1WLTA

Crystal structure of dtdp-4-dehydrorhamnose 3,5-epimerase homologue from sulfolobus tokodaii
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
176
structure length
176
Chain Sequence
MPFEFENLGMGIILIKPKVFPDKRGFFLEVFKSEDFTKMRIPNVIQTNMSFSRKGVVRGLHYQRTPKEQGKIIFVPKGRILDVAVDVRKSSPTFGKYVKAELNEENHYMLWIPPGFAHGFQALEDSIVIYFITHNEYSPPHERCISYSYIDWPIKEVIISDKDLQCPSLEKAEVFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of dTDP-4-dehydrorhamnose 3,5-epimerase homologue
rcsb
source organism Sulfolobus tokodaii
molecule tags Isomerase
molecule keywords 176aa long hypothetical dTDP-4-dehydrorhamnose 3,5-epimerase
total genus 38
structure length 176
sequence length 176
chains with identical sequence B
ec nomenclature ec 5.1.3.13: dTDP-4-dehydrorhamnose 3,5-epimerase.
pdb deposition date 2004-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00908 dTDP_sugar_isom dTDP-4-dehydrorhamnose 3,5-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1wltA00
5FPZA 5LRRA 5I0RA 3KCCA 2PQQA 4X6QB 3L2HA 4L11A 4UXAA 5AVPA 4E2QA 3GBFA 2BNMA 5E1RA 3SMHA 4MGYE 3SCHA 4XETA 2WFPA 1O3TA 4KWJA 2E9QA 3BU7A 2D93A 2BGCA 2C0ZA 4TLFA 1VP6A 3LA7A 4IEXA 3LOIA 2QVSB 3HIFA 2QJVA 2OYZA 5HI0A 4P9GA 4XFHA 1VJ2A 2OA2A 1ZVFA 1CAUB 4HZFA 2VPVA 3ACLA 1I5ZA 1CAUA 3LZZA 4MGIE 3LAGA 4JV4A 5CADA 4WBBA 1DGRA 4QGMA 3DV8A 2UYAA 4AVBA 1GQHA 2P17A 4Z82A 4E2SA 3HT2A 2BEOA 4I09A 2PA7A 1QXJA 4PIZA 2K9ZA 4IEVA 4XF1A 1NE4A 4UBHA 2QDRA 3E6BA 1L3JA 2BNOA 3FHIB 1YFWA 1UPIA 4LTAA 1IPJA 4R8HA 5I8TA 4QM8A 3TNQA 1ZNPA 5C8WA 4BIFA 5I0SA 4F8AA 4GULA 2Q1ZB 3SCGA 1PM7A 3E6CC 3H50A 3OF1A 2Q4SA 4HSJA 4PIXA 1ZZ7A 1U12A 3KGLA 4IEOA 2PYTA 1DZTA 4MH0E 1ZRCA 4FAHA 5EZWA 4XF0A 4XFFA 3OTFA 5I93A 5FLHA 4XEZA 4EWDA 2ET1A 4EWAA 1CAXB 5FCCA 1VR3A 4IEYA 1GQGA 4N9HA 2CV6A 3ZDSA 4HN1A 3H7YA 3MZHA 4HN0A 3SXWA 4MUVA 5E16A 1ZZ9A 3EJKA 2BNNA 1J3QA 3TNPB 1FT9A 3EBRA 3WW2A 1ZRRA 3FFQA 3I59A 1WLTA 1Y9QA 2GH2A 4QMAA 2Q0AA 1H1IA 4X6RB 3S7IA 2XKPA 1RL3A 4D7TA 3VHRA 4YSFA 3SHRA 2I45A 4PJYA 2CAUA 3LA2A 5FPXA 3ROUA 5BXXA 1DZRA 1FI2A 1WGPA 4Q0QA 5CVRA 1NXMA 1SQ4A 2EA7A 5J48A 3LWCA 4LA2A 4KU7A 3CLPA 3OGJA 2B9UA 3OCPA 5T3NA 2PHLA 3MDPA 3MYXA 1X8MA 3H1YA 3WW4A 3USSA 3H3ZA 1UCXA 1O7FA 4HMZA 1OD5A 4Q29A 4CYDA 5KBFA 1J58A 4F7ZA 4AXOA 2B5HA 2ET7A 2BYVE 3E5UA 1RUNA 1OI6A 3UKTA 2OZ6A 4I3PA 4NVPA 4BH9A 3I7DA 1I6XA 1Q43A 4EV0A 2IXKA 1EYBA 1ZREA 1YLLA 2PAEA 4H7LA 3I59B 4AVCA 2D40A 1ZZ8A 4RD7A 2XLGA 5I0TA 3ES4A 1O4TA 1OMIA 2K0GA 4L2NA 1QWRA 3ST7A 2IXHA 5I91A 3NW4A 1YFYA 4KU8A 3H9AA 4J1WA 3JZVA 4I02A 1J59A 3FZ3A 2FQPA 4HBNA 4XFCA 1YFUA 2UY8A 1ZZCA 3FWEA 2QNKA 5D1IA 5I0UA 5JAXA 3ELNA 3DL3A 2ETEA 3CF6E 1X8EA 4J1XA 3EO6A 4XF3A 2H6BA 3E5QA 4JVAA 3O14A 3IDBB 3PVBB 4UBGA 4IETA 3H7JA 3H8UA 4IEQA 4LLOA 1ZRFA 2ZCWA 1O5LA 4XF4A 4HVOA 1RGSA 1CX4A 3N4MA 1CAVB 2CGPA 3S0MA 1Q3EA 4EWEA 4FT8A 2V09A 3QACA 1J1LA 4MV2A 4K8FA 1G6NA 1CAXA 4MGZE 1WA4A 1J3RA 3NL1A 4O9EA 4MZUA 4XFBA 1SEFA 4I0BA 3GYDA 2ZKLA 2H0VA 2MNGA 4QGLA 4D7SA 5KHHA 1NZCA 4DINB 5KHKA 4KL1A 4META 1LB2A 4BHPA 1O3QA 3UKNA 5EFUA 1Y3TA 2HJIA 4QX5A 5FQ0A 3U11A 3ETQA 1SFNA 2DCTA 2Z69A 4OLLA 4I2OA 2Y0OA 3LA3A 3D82A 3RZZA 4B29A 4QM9A 4KWKA 3PLQA 3G7DA 3KGZA 4QXKA 3E97A 1IPKA 4FBFA 1JUHA 4IEWA 2XLFA 5F1RA 3EHKA 1YFXA 5KHGA 1UW8A 1X7NA 3IWZA 3NVCA 3BB6A 2KXLA 2GU9A 3IIAA 1H1MA 1XE8A 3D0SA 1LRHA 1ZX5A 2OZJA 2Z2SB 4JTOA 3E5XA 5JR7B 3SCFA 1ZZBA 3WW1A 2PAKA 4I0AA 1UD1A 4OFGA 3M70A 3U10A 1QY4A 3FX3A 1TQ5A 2H6CA 2MPFA 4IESA 4Q0PA 1CGPA 4HVQA 5I8SA 4ZU4A 3H3UA 2HKXA 3HT1A 2PTMA 4ZU5A 2PAMA 4HSLA 5CU1A 4BYYA 1YHFA 4HVRA 3D0JA 1LR5A 5FQ0B 1YWKA 2B8MA 2IXLA 4ORFA 5LEKA 3C3VA 3IBMA 4YRDA 1X82A 2MHFA 1RC6A 3H1WA 3DN7A 1EY2A 4XF9A 2IXIA 1HW5A 1V70A 2O1QA 1FXZA 4EROA 5J3UA 2GC2A 3S7EA 3H1MA 4E2GA 5FDBA 4AQ2A 4Q0UA 2F4PA 4XFAA 5FLJA 4AQ6A 2XHKA 5BV6A 3R6SA 1UIKA 4LA3A 3FJSA 2FMYA 1UIJA 1XE7A 3RDIA 4WZCA 3CJXA 1EP0A 2IC1A 1NE6A 3FE5A 4YNIA 4I01A 5BPXA 2GC1A 4PIYA 3MPBA 4WVZA 3CEWA 2GZWA 5K8SA 4FAGA 3CL1A 4LEJA 5I8YA 1CAWB 3RYRA 2XL9A 2GAUA 5KHIA 2VECA 5BY5A 5JSPA 4LUMA 4YARA 3RNSA 3BALA 1O3SA 2UY9A 2Q30A 1O3RA 2XLAA 3KMHA 4LULA 1ZRDA 2EAAA 2GC3A 4KWLA 2OPKA 2ATFA 3ES1A 5JCTA 1EPZA 2N7GA 3E6DA 3WW3A 3IDCB 1ZZ6A 4Q0SA 2VQAA 4JTNA 2IXCA 5JSRA 3B02A 3RYKA 3RYPA 3QOPA 2CAVA 3NKTA 4YYOA 4A2UA 1CAVA 1PMIA 3NSTA 4O9GA 2IXJA 4QGNA 3BCWA 1CAWA 4MGKE 4AVAA 2GC0A 4XFIA 3U0ZA 1LKNA 4ONUA 4ZU7A 4IERA 1OFNA 2D5HA 1YUDA 2D5FA 3PNAA 2UYBA 4LUKA 3RPQA 1J3PA 3DKWA 3UKVA 4XFGA 5LEJA 2O8QA 3CO2A 3BPZA 5FLIA 5LRSA 1XRUA 2XKOA 4MX3A 5C6CA 2XL7A 5J7MA 4Q0VA 4IEPA 3KSCA 1Q5OA 4HLTA 5BUVA 2WC2A 3NJZA 1RTVA 1O5UA 4IEZA 1RUOA 3EQEA 3HQXA 5JSOA 2XGXA 3M3IA 3OD0A 1NYWA 2PHDA 2QCSB 2PFWA 1QXRA 2EVXA 5KHJA 4IEUA 1DGWA 4Z07A 4R52A 3I54A 4N9IA
chains in the Genus database with same CATH superfamily
