1WLTA

Crystal structure of dtdp-4-dehydrorhamnose 3,5-epimerase homologue from sulfolobus tokodaii
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
176
structure length
176
Chain Sequence
MPFEFENLGMGIILIKPKVFPDKRGFFLEVFKSEDFTKMRIPNVIQTNMSFSRKGVVRGLHYQRTPKEQGKIIFVPKGRILDVAVDVRKSSPTFGKYVKAELNEENHYMLWIPPGFAHGFQALEDSIVIYFITHNEYSPPHERCISYSYIDWPIKEVIISDKDLQCPSLEKAEVFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords 176aa long hypothetical dTDP-4-dehydrorhamnose 3,5-epimerase
publication title Crystal Structure of dTDP-4-dehydrorhamnose 3,5-epimerase homologue
rcsb
source organism Sulfolobus tokodaii
total genus 38
structure length 176
sequence length 176
chains with identical sequence B
ec nomenclature ec 5.1.3.13: dTDP-4-dehydrorhamnose 3,5-epimerase.
pdb deposition date 2004-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00908 dTDP_sugar_isom dTDP-4-dehydrorhamnose 3,5-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1wltA00
3HT1A 4MGIE 2XL7A 2Z69A 5BV6A 5I8TA 5JSRA 2H0VA 2P17A 4EWEA 2D5HA 5FPXA 3IIAA 4FAHA 3G7DA 2UY9A 4R52A 1NE4A 3B02A 4IEUA 3U11A 4I0BA 4ONUA 1SEFA 3HIFA 3ELNA 4D7TA 2XKPA 1ZRCA 1FI2A 3WW2A 2OZJA 2GC1A 4Q0SA 4JVAA 4QX5A 3FWEA 3WW4A 4NVPA 1J3RA 2CAVA 4MH0E 5LEJA 2PQQA 2GC3A 2XLAA 2F4PA 3ZDSA 1I6XA 4KU7A 5KHJA 3OD0A 1V70A 2PYTA 2MHFA 5E1RA 3D0JA 4E2GA 3FFQA 1Q43A 3EQEA 4MGYE 2CGPA 5I8YA 2HKXA 3I59B 1O3RA 4UBGA 1QY4A 2WC2A 4XFHA 2V09A 1SFNA 1EY2A 1CAXA 1UW8A 1X7NA 3FHIB 3CLPA 3DN7A 5FLIA 3U10A 5F1RA 4XF0A 3S7IA 1RUOA 1RTVA 1X8EA 2XGXA 3N4MA 4HN0A 2VPVA 3OCPA 4OFGA 1LRHA 5K8SA 1YWKA 4HLTA 4IESA 4D7SA 1NYWA 1ZRRA 3TNPB 5BY5A 1ZRFA 4ZU4A 4KWKA 4MGZE 4HVQA 4CYDA 1DGWA 1ZVFA 1O3TA 2B5HA 5JSPA 5C6CA 2I45A 3R6SA 4EV0A 3LAGA 3NL1A 1J59A 4AVBA 3RDIA 1XRUA 2XHKA 3KGZA 3OF1A 3PLQA 4ZU5A 3BB6A 4KWLA 2KXLA 3TNQA 2BNNA 3NW4A 4QGNA 5FDBA 5KHGA 4I2OA 1YFUA 2ZKLA 4XFGA 3MZHA 1IPKA 1QXRA 3UKVA 2GU9A 3KMHA 3DL3A 3EHKA 2N7GA 3ES4A 5JCTA 1UIJA 4HVOA 2Q4SA 1UPIA 1X82A 1Y3TA 5FCCA 4IEWA 4LA3A 1DGRA 4XFBA 5BPXA 1XE8A 4I02A 4QM9A 4Z82A 1RC6A 4Q0PA 3E5XA 3E6CC 4K8FA 3UKTA 4E2SA 4PIYA 4LEJA 4IERA 3GYDA 1UIKA 4YRDA 3UKNA 4WBBA 2IXCA 3ROUA 2OYZA 1FXZA 4KL1A 3USSA 3JZVA 4XFFA 1LR5A 2QJVA 4XFAA 4MGKE 3DV8A 2UY8A 3DKWA 3D0SA 4L11A 4IEZA 4I0AA 1U12A 4MV2A 4WVZA 1OFNA 4Q0VA 3LZZA 2Z2SB 3HT2A 3QACA 1HW5A 1PMIA 1YLLA 1ZZ7A 3LWCA 4H7LA 3NSTA 4Q0UA 1J3QA 4META 2EAAA 2PHDA 1ZX5A 4O9GA 5T3NA 5I0SA 5I8SA 3RZZA 2IXIA 4HN1A 3PVBB 4YSFA 4PJYA 1O3SA 1YFXA 5FQ0A 4JV4A 3I59A 1G6NA 4XF3A 2GAUA 4AQ6A 2CV6A 5I0TA 4LUMA 4XF9A 3H8UA 4LA2A 2VQAA 4RD7A 1GQGA 3WW1A 2ET1A 3BALA 3EJKA 2D5FA 3E6DA 4XEZA 1J3PA 2IXLA 3QOPA 5D1IA 2MPFA 2UYAA 4TLFA 4UBHA 4LULA 2EA7A 4Q0QA 1VJ2A 5EFUA 3E97A 2MNGA 4HZFA 3OGJA 4OLLA 4GULA 1WLTA 2IC1A 4XF4A 4PIXA 3ACLA 2GH2A 3IWZA 1YFYA 3LA3A 2B8MA 3M70A 1VP6A 2ZCWA 3FX3A 4XFCA 2QNKA 3LOIA 3ETQA 1CAVA 4QXKA 4R8HA 3RYPA 2EVXA 5EZWA 1YFWA 5J3UA 2XL9A 4QGMA 2BGCA 3SCHA 4QGLA 2K0GA 1O7FA 5JR7B 3E5UA 2XLFA 2GZWA 4N9HA 5LRRA 2QVSB 1ZNPA 2H6BA 4UXAA 2Q0AA 4KWJA 1ZRDA 2GC2A 4EWAA 2XKOA 1Q3EA 4X6RB 3BU7A 1EYBA 3IDCB 3CJXA 4Z07A 1YUDA 2O8QA 1ZZ8A 4HSLA 1RGSA 2OPKA 2ETEA 2PFWA 3I7DA 2IXJA 4X6QB 3H50A 4AVAA 1J1LA 5AVPA 3EBRA 5BUVA 3PNAA 1GQHA 4F7ZA 3RNSA 5I0UA 5CADA 3NVCA 4YARA 3H7JA 3C3VA 2XLGA 3CL1A 1CAUA 5JSOA 3D82A 2PAMA 3O14A 2B9UA 4LUKA 5KHKA 4FBFA 4HSJA 3BCWA 1O5LA 2PAKA 1CAWB 1ZZBA 2O1QA 4XFIA 4F8AA 4IEQA 4FT8A 5JAXA 1J58A 4YNIA 1PM7A 2OA2A 4DINB 1O4TA 3IBMA 2IXKA 1OD5A 1NE6A 1JUHA 3E5QA 3ST7A 5FPZA 3SMHA 3H3UA 3MYXA 1WA4A 5C8WA 1QWRA 1NZCA 4EROA 1OMIA 3CEWA 4MUVA 2Q30A 4FAGA 1L3JA 1ZZ6A 3MDPA 3CF6E 4B29A 5KHHA 5I0RA 3RPQA 3KSCA 2HJIA 1WGPA 3NKTA 5E16A 1CGPA 3SCFA 4I09A 3KGLA 4ORFA 5FLJA 1DZTA 3FJSA 3H7YA 3H9AA 2H6CA 2WFPA 4KU8A 2ATFA 4WZCA 1X8MA 1ZZ9A 4LLOA 4BH9A 5I93A 2BEOA 4YYOA 2QCSB 4AXOA 1Y9QA 4E2QA 3H3ZA 2PTMA 2FMYA 2C0ZA 1H1IA 4MZUA 1VR3A 4Q29A 2OZ6A 3SHRA 4EWDA 1UCXA 3NJZA 3BPZA 5FQ0B 1FT9A 3S7EA 2D40A 3S0MA 3FE5A 1RL3A 3M3IA 2ET7A 2D93A 3IDBB 1O3QA 4IEYA 3I54A 5HI0A 3EO6A 1ZREA 3L2HA 4QMAA 5I91A 1CAXB 5J7MA 4HBNA 5KBFA 3KCCA 1DZRA 2BYVE 2UYBA 5LRSA 4N9IA 4IEXA 4XF1A 1RUNA 1SQ4A 2DCTA 3H1MA 4BIFA 4MX3A 1IPJA 2PAEA 4AVCA 5FLHA 2CAUA 1CX4A 3CO2A 1TQ5A 4A2UA 1UD1A 4QM8A 1CAVB 2E9QA 4O9EA 1Q5OA 4P9GA 3HQXA 4HVRA 5J48A 3SCGA 3OTFA 3GBFA 1EPZA 3FZ3A 3SXWA 2GC0A 3LA2A 4JTOA 2QDRA 1QXJA 2FQPA 3U0ZA 4LTAA 4J1XA 2PA7A 4I3PA 4XETA 1OI6A 1YHFA 1LKNA 1NXMA 4I01A 3ES1A 1CAWA 3WW3A 3E6BA 4IETA 5KHIA 2PHLA 3MPBA 5LEKA 2IXHA 4IEPA 3LA7A 1I5ZA 2BNOA 4HMZA 4AQ2A 4BHPA 3H1YA 2BNMA 3RYRA 4BYYA 5CVRA 3H1WA 1ZZCA 5CU1A 1H1MA 1EP0A 3VHRA 4PIZA 3RYKA 4IEOA 4IEVA 4JTNA 1LB2A 1O5UA 1CAUB 4ZU7A 1XE7A 2K9ZA 2Y0OA 4J1WA 5BXXA 2VECA 4L2NA 2Q1ZB
chains in the Genus database with same CATH superfamily
