1DGRA

Refined crystal structure of canavalin from jack bean
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
178
structure length
178
Chain Sequence
NNPYLFRSNKFLTLFKNQHGSLRLLQRFNEDTEKLENLRDYRVLEYCSKPNTLLLPHHSDSDLLVLVLEGQAILVLVNPDGRDTYKLDQGDAIKIQAGTPFYLINPDNNQNLRILKFAITFRRPGTVEDFFLSSTKRLPSYLSAFSKNFLEASYDSPYDEIEQTLLQEEQEGVIVKMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CANAVALIN
publication title X-ray diffraction and atomic force microscopy analysis of twinned crystals: rhombohedral canavalin.
pubmed doi rcsb
molecule tags Plant protein
total genus 39
structure length 178
sequence length 178
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1999-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00190 Cupin_1 Cupin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1dgrA00
1X7NA 5I8SA 3BU7A 1CAVB 1V70A 4KL1A 2FMYA 5BXXA 5EFUA 5I0RA 4UBGA 1YLLA 4IEZA 3QOPA 3ETQA 1G6NA 1IPJA 5LEJA 3RNSA 1IPKA 3E5QA 4ZU7A 3CEWA 3MPBA 1DZTA 2PTMA 5C8WA 5J7MA 2H0VA 3OCPA 4IESA 4LA2A 2D5FA 2DCTA 1O3RA 1XE8A 3EQEA 2UY8A 1X82A 4JTOA 4MH0E 3WW4A 2UY9A 4D7TA 3OD0A 1O3TA 3FHIB 3N4MA 3IWZA 2PYTA 2ETEA 5I91A 5KHGA 3H50A 4MGYE 4ZU4A 5EZWA 3H9AA 1ZRCA 4HVRA 4LLOA 1Q3EA 5J3UA 3GBFA 2F4PA 4EROA 3SCFA 1HW5A 1CAWB 2QVSB 4ZU5A 4KU7A 4K8FA 3M70A 2PQQA 3RZZA 3H1MA 4QX5A 5JAXA 2EA7A 3USSA 2Q4SA 3UKVA 4MZUA 1QXJA 4FAHA 4PIXA 4UBHA 1GQGA 3OGJA 2GC1A 1RL3A 4BH9A 1FT9A 2IXHA 3BPZA 3JZVA 5F1RA 4LUKA 2CAVA 5JSPA 3NVCA 4YNIA 4KWLA 1RC6A 1Q43A 3BALA 3BB6A 3U0ZA 2XLAA 3D0JA 2B8MA 5KBFA 1YHFA 3CLPA 4J1XA 3O14A 3U11A 3ACLA 1ZNPA 2I45A 3HIFA 5JCTA 4LTAA 4FBFA 3LAGA 3KSCA 5J48A 4XF0A 1OFNA 4O9GA 1ZRRA 2XL7A 4QM9A 5CVRA 5AVPA 3KGLA 1O4TA 1VP6A 4IEWA 1O7FA 2ZKLA 3KMHA 1ZZCA 1WA4A 3B02A 1JUHA 2D40A 2GC2A 4IEUA 4JTNA 3NKTA 4I0BA 3IBMA 4I02A 3UKTA 1X8MA 4XF3A 1I6XA 4HN0A 3EO6A 2BNMA 2H6CA 3EBRA 2V09A 2GH2A 4OLLA 4H7LA 4QGMA 3LWCA 4P9GA 2BEOA 2EAAA 2XLGA 2CAUA 3HT1A 4JV4A 1Y9QA 5BV6A 1O3SA 3RYKA 4AVAA 2Z69A 3E6BA 4HSLA 4ORFA 3ES4A 5FLJA 3SCHA 4IEYA 5FPXA 4KWJA 4WBBA 3RDIA 4EV0A 4HVQA 1CAXB 4O9EA 2KXLA 4D7SA 1EY2A 3I54A 3E5UA 3H3UA 3LA3A 1OD5A 1YFXA 3DL3A 3H1WA 2IC1A 2E9QA 2ET7A 2OPKA 1LB2A 1ZZ9A 4AVCA 1CAUB 4L2NA 2ET1A 4MGIE 2QDRA 1J58A 1NYWA 2BYVE 5LRSA 4EWAA 1EPZA 4XFHA 5JSRA 1Y3TA 3ZDSA 1Q5OA 1WLTA 4Q0UA 1J59A 3E97A 1OMIA 1XRUA 2WC2A 1CX4A 1DGRA 4Z07A 2IXIA 4QGLA 4KU8A 4XF4A 1NE6A 3IDBB 2ATFA 1YFUA 2OA2A 1UPIA 4IEPA 5FCCA 4BYYA 1TQ5A 4F8AA 5I8TA 2MNGA 2GAUA 2P17A 3GYDA 4BIFA 2UYAA 2MHFA 4XFFA 3FWEA 3S7EA 1YFWA 4LULA 2Q30A 1LKNA 3RYRA 3M3IA 2PFWA 3ROUA 1LR5A 3CO2A 1CAVA 2Y0OA 1DZRA 1SFNA 3ST7A 2C0ZA 4QM8A 3SMHA 5CADA 2B9UA 3LA2A 3CJXA 3PVBB 2QCSB 4YYOA 2O8QA 2OZJA 1UD1A 4UXAA 1QWRA 2GZWA 3NJZA 5C6CA 1O5LA 1U12A 1PM7A 3L2HA 4HLTA 3DN7A 2WFPA 3H1YA 3D82A 1VJ2A 4FT8A 3EHKA 4QGNA 3E6CC 1OI6A 4I2OA 4YSFA 2OZ6A 4AQ6A 4WVZA 4F7ZA 2B5HA 3LOIA 2GU9A 2ZCWA 1RTVA 1I5ZA 1X8EA 1YFYA 4MUVA 3PLQA 5JSOA 1ZRDA 3CF6E 4N9HA 4AQ2A 2HJIA 2VECA 4A2UA 2BGCA 1O5UA 1O3QA 1H1IA 3IIAA 4LA3A 3I59A 3KGZA 4IETA 5BY5A 2GC3A 4KWKA 1ZZ7A 3SCGA 3OF1A 4L11A 2IXKA 3U10A 4XETA 4ONUA 4MV2A 4R52A 4TLFA 3HT2A 4IEOA 5KHJA 2UYBA 3S7IA 3ELNA 1ZREA 4HVOA 4MGKE 1RGSA 5D1IA 5FLIA 2BNOA 3TNQA 1J3PA 2XHKA 2Z2SB 3H7JA 1VR3A 2PHLA 3QACA 5T3NA 2XL9A 3I7DA 1J3QA 4J1WA 3G7DA 4JVAA 1EP0A 2BNNA 4Q29A 4IEVA 3MDPA 1ZX5A 2HKXA 2IXJA 4XF9A 3FZ3A 4CYDA 1NE4A 4LEJA 5BPXA 3CL1A 3S0MA 1EYBA 1WGPA 2EVXA 1DGWA 4MX3A 4XFIA 4PIZA 3E5XA 5I0TA 3H8UA 4EWDA 4Q0QA 3C3VA 3H3ZA 2PAEA 4XFAA 3HQXA 4IEXA 4I3PA 4AXOA 1FI2A 3SHRA 4IERA 2QJVA 4XFCA 5FQ0A 1L3JA 2CGPA 3WW2A 4AVBA 4OFGA 2XLFA 4I09A 4Q0SA 3FFQA 1FXZA 3VHRA 4XEZA 3R6SA 4GULA 3LZZA 5I8YA 3BCWA 4HBNA 5FDBA 4META 2OYZA 2N7GA 3FE5A 4RD7A 2IXCA 3E6DA 4IEQA 3SXWA 4Q0VA 5LEKA 1H1MA 5LRRA 2XKOA 1RUNA 4MGZE 3I59B 3UKNA 1NZCA 1ZVFA 1UIKA 2IXLA 1UCXA 2PA7A 4EWEA 1UW8A 4HMZA 1ZZBA 3ES1A 4E2QA 4E2GA 5K8SA 2MPFA 1CGPA 1PMIA 1CAXA 3NL1A 4DINB 1QXRA 4WZCA 3DKWA 4X6QB 1J3RA 1RUOA 4BHPA 4R8HA 1ZRFA 4N9IA 5KHHA 5KHIA 3MZHA 5HI0A 1J1LA 4I0AA 1ZZ6A 5KHKA 2FQPA 3NSTA 5E1RA 3RPQA 2VQAA 1CAUA 3DV8A 5FPZA 5I93A 3PNAA 3OTFA 4YRDA 3LA7A 4QMAA 4PIYA 3FJSA 4HZFA 1ZZ8A 3IDCB 2XKPA 1NXMA 4NVPA 3H7YA 1CAWA 4X6RB 1YUDA 2H6BA 4LUMA 5BUVA 5FLHA 2Q1ZB 3WW3A 1UIJA 4I01A 2O1QA 5FQ0B 3MYXA 2K0GA 3EJKA 3D0SA 2K9ZA 5E16A 3WW1A 1SQ4A 4XF1A 4HSJA 2PAMA 4HN1A 3FX3A 3KCCA 2CV6A 4B29A 3NW4A 4PJYA 1GQHA 3RYPA 2Q0AA 4E2SA 2PHDA 4FAGA 5CU1A 5I0UA 2VPVA 3TNPB 4XFBA 1LRHA 4Q0PA 4QXKA 4Z82A 4XFGA 1YWKA 2D93A 5I0SA 2QNKA 1SEFA 4YARA 2GC0A 2PAKA 1QY4A 1XE7A 2XGXA 5JR7B 2D5HA
chains in the Genus database with same CATH superfamily
