1WLTA

Crystal structure of dtdp-4-dehydrorhamnose 3,5-epimerase homologue from sulfolobus tokodaii
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
176
structure length
176
Chain Sequence
MPFEFENLGMGIILIKPKVFPDKRGFFLEVFKSEDFTKMRIPNVIQTNMSFSRKGVVRGLHYQRTPKEQGKIIFVPKGRILDVAVDVRKSSPTFGKYVKAELNEENHYMLWIPPGFAHGFQALEDSIVIYFITHNEYSPPHERCISYSYIDWPIKEVIISDKDLQCPSLEKAEVFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of dTDP-4-dehydrorhamnose 3,5-epimerase homologue
rcsb
source organism Sulfolobus tokodaii
molecule tags Isomerase
molecule keywords 176aa long hypothetical dTDP-4-dehydrorhamnose 3,5-epimerase
total genus 38
structure length 176
sequence length 176
chains with identical sequence B
ec nomenclature ec 5.1.3.13: dTDP-4-dehydrorhamnose 3,5-epimerase.
pdb deposition date 2004-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00908 dTDP_sugar_isom dTDP-4-dehydrorhamnose 3,5-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1wltA00
4I0AA 3E5UA 1CAWA 3WW3A 4FT8A 1ZZCA 4KWLA 1TQ5A 3DV8A 5I0RA 3ACLA 1YFUA 3LAGA 3CO2A 1RC6A 3LA2A 3E6BA 3H1YA 1UPIA 3BPZA 4PIXA 4AVBA 1RGSA 4QX5A 5FDBA 4KU7A 2CV6A 2XLFA 2GC2A 1I6XA 1EP0A 1X7NA 2B8MA 1YHFA 2WC2A 2CAVA 1ZZ9A 5JR7B 3QOPA 3RYKA 2PAEA 4WVZA 2K9ZA 2PHDA 1QXRA 1O3SA 1CAUA 2BEOA 5I93A 4EWEA 5E1RA 4EROA 2BNNA 3OCPA 3ST7A 5LEKA 2O8QA 5KHHA 3H9AA 4JTNA 1VJ2A 3LA7A 3OTFA 1J1LA 2UY9A 5KHIA 4AVAA 3NJZA 1ZRFA 3GBFA 1CX4A 5C8WA 5JSOA 3EJKA 1X8EA 1DGRA 2ATFA 2PFWA 3H1WA 3NL1A 1RUOA 5CADA 4JTOA 2D5HA 1RUNA 5I0TA 1ZZ6A 4HVOA 5KHGA 3OD0A 2PAKA 4X6RB 2Z69A 3IBMA 3LOIA 3FX3A 2UYBA 1OI6A 2FMYA 3KCCA 4LTAA 1X8MA 4IEQA 3DL3A 4O9GA 3RNSA 5I0SA 3ROUA 3CEWA 5J48A 2V09A 3U11A 2XGXA 2IXLA 4JVAA 1LB2A 4BYYA 3IDBB 3SXWA 1Y9QA 2Y0OA 4XFAA 4XF1A 4D7SA 1ZZ8A 3FJSA 4QXKA 3SMHA 1YLLA 3L2HA 2UY8A 4E2SA 4OFGA 1UIKA 2OA2A 4IEPA 4LEJA 3H3UA 4QMAA 3FFQA 2GC0A 3QACA 3ES1A 3MPBA 2IXJA 1NE6A 2GZWA 3R6SA 2XHKA 2Q1ZB 3MDPA 3IDCB 3KMHA 2KXLA 4XF0A 1LKNA 1GQHA 3PLQA 2BGCA 5BV6A 3FZ3A 2HJIA 4YNIA 4LLOA 1PMIA 1SFNA 4A2UA 4P9GA 4HSJA 1J3QA 1Q3EA 4LA3A 3D82A 3S7EA 3HQXA 5FQ0B 3E6CC 5FPXA 3RYRA 5I8TA 3H7YA 3RZZA 4BHPA 2H0VA 1IPJA 1H1MA 4IEUA 1UD1A 2OPKA 1O3TA 4XFIA 3UKNA 5K8SA 2EVXA 1ZZ7A 4IEYA 3KSCA 4IETA 2QNKA 3FE5A 1VP6A 3IWZA 4IEWA 2H6CA 2VPVA 2O1QA 3BB6A 3EHKA 4EWAA 3M70A 4EV0A 1CAVA 4Q0VA 5HI0A 1UIJA 1NXMA 3E6DA 3HT1A 2F4PA 1O5UA 5JCTA 4HSLA 4YSFA 3UKVA 1J58A 4XF3A 3BALA 2EAAA 1J3RA 2IC1A 5T3NA 4GULA 4MUVA 4R52A 3RDIA 2ZKLA 3OF1A 5FPZA 1WA4A 1O3RA 1CAVB 4XFGA 4XFBA 4QGNA 3H1MA 1FI2A 4I01A 2ET1A 1YFWA 1FXZA 4MGKE 4QGMA 4RD7A 1JUHA 2Q0AA 2PAMA 2Q30A 2GC3A 3BCWA 1ZRDA 1Y3TA 2UYAA 2IXCA 3EO6A 4MV2A 3O14A 4LUKA 5C6CA 1G6NA 4K8FA 2BYVE 3CF6E 4QM9A 1VR3A 2H6BA 1SQ4A 4Z82A 4F7ZA 3OGJA 1YWKA 3G7DA 4IEZA 3MYXA 1H1IA 4HVRA 4I02A 1LRHA 5KHJA 3I7DA 5I0UA 3FHIB 2D40A 2CAUA 2VECA 3H7JA 3B02A 2QDRA 4FAHA 2IXIA 4B29A 3TNQA 2OZ6A 1QXJA 3D0JA 4N9IA 4HN1A 2IXKA 1ZREA 4BH9A 1DZTA 3WW2A 3I54A 2XLAA 5BUVA 1XE8A 4XEZA 2XL9A 4WBBA 3HIFA 2N7GA 4Z07A 4UBHA 3EBRA 4Q29A 3IIAA 2FQPA 1CAXB 4IEXA 3SCHA 1IPKA 2MPFA 3CL1A 3UKTA 3EQEA 4I0BA 5J3UA 3USSA 1CAUB 1YFXA 2GAUA 3NW4A 1DGWA 1ZX5A 2IXHA 1CAWB 3PNAA 3S0MA 2XL7A 3HT2A 3KGZA 3D0SA 4H7LA 4QM8A 1CAXA 4XETA 3NSTA 4MZUA 5JSRA 5E16A 1OMIA 4ZU5A 1FT9A 4F8AA 2E9QA 2MNGA 3VHRA 1OFNA 4MGZE 1I5ZA 3LZZA 4PIZA 5BPXA 3GYDA 5I91A 3M3IA 4ZU7A 1YFYA 4WZCA 2VQAA 4N9HA 1O3QA 3FWEA 4PIYA 4Q0PA 1RL3A 2WFPA 4O9EA 4IEOA 4IEVA 4XFHA 4QGLA 1UW8A 4CYDA 5KBFA 1SEFA 4I3PA 3NVCA 2QCSB 4Q0QA 5CU1A 3CJXA 1ZRRA 4XFCA 3CLPA 2GU9A 4META 1PM7A 4UBGA 4MGYE 5BY5A 1J3PA 2HKXA 1ZZBA 2PQQA 5I8YA 1ZVFA 4XF9A 4Q0SA 3H3ZA 4MH0E 4AVCA 1Q5OA 4J1XA 3ETQA 2BNOA 2GC1A 1J59A 4ONUA 1O7FA 2BNMA 4Q0UA 1WGPA 1NZCA 3ES4A 1O5LA 4TLFA 3LA3A 3E5XA 4EWDA 2PA7A 1GQGA 2GH2A 4IESA 3ZDSA 5EZWA 4BIFA 4L2NA 4DINB 3RPQA 2XKPA 3JZVA 2OYZA 3PVBB 4HLTA 1U12A 4LUMA 4HMZA 2Z2SB 4KL1A 1Q43A 1CGPA 4YARA 3TNPB 5CVRA 2K0GA 2C0ZA 3NKTA 3I59B 2ETEA 5J7MA 5EFUA 1DZRA 1O4TA 5LRRA 2MHFA 3I59A 4YRDA 3H50A 4J1WA 4IERA 1OD5A 3KGLA 3C3VA 5LRSA 2PTMA 5D1IA 4E2QA 4HZFA 4FBFA 2D93A 5I8SA 5JAXA 2QVSB 4XFFA 4AQ2A 4MX3A 4FAGA 1ZRCA 5FLHA 4D7TA 3U0ZA 1LR5A 4LULA 4HN0A 1NYWA 5F1RA 1V70A 3BU7A 3RYPA 3H8UA 5FCCA 2P17A 4YYOA 1QWRA 4NVPA 3E97A 2XLGA 4I2OA 3MZHA 2QJVA 5JSPA 4MGIE 5KHKA 4AXOA 4HBNA 4KWKA 1EPZA 1XRUA 2ET7A 4UXAA 3SHRA 3ELNA 4PJYA 3N4MA 1RTVA 2D5FA 3SCFA 2Q4SA 5FLJA 3DN7A 4LA2A 1NE4A 3WW4A 5FQ0A 5FLIA 4AQ6A 2PHLA 2CGPA 4XF4A 4JV4A 4ORFA 1HW5A 1ZNPA 2I45A 4HVQA 2OZJA 4I09A 5BXXA 1EY2A 1X82A 3S7IA 4ZU4A 3WW1A 2B5HA 1L3JA 4OLLA 4X6QB 1XE7A 5AVPA 1EYBA 4KU8A 4R8HA 2PYTA 3LWCA 5LEJA 2XKOA 4L11A 2DCTA 4KWJA 1YUDA 1UCXA 3U10A 1QY4A 4E2GA 2B9UA 3DKWA 3SCGA 2ZCWA 1WLTA 2EA7A 3E5QA
chains in the Genus database with same CATH superfamily