3OYWA 4MGIE 1FNZA 4P9IA 4V1PA 5IK5A 5C9AA 1WW7A 2HWD3 3C2UA 1OPOA 4Z92B 3ZVXA 5ABJB 5TSWA 5DAWA 2AENA 3RJ2X 2UY9A 1BBT3 5BNNB 1MEC1 2BV4A 2HBUA 1NE4A 2HWB1 4PCRA 4QKNA 2WWJA 3B02A 3NV4A 3BU0A 2Y26A 3WP4A 1OQDA 4I0BA 2FDIA 1SEFA 2GNMA 5HPOA 4FOWA 2WNUB 3WCSA 1RUF2 3K51A 5L9VA 3IKWA 4D7TA 4UYBA 2AC1A 3PTRB 4H14A 4AFAA 3WW4A 4Q0SA 5LWBA 3IAQA 5FKBA 4UT5A 1R081 4CP9A 2VMCA 1GZCA 2Y33A 4EE2A 2CAVA 4MH0E 4Y22B 4GQ7A 4E27A 2GC3A 2F4PA 2CDOA 4JZRA 4XMAA 2AREA 3ZDVA 5E1RA 3THDA 3D0JA 2P2KA 5F6LB 1Y9MA 4MGYE 5JIUA 5I8YA 2NM1A 1C5IA 4Y20B 5DUXA 1ZM1A 3ZR5A 1QJY2 1G7YA 4M3CE 4UBGA 1VBE2 3HPNA 1EAH2 1RUC1 4GMP3 4XFHA 1DQ1A 4FOVA 2V09A 1EY2A 4CDXB 2HBTA 1X7NA 3LFMA 3J4UH 3DECA 4QPIA 1LJ7A 4YPJA 4BLJA 4CUGA 3X29B 2YB7A 4XDPA 4AFCA 5A3MA 2WSVA 3OBZA 3ZXLA 1AR63 1IGOA 3IT8A 5IWFA 2JB4A 3PL0A 4KI5M 3URFA 3GALA 4W6YA 1ENRA 2VQTA 1PGL2 2VE1A 4HN0A 5K8SA 1YWKA 2XVKA 2Y60A 4HLTA 4IE5A 4QDSA 5A33A 1ZRRA 3TNPB 1ZRFA 5KWRA 1BXHA 3MLKA 2A7AA 4A6OA 5FP7A 4HVQA 3DYPA 3RGBA 4OHYA 1WD3A 2A3YA 1JW6A 4XHXA 4UW3A 1HKDA 4FI9A 3PUQA 4L8QA 4ZZ8A 2XWJB 3LAGA 2WAOA 5L36A 3NNMA 3WUDA 4D7YA 1OLQA 1J59A 2G9ZA 1RIRA 2UWCA 3GZUC 3PMEA 4LHLA 3MW4A 4DEVA 1XRUA 2ZGOA 3UGGA 5CKQA 3BB6A 3W21A 1H30A 2JICA 1DQ0A 2KXLA 2JB8A 3NW4A 5E8AA 2NYYA 2RS31 1UU4A 2ZXQA 4JAAA 3CDZB 4QGNA 5IAXA 4I2OA 4FFFA 3VL8A 4E4SA 5C33A 3LPFA 1QXRA 4YG6A 3I4IA 3RFRA 3VDAA 2WO1A 1MPXA 2WZR1 3DL3A 4LBOA 3RRDA 2HYKA 3ZSEA 1WW4A 5A6YA 2TBVA 4B1MA 1UPIA 1FNYA 1X82A 1Y3TA 3OEAA 3VBOA 5FYTA 3VHPA 2KD7A 5CB7A 4AI3A 5LBCA 1FOD3 1AL21 2NLRA 4LA3A 4QT6A 5LK7B 3QLQA 1GZWA 3PVEA 3LEGA 1TNFA 3T4HB 1REEA 4I02A 5BPXA 4OHZA 1GR3A 1DGLA 2R043 4QM9A 1RXGA 4CDWB 4OHVA 1WW6A 4BQYA 4XUNA 1OOPB 4NIDA 1QJU2 2JX9A 2OX0A 4K8FA 5IYYA 1UOBA 3M2MA 3UKTA 4RSUA 1HV1A 3LOBA 2ILMA 5L9BA 2YC4A 4FP2A 4AI0A 2ZGTA 1D4M2 3WNOA 4OQ8A 3UKNA 2VXRA 1R1A1 2OYZA 1FXZA 5KR7A 2VJXA 4QKBA 1NLRA 1W8TA 3JZVA 2Q8CA 5A3LA 4XFFA 1LR5A 3AK0A 4AE2A 2A6WA 4M0HA 4NMIA 3ACIA 4HL0A 3ZYGA 3TWIA 4XQ4A 2WN2A 4QQOA 5A7OA 1MEC2 5H9QA 1W0NA 3DV8A 2HWB2 3D0SA 2RR13 2VXJA 1L7QA 1PNGA 1U12A 2R1DA 4MV2A 1HXS1 4NIAA 1AR81 1KDKA 4Q4W1 5CKNA 1DGWX 3H42B 4IE4A 3ECQA 3T1LA 2ES3A 3LF7A 1W6MA 1HW5A 4RFT0 3DUIA 1RJ7A 5A1FA 3AYDA 4YW6A 3AZVA 1ZZ7A 2GNDA 3LWCA 1B35C 2Y6JA 4MO3M 4GD4A 4NPRA 5FYIA 5A7SA 2VMGA 1R082 4Q0UA 4QPWA 3BYWA 2EAAA 2PHDA 2WQ8A 4XXAA 4S2HA 3U4SA 1H1AA 4MLOA 1C8NA 2EIDA 4OZOA 4RR3A 5I8SA 3RZZA 4D94A 3FBMA 3P3NA 1U0AA 2IXIA 4N43A 5JOYA 3UYJA 3O0VA 4DB5A 2QQPA 4XPVA 1VBB1 3GNEA 2P37A 5FYMA 4BA6A 1RUE3 1RMU3 1LTEA 4RGKA 2CSGA 3Q8CA 5FZ9A 3TEYA 5IVBA 2GAUA 2ZGKA 3JUUA 2CV6A 4GB32 2GSYA 4LUMA 1BEV3 4XF9A 2X5IA 3PJQA 4O61A 4Q4X2 1GKBA 1APNA 1RUC2 4LA2A 3AJZA 4TWTA 2VQAA 2ZKNA 3MW3A 5F7UA 3INAA 4XCAA 5FZBA 3ZOIA 1GQGA 1UY0A 4LKSA 1W05A 2GALA 1W8OA 2A6ZA 4GWMA 1J3PA 2JDMA 4M0NA 1KEXA 2VZ1A 3IPVB 5EYYA 4BQ5A 4GWJA 4AVTA 1ND3A 1PVC2 1RYYA 2ARAA 1K45A 2UYAA 1CJPA 2NMOA 4Y4YA 3T2TA 1ALYA 5FPVA 2RS51 1L7LA 4BJ0A 4GALA 3CNAA 4B4RA 4URTA 5HXVA 2PLV1 1UAIA 3OGJA 4ARXA 4CZSA 4IV3B 2XPJA 4LITA 3QBQA 1NCRC 3WNXA 1S2KA 2BRTA 4CVUA 1ND2A 2WN3A 4ARYA 5L7OA 4PIXA 2B7YA 5FAXA 3LA3A 2YPJA 1S1AA 3GGLA 2ZCWA 1CD3G 4WM8B 4Y24A 4YW2A 5L19A 5DAXA 2RMU1 3ETQA 1CAVA 4MGQA 3MW2A 2QQUA 2ADDA 3ASIA 3D6EA 4XHBA 4Y1ZA 1YFWA 4HKLA 5EWSA 5J3UA 1W6PB 3V0BB 2CL2A 3HNMA 3O1PA 4M3CF 4QGMA 4CEWB 4KGGA 1NCQC 2E63A 5EJZB 4QGLA 2K0GA 1O7FA 5JR7B 4DUWA 1UOFA 1XNDA 4HXCA 3OOXA 4R9BA 4IE6A 2PN5A 1KS5A 1LOFA 2QVSB 1JYWA 2Q0AA 1ZRDA 2GC2A 3GHNA 2D44A 4SBVA 1MQTC 4XE9A 5FZEA 4BXFA 2JG8A 2EALA 4XJ9A 4A7YA 3KQ4B 4Z2WA 2PHTA 2ZGMA 5FZ3A 1WMXA 4LBQA 4QPGB 1VBC1 2BWCA 3VZMA 4TYSA 1STMA 1TEIA 1HJGA 1REDA 5JMOA 2PHFA 4JKKA 4BQ3A 1IKQA 3RG0A 4P9XA 4OHWA 1ZA4A 4Y1YA 5C4WB 4XVHA 1F5FA 2GMPA 4AF9A 2FDGA 1OLMA 3GZAA 4GJZA 4CA9A 3RZHA 1F2NA 3K2OA 4R4XA 4GKYA 4F7ZA 2ZMKA 5CADA 1D0HA 3K4ZA 3ZLIA 3ZXJA 1NCQB 1HLCA 3J7NA 2HWC3 1IS3A 3KWVA 2BVBA 4QPYA 3N9LA 1R1A2 5CNAA 2WFF1 1HRI3 1PGW2 2WABA 2BPA2 3FHQA 3I2OA 1DF0A 1MS0A 3ZN6B 2RV9A 5FOBB 2RDSA 1O5LA 4LBKA 4MOAA 1JZ4A 1IS4A 5DDJ3 5BNPC 1ZZBA 4FPKA 4MXWA 3ZSKA 4FTBA 3ZFFC 4XFIA 1EUUA 1XYPA 4Q4W2 4FT8A 4LBNA 5JAXA 3AP5A 1QDOA 4LE3A 4YNIA 4YM0A 5L9RA 3U4XA 5GM0A 2YMZA 3HQUA 3MIFA 3IMNA 2E31A 3J9SA 3N9NA 3Q8EA 4PDWC 1PM4A 4RS5C 1LHNA 1OD5A 1TMF3 5FYZA 3E5QA 3I2DA 2KA3A 2ZEXA 1W39A 1SLIA 1QU0A 3H3UA 4L92A 1MZ5A 1AR71 2JG9B 4XAAA 3VBFA 1VBB2 4OUEA 1JZ5A 3R4UA 5IVCA 1S0DA 2VH9A 3RZLA 3F2ZA 2CWSA 1JBCA 4FAGA 2EIBA 3MDPA 4ZY9A 5FZFA 1O91A 3WF2A 4E4ZA 2WKKA 4SLIA 1S0CA 2WO3A 1QKQA 3NNJA 1GNHA 3N9PA 2ZS6B 3N9OA 2G4IA 1UYYA 2BFUS 1RVF3 1JYTA 2E33A 3PU3A 5A7WB 2GNBA 4BZ4A 5JUVA 1PZ7A 2ZHMA 4W4ZA 4I09A 3JBG3 2R6QA 1POV3 2DVAA 4MGSA 2WT1A 3FJSA 2RJLA 3AP7A 3MIHA 3B9CA 3B5LB 1LENA 3H9AA 2H6CA 2EIGA 3AKTA 1CZSA 1SG3A 3D3AA 1JYNA 1G86A 2P6HA 4WZCA 1J83A 1X8MA 4Q26A 5K0UC 1SLLA 5I93A 3LDBA 1OA4A 3ILFA 2JD4A 2PLV2 2QCSB 4TTGA 5T52A 5LY1A 4JQTA 1GUIA 2A75A 4U36A 4NPLA 3T30A 2OW4A 3H3ZA 5FKCA 2ZJCA 2RHPA 1WBFA 2FMYA 2WO2A 3WR0A 2WL1A 3SHRA 1Q8SA 2WRAA 3W9AA 4EWDA 1UCXA 5FQ0B 3R4DB 2CU5A 5F9TA 1HQNA 3BIWE 1UY3A 3AZWA 2RMU2 4NR1A 1W9WA 1S0BA 1WMDA 4AW7A 2VVEA 1S4CA 2G1MA 3S7EA 2IFRA 3LQCA 4BQWA 4AGVA 2OXBA 2RJ2A 1FMD1 4UFJA 1V6IA 2X05A 2A6VA 2WQ4A 3JCIA 5B2GB 3GJBA 1O3QA 2C26A 4XJZA 4DOUA 2XVGA 3PHMA 4R9CA 3A7QA 3VBRA 2DFCA 2PHRA 1N3OA 4HBNA 2WA3A 4P9YA 2ZHNA 3VDDA 3KCCA 3VV1A 4M3CA 4S2DA 5LA2A 4QX1A 1RITA 5JXJA 2VZ3A 2ZTNA 1DZRA 3IM0A 5A7QA 1UX7A 1BHGA 1O6UA 2DVBA 