 5LASA 1EPZA 3ILRA 3POWA 3D5OA 5A33B 3BTAA 5BPXA 4HVQA 2KM2A 3USUB 4Q0UA 1ZRIA 4FPYA 4LPLA 1CAWA 4JGZB 1F5FA 4FPJA 2W1QA 4NVPA 2XGXA 1RUF2 3T0DA 1CAXA 2HWE1 2ZBJA 4P00B 4QHBA 3E6DA 4FP2A 5J09A 2HYXA 4DUVA 4MGYE 5FZFA 1GZCA 1LOEA 4GB33 4Y1XA 4A3ZA 2E63A 2GH8A 3MI8A 1TMF2 4IGPA 3WDTA 1OUSA 4IV1A 4YW4A 2DTYA 1PIV3 4E27A 3OEAA 4QGLA 1NCRA 1W6MA 5GKAC 2E51A 2RM22 3KQ4B 5BNNA 1OXCA 2ZEZA 4FVVA 3AKRA 3FE5A 2RS12 3S7IA 2LUWA 2VOKA 4OQ8A 4CA9A 1NYWA 1WZXA 1F35A 1SLCA 2WYSA 3A0KA 2BFUS 4FOWA 4Q2FA 4KI5M 4PDWB 2EIGA 1COV1 2VUAA 1JOBA 1QJY3 2HWB2 2XLFA 2AEZA 4QPIB 5F6LB 4ZU5A 2OKXA 3ZYGA 2RS31 5C70A 1ONAA 3GDBA 4XF4A 2QUOA 2G4IA 3AKTA 1HW5A 2PHXA 2ET1A 3EB7A 4K8FA 4PF5A 1JZ7A 4YW2A 4YARA 2DCKA 4P14A 5FZEA 4H7MA 1JZ4A 1POV3 3PIGA 3H8UA 1Q8QA 1CX4A 5FQ0A 1O4YA 1LEMA 1TG7A 1GNYA 2WIIB 3IBMA 4OHWA 5BUVA 5CBLA 5L7OA 1NQDA 3BKZA 2IXKA 1QH6A 4NHYA 3H8RA 1AR63 1TVGA 2UWBA 4NRMA 1OF4A 2W08A 5FYSA 1PVXA 4V1PA 2E33A 5BNNC 2DV9A 3OPZA 4XUNA 3O5SA 1ULOA 3C3VA 2WZR1 4LEJA 2VVEA 3T1LA 4BOWA 2PMWB 5HCAA 4ES9A 1V0AA 3HT2A 3IB3A 4CU9A 3AMNA 3W58A 5JIAA 2WKKA 4XHXA 5JVVA 4IE0A 1D0HA 4L99A 4W8JA 3VL9A 1PMHX 2FZ2A 1HQLA 2J1SA 4I09A 4LKEA 4MXWB 3ZYBA 1DQ2A 5I0TA 2YXSA 2DTWA 3CEWA 3M7AA 2YUEA 4AEJA 1R091 5IAVA 5LWBA 3ZFGB 4RSUA 4EWEA 5CFCA 2XHNA 3I2KA 4HZFA 4UFIA 1NX9A 3OPTA 4Z92B 4FBFA 1WCKA 3N9NA 4R9CA 4XXPA 4QKNA 4YFWA 1IHMA 1AUYA 2CWMA 2RDQA 4K9SA 2EIDA 4NPRA 4P9GA 1F4HA 4X8PA 2ZGNA 4DY5A 3BTYA 1PK6C 1V9U1 5FPLA 1TME1 4BQ4A 4F83A 4EWDA 4HONA 2WWSA 1LULA 4FPLA 4QAWA 4COUA 1S0FA 1S2KA 3VBSB 1R082 2JIGA 2XVLA 2ZHKA 3W59A 2X29A 1FPN2 1ZBE1 5HXVA 3WQBA 4HLTA 1JODA 3N35A 1SLIA 4PT6A 2VO5A 1RJ7A 2LROA 4Y22B 3AP9A 4A2UA 1KRIA 1BCXA 3ZR6A 5EV7A 2VGDA 5FCCA 1G9AA 3FC0A 4IQPA 1W0NA 3ABZA 4MV2A 4QB6A 3AX4A 1NCQB 4N53B 3FLPA 3IPVB 3GJBA 1ALYA 3DUIA 4M4RA 3SCHA 2GZWA 3GM8A 4WM8A 2HBTA 1POQA 3PTYA 2DCZA 1SQ4A 5FXWA 5A1AA 3ZDSA 4CDQB 5IT6A 3ORJA 1F8VA 2VCCA 4A7YA 3PUAA 4S2DA 1S0IA 4M3CB 4EJRA 4PLNA 4XETA 1O3QA 3FN9A 3MUY1 2IWGB 1XYNA 3PUQA 5D8AB 1UOJA 2ZZJA 3LPGA 1UY4A 4MHUA 5DDJ1 4A7ZA 4M0HA 4CPBD 4Y26A 1SMVA 2WNOA 3U10A 3A23A 1Q5OA 4OUEA 5HXMA 3D82A 3ELNA 5GLWA 2V4VA 4LO7A 1AR83 1CONA 2AREA 1OD3A 4GWMA 4PI2A 2X53S 3ILNA 1V00A 1QMJA 2ZEWA 3UGHA 2NYYA 2OZJA 4WM8C 1V6NA 3DKQA 2RE9A 3VBHC 3WD5A 1OUXA 3SNMA 5FKBA 4CCOA 2PHTA 2EAKA 1IQAA 2VE1A 4WVZA 4GWNA 5CFDA 1GYKA 2FCUA 2OPWA 5FWEA 4BCUA 3U14A 2WLPA 5FO7B 1V6IA 2E9QA 4LOTA 1F4AA 1OI6A 5IAXA 5F5IA 3N7MA 4AFMA 2MHFA 4MX3A 4CP9A 5C3PA 1AYM3 3O1RA 1RXFA 1GWKA 3WT3A 5FWJA 3EYPA 2PELA 1IPSA 3QCWA 3KGZA 2FMDA 1OURA 3H3LA 3BYWA 1QDCA 4QPGB 4QKDA 1L3JA 1NE6A 2DUOA 1JZ3A 4BZ4A 1PO21 5FZ6A 1RUNA 2WS92 5CB7A 1F5JA 4YFZA 2RMU2 4OVEA 1GV9A 1X82A 2B8MA 3ES1A 4QDRA 1RHI3 1W6OA 4YLZA 1AR73 4QXHA 1RUE3 1LGBA 2Q4SA 1W06A 4INDA 1SHWB 1RUD3 2YV8A 1VBA1 4LKFA 5HCHA 5KWRA 1QF3A 2Q0AA 3A22A 2VAUA 4TSVA 4Q5OA 5FMCA 4B29A 4OFGA 3FJSA 4DIQA 1V70A 1HKDA 4ARXA 1G7YA 2UU8A 2ET7A 3FMGA 3DL3A 4AGGA 4CCEA 3I3MA 3AP5A 1HN0A 5A7OA 1ZBA2 4XILA 1C8M3 2BJSA 1YQ6A 1DCSA 