4IE5A 1HQNA 1FPN1 1PZ7A 2OS2A 2RS12 2VBDA 5LRRA 4COUA 5C8CA 4OUMA 4QB1A 1S0EA 1HX6A 2D6MA 2WYSA 4YW4A 2XBO1 4BISA 2E33A 2PQQA 3O0VA 2XWBB 4BQYA 2JE7A 4CEWC 1UNBA 3P6BA 3ZYJB 4E2QA 1DGRN 2BJSA 5IJRA 3C7HA 3VHOA 4BK5A 1CN1A 3W59A 4Y20B 1QHDA 2E31A 1RUE3 1EV12 1O3TA 3AXDA 3NQHA 2WWUA 2E9QA 3BU7A 2D93A 3AL6A 3K3NA 4ATFA 2C0ZA 2ZGQA 4Q4Y2 4JQRA 3ZX7A 4DUWA 5T54A 3LOIA 3T08A 2QJVA 4IE4A 2OYZA 2AR6A 5IWFA 4XFHA 5FY8A 4Y4YA 3ACIA 4E8DA 2OA2A 3I97A 4XE9A 3I3QA 5L73A 1CAUB 4I3GA 3VBHA 2ZEYA 3TN92 2VPVA 3RSJA 3SITA 4CDUC 1I5ZA 1TG7A 2WO3A 2P5BA 3GM8A 2Z5WA 5FP9A 2WUHA 4BCUA 1NA1A 2YV8A 4XPVA 2D7FA 3WNNA 3LAGA 3UGHA 4FSJA 1NCRC 4A6SA 2WS92 4JV4A 4YM0A 4BMEA 4Y22A 4XUPA 4HL0A 2WAAA 1LHWA 4ISRA 3DV8A 4CDXB 2D98A 5FPLA 2JENA 3RG0A 4Q4X2 3HT2A 1EPWA 3M7AA 2PA7A 2ZGSA 4XCAA 4NE9A 5FMCA 4XURA 3ZN6A 3KQRA 1WCDJ 2Y6KA 4IEVA 4MSVA 4BB3A 3WF1A 3WLUA 1VBD3 3ZSEA 4CEYB 4WZFA 2VW0A 4XBQA 2A70A 2DWRA 4NHKA 4RR3C 3VBUB 2NMNA 4IV3A 4AI0A 3FHIB 2WO1A 1A8MA 5FPVA 1O4YA 3WG2A 1LOFA 2ZX3A 4B7KA 2VG9A 3BU0A 2HYKA 1W6NB 5C8WA 2CHHA 2WS93 2HWE2 3H50A 4AI2A 2FDFA 4UFHA 3IB3A 2Q4SA 1BQPA 2X5IC 1GOFA 2ES3A 5DN2A 1WW5A 3WX5A 1RUF2 1RMU1 1W9WA 1D0HA 1U12A 1ZZ7A 2PYTA 3AKSA 1DZTA 2R1BA 2IVJA 1OUXA 4MH0E 2XR4A 4Y20A 2QQWA 4FAHA 4UW5A 1NY72 1RUD2 2ZMLA 4XF0A 1EAH2 1UU5A 4QDQA 5FLHA 1RXGA 4N53A 1FOD1 2AUYA 2DF7A 2HWB3 2J1RA 4XEZA 2IFWA 4LBJA 5IHRA 3AC0A 3HN1A 1POV3 3LKJA 3TBDA 4MG2A 2YZ4A 1NLSA 2CV6A 5LBBA 4YG6A 3S6PA 1ZBE1 3MW3A 3WDUA 3MZHA 1AXYA 3AMHA 4PCRA 5E16A 1ZZ9A 3JBG1 4YFWA 3VDAA 1J3QA 1RUH3 3PHMA 3TNPB 3IIIA 5JXGA 3WW2A 2OT7A 3FFQA 3I3BA 3POFA 4JDNA 5EXOA 4NRPA 3VZJA 1MS5A 5FREA 2E7TA 5CZKA 5C7GA 1FPN3 5GALA 3WY6A 4FFHA 1FATA 1IKPA 2XKPA 1CZTA 4YSFA 1HJGA 1DIWA 3F95A 4M3CB 4PJYA 1JOPA 2YROA 3LA2A 4YW3A 4IV3B 1MEC3 4LHLA 4L0PA 3ZYHA 4Q0QA 4YFZA 2VZ3A 2A75A 4AI8A 4Q4Y1 3WQBA 2RMU1 2XJRA 3JB8A 4DEQA 1AX1A 4NAMA 3S30A 4AEDB 2XWJB 4JX0A 4LKFA 4LA2A 3SEEA 5FZBA 5J98B 3WD5A 1LHVA 3T4VA 1K12A 4JRAA 2Y38A 5FZIA 5DUUA 5CIRA 3SH5A 4DFSA 4XXAA 4GIQA 3MDPA 2R043 3UJQA 1JHNA 3N7LA 4AQSA 2L9LA 2YU2A 1IHMA 3AKTA 1QDOA 4OUSA 1FOD3 3N9MA 5KBFA 1AR73 1W6MB 1YQ2A 4AFDA 1DQ5A 2GNDA 3IAQA 3FC0A 3T30A 4WM8B 1AYM3 4S2DA 1MR5A 5GLTA 3T2PA 2RV9A 3E5UA 5I0DA 3BUCA 3VHPA 1RUNA 3VD4A 3GCXA 3I2GA 3RI9A 1OQ1A 3UKTA 4FPLA 4AFMA 2OZ6A 4I3PA 3N7KA 1TME2 2JG9A 4IGQA 5DDJ1 1ASJ2 1XNDA 3OYWA 4Q4X3 4BH9A 4EV0A 2GNTA 4J6GA 1LOCA 3DEMA 4BM8A 1LCLA 3OGSA 2IXKA 2AENA 3FBMA 4RFT0 3AP7A 1XNCA 1WMDA 1S0BA 1YLLA 3I3EA 2VQ0A 2PAEA 2WRAA 4FXGB 2FDIA 3TEWA 2HBTA 3U75A 5JXHA 2PLV2 2BU9A 2X10A 4NR1A 2A6ZA 1RITA 2G19A 2W47A 2WBKA 3CU7A 3ILRA 4IE0A 2E32A 3W9AA 4UOJA 5IFPA 1O4TA 4AGRA 5FPUA 4CZSA 4L2NA 5FJHA 4LQRA 3H8OA 4HKOA 4P9YA 4MYEA 1PZ9A 5IVYA 5FO7B 1D2QA 4I02A 2YC0A 4ZS2A 4JQTA 5GZDA 1BJQA 1LU1A 1S2BA 2WINB 3RZMA 2HH9A 5KXCA 1K3IA 4FPKA 2PHTA 2QTWB 4HBNA 4XFCA 2Y0IA 2VULA 3FWEA 5D1IA 3U14A 5HV0A 1W6OA 3ELNA 3R4UA 3VBOA 1X8EA 3Q9OA 4UAPA 4XF3A 5FP4A 2NZ9A 4Y1ZA 5A3OA 4JVAA 4Y1XA 1GZCA 3FLTA 4W4ZA 4UBGA 3VBOB 1LOGA 2G9GA 5A33B 5CKQA 3AZWA 3OEAA 3GJBA 4BQ2A 5L19A 3OGRA 2X8KA 1Z7S1 2ORZA 4LO5B 2B42B 1CAVB 2W91A 4NRMA 3GBGA 2CSGA 3KCXA 5CKNA 3NV3A 4COWA 4DXSA 4M00A 4XJAA 2V09A 3IT8A 4M4PA 3DXTA 4M4RA 4W6XA 3R4DB 1WW7A 3WG4A 2BW8A 1WA4A 1VBA1 1J3RA 1RUD3 3LF7A 5EHDA 2FDGA 2V5YA 4AL9A 1SDDB 4MZUA 1RUC1 3D6EA 2HWB2 3MUY1 2BTVC 1PHMA 3GYDA 4ES9A 1VBC1 2MNGA 1QF3A 5F3GA 4OQ9A 4ZZ8A 2ARAA 2R7EB 4KL1A 1W0NA 1UX7A 3DXUA 2DTYA 3RJRA 5EFUA 3UKNA 1W2UA 3VZOA 3OGGA 2R32A 3A0NA 1Y3TA 1QOOA 2AACA 2HJIA 5FZ3A 5C33A 1W8UA 4AI9A 5D2AA 1SFNA 3V0BA 4N43A 2DCTA 3JCIA 4WM8A 4LO7A 4OLLA 3ZPYA 3DCQA 2A6YA 1LHOA 2BPA2 3AP9A 5FZ9A 4A6OA 2ZX1A 4B29A 3AP5A 5FYSA 2PHFA 3WP5A 1JYXA 3POGA 3PLQA 3G7DA 3KGZA 2J1SA 1NCQB 4CCCA 1V6OA 2YPDA 1BBT2 1JUHA 1ZBE2 4CXYA 1UYYA 1HB1A 1TNRA 3K75B 1X7NA 4FCAA 5F32A 5JOXA 3OSDA 5DMYA 3ZIXA 1UKGA 5F5IA 2GU9A 1F5FA 2VD7A 2WFF2 4BIOA 4Q4V1 1B35B 4L9BA 4RGGA 1DLLA 3WDWA 1TZOA 2VBBA 3AZZA 3D0SA 3WNXA 1LRHA 2OZJA 2E6VA 4CSWA 1G9BA 2VMFA 2DCYA 5F9TA 1AL21 2XPJA 4OVEA 5DPNA 3S5AA 4OFGA 1G9FA 1QY4A 4AI3A 4BQ4A 1Q8PA 1VRH1 2DYCA 3AFGA 4JHZA 2OXBA 5DAXA 1V9U2 1ONAA 5H9SA 5L9VA 4AAXA 4NIDA 3O1SA 4WM7A 1UMHA 4QXBA 4PBOA 1DP0A 3VBSA 3B69A 4R9AA 1DLCA 4AQTA 5IVJA 2HKXA 4AEKA 3JUUA 3S5QA 2BQPA 4C0HA 2YU1A 4CP1A 5FIXA 5JOWA 1UPSA 1E5IA 1LR5A 1PVC2 1YWKA 4UFLA 1R1ZA 4ORFA 4G9SB 4ASMB 2XUEA 5ABJB 3C3VA 1UZWA 4NIIA 5JPMB 3K4DA 1FV3A 1I5PA 1ZBA1 4YLZA 3M4FA 2YDEA 5FMDA 1AL22 3H1WA 4WVWA 3DN7A 3KV4A 1JS9A 4GB32 1PO21 3PUSA 2JDUA 1PNFA 4XF9A 5CFCB 1R082 1UXZA 2PHRA 1IQAA 1R091 4MVTA 3WF2A 1ODMA 1XOYA 2RDQA 3ASIA 4RR3A 4EROA 4P9WA 4YGDA 2CY6A 3H1MA 3TRSB 4AYUA 2YHJA 4E2GA 3KQ4B 2JEMA 4AQ2A 5BNOA 5FDBA 2DUPA 5M0TA 4XFAA 5FLJA 2WQZC 1C1LA 2YC2A 4KNCA 4Q1RA 4YGBA 1UIKA 4LA3A 2PHWA 1EV13 5G04L 1H4GA 1PO13 1S1AA 3CIHA 3RDIA 2IVIB 1RUG2 1V6LA 2BV4A 4WZCA 2HWD3 2ZGRA 1W6QA 4AEMA 3FE5A 2ARXA 4AI1A 3MFCA 2YBSA 4K40A 1C4RA 1V9U3 4LBMA 4M3CA 2GZWA 2ZAHA 4Y1YA 3WHUA 3ZSKA 2JKXA 4CA9A 5I8YA 5IT6A 1JU3A 3RYRA 5K0UC 2XL9A 3X29B 2G4IA 2GAUA 2XONA 5BNNA 5CKMA 1QNWA 5JSPA 1UYZA 2BFUS 2LTNA 4LHNA 4XUNA 5D8AB 1VBB2 4P5YA 4ZPIA 1RVF3 3RNSA 4U36A 2Q30A 1O3RA 5F39A 4DEVA 1REFA 3HBZA 4XDPA 5H9RA 1GP5A 1TMF1 2WN2A 3CDZB 3KMHA 2Z79A 2VH9A 4AE2A 4YZ1A 3K77A 2GC3A 1ULPA 2WT1A 2OPKA 2QUOA 4WV8A 2VZTA 1ZBE3 1W2AX 1AR83 5F6KA 5FMOS 5JCTA 2N7GA 1GZTA 3ENRA 1UAIA 3WW3A 2BFUL 2DTWA 2VR4A 3H42B 2DV9A 2VQAA 2W0XA 4JTNA 4Q0SA 3UYJA 