2VW2A 3TEXA 4P02B 5FP8A 2ZX4A 4LHSA 1DCSA 4IEXA 1MZEA 3PVNA 4QX2A 5HCFA 1EV13 2W2IA 2W1QA 1H2MA 1VBC2 3B94A 2R30A 3PUHA 3ZKUA 4CDQC 1VRBA 2X29A 2PAEA 4AVCA 4E8DA 4EZ4A 3ACGA 3CO2A 1SLTA 3ACFA 3Q8AA 4N53C 4NWVA 3USUA 1BVP1 4BPZA 2QQNA 2JXAA 4YW4A 5T54A 4O9EA 3VD7A 5K7PA 4JHTA 1KFXL 1H2LA 1UKGA 4GIQA 1E5HA 3LIHA 4P5YA 4UAPA 3ZN5A 2VCMA 4YGBA 1A78A 5C3SA 2GC0A 2D6MA 3A23A 3RS6A 3VD9A 2VBPA 1QXJA 2WBKA 4CTEA 2VZUA 1UXZA 1K5MC 1V9U1 4COWA 3U0ZA 5ANQA 1VLNA 1H8TA 1L7RA 4CU6A 3DPRB 4GWIA 4NHKA 1YHFA 4A4AA 3M3OA 4RGAA 3AM2A 3MIGA 3P5BA 5IVVA 3UV9A 1G9FA 4NE9A 5HCHA 1AX1A 4N53A 3QCWA 4CEYC 5KHIA 1YRZA 3WY6A 2VZSA 3POYA 3NJVA 4IEPA 2HWF1 3LA7A 1XE0A 4KNCA 4RFRB 2P34A 5CG8A 4CUCA 3THPA 4C90A 5JIAA 3LEIA 2MEV3 1N3PA 5CFDA 4O7XA 4EQVA 2CDPA 2BNMA 2VZOA 4FPOB 3SITA 1ULOA 5A32A 4R4ZA 3VBUA 5FK8A 2W94A 5CVRA 4K1ZA 1ZZCA 1EP0A 1OXCA 1W6QA 4PIZA 1KRIA 2QQJA 5D2AA 2A5ZA 3ZXGA 4YFZA 1W3XA 3VBHB 1CAUB 1H6XA 1XU2A 2E26A 2V4AA 4JQRA 4YZ2A 4B3NA 4HETA 2XB6C 4L2NA 5FZOB 1AL0G 2J1AA 5CG9A 1VALA 5F3EA 4YZ3A 5T5JA 4AHYA 1GWKA 1ZBE1 1GNYA 4YVSA 4YVWA 4JRLA 1VE0A 2BW8A 2D5HA 1F8VA 4MYEA 3IIAA 1SCRA 4OYUA 1PGSA 1H4GA 1H4HA 3TN93 4AFMA 4CEYB 2RE9A 1JXNA 2FD8A 1NX9A 1MS3A 2YU1A 4W6WA 5FZCA 5A80A 1JTZX 3U11A 1PK6A 5A70A 4PLOA 5HXMA 3AL5A 3ELNA 1LHVA 3R4SA 3AKRA 5FXVA 2DF7A 5FY5A 2XKPA 1WD4A 1N1SA 3WW2A 3VDBA 1RUF1 1GP4A 2VGDA 5IVYA 3BTXA 4HG6B 5GZDA 4LK6A 4XQWA 5LEJA 1OBNA 2WNOA 2HWB3 3IAPA 5KHJA 1PO21 1V70A 2ARXA 4C0BA 5JDBA 2EF6A 3FFQA 2TUNA 2QQKA 2CGPA 3O7OA 1WKYA 4D69A 1W2NA 3T2QA 1MZFA 4GH4C 2Z79A 3DYMA 3I59B 3KV4A 4I0WB 5A1AA 5F2SA 1O3RA 4FQZA 1FMD2 2Q8DA 1R083 5J1XA 3FHAA 3G6JB 1GSLA 3OGSA 4DS0A 1FYUA 4JGZA 1VAKA 3KLSA 3POWA 1QJY1 1XC6A 1AX0A 3FLRA 2VD7A 4DEQA 2WNVB 1DZQA 1VBE1 2FZ2A 1EAH1 3C7HA 5JSRA 5FLIA 1XBFA 2XVLA 3EMRA 2XJUA 4QU1A 5IJRA 1IHMA 2J7MA 2D3RA 1C5HA 3M7AA 4RA0A 2VZPA 4V2VA 2A6XA 2VZRA 1COV1 2VNGA 2W47A 4Q8KA 1VMFA 1ENQA 2VMEA 1KXGA 3THCA 4NPMA 2BGOA 3CJIC 2VPVA 1W6NB 3H8OA 1RUC3 1W9YA 4AI2A 1VPHA 1NA1B 2WUHA 3P3PA 1OQ1A 4JGYB 5BY5A 3O1VA 2QKDA 3WLUA 5F3CA 4BE3A 5IFPA 5KXDA 4KWKA 1XOYA 5LBFA 4W8JA 1NKGA 4CYDA 2VCAA 1JUIA 1ZVFA 2YHJA 3MLJA 3SH5A 1CX1A 4JC1A 2R16A 1CWPA 5IAVA 3R6SA 4AEDC 5KXCA 4EV0A 2IZWA 4KBBA 1H9WA 2Y6HA 5ERLA 4DMIA 1JOPA 1MS9A 3CHXA 4AVBA 5FMCA 2W1SA 1V9U2 5FZKA 5JPMB 2XHKA 1H0BA 3OF1A 2ZGSA 4HPKB 4UF0B 3TNQA 1UY1A 3KD4A 3ZFGA 4XFGA 4YM2A 4BQ4A 3ZYFA 5FUNA 3BGAA 3UKVA 5KC6A 1WW5A 2GU9A 4L97A 1DHKB 4AVSA 3SKJE 2D6PA 4ET7A 1FV3A 2N7GA 1H9PA 3LSEA 4X8NA 5J09A 2Q4SA 2WT0A 3OD4A 5EP9A 1XU1A 2BP6A 3ON7A 5ABJC 3VKNA 4W65A 2HWF2 4ISQA 5BNNC 5FCCA 1AJOA 2PMWB 1RUI1 4HOOA 5EQUA 4XFBA 1HN1A 2GH8A 2JD9A 3HOBA 1XE8A 2RS33 2WLQA 4FOQA 5C8CA 3KF5A 2DYCA 2WNUC 4FCAA 1UNBA 4NROA 4DY5A 1QMJA 2IVIB 4WM7A 4Q0PA 1U5IA 3E5XA 1OFSA 4E8CA 4DXSA 1WBLA 2WZR3 4PIYA 2Y6LA 4JDOA 2QQIA 1F15A 2DVDA 4EN8B 4YG3A 5FYVA 4YRDA 2W0XA 1C4RA 3GJAA 2XUMA 1AL23 1W28A 2YC0A 1V00A 1D4M1 2OUHA 3KVAA 1KJRA 4P00B 4QXHA 4XZPA 1QQP2 2J1EA 3KF3A 1YXWA 3MPPG 4TZDA 1WMFA 5IVEA 3ZSJA 3WNKA 2LS6A 1FX5A 4MGKE 4EN7B 1QOTA 4AR2A 5GLZA 1JZ8A 1LHOA 4L11A 3OGVA 4IEZA 4WVZA 4GA9A 4P9JA 1E5SA 4Q0VA 4XILA 2W52A 3LZZA 3AMPA 2FDFA 5JI7A 2X09A 4CDXC 3KCXA 2Z2SB 3NV2A 3QACA 5EJ3A 3WCRA 3WF3A 5EV7A 1R1A3 3MIEA 5BNOA 4H7LA 4UFKA 2YZ4A 3OUHA 4CXYA 1NZIA 1LGNA 1J3QA 1UOJA 4META 4CP2A 4LHNA 3SLIA 4IV1A 1HV0A 4LE4A 1SMVA 3TRSB 1K3IA 2WJSA 1ACCA 1KJLA 2BGPA 2Q1MA 4HN1A 1PO22 5FMBA 1H8VA 1HXS3 4CDUB 4PJYA 1AR83 3OEBA 4H3WA 4Q4W3 3OYWB 4YSFA 4NIGA 2PHXA 1HRV1 5C9AB 1I1EA 4JV4A 1GBGA 5DQ0A 1CZVA 4P14A 1S0IA 4FPHA 4OI1A 3WF0A 4DRRA 3BIEA 3EXUA 2ZGNA 2YXSA 1QOOA 4HT1T 5E89A 2ZBJA 2VMIA 5D8AC 3WQ1A 4D6SA 5ACA1 4GB31 5J36A 2YGLA 4RD7A 3RMXA 1PMHX 2VQ0A 3BALA 4P5HA 4Q4X1 4A44A 2R0FA 2NQYA 1VBB3 2UWAA 3H0OA 3VKFC 3RZMA 3RZGA 3KHCA 1COV2 2JECA 4BWOA 4Q0QA 4BQ1A 4CP9B 3SH3A 4FPJA 1PVC1 2MNGA 4HZFA 4OLLA 2WQZC 1WLTA 4GULA 2ZZJA 4S2FA 2FHRA 3VD4A 3UL2A 3KVBA 2AACA 5CEHA 3AZYA 1PMJX 1F4AA 1REFA 2Y6FA 2GH2A 1JN2P 4CCLA 1YFYA 1GWLA 2B8MA 4ZXEA 3BTZA 3J8F2 3C8XA 3WG1A 3POBA 3FX3A 1NY71 2QNKA 4ASKA 1W90A 3I2FA 2RM21 2XQRA 2RS53 2WAAA 1JMUB 1UQXA 3LIGA 2OT7A 1RJ8A 4I30A 4XAEA 4NWWA 4CDWC 2PLV3 1CN1A 1OOPC 2VY0A 1SDWA 3MICA 5D8AB 3VKLA 3W58A 1GP6A 3MFCA 4AQTA 2R063 1BKZA 2EXIA 2E32A 4IGPA 2FCVA 4QPIB 1DYKA 2Y0IA 3J26N 3B9IA 3W5MA 5FPAA 3N7JA 2RG4A 2VW1A 3WXPA 2XMLA 2V5YA 2VM9A 4CU8A 5D21A 4N9HA 4URAA 1SLCA 3ILNA 5IK8A 2RMU3 2GNTA 4UXAA 3MFAA 1VRH1 3WDYA 2RS13 4JKLA 2YFZA 4EWAA 1WCQA 2XKOA 3HN1A 5A33B 3GHMA 4XUQA 4X6RB 1EYBA 3P6BA 3CJXA 5ISLA 1YUDA 1W06A 2O8QA 4Q4Y1 5JZGB 1SBFA 2W1UA 1RUI2 2OPKA 2PFWA 3WDWA 3UJQA 1WLCA 2D3PA 2IXJA 1GICA 3GCWA 1CONA 2QZ2A 2W91A 1BQPA 1AYN1 3DYOA 4P9WA 4X6QB 1ASJ1 1US3A 5BUVA 2WDBA 4XUOA 3PNAA 4OZXA 1Z7S1 3GM8A 4OI2A 3RNSA 3KS7A 5JOWA 5I0UA 2V5DA 2BOIA 2ZHLA 3C3VA 4RGGA 1XSRA 1YQ8A 1VBC3 1OF4A 4Q4V1 5FYYA 3B93A 1W3VA 4BCUA 5FPUA 2EXJA 3D82A 1T6BX 4EYUA 4ZZ5A 2ZABA 4AI8A 4XJUA 3WSOA 2B9UA 3KT7A 4FOYA 1D7PM 1D4VB 1FPN3 4LUKA 2D6KA 2O8OA 2WZPP 2DTYA 5KXBA 4HKOA 1V0AA 1XQNA 5LA9A 1UY4A 1UOGA 2DVFA 4HSJA 4FBFA 1GOHA 2H0BA 5FY0A 4Z8BA 3RZKA 1HQWA 