3ZYBA

Crystal structure of pa-il lectin complexed with galag0 at 2.3 a resolution
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
121
structure length
121
Chain Sequence
AWKGEVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHPDQGLICHDAFCGALVMKIGNSGTIPVNTGLFRWVAPNNVQGAITLIYNDVPGTYGNNSGSFSVNIGKDQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PA-I galactophilic lectin
publication title A Glycopeptide Dendrimer Inhibitor of the Galactose-Specific Lectin Leca and of Pseudomonas Aeruginosa Biofilms.
pubmed doi rcsb
source organism Pseudomonas aeruginosa (strain atcc 15692 / dsm 22644 / cip 104116 / jcm 14847 /
molecule tags Sugar binding protein
total genus 22
structure length 121
sequence length 121
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2011-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07828 PA-IL PA-IL-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 3zybA00
1OKOA 1WZXA 2KR2A 4LKFA 1W90A 1OH3A 4LK7A 4BQ3A 3ZYFA 1W8ZA 2Q1FA 3UT0A 1W9FA 1UOJA 4YW6A 4CP9A 1WCUA 1W8WA 3ORJA 2C24A 1L7LA 4CPBA 4A6SA 1HN0A 1GWMA 4LJHA 2JWPA 3ZYBA 1V0AA 2LRPA 2VXJA 4AL9A 1W8TA 4BQ4A 4BQ2A 2WYFA 4CPBD 4CP9B 5D21A 4LKEA 4YWAA 1W8UA 2LROA 4LKDA 1GWLA 4LK6A 2O14A 1GWKA 1WMXA 3ZYHA 4BQ5A 3F95A 2K46A 4YW7A
chains in the Genus database with same CATH superfamily
3VBUC 5I91A 4GKYA 3PURA 4MYEA 5DG2A 4FPEA 1QXRA 4OFGA 5JZGC 2R062 5K0UB 4XF1A 2X05A 4HETA 4CRQA 4URTA 4URAA 5EPAA 2GMEA 1YXWA 1HB1A 4E4DX 2BFUL 3CJIC 1MZ5A 4DUWA 3BN6A 3CHXA 1C8NA 3MI8A 2WSVA 3ZN5A 5C3QA 4EWDA 1O3TA 4N8MA 1RUD1 3KS7A 4DS0A 4BLIA 5B4NA 5IT6A 3SH4A 3AVSA 3HJRA 3A0NA 1D4M2 3PUQA 3C7GA 4IV3C 3I3BA 1GZ9A 2Z5WA 3WNOA 2VQ0A 3ZYHA 2EXHA 3VHOA 4LHNA 5DAQA 4XDQA 2B46X 5CBLA 1F31A 2XJRA 3ILRA 1YEWA 3O1VA 4LBOA 2B42B 3MIHA 2R6QA 2R061 4E9KA 2D98A 3TEWA 5KHKA 4AI3A 4BXFA 2LS6A 1QF3A 4ZHNA 3E6DA 3KCXA 1HX6A 2P6HA 4H7LA 4KBBA 4LJHA 4AVVA 4ES8A 2D97A 2VH9A 1UYYA 1S2BA 1ZBE3 1ZRCA 3NKGA 2JB4A 4HFSA 3MUY1 4FQ4A 3J8F1 4XFBA 2GMMA 1D4M1 4GKXA 1L7QA 1VBD3 4XBQA 1YCIA 2IWGB 3LOIA 1YQ6A 2QCSB 3ACGA 4HVOA 1UU5A 4COUA 3AK0A 2VTXA 1RUH3 4Q0VA 1RUF2 5FDBA 5FZ6A 2WDBA 1PNFA 4FP2A 4IV1B 4GXLA 4IGOA 1LOAA 4G4FA 1PX3A 3CU7A 5A7QA 1ND3C 1CGPA 5C7GA 5JLVA 1JW6A 1H4HA 4MOAA 2FZ1A 5D8AC 2VG9A 4LO8A 4PIZA 2JEMA 2CDOA 4DY5A 5LW9A 5FBJA 1EV12 1JYIA 1XNKA 1S0JA 5LBFA 4AW7A 2V09A 3SCGA 4SBVA 4UI9L 5DZGA 1JOBA 5ACA3 1Q5OA 3AMHA 5FZLA 4KL1A 1O7FA 1W03A 1H6YA 3NRUA 2QZ3A 3HOBA 1ZRFA 1QY4A 1RTVA 2VZ3A 3WQ1A 2OQ6A 2RS32 1K5MC 1KXGA 1LNSA 3M70A 4PBOA 5ABJB 3QD6A 1CZVA 3OGJA 3PMEA 3B3QE 1PNGA 3GCXA 1PVXA 1RHI3 4HK8A 4AI0A 5C3OA 2PTMA 1WW6A 3H3ZA 3D0SA 4JGYB 4Y1XA 5CG8A 4CP9A 2E7TA 3LDRA 1UD1A 4QMAA 1O5LA 3UKVA 2UU8A 5FOBB 1K45A 2CGOA 1R1A3 3TEZA 4Y4RA 1RGSA 2BQPA 4IDZA 3AM2A 1NG0A 1WGPA 1JXNA 2TBVA 3POFA 3Q9OA 5FLIA 5FP4A 1LEDA 5J7MA 3B93A 4BQWA 4YZ4A 3OB8A 5FZ8A 1O4ZA 1ZA7A 2P34A 1Z7S2 2H6CA 2ZBJA 4YZ2A 1BJQA 2VUJA 2RS31 2WS93 3BODA 2Q8CA 5IYYA 3K3OA 1I9RA 3VBHB 1AR92 3VBFC 3NJVA 1LHUA 5HXMA 3ZFGA 5FRAA 3RYKA 4CEYB 4TYSA 1V9U3 1C28A 4XE9A 1CAWA 3OGSA 5LK7B 4XIKA 3C8XA 3ZIXA 1HV1A 4PBPA 3PJQA 3HNBM 3HAGA 3N3HA 5CKQA 5F2SA 1W06A 4XFCA 3NJXA 4META 3T09A 1U5IA 5IVVA 4RS5B 1PX4A 4HKWA 3WEZA 2JDAA 2NP0A 3LEKA 2WN3A 3PUHA 3WP3A 5KBFA 4Q27A 3WG2A 2VMIA 1W6NB 3OGGA 4B3NA 3VL9A 2HWE3 1SLTA 4KQ7A 2YXSA 3L9JT 4FPJA 4J1XA 2P3YA 1REDA 4GH4B 1RUE1 3DYPA 4LE4A 1PO23 1JHJA 5T50A 4EN8B 1DCSA 3L2YA 2PFWA 5HXVA 4AEMA 1AF9A 3DEMA 4BIOA 4Q4V3 3ZN6B 5AC92 4XUPA 3ZSKA 1LAJA 4OQ9A 3HT1A 1W6MB 3OF1A 1OOPA 1XYNA 5BUVA 1W0PA 5GZCA 4MHRA 4BCUA 3O1RA 4DXTA 4BOWA 5JI9A 3VZOA 5IHRA 1NQDA 4OMCA 1ZBE2 3NV1A 4RL7A 2WZEA 3BKZA 2L9LA 3IM0A 4NIIA 1ODNA 2FQPA 1LRHA 1O3RA 2HLEA 2MHFA 1VBD2 2OW4A 2Q1FA 1MQTB 1UZVA 1VP6A 4N7UA 4C91A 1F35A 2DVFA 5C33A 1L7LA 5A6QA 1SACA 3LKJA 3OUIA 1I6XA 2ZKNA 1O3SA 1MZ6A 4OLLA 1CZTA 2ETEA 1AR63 4FO9A 5T52A 1BBT3 2VM9A 4YGDA 3SH3A 5FR3A 2BWCA 2WZPP 3VZNA 5JPMB 4JHZA 2YHJA 4D0QA 5FO9B 4WM7C 2HKXA 5KXBA 4Q5OA 1KDMA 1RC6A 4QQLA 1W9WA 1UKGA 3VGIA 2BNOA 1HRV1 2JE8A 5A3UA 5FQ0A 2DBIA 1JUIA 4J1WA 4I01A 2IZWA 1ZBE1 3NJZA 1X9TA 4RQPB 3LAGA 1D2QA 4QX8A 3LEIA 4XTMA 3WDVA 4HN0A 1CQ9A 4LK7A 2E63A 1VBD1 3J7HA 3MV11 1G8WA 4UBGA 5ACA2 1OVSA 1Y43B 2W95A 3BPSA 5FOJB 3NAPC 1V6MA 3OBZA 1W28A 1T6GC 1RUH1 4LO5B 3NNMA 4W6WA 4P9JA 1X8MA 5FZGA 4OI2A 3RMYA 4FFHA 4XBNA 3NV2A 3RI8A 4K1ZA 1E5SA 1VAMA 3K75B 4R9AA 1QJY3 3FLPA 4NPRA 3QOPA 5FWJA 2XLGA 1H8TC 2CAUA 3HWJA 1Y4WA 4RR3C 1R1A2 3FN9A 2OX0A 5GJ6A 4LULA 1W6QA 5HV0A 1DYOA 3MHZA 4TZDA 5FXZA 3ZVXA 3HVDA 1SPPB 3ATGA 1GP4A 3ZDSA 4E4SA 3WG3A 3ZYFA 1W8ZA 4KWLA 4ZY9A 4OUMA 5CFCC 5F8PA 3OTFA 2WS92 5C8CC 2R0HA 1XYOA 2GNBA 3AX4A 1JYWA 4CU8A 1MVEA 1RHI1 3KVBA 4M00A 2HBTA 1LU1A 3MLJA 4FPGA 3P6BA 1OQEA 5IK4A 3VKFC 3AKSA 4N53A 5IVBA 1V9U2 1RYYA 2JG8C 3T3YA 2FDFA 2FBEA 2VZPA 3F2ZA 4CSWA 1H1IA 3RZJA 5IVEA 1W2NA 2BV4A 1GSLA 2XLAA 3FHQA 4EWAA 4MLOA 1NE6A 1ND2A 1OUSA 2A1XA 3MF6A 3WLUA 2E51A 1ZVFA 2X09A 5K0UC 1OQDA 2P2KA 4FPOB 3AMNA 3D8CA 3LQCA 4NHXA 4FTBA 3CF6E 3DUIA 1YHFA 4F83A 3VBRC 3RYRA 4PDWC 2WS91 5FUPA 4KI5M 2GNMA 3LIGA 4NE9A 4YVSB 4MH0E 2D44A 3GF6A 5IJRA 3HN3A 4XHXA 2DCJA 3VD5A 4AQSA 4E2SA 4EZ4A 1W6PA 3ZXGA 2HWE2 3UGGA 1QNYA 4MZUA 3UKTA 1N1TA 4CXWA 2XH6A 3GYDA 1EAH1 2D43A 3I2HA 5LASA 1NCRA 3THCA 3VBUA 4EV0A 3WHUA 1PO22 1WMXA 4HPKA 4ZZ8A 1SCRA 4E4HA 2ARCA 3NV3A 5BXXA 1H2MA 4Q4V2 3M1HA 3KD4A 1GP6A 4I3PA 4IE5A 3R6SA 3CJIA 1SCSA 3U14A 4YARA 3KGLA 3K51A 3KGZA 3BU7A 1QOTA 3IIIA 3RZZA 5GLZA 1OF4A 4HK9A 1H9PA 1CPNA 1O8SA 4P08A 3TWIA 2OVUA 1BK0A 3K4ZA 2RM23 4GWJA 4Y5TA 2VQUA 4IV3A 2A71A 2IVJA 4AVTA 3RZHA 4M4RA 4CEWA 3DKWA 1K5JA 3VHPA 1OA3A 2A3XA 4NPMA 4K6BA 5G04L 5APAA 1J3RA 3SXWA 1FI2A 2GAUA 3M3CA 5EV7A 3VD4A 2YPDA 2R1BA 1RUI1 1BBT2 3N9QA 1H1AA 2GN3A 4Q4V1 1W90A 5FY7A 3MUZ1 3H7JA 4PLMA 1O3QA 2QUOA 1QJU2 3POSA 1DU3D 4MX3A 4P9XA 1YI7A 4QT6A 5BNNB 1ULFA 2K0GA 4CE8A 5LRSA 4AF9A 2ZGOA 1UYXA 4YM2A 1Y3TA 4Q0QA 5FPUA 3WR0A 5KHIA 1PM7A 2RR12 1UNBA 2MNGA 2YDEA 3AJYA 4I0BA 1CESA 4XF0A 5FCCA 4C0BA 2PHUA 4UFHA 1UYZA 4AVSA 1OVPA 1BQPA 4QX5A 4QPIB 1TNFA 5CB7A 4DINB 1LOGA 1FOD3 3J7NA 2IUWA 1U5XA 4XFFA 1AR61 4N43A 3N7JA 4P9IA 3NW4A 4WVMB 1BBT1 4XJUA 3T0AA 3ZX7A 4CCNA 4DXSA 1LU2A 1DLCA 2WWSA 1GV9A 1QJY2 3LPGA 2PQSA 2VZUA 2E7AA 4YGBA 3O1MA 5D8AA 1FYUA 3RQ0A 3ZOIA 4DPNA 4D94A 3R05A 4CCCA 1ZZ6A 3LA7A 1IS4A 1YNAA 4MO3M 2XB6C 4QXBA 1F5FA 3KF5A 1NA1B 3ME2A 1QHDA 1PVC3 3MV01 4GD4A 1MACA 4S2FA 4OHYA 3RG0A 4RFRB 4LEJA 1TG7A 1HB3A 4YW4A 1CAXB 1FPN3 3FBMA 2GZWA 2RMU1 4Q0UA 4B29A 2CWSA 5FKCA 2Y38A 3MFAA 1AR82 1X9PA 1AXKA 1REFA 2VW2A 1NCQC 2UURA 5T54A 1HXS1 4QB6A 1NY71 2XHKA 4DUVA 1U12A 5FO8B 4LO4B 1CAVA 2D5HA 4NOTA 1V6OA 4F7ZA 2WQZC 5HCFA 4BQ4A 2QQVA 3BCWA 3PNAA 4LE3A 3PHMA 2HWC1 1D0GA 4RS5C 3NNJA 3DYMA 4FVVA 1AL21 3VBFA 1NLRA 5I0UA 2VOWA 3GHNA 4ONUA 3WP6A 3VBOC 3OYWB 4NRQA 4QKDA 2V4AA 1GANA 1ZRIA 2UYAA 4IE0A 4L0PA 4CDWB 1MPXA 3WCRA 3DKQA 2D7FA 5JVVA 1J3PA 2V72A 5FYHA 1CAUA 1LULA 2BVBA 4BLJA 2XLFA 4ZS3A 3C7EA 3T2QA 1IOAA 4EYUA 4AHWA 4XC9A 1WCQA 4AZZA 4EJRA 1PK6C 1BKZA 1W9SA 5A3OA 5F3EA 2RHPA 3CBNA 1TMF1 3MO4A 4UW3A 2ES3A 1W8UA 3SITA 2VZQA 3WNXA 5BNOC 3H8RA 1PZ9A 2JKBA 5GZGA 3TEYA 1GZTA 4M3CA 4C90A 4R8HA 2RM22 1F8VA 1CVNA 1W3VA 3KCYA 1YC61 1C1LA 1HQNA 3AZYA 2DUQA 3IPVA 3LZZA 3ZXAC 4BMEA 4DB5A 4NIHA 3H1WA 2ZGLA 4FXGB 4QKFA 1YLLA 4B7KA 1GOGA 5AFEA 2P3KA 4D69A 2WAAA 3VZLA 3FHIB 2C6SA 5SV8A 1X50A 2IXLA 3UJQA 2DU1A 1GNHA 1W39A 2E33A 5JSRA 3U11A 2BZDA 3O14A 4YW1A 3WCSA 2GALA 2ZX3A 2XONA 1SBEA 1ULPA 1WLWA 2E32A 2QQKA 2ZGTA 4NHLA 2IFRA 2NZ9A 4NAMA 5K4LA 3ZFEB 4MGSA 5A6YA 3BB6A 1W9YA 4RQPC 3H8XA 5C9AB 3D0JA 2RM21 2WT2A 4ISQA 2JB8A 4CVUA 4AEJA 1BEV2 4OZXA 4QHOA 1RUC2 3H1YA 1XPWA 2HEVF 4HVRA 2AEZA 1LESA 2GC1A 4YZ3A 4C0HA 1W8HA 3GZEA 5FP7A 1DGWA 2BNMA 4LMFA 4WM8B 4NN0A 1FNYA 3CDZB 1VR3A 1Q8OA 4WM7A 3ZR5A 4CDQA 2DTYA 4QGNA 2VZ1A 3CO2A 1DQ5A 3E1F1 4ES9A 4FCAA 4MGQA 1NXD1 1HQLA 4XJAA 1F5JA 4AHZA 5FZMA 4AI1A 1SDDB 4YM3A 2FDKA 4XFAA 1DG6A 1DYKA 1YUDA 5C71A 3ZFFB 2C9AA 3NAPA 4XCAA 1CZSA 2DTWA 3I2IA 4QQOA 1AR72 4YVWC 3N7KA 4DO0A 1FPN2 4YG0A 3WDYA 1PGW2 4MXWA 1Z0HA 3IBMA 2Y8KA 1FOD1 2JDYA 4I09A 2EVXA 3AYEA 3PU8A 4ET7A 3RZGA 3WDXA 3V0BA 1KS5A 2QZ2A 1H8TA 1GLHA 3KCCA 5JR7B 3LA3A 5EHDA 3VDDA 4B4PA 4RR3A 2H0VA 2GP5A 4FSJA 4E2QA 3IB3A 1DQ4A 3DXTA 2AACA 4FPFA 4XQ4A 4D7SA 1SEFA 2PN5A 1G9AA 1PVC1 2G4IA 3WNLA 2J1EA 3GJBA 3MDPA 5FP9A 5CFCA 1FPN1 1OT5A 3VB9A 4EQVA 4FOVA 1PGW1 2A7AA 1UY0A 3ZYGA 4DY3A 2ZEZA 5JOZA 2E53A 1HJGA 1V6IA 4QXCA 5C5TA 2X5IB 4L99A 1UN1A 2G1MA 2WNOA 4H2AA 4HN1A 