1X7NA 5I8SA 1CAVB 3LDBA 3Q8AA 2E53A 4BMBA 1PZ7A 2RJ2A 3HD8B 4QDRA 2WSUA 1PNFA 5I0RA 4NMIA 3B9CA 3QOPA 1H6XA 2RR13 5FUPA 2XMLA 5LBCA 3UGGA 4N43B 1ASJ2 1LHWA 4NJ4A 4Q4V2 4K1ZA 1GMMA 2HYKA 3I3BA 3AP6A 5DZEA 5C8CC 4UW3A 1V6NA 3U14A 4YGDA 2CL2A 2H0VA 3AP5A 4IESA 4CCLA 1DLCA 5T5OA 3C2UA 2ENRA 3GZTB 2D6LX 2DCTA 3P6BA 1J84A 1DYKA 2B42B 2RVAA 3AZXA 1OLQA 4PCRA 2UY8A 1UZVA 1X82A 4JTOA 4LORA 3WUDA 3OPTA 2EIBA 4JKMA 5F9TA 3OD0A 3W5MA 2QQLA 3DYPA 3WEZA 2W91A 3OEAA 1NZIA 2EF6A 3N4MA 2D6MA 1CQ9A 1DQ6A 2ETEA 5I91A 4Y3OA 2R30A 4MGYE 5EZWA 1G7YA 2ARBA 2VQUA 3AZYA 4O65A 2K46A 4LKDA 2X5IB 1QH6A 3GBFA 1UOGA 3RI9A 4BXFA 1AVBA 3O1OA 4FPCA 5T5LA 1EUTA 3MLLA 3TBDA 1W9SA 4YLZA 4RHV3 4BU2A 4ZU5A 3BTAA 2XJVA 3RZZA 3LEKA 2VOTA 4Q8KA 3MV11 3QCWA 1GBGA 3OSDA 4MXWB 5IVYA 1PO22 1OFSA 1YQCA 1MS1A 3B94A 3WNNA 5FYUA 4FPLA 3UKVA 1RVF2 3R4UA 4AI8A 2A3YA 1VBB3 2HWD2 1GLHA 1MVEA 2VNGA 2W46A 4GMP3 4M3CE 2JIGA 3WG1A 1GQGA 4DMIA 5KXEA 4Y5TA 5FZ9A 1L7LA 1XYNA 2GC1A 1OOPB 3X29B 2WKKA 3BPZA 4WVMB 3A4UA 2JDZA 4QX1A 3ZYIB 2KM2A 3N3HA 3POYA 4IV1B 1SCSA 2FDGA 4ZS2A 4XILA 4YW5A 3CKHA 4B7KA 1ZBA1 3BU0A 4D8MA 1RUF1 1RC6A 2XUEA 1Q43A 1ND3A 2BRTA 2LM3A 3MIDA 1VAVA 1LOCA 1RUG1 3RWNA 3BB6A 3P3PA 3PMEA 3VBRB 1QJX1 2GMMA 5KBFA 4PF5A 3T2PA 1PZ8A 2VW1A 1OH3A 1Z78A 3FC0A 4J1XA 2WZPP 3SKVA 3WDWA 1HB2A 2WT2A 1UOFA 4K3UA 3U11A 1HJFA 3ACLA 4QX0A 2DVBA 5FO8B 4YZ3A 1W04A 1XU1A 2G1MA 2VXJA 2V4AA 3BIWE 1ZNPA 2I45A 3LPFA 4QDQA 5FYBA 3A0KA 1W03A 4XUTA 2VJXA 4CEYA 1YYNA 1HRV3 2QQPA 1GR3A 1VBE2 1DQ5A 2JX9A 5EJZB 5LY2A 4CP1A 1QH7A 3VN4A 1EV11 1C8M3 3IMMA 4D6QA 1RUF2 1ZRRA 2KA3A 2VNVA 3Q8CA 4O9GA 4QM9A 3ASIA 4LJHA 2X05A 1O7FA 2ZKLA 5GZDA 3N7LA 4HONA 2Y26A 1WZXA 1WD3A 2D3SA 1D4M1 2P6CA 4HG6B 2XQRA 4MHUA 3WNPA 4E8CA 2D40A 3PUHA 4JTNA 3T1MA 1W6PA 3NNLA 3MHZA 1K5MB 4UFJA 3IBMA 5DAQA 3N9MA 1S2KA 2V72A 1ULDA 5FMCA 1A78A 3UKTA 3VUOA 4CEYC 4YGBA 2VBBA 4NRQA 1QJU2 4XF3A 4HN0A 4QX8A 5FZ0A 3EO6A 3W59A 4BQWA 1GP4A 4Q2FA 2Q8CA 3EBRA 4ES9A 4JHZA 4P9LA 1MEC1 1R091 1TE1B 2A6VA 2Y6HA 1QOTA 4PF1A 1NOVA 4P9GA 3K48A 1XXNA 2WN3A 3LEGA 1OKQA 1ULPA 1H8TB 4RQPA 1H9WA 2DUQA 1TMF2 3HOBA 1TME2 2JDKA 3BTZA 1G9FA 2YGLA 3WUCA 3WHUA 1RUC3 2DDUA 4ORFA 3J26N 3SCHA 2TBVA 5FZCA 4LO5B 5FPXA 1HQNA 5LA1A 1SDWA 4KWJA 4WBBA 3LDKA 1BBT3 2VOWA 4E4DX 1OLMA 4C0HA 3M1HA 3AYCA 3POJA 4RSUA 3HN1A 3GXUA 5D8AC 3DL3A 3OGGA 3H1WA 3WQ7A 2JB4A 3NO8A 4W6YA 1QDCA 4FP2A 5A3LA 2VVFA 1Z0HA 4FPKA 4GKXA 1OF3A 2ET7A 2RS51 4Q26A 2OPKA 4RQPC 1MEC2 1R092 1LB2A 4LR4A 4AVCA 3SC7X 4Y1VA 3NKGA 4MGIE 2QTWB 2BFUL 2QDRA 3HNMA 4NWWA 1NYWA 1UPSA 3M3OA 3WY6A 1D0GA 2RS12 2IFWA 2UWBA 5JSRA 1F8VA 3ZDSA 2HYXA 1H4HA 1XNTA 4Q0UA 1FOD1 1O4YA 1XRUA 4QU2A 1TEIA 1X36A 1CX4A 4DXTA 4PQ9A 1IQAA 4QGLA 2RS31 4LBLA 3IDBB 2WS93 1TVGA 5FP3A 1W6OB 5FPBA 4DEQA 5JOZA 5FP7A 1LNSA 2NZ9A 3MLKA 1OD3A 2ZHNA 3GZUC 4HOOA 2BUKA 4NOTA 2C6SA 3O1MA 2CGOA 2RR11 3IM0A 2CY6A 1HV0A 4UFKA 4XBQA 4QHZA 5C5TA 2LROA 2P3KA 1GWLA 3ACHA 4KG0A 1DF0A 1OUSA 1RUH3 4LULA 3HBKA 4DUWA 2XDVA 3RYRA 2ZGOA 3ZR5A 2Z42A 3R05A 2ZBJA 3I2IA 4JKKA 4UFMA 4LOSA 3ZFGA 2LALA 4JGZA 4PI0A 3OBZA 4XJZA 3WLUA 5KC5A 4JZRA 2ZGRA 1W0PA 5KC6A 2B9UA 4FFIA 4AGRA 2ZX4A 3CJXA 4OUSA 4YYOA 2I2SA 5BNQA 2GN3A 4XURA 2GZWA 2ZGQA 4GD4A 4FXKB 5EWSA 3POSA 3L2HA 4CUCA 4LBQA 2VVEA 4LO8A 1F4HA 4COUA 2FMDA 2WFPA 2ID4A 3C7OA 1PHMA 2XB6C 1H0BA 3H1YA 1VJ2A 4UOJA 4I2OA 5FXVA 3ZFGC 4YSFA 1W2OA 2FBEA 4HL0A 4JGZC 4RHV1 4AQ6A 5FXWA 2VO5A 4DXRA 2B5HA 2XR4A 3LOIA 4F7ZA 1PGL1 1RTVA 5FYYA 1X8EA 4URAA 4MUVA 2QKDA 3CF6E 4K20A 2Y38A 4QXBA 4AQ2A 4Q4X1 1HDKA 2VECA 4Q8LA 5EYXA 2BGCA 2WIIB 4PDWA 3SEEA 4A2UA 5AFBA 2XVKA 4YM2A 4BISA 1UOBA 4BQ3A 1VBB1 1LJ7A 3SLIA 4EN9B 4GMP1 1AL22 4LA3A 3VZKA 3FHAA 2QQMA 1FNZA 2D7FA 4G9SB 1C1FA 2C5DA 3BOPA 5GZFA 4LBQD 1PO12 4QQOA 4RYDA 4XW3A 3TWIA 5BY5A 3PDQA 1G86A 4KWKA 4XIOA 2WO2A 1ZZ7A 1QNWA 2VBDA 2JDYA 2D97A 4JGYB 1WUVA 1MVQA 3I3DA 4Y4RA 4XJWA 4FPJA 1DHKB 4XETA 5JDBA 2AR6A 4D7YA 1UZWA 3Q9OA 4TLFA 5A6YA 3RMYA 3VL8A 3JQWA 1AYM3 4E4ZA 5FUIA 2UYBA 4XXPA 2XXZA 3ELNA 3ZSJA 5HXMA 5GLWA 1RGSA 4P02B 5D1IA 2JDAA 3AZZA 5EQUA 5D21A 1XNBA 4QX3A 3ZN5A 4XJUA 4CCDA 2DF7A 3PUAA 2ZS6B 4LHSA 4DPNA 4IXLA 4DFSA 2VUCA 4Q4X2 3J7LA 2DVAA 2ZHMA 2BOIA 3H7JA 5DDJ1 4LMFA 5CBLA 4YFZA 5CKQA 3FLPA 4KI5M 1QJFA 1OPMA 2WNVA 2XL9A 1MZEA 1OXCA 2W87A 3I7DA 1DQ4A 1E5IA 2DCJA 1QHDA 1CN1A 3G7DA 4YW6A 1EP0A 4P5HA 4Q29A 1HRV1 2NQYA 2ZKNA 3MDPA 3I8TA 4IEVA 3UK9A 4HPKA 2ZACA 3UGHA 4ASMB 1HIXA 5C33A 5JMOA 3VDBA 1W0NA 4CE8A 5CAZA 1KGYA 1U5IA 4H7MA 1C8M1 1V0AA 3KV9A 4CYDA 3DEMA 1PNGA 3AKSA 1UY1A 2C4XA 2WA4A 2EVXA 1DP0A 4B4QA 5FY7A 3E5XA 4N53A 5I0TA 1W9FA 4GAZA 4Q0QA 2NYYA 1YI7A 3C3VA 3H3ZA 3Q8BA 3DF0A 4K7JA 4O7XA 3RZJA 4G3YC 2WNVC 