1WLTA

Crystal structure of dtdp-4-dehydrorhamnose 3,5-epimerase homologue from sulfolobus tokodaii
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
176
structure length
176
Chain Sequence
b'MPFEFENLGMGIILIKPKVFPDKRGFFLEVFKSEDFTKMRIPNVIQTNMSFSRKGVVRGLHYQRTPKEQGKIIFVPKGRILDVAVDVRKSSPTFGKYVKAELNEENHYMLWIPPGFAHGFQALEDSIVIYFITHNEYSPPHERCISYSYIDWPIKEVIISDKDLQCPSLEKAEVFD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 176aa long hypothetical dTDP-4-dehydrorhamnose 3,5-epimerase
publication title Crystal Structure of dTDP-4-dehydrorhamnose 3,5-epimerase homologue
rcsb
source organism Sulfolobus tokodaii
molecule tags Isomerase
total genus 38
structure length 176
sequence length 176
chains with identical sequence B
ec nomenclature ec 5.1.3.13: dTDP-4-dehydrorhamnose 3,5-epimerase.
pdb deposition date 2004-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00908 dTDP_sugar_isom dTDP-4-dehydrorhamnose 3,5-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1wltA00
5FQ0A 4MGYE 3NW4A 4XFIA 2OA2A 1U12A 2Q1ZB 1Y9QA 2Q0AA 3CO2A 1QXJA 2IXIA 3DKWA 2GC0A 3KGLA 5CADA 5C6CA 4Q0QA 4R52A 3CLPA 3O14A 1SFNA 1ZX5A 4I09A 2MPFA 1PM7A 3FE5A 3ES1A 2N7GA 2GZWA 1G6NA 1FT9A 1I5ZA 2ATFA 3FHIB 4QX5A 5F1RA 2H0VA 3L2HA 3ES4A 5BPXA 1H1MA 2PAMA 2CAUA 1YFYA 3E5XA 5FLJA 1VP6A 3D0JA 4KWLA 1ZRCA 1V70A 2ET1A 2ZCWA 1J1LA 2XLAA 3U11A 1RUOA 3NSTA 1RGSA 3PLQA 2B5HA 3BCWA 3U10A 5KHIA 4I0AA 1L3JA 2PHLA 2IXLA 2HKXA 4HZFA 4N9HA 1ZNPA 5I8TA 2QCSB 3IIAA 3H50A 4EROA 2KXLA 1OD5A 4KL1A 2VECA 5D1IA 2OYZA 3CJXA 5J3UA 3G7DA 4KWJA 3PNAA 3N4MA 2K0GA 3KCCA 5FCCA 5J48A 2BYVE 4UXAA 2QNKA 2OZJA 4FBFA 3DV8A 1QY4A 2IXKA 1YLLA 3FFQA 5E16A 2UY9A 4IEOA 1NE4A 4LLOA 1DZRA 2XLGA 2E9QA 1O7FA 3JZVA 1ZRRA 1LR5A 3M3IA 2XGXA 4OFGA 3RNSA 1ZRDA 3SHRA 3KSCA 2B9UA 3FJSA 5CVRA 4LA3A 3QACA 4PIYA 3HT1A 2I45A 4E2GA 2D5FA 4HLTA 3USSA 4A2UA 4XF1A 5E1RA 3OGJA 5CU1A 3DN7A 2GH2A 5JSPA 5KHJA 1EPZA 4HVQA 1SQ4A 4IEQA 3RYRA 4RD7A 1CAUA 2H6CA 5T3NA 5LEJA 4WZCA 4AVCA 2C0ZA 1X7NA 2MNGA 2QVSB 1DZTA 5KHHA 1O5LA 4I2OA 3LOIA 2OZ6A 4LEJA 4PIZA 2K9ZA 2V09A 1WLTA 4BH9A 4MGZE 4KWKA 4BHPA 5EFUA 2VPVA 4HVOA 5I8SA 1QWRA 3I54A 1RUNA 5J7MA 3CF6E 4ONUA 4EWEA 4OLLA 1CAXA 1GQGA 4GULA 1NXMA 2BNNA 3HT2A 3ST7A 3MZHA 4IEPA 5I0UA 2BGCA 3TNPB 2UY8A 1O4TA 4JTNA 4KU7A 3E5QA 1EYBA 2XL9A 2ZKLA 5FLIA 1YFWA 4XF4A 2BNMA 5BXXA 3KMHA 4AVAA 4B29A 4HN1A 4YSFA 4CYDA 1Q3EA 2IXHA 3I59A 3S7IA 3BU7A 3IDCB 4HSJA 3R6SA 2PAKA 4HVRA 5FPZA 1YFXA 2FQPA 4QGNA 5JR7B 3SCGA 3HIFA 2FMYA 4N9IA 4XF3A 3TNQA 1NZCA 4MZUA 5AVPA 1ZREA 4D7SA 1CAWA 3LZZA 4EWAA 3E6DA 5FDBA 1J58A 1IPKA 5FPXA 5FLHA 2CV6A 3NKTA 3BALA 4EWDA 5I93A 4AVBA 1RTVA 2PQQA 1X8MA 3SXWA 4IEYA 3E5UA 2OPKA 1CX4A 1O3TA 4XF0A 4YARA 2DCTA 4F7ZA 4HSLA 3UKVA 1WA4A 1UPIA 3FX3A 4H7LA 3ROUA 1OMIA 4MV2A 1UIKA 4XFCA 1DGWA 3I7DA 1TQ5A 1ZRFA 4XEZA 4L2NA 4Q0UA 4XFFA 4XFGA 4MX3A 1ZZ8A 5JSRA 2PHDA 1EY2A 1X82A 3H3UA 3LAGA 2GC1A 4O9EA 2D93A 3H1YA 3H1WA 1DGRA 1YHFA 2O1QA 1VJ2A 2P17A 4YYOA 2D40A 5I8YA 1O3QA 2EA7A 2BEOA 4J1XA 4LA2A 4HMZA 2IC1A 4DINB 1VR3A 3HQXA 1UIJA 2HJIA 3MPBA 4L11A 3LA3A 4MH0E 3LA2A 3ETQA 3EJKA 3ELNA 2XKOA 2EVXA 1YFUA 4IEZA 4Q29A 1UD1A 1PMIA 1H1IA 1NYWA 1ZVFA 4MGIE 2CAVA 2IXJA 2QJVA 4YRDA 1XE8A 3E97A 3EQEA 1WGPA 2WC2A 3M70A 3GYDA 1LKNA 1QXRA 3RYPA 3RYKA 4R8HA 2ETEA 5KHGA 5LEKA 2PA7A 2GC3A 2Q4SA 3WW2A 4JVAA 5LRRA 4IEWA 1Q43A 4O9GA 5EZWA 3IWZA 4LULA 1GQHA 3NJZA 3PVBB 4I02A 4QM9A 2D5HA 5BV6A 2GU9A 4JTOA 5K8SA 3MDPA 3IBMA 3S7EA 4X6RB 4XETA 5BUVA 4KU8A 4X6QB 5I0SA 1ZZ7A 1CAUB 1CAVB 5JCTA 1UW8A 2GC2A 3CL1A 5I0TA 1RC6A 2VQAA 4PJYA 2XHKA 5JSOA 1J3RA 2PYTA 3UKTA 3VHRA 3BPZA 2XL7A 4E2QA 3LA7A 3BB6A 4XF9A 5BY5A 4IERA 4K8FA 4MGKE 4NVPA 3D82A 1J59A 4Z82A 2PTMA 2Y0OA 5JAXA 2GAUA 3H7JA 2PFWA 3OCPA 5FQ0B 1CAXB 5I91A 2Z2SB 3WW3A 4ZU7A 3ZDSA 1X8EA 5KHKA 4WVZA 4Z07A 3H8UA 4IESA 1Q5OA 4YNIA 1ZZBA 2XKPA 3SMHA 4TLFA 4AQ6A 3NL1A 2BNOA 4ZU5A 4FT8A 3H3ZA 3RZZA 3WW1A 4D7TA 4PIXA 4UBGA 3OD0A 3CEWA 2IXCA 4Q0PA 1YWKA 4Q0SA 3I59B 1CGPA 4P9GA 4HBNA 3E6CC 4FAHA 2Z69A 2B8MA 1Y3TA 5KBFA 1O3RA 4AQ2A 4Q0VA 3GBFA 4IEVA 4F8AA 3LWCA 4LUKA 4QMAA 1FI2A 4J1WA 2Q30A 3RDIA 1JUHA 4JV4A 2MHFA 3KGZA 1NE6A 3U0ZA 5LRSA 1I6XA 4AXOA 4E2SA 1OI6A 3EO6A 1O5UA 3H1MA 4I01A 1CAWB 3EBRA 1ZZ9A 3WW4A 1XRUA 2UYBA 3OTFA 2ET7A 2H6BA 3S0MA 2F4PA 1EP0A 3H7YA 2EAAA 1J3QA 1XE7A 4ZU4A 1RL3A 3MYXA 2XLFA 5C8WA 3SCHA 1LB2A 3DL3A 1OFNA 2PAEA 5I0RA 2CGPA 4BIFA 1J3PA 2O8QA 3E6BA 1IPJA 3QOPA 4HN0A 4MUVA 1HW5A 4LUMA 1LRHA 4IEUA 4BYYA 3ACLA 4QM8A 1SEFA 3EHKA 4XFBA 1UCXA 4IEXA 3NVCA 2QDRA 3RPQA 4XFHA 1CAVA 3FZ3A 3B02A 4I0BA 1ZZCA 3D0SA 4QGMA 4QXKA 4META 3OF1A 1YUDA 3UKNA 2WFPA 1FXZA 3H9AA 4FAGA 3IDBB 4LTAA 4IETA 4WBBA 4I3PA 3C3VA 3SCFA 5HI0A 1ZZ6A 3FWEA 4ORFA 1O3SA 4XFAA 4UBHA 2UYAA 4QGLA 4EV0A
chains in the Genus database with same CATH superfamily
