3ZYBA

Crystal structure of pa-il lectin complexed with galag0 at 2.3 a resolution
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
121
structure length
121
Chain Sequence
AWKGEVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHPDQGLICHDAFCGALVMKIGNSGTIPVNTGLFRWVAPNNVQGAITLIYNDVPGTYGNNSGSFSVNIGKDQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords PA-I galactophilic lectin
publication title A Glycopeptide Dendrimer Inhibitor of the Galactose-Specific Lectin Leca and of Pseudomonas Aeruginosa Biofilms.
pubmed doi rcsb
source organism Pseudomonas aeruginosa (strain atcc 15692 / dsm 22644 / cip 104116 / jcm 14847 /
total genus 22
structure length 121
sequence length 121
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2011-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07828 PA-IL PA-IL-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 3zybA00
3ZYHA 2O14A 4LK6A 4YW7A 3ZYFA 2K46A 4A6SA 1V0AA 3F95A 1WMXA 4CP9A 2LROA 4CPBD 1GWKA 2C24A 4CP9B 4AL9A 3ZYBA 2Q1FA 1OKOA 4YW6A 1W8ZA 4LKEA 2WYFA 3UT0A 1HN0A 1WZXA 1W9FA 1W8WA 1W8UA 4LKDA 1WCUA 4BQ2A 4LJHA 4BQ5A 2KR2A 4BQ4A 4LKFA 2LRPA 1GWMA 5D21A 1GWLA 1L7LA 4BQ3A 2JWPA 1UOJA 4YWAA 1OH3A 4LK7A 1W8TA 2VXJA 4CPBA 1W90A 3ORJA
chains in the Genus database with same CATH superfamily
1HQWA 2EAAA 3T3YA 1CAXB 4LLFA 4JQTA 4XF9A 3CEWA 4D8MA 3C2UA 3RYKA 5B4XA 4D6QA 1WMXA 4PDWA 1TG7A 5DN2A 1PM4A 2AENA 1GZWB 2OX0A 2FD8A 2RR12 5FY7A 1VRBA 5K0UC 1O8PA 2FMDA 2J22A 4GJZA 1WMDA 5FY0A 3JQXA 1W3VA 1O3TA 1JU3A 1V9U3 1W9FA 4MLOA 1NZCA 1QF3A 2QNKA 3PLQA 1UF2C 3K77A 3ZDSA 2ZGPA 4UFHA 4AI1A 4LBKA 2JJ6A 1VRH3 4CCOA 1OA3A 2XWJB 2XGXA 4FP3A 3FN9A 4LORA 3POSA 1W05A 2IZWA 1AR82 2VXJA 1KJLA 3WF2A 2CWSA 2RDRA 1EV12 1GMMA 4CDQA 4XXAA 1MVQA 3MHZA 3UYJA 1D0HA 1PO22 1W2AX 3ME2A 1JI6A 4FOQA 5LY1A 4LUKA 3I3MA 1OFSA 1QJU2 3KVAA 3H1WA 1U5XA 1V6JA 4M00A 1Y7BA 5FYVA 1DGLA 3UT0A 2RS53 3E5QA 1SFNA 2A1XA 3AJYA 1VBB1 2LTNA 1DQ6A 5CG8A 1RUD3 3PJYA 1SQ4A 1QJZA 4H14A 5H9QA 2I74A 4BM8A 1AXYA 2BFUS 1ZRIA 4L92A 4XJUA 3I54A 1NY71 3LB9A 3WZ1A 3AVRA 1WGPA 5FZEA 1QJX2 4QPIA 1XE8A 1BLZA 2XLAA 3HPNA 3TNPB 3MIGA 1PX3A 2D6LX 5FY8A 4WVMA 2WO3A 3O1UA 4JDNA 1G9CA 1NCRB 1UWWA 1JYNA 1A8MA 4LBNA 1OF3A 1PMIA 5LA1A 2JDKA 2OVUA 1FXZA 2GU9A 4COVA 2NZ9A 3LFIA 3SLIA 3RRDA 3ZMOA 3GBFA 4H3WA 1DBNA 5FZ4A 4RFRB 4D7TA 3E1F1 5A3PA 2RS31 4DO0A 1ND2C 4AXOA 4A41A 1XOYA 4IEVA 1AR71 1RMU3 2JWPA 1F9KA 4XAEA 1UYYA 1PIV3 3NSTA 4XZPA 3SHRA 4D69A 1XSQA 2YPDA 1CN1A 2OS2A 5C4WC 3I8TA 4EN6B 3MF6A 3H8XA 2K46A 5IUQA 1W0OA 5T52A 4BH9A 3RZJA 4K7JA 3N7KA 4LBQD 2VQTA 5C4WB 1CX1A 5FZCA 3HIFA 5A6YA 1JHNA 5JIUA 4QU2A 5DG1A 4M0NA 4WM7A 5LEJA 3LE0A 1LOAA 4D7YA 3LGRA 3ECQA 4Q4X1 5C70A 2P37A 3AB0A 3VHOA 4DFSA 2ZXQA 2X09A 4IQPA 1JU4A 3RS6A 3WCSA 1QGLA 4Z07A 1ODNA 1VJ2A 4Y1XA 1IGOA 4H55A 3OJBA 1EPZA 3VGIA 5EJ3A 5BNNB 2HBUA 5T50A 5CFDB 3MICA 1PGL1 4XZUG 1AVBA 1OOPC 2JENA 3JZVA 4FXGB 3HN3A 2UURA 3SQOA 3SEPA 1UKRA 1FMD1 1W3XA 2C9AA 3NAPC 4OUEA 4UW4A 4COZA 4KL1A 2VUJA 1WZXA 4KU7A 3VKNA 3K4DA 3T4VA 1PVXA 3H7YA 1MZ5A 1PVC2 2HBTA 3PL0A 3N9LA 3MV01 4XF4A 1X33A 4OQ9A 2P4EA 4EYUA 3USSA 2WNUC 1G86A 4XF0A 1VBD1 1W6OB 1XU2A 2Y38A 5KHIA 3GZEA 3KQRA 3VV1A 4NIGA 3OGSA 5C3QA 4QXBA 1YQ8A 5FZ3A 2R061 2PHXA 2B9UA 4W50A 5FJHA 2WS92 1DQ4A 2VC9A 4P5YA 5FQ0A 2WZR2 2VULA 1AYM1 3NKTA 4XW3A 1W6MA 4N43A 5HBAA 2WLQA 4NMIA 1H4HA 4FP2A 2IWGB 4A3ZA 2Y6HA 2WL1A 3S57A 2P3YA 4I09A 1CZTA 2VZSA 3K3OA 2VPVA 3GJBA 3VD7A 5D1IA 4NUBA 3I2HA 3Q9OA 1RHI3 1OXCA 3MF9A 3MIDA 4LNVA 2YB7A 5DXDA 4YVWB 3VBOC 3ZKUA 4RS5C 5BNOB 4OI2A 3VL9A 5FPXA 3O1VA 1SLIA 1H4GA 1DHKB 1ZX5A 2WNOA 3AXEA 2ZOEB 1SHWB 1WKYA 2BTVC 1V6KA 3VDDA 3ZN6B 1RUG2 4XACA 5J37A 4FPCA 4AVVA 2DDUA 4ZONA 1SLTA 4A2UA 1DLCA 2RG4A 5CAZA 1F5FA 2Q4SA 3MW3A 2DVFA 2VNRA 2DU0A 4MHRA 4E27A 1FOD3 4ATFA 4CE8A 4DNYA 2HWB2 4JKLA 3ZSKA 1RUJ2 1NZIA 5IK8A 1L7RA 2VZPA 4CDXA 5JMCA 3E5XA 1UY2A 1GNYA 1ZZCA 2RS11 2WJSA 5FUIA 4META 4GD4A 5HV0A 1KXGA 2VCAA 5IT6A 5JPMB 3RWKX 1IS6A 3VBFC 5JIAA 5B4NA 3PNAA 1UU4A 5A1AA 2A6WA 4LTAA 1QQP2 4XCBA 5G05L 2XG3A 5F6KA 2ZGSA 3VD5A 1SFYA 5DDJ3 2Z5WA 4CPBD 4HPKA 2OPWA 4CU9A 4CU8A 2QQWA 3AMMA 3VBFB 2AGSA 3CJIB 5CB7A 1JUHA 5IATA 4PI0A 4RYDA 5L7OA 4OUMA 1VBE2 4XFIA 4AI0A 3C7OA 2W68A 4XTPA 2A6XA 5HCBA 1R1A3 5IVCA 1BEV3 4Q8LA 1LAJA 3OF1A 4LJHA 2PAEA 3KF5A 1W2NA 1HXS3 1GOFA 1PZ7A 2R32A 2VOVA 4OCTA 3A4UA 3SCGA 3WP3A 3ZYJB 3KV5A 1QOTA 1L7LA 2JIGA 3ZMNA 5FYSA 4E8DA 3KHBA 4CP2A 3FLPA 3P1IA 1O91A 4A3XA 1BJQA 3KT7A 2JEMA 3ZYHA 2K9ZA 4N53B 4AQSA 2X53S 1RUH2 4OMCA 3C8XA 3UKTA 3AP7A 1F4AA 4ONUA 1OF4A 3TB0A 4CU6A 3VD9A 4D6SA 4AR2A 3KV9A 4HT1T 4BMBA 4GB32 3TEXA 1IPSA 2D6OX 3UETA 2IUWA 1A6CA 1YFWA 3AKPA 3RZKA 4Y33A 4QB1A 1NE6A 4GALA 3JBG1 4PLMA 5FK7A 1ZYBA 2VZ3A 1JYXA 3KCCA 4R9DA 5C8CC 4QQPA 5IVFA 2EIDA 2ZKNA 4IE6A 3VBHA 2VD7A 4EQVA 1PMJX 4PIXA 4IGQA 4LBQA 1WW5A 4YW5A 4MADA 5FR3A 2K0GA 1JHJA 4HVRA 1O5LA 5H9SA 1C8M1 4AAXA 3TN93 5ACA3 3LA7A 1PK6A 4HKOA 5FKBA 5E88A 4NHKA 2VZRA 2Z69A 3NNGA 4C1XA 2RV9A 1ZRCA 3Q8FA 2AZ5A 3IAPA 3ZX7A 1J3RA 1O3QA 4LBOA 3O0WA 1YQ2A 1GR3A 3EBRA 3T2PA 4UF0B 3ZVXA 4AG4A 2RJ2A 1REDA 4K6BA 5T5JA 1QHDA 1W28A 1CX4A 1NCQC 1YWKA 3N3HA 5EZWA 3KZ4C 3DYPA 1Z7S2 4Y20B 3LDKA 5FZOA 1R082 1WLWA 4MGQA 2ZHLA 3AMNA 1CIWA 1YEWA 1RUOA 2DUQA 3OGVA 4L8QA 3ZXEA 2C1FA 4Q4Y2 5CFCC 2JG8A 4WBBA 5HXVA 3V0AB 1ST8A 1CAUB 4Q29A 1SFPA 2E63A 2HWC1 1GWKA 3TOJA 1W9YA 4LMFA 4H7MA 1LNSA 5CFCB 2F4LA 4JZRA 1H6YA 1GU3A 5KXEA 4RQPC 4RA0A 4N8MA 4QX7A 3JQWA 3U10A 2R043 1F15A 3VZKA 1RUNA 2QQJA 3OBRA 3DUIA 3NNJA 2GMPA 2IXHA 3OUJA 1RVF2 2GZWA 3JB8A 1LTEA 4QGMA 5J36A 5I0SA 2ZMKA 1SBDA 3VB9A 1Q8QA 3E6BA 4CXYA 2D44A 3LIHA 4HVOA 1IPKA 5J09A 5ERLA 2Z42A 3R05A 4PHZA 4DEQA 1QKQA 2J7MA 1MQTC 3TRSB 2DUPA 2JDAA 1J59A 1W99A 2DU1A 3FJSA 1WCSA 3GNEA 3IM0A 4NRQA 1W8OA 2WO2A 1PO11 1LHNA 3KV6A 4FQ4A 4CU7A 3KHCA 3CMGA 3K2OA 5FTTC 4KBBA 1R64A 4MXWB 4HLTA 1R091 5AC92 3AP6A 3O5SA 5DABA 1WD3A 5K0UA 1VBA1 3SEEA 3OUIA 3HOBA 2QQNA 2W5FA 4XILA 5KHHA 4FTEA 5FYTA 4AVBA 1S0JA 3T30A 1LR5A 3OTFA 4FO9A 3MPBA 2WO1A 4Q2FA 4E2SA 4K21A 5JOZA 2A6YA 2XOMA 2Z79A 1TME1 5JXJA 4LE4A 5JUVA 1DZTA 2QFEA 4GZ9A 2GP5A 3ORJA 1DQ1A 3OGJA 3DYOA 4PQ9A 1Z78A 3WINE 2YROA 3OEAA 3IIAA 1VPHA 4WVZA 4JKMA 1QMJA 3WSOA 3GXUA 2RS52 4PBOA 1B35C 2FCTA 3CJXA 5A7PA 4C0HA 4AEMA 4JVAA 4KG0A 1RUC2 1RUD2 1B35B 3J8F1 3MPPG 4M3CB 3Q8EA 1VMJA 2XBO2 2ZBJA 1ZBA1 3GZTB 4YRDA 4RHV2 4KWKA 2ZGLA 4UXAA 5FMBA 4AHYA 4E2QA 5FYYA 1RUI3 4AQ2A 5ABJC 3T1MA 2ARBA 4MHUA 3T2QA 3OPZA 4CPBA 1OFNA 3WG2A 5L36A 4GA9A 4ARXA 3V0BB 1EAH2 4QQOA 2WZPP 1IKPA 1TVGA 3BB6A 4DUVA 1H2LA 1U5ZA 4LHLA 1H2NA 2YPJA 4OUSA 1AL21 1HRV1 4NE9A 4W65A 1LB2A 5ABJB 2WSUA 4W4ZA 1CD3G 1DGWA 4KU8A 1XSRA 4ZS2A 3ZYBA 5JSOA 4OI0A 2BQPA 2IVIB 1JYTA 4J1WA 1RJ7A 4XDOA 1LCLA 4YYOA 4GWMA 1QJY2 4LKDA 2JDPA 1RMU2 1QY4A 1UZYA 4M3CE 4WVVA 1SLAA 3AC0A 3AZXA 1PIV2 4KWJA 1FPN2 4YW3A 3ES1A 4EN0A 4KQ7A 4LUMA 1SPPB 2Y6FA 4LA2A 4TXWA 3WG1A 1VIWB 2BOIA 1MEC1 4PT6A 3RJRA 2R073 2X8KA 2KA3A 1X8MA 2R0FA 1ND2A 5IVYA 4DXSA 5D8AC 4H7LA 1POQA 4KG8A 4CXWA 1Z0HA 5FZ0A 5CKMA 4AHZA 5JZGB 3LSDA 3RNSA 4AI2A 2ZGNA 4AI9A 1IKQA 5FMOL 1L7QA 4O61A 5C4WA 5I93A 2WZEA 5D8AB 5EYYA 5BXXA 4DRRA 2DFCA 1HB1A 2EXJA 2ZPXA 3LDRA 1CWPA 1GP4A 2WFF1 2RM22 3T0AA 4XHXA 1W8WA 4QQLA 2YG0A 1QNYA 2FMYA 4IXLA 2W91A 3CO2A 4DXZA 3KS7A 4GMP0 5FZ9A 1AYN1 4XQ4A 2XJRA 1LOFC 3PTYA 1AXKA 4I0AA 5JWPA 4Y1YA 2CDPA 4BLJA 2ZX3A 5HI0A 1NQDA 3PUQA 2VZ1A 4XJAA 4B8EA 4D6RA 4JHTA 5CADA 5C9AC 3FHIB 4BOWA 2KD7A 4BLIA 1HLCA 2HWF1 2JDHA 3VHPA 2Y6JA 2ZKLA 3ITQA 1MS1A 4QPGC 5A6XA 2QQMA 4NROA 1UL9A 3QOPA 5FWJA 3DECA 5KHJA 1XNCA 3POJA 2H6CA 1X9PA 4S2GA 3MI8A 1MZEA 1FAYA 1OOPA 5J1XA 3WP6A 2MEV3 4F3JA 4QPGB 2DTYA 2JE8A 2KR2A 3OBZA 3NAPA 4OFGA 5D21A 5T5OA 1GWLA 3RPQA 2ETEA 1Y9MA 1CESA 1XE0A 4GH4C 2W1UA 3UGHA 1WW4A 4CCNA 3ENRA 1LOCA 4UW3A 1FI2A 1ENQA 4JRLA 3GCXA 4QXCA 1FX5A 2WNUA 2VR4A 4EN7B 4B4QA 2WYSA 1X9TA 2ZX2A 3ZXFA 1PO21 5JCTA 3O1RA 1OSGA 1WBLA 1KITA 5A7NA 4LIVA 3TWIA 5LA0A 3TEYA 4UFJA 1QJU1 1BK0A 3CNAA 5F1RA 1TMF3 4G9SB 4AHWA 3ZLIA 3HWJA 3HQUA 1YLLA 4WVWA 1ZRRA 2QJVA 3A23A 1YQCA 2IXIA 2YBPA 3GCWA 4JGYC 3WV6A 4AFBA 2ZEZA 2A6ZA 1RHI2 2VBBA 5EHDA 1DDLA 4M01A 1D4M3 4KMQA 4YGBA 3UGFA 5EV7A 4FPLA 1MZ6A 3I2KA 4CEWB 2VVEA 4CZSA 5I0UA 3NKGA 3GF6A 5DAQA 1CIYA 3AFKA 1JYVA 3KWVA 4K8FA 1X50A 1XYPA 2CDOA 2BYVE 1E5HA 1V6IA 3VBOA 3R4UA 3VLBB 1KRIA 1HDKA 3D3AA 3A22A 2BZDA 1F2NA 4RS5A 5K9YA 3RZGA 2P2KA 3QH7A 4QX2A 1FOD2 5J96B 5LCWL 1WW7A 3M3EA 3RGBA 3N9NA 4UWDA 4ITCA 2PHUA 4HSJA 4YW4A 4CDWB 1ND3B 5FJKA 1W9TA 2ZEYA 4DQAA 5A32A 