3HJRA 3LCPA 3GBGA 4AXOA 3AMMA 1ZM1A 5DDJ2 4IERA 4B1LA 4CCEA 5FQ0A 3VBUA 3CZJA 3FBMA 2BVVA 1W0OA 4CXYA 3WW2A 4NO4A 4C8DA 1HXS2 1XE0A 2XLFA 4I09A 4XQ4A 3FFQA 1H9PA 3TYJA 5FWJA 3VHRA 1M4WA 3LSEA 4CCMA 5JXGA 4XEZA 1H2KA 1YQ8A 1RUC1 4N53C 5FP4A 5LB6A 2VZQA 5I8YA 5LA0A 4HBNA 3WCRA 4CEYB 1NKGA 2P37A 3UJQA 1BBT1 3N9OA 4DY5A 2QQVA 1J83A 3BODA 2BZDA 2C9KA 5FBJA 3E6DA 1AXYA 1UWWA 2PXJA 4XQWA 3VBUC 4Q0VA 4AQTA 5JUVA 5IVVA 4AOCA 4Z8BA 2OPWA 4MGZE 5ACA2 4JX0A 1YXWA 4JDNA 1CPNA 1OH4A 2GALA 2WO1A 1SCRA 1POV0 2E7QA 3ZXEA 3H8XA 1UIKA 4HETA 5F6KA 1GZTA 4M0HA 5GJ6A 3WQBA 1W6PB 4K8RB 3ES1A 1LESA 5K8SA 1JN2P 2VZPA 1AX1A 1PMIA 2QQNA 1CAXA 2DCKA 2VD7A 4RR3A 3CZUA 3O5SA 4DINB 2QQIA 2QZ3A 2Y34A 5D8AB 2TEPA 2YBSA 3ATGA 2YU2A 1UZ0A 4NRMA 3OUIA 3D6EA 1RUOA 1U5ZA 2W3JA 4RQPB 3DXTA 4CU9A 1H2MA 1ASJ3 2JIJA 4Q4V3 2B46X 1IS3A 1WCKA 3V56A 3UV9A 1ZZ6A 2FQPA 2WLQA 3WV6A 2BBVA 3ZYGA 2VMGA 5EJ1B 4NPMA 2HWB2 2O0OA 2BP6A 3O1TA 3HQUA 1UU6A 1RHI2 2HBTA 2WNUA 1O8PA 3JB8A 1AR92 1FATA 4LE4A 5FTTC 1SLTA 4RR3C 1OPOA 2WZR2 3B9IA 3DGTA 3M7AA 5GLVA 1RUH1 1PMJX 4BM8A 2X5IA 2VMHA 4QX7A 1MACA 2D98A 4OCTA 5A3UA 2Y6JA 5DUXA 1NXMA 1KDKA 4A6OA 2OT7A 3N9QA 1CIYA 1OA3A 5DAWA 2ZGLA 2BGPA 5A6XA 1N3QA 2E7TA 3AMHA 2O1QA 2WNUC 5E6HA 4DB5A 3EMRA 4P9XA 1SG3A 3N9PA 4KH9A 4YZ4A 4CCCA 1QQP1 5E16A 4HXCA 4XCAA 4XZUG 5FZBA 2BV4A 4XF1A 1UKRA 4XACA 2W68A 2X5IC 1T6BX 3Q8EA 4LIUA 1RB8G 3MIBA 4YM0A 3THPA 1F5JA 1PO23 2CV6A 3DPRA 5FZDA 1OOPA 2JKXA 4MHRA 1T2XA 1V6JA 4I3GA 4PJYA 4WVMA 2R32A 1JBCA 2WABA 1RVF3 3I2FA 4OZOA 2FDHA 2ORXA 2PHDA 4JDOA 2HWD3 1COV2 4FAGA 3N7KA 4BK4A 5IK7A 4YG3A 3R4DB 5I0UA 1HX6A 2ZEXA 5H9PA 3TNPB 2Q5TA 1LRHA 4YFWA 2Y64A 1V6MA 1DZQA 5L19A 3U4SA 2ZX0A 3PJYA 1S0GA 5FUNA 4ES8A 1BCXA 4QU1A 2D6KA 1QY4A 1FMD2 1F31A 1PVC2 1QDOA 2VGDA 2O8OA 4LLFA 3VBHB 4LHLA 3BU7A 1H4GA 1XYOA 2RM21 1ACCA 4RFT0 5FO7B 3W9AA 1D7PM 1ENSA 3DPRC 1OOPC 4KL1A 5BXXA 5LASA 3AMPA 1SHWB 3I2DA 3MF9A 2JWPA 1G8WA 2VCMA 3ALQA 1S0FA 1JOJA 1GNZA 4FTEA 3FMGA 2X29A 5DN2A 4LHNA 1GQPA 3ZYRA 1G6NA 1IPJA 5FZIA 5LEJA 4OUMA 3KWVA 1QIQA 5GALA 1IPKA 1W9WA 2DV9A 5IK8A 5A7WA 3M3QA 4L99A 3CEWA 1PGW2 2NLRA 3MPBA 4LBQB 2Q8DA 1DZTA 3TEWA 4W4ZA 4M0NA 1W2UA 2Y6FA 2Q1MA 1DCSA 3OCPA 1I3HA 4BPZA 1Y7BA 2GNMA 5C70A 1ULFA 4A7YA 1VBE3 1JU3A 1UOJA 4Q27A 2XBO2 2I74A 1YJKA 3MW2A 4JDMA 3WW4A 1C28A 4D7TA 5F8PA 4UW5A 4CDWC 4F3JA 5KR7A 5DZGA 1RUF3 2RM22 1HN1A 2YC2A 3IWZA 4AGGA 2PYTA 2KD7A 2VXRA 3LE0A 4V2VA 3H50A 4ZU4A 3MGUA 2VC9A 2R0FA 1ODMA 3RZKA 4AFCA 2P2KA 3PIJA 4HVRA 3TN92 3QBQA 5J3UA 3QD6A 3R4SA 4BLIA 1E5HA 4OMDA 2VL4A 3SCFA 4LKSA 5LY1A 1QJU3 1XNKA 1HW5A 1CAWB 4OQ8A 2CTVA 1Y9GA 4KMQA 4K8FA 3OGVA 1OSGA 3VD4A 3NV2A 1LHVA 4QX5A 4Y4YA 5JAXA 1GV9A 5C9AC 3T4HB 1UKGA 4DS0A 3BUCA 4QT6A 1XNAA 1HLCA 1TMF3 3C7EA 3RQ0A 1TME3 1JU4A 2BJSA 2Q4SA 3PURA 4TWTA 4TYSA 3ZPOA 4E8DA 1WBLA 4LBOA 3MIGA 2ZXQA 1PVXA 4UBHA 3OGJA 4R4XA 3AK0A 4XE9A 1HB1A 1X33A 4IV3A 1VBA1 3JZVA 3ME2A 3ZYFA 2YY1A 1AJOA 3KV5A 5DAVA 2PHTA 1JYWA 4LUKA 2WNVB 2CAVA 1AR72 1RJ7A 3NVCA 3BGAA 4CDQB 4YNIA 1GP6A 1KFXL 3I4IA 5GKAC 2FDFA 1VBD2 5HV0A 4S2GA 4HPKB 1MEC3 1R093 3WF0A 2OQ7A 1RUI2 1JYVA 3U0ZA 5A3NA 4HKWA 2XLAA 2B8MA 4BZ4A 4CP2A 2JDPA 5FZ8A 4LPLA 4IV3C 3VZLA 3VBOA 2RS13 4N53B 2PHFA 1W6OA 3ZIXA 4ARXA 1UX7A 1AX0A 2VULA 3L2YA 1NUKA 2PQSA 4AR2A 4AI0A 5JI9A 1US3A 4RN5A 1BK0A 4LTAA 1VBA2 3K77A 1VPHA 3MIFA 1EPWA 1XQNA 3VBUB 5IFPA 3JCIA 1O91A 1VMHA 3D4KA 5GLUA 3KSCA 1DQ1A 1GUIA 5J48A 1OFNA 3WDTA 2X09A 5A33A 4PT6A 5C3OA 5AVPA 2YUEA 3KHBA 4KGQA 5IWFA 5E89A 2VMIA 4Q4V1 2GDFA 1WA4A 2ZHKA 4NPLA 3VBOC 2BFUS 5HV4A 2JKBA 1BXHA 2R042 2HBUA 4EZ4A 4I0BA 5CKMA 1X8MA 3JU9A 5A3MA 1JOBA 3HNBM 2ZGNA 4LKFA 2H6CA 3POFA 3VKNA 1GICA 3L9JT 2ZEWA 2GH2A 3KT4A 4QPWA 4H7LA 5A3OA 2BEOA 1DYOA 1KEXA 1S2BA 2BTVC 2EAAA 4JV4A 3LSDA 4QWNA 3N9NA 5A1FA 1C5IA 4FTBA 4CCNA 4AVAA 4GB32 4LBKA 4NWVA 3THCA 1KXGA 1CD3G 3TOJA 3U4XA 2VOVA 2WRAA 1JXNA 1SDDB 4UAPA 3IKWA 4C1WA 1RUD1 4MLOA 2WR9A 4QKDA 4HVQA 1CAXB 5J1XA 3HQRA 4RR3B 4YW3A 1ENRA 2JB8A 4D7SA 5CIRA 1MZFA 2E63A 2OXBA 3I3QA 1W2TA 4FOVA 4YM3A 1YNAA 1OD5A 5K9YA 1UY4A 4LBNA 1DQ0A 2IC1A 4AI1A 4P14A 4TLGA 3KVAA 4GA9A 4A3ZA 3I3MA 1PO21 3V65A 2BWAA 3O7OA 2SLIA 2VTXA 5C7GA 1L7QA 1QJY2 3KVBA 4FPOB 1UN1A 4OUEA 1A8DA 3U07A 1RVF1 1IQDC 1W05A 1GOFA 4JGYA 4KBBA 3VGIA 3ZX7A 5JOXA 4L9BA 2HWD1 2VH9A 2J42A 1AL23 2BYVE 2WNUB 3WVJA 5JMCA 2DU0A 3JBG2 3JUUA 4XFHA 1PO13 4N7UA 1Y3TA 3ZM8A 1JI6A 2OW4A 4YVWC 5A7QA 1J59A 1W6MB 5BNNA 2WC2A 1RUD2 5L9BA 1Q8SA 1W2AX 4QB2A 5EJ3A 1YIFA 4N7IA 3FLTA 1ULGA 5FY8A 1YFUA 4FXGB 3VZOA 1IS5A 3T30A 1WW5A 2OA2A 3OD4A 2VMDA 4UYBA 1QKQA 4FPHA 4IEPA 2VTXJ 1S0JA 5FCCA 3RS6A 2YBKA 3WF3A 1YEWA 3KB5A 4JGYC 2P3YA 4F8AA 