5FQ0A 3J7MA 4BCUA 4OHZA 1FAYA 2BP6A 5FO7B 4CDUB 5JR2A 1W3XA 5FXVA 4TWTA 2Q0AA 4LOTA 1TMF1 4LO6B 3OGGA 1C5HA 1U5IA 1UPSA 4PDWC 1NOVA 3VD5A 4R9CA 3BUCA 4Q0QA 1PNFA 1SDWA 2NLRA 1LHVA 4NJ4A 1UYXA 1SFNA 2DV9A 3O14A 4I09A 2MPFA 2ENRA 4E8CA 1PM7A 1D0GA 1US3A 2ZGQA 2W87A 3ES1A 5T55A 2VG9A 4AFMA 4BLIA 4KWUA 5A3WA 5JDBA 4A44A 3ZKYA 1FT9A 1I5ZA 4GJYA 2VNOA 5F1RA 4N43B 3VN4A 5KC6A 3L2HA 4W6YA 3MIGA 2ADEA 1FPN2 2EIDA 4XC9A 1LECA 4M01A 5BPXA 1YQ8A 2OVUA 2Q8DA 4QQ2A 2VUAA 4QHOA 2CAUA 1YFYA 4H55A 3S30A 3LEKA 3O1SA 3SC7X 4HPKA 1ZRCA 1UMHA 2XBO2 4BK4A 3U14A 5LBFA 2JDYA 5JIUA 3OY8B 1BEV2 5E88A 4KMQA 3WF3A 4FTEA 2WN3A 1UZZA 1CPMA 1VRH3 4LORA 3UL2A 5A3MA 5CBLA 4C0HA 3RWNA 3U11A 3ZMNA 4BQ2A 2W1UA 5IAXA 5LY1A 4Y26A 1WCSA 3BTAA 4JRLA 4DUVA 4XABA 3AJZA 1WW7A 3ZO0B 2HYKA 4QKDA 3NJYA 5E6HA 5IWFA 3T08A 2YPJA 2PLV1 3AKSA 3GCXA 4HK8A 5FZBA 4DPNA 4YW5A 5JZGA 2VMDA 4M3CE 1XU2A 4EROA 3IIAA 4CCNA 3ZFGB 1PK6B 3LKJA 2DBIA 1JOBA 2NN8A 2Y33A 3K48A 3JQWA 3PUAA 2A6WA 2R073 5D1IA 3CJXA 3NV4A 3G7DA 1QDOA 3P6BA 1HB2A 5IHRA 1W06A 1C8M1 1F2NA 2BYVE 3FFZA 4IV1C 1WLWA 3AP4A 1W99A 2YGLA 4PF1A 1Q8QA 5F39A 3VHNA 2BFUL 3I3MA 4D94A 1VBC2 3G6JB 5BNPB 1OVSA 1YLLA 2J1VA 1LHOA 4AEKA 4YW4A 1W6MA 1C4RA 1X36A 2E51A 5E16A 1ND2B 4LLOA 4ES8A 2A70A 2Z79A 4ZZ8A 3V65A 3TEWA 4CTEA 1F4AA 3JZVA 5DAVA 3PMEA 1C8NA 1N3OA 5FUPA 1DGLA 1R082 1W8NA 2HWE3 1TMF3 3RZLA 1WW5A 1YIFA 4OFGA 1RUI3 2Y8KA 5FAXA 3KQ4B 3KSCA 3FJSA 1IHMA 3PDQA 4LA3A 2ZGRA 3WEZA 4YW1A 3A7QA 1BYHA 1QU0A 1KITA 2VD7A 3T0DA 3QH7A 2D5FA 4WZFA 4BJ0A 4XCAA 3KCYA 4CDUA 5FZCA 4Q4W2 2IFRA 1IZ3A 1O6UA 1CZSA 1NA1B 3UESA 3VL8A 3PMSA 1QQP2 2ZHMA 3MEPA 3ZOIA 5JSPA 2VMCA 1WMEA 1SQ4A 2EICA 1W3VA 1MEC3 4RHV3 1CAUA 1SLLA 1JU4A 1OLRA 4NIIA 2H6CA 5A6ZA 5DMYA 2RDNA 2BFUS 4XJUA 2ZAAA 4V2VA 1HQNA 5KXCA 3AL5A 5EYYA 1X7NA 4RN5A 2FDKA 2W92A 2FBEA 3BODA 4CEWA 1JS9A 1DZTA 2E33A 5FZMA 3MGUA 5CIRA 4EJRA 4KWKA 4CEYA 2ZMKA 4BHPA 4CZSA 2VPVA 3H8XA 3N9LA 3NKGA 1OUXA 1MVEA 4O7XA 3WX5A 5EJZB 1QWRA 2JG9C 3I54A 2ARBA 2I74A 1RUNA 4COZA 5AVAA 4A3ZA 4RFRB 4BA6A 3CF6E 4ONUA 1HRI2 1W8WA 2ZX0A 4OLLA 1NCQB 3HMYA 2YC4A 3TOJA 2BNNA 4A6SA 4FPYA 4QB1A 1H0BA 3HT2A 1SZBA 1VRBA 2BGCA 2VZOA 4CCJA 3R4SA 5GJ6A 3WUCA 1VMJA 3O1RA 1Y9MA 1C8M3 3N9OA 1H1AA 1BCXA 2XPJA 3VB9A 5LCWL 2WZR1 2XOMA 1C5IA 2CDOA 4KU7A 2ZEWA 4FQZA 1EYBA 3PTYA 5FLIA 2JJ6A 1YFWA 4QX1A 5C4WC 5FWJA 4AVAA 2A6XA 1BK0A 1GP6A 1CQ9A 1G9AA 2J22A 2HWB2 4JQRA 1WD4A 3NAPC 2JB4A 4OHYA 2A3XA 4QXCA 3R6SA 3MFCA 5A1AA 5EV7A 2PAKA 3CJIA 5DAXA 3ZSJA 1SCRA 4FOWA 3U1XA 2PHUA 4MOAA 1DG6A 1YFXA 1GSLA 1OPOA 2RVAA 4O61A 2IWGB 5BNPA 1IQDC 5JR7B 3SCGA 4A7ZA 5DDJ2 4I0WB 5FZLA 3WF0A 4EZ4A 1Y9GA 3WQ7A 1NZCA 5F2WA 5AVPA 2RHPA 1GBGA 2X10A 5DG1A 4YZ3A 4ZKTB 1H8TC 1W8TA 3WP5A 3AK0A 2GNMA 4EWAA 3E6DA 5F3EA 2WAOA 1R1A1 1HB1A 4QKBA 1J58A 2A6YA 1DYOA 1D4VB 2JXAA 3HQRA 4NR1A 2CV6A 4NRMA 2F17A 5CKQA 4LKFA 5GZCA 5I93A 5CKMA 3I3EA 3T1MA 1F15A 4AVBA 4CUGA 2PQQA 5C3OA 1JW6A 1MS1A 5JPMB 1WW4A 5HCAA 2QQPA 3J8F1 1AUYA 2VNGA 3RI8A 3O1TA 1GWMA 4YPJA 5C8CB 4LBKA 1MS0A 4XF0A 3MW3A 4YGBA 2DCTA 3I2IA 1SHWB 4AI8A 4FPLA 2W08A 2D43A 4F83A 2VGDA 1JTZX 3O1OA 5A7WB 4HANA 2I07B 3NWKA 2HWD1 4PQ9A 3ROUA 2G9FA 3D8CA 5ABJB 3WZ1A 1RVF1 3AZWA 2OUJA 2W47A 2JDHA 1NLQA 5FPVA 2V5DA 2LW8A 3V0BB 1W2UA 2LS6A 4IE6A 2Y60A 4XFGA 2P3YA 3W58A 2OX0A 5FZFA 3I2HA 1EY2A 3NJVA 1S2KA 1WBLA 3UETA 4B3NA 1MS5A 3J9SA 3CU7A 3WOGA 1NAEA 2IUWA 3WHUA 4CE8A 4NOTA 5FZDA 1I1EA 3H1WA 1KJRA 1F8VA 2D6PA 3SEPA 1C1FA 1FOD1 1YHFA 2Q5TA 5CZKA 4NROA 1XOYA 5LWBA 3SKVA 2WZR3 3VBOA 2D40A 3S5AA 4E4HA 4LBJA 4KG8A 5FYMA 2WQ8A 5EJ1B 5FZEA 3AX4A 3ZXLA 3HBKA 2PHWA 3T2QA 2HWF1 3WV6A 3M1HA 1PGW2 1CD3G 2PHRA 2QKDA 1V6JA 4GALA 2YDEA 4CUCA 3W5MA 1XYOA 4JKKA 3ETQA 4RS5B 3RJRA 1RUC2 1VRH2 3D4KA 3ELNA 3HPNA 3OOXA 3PL0A 4H14A 2G19A 1IKQA 1FMD1 2D6KA 2A5ZA 2IVIB 2W1QA 4AHWA 5F5CA 2XJUA 3WT3A 3WDTA 3KQRA 3CZJA 1VB4A 4AEDA 1UOBA 1GOGA 2XH6A 3DKQA 1DGWX 2ZX4A 2DU1A 4YRDA 4CDQB 2RM23 1W6OA 4Q4Y3 1JOPA 3RJ2X 4XTPA 2GALA 3ZIXA 2WC2A 1R1A3 1AR61 2BUKA 4LXLA 4XQWA 3R4DB 5FZ3A 5CAZA 2RS53 4WM7B 3MBWA 1DBNA 2VQ0A 3CNAA 2R072 3C7OA 1GICA 1R091 2EXJA 5JZGC 5J1XA 3AJYA 1H9PA 2E26A 4FFGA 3NV2A 1MS9A 5DAWA 4D0QA 1OURA 2J1SA 5ACA1 5CG9A 1U5XA 3M3OA 2JKXA 2K46A 4UFIA 2XDVA 4IEWA 3LDBA 4N53B 2ARXA 1ENQA 1JMUB 2RMU1 4MLOA 3IWZA 2XVKA 3UT0A 4CCCA 3RZKA 3ZPOA 5L36A 2HWD3 1JI6A 2XBO1 4N90A 2WKKA 4QM9A 5BV6A 3B5LB 1RVF3 2GU9A 1BK1A 1KEXA 4CSWA 1S0FA 4OMCA 5BNOA 3AMNA 5C8CA 2W0XA 5DUXA 4LMFA 2VUDA 5T5PA 1NZIA 4P9IA 4IW3A 5FY7A 1W2AX 4GIQA 1F5FA 5A7WA 1DQ2A 1SBEA 2HWE2 1GP4A 1TMF2 1VBD1 1GZ9A 2W1WA 1RUI2 3KF5A 4D8MA 5ABJA 5GZGA 2AZ5A 3N9MA 2GH8A 4CP2A 1DLLA 1K3IA 2DUOA 3FLPA 2PYTA 3NNGA 3NNFA 3UKTA 4Y20B 1RINA 2VZ3A 1FOD3 2ZXQA 3FC0A 3LA7A 1UAIA 4XF9A 2AEZA 5BY5A 4KQ7A 3ACFA 1H4GA 4IERA 5F3CA 3GZEA 1J59A 1POV0 4Z82A 1GZWB 3PHMA 2VUCA 4ARXA 4CDUC 2PFWA 3CDZB 2CU5A 1WMXA 3DEMA 1MEC2 4RHV2 4CDXA 2HWF3 5K0UB 4CUAA 5A33B 3VDAA 4AAXA 1W05A 5I91A 1KXGA 2GN7A 2RDRA 3ASIA 4CDWB 1H8VA 2W9XA 3BPSA 5FUIA 4EN8B 3OB8A 1UNBA 3OPTA 3RSJA 4P5HA 1JZ4A 3TEZA 1MACA 5TSWA 5T54A 4C8DA 1K42A 2VTXA 3ILNA 5KHKA 1FMD3 1S2EA 4Z07A 4XACA 4B4QA 1UF2C 1ZZBA 4BXSV 4QDQA 4TLFA 3TN91 4AQ6A 4DNYA 4Q26A 3MV11 3RZZA 5JOWA 1AZDA 3IZOA 1LCLA 3WQBA 4CEYC 4B4PA 1WLCA 4AHYA 3AYDA 3T4HB 5FZ4A 4YW2A 2G1MA 3C7GA 2F4LA 3OD0A 5ANQA 1AR63 1QOTA 2IXCA 1XJAA 1YWKA 3I59B 1Q56A 4YVSB 4P9GA 2Y38A 4XQ4A 3SH3A 5LA1A 4R9BA 4HBNA 5FY5A 5ANNA 3I4IA 2Z69A 1NQDA 1R093 