2WQ8A 3G6JB 1PGL2 2PHRA 2PAKA 5JPNB 3ZYRA 1DGRA 4P9JA 3ZPYA 1W03A 3OYWB 1BQPA 4C0HA 5A33A 3DCQA 1ENQA 4W65A 2P5BA 5A7QA 1UIJA 4AVCA 3WNNA 3RMYA 3USUA 4EN6B 3QLQA 1JYIA 2PHWA 5A7SA 5GZCA 1MZ6A 3R4UA 3MIDA 3AYCA 4FFIA 3N7LA 4HBNA 2IVJA 2WN3A 1FMD2 5ACA1 2P3JA 2ZHLA 5E1RA 3H1WA 2XQRA 2Y26A 1AL21 1RUOA 3C7EA 4BU2A 4MLOA 3AZWA 2R043 3JB8A 4KU8A 5FZCA 1YQ8A 2AZ5A 3WCSA 3M70A 5FZ3A 1OA3A 3GBGA 2PA7A 5G04L 5E89A 1TEIA 4XOGA 3UJQA 5FZGA 3E6BA 1J1LA 3W20A 4GKXA 5LA9A 3W21A 2VTXA 2HBUA 5C4WB 1TMF1 1D4M3 1PNGA 2VULA 1JU4A 1WMDA 3O14A 4YM0A 3F2ZA 3KM5A 2VZRA 5JXGA 3ACGA 3U78A 2J1UA 2Q30A 2RM21 4GKYA 3A4UA 5I0DA 1RMU3 2VCAA 4BQYA 1RYYA 3AVRA 2Y38A 1W8NA 3I2GA 3KCCA 1R1A1 5CKQA 5EHDA 4LTAA 2WWUA 1TNRA 2UYBA 3ACFA 2JG9C 3ILFA 5T55A 4IGQA 1DGWA 4LBMA 3NNJA 4E8DA 4LULA 5E88A 4TLFA 2MNGA 4XPVA 1C5HA 4Q4V3 1LR5A 2VMEA 5T3NA 3TN92 2GMPA 2PQSA 3DECA 4QT6A 2V5DA 1CVNA 3WXPA 1QXRA 1O6UA 2J1EA 3N7KA 2VZ1A 4ZU4A 3TOJA 1DYOA 3MDPA 2BW8A 3KD4A 3WF4A 3JQXA 4Q4W3 1UOGA 3NQHA 1B09A 2NLRA 2X5IB 3ASIA 4AEKA 2VNRA 5DUVA 4MGQA 3H8XA 5JMCA 2TEPA 5C9AB 3BTZA 3ZXDA 1DP0A 4AQ6A 4D69A 2XJQA 2BNOA 2LS6A 5DUWA 3SITA 4IEUA 4H7LA 2EXHA 1GOHA 1J83A 4GB31 4P9WA 3X29B 5KHJA 3V0AA 4X6RB 3O1PA 1RUG3 3I97A 4RHV3 4EROA 1NZIA 1PIV1 1ND3C 2XH6A 1FATA 4QQLA 1H9PA 3MPBA 4EZHA 4Q4Y2 4NR1A 1RMU2 2Y33A 4JAAA 5F3EA 1RUI2 3DYOA 4DRVA 5ISLA 2DVFA 2HWD2 3I3EA 2XONA 3WEZA 5JPMB 1DQ6A 1W6PB 1YIPA 2P2KA 3BU0A 4KWJA 1QJY1 5LA2A 1SG3A 1YJLA 4G4FA 4OULA 3RDIA 4FAGA 5C5TA 2CAUA 1SLLA 5FBJA 2YHJA 5EWSA 4CDXA 5FMDA 2O14A 1GP6A 2TBVA 3H9AA 5I0RA 1YUDA 3K77A 1POV1 2D6PA 3VBSA 4CU8A 3PTRB 1W04A 1W39A 2GNTA 1LHUA 2R1DA 2SBAA 3U11A 3E5QA 1R081 1VJ2A 3C7HA 4B7KA 1AR61 5BV6A 4NAOA 4I0AA 1OPOA 1FPN1 4Y22A 2UY9A 2Y8KA 5C7GA 5CG9A 3I2DA 5C6CA 5LK7B 1ND2C 3ZDVA 4UXAA 1UF2C 3BI3A 4RHV2 3MW3A 1EYBA 1KS4A 5D21A 1Q43A 2OT7A 3IPVA 4ZS3A 2VL4A 3GF6A 4FPCA 3KV9A 5H9RA 3VZOA 4WM7B 3JD73 3WSOA 4PF1A 3IZOA 1VAKA 2JD9A 4Y1UA 2VH9A 4CDXC 4WV8A 1JOPA 4CDQA 3RZHA 3LIGA 1DGLA 3BPZA 3AKPA 3CQOA 4FOQA 3UV9A 2VNGA 1WCQA 4ONUA 2RDNA 2WZ8A 4M3CA 3IAQA 1FOD2 3W5NA 4TTGA 4HKWA 4XC9A 1J1TA 4FOYA 1W9SA 3ALQA 4JKMA 5D8AA 5LBFA 2OYZA 4JKLA 3BTXA 1ENRA 2VMIA 4AI1A 5GALA 5LRRA 4ES8A 3CF6E 2A6VA 2W92A 1QNWA 5E16A 2MPFA 4N8MA 3VKOA 1D0GA 2XXZA 2YGMA 3DYMA 3LDKA 5KXBA 2J22A 2W1UA 1TZOA 2QCSB 2YGLA 5A3UA 4Y1VA 2HWE2 4XUPA 4DMIA 2ZMKA 2ZXQA 3AP7A 4OZXA 4MHRA 1UPSA 4TN7A 4IEQA 1ULPA 1W8HA 2YU2A 1BBT3 3WLUA 4I3GA 2JG8B 2WQ4A 1RUC3 1US2A 1LU1A 1DF0A 1IG0A 2AYHA 2ETEA 4DEQA 5BNOA 5K0UA 1S4CA 4AQSA 5JOZA 2XJPA 5K7PA 4CCKA 2V73A 4LBQD 5F6KA 1XE7A 5DAVA 4WZCA 2EIEA 2RHPA 2VUDA 5LCWL 4IE7A 2VTXJ 4P9LA 2BGOA 1SLBA 2W46A 2I07B 3MICA 3RJRA 1XQNA 2WA3A 5FZ4A 4G9SB 4XFCA 1COV2 1H0BA 1WMFA 3WCRA 4CCCA 5JLVA 2D6OX 1Q8VA 1UZ0A 1AYN3 2ZHMA 1W05A 2ZX3A 1O8SA 3O0WA 4B4PA 4IV3C 4D6RA 1LGNA 2ZGLA 2QQMA 3J7MA 4BK5A 4NHMA 4F7ZA 4OMDA 4CP0A 2GH2A 4QPGA 3DYPA 4ASMB 3O1MA 3JQWA 5DAPA 4DEVA 3E97A 3U4XA 3LEIA 4D3WA 3M3CA 2PLV3 3RPQA 4M3CE 5E6HA 5BNOC 3RVHA 4NHKA 3VL8A 3APBA 