2VXRA 2WZR1 2C5DA 2JG8A 4IERA 4A42A 1K3IA 1RUF3 3MW2A 4BM8A 3AP4A 1POV3 4FFIA 3U4XA 2A5ZA 1LOFA 3AP5A 2W47A 3V65A 4S2DA 1CIYA 2DWRA 5K0UA 2VULA 5A7OA 3S5AA 3I2GA 4UAPA 2KM2A 4CZSA 4LOSA 1AUYA 5J3UA 4CXXA 1XE8A 2QTWB 1J59A 2ZJCA 1QXJA 5I0SA 3ZM8A 1VRH1 3IDBB 4UW5A 1JTZX 1LTEA 4PDWA 1SFYA 3EO6A 4W8JA 1KJRA 5FZKA 1EV13 1C8M1 3OGVA 2EAKA 1XSQA 3AC0A 2XXZA 5FYZA 3T2OA 3UT0A 5C4WC 4FFFA 2WLQA 4UBHA 2XKOA 2XDVA 1ENSA 1LHVA 4HL0A 1WW5A 2XJVA 2ZS6B 2ZKLA 4JKLA 3RJRA 3B00A 1TNRA 1SBDA 1YQCA 5AFBA 5JOYA 5J37A 1LKNA 1POQA 4JGZB 1Y7BA 4P00B 5FZOB 4UFKA 4LKDA 4MUVA 4QDQA 4QPGB 4XEZA 1JZ5A 4LBQD 4YFZA 1DFQA 2J1VA 3UESA 2XJQA 1KQRA 1F2NA 2FZ2A 5CU1A 3PVBB 4ZXKA 4LT5A 3FFQA 3AMPA 4NIGA 1CX4A 1PMIA 5GLUA 3B7MA 3ROUA 5FYBA 4IEZA 1NZCA 4HOOA 3VL8A 1R082 2ZHNA 4LNVA 4GMP0 2JICA 1GYKA 1ZBA1 2F6BA 3GNEA 5FZBA 5FZHA 1B35B 1GU3A 2QQOA 2VOVA 5KC6A 1ZYBA 3TN93 1Z7S3 2Y6GA 1R093 4KNCA 4FBFA 1HJFA 3U37A 3WW1A 3MLKA 3R4UA 5A6ZA 4BISA 3OCPA 1UOBA 4AFDA 1LGBA 2FHRA 1NUKA 4TXWA 1TZOA 2NLRA 4IV1A 3IKWA 4NWWA 4CCJA 5CG9A 1CWPA 2VZOA 4Y26A 1IS6A 1OXCA 1UIJA 5DUVA 5EZWA 5FFOC 2VMDA 2IXIA 3D4KA 1JYNA 1QJEA 3OD0A 3MIGA 5L73A 3W5NA 4YW7A 2B9UA 1S1AA 1NX9A 5FZ4A 3H42B 1WBLA 1NCRC 1GOFA 5IAXA 5JIUA 1YRZA 2VBPA 1NE4A 3KT7A 4JDMA 3FFZA 1NA1C 1POV0 3ZKUA 3ES1A 4YPJA 2JE9A 1PZ8A 4NHKA 5FY4A 5ISLA 4UT5A 3GZAA 2QQIA 2BVVA 3NV4A 4XABA 4XHBA 5D2AA 2BNNA 4YNIA 1ULCA 1FV3A 2YFZA 4Q4W3 4QM8A 3ZSJA 3BU0A 1O5UA 2IXJA 4HKLA 5ABJA 1UMIA 2RDSA 4I3GA 1OA4A 5F32A 1GFF2 1QH6A 1C1FA 4Y1VA 5JCTA 3PUIA 1TE1B 2RDRA 4XDPA 1L7RA 4Q8LA 5LBCA 2P3IA 1C5HA 4A3XA 4COVA 1OH4A 2R073 2EIGA 2JD9A 4CEWC 1Q8SA 1G9FA 1DHKB 3H3LA 3GZUC 2C0ZA 2FCVA 4ISRA 1H1MA 3RMXA 1U0AA 4LKFA 5CKNA 5E89A 2P5BA 3NNLA 4CDUB 2W0XA 3OOXA 5LWBA 5AC93 4A3ZA 4QU1A 3WXPA 4QQPA 1OFSA 2CU5A 4X8NA 2A6VA 4A44A 1OLMA 5FPLA 2SBAA 1V0AA 1F9KA 5EYXA 1D2SA 1JYXA 3ECQA 4MXVA 2GN7A 3VN4A 1JUHA 5CAZA 3VZKA 5LZ6A 5GALA 1NCQA 3ACHA 2VQAA 4CEYA 2E7QA 4LBQB 2VW0A 4CDWC 4LXLA 3U07A 1C4RA 5BNPB 2EXIA 3DPRB 3A7QA 5FZFA 3O1PA 4CU6A 4YM1A 1MR5A 3AL6A 1JU4A 1REEA 4N43C 2BGPA 4DEQA 1OLRA 2VNVA 2YC2A 3SCHA 4PHZA 4D8MA 4RS5A 3RZLA 3SHRA 1KJLA 1LHOA 1S0BA 3A21A 3WNNA 5DUXA 2H6BA 2EA7A 4L11A 2WT1A 4GJZA 4KGGA 4QGMA 4D6RA 3E5QA 2A6XA 5JPNB 4K9SA 1V6LA 2YBPA 2XQRA 3UJOA 4COYA 4TSVA 1S0IA 4YWAA 3VBOA 1W6NA 2WNUB 5A1AA 2G9FA 4JHTA 4J25A 4AG4A 2FCUA 4HZFA 4R4XA 3H9AA 3K4AA 2MEV3 5H9QA 4CCDA 3ES4A 3SKVA 4H55A 4LO7A 4TLFA 1AXZA 5K7PA 3MIBA 2ZMLA 1RUF1 2SLIA 3QBQA 2I74A 2QKDA 4JKKA 3JU9A 3M8LA 3O0XA 4QAWA 1IQAA 4AQ2A 4C1XA 2Y0IA 4GB32 4KG8A 4JZRA 3ZN6A 3GHMA 1ENRA 1PK6A 3RGBA 2J22A 2RS13 2ZABA 1EUTA 5FYSA 1ZM1A 3QCWA 5BNOA 1GZWB 3A0KA 4DOUA 1EV11 1W8TA 2UY9A 1R1ZA 4ZS2A 3P3PA 4R52A 1HB2A 2TEPA 2LM3A 1SLIA 2BJSA 4RN5A 1S4CA 2RVAA 1DQ6A 4AFAA 1GZCA 3I4IA 4QDSA 3TN92 2WUHA 4IL7A 1R092 1EPWA 2ZHKA 2OUJA 2ZX4A 5DN2A 1MS0A 1DGLA 5GLVA 4EN6B 3T2PA 4CU9A 4XF3A 2EIDA 3OY8A 4WM8C 4Y1UA 2UYBA 4UFMA 4NPLA 1AZDA 3KHBA 4UF0A 4NRPA 4DMIA 1YWKA 2PHLA 1QIQA 3NL1A 3CEWA 5K8SA 5FPBA 4DXZA 3BYWA 3ZYRA 3KLSA 4RQPA 4I2OA 3POIA 1OI6A 5IVYA 1CR7A 5CYYA 2XJPA 3I7DA 3NMBA 4JTNA 1UW8A 1MZFA 4Y3OA 2ET1A 3THPA 3V64A 1DLLA 1G86A 2WJSA 5DMYA 1Z7S1 1GUIA 1R091 1WD4A 3BIEA 4MHUA 3DV8A 1URXA 4IGQA 4Q4W2 4RYDA 5EWSA 4GA9A 2DCTA 2TUNA 1KDKA 4FXKB 4N9IA 1AR91 3GBWA 1TVGA 4NROA 1XXNA 3E5UA 4CCKA 4TLGA 2EICA 3S7EA 1HLCA 3WF4A 3N9LA 2E6VA 1I5PA 2R072 5IVFA 5FUIA 3G7DA 3T2TA 4LBNA 1LHNA 2WLPA 4NIAA 1W2AX 3FLRA 2ZA9A 5FY5A 2R043 3OG2A 1OHFA 3VHNA 1GQPA 5I8YA 3MBWA 3GBGA 5HBAA 3A4UA 2BW8A 1E5RA 2JDKA 4Z1VA 4IEUA 4ASLA 2YGLA 1QJZA 4YVWA 1OSGA 3JD73 1W8NA 4HBNA 4H14A 4XURA 5FP3A 2PA7A 4Q4W1 4FI9A 4DNYA 5I0RA 2W39A 3ASIA 2D6NA 2ZCWA 4BZ4A 4ZZ5A 2BEOA 3O0WA 3O5SA 1QWRA 1QDOA 4W4ZA 4YW6A 2P37A 4CDXC 1EY2A 4LIVA 4OI1A 1HN0A 2D6LX 4XVHA 3RZKA 4O61A 2IC1A 4N90A 2WC2A 1ODMA 2X10A 2VOTA 2WYFA 1UWWA 2OPWA 4Y5Z0 3M7AA 1COV3 4CP9B 1RITA 5AC91 4IESA 2WFPA 4TTGA 3FJSA 1QJU3 5KHHA 3VBSB 4CDQC 4EE2A 2NN8A 3AMMA 3O1TA 4XETA 2QVSB 3GCWA 3ZMNA 2E26A 4AHYA 3ZDVA 4EZHA 2WAOA 1STMA 1BXHA 2ZMKA 4H3WA 2HH9A 2P17A 2RR13 4ZU7A 5FPXA 3JBG3 1WCUA 2MEV2 4O7XA 4AE2A 2J7MA 2X53S 4XMIA 5J1XA 3ILFA 3SQOA 1UQXA 1VMHA 4JGZC 1JODA 3RI9A 5HCAA 1WCKA 1E5IA 1NLSA 1JS9A 1OQ1A 4UOJA 3ZXKA 3FC0A 3MW4A 4Z2WA 3S30A 3ZFGB 3H7YA 4XQDA 1X7NA 1CAWB 5L7OC 2RS12 2ZACA 1PM4A 2GDFA 3TOJA 2DURA 2BDRA 2QE3A 1OA2A 3C7OA 3M2MA 1C3HA 1TME3 4XUQA 5FY9A 2W68A 2Q8EA 2YG0A 3VDDC 3VD9A 2AH2A 2JDNA 5C4WA 2XMLA 3UL2A 4QHBA 5JXGA 4OCTA 3HQUA 1IKPA 5GZDA 2H0BA 2WNVC 2Y6KA 2DCZA 3KT4A 5FYUA 2G9ZA 5A3TA 1LENA 1YJLA 2ZX0A 4L9BA 4OULA 4Z92B 2MEV1 5ACA1 2CNAA 3Q8EA 2J1SA 3BPZA 4R9BA 2C4XA 1US3A 2PAMA 1E5HA 1HW5A 2LRPA 1RUOA 5ANQA 1A78A 3SLIA 1AR83 2ZGQA 1V70A 3BUCA 1IQDC 2EAAA 2K9ZA 5FMDA 3ZYPA 2LROA 3ALQA 2PAEA 3RFRA 3KWVA 4XAEA 5A7SA 5KC5A 5LBEA 1XC6A 5BNNA 1R1A1 2GC2A 3VDBA 3WT3A 4LBMA 3OD4A 3WF3A 1LOFC 5L9RA 4YLZA 3GDBA 4L97A 3RNSA 3AXDA 4XFHA 3T4VA 5LY1A 4ZU4A 2QNKA 2ZAHA 2AYHA 4V2WA 1ENXA 1OOPB 4BK5A 2IVIB 3BALA 4CUCA 3BGAA 1XNCA 4OUSA 1VB4A 3WD5A 1ZX5A 4QPIA 2XHNA 1RIRA 1OFNA 2BWAA 2XJSA 4QPYA 3ZXLA 1IPSA 1W9TA 2BOIA 1XE0A 3NKTA 4OHVA 4QGLA 4WVMA 4XILA 4B1MA 5FZEA 4CP0A 2BBAA 5JXHA 1ZZCA 3IN9A 4Q4X2 5GKAC 5LY2A 2CY6A 4LKSA 5KR7A 3IMNA 1JHNA 1PMHX 4IUGA 1V9U1 5J09A 4CCLA 3KV4A 4YZ1A 3OSDA 4KU7A 5EYYA 3WUDA 3WY6A 4CUGA 3T0BA 4AFCA 2BU9A 4A7KA 3OJBA 4MGTA 2XGXA 4FTEA 2WL1A 2R042 2Y0OA 5IK5A 4NUBA 1Z78A 1NA1A 3I8TA 4XJZA 1A34A 3IIAA 4JTOA 3VKOA 3CLPA 4Y33A 1CAXA 2VMGA 1ZZ8A 3IDEA 3JD72 1CJPA 2VD7A 2W1WA 1EP0A 1DQ1A 3FZ3A 2EIBA 4MG2A 2NPIA 5CKMA 1RB8G 1RUG3 2OQ7A 1W05A 4LOTA 4A7ZA 2RE9A 4AR2A 2HWE1 4DIQA 2WO3A 1ALYA 2CL2A 2QQWA 2WO2A 2YYOA 4FQZA 2V5DA 3W58A 4GIQA 2YBKA 2Z4FA 1FMD3 1PGSA 1IG0A 1PO21 4E8DA 4YFWA 2R041 4IV1C 4D7YA 3RJ2X 2RV9A 1COV2 1ZRDA 3PJYA 5FXVA 5FP8A 2HEWF 2PLV2 2QQMA 3LEMA 1LOEA 3ETQA 3GM8A 5ANNA 4DRVA 5KXCA 1YFXA 5DDJ3 2JDZA 1IG3A 4P5HA 3SNMA 4BWOA 4CPBA 5IFPA 3ACLA 1JZ3A 2AENA 2AGSA 5A33B 1UF2C 3AZXA 5GLTA 2GH8A 2JDUA 2X8KA 1DIWA 3I2OA 1UY4A 3KV9A 3OYWA 4B4RA 4ORFA 1HB4A 1BEV3 5LBBA 3FUQA 1RUC3 3VD7A 3WSOA 4CDWA 2ZGNA 3JBG2 1O91A 3ACIA 4IEPA 5F5CA 2QJVA 3LSEA 4EROA 5DQ0A 4Y24A 3Q8FA 1SFPA 2YC0A 5LRRA 1O6UA 5DPNA 4JC1A 4MGZE 1COV1 2CYFA 2VMEA 4INDA 4N53B 5FZ1A 4JGYC 5FYCA 4RFT0 4COWA 1QJU1 4GALA 2ADEA 4AVAA 5JWPA 1VBC3 3PMSA 1ENQA 1TME2 1XQNA 1DYPA 4MADA 2D3RA 3V0AB 2W46A 4PI2A 2W1UA 4D6SA 1HDKA 4B4QA 2VC9A 2W5FA 3H0OA 1GNZA 1AYM3 1N47A 4HSLA 2F17A 2NQYA 5DAPA 4PI0A 5AVAA 5FV3A 1ZZ7A 4KU8A 2RR11 4MGKE 2EXKA 4F8AA 1AR73 2E31A 2XL9A 4XF9A 2W2IA 5F9TA 1WWYA 4BH9A 1DBNA 2ZMNA 5C8WA 3AP9A 1AJOA 2WFF3 3M3EA 2JX9A 4Z82A 4X8PA 3S6PA 3VZMA 5EJ1B 3VBHC 1G9CA 4YG3A 1K12A 3NVCA 3T08A 2WKKA 3MIEA 1AX0A 2AREA 1EYBA 4QKBA 1QJY1 5D1IA 5A7WB 1MS9A 3VBUB 1VLNA 4CEYC 3WNPA 1W3XA 2HYXA 3NNFA 4L92A 4O9GA 4XXAA 5JZGB 4L8QA 5FK8A 1RJ8A 1I5ZA 3ZFEA 3S5QA 1LEMA 1JU3A 2VO5A 3AZWA 3CJIB 4XAAA 4XXPA 5FXXA 5C9AA 1LOBA 1HN1A 5IAVA 4A6OA 2W08A 2IXKA 2DU0A 2D5FA 4DFSA 1WMEA 5FZIA 4Q8KA 1NLQA 4IV3B 5JXIA 4WM8A 1N1YA 1UXZA 1UZYA 5C70A 1AR81 1UY3A 1OKQA 1WLCA 3N35A 4FPYA 4Q1RA 2NYYA 3MFCA 1G9DA 1ULEA 2BPA2 1W9FA 1J83A 4GH4C 4CTEA 3MPPG 3USUA 3WX5A 5IW0A 3D82A 2QQNA 1GP5A 5EXOA 5KWRA 4ZU5A 3KSCA 1UL9A 3PTRB 3VKMA 3ZYIB 5FZAA 4DEVA 4AL9A 3JQXA 5HCHA 4Q29A 2LUWA 2CGNA 2WQ8A 3D5OA 4SLIA 1H0BA 1PIV3 4NO4A 1H8VA 1OF3A 3O1OA 2XJTA 2PYTA 2KD7A 2ZGSA 1BZWA 1RUG2 4FOWA 5IK8A 1WA6X 1XBFA 4A7YA 2DUPA 4M3CE 5E1RA 4QX7A 1WUVA 1P8JA 2LW8A 1QEXA 2WQ4A 1PHMA 1MQTC 2XWJB 4QX3A 3UV9A 1VBB3 3ZMOA 3WZ1A 2ZTNA 4AYUA 1FMD2 1XU2A 4P14A 3J4UH 4KWKA 3EJKA 1ND3B 1UIKA 5FPAA 4OMDA 1GKBA 4Y22A 2VVFA 1XB9A 3ZXJA 2R49A 1TQ5A 2YROA 3NSTA 4DQAA 3OEAA 2A70A 2VR4A 1V6JA 2HWF2 3VBSC 4BJ0A 3WDTA 2BTVC 5I8TA 2R7EB 2VBBA 2C26A 2VY0A 2OUHA 5DDJ2 1RXFA 1PGL2 1R083 3I3EA 2YY1A 1PO12 2W1SA 3PDQA 1RUG1 1GWKA 2UWAA 2X5IA 1ZREA 4ZKTB 2B45X 3H8UA 3K2OA 4UW6A 3OGRA 4M0NA 2XKPA 1VMFA 1G6NA 4CDXA 1K5MB 4UYBA 3I3QA 4R4ZA 1RVF3 2XBO3 4PLOA 2R1DA 2YUEA 1WLDA 1UMHA 2RS53 1FMD1 2DCYA 3EMRA 3I2KA 1AX2A 1WBFA 1XOYA 3DCQA 3T30A 2WA4A 5C3PA 1HKDA 1GWMA 4LPLA 2Y34A 1YFYA 3IAPA 3LWCA 4BPZA 1VBE3 1NZIA 4Y20B 1UMZA 5I0TA 1YIFA 4B7EA 1MS8A 1VBC2 3PIGA 4XIOA 3WDUA 4NVPA 2Y26A 1JZ2A 3T4HB 4AOCA 1D0HA 1S0FA 1AYM2 2ERFA 1H2LA 3FBYA 3HNYM 1RUJ2 2RJKA 1UZ0A 1BEV1 4EWEA 1H2NA 1RUC1 3O7OA 5I8SA 4QU2A 4JGZA 2VBDA 3SC7X 1SLLA 4RGGA 5F6LB 4FPCA 5FZOA 2JIGA 2I2SA 4TWTA 5JIAA 4QD2A 2WRAA 1AL0G 5T5OA 2WFF2 3IWZA 5L7OA 5FIXA 5FJKA 2VXJA 2J42A 1CAUB 4Z8BA 1RJ7A 4GMP3 1CJDA 3WW2A 2GC0A 2OS2A 4AEDB 