2EIGA 4HONA 5DAVA 5FZFA 5A80A 4FP2A 2YXSA 3FHAA 3I2KA 1W90A 3RYKA 4CP0A 5C8CC 1VPHA 3LB9A 3N7JA 5DZGA 1PMIA 1D2SA 1NZIA 1RJ8A 1UOFA 3PUQA 2Q8CA 2QQMA 2ZEXA 2IXJA 4QGNA 4BOWA 4C91A 3BYWA 2Q1FA 3PTRB 1VAKA 2DVGA 1SBFA 3ECQA 3VDDA 2D6NA 1PIV2 4MGSA 4RFRB 4MGQA 4Q8LA 1CAWA 2RE9A 3ZO0B 5AC91 3HPNA 1M4WA 5LA9A 1MACA 2GC0A 3DUIA 2RM22 3U0ZA 4R9DA 3EB7A 5KWRA 5DUWA 2AEYA 2CL2A 4ZU7A 4NUBA 1OFNA 1PNGA 2E51A 3ILFA 1BEV3 1J83A 4HK9A 3AYDA 4PI0A 1SBDA 1KJRA 3JBG2 3NV4A 4L92A 2FCTA 1J3PA 1A6CA 3POIA 3KB5A 3UKVA 5C5TA 2W46A 4XFGA 3IPVA 4PF5A 2O8QA 3KV6A 4ZS3A 5FUIA 1HV0A 3A4UA 1XRUA 3RZLA 4MX3A 1V6NA 5C6CA 5J7MA 1VB4A 1TVGA 3KSCA 4N43B 1Q5OA 1Q8SA 4QXHA 3ZFFC 3Q8CA 3BODA 5J96B 4YGEA 4CP9B 3QLQA 3WEZA 2BERA 3NJZA 3KVBA 3ZXEA 1IS4A 1CIYA 1RUOA 4QPIA 4QKFA 4NWVA 2YPJA 1N1YA 1REDA 2W1WA 1SLTA 2CDPA 5K0UB 1IOAA 2QCSB 1YEWA 1YJKA 3KT7A 1UMIA 3VBUA 5FYUA 3U78A 1GR3A 3MW4A 4IEUA 5C9AA 4Z07A 1HRV2 2RR11 3G6JB 2R0HA 3GZEA 3LDBA 4N9IA 1AYN1 3FLPA 3ZXFA 1SPPA 4INDA 1D7PM 5FPZA 1IGOA 2VOXA 2Y64A 5LW9A 4QX0A 1A3KA 5G05L 2YY1A 4A44A 2BGOA 2JD4A 2KM2A 4PLNA 3D4KA 1YQCA 4URAA 4YZ2A 3ETPA 4UXAA 2ZGPA 5JZGC 3GBFA 5FK7A 1H6XA 3VKOA 1J84A 2X05A 4AK3A 3N9NA 3WNOA 1COV1 3WNMA 2ZHLA 3VBFA 4LHKA 4UF0B 3SLIA 4JHTA 3HBKA 1OT5A 3AP6A 1R1A2 5FYTA 5J09A 1URXA 3T3YA 1RUC3 4TLFA 4RSUA 1ZRIA 1IG0A 4XIKA 5BYNA 5BNQA 3WNPA 4NIHA 3DPRB 4P9JA 1V00A 2BOJA 3OPZA 4RYDA 4WVMB 1DF0A 1S0GA 5FY1A 3VZMA 1AHSA 2DVDA 2RR13 2QZ2A 1T2XA 4Y1VA 3FLRA 1SMVA 2WIIB 4DPNA 2VTFA 1G7YA 4W6YA 3VZKA 4L97A 2GDFA 2ILMA 4FQ4A 1IG3A 5J36A 3WP6A 5LCWL 3WV6A 4S2FA 2CU5A 4FPOB 4JGZA 3A21A 3BPSA 4GWJA 4WBBA 1DGRA 2A1XA 3ZFFA 4LOTA 1GZWB 2UYAA 3L2YA 4AVBA 1GQHA 2A3YA 4Z82A 1GP6A 3VBRA 4JGYC 4HKWA 2BVBA 1QXJA 1RMU3 3I3MA 3UNPA 1PGL1 4LKSA 3MICA 5GLZA 4YM3A 1PIV3 1G8WA 4KBBA 5KXEA 1NE4A 2NQYA 2VVDA 5C4WA 2Q1MA 1HB3A 1YI9A 1PGW2 1RJ7A 3RMYA 1QJY1 5JDBA 1UPIA 2GH8A 4LTAA 3UESA 5I8TA 2VOTA 5HCBA 1HV1A 4M0NA 1FPN2 4F8AA 2Q1ZB 3E6CC 4CCEA 5LK5A 4GWIA 2DFBA 3MLKA 5IATA 1MS0A 3OF1A 2EXJA 4CVUA 2WNVA 2VNRA 1AR82 3VD7A 5HXVA 3FUOA 4PIXA 2ZGOA 3TN93 1R1A3 1GFF2 4RHV1 5D8AC 1RMU2 1JZ4A 1CR7A 3ATGA 4GWMA 5EZWA 2AREA 3WNKA 3BKZA 1AR71 4A7YA 1AR93 1C8M3 5FKBA 3J7HA 2JG8C 5LK7B 4Q4W1 2WN3A 5F37A 2A71A 3GDBA 4CPBA 2ET1A 4EWAA 5AFEA 2RJKA 3HQRA 1W8HA 3THCA 1NCQA 2RS53 1OLRA 4IEYA 1QKQA 1VLNA 4Y26A 3ZDSA 4YZ5A 4DB5A 1UY4A 4P9IA 2WA3A 5E89A 4YW1A 5BNOB 4HN0A 1VBD2 4P9LA 1C5IA 4OCTA 5GJ6A 2PLV1 5E6HA 1PVC1 2NYYA 1ST8A 2BWCA 4XC9A 1YNAA 1C57A 3AMMA 5EJ1B 3MV11 4CCKA 1WLTA 4CDWA 2Y6GA 1HJFA 3MBWA 1FV2A 1PK6B 2HWE3 5A3MA 5A7QA 1YYNA 5IK7A 3ZYFA 5F5QA 1IKQA 4BU2A 1S55A 2D43A 5ACA1 4X6RB 4GB31 5CNAA 4JGYB 2OKXA 1TME3 1SDWA 3VHNA 3M3QA 4OZXA 3VHRA 4X8PA 4ARYA 1W8WA 2VJXA 2RJ2A 5FPXA 3AMNA 3RZGA 2VE1A 2GN3A 1SQ4A 2F17A 4J25A 2XBO3 2YFUA 2A3XA 2D44A 2R063 3AJZA 3WQ1A 1E5HA 3ZXKA 1A34A 4CDQC 3HR9A 2GNMA 3LWCA 2JE9A 4RGKA 2WNVB 5CFDB 1IZ3A 5A7PA 4GAZA 5DZEA 3ZXJA 1CJPA 1OLME 3MYXA 1X8MA 1JTZX 3H1YA 4CCNA 1NLRA 3KLSA 3H3ZA 4Q29A 1O7FA 4EN9B 1OD5A 3KHCA 2WO7A 1QJX3 3RGBA 5F3CA 3Q8EA 5B4NA 1OQEA 2XVLA 4F7ZA 3WDXA 1HLCA 1MZEA 5BNNB 1IS5A 2QQVA 2CGOA 1CWPA 3M2MA 1GICA 5FUNA 3OBAA 1PO23 1LEDA 1W06A 2W95A 2BOIA 3VBRB 3ZFGC 3KCYA 2Q8DA 2DFCA 1Z0HA 4OI1A 1Q43A 3GGLA 3Q8AA 1UXXX 5F3EA 5BNOC 2JB8A 4F83A 1EYBA 2HWB1 1ZREA 3WDTA 1C1FA 1CESA 3LDRA 4AWDA 4Y4RA 3U07A 4H7LA 4MXVA 1W6QB 2FZ2A 1MZ6A 3URFA 5A7WA 4ZZ5A 3LDKA 4AVCA 4JKLA 5FYMA 2GMEA 4NPLA 1OVSA 4XBNA 2Y6FA 3HMYA 2ADEA 2J1AA 4A3ZA 5JOZA 5I0TA 4COVA 4X8NA 1HRV1 3PVOA 3TEXA 4DQAA 3HQUA 1M06G 3V0BB 3AL5A 3AZVA 4OHXA 3C7EA 3BI3A 3WCSA 3ZSJA 3LQCA 1QWRA 4GKXA 1OBNA 1YFYA 2ORXA 5BNPA 4AHZA 4CDQA 4UT5A 1CD3G 1OF4A 2C5DA 4YG3A 2LM3A 5F2SA 2VMHA 2DBNA 3O1MA 2FQPA 1AR72 3MHZA 1AL23 1NOVA 4QPIB 2J1UA 1Q8OA 4P02B 3ZXGA 1DQ0A 1DQ2A 2QNKA 2LRPA 2DDUA 5K0UA 4CP2A 5IVCA 3CF6E 1DZQA 1R083 4OMCA 2AZ5A 3AFKA 3GHMA 1UN1A 3EO6A 2H6BA 3ITQA 3EYPA 3LPGA 2ZZQA 3I2HA 4Y5Z0 1MS4A 4IETA 3H7JA 4AVTA 3H8UA 5EJ3A 4GMP3 3QH7A 1WD3A 3BOPA 3ZN4A 4AEDA 2W94A 5EIYB 4I0WB 3BIWE 2ZCWA 1O5LA 4XF4A 5FZ0A 2RS13 1RGSA 2YC4A 4CCOA 3ZYRA 3N4MA 4LHSA 2UWAA 2WZR1 1W39A 1Q3EA 1Y9GA 2J1EA 2V4AA 2VZ1A 1OKOA 4FT8A 4OHWA 5FP8A 3VBHC 4CDUA 5FZ7A 4BLIA 3MIHA 5A6YA 1C28A 3QACA 1VBE2 4Y5SA 4QX1A 4NWWA 4EZ4A 4B3NA 4N8MA 4MV2A 5H9PA 3K51A 2WO2A 3WVJA 4OHVA 1G6NA 1CAXA 1VBA2 3AZYA 1WMEA 4IGPA 5DAWA 1RUJ3 3KZ4C 2GN7A 2QQOA 3O1VA 5T50A 2ZABA 4XFBA 2VZSA 1SEFA 1VBC2 2ZHKA 4I0BA 4QD2A 5FBZA 5A7WB 2ZKLA 4AR2A 1W04A 3WUCA 5KHHA 2ZHMA 4D7SA 3BTYA 4DINB 2A3WA 1W9SA 1NXD1 2E53A 3C2UA 1U5YA 2X53S 2VNVA 3T0AA 3VBFC 1LB2A 2F4LA 2Q8EA 4E4ZA 4MHRA 1CPMA 2VZVA 4D6SA 2FD8A 1RVF2 3HNMA 2J1TA 2X09A 4QQHA 5FYVA 1T6GC 3VKMA 2JE8A 2YBKA 3D5OA 3WZ1A 3JQWA 1V6JA 1WMXA 1POV0 4BMBA 1D0GA 1AZDA 3KWVA 3IMNA 2P3IA 4FPYA 2RJLA 3HAGA 4XUTA 3J4UH 5DUVA 2Z69A 5FYIA 1LAJA 5FZOA 4I2OA 2OUJA 4AFBA 3K2OA 2Y0OA 3RZJA 3OUJA 1JH5A 1R092 4XOGA 4BA6A 1R081 3RZZA 3AX4A 4ET7A 1LHNA 3I2IA 1WUVA 3K46A 4NPRA 4MXWA 1BHGA 5FWJA 4C0BA 1SLLA 5FBJA 3PTYA 2MEV2 2LUWA 3N9QA 4QU1A 4WVMA 5A6QA 3RFRA 1XQNA 3UT0A 2RMU2 4YG0A 1IPKA 4QDSA 4AFCA 2KR2A 2ZACA 5KHGA 2WQ8A 