5J96B 2EXJA 5K0UC 1JUHA 1WLWA 4JTOA 3WF3A 1AR81 4AI2A 3IDCB 1AL0G 3J26N 1MACA 4OMCA 2EIBA 2YYOA 2WABA 5IATA 1RUC2 1DLCA 1S0GA 1LU2A 1PNFA 3LQCA 3KWVA 5LB6A 4K7JA 1BLZA 2WZR2 3M3QA 4M00A 3P3PA 1WW7A 2E7QA 2H0BA 1O59A 4XEZA 1CD3G 5D1IA 4CYDA 4DPNA 4QQPA 3DPRA 3RYKA 2KD7A 4HVRA 2ZACA 3L2HA 1W0PA 5KBFA 5FY4A 3UESA 3TYJA 1XPWA 2ARXA 2BZDA 1XBFA 2W94A 2WSVA 4NJ4A 5K9YA 3ZSMA 1R092 3FHAA 1OVPA 1RB8G 1JH5A 3VBOB 1Y9GA 1L7LA 4UYBA 1RIRA 1AYM1 2BVBA 3POYA 3BCWA 4QX5A 3ZXEA 1ZZ6A 5ABJC 4NROA 2LTNA 4HMZA 1V9U2 3IMNA 5A3NA 3PLQA 3BGAA 1YQ5A 1X9TA 3IM0A 1GUIA 3U1XA 2PLV2 3K3NA 1PVC3 2ZGTA 3PUIA 4SLIA 1ZBE2 3KV6A 4QHOA 5JDBA 2AEYA 3DPRC 2AUYA 2B5HA 5IFPA 1RHI1 3J9SA 4DQAA 5C4WA 5GZGA 4IW3A 5FYUA 1K5MC 4HSLA 1RUE1 4YW5A 5JCTA 3S0MA 1RUD1 5DMYA 3N4MA 1W9YA 3VUOA 3LA3A 2QJVA 2FDGA 1HXS3 2ZS6B 3AXEA 1ZRCA 4EE2A 2WT1A 1MZFA 1W90A 4KWUA 4Q8LA 1H4HA 5DG1A 4KH9A 2HLEA 1H8VA 1ZZBA 2ZKNA 3H3ZA 3KHBA 2WR9A 5H9PA 4KMQA 4GH4A 5FYMA 4F3JA 1O7FA 3TEZA 3LEMA 4GQ7A 2VQUA 4QDSA 4XCAA 1C8M1 3TNQA 3OGVA 4O7XA 3LF7A 5FYVA 1UXXX 3DXTA 4OI4A 1JMUB 2D44A 5FUIA 1O4TA 3WY6A 1Z0HA 1PMJX 4LJHA 3WX5A 1LKNA 1W3XA 4MXVA 4XFFA 5GZDA 3SC7X 1HV1A 5FZKA 1CPNA 3HQXA 1AHSA 3E1F1 4HXCA 5DDJ2 3OD0A 3AK0A 3SISA 4A44A 1XNDA 1KJRA 1DQ4A 2AGSA 2X5IA 4HSJA 3WW4A 4YSFA 1U12A 1HB4A 1J3QA 2WO3A 3S6PA 1VMJA 1UMIA 4QX3A 4RS5B 2VTFA 4XDPA 1AXZA 5B2GB 5C9AA 3I2HA 5FJKA 4AHYA 2FHRA 4CSWA 2Y34A 1NXMA 5FZHA 1HRI3 3AP4A 3WUCA 4S2GA 3HEIA 5FTTC 2HJIA 1NA1C 4AI0A 4GH4C 5L9RA 2I45A 1NOVA 4XUQA 3UGGA 2O8OA 2X8KA 1M06G 3RYPA 5A80A 3RZGA 1D4M1 1SDDB 5J48A 3NMBA 1HLCA 1A78A 4CUAA 4W6XA 2A3XA 4YM3A 1N1VA 1OKQA 3WW2A 3OF1A 1XRUA 1IS4A 2R32A 1OPMA 3KSCA 3OBAA 4H14A 4N43B 1EAH3 1RMU1 3ZO0B 2CY6A 2PHFA 3MIFA 5APAA 5BNPB 4BQ5A 4LA3A 1H6YA 4UW4A 4BIOA 2HWD1 3R4DB 3THTA 4XXAA 2IXHA 2YZ4A 3ZFEA 1XNKA 4XW3A 1ASJ3 2F4LA 3I7DA 4JRLA 4Q4V1 1FYUA 2ZGPA 3JB4C 3K4ZA 4Q1PA 4CVUA 4R9BA 3KS7A 2WNUB 3PDQA 5DZEA 5LATA 2WFPA 4H2AA 1JHJA 5A3OA 5A3PA 2I2SA 2OUJA 5JZGA 3NV4A 4LBQB 1OLRA 3ETQA 5EFUA 5FAXA 1PO22 5FY9A 4Q8KA 3I49A 1DBNA 4K1YA 5BNQA 4LO8A 3WF0A 1H1MA 4B4QA 4EZ4A 4A45A 2D93A 2YBSA 2DBNA 4ZS2A 4N9IA 2W52A 3MGUA 4YW7A 1GQHA 1N3PA 3GHNA 3O1UA 2CGPA 1K3IA 1RUG1 1REDA 1VBA2 2P17A 3FHQA 3KGLA 4XBQA 1FNZA 2YC4A 3QBQA 1Y7BA 2J7MA 4RHV1 2Q8EA 1UY1A 2WAAA 4WM7A 2WZPP 3H8OA 2ZX2A 4IUGA 4NAMA 3ZFEC 1LOGA 1EAH2 1W8WA 1N3OA 1VR3A 3M3IA 1NE4A 2BUKA 4FPFA 3J7NA 2DCTA 5I8TA 3TWIA 4BQ3A 4YM1A 2WNVB 2XKPA 3A0NA 5AC93 4Q0VA 3WW3A 1NLSA 4LBOA 5JZGC 4FFFA 4XF0A 1P8JA 3VBUC 1GKBA 2OS2A 3VDDB 1AVBA 4AGRA 3M8LA 1N3QA 3EHKA 1FI2A 1IKPA 3AL6A 2O1QA 1LAJA 2VZVA 2BP6A 5FPVA 5I91A 4IXLA 5ACA2 4NIIA 3WR0A 4RR3C 4TLGA 1AL22 1XE8A 1G86A 5GLTA 2WT2A 3WDXA 2VBDA 4CCNA 3RRDA 5FZAA 4RN5A 1WKYA 3A7QA 3GXUA 3O1OA 4HKOA 2K2SA 2CYFA 5FV3A 3KVBA 1VMHA 1PO13 3LOIA 2ARBA 2WFF3 3H42B 4H55A 2XOMA 2VZOA 3WP4A 4OI0A 3EO6A 3PHMA 5C71A 1KXGA 2XJUA 1UZWA 3ZPOA 3IT8A 4CEYA 1GOFA 1LNSA 2IFRA 4HVOA 1UIKA 3JD71 2W87A 4BXSV 3GZAA 5J1XA 1DGRN 2D3RA 5FY0A 1XOYA 1QH7A 2WZEA 1R1A2 2RJ2A 