1AHSA 4OHZA 2VTXJ 2RDQA 3AKQA 4Q26A 3PTYA 3KMHA 5H9PA 2WNVA 1DDLA 2A6YA 2ZX2A 1UU6A 1WCSA 1X33A 1QJFA 1YYNA 2DFBA 4FPHA 2QQLA 1AYM1 4DZGA 2FD8A 4JQTA 5FY8A 1B35A 1BYHA 5LCWL 2ARXA 1MEC3 4AXOA 3MGUA 1G9BA 4WZFA 1AR71 4BK4A 1WD3A 4DRRA 1ACCA 2V5YA 2XUMA 4XYXA 4ZONA 4BQ3A 3J8F3 5JXJA 3LDBA 4M3CB 4JDOA 1DGRA 2ZEYA 3ZKYA 5KXEA 2JKXA 2HWB3 1HV0A 3NO8A 4YVSC 5F1RA 4QDRA 4XFIA 1ZZBA 3LD8A 3IPVB 4QQHA 2CTVA 5H9RA 5B4XA 3WVJA 2JXAA 4XQWA 3LPFA 3WNKA 1A8MA 3LE0A 3WF1A 5KXDA 4JKMA 1Q3EA 3N36A 2Q8OA 4LTAA 5T3NA 1SG3A 1NQJA 4X6QB 2JG9B 4P02B 4RSUA 5GZFA 3H8OA 3A22A 4BQ5A 1O4YA 3JUUA 5FYIA 4P9YA 2PMWB 2ZZJA 3TBDA 1PIV2 1Y9MA 3WHTA 3QH6A 4DXRA 3ON7A 2YBSA 2BGOA 1UX6A 4CU7A 2XPJA 3WQBA 3SEPA 1IPKA 2C24A 4FTSA 4S2GA 1DP0A 5HV4A 3B5LB 4WVWA 4RGAA 1SLBA 3TAYA 3LB9A 4LBLA 2GNTA 3T1MA 3ZYBA 4QX2A 4YZ5A 4AAXA 1AJKA 2PHDA 4MGIE 3I59B 1VBB2 1YI9A 4AI9A 1IHMA 2J1TA 3MW3A 4JV4A 3M3IA 5A1LA 4GB33 3K4DA 2QDRA 3M3QA 4WM7B 4CDUA 3AB0A 3UKNA 2YB7A 2CSGA 4QQ2A 1N3PA 5LEJA 1ASJ3 3KHCA 5CZKA 4PQQA 4BYYA 1UO9A 2XVKA 3KQRA 1PIV1 2JENA 3CJXA 3RSJA 4NIDA 4NHYA 2PHFA 2Z2SB 4PQ9A 5BNNC 1VBA2 3RZMA 1UOJA 3BOPA 3FLTA 4E4ZA 3ORJA 3JB8A 5GLWA 3HEIA 3NAPB 1MS5A 1XNTA 2DCKA 2OT7A 3MIDA 1U5ZA 3KV5A 4LBQA 4OHWA 3BI3A 3IAQA 3SISA 3GJAA 3SKJE 1RVF2 2XBO2 4QPIC 2RS52 3DPRA 1APNA 1DF0A 4LUKA 2KXLA 2VVDA 3V0BB 3JQWA 3KF3A 1H8TB 5JOWA 4LK6A 4OHXA 3CIHA 3APBA 1NT0A 2ZPXA 4RR3B 4LIUA 1W99A 5TSWA 2FDIA 1VBE2 2WABA 2YMZA 3D3AA 3MYXA 2ZZQA 1NKGA 2ID4A 4NWVA 1X8EA 2ZGPA 3PLQA 1R081 5FY0A 2DDUA 2VECA 2FCTA 4H7MA 4A45A 3AP7A 3J7LA 1C5IA 2Q5TA 4GWNA 1O8PA 3UYJA 4AAPA 5C8CB 2D3SA 4I30A 5IFTA 1ZRRA 2XBO1 1GBGA 1RUD2 3CZUA 3DL3A 3JZVA 3WW3A 2RS51 3DF0A 5LA1A 4IEYA 3RRDA 1DQ0A 3H1MA 2ZGUA 4Q2FA 2BERA 5A3LA 2JG8B 2UWBA 4P5YA 2O14A 4JGYA 4C1WA 3POWA 3DGTA 3LDKA 3Q8BA 1UYPA 1VBE1 2YU2A 1YQ8A 3ILNA 2J1UA 4PIYA 1GZWA 4Q0SA 3PUAA 4R9CA 3IDCB 1N1VA 1WA4A 2B39A 2VUAA 2JD4A 2VW1A 2WYSA 2DUOA 1W6OB 4ZPIA 2QDNA 3AMQA 1HQWA 1I3HA 1NYWA 3O1UA 3UETA 3VBRB 1MEC2 1F4HA 1Q56A 4PDWB 5CADA 2JWPA 3LA2A 4RD7A 4YGEA 4COZA 1OLME 3MLLA 5A3NA 3M4FA 4AEKA 4P9WA 1C57A 2W87A 3J8F2 5FMCA 3VBHA 3IZOA 2XJUA 4WV8A 3ST7A 1W8OA 2DBNA 1US2A 1AXYA 2CWMA 2HWB2 1JMUB 2VTFA 2VCAA 3HD8B 2YV8A 1GOHA 4GZ9A 3ZLIA 5FZDA 1H2KA 2F4PA 2WR9A 4XF4A 4GMP1 4LR4A 4K7JA 1LGCA 5FMOS 4A2UA 3PL0A 1RMU3 1UXXX 3LOBA 4UFIA 3PVEA 3WG1A 5L9BA 3JB4C 3WF2A 5BYNA 2DV9A 3U10A 5CFDB 3CMGA 4OZOA 3VV1A 1S55A 1MEC1 1HRV3 5F2WA 1VPHA 5FJHA 5FMOL 4ZXEA 5A32B 1OC1A 3ACFA 4PF1A 4OVEA 1ZA4A 1CX1A 3B69A 3T1LA 5DAWA 2D40A 1J58A 2HWB1 1F4AA 2ZOEB 4LHKA 1VIWB 3FX3A 3E5XA 3VD3A 2BYVE 4AFBA 2DVBA 4FOQA 5F6KA 4C8DA 3C7FA 3TEXA 1VJ2A 2OZ6A 3POGA 5E8AA 4GH4A 1CD3G 2QQUA 4X6RB 1KRIA 2C1FA 1IS3A 4HLTA 1AX1A 5ERLA 1OD3A 5CIRA 1QGLA 5JI7A 1POV1 3VZJA 2EF6A 1EPZA 5J36A 4Z2AA 5BV6A 2D6MA 5DZFA 4OI0A 3OUHA 2Q0AA 1QOOA 1BVP1 2YPJA 1Q8QA 2A6ZA 4AK3A 3VDAA 4CP1A 1ASJ2 5F5AA 1W6MA 5F7UA 3N7LA 5FZ0A 3X29B 2JE7A 3AYAA 4IGPA 2VZTA 1JI6A 2AZ5A 5FK7A 3ZFEC 4W65A 2ORZA 2OZJA 2R16A 3HMYA 3IDAA 3USSA 3ZSEA 3QH7A 5C9AC 2VNOA 3ZYJB 4B1LA 4BHPA 1MQTA 1GMMA 1UPSA 4KBZA 2O0OA 2D6PA 2A73B 1UPIA 2VPVA 4L2NA 3WW4A 3WP4A 3R4SA 2YFUA 2E9QA 5HPOA 4XUOA 4GB31 1KFXL 1XE7A 5DAXA 2VE1A 1YQ2A 2XVGA 3LIHA 5LA2A 4I0AA 5F5IA 4AWDA 4UWDA 1ASJ1 2WBKA 1YIPA 3BTAA 1V6KA 3GZTB 3Q8CA 4Q1PA 3VBSA 2PHRA 2VAUA 2JIJA 4W6XA 1G7YA 4QM9A 4WVVA 2P3JA 3VUOA 1JOPA 1S0CA 2DVAA 2Y60A 2FMYA 1LGNA 3TN91 2WWUA 3ZFFC 4K20A 3I3MA 3HBZA 1KS4A 4YM0A 1QXPA 1EUUA 4AI2A 4IE7A 2PQQA 2Q1ZB 5LA0A 5C3RA 5KHGA 1GR3A 3U1XA 2R30A 1NCQB 4JCKA 4YRDA 1PMJX 2VUCA 4Q4X3 3BOWA 2ZGKA 4LBKA 4LLOA 1RUE2 1EAH3 4HMZA 4O9EA 4YW3A 4FOYA 3HIFA 1FXZA 3IMMA 3AKRA 2CV6A 1U5YA 3HT2A 4OUEA 4AEDC 2BBVA 4JQRA 1GICA 2NMOA 1SHWB 3JCIA 1LB2A 1CONA 5D21A 3UGFA 4V2VA 1Q43A 5FUNA 2B5HA 5ABJC 1SPPA 2GU9A 3FE5A 1AYN3 2VQTA 2YU1A 4CA9A 5CVRA 3ZXFA 3S0MA 3JXSA 1OPMA 3ABZA 3FHAA 3ZO0B 3INAA 4I02A 3VBOB 3IT8A 3URFA 4BDVB 4XJ9A 2X5IC 3WQ7A 3O0VA 5CISA 3M3OA 2ATFA 2HYKA 1UOGA 3S7IA 4K8FA 2R071 5BY5A 1OURA 3ITQA 1L3JA 1ZZ9A 1UX7A 1Q8PA 4AGGA 1RUI3 2D3PA 5FPZA 5LK5A 1PK6B 1RMU2 4O65A 1D7PM 5F39A 2JG9C 2IXHA 1JYCA 4BMBA 1N1SA 2WA3A 3I2DA 3EYPA 3OBRA 4XUNA 5DZEA 5AVPA 5BNOB 5JR2A 1YFWA 2HWD3 1HRV2 2PLV3 3HN1A 4IEVA 5DAVA 1W04A 2GH2A 3U75A 2P4EA 2D6OX 5C3SA 4YVSA 4QHZA 5FMBA 5LB6A 3LCPA 5E16A 1S2EA 3ZSMA 5CNAA 3W5MA 1S0GA 1WW7A 4OYUA 4M0HA 3TNQA 5T5JA 2YZ4A 1RUH2 2QQPA 2AUYA 1XNDA 2Z79A 1ULGA 2O8OA 5H9SA 1H4GA 2QFEA 5K9YA 1RMU1 1SFNA 1O59A 1IPJA 3OY8B 1S0DA 4LLFA 3VBRA 1D4VB 4QPGC 4XW3A 3C7HA 3KQ4B 4XDOA 5GM0A 5A70A 4UF0B 1IGOA 5FYYA 2VMFA 3O12A 2W9XA 4BE3A 5DG1A 4OI4A 4K1YA 4AVBA 3UNPA 1KGYA 2LTNA 2G19A 1UU4A 4XOGA 3ZSLA 4QPWA 1QKQA 1QQP3 3I54A 2KR2A 4QWNA 1HRI3 1QU0A 2ZGMA 3T0DA 2JJ6A 3WF0A 4XJ8A 1B35C 2VZRA 3HR9A 2RMU3 3FWEA 1TEIA 2FDHA 3J7MA 5FWEA 1W0OA 5L19A 3SCFA 4GULA 3ZXEA 5JDBA 2RG4A 3B9IA 1RHI2 2GSYA 3CQOA 3PVOA 3GGLA 4PT6A 3EB7A 5F3CA 3RS6A 5I0DA 3AJZA 2BUKA 2I45A 3QACA 2VCBA 4DUXA 1HXS3 1X82A 2RS11 1GWLA 4JRLA 4XFGA 5FZ3A 4HT1T 3RVHA 3LEGA 5GZEA 2Z69A 4JRAA 3ZPYA 4K21A 1WZXA 1IKQA 5A33A 2ARAA 1XRUA 5A3PA 3C3VA 2RDNA 2HWC3 1WW4A 4NHMA 3CL1A 1UZZA 4Q4Y3 2J1AA 4NJ4A 4YVWB 3AVRA 3GALA 1LOCA 5EQUA 4EN7B 2VNGA 1AL23 1JH5A 1KITA 2XG3A 5DUWA 5E6HA 2AC1A 4IEOA 3HQRA 2ENRA 1M4WA 4LA3A 4G3YC 3U4SA 4ATEA 5T5LA 3D6EA 3AYCA 3WUCA 1LODA 1XNBA 1VAVA 2ZEWA 2W3JA 3CNAA 3OEBA 4YW2A 2WWJA 3ZXDA 1EAH2 1AVBA 1XNAA 5A6XA 3I97A 3MIFA 2W91A 5JSPA 1J1TA 1H30A 1OUXA 5C6CA 3Q8AA 3R0RA 2J1RA 4IW3A 3V0AA 3J26N 4CYDA 2N7GA 1OKOA 1DGRN 1UCXA 4HVQA 4LHSA 4CDUC 2Q30A 4A41A 1TMF3 1AYN2 1QNWA 1FT9A 2BGCA 1VALA 2V73A 1SLAA 1UKRA 3NWKA 1SZBA 3PU3A 5FQ0B 4JVAA 3K48A 2HBUA 4Y5SA 5IATA 4OQ8A 1QJX3 1YO8A 2LALA 2WIIB 1MVQA 4RHV3 4M3CF 3B02A 3WG4A 1T2XA 5L9VA 4Y1ZA 5L36A 1K42A 4Q4X1 2VU9A 4AGVA 5A7WA 4FAHA 1NAEA 2Q1MA 2RJ2A 3EBRA 1IZ3A 3RPQA 4BXSV 4I0WB 3FUOA 2PHTA 3E97A 4YYOA 1BMV2 2K2SA 3B9CA 2P6CA 2VL4A 2P1BA 3K77A 5JZGA 1B09A 5EP9A 1RUI2 4IQPA 5F3GA 3POJA 1JOJA 5BNPC 3DPRC 2B9VA 5BPXA 1UY1A 2JDHA 2XUEA 5CFDC 1AYN1 2HWF3 5G05L 1CIWA 5M0TA 3HPNA 1W8WA 2HWD2 3AL5A 5C4WB 4LITA 4AGRA 3JD71 5FBZA 1W6QB 2I07B 5FLHA 5CEHA 2FDGA 4UFLA 3OBAA 1PO13 4B8EA 4QB2A 4CUBA 5F37A 2V4VA 3MPBA 1VE0A 3I2JA 2WNUC 4CPBD 3AYDA 3AFKA 4HANA 1W0NA 4IE4A 4ITCA 2O8QA 4XZUG 4FAGA 1RINA 1BMV1 1AR62 3LGRA 3OPTA 4UFJA 5HCBA 1OD5A 3ZPOA 2XQXA 2D93A 1CPMA 4M4PA 3L2HA 5DXDA 2VCMA 3AKPA 5B2GB 1HIXA 2EXJA 5FYTA 1OBNA 2HWD1 2C9KA 2PLV1 1SQ4A 3UGHA 1LHWA 1FNZA 3OPZA 3POBA 2OXBA 5FYMA 4K40A 3BTYA 1ND2B 4IE6A 2RJLA 1QQP2 5DUUA 2GMPA 3B01A 4WBBA 4XPVA 4FT8A 1HRI2 1RUJ3 1JZ7A 1KD7A 3EXUA 2OYZA 4ASMB 1A3KA 2CAVA 3JBG1 4YG6A 1XSRA 3ZR6A 5FO7B 3I3DA 2RMU2 5IK7A 2VOXA 2W92A 3UK9A 1KFUL 3U0ZA 1ND3A 2WO7A 4PF5A 2Q4SA 1W6PB 1QH7A 1DGWX 1LR5A 3FMGA 3FL7A 1HXS2 5DABA 1NY72 2OA2A 1NCRB 3VLBB 1J1LA 3A23A 3WV6A 4HPKB 1TME1 4QKNA 4W6YA 5A1FA 4KG0A 1IS5A 2Y33A 1QQP1 2D6KA 3TYJA 3AFGA 5FY1A 3VKNA 1W2TA 4XJWA 1VB2A 1LJ7A 4D7TA 2Y6LA 4Z07A 4ARYA 3BTZA 1HRI1 4WVZA 2HWC2 2EALA 4YW5A 4PCRA 4Q4Y2 4W50A 1K5MA 1ULOA 4IEWA 2VZVA 4LUMA 4BQ1A 3ETPA 3N9NA 5A7NA 2O1QA 2DVDA 2W52A 4LA2A 1AL22 5J98B 3RWNA 2VOKA 4K3UA 3BIWE 5BNQA 1J84A 1XU1A 2WZR3 3K3NA 4MVTA 4AQTA 4Q0PA 4XUTA 4CEWB 4QB1A 5IVJA 5JUVA 4E27A 4JAAA 3AP6A 1VRBA 1H9WA 2DF7A 2WNEA 3P3NA 4BA6A 4Y20A 1BCXA 2IFWA 4U2AA 2ZGRA 1WLTA 4P9GA 1W2OA 2VZSA 5LATA 4WZCA 4F3JA 5JOXA 3RWKX 1V00A 3WDWA 3E6BA 3H50A 1BK1A 5C5UA 3LFIA 1XYPA 5A80A 1VRH3 1TMF2 4Q4Y1 1FX5A 3ZFFA 5J48A 2ADDA 2Q8DA 2W94A 1C8M3 4J6GA 2WO1A 1ONAA 3I49A 3R4DB 1JBCA 3KT1A 1QJX2 1MS3A 2VMHA 4RHV2 4V1PA 2K46A 1JZ6A 2ZX1A 4U36A 2B7YA 2DFCA 1S2KA 1V6NA 1Y9QA 1JYTA 1NXMA 4MSVA 5EIYB 2HJIA 2JDPA 4AEDA 3HBKA 4KH9A 4KGQA 4N43B 1ZNPA 4BQYA 3NNGA 2QBXA 2PELA 5JMOA 2YC4A 2GNDA 4JX0A 3VKLA 4CCMA 2PXJA 1WMDA 3OUJA 2TNFA 4GWMA 1GNYA 5D8AB 2BP6A 4BQ2A 3N4MA 2A3WA 2DVGA 3S57A 1DZTA 4MV2A 2Y6JA 5FZ7A 4AI8A 3RYPA 1M06G 5FKBA 5FZCA 5KHJA 2HEYF 1ZBA3 1VBA3 3NQHA 1QJX1 4XBLA 3C2UA 1YFUA 4RHV1 1QDCA 1A6CA 2QQJA 2EIEA 2ZXQA 1SBFA 3MEPA 3WNMA 1OH3A 5EJZB 3MICA 2GP3A 3PUSA 1LCLA 1QMJA 1XJAA 2Y6HA 4LO6B 2CDPA 3N9PA 5FYVA 1YJKA 2ARBA 2XR4A 1YQ5A 2JG9A 2X29A 1JZ4A 1E57A 4CP2A 4GWIA 3AZVA 5JMCA 2NM1A 3ZFGC 1WKYA 1T6BX 4S2HA 4TN7A 3DXUA 2B4KA 2HWF1 2R0FA 5HI0A 2VMCA 3DN7A 2WT0A 2ZHLA 4GAZA 3K46A 4KMQA 3KVAA 1MS1A 5DDJ1 3N9MA 4E2GA 5FREA 1PGL1 1FAYA 5CA6A 1OLQA 4QX0A 4KWUA 1CAVB 1PO11 2UY8A 2VJXA 4NRMA 3E6CC 2PHWA 1VMJA 3POEA 3WOGA 4KWJA 3W9AA 2OIIA 2VGDA 3W59A 3DECA 1DZQA 4JDNA 1J3QA 4HONA 4YSFA 3I59A 1FOD2 3PVNA 4CCOA 1RUD3 