4Z2AA 1AYN2 2ADEA 3WD5A 1V6LA 1W3XA 5FZ4A 1DQ2A 5FK7A 2GN7A 3LQCA 2GAUA 2P17A 4NHYA 4Q4X3 1W8HA 4BIFA 4CU6A 2AENA 1SFPA 5APAA 2L9LA 2UYAA 5F39A 3FWEA 1NQDA 5FBZA 4AI3A 4CCOA 4M3CA 1RXGA 2JG8C 3S7EA 5FP9A 1KS4A 2Q30A 1OURA 5BNNC 3M3IA 3ROUA 1LR5A 3MIEA 3DECA 3DPRB 3CO2A 4OHVA 5FJHA 2Y0OA 3V0BB 4Y20B 1B35A 2WJSA 4AG4A 3ZN4A 1SFNA 2WL1A 3ST7A 1LOBA 1VBE1 1XJAA 1AL0G 3UETA 1JHJA 4QKFA 1LGNA 4GMP0 5JIAA 2V4VA 5HCFA 3O1RA 2PMWB 3TRSB 1W39A 2VW0A 3CIHA 4BMEA 2XH6A 3NJZA 1RITA 1O5LA 4CU7A 1XNCA 1XYPA 5EYYA 2AZ5A 4YG0A 5CYYA 5FY9A 3WP3A 4B3NA 4HLTA 2BQPA 3UL2A 3K51A 2BWCA 5F5CA 4FT8A 2FCTA 3SITA 3E6CC 1OI6A 4P5YA 5DDJ3 1QJU1 4R4ZA 4MYEA 4OHZA 1B35C 1UYPA 3BTYA 3SQOA 5DAXA 5ANQA 4CDWB 1UNBA 2ZCWA 3POWA 5IATA 4L0PA 1HXS3 1CZVA 5JSOA 4LNVA 2YPDA 4COYA 4N9HA 3SH5A 3NJYA 2HJIA 4BQ1A 4BLJA 3NWKA 3ORJA 5A7WB 1TMF1 1O3QA 2Y6KA 3PL0A 1TME1 1UY3A 1JYNA 3OGSA 1H1IA 1WLDA 3IIAA 1BVVA 1JZ7A 2ES3A 1IGOA 5GZGA 5E8AA 1N3OA 3LPGA 3UESA 1AR82 3OF1A 1F5FA 4L11A 5C9AB 1ODNA 3U10A 3IMNA 3WF4A 4COZA 3POEA 4ONUA 1R1ZA 4MV2A 4R52A 4H14A 1RUJ2 1FYUA 2OIIA 5ACA3 3RZGA 2QFEA 3GCXA 3FL7A 2QQKA 3H3LA 3HPNA 4HVOA 1Q8PA 1FNYA 4XDQA 5D8AA 3ILFA 3K46A 5F3EA 2JJ6A 3IT8A 3J7HA 2C26A 3TNQA 3T1LA 4XHBA 1XOYA 3LGRA 3AMNA 1J3PA 4IE7A 4IW3A 4LQRA 1GZWA 2Y33A 4A41A 2RS11 3JD72 2PHLA 3APBA 3QACA 1GOGA 2VOXA 1VAMA 2GMEA 5KXDA 5T3NA 1IKQA 2EXIA 3GDBA 1BKZA 2D44A 4QKNA 4AEKA 1XSQA 1JW6A 2RDRA 4BA6A 3HNYM 4JVAA 3SEPA 4AHYA 3UNPA 1MQTB 3CQOA 3DYMA 2J1AA 2R7EB 2A5ZA 5IK5A 2VUJA 3VDDA 2DTWA 4XMAA 5GLZA 4IV3B 2HWB3 5FMOS 3FZ3A 4IUGA 1NE4A 3PMSA 1OLRA 1X50A 1RHI3 2F4LA 2Y8KA 5BPXA 5FKCA 1WGPA 1GOHA 3M3EA 1AR93 4XFIA 4XC9A 4PIZA 4XABA 4FCAA 3KM5A 4Q4W1 2WZR3 3B5LB 1VMFA 4CSWA 1MS9A 4EWDA 2VVDA 4XFAA 2RJKA 5LBFA 3LKJA 4IEXA 2R1DA 2D6PA 3NJXA 1FI2A 5B2GB 5F7UA 2A6WA 1A3KA 1ZYBA 2QJVA 4ZZ8A 3A21A 2BOJA 3NNMA 1H2NA 3DXUA 3VDDC 1MS8A 4CCJA 1X9PA 4XCBA 5ANNA 1FXZA 1D0HA 1WA6X 5EP9A 3VBOB 1XBFA 3OUHA 2UWCA 3ZMNA 4Y5Z0 3ZOIA 4MG2A 4GULA 4R9BA 1SZBA 2YMZA 1WW4A 1YCIA 1V6IA 1J1TA 3I2GA 1APNA 2R072 3ZXKA 3ZXLA 2OYZA 3RSJA 2JDNA 3FE5A 4BQXA 1ULOA 4Q4W2 1REFA 1OVSA 4IEQA 5C3QA 4QXHA 3ZYJB 4C90A 2X10A 4L8QA 5A33B 5F5IA 5LRRA 1R1A1 2MEV2 4PQQA 1COV3 1OF4A 4AQSA 5LCWL 3I59B 3AMQA 3AVRA 3WNKA 4TZDA 2DUPA 2V73A 3OBTA 3VBHA 3CMGA 5A3WA 3VD5A 3O1SA 1LOEA 1PIV2 3OOXA 5E88A 2IXLA 1UCXA 1A6CA 2PA7A 5IHRA 3SH3A 1UW8A 3GJAA 4Q4Y2 2NMNA 4HMZA 5FZOA 4E2QA 1KD7A 1FMD3 1PVC3 1AL21 3NRUA 3AKRA 5FK8A 1CGPA 2FDIA 3NV4A 3K3NA 3NL1A 2DCZA 3VHOA 1PO11 2JG9B 2DBNA 3ZDVA 5AC91 1NAEA 1QQP3 3DKWA 1EAH2 1W8WA 5IAVA 3RRDA 2NM1A 4MADA 1J3RA 1AJKA 5FIXA 3WG2A 3AC0A 1NLRA 2Y60A 3DCQA 4ISRA 3U75A 1P8JA 5FZHA 4BHPA 3VBHC 5BNPA 5KHHA 3MZHA 1BEV2 1U5XA 5HI0A 4UI9L 3ZLIA 2AC1A 1MPXA 2A1XA 2VMCA 2AGSA 3D5OA 4FFFA 5E1RA 2VQAA 4CP9B 3MUZ1 1R1A2 1VAKA 3AXDA 1WMEA 5I93A 1G9AA 1RIRA 2GNDA 3B7MA 4EN0A 2R1BA 3OTFA 3J9SA 3VZMA 1ENXA 4OI4A 1EUUA 3T0BA 3A7QA 4QMAA 4YVWB 1KFUL 5JXHA 1DLLA 1VALA 2J1SA 2W1UA 4YG6A 5EPAA 3CU7A 2R16A 3FJSA 5J98B 4QB6A 4AEDA 3HN3A 2RM23 2GP5A 3OY8A 3WG4A 3O1PA 2A7AA 2VZSA 2B9VA 3O12A 1GWKA 3EYPA 3TEXA 4M4RA 5AC92 1UZYA 5BNPC 1JZ4A 1CAWA 1JZ3A 5FO9B 3VL9A 2ZGKA 3TN93 4DXSA 2H6BA 3J8F2 4XOGA 4LUMA 5BUVA 2EIEA 1SLAA 1YIPA 1C57A 1S0BA 2AUYA 5HBAA 3ZSLA 4WM7A 1W8ZA 5JIUA 2JG8B 5A3PA 5FJKA 5A7PA 1CWPA 4FFGA 3D0SA 3ITQA 5BNNB 1WCUA 1SQ4A 4BOWA 4HSJA 1CX1A 4K1YA 2BU9A 5FXZA 3VZNA 4AEDC 5JLVA 5H9SA 2JDMA 3KCCA 5CISA 4C0BA 3NW4A 1JYTA 4J25A 3DUIA 2J1RA 1ALYA 1GQHA 3WNOA 1HRI2 2E32A 1DG6A 1W8OA 2A6XA 1F15A 3EB7A 1HXS1 2RDQA 4CDQA 5FY4A 3J7MA 5FY5A 2VPVA 3ACIA 1X9TA 2CWSA 4Q0PA 4WM7C 4M3CB 4CUAA 2VCAA 1Z7S2 5A3TA 2XQXA 1HQLA 5A32A 2QNKA 1SEFA 2GC0A 4NHMA 1XE7A 1LGBA 3RMXA 1AR73 4AHZA 3ACGA 2D5HA 1K12A 2P1BA 1JODA 1B35B 1DFQA 1V70A 1VBD3 2B45X 4AHXA 2HWC1 3AYEA 1UMIA 1RUI3 1WMFA 2YHJA 4QHBA 2GMPA 4UBGA 5EFUA 4ITCA 5K4LA 3BI3A 1VE0A 3ETQA 3K2OA 3NAPA 4LT5A 5ACA1 3GJBA 4XJ8A 2VMFA 2RMU1 1N1SA 2VCCA 4QPYA 4CDQC 1IG0A 1W8NA 2YBPA 3RNSA 4DZGA 1JHNA 3OPZA 2BERA 3WF2A 2VAUA 3E5QA 3FLRA 4R9DA 3VBSA 3ZXFA 3RVHA 2PTMA 4AI9A 5C8WA 1KJRA 3OUJA 4GH4A 4GKYA 1KS5A 4BDVB 1GZ9A 1VBA3 3ZSMA 1LCLA 2D5FA 3OB8A 4XUPA 1O3RA 2B4KA 1WMDA 4R9AA 3EQEA 4ASKA 2RDNA 4MH0E 4HFSA 4NN0A 4JQTA 4AGVA 4CEWA 1GANA 1O3TA 1E5SA 3P5BA 3FHIB 1QOOA 2VCBA 3WP5A 1UXXX 1G9CA 3NAPC 4WVWA 3T0DA 3NMBA 2HWC2 1JS9A 3H9AA 4K40A 1SBFA 1W06A 3VBSC 4E4HA 1ZRCA 1JUIA 1QEXA 2IUWA 4LLOA 1LHOA 2F4PA 4EROA 2HWB1 4LITA 2RMU2 2GH8A 5T5PA 2ZTNA 4CUGA 3D8CA 1RHI1 2XJPA 4GH4C 3ZKYA 4FSJA 1I9RA 5FMOL 5IT6A 1AR91 2QVSB 1GSLA 3AB0A 4NHLA 2W5FA 1AR62 2WZR1 2PQQA 4IQPA 4LOTA 3WX5A 5IVCA 1U0AA 3H1MA 4QX2A 3SISA 