1C3HA 1ODMA 1UYXA 2I45A 2ZGTA 3ES4A 3ZFFB 5E16A 4Q0SA 2XJTA 3GYDA 3ST7A 1GP6A 1G8WA 2B7YA 2CSGA 4P9IA 4QWNA 4P9JA 3FHAA 4QMAA 5FPZA 3R4DB 4WM8C 5FPBA 4AHXA 2X10A 2IFRA 4ZXEA 1J3QA 1MR5A 2QQVA 1W8ZA 2XDVA 5DDJ2 1REEA 5IAXA 3ZOIA 4P9LA 2UWBA 3KLSA 3W59A 2Q5TA 1GQPA 2G9GA 2NMOA 4XUPA 3VBFA 5C7GA 2D40A 3DF0A 1R1A2 3H1YA 1AR61 3AZZA 1DCSA 1ONAA 4CCEA 2EVXA 5CKNA 1HXS2 3SISA 4Z92B 5ISLA 3GBWA 1NXMA 4Q1RA 2KM2A 5ANNA 4RR3B 4Y1UA 1JW6A 1VBB3 4HN1A 2EXHA 3AP4A 4XHBA 3VZLA 5F5IA 4IUGA 4CRQA 3I2OA 5F5AA 1PNFA 1Q8OA 1IG0A 1J58A 1I5PA 2W94A 2YDEA 3LKJA 4JQRA 3WNLA 3B01A 3FHQA 3MFCA 2XR4A 1MS8A 4R9BA 1DIWA 2Y8KA 5DZGA 5CBLA 4NO4A 4QGLA 2FDKA 3W5MA 3UKNA 2BNMA 4MOAA 1S0BA 3WW2A 2ATFA 1VE0A 1BMV2 1RXGA 2G19A 2NYYA 3L9JT 1ZZBA 2ADEA 2LS6A 2JDNA 4V1PA 4DEVA 4ZU4A 1LGCA 3H3ZA 1PVC1 4NPMA 2CL2A 4W8JA 4UI9L 2GNMA 3O1PA 1RUF1 2VTXJ 3DEMA 4C0BA 4P08A 3EJKA 1SBFA 1S0FA 3IBMA 3LAGA 2JXAA 2RS33 1GSLA 3TN92 3JUUA 5C8CA 1AR73 1OUSA 2B4KA 5FYMA 1AL0G 3N7LA 5DUVA 5FZ7A 4AVSA 3POEA 5EYXA 5HV4A 2HKXA 2WZR1 3CIHA 4NWWA 2L9LA 3BPZA 3WQ1A 4PIZA 4LO7A 2F17A 4JRAA 4XC9A 2JG9B 3ZYIB 2VMFA 1SLLA 5KWRA 5FP9A 1UMZA 3D82A 4JDOA 3ZSEA 3L2YA 3APBA 2EXIA 3J7NA 3PVOA 4Y20A 2W9XA 3LPFA 4AE2A 4Q4X3 2OQ6A 4IL7A 1R1ZA 2G9ZA 4PCRA 3IDCB 1NCQA 1YQ5A 4N9IA 4RSUA 5A7OA 3V0AA 1RUG1 4GWJA 5A3TA 2R7EB 3WXPA 5JR2A 1XPWA 2W92A 4PBPA 2RDSA 1CJDA 1K5JA 2XJSA 1YUDA 3ZIXA 5CFCA 4JHZA 2VECA 1W0NA 2W39A 2ZEWA 5A3UA 5CA6A 5JOWA 3Q8CA 2Y0OA 3KVBA 3X29B 5KBFA 2A73B 4EZHA 2A3XA 1VR3A 1RUJ1 2X5IB 1FMD3 3PMEA 4AYUA 1H1MA 4RQPA 2V72A 2VQAA 4Q4V1 2ARCA 3MGUA 4FPFA 3U4SA 3VBUB 3WEZA 1E5SA 2YUEA 3AMPA 1ASJ1 2PN5A 5JOXA 1W9WA 2PQQA 2WUHA 1LU2A 2PFWA 3J7MA 4QQ2A 5F39A 5BPXA 2FQPA 4XJ8A 5FLIA 1RUE1 4XFAA 3O1OA 4FOVA 1F31A 1D4VB 1UX7A 1VBD3 2BBVA 3WNXA 1XYOA 1LEDA 1N3QA 2WKKA 2Q8CA 2GMEA 3K46A 4F83A 2VZUA 4DZGA 3CZUA 4AL9A 1N3PA 2R063 2YZ4A 2AREA 1MQTA 4OVEA 3PTRB 4M3CF 4LE3A 1UOFA 4KNCA 5F3EA 2XQRA 3O12A 4OZOA 1AYM3 5LASA 3GM8A 5BYNA 4BWOA 1HIXA 5SV5A 4DXTA 2PAMA 1U5YA 4I30A 3BU0A 4LO5B 1UN1A 1W8TA 4X6QB 3I3EA 5FAXA 2JDMA 4Y4YA 2PHLA 2WNVB 1H1AA 1NCRC 3MUZ1 4MGYE 4FPYA 1QU0A 4LK6A 5CVRA 4AFMA 1JZ3A 2RMU1 5LBCA 1QOOA 4LHKA 1GANA 1Y43B 1UQXA 1CPMA 3POGA 4JTNA 2HJIA 3OYWB 4OZXA 1VP6A 1IHMA 2CYFA 4MUVA 1B35A 5FLJA 2QQUA 3AKQA 2IXJA 2VU9A 1IS3A 4JDMA 5C33A 5GZDA 2PMWB 3QH6A 3BTZA 4C1WA 2CGPA 2Q0AA 1UOBA 2VXRA 3HNMA 5AVPA 2CNAA 2LM3A 2IC1A 2PHRA 4FPHA 1V6NA 1JUIA 3AL6A 3DPRB 3JXSA 3PU8A 4Z8BA 4NHXA 1LODA 3AMHA 1Q8SA 4RN5A 2RS13 2ORZA 5F2WA 2WIIB 5ABJA 5TSWA 3H8OA 1QXJA 4XJWA 3FMGA 1RL3A 3AP5A 4Q26A 3AL5A 1W8FA 4I2OA 4MGIE 2BFUL 5EP9A 5FZMA 3S7EA 4HANA 1TZOA 3AXDA 1QH7A 4CCMA 4LOSA 2TBVA 5LZ6A 2R072 3I7DA 2BNNA 4HMZA 4B7KA 4FPGA 5BV6A 4P9WA 4A4AA 1R081 3DN7A 2ZGUA 4LO4B 4AGVA 3WDYA 4V2WA 5LRSA 3OBTA 5BNNC 4FSJA 1CAWB 5CFDC 3JD71 4AF9A 1Q56A 1W39A 3IDEA 2UYAA 4XUNA 5JI9A 4IDZA 3HEIA 3POBA 5A3WA 3M3CA 4TLGA 2EXKA 3AYAA 1O4TA 1O59A 1FATA 3O1MA 5D8AA 2GAUA 2C24A 2A70A 2ZEXA 4AFAA 2P3JA 5I8YA 4F8AA 1C4RA 1WCKA 4FFGA 1SEFA 2VAUA 4BPZA 4YM3A 1OD3A 4J25A 1DU3D 4ISQA 2E33A 1K5MC 1OKQA 3AFGA 2YC0A 1JOPA 1URXA 4HZFA 4LO8A 3ZDVA 2D6NA 1DYOA 4AZZA 4CCLA 3WNPA 2VBPA 2WQ4A 4DB5A 2AEYA 4XFFA 2PQSA 1Q43A 3JBG3 1K5MB 5DAWA 3I3DA 3N9PA 2PHWA 1MVEA 5A7SA 3AK0A 1LOFA 3ILNA 3K51A 2D98A 2DCJA 3DCQA 3ILFA 1UYPA 4KBZA 4QD2A 4C8DA 4OQ8A 5FP7A 3ACGA 4PLOA 4QDRA 2J1EA 4S2HA 1O3SA 3OEBA 2ZAHA 1X82A 1S55A 2BV4A 4K1YA 2MEV2 1D7PM 1C8M3 3S0MA 5AC91 5C9AA 2A75A 5H9RA 2E53A 4GWIA 2Q8DA 3ZPYA 4QPGA 4Z2WA 2J1SA 4YVWC 2D6PA 1UZWA 1QWRA 1BVP1 1VAKA 2XVKA 2ZGRA 3PUIA 5FKCA 2BP6A 3WY6A 1OLRA 5BNOC 2VUAA 3IKWA 3BIEA 4YWAA 4JGZC 1ZA7A 3Q8BA 3THCA 3LEIA 1AX2A 3HBZA 2GC0A 5LEKA 3UKVA 3QBQA 1YJKA 5DMYA 5L9VA 1JBCA 5T5LA 4D0QA 4OHZA 3SC7X 4GH4A 3T09A 3ZYFA 1TMF2 1VLNA 4JGZB 1OH4A 4EV0A 2PLV1 4SLIA 1PM7A 4LKSA 4MH0E 3MLJA 5DQ0A 1CAVA 4HK9A 2VCCA 3ETQA 4I3GA 4MYEA 3RG0A 1UXXX 2R16A 1RUC1 2HWC3 1D4M2 2Q1ZB 4YG3A 2WRAA 2QQLA 1UY4A 2XXZA 2YC2A 1ACCA 4DUWA 1WUVA 5F5QA 1ZBE2 3AYDA 3I97A 2DCKA 4LBMA 2XBO1 1YQ6A 4BXFA 5F3CA 4N90A 4Q1PA 4RHV1 3WNKA 1N1TA 2Y33A 3K75B 4JGYA 1IS4A 4W6WA 1NA1C 2VNVA 4UYBA 4Q4W1 4DY5A 2YU1A 1EAH1 1ZRFA 2HEYF 4I0BA 1RINA 4XETA 4XBQA 3CJIC 2DCZA 1J1TA 3I2GA 3WF3A 1DYPA 3NW4A 1NA1B 2QQOA 3UV9A 2W2IA 4PF1A 5EJZB 2E6VA 2VNOA 4QKDA 2W1SA 4GAZA 3TAYA 4Y22A 4MZUA 4Q0QA 1QJY1 1QDCA 4XUTA 1MS5A 4CDUB 2BERA 5KHKA 1FPN1 1XB9A 1W6NB 2JB4A 2LW8A 4K3UA 1PO13 4BQ5A 5JSPA 5IJRA 1COV2 1NX9A 1R093 2AC1A 4EN9B 1W6PA 2XL9A 1W06A 2VMHA 3BGAA 1JN2P 2VQUA 4XIKA 1VBA3 4N53C 4ASMB 1AJOA 2MPFA 5A7WB 1XNKA 1VBC2 4FT8A 2NP0A 2VBDA 2QTWB 4P00B 3QACA 4BDVB 4WM8A 3M8LA 2MNGA 4COUA 1TME3 5GZCA 4N9HA 5FZ8A 1S2KA 3ELNA 4RL7A 3GHNA 3S6PA 5JXIA 2RM21 4IEWA 2B5HA 4Q0PA 3VDCA 3BKZA 4E4ZA 3RJ2X 3BCWA 3N7MA 4QQHA 3MUY1 4XFGA 1LULA 4XFBA 4YW1A 5AVAA 3ZFGB 3ZM8A 3ZXJA 1LEMA 4J1XA 1VBB2 4AEDC 4LKFA 4QKBA 4UBHA 3LF7A 3PU3A 2DV9A 3NVCA 5IW0A 1AZDA 3O1TA 2PYTA 1QEXA 4KGQA 4P9YA 3RYPA 2CHHA 4L11A 1GLHA 3ZN5A 1LOEA 3FUOA 2D43A 3POFA 1VB4A 3J8F3 4MX3A 4AEDB 4Z2AA 3E5UA 4RGGA 4UFLA 1ZBA3 1NY72 2DBNA 1JYCA 2HWD1 2VUDA 5FMDA 1OURA 3ZFEB 4EE2A 2VOXA 4MG2A 2GC3A 3I49A 3VKOA 2OIIA 1MS9A 4CP9B 2ORXA 4MGZE 1W6QA 1GZCA 1V6LA 2V09A 5K8SA 1AL23 1HRV3 1K45A 5IK5A 2DYCA 3I2DA 2XJUA 3W5NA 3OB8A 3LWCA 4B1LA 3ACFA 4BMEA 1EYBA 2KXLA 5FK8A 2XL7A 5LBEA 4E2GA 5FZBA 4D7SA 3BODA 3IDBB 1WMEA 4A45A 4DOUA 3CLPA 5F37A 2VMCA 1GOHA 1QXPA 3A7QA 1DZQA 2XQXA 1DF0A 5GKAC 3ASIA 3FC0A 4ORFA 1YI7A 1MEC3 1WLCA 2E51A 2NLRA 4AEKA 3EB7A 3F95A 1HRI1 3IIIA 3O0VA 2O8OA 1E57A 1DGRA 1HV0A 2YY1A 1O5UA 3NL1A 4IV1B 2P3IA 5J98B 5AFBA 4YVSB 5T3NA 5FP4A 4AVCA 1WBFA 1CPNA 4YNIA 1JZ4A 3PVEA 5I8TA 5EXOA 3CL1A 2CAVA 3TEZA 3WR0A 1MS0A 3INAA 1PGW2 2VO5A 2WFF3 4YFZA 2D97A 2D3SA 4Q4X2 1WLDA 2VW0A 4ET7A 5KXCA 2E7TA 1KS4A 1OH3A 5JXHA 2VZTA 5FO7B 1YFXA 3PDQA 3M70A 4GULA 4WZCA 1X7NA 1AYN3 3EMRA 5KHGA 1REFA 3N9MA 5APAA 1CAXA 4L9BA 5FXVA 5GALA 4ZZ8A 5FOBB 2ZGMA 2JB8A 3ZN4A 3RZLA 2V73A 1LKNA 2ZJCA 1GZWA 1V9U2 4I02A 1YIFA 2ILMA 4FOWA 1FMD2 1AR91 4RGKA 4W6YA 4A42A 4C90A 2HWF3 4XJ9A 1XBFA 1W8HA 1CVNA 3U37A 1VRH2 2J1VA 3PUSA 4YM2A 2ID4A 3SKJE 5GLTA 3BN6A 3P6BA 1DFQA 3WUDA 2ZS6B 2HWE1 4KWUA 1ULGA 3NV2A 4HONA 4GWNA 1VBD2 3U07A 1UD1A 1POV0 2A3WA 2E26A 4CCKA 4XOGA 4Y5Z0 4CDQB 2R062 3GALA 2O0OA 2VCBA 4CCJA 1IZ3A 3WQ7A 3LCPA 3IB3A 1UX6A 2VW2A 1PO23 1OKOA 2VGDA 3HJRA 1OA2A 2G9FA 1UZ0A 3KQ4B 1AYM2 1QJU3 2ADDA 2QE3A 3C7HA 1JZ5A 3A0KA 4IE7A 5DUXA 4Z1VA 2QQPA 3NNFA 3ALQA 1ZZ7A 3OUHA 2DBIA 1VMHA 2ET1A 2V4AA 2ZX1A 2VH9A 5JAXA 1US3A 2G4IA 1ENRA 5JI7A 4BZ4A 1XNBA 2YBKA 2YC4A 1BBT1 4QPIB 2JDYA 3USUB 3U1XA 3P3PA 4AQ6A 4YG6A 2WINB 4WVMB 1IPJA 5F8PA 1OLQA 2WWSA 2OZJA 3WD5A 1NCRA 1PX4A 3SCHA 3UNPA 3VKLA 3NRUA 1NLQA 2NMNA 3GJAA 3NJYA 1Q8PA 2HH9A 3TBDA 4R52A 4LA3A 2CWMA 3O14A 2XPJA 1RC6A 2YU2A 4Y3OA 2XONA 3K4ZA 3S5AA 2DTWA 4FPJA 2WT0A 2RS12 5JZGC 2XKPA 1GZ9A 4TYSA 4FVVA 3VDBA 2EIEA 5LW9A 3NO8A 2HEWF 3NMBA 3G7DA 2VVDA 4MVTA 5GLVA 5FY9A 3VZJA 1J1LA 4DXRA 1JZ8A 3UJOA 1YXWA 2BRTA 2B46X 3BTYA 1DYKA 1MS3A 3WDTA 4A7YA 5HPOA 1S0DA 5FYZA 2QBXA 3AKRA 1MPXA 5KXDA 5FFOC 4WM7B 1PNGA 2ZGKA 1CGPA 4QX0A 2VTFA 3OD4A 1AR63 5GLWA 3M7AA 1ENXA 4BQ4A 3P5BA 5DAPA 3NJZA 1JH5A 3LEMA 3RYRA 3MIBA 2GDFA 4TZDA 3R4SA 3HN1A 3MO4A 3HVDA 5DPNA 5JR7B 3FBYA 3GHMA 2Q8OA 4XIOA 2J1TA 1WWYA 5DUUA 4QDSA 3MEPA 1BYHA 1OVSA 1SLCA 2RHPA 2W47A 3KM5A 4HKWA 4IERA 3BPSA 4IGPA 5BNNA 5CFDA 1CR7A 3PUAA 1OLME 2IVJA 4XF1A 2Q1FA 2RR11 5L9BA 3SMHA 2D6KA 4DY3A 1A34A 3HD8B 1KQRA 2H0VA 4HBNA 4LEJA 3WP4A 3M1HA 5GZGA 4YFWA 1I1EA 3HQRA 3RZMA 5FDBA 3WHTA 2WQZC 4XMIA 3ACIA 3JBG2 4HSLA 3LEGA 2WT2A 1PVC3 1K5MA 1OBNA 1ULFA 1W6OA 3RI9A 2WLPA 1AR81 2EF6A 3KF3A 5F3IA 3AZVA 1LGBA 1RUF3 1EV11 5IWFA 4XF3A 1STMA 2XVGA 3A21A 3PMSA 4RFT0 4BQXA 4J6GA 4NAOA 4E9KA 3NNMA 3H8RA 4SBVA 3NNLA 3VD3A 2B45X 5FQ0B 4XCAA 1YFYA 1W2OA 5C8WA 4B1MA 5C3OA 2NN8A 5C3RA 1W6MB 3B5LB 4N43B 1ZVFA 3NV1A 1SCRA 4M0HA 2WZR3 4CEWC 3WCRA 4ZXKA 5FZHA 4BE3A 2RJLA 1EP0A 3ZPOA 3LOBA 1D0GA 1TEIA 3N4MA 1NYWA 4DMIA 1Y9GA 2E31A 4YVWA 1I3HA 3BOWA 4FI9A 5BNOA 1XNAA 2AACA 4AVTA 5IK7A 1QJX1 1ZZ9A 2MHFA 3M3IA 4JCKA 4JGZA 3EO6A 3VDDB 4AAPA 2WO7A 3FLRA 3ZN6A 1NQJA 2GC2A 4A6OA 2HWC2 4LT5A 4Z82A 3I3QA 2Y6KA 4CDWC 1ND3C 1YHFA 4W6XA 4XXPA 3V65A 5K7PA 4NRPA 1RUG3 1C28A 3E97A 4UBGA 3ZFFC 3CKHA 5IHRA 4KH9A 5B2GB 2WABA 4OMDA 4PF5A 4G4FA 4IE4A 5A33B 5GJ6A 2GN3A 3UESA 1DG6A 4HN0A 4BK5A 2BNOA 5BNQA 4QPWA 2RDQA 3U11A 3JB4C 1X36A 2XVLA 4NPLA 1RUJ3 4P5HA 3K3NA 3NWKA 4XE9A 1NXD1 1L3JA 4YPJA 4JV4A 1AX0A 1SMVA 4Q4V3 1H9PA 3WOGA 3MFAA 