3GXUA 4JKKA 2XBO3 3O1UA 3CJIA 4OUMA 4AEKA 1ZZCA 1TQ5A 5GZDA 1YFUA 1VB4A 3HNMA 1MS1A 2A6VA 3PU8A 1UPIA 3PUAA 4PIXA 4UFMA 3TN91 1RGSA 1C1LA 3WEZA 3VBOC 1COV3 1JYNA 4G3YC 1YHFA 2VMGA 2BERA 3ZIXA 3SEEA 2RMU2 3L2YA 4QHBA 3RYKA 4CCNA 1NCQB 4BQWA 1DCSA 4WVZA 2K9ZA 1W9WA 5LBEA 1O3SA 1CAUA 2BEOA 5A7WA 5CFDA 3J4UH 4EROA 4FPJA 5IVEA 5JXJA 2FDHA 5FAXA 1MR5A 3NJXA 2DUOA 3S5AA 3DYMA 4UFIA 3OTFA 1DYOA 4HPKB 4EZ4A 1GFF2 1W0OA 4BQXA 2LM3A 1BQPA 1W05A 1WCQA 4Q4V3 4FPFA 3WCRA 4A42A 3BTXA 5KHIA 4OHYA 4AVAA 5D21A 2DBIA 1QMJA 1W8ZA 1GP5A 1QJU1 4YVSC 1ZRFA 1EUUA 4B8EA 4FPKA 5CKQA 4XCBA 1QU0A 4NRMA 1WKYA 2ARBA 1X8EA 5CB7A 2ZGLA 2ZX2A 2ATFA 3NL1A 3H1WA 4CU7A 3UJOA 2ZX0A 3RZGA 1RUOA 4YVWB 3MFAA 4FXKB 4YW3A 2VBDA 1ZZ6A 3ZR5A 5ANQA 3WD5A 2Y0IA 2IWGB 5FXVA 1JZ2A 1KEXA 5C7GA 2Z69A 2D6NA 1OFSA 3LE0A 5JPNB 3FX3A 1F4AA 2PHFA 3INAA 1VBA1 4YW1A 3J7NA 3WUCA 2FMYA 2LW8A 1TNFA 2HBUA 3RMYA 1RJ8A 5FYBA 4O9GA 4Y22A 3CEWA 4UF0B 2V09A 3U11A 3N7JA 4KH9A 1AR61 2JG9B 1UZZA 2B42B 3B94A 3WG1A 4EJRA 5FMOS 3WP6A 1WCUA 4FFHA 3IDBB 3U75A 2Y0OA 1CZSA 1JOJA 2AC1A 1W39A 1HRI2 2VOWA 1ODMA 4DNYA 1SCSA 1RUI1 2NYYA 5FFOC 2NMNA 1DDLA 1NLSA 5EQUA 2G9GA 3AZWA 5FY5A 4C0BA 2BWCA 3L2HA 4B7EA 5EP9A 4OFGA 5L7OA 5FZLA 2OA2A 1TZOA 2HWB3 3RS6A 4IEPA 5C71A 2VZSA 3DGTA 3POEA 4GKYA 2LROA 5JLVA 2A3XA 2BQPA 3PJYA 1OA2A 3ILRA 1UX7A 5CFCB 3I3DA 4B1LA 4OI0A 3VD3A 2YV8A 4F83A 2E32A 1APNA 1XE0A 2IXJA 1XSRA 2GZWA 3R6SA 2EICA 2RDSA 1OVSA 4NHMA 3IDCB 5A6QA 3KMHA 1QHDA 3O0WA 2ZMNA 4XF0A 3Q8AA 4W8JA 3VBHA 4L99A 1ZA4A 3I49A 5ABJA 4P08A 5H9PA 4KMQA 1NA1A 3T2TA 1BEV2 1HLCA 4Q4Y1 3VZJA 4AGRA 1YQCA 1EV11 2F17A 5CFCC 1Q3EA 2YB7A 4IE7A 4QKNA 1PIV1 3LEGA 3M1HA 5FP4A 3S7EA 4QPIA 4A6OA 1RUD1 4QX3A 5FPXA 2C26A 4D6SA 5HCHA 4BXSV 5I8TA 1OPMA 2FDJA 3ZSKA 1WMXA 1GANA 4PQ9A 3RZMA 4BHPA 1DIWA 1XYPA 2QDNA 1H8TB 4IEUA 4NE9A 4Q8KA 5KXEA 2OPKA 2I07B 1HB2A 3BYWA 4OHXA 1NUKA 5K8SA 3VDBA 2ARAA 5CAZA 1AR73 5FREA 1FMD2 1L7QA 5C9AB 3KSCA 2D3SA 3FE5A 1SLIA 1RHI3 1VB2A 3LDRA 4IDZA 2DU0A 2H6CA 2MEV3 2P3KA 2R0FA 3C7FA 4ISQA 3K51A 4JGZB 3EHKA 2EIGA 4CUAA 4EV0A 3KT7A 3ZVXA 2PHUA 2K46A 4LO4B 4Y1UA 1HRI1 4CXXA 4JKMA 2XJPA 1O5UA 2JE9A 4UI9L 5AFEA 2JD9A 3RVHA 4YZ1A 5FZ4A 1UXXX 3NQHA 2UU8A 4YSFA 3K46A 2LS6A 1RUD3 1RHI2 1VALA 4OHVA 2E6VA 3ZSEA 5FY8A 1IS4A 2EAAA 4GULA 4GH4A 2ZKLA 3RDIA 2JDYA 3BOPA 5E88A 3OF1A 4YFZA 1REEA 4HKWA 4QX8A 3NJYA 4SBVA 4CDXA 3TOJA 4ZONA 4BK5A 1FV2A 3A22A 1CAVB 4HG6B 4XFGA 3WF1A 4XUNA 5FV3A 4CCOA 4AI9A 4OI4A 5ABJC 2ET1A 1CESA 1FYUA 5FYCA 1FXZA 3FFZA 2AZ5A 4MGKE 5FY0A 4CCCA 2JEMA 1G8WA 3MLLA 1UZVA 2VZUA 1GSLA 3NNGA 4CP0A 1DQ2A 2W08A 2XWBB 2CHHA 4YVSB 2GC3A 1BEV1 3S6PA 5FK8A 2UYAA 5DG1A 2BBVA 2PQSA 4QHOA 1GZTA 1YIFA 2CSGA 1X33A 3O14A 1A78A 3I3QA 1GU3A 1G6NA 1QGLA 2H0BA 2NMOA 1Z0HA 2BYVE 3EYPA 4HK9A 4N7UA 1MZEA 5HXMA 1W06A 3WDVA 4KQ7A 2WO7A 1YJLA 3NO8A 3OEAA 4Y4YA 1VR3A 3LCPA 1PK6A 5FPAA 3WHTA 4NWVA 2UWBA 4CEWB 3URFA 4J25A 1XJAA 3BUCA 1AX1A 4LLFA 2X09A 1WBLA 5T54A 4CZSA 4S2GA 4FPHA 4KGGA 4F7ZA 1PO23 3OGJA 4RQPB 3ZN6B 3LFIA 3G7DA 3T1LA 4HVRA 3AKQA 2DURA 5IHRA 4I02A 3VLBB 3WZ1A 4ZXKA 1PO22 1KFUL 3I3MA 3I7DA 5I0UA 4M3CB 1UU4A 1RUI2 2CAUA 2VECA 2XQRA 3VZNA 1N3OA 4XOGA 3MFCA 3TNQA 3MLKA 3POGA 2W95A 3KV5A 2XHNA 4XTPA 5EWSA 3ZM8A 1CX1A 3KCXA 1ZREA 4BH9A 4Q27A 1DZTA 2WAAA 2AGSA 2TUNA 2YHJA 3I54A 5A7QA 5BUVA 1SCRA 2HWC2 4KBBA 5FY1A 5APAA 3FBYA 3OY8B 3HIFA 3CMGA 2NP0A 4LBQB 4XAAA 3BIEA 1OD3A 3J8F3 1Q8OA 1RMU1 1CAXB 4CDQA 1F35A 1F8VA 3W20A 5LZ6A 1UPSA 2J1UA 3PMSA 3I2IA 2BDRA 3EQEA 3M2MA 4FVVA 4QT6A 5C70A 2HYKA 3U4XA 5FO9B 5F2WA 2ZKNA 2GAUA 2PHXA 1ZX5A 5DDJ2 5IW0A 3CHXA 4B7KA 1JN2P 3LSEA 3ILNA 4IE5A 2RE9A 1IQDC 2XL7A 2ZHMA 3IDAA 3QH6A 1QEXA 2PLV2 2QQVA 3KGZA 3WDWA 4A45A 5BNNB 2WFF1 3AJZA 2BV4A 4H7LA 4QM8A 1OUSA 2OW4A 3UT0A 4AL9A 3AFKA 5EPAA 2YPJA 1V6NA 2IFRA 1MS4A 5FYUA 1BBT2 4XAEA 1CZVA 4K21A 5F5IA 4ZU5A 1JZ4A 3WG4A 3CU7A 3ECQA 3BPSA 4S2FA 4LE3A 3ZR6A 3C7GA 4PIZA 5I91A 1HQWA 3SC7X 4NRQA 1YFYA 4P9LA 1DQ4A 2A75A 5GLTA 4N9HA 2BFUL 2QQWA 4LO5B 2VNOA 1C5IA 3FWEA 4PIYA 1I1EA 1QOSA 4Q0PA 1RL3A 2WFPA 4ISRA 4LBLA 2VTFA 4IEOA 4WM7C 4CCKA 2JIGA 2ZMLA 5IFTA 4QGLA 3B00A 3VBUB 3DYPA 2WWSA 3WSOA 2YU1A 4Y1XA 3TRSB 4MVTA 2HWF3 3TN93 4URTA 2WZ8A 3O1SA 5KC6A 1TG7A 2I74A 3J8F1 1WLWA 5DUWA 2VC9A 4META 1ZBA2 4MGYE 4RR3C 3VL8A 1V6MA 3O1MA 1WBFA 2W1SA 4R4ZA 3RWKX 2PQQA 5I8YA 1ZVFA 3VBRB 1R093 4XUTA 2W3JA 3SEPA 1F5FA 3N9MA 1R092 2BBAA 4IGPA 4LOTA 5LA2A 4AVCA 1RHI1 1ULOA 3WR0A 1T6BX 5FYIA 4GD4A 4AZZA 5F5QA 2DVDA 3AL6A 3VKNA 1MQTA 4YGCA 5IATA 1XXNA 1QJU2 3MGUA 3AYCA 1UYPA 2V4AA 1VRBA 4QQOA 2QQOA 3I2JA 1VBD3 4CUCA 3OB8A 4YM0A 5F7UA 2LALA 1SDDB 3ZDSA 2A71A 5EZWA 1RUH1 2JDZA 1HV1A 1NCQC 4Y5TA 3KV9A 4QX7A 4O61A 2Q8EA 4BIFA 4DINB 2GDFA 2YDEA 5C9AA 1ZBE3 4IXLA 2A6WA 4LKEA 4PI0A 4TWTA 2WO1A 3PVBB 1W8TA 3J26N 3ZKUA 2JKBA 3KS7A 5JXHA 4LUMA 1C8NA 3R4DB 4HMZA 1BMV1 2G9ZA 3PTYA 2C9KA 4GB32 3S57A 2RHPA 4UFJA 4B1MA 3ZO0B 2NLRA 4GB33 1JYVA 3BTZA 1ULEA 1OLME 2Y26A 3O1RA 2WJSA 4AFBA 1XNTA 4RGGA 1GQPA 4YG3A 4B3NA 5C3PA 1UO9A 3VZKA 5IVVA 3M3CA 3POIA 5GLZA 3VHPA 4BDVB 1WD4A 1WWYA 1DGWX 3CNAA 1C8M3 2WN3A 2JWPA 2WZR3 3ZYGA 1Q8SA 4YRDA 2JICA 2ZAAA 4GH4C 5F6LB 3ZSLA 4J1WA 1LHUA 2XVGA 1OD5A 1WCDJ 1K42A 1TMF2 1PNGA 5F3GA 3VBHB 5LRSA 5FMDA 5LBFA 4E2QA 2VAUA 3N7MA 3T1MA 2X5IA 3T0AA 4IV1A 1O8SA 3ENRA 3OJBA 5T5OA 2D93A 1FAYA 3BODA 3HOBA 5I8SA 2QVSB 2DFBA 2P2KA 4YVSA 3D8CA 4XMAA 4MX3A 4FAGA 3U0ZA 3DKQA 2P5BA 2R062 2YY1A 3FLRA 3WQBA 5FOBB 1LR5A 2JG9C 4NO4A 3RQ0A 