1YFXA 2XJQA 2ZGMA 5EP9A 3A23A 5E88A 3VBRC 1F5JA 4QX8A 5C4WC 4XHBA 3NVCA 1DFQA 2GP5A 1W0OA 5A3NA 4K9SA 4B4PA 3B5LB 3WT3A 1QEXA 1H1MA 3UGGA 4OUEA 3LSDA 5B2GB 2CYFA 2Z2SB 4CDUB 3O12A 3UJOA 1X36A 2QE3A 1RUJ2 3SCFA 1ZZBA 3O0XA 1SFPA 3WW1A 4FFGA 1QJX2 3PVEA 4NROA 3SH4A 5L36A 3AKRA 1S0CA 3JQXA 4YVSA 2CGNA 1E5RA 2XDVA 3FX3A 3SKJE 1TQ5A 4CDXA 3H8RA 1W0PA 1DGLA 1N3QA 3C7GA 4QQOA 4OI0A 3GALA 3ORJA 4HVQA 2XHNA 5I8SA 3THTA 1XNBA 4FPHA 5DDJ3 2QQUA 2R073 2W68A 4ZU4A 1U5ZA 1UF2C 3H3UA 3LEKA 4NRQA 3ZYIB 3HT1A 2CWSA 1QOTA 1OFSA 4HPKA 4M3CF 3LIHA 1SLAA 3CBNA 4ZU5A 2R1DA 4B8EA 4BYYA 2P6HA 4N43C 4HVRA 1XU2A 1KDKA 3CQOA 2VCAA 1UU6A 2IXLA 4FPFA 2JG9C 1OA4A 4S2HA 4QKDA 5LEKA 4YRDA 2PHUA 1X82A 1BK1A 1FNYA 2R041 4NHLA 1MS9A 2VOVA 3AYEA 5FZCA 1NQDA 1O59A 1YQ5A 4GH4B 4QX3A 4CRQA 3NO8A 2G9ZA 4BQ3A 4EYUA 1VBB3 1UU4A 1FYUA 3ALQA 4XZPA 1TMF3 4DY3A 2D3PA 1BMV2 1UO9A 1QJX1 4ES8A 3H8XA 4LT5A 1N47A 2AGSA 4Q0UA 3ZYPA 2WSUA 2F4PA 5CFDC 1LODA 3HD8B 3IMMA 3J8F3 4GXLA 1WW4A 4NHYA 4XXPA 5HCFA 3R6SA 3RRDA 5IAVA 5BV6A 1K5MB 4XQDA 1UIJA 1WLCA 3NV2A 1X9TA 4PF1A 2HWC2 5T52A 4FTBA 4YM2A 1IQDC 1H2MA 5FYBA 5C3QA 1UWWA 1JYVA 3PMEA 3T1LA 4ZONA 3IAPA 1QJEA 2HWE1 3RZHA 1LJ7A 3AVSA 1D4M2 1Y4WA 4I01A 1RUD1 3HWJA 5BNNC 4PIYA 5FPBA 1QGLA 1ZM1A 2W92A 1FOD2 1B35A 4HFSA 4ZXEA 5K8SA 2WZEA 4MGTA 1XXNA 3LOBA 1AXZA 4K1YA 4YPJA 4MLOA 4COYA 1OVPA 1GZWA 4FFIA 1IS6A 2VZPA 1QQP3 4LBQD 4LUMA 3OUIA 1U5XA 4EQVA 1NY71 5DQ0A 1AVBA 4CPBD 3BALA 4DRVA 2B7YA 4HPKB 2XLAA 1QOSA 1W9YA 3QCWA 2W1QA 5FYYA 4QHBA 2Q5TA 1W8FA 5L7OA 1VBB1 4H3WA 2ATFA 3M8LA 3ZM8A 5CYYA 1RB8G 1CX1A 3ZXDA 1PGW1 1YRZA 4LITA 1W6NA 5LA1A 1JZ8A 1H6YA 2WZR2 4LIUA 2VMDA 3PVNA 3VKLA 5IK4A 3Q8BA 1G9CA 4QB6A 3ZDVA 1VAVA 3RYPA 2V72A 1KEXA 4R9BA 2WNUB 4P00B 1G9AA 5JXJA 1GZ9A 1JUIA 4URTA 3VL9A 3DYMA 1N3OA 4MGKE 3NMBA 3AKPA 3ZXAC 2XJUA 2HEWF 4DXRA 4BZ4A 3WG3A 3CZJA 4R4XA 3DPRC 3FL7A 3SEPA 5HCHA 1I3HA 1RXFA 2VVEA 2VZRA 3SC7X 1QJU1 4RN5A 3EMRA 4OHZA 2D5FA 1UYPA 2NMOA 2UYBA 2P3YA 3DKWA 1OURA 3ME2A 4LUKA 3RPQA 4IL7A 4DUXA 1ND3A 1WMFA 3MF9A 4LO6B 3CO2A 4UFIA 3BPZA 5FLIA 3V64A 1VBD1 4JRLA 4DY5A 2JX9A 4TN7A 2XL7A 2E26A 4Q4V3 3WDYA 4IEPA 5ISLA 2B9VA 4EN7B 4K8RB 1JYCA 3CJIC 4HLTA 4IUGA 4PI2A 1TNFA 2QZ3A 4XACA 3IDEA 4RQPC 1XB9A 3R05A 2XGXA 3JD73 5APAA 1NA1C 5A32B 4AZZA 4CE8A 2R30A 3ZFGA 1UX6A 2UWBA 4N53C 2PHDA 1U5IA 4A7ZA 3NRUA 1XC6A 2BP6A 5D21A 3ZSMA 1DGWA 2XQXA 1H30A 4R52A 1F4AA 3POJA 3NAPB 1N1TA 2VCMA 3BVCA 1AYN2 2E7QA 5I0RA 4Q27A 2ZBJA 5CFDA 2YB7A 4IV1A 1BEV2 4CU7A 2JB4A 3T0DA 1WD4A 3VDDB 1F2NA 4L11A 1AYM2 3BIEA 2KA3A 1O4ZA 5E1RA 4GZ9A 1JZ5A 3SMHA 4MGYE 1YQ6A 3AP4A 1MEC2 4KWUA 2WFPA 1ASJ3 2O0OA 3AYAA 5ACA3 5J37A 5JWPA 2R16A 4KWJA 2RVAA 4AGVA 1VBC3 2W1UA 4LPLA 4YW2A 4E9KA 4LNVA 2OX0A 2BGCA 5C3RA 2NP0A 4DIQA 1VP6A 2EXKA 2XMLA 3GF6A 3J7MA 1F8VA 2ADDA 1PM4A 1UY1A 2WLQA 1TEIA 1YJLA 3MLLA 5F7UA 2BDRA 4XZUG 3VZNA 2ZZJA 3WOGA 1H8TB 1LEMA 4GH4C 5F6LB 1ZVFA 3CKHA 1G86A 2W52A 4EN8B 3O1PA 3ACLA 2YUEA 4XJZA 4XQWA 1KFXL 1LTEA 1WW6A 1OH4A 2JDZA 3LZZA 3T1MA 2DBIA 2TBVA 4QPIC 3ZFEC 1C8M1 2RS31 2WABA 4BWOA 1AR92 2JKBA 1GWKA 5A3WA 4LBQB 5JI9A 1BEV1 2P6CA 1UZVA 4EN6B 1DYOA 4QPYA 4E2SA 2BEOA 5LA2A 4LR4A 1LECA 4UWDA 4BQWA 1LGCA 3ZR5A 5AC93 5FZKA 4D94A 1QQP2 4UBHA 1OOPC 4JZRA 1L3JA 4DS0A 2BNOA 1JHJA 2VAUA 4QQ2A 5A7OA 5A3TA 1YFWA 1IPJA 1LNSA 5F5CA 1RUC2 3TNQA 1ZNPA 2YYOA 3ZVXA 1E5SA 4JKKA 4BIFA 2DURA 1AR62 1PM7A 2I07B 1ALYA 1OPOA 2VGDA 4JC1A 1V6MA 2DVFA 2K46A 3MI8A 1C8NA 1AR81 4HSJA 1ENQA 4LXLA 4BXFA 4CEWB 3KGLA 3ZXLA 5FZOB 4PHZA 4Q1PA 1ZRCA 4UW3A 1K45A 4D6RA 2VNOA 4KQ7A 5CAZA 4XFFA 5I93A 5GM0A 4WM7C 4FPJA 3BOWA 3OD4A 3J7LA 1BK0A 4UF0A 1LENA 4QPGC 4Q4X1 1GQGA 2X5IB 4U2AA 5FK8A 2UWCA 4G3YC 5GLWA 3ZN5A 4CXXA 4UFMA 2JWPA 1YC61 4TWTA 4YW7A 1ENXA 1RUG1 3SXWA 5FO9B 2BNNA 2ZX2A 3MV01 1PGSA 4QQPA 1FT9A 3EBRA 1ZRRA 1LOAA 3I59A 4GMP0 3RWNA 1APNA 4N7IA 3Q8FA 4XAEA 5A33A 2GH2A 1HDKA 4CDXC 1ULGA 4QMAA 1FMD3 2C9AA 2Z4FA 1RYYA 2DVBA 1H1IA 3ACGA 4AGGA 1US2A 4ZHNA 4TZDA 3VDDC 4XAAA 4D7TA 4H2AA 5FUPA 3SHRA 4PLMA 1JMUB 4ITCA 3ROUA 5BXXA 4FP3A 1WGPA 2V73A 5CVRA 1NXMA 2VW1A 1H2NA 3KT1A 5LA0A 4IV1C 4XQ4A 5FY9A 4CU8A 2RDNA 2ZS6B 1R093 2VY0A 4Y5TA 4C8DA 2GALA 2HWD1 4M3CE 4RS5A 5FZMA 4BDVB 1LOFC 1W6PB 4YW6A 5J1XA 2DCJA 2WFF3 3OGJA 2QQPA 2QQJA 2B9UA 1NA1B 2RS52 2MEV3 3TYJA 4WVVA 2QQLA 4Y22B 1J1TA 2XUMA 1IPSA 1UCXA 3NKGA 4HMZA 4XYXA 4QKNA 5FRAA 2NN8A 1A78A 1REEA 1W2TA 5FZ6A 5A3PA 1J58A 1QNYA 1MQTC 2UURA 3LEGA 3NNJA 3BN6A 2B5HA 4KG0A 3U37A 4AXOA 5IK5A 1XNTA 2ET7A 3QBQA 3SNMA 3KM5A 1H2KA 3ZN6B 1WCUA 4BPZA 1WKYA 4RHV3 1XPWA 1PZ8A 1OI6A 5FAXA 5ABJC 4NVPA 2VC9A 3I7DA 3ZFEB 2VM9A 4CU6A 1BBT3 1N3PA 1OA3A 4MOAA 1WA6X 1RUI2 3LIGA 1F35A 4BQ5A 4Q4W3 5A1AA 2H0BA 2J7MA 4Y1UA 3PURA 1WBFA 5A3UA 5T5JA 3ZR6A 2XBO2 3AKQA 3HOBA 5GZCA 1HXS1 4JAAA 3GZUC 5IYYA 5JIAA 2ARCA 5BNPC 5CG8A 5FJKA 1ZZ8A 2VMCA 4FOQA 2R49A 3MFAA 3INAA 1BZWA 1BXHA 4V1PA 5FP3A 3PUIA 5FXZA 1GP4A 3ES4A 1JYNA 2Y60A 3LEMA 1VBE3 1OMIA 2Y34A 4AG4A 2K0GA 1GOGA 3J9SA 1VE0A 3KHBA 4Q2FA 3OPWA 4I30A 3ST7A 5I91A 4NOTA 2ZGUA 4JKMA 3NW4A 2XQRA 1NAEA 3DYOA 4KU8A 4RQPB 3H9AA 3UK9A 4J1WA 3NNGA 5FZHA 2CDOA 5EYXA 5IVEA 5D8AA 1OD3A 