1NA1A 1ASJ3 2BGOA 1JTZX 3IMNA 4IEOA 3RWNA 4FPOB 1H2KA 5ACA1 4HPKB 4FCAA 1RUE3 2PTMA 3KGZA 3CJIA 1KD7A 1GFF2 2C5DA 4LXLA 1BEV2 1SBEA 3ZSMA 1PO12 4YZ5A 1G7YA 5A3LA 2WSVA 1UZZA 4IEXA 3U75A 1UMHA 4RR3C 1R092 3ZXDA 3AVSA 3R0RA 4PQQA 5F3GA 3ZYRA 2Q30A 4XPVA 4AGRA 1OI6A 4HG6B 3WW3A 1VBA2 3MV11 4XFHA 1GQHA 2OUJA 2W46A 5LY2A 3QCWA 2YGLA 5F6LB 3Q8AA 2VY0A 2Y6GA 4Q0VA 4CXXA 4BISA 1UOGA 3V56A 4O9GA 4XUOA 5FUNA 2K2SA 1LHUA 5DG2A 4LHSA 2VUCA 4C91A 4N53A 5E89A 3RMXA 1C5IA 3HMYA 3BVCA 2YYOA 5FY1A 2JKXA 3T1LA 3OY8B 2RMU3 1D2SA 2YGMA 5KR7A 2XUMA 3MLKA 1W2UA 3UGGA 1N3OA 3H1MA 3T4HB 1VB2A 4I0WB 3N7JA 1QXRA 4DS0A 4AOCA 4LQRA 1VMFA 1OQ1A 3NV4A 3WG3A 3OGRA 5FY4A 2DVDA 4UFIA 1APNA 2JD9A 4BCUA 1RXFA 2IXKA 1DGWX 1BHGA 3LEKA 4EN8B 1UYZA 1UPSA 3ZSJA 4AEDA 5JXGA 5A3MA 3T0BA 2DUOA 1W90A 3SNMA 5ACA2 1CONA 4LBQB 1S4CA 2VW1A 3VZMA 5IVJA 2W87A 4COYA 5F2SA 5FPVA 2JG9C 2WS91 1AL22 2ES3A 2P6CA 1PK6B 3S30A 3VKMA 4CP9A 3ZXLA 4UT5A 5E8AA 5LATA 2GN7A 3O0XA 4CSWA 4B29A 1LHWA 1UXZA 4JKKA 5F32A 1PZ8A 1GP5A 4GJYA 2VNGA 4IETA 4OI1A 5EQUA 3D6EA 2OT7A 4IEQA 1GKBA 1LHVA 5BY5A 2I07B 1WD4A 4XDPA 4M4PA 2B8MA 3FLTA 4UF0A 2E9QA 5CIRA 4NJ4A 2ERFA 4RGAA 3FUQA 4K40A 5L19A 1LU1A 2XHNA 1ZREA 3VZOA 1UOJA 1HN1A 3D8CA 1RIRA 5FPUA 2FDGA 3M2MA 1XRUA 5FZOB 4KGGA 1JYWA 2BWCA 3BALA 1N1YA 4QX3A 1RITA 1DZRA 2A5ZA 1R083 2W1QA 1POV1 4S2DA 4LITA 2C6SA 2JG8B 4FPEA 3JD73 5LRRA 1CAUA 2VMIA 5EPAA 4R4XA 5CKQA 4EJRA 3AYEA 4BHPA 3RI8A 2WZ8A 3IAQA 1UW8A 1WCQA 1IG3A 2UY8A 2R042 2X5IC 5GZFA 1UY3A 4QDQA 3FL7A 4AW7A 2V5YA 3VBUC 1ZBE1 2VQ0A 4QX5A 3BOPA 4AFCA 1DLLA 2HWB1 4BYYA 3AZYA 4IEPA 4EZ4A 2QZ2A 3GZAA 1ENSA 4UW5A 5FY5A 2OYZA 3POWA 3W20A 3B69A 1AYN2 4CUCA 4MGTA 3N36A 4LBJA 1GICA 3GBGA 1WMFA 3THDA 3ACLA 5FXXA 5GZEA 3ETPA 2C0ZA 2V4VA 3KV4A 4Y1VA 3SH3A 5BUVA 4XTMA 2NM1A 2JECA 1QQP1 3AX4A 4KWLA 3WF1A 2R6QA 3SKVA 3N9QA 1XJAA 3H9AA 1BQPA 4NPRA 2HWF2 3GGLA 4XQDA 4XVHA 3G6JB 2EIBA 2XLGA 1VBE1 1YYNA 4CCCA 4FFFA 1I9RA 1PMHX 5FZLA 1E5IA 1BCXA 2V5DA 1OVPA 4MXWA 1BKZA 4QM9A 4X8NA 4Q27A 1QDOA 1Q5OA 5K0UB 4PIYA 1COV1 3H8UA 5AC93 4HK8A 3BIWE 3OCPA 2JDZA 1KEXA 2WNVC 4ARYA 1G6NA 5FZ1A 2C9KA 4E4SA 3WQBA 2O8QA 1QIQA 4CUGA 3T2TA 1VBC1 4R8HA 2CV6A 2W52A 5FWEA 4XURA 2QUOA 3LFMA 4OHWA 5A6QA 3ZIWA 3MBWA 3DV8A 4XJZA 1V0AA 1RUH1 2WR9A 1H8TC 4NVPA 4B4PA 2CGOA 4YARA 5A7QA 2UWCA 2Y64A 1UAIA 1H8VA 1W8NA 2GNDA 4F7ZA 2ZAAA 2PLV3 3I3BA 2PHDA 2Y26A 2SLIA 3OBAA 4GB31 2OA2A 4NR1A 4Y1ZA 5LB6A 3VDAA 1OPOA 1H8TB 1T6BX 2VZVA 3I2JA 3WDUA 4OHYA 3J7HA 4GQ7A 4AQTA 1QNWA 3DPRC 4M3CA 4TN7A 1RUC3 1SG3A 1MS4A 1RUI2 3THPA 3WP5A 1YCIA 4Q8KA 1S0IA 4GMP1 2XBO3 1GBGA 3ZXKA 2HLEA 2JKBA 3V0BA 4RHV3 4YGCA 5FO8B 3AZWA 1P8JA 3USUA 3H50A 1LECA 1NE4A 3KB5A 4A6SA 4Q4W3 2DFBA 1OT5A 4ISRA 1EAH3 2LROA 3J9SA 2CGNA 2GSYA 5C5TA 2RE9A 1HX6A 5IK4A 1OQEA 1UMIA 2XUEA 2Z4FA 2ZTNA 3U0ZA 5BNPC 3VHNA 2LALA 3EHKA 3QD6A 5DAXA 2W0XA 3KT1A 2XMLA 1QJY3 1N1SA 3C7GA 1SPPA 2WA4A 4N7UA 4ATEA 4B3NA 2VG9A 3L2HA 3MW4A 4CP1A 3VHRA 1FPN3 1Z7S1 5BNPB 3OGGA 3AYCA 4N7IA 1RTVA 3IWZA 1H2MA 1ND2B 4YZ2A 3DXTA 5A80A 1NLRA 2OPKA 1O3RA 3A0NA 4B4RA 2ZGOA 1I6XA 4IE0A 4Q4Y1 3BI3A 1GV9A 1OMIA 5JZGA 5IYYA 5E6HA 3RQ0A 1LOGA 1OLMA 3VL8A 5FYIA 1CZVA 2VMDA 3URFA 5LWBA 2JE9A 2UY9A 4YW6A 3R6SA 3K4AA 1AR62 2PHTA 1WA6X 2YFZA 1RJ8A 2E7AA 4NWVA 2Y6LA 1TE1B 3I59B 1PGW1 2RM23 5CNAA 5FMCA 3OD0A 1D2QA 1RVF1 5T54A 4R9CA 4A7KA 5SV8A 1A78A 3GZUC 1A3KA 2GALA 1H0BA 2QZ3A 1OPMA 2UU8A 2WA3A 3J4UH 1BK1A 3WUCA 3NJXA 4PI2A 3TYJA 4AGGA 4QHZA 1A8DA 2XLFA 3FZ3A 4ZU7A 5D2AA 1NKGA 1V9U1 4WV8A 2HWD3 1OC1A 2R49A 3O7OA 4EWDA 3PVNA 2WYFA 3W21A 3WW4A 1ZNPA 4AWDA 1HN0A 3EXUA 1OOPB 1VRH1 5FBJA 4K9SA 3ACHA 3MDPA 4CEYC 1KFUL 2FHRA 3IPVB 3POIA 4NRMA 1AHSA 1W04A 1WW6A 2FDJA 3NAPB 2ZHMA 4Y5SA 4BJ0A 4GKYA 2P17A 3PVBB 4XDQA 1RUF2 2EALA 4OI4A 2BW8A 4L99A 4XUQA 5T5PA 4CEYB 3OOXA 2Y60A 5DUWA 2D5FA 3BTXA 5FIXA 4L2NA 5FZGA 3DYMA 1W2TA 2WNUB 4GXLA 2DVAA 3K48A 3ZXGA 4CYDA 3CU7A 4P9XA 2R1BA 4S2FA 4Y26A 3VBRC 4DINB 3WHUA 2QDNA 1CZSA 3HR9A 1JZ6A 1UCXA 3NJVA 2D5HA 1LOBA 4P9GA 2RS51 2DCTA 3W9AA 2ET7A 2DWRA 4JTOA 3SCFA 5C6CA 1HRI3 2VOKA 3VBRB 1W8UA 1RUD1 3QLQA 4IEZA 1HQLA 5FPAA 5C5UA 1RB8G 4UAPA 2ZCWA 4IE5A 4YM0A 1LJ7A 1HB2A 1JS9A 2J1UA 2VE1A 4NIDA 4QKNA 4INDA 3PIGA 4L0PA 4CEWA 4XMAA 5DZFA 5FCCA 3OPWA 2BDRA 5JOYA 1SACA 1TNRA 4QKFA 1VAVA 2ZHKA 3VBOB 5EJ1B 2ZMNA 5FO9B 2FZ2A 2G1MA 4BIOA 4NHMA 4RS5B 5FUPA 5M0TA 1F35A 4CDUC 5J7MA 1SDWA 4X6RB 2QDRA 3WG4A 2AEZA 1EUTA 4HVQA 2NQYA 2FZ1A 4MSVA 1VALA 3U4XA 2B9VA 2XJQA 4NHLA 3WQ0A 5A33A 2FCVA 4NIIA 1B09A 3RVHA 3WF4A 5IAVA 1KJRA 1ND3A 1RMU1 5A32B 1FNYA 3ZYGA 1LHOA 2GNBA 5GM0A 4YZ1A 1PIV1 5FYHA 1PGSA 3ZFFA 1E5RA 1AR93 3MIHA 4EROA 4GKXA 4Q4V2 4XBLA 2ZA9A 1O4YA 3OSDA 1UU5A 2BGCA 1ASJ2 3W58A 4AI8A 3PIJA 4WZFA 2HWE3 1RUE2 5GLUA 4IGOA 3SITA 2RJKA 5AFEA 2Y0IA 4TSVA 3ABZA 1G9FA 3LIGA 2Q8EA 4CUBA 3ZFGC 2EA7A 5HCHA 3KMHA 2D6MA 2JIJA 3F2ZA 3WNNA 4ZPIA 1XNDA 2E7QA 1G9DA 3WDXA 3M3QA 2VTXA 1GNHA 4E4HA 1HJFA 1IQDC 3AKTA 3RSJA 2P34A 3AM2A 4RR3A 3ZFEC 3RDIA 4HL0A 1WLTA 4A44A 2J1RA 3CDZB 3D0SA 2Q1MA 1M4WA 4LULA 2X05A 3LOIA 4QB6A 1BZWA 3N9OA 3WDVA 1KDMA 1YJLA 4HETA 1HKDA 3IDAA 2TEPA 2A3YA 4YW7A 3U14A 2Y34A 4L97A 2RMU2 3EYPA 4AK3A 3B00A 1U5IA 4IV3C 3WNMA 5IVVA 1EY2A 3VZNA 4XBNA 1N47A 3WLUA 1BBT3 1IQAA 1KDKA 3OY8A 3C3VA 3D5OA 4QX1A 4NHYA 4IV3B 2OQ7A 1HQNA 2J42A 3FFQA 3J26N 2QQIA 2YV8A 1JOBA 5FYBA 1SLBA 1X8EA 2RDNA 2RS32 3VUOA 2WQ8A 5I8SA 5JPNB 4PJYA 1AR72 1QJEA 3MYXA 4QGNA 4YM1A 5FP8A 2EIGA 3VBSC 4BK4A 2BVVA 3ROUA 5C8CB 3DL3A 3UL2A 3E6CC 4IV1C 2QVSB 4D94A 4YVSC 3LZZA 3IN9A 4O7XA 3HNYM 5A6ZA 1IS5A 1S1AA 3I2FA 4XFCA 1UU6A 3VBSB 4NOTA 1G9AA 4EWEA 3THTA 4BXSV 2WN2A 1ALYA 3MZHA 1XYNA 1NT0A 3VKFC 2YMZA 1C8NA 1VAMA 2JG9A 1NG0A 2WWUA 2D3RA 2YHJA 2WT1A 3FE5A 1RHI1 4YSFA 5FREA 3VD4A 1MACA 2R0HA 4FBFA 4UFKA 2X29A 2P3KA 3RMYA 4RD7A 4CA9A 5FYUA 2N7GA 4NN0A 4Y4RA 1KGYA 1U0AA 2GC1A 3LSEA 1F5JA 1ULCA 2W95A 3ZO0B 2JDUA 4ZKTB 4JAAA 1Y9QA 3JD72 2ZX0A 4PDWC 1OD5A 3U78A 4LO6B 3P3NA 1NCQB 4ZZ5A 1O6UA 1O8SA 4HKLA 4TWTA 4U36A 2PAKA 1HB4A 1PHMA 5FZFA 4PDWB 3DXUA 2QQKA 2AUYA 2F6BA 1PGL2 1FOD1 2ZZQA 3KD4A 4B7EA 2QCSB 3BU7A 4FFIA 1YIPA 4ZS3A 3OPTA 1NLSA 1Q8VA 2RR13 2TNFA 2WC2A 5LA9A 1LENA 2UWAA 3MIEA 2X5IA 1GWMA 2HYXA 4YW2A 3RZHA 1C57A 4RQPB 1FYUA 3VBUA 1G9BA 1K3IA 5IVBA 1JODA 1ULOA 3ZYPA 4CDQC 1Q3EA 4LK7A 4IESA 2WAOA 4BQWA 1XE7A 2A71A 5DDJ1 1OHFA 2Z2SB 1ZM1A 2ARAA 5A70A 1O4ZA 4K20A 1AR83 3BYWA 4BQYA 1FT9A 2WWJA 1I5ZA 5CG9A 1EV13 1R1A1 5FPLA 1BEV1 1ZA4A 3POYA 4LR4A 1TQ5A 4XAAA 3HBKA 1YRZA 2FDIA 1HXS1 1MQTB 1M06G 5C3PA 4V2VA 3HT1A 1JXNA 2DCYA 4QXKA 4UOJA 5ANQA 4AFDA 1HJGA 5FRAA 4FAHA 4NAMA 3JCIA 2VZOA 1NUKA 4M4RA 4H2AA 3B94A 1HB3A 2HEVF 3N35A 4BQ3A 1OA4A 2W3JA 3CHXA 2D3PA 4QPIC 4QXHA 3UK9A 3GDBA 4XABA 4YZ4A 2WNVA 5T55A 3T2OA 3NV3A 1S2EA 4JC1A 3H3LA 3ZKYA 1XC6A 3CF6E 3RFRA 2DF7A 3PJQA 2XKOA 2PLV2 5CISA 1W9SA 4IEYA 1UIJA 5LK5A 1QJX3 5KC5A 2A6VA 1U12A 1BMV1 2BUKA 3LA2A 1EPWA 2B39A 1GNZA 1S0EA 1DQ5A 4LKEA 4QT6A 4YGDA 4CP0A 3M4FA 1UO9A 3TNQA 3OYWA 2ZACA 1H8TA 5CYYA 1C1FA 5H9PA 5EIYB 3KSCA 2FDHA 2BU9A 2LRPA 5FMOS 4MGKE 4DUXA 5CEHA 2XH6A 2GH2A 4BB3A 4KI5M 4ES9A 3KCXA 5CZKA 2W1WA 2OXBA 3KT4A 3DPRA 3TN91 4Q4W2 4QHOA 4BQ1A 2CAUA 2VL4A 3WT3A 3WX5A 3PHMA 2SBAA 4LBLA 1Y4WA 4FAGA 2C4XA 4I3PA 1ULPA 4WM7C 4ZY9A 2GNTA 1UZVA 2ZHNA 1J84A 1QJFA 2WFPA 3MLLA 2VOTA 3B93A 2LUWA 4Q5OA 4E4DX 1V70A 4MXVA 3FBMA 4XEZA 3IMMA 4FTBA 1CJPA 1DGRN 1XU1A 2P1BA 1SCSA 2JICA 3D0JA 4ZHNA 1LRHA 1WCUA 4UW6A 4FOYA 5FZAA 4Y5TA 1NAEA 2ENRA 2JE7A 2XWBB 5A3OA 2PHFA 5JSRA 5FV3A 5BNPA 3IZOA 5HXMA 1S0GA 2F4PA 2NPIA 1SDDB 2C26A 4Q0UA 1V00A 1CAWA 2ZX4A 2ZABA 2RVAA 2JX9A 2VZQA 1J3PA 2BGPA 1FV3A 5F9TA 2W08A 5KC6A 2BOJA 4K8RB 3AMQA 2VM9A 1MZFA 3H0OA 1O7FA 2ZGQA 2R041 1JOJA 4GIQA 5L73A 2CY6A 1LGNA 4BU2A 1JYIA 3V64A 3RZZA 3J7LA 2J1AA 4NIHA 3I59A 4MO3M 4OYUA 3TEWA 3NQHA 1K12A 2D7FA 4CVUA 2VCMA 5A1LA 2VVFA 4UFMA 1W03A 2DURA 3AP9A 2VMEA 3H3UA 3B02A 3HAGA 3EQEA 3O1SA 1WCDJ 2E32A 1ULDA 5IVEA 1YC61 3C7FA 5FZ6A 2BVBA 3LDBA 4G3YC 1GYKA 4QU1A 5I0TA 4NIAA 3BUCA 1KFXL 5DAVA 5CU1A 1ZZ8A 1AF9A 2WNEA 4LOTA 2O14A 2HWD2 4FPKA 5FOJB 4FTSA 2VMGA 1S2BA 3FFZA 5LK7B 4Y24A 1C8M2 4DIQA 2ZZJA 4N43C 1T2XA 3HQXA 4EWAA 2R30A 3HNBM 1HV1A 5A1FA 5HCFA 3M3OA 5FZDA 2PXJA 5C9AB 2WS93 4QB2A 4TTGA 2I2SA 3IPVA 4IEUA 3ZXAC 4BQ2A 1GUIA 5F7UA 1AX1A 4JX0A 2ARXA 1FNZA 3T08A 2WBKA 1HW5A 3UJQA 4LIUA 3SH4A 1H1IA 4CEYA 2IXCA 1AJKA 5FXZA 4CCDA 4MV2A 3PURA 3VDDC 4PLNA 4QX8A 1SZBA 4OHVA 3LPGA 4BA6A 1XXNA 4CDWA 2GH8A 4XQWA 4XYXA 1UY1A 4GH4B 3B9CA 3DGTA 3ZR5A 1UY0A 4YZ3A 5LBFA 3FWEA 3SH5A 2DVBA 1HRI2 1GQGA 