3IMMA 1TMF3 2VMHA 4CCDA 1QOOA 4OHZA 4YZ4A 5F1RA 1BJQA 4LE4A 1ULDA 5DABA 3BU7A 2RS12 1W6QA 2VZRA 5FCCA 3VZLA 4YYOA 4E4ZA 1QWRA 3E97A 4NIAA 2YGMA 1WMFA 4Q2FA 2DU1A 2ENRA 2QQNA 4I2OA 5FPBA 2QJVA 3PIGA 2JG9A 4XCAA 1QXPA 4YWAA 4DRRA 4MGTA 4LBKA 3O0XA 3TYJA 3OGGA 4HBNA 4YVWC 4AI1A 5CG9A 4GJYA 3N4MA 1Z7S3 4BLIA 1RTVA 2D5FA 4CEYA 1PO13 1WW7A 2Q4SA 5DZGA 5FLJA 5A7OA 5A7SA 5KC5A 4ZS3A 2BWAA 1Z78A 2WR9A 3WDXA 3WDYA 3WW4A 1S0BA 3GZAA 5ACA2 4LORA 1QQP2 2WS93 1QF3A 1WW4A 4XF4A 1G86A 4BMEA 4HKOA 1Z7S2 1W99A 2XVKA 3H3LA 2VG9A 4I09A 4PLMA 1GKBA 1X82A 4K8RB 5LY1A 2B5HA 4BQYA 3OBRA 4ZPIA 2KA3A 4BMBA 2V5YA 2YROA 3PVEA 4PCRA 3RJRA 3UESA 4KU8A 4R8HA 4URAA 4XW3A 1RUJ3 2XKOA 5JI9A 4L11A 2BTVC 1YUDA 1UCXA 3GZTB 4QD2A 4LHNA 5EYYA 1VAKA 2B9UA 3MIFA 3FHQA 1WLTA 4LIVA 2EA7A 4YLZA 5C33A 1EV13 3OEBA 4N8MA 2JDNA 5K0UB 2RS51 4LO7A 2HH9A 2O8OA 4NROA 1VMHA 3WW3A 2R042 4W4ZA 1VMJA 1FPN1 2DUPA 3ACLA 3NNFA 5FJKA 3VBRC 5IT6A 3LAGA 2ORXA 2WNUA 1RC6A 5C9AC 3HJRA 3T2PA 4DEQA 2R30A 2ZS6B 5IJRA 3KQRA 1K5JA 2RMU1 3H1YA 5CNAA 4YZ2A 4AVBA 3F95A 1QJX3 4QX5A 5FDBA 4KU7A 2VOXA 4AYUA 4FP2A 4XE9A 3JB8A 5JI7A 1DZQA 2P37A 3ZN5A 2AACA 2ZZQA 1ASJ1 2X05A 4AFCA 3QOPA 4O7XA 3VD4A 3V0AB 4QB6A 3ZFGC 1S0CA 1UMHA 5IVBA 1EAH2 4NHLA 4CXYA 4YW2A 2GALA 1H1AA 3AX4A 3GJAA 4QU1A 5I93A 4EWEA 2VZ3A 3V0BA 5F39A 4AOCA 3OCPA 1J1TA 2RG4A 1YI7A 4E9KA 4GMP3 4JTNA 1VJ2A 1UKGA 1URXA 3HR9A 1XNCA 4E4SA 2PHWA 1HV0A 4AR2A 3OPTA 2RDRA 1H9WA 3NNMA 4SLIA 3THDA 2EF6A 4AG4A 4RHV2 2WNEA 3WF4A 2WNVB 4PDWB 2XJQA 5J96B 4CCMA 1MVQA 2XR4A 3EJKA 1DGRA 3POJA 1G9CA 5CADA 3B9CA 4BQ1A 1L7RA 1RUNA 1YIPA 4DZGA 4HOOA 4IV3A 3WDTA 5BNOB 4LO8A 1QJY2 3OD0A 2PAKA 4X6RB 4JGZC 5CFDC 2XXZA 3I97A 3P5BA 4X8NA 1UAIA 4AEDC 3LOBA 3WNPA 4DXTA 4XDQA 1WW6A 3LOIA 4UFKA 3TEZA 2UYBA 1KITA 3AP5A 1ZBA1 3ZN6A 4MXVA 1LOAA 4MO3M 1X8MA 4IEQA 2D44A 1QIQA 3R05A 4NPLA 4D6RA 4D7YA 5I0SA 4N90A 5J48A 5ISLA 1JOBA 4QB2A 2XGXA 2IXLA 3MICA 5CKNA 2B7YA 3B9IA 3V0AA 3ATGA 2WNUC 4XF1A 1W03A 2C6SA 4AEDB 1W6OA 2D98A 5IK4A 4XHBA 3PVNA 3FJSA 4QXKA 5C8CA 3SMHA 5FXXA 1W6PA 3SKVA 1LAJA 5FYZA 3T30A 3WQ1A 4K6BA 5BYNA 3POYA 1PGSA 3BVCA 1R1A2 1RUE1 3B69A 2X29A 3LIGA 4CU9A 4GAZA 1LU1A 2ZEXA 2DVBA 4UWDA 3GNEA 1RUF1 3EXUA 2DCKA 3ES1A 1L7LA 1ODNA 4F3JA 3ZYBA 2R063 4M0NA 2G9FA 3MPBA 3NV1A 1NE6A 3P1IA 1QJFA 4PI2A 2C4XA 1TME2 4RN5A 2WZEA 3MDPA 3Q8FA 3USUB 5LW9A 2J1TA 1MVEA 3FLPA 3KT4A 3VKFC 2Y38A 1TME3 5E6HA 1GUIA 3Q8CA 4MADA 2PLV1 1JS9A 4RGKA 3WY6A 4RR3A 2BVVA 4GH4B 4PBOA 4XIOA 5FPLA 1IPSA 3ZXFA 4EZHA 3IT8A 3FZ3A 4ATEA 5DDJ1 3WQ7A 4GZ9A 4CCJA 4YNIA 3ASIA 1WMEA 3FLTA 4LLOA 1GNHA 1PMIA 5L9BA 4CEWC 3RZHA 1SFNA 1GWMA 4CEYC 4A2UA 5L36A 1HRV1 3ZKYA 3VUOA 1VAVA 4HSJA 5SV8A 4AHWA 4LT5A 5FZIA 1A8DA 5DAVA 1LHOA 3NAPC 1AZDA 5FZ0A 4Y1VA 3UL2A 3IZOA 4DOUA 4TSVA 3U4SA 1OOPC 2ARCA 3KF3A 2JX9A 2Q1MA 4GALA 1K12A 1XNAA 1XOYA 2ZHLA 2ZTNA 1HRI3 1IPJA 4OI1A 1UD1A 1VRH3 1XYOA 3K3NA 5T5LA 2ZGOA 5CBLA 2EVXA 3VBSA 2VBBA 3D6EA 4AVVA 1ZZ7A 2RM23 4JZRA 5FY4A 3D4KA 4IETA 4Q1RA 4Y5SA 4IEWA 2XJUA 1V0AA 4TN7A 2O1QA 5JZGA 3RZJA 2XB6C 3BB6A 1DLCA 5EJ1B 3ZXDA 1OOPA 4FXGB 3WT3A 4E27A 1NG0A 3U07A 1C28A 1OLQA 4WM7B 1EUTA 3RZLA 3TWIA 1JYCA 1DHKB 4LKDA 1HX6A 3DPRB 1US2A 2B45X 2VCBA 3AMMA 3J7HA 1XU1A 4CDUB 3AYAA 3OUHA 4LBQD 4BIOA 1S2EA 1MZ6A 4BE3A 1IHMA 4WZFA 2GNDA 1NCRA 4MUVA 3OYWB 2WT0A 4XUQA 1UY2A 5DAWA 1UMZA 1OF3A 1W6PB 1STMA 2BVBA 5FPZA 4A6SA 4P00B 4ZHNA 4WM7A 3K75B 3PUQA 4FSJA 4D3WA 2WSVA 3BKZA 4Q5OA 5FUIA 4FPYA 3H1MA 4PQQA 1FI2A 1OVPA 4I01A 2Q8OA 1PMJX 3OYWA 4K3UA 1U5XA 1Q8VA 1YFWA 4I30A 4LNVA 4IW3A 2Y8KA 3LGRA 3ZYRA 4W65A 1JUHA 4Y22B 5TSWA 4YM1A 5FOJB 4Q4Y2 2PAMA 4CVUA 2Q30A 3C7HA 1ZRDA 2P1BA 4FPOB 5T52A 3EO6A 1NXD1 5FZDA 2WNVC 4PDWC 2VMFA 3N36A 5K0UC 2R6QA 1VBA3 4MV2A 1W6OB 3THCA 4LIUA 4UAPA 4LUKA 5GM0A 4K8FA 2WBKA 3VV1A 3GCWA 3HQRA 4LKFA 1RUH3 3J7LA 3ZFEA 3ME2A 2Y33A 5FPUA 2VCMA 1SQ4A 1UZYA 1JMUB 4OCTA 3AL5A 3OG2A 1AYM1 1ZYBA 1BXHA 5D8AB 1VBD1 3IIIA 2ZZJA 3MYXA 1PZ7A 2EIBA 1C5HA 1MQTC 4RR3B 4FOQA 4A7YA 5FK7A 1LRHA 4BB3A 5KHJA 4WVWA 4U36A 2AYHA 3RWNA 1RUG3 1R081 5F3EA 1DQ0A 3MEPA 2VMCA 1XNDA 2JG8A 5DAQA 4FAHA 2ES3A 3AJYA 4RS5A 1GZWA 1W9FA 1SBEA 4JHTA 4O65A 4AK3A 2LRPA 2E33A 2OQ6A 2IXKA 3K3OA 4N53C 4DUVA 4M01A 5D8AC 1LU2A 4D94A 1GR3A 1XE8A 4XEZA 5IVJA 4JDMA 4Z07A 1AR63 3EBRA 4Z2AA 4Q29A 2FQPA 3ZXLA 1O8PA 1SBDA 1GICA 4IEXA 4IE4A 2JE8A 3SCHA 2NPIA 1IPKA 1PIV3 4P9JA 3CL1A 2WNOA 3LD8A 4QX0A 4DQAA 2J1SA 1UMIA 5D2AA 5BNOC 2WSUA 4QU2A 1UQXA 4I0BA 4LBNA 3W59A 5M0TA 2R16A 1CAUB 1YFXA 3B3QE 5FZ6A 3WVJA 3ACFA 4BISA 4TTGA 3NW4A 1DGWA 3K48A 2HWD1 1H2MA 1US3A 5FZEA 3S0MA 5LWBA 1JZ6A 4XJAA 4XJ8A 5DN2A 1PZ9A 3HT2A 5FXWA 2CGNA 1YO8A 3UK9A 2NM1A 1JHJA 5C4WC 2BRTA 5IAXA 3VBOB 2W46A 1JTZX 4XETA 4AEDA 4MZUA 3MW4A 1TVGA 1NQJA 4XPVA 4AVTA 2VGDA 4IL7A 1E5SA 2YBSA 2ADDA 4Z1VA 1IOAA 3IAQA 4JX0A 4Q1PA 2ZEYA 4NPRA 1FT9A 2MNGA 4AWDA 1SHWB 4DRVA 3VDDA 4H55A 4M4RA 4MGQA 3LZZA 4NN0A 2VXJA 4V1PA 2E7AA 1UZWA 3M3IA 5C3SA 2YU2A 2CGOA 1KGYA 2BGOA 1H4GA 3T09A 4E4HA 1O3QA 2RJKA 2FZ1A 4AI3A 3WCSA 4JGYC 3FBMA 3ZPOA 5HCFA 1NX9A 4O9EA 2HEYF 5CA6A 4A4AA 1G9FA 3ZYHA 4FOWA 4XFHA 4L0PA 2ZX3A 1UW8A 4CYDA 3B93A 5KBFA 1SEFA 