3GJAA 3ABZA 5GZFA 5HPOA 2C9KA 1SCSA 3AZXA 5FYCA 3ACHA 1S2EA 2P34A 3J7NA 1YFUA 3LE0A 1ZZCA 2HWC1 5GKAC 4AEDC 2IZWA 2VUDA 2X5IA 4K7JA 5I0UA 4D0QA 4DZGA 4HG6B 2ZXQA 4UI9L 1O91A 4W65A 1XNAA 3GZAA 3H0OA 1KJLA 3IDBB 1UY3A 3O14A 4BQXA 4IGOA 4KH9A 4CDWB 3USUB 2RHPA 3GNEA 5LY1A 4P9XA 1UOGA 1W2OA 4OZOA 1AX2A 1OSGA 2OW4A 4LLOA 5DAQA 2VZOA 2W3JA 2RS33 4HVOA 1O8PA 3NAPA 1X33A 4L8QA 1S0IA 1DHKB 4HETA 4XW3A 4BLJA 1CX4A 4CUGA 2W5FA 1ZA4A 4EWEA 3S0MA 3WCRA 3BGAA 4CUCA 4FTEA 1AX0A 4GJZA 4JGYA 5FY4A 4NHXA 1OPMA 2VXJA 2XG3A 3AM2A 3THDA 5A32A 5IUQA 3OY8A 3J8F1 1J1LA 1JODA 4K8FA 2UU8A 4JGZC 4YVSB 4DRRA 3O5SA 4MGZE 1WBLA 1W99A 2RMU3 5FY7A 5TSWA 5C70A 4O9EA 3CMGA 2P4EA 3TOJA 2VUCA 5FPAA 1JZ7A 4NIGA 4PT6A 2W1SA 1BLZA 5LWBA 4YVWA 4O61A 2DU1A 2H0VA 2W39A 3I2JA 4LBNA 4DMIA 4A4AA 1V0AA 2HWD2 2VZQA 1GKBA 4V2WA 3W21A 5KHKA 2YMZA 4META 1LULA 2OVUA 4Z2WA 1Z7S2 2JDMA 4UYBA 4BHPA 1O3QA 5EPAA 5HBAA 1W8NA 3LSEA 4RL7A 3IDAA 3T2OA 5A6ZA 1NT0A 3AJYA 4A41A 2XJPA 3APBA 5BNPB 1BVP1 1DBNA 1LOBA 3R0RA 2W2IA 4ZKTB 2Q8OA 3I49A 2ZX0A 4PDWB 1O8SA 2VTXA 3ZOIA 5ACA2 2VOKA 4NJ4A 3GCWA 4V2VA 2R062 3WQ0A 1OLMA 1AXKA 1DQ4A 1GSLA 4ISQA 4KWKA 3GHNA 4QM9A 3SH3A 3VBFB 1ND3C 4AOCA 4CCDA 1VRBA 5C3SA 5CEHA 2BBVA 4QXKA 4F3JA 5GLUA 4COZA 2P2KA 3E97A 3N36A 2LROA 4HXCA 4W50A 3TWIA 4FBFA 1U0AA 5AFBA 1W9TA 1ZYBA 2EF6A 1H9PA 2HEYF 2FZ1A 1ZBA2 3IWZA 4SBVA 1ND2C 3BB6A 2TNFA 5LB6A 4JCKA 2Y6JA 1STMA 3C7FA 3IIAA 4H7MA 4XMIA 2ZHNA 5GLVA 1JN2P 1ULOA 3T4HB 1CONA 1XE8A 3B7MA 4JTOA 3TB0A 2VQTA 3RJ2X 3VDBA 3E5XA 2SLIA 1VMFA 4IDZA 5FMOL 3IPVB 5JR7B 5CA6A 4C90A 2PAKA 1XSRA 4XILA 1DU3D 4JGZB 4YVSC 1UD1A 5SV5A 2ZJCA 1BKZA 4Y3OA 2R6QA 1HN1A 2H6CA 5FFOC 2MPFA 2DVAA 3RI8A 2FCVA 4Q0PA 1CQ9A 2PXJA 3WF3A 1XJAA 4AHXA 2WAOA 5FR3A 1HB4A 4BJ0A 1HRV3 3C7OA 1UZZA 2WNOA 4YZ4A 5A7NA 4C1XA 2PTMA 3N3HA 2PAMA 2Y33A 1W3XA 5CU1A 3DECA 5DG1A 1YHFA 1W8OA 1SLBA 1B09A 3VBOC 1XYOA 1V6KA 1SPPB 2NM1A 2JG8A 3FHQA 2A6WA 2P3KA 3PUHA 2MHFA 4AF9A 1XSQA 1W05A 4LBOA 1POQA 2WFF1 4BQ1A 2GMMA 2WZPP 2GP3A 2ZGKA 3VV1A 1N1VA 3PUAA 2IXIA 4LBLA 4QB2A 1W8TA 1YQ8A 1HW5A 1V70A 2C26A 4QU2A 3V65A 1FXZA 2VMGA 2LALA 4OHYA 5J3UA 2GC2A 1FNZA 3S7EA 2NLRA 1MEC1 4PQQA 4GALA 4ATEA 2NPIA 2WWJA 3OUHA 5JXIA 2JG9B 1RHI2 3N9PA 1O6UA 1RUE1 3SQOA 2FMYA 2C24A 2EICA 3CNAA 4DUVA 2QQKA 1OOPA 2RM23 1B35C 5LY2A 5C9AC 3CJXA 3N9LA 3TEYA 2A73B 1EP0A 4YVWC 2IC1A 1H8TA 1PX4A 2JDKA 1NE6A 4FPCA 1JI6A 5BPXA 1AUYA 5FV3A 2RS32 4LIVA 3JBG3 4PDWA 4QXCA 1JBCA 1GLHA 2PN5A 2JICA 5FZEA 4CU9A 2ZPXA 2ENRA 3RQ0A 4FAGA 5ANQA 2PQSA 1Y9MA 2V5DA 2Y26A 3I2FA 1XYPA 1S0DA 1CAWB 1XE0A 4AFAA 3ACFA 1GNYA 1POV1 2BWAA 2WA4A 5KHIA 1X50A 4RS5B 5FKCA 3PJYA 4R4ZA 1W3VA 2UY9A 3L9JT 1RUH1 1OXCA 1H1AA 4B4RA 4LULA 4XCBA 1MVEA 2EAAA 4WM7B 5A1FA 4UFJA 1OA2A 4FPGA 4E4DX 4NN0A 1CPNA 3ZIWA 2RDRA 3P5BA 1UOBA 3ES1A 3E6DA 4E8CA 1DGWX 4Q4V2 1SCRA 1ZZ6A 1ZBA3 5JSRA 3B02A 1KXGA 1GANA 1MZ5A 3IKWA 5IW0A 3VD5A 1HXS3 2HWF1 3B01A 2CAVA 3QOPA 1JOBA 3B9IA 3NKTA 1OC1A 4YYOA 4A2UA 1CAVA 1CZSA 1D4M3 1ENRA 1UL9A 2A7AA 3OOXA 4O9GA 2PELA 4YWAA 2DUQA 2HLEA 5CG9A 4CCMA 1PMJX 3OEBA 2IFRA 3OYWB 3PMSA 4AVAA 5T55A 3FBYA 5GZEA 5JMCA 1GYKA 1UYXA 1VMHA 3V0AA 3N7MA 2D6LX 3DPRA 3DF0A 4QT6A 3PIGA 3VD9A 2ZMNA 2VQUA 4ONUA 3KF3A 3D8CA 3ZLIA 1QJU2 2YBPA 1EAH3 1W9FA 3HNBM 2D5HA 1KS4A 3HVDA 5KR7A 4QWNA 2DU0A 1ND3B 1OF3A 3EXUA 2PMWB 1QJY3 1YCIA 3PNAA 2B45X 2FHRA 3VBSC 3M3OA 4AVSA 1NCQC 3WR0A 2C6SA 2W87A 4JDMA 4IXLA 4RQPA 2XKOA 2XXZA 2O14A 1SHWB 3NAPC 3I3DA 4KGGA 3FUQA 4E4SA 4GH4A 1PK6A 1LGBA 5IVVA 2DCKA 2WC2A 3CJIA 1HQLA 1AJKA 1O5UA 4L99A 1I1EA 4Q4Y3 1SBEA 1GBGA 1MS1A 2WYFA 4QPGA 1NCRA 1Y43B 4GA9A 1FMD2 5FZ1A 3N9OA 5GZGA 3V56A 2WT2A 5FY0A 4MO3M 1NYWA 3I4IA 4GJYA 2C4XA 4A3XA 3DYPA 4E4HA 2VCCA 5CFCC 5KHJA 5FZGA 1W2NA 1I9RA 1PO11 4QPWA 1GUIA 2ZEWA 3ZSLA 2IUWA 3I54A 1OOPB 3W5MA 1FAYA 3BTXA 4XBLA 1KFUL 1ODNA 4FO9A 1YO8A 3KCCA 1W6PA 2RG4A 3OJBA 5F8PA 2VZUA 4GQ7A 2XVKA 4X6QB 3S57A 1PVC3 3MGUA 4H55A 1XU1A 2AYHA 3L2HA 2R0FA 1GWMA 4HT1T 4JDOA 4LO8A 5AVPA 1MS8A 3RVHA 4CCLA 2BNMA 5LZ6A 3WP3A 2ZX4A 1ASJ1 3ON7A 3T2QA 1PMHX 3SCHA 2BGPA 4XETA 4GB33 1ENSA 4XJWA 4E27A 4FOYA 4A7KA 3W58A 3WHTA 1FMD1 4OI2A 2JDAA 2YG0A 2YGMA 3WG1A 1R64A 1ULDA 1MZFA 5LBEA 3LA7A 4IEXA 2QVSB 3HIFA 3O0WA 5FO8B 2VUAA 1BMV1 1DQ6A 5HI0A 1QH7A 4P9GA 4Q26A 5IVBA 5H9QA 1VJ2A 4NPMA 3VBSB 5C3PA 3TEZA 4DOUA 4FFFA 3B3QE 4M0HA 4ASKA 3PU8A 4EN0A 3FFZA 3NNFA 1RUF3 5LATA 4HZFA 2OPWA 4Q8KA 1CAUA 4G4FA 3CHXA 3KV5A 4MGIE 3O1TA 4LORA 3O1OA 3MO4A 4IE6A 5CADA 1XBFA 5ABJA 1UZ0A 1PO22 2J22A 1PK6C 3A0KA 3SKVA 4QGMA 3B00A 2WJSA 5B4XA 3VD3A 3KD4A 4QX7A 4OULA 2P17A 2VVFA 5FOBB 2EIDA 4IV3C 4CP9A 4I09A 3MIFA 1K5JA 1R1A1 4LLFA 4PIZA 4PBPA 3F2ZA 2K9ZA 4CDWC 1HRI1 1NQJA 3LD8A 4MXWB 5KC5A 1S2KA 1C3HA 4XF1A 5JMOA 4OMDA 2QDRA 3LFIA 3E6BA 4A45A 4D8MA 4R8HA 2ID4A 3RS6A 4QM8A 3RWKX 2VU9A 3QH6A 5A7SA 1QJU3 5I0SA 2E63A 2FCUA 4GULA 4XJUA 3SCGA 4FXKB 4OQ8A 2XB6C 4TSVA 3B9CA 1RUF1 2ARBA 5EWSA 2XOMA 2HBUA 2E7AA 1AJOA 3TAYA 3KF5A 4IEOA 1HQWA 2CWMA 2YGLA 2J42A 4GD4A 1RINA 3AYCA 2JDNA 3ZFGB 3OTFA 4WM8C 5JPNB 1VRH2 3CJIB 3KT4A 5FZDA 1XNKA 1W28A 4LBQA 4EWDA 5JR2A 2D3SA 4GKYA 4N90A 4RA0A 2JIJA 1K5MC 