2VCCA 5A3WA 4XCBA 3VBFB 4CUAA 1LECA 1OMIA 1ST8A 3EHKA 3KM5A 4HXCA 4Y4YA 4XMAA 5T55A 4QPGA 4HG6B 1SLCA 3HQXA 3SMHA 3AKTA 4UXAA 3WP5A 2MPFA 1I1EA 4AHXA 3ZN4A 4XTPA 3WINE 3USUB 2IXCA 3OPWA 5FAXA 1VBC1 4QXHA 2R063 2KA3A 2YGMA 4FP3A 1N3OA 1PVC2 4QX1A 1RUJ1 2PHXA 3EQEA 1DZRA 3CKHA 3I2FA 4MGYE 2ZEXA 1OOPC 4N9HA 5IUQA 3VDCA 4QXKA 1O4TA 1W2UA 1BVVA 2R32A 2FMDA 5LEKA 4AQ6A 4CCEA 2A6WA 4RA0A 4D6QA 3AXEA 3KV6A 4GJYA 1D4M3 4BQXA 2WZ8A 2WFF1 2WZR2 4ASKA 3TB0A 3P5BA 1A8DA 2DYCA 2UWCA 3N9OA 1FATA 1R64A 3RDIA 3W21A 2AR6A 2WINB 4AVCA 4N7IA 3U78A 4EN9B 1DQ2A 4R9DA 5F5QA 1UOFA 5F3IA 4IETA 2B8MA 1Q8VA 5J96B 1JZ8A 4Y22B 2WN2A 1KEXA 2AEYA 5IWFA 1RXGA 2ZAAA 2OKXA 3THDA 1GQHA 5IVCA 3BVCA 4LHLA 4XZPA 3P1IA 3KZ4C 1VRH2 4EN0A 5C8CA 3NJYA 4IEXA 3QLQA 3BTXA 1C8M2 1ULDA 3POYA 3TNPB 2NMNA 4LBJA 4ATFA 4K8RB 4IXLA 2JDMA 1H6XA 4Y1YA 4PJYA 3OBTA 4P9LA 4D3WA 3SEEA 4FFGA 2JECA 3THTA 4A6SA 2Y6FA 2VUDA 4CDXB 3N7MA 1F15A 4HSJA 3SH5A 3V56A 3B94A 4LQRA 1JYVA 1FV2A 4E8CA 1NOVA 2CGPA 1MS4A 3AZZA 3TRSB 1WMFA 3MF9A 4FPLA 3H3UA 2ET7A 3CZJA 4NR1A 1UY2A 2ZHMA 4CDQB 3J9SA 1W6OA 5A7PA 4AFMA 5EJ3A 3LFMA 2VVEA 3LSDA 2CHHA 4CXYA 3ELNA 2PAKA 2OPKA 4NAOA 1ZBA2 3PIJA 1W8FA 5FTTC 5FLJA 2ILMA 1BLZA 4G9SB 4PIXA 1CN1A 3W20A 3HNMA 2XVLA 5FXWA 2W1QA 3DYOA 1UZWA 2RS33 1N3QA 3WQ0A 1VAKA 4BB3A 1Y9GA 5A3MA 4MXWB 4LKEA 1VBB1 1WCDJ 3ENRA 4HKOA 5JSOA 1PZ7A 5BNPA 1MZEA 2XL7A 4RGKA 5L7OB 3GBFA 2Y64A 4XACA 1BHGA 4YGCA 5CFDA 2ORXA 5SV5A 3VHRA 1S0EA 5T5PA 4IEQA 3F95A 4N53C 3VDDB 3ZIWA 2XOMA 5FPVA 4BIFA 4BU2A 5A32A 4LORA 2A3YA 1SDWA 2WNVB 1VBA1 1ND2C 5JAXA 2BRTA 2WNUA 5EFUA 4ARXA 1GQGA 1SMVA 1UAIA 3G6JB 4A4AA 1QOSA 2WSUA 5CFCB 2A75A 1RUNA 1X36A 4FPKA 1JN2P 1AR93 1RVF1 3GXUA 3LF7A 2XWBB 4NMIA 2G9GA 3O1SA 1RL3A 2FDJA 1OPOA 4GQ7A 2GC3A 4M01A 3MZHA 5E88A 5FZ9A 5I93A 2VNRA 2F4LA 3KB5A 4UW4A 5LA9A 1RUE3 2BOJA 2Z42A 4PLNA 2BFUS
chains in the Genus database with same CATH topology
1OKOA 1WZXA 2KR2A 4LKFA 1W90A 1OH3A 4LK7A 4BQ3A 3ZYFA 1W8ZA 2Q1FA 3UT0A 1W9FA 1UOJA 4YW6A 4CP9A 1WCUA 1W8WA 3ORJA 2C24A 1L7LA 4CPBA 4A6SA 1HN0A 1GWMA 4LJHA 2JWPA 3ZYBA 1V0AA 2LRPA 2VXJA 4AL9A 1W8TA 4BQ4A 4BQ2A 2WYFA 4CPBD 4CP9B 5D21A 4LKEA 4YWAA 1W8UA 2LROA 4LKDA 1GWLA 4LK6A 2O14A 1GWKA 1WMXA 3ZYHA 4BQ5A 3F95A 2K46A 4YW7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OKO A;  1WZX A;  2KR2 A;  4LKF A;  1W90 A;  1OH3 A;  4LK7 A;  4BQ3 A;  3ZYF A;  1W8Z A;  2Q1F A;  3UT0 A;  1W9F A;  1UOJ A;  4YW6 A;  4CP9 A;  1WCU A;  1W8W A;  3ORJ A;  2C24 A;  1L7L A;  4CPB A;  4A6S A;  1HN0 A;  1GWM A;  4LJH A;  2JWP A;  3ZYB A;  1V0A A;  2LRP A;  2VXJ A;  4AL9 A;  1W8T A;  4BQ4 A;  4BQ2 A;  2WYF A;  4CPB D;  4CP9 B;  5D21 A;  4LKE A;  4YWA A;  1W8U A;  2LRO A;  4LKD A;  1GWL A;  4LK6 A;  2O14 A;  1GWK A;  1WMX A;  3ZYH A;  4BQ5 A;  3F95 A;  2K46 A;  4YW7 A; 
#chains in the Genus database with same CATH topology
 3VBU C;  5I91 A;  4GKY A;  3PUR A;  4MYE A;  5DG2 A;  4FPE A;  1QXR A;  4OFG A;  5JZG C;  2R06 2;  5K0U B;  4XF1 A;  2X05 A;  4HET A;  4CRQ A;  4URT A;  4URA A;  5EPA A;  2GME A;  1YXW A;  1HB1 A;  4E4D X;  2BFU L;  3CJI C;  1MZ5 A;  4DUW A;  3BN6 A;  3CHX A;  1C8N A;  3MI8 A;  2WSV A;  3ZN5 A;  5C3Q A;  4EWD A;  1O3T A;  4N8M A;  1RUD 1;  3KS7 A;  4DS0 A;  4BLI A;  5B4N A;  5IT6 A;  3SH4 A;  3AVS A;  3HJR A;  3A0N A;  1D4M 2;  3PUQ A;  3C7G A;  4IV3 C;  3I3B A;  1GZ9 A;  2Z5W A;  3WNO A;  2VQ0 A;  3ZYH A;  2EXH A;  3VHO A;  4LHN A;  5DAQ A;  4XDQ A;  2B46 X;  5CBL A;  1F31 A;  2XJR A;  3ILR A;  1YEW A;  3O1V A;  4LBO A;  2B42 B;  3MIH A;  2R6Q A;  2R06 1;  4E9K A;  2D98 A;  3TEW A;  5KHK A;  4AI3 A;  4BXF A;  2LS6 A;  1QF3 A;  4ZHN A;  3E6D A;  3KCX A;  1HX6 A;  2P6H A;  4H7L A;  4KBB A;  4LJH A;  4AVV A;  4ES8 A;  2D97 A;  2VH9 A;  1UYY A;  1S2B A;  1ZBE 3;  1ZRC A;  3NKG A;  2JB4 A;  4HFS A;  3MUY 1;  4FQ4 A;  3J8F 1;  4XFB A;  2GMM A;  1D4M 1;  4GKX A;  1L7Q A;  1VBD 3;  4XBQ A;  1YCI A;  2IWG B;  3LOI A;  1YQ6 A;  2QCS B;  3ACG A;  4HVO A;  1UU5 A;  4COU A;  3AK0 A;  2VTX A;  1RUH 3;  4Q0V A;  1RUF 2;  5FDB A;  5FZ6 A;  2WDB A;  1PNF A;  4FP2 A;  4IV1 B;  4GXL A;  4IGO A;  1LOA A;  4G4F A;  1PX3 A;  3CU7 A;  5A7Q A;  1ND3 C;  1CGP A;  5C7G A;  5JLV A;  1JW6 A;  1H4H A;  4MOA A;  2FZ1 A;  5D8A C;  2VG9 A;  4LO8 A;  4PIZ A;  2JEM A;  2CDO A;  4DY5 A;  5LW9 A;  5FBJ A;  1EV1 2;  1JYI A;  1XNK A;  1S0J A;  5LBF A;  4AW7 A;  2V09 A;  3SCG A;  4SBV A;  4UI9 L;  5DZG A;  1JOB A;  5ACA 3;  1Q5O A;  3AMH A;  5FZL A;  4KL1 A;  1O7F A;  1W03 A;  1H6Y A;  3NRU A;  2QZ3 A;  3HOB A;  1ZRF A;  1QY4 A;  1RTV A;  2VZ3 A;  3WQ1 A;  2OQ6 A;  2RS3 2;  1K5M C;  1KXG A;  1LNS A;  3M70 A;  4PBO A;  5ABJ B;  3QD6 A;  1CZV A;  3OGJ A;  3PME A;  3B3Q E;  1PNG A;  3GCX A;  1PVX A;  1RHI 3;  4HK8 A;  4AI0 A;  5C3O A;  2PTM A;  1WW6 A;  3H3Z A;  3D0S A;  4JGY B;  4Y1X A;  5CG8 A;  4CP9 A;  2E7T A;  3LDR A;  1UD1 A;  4QMA A;  1O5L A;  3UKV A;  2UU8 A;  5FOB B;  1K45 A;  2CGO A;  1R1A 3;  3TEZ A;  4Y4R A;  1RGS A;  2BQP A;  4IDZ A;  3AM2 A;  1NG0 A;  1WGP A;  1JXN A;  2TBV A;  3POF A;  3Q9O A;  5FLI A;  5FP4 A;  1LED A;  5J7M A;  3B93 A;  4BQW A;  4YZ4 A;  3OB8 A;  5FZ8 A;  1O4Z A;  1ZA7 A;  2P34 A;  1Z7S 2;  2H6C A;  2ZBJ A;  4YZ2 A;  1BJQ A;  2VUJ A;  2RS3 1;  2WS9 3;  3BOD A;  2Q8C A;  5IYY A;  3K3O A;  1I9R A;  3VBH B;  1AR9 2;  3VBF C;  3NJV A;  1LHU A;  5HXM A;  3ZFG A;  5FRA A;  3RYK A;  4CEY B;  4TYS A;  1V9U 3;  1C28 A;  4XE9 A;  1CAW A;  3OGS A;  5LK7 B;  4XIK A;  3C8X A;  3ZIX A;  1HV1 A;  4PBP A;  3PJQ A;  3HNB M;  3HAG A;  3N3H A;  5CKQ A;  5F2S A;  1W06 A;  4XFC A;  3NJX A;  4MET A;  3T09 A;  1U5I A;  5IVV A;  4RS5 B;  1PX4 A;  4HKW A;  3WEZ A;  2JDA A;  2NP0 A;  3LEK A;  2WN3 A;  3PUH A;  3WP3 A;  5KBF A;  4Q27 A;  3WG2 A;  2VMI A;  1W6N B;  3OGG A;  4B3N A;  3VL9 A;  2HWE 3;  1SLT A;  4KQ7 A;  2YXS A;  3L9J T;  4FPJ A;  4J1X A;  2P3Y A;  1RED A;  4GH4 B;  1RUE 1;  3DYP A;  4LE4 A;  1PO2 3;  1JHJ A;  5T50 A;  4EN8 B;  1DCS A;  3L2Y A;  2PFW A;  5HXV A;  4AEM A;  1AF9 A;  3DEM A;  4BIO A;  4Q4V 3;  3ZN6 B;  5AC9 2;  4XUP A;  3ZSK A;  1LAJ A;  4OQ9 A;  3HT1 A;  1W6M B;  3OF1 A;  1OOP A;  1XYN A;  5BUV A;  1W0P A;  5GZC A;  4MHR A;  4BCU A;  3O1R A;  4DXT A;  4BOW A;  5JI9 A;  3VZO A;  5IHR A;  1NQD A;  4OMC A;  1ZBE 2;  3NV1 A;  4RL7 A;  2WZE A;  3BKZ A;  2L9L A;  3IM0 A;  4NII A;  1ODN A;  2FQP A;  1LRH A;  1O3R A;  2HLE A;  2MHF A;  1VBD 2;  2OW4 A;  2Q1F A;  1MQT B;  1UZV A;  1VP6 A;  4N7U A;  4C91 A;  1F35 A;  2DVF A;  5C33 A;  1L7L A;  5A6Q A;  1SAC A;  3LKJ A;  3OUI A;  1I6X A;  2ZKN A;  1O3S A;  1MZ6 A;  4OLL A;  1CZT A;  2ETE A;  1AR6 3;  4FO9 A;  5T52 A;  1BBT 3;  2VM9 A;  4YGD A;  3SH3 A;  5FR3 A;  2BWC A;  2WZP P;  3VZN A;  5JPM B;  4JHZ A;  2YHJ A;  4D0Q A;  5FO9 B;  4WM7 C;  2HKX A;  5KXB A;  4Q5O A;  1KDM A;  1RC6 A;  4QQL A;  1W9W A;  1UKG A;  3VGI A;  2BNO A;  1HRV 1;  2JE8 A;  5A3U A;  5FQ0 A;  2DBI A;  1JUI A;  4J1W A;  4I01 A;  2IZW A;  1ZBE 1;  3NJZ A;  1X9T A;  4RQP B;  3LAG A;  1D2Q A;  4QX8 A;  3LEI A;  4XTM A;  3WDV A;  4HN0 A;  1CQ9 A;  4LK7 A;  2E63 A;  1VBD 1;  3J7H A;  3MV1 1;  1G8W A;  4UBG A;  5ACA 2;  1OVS A;  1Y43 B;  2W95 A;  3BPS A;  5FOJ B;  3NAP C;  1V6M A;  3OBZ A;  1W28 A;  1T6G C;  1RUH 1;  4LO5 B;  3NNM A;  4W6W A;  4P9J A;  1X8M A;  5FZG A;  4OI2 A;  3RMY A;  4FFH A;  4XBN A;  3NV2 A;  3RI8 A;  4K1Z A;  1E5S A;  1VAM A;  3K75 B;  4R9A A;  1QJY 3;  3FLP A;  4NPR A;  3QOP A;  5FWJ A;  2XLG A;  1H8T C;  2CAU A;  3HWJ A;  1Y4W A;  4RR3 C;  1R1A 2;  3FN9 A;  2OX0 A;  5GJ6 A;  4LUL A;  1W6Q A;  5HV0 A;  1DYO A;  3MHZ A;  4TZD A;  5FXZ A;  3ZVX A;  3HVD A;  1SPP B;  3ATG A;  1GP4 A;  3ZDS A;  4E4S A;  3WG3 A;  3ZYF A;  1W8Z A;  4KWL A;  4ZY9 A;  4OUM A;  5CFC C;  5F8P A;  3OTF A;  2WS9 2;  5C8C C;  2R0H A;  1XYO A;  2GNB A;  3AX4 A;  1JYW A;  4CU8 A;  1MVE A;  1RHI 1;  3KVB A;  4M00 A;  2HBT A;  1LU1 A;  3MLJ A;  4FPG A;  3P6B A;  1OQE A;  5IK4 A;  3VKF C;  3AKS A;  4N53 A;  5IVB A;  1V9U 2;  1RYY A;  2JG8 C;  3T3Y A;  2FDF A;  2FBE A;  2VZP A;  3F2Z A;  4CSW A;  1H1I A;  3RZJ A;  5IVE A;  1W2N A;  2BV4 A;  1GSL A;  2XLA A;  3FHQ A;  4EWA A;  4MLO A;  1NE6 A;  1ND2 A;  1OUS A;  2A1X A;  3MF6 A;  3WLU A;  2E51 A;  1ZVF A;  2X09 A;  5K0U C;  1OQD A;  2P2K A;  4FPO B;  3AMN A;  3D8C A;  3LQC A;  4NHX A;  4FTB A;  3CF6 E;  3DUI A;  1YHF A;  4F83 A;  3VBR C;  3RYR A;  4PDW C;  2WS9 1;  5FUP A;  4KI5 M;  2GNM A;  3LIG A;  4NE9 A;  4YVS B;  4MH0 E;  2D44 