2JDAA 2TEPA 3AP4A 1CAWB 1PGW1 1UMZA 2G9FA 2XOMA 2DU1A 4ZS3A 3VBOB 1WLWA 1OUSA 1NG0A 1ZYBA 3MLLA 2E53A 4XCBA 4S2GA 4AG4A 4F8AA 1AF9A 5DAQA 4AHZA 1C28A 1RUJ2 4Q8LA 4DZGA 3O1OA 1GZWB 1M4WA 4G3YC 4ISRA 3BKZA 1PM7A 3FUOA 5C71A 5T50A 2ID4A 3OY8A 5EYXA 1U5YA 2WFF3 2WIIB 4BK4A 3AYAA 1B09A 3MI8A 1G9CA 1GMMA 5A6QA 2QQMA 3AFKA 1TME2 2B4KA 2PXJA 2VMFA 3VHOA 1QJEA 4LBQD 1OC1A 3B7MA 3VZJA 4IV3C 4YW5A 5C8WA 2DCZA 4FXKB 2W9XA 4DRVA 1PZ8A 3CEWA 4MUVA 4WVMB 5T5LA 5JI9A 1HRV2 1ZZ6A 1AR91 3CF6E 5FZGA 4PT6A 3MBWA 5IK7A 4Y5TA 2C24A 3LE0A 1OD3A 1RUG1 2QFEA 4CE8A 4WM8C 5CZKA 1W03A 3J7MA 5FY8A 1LOBA 5FWJA 2BQPA 2VL4A 1QHDA 5ACA2 4YGDA 3I2GA 3HMYA 3WP3A 1HJFA 2HJIA 3BN6A 3NKTA 2W95A 2OKXA 3S57A 3J7LA 2DBIA 3VZOA 1AR73 5FYUA 4ORFA 1VBD1 4QX0A 1AZDA 2DUQA 3KT4A 5FLJA 4XTPA 1W6MB 1JYIA 3WZ1A 4CEWC 3DXTA 5FZDA 5LATA 1BMV1 1B35A 4LBMA 3I2IA 2XBO2 2G9GA 2WFPA 3S5AA 2AUYA 4XZUG 3V0AB 2BEOA 2GN3A 4UFHA 3O12A 1YI9A 2VTXA 3O0XA 4N43B 5J98B 1HB1A 4P9LA 5FRAA 2C0ZA 1H1IA 2R0HA 1VR3A 2UURA 2XQXA 4NRMA 4Q29A 3VB9A 3ZM8A 4FVVA 4QPGC 2VO5A 4QHOA 4RN5A 1NY72 3M4FA 3WQBA 1VBA1 3WP6A 2RM22 4DO0A 2D40A 1KITA 2PELA 2EXHA 2X5IB 3N7LA 2FCTA 3POJA 1PO11 3JD72 3M3IA 4A3XA 2ET7A 3FC0A 5C4WC 4IUGA 3WV6A 4B8EA 3WP5A 1NAEA 2AH2A 3I54A 5F5IA 3L2HA 4QMAA 1SLAA 2HWE2 5F39A 1CAXB 3U37A 1ND3B 5KBFA 3PTYA 2VUDA 2VUJA 1YI7A 4K21A 5GALA 4Y1VA 5LRSA 1VRH2 4I3GA 5EXOA 2D43A 3GBWA 5K4LA 4XF1A 2GMEA 1NCRA 2Q8OA 4D6QA 1RUNA 2A6YA 2DCTA 4QPGA 2FZ1A 1FMD3 5L7OB 1UO9A 4Q4Y2 3FLPA 2FMDA 2JDYA 3K77A 4KMQA 4QHZA 1CESA 4AOCA 4MSVA 4UFIA 1DBNA 2E7TA 2XHNA 5FUIA 4NUBA 3GZEA 4A2UA 1CAVB 3EYPA 3AMQA 1AYN2 1Q5OA 2R49A 2VG9A 4DY3A 1OKOA 4CU9A 1ASJ2 3O0WA 2CYFA 1W6OB 3OTFA 1Z7S2 3U14A 2Q1FA 3AP9A 3SXWA 4XIKA 1NCQA 3J7HA 4HFSA 3M1HA 4Q4V2 2ZAHA 4J6GA 4RL7A 1DYOA 2PA7A 4QXBA 1KD7A 2JG9C 1CPNA 1MZ6A 1UN1A 1W2OA 1YIFA 2ZGPA 5F6KA 5LY2A 4XMIA 4BDVB 4Y4RA 3PUAA 1JH5A 2JE7A 3RWKX 1IOAA 1MQTA 1HQLA 2YC2A 3RZJA 1ULEA 2JG8B 3M3CA 3JQXA 3WG3A 1Q8PA 5FZMA 1A3KA 4IETA 4B4QA 2PHLA 4YW1A 1US2A 1GV9A 3CQOA 1QNWA 4AZZA 1V9U3 2HWD2 3D5OA 1UWWA 1WCUA 4Y1UA 3KV9A 1KS4A 2WS91 1IKPA 1S55A 1BBT2 1W9SA 5T5PA 3H1YA 5CISA 3RYRA 1Q8QA 1JHNA 2DCJA 2E6VA 1CIYA 4BYYA 5CU1A 5C7GA 1X9PA 3RYKA 1BCXA 4LBJA 2P3JA 3ZSMA 1O5UA 4ZU7A 5IUQA 3RWNA 3CIHA 2Y0OA 4NIIA 1BYHA 1S0FA 2HWF3 1AR92 3VBSC 4KBZA 1UZZA 2JKBA 3CU7A 4C91A 2JWPA 3HT1A 3LCPA 3THTA 2XL7A 2YYOA 1RUG2 5BV6A 3K4DA 1Y4WA 5I8TA 1GOFA 2WR9A 4E4HA 3N36A 3LEMA 3TEZA 3NO8A 4A7KA 4EWEA 4GWNA 5FPXA 4L99A 1OURA 2DFBA 1UZ0A 1LODA 4IW3A 5JPNB 2B42B 5BNPA 1R1ZA 3G7DA 2A73B 3ZYRA 1LULA 4MXWB 3ZFFA 4R52A 2VZTA 3ETPA 2PQSA 4A45A 4BLIA 1VBD2 3I2JA 1OKQA 1RUD1 4ONUA 3MIDA 5FBZA 1BMV2 1CIWA 3RVHA 4JCKA 4RQPC 5AC91 4PDWA 4RS5A 2LUWA 1ZRCA 1FI2A 3LGRA 1E5RA 5FK7A 1ZBE3 4QX5A 3FWEA 3POSA 1J3RA 1QF3A 2WLPA 3NNLA 1W8HA 2NPIA 4Y1XA 3U07A 1HB4A 2Z5WA 4A41A 2BZDA 2PQQA 3VBFB 3ZDSA 1I6XA 2DUOA 4Q27A 4KU7A 1AR62 1ULFA 4XACA 2PYTA 1DQ5A 2MHFA 4NN0A 4E2GA 3ZO0B 3VBSB 1VBA2 4COZA 1OQEA 1H2KA 2YGMA 3WNLA 3O5SA 1ONAA 1JU3A 1PO12 5F5QA 2J1TA 2HYXA 1RUF3 2P3KA 4C1XA 5GZEA 2F17A 1QY4A 4PLMA 1QOSA 1YNAA 4XUTA 1SFNA 4WVWA 1Z0HA 3AMHA 4QXCA 3OBAA 3FHIB 1WCSA 3MUY1 3DN7A 3MGUA 1PO23 4CUBA 1AHSA 3N7KA 5DPNA 1GYKA 3VKMA 1SHWB 4RQPB 1UL9A 1Y7BA 5K0UA 1MS1A 1IQDC 1RTVA 2WNEA 4DXTA 2RDRA 2J1VA 1KGYA 1X8EA 2XGXA 3M3QA 2LROA 5C5TA 3DPRC 5C3QA 2XJVA 3WDTA 4OFGA 4AFDA 4IESA 4YG0A 1SFYA 4D7SA 5C3PA 1QJY3 4ITCA 3EB7A 1GNZA 1K12A 1VBE3 2L9LA 1EAH3 2YV8A 4PHZA 1TG7A 3AZXA 4LKDA 4LPLA 4GXLA 5FREA 5GZFA 2W3JA 1O3TA 1C1LA 1X33A 3WHUA 3ORJA 3WNMA 4ZS2A 1U5XA 2FDJA 3BI3A 2YDEA 4K8RB 4TSVA 2QQLA 1SZBA 1BJQA 3NL1A 4FXGB 3HBKA 3RDIA 3VBRB 2R042 1BLZA 3NAPB 1LOCA 4ZU5A 4YW7A 3VDDB 3VBHC 5K9YA 2BNNA 4XDQA 5FDBA 5KHGA 1YFUA 2ZKLA 5FZ4A 3MZHA 4Z2AA 2VTXJ 3ALQA 4YZ5A 5ANNA 1SFPA 5GLVA 2KM2A 3FL7A 2A3WA 3KT1A 1LGBA 3FMGA 2QUOA 4MVTA 3ES4A 1RHI1 5JCTA 1UIJA 2J1RA 1W8FA 3OGGA 4HVOA 4CDQA 4NIHA 4XDOA 5HCAA 4QDRA 3O1TA 3WD5A 3USUB 4IEWA 1DGRA 4GJYA 3FUQA 1UYZA 2CTVA 2WS92 2JDNA 1OH3A 1UY2A 4Z82A 1W8ZA 1QH6A 3POGA 5IVJA 2WYFA 3SH4A 2AEZA 2PHWA 2JKXA 3WOGA 3OB8A 4CCEA 3E6CC 4Q1RA 2JIGA 1SPPA 4E2SA 2Y38A 2VUAA 4IERA 1K5MA 2BBAA 5FTTC 4D3WA 2D6OX 3GYDA 3IIIA 5IATA 5FZOA 1UIKA 5DG1A 1HX6A 2Z4FA 2OQ7A 4WBBA 1RUI3 5JXIA 2IXCA 3ROUA 1E5IA 4KL1A 4UI9L 3USSA 2BU9A 1UU6A 4XFAA 5DXDA 3LSDA 5CKMA 2YROA 4CEYA 4YM1A 1I9RA 3I3DA 3DKWA 1QQP1 1PIV1 1SACA 4U2AA 5FMOL 4G4FA 1QJU3 2VNOA 4I0AA 1RUD2 3ZIXA 3O1SA 1GZ9A 3UT0A 2WNVC 5FPLA 3TEWA 1AX2A 1YLLA 5AC92 5CFDB 2R7EB 5FZ0A 4TLGA 1D4M3 1OPMA 5A32B 3NSTA 3VBUB 4CCKA 4DNYA 2I74A 2V73A 4LR4A 5AVAA 1W6QB 2JDZA 2ZGRA 3GZTB 1YEWA 1DP0A 1UZYA 1W2UA 5GZGA 2P6CA 1GWMA 4FO9A 5F5CA 1MEC3 1O3SA 1NA1C 4JGYC 5T5OA 3WINE 5FY4A 1YFXA 1H6YA 3PJYA 5GJ6A 2A71A 2HH9A 4QD2A 3I59A 4YVSB 4YVWB 1G6NA 2P1BA 4AQ6A 3SC7X 4BK5A 3U78A 1SLBA 2LTNA 4COYA 2B9VA 2QQVA 2ZA9A 3VL9A 4ES9A 1UPSA 2FCUA 5JXHA 1C8M1 3NQHA 2RVAA 4AQSA 3WW1A 2ET1A 3DGTA 1XNTA 3EJKA 5LB6A 4QDQA 3N9QA 4JDMA 2BDRA 2JJ6A 2R071 3E6DA 1LEMA 4BM8A 3OG2A 5IFTA 2E7QA 2XR4A 4P08A 5F37A 4QHBA 1HRV3 4TLFA 1YC61 4L0PA 2WT2A 2VMDA 4LMFA 5EFUA 1O4ZA 