1CAXB 4Y33A 2WDBA 1VR3A 3C8XA 5FCCA 2MEV1 5C71A 4N9HA 4QDRA 1KDMA 5EJZB 5T5OA 4EJRA 4HN1A 3H7YA 1JOJA 1OKQA 4YVWB 3SISA 4CCJA 2W08A 4MUVA 4NIAA 3KVAA 5KC6A 3EJKA 2C1FA 4IV1B 4LK7A 4Q5OA 4K21A 4DXTA 1BCXA 3BTAA 3K48A 2DCZA 4S2GA 1Y9QA 5EYYA 4CDQB 4ZXKA 4BE3A 5IFTA 1N1SA 2HEVF 2Q0AA 4RHV2 4B7EA 1C8M2 2BVVA 3VUOA 3NJVA 2WZ8A 2QQIA 3S7IA 4KMQA 1RL3A 3O1UA 1DYPA 2SBAA 2I45A 2BUKA 1GMMA 2VL4A 3NJYA 4RS5C 1W03A 1SFYA 2ZEZA 4FOWA 2CAUA 3VL8A 3HEIA 5JZGA 3I2OA 4Q4W2 2ZKNA 1DZRA 1FI2A 2VMIA 2FBEA 2ZGNA 3MIDA 3JD71 4LO4B 1XYNA 2EA7A 2TEPA 3GXUA 4LE4A 4SLIA 5EQUA 3ZKYA 3OBRA 2HYXA 3OGVA 3WUDA 1CZVA 1VALA 2PLV3 5J48A 3U1XA 1IS3A 3WNLA 1RUG3 2RDSA 3USUA 2RM21 3CLPA 4KU7A 1A8DA 1W6OB 1WZXA 2JIGA 3WQ7A 1AR61 2JECA 1CIWA 3J26N 2PHLA 3OCPA 5T3NA 2RS51 5FZLA 5JZGB 2AH2A 4TTGA 2Z42A 5FZ4A 4LOSA 2OIIA 4N7UA 5DG2A 2OQ7A 3WW4A 4W6WA 2B4KA 3USSA 3U4SA 4CYDA 3WF4A 1V6IA 2RS11 3NV1A 4XTMA 4KG8A 4NO4A 2TUNA 3MUZ1 3NWKA 1LHUA 4CUBA 3E1F1 1Q8QA 5EV7A 1Z78A 1NUKA 3LPFA 5C5UA 2BYVE 3LFMA 1KD7A 1ULEA 2CNAA 4K20A 3ZFEA 4DNYA 1L7QA 3ZKUA 4MADA 1HN0A 1GOHA 2ZGLA 2VMEA 5FOJB 1I6XA 2FMDA 1K5MA 1UZYA 1SLIA 4FOVA 2KD7A 2PHXA 1UOJA 3JU9A 4KBZA 1PGL2 1D4M1 4IW3A 3ZPOA 2LS6A 4Z92B 3K3OA 3I59B 3OB8A 3UGFA 3MEPA 4D69A 2EAKA 2A5ZA 4NMIA 1T6BX 1VAMA 2B46X 2D40A 2FDJA 4O7XA 4UW6A 4M01A 4RD7A 2XLGA 4CEWA 1VBE1 4K6BA 2VO5A 3POSA 1W8ZA 3TN91 4AHWA 1HXS2 1YXWA 1COV2 1F15A 3ZMOA 3KV9A 5JIUA 2EXHA 1OLQA 1UY2A 3HNYM 2HWF2 3PIJA 2WLPA 4XABA 1L7LA 1SACA 4AEJA 2IXHA 3VLBB 5A3LA 5E8AA 3O1RA 4PDWC 2WR9A 3JZVA 1J59A 3VN4A 3FZ3A 3W20A 4CTEA 1GNHA 4Z2AA 1PVXA 3OG2A 4FPEA 5FMBA 4CEYA 1ZA7A 5T5PA 1H8TC 2ZOEB 5KXBA 1WCSA 1NCRB 1K42A 2ZTNA 2BRTA 5JUVA 2UY8A 4AAPA 2JXAA 2P3JA 5JAXA 3WF0A 1AR63 3DL3A 2ETEA 2JDYA 4XUQA 3MPPG 5A6XA 5CISA 3JXSA 4J1XA 2EIBA 1JXNA 1NLQA 3E5QA 3MIBA 3PVBB 4LBKA 5DZFA 1QDCA 3POEA 2QBXA 4IEQA 3LCPA 4XIOA 4ASLA 3FMGA 3IZOA 1AF9A 2DUOA 2VNGA 1RHI3 3NNMA 4P08A 5ERLA 1GWLA 1ZRFA 1C5HA 4BK4A 1KS5A 1W6MA 2WNUA 2CGPA 3MIGA 1WCQA 1H2LA 3WSOA 4YW5A 2XH6A 4LKEA 1Y7BA 4D6QA 5HCAA 5K7PA 4MHUA 4QAWA 5FZ8A 1HRI2 3K4AA 4XHXA 1US3A 2XVGA 5L9BA 5FXXA 3N35A 3V0AB 3ZFFB 1V9U1 4KGQA 3IM0A 3NL1A 1OH3A 3A22A 1YI7A 3HN3A 3QD6A 1JYWA 2I74A 1D4VB 2D6PA 2IWGB 1RUH2 1NKGA 5HXMA 4ZY9A 4AHYA 4QGLA 2FDHA 4UFKA 1NZCA 4Y24A 2VOWA 1SLCA 1JZ2A 5C3OA 2Y6LA 4CUAA 3GBWA 2WZR3 2Y8KA 1E57A 3FN9A 4QX5A 2Y6HA 5FQ0A 3OPTA 4QHOA 3U11A 3ETQA 2JG8B 1DQ1A 2D6KA 5IK8A 2D6OX 4Z1VA 1VBA3 2OQ6A 2D97A 1RUJ1 4GMP1 5DXDA 2JDHA 5FYZA 2A6VA 4D7YA 1WWYA 3LA3A 3D82A 3OY8B 2AC1A 1MQTA 4ARXA 1WLWA 3POBA 2JDPA 3B94A 5IVFA 4XJ8A 2W9XA 1DDLA 2GMPA 1MVQA 1L7RA 3WDVA 1H9WA 2XJSA 1GU3A 4HKLA 3RZKA 2VXRA 1JU4A 1RHI1 4LJHA 3PL0A 4IEWA 2XLFA 4PLOA 3EHKA 4TYSA 5DAPA 1UW8A 3P1IA 3VGIA 5F1RA 2ZAAA 1VIWB 5C8CB 4XTPA 3UETA 2QDNA 5T5LA 2KXLA 3PDQA 4EZHA 4QX2A 1HRI3 3POYA 3M3EA 5F2WA 3H3LA 1ZX5A 3B93A 2HWC3 1QXPA 4C1WA 4Z8BA 1NX9A 3IN9A 2WNVC 2QFEA 1HKDA 1QJFA 4IE7A 5K4LA 3R4SA 4YM1A 1LESA 4I0AA 1GV9A 4NHMA 2BZDA 2B39A 3M70A 3U10A 3VZLA 3JD72 2G9FA 3POWA 1KRIA 2HWF3 3NJXA 5LASA 4RGAA 4HOOA 3ZMNA 1EAH1 4IESA 3AMPA 1CGPA 1PO12 1MQTB 2F6BA 5FXVA 5L7OB 3U4XA 4XUOA 1MPXA 1TMF2 4LMFA 3T09A 1MS3A 3BTZA 4CEYC 4XVHA 4HSLA 5A1LA 2G1MA 2EXIA 5AVAA 2ZA9A 1HB2A 3D0JA 4TXWA 3AMQA 5L9RA 1HIXA 1Q8VA 5FQ0B 2B8MA 2WT0A 4FI9A 2EIEA 1S4CA 1TE1B 3IBMA 4FVVA 1CJDA 1RC6A 4P5HA 1LGNA 1SG3A 4BXSV 1ULFA 1QIQA 1COV3 3VB9A 4IQPA 1EY2A 5L7OC 1F9KA 4DXZA 3D3AA 2K2SA 1H0BA 2VBPA 1QH6A 2R061 2WKKA 2WNUC 2D3RA 3MLJA 2O1QA 2ZMKA 1LOEA 5CFCA 2YFZA 4UW4A 2GSYA 3PU3A 4QQLA 3K4ZA 3T2TA 4AQ6A 1QQP1 1P8JA 1AYN3 2XHKA 4OYUA 3VDCA 4XDOA 4A42A 3FJSA 1JYTA 1ND2B 1XE7A 1S0JA 4LE3A 1SZBA 5HV4A 5SV8A 4HANA 1DG6A 3JB4C 4P14A 5FZAA 5IAXA 2VTXJ 4H14A 3I2DA 2JD9A 2WQ4A 3ZYBA 4YNIA 2EALA 2R042 4XJ9A 3THPA 3O7OA 2GC1A 3LEIA 1WCKA 4LK6A 3MPBA 4WVZA 1KQRA 3CEWA 1YIFA 1KGYA 2O8OA 5ANNA 2R072 1OUSA 2ZGTA 3CL1A 3AVRA 1RIRA 2QQNA 3P3PA 4LEJA 5JOYA 3J8F2 3MIEA 1UQXA 1EV11 3NNLA 4DO0A 5K9YA 1BVVA 4N53B 4TLGA 2FDKA 2VECA 5BY5A 4YARA 1Z7S3 1FX5A 4D3WA 1O3SA 5FXWA 3KS7A 5DUXA 1WLDA 5JVVA 1UMZA 1QJY2 1QMJA 3AK0A 1G9DA 1RUI3 5JI7A 1ZRDA 4KWLA 1QJZA 3AXEA 1ACCA 3UL2A 1EPZA 3VKFC 2QKDA 3IDCB 3T0BA 2IXCA 3ZYGA 4B4QA 1DCSA 1OHFA 3ILNA 5FYHA 3MW2A 2AEZA 4AW7A 2WS91 3VKNA 2VCBA 1BYHA 1UKRA 2X29A 1AR91 5FTTC 3NSTA 2J1VA 2BBAA 2LW8A 1VMJA 5LBFA 3WXPA 5A70A 1JZ6A 1LU2A 3BCWA 4HK8A 1X9PA 3W5NA 1YIPA 5AC92 1JYIA 1BBT1 1PIV1 1ULCA 1PX3A 2I2SA 3M3CA 1JZ3A 2A6XA 3PJQA 4XFIA 3A7QA 2R071 4FQZA 1LKNA 2P1BA 1NG0A 2XJVA 1F4HA 3GZTB 3P3NA 5FWEA 1VB2A 1RUE2 4IERA 1H8VA 1VRH3 5C9AB 2WNEA 2CTVA 3OBTA 1GQPA 4QHZA 5DABA 5FP7A 5F3IA 5CB7A 5JLVA 1YUDA 5LBCA 3DGTA 3M1HA 4GWNA 1EUUA 4R9CA 1RVF1 4PQ9A 2WWSA 3OBZA 4LKDA 3LGRA 1JW6A 3I8TA 1S0FA 3CZUA 4O65A 3HJRA 4YGCA 3VBHB 5LEJA 2VUJA 1KITA 1OQDA 5FY5A 1GNZA 4NAOA 5LRSA 4EE2A 4XMAA 4W8JA 4Q0VA 1QU0A 1Q56A 4CXWA 2WL1A 4KI5M 1F31A 4QPGB 5BUVA 4XDQA 1AYM1 2OUHA 1RUI1 1H4HA 1RTVA 2ERFA 4IEZA 5F5AA 3EQEA 3HQXA 5JSOA 3RMXA 3WP4A 5C4WB 2JJ6A 2P37A 3M3IA 3MF6A 4OI4A 3WINE 4B1MA 5CBLA 2GNBA 4AVVA 2V4VA 3AB0A 3OD0A 4RR3B 4YZ3A 1DYKA 4QKBA 2XJTA 2PFWA 1QXRA 2VW2A 4K1ZA 3VBUC 4B1LA 4FTSA 2EVXA 1UY0A 2WSVA 3DKQA 1TME1 2RR12 1ND2A 5DDJ2 1AL0G 5KXDA 1EUTA 4K3UA 3UV9A 1CVNA