1EUUA 1AXZA 3JU9A 1GOGA 2GP3A 1Y3TA 1W0PA 4U2AA 5EFUA 5FZIA 1POV3 1CAVB 4LHNA 1RYYA 3VBRA 1XNTA 4CDXC 2CTVA 2BEOA 1LESA 5JLVA 1IOAA 2DVGA 3S7IA 2BPA2 1YFUA 5FBZA 2AYHA 1RGSA 3ILRA 2P5BA 3DKQA 1RUI1 1V6MA 2TUNA 5FZKA 5EWSA 5JDBA 2A7AA 1ZBE3 4LLOA 4CDXB 1XQNA 4JGYB 2UYBA 2HWB3 3I4IA 1DP0A 1QH6A 2OZ6A 3BTAA 1C1LA 4K1ZA 4ASKA 4CUAA 1GZTA 5L7OC 1J83A 2WAAA 5GLZA 2BBAA 3ON7A 4QAWA 4URAA 2XHKA 2XJPA 5I91A 4COWA 1QQP3 1TNFA 5JMOA 5L7OB 1F4HA 3LD8A 4Y22B 2FDFA 4YG0A 1AR92 4O65A 4CTEA 3I2IA 3LA3A 4CDUA 3MIFA 4P14A 2O1QA 3PUHA 4DRVA 1W6NA 2ZMLA 2P6HA 1VBE3 1ULEA 2R071 1JZ7A 5FYCA 3SXWA 4QHBA 5G04L 4AEJA 1FV2A 4IW3A 3H42B 3B7MA 1W6PB 3CBNA 4AVAA 2HWE2 2FBEA 4X8PA 4URTA 2WDBA 5JVVA 1COV3 2EAKA 4O9EA 5A7WA 5HCAA 5IFTA 3E6DA 2YXSA 3KGLA 1TME2 1JZ2A 1AUYA 5DZEA 4OHXA 4WM8B 1QOSA 1H9WA 1VBC3 4QPYA 5FLHA 2HYKA 2PA7A 4R9AA 2FCUA 3DKWA 3WDWA 3WW1A 1RUH3 2EICA 4LPLA 3H7JA 4FXKB 2IXLA 1ZZ6A 3HT2A 3OG2A 1H6XA 3VBHC 3ZFGA 5A3NA 5C3SA 5I0DA 1ZRDA 4OLLA 3D4KA 3LQCA 3ATGA 4GB33 4FQZA 3S5QA 4A7ZA 5J48A 4ZU5A 3J8F2 1UPIA 5C71A 5LBBA 1CQ9A 1ZBA2 3CZJA 3VBHB 2AR6A 1H30A 1OQDA 4TLFA 4MGSA 1JMUB 3AJZA 4HOOA 1PK6C 1US2A 3MW2A 4D3WA 5KXBA 5FP3A 3WF0A 3ZFEA 4DPNA 1BBT2 1YI9A 4GMP3 1NOVA 2B42B 4FFHA 4HFSA 1S0CA 4HXCA 4YGEA 2VJXA 5FXWA 4E8CA 3ZR6A 1F8VA 1HRV2 1N1VA 1V6OA 2BWAA 1W6QB 3ZSLA 2MEV1 4I01A 1YO8A 4IV3A 2OW4A 2OKXA 3C7EA 4BIFA 3T0DA 1KS5A 2R1DA 2PELA 2QKDA 5E1RA 2YFUA 2H6BA 1T6GC 4ES8A 1UIKA 3CQOA 4P02B 2AH2A 1DQ0A 2CU5A 2IFWA 1UNBA 2BJSA 2JG8C 4R4ZA 1MEC2 1BXHA 5I0RA 4AI3A 1Z7S3 1TMF1 3IT8A 1DQ2A 4YLZA 3B3QE 3VBSA 5J3UA 1C5HA 3WVJA 4QM8A 1BVVA 4IV1A 1UKGA 2XB6C 2YBSA 4Q4Y3 4YVSA 1K42A 3VN4A 2WFF2 1D4M1 3FX3A 2WN3A 4OULA 1WA4A 5LA2A 2VOWA 1PZ9A 3WNOA 2OUHA 1OUXA 3AKSA 3B9IA 5K4LA 2GMMA 2H0BA 3KCYA 2D93A 2XJVA 4ASLA 1RVF3 5L9RA 5IFPA 2JD4A 5F5CA 1YNAA
chains in the Genus database with same CATH topology
3ZYHA 2O14A 4LK6A 4YW7A 3ZYFA 2K46A 4A6SA 1V0AA 3F95A 1WMXA 4CP9A 2LROA 4CPBD 1GWKA 2C24A 4CP9B 4AL9A 3ZYBA 2Q1FA 1OKOA 4YW6A 1W8ZA 4LKEA 2WYFA 3UT0A 1HN0A 1WZXA 1W9FA 1W8WA 1W8UA 4LKDA 1WCUA 4BQ2A 4LJHA 4BQ5A 2KR2A 4BQ4A 4LKFA 2LRPA 1GWMA 5D21A 1GWLA 1L7LA 4BQ3A 2JWPA 1UOJA 4YWAA 1OH3A 4LK7A 1W8TA 2VXJA 4CPBA 1W90A 3ORJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZYH A;  2O14 A;  4LK6 A;  4YW7 A;  3ZYF A;  2K46 A;  4A6S A;  1V0A A;  3F95 A;  1WMX A;  4CP9 A;  2LRO A;  4CPB D;  1GWK A;  2C24 A;  4CP9 B;  4AL9 A;  3ZYB A;  2Q1F A;  1OKO A;  4YW6 A;  1W8Z A;  4LKE A;  2WYF A;  3UT0 A;  1HN0 A;  1WZX A;  1W9F A;  1W8W A;  1W8U A;  4LKD A;  1WCU A;  4BQ2 A;  4LJH A;  4BQ5 A;  2KR2 A;  4BQ4 A;  4LKF A;  2LRP A;  1GWM A;  5D21 A;  1GWL A;  1L7L A;  4BQ3 A;  2JWP A;  1UOJ A;  4YWA A;  1OH3 A;  4LK7 A;  1W8T A;  2VXJ A;  4CPB A;  1W90 A;  3ORJ A; 
#chains in the Genus database with same CATH topology
 1HQW A;  2EAA A;  3T3Y A;  1CAX B;  4LLF A;  4JQT A;  4XF9 A;  3CEW A;  4D8M A;  3C2U A;  3RYK A;  5B4X A;  4D6Q A;  1WMX A;  4PDW A;  1TG7 A;  5DN2 A;  1PM4 A;  2AEN A;  1GZW B;  2OX0 A;  2FD8 A;  2RR1 2;  5FY7 A;  1VRB A;  5K0U C;  1O8P A;  2FMD A;  2J22 A;  4GJZ A;  1WMD A;  5FY0 A;  3JQX A;  1W3V A;  1O3T A;  1JU3 A;  1V9U 3;  1W9F A;  4MLO A;  1NZC A;  1QF3 A;  2QNK A;  3PLQ A;  1UF2 C;  3K77 A;  3ZDS A;  2ZGP A;  4UFH A;  4AI1 A;  4LBK A;  2JJ6 A;  1VRH 3;  4CCO A;  1OA3 A;  2XWJ B;  2XGX A;  4FP3 A;  3FN9 A;  4LOR A;  3POS A;  1W05 A;  2IZW A;  1AR8 2;  2VXJ A;  1KJL A;  3WF2 A;  2CWS A;  2RDR A;  1EV1 2;  1GMM A;  4CDQ A;  4XXA A;  1MVQ A;  3MHZ A;  3UYJ A;  1D0H A;  1PO2 2;  1W2A X;  3ME2 A;  1JI6 A;  4FOQ A;  5LY1 A;  4LUK A;  3I3M A;  1OFS A;  1QJU 2;  3KVA A;  3H1W A;  1U5X A;  1V6J A;  4M00 A;  1Y7B A;  5FYV A;  1DGL A;  3UT0 A;  2RS5 3;  3E5Q A;  1SFN A;  2A1X A;  3AJY A;  1VBB 1;  2LTN A;  1DQ6 A;  5CG8 A;  1RUD 3;  3PJY A;  1SQ4 A;  1QJZ A;  4H14 A;  5H9Q A;  2I74 A;  4BM8 A;  1AXY A;  2BFU S;  1ZRI A;  4L92 A;  4XJU A;  3I54 A;  1NY7 1;  3LB9 A;  3WZ1 A;  3AVR A;  1WGP A;  5FZE A;  1QJX 2;  4QPI A;  1XE8 A;  1BLZ A;  2XLA A;  3HPN A;  3TNP B;  3MIG A;  1PX3 A;  2D6L X;  5FY8 A;  4WVM A;  2WO3 A;  3O1U A;  4JDN A;  1G9C A;  1NCR B;  1UWW A;  1JYN A;  1A8M A;  4LBN A;  1OF3 A;  1PMI A;  5LA1 A;  2JDK A;  2OVU A;  1FXZ A;  2GU9 A;  4COV A;  2NZ9 A;  3LFI A;  3SLI A;  3RRD A;  3ZMO A;  3GBF A;  4H3W A;  1DBN A;  5FZ4 A;  4RFR B;  4D7T A;  3E1F 1;  5A3P A;  2RS3 1;  4DO0 A;  1ND2 C;  4AXO A;  4A41 A;  1XOY A;  4IEV A;  1AR7 1;  1RMU 3;  2JWP A;  1F9K A;  4XAE A;  1UYY A;  1PIV 3;  3NST A;  4XZP A;  3SHR A;  4D69 A;  1XSQ A;  2YPD A;  1CN1 A;  2OS2 A;  5C4W C;  3I8T A;  4EN6 B;  3MF6 A;  3H8X A;  2K46 A;  5IUQ A;  1W0O A;  5T52 A;  4BH9 A;  3RZJ A;  4K7J A;  3N7K A;  4LBQ D;  2VQT A;  5C4W B;  1CX1 A;  5FZC A;  3HIF A;  5A6Y A;  1JHN A;  5JIU A;  4QU2 A;  5DG1 A;  4M0N A;  4WM7 A;  5LEJ A;  3LE0 A;  1LOA A;  4D7Y A;  3LGR A;  3ECQ A;  4Q4X 1;  5C70 A;  2P37 A;  3AB0 A;  3VHO A;  4DFS A;  2ZXQ A;  2X09 A;  4IQP A;  1JU4 A;  3RS6 A;  3WCS A;  1QGL A;  4Z07 A;  1ODN A;  1VJ2 A;  4Y1X A;  1IGO A;  4H55 A;  3OJB A;  1EPZ A;  3VGI A;  5EJ3 A;  5BNN B;  2HBU A;  5T50 A;  5CFD B;  3MIC A;  1PGL 1;  4XZU G;  1AVB A;  1OOP C;  2JEN A;  3JZV A;  4FXG B;  3HN3 A;  2UUR A;  3SQO A;  3SEP A;  1UKR A;  1FMD 1;  1W3X A;  2C9A A;  3NAP C;  4OUE A;  4UW4 A;  4COZ A;  4KL1 A;  2VUJ A;  1WZX A;  4KU7 A;  3VKN A;  3K4D A;  3T4V A;  1PVX A;  3H7Y A;  1MZ5 A;  1PVC 2;  2HBT A;  3PL0 A;  3N9L A;  3MV0 1;  4XF4 A;  1X33 A;  4OQ9 A;  2P4E A;  4EYU A;  3USS A;  2WNU C;  1G86 A;  4XF0 A;  1VBD 1;  1W6O B;  1XU2 A;  2Y38 A;  5KHI A;  3GZE A;  3KQR A;  3VV1 A;  4NIG A;  3OGS A;  5C3Q A;  4QXB A;  1YQ8 A;  5FZ3 A;  2R06 1;  2PHX A;  2B9U A;  4W50 A;  5FJH A;  2WS9 2;  1DQ4 A;  2VC9 A;  4P5Y A;  5FQ0 A;  2WZR 2;  2VUL A;  1AYM 1;  3NKT A;  4XW3 A;  1W6M A;  4N43 A;  5HBA A;  2WLQ A;  4NMI A;  1H4H A;  4FP2 A;  2IWG B;  4A3Z A;  2Y6H A;  2WL1 A;  3S57 A;  2P3Y A;  4I09 A;  1CZT A;  2VZS A;  3K3O A;  2VPV A;  3GJB A;  3VD7 A;  5D1I A;  4NUB A;  3I2H A;  3Q9O A;  1RHI 3;  1OXC A;  3MF9 A;  3MID A;  4LNV A;  2YB7 A;  5DXD A;  4YVW B;  3VBO C;  3ZKU A;  4RS5 C;  5BNO B;  4OI2 A;  3VL9 A;  5FPX A;  3O1V A;  1SLI A;  1H4G A;  1DHK B;  1ZX5 A;  2WNO A;  3AXE A;  2ZOE B;  1SHW B;  1WKY A;  2BTV C;  1V6K A;  3VDD A;  3ZN6 B;  1RUG 2;  4XAC A;  5J37 A;  4FPC A;  4AVV A;  2DDU A;  4ZON A;  1SLT A;  4A2U A;  1DLC A;  2RG4 A;  5CAZ A;  1F5F A;  2Q4S A;  3MW3 A;  2DVF A;  2VNR A;  2DU0 A;  4MHR A;  4E27 A;  1FOD 3;  4ATF A;  4CE8 A;  4DNY A;  2HWB 2;  4JKL A;  3ZSK A;  1RUJ 2;  1NZI A;  5IK8 A;  1L7R A;  2VZP A;  4CDX A;  5JMC A;  3E5X A;  1UY2 A;  1GNY A;  1ZZC A;  2RS1 1;  2WJS A;  5FUI A;  4MET A;  4GD4 A;  5HV0 A;  1KXG A;  2VCA A;  5IT6 A;  5JPM B;  3RWK X;  1IS6 A;  3VBF C;  5JIA A;  5B4N A;  3PNA A;  1UU4 A;  5A1A A;  2A6W A;  4LTA A;  1QQP 2;  4XCB A;  5G05 L;  2XG3 A;  5F6K A;  2ZGS A;  3VD5 A;  1SFY A;  5DDJ 3;  2Z5W A;  4CPB D;  4HPK A;  2OPW A;  4CU9 A;  4CU8 A;  2QQW A;  3AMM A;  3VBF B;  2AGS A;  3CJI B;  5CB7 A;  1JUH A;  5IAT A;  4PI0 A;  4RYD A;  5L7O A;  4OUM A;  1VBE 2;  4XFI A;  4AI0 A;  3C7O A;  2W68 A;  4XTP A;  2A6X A;  5HCB A;  1R1A 3;  5IVC A;  1BEV 3;  4Q8L A;  1LAJ A;  3OF1 A;  4LJH A;  2PAE A;  3KF5 A;  1W2N A;  1HXS 3;  1GOF A;  1PZ7 A;  2R32 A;  2VOV A;  4OCT A;  3A4U A;  3SCG A;  3WP3 A;  3ZYJ B;  3KV5 A;  1QOT A;  1L7L A;  2JIG A;  3ZMN A;  5FYS A;  4E8D A;  3KHB A;  4CP2 A;  3FLP A;  3P1I A;  1O91 A;  4A3X A;  1BJQ A;  3KT7 A;  2JEM A;  3ZYH A;  2K9Z A;  4N53 B;  4AQS A;  2X53 S;  1RUH 2;  4OMC A;  3C8X A;  3UKT A;  3AP7 A;  1F4A A;  4ONU A;  1OF4 A;  3TB0 A;  4CU6 A;  3VD9 A;  4D6S A;  4AR2 A;  3KV9 A;  4HT1 T;  4BMB A;  4GB3 2;  3TEX A;  1IPS A;  2D6O X;  3UET A;  2IUW A;  1A6C A;  1YFW A;  3AKP A;  3RZK A;  4Y33 A;  4QB1 A;  1NE6 A;  4GAL A;  3JBG 1;  4PLM A;  5FK7 A;  1ZYB A;  2VZ3 A;  1JYX A;  3KCC A;  4R9D A;  5C8C C;  4QQP A;  5IVF A;  2EID A;  2ZKN A;  4IE6 A;  3VBH A;  2VD7 A;  4EQV A;  1PMJ X;  4PIX A;  4IGQ A;  4LBQ A;  1WW5 A;  4YW5 A;  4MAD A;  5FR3 A;  2K0G A;  1JHJ A;  4HVR A;  1O5L A;  5H9S A;  1C8M 1;  4AAX A;  3TN9 3;  5ACA 3;  3LA7 A;  1PK6 A;  4HKO A;  5FKB A;  5E88 A;  4NHK A;  2VZR A;  2Z69 A;  3NNG A;  4C1X A;  2RV9 A;  1ZRC A;  3Q8F A;  2AZ5 A;  3IAP A;  3ZX7 A;  1J3R A;  1O3Q A;  4LBO A;  3O0W A;  1YQ2 A;  1GR3 A;  3EBR A;  3T2P A;  4UF0 B;  3ZVX A;  4AG4 A;  