3WQ7A 3A0KA 1UF2C 2JE9A 3ZYIB 3VZKA 4ATFA 3U1XA 1IPSA 4GB33 1UMIA 2VCCA 5DAVA 3ZX7A 3VD5A 3A22A 1PNFA 4Q4X3 1XYNA 2XUEA 2QQOA 3ZXDA 5JVVA 3SEPA 5CFCC 2IWGB 4AI9A 2VAUA 4CCNA 1W9TA 4LQRA 4GH4A 4JKMA 4AEMA 4ES8A 4NRPA 1YQ6A 1UMHA 3SEEA 3J8F1 5EIYB 3E1F1 3NV3A 3W5NA 1PVC3 4FFIA 4JGZB 4BIOA 1RUH1 3GDBA 2VU9A 1JYXA 3BODA 4E9KA 4BB3A 2BGCA 3SCHA 3V64A 4HPKA 3POIA 4UF0A 1NLQA 5DZFA 1FV2A 2XLFA 2ORZA 1Y9GA 4A3ZA 4KG0A 5G04L 1YIPA 5LRRA 5HCBA 4FP3A 4XURA 1ZNPA 2H6BA 1OF3A 2RM23 4RYDA 1U5ZA 1VMJA 4PLNA 3AYCA 2VTFA 3CJIA 1A34A 1QJX1 5FP9A 5LA1A 1RHI2 3HNBM 3BU7A 3IDCB 4Z07A 2X53S 4IE7A 5FZIA 1RGSA 2ETEA 3I7DA 2Q8EA 2DDUA 5CFCB 4A6SA 4LO7A 4ASMB 2QZ3A 3H50A 3ZFEB 1MVEA 5GLTA 4AEDA 4MG2A 3WQ0A 4LK7A 1GANA 4Y3OA 2AGSA 1VRH3 1PHMA 4WVVA 1GQHA 4EZHA 2VC9A 1SBDA 1KFUL 3V65A 3RMYA 1AYM1 1C57A 3LD8A 3H7JA 3OPZA 4Q4Y3 2XLGA 3CL1A 1NXD1 1JZ2A 1DQ6A 2O0OA 5JSOA 4NJ4A 3WNNA 3ZFGB 4OI4A 4IDZA 3D4KA 4CDUC 3C7EA 1NUKA 3L2YA 1G9DA 2BJSA 1C1FA 1P8JA 4FPLA 3VZNA 5C9AC 2ZHKA 2V72A 1VB4A 1ASJ3 3SQOA 3KM5A 1Z7S3 1PIV2 5ABJA 3I3BA 5BNNA 2O1QA 4Y5Z0 4AAPA 4IXLA 2F6BA 4IEQA 3I97A 4Q4V3 3ZXKA 1O8PA 5C8CB 2O14A 2WNUA 4FPFA 2OA2A 4DINB 1W2AX 1F9KA 1MS5A 2DWRA 4LKEA 4QU2A 1RUJ1 4CPBA 4WM7B 1O4TA 3IBMA 2ZZQA 2IXKA 2A70A 4OQ9A 2WA4A 2P3IA 4XBLA 1JUHA 2IFWA 3FBYA 3CMGA 3POEA 5FPZA 3MHZA 4WV8A 3SMHA 3ST7A 2JDKA 3N7MA 3AX4A 3MYXA 5A3WA 3BVCA 4DXRA 4Y22A 4FTEA 5FP4A 1QWRA 2PHUA 4INDA 3T0DA 4M01A 5F3GA 2XG3A 5IK4A 1TME1 1L3JA 3WEZA 1ZBA1 2NN8A 2C6SA 3HEIA 2LRPA 4B29A 4UW6A 5A7PA 5FP3A 2YPDA 4RHV1 3KSCA 4Y20A 3RPQA 1OT5A 4H7MA 3ZMOA 4IE0A 3RJRA 4F83A 3ZXEA 5SV8A 1C8M2 5FXZA 1JYCA 2C9AA 3OUJA 3SCFA 4Q1PA 1XPWA 1QJZA 4CDXA 2R072 3KGLA 2V4VA 3AXDA 4XBQA 3N9MA 1N47A 1DZTA 4XC9A 5J37A 4QPIC 3H7YA 2XONA 5BNOB 2WZ8A 1AR93 1LEDA 1PX3A 2WWUA 5FY1A 3KQRA 1VMHA 5B4XA 3WNPA 5LW9A 1POQA 1RUG3 4ATEA 3WDUA 5IHRA 2OS2A 4IV1B 4HK8A 4YYOA 4AXOA 1ODMA 3MV01 2XBO1 3PMSA 2J22A 4B7EA 4B7KA 1Y9QA 3SKVA 3PIJA 4E2QA 1M06G 2PTMA 4MXVA 1QXPA 4MZUA 1AVBA 2J1UA 1QIQA 2OZ6A 2EXKA 1CZTA 1GOGA 1H2NA 3CZUA 1QH7A 1SBEA 4OUSA 1VBD3 3HAGA 5GLWA 2GDFA 1A8MA 3CKHA 3HD8B 3NJZA 5JZGC 3T09A 1EV12 4QAWA 3C7FA 1G9BA 3QH7A 4AK3A 2LM3A 3ZPOA 4QB6A 1HB3A 5FZ1A 4B1LA 5F5AA 1ENSA 3R05A 3S0MA 5D8AA 3WVJA 1RL3A 3NRUA 1BVVA 1RUH2 4CU7A 1ZA7A 1QGLA 2YBKA 2VUCA 3IDBB 4IEYA 3EO6A 3JD71 4R9DA 5A6XA 5I91A 4BMBA 2XJPA 2VVFA 5G05L 5J7MA 4LJHA 4LO4B 1I3HA 4OMCA 4PQ9A 3T1MA 4DPNA 2HWE1 4QB2A 1VBA3 2BYVE 5FJHA 2UYBA 4QQLA 4N9IA 1TE1B 4XBNA 4FFGA 4PF5A 5FPBA 1QJX2 5FYHA 4AGGA 1PO13 4YGCA 1SQ4A 2BTVC 5FZAA 3PDQA 4KH9A 5JZGA 3NJYA 2YU2A 4M4RA 2JDHA 2VVDA 4HKWA 3MEPA 4MX3A 4F3JA 1YQ2A 1W8UA 3OSDA 3K4AA 4XIOA 5DUWA 4AGRA 1V6KA 2CAUA 1BK0A 3VBOC 2W92A 5CYYA 4D0QA 2VCBA 2EIEA 3AXEA 1R091 4QM8A 2E9QA 3ITQA 4PI2A 1W99A 4J25A 4NHLA 4CDWA 3DXUA 3OBTA 3OGRA 3HQXA 5A3NA 1WZXA 4BXSV 3SCGA 1GQPA 1OOPA 3GBFA 1XSQA 1S0JA 2VZVA 1LECA 1AYM2 3AMNA 4JTOA 1RINA 3IN9A 4COVA 5C70A 1PVXA 4LNVA 2QDRA 3K3OA 3I49A 3FFZA 3ME2A 3B3QE 2GMMA 4AAXA 2MEV2 4NHMA 3UGHA 4J1XA 1GU3A 5FMDA 2FDHA 3AYEA 1WCKA 2DUPA 1UYPA 1MR5A 1W2TA 4MGTA 3AZZA 4I3PA 4DQAA 3LPGA 1OI6A 2VZQA 3LB9A 2W39A 1NXMA 5L73A 4I01A 2ARBA 4XJ8A 4DIQA 1F5JA 4NAOA 3ES1A 1CAWA 3WW3A 4Z1VA 4KG8A 3E6BA 1OA2A 3UGFA 2ZEWA 1O8SA 2BWAA 4UW4A 3K46A 3MPBA 1D2QA 3DCQA 2IXHA 3LDKA 5DZEA 1DDLA 4QQHA 1KQRA 3AKPA 4ZONA 2CGOA 4XUPA 5LBEA 1X36A 4GKXA 2BBVA 3TN92 2HWD1 1F35A 2QBXA 1FAYA 2BOJA 5E6HA 1N1TA 4XOGA 3QD6A 3RSJA 4CUAA 4UW5A 3MO4A 1BBT1 4CXXA 3VHRA 4IQPA 4AVVA 3I3MA 4RR3C 4NO4A 4WVMA 1PZ9A 2XDVA 4EN6B 5CBLA 3ZXAC 1LESA 1XE7A 4N43C 4J1WA 5BXXA 5A3OA 2VECA 3U75A 2DU0A 1ZBA2 1J1TA 5JWPA 4MHRA 4YGEA 4COUA 3T0BA 3OPTA 5FY9A 2Z69A 1Y43B 3TYJA 2WS93 4BMEA 1JI6A 1SCSA 2H0VA 2P17A 2SLIA 3ACHA 4RHV2 4XQDA 3S30A 4ASLA 2VOTA 2W5FA 3S6PA 3MIBA 3WUCA 1X9TA 1W04A 4X8PA 2ZGQA 2EICA 2GP3A 4FAHA 2X5IC 5FO8B 4K3UA 3CBNA 4OMDA 3VHNA 4IEUA 1LNSA 4FFHA 2AEYA 3NWKA 4HK9A 5JLVA 3HIFA 4PI0A 1UXXX 5DUUA 3IPVA 1NQJA 3OY8B 1WLDA 4BISA 2ZGUA 1G9AA 4OI0A 1ND3C 3V0AA 5F8PA 2OZJA 2GC1A 1LU2A 1W0PA 1LOGA 1JS9A 1Q8OA 4JVAA 4N7IA 4NVPA 5FOJB 4GMP1 1VB2A 4LKFA 4NAMA 4K7JA 1NQDA 2D97A 4IV3A 1OVPA 4BU2A 2XLAA 3T3YA 5BYNA 4RR3B 1F31A 1ND2C 3BPSA 3OD0A 5L7OC 5F3IA 3ZYBA 1RUD3 5DUVA 1G8WA 3IB3A 1W8NA 3H8XA 2WYSA 1AR61 4W50A 1Q43A 1MVQA 3EQEA 3UJOA 3LDRA 1TVGA 2HKXA 4WM8A 4XABA 5FO7B 3NMBA 1W0OA 5AC93 5J96B 2DURA 3ZN4A 4CCCA 3KZ4C 5DAPA 3V0BA 2VOVA 1W6PA 2WC2A 3AJYA 5LCWL 1CAXA 1IG0A 1UW8A 2FDKA 3H3LA 4CEWA 3CLPA 1YQ5A 5FR3A 3F95A 3T4VA 3U10A 1B35B 3A0NA 1IS5A 1EPWA 2ZGLA 1YJKA 4AWDA 3ILRA 4A7ZA 2VR4A 2RDQA 5F1RA 4XF0A 3S7IA 3L9JT 4AHXA 1RUOA 1IQAA 5APAA 3DKQA 3T08A 4A42A 2BFUL 1LOFC 3HQRA 3I3QA 5LASA 2R061 3N4MA 3Q8FA 2Y8KA 3RQ0A 4ZHNA 1XNBA 3OCPA 3A21A 2JG8C 1LRHA 1OH4A 3IMMA 4LIUA 3WX5A 3PIGA 2QTWB 4QWNA 1NYWA 1TZOA 4H55A 1ND2B 2A1XA 4UFMA 4JX0A 4DFSA 3PUIA 2W08A 4QQPA 1R092 1DLLA 4ZU4A 2RS11 3NNFA 4MGZE 2OIIA 1DGWA 3AVSA 1W6OA 4OCTA 2B5HA 4EN0A 5FIXA 5LBBA 2I45A 5C4WA 2DCKA 3B00A 5C6CA 5JSPA 5LZ6A 3NKGA 2VW0A 2ZEYA 1QDCA 2HLEA 2RS32 2ZEZA 3N35A 1LGCA 1LHUA 3KGZA 3NNGA 3PLQA 5B4NA 1FOD1 1UU5A 4KWLA 3WDVA 3TOJA 