3AYEA 1Y3TA 3KT4A 2Y6GA 4Q1PA 4QB6A 4CDQA 4N7IA 3DYMA 1HV0A 1HXS3 1VBE3 1W6PB 3GBFA 3ZXEA 1JYIA 3GZAA 4LUKA 4CRQA 3MUZ1 1C8M2 1FI2A 2WNVA 3LEMA 2DU0A 3URFA 4JV4A 2MHFA 3M3QA 3U0ZA 1I6XA 3TEXA 2SBAA 3DCQA 2RMU3 1BBT1 1OI6A 1NUKA 1RJ8A 1AR91 1XB9A 2HH9A 1O5UA 5L7OB 1COV1 3PIGA 3O1UA 1ZZ9A 2JDZA 1XRUA 5FR3A 3K75B 4DMIA 3OTFA 3ZSEA 5BNQA 2VR4A 2V4VA 5FZ9A 3TWIA 2F4PA 5IVBA 2EAAA 4LQRA 1J3QA 2R1BA 3WG2A 1RL3A 3MYXA 2V5YA 2DCZA 4EN6B 4D6QA 3U07A 1UY1A 1UZYA 3SCHA 1LB2A 1FV3A 4ZS2A 1OFNA 2PAEA 1ONAA 1MQTA 1W8OA 1VBD3 2JDMA 4UF0B 4R4ZA 2X8KA 2GP5A 2AYHA 3KZ4C 1W8UA 1XXNA 3C8XA 3POYA 3LPFA 4LHSA 4MUVA 2LROA 3CJIC 3SISA 3CBNA 4K8RB 5BNPC 1PZ9A 2VNVA 3ACLA 4LIVA 1F4HA 3EHKA 1DYKA 3NVCA 3ZYBA 4LKSA 1PMHX 5CFCB 5B4XA 3TBDA 2P4EA 1J1TA 1JHNA 1WZXA 2X5IB 3N36A 5DN2A 4QXKA 5A7OA 1JYWA 3TEYA 2CWSA 3UJQA 3B7MA 2D6LX 1GFF2 3OF1A 5A3OA 4MXVA 2QQWA 3HJRA 1ODNA 1WKYA 4CP9B 5L73A 1ND3B 1JXNA 3OGVA 4LBQB 4LTAA 2XJPA 1XC6A 3LSEA 1LOFA 2KA3A 2JE8A 3R4UA 4IETA 2ZJCA 1OF4A 2CDPA 4P14A 4YWAA 1WA6X 3AKTA 2WUHA 2WIIB 4C90A 1NY71 5FYUA 1IPSA 3FWEA 5GLUA 1GZWA 4MHUA 4XHBA 3WD5A 4QGLA 2ZACA 5K0UA 3LIHA 3LDRA 5JLVA 4LLFA 1Q8OA 4XFIA 3TN93 4CCKA 1Y4WA 2Q1ZB 2JB8A 4CDWA 3ZXGA 2DVFA 2VTXJ 3IIIA 3KT1A 1TME3 1W6NB 1RUD3 3KGLA 2W46A 4HK9A 3VBRB 5C6CA 3DPRB 2KD7A 2OQ7A 3CLPA 1NXD1 1FNYA 4YW7A 2QE3A 2W39A 5FP9A 2QZ3A 3PTRB 4DXRA 2ATFA 3FHIB 3WDXA 4K40A 4EZHA 4FTBA 2H0VA 4LK6A 1S0CA 2JKBA 4YVWB 3W20A 1D2QA 2A3WA 2VZSA 4QPIB 3WDYA 2JIJA 3ES4A 2YHJA 2VCMA 3ILFA 5A7SA 4AW7A 1XYPA 2ZGSA 3JBG3 2VZRA 4OMDA 2WT0A 2WZR2 4AEJA 1H1MA 4HKOA 5L9BA 2PAMA 3E5XA 3NV3A 2HBUA 4YVSA 3VBSB 2OT7A 1XNTA 4GMP3 1AR93 4KWLA 5GM0A 1COV3 3SLIA 1S2BA 4UFHA 2ORXA 3VBOC 1AR71 1DCSA 1V70A 4ZONA 1IS5A 1W8FA 4Q4X3 1W6PA 2BDRA 1G9DA 5EYXA 4LE3A 5J98B 2D7FA 4YM2A 3WF2A 5FYHA 4AGRA 3M7AA 1ACCA 1GNZA 3BCWA 3RFRA 1PO11 2JDKA 3U10A 1D0HA 1CONA 2PHLA 3LPGA 3THPA 2WO2A 4M3CB 5L7OA 3WP3A 3MHZA 4I3GA 3KD4A 4HZFA 4N9HA 5F37A 3OEBA 1KDKA 1CIWA 5I8TA 3K51A 2RM22 4YZ2A 2JDAA 4Q4Y2 3BIWE 5FJKA 4AEDC 2QQKA 1R1A2 4D7YA 1JZ8A 1QH6A 1UYZA 3CQOA 4YG3A 1RMU3 4QU2A 2NYYA 5A1LA 2RS52 4H2AA 5FCCA 4LOSA 1UX7A 3HN3A 5J48A 4GH4B 4DS0A 3RMYA 2XHNA 2R1DA 4YFZA 3N7JA 1OD3A 1AX1A 2PHXA 5D8AA 1J83A 3BI3A 1ALYA 3MIHA 5FZKA 3MIEA 2QQJA 2YU2A 2QBXA 1QY4A 3B3QE 5IAVA 4S2DA 3VZLA 1RHI3 2NZ9A 5FREA 2Q8EA 4Y5SA 1VLNA 4K1ZA 4ASLA 2X5IA 3FFQA 4FFIA 4IEOA 4S2HA 1AF9A 4AOCA 4D3WA 5A6QA 2PHFA 2E9QA 3O1MA 5FYBA 1O7FA 2HWD2 4P9XA 4DQAA 2X05A 1O91A 1ND3A 1UZ0A 1RVF2 4LBQA 1DDLA 3M3IA 2GMPA 3B00A 2VZVA 4UYBA 3T09A 3UGHA 5CYYA 1SG3A 3RNSA 3Q8EA 2GN3A 5LA0A 2GSYA 5FYYA 2QQIA 3AC0A 1AHSA 4NHMA 2GMEA 1Y7BA 4ATFA 1JZ2A 2PHTA 3LEIA 3QACA 1ST8A 3FN9A 1QJZA 1QJY1 5BNOC 5C8CC 4FPFA 4E2GA 4JAAA 5IK7A 1AXZA 3AXEA 3QLQA 3I3QA 3I2KA 5JXJA 4HLTA 3SH4A 3MPPG 3WVJA 5F9TA 3LE0A 4Q27A 3HVDA 2DWRA 5E1RA 1I3HA 2B4KA 2DURA 4HKWA 4S2GA 1OUSA 5ISLA 3KVAA 5ABJC 3AFKA 1Q8SA 1W6NA 5KHJA 1EPZA 1FOD2 2WFF1 3ORJA 3PUSA 4K21A 1DGRN 3DPRA 3K4AA 1O4ZA 1HB3A 1YQ2A 2VL4A 5T3NA 4L99A 4HXCA 1HX6A 3AMMA 3I2OA 2C0ZA 5A7NA 1PVC1 1JH5A 2HWF2 2DFCA 2BOJA 1AR73 2MNGA 2QVSB 2BV4A 4L9BA 1O5LA 3AZVA 2V4AA 4MADA 4QPIA 1OBNA 1CX1A 2V72A 3V0AB 3WLUA 3A4UA 5EFUA 1OT5A 1DLCA 4CDXC 2QZ2A 1H2LA 4HVOA 2P5BA 3VBSA 1PO13 4GAZA 1FMD2 1RIRA 2UU8A 1WMFA 3O12A 4IGPA 1GZCA 4IDZA 4R9DA 4DEVA 1EV11 5DZEA 3BN6A 5J7MA 3WG4A 3JCIA 4QXBA 4EWEA 4K9SA 4UT5A 5T5LA 1NCRA 1I9RA 1YCIA 3IMMA 5DABA 2HWE1 3LFIA 3WR0A 4AYUA 4CP1A 1RUI1 3J7HA 5FP7A 1NXMA 1Q8PA 4DUWA 4UFKA 3ST7A 4NUBA 1AR62 4IE5A 3WNOA 1O8SA 4IEPA 4LBQD 5I0UA 3U75A 5B2GB 1IG0A 1QNWA 3I49A 2UY8A 2VCAA 3AB0A 4BISA 2HWC3 4WM8A 4GD4A 3T3YA 5DG2A 1R092 4AGGA 1HXS2 4OULA 4XF4A 1KGYA 5BXXA 5FPUA 4NE9A 4Y4RA 5ACA2 4FXKB 2YFUA 3AVSA 1MEC1 1VB2A 4RHV1 4CDQC 4DXZA 2IXHA 2RMU2 2Q8OA 3BU7A 3OEAA 4A42A 3WP6A 2WNVC 3VUOA 4XBNA 1UXXX 3TYJA 2OKXA 4MXWB 4AL9A 4HVRA 1AXKA 1LHWA 5T52A 1KJLA 2FQPA 3FLRA 4Y24A 2W68A 3TNQA 3VD4A 1APNA 3QCWA 3S6PA 3USUB 5DZGA 5JWPA 2VOTA 1DYPA 2R0HA 4QDRA 2Y0IA 3OYWA 1VBD2 1QJY3 3DECA 4D7SA 1SLTA 1GV9A 2VMGA 3LZZA 4QX7A 4ZXKA 1MQTC 1ZA4A 2R063 2RJLA 4DZGA 4CU6A 1CPNA 1N1TA 1OKOA 1STMA 2WFF3 3BTZA 4PCRA 2DVGA 1NX9A 5CG8A 2BBVA 1OH4A 1ZRIA 3I3DA 4JC1A 1WMDA 1W8ZA 5FYTA 2Q1MA 4JRAA 5K7PA 4YARA 4HT1T 3ZFEA 2D6NA 4L92A 1YC61 2UWBA 1PVC3 1H2NA 2QQOA 4F7ZA 1K5MB 1OC1A 1ZYBA 5DUWA 4BLJA 1M06G 2DUPA 3MIFA 1WA4A 1LEMA 2B46X 4L97A 5C7GA 3GHNA 1MPXA 4MV2A 1VBB1 1LOFC 2D97A 4MG2A 1DGWA 2PQSA 1EV13 1ULOA 1W04A 4FFHA 4L2NA 1V0AA 4Q0UA 4XFFA 3GZTB 4MX3A 3TN92 1HJGA 2ZMLA 3DF0A 2YUEA 3VDDB 2PHDA 3N9QA 1AVBA 1AL0G 1TEIA 3H3UA 3FMGA 4COUA 2GC1A 5K0UC 1TME2 1OLMA 4NHKA 4NWWA 3H1YA 2Y6HA 3ZFFB 4CDWC 4M0NA 4QAWA 4P02B 2R7EB 1AJOA 5LY2A 2O1QA 4ITCA 3KT7A 5IT6A 1O3QA 2VZ1A 2VZQA 3HQUA 2BEOA 4IXLA 4CCOA 1OSGA 4W6XA 3JBG2 4ISQA 2IC1A 4Y1YA 3SQOA 4AHZA 3LQCA 5FMOL 1HN1A 4YM3A 3HQXA 2HJIA 3MPBA 1BBT2 1HIXA 1AR92 1LAJA 3M8LA 3MICA 1COV2 4MH0E 4MHRA 3ITQA 1KS4A 3EJKA 1H9WA 1LU2A 2XKOA 4YVSC 4OQ9A 2EVXA 3ETPA 2UWCA 4N43A 1Y43B 1PX4A 2ZX3A 5FZAA 2RR13 3AKRA 1ASJ1 2LTNA 1MS4A 4MGIE 4QQLA 1IS3A 2IXJA 4QX8A 4BMBA 2QJVA 4AGVA 3E97A 3OY8A 4NRQA 