4CEWC 2EA7A 2ZEZA 2BBAA 5FPAA 2XJUA 5A80A 1WLWA 5FRAA 3USSA 4TTGA 3AJYA 4H55A 4OHWA 3ZXAC 4GB33 1V6OA 2E7AA 5J37A 5T54A 4PLOA 3ZXDA 2ARXA 3T09A 3B3QE 4BH9A 1GZWB 5HCBA 1SPPB 2DURA 5CEHA 4Y1YA 1JMUB 3W58A 2E33A 3UJOA 5CFCB 3I2KA 1LOAA 1NQJA 1BLZA 3J7NA 5DUUA 5JSPA 5DUWA 2W94A 2ZGTA 3CJIA 5JWPA 3ON7A 4FOYA 4OMCA 1QJY3 4MGTA 1Q8OA 3VDDB 1ND2B 4I0WB 1LHUA 5IAXA 1VRH2 1W6MA 5J09A 1COV1 5EHDA 3WZ1A 1W8TA 3CLPA 2QQUA 2WNOA 3M2MA 5DAPA 3ZYBA 3JBG3 3O14A 2VMEA 3LIHA 4GQ7A 4PBPA 1REDA 4LK6A 4OI2A 3I3EA 1QGLA 4LHKA 1RUD3 3HIFA 3THTA 2OX0A 2W92A 4YW4A 1FMD1 1R081 1PVC1 1CZTA 2ZGMA 3WNLA 1VBC2 5KXBA 3CHXA 3H8OA 3CJIC 4FBFA 4OI0A 3LAGA 3MO4A 3VHPA 3VHNA 4AAPA 4B7EA 1AYN3 3O1VA 3I2OA 3RZHA 3TEZA 1US2A 5CVRA 1KDMA 4UF0A 1O4TA 3MF6A 5F5AA 1GNYA 5IJRA 3VD9A 1G9DA 1ZZCA 4GXLA 4E4SA 3V0BA 4Y20A 5F3GA 1JUHA 1ONAA 2Y6LA 3H0OA 4NE9A 3NKTA 1PGW1 2WWJA 3ZR6A 3RZLA 1V9U2 1W9TA 4TN7A 3MEPA 1D4VB 4O61A 4QXCA 4NRPA 2V09A 4QPGA 1BQPA 2XBO1 4OLLA 4QQLA 1H30A 2ZX2A 2VZVA 1IPSA 2GSYA 1R082 2JENA 3HT1A 3P1IA 4BQYA 2P3JA 1DIWA 1Y9QA 4WM8A 5A6QA 3GHMA 1O3SA 4AEJA 3OBRA 4TSVA 3E6BA 1O59A 4HSLA 3WXPA 4FQZA 2LTNA 4IEYA 5FZOB 4ZXEA 4CDWA 1HN0A 3TN91 3GBWA 3ZFFA 2DVGA 3NNFA 3RZMA 4O9EA 1KITA 2KXLA 5G05L 4IGOA 3VDAA 3WT3A 3H3UA 3LA3A 3ILNA 3BPSA 4QPGC 4Y1UA 3S5AA 3QH7A 4FPEA 2Z79A 2R062 1MZ6A 4AFBA 2ZGPA 3DKQA 5BNPB 2CHHA 3PU3A 4XDPA 3FFZA 4WM8C 3V0AB 4QPIA 1UY2A 2HWF2 4EN8B 1ZZ9A 1QU0A 3JXSA 4KBZA 4L2NA 4NAMA 1QOSA 4QAWA 4UW6A 4XHXA 4WVVA 5JI7A 1C4RA 1ZA4A 2PLV2 4BQ5A 2ZA9A 5C9AA 2W1SA 1GWMA 2J7MA 4QD2A 3ZFFC 4A6SA 3OEBA 1EPZA 4NHXA 1YI9A 2FDJA 5A7OA 1YO8A 1DDLA 2P5BA 3H42B 2J22A 1Q5OA 3EXUA 1AR83 1WLTA 2XJTA 1I5PA 2YV8A 4GIQA 3E97A 3UYJA 1RUE2 2J1UA 4AEDB 3TB0A 4Z07A 3ZN6B 2IXIA 2Q1FA 1H1AA 1RUJ3 1AR71 3OY8B 5IK4A 1N1TA 3HWJA 1LGCA 1NE6A 2YFUA 4KU8A 2ATFA 1ZA7A 3GHNA 1BK1A 3NNGA 3PHMA 1VBD1 3LF7A 4QPIC 1L7RA 1UY0A 2W95A 3F2ZA 1UPIA 2WA3A 1RUI1 5L36A 3DYOA 4B1MA 4AI2A 5I8TA 2MNGA 4Y33A 4AVVA 4WM7B 2FZ2A 4I30A 4XPVA 2VZTA 2YGMA 2WINB 1MQTA 3GZAA 4XFFA 5IW0A 3IN9A 5B4NA 1GYKA 5BNOA 3JD73 1YFWA 4FPFA 4XAAA 3VKLA 1LKNA 3T2TA 2P34A 5F3CA 1GNHA 2D6NA 1OKOA 3VV1A 4XVHA 3D3AA 4AF9A 1S1AA 2WUHA 4W50A 1DZRA 3PIGA 5A1AA 2HWE2 1FAYA 5DQ0A 3PJQA 3LEMA 3KV6A 2C0ZA 4QM8A 3LD8A 3SMHA 1AZDA 2PN5A 1YC61 1LEDA 3LA2A 1UO9A 4NROA 2E51A 2JE9A 3PVBB 4OYUA 2AYHA 1TNFA 2O8QA 2OZJA 4E27A 2EXKA 4XDOA 4UXAA 1QWRA 4DUVA 4QQHA 1MQTC 1PX3A 5BNOC 2NPIA 5C6CA 5A32B 3PUSA 1FV2A 4GZ9A 1PM7A 1IKPA 4OQ9A 5HCAA 2R041 2ZGUA 3AX4A 4NIIA 4DOUA 5EIYB 3DN7A 3HEIA 4QQ2A 3GF6A 4AL9A 3BOWA 5FZ7A 5A1LA 2EALA 4QGNA 5FYVA 2OZ6A 3OGRA 1LULA 5LA2A 2WYFA 1JZ5A 3SKJE 1PM4A 1WLCA 1I5ZA 3NAPB 1YFYA 1ZRDA 3PLQA 4D69A 1S0DA 3BKZA 4P9WA 4B8EA 4HANA 1A34A 3RWKX 3VBSB 5DABA 4AFMA 4X8NA 3KCXA 5CFDA 4GB31 1NLSA 5LZ6A 1E5RA 2CGNA 3VZJA 4G4FA 2B7YA 1STMA 4GH4B 4RA0A 3T4VA 3WCSA 3IDEA 2R073 3I59A 2ZAAA 2WNEA 3KGZA 1PK6A 2PHRA 1A8MA 1FPN1 2WQZC 3AKPA 4OULA 3U78A 4A7KA 5L9VA 2GC3A 3MW4A 3HVDA 4N90A 4Q4W3 3O0VA 3QLQA 4XAEA 1JTZX 1OQ1A 2W0XA 3SCGA 4DRVA 2WLPA 4Y22B 2WZ8A 5A6ZA 2IXKA 2XVGA 4CEWB 3C7HA 3LFMA 1CZSA 1RMU1 4P9IA 2HEVF 2SBAA 3W5NA 3HT2A 3LB9A 4IEOA 5KHJA 3MFCA 4Q1PA 3KZ4C 3OPWA 5SV8A 3RJRA 2CNAA 3KCYA 2ADDA 3S7IA 1QJEA 1AUYA 1ZREA 4JRAA 1PIV3 1Y4WA 2VG9A 3ZSKA 1QJY1 2JG9A 3GGLA 5LK5A 5FLIA 5CFDC 1NXD1 3AYDA 5JVVA 1CONA 4Q4Y3 2BNOA 3T2QA 4FPYA 2ZMLA 4YZ5A 1LU1A 3WP6A 1Y43B 4UFIA 3FHQA 2XHKA 1PK6C 3JBG1 3NQHA 3KQ4B 5FZ3A 1VR3A 4FOQA 2WT1A 2QZ2A 3IZOA 3ENRA 1HV1A 1AF9A 1WW7A 3POIA 1FX5A 5GM0A 1EAH3 2DCYA 4CP9A 1URXA 5FZKA 5ABJA 4J1WA 1J3QA 5FYHA 1ULCA 1FPN2 1RYYA 2FCVA 2VZ3A 4PHZA 4C91A 2BNNA 5F2WA 1S0IA 3N9LA 1BEV3 1IHMA 1DGWX 1ZBE2 2R6QA 1GFF2 2RDSA 4FTSA 3FUOA 4YVWA 4EQVA 1RXFA 2JG9C 4M3CF 2G19A 1DBNA 1RMU2 1R1A3 2IXJA 3K4DA 4P9JA 4C1XA 5ISLA 4NUBA 1AYN1 4W6WA 1H8VA 4LEJA 5F3IA 3S0MA 3CL1A 3WDUA 4RL7A 1OUXA 1DGWA 4MX3A 5JPMB 1SACA 4GJYA 4NAOA 3TAYA 4COVA 3GALA 1OBNA 1R64A 2VQ0A 2VR4A 4R9CA 4ZONA 1C3HA 3GM8A 3C8XA 4GWIA 5C4WA 5IFTA 5ABJC 3CJIB 4LXLA 1RJ8A 2RJLA 3PVOA 5FPUA 1K42A 3KT7A 2Y6GA 2NN8A 4MO3M 2DBIA 4HT1T 4XFCA 1WCDJ 1XPWA 2JG8A 5AC93 5LW9A 1L3JA 1NT0A 2W47A 3LEIA 2CGPA 1ZRIA 2YXSA 3UGFA 3IAPA 4D0QA 3J8F3 2FHRA 5A70A 3S5QA 4XZPA 2RS33 4P00B 3KHCA 3URFA 1K3IA 4DNYA 2V5DA 2YDEA 2YPJA 5T5JA 3AFKA 4RS5B 4YW2A 2W1WA 5F6LB 3K75B 4OHXA 4WZFA 3LZZA 1Y9MA 5SV5A 2VTFA 3R6SA 1W6NB 3WSOA 2ZJCA 3VBFA 4LIVA 5M0TA 5C4WC 1YQ5A 2AEZA 3VLBB 4META 4HK8A 5JOWA 1MS5A 3S6PA 1NG0A 4AYUA 4KQ7A 2OS2A 4OVEA 4Q5OA 1LENA 2IXCA 4FPGA 3AZVA 4CP0A 1TZOA 5T52A 3SXWA 1H2LA 1HRI3 1S0EA 3AFGA 4EN7B 2OVUA 1HJGA 2XKOA 1UF2C 4UF0B 3MFAA 1UMZA 2EICA 2G9FA 1NZCA 2E31A 3VKMA 