4YZ1A 5C5UA 1ULGA 4LOSA 3WF4A 2R041 1YQCA 2WZR2 3TBDA 1DU3D 1IPKA 3APBA 2OQ6A 3D8CA 3HN3A 1NT0A 3KMHA 1NCRB 2AYHA 5F2WA 2DTWA 5CAZA 3QH6A 1UYXA 3EHKA 1BK1A 3ZN6A 1VAVA 1C3HA 5HV4A 1Q56A 1AL22 2Z42A 5E88A 4AL9A 5FV3A 1DYPA 1RB8G 4DXZA 4YFWA 2ZACA 1WCDJ 3Q9OA 4LBQB 1FPN1 3ZPYA 1AXZA 1D0GA 1URXA 2UWBA 4LIVA 5AFEA 4PQQA 1V6OA 1IS6A 2DVGA 2Y64A 5CIRA 3VUOA 1SDDB 3ATGA 4OULA 1RC6A 3VLBB 1DGRN 1OLRA 2JENA 2XJQA 2R32A 3C7GA 3KHBA 2RR11 4LEJA 1ULDA 1RHI3 4GMP0 4TXWA 2ZPXA 3I8TA 4JDNA 3AL6A 2JG9A 3RI9A 3K3NA 3VBFC 3WG2A 2HEVF 2WZEA 3H8RA 4PBPA 5KC5A 2SBAA 3W59A 1MQTB 5M0TA 2QJVA 2DCYA 2DV9A 1PX4A 3UNPA 2XWBB 1HXS2 1AR82 2UY8A 4QX3A 4FPYA 5DABA 3VN4A 4BQ2A 4K6BA 5A7WA 5LA0A 4LO5B 4UFLA 1OFNA 4BQXA 5DMYA 3BUCA 2ZX3A 4JRAA 1JOJA 3HT2A 1RUE1 1RMU1 4C0HA 1V6JA 1PMIA 4AI1A 3IDEA 2F4LA 3OUIA 2WO7A 3BTYA 1MS8A 1N1YA 1WUVA 1BEV1 3NV1A 3JB8A 5FO9B 3ABZA 3VDCA 4O9GA 1ZX5A 3WT3A 4LHKA 1ENXA 5T3NA 5DN2A 1ZRIA 5I0SA 2WWSA 2VNRA 1CVNA 2CWMA 4WZFA 2RDNA 4PBOA 3MF9A 4LO8A 5A7NA 2XJSA 1QQP3 5FWEA 1PIV3 4W6XA 5FY7A 5FZ8A 3VBSA 1AXYA 4YM3A 1N3QA 2JIJA 3PVBB 3DEMA 4C8DA 2GP5A 2XJRA 5FZHA 2RJKA 3FLTA 1K42A 5FQ0A 2K46A 1CR7A 1F4HA 4XTMA 3I2KA 3PVOA 4XF3A 2YG0A 5I0TA 3H8UA 5BNPB 2OUJA 2Y34A 5FZLA 3ZFFB 3T2PA 2FBEA 2VOWA 2I2SA 4DUXA 2D6LX 2VMHA 3ZYPA 3BOPA 1XXNA 2ADEA 2D5FA 2C9KA 4XEZA 3MF6A 2IXLA 3O1RA 2RS52 4RQPA 3VBRC 1LOAA 3ZSLA 1DFQA 3QOPA 4PDWB 4RS5B 5D1IA 4LBLA 3NAPC 3AKQA 2MPFA 4QKFA 3VDDC 4UBHA 3OPWA 3WDXA 4LULA 2EA7A 3TAYA 4AFBA 1VJ2A 1A8DA 2R062 3FN9A 3UK9A 3E97A 4AHWA 2XXZA 3M8LA 2YBSA 3HNYM 1ST8A 2C4XA 2LALA 2ERFA 1V6LA 3KCYA 2B46X 1OSGA 2IC1A 3S5QA 4FSJA 1C8M3 4XF4A 5IW0A 3ACLA 4ZXKA 2VBDA 2VBBA 3AFGA 3IWZA 1A6CA 3K75B 3PUSA 3Q8BA 1ULCA 4V2WA 5FZ7A 3M70A 1VP6A 1DQ2A 2B45X 2R073 2RS12 4KGQA 3PURA 1UZVA 4IGQA 2NZ9A 4XFCA 4NRQA 5FXXA 3LOIA 4CXWA 4LORA 3CZJA 2CNAA 2VNVA 4QXKA 4R8HA 3RYPA 1K5JA 2EVXA 4EJRA 5EZWA 2X8KA 5CA6A 4LLFA 1COV3 5FXWA 1CPMA 1WMEA 2XL9A 2W46A 3NAPA 1NOVA 1FOD2 1Z78A 5H9PA 3SISA 1DG6A 1GFF2 3E5UA 3M3EA 1OUXA 5FYSA 4CCJA 1R64A 3VZLA 5K0UB 1GLHA 1HB2A 4O65A 3KV6A 2GZWA 5JR2A 1AXKA 1H8TC 4M3CB 2JE8A 5A6ZA 3DPRA 4KWJA 3ZXFA 2CGNA 3J8F3 5FYCA 3R0RA 2AZ5A 2OVUA 1Q3EA 4CSWA 5BNQA 5A3TA 3B01A 3IDAA 2P3YA 3AMMA 1RUH3 4L9BA 4QKDA 4EN9B 1ZZ8A 2HWC1 2GN7A 2AR6A 5JOZA 4HSLA 2A3XA 1FPN2 3O1MA 5FFOC 1JU4A 3SNMA 4QQ2A 3GF6A 2IVJA 3HBZA 1CQ9A 4KWUA 1HRI1 2QQWA 4MHUA 4AVAA 1J1LA 4Q5OA 5AVPA 5CFDC 2CY6A 3EBRA 2RR12 5DDJ1 4YLZA 1QJX3 3LKJA 1DQ4A 3VBUC 3AC0A 3BTAA 3NVCA 4AYUA 4YARA 2NMNA 3VGIA 5DZGA 3VBHA 2ZMNA 2WFF2 1CAUA 3HR9A 5FBJA 4FTSA 1LOEA 2PAMA 2HEWF 4DUVA 3O14A 3GBGA 3JU9A 4M4PA 1H8TB 5KHKA 1TMF1 1MACA 2VOXA 4YVWC 4YVSC 3BCWA 1BZWA 4CCDA 4CDQB 2PAKA 1J84A 1Q8VA 5IT6A 5FJKA 4PF1A 4Y33A 1QNYA 4Q2FA 1AYM3 5A3UA 2ZX1A 4N53B 4Y26A 4NHYA 3HJRA 2K2SA 2ARCA 4UOJA 1J58A 1JZ7A 1RUE2 1RMU2 3AB0A 1ODNA 1PK6C 2BUKA 3C7OA 4NHXA 1DIWA 1V6MA 2ZMLA 2XH6A 1BEV2 3K48A 3P1IA 4B4PA 2C5DA 2YFUA 4HONA 1AR72 1SPPB 3O1UA 3N3HA 1NE6A 1RVF1 4FQ4A 3T2OA 5GZCA 1K5MB 4Y5SA 1QEXA 3JQWA 1JODA 1WA4A 2ZX2A 4ZKTB 3JBG1 1NZCA 4BOWA 1UZWA 2VQUA 4EROA 1POV1 2VOKA 1N1VA 1OMIA 2Y6GA 4IGOA 2Q30A 1XNKA 5H9SA 4OHXA 1GP5A 2HEYF 1KDMA 5FYBA 5KHHA 5I0RA 1RUJ3 2BERA 1S2BA 4G9SB 1OVSA 1T6GC 4QB1A 4YZ4A 1WGPA 2CHHA 5E16A 1XNAA 2QDNA 3T0AA 1TNRA 2BVVA 4HANA 3WF1A 5HBAA 1CGPA 4FPEA 4R9AA 4JGZC 2G19A 4KQ7A 1YYNA 1JZ3A 1RXFA 2WNVA 1VIWB 3LEKA 2WSUA 4CDUA 1E57A 1TME3 1PK6B 1UX6A 1OHFA 4CP0A 1ZBA3 4KU8A 2ATFA 2IUWA 4N8MA 2DBNA 1ZZ9A 4LLOA 5LK5A 4BH9A 1W9FA 1HN0A 3ZYJB 1D2SA 4RHV3 2D7FA 3HWJA 2TNFA 1QJFA 1IG3A 1W6NA 5JXGA 2E51A 2C1FA 1IZ3A 1NA1A 3BOWA 1XJAA 4JGYA 4D6RA 5ACA3 3ZR6A 4TN7A 1X50A 3BPZA 2P5BA 4N7UA 2R1BA 4FPCA 1FT9A 4FPGA 4LXLA 4K40A 4CRQA 3ZIWA 5F32A 4CPBD 2JEMA 2UU8A 3AVRA 3OJBA 3ZYHA 1LHWA 1W8WA 2OPWA 2P4EA 1HDKA 3FE5A 1CJDA 3JXSA 1EV11 1DLCA 2X10A 5C3RA 3ZFEC 5GKAC 2XBO3 2ORXA 2D93A 1JYVA 1NLSA 5HI0A 1XYOA 4XJAA 1ZREA 1AJKA 1YJLA 2D6NA 1UKRA 2YY1A 5DG2A 3UETA 5KXEA 2I07B 2J42A 1JHJA 3JB4C 1LAJA 4XW3A 4ZPIA 4K9SA 2LW8A 2WINB 4D8MA 4UWDA 1AUYA 3ZFGC 1YO8A 3UESA 5IVFA 1FATA 2W87A 4LOTA 4LO6B 2E7AA 1PGL1 2J1SA 1OLME 2HWC2 1VAMA 3H1MA 4XYXA 4BIFA 3HVDA 3JD73 1IPJA 1O4YA 5CFCA 4OVEA 4NOTA 5FLHA 1CX4A 1T2XA 5JMCA 2XJTA 4AEJA 3VD3A 1OA3A 5T55A 1TQ5A 4GH4B 4K1YA 2JDPA 1UD1A 3I3EA 3V56A 2NP0A 4XJWA 1HRI2 3DF0A 3ZFEA 4C1WA 5A3PA 5AFBA 2YBPA 2B39A 2HWE3 2W1WA 5C8CC 4P9GA 3RI8A 4HVRA 5J48A 4E4DX 2ZX0A 3ENRA 3KV5A 1EPZA 3FZ3A 5DDJ2 4WM7C 3LA2A 3WHTA 4K20A 4CP1A 1S2EA 1S0EA 2D98A 2FQPA 4YWAA 4LT5A 5FMOS 4LTAA 4MADA 2Q5TA 4CCOA 2JDUA 1POV0 3POFA 1MS4A 4QX8A 4GAZA 2MEV1 1R093 3OBRA 5HV0A 5FZ6A 4XETA 1LU1A 3GXUA 4OUMA 1LKNA 3AKSA 1TMF2 3CJIB 4CCMA 1O59A 1EUTA 5SV5A 2EAKA 2Y6KA 1JOBA 1AYN3 4AEKA 3GCXA 3VKOA 3ZMNA 3PU8A 5LEKA 3TB0A 5A1LA 4M00A 1GZTA 1WA6X 5EHDA 2VULA 1YCIA 4IL7A 1I5ZA 4YW3A 3ZKYA 3AP6A 3NJXA 4JHZA 2BNOA 3WG4A 4N90A 5I0DA 1JZ6A 2QE3A 1XB9A 5EPAA 4AEDB 4HMZA 2ZAAA 4QX7A 4AQ2A 4BHPA 2D3SA 1V6NA 5EJ1B 5BNOC 1QJU1 1RVF2 3B69A 3MV11 3W20A 5JOXA 5FUPA 1HIXA 3TN91 2YUEA 1WWYA 3A4UA 1H1MA 1S0GA 3H1WA 3IZOA 4XXPA 4IEOA 4IEVA 3JBG2 4IV1C 5H9RA 4GZ9A 4JTNA 1LB2A 1I5PA 1ULPA 3KB5A 3I2HA 1LCLA 3LFIA 2ENRA 2KR2A 2K9ZA 2W68A 4H2AA 1ZBE2 3MUZ1 5C3OA 2Q1ZB 1XNCA 5GLUA 2ZOEB