A;  3GF6 A;  5IJR A;  3HN3 A;  4XHX A;  2DCJ A;  3VD5 A;  4AQS A;  4E2S A;  4EZ4 A;  1W6P A;  3ZXG A;  2HWE 2;  3UGG A;  1QNY A;  4MZU A;  3UKT A;  1N1T A;  4CXW A;  2XH6 A;  3GYD A;  1EAH 1;  2D43 A;  3I2H A;  5LAS A;  1NCR A;  3THC A;  3VBU A;  4EV0 A;  3WHU A;  1PO2 2;  1WMX A;  4HPK A;  4ZZ8 A;  1SCR A;  4E4H A;  2ARC A;  3NV3 A;  5BXX A;  1H2M A;  4Q4V 2;  3M1H A;  3KD4 A;  1GP6 A;  4I3P A;  4IE5 A;  3R6S A;  3CJI A;  1SCS A;  3U14 A;  4YAR A;  3KGL A;  3K51 A;  3KGZ A;  3BU7 A;  1QOT A;  3III A;  3RZZ A;  5GLZ A;  1OF4 A;  4HK9 A;  1H9P A;  1CPN A;  1O8S A;  4P08 A;  3TWI A;  2OVU A;  1BK0 A;  3K4Z A;  2RM2 3;  4GWJ A;  4Y5T A;  2VQU A;  4IV3 A;  2A71 A;  2IVJ A;  4AVT A;  3RZH A;  4M4R A;  4CEW A;  3DKW A;  1K5J A;  3VHP A;  1OA3 A;  2A3X A;  4NPM A;  4K6B A;  5G04 L;  5APA A;  1J3R A;  3SXW A;  1FI2 A;  2GAU A;  3M3C A;  5EV7 A;  3VD4 A;  2YPD A;  2R1B A;  1RUI 1;  1BBT 2;  3N9Q A;  1H1A A;  2GN3 A;  4Q4V 1;  1W90 A;  5FY7 A;  3MUZ 1;  3H7J A;  4PLM A;  1O3Q A;  2QUO A;  1QJU 2;  3POS A;  1DU3 D;  4MX3 A;  4P9X A;  1YI7 A;  4QT6 A;  5BNN B;  1ULF A;  2K0G A;  4CE8 A;  5LRS A;  4AF9 A;  2ZGO A;  1UYX A;  4YM2 A;  1Y3T A;  4Q0Q A;  5FPU A;  3WR0 A;  5KHI A;  1PM7 A;  2RR1 2;  1UNB A;  2MNG A;  2YDE A;  3AJY A;  4I0B A;  1CES A;  4XF0 A;  5FCC A;  4C0B A;  2PHU A;  4UFH A;  1UYZ A;  4AVS A;  1OVP A;  1BQP A;  4QX5 A;  4QPI B;  1TNF A;  5CB7 A;  4DIN B;  1LOG A;  1FOD 3;  3J7N A;  2IUW A;  1U5X A;  4XFF A;  1AR6 1;  4N43 A;  3N7J A;  4P9I A;  3NW4 A;  4WVM B;  1BBT 1;  4XJU A;  3T0A A;  3ZX7 A;  4CCN A;  4DXS A;  1LU2 A;  1DLC A;  2WWS A;  1GV9 A;  1QJY 2;  3LPG A;  2PQS A;  2VZU A;  2E7A A;  4YGB A;  3O1M A;  5D8A A;  1FYU A;  3RQ0 A;  3ZOI A;  4DPN A;  4D94 A;  3R05 A;  4CCC A;  1ZZ6 A;  3LA7 A;  1IS4 A;  1YNA A;  4MO3 M;  2XB6 C;  4QXB A;  1F5F A;  3KF5 A;  1NA1 B;  3ME2 A;  1QHD A;  1PVC 3;  3MV0 1;  4GD4 A;  1MAC A;  4S2F A;  4OHY A;  3RG0 A;  4RFR B;  4LEJ A;  1TG7 A;  1HB3 A;  4YW4 A;  1CAX B;  1FPN 3;  3FBM A;  2GZW A;  2RMU 1;  4Q0U A;  4B29 A;  2CWS A;  5FKC A;  2Y38 A;  3MFA A;  1AR8 2;  1X9P A;  1AXK A;  1REF A;  2VW2 A;  1NCQ C;  2UUR A;  5T54 A;  1HXS 1;  4QB6 A;  1NY7 1;  2XHK A;  4DUV A;  1U12 A;  5FO8 B;  4LO4 B;  1CAV A;  2D5H A;  4NOT A;  1V6O A;  4F7Z A;  2WQZ C;  5HCF A;  4BQ4 A;  2QQV A;  3BCW A;  3PNA A;  4LE3 A;  3PHM A;  2HWC 1;  1D0G A;  4RS5 C;  3NNJ A;  3DYM A;  4FVV A;  1AL2 1;  3VBF A;  1NLR A;  5I0U A;  2VOW A;  3GHN A;  4ONU A;  3WP6 A;  3VBO C;  3OYW B;  4NRQ A;  4QKD A;  2V4A A;  1GAN A;  1ZRI A;  2UYA A;  4IE0 A;  4L0P A;  4CDW B;  1MPX A;  3WCR A;  3DKQ A;  2D7F A;  5JVV A;  1J3P A;  2V72 A;  5FYH A;  1CAU A;  1LUL A;  2BVB A;  4BLJ A;  2XLF A;  4ZS3 A;  3C7E A;  3T2Q A;  1IOA A;  4EYU A;  4AHW A;  4XC9 A;  1WCQ A;  4AZZ A;  4EJR A;  1PK6 C;  1BKZ A;  1W9S A;  5A3O A;  5F3E A;  2RHP A;  3CBN A;  1TMF 1;  3MO4 A;  4UW3 A;  2ES3 A;  1W8U A;  3SIT A;  2VZQ A;  3WNX A;  5BNO C;  3H8R A;  1PZ9 A;  2JKB A;  5GZG A;  3TEY A;  1GZT A;  4M3C A;  4C90 A;  4R8H A;  2RM2 2;  1F8V A;  1CVN A;  1W3V A;  3KCY A;  1YC6 1;  1C1L A;  1HQN A;  3AZY A;  2DUQ A;  3IPV A;  3LZZ A;  3ZXA C;  4BME A;  4DB5 A;  4NIH A;  3H1W A;  2ZGL A;  4FXG B;  4QKF A;  1YLL A;  4B7K A;  1GOG A;  5AFE A;  2P3K A;  4D69 A;  2WAA A;  3VZL A;  3FHI B;  2C6S A;  5SV8 A;  1X50 A;  2IXL A;  3UJQ A;  2DU1 A;  1GNH A;  1W39 A;  2E33 A;  5JSR A;  3U11 A;  2BZD A;  3O14 A;  4YW1 A;  3WCS A;  2GAL A;  2ZX3 A;  2XON A;  1SBE A;  1ULP A;  1WLW A;  2E32 A;  2QQK A;  2ZGT A;  4NHL A;  2IFR A;  2NZ9 A;  4NAM A;  5K4L A;  3ZFE B;  4MGS A;  5A6Y A;  3BB6 A;  1W9Y A;  4RQP C;  3H8X A;  5C9A B;  3D0J A;  2RM2 1;  2WT2 A;  4ISQ A;  2JB8 A;  4CVU A;  4AEJ A;  1BEV 2;  4OZX A;  4QHO A;  1RUC 2;  3H1Y A;  1XPW A;  2HEV F;  4HVR A;  2AEZ A;  1LES A;  2GC1 A;  4YZ3 A;  4C0H A;  1W8H A;  3GZE A;  5FP7 A;  1DGW A;  2BNM A;  4LMF A;  4WM8 B;  4NN0 A;  1FNY A;  3CDZ B;  1VR3 A;  1Q8O A;  4WM7 A;  3ZR5 A;  4CDQ A;  2DTY A;  4QGN A;  2VZ1 A;  3CO2 A;  1DQ5 A;  3E1F 1;  4ES9 A;  4FCA A;  4MGQ A;  1NXD 1;  1HQL A;  4XJA A;  1F5J A;  4AHZ A;  5FZM A;  4AI1 A;  1SDD B;  4YM3 A;  2FDK A;  4XFA A;  1DG6 A;  1DYK A;  1YUD A;  5C71 A;  3ZFF B;  2C9A A;  3NAP A;  4XCA A;  1CZS A;  2DTW A;  3I2I A;  4QQO A;  1AR7 2;  4YVW C;  3N7K A;  4DO0 A;  1FPN 2;  4YG0 A;  3WDY A;  1PGW 2;  4MXW A;  1Z0H A;  3IBM A;  2Y8K A;  1FOD 1;  2JDY A;  4I09 A;  2EVX A;  3AYE A;  3PU8 A;  4ET7 A;  3RZG A;  3WDX A;  3V0B A;  1KS5 A;  2QZ2 A;  1H8T A;  1GLH A;  3KCC A;  5JR7 B;  3LA3 A;  5EHD A;  3VDD A;  4B4P A;  4RR3 A;  2H0V A;  2GP5 A;  4FSJ A;  4E2Q A;  3IB3 A;  1DQ4 A;  3DXT A;  2AAC A;  4FPF A;  4XQ4 A;  4D7S A;  1SEF A;  2PN5 A;  1G9A A;  1PVC 1;  2G4I A;  3WNL A;  2J1E A;  3GJB A;  3MDP A;  5FP9 A;  5CFC A;  1FPN 1;  1OT5 A;  3VB9 A;  4EQV A;  4FOV A;  1PGW 1;  2A7A A;  1UY0 A;  3ZYG A;  4DY3 A;  2ZEZ A;  5JOZ A;  2E53 A;  1HJG A;  1V6I A;  4QXC A;  5C5T A;  2X5I B;  4L99 A;  1UN1 A;  2G1M A;  2WNO A;  4H2A A;  4HN1 A;  2VXR A;  2WZR 1;  2C5D A;  2JG8 A;  4IER A;  4A42 A;  1K3I A;  1RUF 3;  3MW2 A;  4BM8 A;  3AP4 A;  1POV 3;  4FFI A;  3U4X A;  2A5Z A;  1LOF A;  3AP5 A;  2W47 A;  3V65 A;  4S2D A;  1CIY A;  2DWR A;  5K0U A;  2VUL A;  5A7O A;  3S5A A;  3I2G A;  4UAP A;  2KM2 A;  4CZS A;  4LOS A;  1AUY A;  5J3U A;  4CXX A;  1XE8 A;  2QTW B;  1J59 A;  2ZJC A;  1QXJ A;  5I0S A;  3ZM8 A;  1VRH 1;  3IDB B;  4UW5 A;  1JTZ X;  1LTE A;  4PDW A;  1SFY A;  3EO6 A;  4W8J A;  1KJR A;  5FZK A;  1EV1 3;  1C8M 1;  3OGV A;  2EAK A;  1XSQ A;  3AC0 A;  2XXZ A;  5FYZ A;  3T2O A;  3UT0 A;  5C4W C;  4FFF A;  2WLQ A;  4UBH A;  2XKO A;  2XDV A;  1ENS A;  1LHV A;  4HL0 A;  1WW5 A;  2XJV A;  2ZS6 B;  2ZKL A;  4JKL A;  3RJR A;  3B00 A;  1TNR A;  1SBD A;  1YQC A;  5AFB A;  5JOY A;  5J37 A;  1LKN A;  1POQ A;  4JGZ B;  1Y7B A;  4P00 B;  5FZO B;  4UFK A;  4LKD A;  4MUV A;  4QDQ A;  4QPG B;  4XEZ A;  1JZ5 A;  4LBQ D;  4YFZ A;  1DFQ A;  2J1V A;  3UES A;  2XJQ A;  1KQR A;  1F2N A;  2FZ2 A;  5CU1 A;  3PVB B;  4ZXK A;  4LT5 A;  3FFQ A;  3AMP A;  4NIG A;  1CX4 A;  1PMI A;  5GLU A;  3B7M A;  3ROU A;  5FYB A;  4IEZ A;  1NZC A;  4HOO A;  3VL8 A;  1R08 2;  2ZHN A;  4LNV A;  4GMP 0;  2JIC A;  1GYK A;  1ZBA 1;  2F6B A;  3GNE A;  5FZB A;  5FZH A;  1B35 B;  1GU3 A;  2QQO A;  2VOV A;  5KC6 A;  1ZYB A;  3TN9 3;  1Z7S 3;  2Y6G A;  1R09 3;  4KNC A;  4FBF A;  1HJF A;  3U37 A;  3WW1 A;  3MLK A;  3R4U A;  5A6Z A;  4BIS A;  3OCP A;  1UOB A;  4AFD A;  1LGB A;  2FHR A;  1NUK A;  4TXW A;  1TZO A;  2NLR A;  4IV1 A;  3IKW A;  4NWW A;  4CCJ A;  5CG9 A;  1CWP A;  2VZO A;  4Y26 A;  1IS6 A;  1OXC A;  1UIJ A;  5DUV A;  5EZW A;  5FFO C;  2VMD A;  2IXI A;  3D4K A;  1JYN A;  1QJE A;  3OD0 A;  3MIG A;  5L73 A;  3W5N A;  4YW7 A;  2B9U A;  1S1A A;  1NX9 A;  5FZ4 A;  3H42 B;  1WBL A;  1NCR C;  1GOF A;  5IAX A;  5JIU A;  1YRZ A;  2VBP A;  1NE4 A;  3KT7 A;  4JDM A;  3FFZ A;  1NA1 C;  1POV 0;  3ZKU A;  3ES1 A;  4YPJ A;  2JE9 A;  1PZ8 A;  4NHK A;  5FY4 A;  5ISL A;  4UT5 A;  3GZA A;  2QQI A;  2BVV A;  3NV4 A;  4XAB A;  4XHB A;  5D2A A;  2BNN A;  4YNI A;  1ULC A;  1FV3 A;  2YFZ A;  4Q4W 3;  4QM8 A;  3ZSJ A;  3BU0 A;  1O5U A;  2IXJ A;  4HKL A;  5ABJ A;  1UMI A;  2RDS A;  4I3G A;  1OA4 A;  5F32 A;  1GFF 2;  1QH6 A;  1C1F A;  4Y1V A;  5JCT A;  3PUI A;  1TE1 B;  2RDR A;  4XDP A;  1L7R A;  4Q8L A;  5LBC A;  2P3I A;  1C5H A;  4A3X A;  4COV A;  1OH4 A;  2R07 3;  2EIG A;  2JD9 A;  4CEW C;  1Q8S A;  1G9F A;  1DHK B;  3H3L A;  3GZU C;  2C0Z A;  2FCV A;  4ISR A;  1H1M A;  3RMX A;  1U0A A;  4LKF A;  5CKN A;  5E89 A;  2P5B A;  3NNL A;  4CDU B;  2W0X A;  3OOX A;  5LWB A;  5AC9 3;  4A3Z A;  4QU1 A;  3WXP A;  4QQP A;  1OFS A;  2CU5 A;  4X8N A;  2A6V A;  4A44 A;  1OLM A;  5FPL A;  2SBA A;  1V0A A;  1F9K A;  5EYX A;  1D2S A;  1JYX A;  3ECQ A;  4MXV A;  2GN7 A;  3VN4 A;  1JUH A;  5CAZ A;  3VZK A;  5LZ6 A;  5GAL A;  1NCQ A;  3ACH A;  2VQA A;  4CEY A;  2E7Q A;  4LBQ B;  2VW0 A;  4CDW C;  4LXL A;  3U07 A;  1C4R A;  5BNP B;  2EXI A;  3DPR B;  3A7Q A;  5FZF A;  3O1P A;  4CU6 A;  4YM1 A;  1MR5 A;  3AL6 A;  1JU4 A;  1REE A;  4N43 C;  2BGP A;  4DEQ A;  1OLR A;  2VNV A;  2YC2 A;  3SCH A;  4PHZ A;  4D8M A;  4RS5 A;  3RZL A;  3SHR A;  1KJL A;  1LHO A;  1S0B A;  3A21 A;  3WNN A;  5DUX A;  2H6B A;  2EA7 A;  4L11 A;  2WT1 A;  4GJZ A;  4KGG A;  4QGM A;  4D6R A;  3E5Q A;  2A6X A;  5JPN B;  4K9S A;  1V6L A;  2YBP A;  2XQR