2KR2A 3CZJA 1YLLA 4OLLA 1OFNA 5L9BA 3SEEA 4NPLA 2W68A 1UN1A 2D6MA 5FZBA 3Q8EA 4DXRA 1QJZA 1QQP3 5T52A 3G7DA 5A3TA 2W3JA 3W9AA 5JAXA 3LIHA 2IXCA 1FV3A 4MGKE 1J84A 5CEHA 2PAEA 2B9UA 2GMEA 2XJTA 1APNA 2H0VA 2ZZQA 1BMV1 4IV1C 1GOGA 2PHDA 2R073 1T6GC 2ZEYA 2Y60A 1NKGA 4NWVA 4PBOA 5EYXA 3ZXLA 4CEYC 5JXIA 1NCRC 5BYNA 2ZA9A 3Q8BA 4GB32 3PVBB 4W6YA 2WFF2 4YRDA 4CRQA 2BEOA 1BBT1 3VBFB 3NAPA 3RZJA 3AB0A 2W47A 1RUC1 5GLVA 4NO4A 3OOXA 1PIV2 2OQ7A 2GDFA 1LENA 4HT1T 4LLFA 5FZDA 1IPJA 1MEC3 2RS53 1GQGA 4YVWB 1W2NA 4RFRB 4L97A 1BJQA 1N1YA 2BWAA 5FYTA 4CCDA 3B7MA 4E4DX 4CUGA 3VBOA 1JYXA 5CKMA 5LW9A 2WJSA 1QJY2 4OHYA 1QY4A 4LQRA 3C2UA 4YVSB 4XFBA 4RQPB 5CADA 5FZ0A 1AYN1 1QQP2 2QQNA 5L7OC 2DVBA 5F37A 3HT1A 4MADA 1RVF3 3NVCA 3LCPA 4P9XA 4XQWA 2QZ2A 5A7PA 2D98A 3UT0A 4PIXA 1X50A 2X05A 4XAEA 4C1WA 2OQ6A 1VMFA 3NAPC 4QXBA 4BE3A 3PVOA 2YB7A 1US3A 1J59A 2PLV1 2VOTA 2IXJA 5FMOS 4AQTA 4BISA 3CJIB 1AR62 4CDUB 1J3PA 4XJ9A 1CWPA 1C8NA 2P6CA 1NUKA 4XJZA 5FO9B 2X09A 3LDBA 3WV6A 1LHWA 4B3NA 3I8TA 4JV4A 3K4DA 4AK3A 2R16A 2J1RA 4HG6B 3BOWA 3TAYA 3LE0A 4IL7A 3ST7A 3B94A 3ZFFB 1E5IA 4ZY9A 2ZGQA 3JCIA 5CFCC 5CIRA 4I2OA 4NHXA 5DN2A 4AI3A 3DV8A 3KV4A 1WLCA 4BB3A 1Z7S3 2KXLA 4ATEA 1Q8SA 1VRBA 4BQ2A 4YG0A 1HDKA 1S55A 2V72A 2Y0OA 1BZWA 3EXUA 3I3BA 5EJZB 2ZAHA 4CCMA 1LEDA 5JI9A 3LGRA 1QU0A 4QQOA 1G9FA 2XHKA 4R4XA 1W6QB 4IEVA 5A1LA 2VZUA 3OD4A 3JXSA 3RG0A 1UOFA 5A1FA 1F2NA 2VC9A 3R05A 1Y43B 3VD7A 2ZGSA 1ZA7A 2A3YA 1ZVFA 2R30A 4JZRA 4HN1A 4PCRA 3N9MA 2BBAA 1UU4A 4RS5A 1VIWB 2W5FA 3DKWA 1PVC1 4K3UA 2XPJA 5A32B 3T2QA 4B1LA 5C8WA 1PX4A 4FP3A 4D8MA 2VNVA 1RC6A 5FPBA 3KB5A 4XTMA 1FX5A 1POV0 2FDHA 1K42A 1C57A 1DIWA 2NQYA 4P02B 4HOOA 3HQRA 2RVAA 4IE6A 3CU7A 4DY3A 1NQJA 1O3RA 1URXA 2YG0A 4XTPA 4A6OA 5LRSA 3SCGA 3H1YA 2D43A 3MUZ1 1Q56A 1W9TA 1UPIA 2D3PA 1HXS1 1IQDC 2G1MA 4LHNA 4N43A 4UAPA 4ZPIA 5IVYA 2VBPA 2ZEXA 3BPSA 3JZVA 3I2OA 3ZLIA 2Y6KA 4PBPA 4R52A 3BUCA 1UL9A 2A71A 2VNOA 3AP6A 4YG3A 2JEMA 5FP3A 3QH6A 1MS1A 1KDKA 1MS0A 3T0AA 1GZWB 4LHLA 5HV0A 3E5UA 3M4FA 4N7UA 3AFGA 3UK9A 3H7YA 4UOJA 3T2TA 4FPGA 3NNFA 1JU3A 1YXWA 4Y5TA 2WYFA 1CZTA 1REEA 3ENRA 4CEWA 3U0ZA 4V2WA 3WINE 2P3YA 1PX3A 3AXDA 2HWC3 4JQRA 5F5AA 3V64A 1QJX3 4LBQA 2A7AA 4YZ3A 4QX0A 2FD8A 1GQPA 3CMGA 1JZ6A 1H2MA 2E53A 1I9RA 4JTNA 1AR82 2JKBA 2BU9A 4IEWA 1UMZA 4GIQA 3RFRA 5CFDC 2CNAA 1X8EA 2ORXA 3VKNA 1W9FA 3TEYA 3PMEA 1B35B 1UAIA 2R6QA 4AEDB 4PQ9A 3TEWA 4TYSA 1WMXA 5A7WA 1HX6A 4JVAA 1QWRA 1WWYA 2CV6A 2VUCA 4JGYB 5IWFA 1KITA 4CCLA 4CEWC 4PHZA 2QVSB 2W0XA 1EAH1 4XURA 3POFA 1RXGA 4K1ZA 1AJKA 1HJGA 1UYZA 3KLSA 2XDVA 4OUMA 1X8MA 1HRV3 1PM7A 1AYM2 5DPNA 5AFEA 1D2SA 3VDDA 3VBRB 5T5PA 3O1TA 4XHBA 3NO8A 5T50A 4GWJA 3VHRA 3VKMA 1ASJ1 5FYYA 2IUWA 1QJX2 1MS4A 1PMIA 1R1ZA 1OOPB 2AR6A 2OW4A 3ZYPA 4JGZA 5DUUA 4LK7A 4UFKA 4ZXEA 4BJ0A 2P37A 3SH4A 4FXKB 3FWEA 2XR4A 3O7OA 1DU3D 1UZVA 3RYRA 1KD7A 3BALA 4CU7A 2CGOA 2D40A 5A6ZA 3P1IA 1RHI2 4F8AA 1ZA4A 1S0BA 1AR72 5FKCA 3QACA 4B7EA 1F9KA 1RUE2 2ZGRA 4E2GA 4IEOA 1RUD2 3KF3A 3N3HA 5FJHA 5C3QA 1LRHA 4LITA 