5EP9A 4MXWA 4YZ5A 2W1SA 3KV9A 3VBUB 4XJZA 5BNNB 3M70A 4SBVA 1GQPA 3RYKA 5L7OC 4LE4A 5FZHA 2R043 3WDWA 5KHGA 4P9JA 3USUA 1HLCA 1ULCA 4AHXA 2DFBA 2PA7A 2Z4FA 5G04L 1RMU2 3S57A 4CCMA 2FD8A 2R0FA 5FXZA 4RGAA 1CJPA 1T6GC 1RXFA 1G7YA 1UYYA 2Q4SA 3FHQA 4JDMA 1G9CA 3IB3A 2LRPA 5LASA 3WW2A 4JVAA 1JBCA 2EIGA 1KS5A 4OHWA 3ZIWA 4OYUA 5F32A 4RGKA 4O9GA 5EPAA 2YBKA 1TNFA 5FMOS 2WLPA 1PK6A 1YRZA 5FWEA 3ZFGA 4DOUA 3PVOA 2VW0A 2WJSA 4LBLA 3BGAA 3OBRA 5E89A 1NY72 1GZTA 4JTOA 5D8AC 1V9U1 3S7EA 1PZ8A 1VBB3 3ZYRA 1P8JA 3ZYHA 5T50A 3LGRA 3J7NA 2X5IC 4S2FA 5I0SA 4UWDA 4NRPA 1ULFA 1RB8G 3ECQA 3WDVA 1F35A 1OLQA 2GC2A 3Q8AA 1O59A 5HV0A 1ND3C 3CKHA 1ND2A 3OSDA 5I0TA 3QBQA 4PJYA 2XHKA 5C5TA 2AEYA 5JSOA 1GYKA 1J3RA 5G05L 5CFDB 2E32A 1LOEA 2G9ZA 3VHRA 2WT2A 2W3JA 1JUIA 4QT6A 2XJRA 2RM21 4CEWB 2C4XA 1MVQA 2WQZC 1HN0A 1RITA 2XL7A 4Q4Y1 4TYSA 4RQPB 2QDNA 3VDDA 4MGKE 4PBOA 4NVPA 2PTMA 1UKGA 2RS51 4LO7A 1GUIA 3MV01 2QUOA 1G9BA 2AH2A 2TNFA 2VZUA 3W59A 4GWMA 3APBA 1CAXB 3WINE 2Z2SB 4IL7A 3AXDA 3GJBA 3VKOA 1S0BA 4ZU7A 3DPRC 1UY2A 3KVBA 1AJKA 1AR72 3OBAA 5CB7A 1NA1A 3I2GA 4P9YA 1UY3A 3N35A 4XTMA 3T1LA 4IESA 4NIGA 1Q5OA 1X50A 5FY0A 2YC0A 5LBEA 1ASJ3 2YGMA 3SMHA 2BNOA 1PO12 3BKZA 2FDFA 4QPIC 4YZ4A 2Z5WA 1JU3A 1DP0A 1DIWA 4XMAA 2JE7A 2WNUB 1NLSA 2ZA9A 2E7AA 2VOWA 3ZR6A 3VBSC 4Q0PA 4G4FA 5KXDA 1X9TA 3NNLA 1CGPA 1GMMA 4IV3B 4DB5A 1MZEA 4AZZA 4FOVA 1YEWA 2Y26A 2ZBJA 3ABZA 3E6CC 2WWJA 4C1XA 3ACIA 3VDCA 2CWMA 1NCRC 2ZGUA 3PIJA 4BZ4A 2B8MA 5APAA 4XHXA 5KBFA 4PI2A 1LTEA 1R1ZA 4AQ2A 2ZHLA 2YC2A 4IEVA 4QWNA 1DZQA 1JZ5A 4EN9B 1M4WA 1EAH1 2Q30A 3NJXA 1H6XA 3RDIA 3HAGA 5BNNA 3FBMA 4K7JA 3ZXAC 2DCJA 5AFEA 1NCQA 4HFSA 1WUVA 1OOPB 4HL0A 5FP3A 3EO6A 4WM8C 1CAWB 2TBVA 2ZEYA 2VCBA 2WNEA 2ZX2A 4AE2A 1IS4A 2VMFA 2XWJB 1V9U3 5FPLA 2P3KA 1W39A 2WT1A 3UGFA 3S0MA 3ZSMA 5JVVA 1WBFA 3POSA 3LSDA 2P34A 4D6SA 2ZEZA 3DL3A 3KF3A 4KNCA 4NPRA 4BIFA 2PN5A 4XJWA 4BQ3A 4FOQA 5ERLA 1HW5A 4NN0A 4Q1RA 4UFJA 5FBJA 4BU2A 4QX2A 1LRHA 5FPAA 4IEUA 4CCLA 4UFLA 4BYYA 1QJY2 3JU9A 2VQUA 4QM8A 3ILRA 1JYVA 1V6MA 2YPDA 1VMFA 4J25A 4XMIA 2QDRA 4PDWB 5T5JA 2VVEA 4XFHA 3FZ3A 1T6BX 3B02A 4I0BA 1ZZCA 4RR3B 2R062 5J37A 5LATA 4RSUA 2B42B 4ES9A 2WFF2 1W90A 2XMLA 5C3RA 1GR3A 2ZMNA 2WFPA 5DXDA 1S55A 4Z92B 1FXZA 2YYOA 4DEQA 3IMNA 3IDBB 4AI3A 4QXHA 2VVFA 2XUMA 1HXS1 1VBE1 4KG0A 3O1VA 1KFXL 4I3PA 4IE7A 1GP5A 2B9VA 1PVC2 3MIBA 3SCFA 5DUVA 4DXSA 5HI0A 1RUE1 2BGOA 4KGGA 1F9KA 1W6QB 4UBHA 2UYAA 3ZFEC 3I2FA 1JHJA 2XJTA 4EV0A 3W5NA 4MGYE 3NW4A 3E1F1 5HV4A 2OA2A 3CO2A 1OQ1A 1EV12 1WCQA 3DYPA 1GWKA 4QPGB 3N7KA 1SLAA 2JEMA 4R52A 3KV5A 4YGCA 5FV3A 1YXWA 1ZX5A 2ZX1A 2OS2A 3FE5A 3MO4A 5LB6A 3VZKA 3U4XA 1D4M1 4ASKA 2GZWA 1QIQA 3PUIA 5IK5A 2O14A 1YYNA 1G6NA 1O4YA 4QX5A 3KM5A 1RUH1 3V0BA 4KBBA 1K12A 2VM9A 5GZDA 4FTSA 1EAH3 1V6IA 4JQTA 3Q8FA 4M4PA 5LBCA 3ZXFA 4B1MA 3NRUA 2EAKA 1G86A 3D0JA 3ZSKA 1US2A 4CU8A 4Z2AA 5IVJA 2XUEA 1BJQA 3IDEA 1CR7A 1VE0A 4BQXA 1BQPA 4E4ZA 4IV1B 3WNMA 2XLAA 2YXSA 5IYYA 1TG7A 1A6CA 1RGSA 1MS3A 2DDUA 5FZGA 3IT8A 3BTYA 4XQDA 3WNPA 2B5HA 3RZGA 1A78A 4X8NA 3J26N 1LOCA 4I0AA 4JKMA 4XDOA 1IQAA 2IXLA 1KFUL 1SFYA 4XXAA 2XVLA 2HKXA 5GLTA 3V64A 5F7UA 3OPZA 3RZMA 3MLKA 5FK8A 3VHPA 4GJZA 3GM8A 4N43C 2VW1A 3POWA 4AEMA 5FOBB 2BWAA 2QCSB 2VBPA 3H50A 2D3RA 3GDBA 4NMIA 1AX0A 1OD5A 4RS5A 4DY5A 4OUMA 1TME1 4BM8A 1RUD1 4BQ1A 1POV3 4M00A 5F3GA 2OYZA 3V56A 2XQXA 2XXZA 5FO9B 5J3UA 3SEEA 2YBSA 2K0GA 2R042 2FMDA 3KCCA 1H6YA 2YROA 1S0JA 3LF7A 1L7RA 4FSJA 4UXAA 4BQ4A 4PLMA 2OZJA 3DV8A 1E5RA 2EIBA 1W9SA 2W5FA 2IXKA 3AZXA 3UV9A 3VZNA 3K46A 3CMGA 1QJU3 4OCTA 5FK7A 3NMBA 1OQDA 2KR2A 5FYCA 4AQTA 1PHMA 2VO5A 3JBG1 1NE4A 1PO21 3OBTA 4RR3A 4E9KA 2HEWF 1RUE3 2XLGA 3KHBA 1QJX3 1UL9A 3Q9OA 4WM7A 5LW9A 4GMP1 2AGSA 4YM0A 1L7QA 4GWJA 5JXGA 5H9SA 3BVCA 3M3CA 2D98A 1VBB2 2XGXA 4GB31 4UW6A 1PK6C 4WVVA 4Q4X1 1QDCA 3ZFGC 2BW8A 4LITA 1XNKA 1FATA 4B7EA 1VAMA 1SLBA 4JDOA 4LO5B 3VKLA 2QQMA 4N53A 3HNYM 3AM2A 5GZFA 3VZOA 3EB7A 4CU9A 3P3NA 4PIYA 2JG9B 2LALA 3HT1A 3KS7A 5GLWA 1FPN3 2EF6A 1D4M3 1UYPA 4BWOA 1CESA 2VW2A 4A2UA 3GGLA 1AYM1 2RE9A 3OGJA 3O0XA 1RUH3 5CU1A 3GBWA 2DF7A 4C1WA 4CXYA 2HEVF 1BEV3 1NQJA 5F5AA 1ND2C 4HVQA 5C3SA 4QPGA 4IEQA 4ZXEA 3RYRA 1GOFA 3BYWA 3OGRA 1ULEA 4M0HA 2ZZJA 2ZGLA 4LKDA 1RMU1 1NLRA 4ISRA 4C0BA 1OA3A 4ZPIA 2WZPP 5LEJA 1SDDB 3POBA 2OIIA 1CZTA 3VDDC 5A1FA 4PLOA 5KHHA 4BQ5A 4I2OA 1SACA 3LOIA 3MF6A 4XIKA 4PIZA 2K9ZA 2V09A 1WLTA 5IVYA 1RUJ1 2Y6JA 2DVDA 4Y20A 4NIDA 1RHI1 2A75A 1F31A 2PMWB 4M4RA 4CVUA 5DZFA 4PLNA 2JICA 1XNCA 5E8AA 1S1AA 5HXMA 2J1UA 3NAPB 4Y4YA 1ASJ2 1GWLA 1NA1C 1IKPA 2VZTA 5A33A 2JE9A 2C9KA 1YQ6A 2YU1A 2DTWA 2ZAHA 2AENA 1UU6A 1G8WA 3PJQA 1GQGA 2WABA 2OW4A 4JCKA 4AWDA 4ATEA 2A6ZA 2RV9A 2C9AA 3AFGA 3WCRA 1JODA 1GU3A 2WRAA 1TZOA 2XR4A 3WF4A 4AI9A 1WCDJ 2WSVA 3VZJA 5JUVA 5FZ0A 1O4TA 1CVNA 2AACA 3GALA 5A6XA 4COYA 1CWPA 4JTNA 1PGSA 1W0OA 3E5QA 1GNHA 1W03A 1OVPA 4QPYA 4HONA 1C57A 2BWCA 3KMHA 4HN1A 5F5QA 3LFMA 3ME2A 1B35B 1RUF1 1PO23 1UOGA 2BBAA 2OUHA 3LD8A 1ENXA 3I59A 5J09A 1R083 2BGPA 1FV2A 5A3NA 5JOYA 2UURA 5BNNC 2IVJA 1HRV1 1EPWA 3A23A 5FYZA 1MR5A 1NCQC 1V9U2 4P5YA 4GB33 5FPZA 1PMJX 5GZEA 2UWAA 3LIGA 