A;  3UJO A;  4COY A;  4TSV A;  1S0I A;  4YWA A;  3VBO A;  1W6N A;  2WNU B;  5A1A A;  2G9F A;  4JHT A;  4J25 A;  4AG4 A;  2FCU A;  4HZF A;  4R4X A;  3H9A A;  3K4A A;  2MEV 3;  5H9Q A;  4CCD A;  3ES4 A;  3SKV A;  4H55 A;  4LO7 A;  4TLF A;  1AXZ A;  5K7P A;  3MIB A;  2ZML A;  1RUF 1;  2SLI A;  3QBQ A;  2I74 A;  2QKD A;  4JKK A;  3JU9 A;  3M8L A;  3O0X A;  4QAW A;  1IQA A;  4AQ2 A;  4C1X A;  2Y0I A;  4GB3 2;  4KG8 A;  4JZR A;  3ZN6 A;  3GHM A;  1ENR A;  1PK6 A;  3RGB A;  2J22 A;  2RS1 3;  2ZAB A;  1EUT A;  5FYS A;  1ZM1 A;  3QCW A;  5BNO A;  1GZW B;  3A0K A;  4DOU A;  1EV1 1;  1W8T A;  2UY9 A;  1R1Z A;  4ZS2 A;  3P3P A;  4R52 A;  1HB2 A;  2TEP A;  2LM3 A;  1SLI A;  2BJS A;  4RN5 A;  1S4C A;  2RVA A;  1DQ6 A;  4AFA A;  1GZC A;  3I4I A;  4QDS A;  3TN9 2;  2WUH A;  4IL7 A;  1R09 2;  1EPW A;  2ZHK A;  2OUJ A;  2ZX4 A;  5DN2 A;  1MS0 A;  1DGL A;  5GLV A;  4EN6 B;  3T2P A;  4CU9 A;  4XF3 A;  2EID A;  3OY8 A;  4WM8 C;  4Y1U A;  2UYB A;  4UFM A;  4NPL A;  1AZD A;  3KHB A;  4UF0 A;  4NRP A;  4DMI A;  1YWK A;  2PHL A;  1QIQ A;  3NL1 A;  3CEW A;  5K8S A;  5FPB A;  4DXZ A;  3BYW A;  3ZYR A;  3KLS A;  4RQP A;  4I2O A;  3POI A;  1OI6 A;  5IVY A;  1CR7 A;  5CYY A;  2XJP A;  3I7D A;  3NMB A;  4JTN A;  1UW8 A;  1MZF A;  4Y3O A;  2ET1 A;  3THP A;  3V64 A;  1DLL A;  1G86 A;  2WJS A;  5DMY A;  1Z7S 1;  1GUI A;  1R09 1;  1WD4 A;  3BIE A;  4MHU A;  3DV8 A;  1URX A;  4IGQ A;  4Q4W 2;  4RYD A;  5EWS A;  4GA9 A;  2DCT A;  2TUN A;  1KDK A;  4FXK B;  4N9I A;  1AR9 1;  3GBW A;  1TVG A;  4NRO A;  1XXN A;  3E5U A;  4CCK A;  4TLG A;  2EIC A;  3S7E A;  1HLC A;  3WF4 A;  3N9L A;  2E6V A;  1I5P A;  2R07 2;  5IVF A;  5FUI A;  3G7D A;  3T2T A;  4LBN A;  1LHN A;  2WLP A;  4NIA A;  1W2A X;  3FLR A;  2ZA9 A;  5FY5 A;  2R04 3;  3OG2 A;  1OHF A;  3VHN A;  1GQP A;  5I8Y A;  3MBW A;  3GBG A;  5HBA A;  3A4U A;  2BW8 A;  1E5R A;  2JDK A;  4Z1V A;  4IEU A;  4ASL A;  2YGL A;  1QJZ A;  4YVW A;  1OSG A;  3JD7 3;  1W8N A;  4HBN A;  4H14 A;  4XUR A;  5FP3 A;  2PA7 A;  4Q4W 1;  4FI9 A;  4DNY A;  5I0R A;  2W39 A;  3ASI A;  2D6N A;  2ZCW A;  4BZ4 A;  4ZZ5 A;  2BEO A;  3O0W A;  3O5S A;  1QWR A;  1QDO A;  4W4Z A;  4YW6 A;  2P37 A;  4CDX C;  1EY2 A;  4LIV A;  4OI1 A;  1HN0 A;  2D6L X;  4XVH A;  3RZK A;  4O61 A;  2IC1 A;  4N90 A;  2WC2 A;  1ODM A;  2X10 A;  2VOT A;  2WYF A;  1UWW A;  2OPW A;  4Y5Z 0;  3M7A A;  1COV 3;  4CP9 B;  1RIT A;  5AC9 1;  4IES A;  2WFP A;  4TTG A;  3FJS A;  1QJU 3;  5KHH A;  3VBS B;  4CDQ C;  4EE2 A;  2NN8 A;  3AMM A;  3O1T A;  4XET A;  2QVS B;  3GCW A;  3ZMN A;  2E26 A;  4AHY A;  3ZDV A;  4EZH A;  2WAO A;  1STM A;  1BXH A;  2ZMK A;  4H3W A;  2HH9 A;  2P17 A;  2RR1 3;  4ZU7 A;  5FPX A;  3JBG 3;  1WCU A;  2MEV 2;  4O7X A;  4AE2 A;  2J7M A;  2X53 S;  4XMI A;  5J1X A;  3ILF A;  3SQO A;  1UQX A;  1VMH A;  4JGZ C;  1JOD A;  3RI9 A;  5HCA A;  1WCK A;  1E5I A;  1NLS A;  1JS9 A;  1OQ1 A;  4UOJ A;  3ZXK A;  3FC0 A;  3MW4 A;  4Z2W A;  3S30 A;  3ZFG B;  3H7Y A;  4XQD A;  1X7N A;  1CAW B;  5L7O C;  2RS1 2;  2ZAC A;  1PM4 A;  2GDF A;  3TOJ A;  2DUR A;  2BDR A;  2QE3 A;  1OA2 A;  3C7O A;  3M2M A;  1C3H A;  1TME 3;  4XUQ A;  5FY9 A;  2W68 A;  2Q8E A;  2YG0 A;  3VDD C;  3VD9 A;  2AH2 A;  2JDN A;  5C4W A;  2XML A;  3UL2 A;  4QHB A;  5JXG A;  4OCT A;  3HQU A;  1IKP A;  5GZD A;  2H0B A;  2WNV C;  2Y6K A;  2DCZ A;  3KT4 A;  5FYU A;  2G9Z A;  5A3T A;  1LEN A;  1YJL A;  2ZX0 A;  4L9B A;  4OUL A;  4Z92 B;  2MEV 1;  5ACA 1;  2CNA A;  3Q8E A;  2J1S A;  3BPZ A;  4R9B A;  2C4X A;  1US3 A;  2PAM A;  1E5H A;  1HW5 A;  2LRP A;  1RUO A;  5ANQ A;  1A78 A;  3SLI A;  1AR8 3;  2ZGQ A;  1V70 A;  3BUC A;  1IQD C;  2EAA A;  2K9Z A;  5FMD A;  3ZYP A;  2LRO A;  3ALQ A;  2PAE A;  3RFR A;  3KWV A;  4XAE A;  5A7S A;  5KC5 A;  5LBE A;  1XC6 A;  5BNN A;  1R1A 1;  2GC2 A;  3VDB A;  3WT3 A;  4LBM A;  3OD4 A;  3WF3 A;  1LOF C;  5L9R A;  4YLZ A;  3GDB A;  4L97 A;  3RNS A;  3AXD A;  4XFH A;  3T4V A;  5LY1 A;  4ZU4 A;  2QNK A;  2ZAH A;  2AYH A;  4V2W A;  1ENX A;  1OOP B;  4BK5 A;  2IVI B;  3BAL A;  4CUC A;  3BGA A;  1XNC A;  4OUS A;  1VB4 A;  3WD5 A;  1ZX5 A;  4QPI A;  2XHN A;  1RIR A;  1OFN A;  2BWA A;  2XJS A;  4QPY A;  3ZXL A;  1IPS A;  1W9T A;  2BOI A;  1XE0 A;  3NKT A;  4OHV A;  4QGL A;  4WVM A;  4XIL A;  4B1M A;  5FZE A;  4CP0 A;  2BBA A;  5JXH A;  1ZZC A;  3IN9 A;  4Q4X 2;  5GKA C;  5LY2 A;  2CY6 A;  4LKS A;  5KR7 A;  3IMN A;  1JHN A;  1PMH X;  4IUG A;  1V9U 1;  5J09 A;  4CCL A;  3KV4 A;  4YZ1 A;  3OSD A;  4KU7 A;  5EYY A;  3WUD A;  3WY6 A;  4CUG A;  3T0B A;  4AFC A;  2BU9 A;  4A7K A;  3OJB A;  4MGT A;  2XGX A;  4FTE A;  2WL1 A;  2R04 2;  2Y0O A;  5IK5 A;  4NUB A;  1Z78 A;  1NA1 A;  3I8T A;  4XJZ A;  1A34 A;  3IIA A;  4JTO A;  3VKO A;  3CLP A;  4Y33 A;  1CAX A;  2VMG A;  1ZZ8 A;  3IDE A;  3JD7 2;  1CJP A;  2VD7 A;  2W1W A;  1EP0 A;  1DQ1 A;  3FZ3 A;  2EIB A;  4MG2 A;  2NPI A;  5CKM A;  1RB8 G;  1RUG 3;  2OQ7 A;  1W05 A;  4LOT A;  4A7Z A;  2RE9 A;  4AR2 A;  2HWE 1;  4DIQ A;  2WO3 A;  1ALY A;  2CL2 A;  2QQW A;  2WO2 A;  2YYO A;  4FQZ A;  2V5D A;  3W58 A;  4GIQ A;  2YBK A;  2Z4F A;  1FMD 3;  1PGS A;  1IG0 A;  1PO2 1;  4E8D A;  4YFW A;  2R04 1;  4IV1 C;  4D7Y A;  3RJ2 X;  2RV9 A;  1COV 2;  1ZRD A;  3PJY A;  5FXV A;  5FP8 A;  2HEW F;  2PLV 2;  2QQM A;  3LEM A;  1LOE A;  3ETQ A;  3GM8 A;  5ANN A;  4DRV A;  5KXC A;  1YFX A;  5DDJ 3;  2JDZ A;  1IG3 A;  4P5H A;  3SNM A;  4BWO A;  4CPB A;  5IFP A;  3ACL A;  1JZ3 A;  2AEN A;  2AGS A;  5A33 B;  1UF2 C;  3AZX A;  5GLT A;  2GH8 A;  2JDU A;  2X8K A;  1DIW A;  3I2O A;  1UY4 A;  3KV9 A;  3OYW A;  4B4R A;  4ORF A;  1HB4 A;  1BEV 3;  5LBB A;  3FUQ A;  1RUC 3;  3VD7 A;  3WSO A;  4CDW A;  2ZGN A;  3JBG 2;  1O91 A;  3ACI A;  4IEP A;  5F5C A;  2QJV A;  3LSE A;  4ERO A;  5DQ0 A;  4Y24 A;  3Q8F A;  1SFP A;  2YC0 A;  5LRR A;  1O6U A;  5DPN A;  4JC1 A;  4MGZ E;  1COV 1;  2CYF A;  2VME A;  4IND A;  4N53 B;  5FZ1 A;  4JGY C;  5FYC A;  4RFT 0;  4COW A;  1QJU 1;  4GAL A;  2ADE A;  4AVA A;  5JWP A;  1VBC 3;  3PMS A;  1ENQ A;  1TME 2;  1XQN A;  1DYP A;  4MAD A;  2D3R A;  3V0A B;  2W46 A;  4PI2 A;  2W1U A;  4D6S A;  1HDK A;  4B4Q A;  2VC9 A;  2W5F A;  3H0O A;  1GNZ A;  1AYM 3;  1N47 A;  4HSL A;  2F17 A;  2NQY A;  5DAP A;  4PI0 A;  5AVA A;  5FV3 A;  1ZZ7 A;  4KU8 A;  2RR1 1;  4MGK E;  2EXK A;  4F8A A;  1AR7 3;  2E31 A;  2XL9 A;  4XF9 A;  2W2I A;  5F9T A;  1WWY A;  4BH9 A;  1DBN A;  2ZMN A;  5C8W A;  3AP9 A;  1AJO A;  2WFF 3;  3M3E A;  2JX9 A;  4Z82 A;  4X8P A;  3S6P A;  3VZM A;  5EJ1 B;  3VBH C;  1G9C A;  4YG3 A;  1K12 A;  3NVC A;  3T08 A;  2WKK A;  3MIE A;  1AX0 A;  2ARE A;  1EYB A;  4QKB A;  1QJY 1;  5D1I A;  5A7W B;  1MS9 A;  3VBU B;  1VLN A;  4CEY C;  3WNP A;  1W3X A;  2HYX A;  3NNF A;  4L92 A;  4O9G A;  4XXA A;  5JZG B;  4L8Q A;  5FK8 A;  1RJ8 A;  1I5Z A;  3ZFE A;  3S5Q A;  1LEM A;  1JU3 A;  2VO5 A;  3AZW A;  3CJI B;  4XAA A;  4XXP A;  5FXX A;  5C9A A;  1LOB A;  1HN1 A;  5IAV A;  4A6O A;  2W08 A;  2IXK A;  2DU0 A;  2D5F A;  4DFS A;  1WME A;  5FZI A;  4Q8K A;  1NLQ A;  4IV3 B;  5JXI A;  4WM8 A;  1N1Y A;  1UXZ A;  1UZY A;  5C70 A;  1AR8 1;  1UY3 A;  1OKQ A;  1WLC A;  3N35 A;  4FPY A;  4Q1R A;  2NYY A;  3MFC A;  1G9D A;  1ULE A;  2BPA 2;  1W9F A;  1J83 A;  4GH4 C;  4CTE A;  3MPP G;  3USU A;  3WX5 A;  5IW0 A;  3D82 A;  2QQN A;  1GP5 A;  5EXO A;  5KWR A;  4ZU5 A;  3KSC A;  1UL9 A;  3PTR B;  3VKM A;  3ZYI B;  5FZA A;  4DEV A;  4AL9 A;  3JQX A;  5HCH A;  4Q29 A;  2LUW A;  2CGN A;  2WQ8 A;  3D5O A;  4SLI A;  1H0B A;  1PIV 3;  4NO4 A;  1H8V A;  1OF3 A;  3O1O A;  2XJT A;  2PYT A;  2KD7 A;  2ZGS A;  1BZW A;  1RUG 2;  4FOW A;  5IK8 A;  1WA6 X;  1XBF A;  4A7Y A;  2DUP A;  4M3C E;  5E1R A;  4QX7 A;  1WUV A;  1P8J A;  2LW8 A;  1QEX A;  2WQ4 A;  1PHM A;  1MQT C;  2XWJ B;  4QX3 A;  3UV9 A;  1VBB 3;  3ZMO A;  3WZ1 A;  2ZTN A;  4AYU A;  1FMD 2;  1XU2 A;  4P14 A;  3J4U H;  4KWK A;  3EJK A;  1ND3 B;  1UIK A;  5FPA A;  4OMD A;  1GKB A;  4Y22 A;  2VVF A;  1XB9 A;  3ZXJ A;  2R49 A;  1TQ5 A;  2YRO A;  3NST A;  4DQA A;  3OEA A;  2A70 A;  2VR4 A;  1V6J A;  2HWF 2;  3VBS C;  4BJ0 A;  3WDT A;  2BTV C;  5I8T A;  2R7E B;  2VBB A;  2C26 A;  2VY0 A;  2OUH A;  5DDJ 2;  1RXF A;  1PGL 2;  1R08 3;  3I3E A;  2YY1 A;  1PO1 2;  2W1S A;  3PDQ A;  1RUG 1;  1GWK A;  2UWA A;  2X5I A;  1ZRE A;  4ZKT B;  2B45 X;  3H8U A;  3K2O A;  4UW6 A;  3OGR A;  4M0N A;  2XKP A;  1VMF A;  1G6N A;  4CDX A;  1K5M B;  4UYB A;  3I3Q A;  4R4Z A;  1RVF 3;  2XBO 3;  4PLO A;  2R1D