5LBBA 3VD5A 5HPOA 4NIGA 5C3OA 3I54A 1UY2A 3DN7A 4P5YA 1OFSA 4D0QA 4LBKA 1JYNA 3NW4A 2YPDA 3WDVA 3O1VA 2HYKA 1PZ8A 3CKHA 2ILMA 2ES3A 3ZN4A 1JYTA 4AFCA 1C28A 1C8M2 2A5ZA 2WNEA 3OBTA 4PDWA 4L9BA 1X7NA 4JGZC 1PM4A 5AC91 5F7UA 5L73A 1ULDA 1EV13 2QQIA 4QPIA 2RDSA 1IZ3A 1SDWA 4JCKA 1W2UA 4XDOA 4Z82A 3T4VA 5IW0A 5KC6A 1SEFA 1AXKA 3HD8B 4CDWB 3GCWA 4WZFA 3KCXA 5T54A 1GSLA 2DBIA 1IOAA 2WN2A 4N90A 1H4GA 3A21A 4PJYA 2VM9A 1R64A 2R042 2WQZC 4UF0B 2VZQA 4XJWA 2XUEA 3GJAA 1LGCA 1CZVA 4CE8A 2DVDA 1H1AA 5LBCA 1MQTB 3VBFA 5F32A 2AC1A 4BQXA 2MEV3 2ZKLA 2DURA 2VPVA 1UOBA 2WFF1 3KT4A 3PVNA 3OUHA 5DABA 3VDCA 1TQ5A 1UU6A 4PDWC 1D4M2 3KF5A 1ACCA 4QPIC 5C8CB 2WO2A 3MZHA 2QQUA 3ZXKA 1W3VA 4YVWA 5FPZA 4XACA 1CJDA 4TWTA 1UKGA 4MXWA 2VMDA 3POGA 1UQXA 5HCFA 3PUHA 2RR13 1ZYBA 3MEPA 4FXGB 1WA4A 4MH0E 1V6JA 4QGNA 5CNAA 3ZFGA 5JR2A 3LKJA 5FMBA 1A8DA 4O9EA 1EP0A 4XCBA 1VLNA 3TEXA 4MO3M 3ITQA 3DGTA 4A42A 3OGGA 3JBG3 1CJPA 1VALA 4Q4V2 4AVVA 1QQP1 4QX7A 3GCXA 4FQ4A 1H8TB 4B1MA 2QQPA 4HKLA 1UX6A 5GJ6A 3S57A 5DUXA 2BOJA 4XIKA 2PHUA 3OGJA 3GNEA 4Y1YA 3LAGA 4OI2A 4Q4W2 4R9DA 4AI9A 4CP1A 1SLAA 3N9PA 1PZ9A 3CJIA 4CDUA 3MYXA 2VMFA 2R071 4DRRA 4URAA 3HIFA 1XNAA 2YY1A 3AJYA 1W8OA 2VW1A 4IERA 3ZOIA 2W9XA 1XYPA 2JDKA 1RUG2 2ZCWA 3IN9A 1LESA 3OBZA 3WOGA 2UWCA 3ZFFA 1UW8A 3LD8A 4E2SA 4EN8B 1YFXA 4HPKB 2J1AA 5FZOB 2Y6FA 1UNBA 4XFHA 5H9SA 3ZFGC 2E32A 2AH2A 1NCQA 4N53A 1DZTA 2E6VA 4ARYA 1AX0A 2P3KA 3AYEA 3LSDA 1YIFA 1MEC1 1O4ZA 3WF2A 1ULEA 1CESA 4OUSA 3KCYA 4OQ9A 3HWJA 3MW2A 3ZIWA 1AR93 1W6QA 2XQXA 2JENA 2ZX1A 1OH3A 2JXAA 3WDYA 3VBSC 2GP5A 4HETA 3VZNA 1VBB3 5F3IA 3WNMA 2P6HA 3AVSA 3ES4A 3D0JA 4JKKA 4W4ZA 1V6LA 1CQ9A 3RI9A 2OXBA 2ZMNA 1RVF1 2Q1FA
chains in the Genus database with same CATH topology
2VU9A 4R9AA 4S2FA 2WA4A 5A32A 4BLIA 2CGNA 2G9FA 4META 3J4UH 2D6LX 5T5OA 5H9QA 1JW6A 2JDZA 1NCQC 3B5LB 4FO9A 1ZRRA 3IDBB 3OJBA 4N53C 4WBBA 3TBDA 3L9JT 3BU7A 4PIZA 1A8MA 4H3WA 3AZZA 4CDQC 2XJSA 1AXYA 5DG2A 3ZMOA 3ZN6B 3WP6A 4UBHA 5DXDA 3ZSKA 4Q1RA 3WQ7A 3JD72 1RJ8A 2ZABA 1RTVA 4YZ2A 1SCSA 2D97A 5D8AC 1Z7S1 2VOVA 5CA6A 2P3IA 3UKTA 3VGIA 3OBRA 1LB2A 2FQPA 1S0DA 4M0NA 1CAUB 4N7IA 4LA2A 4Q29A 4BMEA 1VRH3 2DU1A 4LBJA 1YHFA 1AX2A 1O3SA 2BTVC 2NM1A 1SBDA 2CWSA 2K0GA 1YI9A 2ZPXA 2LM3A 1OQEA 1HQWA 3CL1A 1W0OA 1BMV2 3MIHA 1GR3A 4FTBA 3WDUA 3KT1A 2DF7A 1LOFA 2ERFA 2NPIA 5BNNB 1NLRA 3B69A 2BYVE 4L8QA 3AMQA 3AZXA 1BBT2 2FBEA 4AVBA 4MGZE 4IEPA 1U0AA 5FLJA 1BKZA 4AG4A 4JGYA 3TB0A 4OHXA 2C9AA 2HEVF 1G9BA 4WVWA 1WD4A 1QJU3 1TME3 4LE4A 1OD5A 2VY0A 3MPPG 3PJYA 4XYXA 2HWF3 1VBC3 2BFUL 5DZGA 5FQ0B 4QPGC 1I1EA 3VBRA 1N47A 2P34A 3TNPB 2ZAAA 3OYWA 3WG2A 1AYN2 1Y3TA 1XNBA 5I0SA 1RUJ3 2HEWF 4BHPA 4MSVA 1ULFA 1PK6B 2HWC1 4S2HA 5FOBB 3PNAA 1QJX1 2TUNA 4C91A 4ISRA 3SMHA 4FAHA 4L11A 5FPXA 3WHTA 4M3CF 4AVAA 1ZZCA 1GNHA 3LZZA 4KWLA 1G6NA 4LBLA 2XKOA 4E4ZA 2YDEA 3VN4A 1AR71 2VUJA 4TZDA 4J6GA 2DYCA 1KQRA 1C1FA 4RA0A 2JX9A 5J98B 3ZVXA 3K48A 1WW5A 2XJVA 3UKVA 5HI0A 4I30A 2OA2A 5SV5A 3RWNA 3VLBB 4AWDA 3AJZA 1HRV1 1LTEA 2JE7A 1RUJ2 