chains in the Genus database with same CATH topology
1HQNA 1FPN1 1PZ7A 2RS12 5LRRA 4COUA 5C8CA 4OUMA 1S0EA 1HX6A 2D6MA 4YW4A 2XBO1 3O0VA 2PQQA 2XWBB 2JE7A 4CEWC 3ZYJB 4E2QA 1DGRN 3VHOA 1CN1A 3W59A 4Y20B 1QHDA 1RUE3 1EV12 1O3TA 3AXDA 2E9QA 3BU7A 2D93A 4ATFA 2C0ZA 2ZGQA 4Q4Y2 4JQRA 3ZX7A 5T54A 3LOIA 2QJVA 2OYZA 2AR6A 4XFHA 4Y4YA 2OA2A 4XE9A 5L73A 1CAUB 4I3GA 3VBHA 3TN92 2VPVA 3RSJA 3SITA 4CDUC 1I5ZA 2Z5WA 4BCUA 1NA1A 2YV8A 4XPVA 2D7FA 4FSJA 3LAGA 1NCRC 2WS92 4JV4A 4YM0A 4BMEA 4Y22A 4HL0A 1LHWA 4ISRA 3DV8A 4CDXB 2D98A 3RG0A 2JENA 4Q4X2 3HT2A 1EPWA 3M7AA 2PA7A 2ZGSA 3ZN6A 3KQRA 1WCDJ 4IEVA 4MSVA 3WLUA 1VBD3 3ZSEA 4CEYB 4WZFA 2VW0A 4XBQA 2A70A 2DWRA 4NHKA 4RR3C 3VBUB 2NMNA 4IV3A 4AI0A 3FHIB 1A8MA 1O4YA 3WG2A 1LOFA 2ZX3A 4B7KA 2VG9A 2HYKA 1W6NB 5C8WA 2WS93 2HWE2 3H50A 4AI2A 2Q4SA 1BQPA 2X5IC 2ES3A 1WW5A 3WX5A 1RUF2 1RMU1 1D0HA 1U12A 1ZZ7A 2PYTA 3AKSA 1DZTA 2R1BA 4MH0E 4Y20A 4FAHA 4UW5A 1NY72 1RUD2 2ZMLA 4XF0A 1EAH2 1UU5A 5FLHA 4N53A 1FOD1 2AUYA 2DF7A 2HWB3 4XEZA 2IFWA 4LBJA 3HN1A 1POV3 3LKJA 3TBDA 2YZ4A 1NLSA 2CV6A 4YG6A 3S6PA 1ZBE1 3MW3A 3WDUA 3MZHA 1AXYA 3AMHA 4PCRA 5E16A 1ZZ9A 3JBG1 4YFWA 1J3QA 1RUH3 3PHMA 3TNPB 3WW2A 3FFQA 4JDNA 5EXOA 3VZJA 1MS5A 5FREA 2E7TA 1FPN3 5GALA 3WY6A 1FATA 1IKPA 2XKPA 4YSFA 1DIWA 4M3CB 4PJYA 2YROA 3LA2A 4YW3A 4IV3B 1MEC3 4LHLA 4YFZA 4Q0QA 2A75A 4AI8A 4Q4Y1 2RMU1 2XJRA 3JB8A 1AX1A 3S30A 4AEDB 2XWJB 4LA2A 5J98B 3WD5A 1LHVA 4JRAA 2Y38A 5DUUA 5CIRA 3SH5A 4DFSA 4XXAA 4GIQA 3MDPA 2R043 3UJQA 1JHNA 3N7LA 4AQSA 3AKTA 1IHMA 1QDOA 4OUSA 1FOD3 5KBFA 1AR73 1W6MB 4AFDA 1DQ5A 2GNDA 3FC0A 4WM8B 1AYM3 4S2DA 1MR5A 5GLTA 3E5UA 3VHPA 1RUNA 3RI9A 1OQ1A 3UKTA 4FPLA 4AFMA 2OZ6A 4I3PA 3N7KA 1TME2 2JG9A 5DDJ1 4BH9A 1ASJ2 1XNDA 3OYWA 4Q4X3 4EV0A 2GNTA 4J6GA 1LOCA 4BM8A 1LCLA 2IXKA 2AENA 3FBMA 4RFT0 3AP7A 1XNCA 1WMDA 1S0BA 1YLLA 4FXGB 2VQ0A 2PAEA 2PLV2 4NR1A 2A6ZA 1RITA 3CU7A 3ILRA 3W9AA 1O4TA 4AGRA 4CZSA 4L2NA 4HKOA 4P9YA 4MYEA 1PZ9A 5FO7B 1D2QA 4I02A 2YC0A 5GZDA 1BJQA 1LU1A 1S2BA 2WINB 5KXCA 4FPKA 2PHTA 4HBNA 4XFCA 2Y0IA 2VULA 3FWEA 5D1IA 1W6OA 3ELNA 3R4UA 3VBOA 1X8EA 3Q9OA 4XF3A 2NZ9A 4Y1ZA 4JVAA 4Y1XA 1GZCA 3FLTA 4UBGA 3VBOB 1LOGA 2G9GA 5A33B 3AZWA 5L19A 2X8KA 1Z7S1 4LO5B 2B42B 1CAVB 3GBGA 3KCXA 3NV3A 4COWA 4M00A 4XJAA 2V09A 3IT8A 4W6XA 3R4DB 1WW7A 3WG4A 2BW8A 1WA4A 1VBA1 1J3RA 1RUD3 2V5YA 4MZUA 1RUC1 3D6EA 2HWB2 4ES9A 2BTVC 1PHMA 3GYDA 1VBC1 2MNGA 1QF3A 4KL1A 2DTYA 3RJRA 5EFUA 3UKNA 1W2UA 3VZOA 3OGGA 2R32A 3A0NA 1Y3TA 1QOOA 2HJIA 5C33A 1SFNA 3V0BA 4N43A 2DCTA 3JCIA 4WM8A 4LO7A 4OLLA 3ZPYA 2A6YA 1LHOA 2BPA2 3AP9A 2ZX1A 4B29A 3AP5A 2PHFA 3WP5A 3PLQA 3G7DA 3KGZA 1NCQB 1V6OA 1BBT2 1JUHA 1ZBE2 1TNRA 1X7NA 4FCAA 5JOXA 3ZIXA 1UKGA 2GU9A 1F5FA 2WFF2 4BIOA 4Q4V1 1B35B 4L9BA 4RGGA 1DLLA 3WDWA 3AZZA 3WNXA 3D0SA 1G9BA 1LRHA 2OZJA 2E6VA 2DCYA 5F9TA 1AL21 2XPJA 4OVEA 4OFGA 1G9FA 1QY4A 4AI3A 1Q8PA 1VRH1 2DYCA 3AFGA 1V9U2 1ONAA 5H9SA 4WM7A 4PBOA 3VBSA 3B69A 4R9AA 4AQTA 2HKXA 4AEKA 3JUUA 2BQPA 4C0HA 4CP1A 5JOWA 1UPSA 1LR5A 1PVC2 1YWKA 1R1ZA 4ORFA 4G9SB 4ASMB 5ABJB 3C3VA 5JPMB 1FV3A 4YLZA 1ZBA1 3M4FA 2YDEA 1AL22 3H1WA 4WVWA 3DN7A 4GB32 1PO21 4XF9A 1PNFA 5CFCB 1R082 2PHRA 1IQAA 1R091 4MVTA 3ASIA 4RR3A 4EROA 4P9WA 4YGDA 2CY6A 3H1MA 3TRSB 4AYUA 2YHJA 4E2GA 5BNOA 2JEMA 4AQ2A 5FDBA 2DUPA 4XFAA 5FLJA 2WQZC 1C1LA 4KNCA 4Q1RA 4YGBA 1UIKA 4LA3A 2PHWA 1EV13 1H4GA 1PO13 1S1AA 3RDIA 1RUG2 1V6LA 4WZCA 2HWD3 2ZGRA 1W6QA 4AEMA 3FE5A 2ARXA 4AI1A 3MFCA 4K40A 1C4RA 1V9U3 4LBMA 4M3CA 2GZWA 2ZAHA 4Y1YA 3WHUA 3ZSKA 5I8YA 5IT6A 3RYRA 5K0UC 2XL9A 3X29B 2G4IA 2GAUA 5BNNA 1QNWA 5JSPA 2BFUS 2LTNA 4LHNA 5D8AB 1VBB2 1RVF3 3RNSA 4U36A 2Q30A 1O3RA 1REFA 3HBZA 5H9RA 3KMHA 1TMF1 2Z79A 2VH9A 4AE2A 4YZ1A 2GC3A 2WT1A 2OPKA 2QUOA 4WV8A 1ZBE3 1AR83 5F6KA 5FMOS 5JCTA 2N7GA 3ENRA 3WW3A 1UAIA 2BFUL 2DTWA 4Q0SA 2DV9A 2VQAA 2W0XA 4JTNA 2EIGA 4FP2A 2YXSA 4CP0A 3RYKA 5C8CC 3LB9A 3N7JA 5DZGA 1PMIA 1D2SA 1RJ8A 5JZGB 4BOWA 4C91A 2IXJA 4QGNA 3VDDA 1VAKA 2DVGA 1SBFA 3ECQA 2D6NA 1PIV2 4Q8LA 1CAWA 2RE9A 3ZO0B 5AC91 1M4WA 1MACA 2GC0A 3DUIA 2RM22 3U0ZA 4R9DA 5KWRA 5DUWA 2CL2A 4ZU7A 1OFNA 1PNGA 2E51A 3ILFA 1BEV3 4HK9A 3AYDA 1SBDA 1KJRA 3JBG2 3NV4A 4L92A 1J3PA 1A6CA 3KB5A 3UKVA 4XFGA 3IPVA 4PF5A 2O8QA 1HV0A 3A4UA 1XRUA 4MX3A 1V6NA 5C6CA 5J7MA 1VB4A 3KSCA 4N43B 1Q5OA 1Q8SA 3ZFFC 3BODA 5J96B 4YGEA 3QLQA 3NJZA 3ZXEA 1IS4A 1RUOA 4QPIA 4NWVA 2YPJA 1N1YA 1REDA 1SLTA 5K0UB 1IOAA 2QCSB 1YJKA 3KT7A 3VBUA 1GR3A 3MW4A 4IEUA 5C9AA 4Z07A 1HRV2 2RR11 3G6JB 2R0HA 3RRDA 4N9IA 1AYN1 3FLPA 3ZXFA 4INDA 5FPZA 1IGOA 2VOXA 1A3KA 2YY1A 2JD4A 2KM2A 4PLNA 3D4KA 4YZ2A 4UXAA 5JZGC 2ZGPA 3GBFA 3VKOA 4AK3A 1COV1 2ZHLA 3VBFA 4LHKA 3SLIA 3AP6A 1R1A2 5J09A 1URXA 1RUC3 4TLFA 4RSUA 5BYNA 4XIKA 5BNQA 3DPRB 4P9JA 1V00A 3OPZA 4WVMB 1DF0A 1S0GA 3VZMA 1AHSA 2DVDA 2RR13 2QZ2A 4Y1VA 3FLRA 1SMVA 2WIIB 4DPNA 4W6YA 1G7YA 3VZKA 4L97A 2GDFA 2ILMA 4FQ4A 5J36A 3WP6A 3WV6A 4S2FA 4FPOB 4JGZA 4WBBA 1DGRA 3ZFFA 1GZWB 2UYAA 3L2YA 4AVBA 1GQHA 2A3YA 4Z82A 3VBRA 4JGYC 4HKWA 2BVBA 1QXJA 1RMU3 1PGL1 