A;  2YUE A;  1WLD A;  1UMH A;  2RS5 3;  1FMD 1;  2DCY A;  3EMR A;  3I2K A;  1AX2 A;  1WBF A;  1XOY A;  3DCQ A;  3T30 A;  2WA4 A;  5C3P A;  1HKD A;  1GWM A;  4LPL A;  2Y34 A;  1YFY A;  3IAP A;  3LWC A;  4BPZ A;  1VBE 3;  1NZI A;  4Y20 B;  1UMZ A;  5I0T A;  1YIF A;  4B7E A;  1MS8 A;  1VBC 2;  3PIG A;  4XIO A;  3WDU A;  4NVP A;  2Y26 A;  1JZ2 A;  3T4H B;  4AOC A;  1D0H A;  1S0F A;  1AYM 2;  2ERF A;  1H2L A;  3FBY A;  3HNY M;  1RUJ 2;  2RJK A;  1UZ0 A;  1BEV 1;  4EWE A;  1H2N A;  1RUC 1;  3O7O A;  5I8S A;  4QU2 A;  4JGZ A;  2VBD A;  3SC7 X;  1SLL A;  4RGG A;  5F6L B;  4FPC A;  5FZO A;  2JIG A;  2I2S A;  4TWT A;  5JIA A;  4QD2 A;  2WRA A;  1AL0 G;  5T5O A;  2WFF 2;  3IWZ A;  5L7O A;  5FIX A;  5FJK A;  2VXJ A;  2J42 A;  1CAU B;  4Z8B A;  1RJ7 A;  4GMP 3;  1CJD A;  3WW2 A;  2GC0 A;  2OS2 A;  4AED B;  1AHS A;  4OHZ A;  2VTX J;  2RDQ A;  3AKQ A;  4Q26 A;  3PTY A;  3KMH A;  5H9P A;  2WNV A;  1DDL A;  2A6Y A;  2ZX2 A;  1UU6 A;  1WCS A;  1X33 A;  1QJF A;  1YYN A;  2DFB A;  4FPH A;  2QQL A;  1AYM 1;  4DZG A;  2FD8 A;  4JQT A;  5FY8 A;  1B35 A;  1BYH A;  5LCW L;  2ARX A;  1MEC 3;  4AXO A;  3MGU A;  1G9B A;  4WZF A;  1AR7 1;  4BK4 A;  1WD3 A;  4DRR A;  1ACC A;  2V5Y A;  2XUM A;  4XYX A;  4ZON A;  4BQ3 A;  3J8F 3;  5JXJ A;  3LDB A;  4M3C B;  4JDO A;  1DGR A;  2ZEY A;  3ZKY A;  5KXE A;  2JKX A;  2HWB 3;  1HV0 A;  3NO8 A;  4YVS C;  5F1R A;  4QDR A;  4XFI A;  1ZZB A;  3LD8 A;  3IPV B;  4QQH A;  2CTV A;  5H9R A;  5B4X A;  3WVJ A;  2JXA A;  4XQW A;  3LPF A;  3WNK A;  1A8M A;  3LE0 A;  3WF1 A;  5KXD A;  4JKM A;  1Q3E A;  3N36 A;  2Q8O A;  4LTA A;  5T3N A;  1SG3 A;  1NQJ A;  4X6Q B;  2JG9 B;  4P02 B;  4RSU A;  5GZF A;  3H8O A;  3A22 A;  4BQ5 A;  1O4Y A;  3JUU A;  5FYI A;  4P9Y A;  2PMW B;  2ZZJ A;  3TBD A;  1PIV 2;  1Y9M A;  3WHT A;  3QH6 A;  4DXR A;  3ON7 A;  2YBS A;  2BGO A;  1UX6 A;  4CU7 A;  2XPJ A;  3WQB A;  3SEP A;  1IPK A;  2C24 A;  4FTS A;  4S2G A;  1DP0 A;  5HV4 A;  3B5L B;  4WVW A;  4RGA A;  1SLB A;  3TAY A;  3LB9 A;  4LBL A;  2GNT A;  3T1M A;  3ZYB A;  4QX2 A;  4YZ5 A;  4AAX A;  1AJK A;  2PHD A;  4MGI E;  3I59 B;  1VBB 2;  1YI9 A;  4AI9 A;  1IHM A;  2J1T A;  3MW3 A;  4JV4 A;  3M3I A;  5A1L A;  4GB3 3;  3K4D A;  2QDR A;  3M3Q A;  4WM7 B;  4CDU A;  3AB0 A;  3UKN A;  2YB7 A;  2CSG A;  4QQ2 A;  1N3P A;  5LEJ A;  1ASJ 3;  3KHC A;  5CZK A;  4PQQ A;  4BYY A;  1UO9 A;  2XVK A;  3KQR A;  1PIV 1;  2JEN A;  3CJX A;  3RSJ A;  4NID A;  4NHY A;  2PHF A;  2Z2S B;  4PQ9 A;  5BNN C;  1VBA 2;  3RZM A;  1UOJ A;  3BOP A;  3FLT A;  4E4Z A;  3ORJ A;  3JB8 A;  5GLW A;  3HEI A;  3NAP B;  1MS5 A;  1XNT A;  2DCK A;  2OT7 A;  3MID A;  1U5Z A;  3KV5 A;  4LBQ A;  4OHW A;  3BI3 A;  3IAQ A;  3SIS A;  3GJA A;  3SKJ E;  1RVF 2;  2XBO 2;  4QPI C;  2RS5 2;  3DPR A;  1APN A;  1DF0 A;  4LUK A;  2KXL A;  2VVD A;  3V0B B;  3JQW A;  3KF3 A;  1H8T B;  5JOW A;  4LK6 A;  4OHX A;  3CIH A;  3APB A;  1NT0 A;  2ZPX A;  4RR3 B;  4LIU A;  1W99 A;  5TSW A;  2FDI A;  1VBE 2;  2WAB A;  2YMZ A;  3D3A A;  3MYX A;  2ZZQ A;  1NKG A;  2ID4 A;  4NWV A;  1X8E A;  2ZGP A;  3PLQ A;  1R08 1;  5FY0 A;  2DDU A;  2VEC A;  2FCT A;  4H7M A;  4A45 A;  3AP7 A;  3J7L A;  1C5I A;  2Q5T A;  4GWN A;  1O8P A;  3UYJ A;  4AAP A;  5C8C B;  2D3S A;  4I30 A;  5IFT A;  1ZRR A;  2XBO 1;  1GBG A;  1RUD 2;  3CZU A;  3DL3 A;  3JZV A;  3WW3 A;  2RS5 1;  3DF0 A;  5LA1 A;  4IEY A;  3RRD A;  1DQ0 A;  3H1M A;  2ZGU A;  4Q2F A;  2BER A;  5A3L A;  2JG8 B;  2UWB A;  4P5Y A;  2O14 A;  4JGY A;  4C1W A;  3POW A;  3DGT A;  3LDK A;  3Q8B A;  1UYP A;  1VBE 1;  2YU2 A;  1YQ8 A;  3ILN A;  2J1U A;  4PIY A;  1GZW A;  4Q0S A;  3PUA A;  4R9C A;  3IDC B;  1N1V A;  1WA4 A;  2B39 A;  2VUA A;  2JD4 A;  2VW1 A;  2WYS A;  2DUO A;  1W6O B;  4ZPI A;  2QDN A;  3AMQ A;  1HQW A;  1I3H A;  1NYW A;  3O1U A;  3UET A;  3VBR B;  1MEC 2;  1F4H A;  1Q56 A;  4PDW B;  5CAD A;  2JWP A;  3LA2 A;  4RD7 A;  4YGE A;  4COZ A;  1OLM E;  3MLL A;  5A3N A;  3M4F A;  4AEK A;  4P9W A;  1C57 A;  2W87 A;  3J8F 2;  5FMC A;  3VBH A;  3IZO A;  2XJU A;  4WV8 A;  3ST7 A;  1W8O A;  2DBN A;  1US2 A;  1AXY A;  2CWM A;  2HWB 2;  1JMU B;  2VTF A;  2VCA A;  3HD8 B;  2YV8 A;  1GOH A;  4GZ9 A;  3ZLI A;  5FZD A;  1H2K A;  2F4P A;  2WR9 A;  4XF4 A;  4GMP 1;  4LR4 A;  4K7J A;  1LGC A;  5FMO S;  4A2U A;  3PL0 A;  1RMU 3;  1UXX X;  3LOB A;  4UFI A;  3PVE A;  3WG1 A;  5L9B A;  3JB4 C;  3WF2 A;  5BYN A;  2DV9 A;  3U10 A;  5CFD B;  3CMG A;  4OZO A;  3VV1 A;  1S55 A;  1MEC 1;  1HRV 3;  5F2W A;  1VPH A;  5FJH A;  5FMO L;  4ZXE A;  5A32 B;  1OC1 A;  3ACF A;  4PF1 A;  4OVE A;  1ZA4 A;  1CX1 A;  3B69 A;  3T1L A;  5DAW A;  2D40 A;  1J58 A;  2HWB 1;  1F4A A;  2ZOE B;  4LHK A;  1VIW B;  3FX3 A;  3E5X A;  3VD3 A;  2BYV E;  4AFB A;  2DVB A;  4FOQ A;  5F6K A;  4C8D A;  3C7F A;  3TEX A;  1VJ2 A;  2OZ6 A;  3POG A;  5E8A A;  4GH4 A;  1CD3 G;  2QQU A;  4X6R B;  1KRI A;  2C1F A;  1IS3 A;  4HLT A;  1AX1 A;  5ERL A;  1OD3 A;  5CIR A;  1QGL A;  5JI7 A;  1POV 1;  3VZJ A;  2EF6 A;  1EPZ A;  5J36 A;  4Z2A A;  5BV6 A;  2D6M A;  5DZF A;  4OI0 A;  3OUH A;  2Q0A A;  1QOO A;  1BVP 1;  2YPJ A;  1Q8Q A;  2A6Z A;  4AK3 A;  3VDA A;  4CP1 A;  1ASJ 2;  5F5A A;  1W6M A;  5F7U A;  3N7L A;  5FZ0 A;  3X29 B;  2JE7 A;  3AYA A;  4IGP A;  2VZT A;  1JI6 A;  2AZ5 A;  5FK7 A;  3ZFE C;  4W65 A;  2ORZ A;  2OZJ A;  2R16 A;  3HMY A;  3IDA A;  3USS A;  3ZSE A;  3QH7 A;  5C9A C;  2VNO A;  3ZYJ B;  4B1L A;  4BHP A;  1MQT A;  1GMM A;  1UPS A;  4KBZ A;  2O0O A;  2D6P A;  2A73 B;  1UPI A;  2VPV A;  4L2N A;  3WW4 A;  3WP4 A;  3R4S A;  2YFU A;  2E9Q A;  5HPO A;  4XUO A;  4GB3 1;  1KFX L;  1XE7 A;  5DAX A;  2VE1 A;  1YQ2 A;  2XVG A;  3LIH A;  5LA2 A;  4I0A A;  5F5I A;  4AWD A;  4UWD A;  1ASJ 1;  2WBK A;  1YIP A;  3BTA A;  1V6K A;  3GZT B;  3Q8C A;  4Q1P A;  3VBS A;  2PHR A;  2VAU A;  2JIJ A;  4W6X A;  1G7Y A;  4QM9 A;  4WVV A;  2P3J A;  3VUO A;  1JOP A;  1S0C A;  2DVA A;  2Y60 A;  2FMY A;  1LGN A;  3TN9 1;  2WWU A;  3ZFF C;  4K20 A;  3I3M A;  3HBZ A;  1KS4 A;  4YM0 A;  1QXP A;  1EUU A;  4AI2 A;  4IE7 A;  2PQQ A;  2Q1Z B;  5LA0 A;  5C3R A;  5KHG A;  1GR3 A;  3U1X A;  2R30 A;  1NCQ B;  4JCK A;  4YRD A;  1PMJ X;  2VUC A;  4Q4X 3;  3BOW A;  2ZGK A;  4LBK A;  4LLO A;  1RUE 2;  1EAH 3;  4HMZ A;  4O9E A;  4YW3 A;  4FOY A;  3HIF A;  1FXZ A;  3IMM A;  3AKR A;  2CV6 A;  1U5Y A;  3HT2 A;  4OUE A;  4AED C;  2BBV A;  4JQR A;  1GIC A;  2NMO A;  1SHW B;  3JCI A;  1LB2 A;  1CON A;  5D21 A;  3UGF A;  4V2V A;  1Q43 A;  5FUN A;  2B5H A;  5ABJ C;  1SPP A;  2GU9 A;  3FE5 A;  1AYN 3;  2VQT A;  2YU1 A;  4CA9 A;  5CVR A;  3ZXF A;  3S0M A;  3JXS A;  1OPM A;  3ABZ A;  3FHA A;  3ZO0 B;  3INA A;  4I02 A;  3VBO B;  3IT8 A;  3URF A;  4BDV B;  4XJ9 A;  2X5I C;  3WQ7 A;  3O0V A;  5CIS A;  3M3O A;  2ATF A;  2HYK A;  1UOG A;  3S7I A;  4K8F A;  2R07 1;  5BY5 A;  1OUR A;  3ITQ A;  1L3J A;  1ZZ9 A;  1UX7 A;  1Q8P A;  4AGG A;  1RUI 3;  2D3P A;  5FPZ A;  5LK5 A;  1PK6 B;  1RMU 2;  4O65 A;  1D7P M;  5F39 A;  2JG9 C;  2IXH A;  1JYC A;  4BMB A;  1N1S A;  2WA3 A;  3I2D A;  3EYP A;  3OBR A;  4XUN A;  5DZE A;  5AVP A;  5BNO B;  5JR2 A;  1YFW A;  2HWD 3;  1HRV 2;  2PLV 3;  3HN1 A;  4IEV A;  5DAV A;  1W04 A;  2GH2 A;  3U75 A;  2P4E A;  2D6O X;  5C3S A;  4YVS A;  4QHZ A;  5FMB A;  5LB6 A;  3LCP A;  5E16 A;  1S2E A;  3ZSM A;  5CNA A;  3W5M A;  1S0G A;  1WW7 A;  4OYU A;  4M0H A;  3TNQ A;  5T5J A;  2YZ4 A;  1RUH 2;  2QQP A;  2AUY A;  1XND A;  2Z79 A;  1ULG A;  2O8O A;  5H9S A;  1H4G A;  2QFE A;  5K9Y A;  1RMU 1;  1SFN A;  1O59 A;  1IPJ A;  3OY8 B;  1S0D A;  4LLF A;  3VBR A;  1D4V B;  4QPG C;  4XW3 A;  3C7H A;  3KQ4 B;  4XDO A;  5GM0 A;  5A70 A;  4UF0 B;  1IGO A;  5FYY A;  2VMF A;  3O12 A;  2W9X A;  4BE3 A;  5DG1 A;  4OI4 A;  4K1Y A;  4AVB A;  3UNP A;  1KGY A;  2LTN A;  2G19 A;  1UU4 A;  4XOG A;  3ZSL A;  4QPW A;  1QKQ A;  1QQP 3;  3I54 A;  2KR2 A;  4QWN A;  1HRI 3;  1QU0 A;  2ZGM A;  3T0D A;  2JJ6 A;  3WF0 A;  4XJ8 A;  1B35 C;  2VZR A;  3HR9 A;  2RMU 3;  3FWE A;  1TEI A;  2FDH A;  3J7M A;  5FWE A;  1W0O A;  5L19 A;  3SCF A;  4GUL A;  3ZXE A;  5JDB A;  2RG4 A;  3B9I A;  1RHI 2;  2GSY A;  3CQO A;  3PVO A;  3GGL A;  4PT6 A;  3EB7 A;  5F3C A;  3RS6 A;  5I0D A;  3AJZ A;  2BUK A;  2I45 A;  3QAC A;  2VCB A;  4DUX A;  1HXS 3;  1X82 A;  2RS1 1;  1GWL A;  4JRL A;  4XFG A;  5FZ3 A;  4HT1 T;  3RVH A;  3LEG A;  5GZE A;  2Z69 A;  4JRA A;  3ZPY A;  4K21 A;  1WZX A;  1IKQ A;  5A33 A;  2ARA A;  1XRU A;  5A3P A;  3C3V A;  2RDN A;  2HWC 3;  1WW4 