1SG3A 1WD3A 2J1AA 4UW3A 1VBC1 3WNNA 2WIIB 4QB1A 2QCSB 5CU1A 4COUA 2PMWB 1SPPB 4K20A 1C1FA 3RRDA 2RS13 4Z8BA 1N3QA 3JU9A 1N1VA 3JBG2 5J09A 1MEC1 3ZXAC 2A3WA 4RSUA 2DUQA 3MIHA 5FP3A 1PVC1 1VRH2 3FUQA 3I2FA 4CDQB 2QZ3A 5GJ6A 1RINA 4Q0SA 2VZOA 5F2SA 3H3ZA 4MH0E 5HBAA 2NN8A 1LHWA 4DPNA 3ZYIB 2WS92 3GDBA 5FKCA 4FTSA 2JKXA 2JXAA 3K2OA 4NMIA 3WV6A 4EE2A 2BNMA 5FZCA 1WZXA 2KR2A 1PGL2 2W94A 3N7LA 3ZXEA 4JC1A 1NZCA 1O5LA 1B35B 3KHBA 2A3YA 2DTYA 4LPLA 2RV9A 4W6XA 3E5XA 2B9VA 2YC4A 1ND2A 4QPGB 1GQGA 1CONA 1LJ7A 1COV2 1OSGA 2ADEA 3CIHA 4E8CA 2XMLA 3VHOA 3ZX7A 4CA9A 1AF9A 2Q5TA 4COZA 5GLUA 3LF7A 1KD7A 4YFWA 2C9AA 2EIDA 3JZVA 4C90A 1LEDA 3SH3A 2GNBA 4XJWA 3UGHA 1QJX2 2R043 3GZEA 2ZGNA 2HWE3 1ZBE1 1PGW1 4RYDA 4CDUC 2BU9A 5KR7A 2VOVA 2W0XA 2HWE2 1RUJ1 3MF6A 4JGYA 1ULCA 5HCAA 4QDQA 1Q43A 1O59A 4HT1T 4C0HA 3TNPB 5GLVA 5JIAA 2HWF2 2LUWA 5FMOL 2R071 3NKTA 2ZPXA 2RJ2A 3MUY1 1F15A 5JOXA 1UOJA 3GBGA 3POWA 1AR91 5LRRA 3AKPA 5B2GB 5KWRA 3H8XA 3VKMA 4BQ2A 1YXWA 2WS91 3FL7A 3LIHA 4HETA 5FYHA 5EV7A 4LMFA 4IERA 1C3HA 4QKFA 2OXBA 4Y1YA 3C3VA 5H9RA 3AM2A 4N53B 1DP0A 1T2XA 2JIJA 4INDA 5D1IA 3VHNA 4D69A 5FMCA 4JDOA 1VBB3 5CIRA 2ARXA 4FBFA 5JAXA 5LA1A 2IFWA 4D6QA 2QE3A 1CIWA 1MEC2 3AVRA 1QOTA 1U5YA 1AR72 4NAOA 2CTVA 4GQ7A 2E51A 2VMIA 1ZRCA 4D7TA 1EAH1 1JZ3A 4LOSA 2VULA 1V6KA 1ENQA 2HYXA 4DFSA 3MIEA 4HN0A 2HWF1 2EXJA 4XABA 5GZGA 4P02B 3CDZB 2WN2A 3UGFA 1Y4WA 1C57A 2HWE1 4B4PA 3IB3A 1IS5A 1ZBE2 5LB6A 1JU3A 4JGZA 4NVPA 1A34A 2XLGA 4EN9B 1FOD1 1W9TA 5FR3A 3HMYA 2XJRA 4MGIE 4QKDA 5EJ3A 5FUNA 1YYNA 1GV9A 1UOFA 1VMFA 2A70A 2UURA 2HEVF 1H2NA 5FZGA 3OGSA 4UXAA 5LATA 3ELNA 1N3PA 4XYXA 1LCLA 4LBMA 2JD4A 4AVSA 3NRUA 3ZPYA 1O6UA 3BTAA 4CDXC 5FZHA 2B39A 4A7ZA 1PGL1 5FQ0A 1GNZA 3OSDA 5BNPC 5FKBA 3HPNA 5FLIA 3QBQA 2XVLA 3AYEA 2CGPA 5SV5A 5JVVA 4ZZ8A 4OUEA 1HW5A 1POQA 1ZNPA 2I45A 2XJTA 1OA3A 4R4XA 5BNQA 4OZXA 2SLIA 4RA0A 2R073 3WW1A 1L3JA 3M7AA 4NWWA 2VCCA 1D4M2 3A21A 2D3RA 4OLLA 4PLNA 3M8LA 1PVC2 1XQNA 1SDWA 5AVPA 3SNMA 1RUE3 2E7QA 4XUPA 4MYEA 2DCTA 2Z79A 3I8TA 4XACA 4CP2A 4DUXA 1NA1C 4XBQA 1QY4A 1B35A 1RVF1 2HWB1 5IFPA 1RUI3 3HBKA 3K77A 4Q4V2 3SCGA 1F2NA 3E5QA 4ZY9A 3WNLA 4I0AA 2YZ4A 5C4WB 3TB0A 2FDFA 1VBC2 1PHMA 1RUC1 4NUBA 4KWLA 2X53S 1ZBA3 2IVJA 3DV8A 4FO9A 5I0RA 1PVC3 2CWMA 3CO2A 4FPEA 3SH4A 2OS2A 1LEMA 1UYZA 3E6BA 4MHUA 1LOFA 5L7OB 1W3XA 4R9BA 3V64A 3HN1A 2CV6A 1W2OA 4BU2A 2VE1A 3GF6A 1JOPA 1I6XA 4QXBA 1NY72 3W9AA 2FDIA 2YG0A 1VBC3 2CAVA 1FNYA 2D97A 3LEKA 2QQLA 5JR7B 1LOGA 3LDKA 4HL0A 4B4QA 2PHDA 3KVAA 1QJU3 1XB9A 1AYN3 2J1EA 1PO12 4BQ3A 4NIGA 3AKSA 4QX1A 1IZ3A 3CKHA 5A3WA 4ITCA 4LR4A 1CJDA 4Q4W2 3ST7A 2YFUA 1V6OA 2O8QA 1JUIA 3Q8EA 5KHHA 1FV3A 2RVAA 3I3EA 4KBZA 2DVFA 1GZ9A 3VBRA 1LNSA 1AVBA 1BZWA 4P5HA 2QQMA 3OY8A 3T4VA 3NJZA 2DCZA 4JQTA 1S55A 5BNPA 4W6YA 2V72A 2ZHKA 3GBFA 1CX4A 5L73A 3PJQA 1AXYA 2YBKA 3OGRA 4FP3A 1DYKA 4GIQA 3ITQA 4L92A 2PFWA 1WLCA 2BUKA 1OQ1A 4AHXA 2A6YA 4JTOA 4YM2A 4HVOA 1W0PA 4XJZA 4U2AA 5KHGA 3O5SA 4JRAA 5BNNC 4MOAA 4AQSA 1W8WA 1FNZA 4FPLA 1AL23 4AF9A 4M3CA 4K40A 3IBMA 2WO2A 4UW6A 2RS53 1T6GC 4MXWA 4P9IA 1A3KA 1FPN3 4AFDA 3WF3A 5A80A 1OI6A 4K1ZA 4LTAA 4P5YA 5IK7A 4AI0A 4ET7A 2JDHA 3LDBA 3OPWA 5FY7A 3DL3A 1B35C 1O4YA 3C7OA 4BJ0A 4DB5A 3MV11 1RXFA 5C3OA 1W6NB 4QQPA 1EV12 3I2GA 1SACA 5JIUA 4M00A 1COV1 1AUYA 4ATFA 5A3UA 4BYYA 2VNRA 1H8VA 4D0QA 1Y9QA 1LB2A 4M3CF 3AKRA 1NCQA 3Q8BA 3K4DA 1OBNA 1PMHX 1AL21 1ZZ8A 1PVXA 1RXGA 2GSYA 4P9XA 3I4IA 5CG8A 3ZSJA 1CZTA 1H6XA 4IV3C 4RFRB 2UY8A 1AYM2 1LOCA 4E2SA 2V73A 1JU4A 2Y6KA 3AZXA 3MV01 4FQZA 4PF5A 3J9SA 1OH4A 1DBNA 5FRAA 3WINE 2GMEA 2RM21 1EAH3 3FFQA 4YW5A 1VRH1 1WLDA 1H8TC 1OKOA 2O14A 3PIJA 2DVGA 2Q1ZB 2XHKA 2CU5A 5C3QA 1SLBA 2KXLA 3BGAA 3QD6A 1LKNA 4UT5A 2MEV2 1YQ8A 2P6CA 2ZEWA 4YZ5A 5A70A 3OPZA 2ZACA 1DG6A 3J8F2 1GQHA 4AFMA 4PF1A 2BGCA 2ZGUA 1W8NA 3JD72 2BGPA 3ILFA 4CSWA 5JR2A 3W5MA 2BZDA 1AYN1 2CL2A 3N9PA 3FMGA 1HRV2 1HXS3 3LKJA 5D8AA 4E8DA 4RL7A 1QJY3 1CN1A 1AR62 4X8PA 4P9GA 4CCEA 3FHAA 2F4LA 4LA3A 4OVEA 3D82A 4RS5B 1JBCA 1N47A 2X10A 4LITA 1RUG1 5CISA 1VBE3 3HQXA 1UYXA 5A1AA 2PLV3 5DZFA 4S2DA 4ZKTB 4W6WA 4XURA 3WG2A 5IVFA 4P14A 4P9YA 2XBO2 4Y26A 2FCUA 1OF4A 1V00A 3AK0A 3RZZA 2H0VA 1YQ2A 3AP6A 4NAMA 3GJBA 4XFIA 2J1RA 3T0BA 3WF0A 1RJ7A 1PX3A 3V56A 4FFGA 1KFXL 2Z42A 3HQUA 1OA4A 3DECA 4GKXA 1UY0A 4Q4X3 1NA1B 1U5ZA 1ULFA 1KJLA 1K45A 1G7YA 1FATA 1R1A1 2QNKA 2VMDA 5ABJB 3CQOA 1VP6A 3IWZA 5AC93 3SISA 4WVMA 3UGGA 1HB3A 4WM8B 4EWAA 1YQ5A 4BXFA 1CAVA 1D7PM 1HQNA 1DQ1A 4Q0VA 1G9BA 2OPWA 4JGYB 4QPIB 4PT6A 3E6DA 1AR83 2F4PA 3I2DA 3PUHA 5JCTA 1BEV3 5L7OC 2PELA 4HSLA 1AHSA 3HN3A 3G6JB 2WDBA 3VN4A 1J58A 2CDOA 2NQYA 5L9RA 4ASLA 4GMP0 4XF3A 3BALA 2QQUA 1CPMA 3VB9A 1H2KA 1J3RA 5BNPB 5T3NA 5GLWA 1R1A3 2VUJA 1ENXA 5A3TA 1VPHA 3NV3A 2WKKA 3ZYFA 5A3NA 1ND2B 4XJUA 2GMMA 3VBHC 1DU3D 3C8XA 1WA4A 4DXSA 2VR4A 5FY9A 1LGNA 4OI2A 1JZ7A 5BV6A 2NZ9A 2W92A 1OLMA 1JYTA 5J1XA 3DUIA 4RD7A 3QCWA 2PHRA 4XDPA 2QQKA 1NLRA 2R1DA 3PHMA 3N35A 3NJVA 4CP9A 4GWJA 4HK8A 4XQDA 3BCWA 3ZYJB 1Y3TA 1R082 1AYN2 2IXCA 1QNYA 4JDNA 1HXS1 2HWC3 5LK5A 4EN6B 2K2SA 4N53A 3ACHA 4E4DX 3TEYA 1VBD2 3CF6E 3O12A 2GMPA 4QM9A 2P3JA 1Y7BA 