3B01A 2B42B 3O0VA 3LA2A 3VZJA 1DLLA 1Y9QA 1RUH3 2JD4A 2VQ0A 4MGIE 1AJOA 5EYYA 4BM8A 1WBLA 3FLRA 4NHLA 4O9GA 2WSUA 1G9DA 5C4WC 1PVC2 4AHXA 5FMOL 4YGBA 1FNYA 4EN9B 4WVVA 3PMSA 5JOXA 1MQTA 2R041 1N1SA 4QU2A 1UU5A 2WINB 2D5FA 5IUQA 2HKXA 4RGGA 4WM8B 4OI1A 1D4VB 3NV1A 3VBHB 5C8CA 4GMP3 5C33A 3NKTA 1TNFA 1HXS2 3J8F3 4Z07A 4AQ2A 1I6XA 2PHLA 1ENXA 4LHKA 2DFCA 3MF9A 5GLZA 4LUKA 1W6PA 2XBO3 4PLMA 4DNYA 1KS5A 3AFKA 1EV11 2AENA 1YRZA 2DFBA 2X5IC 3O12A 2GSYA 3M2MA 1GBGA 3EBRA 3OCPA 5T5JA 5C9AC 1OLQA 4XFGA 2R0FA 4LBNA 2E7TA 3ZX7A 2VOXA 2VW2A 1EY2A 2WT0A 3OY8B 2A75A 3ZSJA 3O0XA 4Q4W1 4YZ4A 1WCSA 5J7MA 3H3UA 1HRI2 4IEXA 4URTA 2ZX0A 3S30A 4Q4X3 1VBD3 2PQQA 4HPKA 3RNSA 5IK5A 2A3WA 3J8F2 4YNIA 4KG0A 1GNZA 4P9IA 2BNNA 4JRAA 4RGAA 2ATFA 4BMBA 3FFZA 2RR11 3HAGA 5HBAA 2YMZA 1RUF3 2ZGKA 2R0HA 1DYKA 3NSTA 5JIUA 1ASJ2 1CGPA 1YWKA 3JBG1 4XF9A 3NL1A 3BIWE 4AF9A 2OIIA 1W6OB 3ZXFA 1H2NA 1QNYA 1TMF3 3R0RA 1MVEA 1JBCA 1KJLA 3MF6A 4FPHA 3SCFA 2Z2SB 2YC0A 4XJ8A 4R8HA 5J36A 3ZXJA 1YCIA 2Q8OA 1NXD1 1LCLA 4WM7C 2H6CA 2RS13 1QDOA 2Q1MA 1VBD2 3KT7A 3MLJA 2JG8A 1YO8A 2ZMLA 4RL7A 3ZMNA 3ZN6A 2HWB3 2VXRA 4QM8A 3U07A 2GNMA 3GBWA 4ZU7A 4YGDA 1PGW1 4FSJA 4GMP0 1CAUA 4KG8A 1BXHA 5AC92 1ZX5A 1AR91 2JG9B 3E5XA 3CO2A 4Y4YA 3D8CA 1EPWA 3N36A 3AYAA 3HN1A 1VBB1 2XLAA 3ZSEA 2PYTA 5TSWA 3R6SA 4XQDA 2GMMA 4KGGA 2JG8C 3PVEA 4Q27A 4RFT0 1SFNA 2C1FA 2QE3A 5F1RA 1JTZX 5DZFA 2BPA2 1O5UA 3UJOA 4ORFA 1SBFA 2XVKA 4XQ4A 4AFAA 1UKRA 1PO12 4AGVA 1JHNA 1YFYA 1ND3B 1NG0A 1WMEA 4E2QA 3B9IA 4JDNA 2C0ZA 3FLTA 3ATGA 5FOJB 2D6KA 1WUVA 3MIBA 1WBFA 4Q0SA 3VHOA 5GZEA 3GALA 4EWAA 5FREA 4XZPA 1R083 1FT9A 2XL9A 1FPN3 2BGCA 1ZZ9A 3USSA 1NZCA 3THPA 4QXKA 4DXZA 2W39A 1VRH1 1PK6A 3B3QE 4UBGA 3VKLA 1VBE3 2Z42A 3SXWA 3V0AB 1HQNA 4B8EA 2GNBA 5I93A 4BLJA 1AX1A 2A6ZA 1FAYA 2NMOA 2R072 4X6QB 4YW1A 2OZ6A 5JI7A 3VHPA 4KNCA 3WUDA 1QXPA 4NN0A 3NJZA 4AHZA 3H50A 4AVSA 1ND2B 4UW6A 4I01A 1W6NB 1C4RA 1QKQA 3IDEA 2QNKA 2ZGUA 1S0CA 3V65A 2RJLA 3VBOC 5K8SA 3LA7A 4HK8A 1PZ7A 2GC1A 4Z8BA 1DQ0A 3MIEA 1MEC2 2RS52 3WNXA 2F4PA 1MS8A 3B02A 1QXJA 1QJU1 3AZYA 1F31A 4CDXB 5JSRA 5KXEA 1IKQA 1SCRA 2IXLA 4YYOA 4GULA 5FFOC 2HWF1 1VBC1 5HCBA 2DVGA 4ZXKA 2XLGA 4YZ1A 2GN3A 4LUMA 2WL1A 1DQ1A 3VZLA 3IKWA 1RUJ1 1BEV3 1RVF2 5EXOA 1VBE2 4D7SA 1ULGA 1WW4A 2N7GA 2D5HA 1MS5A 3I59B 3ZYIB 3FBYA 3WQ1A 5AFBA 5L19A 4K20A 5JSOA 4EN0A 3RZZA 4DB5A 1DQ5A 3WG4A 1CPMA 1MS3A 3VBHA 1MS9A 3B93A 4ASLA 2DWRA 1U5YA 3LOBA 1E57A 4AEMA 1QGLA 4Q0PA 5IK4A 5AVAA 4X8NA 1Z7S2 4NWWA 2JICA 5BNPA 1H2LA 1M4WA 2BBVA 3FX3A 1BVVA 4YGEA 3NV2A 1OA4A 1DYPA 2WS93 3JU9A 3AMPA 4RS5C 4IV3B 3KMHA 4NOTA 2RMU3 1BEV2 4D7TA 2B39A 2OPKA 3RJ2X 3ZXAC 2WLQA 2WNUA 3VZKA 4ZKTB 1OQDA 1RUH1 2R063 1SFYA 1KDMA 3OY8A 4XF3A 4COZA 4BPZA 5BNOB 2IFWA 1CR7A 5K0UB 1CN1A 2QZ3A 5FO8B 1ZNPA 3M1HA 1VB4A 4N43C 1CAVB 1ZBA3 1HRI1 5F9TA 4Y24A 4XIOA 5BNPC 3FFQA 4G3YC 2Q1ZB 1Q3EA 4U2AA 1SACA 4LO6B 4DOUA 1J3RA 2PAMA 4GMP1 1QOSA 4HANA 4COYA 4C0BA 3AKSA 2PTMA 3MLLA 4FTSA 5BY5A 1S1AA 3J8F1 3FBMA 4HN0A 1QHDA 4KWKA 4HFSA 4LR4A 4CTEA 