A;  4NHM A;  3CL1 A;  1UZZ A;  4Q4Y 3;  2J1A A;  4NJ4 A;  4YVW B;  3AVR A;  3GAL A;  1LOC A;  5EQU A;  4EN7 B;  2VNG A;  1AL2 3;  1JH5 A;  1KIT A;  2XG3 A;  5DUW A;  5E6H A;  2AC1 A;  4IEO A;  3HQR A;  2ENR A;  1M4W A;  4LA3 A;  4G3Y C;  3U4S A;  4ATE A;  5T5L A;  3D6E A;  3AYC A;  3WUC A;  1LOD A;  1XNB A;  1VAV A;  2ZEW A;  2W3J A;  3CNA A;  3OEB A;  4YW2 A;  2WWJ A;  3ZXD A;  1EAH 2;  1AVB A;  1XNA A;  5A6X A;  3I97 A;  3MIF A;  2W91 A;  5JSP A;  1J1T A;  1H30 A;  1OUX A;  5C6C A;  3Q8A A;  3R0R A;  2J1R A;  4IW3 A;  3V0A A;  3J26 N;  4CYD A;  2N7G A;  1OKO A;  1DGR N;  1UCX A;  4HVQ A;  4LHS A;  4CDU C;  2Q30 A;  4A41 A;  1TMF 3;  1AYN 2;  1QNW A;  1FT9 A;  2BGC A;  1VAL A;  2V73 A;  1SLA A;  1UKR A;  3NWK A;  1SZB A;  3PU3 A;  5FQ0 B;  4JVA A;  3K48 A;  2HBU A;  4Y5S A;  5IAT A;  4OQ8 A;  1QJX 3;  1YO8 A;  2LAL A;  2WII B;  1MVQ A;  4RHV 3;  4M3C F;  3B02 A;  3WG4 A;  1T2X A;  5L9V A;  4Y1Z A;  5L36 A;  1K42 A;  4Q4X 1;  2VU9 A;  4AGV A;  5A7W A;  4FAH A;  1NAE A;  2Q1M A;  2RJ2 A;  3EBR A;  1IZ3 A;  3RPQ A;  4BXS V;  4I0W B;  3FUO A;  2PHT A;  3E97 A;  4YYO A;  1BMV 2;  2K2S A;  3B9C A;  2P6C A;  2VL4 A;  2P1B A;  3K77 A;  5JZG A;  1B09 A;  5EP9 A;  1RUI 2;  4IQP A;  5F3G A;  3POJ A;  1JOJ A;  5BNP C;  3DPR C;  2B9V A;  5BPX A;  1UY1 A;  2JDH A;  2XUE A;  5CFD C;  1AYN 1;  2HWF 3;  5G05 L;  1CIW A;  5M0T A;  3HPN A;  1W8W A;  2HWD 2;  3AL5 A;  5C4W B;  4LIT A;  4AGR A;  3JD7 1;  5FBZ A;  1W6Q B;  2I07 B;  5FLH A;  5CEH A;  2FDG A;  4UFL A;  3OBA A;  1PO1 3;  4B8E A;  4QB2 A;  4CUB A;  5F37 A;  2V4V A;  3MPB A;  1VE0 A;  3I2J A;  2WNU C;  4CPB D;  3AYD A;  3AFK A;  4HAN A;  1W0N A;  4IE4 A;  4ITC A;  2O8Q A;  4XZU G;  4FAG A;  1RIN A;  1BMV 1;  1AR6 2;  3LGR A;  3OPT A;  4UFJ A;  5HCB A;  1OD5 A;  3ZPO A;  2XQX A;  2D93 A;  1CPM A;  4M4P A;  3L2H A;  5DXD A;  2VCM A;  3AKP A;  5B2G B;  1HIX A;  2EXJ A;  5FYT A;  1OBN A;  2HWD 1;  2C9K A;  2PLV 1;  1SQ4 A;  3UGH A;  1LHW A;  1FNZ A;  3OPZ A;  3POB A;  2OXB A;  5FYM A;  4K40 A;  3BTY A;  1ND2 B;  4IE6 A;  2RJL A;  1QQP 2;  5DUU A;  2GMP A;  3B01 A;  4WBB A;  4XPV A;  4FT8 A;  1HRI 2;  1RUJ 3;  1JZ7 A;  1KD7 A;  3EXU A;  2OYZ A;  4ASM B;  1A3K A;  2CAV A;  3JBG 1;  4YG6 A;  1XSR A;  3ZR6 A;  5FO7 B;  3I3D A;  2RMU 2;  5IK7 A;  2VOX A;  2W92 A;  3UK9 A;  1KFU L;  3U0Z A;  1ND3 A;  2WO7 A;  4PF5 A;  2Q4S A;  1W6P B;  1QH7 A;  1DGW X;  1LR5 A;  3FMG A;  3FL7 A;  1HXS 2;  5DAB A;  1NY7 2;  2OA2 A;  1NCR B;  3VLB B;  1J1L A;  3A23 A;  3WV6 A;  4HPK B;  1TME 1;  4QKN A;  4W6Y A;  5A1F A;  4KG0 A;  1IS5 A;  2Y33 A;  1QQP 1;  2D6K A;  3TYJ A;  3AFG A;  5FY1 A;  3VKN A;  1W2T A;  4XJW A;  1VB2 A;  1LJ7 A;  4D7T A;  2Y6L A;  4Z07 A;  4ARY A;  3BTZ A;  1HRI 1;  4WVZ A;  2HWC 2;  2EAL A;  4YW5 A;  4PCR A;  4Q4Y 2;  4W50 A;  1K5M A;  1ULO A;  4IEW A;  2VZV A;  4LUM A;  4BQ1 A;  3ETP A;  3N9N A;  5A7N A;  2O1Q A;  2DVD A;  2W52 A;  4LA2 A;  1AL2 2;  5J98 B;  3RWN A;  2VOK A;  4K3U A;  3BIW E;  5BNQ A;  1J84 A;  1XU1 A;  2WZR 3;  3K3N A;  4MVT A;  4AQT A;  4Q0P A;  4XUT A;  4CEW B;  4QB1 A;  5IVJ A;  5JUV A;  4E27 A;  4JAA A;  3AP6 A;  1VRB A;  1H9W A;  2DF7 A;  2WNE A;  3P3N A;  4BA6 A;  4Y20 A;  1BCX A;  2IFW A;  4U2A A;  2ZGR A;  1WLT A;  4P9G A;  1W2O A;  2VZS A;  5LAT A;  4WZC A;  4F3J A;  5JOX A;  3RWK X;  1V00 A;  3WDW A;  3E6B A;  3H50 A;  1BK1 A;  5C5U A;  3LFI A;  1XYP A;  5A80 A;  1VRH 3;  1TMF 2;  4Q4Y 1;  1FX5 A;  3ZFF A;  5J48 A;  2ADD A;  2Q8D A;  2W94 A;  1C8M 3;  4J6G A;  2WO1 A;  1ONA A;  3I49 A;  3R4D B;  1JBC A;  3KT1 A;  1QJX 2;  1MS3 A;  2VMH A;  4RHV 2;  4V1P A;  2K46 A;  1JZ6 A;  2ZX1 A;  4U36 A;  2B7Y A;  2DFC A;  1S2K A;  1V6N A;  1Y9Q A;  1JYT A;  1NXM A;  4MSV A;  5EIY B;  2HJI A;  2JDP A;  4AED A;  3HBK A;  4KH9 A;  4KGQ A;  4N43 B;  1ZNP A;  4BQY A;  3NNG A;  2QBX A;  2PEL A;  5JMO A;  2YC4 A;  2GND A;  4JX0 A;  3VKL A;  4CCM A;  2PXJ A;  1WMD A;  3OUJ A;  2TNF A;  4GWM A;  1GNY A;  5D8A B;  2BP6 A;  4BQ2 A;  3N4M A;  2A3W A;  2DVG A;  3S57 A;  1DZT A;  4MV2 A;  2Y6J A;  5FZ7 A;  4AI8 A;  3RYP A;  1M06 G;  5FKB A;  5FZC A;  5KHJ A;  2HEY F;  1ZBA 3;  1VBA 3;  3NQH A;  1QJX 1;  4XBL A;  3C2U A;  1YFU A;  4RHV 1;  1QDC A;  1A6C A;  2QQJ A;  2EIE A;  2ZXQ A;  1SBF A;  3MEP A;  3WNM A;  1OH3 A;  5EJZ B;  3MIC A;  2GP3 A;  3PUS A;  1LCL A;  1QMJ A;  1XJA A;  2Y6H A;  4LO6 B;  2CDP A;  3N9P A;  5FYV A;  1YJK A;  2ARB A;  2XR4 A;  1YQ5 A;  2JG9 A;  2X29 A;  1JZ4 A;  1E57 A;  4CP2 A;  4GWI A;  3AZV A;  5JMC A;  2NM1 A;  3ZFG C;  1WKY A;  1T6B X;  4S2H A;  4TN7 A;  3DXU A;  2B4K A;  2HWF 1;  2R0F A;  5HI0 A;  2VMC A;  3DN7 A;  2WT0 A;  2ZHL A;  4GAZ A;  3K46 A;  4KMQ A;  3KVA A;  1MS1 A;  5DDJ 1;  3N9M A;  4E2G A;  5FRE A;  1PGL 1;  1FAY A;  5CA6 A;  1OLQ A;  4QX0 A;  4KWU A;  1CAV B;  1PO1 1;  2UY8 A;  2VJX A;  4NRM A;  3E6C C;  2PHW A;  1VMJ A;  3POE A;  3WOG A;  4KWJ A;  3W9A A;  2OII A;  2VGD A;  3W59 A;  3DEC A;  1DZQ A;  4JDN A;  1J3Q A;  4HON A;  4YSF A;  3I59 A;  1FOD 2;  3PVN A;  4CCO A;  1RUD 3;  2VCC A;  5A3W A;  4XCB A;  3VBF B;  4CUA A;  1LEC A;  1OMI A;  1ST8 A;  3EHK A;  3KM5 A;  4HXC A;  4Y4Y A;  4XMA A;  5T55 A;  4QPG A;  4HG6 B;  1SLC A;  3HQX A;  3SMH A;  3AKT A;  4UXA A;  3WP5 A;  2MPF A;  1I1E A;  4AHX A;  3ZN4 A;  4XTP A;  3WIN E;  3USU B;  2IXC A;  3OPW A;  5FAX A;  1VBC 1;  4QXH A;  2R06 3;  2KA3 A;  2YGM A;  4FP3 A;  1N3O A;  1PVC 2;  4QX1 A;  1RUJ 1;  2PHX A;  3EQE A;  1DZR A;  3CKH A;  3I2F A;  4MGY E;  2ZEX A;  1OOP C;  4N9H A;  5IUQ A;  3VDC A;  4QXK A;  1O4T A;  1W2U A;  1BVV A;  2R32 A;  2FMD A;  5LEK A;  4AQ6 A;  4CCE A;  2A6W A;  4RA0 A;  4D6Q A;  3AXE A;  3KV6 A;  4GJY A;  1D4M 3;  4BQX A;  2WZ8 A;  2WFF 1;  2WZR 2;  4ASK A;  3TB0 A;  3P5B A;  1A8D A;  2DYC A;  2UWC A;  3N9O A;  1FAT A;  1R64 A;  3RDI A;  3W21 A;  2AR6 A;  2WIN B;  4AVC A;  4N7I A;  3U78 A;  4EN9 B;  1DQ2 A;  4R9D A;  5F5Q A;  1UOF A;  5F3I A;  4IET A;  2B8M A;  1Q8V A;  5J96 B;  1JZ8 A;  4Y22 B;  2WN2 A;  1KEX A;  2AEY A;  5IWF A;  1RXG A;  2ZAA A;  2OKX A;  3THD A;  1GQH A;  5IVC A;  3BVC A;  4LHL A;  4XZP A;  3P1I A;  3KZ4 C;  1VRH 2;  4EN0 A;  5C8C A;  3NJY A;  4IEX A;  3QLQ A;  3BTX A;  1C8M 2;  1ULD A;  3POY A;  3TNP B;  2NMN A;  4LBJ A;  4ATF A;  4K8R B;  4IXL A;  2JDM A;  1H6X A;  4Y1Y A;  4PJY A;  3OBT A;  4P9L A;  4D3W A;  3SEE A;  4FFG A;  2JEC A;  3THT A;  4A6S A;  2Y6F A;  2VUD A;  4CDX B;  3N7M A;  1F15 A;  4HSJ A;  3SH5 A;  3V56 A;  3B94 A;  4LQR A;  1JYV A;  1FV2 A;  4E8C A;  1NOV A;  2CGP A;  1MS4 A;  3AZZ A;  3TRS B;  1WMF A;  3MF9 A;  4FPL A;  3H3U A;  2ET7 A;  3CZJ A;  4NR1 A;  1UY2 A;  2ZHM A;  4CDQ B;  3J9S A;  1W6O A;  5A7P A;  4AFM A;  5EJ3 A;  3LFM A;  2VVE A;  3LSD A;  2CHH A;  4CXY A;  3ELN A;  2PAK A;  2OPK A;  4NAO A;  1ZBA 2;  3PIJ A;  1W8F A;  5FTT C;  5FLJ A;  2ILM A;  1BLZ A;  4G9S B;  4PIX A;  1CN1 A;  3W20 A;  3HNM A;  2XVL A;  5FXW A;  2W1Q A;  3DYO A;  1UZW A;  2RS3 3;  1N3Q A;  3WQ0 A;  1VAK A;  4BB3 A;  1Y9G A;  5A3M A;  4MXW B;  4LKE A;  1VBB 1;  1WCD J;  3ENR A;  4HKO A;  5JSO A;  1PZ7 A;  5BNP A;  1MZE A;  2XL7 A;  4RGK A;  5L7O B;  3GBF A;  2Y64 A;  4XAC A;  1BHG A;  4YGC A;  5CFD A;  2ORX A;  5SV5 A;  3VHR A;  1S0E A;  5T5P A;  4IEQ A;  3F95 A;  4N53 C;  3VDD B;  3ZIW A;  2XOM A;  5FPV A;  4BIF A;  4BU2 A;  5A32 A;  4LOR A;  2A3Y A;  1SDW A;  2WNV B;  1VBA 1;  1ND2 C;  5JAX A;  2BRT A;  2WNU A;  5EFU A;  4ARX A;  1GQG A;  1SMV A;  1UAI A;  3G6J B;  4A4A A;  1QOS A;  2WSU A;  5CFC B;  2A75 A;  1RUN A;  1X36 A;  4FPK A;  1JN2 P;  1AR9 3;  1RVF 1;  3GXU A;  3LF7 A;  2XWB B;  4NMI A;  2G9G A;  3O1S A;  1RL3 A;  2FDJ A;  1OPO A;  4GQ7 A;  2GC3 A;  4M01 A;  3MZH A;  5E88 A;  5FZ9 A;  5I93 A;  2VNR A;  2F4L A;  3KB5 A;  4UW4 A;  5LA9 A;  1RUE 3;  2BOJ A;  2Z42 A;  4PLN A;  2BFU S; 
#chains in the Genus database with same CATH homology
 1OKO A;  1WZX A;  2KR2 A;  4LKF A;  1W90 A;  1OH3 A;  4LK7 A;  4BQ3 A;  3ZYF A;  1W8Z A;  2Q1F A;  3UT0 A;  1W9F A;  1UOJ A;  4YW6 A;  4CP9 A;  1WCU A;  1W8W A;  3ORJ A;  2C24 A;  1L7L A;  4CPB A;  4A6S A;  1HN0 A;  1GWM A;  4LJH A;  2JWP A;  3ZYB A;  1V0A A;  2LRP A;  2VXJ A;  4AL9 A;  1W8T A;  4BQ4 A;  4BQ2 A;  2WYF A;  4CPB D;  4CP9 B;  5D21 A;  4LKE A;  4YWA A;  1W8U A;  2LRO A;  4LKD A;  1GWL A;  4LK6 A;  2O14 A;  1GWK A;  1WMX A;  3ZYH A;  4BQ5 A;  3F95 A;  2K46 A;  4YW7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...