3MI8A 2W1QA 4LBMA 3AYAA 1SBDA 2G9ZA 1O6UA 1OVPA 1Z7S3 2XUMA 5FMDA 1W6QA 5FP8A 4F83A 2QQJA 5DMYA 3IPVB 3I49A 3CDZB 4E2GA 4XJ9A 2MPFA 2D43A 2XVLA 3HAGA 3VBFC 2BW8A 2A70A 1LAJA 2CU5A 4D6RA 4CPBA 4E9KA 1Q8VA 1QXRA 4QPGB 2RE9A 2UURA 3RJ2X 4KG8A 2ZAHA 1AR81 4JCKA 1CESA 1HQWA 4LKEA 2VNOA 3HR9A 4X6QB 3MW3A 1C8NA 4GJZA 4A44A 2XPJA 2QQWA 4R8HA 2W2IA 2DFBA 1RUJ1 4QB1A 4SBVA 4WM8B 1ZRFA 1UX6A 4N9IA 1CIWA 5KHKA 3RPQA 3JQXA 4XQDA 1CAUA 1NY71 1K45A 1PGSA 4XUNA 3DV8A 5FPZA 3ZFFB 4MSVA 4HKLA 1F2NA 1XC6A 3P3NA 3PVEA 3LA7A 4A3XA 2DUOA 1O4ZA 5C3RA 2WQ4A 4ASLA 3JD71 4ZHNA 4ISQA 1LEMA 5DXDA 5FZ6A 4PIYA 4YW1A 4CPBD 1BZWA 3ZIWA 5FYIA 2XG3A 5L73A 2ZGSA 1ZZ8A 4HZFA 4QPIB 4P9YA 2VZUA 4B4PA 3MPPG 3BN6A 1K5JA 1NCRA 4FFHA 4V2WA 1WCSA 2HWC3 3ZYHA 2DFCA 5JZGB 1VIWB 1SLIA 1MS4A 5FY0A 3JB4C 5HCHA 2A6YA 2RMU3 3WW3A 3KQRA 2BVBA 1ND3C 3MYXA 3WDVA 2K0GA 3EJKA 4OZXA 1NY72 1AR63 2WWSA 1F4AA 1SLBA 3WW1A 1ZBA2 5FXXA 2PAMA 1OHFA 2PELA 4EN6B 1RUG2 3AM2A 2EXHA 3H8RA 1SPPA 1NCRC 1QJX2 4IL7A 3N36A 1N1VA 5CFCA 4XTMA 3B00A 3OG2A 5CU1A 4DEVA 3HMYA 2PHXA 4W65A 4RGAA 4XFBA 5BNOB 2DWRA 3T2OA 4K21A 4W8JA 4YGEA 4XFGA 1N1YA 1YWKA 2D93A 1OC1A 2WFF1 4JAAA 4RFRB 3VD3A 2A73B 1ND2A 3GZEA 3VDCA 4KNCA 2IZWA 3ZFEB 4CDUB 2XGXA 5JR7B 3BIEA 1SFYA 4L97A 4DUXA 2QBXA 2R071 4YW7A 4OHYA 1SBEA 2K2SA 5J96B 1UYXA 2FMYA 1LU2A 3F95A 3USUA 1V6KA 1VMJA 1H6YA 4MGSA 4MVTA 1EV12 1YLLA 4OI1A 4IEZA 2PHUA 4YVSA 4UWDA 1LOFA 5CFCC 1BJQA 1VRH3 2QQOA 2MEV1 1OA4A 5K0UA 3AL5A 1D4M2 2VQTA 2A3WA 5FYCA 5DUVA 2C24A 1OLME 2ZZJA 4CDXA 1UZZA 2JDHA 1PIV1 5AFEA 4ZU7A 2XHNA 4A42A 2ARAA 3B01A 3KF5A 1ND2C 2DU1A 2YROA 4Q4Y1 2ZEYA 5F32A 4M4PA 5J7MA 1KJLA 4YGCA 4K9SA 1C1LA 4LA2A 1NCQA 4LO6B 1VBC3 2VW2A 2WDBA 3QH6A 4BQ2A 2ZZQA 5FPLA 1UAIA 2WFF2 3ETPA 2W9XA 3NJVA 1XE8A 2CSGA 1UYZA 4YZ2A 4K6BA 1EAH1 2UY9A 5IVJA 5L7OA 4BXSV 4YVSC 3O1UA 1LOFC 3I2JA 4ZPIA 2VNRA 3M8LA 4QKBA 2DYCA 5K0UC 4ZS3A 5KHGA 1BEV1 1MS3A 5CFDB 4CDXC 2ZOEB 1S4CA 4CVUA 3WNXA 5FFOC 2AH2A 2GNBA 1Q3EA 1W8FA 3VKOA 1IZ3A 1PK6B 4NIAA 1V9U3 3ABZA 5DPNA 4XBLA 5LATA 1NCQC 2ZHLA 1Q56A 4XXAA 1U5YA 3B69A 2FZ1A 3THDA 1UQXA 2DTYA 4FOWA 4KU7A 1TNRA 3M70A 3NV3A 3CBNA 3RFRA 3K3OA 2P6HA 3WQ0A 5L7OC 1R083 5BYNA 2RS52 4CZSA 4Z2WA 4MZUA 2YYOA 1QXJA 4FAHA 4PIXA 2VZRA 1CR7A 1D2QA 4JHTA 2JE8A 3J8F1 1IOAA 4YM1A 3WR0A 1BMV2 2TUNA 1RL3A 2YZ4A 3WOGA 4CUBA 5HPOA 4WV8A 4A7ZA 2A6ZA 1FT9A 2IXHA 3V0AA 4ZKTB 2W39A 4NIDA 5F1RA 1FOD2 1AX2A 4AFAA 1O8SA 5ABJB 2R063 3AXEA 2RS32 2V5YA 2VOKA 4KWLA 1W3VA 5FWEA 3BALA 4Y24A 1MR5A 5C3SA 5F37A 2HWF3 1D2SA 5C8CB 4MGQA 4RGGA 2XBO3 2WT0A 5KXCA 4MXVA 5CNAA 1HRI1 4U2AA 2RR12 2PLV3 3D0JA 2J1VA 1YHFA 5FZLA 4DO0A 5T50A 4ZZ5A 3T3YA 1UMHA 2XOMA 2OKXA 2I07B 4SLIA 3ZN6A 4JC1A 5GZEA 1UU4A 1XSRA 4S2DA 5LBEA 5FYSA 2JECA 4A4AA 2LRPA 4CXXA 1Z7S1 1UU5A 3KV4A 2Q8EA 4XTPA 3T08A 3OYWA 2BPA2 5C4WB 3A0NA 1RUE3 3ZXGA 5JCTA 4BB3A 2YFZA 2VZ1A 3PTRB 3K4ZA 4Z1VA 3IB3A 3AL6A 3R0RA 2OUHA 4PI2A 3FN9A 4XF0A 5FPVA 5IVFA 3KS7A 3ZXJA 4ZXKA 4LO4B 3IIIA 2XL7A 3KGLA 1VP6A 4IEWA 3AKTA 4BWOA 4J6GA 3KMHA 3RI8A 5CG9A 4ATFA 5FZAA 3B02A 5CKNA 4BK5A 4V1PA 1JYIA 2GC2A 4IEUA 2WO3A 5F5QA 3VBFB 4DXZA 3I97A 2QE3A 4I02A 1JZ8A 1HB3A 1HB4A 1I6XA 3ILRA 1WBFA 4RHV2 5F2SA 2BNMA 2CDOA 3W20A 4PDWC 2HWE3 1PGL2 1SLLA 3NV1A 2UU8A 2VE1A 4QGMA 3LWCA 3PVNA 4XUQA 4XBNA 1UYYA 3N7JA 4DIQA 2XLGA 2J1EA 2CAUA 4Y1XA 4S2HA 1ENQA 5TSWA 2XWBB 3B93A 5BV6A 3POBA 5FYZA 5A7SA 3RYKA 3BYWA 4P08A 1RINA 2OUJA 2Z69A 1W6QB 5J36A 4A45A 1VBB2 3ES4A 5FLJA 4KWUA 4AVSA 3C7FA 1PX4A 1NX9A 3RDIA 3Q8FA 1NA1A 4EV0A 1WMXA 4NIGA 3WHTA 5G04L 1W99A 2IFRA 4M01A 1E57A 2EXJA 4AW7A 5GZCA 5JXIA 1EY2A 4FQ4A 3I54A 3E5UA 2O14A 2QUOA 3GCWA 2A3XA 5FMBA 1AR61 1MZ5A 1YFXA 2XWJB 3A23A 4EE2A 1QMJA 3MV01 1WCQA 1S0CA 3AP7A 4BQ4A 4AVTA 2E9QA 1OQEA 4CA9A 4YZ1A 1JH5A 2F17A 1GU3A 1CAUB 2IWGB 3BVCA 2ET1A 4QQPA 3G6JB 3LOBA 3M3CA 4Y22A 3O0WA 5FZGA 1J58A 2ERFA 5LRSA 1ND3B 4LE3A 4EWAA 1NA1C 2VZOA 3KLSA 3MIHA 1W2NA 3WNMA 5KWRA 5JOYA 2R043 1OMIA 2WAOA 1VRBA 3IAQA 3RG0A 4CRQA 2IVJA 1DGRA 3LFIA 5H9QA 3N7MA 4GALA 2ILMA 1HRV2 4XF4A 1NCRB 2BDRA 4B4RA 1BHGA 4FO9A 1W90A 2X8KA 3N35A 4BYYA 1TQ5A 4LK7A 4AEMA 2D3RA 4URTA 1C8M2 3MLJA 5A7NA 2WSVA 4IGPA 1VRH1 1B09A 1N47A 2YG0A 3GYDA 1LHNA 1POV3 2ZMKA 2MHFA 1JYXA 3V64A 5JR2A 3K4AA 5HXVA 2LUWA 1JOPA 3HBZA 2PFWA 4QDSA 3WDXA 2ORZA 4HKOA 1F35A 1FPN3 3S30A 3UT0A 1VBC1 1CAVA 1ZBE3 2W08A 2A75A 2Z4FA 5FYMA 2ZABA 2HEWF 2WQ8A 5CADA 1RMU3 4CCKA 2AEYA 1DYPA 3WQ1A 4D6SA 1QXPA 2QCSB 4N43A 5B4XA 2VUDA 1CPMA 1UD1A 2AACA 4AAXA 2E6VA 1RUC2 1U12A 2VUAA 2LS6A 5T55A 3CNAA 3SNMA 3AKQA 4DQAA 1VB2A 5I0DA 3FUQA 1BBT2 1QF3A 3VD7A 2XONA 3WINE 2YB7A 2CYFA 1ST8A 2HEYF 1UL9A 3D82A 5FZ1A 3EHKA 1V9U1 