2RJ2 A;  1RED A;  4K6B A;  5T5J A;  1QHD A;  1W28 A;  1CX4 A;  1NCQ C;  1YWK A;  3N3H A;  5EZW A;  3KZ4 C;  3DYP A;  1Z7S 2;  4Y20 B;  3LDK A;  5FZO A;  1R08 2;  1WLW A;  4MGQ A;  2ZHL A;  3AMN A;  1CIW A;  1YEW A;  1RUO A;  2DUQ A;  3OGV A;  4L8Q A;  3ZXE A;  2C1F A;  4Q4Y 2;  5CFC C;  2JG8 A;  4WBB A;  5HXV A;  3V0A B;  1ST8 A;  1CAU B;  4Q29 A;  1SFP A;  2E63 A;  2HWC 1;  1GWK A;  3TOJ A;  1W9Y A;  4LMF A;  4H7M A;  1LNS A;  5CFC B;  2F4L A;  4JZR A;  1H6Y A;  1GU3 A;  5KXE A;  4RQP C;  4RA0 A;  4N8M A;  4QX7 A;  3JQW A;  3U10 A;  2R04 3;  1F15 A;  3VZK A;  1RUN A;  2QQJ A;  3OBR A;  3DUI A;  3NNJ A;  2GMP A;  2IXH A;  3OUJ A;  1RVF 2;  2GZW A;  3JB8 A;  1LTE A;  4QGM A;  5J36 A;  5I0S A;  2ZMK A;  1SBD A;  3VB9 A;  1Q8Q A;  3E6B A;  4CXY A;  2D44 A;  3LIH A;  4HVO A;  1IPK A;  5J09 A;  5ERL A;  2Z42 A;  3R05 A;  4PHZ A;  4DEQ A;  1QKQ A;  2J7M A;  1MQT C;  3TRS B;  2DUP A;  2JDA A;  1J59 A;  1W99 A;  2DU1 A;  3FJS A;  1WCS A;  3GNE A;  3IM0 A;  4NRQ A;  1W8O A;  2WO2 A;  1PO1 1;  1LHN A;  3KV6 A;  4FQ4 A;  4CU7 A;  3KHC A;  3CMG A;  3K2O A;  5FTT C;  4KBB A;  1R64 A;  4MXW B;  4HLT A;  1R09 1;  5AC9 2;  3AP6 A;  3O5S A;  5DAB A;  1WD3 A;  5K0U A;  1VBA 1;  3SEE A;  3OUI A;  3HOB A;  2QQN A;  2W5F A;  4XIL A;  5KHH A;  4FTE A;  5FYT A;  4AVB A;  1S0J A;  3T30 A;  1LR5 A;  3OTF A;  4FO9 A;  3MPB A;  2WO1 A;  4Q2F A;  4E2S A;  4K21 A;  5JOZ A;  2A6Y A;  2XOM A;  2Z79 A;  1TME 1;  5JXJ A;  4LE4 A;  5JUV A;  1DZT A;  2QFE A;  4GZ9 A;  2GP5 A;  3ORJ A;  1DQ1 A;  3OGJ A;  3DYO A;  4PQ9 A;  1Z78 A;  3WIN E;  2YRO A;  3OEA A;  3IIA A;  1VPH A;  4WVZ A;  4JKM A;  1QMJ A;  3WSO A;  3GXU A;  2RS5 2;  4PBO A;  1B35 C;  2FCT A;  3CJX A;  5A7P A;  4C0H A;  4AEM A;  4JVA A;  4KG0 A;  1RUC 2;  1RUD 2;  1B35 B;  3J8F 1;  3MPP G;  4M3C B;  3Q8E A;  1VMJ A;  2XBO 2;  2ZBJ A;  1ZBA 1;  3GZT B;  4YRD A;  4RHV 2;  4KWK A;  2ZGL A;  4UXA A;  5FMB A;  4AHY A;  4E2Q A;  5FYY A;  1RUI 3;  4AQ2 A;  5ABJ C;  3T1M A;  2ARB A;  4MHU A;  3T2Q A;  3OPZ A;  4CPB A;  1OFN A;  3WG2 A;  5L36 A;  4GA9 A;  4ARX A;  3V0B B;  1EAH 2;  4QQO A;  2WZP P;  1IKP A;  1TVG A;  3BB6 A;  4DUV A;  1H2L A;  1U5Z A;  4LHL A;  1H2N A;  2YPJ A;  4OUS A;  1AL2 1;  1HRV 1;  4NE9 A;  4W65 A;  1LB2 A;  5ABJ B;  2WSU A;  4W4Z A;  1CD3 G;  1DGW A;  4KU8 A;  1XSR A;  4ZS2 A;  3ZYB A;  5JSO A;  4OI0 A;  2BQP A;  2IVI B;  1JYT A;  4J1W A;  1RJ7 A;  4XDO A;  1LCL A;  4YYO A;  4GWM A;  1QJY 2;  4LKD A;  2JDP A;  1RMU 2;  1QY4 A;  1UZY A;  4M3C E;  4WVV A;  1SLA A;  3AC0 A;  3AZX A;  1PIV 2;  4KWJ A;  1FPN 2;  4YW3 A;  3ES1 A;  4EN0 A;  4KQ7 A;  4LUM A;  1SPP B;  2Y6F A;  4LA2 A;  4TXW A;  3WG1 A;  1VIW B;  2BOI A;  1MEC 1;  4PT6 A;  3RJR A;  2R07 3;  2X8K A;  2KA3 A;  1X8M A;  2R0F A;  1ND2 A;  5IVY A;  4DXS A;  5D8A C;  4H7L A;  1POQ A;  4KG8 A;  4CXW A;  1Z0H A;  5FZ0 A;  5CKM A;  4AHZ A;  5JZG B;  3LSD A;  3RNS A;  4AI2 A;  2ZGN A;  4AI9 A;  1IKQ A;  5FMO L;  1L7Q A;  4O61 A;  5C4W A;  5I93 A;  2WZE A;  5D8A B;  5EYY A;  5BXX A;  4DRR A;  2DFC A;  1HB1 A;  2EXJ A;  2ZPX A;  3LDR A;  1CWP A;  1GP4 A;  2WFF 1;  2RM2 2;  3T0A A;  4XHX A;  1W8W A;  4QQL A;  2YG0 A;  1QNY A;  2FMY A;  4IXL A;  2W91 A;  3CO2 A;  4DXZ A;  3KS7 A;  4GMP 0;  5FZ9 A;  1AYN 1;  4XQ4 A;  2XJR A;  1LOF C;  3PTY A;  1AXK A;  4I0A A;  5JWP A;  4Y1Y A;  2CDP A;  4BLJ A;  2ZX3 A;  5HI0 A;  1NQD A;  3PUQ A;  2VZ1 A;  4XJA A;  4B8E A;  4D6R A;  4JHT A;  5CAD A;  5C9A C;  3FHI B;  4BOW A;  2KD7 A;  4BLI A;  1HLC A;  2HWF 1;  2JDH A;  3VHP A;  2Y6J A;  2ZKL A;  3ITQ A;  1MS1 A;  4QPG C;  5A6X A;  2QQM A;  4NRO A;  1UL9 A;  3QOP A;  5FWJ A;  3DEC A;  5KHJ A;  1XNC A;  3POJ A;  2H6C A;  1X9P A;  4S2G A;  3MI8 A;  1MZE A;  1FAY A;  1OOP A;  5J1X A;  3WP6 A;  2MEV 3;  4F3J A;  4QPG B;  2DTY A;  2JE8 A;  2KR2 A;  3OBZ A;  3NAP A;  4OFG A;  5D21 A;  5T5O A;  1GWL A;  3RPQ A;  2ETE A;  1Y9M A;  1CES A;  1XE0 A;  4GH4 C;  2W1U A;  3UGH A;  1WW4 A;  4CCN A;  3ENR A;  1LOC A;  4UW3 A;  1FI2 A;  1ENQ A;  4JRL A;  3GCX A;  4QXC A;  1FX5 A;  2WNU A;  2VR4 A;  4EN7 B;  4B4Q A;  2WYS A;  1X9T A;  2ZX2 A;  3ZXF A;  1PO2 1;  5JCT A;  3O1R A;  1OSG A;  1WBL A;  1KIT A;  5A7N A;  4LIV A;  3TWI A;  5LA0 A;  3TEY A;  4UFJ A;  1QJU 1;  1BK0 A;  3CNA A;  5F1R A;  1TMF 3;  4G9S B;  4AHW A;  3ZLI A;  3HWJ A;  3HQU A;  1YLL A;  4WVW A;  1ZRR A;  2QJV A;  3A23 A;  1YQC A;  2IXI A;  2YBP A;  3GCW A;  4JGY C;  3WV6 A;  4AFB A;  2ZEZ A;  2A6Z A;  1RHI 2;  2VBB A;  5EHD A;  1DDL A;  4M01 A;  1D4M 3;  4KMQ A;  4YGB A;  3UGF A;  5EV7 A;  4FPL A;  1MZ6 A;  3I2K A;  4CEW B;  2VVE A;  4CZS A;  5I0U A;  3NKG A;  3GF6 A;  5DAQ A;  1CIY A;  3AFK A;  1JYV A;  3KWV A;  4K8F A;  1X50 A;  1XYP A;  2CDO A;  2BYV E;  1E5H A;  1V6I A;  3VBO A;  3R4U A;  3VLB B;  1KRI A;  1HDK A;  3D3A A;  3A22 A;  2BZD A;  1F2N A;  4RS5 A;  5K9Y A;  3RZG A;  2P2K A;  3QH7 A;  4QX2 A;  1FOD 2;  5J96 B;  5LCW L;  1WW7 A;  3M3E A;  3RGB A;  3N9N A;  4UWD A;  4ITC A;  2PHU A;  4HSJ A;  4YW4 A;  4CDW B;  1ND3 B;  5FJK A;  1W9T A;  2ZEY A;  4DQA A;  5A32 A;  1C3H A;  1ODM A;  1UYX A;  2I45 A;  2ZGT A;  3ES4 A;  3ZFF B;  5E16 A;  4Q0S A;  2XJT A;  3GYD A;  3ST7 A;  1GP6 A;  1G8W A;  2B7Y A;  2CSG A;  4P9I A;  4QWN A;  4P9J A;  3FHA A;  4QMA A;  5FPZ A;  3R4D B;  4WM8 C;  5FPB A;  4AHX A;  2X10 A;  2IFR A;  4ZXE A;  1J3Q A;  1MR5 A;  2QQV A;  1W8Z A;  2XDV A;  5DDJ 2;  1REE A;  5IAX A;  3ZOI A;  4P9L A;  2UWB A;  3KLS A;  3W59 A;  2Q5T A;  1GQP A;  2G9G A;  2NMO A;  4XUP A;  3VBF A;  5C7G A;  2D40 A;  3DF0 A;  1R1A 2;  3H1Y A;  1AR6 1;  3AZZ A;  1DCS A;  1ONA A;  4CCE A;  2EVX A;  5CKN A;  1HXS 2;  3SIS A;  4Z92 B;  5ISL A;  3GBW A;  1NXM A;  4Q1R A;  2KM2 A;  5ANN A;  4RR3 B;  4Y1U A;  1JW6 A;  1VBB 3;  4HN1 A;  2EXH A;  3AP4 A;  4XHB A;  3VZL A;  5F5I A;  4IUG A;  4CRQ A;  3I2O A;  5F5A A;  1PNF A;  1Q8O A;  1IG0 A;  1J58 A;  1I5P A;  2W94 A;  2YDE A;  3LKJ A;  4JQR A;  3WNL A;  3B01 A;  3FHQ A;  3MFC A;  2XR4 A;  1MS8 A;  4R9B A;  1DIW A;  2Y8K A;  5DZG A;  5CBL A;  4NO4 A;  4QGL A;  2FDK A;  3W5M A;  3UKN A;  2BNM A;  4MOA A;  1S0B A;  3WW2 A;  2ATF A;  1VE0 A;  1BMV 2;  1RXG A;  2G19 A;  2NYY A;  3L9J T;  1ZZB A;  2ADE A;  2LS6 A;  2JDN A;  4V1P A;  4DEV A;  4ZU4 A;  1LGC A;  3H3Z A;  1PVC 1;  4NPM A;  2CL2 A;  4W8J A;  4UI9 L;  2GNM A;  3O1P A;  1RUF 1;  2VTX J;  3DEM A;  4C0B A;  4P08 A;  3EJK A;  1SBF A;  1S0F A;  3IBM A;  3LAG A;  2JXA A;  2RS3 3;  1GSL A;  3TN9 2;  3JUU A;  5C8C A;  1AR7 3;  1OUS A;  2B4K A;  5FYM A;  1AL0 G;  3N7L A;  5DUV A;  5FZ7 A;  4AVS A;  3POE A;  5EYX A;  5HV4 A;  2HKX A;  2WZR 1;  3CIH A;  4NWW A;  2L9L A;  3BPZ A;  3WQ1 A;  4PIZ A;  4LO7 A;  2F17 A;  4JRA A;  4XC9 A;  2JG9 B;  3ZYI B;  2VMF A;  1SLL A;  5KWR A;  5FP9 A;  1UMZ A;  3D82 A;  4JDO A;  3ZSE A;  3L2Y A;  3APB A;  2EXI A;  3J7N A;  3PVO A;  4Y20 A;  2W9X A;  3LPF A;  4AE2 A;  4Q4X 3;  2OQ6 A;  4IL7 A;  1R1Z A;  2G9Z A;  4PCR A;  3IDC B;  1NCQ A;  1YQ5 A;  4N9I A;  4RSU A;  5A7O A;  3V0A A;  1RUG 1;  4GWJ A;  5A3T A;  2R7E B;  3WXP A;  5JR2 A;  1XPW A;  2W92 A;  4PBP A;  2RDS A;  1CJD A;  1K5J A;  2XJS A;  1YUD A;  3ZIX A;  5CFC A;  4JHZ A;  2VEC A;  1W0N A;  2W39 A;  2ZEW A;  5A3U A;  5CA6 A;  5JOW A;  3Q8C A;  2Y0O A;  3KVB A;  3X29 B;  5KBF A;  2A73 B;  4EZH A;  2A3X A;  1VR3 A;  1RUJ 1;  2X5I B;  1FMD 3;  3PME A;  4AYU A;  1H1M A;  4RQP A;  2V72 A;  2VQA A;  4Q4V 1;  2ARC A;  3MGU A;  4FPF A;  3U4S A;  3VBU B;  3WEZ A;  1E5S A;  2YUE A;  3AMP A;  1ASJ 1;  2PN5 A;  5JOX A;  1W9W A;  2PQQ A;  2WUH A;  1LU2 A;  2PFW A;  3J7M A;  4QQ2 A;  5F39 A;  5BPX A;  2FQP A;  4XJ8 A;  5FLI A;  1RUE 1;  4XFA A;  3O1O A;  4FOV A;  1F31 A;  1D4V B;  1UX7 A;  1VBD 3;  2BBV A;  3WNX A;  1XYO A;  1LED A;  1N3Q A;  2WKK A;  2Q8C A;  2GME A;  3K46 A;  4F83 A;  2VZU A;  4DZG A;  3CZU A;  4AL9 A;  1N3P A;  2R06 3;  2YZ4 A;  2ARE A;  1MQT A;  4OVE A;  3PTR B;  4M3C F;  4LE3 A;  1UOF A;  4KNC A;  5F3E A;  2XQR A;  3O12 A;  4OZO A;  1AYM 3;  5LAS A;  3GM8 A;  5BYN A;  4BWO A;  1HIX A;  5SV5 A;  4DXT A;  2PAM A;  1U5Y A;  4I30 A;  3BU0 A;  4LO5 B;  1UN1 A;  1W8T A;  4X6Q B;  3I3E A;  5FAX A;  2JDM A;  4Y4Y A;  2PHL A;  2WNV B;  1H1A A;  1NCR C;  3MUZ 1;  4MGY E;  4FPY A;  1QU0 A;  4LK6 A;  5CVR A;  4AFM A;  1JZ3 A;  2RMU 1;  5LBC A;  1QOO A;  4LHK A;  1GAN A;  1Y43 B;  1UQX A;  1CPM A;  3POG A;  4JTN A;  2HJI A;  3OYW B;  4OZX A;  1VP6 A;  1IHM A;  