3DYOA 3D3AA 4QGNA 4NAMA 4TTGA 2F6BA 4FP3A 4N9IA 3AP7A 4YZ1A 4MZUA 3VLBB 2YG0A 2X29A 4CA9A 2HBTA 3JXSA 5FRAA 1QGLA 3VDBA 2YB7A 5FTTC 5DQ0A 5IUQA 4AK3A 2EALA 5HCHA 3SNMA 4GQ7A 3RG0A 5FYVA 4OI1A 1AYM3 5L19A 1IOAA 3ZPYA 1H2MA 4MVTA 2SLIA 4EWDA 1J84A 1V6NA 5F5IA 1VALA 4KI5M 2IZWA 4QU1A 2WINB 1LGBA 3SXWA 1TNRA 2OPKA 4UF0A 1IG3A 5FY1A 1CX4A 1XNDA 3C2UA 3TRSB 4I30A 2B7YA 4EYUA 1O3TA 2ZHKA 5DAQA 2W95A 2HWC1 4WVWA 5L9RA 4ARYA 4FFFA 2DVBA 1Z0HA 2WN2A 4AG4A 4HSLA 5DUUA 4B8EA 3O0WA 5SV5A 3HWJA 3UKVA 1RUJ3 3ZN5A 1C28A 4U36A 1UPIA 2BTVC 3FX3A 4XIOA 4H7LA 4Y1UA 5CFCA 3AKPA 2YV8A 1UXZA 2C1FA 5CNAA 4EQVA 2BVBA 1LODA 3O7OA 3I2DA 4Q4V1 2X53S 3AP6A 4XFCA 1LULA 3RVHA 2LUWA 3NNJA 4HG6B 3I7DA 1TQ5A 1AYN1 1ZBA1 2TUNA 5JMCA 4CP9A 3RZJA 1CJDA 2PXJA 4KBZA 5FKBA 5HPOA 1N47A 3ZN4A 1X82A 2VMHA 3B69A 3AYAA 3LAGA 4HPKB 4IGQA 3T0AA 4LIUA 2JENA 3KB5A 5EWSA 5JIAA 3VBHB 5DPNA 2WA4A 4E8DA 2BU9A 1CIYA 4OUSA 5IW0A 3ALQA 4JDNA 4Y22B 2BQPA 5CEHA 1QNYA 2P3JA 4L8QA 4Q5OA 1U5YA 1VJ2A 1REDA 4YYOA 1LOGA 1SLCA 2PELA 4XDQA 3UK9A 2HWB3 2R061 1JZ7A 5A3TA 1VAKA 1K45A 3IN9A 1MZ5A 2C6SA 1EAH2 1JOJA 2VMEA 3VBRA 4HMZA 2FZ2A 1ENRA 1RUF3 3N7MA 1YJLA 4AAPA 1D2SA 4DINB 4DO0A 1VR3A 1UIJA 4AI2A 4L11A 3LA3A 5IVVA 1UMZA 1DU3D 1HRV3 1RUG1 4IE0A 4ZZ5A 4UW4A 4M3CF 3ZN6B 1O3RA 4YVWA 5FO8B 1CZVA 2WR9A 4IEZA 2Z42A 1N1YA 1UD1A 4YGDA 4BXFA 5C9AA 2Y6LA 1XQNA 1PMIA 1B35A 2QFEA 4Y3OA 1NYWA 4OI2A 3ZMOA 4XCBA 5EIYB 2WS93 1EUTA 3LEGA 2JX9A 2MEV1 4JX0A 1XE8A 5FZ6A 1JZ6A 2E7TA 3EQEA 3M4FA 4G3YC 1QXRA 1V6OA 3B94A 3RYPA 2A6VA 4YG6A 3CHXA 1GNYA 4CUBA 5KXEA 1S0DA 3U78A 4R8HA 4FPKA 4Q8LA 4K20A 4XILA 1JN2P 3A0NA 3O5SA 3I2JA 3RI9A 3BU0A 1I5PA 4Y5Z0 1V6LA 1REFA 4MO3M 4M3CA 2P3IA 4RS5C 5HBAA 1PGL1 4E4SA 1S0IA 1XSRA 4GZ9A 5F8PA 4BDVB 1Q43A 4NPLA 2VVDA 2J1RA 4RYDA 5EZWA 1VBE2 3N9PA 4AF9A 5IVFA 1QJU2 3HOBA 5IJRA 1GQHA 4XUPA 3T2PA 2Y34A 4I02A 2CTVA 4TXWA 1RUE2 3BIEA 2RJKA 1QJX2 2RS11 4FXGB 1IS6A 4Q4V3 3MIDA 2ZGKA 4X6RB 4FCAA 1PIV3 4X6QB 5IVCA 1AYN3 1T2XA 1ZBA3 1OH3A 2K2SA 4GH4A 2VJXA 1SCSA 4RR3C 1ZZ7A 2CYFA 4R9AA 1AR81 1CAUB 5JCTA 1OA2A 1UW8A 4WM7C 2WQ4A 2RR11 2FDGA 3QD6A 4UI9L 4LKEA 2VH9A 2FHRA 2RG4A 2W94A 2VQAA 4H7MA 3IM0A 1SMVA 2VBDA 1VBA1 2Y6KA 3W9AA 4AFBA 3VBFB 1HV1A 1D4M2 3MLLA 3ZXDA 3HR9A 4CEYB 1OQEA 3BB6A 4N53C 3POFA 3MF9A 3D82A 2Y0OA 1POQA 1RUH2 3VBHA 4ASMB 1JYXA 5A3LA 2R041 3H7JA 5FP8A 5HCFA 2ZS6B 1RUC3 3OCPA 3UNPA 3K4ZA 4BK5A 3WQ0A 3TB0A 4Y22A 1UKRA 2VMIA 3OPWA 1HKDA 2WA3A 1BKZA 3WW3A 3UYJA 4QPGC 2Q1FA 3ZDSA 1RUG3 4JGZB 3PUHA 1W2NA 3N9NA 1LU1A 1X8EA 4DXTA 3H8UA 2A71A 3NNMA 3ZXKA 4YNIA 3KCXA 3P1IA 3NL1A 4ZU5A 1UWWA 4XBQA 3H3ZA 4L0PA 2VUJA 5F2SA 1BMV1 3WW1A 3IPVB 1ULGA 2MEV3 2QQUA 4PIXA 1LOBA 4RA0A 4BQWA 1W9TA 4XXPA 4F3JA 4UBGA 3ZN6A 3ZKUA 5A70A 2DVAA 1QEXA 3CEWA 1W0PA 3NO8A 3R0RA 2WWSA 3ZYFA 5EJ3A 4QQPA 1JYNA 3V0AA 1K5JA 2DBNA 4Y5TA 4GWIA 3J7LA 4LO8A 4XJ9A 3MI8A 5H9RA 1RUD2 1TVGA 4LHKA 1OXCA 3CJIB 4QQOA 1R64A 2RS31 5B4NA 1W9FA 4FPGA 4W8JA 5CISA 1SPPB 4MYEA 4Q0VA 4PQQA 1A8DA 3GXUA 4BQYA 5L9VA 4J6GA 1XPWA 2NMOA 3LWCA 4GKYA 4V1PA 4DIQA 1JUHA 3VKMA 5LRSA 3D5OA 5JOXA 2JG8B 2WNOA 5A3PA 3AKQA 2ADDA 1LEDA 3LOBA 3H1MA 3AMQA 3WW4A 3WCSA 1PO22 2YY1A 4YGEA 2CHHA 2ZTNA 4XJAA 3WUDA 2FCTA 2UYBA 1BHGA 2RS13 2ET7A 2H6BA 3HN1A 3K2OA 4YLZA 4P08A 3VKNA 3KV4A 4IE4A 4C91A 2W91A 2XLFA 2R30A 3GBGA 1AR83 1FX5A 4GB32 1ULDA 1OFSA 1DQ4A 3OD4A 4Q4X2 5J96B 4WVMB 3PVEA 2O8QA 4HN0A 2GNBA 2LM3A 3Q8CA 3RMXA 3MUY1 2CGNA 1DQ0A 4LUMA 5FY9A 2R49A 5LZ6A 2FDJA 3POEA 1AL21 1NT0A 1VBA3 2VU9A 4ZY9A 1UCXA 2JECA 3POGA 5C70A 5A7PA 4HETA 4URAA 5D2AA 1AYM2 5KC5A 3P5BA 5SV8A 3AMHA 4META 1YUDA 5FZ1A 3UKNA 5IK4A 3H9AA 2GP3A 2O0OA 4FAGA 2DCYA 4Y1ZA 2ZGMA 4LO4B 4O65A 1N3PA 3VBFA 4ZS3A 4WBBA 5FOJB 3ZYPA 4JHTA 5CKNA 4LBMA 1HQLA 1ZZ6A 1IGOA 3AVRA 3C7EA 1RUJ2 4YW3A 1RHI2 1OLME 4W4ZA 2PLV3 1H4HA 3PU8A 4A3XA 3ON7A 2OQ6A 4GKXA 2G9GA 3VBOB 1U12A 4LT5A 1Y9QA 2VCCA 2ZZQA 1QMJA 1QXJA 4P9LA 5BYNA 2IXIA 3DKWA 4PHZA 2GC0A 2XVGA 5CFCC 3K3NA 4JGZA 5CADA 2EIEA 1K5MA 4P00B 4Q8KA 2EXIA 3POJA 5GALA 4P9WA 5FMCA 4K1YA 2VC9A 3F95A 2N7GA 4LK7A 5EQUA 1W28A 1QHDA 4IGOA 3SKJE 1N1VA 3AZYA 5F6KA 1W8HA 2RS33 1OKQA 3GJAA 3IPVA 3VGIA 1SBFA 5JPNB 4CU7A 4TLGA 2HYXA 3EXUA 4EN0A 2BVVA 4PT6A 1GOHA 5FUNA 2R16A 4PI0A 5HCBA 4AEDB 1BZWA 5FLJA 3M3EA 1VP6A 2WO7A 5GLVA 5LA9A 3U37A 1OF3A 2ZOEB 5AC91 1HB4A 2GNDA 1W6OB 3I8TA 5J36A 4FPEA 1RUF2 1HQWA 4NAOA 2CNAA 2NM1A 5FY4A 2ET1A 1SPPA 3ZFFA 4LHNA 1XNBA 5FPBA 3EYPA 2ZCWA 3JQXA 1J1LA 1RUOA 1LJ7A 3NSTA 3VBRC 1HRV2 2FDIA 3PLQA 2ARAA 2JG8A 4AFDA 5KHIA 1DQ6A 1L3JA 2XJSA 3WP4A 2JDUA 4XUQA 4EN7B 3RWKX 1VPHA 2VY0A 4KGQA 5FKCA 3RGBA 2ZGTA 2ZGPA 1ZNPA 2VOVA 2ARCA 2WS92 3BOWA 4FPOB 4YFWA 4YVWC 1C3HA 4QX3A 4FVVA 1AL23 3GF6A 5FMBA 5FZ8A 4NIAA 3HNMA 4MGSA 3ZLIA 2KXLA 5C9AC 1B35C 2IFWA 2ORZA 1KQRA 4KL1A 1ZBE1 2VBBA 2VECA 1DQ1A 3JD71 1Q8VA 4XPVA 4WVMA 4KWJA 3PNAA 3N4MA 5JMOA 5KWRA 5BNOB 3WG3A 1RJ7A 5EXOA 1ULPA 5I0DA 3ACHA 1KD7A 2CY6A 2ID4A 2QNKA 4MSVA 2YZ4A 3MW4A 4FPJA 4FBFA 4W65A 4OI4A 4UFMA 4JGYB 4QHZA 2HWC2 3ENRA 4UOJA 3VBUA 2UY9A 2D44A 4AQSA 1DZRA 1X9PA 2A3YA 2DUQA 3T30A 3IAQA 4HKLA 3RS6A 5C9AB 3OG2A 1AX2A 2ERFA 1A3KA 1ZRRA 2BZDA 