2RM22 2Y64A 2WWJA 2D6MA 1GMMA 1GOFA 3NAPB 5F6KA 3W58A 2SBAA 2TEPA 2VZVA 4Q4W1 2W52A 3VBSB 4GA9A 1MS9A 1GOHA 2HWD3 3JCIA 1D2QA 2ZBJA 5FP8A 4HFSA 4Z82A 2PXJA 2DBNA 2R0HA 4Y4RA 2VVDA 4IEZA 2DFCA 1ENSA 1OH3A 2RR13 1S1AA 3WX5A 4COVA 2EALA 2J7MA 1OPOA 2A5ZA 1YC61 2Y60A 1W28A 2ERFA 1VAMA 2LTNA 3H7JA 4OYUA 3B02A 3USUA 4AHZA 1Y43B 4CDQC 1MZ5A 5LK7B 2IXIA 4B29A 1QKQA 1WCSA 3GBWA 3KZ4C 1QXJA 1HB4A 4XILA 3D0JA 2HWD2 2Y6GA 1AR93 3RG0A 2RMU3 1S0GA 1UF2C 2EXHA 5FIXA 3PTRB 3GZUC 1WMDA 5C5TA 2RS52 5B4NA 2DCJA 2ZGQA 4Z2WA 2XL9A 5A32A 5GZEA 4UBHA 4XQWA 1BCXA 3BU0A 1ND3B 3WQ0A 3JXSA 4QPYA 1JYXA 1BK0A 3KT1A 3THTA 4C91A 4IGQA 1X50A 2WINB 2YFZA 2YGLA 1CJPA 3B01A 1LENA 4A44A 5LA0A 2AREA 1CIYA 1O4ZA 2F6BA 3UKTA 3CZJA 4FFFA 2ZHNA 3WG3A 4GWNA 4OMDA 4XZUG 5EIYB 3S30A 4YGBA 1IG0A 3ORJA 4XC9A 1AYM3 3E1F1 4R9AA 2VJXA 3PNAA 1CAWB 3OBTA 4UF0A 5FYVA 1ULGA 4WVVA 3MUZ1 3HNYM 5A1FA 2HLEA 3O7OA 2OUJA 4Y24A 4FTBA 4IV1C 4AAXA 5FMBA 1D0GA 1JH5A 5F5CA 3HAGA 5HV0A 4NHKA 2FBEA 3KV4A 2QUOA 2Q8CA 1NLQA 1YRZA 3O1TA 3IM0A 1K5MA 3ZSMA 2ZEZA 3ZFGA 5E16A 3GHNA 4Y1ZA 5DAXA 1OMIA 1FMD1 2ZOEB 3N7KA 4Y20A 3VD7A 1PO11 5BNOA 2AEYA 5ERLA 1V6JA 1RMU3 2E9QA 3GCXA 1WUVA 4DIQA 1OFNA 5JUVA 3IAPA 5CZKA 2O0OA 1OC1A 1GZWB 5BPXA 4ZU7A 2VQAA 1VBB2 4LHSA 2WA4A 3AYDA 1YQ6A 2GNMA 4V2VA 2C1FA 4YGDA 5I0DA 4FFIA 1HIXA 1MEC3 4YGEA 5FYSA 2KM2A 1NAEA 2YMZA 2Y6HA 1C4RA 4NIIA 1NY71 3DF0A 4IEVA 2OT7A 5FZAA 4A7KA 2WLQA 5CYYA 1SZBA 4YVWA 3U1XA 3WNMA 1IG3A 3HWJA 2XQXA 4ES9A 3H8RA 4NPMA 3TEXA 3GHMA 1SBFA 4Q0QA 2HWB2 1H6YA 4QDRA 2R32A 2WNVA 3N9QA 4PDWA 4XFCA 3CLPA 3THPA 3X29B 1PM7A 1HN0A 1SFYA 5F5AA 3WUDA 4AQTA 2HKXA 2ZXQA 3LSDA 1MZFA 1S0EA 2Y6LA 4L8QA 2Y6JA 2A7AA 2JJ6A 1V9U2 4XF9A 1JYIA 2VO5A 2BPA2 3P3NA 3ZDVA 4Y5Z0 3WNXA 2VXRA 1GYKA 1W2NA 4FCAA 4J6GA 4XIKA 5IWFA 1Q5OA 4GWMA 1LGCA 3VKOA 3N3HA 2WLPA 1HQLA 2VVEA 5HXVA 2BFUS 3KWVA 3ETQA 2BNOA 2GC1A 1QQP1 1J59A 5HPOA 1DGLA 1OKQA 2QTWB 3PMEA 3CJIB 2WUHA 5FZBA 3A0KA 3N9OA 4W50A 3U78A 1WGPA 2R072 2DWRA 1HN1A 2E53A 4G9SB 2V4VA 4XXPA 1W8FA 4TLFA 4H2AA 4CDXB 3LA3A 3MO4A 1XPWA 3J7MA 3AVSA 2JENA 2PA7A 2GH2A 4IESA 2VM9A 4BOWA 2R7EB 2JDPA 1W8OA 3H0OA 1NCRB 2WYFA 1BK1A 1QH7A 5LBCA 5T5PA 3RPQA 3PVOA 2VVFA 3FUOA 3IDEA 2C24A 3CJIC 5G05L 5FYMA 4MLOA 1UWWA 5IUQA 1LOFC 5F9TA 4KL1A 2WT2A 2HBTA 4H7MA 5JOYA 2CWSA 4CU8A 4EN0A 5IYYA 4QXHA 2ID4A 1JI6A 2C0ZA 1Y9GA 1GWLA 1NCRC 1VBB1 3I59B 3POSA 4PLOA 4AGVA 3GM8A 2DDUA 5A6XA 1RB8G 5J7MA 1ND2C 2RJLA 3EMRA 3RI8A 2VW1A 4L9BA 3U14A 4YW7A 2MHFA 2BP6A 2CDPA 3S5QA 3O1OA 1AL0G 3AXDA 1KS4A 5JXGA 3ZFEB 1AR71 3DEMA 4CCLA 3QH7A 2RR11 3NNJA 1XBFA 2Z5WA 4ARYA 3W21A 1QJZA 5LA9A 4CP9B 3UETA 4IE0A 3L9JT 1D2SA 4XUOA 5FLHA 3VDDC 1RUF3 3AP7A 3NKGA 2YXSA 1GWKA 3DCQA 1P8JA 1DYPA 3AKTA 3C2UA 2GP3A 2W2IA 1AR92 3ALQA 1PX4A 3VKLA 1NYWA 5FYTA 3ZFEC 4WV8A 1V70A 2RS31 2VD7A 4CDWC 4JRLA 1AXKA 3H8UA 3P6BA 3ZFFC 4KG0A 5A6ZA 1WCKA 2ILMA 5LCWL 1CR7A 1WW5A 2G1MA 5DZEA 4TZDA 1R1ZA 4QX2A 4WVMB 1RUJ2 5E89A 1TNRA 1BVP1 1DQ5A 1FPN2 4KWUA 4PHZA 3AMHA 2P4EA 5JSPA 3MZHA 3LEMA 2J22A 2YUEA 2P3IA 1UU5A 1W0NA 5A33A 3LEIA 2AR6A 2VZ1A 4AXOA 4KWKA 3LFMA 4OMCA 1B09A 1XRUA 5FO7B 4BM8A 2L9LA 1UY3A 2IZWA 4PJYA 4QKBA 4XZPA 5F32A 3SHRA 2JDKA 1UKRA 1J84A 1AJOA 2EIEA 5GALA 2VZPA 4MXWB 3ZN4A 3MLJA 3ZFFB 4LA2A 1F4HA 3GALA 1GOGA 2B46X 1NE4A 5FWJA 1E57A 2FZ2A 2P6HA 1XNKA 2XONA 4DXZA 1QDCA 2PHLA 4Q4X1 3O1VA 2VZTA 4JV4A 5F3CA 5FZKA 4BA6A 1X9PA 5FP9A 3PU3A 1SFPA 2OZJA 1EY2A 1KDKA 1S0DA 1DFQA 3S7IA 4ZU4A 2D3PA 4AGGA 2W5FA 3RGBA 1HJGA 4G4FA 4X6QB 2AENA 3ZFGB 1MS3A 4M4PA 2W1WA 3M3EA 3RFRA 3KD4A 3ACIA 4S2HA 1MS0A 1IKPA 1UX6A 2PYTA 1V6LA 2ZX1A 4LK7A 1YI9A 4QQ2A 1ASJ3 3KV6A 4N43A 3HD8B 3U10A 1IGOA 4IV3B 5J98B 4E2GA 1HRV3 1HXS2 1OXCA 2UWCA 3AMPA 4GMP1 3E5UA 1CAWA 1JYWA 2VMEA 5FWEA 3V0BB 3JD73 1REDA 4FT8A 4V2WA 2FDKA 1NKGA 3LA2A 3WOGA 4Y20B 3WXPA 4QQHA 2JB4A 1E5HA 1RUC3 3BPZA 5FZOB 4IGOA 1K5MB 5C5UA 1YEWA 3T4HB 1QNWA 4TXWA 2RS11 2XLFA 2GC2A 1X7NA 1EP0A 2B8MA 2WC2A 1RVF3 5DAPA 5HCBA 2A73B 3OGVA 5A3OA 1ZZ9A 2QFEA 2J42A 2PAEA 4TYSA 4B4RA 1BVVA 4QPWA 1QXRA 4HONA 5A7WB 5CFDB 3LB9A 1RUC2 3DXUA 1W6NA 5E1RA 2BNNA 3MIBA 4Q4V1 5DQ0A 3VBFC 3UJQA 1VBE2 5LEKA 5FTTC 4XJ9A 3H9AA 4NJ4A 1V9U3 3VDAA 3LA7A 3NNLA 1REFA 3ETPA 1PNFA 1J1LA 2UY9A 3M3OA 4EYUA 1UOGA 3RMXA 1ND3A 2OQ7A 4YZ3A 4JCKA 4BQ5A 1CVNA 5A32B 1BBT3 3KVBA 5K4LA 4A41A 1IKQA 4ES8A 3PDQA 1GP6A 1VIWB 1BLZA 2E63A 2A6XA 2W68A 2WNUB 4CUBA 2VTXA 5C8WA 1S0FA 1XC6A 5FJHA 3WP4A 5JSOA 5KXDA 2QQPA 3AFGA 4NHYA 2R1BA 1UNBA 3KB5A 4CPBD 3NAPA 3BTYA 4NRPA 4OHWA 2D5HA 5I0TA 1ZM1A 3IPVB 2JECA 2GN7A 1V9U1 3OBAA 4QWNA 4XBNA 1AR82 5EJZB 5FPVA 4WM8C 2ZX4A 3IN9A 5DUUA 5AVAA 2XBO1 2ZAHA 3UYJA 4XXAA 1HKDA 2HWC1 4CDWA 2Y34A 3KCCA 1LODA 1UN1A 2WWUA 5FO8B 1CPNA 2JG8C 3PURA 3N9LA 3RNSA 3ROUA 4K7JA 3VBSC 2PN5A 2QQJA 4EQVA 1YJKA 2QKDA 1M4WA 5FZFA 4UW5A 1A8MA 3ON7A 4JVAA 2CNAA 3H8OA 5GZFA 4XDOA 4LKSA 3SXWA 4LBOA 2JE7A 4XFAA 1LOBA 2XDVA 1JHNA 2ZABA 3CZUA 3JD71 4D7SA 1PO21 2ZGSA 3JBG3 5IK8A 5AFBA 2VQ0A 3N9NA 4LQRA 4CEYB 3MIGA 4FOYA 1YLLA 5DUVA 2FCVA 5BNNA 1TE1B 4YM3A 1LULA 2BOJA 3W5NA 3ZMOA 5J37A 1OQDA 1UIKA 1GLHA 2JDUA 4DEVA 2VOTA 4LEJA 4NOTA 1UXZA 1V6IA 