4L92A 5JSPA 4LO5B 2LALA 3CLPA 1NY71 2A73B 2WNVA 2WNUC 3KZ4C 1H2KA 4M01A 1IS6A 1FMD3 1SLTA 4KU7A 4MUVA 3UJQA 2XBO1 2DVAA 3RQ0A 2JE9A 3GZUC 1X36A 4Y5Z0 4D7YA 5CVRA 5ABJB 5IK8A 2R062 2HWC2 4LE3A 3LSEA 4L2NA 2V5YA 1DHKB 4XMIA 4WVMB 4XJUA 3BODA 2NP0A 2ZX4A 3Q9OA 1H1IA 2H6BA 3DPRB 3QOPA 4I02A 4FBFA 3BOPA 1GICA 3ACLA 3VZMA 4D94A 3WVJA 4XFIA 4QQHA 1K5MB 4Q4X1 1VBD1 2WNVC 4CZSA 1PHMA 4E4SA 1YI7A 4BH9A 1XYOA 3TN93 5GZFA 4Y1ZA 3V0BB 1X33A 3VDDC 1LOBA 1V6OA 3ZYJB 2JG9A 4XDQA 2C5DA 1GLHA 1RINA 1WLDA 2VVFA 5SV8A 4Q26A 2FMYA 1HRV2 4XF1A 1RUF1 1XU2A 5I0UA 4KBBA 3POSA 2GC3A 3JUUA 4JC1A 2VW0A 3N7JA 5FBZA 4KQ7A 1YYNA 1U5XA 3URFA 1HIXA 3ZN5A 2KA3A 1WLTA 2A6WA 4GA9A 1DFQA 2XL7A 1IGOA 4N9HA 4Q4Y3 2VG9A 1A3KA 4IESA 4YG6A 4FQZA 2RS11 1NA1B 1RUI3 4GH4B 4PIYA 3SH5A 4EV0A 5BNQA 3AKQA 4YM2A 2HWD3 2ZTNA 2GC0A 1S0JA 4XFAA 1ND3A 5E8AA 3SH3A 1ZRFA 1PO11 3NKGA 2HWB1 3GBFA 3R4SA 2R49A 1ZZ8A 3ME2A 3ROUA 1QOOA 4BQ1A 5T5LA 4W6WA 3K51A 1OSGA 3FUOA 3ZXGA 1S2BA 4E9KA 3GHMA 1EV12 1WD3A 4YVSA 3IIAA 4LT5A 4RQPA 5KHHA 1ZM1A 1ENSA 4I0WB 5JOYA 2QKDA 2DUPA 4J1WA 4QD2A 2QDRA 1SBEA 5J3UA 1J58A 1U5IA 4Y20B 3L2YA 3VBFC 4GALA 4K21A 2ZGOA 5LEKA 2XG3A 5GM0A 3D0SA 4FPKA 5LK5A 3SHRA 1UZYA 1ND2A 1W6NA 4YVWC 1VB2A 3S7EA 2YPJA 1VP6A 2MEV2 4U36A 3E6CC 1DG6A 5AVPA 5LEJA 1FOD3 4JDMA 3VHNA 1UD1A 4YVSC 4RQPC 2VECA 3I4IA 3MFAA 3ZFEB 1C1LA 3CNAA 3AMMA 5A3MA 4AVTA 2NZ9A 1C5IA 2RS51 4BA6A 1LOAA 2HEYF 2K9ZA 2RR12 5JZGB 1YFWA 2EALA 4QMAA 2HWE3 3VBUB 4J1XA 4AE2A 3LWCA 3HR9A 5KC5A 2IC1A 3CJIC 3JBG2 4CDUC 2UY8A 3AYDA 3I59A 1VBE1 4RR3B 1XXNA 2VQAA 2EXKA 3GZTB 4B4RA 2EVXA 3LB9A 3SLIA 3ZFFC 1ZREA 4BIFA 1DZRA 2EAAA 5JR7B 1UCXA 3RMXA 3RI8A 4ITCA 4A7KA 2G9GA 1YNAA 1LHVA 2UURA 1COV3 2JJ6A 3M3OA 4KL1A 2D3SA 2RS33 3BB6A 2R1BA 1H30A 1A6CA 1OHFA 2Z79A 2GN7A 4A3XA 1PGW2 2O0OA 4IEZA 2B45X 1HV0A 4CYDA 1AR92 2RJKA 4R4ZA 4P9YA 1MZ5A 1CAWB 1XNCA 1GZWA 2JECA 4IV3A 2IXIA 3H1MA 3HBZA 1AZDA 3GYDA 1RITA 3D6EA 1GANA 1VBB2 3NV3A 4KGQA 1CAXB 2EF6A 3H0OA 3ZIXA 1BEV1 4DS0A 1XU1A 2NN8A 4HK9A 2FZ1A 2WZR3 1DDLA 2XWBB 3RSJA 1WCDJ 4IV1B 4BYYA 1LJ7A 1Q8PA 4ATFA 2ZHNA 2BWCA 4COWA 3WP5A 4AHWA 4CEYB 4MVTA 1NCRB 1W6MB 1CAVA 3RS6A 4FPEA 4HL0A 1V6MA 1RL3A 3QH7A 1WW6A 3T1MA 4CP2A 1JUIA 1B35A 1R093 1QOTA 2B46X 2DU0A 2RS32 4AEDA 3WP3A 3ZSLA 1YJKA 1C3HA 4MYEA 5IK7A 2GNDA 4FT8A 2XWJB 2CAVA 1V9U3 3VKFC 4BWOA 2EA7A 5A3LA 2VMGA 3V56A 2D6NA 3WDWA 2IZWA 5FDBA 2ENRA 1LOCA 4QM9A 1N1TA 2B7YA 4FCAA 4QQ2A 1ZBE3 4C90A 5L7OB 1LODA 1ZRDA 1YFUA 5ABJA 2WS91 1VRH2 3DF0A 4Q0QA 1MZEA 1JN2P 2RMU1 2Z69A 4K6BA 1V6KA 1OOPA 2OUHA 1G9CA 1LOFC 3FHIB 4ISQA 3FZ3A 4WVMA 2R061 4XBLA 3EQEA 3NAPB 1B35C 4AEDC 4AW7A 1OMIA 4LNVA 1KFXL 4XMAA 1O3TA 3CJXA 4AXOA 4JGYC 2XJRA 1FV2A 4QGMA 4XBNA 1K5MA 3H7JA 1MVQA 2BNMA 4AFBA 2OVUA 5BXXA 1Z78A 1ZBA1 2O8QA 3D4KA 1PGL1 2WC2A 4MZUA 5GLUA 1ZZ7A 4C1XA 3QD6A 1JYCA 2Y0IA 1LHOA 3V0BA 5CFCB 3MFCA 2PFWA 5F5QA 3VBRC 1CIWA 2NMNA 1QJU2 2BVVA 3AZVA 1OA2A 1TME2 3M3EA 5DDJ3 1OOPC 4EN7B 3WHUA 4FPOB 1FMD1 1VBC2 2HWF2 1ULCA 1D2QA 3ECQA 1REFA 1I3HA 1VAVA 5CU1A 4Z2WA 