4XJ8A 3BTXA 3K3OA 4QQHA 2OXBA 1LR5A 4HOOA 2VNRA 5LA2A 3KV6A 2E63A 4Q4V2 2JIGA 3A0KA 1ZRDA 1PIV2 3DXTA 1AYN2 1ZBA2 2B9UA 2JWPA 2ES3A 2O8OA 2TEPA 2XJQA 5CVRA 3SHRA 4CDXB 1UX6A 2AC1A 2JDPA 1Z7S1 4UW3A 3RRDA 3VHOA 2FZ1A 1UOFA 2AR6A 3AZZA 2WYFA 4KH9A 3S5QA 1DF0A 2I45A 1YI9A 3AMPA 3C7FA 4GH4C 3ZYIB 1YQ5A 3L2YA 3USSA 2RJ2A 3JB4C 4XF1A 4RGGA 2GH2A 3DN7A 3WY6A 5FJHA 1QOSA 3WF1A 2G4IA 4IUGA 2C26A 4GA9A 2B39A 1JZ3A 4RD7A 2BOIA 1POV1 4AI0A 1WCUA 4XAAA 1UY4A 2J1EA 1UMIA 4JZRA 5FXWA 1LGCA 2VULA 3VV1A 2VTFA 4A7KA 5AC93 4WZCA 4XZUG 4AVCA 4COWA 2WL1A 4BPZA 2OPWA 5CFDA 4YM1A 3VBHC 1S0GA 1WWYA 2OZ6A 2ZGOA 4LEJA 3ZX7A 4BH9A 4NWVA 3WXPA 2P2KA 4Z1VA 4MGZE 3T4VA 4NPMA 5IVEA 1QJU1 1RUG2 4OHVA 3AP9A 4OVEA 4RQPA 1XNAA 2D3SA 3T2TA 1QJEA 3B01A 3LB9A 4DRVA 5I8SA 3WNKA 2WAAA 4Q2FA 4QB2A 1L7LA 2QQVA 3IDAA 1QJX1 1E5HA 4CPBA 3FHAA 2WNVB 4GWNA 4QDSA 3WHTA 2Y6FA 1CAXA 3PURA 4LHLA 2MEV2 1EUUA 4Z2WA 4GULA 3ZSLA 1ZBE3 5LBBA 2XQRA 2DYCA 5FFOC 4TSVA 3A21A 3KHCA 1H2KA 3JD73 3MZHA 3J8F3 4GXLA 3TNPB 4UW5A 1FPN1 4XUTA 5A32B 4NHLA 5GLZA 2I2SA 1E57A 1E5SA 2XL9A 2ZKLA 1MQTB 2D6OX 2GDFA 2BNMA 2WNUA 1PGL2 4XUOA 1JYTA 1BEV1 4B29A 3ATGA 4YSFA 5A80A 4CYDA 5FZIA 1Q3EA 4FOYA 3KWVA 3HNBM 4IV3A 3S7IA 3IDCB 1U0AA 4LBOA 2NP0A 2CSGA 2WO1A 2ZPXA 4HSJA 4TZDA 1LGNA 2X09A 3ACGA 4XE9A 2P37A 2RS12 4JGYA 1UZWA 1FNZA 4LNVA 4LBNA 5K4LA 3HIFA 3ZVXA 1PM4A 2FMYA 4XF3A 3T0BA 1YJKA 4E27A 1AR82 3F2ZA 2DTYA 1Z7S3 3PVNA 3J4UH 1OOPA 1ZREA 2A1XA 2BERA 3GCWA 4FPCA 2RR12 5CA6A 1CAWA 2WDBA 5IK8A 4Z8BA 5KXBA 2YBPA 4QKFA 5FDBA 2J1AA 4CCEA 4PF5A 4YW6A 5FY8A 5H9QA 2WSUA 2Q8CA 1IPKA 5FYSA 2ILMA 2JD9A 2QTWB 2W2IA 1RXGA 1VBA2 2H0BA 3BALA 3NKTA 5FLHA 3WDUA 4NO4A 4CXWA 2BJSA 4K6BA 4XYXA 4CPBD 3M2MA 3GHMA 1RTVA 5FZOB 4IQPA 5A7QA 4QHBA 1X8MA 2WZEA 2B45X 2YFZA 1D7PM 3E5UA 4IEYA 4R4XA 1PX3A 1VBC1 3K4DA 4QD2A 1ZM1A 2BRTA 1SBDA 5LK5A 5JOZA 2ZEXA 3AP5A 4XURA 4XZPA 1KRIA 1YQCA 1UO9A 2HLEA 1GANA 4OI0A 3B9IA 4A6OA 4PDWA 1OMIA 1NG0A 2WYSA 3NV1A 3VL9A 1UIKA 3VBFC 1R081 1VAVA 3H3LA 3OJBA 4K3UA 4OZOA 4DRRA 4FP2A 1UOJA 2PLV2 4RFT0 4DY3A 5C5UA 4QPWA 3DGTA 4XEZA 1ZRFA 1VIWB 2XONA 4A41A 3RQ0A 1ZZ8A 5JSRA 4FI9A 1S4CA 5T5OA 1BMV2 1OPMA 1QF3A 3ZM8A 3Q8BA 3OUHA 1LHNA 1W0NA 3O0VA 4B7KA 5IATA 5HXVA 2ZHNA 3LCPA 1ZA7A 4O9EA 3OBZA 1E5IA 4Q4W1 2D93A 2RDQA 3T2OA 4Y1VA 1DGRA 1QQP1 3HBZA 5AFBA 2A7AA 1W6QA 5JXIA 1A34A 1Z78A 3WNNA 2EXHA 1WW6A 4JGZC 4A45A 1OA4A 5ACA3 3MW2A 1K5MC 2P17A 2RS32 4BOWA 5I8YA 5IFTA 2EA7A 3JB8A 2J1TA 2VQTA 2XBO3 1CN1A 1VMHA 4J1XA 4LA2A 3JUUA 2E6VA 1ENSA 3PU3A 2VZPA 1B09A 4URTA 1F5JA 3WSOA 5LK7B 5C3QA 2AUYA 5A32A 3LA2A 1KDMA 1X33A 3N7LA 4E4DX 2BPA2 1YFUA 1MZFA 1N1SA 2XWBB 4Q29A 1MS8A 3OUJA 4XOGA 1LHUA 1H1IA 1HRI1 2WO3A 5C4WB 1ZVFA 3ZFFC 4ET7A 2JDNA 5C3PA 2CAVA 2EXKA 2ZABA 5D8AB 3O1PA 3HD8B 3B9CA 3R05A 4FQ4A 1YNAA 2P1BA 4AI1A 2JG8C 3UJOA 1WGPA 2KM2A 1HJFA 3OUIA 4IV1A 3GYDA 1LKNA 1AL22 1A8MA 1W2TA 3VKFC 4U2AA 2RDSA 2ETEA 3UGGA 5LEKA 2QQLA 4XBLA 1LESA 1C1LA 1WCKA 1VBC3 1DQ5A 2GC3A 4A4AA 3IAPA 2L9LA 4DFSA 3SH5A 1H8TB 3FUOA 4X8PA 5LRRA 3C7HA 1YO8A 2NQYA 4UAPA 1N3QA 3H42B 1URXA 1XSQA 4H3WA 2HWB1 3ZR5A 4LULA 3PVBB 1LNSA 3NJZA 5GKAC 4GMP0 5FZOA 2E31A 3H8RA 2D5HA 1U5ZA 2WBKA 3CIHA 3MDPA 3IBMA 3H0OA 5FMDA 1G9FA 5K8SA 3P3PA 5BUVA 4XETA 5A3UA 3WG1A 4KU8A 3VBUC 2WWUA 4XVHA 5K9YA 5DDJ1 1WLDA 5FYIA 1QOOA 3POIA 3W21A 1CAVB 2ZGNA 3EMRA 4QX0A 2VOXA 2R32A 4DUXA 3ZDVA 3U4SA 3CL1A 1O8PA 3THCA 5A6YA 4COVA 1RC6A 1DHKB 4Q4W3 1PZ7A 4XDPA 1DFQA 4Y33A 2AREA 2WS91 1QQP3 4XUNA 1W9WA 2D6MA 1XBFA 5F6LB 2E7QA 3BPZA 3PJYA 1W2OA 4E2QA 4TN7A 3MFAA 4ZHNA 4FO9A 1QH7A 2XJVA 5H9PA 4K8FA 1BBT3 5JAXA 2GAUA 3QH6A 4AFAA 4LPLA 4AVTA 2FDHA 4LJHA 5IFPA 1BVVA 5FQ0B 1NCRB 2DCKA 2JG9A 4OZXA 5AC92 3LDKA 3FUQA 5M0TA 2FCVA 4XAEA 3WQ1A 2XB6C 3NQHA 4G9SB 3VD9A 4W50A 1UQXA 3X29B 2P6HA 4SLIA 4D69A 1H30A 2J7MA 2HEYF 3CZUA 4WVZA 4BIOA 1NKGA 1UU5A 4MGTA 4EE2A 4WM8B 1HRI3 1QJFA 2XKPA 5CFDC 3OGSA 5JXHA 4FT8A 2WZ8A 4CEWC 3BOPA 3FL7A 2GNTA 5FBZA 4D7TA 5C71A 1FYUA 1PVXA 2C5DA 4RL7A 5EHDA 4N7UA 4W6WA 2XG3A 1PIV1 4RQPC 3FBYA 5FP4A 4CP0A 2WLQA 2FCUA 3K77A 4BMEA 2CGOA 2P6CA 4Q0SA 1TE1B 3I97A 2W52A 5JI9A 1BLZA 3GNEA 2Y64A 5FIXA 5C4WA 1ZBE2 4AVVA 2YMZA 4FAHA 4OHXA 3THTA 1YIPA 3JD72 3AL6A 1XYNA 3DUIA 4OQ8A 1GLHA 3J8F2 4LR4A 4CXXA 2QQNA 3MLJA 4F8AA 3RZHA 4QMAA 3NAPA 4N8MA 1LENA 3GZUC 4J1WA 4OUEA 2JD4A 3N3HA 3KGZA 1NE6A 1S0EA 4JKLA 2VXRA 4V2WA 5D21A 4AXOA 4E2SA 1PGW1 5KR7A 1UZVA 3OYWB 3SITA 1HDKA 5JI7A 4JHZA 1PNGA 4FPHA 4I01A 3EBRA 3L9JT 2VE1A 4B4RA 1RUC1 1VRH1 2D3PA 1AXYA 1REEA 1XE0A 3VD3A 1ODMA 2J42A 2VAUA 4CCDA 2VXJA 3I3BA 3PUQA 2E53A 1LOAA 2WNUC 5JZGB 1SLIA 1EP0A 3H7YA 1H8TA 4WV8A 1XE7A 4ZU4A 5DDJ3 5FXXA 2NMNA 1MZ6A 5C8WA 5DAPA 3ZYJB 4BE3A 4IV3C 5I0RA 2CGPA 1JYCA 4YG0A 1J3PA 3QOPA 1OHFA 1IPJA 3E6BA 3ZFEB 4NHYA 3WNXA 5F3IA 3IKWA 4B1LA 4AR2A 1BVP1 1Z7S2 4BB3A 4JGYC 1V00A 4MGQA 3B93A 5FZ7A 1SEFA 4XFBA 3VD7A 5FPXA 1UN1A 4IEXA 1QKQA 1V6KA 1SFPA 1WD3A 1XU1A 4INDA 2R071 2NPIA 3RPQA 1W6MB 1CAVA 1W9YA 1UU4A 2CL2A 4AFCA 4Y1XA 1OOPC 1YI7A 3D0SA 4QGMA 3H8OA 2V73A 3ZXJA 4XW3A 3TAYA 3INAA 5C33A 2R6QA 2VOKA 2ZKNA 4AVSA 3WNLA 4NIHA 2GMMA 3D6EA 1QXPA 2A73B 3KLSA 3ZYGA 4A7YA 3FLTA 1UY0A 3C3VA 1RYYA 4NHXA 3DXUA 1BXHA 3THDA 4D6RA 3A22A 3HEIA 4ORFA 1O3SA 4QKNA 4XFAA 1GKBA 2C24A 3AYCA 4PBPA 3VZMA