2CYF A;  4MUV A;  1B35 A;  5FLJ A;  2QQU A;  3AKQ A;  2IXJ A;  2VU9 A;  1IS3 A;  4JDM A;  5C33 A;  5GZD A;  2PMW B;  3QH6 A;  3BTZ A;  4C1W A;  2CGP A;  2Q0A A;  1UOB A;  2VXR A;  3HNM A;  5AVP A;  2CNA A;  2LM3 A;  2IC1 A;  2PHR A;  4FPH A;  1V6N A;  1JUI A;  3AL6 A;  3DPR B;  3JXS A;  3PU8 A;  4Z8B A;  4NHX A;  1LOD A;  3AMH A;  1Q8S A;  4RN5 A;  2RS1 3;  2ORZ A;  5F2W A;  2WII B;  5ABJ A;  5TSW A;  3H8O A;  1QXJ A;  4XJW A;  3FMG A;  1RL3 A;  3AP5 A;  4Q26 A;  3AL5 A;  1W8F A;  4I2O A;  4MGI E;  2BFU L;  5EP9 A;  5FZM A;  3S7E A;  4HAN A;  1TZO A;  3AXD A;  1QH7 A;  4CCM A;  4LOS A;  2TBV A;  5LZ6 A;  2R07 2;  3I7D A;  2BNN A;  4HMZ A;  4B7K A;  4FPG A;  5BV6 A;  4P9W A;  4A4A A;  1R08 1;  3DN7 A;  2ZGU A;  4LO4 B;  4AGV A;  3WDY A;  4V2W A;  5LRS A;  3OBT A;  5BNN C;  4FSJ A;  1CAW B;  5CFD C;  3JD7 1;  4AF9 A;  1Q56 A;  1W39 A;  3IDE A;  2UYA A;  4XUN A;  5JI9 A;  4IDZ A;  3HEI A;  3POB A;  5A3W A;  3M3C A;  4TLG A;  2EXK A;  3AYA A;  1O4T A;  1O59 A;  1FAT A;  3O1M A;  5D8A A;  2GAU A;  2C24 A;  2A70 A;  2ZEX A;  4AFA A;  2P3J A;  5I8Y A;  4F8A A;  1C4R A;  1WCK A;  4FFG A;  1SEF A;  2VAU A;  4BPZ A;  4YM3 A;  1OD3 A;  4J25 A;  1DU3 D;  4ISQ A;  2E33 A;  1K5M C;  1OKQ A;  3AFG A;  2YC0 A;  1JOP A;  1URX A;  4HZF A;  4LO8 A;  3ZDV A;  2D6N A;  1DYO A;  4AZZ A;  4CCL A;  3WNP A;  2VBP A;  2WQ4 A;  4DB5 A;  2AEY A;  4XFF A;  2PQS A;  1Q43 A;  3JBG 3;  1K5M B;  5DAW A;  3I3D A;  3N9P A;  2PHW A;  1MVE A;  5A7S A;  3AK0 A;  1LOF A;  3ILN A;  3K51 A;  2D98 A;  2DCJ A;  3DCQ A;  3ILF A;  1UYP A;  4KBZ A;  4QD2 A;  4C8D A;  4OQ8 A;  5FP7 A;  3ACG A;  4PLO A;  4QDR A;  2J1E A;  4S2H A;  1O3S A;  3OEB A;  2ZAH A;  1X82 A;  1S55 A;  2BV4 A;  4K1Y A;  2MEV 2;  1D7P M;  1C8M 3;  3S0M A;  5AC9 1;  5C9A A;  2A75 A;  5H9R A;  2E53 A;  4GWI A;  2Q8D A;  3ZPY A;  4QPG A;  4Z2W A;  2J1S A;  4YVW C;  2D6P A;  1UZW A;  1QWR A;  1BVP 1;  1VAK A;  2XVK A;  2ZGR A;  3PUI A;  5FKC A;  2BP6 A;  3WY6 A;  1OLR A;  5BNO C;  2VUA A;  3IKW A;  3BIE A;  4YWA A;  4JGZ C;  1ZA7 A;  3Q8B A;  3THC A;  3LEI A;  1AX2 A;  3HBZ A;  2GC0 A;  5LEK A;  3UKV A;  3QBQ A;  1YJK A;  5DMY A;  5L9V A;  1JBC A;  5T5L A;  4D0Q A;  4OHZ A;  3SC7 X;  4GH4 A;  3T09 A;  3ZYF A;  1TMF 2;  1VLN A;  4JGZ B;  1OH4 A;  4EV0 A;  2PLV 1;  4SLI A;  1PM7 A;  4LKS A;  4MH0 E;  3MLJ A;  5DQ0 A;  1CAV A;  4HK9 A;  2VCC A;  3ETQ A;  4I3G A;  4MYE A;  3RG0 A;  1UXX X;  2R16 A;  1RUC 1;  2HWC 3;  1D4M 2;  2Q1Z B;  4YG3 A;  2WRA A;  2QQL A;  1UY4 A;  2XXZ A;  2YC2 A;  1ACC A;  4DUW A;  1WUV A;  5F5Q A;  1ZBE 2;  3AYD A;  3I97 A;  2DCK A;  4LBM A;  2XBO 1;  1YQ6 A;  4BXF A;  5F3C A;  4N90 A;  4Q1P A;  4RHV 1;  3WNK A;  1N1T A;  2Y33 A;  3K75 B;  4JGY A;  1IS4 A;  4W6W A;  1NA1 C;  2VNV A;  4UYB A;  4Q4W 1;  4DY5 A;  2YU1 A;  1EAH 1;  1ZRF A;  2HEY F;  4I0B A;  1RIN A;  4XET A;  4XBQ A;  3CJI C;  2DCZ A;  1J1T A;  3I2G A;  3WF3 A;  1DYP A;  3NW4 A;  1NA1 B;  2QQO A;  3UV9 A;  2W2I A;  4PF1 A;  5EJZ B;  2E6V A;  2VNO A;  4QKD A;  2W1S A;  4GAZ A;  3TAY A;  4Y22 A;  4MZU A;  4Q0Q A;  1QJY 1;  1QDC A;  4XUT A;  1MS5 A;  4CDU B;  2BER A;  5KHK A;  1FPN 1;  1XB9 A;  1W6N B;  2JB4 A;  2LW8 A;  4K3U A;  1PO1 3;  4BQ5 A;  5JSP A;  5IJR A;  1COV 2;  1NX9 A;  1R09 3;  2AC1 A;  4EN9 B;  1W6P A;  2XL9 A;  1W06 A;  2VMH A;  3BGA A;  1JN2 P;  2VQU A;  4XIK A;  1VBA 3;  4N53 C;  4ASM B;  1AJO A;  2MPF A;  5A7W B;  1XNK A;  1VBC 2;  4FT8 A;  2NP0 A;  2VBD A;  2QTW B;  4P00 B;  3QAC A;  4BDV B;  4WM8 A;  3M8L A;  2MNG A;  4COU A;  1TME 3;  5GZC A;  4N9H A;  5FZ8 A;  1S2K A;  3ELN A;  4RL7 A;  3GHN A;  3S6P A;  5JXI A;  2RM2 1;  4IEW A;  2B5H A;  4Q0P A;  3VDC A;  3BKZ A;  4E4Z A;  3RJ2 X;  3BCW A;  3N7M A;  4QQH A;  3MUY 1;  4XFG A;  1LUL A;  4XFB A;  4YW1 A;  5AVA A;  3ZFG B;  3ZM8 A;  3ZXJ A;  1LEM A;  4J1X A;  1VBB 2;  4AED C;  4LKF A;  4QKB A;  4UBH A;  3LF7 A;  3PU3 A;  2DV9 A;  3NVC A;  5IW0 A;  1AZD A;  3O1T A;  2PYT A;  1QEX A;  4KGQ A;  4P9Y A;  3RYP A;  2CHH A;  4L11 A;  1GLH A;  3ZN5 A;  1LOE A;  3FUO A;  2D43 A;  3POF A;  1VB4 A;  3J8F 3;  4MX3 A;  4AED B;  4Z2A A;  3E5U A;  4RGG A;  4UFL A;  1ZBA 3;  1NY7 2;  2DBN A;  1JYC A;  2HWD 1;  2VUD A;  5FMD A;  1OUR A;  3ZFE B;  4EE2 A;  2VOX A;  4MG2 A;  2GC3 A;  3I49 A;  3VKO A;  2OII A;  1MS9 A;  4CP9 B;  2ORX A;  4MGZ E;  1W6Q A;  1GZC A;  1V6L A;  2V09 A;  5K8S A;  1AL2 3;  1HRV 3;  1K45 A;  5IK5 A;  2DYC A;  3I2D A;  2XJU A;  3W5N A;  3OB8 A;  3LWC A;  4B1L A;  3ACF A;  4BME A;  1EYB A;  2KXL A;  5FK8 A;  2XL7 A;  5LBE A;  4E2G A;  5FZB A;  4D7S A;  3BOD A;  3IDB B;  1WME A;  4A45 A;  4DOU A;  3CLP A;  5F37 A;  2VMC A;  1GOH A;  1QXP A;  3A7Q A;  1DZQ A;  2XQX A;  1DF0 A;  5GKA C;  3ASI A;  3FC0 A;  4ORF A;  1YI7 A;  1MEC 3;  1WLC A;  2E51 A;  2NLR A;  4AEK A;  3EB7 A;  3F95 A;  1HRI 1;  3III A;  3O0V A;  2O8O A;  1E57 A;  1DGR A;  1HV0 A;  2YY1 A;  1O5U A;  3NL1 A;  4IV1 B;  2P3I A;  5J98 B;  5AFB A;  4YVS B;  5T3N A;  5FP4 A;  4AVC A;  1WBF A;  1CPN A;  4YNI A;  1JZ4 A;  3PVE A;  5I8T A;  5EXO A;  3CL1 A;  2CAV A;  3TEZ A;  3WR0 A;  1MS0 A;  3INA A;  1PGW 2;  2VO5 A;  2WFF 3;  4YFZ A;  2D97 A;  2D3S A;  4Q4X 2;  1WLD A;  2VW0 A;  4ET7 A;  5KXC A;  2E7T A;  1KS4 A;  1OH3 A;  5JXH A;  2VZT A;  5FO7 B;  1YFX A;  3PDQ A;  3M70 A;  4GUL A;  4WZC A;  1X7N A;  1AYN 3;  3EMR A;  5KHG A;  1REF A;  3N9M A;  5APA A;  1CAX A;  4L9B A;  5FXV A;  5GAL A;  4ZZ8 A;  5FOB B;  2ZGM A;  2JB8 A;  3ZN4 A;  3RZL A;  2V73 A;  1LKN A;  2ZJC A;  1GZW A;  1V9U 2;  4I02 A;  1YIF A;  2ILM A;  4FOW A;  1FMD 2;  1AR9 1;  4RGK A;  4W6Y A;  4A42 A;  4C90 A;  2HWF 3;  4XJ9 A;  1XBF A;  1W8H A;  1CVN A;  3U37 A;  1VRH 2;  2J1V A;  3PUS A;  4YM2 A;  2ID4 A;  3SKJ E;  5GLT A;  3BN6 A;  3P6B A;  1DFQ A;  3WUD A;  2ZS6 B;  2HWE 1;  4KWU A;  1ULG A;  3NV2 A;  4HON A;  4GWN A;  1VBD 2;  3U07 A;  1UD1 A;  1POV 0;  2A3W A;  2E26 A;  4CCK A;  4XOG A;  4Y5Z 0;  4CDQ B;  2R06 2;  3GAL A;  2O0O A;  2VCB A;  4CCJ A;  1IZ3 A;  3WQ7 A;  3LCP A;  3IB3 A;  1UX6 A;  2VW2 A;  1PO2 3;  1OKO A;  2VGD A;  3HJR A;  1OA2 A;  2G9F A;  1UZ0 A;  3KQ4 B;  1AYM 2;  1QJU 3;  2ADD A;  2QE3 A;  3C7H A;  1JZ5 A;  3A0K A;  4IE7 A;  5DUX A;  4Z1V A;  2QQP A;  3NNF A;  3ALQ A;  1ZZ7 A;  3OUH A;  2DBI A;  1VMH A;  2ET1 A;  2V4A A;  2ZX1 A;  2VH9 A;  5JAX A;  1US3 A;  2G4I A;  1ENR A;  5JI7 A;  4BZ4 A;  1XNB A;  2YBK A;  2YC4 A;  1BBT 1;  4QPI B;  2JDY A;  3USU B;  3U1X A;  3P3P A;  4AQ6 A;  4YG6 A;  2WIN B;  4WVM B;  1IPJ A;  5F8P A;  1OLQ A;  2WWS A;  2OZJ A;  3WD5 A;  1NCR A;  1PX4 A;  3SCH A;  3UNP A;  3VKL A;  3NRU A;  1NLQ A;  2NMN A;  3GJA A;  3NJY A;  1Q8P A;  2HH9 A;  3TBD A;  4R52 A;  4LA3 A;  2CWM A;  3O14 A;  2XPJ A;  1RC6 A;  2YU2 A;  4Y3O A;  2XON A;  3K4Z A;  3S5A A;  2DTW A;  4FPJ A;  2WT0 A;  2RS1 2;  5JZG C;  2XKP A;  1GZ9 A;  4TYS A;  4FVV A;  3VDB A;  2EIE A;  5LW9 A;  3NO8 A;  2HEW F;  3NMB A;  3G7D A;  2VVD A;  4MVT A;  5GLV A;  5FY9 A;  3VZJ A;  1J1L A;  4DXR A;  1JZ8 A;  3UJO A;  1YXW A;  2BRT A;  2B46 X;  3BTY A;  1DYK A;  1MS3 A;  3WDT A;  4A7Y A;  5HPO A;  1S0D A;  5FYZ A;  2QBX A;  3AKR A;  1MPX A;  5KXD A;  5FFO C;  4WM7 B;  1PNG A;  2ZGK A;  1CGP A;  4QX0 A;  2VTF A;  3OD4 A;  1AR6 3;  5GLW A;  3M7A A;  1ENX A;  4BQ4 A;  3P5B A;  5DAP A;  3NJZ A;  1JH5 A;  3LEM A;  3RYR A;  3MIB A;  2GDF A;  4TZD A;  3R4S A;  3HN1 A;  3MO4 A;  3HVD A;  5DPN A;  5JR7 B;  3FBY A;  3GHM A;  2Q8O A;  4XIO A;  2J1T A;  1WWY A;  5DUU A;  4QDS A;  3MEP A;  1BYH A;  1OVS A;  1SLC A;  2RHP A;  2W47 A;  3KM5 A;  4HKW A;  4IER A;  3BPS A;  4IGP A;  5BNN A;  5CFD A;  1CR7 A;  3PUA A;  1OLM E;  2IVJ A;  4XF1 A;  2Q1F A;  2RR1 1;  5L9B A;  3SMH A;  2D6K A;  4DY3 A;  1A34 A;  3HD8 B;  1KQR A;  2H0V A;  4HBN A;  4LEJ A;  3WP4 A;  3M1H A;  5GZG A;  4YFW A;  1I1E A;  3HQR A;  3RZM A;  5FDB A;  3WHT A;  2WQZ C;  4XMI A;  3ACI A;  3JBG 2;  4HSL A;  3LEG A;  2WT2 A;  1PVC 3;  1K5M A;  1OBN A;  1ULF A;  1W6O A;  3RI9 A;  2WLP A;  1AR8 1;  2EF6 A;  3KF3 A;  5F3I A;  3AZV A;  1LGB A;  1RUF 3;  1EV1 1;  5IWF A;  4XF3 A;  1STM A;  2XVG A;  3A21 A;  3PMS A;  4RFT 0;  4BQX A;  4J6G A;  4NAO A;  4E9K A;  3NNM A;  3H8R A;  4SBV A;  3NNL A;  3VD3 A;  2B45 X;  5FQ0 B;  4XCA A;  1YFY A;  1W2O A;  5C8W A;  4B1M A;  5C3O A;  2NN8 A;  5C3R A;  1W6M B;  3B5L B;  4N43 B;  1ZVF A;  3NV1 A;  1SCR A;  4M0H A;  2WZR 3;  4CEW C;  3WCR A;  4ZXK A;  5FZH A;  4BE3 A;  2RJL