chains in the Genus database with same CATH topology
3OYWA 4MGIE 1FNZA 4P9IA 4V1PA 5IK5A 5C9AA 1WW7A 2HWD3 3C2UA 1OPOA 4Z92B 3ZVXA 5ABJB 5TSWA 2AENA 3RJ2X 2UY9A 1BBT3 5BNNB 1MEC1 1NE4A 2HWB1 4PCRA 3B02A 3NV4A 2Y26A 3WP4A 1OQDA 4I0BA 1SEFA 2GNMA 4FOWA 2WNUB 3WCSA 1RUF2 3K51A 3IKWA 4D7TA 4H14A 4AFAA 3WW4A 4Q0SA 1R081 1GZCA 2CAVA 4MH0E 4Y22B 4GQ7A 4E27A 2GC3A 2F4PA 4XMAA 2AREA 5E1RA 3D0JA 2P2KA 5F6LB 4MGYE 5JIUA 5I8YA 2NM1A 1C5IA 4Y20B 5DUXA 1ZM1A 1QJY2 1G7YA 4M3CE 4UBGA 1VBE2 1EAH2 1RUC1 4GMP3 4XFHA 1DQ1A 4FOVA 2V09A 1EY2A 4CDXB 1X7NA 3J4UH 4QPIA 1LJ7A 4BLJA 3X29B 4AFCA 5A3MA 2WSVA 3ZXLA 1AR63 1IGOA 3IT8A 3URFA 3GALA 4W6YA 1ENRA 1PGL2 4HN0A 5K8SA 1YWKA 2XVKA 4HLTA 5A33A 1ZRRA 3TNPB 1ZRFA 5KWRA 1BXHA 3MLKA 2A7AA 4HVQA 4OHYA 1WD3A 2A3YA 1JW6A 4XHXA 4UW3A 1HKDA 4L8QA 2XWJB 3LAGA 5L36A 3WUDA 4D7YA 1OLQA 1J59A 3GZUC 1RIRA 2UWCA 3PMEA 4LHLA 3MW4A 1XRUA 2ZGOA 3BB6A 1H30A 2JICA 1DQ0A 2KXLA 3NW4A 5E8AA 2NYYA 2RS31 1UU4A 4JAAA 4QGNA 4I2OA 3VL8A 4E4SA 5C33A 1QXRA 4YG6A 3I4IA 3DL3A 2WZR1 4LBOA 3RRDA 2HYKA 3ZSEA 1WW4A 2TBVA 1UPIA 1FNYA 1X82A 1Y3TA 3VBOA 3VHPA 5CB7A 4AI3A 1FOD3 1AL21 2NLRA 4LA3A 4QT6A 5LK7B 3QLQA 1GZWA 3PVEA 1TNFA 4AFBA 1REEA 4I02A 5BPXA 4OHZA 1GR3A 1DGLA 2R043 4QM9A 4CDWB 4OHVA 1WW6A 1OOPB 1QJU2 2JX9A 4K8FA 3M2MA 3UKTA 4RSUA 1HV1A 3LOBA 2ILMA 4FP2A 4AI0A 2ZGTA 1D4M2 3UKNA 2VXRA 1R1A1 2OYZA 1FXZA 1NLRA 5A3LA 3JZVA 4XFFA 1LR5A 3AK0A 4AE2A 2A6WA 4M0HA 3ZYGA 4HL0A 3TWIA 4XQ4A 4QQOA 1MEC2 5H9QA 3DV8A 2HWB2 3D0SA 2RR13 1PNGA 1U12A 2R1DA 4MV2A 1HXS1 1AR81 1KDKA 4Q4W1 1DGWX 3ECQA 3T1LA 2ES3A 1W6MA 1HW5A 4RFT0 3DUIA 1RJ7A 3AYDA 3AZVA 1ZZ7A 2GNDA 3LWCA 1B35C 4NPRA 2VMGA 1R082 4Q0UA 4XXAA 2EAAA 2PHDA 4S2HA 1H1AA 4MLOA 1C8NA 4RR3A 5I8SA 3RZZA 4D94A 3FBMA 3P3NA 1U0AA 2IXIA 4N43A 5JOYA 3O0VA 4DB5A 2QQPA 4XPVA 1VBB1 3GNEA 2P37A 4BA6A 1RUE3 1RMU3 1LTEA 2GAUA 2ZGKA 3JUUA 2CV6A 4GB32 2GSYA 4LUMA 1BEV3 4XF9A 2X5IA 3PJQA 4Q4X2 1GKBA 1APNA 1RUC2 4LA2A 3AJZA 4TWTA 2VQAA 2ZKNA 3MW3A 3INAA 1GQGA 2GALA 2A6ZA 4GWMA 1J3PA 4M0NA 3IPVB 5EYYA 4AVTA 1ND3A 1PVC2 2UYAA 1CJPA 2NMOA 4Y4YA 3T2TA 1ALYA 2RS51 4GALA 3CNAA 4B4RA 4URTA 5HXVA 2PLV1 1UAIA 3OGJA 4CZSA 2XPJA 4IV3B 3QBQA 1NCRC 3WNXA 1S2KA 1ND2A 5L7OA 4PIXA 2B7YA 5FAXA 3LA3A 2YPJA 1S1AA 2ZCWA 1CD3G 4WM8B 4Y24A 4YW2A 5L19A 2RMU1 3ETQA 1CAVA 3MW2A 3D6EA 3ASIA 4XHBA 4Y1ZA 1YFWA 4HKLA 5EWSA 5J3UA 1W6PB 3V0BB 2CL2A 4M3CF 4QGMA 4CEWB 4KGGA 1NCQC 2E63A 4QGLA 2K0GA 1O7FA 5JR7B 1XNDA 4R9BA 2PN5A 1KS5A 1LOFA 2QVSB 2Q0AA 1ZRDA 2GC2A 3GHNA 2D44A 4SBVA 1MQTC 4XE9A 2JG8A 2EALA 4XJ9A 4A7YA 4Z2WA 2PHTA 2ZGMA 4LBQA 4QPGB 1VBC1 2BWCA 3VZMA 4TYSA 1TEIA 1REDA 2PHFA 1IKQA 3RG0A 4P9XA 4OHWA 1ZA4A 4Y1YA 5C4WB 1F5FA 2GMPA 4AF9A 3GZAA 1F2NA 4R4XA 4GKYA 4F7ZA 2ZMKA 5CADA 1D0HA 3ZXJA 1NCQB 1HLCA 2HWC3 1IS3A 2BVBA 4QPYA 1R1A2 5CNAA 2WFF1 1HRI3 1PGW2 2BPA2 1DF0A 1MS0A 3ZN6B 5FOBB 1O5LA 4LBKA 1IS4A 5DDJ3 5BNPC 1ZZBA 4FPKA 4MXWA 3ZSKA 4FTBA 3ZFFC 4XFIA 1XYPA 4Q4W2 4FT8A 4LBNA 5JAXA 3AP5A 1QDOA 4LE3A 4YNIA 4YM0A 3U4XA 5GM0A 2YMZA 3MIFA 3IMNA 3J9SA 4PDWC 4RS5C 1LHNA 1OD5A 1TMF3 3E5QA 3I2DA 2KA3A 1W39A 1SLIA 1QU0A 3H3UA 4L92A 1MZ5A 1AR71 2JG9B 3VBFA 1VBB2 3R4UA 1S0DA 2VH9A 2CWSA 1JBCA 4FAGA 3MDPA 1O91A 4E4ZA 2WKKA 4SLIA 1S0CA 1QKQA 1GNHA 2ZS6B 2G4IA 2BFUS 1RVF3 2GNBA 4BZ4A 1PZ7A 2ZHMA 4I09A 3JBG3 2R6QA 1POV3 2DVAA 2WT1A 3FJSA 2RJLA 3AP7A 3MIHA 3B9CA 3B5LB 1LENA 3H9AA 2EIGA 2H6CA 3AKTA 1G86A 4WZCA 1X8MA 5K0UC 4Q26A 1SLLA 5I93A 1OA4A 3ILFA 2JD4A 2PLV2 2QCSB 5T52A 2A75A 4U36A 2OW4A 3H3ZA 2ZJCA 2RHPA 1WBFA 2FMYA 3WR0A 2WL1A 3SHRA 1Q8SA 3W9AA 4EWDA 1UCXA 5FQ0B 3R4DB 5F9TA 1HQNA 3BIWE 3AZWA 4NR1A 2RMU2 1S0BA 1WMDA 4AW7A 2VVEA 3S7EA 2IFRA 4AGVA 1FMD1 1V6IA 2A6VA 2WQ4A 3JCIA 5B2GB 1O3QA 4XJZA 4DOUA 2XVGA 3PHMA 4R9CA 3VBRA 2DFCA 2PHRA 1N3OA 4HBNA 2WA3A 4P9YA 2ZHNA 3VDDA 3KCCA 3VV1A 4M3CA 4S2DA 1RITA 2ZTNA 1DZRA 3IM0A 2DVBA 2VW2A 2ZX4A 4IEXA 1MZEA 3PVNA 5HCFA 1EV13 1H2MA 1VBC2 3B94A 2R30A 4CDQC 2X29A 2PAEA 4AVCA 3CO2A 1SLTA 4N53C 4NWVA 3USUA 1BVP1 4BPZA 4YW4A 2JXAA 5T54A 4O9EA 5K7PA 1KFXL 1H2LA 1UKGA 4GIQA 3ZN5A 4YGBA 1A78A 2GC0A 2D6MA 3RS6A 1QXJA 4CTEA 1K5MC 1V9U1 4COWA 3U0ZA 1VLNA 1H8TA 3DPRB 4NHKA 1YHFA 3M3OA 4RGAA 3AM2A 3MIGA 3UV9A 1G9FA 1AX1A 4N53A 3QCWA 4CEYC 5KHIA 1YRZA 3WY6A 3POYA 4IEPA 2HWF1 3LA7A 4KNCA 2P34A 5CG8A 3THPA 4C90A 5JIAA 2MEV3 1N3PA 5CFDA 2BNMA 4FPOB 3SITA 5A32A 4R4ZA 3VBUA 5CVRA 4K1ZA 1ZZCA 1EP0A 1W6QA 4PIZA 1KRIA 2A5ZA 3ZXGA 4YFZA 3VBHB 1CAUB 1XU2A 4JQRA 4YZ2A 4B3NA 4HETA 2XB6C 4L2NA 1AL0G 5CG9A 1VALA 4YZ3A 5T5JA 4AHYA 1ZBE1 4YVWA 4YVSA 4JRLA 2BW8A 1F8VA 2D5HA 4MYEA 3IIAA 1SCRA 1PGSA 1H4GA 1H4HA 3TN93 4AFMA 4CEYB 2RE9A 1JXNA 1MS3A 4W6WA 3U11A 1JTZX 1PK6A 4PLOA 3ELNA 1LHVA 3R4SA 3AKRA 2DF7A 2XKPA 1WD4A 1N1SA 3WW2A 1RUF1 2VGDA 5GZDA 4XQWA 5LEJA 2HWB3 5KHJA 1PO21 1V70A 2ARXA 4C0BA 5JDBA 2EF6A 3FFQA 2TUNA 2CGPA 3O7OA 4D69A 1MZFA 4GH4C 2Z79A 3I59B 4I0WB 1O3RA 4FQZA 1FMD2 1R083 3G6JB 1GSLA 4DS0A 1FYUA 4JGZA 1VAKA 3KLSA 3POWA 1QJY1 1AX0A 3FLRA 2WNVB 1DZQA 1VBE1 2FZ2A 1EAH1 