1AXZA 1REEA 3USUB 2WS91 1IG3A 2XJQA 4FI9A 4UT5A 2RG4A 4WVZA 2RHPA 2GU9A 4RS5A 4YVSB 5FZMA 5LBBA 4BCUA 1W6NA 5K0UB 1V00A 1GZCA 2E26A 4FP3A 4MOAA 4N43C 4CDXB 1BVP1 1O5UA 4N8MA 3OJBA 5IUQA 3M4FA 3GNEA 4AFDA 4JKLA 3ZKUA 5D2AA 5AVAA 1NCQB 2PHWA 2C1FA 4AK3A 4IETA 3WF1A 4NHKA 5CB7A 3ZPYA 4BE3A 3VKFC 4IE5A 5JXJA 3NNJA 3MBWA 5L7OB 1Q8QA 3AVSA 4RS5C 3IPVA 2R061 2WO7A 1W9YA 1DU3D 2RV9A 4YPJA 1JZ6A 2HLEA 4DY3A 2WS92 4MXWA 4QHOA 4MGKE 1VLNA 2HWF1 3U1XA 4U36A 4EJRA 5FOBB 5CG8A 2YC4A 3PUQA 4PLNA 2YU1A 2PLV1 1TG7A 2A71A 2XJSA 4GWMA 4EZHA 2GNTA 2BGOA 2LW8A 5FREA 2FDKA 1CVNA 1AXKA 1POQA 2WYSA 3LDRA 4JQRA 5FAXA 4Z92B 3ZYPA 1MS0A 2Z2SB 5H9RA 5C71A 1T6GC 4XUOA 1RUH2 4XJAA 2VM9A 4IV1A 1GKBA 2EAKA 2CDPA 1RUE1 1IS4A 4AWDA 3O0XA 1ZX5A 2VU9A 4D94A 3VBRA 2HKXA 4XMIA 4XF9A 2WBKA 4H3WA 2G9GA 3AP4A 2NP0A 3ZFGB 4UFLA 1EYBA 4JGZB 5LWBA 3ZMOA 4LBJA 1QQP2 3H8UA 2G4IA 4INDA 3W21A 2PAEA 4KGGA 5JZGA 2Z5WA 3HQXA 2Y0IA 3SH4A 4IDZA 4IV1C 4ZY9A 5C3PA 5FR3A 4BJ0A 4H2AA 4I3PA 1AYM1 3PU8A 1XB9A 2P4EA 2R0HA 4W6XA 5FKBA 3SHRA 4NR1A 3AP9A 1OT5A 5DG2A 4GWNA 2HWE1 1DGRN 3PUIA 2B39A 3FBYA 2Q8OA 2ARCA 3VBRC 3WP4A 3T0AA 4AVBA 4OFGA 2P3IA 2ZX3A 4Q0SA 1AHSA 2WN2A 5DG1A 1WWYA 3ZVXA 1YQ2A 2JEMA 2H0BA 4Q1RA 1XNDA 5FYTA 1OA2A 4ARYA 5LK7B 4FVVA 4PBOA 5FZEA 3WG3A 4COWA 3OYWB 1W28A 4CTEA 3BCWA 3KF3A 2AREA 1ZBA3 2R49A 5JZGC 5FDBA 1K5MA 2JXAA 3AZWA 5L9RA 1RUG3 2N7GA 3POGA 4PDWB 3MICA 3U37A 1S55A 4RD7A 1VB4A 2IVIB 4RGKA 3INAA 1QJX3 1FV3A 4UFHA 2JDUA 3VB9A 1H1MA 1JZ2A 4HK9A 5LEKA 4TXWA 1ULEA 1RUNA 1UXZA 3RGBA 3ZFEA 4CDUA 1AYM2 4CU8A 3UKNA 1WW6A 2XJRA 1H8TA 1N3PA 1ZVFA 2J1TA 2X53S 1SMVA 1YQ6A 1LODA 5EV7A 4JRLA 4NIHA 3AJZA 2ZMNA 4GWJA 3OBAA 4EWEA 4EYUA 4IE6A 1ZZBA 4IE4A 4Y1ZA 1KRIA 3A22A 4M00A 1K5MC 5IVBA 2DVFA 2JD4A 5JPNB 4XIKA 4BIOA 4ET7A 5FZFA 4WZCA 3BTXA 4UW4A 1BMV1 1EV13 1LOGA 4Y5SA 5DZFA 3ZFEC 4CDUC 2EIDA 4S2FA 3TEYA 3C7GA 2FCUA 1SLCA 1BYHA 5KHIA 2DVDA 1J1LA 1D4M3 1H8TC 4I0AA 4NPRA 4DRRA 3NSTA 2YC0A 4D3WA 1CJPA 5FV3A 2GP3A 1I1EA 3ACFA 5IVEA 2KR2A 4AZZA 4PLMA 2CWMA 4LO7A 1NA1B 3PNAA 5FOJB 2ZPXA 2W52A 4XYXA 4YRDA 5EXOA 1QJZA 1WD4A 2JD9A 1F9KA 1POV1 2QDNA 2WWUA 2EIGA 3ECQA 3LIGA 1DGLA 2UWAA 2WFF3 4IE0A 2TNFA 2NMOA 4L92A 3ZO0B 1W8UA 1C5HA 3IDCB 1NLQA 2HH9A 2XKPA 5CA6A 5K7PA 2D3PA 2VBPA 5ERLA 4NVPA 3H7YA 2ZX1A 1ZBE1 1YJLA 2F6BA 1PZ9A 4X6RB 3MUY1 1YUDA 2WZEA 4X8PA 2MEV3 3S57A 5FLHA 1JYCA 1HKDA 1UIJA 2Q1ZB 3I2HA 4I01A 4IGQA 2FD8A 5FQ0B 3KT1A 3IDAA 4AHWA 2K9ZA 2VY0A 5GLTA 2D6OX 4HN1A 3FX3A 1M06G 2JICA 4YWAA 3KD4A 4ATEA 2RS53 1ASJ1 4B29A 1WKYA 2OQ6A 2JE7A 1KQRA 1LTEA 3J4UH 3RYPA 1XU2A 2Q0AA 4E2SA 3ZSEA 5IYYA 1OQDA 1YRZA 3PTYA 1S2EA 2C9AA 1GP5A 1LECA 4Z82A 5CZKA 4QXKA 1G9BA 4AE2A 3WDYA 2WAAA 3E1F1 4CXWA 5I0SA 1FOD3 5C8CA 5FY1A 5C5UA 1CJDA 1PMHX 4YARA 1QNYA 2PAKA 5LA9A 4Y26A 1IS6A
chains in the Genus database with same CATH topology
1X7NA 5I8SA 1CAVB 2E53A 4BMBA 1PZ7A 3HD8B 2WSUA 1PNFA 5I0RA 3B9CA 3QOPA 2RR13 4N43B 1ASJ2 1LHWA 4Q4V2 4K1ZA 2HYKA 3AP6A 5DZEA 5C8CC 4UW3A 1V6NA 4YGDA 2CL2A 2H0VA 3AP5A 4IESA 5T5OA 3C2UA 2ENRA 3GZTB 2D6LX 2DCTA 1DYKA 2B42B 3AZXA 4PCRA 1OLQA 3WUDA 2UY8A 1X82A 4JTOA 5F9TA 3OD0A 2EF6A 3N4MA 2D6MA 1CQ9A 1DQ6A 2ETEA 5I91A 2R30A 4MGYE 5EZWA 1G7YA 2ARBA 3AZYA 2X5IB 1QH6A 3GBFA 3RI9A 1AVBA 4FPCA 5T5LA 3TBDA 3MLLA 4YLZA 4RHV3 4ZU5A 3BTAA 2XJVA 3RZZA 4Q8KA 3QCWA 1GBGA 4MXWB 1PO22 1OFSA 1MS1A 3B94A 4FPLA 3UKVA 1RVF2 3R4UA 4AI8A 2A3YA 1VBB3 2HWD2 1GLHA 1MVEA 2VNGA 4GMP3 4M3CE 3WG1A 4DMIA 4EN8B 1GQGA 5KXEA 1XYNA 2GC1A 1OOPB 3X29B 2WKKA 3BPZA 4WVMB 3A4UA 2JDZA 3ZYIB 2KM2A 3N3HA 3POYA 4IV1B 1SCSA 4XILA 4YW5A 4B7KA 1ZBA1 1RUF1 1RC6A 1Q43A 1ND3A 2LM3A 3MIDA 3RWNA 1VAVA 1LOCA 1RUG1 3BB6A 3P3PA 3PMEA 3VBRB 1QJX1 2GMMA 5KBFA 4PF5A 1PZ8A 2VW1A 1Z78A 3FC0A 4J1XA 2WZPP 3WDWA 2WT2A 4K3UA 3U11A 3ACLA 2DVBA 5FO8B 4YZ3A 1XU1A 3BIWE 3VN4A 1ZNPA 2I45A 3A0KA 4CEYA 1YYNA 1HRV3 2QQPA 1GR3A 1VBE2 1DQ5A 2JX9A 4CP1A 1QH7A 1EV11 1C8M3 1RUF2 1ZRRA 2KA3A 4O9GA 4QM9A 3ASIA 1O7FA 2ZKLA 5GZDA 3N7LA 2Y26A 1WD3A 2D3SA 1D4M1 2D40A 4JTNA 3T1MA 1W6PA 1K5MB 3IBMA 1S2KA 1ULDA 1A78A 3UKTA 3VUOA 4CEYC 4YGBA 1QJU2 4XF3A 4HN0A 3EO6A 3W59A 4Q2FA 4ES9A 3EBRA 4P9LA 1MEC1 1R091 1TE1B 2A6VA 1QOTA 1NOVA 4P9GA 3K48A 1XXNA 1OKQA 1H8TB 4RQPA 1H9WA 2DUQA 1TMF2 1TME2 1G9FA 2YGLA 3WUCA 3WHUA 1RUC3 4ORFA 3J26N 3SCHA 2TBVA 4LO5B 5FPXA 1HQNA 1SDWA 4KWJA 4WBBA 1BBT3 2VOWA 4E4DX 4C0HA 3M1HA 3AYCA 4RSUA 3HN1A 5D8AC 3DL3A 3OGGA 3H1WA 3WQ7A 3NO8A 4W6YA 1QDCA 4FP2A 5A3LA 2VVFA 1Z0HA 4FPKA 4GKXA 4Q26A 2ET7A 2RS51 4RQPC 2OPKA 1LB2A 1MEC2 1R092 4LR4A 4AVCA 4Y1VA 3NKGA 4MGIE 2BFUL 2QDRA 4NWWA 1NYWA 1UPSA 3M3OA 3WY6A 1D0GA 2RS12 2IFWA 2UWBA 5JSRA 1F8VA 3ZDSA 