A;  1EP0 A;  3ZPO A;  3LOB A;  1D0G A;  1TEI A;  3N4M A;  1NYW A;  4DMI A;  1Y9G A;  2E31 A;  4YVW A;  1I3H A;  3BOW A;  4FI9 A;  5BNO A;  1XNA A;  2AAC A;  4AVT A;  5IK7 A;  1QJX 1;  1ZZ9 A;  2MHF A;  3M3I A;  4JCK A;  4JGZ A;  3EO6 A;  3VDD B;  4AAP A;  2WO7 A;  3FLR A;  3ZN6 A;  1NQJ A;  2GC2 A;  4A6O A;  2HWC 2;  4LT5 A;  4Z82 A;  3I3Q A;  2Y6K A;  4CDW C;  1ND3 C;  1YHF A;  4W6X A;  4XXP A;  3V65 A;  5K7P A;  4NRP A;  1RUG 3;  1C28 A;  3E97 A;  4UBG A;  3ZFF C;  3CKH A;  5IHR A;  4KH9 A;  5B2G B;  2WAB A;  4OMD A;  4PF5 A;  4G4F A;  4IE4 A;  5A33 B;  5GJ6 A;  2GN3 A;  3UES A;  1DG6 A;  4HN0 A;  4BK5 A;  2BNO A;  5BNQ A;  4QPW A;  2RDQ A;  3U11 A;  3JB4 C;  1X36 A;  2XVL A;  4NPL A;  1RUJ 3;  4P5H A;  3K3N A;  3NWK A;  4XE9 A;  1NXD 1;  1L3J A;  4YPJ A;  4JV4 A;  1AX0 A;  1SMV A;  4Q4V 3;  1H9P A;  3WOG A;  3MFA A;  1NA1 A;  1ASJ 3;  2BGO A;  1JTZ X;  3IMN A;  4IEO A;  3RWN A;  4FPO B;  1H2K A;  5ACA 1;  4HPK B;  4FCA A;  1RUE 3;  2PTM A;  3KGZ A;  3CJI A;  1KD7 A;  1GFF 2;  2C5D A;  4LXL A;  1BEV 2;  1SBE A;  3ZSM A;  1PO1 2;  4YZ5 A;  1G7Y A;  5A3L A;  2WSV A;  1UZZ A;  4IEX A;  3U75 A;  1UMH A;  4RR3 C;  1R09 2;  3ZXD A;  3AVS A;  3R0R A;  4PQQ A;  5F3G A;  3ZYR A;  2Q30 A;  4XPV A;  4AGR A;  1OI6 A;  4HG6 B;  3WW3 A;  1VBA 2;  3MV1 1;  4XFH A;  1GQH A;  2OUJ A;  2W46 A;  5LY2 A;  3QCW A;  2YGL A;  5F6L B;  3Q8A A;  2VY0 A;  2Y6G A;  4Q0V A;  4CXX A;  4BIS A;  1UOG A;  3V56 A;  4O9G A;  4XUO A;  5FUN A;  2K2S A;  1LHU A;  5DG2 A;  4LHS A;  2VUC A;  4C91 A;  4N53 A;  5E89 A;  3RMX A;  1C5I A;  3HMY A;  3BVC A;  2YYO A;  5FY1 A;  2JKX A;  3T1L A;  3OY8 B;  2RMU 3;  1D2S A;  2YGM A;  5KR7 A;  2XUM A;  3MLK A;  1W2U A;  3UGG A;  1N3O A;  3H1M A;  3T4H B;  1VB2 A;  4I0W B;  3N7J A;  1QXR A;  4DS0 A;  4AOC A;  4LQR A;  1VMF A;  1OQ1 A;  3NV4 A;  3WG3 A;  3OGR A;  5FY4 A;  2DVD A;  4UFI A;  1APN A;  2JD9 A;  4BCU A;  1RXF A;  2IXK A;  1DGW X;  1BHG A;  3LEK A;  4EN8 B;  1UYZ A;  1UPS A;  3ZSJ A;  4AED A;  5JXG A;  5A3M A;  3T0B A;  2DUO A;  1W90 A;  3SNM A;  5ACA 2;  1CON A;  4LBQ B;  1S4C A;  2VW1 A;  3VZM A;  5IVJ A;  2W87 A;  4COY A;  5F2S A;  5FPV A;  2JG9 C;  2WS9 1;  1AL2 2;  2ES3 A;  2P6C A;  1PK6 B;  3S30 A;  3VKM A;  4CP9 A;  3ZXL A;  4UT5 A;  5E8A A;  5LAT A;  2GN7 A;  3O0X A;  4CSW A;  4B29 A;  1LHW A;  1UXZ A;  4JKK A;  5F32 A;  1PZ8 A;  1GP5 A;  4GJY A;  2VNG A;  4IET A;  4OI1 A;  5EQU A;  3D6E A;  2OT7 A;  4IEQ A;  1GKB A;  1LHV A;  5BY5 A;  2I07 B;  1WD4 A;  4XDP A;  4M4P A;  2B8M A;  3FLT A;  4UF0 A;  2E9Q A;  5CIR A;  4NJ4 A;  2ERF A;  4RGA A;  3FUQ A;  4K40 A;  5L19 A;  1LU1 A;  2XHN A;  1ZRE A;  3VZO A;  1UOJ A;  1HN1 A;  3D8C A;  1RIR A;  5FPU A;  2FDG A;  3M2M A;  1XRU A;  5FZO B;  4KGG A;  1JYW A;  2BWC A;  3BAL A;  1N1Y A;  4QX3 A;  1RIT A;  1DZR A;  2A5Z A;  1R08 3;  2W1Q A;  1POV 1;  4S2D A;  4LIT A;  2C6S A;  2JG8 B;  4FPE A;  3JD7 3;  5LRR A;  1CAU A;  2VMI A;  5EPA A;  4R4X A;  5CKQ A;  4EJR A;  3AYE A;  4BHP A;  3RI8 A;  2WZ8 A;  3IAQ A;  1UW8 A;  1WCQ A;  1IG3 A;  2UY8 A;  2R04 2;  2X5I C;  5GZF A;  1UY3 A;  4QDQ A;  3FL7 A;  4AW7 A;  2V5Y A;  3VBU C;  1ZBE 1;  2VQ0 A;  4QX5 A;  3BOP A;  4AFC A;  1DLL A;  2HWB 1;  4BYY A;  3AZY A;  4IEP A;  4EZ4 A;  2QZ2 A;  3GZA A;  1ENS A;  4UW5 A;  5FY5 A;  2OYZ A;  3POW A;  3W20 A;  3B69 A;  1AYN 2;  4CUC A;  4MGT A;  3N36 A;  4LBJ A;  1GIC A;  3GBG A;  1WMF A;  3THD A;  3ACL A;  5FXX A;  5GZE A;  3ETP A;  2C0Z A;  2V4V A;  3KV4 A;  4Y1V A;  3SH3 A;  5BUV A;  4XTM A;  2NM1 A;  2JEC A;  1QQP 1;  3AX4 A;  4KWL A;  3WF1 A;  2R6Q A;  3SKV A;  3N9Q A;  1XJA A;  3H9A A;  1BQP A;  4NPR A;  2HWF 2;  3GGL A;  4XQD A;  4XVH A;  3G6J B;  2EIB A;  2XLG A;  1VBE 1;  1YYN A;  4CCC A;  4FFF A;  1I9R A;  1PMH X;  5FZL A;  1E5I A;  1BCX A;  2V5D A;  1OVP A;  4MXW A;  1BKZ A;  4QM9 A;  4X8N A;  4Q27 A;  1QDO A;  1Q5O A;  5K0U B;  4PIY A;  1COV 1;  3H8U A;  5AC9 3;  4HK8 A;  3BIW E;  3OCP A;  2JDZ A;  1KEX A;  2WNV C;  4ARY A;  1G6N A;  5FZ1 A;  2C9K A;  4E4S A;  3WQB A;  2O8Q A;  1QIQ A;  4CUG A;  3T2T A;  1VBC 1;  4R8H A;  2CV6 A;  2W52 A;  5FWE A;  4XUR A;  2QUO A;  3LFM A;  4OHW A;  5A6Q A;  3ZIW A;  3MBW A;  3DV8 A;  4XJZ A;  1V0A A;  1RUH 1;  2WR9 A;  1H8T C;  4NVP A;  4B4P A;  2CGO A;  4YAR A;  5A7Q A;  2UWC A;  2Y64 A;  1UAI A;  1H8V A;  1W8N A;  2GND A;  4F7Z A;  2ZAA A;  2PLV 3;  3I3B A;  2PHD A;  2Y26 A;  2SLI A;  3OBA A;  4GB3 1;  2OA2 A;  4NR1 A;  4Y1Z A;  5LB6 A;  3VDA A;  1OPO A;  1H8T B;  1T6B X;  2VZV A;  3I2J A;  3WDU A;  4OHY A;  3J7H A;  4GQ7 A;  4AQT A;  1QNW A;  3DPR C;  4M3C A;  4TN7 A;  1RUC 3;  1SG3 A;  1MS4 A;  1RUI 2;  3THP A;  3WP5 A;  1YCI A;  4Q8K A;  1S0I A;  4GMP 1;  2XBO 3;  1GBG A;  3ZXK A;  2HLE A;  2JKB A;  3V0B A;  4RHV 3;  4YGC A;  5FO8 B;  3AZW A;  1P8J A;  3USU A;  3H50 A;  1LEC A;  1NE4 A;  3KB5 A;  4A6S A;  4Q4W 3;  2DFB A;  1OT5 A;  4ISR A;  1EAH 3;  2LRO A;  3J9S A;  2CGN A;  2GSY A;  5C5T A;  2RE9 A;  1HX6 A;  5IK4 A;  1OQE A;  1UMI A;  2XUE A;  2Z4F A;  2ZTN A;  3U0Z A;  5BNP C;  3VHN A;  2LAL A;  3EHK A;  3QD6 A;  5DAX A;  2W0X A;  3KT1 A;  2XML A;  1QJY 3;  1N1S A;  3C7G A;  1SPP A;  2WA4 A;  4N7U A;  4ATE A;  4B3N A;  2VG9 A;  3L2H A;  3MW4 A;  4CP1 A;  3VHR A;  1FPN 3;  1Z7S 1;  5BNP B;  3OGG A;  3AYC A;  4N7I A;  1RTV A;  3IWZ A;  1H2M A;  1ND2 B;  4YZ2 A;  3DXT A;  5A80 A;  1NLR A;  2OPK A;  1O3R A;  3A0N A;  4B4R A;  2ZGO A;  1I6X A;  4IE0 A;  4Q4Y 1;  3BI3 A;  1GV9 A;  1OMI A;  5JZG A;  5IYY A;  5E6H A;  3RQ0 A;  1LOG A;  1OLM A;  3VL8 A;  5FYI A;  1CZV A;  2VMD A;  3URF A;  5LWB A;  2JE9 A;  2UY9 A;  4YW6 A;  3R6S A;  3K4A A;  1AR6 2;  2PHT A;  1WA6 X;  2YFZ A;  1RJ8 A;  2E7A A;  4NWV A;  2Y6L A;  1TE1 B;  3I59 B;  1PGW 1;  2RM2 3;  5CNA A;  5FMC A;  3OD0 A;  1D2Q A;  1RVF 1;  5T54 A;  4R9C A;  4A7K A;  5SV8 A;  1A78 A;  3GZU C;  1A3K A;  2GAL A;  1H0B A;  2QZ3 A;  1OPM A;  2UU8 A;  2WA3 A;  3J4U H;  1BK1 A;  3WUC A;  3NJX A;  4PI2 A;  3TYJ A;  4AGG A;  4QHZ A;  1A8D A;  2XLF A;  3FZ3 A;  4ZU7 A;  5D2A A;  1NKG A;  1V9U 1;  4WV8 A;  2HWD 3;  1OC1 A;  2R49 A;  3O7O A;  4EWD A;  3PVN A;  2WYF A;  3W21 A;  3WW4 A;  1ZNP A;  4AWD A;  1HN0 A;  3EXU A;  1OOP B;  1VRH 1;  5FBJ A;  4K9S A;  3ACH A;  3MDP A;  4CEY C;  1KFU L;  2FHR A;  3IPV B;  3POI A;  4NRM A;  1AHS A;  1W04 A;  1WW6 A;  2FDJ A;  3NAP B;  2ZHM A;  4Y5S A;  4BJ0 A;  4GKY A;  2P17 A;  3PVB B;  4XDQ A;  1RUF 2;  2EAL A;  4OI4 A;  2BW8 A;  4L99 A;  4XUQ A;  5T5P A;  4CEY B;  3OOX A;  2Y60 A;  5DUW A;  2D5F A;  3BTX A;  5FIX A;  4L2N A;  5FZG A;  3DYM A;  1W2T A;  2WNU B;  4GXL A;  2DVA A;  3K48 A;  3ZXG A;  4CYD A;  3CU7 A;  4P9X A;  2R1B A;  4S2F A;  4Y26 A;  3VBR C;  4DIN B;  3WHU A;  2QDN A;  1CZS A;  3HR9 A;  1JZ6 A;  1UCX A;  3NJV A;  2D5H A;  1LOB A;  4P9G A;  2RS5 1;  2DCT A;  3W9A A;  2ET7 A;  2DWR A;  4JTO A;  3SCF A;  5C6C A;  1HRI 3;  2VOK A;  3VBR B;  1W8U A;  1RUD 1;  3QLQ A;  4IEZ A;  1HQL A;  5FPA A;  5C5U A;  1RB8 G;  4UAP A;  2ZCW A;  4IE5 A;  4YM0 A;  1LJ7 A;  1HB2 A;  1JS9 A;  2J1U A;  2VE1 A;  4NID A;  4QKN A;  4IND A;  3PIG A;  4L0P A;  4CEW A;  4XMA A;  5DZF A;  5FCC A;  3OPW A;  2BDR A;  5JOY A;  1SAC A;  1TNR A;  4QKF A;  1VAV A;  2ZHK A;  3VBO B;  5EJ1 B;  2ZMN A;  5FO9 B;  2FZ2 A;  2G1M A;  4BIO A;  4NHM A;  4RS5 B;  5FUP A;  5M0T A;  1F35 A;  4CDU C;  5J7M A;  1SDW A;  4X6R B;  2QDR A;  3WG4 A;  2AEZ A;  1EUT A;  4HVQ A;  2NQY A;  2FZ1 A;  4MSV A;  1VAL A;  3U4X A;  2B9V A;  2XJQ A;  4NHL A;  3WQ0 A;  5A33 A;  2FCV A;  4NII A;  1B09 A;  3RVH A;  3WF4 A;  5IAV A;  1KJR A;  1ND3 A;  1RMU 1;  5A32 B;  1FNY A;  3ZYG A;  1LHO A;  2GNB A;  5GM0 A;  4YZ1 A;  1PIV 1;  5FYH A;  1PGS A;  3ZFF A;  1E5R A;  1AR9 3;  3MIH A;  4ERO A;  4GKX A;  4Q4V 2;  4XBL A;  2ZA9 A;  1O4Y A;  3OSD A;  1UU5 A;  2BGC A;  1ASJ 2;  3W58 A;  4AI8 A;  3PIJ A;  4WZF A;  2HWE 3;  1RUE 2;  5GLU A;  4IGO A;  3SIT A;  2RJK A;  5AFE A;  2Y0I A;  4TSV A;  3ABZ A;  1G9F A;  3LIG A;  2Q8E A;  4CUB A;  3ZFG C;  2EA7 A;  5HCH A;  3KMH A;  2D6M A;  2JIJ A;  3F2Z A;  3WNN A;  4ZPI A;  1XND A;  2E7Q A;  1G9D A;  3WDX A;  3M3Q A;  2VTX A;  1GNH A;  4E4H A;  1HJF A;  1IQD C;  3AKT A;  3RSJ A;  2P34 A;  3AM2 A;  4RR3 A;  3ZFE C;  3RDI A;  4HL0 A;  1WLT A;  4A44 A;  2J1R A;  3CDZ B;  3D0S A;  2Q1M A;  1M4W A;  4LUL A;  2X05 A;  3LOI A;  4QB6 A;  1BZW A;  3N9O A;  3WDV A;  1KDM A;  1YJL A;  4HET A;  1HKD A;  3IDA A;  