3H3UA 4QMAA 2XG3A 2GC0A 3QACA 1UZ0A 2XH6A 3QLQA 2AUYA 5IVCA 2BW8A 4OQ9A 4Z92B 5EXOA 1LGBA 2IVIB 1ND3C 3HNBM 4Q4W3 2PHTA 1R64A 4XHXA 3ZIWA 1LHVA 4ASMB 5JMOA 3R4SA 1IS6A 1QDOA 1UY1A 2AEZA 4LBQA 2GH8A 4MHRA 4DUWA 3KQ4B 1AL22 3PLQA 1VE0A 5AC91 5IAVA 1PIV2 1Q8QA 2HJIA 2WAOA 4RQPA 2G19A 4K9SA 5C3RA 2E31A 4Q26A 2R49A 2TNFA 5F8PA 2YC0A 4L97A 3WF2A 3B5LB 5FXZA 4AEMA 2VNVA 1J83A 5K0UA 4UW4A 4XBLA 1J3QA 1LECA 1PK6B 3DPRC 2VQUA 2CY6A 4H3WA 4IV1B 5FUPA 3AC0A 1SMVA 5FQ0B 3E6CC 1TEIA 1D0HA 1MACA 4BK4A 4QPGC 3RYRA 4DMIA 4LHKA 1PGW2 5A7PA 3H7YA 3K4ZA 2VNGA 4RQPC 1YCIA 3RSJA 1W6MB 1AR81 3JQWA 1H1MA 3D5OA 3MHZA 1D4M1 4C1XA 3BI3A 3TEWA 2XPJA 4CPBA 1O3TA 4GWIA 3A23A 4GXLA 3UKNA 3FN9A 4PBPA 4BQ4A 1W9YA 2IUWA 2XJVA 4IEYA 1LTEA 1NQDA 1UU6A 1RUE2 3SKJE 5A3LA 5ANNA 2VUCA 3WLUA 3APBA 3OD4A 3AZZA 1UYYA 2VPVA 3GGLA 4GJZA 2XWJB 2VCAA 4CTEA 5DG2A 3VBFA 3M70A 4KNCA 2A6ZA 4QPGA 5HI0A 4ASKA 1SLLA 1UIJA 1SLAA 4N7IA 1KXGA 3F2ZA 1NXMA 3ZXKA 3HT1A 2X8KA 3M3QA 1AJKA 1W2AX 1H30A 3I2OA 1K5MC 2QBXA 5DMYA 3UKVA 3IKWA 2GP5A 1VBE1 1DGRN 1ULPA 2I2SA 2V5DA 5GKAC 4DXRA 2IC1A 4R52A 3BOWA 4BPZA 1HJFA 4MSVA 5JDBA 1JODA 1FOD2 2EAKA 2WA3A 3POBA 2ZGTA 3KCYA 1W6QB 5J36A 3PUSA 2VW0A 1O3RA 1E5RA 3JBG1 1KRIA 3VBFB 4XFBA 1BKZA 1ENRA 3R0RA 4KGQA 4QGNA 1JZ5A 3LQCA 1KQRA 1RUG2 4FI9A 4XQ4A 5DDJ3 4CUGA 1MQTB 2JDAA 3I2KA 2ZGKA 4QGMA 1Y9MA 4HXCA 4EN7B 1LHNA 2P34A 4JAAA 1CD3G 5KXCA 1S0IA 2Q0AA 1ZRIA 5A7NA 1NT0A 2AH2A 1W6MA 3AZVA 4XMIA 3PUIA 1ACCA 2P3YA 5DPNA 2X5IB 3T2OA 2E26A 3D3AA 1POV1 4HKLA 5H9SA 1H4HA 5C6CA 2MEV1 2HEWF 5JOWA 5T50A 5GZCA 2DF7A 1OURA 1OQEA 1U0AA 1W9SA 1TMF1 1TME1 1ZA7A 4FPCA 3VL9A 4RS5C 4QDSA 2H6BA 4LHLA 5FBJA 5C8CC 3VD9A 3NWKA 1F9KA 3VDCA 4YG6A 4AI2A 2VUAA 4MGSA 5FZ7A 4IQPA 2VW2A 1X9TA 2WT1A 3RZKA 1H8TA 5JZGC 2G4IA 2VL4A 1YWKA 4TLGA 5F3IA 3WNOA 1H1IA 3Q9OA 3VBUC 4Q4X2 4COYA 1AX2A 3PL0A 1IS3A 3TBDA 2X5IC 5JWPA 2QZ2A 2ZJCA 2WQ4A 3FHIB 2D40A 4RFT0 1G9AA 2WRAA 3NV4A 2QDRA 2VQTA 1W3VA 2OZ6A 2XOMA 3TN92 5LBBA 1XNBA 4N9IA 4A3ZA 4HN1A 4FTEA 2Y6FA 5CFCA 1KDMA 5EHDA 1OT5A 2XUEA 1D4M3 1QH6A 4CXWA 3WW2A 4QPIC 2XLAA 4NR1A 1VBA2 1ONAA 4DY5A 1VLNA 4WBBA 2N7GA 2YYOA 1JW6A 3HBZA 1S0JA 5FZ1A 5A1LA 4LXLA 3VGIA 5FP7A 3IIAA 2Z4FA 2VBPA 1OLRA 2VH9A 4ZXEA 1PZ8A 5CEHA 2JDMA 4AHYA 3U37A 3B7MA 1AX0A 1R083 2MPFA 4FQ4A 1WA6X 2C5DA 3MBWA 4DY3A 3HVDA 4UFHA 2RS32 1QJY1 4QHZA 3SH5A 1FMD3 5J3UA 3USSA 1MPXA 4BLJA 3SLIA 4K1YA 2OUHA 2IXHA 4I0WB 4P9WA 4H14A 2RDNA 2DCYA 1D4VB 1OUXA 4DS0A 3D0SA 1BHGA 1R091 4COWA 2JG8B 1DF0A 2VU9A 4M0HA 2D7FA 4N43B 4CDWB 3TAYA 1CAXA 3T3YA 4CU6A 4NIHA 3AP9A 2TBVA 3NSTA 1A6CA 3UV9A 2RR12 5FZOA 1DQ6A 5JSRA 2OX0A 3M4FA 2D6PA 3BIWE 4KI5M 4ZS2A 1RUF2 3NV2A 4AI8A 4KG8A 5K9YA 1NOVA 2FDGA 5EYXA 3O0VA 3HEIA 5H9QA 1CQ9A 4F8AA 3VHRA 3WHUA 4CEWA 4MGZE 5C4WA 1I5ZA 2DTWA 3DXTA 3VBUA 3FC0A 3GYDA 3MW3A 5IK5A 5FBZA 1X36A 3WDUA 3JB4C 4WZCA 3WP3A 2FD8A 4N43C 1N1YA 3H42B 5L19A 4JKLA 2WO3A 5A6YA 2D6KA 1Q56A 2OIIA 3AZYA 5DUXA 2XJSA 2ZGMA 2ZGPA 3AB0A 2W9XA 1AXZA 5JXIA 4UOJA 3KM5A 1C8M2 2WZR2 4XVHA 5T55A 5A3PA 1H0BA 3VDDB 4I3PA 5CKMA 4IE6A 3NVCA 2ZGRA 1QJEA 1QJX1 4I3GA 5AC92 3EB7A 3CJXA 4LJHA 3T2QA 1ZRRA 5JPMB 2D6LX 2BJSA 2GU9A 1BBT1 3A0NA 3OUJA 4UBGA 3SITA 4BZ4A 3AMNA 5BY5A 4MG2A 4NIDA 3UNPA 1J3PA 4LO6B 1ZZBA 1S2KA 5F37A 2YBPA 2WFF3 4YW4A 1PK6C 2GN3A 2WFF2 5B4XA 1S4CA 1POV3 2W39A 4J1XA 2GNTA 2FHRA 1Q8PA 5HV4A 4ONUA 2WL1A 4RHV1 1O7FA 5LY2A 1Z7S1 2Q8DA 4YW6A 5FYYA 5G04L 1JZ8A 2EXKA 4Q0UA 3LPFA 2EXIA 1EPWA 3DPRA 3ES4A 4JHZA 4YG0A 4CE8A 4IUGA 2A1XA 4EWDA 1OOPB 3JUUA 1RMU2 4OZOA 4LBJA 3V65A 4L2NA 1H2LA 1BMV2 2OVUA 3KHCA 1LESA 2XKPA 4ZZ5A 1PM4A 2ORZA 3OUIA 2OYZA 4CP1A 1IQAA 5L9VA 4HLTA 1SLTA 1U12A 2E7TA 4AEJA 1HDKA 1N1SA 3AP4A 4EN8B 2Z2SB 1ASJ2 3AXEA 3WNKA 1W8HA 4Y33A 3K4AA 1W2UA 5JMCA 1FOD3 1CGPA 1UY4A 2WYSA 1GNYA 2ZMKA 5CVRA 4YARA 4JQRA 2UWAA 3VD5A 1KJRA 2K0GA 2ETEA 2DVAA 3JQXA 2R061 4XTMA 2YPDA 5EFUA 2R041 1DZRA 1O4TA 1W2TA 3VZMA 4OQ8A 2RDQA 1NZIA 4AAPA 5A33B 3ZXGA 1QQP3 5K7PA 2WQ8A 3I59A 1XYNA 1E5IA 1W04A 4BWOA 1RVF2 3BN6A 3H50A 2W91A 2BOIA 3KGLA 1UL9A 3MI8A 5ACA3 3NMBA 3T08A 1GBGA 2PTMA 3ZFFA 1M06G 3O1PA 1W90A 2VTXJ 4HZFA 5LASA 1W8UA 3P3PA 4XFFA 4AFAA 3MW2A 4R9DA 4NHXA 4AQ2A 1F31A 1SLCA 4LK6A 3RI9A 1JXNA 3POFA 1I5PA 3A4UA 4C8DA 1OHFA 4C1WA 4LULA 3KF5A 5FZ3A 5FZMA 3SQOA 5ACA1 5IVYA 1C8M1 1I9RA 2W1UA 2J1VA 1XU2A 2WZR1 2FMDA 3VZOA 1LOEA 3C7EA 2WZPP 4Q4Y3 5C8CB 2QQIA 2XUMA 4BCUA 3RYPA 3IMNA 3MF9A 2YC2A 3OBZA 1BYHA 3MPPG 2OKXA 2FCTA 5FZ8A 4FPGA 2VUDA 1RYYA 2P17A 4QQLA 4WM8A 4YPJA 5JZGB 5A3MA 1G9DA 4GB31 4CRQA 4R9CA 4DO0A 2W47A 3I2HA 4M3CE 3I3BA 2D6OX 5KHKA 4OUSA 3ZOIA 1GP4A 4AE2A 2ET7A 1ALYA 1EPZA 1RIRA 1GZCA 2DYCA 2Q1FA 4HANA 1O91A 5DXDA 4RGAA 4CDUA 3AMQA 1ST8A 1CWPA 3A7QA 3RJ2X 2D43A 2VOKA 2ZA9A 3ABZA 3SCFA 1F5JA 3WP5A 1RUH2 2RS33 3DN7A 1MS5A 1K3IA 4OULA 2WABA 2W1QA 4QXCA 2CYFA 1HB1A 2KD7A 3R4UA 5JOZA 3CBNA 5T5JA 1DLLA 1MS8A 4UFLA 1U5IA 3ZYPA 1S2BA 4AQ6A 3MIDA 1POV0 1SPPA 4Q8LA 3LPGA 4D8MA 4ORFA 3ZXJA 1H9PA 1UOBA 4AW7A 4HVQA 5BXXA 5KXBA 3T0DA 1XSQA 2B4KA 2WQZC 1YNAA 4FOVA 1RITA 4UYBA 1XE7A 3DYOA 1KS5A 1EYBA 3KLSA 4QAWA 4Y3OA 2DV9A 1I3HA 2W87A 3LWCA 3ACGA 3OOXA 2VY0A 4RHV3 5E8AA 1FX5A 3VBOA 3ZLIA 5LEJA 4KWJA 4HPKA 1RUD2 1N1TA 4A3XA 3DKWA 3IPVA 2ZCWA 2JB8A 5FZ9A 4ARXA 3ZMNA 2VZQA