chains in the Genus database with same CATH topology
5FQ0A 4BCUA 4OHZA 1FAYA 4CDUB 5FO7B 4TWTA 2Q0AA 1TMF1 4LO6B 3OGGA 1C5HA 1U5IA 1UPSA 4PDWC 1NOVA 4R9CA 4Q0QA 1PNFA 1SDWA 2NLRA 1LHVA 3O14A 1SFNA 2DV9A 4I09A 2MPFA 2ENRA 4EN8B 1PM7A 1D0GA 2ZGQA 5T55A 4BLIA 3ES1A 4AFMA 2VG9A 5JDBA 1FT9A 1I5ZA 5F1RA 2VNOA 4N43B 3VN4A 5KC6A 3L2HA 4W6YA 3MIGA 1FPN2 1LECA 4M01A 5BPXA 2OVUA 4QQ2A 2VUAA 2CAUA 1YFYA 4H55A 3S30A 4HPKA 1ZRCA 2XBO2 5JIUA 3OY8B 1BEV2 5E88A 5A3MA 1UZZA 1CPMA 1VRH3 3UL2A 5CBLA 4C0HA 3RWNA 3U11A 3ZMNA 4Y26A 1WCSA 3BTAA 4JRLA 3ZO0B 3AJZA 1WW7A 2HYKA 2YPJA 2PLV1 3AKSA 4HK8A 4DPNA 4YW5A 5JZGA 4M3CE 1XU2A 4EROA 3IIAA 3ZFGB 1PK6B 3LKJA 2NN8A 3K48A 3JQWA 2A6WA 2R073 5D1IA 3CJXA 3NV4A 3G7DA 1QDOA 1C8M1 1F2NA 2BYVE 3FFZA 4IV1C 1WLWA 3AP4A 2YGLA 1Q8QA 3VHNA 2BFUL 4D94A 1VBC2 3G6JB 5BNPB 1YLLA 1LHOA 4AEKA 4YW4A 1W6MA 1C4RA 1X36A 2E51A 5E16A 1ND2B 4LLOA 4ES8A 2A70A 2Z79A 3V65A 4CTEA 3JZVA 3PMEA 1C8NA 1N3OA 1DGLA 1R082 2HWE3 1TMF3 1WW5A 1YIFA 4OFGA 1RUI3 5FAXA 3KSCA 3FJSA 1IHMA 4LA3A 2ZGRA 4YW1A 1BYHA 1QU0A 1KITA 3QH7A 2D5FA 4WZFA 4CDUA 3KCYA 4Q4W2 2IFRA 1IZ3A 1NA1B 3VL8A 3PMSA 1QQP2 2ZHMA 3MEPA 5JSPA 1WMEA 1SQ4A 1MEC3 4RHV3 1CAUA 1SLLA 1OLRA 2H6CA 2BFUS 4XJUA 2ZAAA 1HQNA 5KXCA 5EYYA 1X7NA 2FBEA 3BODA 1DZTA 3MGUA 5CIRA 4EJRA 4KWKA 4CEYA 2ZMKA 4BHPA 4CZSA 2VPVA 3NKGA 1MVEA 3WX5A 1QWRA 2JG9C 3I54A 2ARBA 2I74A 1RUNA 4COZA 5AVAA 4BA6A 3CF6E 4ONUA 1HRI2 2ZX0A 4OLLA 1NCQB 3HMYA 3TOJA 2BNNA 4FPYA 1H0BA 3HT2A 2BGCA 3R4SA 5GJ6A 3WUCA 1C8M3 1H1AA 1BCXA 2XPJA 2WZR1 1C5IA 4KU7A 4FQZA 1EYBA 3PTYA 5FLIA 2JJ6A 1YFWA 5C4WC 4AVAA 2A6XA 1CQ9A 1G9AA 2HWB2 4JQRA 1WD4A 3NAPC 4OHYA 2A3XA 3R6SA 3MFCA 5EV7A 2PAKA 3CJIA 3ZSJA 1SCRA 4FOWA 2PHUA 5BNPA 1DG6A 1YFXA 1GSLA 1OPOA 2IWGB 5JR7B 3SCGA 4A7ZA 5DDJ2 4I0WB 3WQ7A 1NZCA 5AVPA 2RHPA 1GBGA 5DG1A 4YZ3A 4ZKTB 1H8TC 3WP5A 3AK0A 2GNMA 4EWAA 3E6DA 1R1A1 1J58A 2A6YA 1D4VB 2JXAA 4NR1A 2CV6A 5GZCA 5I93A 3T1MA 4AVBA 2PQQA 1JW6A 1MS1A 5JPMB 1WW4A 5HCAA 2QQPA 3J8F1 1AUYA 2VNGA 3RI8A 5C8CB 4LBKA 1MS0A 4XF0A 3MW3A 4YGBA 2DCTA 4AI8A 4FPLA 2W08A 2D43A 4F83A 2VGDA 1JTZX 4HANA 2I07B 3NWKA 2HWD1 4PQ9A 3ROUA 2G9FA 3D8CA 5ABJB 3WZ1A 1RVF1 3AZWA 2OUJA 3V0BB 1W2UA 4XFGA 3W58A 1EY2A 1S2KA 1WBLA 4B3NA 1MS5A 3J9SA 3CU7A 3WOGA 3WHUA 4NOTA 1I1EA 3H1WA 1KJRA 1F8VA 2D6PA 1C1FA 1FOD1 1YHFA 2Q5TA 2WZR3 3VBOA 2D40A 4LBJA 4KG8A 3AX4A 3ZXLA 2PHWA 2HWF1 3WV6A 3M1HA 1PGW2 1CD3G 2PHRA 2QKDA 1V6JA 4GALA 2YDEA 1XYOA 3ETQA 4RS5B 3RJRA 1RUC2 1VRH2 3D4KA 3ELNA 4H14A 1IKQA 1FMD1 2D6KA 2A5ZA 4AHWA 2XJUA 3WT3A 3WDTA 3KQRA 1VB4A 4AEDA 2XH6A 1DGWX 2ZX4A 2DU1A 4YRDA 4CDQB 2RM23 1W6OA 4Q4Y3 3RJ2X 4XTPA 2GALA 3ZIXA 2WC2A 1R1A3 1AR61 2BUKA 4XQWA 3R4DB 5CAZA 2RS53 4WM7B 1DBNA 2VQ0A 3CNAA 2R072 1GICA 1R091 2EXJA 5JZGC 3AJYA 1H9PA 3NV2A 1MS9A 5ACA1 5CG9A 1U5XA 3M3OA 4IEWA 4N53B 2ARXA 1ENQA 2RMU1 4MLOA 3IWZA 2XVKA 5L36A 2HWD3 2XBO1 4N90A 2WKKA 4QM9A 5BV6A 3B5LB 1RVF3 2GU9A 1BK1A 1S0FA 5BNOA 3AMNA 5C8CA 2W0XA 5DUXA 5T5PA 4P9IA 4GIQA 1F5FA 1DQ2A 1SBEA 2HWE2 1TMF2 1VBD1 1GZ9A 1RUI2 5ABJA 5GZGA 2AZ5A 2GH8A 4CP2A 1DLLA 3FLPA 2DUOA 2PYTA 3UKTA 4Y20B 1RINA 1FOD3 3FC0A 3LA7A 1UAIA 4XF9A 5BY5A 4KQ7A 1H4GA 4IERA 1J59A 1POV0 4Z82A 1GZWB 3PHMA 4CDUC 2PFWA 1MEC2 4RHV2 4CDXA 2HWF3 5K0UB 5A33B 5I91A 1KXGA 2GN7A 3ASIA 4CDWB 1H8VA 3RSJA 4P5HA 1MACA 5TSWA 5T54A 3ILNA 5KHKA 1FMD3 4Z07A 4B4QA 1UF2C 1ZZBA 4TLFA 4AQ6A 3TN91 4DNYA 4Q26A 3RZZA 5JOWA 1AZDA 1LCLA 4CEYC 4B4PA 1WLCA 3AYDA 4YW2A 3OD0A 1AR63 1QOTA 2IXCA 1YWKA 3I59B 1Q56A 4YVSB 4P9GA 2Y38A 4XQ4A 3SH3A 4R9BA 4HBNA 3I4IA 2Z69A 1NQDA 1R093 3AYEA 1Y3TA 3KT4A 4Q1PA 4CDQA 4N7IA 1HV0A 1HXS3 1VBE3 1W6PB 3GBFA 3ZXEA 1JYIA 3GZAA 4LUKA 4CRQA 1C8M2 1FI2A 2WNVA 2DU0A 3URFA 4JV4A 2MHFA 3M3QA 3U0ZA 1I6XA 2SBAA 2RMU3 1BBT1 1OI6A 1RJ8A 1AR91 1O5UA 5L7OB 1COV1 1ZZ9A 2JDZA 1XRUA 4DMIA 3OTFA 3ZSEA 5BNQA 3TWIA 2F4PA 2EAAA 1J3QA 2R1BA 3WG2A 1RL3A 3MYXA 2V5YA 2DCZA 4EN6B 3U07A 1UZYA 3SCHA 1LB2A 1FV3A 1OFNA 2PAEA 1ONAA 1MQTA 1VBD3 4R4ZA 2X8KA 3KZ4C 2AYHA 3POYA 4MUVA 1XXNA 3CJIC 3SISA 5BNPC 1PZ9A 3ACLA 3EHKA 1DYKA 3NVCA 5CFCB 3TBDA 1J1TA 1JHNA 2X5IB 3N36A 4QXKA 2CWSA 3UJQA 3B7MA 2D6LX 1GFF2 3OF1A 4MXVA 5L73A 1ND3B 1JXNA 4LBQB 4LTAA 2XJPA 3LSEA 4IETA 1LOFA 2KA3A 3R4UA 2ZJCA 4P14A 3AKTA 2WIIB 4C90A 1NY71 3FWEA 5GLUA 1GZWA 4XHBA 3WD5A 4QGLA 2ZACA 5K0UA 5JLVA 4LLFA 1Q8OA 4XFIA 3TN93 2Q1ZB 4CDWA 3ZXGA 2DVFA 3KT1A 1TME3 1W6NB 1RUD3 3KGLA 4HK9A 3VBRB 5C6CA 3DPRB 3CLPA 1NXD1 1FNYA 2QE3A 2W39A 2QZ3A 2ATFA 3FHIB 3WDXA 4K40A 4FTBA 2H0VA 3WDYA 1S0CA 2JKBA 4YVWB 1D2QA 2A3WA 4QPIB 3ES4A 2YHJA 5C9AB 3ILFA 4AW7A 1XYPA 2ZGSA 3JBG3 2WT0A 2WZR2 4AEJA 1H1MA 4HKOA 2PAMA 3E5XA 3NV3A 4YVSA 3VBSB 4KWLA 4GMP3 1AR93 5GM0A 1COV3 3SLIA 1S2BA 3VBOC 1AR71 1V70A 1IS5A 1G9DA 4Q4X3 1W6PA 5EYXA 4LE3A 5J98B 2D7FA 4YM2A 4AGRA 3M7AA 1GNZA 3BCWA 3U10A 1PO11 1D0HA 1CONA 2PHLA 3THPA 4M3CB 5L7OA 3WP3A 4I3GA 3KD4A 4HZFA 4N9HA 1KDKA 1CIWA 5I8TA 3K51A 2RM22 4YZ2A 4Q4Y2 3BIWE 4AEDC 1R1A2 4D7YA 1QH6A 4YG3A 1RMU3 4QU2A 2NYYA 2RS52 5FCCA 5J48A 