2TEP A;  2A3Y A;  4YW7 A;  3U14 A;  2Y34 A;  4L97 A;  2RMU 2;  3EYP A;  4AK3 A;  3B00 A;  1U5I A;  4IV3 C;  3WNM A;  5IVV A;  1EY2 A;  3VZN A;  4XBN A;  1N47 A;  3WLU A;  1BBT 3;  1IQA A;  1KDK A;  3OY8 A;  3C3V A;  3D5O A;  4QX1 A;  4NHY A;  4IV3 B;  2OQ7 A;  1HQN A;  2J42 A;  3FFQ A;  3J26 N;  2QQI A;  2YV8 A;  1JOB A;  5FYB A;  1SLB A;  1X8E A;  2RDN A;  2RS3 2;  3VUO A;  2WQ8 A;  5I8S A;  5JPN B;  4PJY A;  1AR7 2;  1QJE A;  3MYX A;  4QGN A;  4YM1 A;  5FP8 A;  2EIG A;  3VBS C;  4BK4 A;  2BVV A;  3ROU A;  5C8C B;  3DL3 A;  3UL2 A;  3E6C C;  4IV1 C;  2QVS B;  4D94 A;  4YVS C;  3LZZ A;  3IN9 A;  4O7X A;  3HNY M;  5A6Z A;  1IS5 A;  1S1A A;  3I2F A;  4XFC A;  1UU6 A;  3VBS B;  4NOT A;  1G9A A;  4EWE A;  3THT A;  4BXS V;  2WN2 A;  1ALY A;  3MZH A;  1XYN A;  1NT0 A;  3VKF C;  2YMZ A;  1C8N A;  1VAM A;  2JG9 A;  1NG0 A;  2WWU A;  2D3R A;  2YHJ A;  2WT1 A;  3FE5 A;  1RHI 1;  4YSF A;  5FRE A;  3VD4 A;  1MAC A;  2R0H A;  4FBF A;  4UFK A;  2X29 A;  2P3K A;  3RMY A;  4RD7 A;  4CA9 A;  5FYU A;  2N7G A;  4NN0 A;  4Y4R A;  1KGY A;  1U0A A;  2GC1 A;  3LSE A;  1F5J A;  1ULC A;  2W95 A;  3ZO0 B;  2JDU A;  4ZKT B;  4JAA A;  1Y9Q A;  3JD7 2;  2ZX0 A;  4PDW C;  1OD5 A;  3U78 A;  4LO6 B;  3P3N A;  1NCQ B;  4ZZ5 A;  1O6U A;  1O8S A;  4HKL A;  4TWT A;  4U36 A;  2PAK A;  1HB4 A;  1PHM A;  5FZF A;  4PDW B;  3DXU A;  2QQK A;  2AUY A;  2F6B A;  1PGL 2;  1FOD 1;  2ZZQ A;  3KD4 A;  4B7E A;  2QCS B;  3BU7 A;  4FFI A;  1YIP A;  4ZS3 A;  3OPT A;  1NLS A;  1Q8V A;  2RR1 3;  2TNF A;  2WC2 A;  5LA9 A;  1LEN A;  2UWA A;  3MIE A;  2X5I A;  1GWM A;  2HYX A;  4YW2 A;  3RZH A;  1C57 A;  4RQP B;  1FYU A;  3VBU A;  1G9B A;  1K3I A;  5IVB A;  1JOD A;  1ULO A;  3ZYP A;  4CDQ C;  1Q3E A;  4LK7 A;  4IES A;  2WAO A;  4BQW A;  1XE7 A;  2A71 A;  5DDJ 1;  1OHF A;  2Z2S B;  1ZM1 A;  2ARA A;  5A70 A;  1O4Z A;  4K20 A;  1AR8 3;  3BYW A;  4BQY A;  1FT9 A;  2WWJ A;  1I5Z A;  5CG9 A;  1EV1 3;  1R1A 1;  5FPL A;  1BEV 1;  1ZA4 A;  3POY A;  4LR4 A;  1TQ5 A;  4XAA A;  3HBK A;  1YRZ A;  2FDI A;  1HXS 1;  1MQT B;  1M06 G;  5C3P A;  4V2V A;  3HT1 A;  1JXN A;  2DCY A;  4QXK A;  4UOJ A;  5ANQ A;  4AFD A;  1HJG A;  5FRA A;  4FAH A;  4NAM A;  3JCI A;  2VZO A;  1NUK A;  4M4R A;  4H2A A;  3B94 A;  1HB3 A;  2HEV F;  3N35 A;  4BQ3 A;  1OA4 A;  2W3J A;  3CHX A;  2D3P A;  4QPI C;  4QXH A;  3UK9 A;  3GDB A;  4XAB A;  4YZ4 A;  2WNV A;  5T55 A;  3T2O A;  3NV3 A;  1S2E A;  4JC1 A;  3H3L A;  3ZKY A;  1XC6 A;  3CF6 E;  3RFR A;  2DF7 A;  3PJQ A;  2XKO A;  2PLV 2;  5CIS A;  1W9S A;  4IEY A;  1UIJ A;  5LK5 A;  1QJX 3;  5KC5 A;  2A6V A;  1U12 A;  1BMV 1;  2BUK A;  3LA2 A;  1EPW A;  2B39 A;  1GNZ A;  1S0E A;  1DQ5 A;  4LKE A;  4QT6 A;  4YGD A;  4CP0 A;  3M4F A;  1UO9 A;  3TNQ A;  3OYW A;  2ZAC A;  1H8T A;  5CYY A;  1C1F A;  5H9P A;  5EIY B;  3KSC A;  2FDH A;  2BU9 A;  2LRP A;  5FMO S;  4MGK E;  4DUX A;  5CEH A;  2XH6 A;  2GH2 A;  4BB3 A;  4KI5 M;  4ES9 A;  3KCX A;  5CZK A;  2W1W A;  2OXB A;  3KT4 A;  3DPR A;  3TN9 1;  4Q4W 2;  4QHO A;  4BQ1 A;  2CAU A;  2VL4 A;  3WT3 A;  3WX5 A;  3PHM A;  2SBA A;  4LBL A;  1Y4W A;  4FAG A;  2C4X A;  4I3P A;  1ULP A;  4WM7 C;  4ZY9 A;  2GNT A;  1UZV A;  2ZHN A;  1J84 A;  1QJF A;  2WFP A;  3MLL A;  2VOT A;  3B93 A;  2LUW A;  4Q5O A;  4E4D X;  1V70 A;  4MXV A;  3FBM A;  4XEZ A;  3IMM A;  4FTB A;  1CJP A;  1DGR N;  1XU1 A;  2P1B A;  1SCS A;  2JIC A;  3D0J A;  4ZHN A;  1LRH A;  1WCU A;  4UW6 A;  4FOY A;  5FZA A;  4Y5T A;  1NAE A;  2ENR A;  2JE7 A;  2XWB B;  5A3O A;  2PHF A;  5JSR A;  5FV3 A;  5BNP A;  3IZO A;  5HXM A;  1S0G A;  2F4P A;  2NPI A;  1SDD B;  2C26 A;  4Q0U A;  1V00 A;  1CAW A;  2ZX4 A;  2ZAB A;  2RVA A;  2JX9 A;  2VZQ A;  1J3P A;  2BGP A;  1FV3 A;  5F9T A;  2W08 A;  5KC6 A;  2BOJ A;  4K8R B;  3AMQ A;  2VM9 A;  1MZF A;  3H0O A;  1O7F A;  2ZGQ A;  2R04 1;  1JOJ A;  4GIQ A;  5L73 A;  2CY6 A;  1LGN A;  4BU2 A;  1JYI A;  3V64 A;  3RZZ A;  3J7L A;  2J1A A;  4NIH A;  3I59 A;  4MO3 M;  4OYU A;  3TEW A;  3NQH A;  1K12 A;  2D7F A;  4CVU A;  2VCM A;  5A1L A;  2VVF A;  4UFM A;  1W03 A;  2DUR A;  3AP9 A;  2VME A;  3H3U A;  3B02 A;  3HAG A;  3EQE A;  3O1S A;  1WCD J;  2E32 A;  1ULD A;  5IVE A;  1YC6 1;  3C7F A;  5FZ6 A;  2BVB A;  3LDB A;  4G3Y C;  1GYK A;  4QU1 A;  5I0T A;  4NIA A;  3BUC A;  1KFX L;  5DAV A;  5CU1 A;  1ZZ8 A;  1AF9 A;  2WNE A;  4LOT A;  2O14 A;  2HWD 2;  4FPK A;  5FOJ B;  4FTS A;  2VMG A;  1S2B A;  3FFZ A;  5LK7 B;  4Y24 A;  1C8M 2;  4DIQ A;  2ZZJ A;  4N43 C;  1T2X A;  3HQX A;  4EWA A;  2R30 A;  3HNB M;  1HV1 A;  5A1F A;  5HCF A;  3M3O A;  5FZD A;  2PXJ A;  5C9A B;  2WS9 3;  4QB2 A;  4TTG A;  2I2S A;  3IPV A;  4IEU A;  3ZXA C;  4BQ2 A;  1GUI A;  5F7U A;  1AX1 A;  4JX0 A;  2ARX A;  1FNZ A;  3T08 A;  2WBK A;  1HW5 A;  3UJQ A;  4LIU A;  3SH4 A;  1H1I A;  4CEY A;  2IXC A;  1AJK A;  5FXZ A;  4CCD A;  4MV2 A;  3PUR A;  3VDD C;  4PLN A;  4QX8 A;  1SZB A;  4OHV A;  3LPG A;  4BA6 A;  1XXN A;  4CDW A;  2GH8 A;  4XQW A;  4XYX A;  1UY1 A;  4GH4 B;  3B9C A;  3DGT A;  3ZR5 A;  1UY0 A;  4YZ3 A;  5LBF A;  3FWE A;  3SH5 A;  2DVB A;  1HRI 2;  1GQG A;  1EUU A;  1AXZ A;  3JU9 A;  1GOG A;  2GP3 A;  1Y3T A;  1W0P A;  4U2A A;  5EFU A;  5FZI A;  1POV 3;  1CAV B;  4LHN A;  1RYY A;  3VBR A;  1XNT A;  4CDX C;  2CTV A;  2BEO A;  1LES A;  5JLV A;  1IOA A;  2DVG A;  3S7I A;  2BPA 2;  1YFU A;  5FBZ A;  2AYH A;  1RGS A;  3ILR A;  2P5B A;  3DKQ A;  1RUI 1;  1V6M A;  2TUN A;  5FZK A;  5EWS A;  5JDB A;  2A7A A;  1ZBE 3;  4LLO A;  4CDX B;  1XQN A;  4JGY B;  2UYB A;  2HWB 3;  3I4I A;  1DP0 A;  1QH6 A;  2OZ6 A;  3BTA A;  1C1L A;  4K1Z A;  4ASK A;  4CUA A;  1GZT A;  5L7O C;  1J83 A;  2WAA A;  5GLZ A;  2BBA A;  3ON7 A;  4QAW A;  4URA A;  2XHK A;  2XJP A;  5I91 A;  4COW A;  1QQP 3;  1TNF A;  5JMO A;  5L7O B;  1F4H A;  3LD8 A;  4Y22 B;  2FDF A;  4YG0 A;  1AR9 2;  4O65 A;  4CTE A;  3I2I A;  3LA3 A;  4CDU A;  3MIF A;  4P14 A;  2O1Q A;  3PUH A;  4DRV A;  1W6N A;  2ZML A;  2P6H A;  1VBE 3;  1ULE A;  2R07 1;  1JZ7 A;  5FYC A;  3SXW A;  4QHB A;  5G04 L;  4AEJ A;  1FV2 A;  4IW3 A;  3H42 B;  3B7M A;  1W6P B;  3CBN A;  4AVA A;  2HWE 2;  2FBE A;  4X8P A;  4URT A;  2WDB A;  5JVV A;  1COV 3;  2EAK A;  4O9E A;  5A7W A;  5HCA A;  5IFT A;  3E6D A;  2YXS A;  3KGL A;  1TME 2;  1JZ2 A;  1AUY A;  5DZE A;  4OHX A;  4WM8 B;  1QOS A;  1H9W A;  1VBC 3;  4QPY A;  5FLH A;  2HYK A;  2PA7 A;  4R9A A;  2FCU A;  3DKW A;  3WDW A;  3WW1 A;  1RUH 3;  2EIC A;  4LPL A;  3H7J A;  4FXK B;  2IXL A;  1ZZ6 A;  3HT2 A;  3OG2 A;  1H6X A;  3VBH C;  3ZFG A;  5A3N A;  5C3S A;  5I0D A;  1ZRD A;  4OLL A;  3D4K A;  3LQC A;  3ATG A;  4GB3 3;  4FQZ A;  3S5Q A;  4A7Z A;  5J48 A;  4ZU5 A;  3J8F 2;  1UPI A;  5C71 A;  5LBB A;  1CQ9 A;  1ZBA 2;  3CZJ A;  3VBH B;  2AR6 A;  1H30 A;  1OQD A;  4TLF A;  4MGS A;  1JMU B;  3AJZ A;  4HOO A;  1PK6 C;  1US2 A;  3MW2 A;  4D3W A;  5KXB A;  5FP3 A;  3WF0 A;  3ZFE A;  4DPN A;  1BBT 2;  1YI9 A;  4GMP 3;  1NOV A;  2B42 B;  4FFH A;  4HFS A;  1S0C A;  4HXC A;  4YGE A;  2VJX A;  5FXW A;  4E8C A;  3ZR6 A;  1F8V A;  1HRV 2;  1N1V A;  1V6O A;  2BWA A;  1W6Q B;  3ZSL A;  2MEV 1;  4I01 A;  1YO8 A;  4IV3 A;  2OW4 A;  2OKX A;  3C7E A;  4BIF A;  3T0D A;  1KS5 A;  2R1D A;  2PEL A;  2QKD A;  5E1R A;  2YFU A;  2H6B A;  1T6G C;  4ES8 A;  1UIK A;  3CQO A;  4P02 B;  2AH2 A;  1DQ0 A;  2CU5 A;  2IFW A;  1UNB A;  2BJS A;  2JG8 C;  4R4Z A;  1MEC 2;  1BXH A;  5I0R A;  4AI3 A;  1Z7S 3;  1TMF 1;  3IT8 A;  1DQ2 A;  4YLZ A;  3B3Q E;  3VBS A;  5J3U A;  1C5H A;  3WVJ A;  4QM8 A;  1BVV A;  4IV1 A;  1UKG A;  2XB6 C;  2YBS A;  4Q4Y 3;  4YVS A;  1K42 A;  3VN4 A;  2WFF 2;  1D4M 1;  3FX3 A;  2WN3 A;  4OUL A;  1WA4 A;  5LA2 A;  2VOW A;  1PZ9 A;  3WNO A;  2OUH A;  1OUX A;  3AKS A;  3B9I A;  5K4L A;  2GMM A;  2H0B A;  3KCY A;  2D93 A;  2XJV A;  4ASL A;  1RVF 3;  5L9R A;  5IFP A;  2JD4 A;  5F5C A;  1YNA A; 
#chains in the Genus database with same CATH homology
 3ZYH A;  2O14 A;  4LK6 A;  4YW7 A;  3ZYF A;  2K46 A;  4A6S A;  1V0A A;  3F95 A;  1WMX A;  4CP9 A;  2LRO A;  4CPB D;  1GWK A;  2C24 A;  4CP9 B;  4AL9 A;  3ZYB A;  2Q1F A;  1OKO A;  4YW6 A;  1W8Z A;  4LKE A;  2WYF A;  3UT0 A;  1HN0 A;  1WZX A;  1W9F A;  1W8W A;  1W8U A;  4LKD A;  1WCU A;  4BQ2 A;  4LJH A;  4BQ5 A;  2KR2 A;  4BQ4 A;  4LKF A;  2LRP A;  1GWM A;  5D21 A;  1GWL A;  1L7L A;  4BQ3 A;  2JWP A;  1UOJ A;  4YWA A;  1OH3 A;  4LK7 A;  1W8T A;  2VXJ A;  4CPB A;  1W90 A;  3ORJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...