chains in the Genus database with same CATH topology
2XBO3 3CJIA 4OUMA 4AEKA 1ZZCA 1TQ5A 5GZDA 1YFUA 1VB4A 1MS1A 2A6VA 1UPIA 4PIXA 3TN91 1RGSA 1C1LA 3VBOC 1COV3 4G3YC 1YHFA 2VMGA 3ZIXA 2RMU2 3L2YA 4QHBA 3RYKA 1NCQB 4WVZA 2K9ZA 1O3SA 1CAUA 2BEOA 5CFDA 3J4UH 4EROA 4FPJA 5FAXA 1MR5A 2DUOA 3OTFA 4HPKB 1GFF2 1W0OA 2LM3A 1BQPA 4Q4V3 4OHYA 3WCRA 4FPFA 5KHIA 4AVAA 1QMJA 4YVSC 1QJU1 1ZRFA 4B8EA 4FPKA 1QU0A 2ARBA 1X8EA 5CB7A 2ZGLA 2ZX2A 2ATFA 3NL1A 3H1WA 3UJOA 2ZX0A 1RUOA 4YVWB 3MFAA 4FXKB 4YW3A 1ZZ6A 3WD5A 2Y0IA 2IWGB 2Z69A 2D6NA 1OFSA 5JPNB 3FX3A 2PHFA 3INAA 1VBA1 4YW1A 3WUCA 2FMYA 1TNFA 3RMYA 1RJ8A 4O9GA 4Y22A 3CEWA 2V09A 3U11A 3N7JA 4KH9A 1AR61 2JG9B 1UZZA 2B42B 3B94A 3WG1A 4EJRA 5FMOS 3WP6A 3IDBB 2Y0OA 1JOJA 1W39A 1HRI2 2VOWA 4DNYA 1SCSA 1RUI1 2NYYA 5FFOC 2NMNA 1DDLA 1NLSA 4C0BA 2G9GA 3AZWA 2BWCA 3L2HA 4B7EA 4OFGA 5L7OA 2OA2A 2HWB3 3RS6A 4IEPA 3DGTA 4GKYA 5JLVA 2A3XA 2BQPA 3PJYA 1OA2A 3ILRA 5CFCB 4OI0A 2YV8A 4F83A 1APNA 2IXJA 2GZWA 3R6SA 4NHMA 3IDCB 3KMHA 1QHDA 3O0WA 2ZMNA 4XF0A 3VBHA 4L99A 1ZA4A 5ABJA 5H9PA 1NA1A 3T2TA 1BEV2 1HLCA 4Q4Y1 3VZJA 4AGRA 1EV11 5CFCC 1Q3EA 1PIV1 3M1HA 3S7EA 4QPIA 1RUD1 5FPXA 5I8TA 1OPMA 3ZSKA 1GANA 4PQ9A 4BHPA 1DIWA 1XYPA 2QDNA 1H8TB 4IEUA 4Q8KA 5KXEA 2OPKA 2I07B 4OHXA 5K8SA 5CAZA 1AR73 5FREA 1FMD2 5C9AB 3KSCA 2D3SA 3FE5A 1SLIA 1RHI3 1VB2A 2DU0A 2H6CA 2MEV3 2P3KA 2R0FA 4ISQA 3K51A 4JGZB 3EHKA 2EIGA 4EV0A 3KT7A 3ZVXA 2PHUA 4LO4B 4Y1UA 1HRI1 2XJPA 1O5UA 2JE9A 5AFEA 4YZ1A 4YSFA 2UU8A 1RUD3 1RHI2 1VALA 4OHVA 2E6VA 3ZSEA 1IS4A 2EAAA 4GULA 4GH4A 2ZKLA 3RDIA 3BOPA 5E88A 3OF1A 4YFZA 1REEA 4HKWA 4SBVA 4CDXA 3TOJA 1FV2A 1CAVB 4XFGA 5ABJC 4OI4A 2ET1A 1CESA 1FYUA 1FXZA 3FFZA 2AZ5A 4MGKE 2JEMA 1G8WA 3MLLA 1GSLA 4CP0A 1DQ2A 2W08A 2XWBB 4YVSB 2GC3A 1BEV1 3S6PA 2UYAA 5DG1A 2BBVA 1YIFA 1X33A 3O14A 1A78A 1G6NA 1QGLA 2H0BA 2NMOA 1Z0HA 2BYVE 4HK9A 4N7UA 1MZEA 3WDVA 4KQ7A 1YJLA 3NO8A 4Y4YA 1VR3A 3LCPA 1PK6A 3WHTA 4NWVA 2UWBA 4CEWB 3URFA 1AX1A 4LLFA 1WBLA 5T54A 4CZSA 4S2GA 4FPHA 4KGGA 4F7ZA 1PO23 3OGJA 4RQPB 3ZN6B 3G7DA 3T1LA 4HVRA 3AKQA 2DURA 4I02A 3VLBB 3WZ1A 4ZXKA 1PO22 1KFUL 3I7DA 5I0UA 4M3CB 1UU4A 1RUI2 2CAUA 2VECA 3VZNA 1N3OA 4XOGA 3MFCA 3TNQA 3MLKA 4XTPA 5EWSA 3KCXA 1ZREA 4BH9A 4Q27A 1DZTA 2AGSA 2TUNA 2YHJA 3I54A 5BUVA 1SCRA 2HWC2 4KBBA 3FBYA 3OY8B 3HIFA 2NP0A 4LBQB 3J8F3 1Q8OA 1RMU1 1CAXB 4CDQA 1F8VA 1UPSA 3PMSA 3EQEA 3M2MA 4FVVA 4QT6A 2HYKA 3U4XA 5FO9B 2ZKNA 2GAUA 2PHXA 1ZX5A 5DDJ2 4B7KA 1JN2P 3LSEA 3ILNA 2RE9A 2XL7A 2ZHMA 3QH6A 2PLV2 3KGZA 3WDWA 5BNNB 2WFF1 3AJZA 4H7LA 4QM8A 2OW4A 3AFKA 2YPJA 1V6NA 2IFRA 1MS4A 1BBT2 4K21A 4ZU5A 3WG4A 3CU7A 3ECQA 4S2FA 4LE3A 4PIZA 5I91A 1HQWA 1YFYA 4P9LA 1DQ4A 2A75A 5GLTA 4N9HA 2BFUL 4LO5B 2VNOA 1C5IA 3FWEA 4PIYA 1I1EA 1QOSA 4Q0PA 1RL3A 2WFPA 4ISRA 4LBLA 4IEOA 4WM7C 2ZMLA 4QGLA 3B00A 3VBUB 2WWSA 4Y1XA 3TRSB 4MVTA 2HWF3 3TN93 4URTA 5KC6A 2I74A 3J8F1 5DUWA 1WLWA 4META 1ZBA2 4MGYE 4RR3C 3VL8A 1V6MA 1WBFA 4R4ZA 2PQQA 5I8YA 1ZVFA 3VBRB 1R093 1F5FA 1R092 4AVCA 1RHI1 3WR0A 5F5QA 2DVDA 3VKNA 1MQTA 4YGCA 1XXNA 1QJU2 3MGUA 3AYCA 4QQOA 1VBD3 4YM0A 2LALA 3ZDSA 2A71A 5EZWA 1RUH1 2JDZA 1HV1A 1NCQC 4BIFA 4DINB 2GDFA 2YDEA 5C9AA 1ZBE3 4IXLA 2A6WA 4TWTA 3PVBB 3J26N 2JKBA 3KS7A 4LUMA 1C8NA 3R4DB 4HMZA 1BMV1 3PTYA 4GB32 2RHPA 3ZO0B 2NLRA 4GB33 1ULEA 2Y26A 2WJSA 4AFBA 4RGGA 4YG3A 4B3NA 3VZKA 3M3CA 3VHPA 5GLZA 1WD4A 1DGWX 3CNAA 1C8M3 2WZR3 3ZYGA 1Q8SA 4YRDA 2JICA 2ZAAA 4GH4C 5F6LB 3ZSLA 4J1WA 1LHUA 2XVGA 1OD5A 1WCDJ 1TMF2 1PNGA 3VBHB 5LRSA 4E2QA 3N7MA 3T1MA 2X5IA 4IV1A 3ENRA 3OJBA 5T5OA 2D93A 1FAYA 3BODA 5I8SA 2QVSB 2DFBA 2P2KA 4YVSA 3D8CA 4XMAA 4MX3A 4FAGA 3U0ZA 3FLRA 2R062 2YY1A 5FOBB 1LR5A 2JG9C 4NO4A 3RQ0A 1TMF3 2VMHA 1QOOA 4OHZA 4YZ4A 5F1RA 1BJQA 4LE4A 1ULDA 3BU7A 2RS12 1W6QA 5FCCA 3VZLA 4YYOA 4E4ZA 1QWRA 3E97A 2YGMA 1WMFA 4Q2FA 2DU1A 2ENRA 4I2OA 2QJVA 2JG9A 1QXPA 4DRRA 4LBKA 3O0XA 3TYJA 3OGGA 4HBNA 4YVWC 4AI1A 5CG9A 3N4MA 1Z7S3 4BLIA 1RTVA 2D5FA 4CEYA 1PO13 1WW7A 2Q4SA 5DZGA 5FLJA 5KC5A 2BWAA 1Z78A 3WDXA 3WDYA 3WW4A 1S0BA 3GZAA 5ACA2 1QQP2 2WS93 1QF3A 1WW4A 4XF4A 1G86A 4BMEA 4HKOA 1Z7S2 2XVKA 4I09A 2VG9A 4PLMA 1GKBA 1X82A 2B5HA 3OBRA 2KA3A 4BMBA 2V5YA 2YROA 3PVEA 4PCRA 3RJRA 4KU8A 4R8HA 4XW3A 1RUJ3 2XKOA 5JI9A 4L11A 2BTVC 1YUDA 1UCXA 3GZTB 4QD2A 4LHNA 5EYYA 1VAKA 2B9UA 3MIFA 1WLTA 4YLZA 2EA7A 5C33A 1EV13 5K0UB 2RS51 4LO7A 2O8OA 3WW3A 2R042 1FPN1 2DUPA 3ACLA 5IT6A 3VBRC 3LAGA 2WNUA 1RC6A 5C9AC 2R30A 2ZS6B 3KQRA 3H1YA 2RMU1 5CNAA 4YZ2A 4AVBA 1QJX3 4QX5A 5FDBA 4KU7A 2VOXA 4AYUA 4FP2A 4XE9A 3JB8A 5JI7A 1DZQA 2P37A 3ZN5A 2ZZQA 1ASJ1 4AFCA 3QOPA 3V0AB 3ZFGC 1S0CA 1EAH2 4NHLA 4YW2A 2GALA 1H1AA 3AX4A 5I93A 4EWEA 3V0BA 3OCPA 1J1TA 1YI7A 4E9KA 4GMP3 4JTNA 1VJ2A 1UKGA 1URXA 3HR9A 1XNCA 4E4SA 2PHWA 1HV0A 1H9WA 4SLIA 2EF6A 4AG4A 4RHV2 2WNEA 2WNVB 4PDWB 2XJQA 5J96B 1MVQA 3EJKA 1DGRA 1G9CA 5CADA 3B9CA 4BQ1A 1RUNA 1YIPA 4DZGA 3WDTA 4IV3A 5BNOB 4LO8A 1QJY2 3OD0A 2PAKA 4X6RB 4JGZC 5CFDC 4AEDC 4X8NA 1UAIA 3LOBA 4XDQA 1WW6A 3LOIA 2UYBA 1KITA 3AP5A 1ZBA1 3ZN6A 4MXVA 