3MICA 5GLZA 4YM3A 1PIV3 1G8WA 4KBBA 5KXEA 1NE4A 2NQYA 2VVDA 5C4WA 2Q1MA 1YI9A 1PGW2 1RJ7A 3RMYA 1QJY1 5JDBA 1UPIA 2GH8A 4LTAA 5I8TA 5HCBA 1HV1A 4M0NA 1FPN2 4F8AA 2Q1ZB 3E6CC 5LK5A 2DFBA 3MLKA 1MS0A 3OF1A 2EXJA 2WNVA 2VNRA 1AR82 5HXVA 3FUOA 4PIXA 2ZGOA 3TN93 1R1A3 1GFF2 4RHV1 5D8AC 1RMU2 1CR7A 3ATGA 4GWMA 5EZWA 2AREA 1AR71 4A7YA 1AR93 1C8M3 2JG8C 5LK7B 4Q4W1 2A71A 5AFEA 2ET1A 4EWAA 2RJKA 1NCQA 2RS53 1OLRA 4IEYA 1QKQA 1VLNA 4Y26A 3ZDSA 4YZ5A 4DB5A 4P9IA 2WA3A 5E89A 4YW1A 5BNOB 4HN0A 1VBD2 4P9LA 1C5IA 5GJ6A 2PLV1 1PVC1 2NYYA 2BWCA 1YNAA 1C57A 3AMMA 1WLTA 4CDWA 1FV2A 1PK6B 2HWE3 5A3MA 5IK7A 1YYNA 5F5QA 1IKQA 1S55A 2D43A 5ACA1 4X6RB 4GB31 5CNAA 4JGYB 1TME3 1SDWA 3VHNA 3M3QA 4OZXA 3VHRA 4X8PA 5FPXA 3AMNA 2GN3A 1SQ4A 2XBO3 2A3XA 2D44A 2R063 3AJZA 3WQ1A 3ZXKA 4CDQC 3HR9A 2GNMA 3LWCA 2JE9A 2WNVB 5CFDB 1IZ3A 5DZEA 3ZXJA 1CJPA 3MYXA 1X8MA 1JTZX 3H1YA 1NLRA 3KLSA 3H3ZA 4Q29A 1O7FA 4EN9B 1OD5A 1QJX3 2XVLA 1OQEA 4F7ZA 3WDXA 1HLCA 1MZEA 5BNNB 1IS5A 2CGOA 3M2MA 1GICA 1PO23 1LEDA 3VBRB 3ZFGC 3KCYA 2DFCA 1Z0HA 4OI1A 1Q43A 5BNOC 4F83A 1EYBA 2HWB1 1ZREA 3WDTA 1C1FA 1CESA 4AWDA 3U07A 4H7LA 4MXVA 1W6QB 2FZ2A 1MZ6A 3URFA 4AVCA 2GMEA 4XBNA 3HMYA 5JOZA 5I0TA 4COVA 4X8NA 1HRV1 3PVOA 4DQAA 1M06G 3V0BB 3AZVA 4OHXA 3WCSA 3ZSJA 1QWRA 4GKXA 1YFYA 5BNPA 4AHZA 4CDQA 1CD3G 4YG3A 2C5DA 2LM3A 2VMHA 2FQPA 1AR72 1AL23 1NOVA 4QPIB 1Q8OA 3ZXGA 1DQ0A 1DQ2A 2QNKA 5K0UA 4CP2A 3CF6E 1DZQA 1R083 2AZ5A 3AFKA 3GHMA 1UN1A 3EO6A 2H6BA 2ZZQA 4Y5Z0 1MS4A 4IETA 3H7JA 4AVTA 3H8UA 5EJ3A 4GMP3 3QH7A 1WD3A 3BOPA 3ZN4A 4AEDA 4I0WB 3BIWE 2ZCWA 1O5LA 4XF4A 2RS13 1RGSA 3ZYRA 3N4MA 2UWAA 2WZR1 1W39A 1Q3EA 3VBHC 4EWEA 4FT8A 4OHWA 4CDUA 4BLIA 3MIHA 1C28A 3QACA 1VBE2 4NWWA 4B3NA 4MV2A 5H9PA 3K51A 3WVJA 4OHVA 1G6NA 1CAXA 1VBA2 3AZYA 1WMEA 1RUJ3 3KZ4C 2GN7A 5T50A 2ZABA 4XFBA 1SEFA 1VBC2 2ZHKA 4I0BA 4QD2A 5FBZA 2ZKLA 3WUCA 5KHHA 2ZHMA 4D7SA 4DINB 2A3WA 2E53A 1NXD1 3C2UA 1U5YA 2X53S 3VBFC 1LB2A 4E4ZA 1CPMA 1RVF2 4QQHA 1T6GC 3VKMA 3D5OA 3WZ1A 3JQWA 1V6JA 1POV0 4BMBA 1D0GA 1AZDA 3IMNA 2P3IA 4FPYA 2RJLA 3HAGA 3J4UH 5DUVA 2Z69A 4I2OA 2OUJA 4AFBA 2Y0OA 1JH5A 1R092 4XOGA 4BA6A 1R081 3RZZA 3AX4A 1LHNA 1WUVA 4NPRA 4MXWA 4C0BA 1SLLA 3PTYA 2MEV2 2LUWA 4WVMA 1XQNA 2RMU2 4YG0A 1IPKA 4AFCA 2ZACA 5KHGA 1YFXA 2XJQA 2ZGMA 3VBRC 5E88A 1F5JA 5C4WC 4XHBA 3NVCA 1DFQA 1W0OA 4K9SA 4B4PA 3B5LB 3WT3A 1H1MA 3LSDA 5B2GB 2CYFA 2Z2SB 4CDUB 3O12A 3UJOA 1X36A 2QE3A 1RUJ2 3SCFA 1ZZBA 3O0XA 3WW1A 1QJX2 3PVEA 3SH4A 5L36A 3AKRA 1S0CA 3JQXA 4YVSA 2CGNA 3FX3A 4CDXA 1TQ5A 1W0PA 1DGLA 1N3QA 4QQOA 4OI0A 3GALA 4HVQA 5I8SA 3THTA 1XNBA 4FPHA 5DDJ3 2R073 2W68A 4ZU4A 1U5ZA 1UF2C 3H3UA 3ZYIB 3HT1A 2CWSA 1QOTA 1OFSA 4HPKA 4M3CF 4ZU5A 1SLAA 2R1DA 4B8EA 4BYYA 4N43C 4HVRA 1XU2A 1KDKA 1UU6A 2IXLA 4FPFA 2JG9C 1OA4A 4S2HA 5LEKA 4YRDA 2PHUA 1X82A 1BK1A 2R041 1FNYA 4NHLA 1MS9A 2VOVA 3AYEA 1NQDA 4CRQA 4GH4B 3NO8A 1VBB3 3ALQA 1UU4A 1FYUA 4XZPA 1TMF3 4DY3A 2D3PA 1BMV2 4ES8A 1QJX1 4LT5A 1N47A 2AGSA 4Q0UA 3ZYPA 2WSUA 2F4PA 5CFDC 1LODA 3HD8B 3J8F3 4GXLA 4XXPA 1WW4A 5HCFA 5BV6A 3R6SA 1K5MB 4XQDA 1UIJA 1WLCA 3NV2A 4FTBA 2HWC2 5T52A 4YM2A 1H2MA 3PMEA 3T1LA 2HWE1 1LJ7A 1D4M2 4I01A 1RUD1 3HWJA 5BNNC 4PIYA 1QGLA 1ZM1A 1FOD2 1B35A 4HFSA 5K8SA 1XXNA 3LOBA 1AXZA 4K1YA 4MLOA 4COYA 1GZWA 1IS6A 1QQP3 4LBQD 4LUMA 1U5XA 1NY71 1AVBA 3BALA 4DRVA 2B7YA 4HPKB 2XLAA 1QOSA 3QCWA 4QHBA 2Q5TA 5L7OA 1VBB1 4H3WA 2ATFA 3M8LA 1RB8G 3ZXDA 1PGW1 1YRZA 1W6NA 2WZR2 3VKLA 3PVNA 5IK4A 1G9CA 1VAVA 3RYPA 1G9AA 4R9BA 2WNUB 1GZ9A 1JUIA 4URTA 3VL9A 1N3OA 4MGKE 3AKPA 3ZXAC 2XJUA 2HEWF 4BZ4A 3WG3A 4R4XA 3DPRC 1I3HA 2VVEA 1QJU1 4OHZA 2D5FA 2NMOA 2UYBA 3ME2A 4LUKA 3DKWA 3RPQA 4IL7A 1ND3A 1WMFA 3MF9A 4LO6B 3CO2A 5FLIA 3BPZA 3V64A 1VBD1 4JRLA 4DY5A 2JX9A 2XL7A 4Q4V3 3WDYA 4IEPA 4EN7B 1JYCA 3CJIC 4HLTA 1TNFA 2QZ3A 3IDEA 4RQPC 3R05A 2XGXA 3JD73 1NA1C 5A32B 2R30A 3ZFGA 1UX6A 2UWBA 4N53C 2PHDA 1U5IA 4A7ZA 3ZSMA 1DGWA 1H30A 4R52A 3NAPB 1N1TA 1AYN2 2E7QA 5I0RA 4Q27A 2ZBJA 5CFDA 4IV1A 1BEV2 1WD4A 3VDDB 1F2NA 4L11A 1AYM2 2KA3A 1O4ZA 5E1RA 3SMHA 4MGYE 3AP4A 1MEC2 2WFPA 1ASJ3 2O0OA 3AYAA 5ACA3 5J37A 5JWPA 2R16A 4KWJA 4AGVA 4E9KA 1VBC3 4YW2A 4LNVA 2BGCA 2NP0A 1VP6A 2EXKA 3GF6A 1F8VA 2WLQA 3MLLA 1TEIA 1YJLA 3VZNA 2ZZJA 3WOGA 1H8TB 1LEMA 4GH4C 5F6LB 1ZVFA 1G86A 2W52A 4EN8B 3ACLA 2YUEA 4XJZA 4XQWA 1KFXL 1LTEA 1WW6A 2JDZA 3LZZA 3T1MA 4QPIC 2TBVA 3ZFEC 1C8M1 2RS31 4BWOA 1AR92 2JKBA 5JI9A 4LBQB 1BEV1 4EN6B 4QPYA 4E2SA 2BEOA 4LR4A 1LECA 1LGCA 5AC93 4D94A 1QQP2 4UBHA 1OOPC 1L3JA 4DS0A 2BNOA 4QQ2A 1YFWA 1IPJA 1RUC2 3TNQA 1ZNPA 2YYOA 3ZVXA 4BIFA 2DURA 1AR62 1PM7A 2I07B 1ALYA 1OPOA 2VGDA 4JC1A 1V6MA 2DVFA 3MI8A 1C8NA 1AR81 4HSJA 1ENQA 4CEWB 3KGLA 3ZXLA 4Q1PA 1ZRCA 4UW3A 2VNOA 4KQ7A 5CAZA 4XFFA 5I93A 5GM0A 4WM7C 4FPJA 3BOWA 3OD4A 1LENA 4QPGC 4Q4X1 1GQGA 2X5IB 4U2AA 2UWCA 4G3YC 5GLWA 3ZN5A 4TWTA 1ENXA 1RUG1 3SXWA 5FO9B 2ZX2A 2BNNA 4QQPA 1PGSA 1FT9A 3EBRA 1ZRRA 1LOAA 3I59A 4GMP0 3RWNA 1APNA 4N7IA 5A33A 2GH2A 1HDKA 4CDXC 1ULGA 4QMAA 1FMD3 2C9AA 4AGGA 2DVBA 1H1IA 4TZDA 3VDDC 4D7TA 3SHRA 4PLMA 4ITCA 3ROUA 5BXXA 4FP3A 1WGPA 2V73A 5CVRA 1NXMA 2VW1A 1H2NA 3KT1A 4IV1C 4XQ4A 2ZS6B 1R093