5FLIA 2XVLA 2XJUA 1IHMA 2D3RA 1C5HA 3M7AA 4RA0A 2A6XA 1COV1 2VNGA 4Q8KA 1ENQA 1KXGA 3CJIC 2VPVA 1W6NB 1RUC3 4AI2A 1NA1B 3P3PA 4JGYB 1OQ1A 5BY5A 2QKDA 3WLUA 4BE3A 5KXDA 4KWKA 4CYDA 1JUIA 1ZVFA 2YHJA 3MLJA 3SH5A 4JC1A 2R16A 3R6SA 4AEDC 5KXCA 4EV0A 2IZWA 4KBBA 1H9WA 4DMIA 1MS9A 4AVBA 1V9U2 2XHKA 1H0BA 3OF1A 2ZGSA 4HPKB 3TNQA 3KD4A 3ZFGA 4XFGA 4YM2A 3UKVA 5KC6A 1WW5A 2GU9A 4L97A 1DHKB 4AVSA 2D6PA 1FV3A 2N7GA 1H9PA 3LSEA 4X8NA 5J09A 2Q4SA 2WT0A 3OD4A 1XU1A 5ABJC 3VKNA 4W65A 2HWF2 4ISQA 5BNNC 5FCCA 1AJOA 1RUI1 4XFBA 2GH8A 5C8CA 1XE8A 2RS33 2WLQA 4FOQA 2DYCA 2WNUC 4FCAA 4DY5A 1QMJA 4WM7A 4Q0PA 1U5IA 3E5XA 1OFSA 1WBLA 2WZR3 4PIYA 4JDOA 2DVDA 4EN8B 4YG3A 4YRDA 2W0XA 1C4RA 2XUMA 1AL23 2YC0A 1V00A 1D4M1 2OUHA 1KJRA 4XZPA 1QQP2 3MPPG 1YXWA 4TZDA 1WMFA 3ZSJA 4MGKE 1FX5A 4EN7B 1QOTA 5GLZA 1LHOA 4L11A 4IEZA 4WVZA 4GA9A 4P9JA 4Q0VA 4XILA 2W52A 3LZZA 3AMPA 5JI7A 4CDXC 3KCXA 2Z2SB 3NV2A 3QACA 5EJ3A 3WCRA 5EV7A 1R1A3 3MIEA 5BNOA 4H7LA 2YZ4A 1LGNA 1J3QA 4META 4CP2A 4LHNA 3SLIA 4IV1A 1HV0A 4LE4A 1SMVA 3TRSB 2WJSA 1KJLA 4HN1A 2Q1MA 1PO22 1H8VA 1HXS3 4CDUB 4PJYA 1AR83 4YSFA 4H3WA 4Q4W3 3OYWB 2PHXA 1HRV1 5C9AB 1I1EA 4JV4A 1GBGA 4P14A 1S0IA 4FPHA 4OI1A 4DRRA 3EXUA 2ZGNA 2YXSA 1QOOA 4HT1T 5E89A 2ZBJA 2VMIA 5D8AC 3WQ1A 5ACA1 5J36A 4GB31 2YGLA 4RD7A 3RMXA 2VQ0A 3BALA 4P5HA 4Q4X1 2R0FA 2NQYA 1VBB3 2UWAA 3H0OA 3VKFC 1COV2 2JECA 4BWOA 4Q0QA 4BQ1A 3SH3A 4FPJA 1PVC1 2MNGA 4HZFA 4OLLA 2WQZC 1WLTA 4GULA 2ZZJA 4S2FA 2FHRA 3UL2A 3AZYA 1REFA 2GH2A 1JN2P 1YFYA 2B8MA 3J8F2 3WG1A 3FX3A 1NY71 2QNKA 2RM21 2RS53 4I30A 4CDWC 1RJ8A 4NWWA 2PLV3 1CN1A 1OOPC 2VY0A 1SDWA 3MICA 5D8AB 3VKLA 3W58A 3MFCA 4AQTA 2R063 1BKZA 2EXIA 4QPIB 1DYKA 2Y0IA 3J26N 3B9IA 3N7JA 2VW1A 3WXPA 2V5YA 4N9HA 1SLCA 3ILNA 5IK8A 2RMU3 2GNTA 4UXAA 3MFAA 1VRH1 3WDYA 2RS13 4EWAA 2XKOA 3HN1A 5A33B 3GHMA 4X6RB 1EYBA 3CJXA 1YUDA 2O8QA 4Q4Y1 5JZGB 1SBFA 1RUI2 2OPKA 2PFWA 3WDWA 3UJQA 1WLCA 2D3PA 2IXJA 1GICA 1CONA 2QZ2A 4X6QB 1BQPA 1AYN1 4P9WA 1ASJ1 5BUVA 3PNAA 4OZXA 1Z7S1 4OI2A 3RNSA 3KS7A 5JOWA 5I0UA 2ZHLA 3C3VA 4RGGA 1VBC3 4Q4V1 3B93A 4BCUA 2EXJA 3D82A 2ZABA 4AI8A 4XJUA 2B9UA 3KT7A 4FOYA 1D4VB 1FPN3 4LUKA 2D6KA 2O8OA 2WZPP 2DTYA 5KXBA 4HKOA 1XQNA 4FBFA 2DVFA 4HSJA 2H0BA 4Z8BA 1HQWA 2TEPA 3AP4A 1CAWB 1PGW1 1UMZA 2G9FA 3VBOB 2DU1A 5JPMB 1WLWA 1ZYBA 1NG0A 3MLLA 4AG4A 2E53A 4S2GA 4F8AA 1AF9A 4AHZA 1C28A 1RUJ2 4Q8LA 4DZGA 1GZWB 1M4WA 4G3YC 4ISRA 1PM7A 3FUOA 5T50A 3OY8A 5EYXA 1U5YA 2WFF3 2WIIB 3AYAA 1B09A 3MI8A 1G9CA 3AFKA 1TME2 3VHOA 4LBQD 5C8WA 3B7MA 3VZJA 4IV3C 4YW5A 2DCZA 4FXKB 4DRVA 1PZ8A 3CEWA 4MUVA 4WVMB 5T5LA 5JI9A 1HRV2 1ZZ6A 1AR91 3CF6E 5IK7A 1RUG1 2QFEA 4WM8C 1LOBA 2BQPA 5ACA2 1QHDA 4YGDA 3HMYA 3WP3A 2HJIA 3NKTA 3VZOA 1AR73 4ORFA 1VBD1 5FLJA 1AZDA 2DUQA 3KT4A 4XTPA 1W6MB 1JYIA 3WZ1A 4CEWC 1BMV1 1B35A 4LBMA 2XBO2 2G9GA 2WFPA 2AUYA 3V0AB 2BEOA 2GN3A 3O12A 1YI9A 3O0XA 4N43B 5J98B 4P9LA 5FRAA 2UURA 2C0ZA 1H1IA 1VR3A 2R0HA 4Q29A 4FVVA 4QPGC 1NY72 3M4FA 1VBA1 3WP6A 2RM22 2D40A 1KITA 2PELA 2EXHA 2X5IB 3N7LA 1PO11 3JD72 3M3IA 4A3XA 2ET7A 3FC0A 5C4WC 3WV6A 4B8EA 3WP5A 2AH2A 3I54A 3L2HA 4QMAA 1SLAA 2HWE2 1CAXB 1ND3B 5KBFA 3PTYA 2VUJA 1YI7A 4K21A 5GALA 4Y1VA 5LRSA 1VRH2 4I3GA 5EXOA 2D43A 3GBWA 4XF1A 2GMEA 1NCRA 2Q8OA 1RUNA 2A6YA 2DCTA 4QPGA 2FZ1A 1FMD3 5L7OB 4Q4Y2 3FLPA 2FMDA 1CESA 4MSVA 1DBNA 2E7TA 4A2UA 1CAVB 3AMQA 1AYN2 1Q5OA 2R49A 2VG9A 4DY3A 1ASJ2 3O0WA 2CYFA 1W6OB 3OTFA 1Z7S2 3AP9A 3SXWA 4XIKA 1NCQA 4HFSA 3M1HA 4Q4V2 2ZAHA 4J6GA 4RL7A 2PA7A 1KD7A 2JG9C 1CPNA 1MZ6A 1UN1A 1YIFA 2ZGPA 5F6KA 4XMIA 1JH5A 2JE7A 1IOAA 1MQTA 1HQLA 1ULEA 2JG8B 3M3CA 3JQXA 3WG3A 1Q8PA 1A3KA 4IETA 4B4QA 2PHLA 4YW1A 1GV9A 1QNWA 1V9U3 2HWD2 3D5OA 4Y1UA 1KS4A 2WS91 1IKPA 1S55A 1BBT2 5T5PA 3H1YA 3RYRA 1Q8QA 1JHNA 2DCJA 2E6VA 4BYYA 5CU1A 3RYKA 1BCXA 4LBJA 2P3JA 3ZSMA 1O5UA 4ZU7A 5IUQA 3RWNA 2Y0OA 1BYHA 1S0FA 2HWF3 1AR92 3VBSC 1UZZA 2JKBA 3CU7A 4C91A 3HT1A 3LCPA 3THTA 2XL7A 2YYOA 1RUG2 5BV6A 5I8TA 3N36A 3NO8A 4A7KA 4EWEA 4GWNA 5FPXA 4L99A 2DFBA 1LODA 5JPNB 2B42B 5BNPA 1R1ZA 3G7DA 2A73B 3ZYRA 1LULA 4MXWB 3ZFFA 4R52A 4BLIA 1VBD2 1OKQA 1RUD1 4ONUA 3MIDA 5FBZA 1BMV2 1CIWA 4JCKA 4RQPC 5AC91 4PDWA 4RS5A 2LUWA 1ZRCA 1FI2A 3LGRA 1ZBE3 4QX5A 3FWEA 3POSA 1J3RA 1QF3A 2WLPA 3U07A 2NPIA 2Z5WA 2PQQA 3VBFB 3ZDSA 1I6XA 2DUOA 4Q27A 4KU7A 1AR62 1ULFA 2PYTA 1DQ5A 2MHFA 4NN0A 4E2GA 3ZO0B 3VBSB 1VBA2 4COZA 1OQEA 1H2KA 2YGMA 3O5SA 1ONAA 1PO12 5F5QA 4C1XA 2P3KA 1RUF3 5GZEA 1QY4A 4PLMA 1QOSA 1YNAA 1SFNA 4WVWA 1Z0HA 3AMHA 3FHIB 1WCSA 3DN7A 3MGUA 1PO23 1AHSA 3N7KA 1GYKA 3VKMA 5K0UA 4RQPB 1UL9A 1Y7BA 1MS1A 2WNEA 1RTVA 3M3QA 1X8EA 2XGXA 3DPRC 2XJVA 3WDTA 4OFGA 4AFDA 4IESA 4YG0A 1SFYA 4D7SA 1QJY3 4ITCA 1GNZA 1VBE3 1EAH3 2YV8A 3AZXA 4GXLA 5FREA 5GZFA 1O3TA 1C1LA 1X33A 3WHUA 1U5XA 2YDEA 4TSVA 3NL1A 1BJQA 4FXGB 3RDIA 3VBRB 2R042 3NAPB 1LOCA 4ZU5A 3VDDB 3VBHC 5K9YA 2BNNA 4XDQA 5FDBA 5KHGA 1YFUA 2ZKLA 3MZHA 3ALQA 4YZ5A 5GLVA 2KM2A 3KT1A 2A3WA 1LGBA 3FMGA 2QUOA 4MVTA 3ES4A 1RHI1 5JCTA 1UIJA 4HVOA 3OGGA 4CDQA 5HCAA 3WD5A 3USUB 4IEWA 1DGRA 3FUQA 2CTVA 2WS92 4Z82A 1QH6A 3SH4A 2PHWA 3E6CC 3WOGA 4Q1RA 4E2SA 2Y38A 2VUAA 4IERA 1K5MA 4D3WA 5FTTC