4GXLA 4CDWA 2UYAA 1IS3A 1G8WA 3P3NA 3TRSB 2QFEA 2ZOEB 2GU9A 2XB6C 2A70A 1DZQA 3UL2A 3AM2A 3WQ0A 2GAUA 1GZ9A 4DZGA 2A6XA 4IEYA 1LECA 4IETA 3MIGA 1NA1A 2DUQA 1LHNA 3WG1A 2VMHA 5KXCA 3IWZA 4Z1VA 4AI8A 5FLHA 4YGCA 4FOVA 5I8SA 2CTVA 4PLOA 2GC2A 2I74A 4QPYA 4LO4B 2D7FA 3TN91 2CL2A 4AFDA 4CDWC 4AYUA 2QDNA 2A6YA 3NWKA 1Q8OA 4YW3A 3KQRA 1PO23 1U5ZA 3FUQA 1UZZA 5KHKA 5L36A 1JOJA 1BVP1 1JXNA 1DGWX 1O91A 2DCJA 2SLIA 2EXIA 2XUMA 1H8TA 3VV1A 4Y20A 2PN5A 2TNFA 4OHVA 1MQTC 1MR5A 1RUH2 5CG8A 3B9CA 2F6BA 1VBA3 4XE9A 3MW4A 3PJQA 3WZ1A 1VAMA 2Z5WA 5C8CC 2BQPA 3INAA 2YROA 1FXZA 4Q4Y1 5J37A 3WW1A 5CFDB 1RUI1 1H9WA 4COVA 2V09A 5KHGA 4K40A 4OHZA 1TE1B 2MEV1 2ZGMA 1WGPA 1GFF2 4UW3A 1RGSA 5FRAA 3B00A 1PGSA 4XJAA 1KFUL 4CEWB 1BYHA 1IPKA 1H8TC 1NY72 4LLOA 2XVGA 5ACA3 3OTFA 1AL23 2XBO2 3VBUA 1OQ1A 1I5ZA 2VOWA 4DFSA 4UW5A 2Q5TA 5FLIA 4RR3A 2ZJCA 2E7AA 4P5HA 1S0EA 3AMHA 5EZWA 4I3PA 4RD7A 1AF9A 5EJ3A 4YZ5A 5I8YA 5KHIA 2VVDA 1IS5A 2RM23 3EJKA 2GALA 4SBVA 4DINB 4JDOA 5JOWA 1R1A3 4Q4X2 3UKNA 4I0BA 3HMYA 1BK1A 3MLKA 1FOD1 2UWAA 1O5LA 5KXDA 3WG3A 2DCYA 4FTEA 1EPZA 3ILRA 3POWA 3D5OA 5A33B 3BTAA 5BPXA 4HVQA 2KM2A 3USUB 4Q0UA 4FPYA 1CAWA 4JGZB 1F5FA 4FPJA 4NVPA 2XGXA 1RUF2 1CAXA 2HWE1 2ZBJA 4QHBA 3E6DA 4FP2A 5J09A 4MGYE 1GZCA 1LOEA 4GB33 4Y1XA 2E63A 2GH8A 3MI8A 1TMF2 3WDTA 4IV1A 4YW4A 2DTYA 1PIV3 4E27A 4QGLA 1NCRA 1W6MA 5GKAC 2E51A 2RM22 5BNNA 4FVVA 3AKRA 3FE5A 2RS12 3S7IA 2LUWA 2VOKA 1NYWA 1SLCA 3A0KA 2BFUS 4FOWA 4Q2FA 4PDWB 2EIGA 1COV1 2VUAA 4ZU5A 1QJY3 2HWB2 2XLFA 5F6LB 4QPIB 3ZYGA 5JWPA 2RS31 1ONAA 4XF4A 2QUOA 2G4IA 3AKTA 1HW5A 2PHXA 2ET1A 4K8FA 4PF5A 4YW2A 4YARA 2DCKA 4P14A 4H7MA 1POV3 3H8UA 1Q8QA 1CX4A 5FQ0A 1O4YA 1LEMA 3IBMA 4OHWA 2WIIB 5BUVA 5CBLA 5L7OA 1NQDA 2IXKA 1QH6A 1AR63 2UWBA 2W08A 1PVXA 4V1PA 5BNNC 2DV9A 3OPZA 3O5SA 3C3VA 2WZR1 4LEJA 2VVEA 3T1LA 4BOWA 5HCAA 4ES9A 3HT2A 3AMNA 3W58A 5JIAA 2WKKA 4XHXA 5JVVA 1D0HA 4L99A 3VL9A 2FZ2A 1HQLA 4I09A 4MXWB 1DQ2A 5I0TA 2YXSA 2DTWA 3CEWA 3M7AA 2YUEA 4AEJA 1R091 3ZFGB 4RSUA 4EWEA 5CFCA 4HZFA 4Z92B 1WCKA 4R9CA 4XXPA 4YFWA 1IHMA 1AUYA 2CWMA 4K9SA 4NPRA 4P9GA 4X8PA 2ZGNA 4DY5A 1PK6C 1V9U1 4F83A 1TME1 4EWDA 2WWSA 1LULA 4FPLA 4COUA 1S0FA 1S2KA 3VBSB 1R082 2XVLA 3W59A 2ZHKA 2X29A 1FPN2 1ZBE1 5HXVA 4HLTA 3N35A 1SLIA 1RJ7A 4Y22B 3AP9A 4A2UA 1KRIA 1BCXA 5EV7A 2VGDA 5FCCA 1G9AA 3FC0A 4IQPA 4MV2A 3AX4A 1NCQB 4N53B 3FLPA 3IPVB 1ALYA 3DUIA 3SCHA 2GZWA 4WM8A 3PTYA 2DCZA 1SQ4A 3ZDSA 4CDQB 5IT6A 1F8VA 4A7YA 4S2DA 1S0IA 4M3CB 4EJRA 4PLNA 4XETA 1O3QA 2IWGB 1XYNA 5D8AB 2ZZJA 5DDJ1 4A7ZA 4M0HA 4Y26A 1SMVA 3U10A 1Q5OA 3D82A 3ELNA 5GLWA 4LO7A 1AR83 1CONA 2AREA 4GWMA 2X53S 3ILNA 1V00A 1QMJA 2NYYA 2OZJA 4WM8C 1V6NA 2RE9A 3VBHC 3WD5A 3SNMA 2PHTA 2EAKA 1IQAA 4WVZA 4GWNA 5CFDA 1GYKA 4BCUA 2WLPA 5FO7B 1V6IA 2E9QA 1OI6A 3N7MA 4AFMA 2MHFA 4MX3A 1AYM3 3WT3A 2PELA 3QCWA 3KGZA 2FMDA 1QDCA 4QPGB 1L3JA 1NE6A 2DUOA 4BZ4A 1PO21 1RUNA 2WS92 5CB7A 1F5JA 4YFZA 2RMU2 4OVEA 1GV9A 1X82A 2B8MA 3ES1A 1RHI3 1W6OA 4YLZA 1AR73 1RUE3 1LGBA 2Q4SA 4INDA 2YV8A 1RUD3 1VBA1