1LOAA 1X8MA 4IEQA 2D44A 4D7YA 3R05A 5I0SA 4N90A 5J48A 2XGXA 2IXLA 3MICA 2B7YA 3B9IA 3V0AA 3ATGA 2WNUC 4XF1A 4AEDB 1W6OA 2D98A 5IK4A 4XHBA 3PVNA 3FJSA 4QXKA 5C8CA 3SMHA 1W6PA 3WQ1A 4K6BA 5BYNA 3POYA 1PGSA 1R1A2 1RUE1 3B69A 2X29A 1LU1A 2DVBA 3GNEA 1RUF1 3EXUA 2DCKA 3ES1A 4F3JA 2R063 4M0NA 2G9FA 3MPBA 3NV1A 1NE6A 1TME2 3MDPA 3USUB 1MVEA 3FLPA 3KT4A 3VKFC 2Y38A 1TME3 2PLV1 3WY6A 4RR3A 2BVVA 4GH4B 4PBOA 4XIOA 3ZXFA 5BV6A 3IT8A 3FZ3A 4ATEA 5DDJ1 3WQ7A 4YNIA 3ASIA 1WMEA 3FLTA 4LLOA 1GNHA 1PMIA 4CEWC 1SFNA 4CEYC 4A2UA 5L36A 1HRV1 3VUOA 1VAVA 4HSJA 5SV8A 4AHWA 4LT5A 1A8DA 1LHOA 3NAPC 1AZDA 4Y1VA 3UL2A 4DOUA 4TSVA 1OOPC 2JX9A 2Q1MA 4GALA 2ZHLA 2ZTNA 1HRI3 1IPJA 4OI1A 1UD1A 1VRH3 1XYOA 5T5LA 2ZGOA 5CBLA 2EVXA 3VBSA 3D6EA 4AVVA 2RM23 1ZZ7A 3D4KA 4IETA 4Q1RA 4IEWA 2XJUA 2O1QA 5JZGA 2XB6C 3BB6A 3ZXDA 1OOPA 4FXGB 3WT3A 4E27A 1NG0A 3U07A 1C28A 1OLQA 4WM7B 3TWIA 1JYCA 1DHKB 1HX6A 3DPRB 2B45X 3AMMA 1XU1A 4CDUB 3AYAA 4LBQD 4BIOA 1MZ6A 4BE3A 1IHMA 4WZFA 2GNDA 1NCRA 4MUVA 3OYWB 2WT0A 1UMZA 1W6PB 2BVBA 5FPZA 4WM7A 4FSJA 4D3WA 2WSVA 4FPYA 3H1MA 1FI2A 4I01A 2Q8OA 3OYWA 4LNVA 4K3UA 1U5XA 1Q8VA 1YFWA 4I30A 3ZYRA 3LGRA 4W65A 1JUHA 4Y22B 5TSWA 4YM1A 5FOJB 4Q4Y2 2PAMA 2Q30A 1ZRDA 5T52A 4FPOB 3EO6A 1NXD1 2WNVC 4PDWC 3N36A 5K0UC 2R6QA 1VBA3 4MV2A 1W6OB 4LUKA 5GM0A 4K8FA 3VV1A 1RUH3 3ZFEA 3ME2A 1SQ4A 1UZYA 1AYM1 1ZYBA 1BXHA 5D8AB 1VBD1 2ZZJA 3MYXA 1PZ7A 1C5HA 1MQTC 4RR3B 4FOQA 4A7YA 1LRHA 5KHJA 4WVWA 4U36A 2AYHA 3RWNA 1RUG3 1R081 1DQ0A 3MEPA 1XNDA 2JG8A 4FAHA 2ES3A 3AJYA 4RS5A 1GZWA 1SBEA 4AK3A 2IXKA 4N53C 4M01A 5D8AC 1LU2A 4D94A 1GR3A 1XE8A 4XEZA 4JDMA 4Z07A 1AR63 3EBRA 4Q29A 2FQPA 3ZXLA 1SBDA 1GICA 4IEXA 3SCHA 2NPIA 1IPKA 1PIV3 4P9JA 3CL1A 4DQAA 5BNOC 2WSUA 4QU2A 4I0BA 4LBNA 3W59A 2R16A 1CAUB 1YFXA 3B3QE 3WVJA 3NW4A 1DGWA 3K48A 2HWD1 1H2MA 3S0MA 4XJAA 4XJ8A 1PZ9A 3HT2A 2CGNA 1YO8A 3UK9A 2NM1A 5C4WC 3VBOB 1JTZX 4XETA 4AEDA 4MZUA 3MW4A 4XPVA 1NQJA 4AVTA 2VGDA 4IL7A 4Z1VA 1IOAA 4Q1PA 4NPRA 1FT9A 2MNGA 4AWDA 4DRVA 3VDDA 4H55A 3LZZA 4NN0A 4V1PA 2E7AA 3M3IA 2CGOA 1H4GA 1O3QA 2RJKA 2FZ1A 4AI3A 3WCSA 4JGYC 3FBMA 5CA6A 5HCFA 4O9EA 2HEYF 1G9FA 4FOWA 4XFHA 2ZX3A 1UW8A 4CYDA 3B93A 5KBFA 1SEFA 1WD3A 4UW3A 1VBC1 2WIIB 2QCSB 5CU1A 4COUA 4K20A 1C1FA 3RRDA 2RS13 4Z8BA 1N3QA 3JU9A 1N1VA 3JBG2 5J09A 1MEC1 3ZXAC 2A3WA 4RSUA 2DUQA 3MIHA 1PVC1 1VRH2 3FUQA 4CDQB 2QZ3A 5GJ6A 1RINA 4Q0SA 3H3ZA 4MH0E 2NN8A 1LHWA 4DPNA 3ZYIB 2WS92 4FTSA 2JXAA 3WV6A 2BNMA 1PGL2 3N7LA 3ZXEA 4JC1A 1NZCA 1O5LA 1B35B 2A3YA 2DTYA 4W6XA 3E5XA 1ND2A 4QPGB 1GQGA 1CONA 1LJ7A 1COV2 1OSGA 3VHOA 3ZX7A 1AF9A 2Q5TA 4COZA 5GLUA 1KD7A 4YFWA 2C9AA 3JZVA 4C90A 1LEDA 3SH3A 2GNBA 4XJWA 1QJX2 2R043 2ZGNA 2HWE3 1ZBE1 1PGW1 4CDUC 2VOVA 2W0XA 2HWE2 1RUJ1 3MF6A 4JGYA 1ULCA 5HCAA 1Q43A 4HT1T 4C0HA 3TNPB 5GLVA 5JIAA 2HWF2 2LUWA 5FMOL 2R071 3NKTA 2ZPXA 5JOXA 3GBGA 3POWA 1AR91 5LRRA 3AKPA 5B2GB 5KWRA 3VKMA 1YXWA 2WS91 4HETA 5EV7A 4IERA 1C3HA 4Y1YA 3C3VA 5H9RA 3AM2A 4N53B 3VHNA 4INDA 5D1IA 4D69A 4JDOA 1VBB3 5CIRA 2ARXA 4FBFA 5JAXA 2IFWA 2QE3A 1CIWA 1MEC2 1QOTA 1U5YA 1AR72 2CTVA 4GQ7A 2E51A 2VMIA 1ZRCA 4D7TA 1EAH1 2VULA 1V6KA 1ENQA 4DFSA 3MIEA 4HN0A 2HWF1 2EXJA 5GZGA 1C57A 2HWE1 4B4PA 1IS5A 1ZBE2 4JGZA 4NVPA 2XLGA 4EN9B 1FOD1 3HMYA 2XJRA 4MGIE 5EJ3A 1YYNA 1GV9A 2A70A 2UURA 2HEVF 1H2NA 4UXAA 3ELNA 1N3PA 4XYXA 1LCLA 4LBMA 2JD4A 4AVSA 3ZPYA 3BTAA 4CDXC 2B39A 4A7ZA 1PGL1 5FQ0A 1GNZA 5BNPC 5FLIA 3QBQA 2XVLA 3AYEA 2CGPA 5SV5A 5JVVA 1HW5A 1ZNPA 2XJTA 2I45A 4R4XA 1OA3A 5BNQA 4OZXA 2SLIA 4RA0A 2R073 3WW1A 1L3JA 3M7AA 4NWWA 4OLLA 1D4M2 2D3RA 4PLNA 3M8LA 1PVC2 1XQNA 1SDWA 5AVPA 3SNMA 1RUE3 2E7QA 4MYEA 2DCTA 2Z79A 3I8TA 4CP2A 1NA1C 4XBQA 1QY4A 1B35A 1RVF1 2HWB1 1RUI3 3SCGA 4Q4V2 1F2NA 3E5QA 5C4WB 4I0AA 2YZ4A 3TB0A 1VBC2 1PHMA 1RUC1 4KWLA 2X53S 1ZBA3 3DV8A 4FO9A 5I0RA 1PVC3 2CWMA 3CO2A 4FPEA 3SH4A 1LEMA 3E6BA 1LOFA 5L7OB 4R9BA 3V64A 3HN1A 2CV6A 3GF6A 1I6XA 3W9AA 1NY72 1VBC3 2CAVA 1FNYA 2D97A 5JR7B 1LOGA 4HL0A 4B4QA 2PHDA 1QJU3 1AYN3 1PO12 3AKSA 1IZ3A 4ITCA 4LR4A 1CJDA 4Q4W2 3ST7A 1V6OA 2O8QA 1JUIA 5KHHA 1FV3A 2DVFA 1GZ9A 3VBRA 1AVBA 1BZWA 4P5HA 3OY8A 3NJZA 2DCZA 1S55A 4W6YA 2ZHKA 3GBFA 1CX4A 5L73A 3PJQA 1AXYA 4FP3A 1DYKA 4GIQA 4L92A 2PFWA 1WLCA 2BUKA 1OQ1A 4AHXA 2A6YA 4JTOA 4YM2A 4HVOA 1W0PA 4XJZA 4U2AA 5KHGA 3O5SA 4JRAA 5BNNC 4AQSA 1FNZA 4FPLA 1AL23 4AF9A 4M3CA 4K40A 3IBMA 4UW6A 2RS53 1T6GC 4MXWA 4P9IA 1A3KA 1FPN3 4AFDA 1OI6A 4K1ZA 4LTAA 5IK7A 4AI0A 3DL3A 1B35C 1O4YA 4DB5A 1W6NB 4QQPA 1EV12 1SACA 5JIUA 4M00A 1COV1 1AUYA 4ATFA 1LB2A 4BYYA 2VNRA 1H8VA 1Y9QA 4M3CF 3AKRA 1NCQA 1AL21 1ZZ8A 1PVXA 2GSYA 4P9XA 3I4IA 5CG8A 3ZSJA 4IV3C 2UY8A 1AYM2 1LOCA 4E2SA 2V73A 3AZXA 4FQZA 4PF5A 3J9SA 1DBNA 5FRAA 3WINE 2GMEA 2RM21 1EAH3 3FFQA 4YW5A 1VRH1 1WLDA 1H8TC 2DVGA 2Q1ZB 2XHKA 1SLBA 2KXLA 3QD6A 1LKNA 2MEV2 4YZ5A 3OPZA 2ZACA 1DG6A 3J8F2 1GQHA 4AFMA 2BGCA 2ZGUA 3JD72 3ILFA 2CL2A 1AYN1 3FMGA 1HRV2 1HXS3 3LKJA 5D8AA 4RL7A 1QJY3 1CN1A 1AR62 4X8PA 4P9GA 4LA3A 4OVEA 3D82A 4RS5B 1JBCA 1N47A 1RUG1 1VBE3 3HQXA 2PLV3 5DZFA 4S2DA 4ZKTB 4W6WA 3WG2A 4P14A 4P9YA 2XBO2 4Y26A 1V00A 3AK0A 3RZZA 2H0VA 3AP6A 4XFIA 1RJ7A 3V56A 1KFXL 2Z42A