4GH4B 4DS0A 3RMYA 2R1DA 4YFZA 3N7JA 1AX1A 2PHXA 5D8AA 1ALYA 3MIHA 3MIEA 1QY4A 3B3QE 4S2DA 3VZLA 1RHI3 2NZ9A 5FREA 1VLNA 4K1ZA 4ASLA 2X5IA 3FFQA 4S2HA 4IEOA 4D3WA 1AF9A 2PHFA 2E9QA 1O7FA 2HWD2 4P9XA 4DQAA 1O91A 1ND3A 1DDLA 1RVF2 4LBQA 3M3IA 2GMPA 3B00A 3RNSA 2GN3A 2GSYA 1AHSA 4NHMA 2GMEA 1Y7BA 4ATFA 2PHTA 3QACA 1QJZA 1QJY1 5BNOC 5C8CC 4FPFA 4E2GA 4JAAA 5IK7A 1AXZA 3AXEA 3QLQA 4HLTA 3SH4A 3MPPG 3WVJA 5F9TA 4Q27A 2DWRA 5E1RA 1I3HA 2DURA 4HKWA 4S2GA 5ABJC 3AFKA 1Q8SA 1W6NA 5KHJA 1EPZA 1FOD2 2WFF1 4K21A 1DGRN 3DPRA 1O4ZA 5T3NA 4L99A 1HX6A 3AMMA 2C0ZA 1PVC1 1JH5A 2HWF2 2DFCA 2MNGA 1AR73 2QVSB 4L9BA 1O5LA 3AZVA 4QPIA 3V0AB 3WLUA 3A4UA 5EFUA 4CDXC 2QZ2A 1H2LA 4HVOA 3VBSA 1PO13 1FMD2 1RIRA 2UU8A 1WMFA 3O12A 4R9DA 1GZCA 1EV11 5DZEA 5J7MA 3WG4A 3JCIA 4EWEA 4K9SA 5T5LA 1NCRA 1I9RA 1YCIA 2HWE1 3WR0A 4AYUA 4CP1A 1RUI1 1NXMA 1Q8PA 3ST7A 1AR62 4IEPA 4LBQD 5I0UA 5B2GB 1QNWA 2UY8A 3AB0A 2HWC3 4WM8A 5DG2A 1R092 4AGGA 1HXS2 4OULA 4XF4A 5BXXA 5ACA2 4FXKB 1MEC1 1VB2A 4RHV1 4CDQC 4DXZA 2IXHA 2RMU2 2Q8OA 3BU7A 3WP6A 2WNVC 3VUOA 4XBNA 3TYJA 4MXWB 4HVRA 1AXKA 1LHWA 5T52A 1KJLA 2FQPA 3FLRA 4Y24A 2W68A 3TNQA 1APNA 3QCWA 3S6PA 3USUB 5DZGA 5JWPA 1DYPA 2R0HA 2Y0IA 3OYWA 1VBD2 1QJY3 4D7SA 1SLTA 1GV9A 2VMGA 3LZZA 4ZXKA 1MQTC 1ZA4A 2R063 2RJLA 4DZGA 1CPNA 1N1TA 2WFF3 4PCRA 2DVGA 5CG8A 2BBVA 4JC1A 1WMDA 2Q1MA 4JRAA 5K7PA 4YARA 4HT1T 3ZFEA 2D6NA 4L92A 2UWBA 1PVC3 1H2NA 4F7ZA 1K5MB 1ZYBA 5DUWA 4BLJA 1M06G 2DUPA 3MIFA 1WA4A 1LEMA 2B46X 4L97A 3GHNA 4MV2A 1VBB1 1LOFC 2D97A 1DGWA 1EV13 4L2NA 4Q0UA 4XFFA 3GZTB 4MX3A 3TN92 2ZMLA 3VDDB 3DF0A 2YUEA 2PHDA 1AVBA 1AL0G 1TEIA 3H3UA 3FMGA 4COUA 2GC1A 5K0UC 1TME2 4NHKA 4NWWA 3H1YA 3ZFFB 4CDWC 4M0NA 1AJOA 2O1QA 4ITCA 3KT7A 5IT6A 1O3QA 2BEOA 4IXLA 1OSGA 4W6XA 3JBG2 4ISQA 2IC1A 4Y1YA 4AHZA 5FMOL 4YM3A 3HQXA 2HJIA 3MPBA 1BBT2 1HIXA 1AR92 3M8LA 3MICA 1COV2 4MH0E 1KS4A 3EJKA 1H9WA 1LU2A 2XKOA 4YVSC 2EVXA 2UWCA 4N43A 1Y43B 2ZX3A 2RR13 3AKRA 1ASJ1 2LTNA 1MS4A 4MGIE 4QQLA 1IS3A 2IXJA 4BMBA 2QJVA 4AGVA 3E97A 3OY8A 4MXWA 4YZ5A 3VBUB 4XJZA 5BNNB 3M70A 4SBVA 3RYKA 5L7OC 4LE4A 2R043 3WDWA 5KHGA 4P9JA 3USUA 1HLCA 1ULCA 4AHXA 2DFBA 2PA7A 1RMU2 2R0FA 4RGAA 1CJPA 1T6GC 2Q4SA 1G7YA 4JDMA 1G9CA 3WW2A 4JVAA 1JBCA 2EIGA 1KS5A 4OHWA 3ZIWA 4O9GA 5FMOS 1TNFA 3ZFGA 2WLPA 1PK6A 1YRZA 4DOUA 3PVOA 2VW0A 2WJSA 4LBLA 3OBRA 5E89A 1NY72 5D8AC 4JTOA 1V9U1 3S7EA 1PZ8A 1VBB3 3ZYRA 5T50A 3LGRA 2X5IC 4S2FA 5I0SA 1ULFA 1RB8G 3ECQA 3WDVA 1OLQA 2GC2A 1ND3C 1ND2A 5I0TA 3QBQA 4PJYA 2XHKA 5JSOA 1GYKA 1J3RA 5CFDB 1LOEA 3VHRA 2WT2A 4CEWB 1JUIA 4QT6A 2XJRA 2RM21 1MVQA 2WQZC 4Q4Y1 1RITA 2XL7A 4TYSA 4RQPB 2QDNA 3VDDA 4MGKE 4PBOA 4NVPA 2PTMA 1UKGA 2RS51 4LO7A 2QUOA 1G9BA 2AH2A 2TNFA 3W59A 4GWMA 3APBA 1CAXB 3WINE 2Z2SB 4IL7A 3AXDA 3VKOA 1S0BA 4ZU7A 3DPRC 5CB7A 1AJKA 1AR72 1NA1A 4P9YA 3N35A 4XTMA 3T1LA 4IESA 1Q5OA 1X50A 2YC0A 1ASJ3 2YGMA 3SMHA 2BNOA 1PO12 4QPIC 4YZ4A 2Z5WA 1DIWA 4XMAA 2JE7A 2WNUB 1NLSA 2ZA9A 2E7AA 2VOWA 3VBSC 4Q0PA 4G4FA 5KXDA 1CGPA 4IV3B 4DB5A 1MZEA 4FOVA 2Y26A 2ZBJA 3E6CC 4C1XA 2CWMA 1NCRC 2ZGUA 4BZ4A 2B8MA 4XHXA 5KBFA 1LTEA 1R1ZA 4AQ2A 2ZHLA 4IEVA 1DZQA 4EN9B 1M4WA 1EAH1 2Q30A 3RDIA 5BNNA 3HAGA 3FBMA 4K7JA 3ZXAC 2DCJA 5AFEA 1NCQA 4HFSA 1WUVA 1OOPB 4HL0A 3EO6A 4WM8C 1CAWB 2TBVA 2WNEA 2ZX2A 4AE2A 1IS4A 2XWJB 1V9U3 2P3KA 1W39A 2WT1A 3S0MA 3ZSMA 5JVVA 1WBFA 3POSA 3LSDA 2P34A 3DL3A 4KNCA 4NPRA 4BIFA 2PN5A 4XJWA 4FOQA 1HW5A 4NN0A 4Q1RA 1LRHA 4IEUA 4BYYA 1QJY2 3JU9A 4QM8A 3ILRA 1V6MA 4XMIA 2QDRA 4PDWB 5T5JA 2VVEA 4XFHA 3FZ3A 3B02A 4I0BA 1ZZCA 4RR3B 2R062 5J37A 4RSUA 2B42B 4ES9A 2WFF2 1GR3A 2ZMNA 2WFPA 5DXDA 1S55A 4Z92B 1FXZA 2YYOA 3IMNA 3IDBB 4AI3A 2VVFA 2XUMA 1HXS1 1VBE1 4KG0A 1KFXL 4I3PA 1PVC2 3MIBA 3SCFA 5DUVA 5HI0A 1RUE1 4KGGA 1F9KA 1W6QB 4UBHA 2UYAA 3ZFEC 2XJTA 4EV0A 4MGYE 3NW4A 2OA2A 3CO2A 1OQ1A 1EV12 4QPGB 3N7KA 1SLAA 2JEMA 4R52A 4YGCA 1YXWA 1ZX5A 2ZX1A 3FE5A 3VZKA 3U4XA 1D4M1 2GZWA 5IK5A 1YYNA 1G6NA 1O4YA 4QX5A 3KM5A 1RUH1 3V0BA 4KBBA 5GZDA 4FTSA 1EAH3 1V6IA 3ZXFA 2EAKA 1G86A 3D0JA 3ZSKA 3IDEA 1BJQA 1CR7A 1BQPA 4E4ZA 4IV1B 2XLAA 2YXSA 1A6CA 1RGSA 1MS3A 3IT8A 4XQDA 2B5HA 1A78A 4X8NA 3J26N 1LOCA 4I0AA 1IQAA 2IXLA 1KFUL 1SFYA 4XXAA 2XVLA 2HKXA 5GLTA 3V64A 3OPZA 3MLKA 3VHPA 4N43C 2VW1A 3POWA 4AEMA 5FOBB 2BWAA 2QCSB 3H50A 2D3RA 1AX0A 1OD5A 4RS5A 4DY5A 4OUMA 1TME1 4BM8A 1RUD1 4BQ1A 1POV3 4M00A 2OYZA 3V56A 5FO9B 5J3UA 2K0GA 2R042 2FMDA 3KCCA 2YROA 1S0JA 4FSJA 4UXAA 4PLMA 2OZJA 3DV8A 2IXKA 3AZXA 3UV9A 3VZNA 1QJU3 4AQTA 1OQDA 1PHMA 3JBG1 1NE4A 1PO21 3OBTA 4RR3A 4E9KA 2HEWF 1RUE3 2XLGA 3Q9OA 1QJX3 1UL9A 4WM7A 4GMP1 2AGSA 4YM0A 5H9SA 3M3CA 2D98A 1VBB2 2XGXA 4GB31 4UW6A 1PK6C 4WVVA 4Q4X1 1QDCA 3ZFGC 2BW8A 1XNKA 1FATA 4B7EA 1VAMA 1SLBA 4JDOA 4LO5B 3VKLA 4N53A 3VZOA 3AM2A 5GZFA 3P3NA 4PIYA 2JG9B 2LALA 3HT1A 3KS7A 5GLWA 1FPN3 2EF6A 1D4M3 4BWOA 1CESA 2VW2A 4A2UA 1AYM1 2RE9A 3OGJA 3O0XA 1RUH3 5CU1A 3GBWA 2DF7A 4C1WA 2HEVF 1BEV3 1NQJA 4HVQA 1ND2C 4QPGA 4IEQA 3RYRA 4M0HA 1ULEA 2ZZJA 2ZGLA 1RMU1 1NLRA 4ISRA 4C0BA 1OA3A 2WZPP 5LEJA 2OIIA 3VDDC 4PLOA 5KHHA 4I2OA 1SACA 3LOIA 3MF6A 4XIKA 4PIZA 2K9ZA 2V09A 1WLTA 1RUJ1 4Y20A 2DVDA 1RHI1 2A75A