1H4HA 4Q0UA 4QU2A 1FOD1 1O4YA 1XRUA 1TEIA 1X36A 1CX4A 4PQ9A 1IQAA 4QGLA 2RS31 4LBLA 3IDBB 2WS93 5JOZA 1W6OB 2NZ9A 3MLKA 2ZHNA 3GZUC 2BUKA 4NOTA 2CGOA 2RR11 3IM0A 2CY6A 1HV0A 4XBQA 2P3KA 4KG0A 1DF0A 1RUH3 4LULA 3RYRA 2ZGOA 2Z42A 3R05A 2ZBJA 3ZFGA 2LALA 4JGZA 4XJZA 5KC5A 3WLUA 2ZGRA 1W0PA 5KC6A 2B9UA 4AGRA 2ZX4A 3CJXA 4OUSA 4YYOA 2I2SA 5BNQA 2GN3A 2GZWA 2ZGQA 4FXKB 5EWSA 3POSA 3L2HA 4LBQA 2VVEA 4LO8A 4COUA 2FMDA 2WFPA 1PHMA 2XB6C 1H0BA 3H1YA 1VJ2A 4I2OA 4YSFA 3ZFGC 2FBEA 4HL0A 4JGZC 4RHV1 4AQ6A 4F7ZA 2B5HA 3LOIA 1PGL1 1RTVA 1X8EA 4MUVA 2QKDA 3CF6E 4K20A 2Y38A 4AQ2A 4Q4X1 1HDKA 2VECA 4Q8LA 5EYXA 2BGCA 2WIIB 4PDWA 4A2UA 5AFBA 2XVKA 4YM2A 1VBB1 1LJ7A 3SLIA 4EN9B 4GMP1 1AL22 4LA3A 3VZKA 1FNZA 2D7FA 4G9SB 1C1FA 2C5DA 3BOPA 5GZFA 4LBQD 1PO12 4QQOA 3TWIA 4XW3A 5BY5A 1G86A 4KWKA 4XIOA 1ZZ7A 1QNWA 4JGYB 2D97A 1WUVA 1MVQA 4XJWA 4FPJA 1DHKB 4XETA 5JDBA 2AR6A 4D7YA 4TLFA 3Q9OA 3RMYA 3VL8A 3JQWA 1AYM3 4E4ZA 2UYBA 4XXPA 3ELNA 3ZSJA 5GLWA 1RGSA 5D1IA 3AZZA 1XNBA 3ZN5A 4XJUA 2DF7A 2ZS6B 4DPNA 4IXLA 4DFSA 4Q4X2 2DVAA 2ZHMA 3H7JA 5DDJ1 5CBLA 4YFZA 3FLPA 2WNVA 2XL9A 1OPMA 1MZEA 3I7DA 1DQ4A 3G7DA 2DCJA 1QHDA 1CN1A 1EP0A 4P5HA 4Q29A 1HRV1 2NQYA 2ZKNA 3MDPA 3I8TA 4IEVA 3UK9A 4HPKA 2ZACA 4ASMB 5C33A 1HIXA 5CAZA 1U5IA 4H7MA 1C8M1 4CYDA 1PNGA 3AKSA 2WA4A 4B4QA 2EVXA 3E5XA 4N53A 5I0TA 4Q0QA 2NYYA 1YI7A 3C3VA 3H3ZA 4K7JA 3DF0A 4G3YC 2WNVC 3LCPA 3GBGA 4AXOA 3AMMA 1ZM1A 5DDJ2 4IERA 5FQ0A 3VBUA 3FBMA 2BVVA 1W0OA 3WW2A 4NO4A 1HXS2 2XLFA 4I09A 4XQ4A 3FFQA 1H9PA 3TYJA 3VHRA 1M4WA 3LSEA 4XEZA 1H2KA 1RUC1 4N53C 5I8YA 4HBNA 3WCRA 4CEYB 2P37A 3UJQA 1BBT1 4DY5A 3BODA 3E6DA 1AXYA 4XQWA 3VBUC 4Q0VA 4AQTA 4Z8BA 4MGZE 5ACA2 1YXWA 4JDNA 1CPNA 2GALA 3ZXEA 1SCRA 1POV0 2E7QA 1UIKA 4HETA 5F6KA 4M0HA 5GJ6A 1W6PB 3ES1A 1LESA 5K8SA 1JN2P 1AX1A 1PMIA 1CAXA 2DCKA 4RR3A 3O5SA 4DINB 2QZ3A 5D8AB 2TEPA 3ATGA 3D6EA 1RUOA 1U5ZA 4RQPB 1H2MA 1ASJ3 4Q4V3 2B46X 1IS3A 1WCKA 3V56A 3UV9A 1ZZ6A 2FQPA 2WLQA 3WV6A 2BBVA 3ZYGA 2VMGA 2HWB2 2O0OA 1UU6A 1RHI2 2WNUA 3JB8A 1AR92 1FATA 4LE4A 5FTTC 1SLTA 4RR3C 1OPOA 2WZR2 3B9IA 3DGTA 3M7AA 5GLVA 1RUH1 4BM8A 2X5IA 2VMHA 1MACA 2D98A 5DUXA 1NXMA 1KDKA 1OA3A 2ZGLA 1N3QA 2E7TA 3AMHA 2O1QA 2WNUC 4DB5A 4P9XA 4KH9A 4YZ4A 1QQP1 5E16A 4XF1A 1UKRA 2W68A 2X5IC 1RB8G 3MIBA 4YM0A 3THPA 1F5JA 1PO23 2CV6A 3DPRA 1OOPA 4I3GA 1V6JA 4WVMA 4PJYA 3ZMOA 2R32A 1JBCA 1RVF3 2PHDA 4JDOA 2HWD3 1COV2 4FAGA 3N7KA 5IK7A 4YG3A 3R4DB 5I0UA 1HX6A 5H9PA 3TNPB 2Q5TA 1LRHA 4YFWA 1V6MA 1DZQA 5L19A 2ZX0A 3PJYA 1S0GA 4ES8A 1BCXA 2D6KA 1QY4A 1FMD2 1F31A 1PVC2 1QDOA 2VGDA 2O8OA 4LLFA 3VBHB 4LHLA 3BU7A 1H4GA 1XYOA 2RM21 4RFT0 5FO7B 3W9AA 1ENSA 3DPRC 1OOPC 4KL1A 5BXXA 3AMPA 3I2DA 3MF9A 1G8WA 3ALQA 1S0FA 1JOJA 1GNZA 4FTEA 3FMGA 2X29A 3ZYRA 4LHNA 1G6NA 1IPJA 5LEJA 4OUMA 5GALA 1IPKA 2DV9A 5IK8A 3M3QA 4L99A 3CEWA 1PGW2 2NLRA 3MPBA 4LBQB 1DZTA 4M0NA 1W2UA 2Q1MA 3OCPA 1I3HA 4BPZA 1Y7BA 2GNMA 1ULFA 4A7YA 1VBE3 4Q27A 2XBO2 2I74A 1YJKA 3MW2A 4JDMA 3WW4A 1C28A 4D7TA 4UW5A 4CDWC 4F3JA 5DZGA 1RUF3 2RM22 3IWZA 4AGGA 2PYTA 2VXRA 3H50A 4ZU4A 3MGUA 2R0FA 4AFCA 2P2KA 4HVRA 3TN92 3QBQA 5J3UA 3QD6A 3R4SA 4BLIA 3SCFA 1QJU3 1XNKA 1HW5A 1CAWB 1IS6A 2CTVA 4K8FA 1OSGA 3NV2A 1LHVA 4QX5A 4Y4YA 5JAXA 1GV9A 5C9AC 1UKGA 4DS0A 4QT6A 1HLCA 1TMF3 3RQ0A 1TME3 4TWTA 2Q4SA 4TYSA 1WBLA 4LBOA 3MIGA 1PVXA 4UBHA 3OGJA 4R4XA 3AK0A 4XE9A 1X33A 4IV3A 1VBA1 3JZVA 3ME2A 2YY1A 1AJOA 2PHTA 4LUKA 2WNVB 2CAVA 1AR72 1RJ7A 3NVCA 4CDQB 4YNIA 1KFXL 3I4IA 5GKAC 1VBD2 4S2GA 4HPKB 1MEC3 1R093 1RUI2 3U0ZA 4HKWA 2XLAA 2B8MA 4BZ4A 4CP2A 4IV3C 3VZLA 3VBOA 2RS13 4N53B 2PHFA 1W6OA 3ZIXA 1AX0A 2VULA 3L2YA 4AI0A 5JI9A 4LTAA 1VBA2 3MIFA 1EPWA 1XQNA 3VBUB 3JCIA 1O91A 5GLUA 3D4KA 3KSCA 1DQ1A 5J48A 1OFNA 3WDTA 5A33A 5AVPA 2YUEA 4KGQA 5E89A 2VMIA 4Q4V1 2GDFA 1WA4A 2ZHKA 3VBOC 2BFUS 2JKBA 1BXHA 2R042 4I0BA 1X8MA 3JU9A 5A3MA 2ZGNA 2H6CA 3VKNA 1GICA 3L9JT 2GH2A 3KT4A 4H7LA 2BEOA 1S2BA 2BTVC 2EAAA 4JV4A 3LSDA 4FTBA 1C5IA 4AVAA 4GB32 4LBKA 4NWVA 1KXGA 1CD3G 3TOJA 3U4XA 2VOVA 1JXNA 3IKWA 4C1WA 1RUD1 4MLOA 4HVQA 1CAXB 4RR3B 4YW3A 1ENRA 4D7SA 5CIRA 1MZFA 2E63A 4FOVA 4YM3A 1YNAA 1OD5A 5K9YA 4LBNA 1DQ0A 2IC1A 4AI1A 4P14A 4GA9A 1PO21 3V65A 2BWAA 3O7OA 2SLIA 1QJY2 4FPOB 1UN1A 1A8DA 3U07A 1RVF1 4JGYA 3ZX7A 4KBBA 5JOXA 3VGIA 4L9BA 2HWD1 2VH9A 1AL23 2BYVE 2WNUB 3WVJA 5JMCA 2DU0A 3JBG2 3JUUA 4XFHA 1PO13 4N7UA 1Y3TA 2OW4A 4YVWC 1J59A 1W6MB 5BNNA 2WC2A 1RUD2 1Q8SA 5EJ3A 1YIFA 4N7IA 3FLTA 1ULGA 1YFUA 4FXGB 3VZOA 1IS5A 1WW5A 2OA2A 3OD4A 1QKQA 4FPHA 4IEPA 5FCCA 1S0JA 3RS6A 4JGYC 3KB5A 4F8AA 1AYN2 3WD5A 1V6LA 1DQ2A 2GN7A 2GAUA 2P17A 4Q4X3 4BIFA 2AENA 2UYAA 5FBZA 3FWEA 1NQDA 4AI3A 4M3CA 2JG8C 3S7EA 1KS4A 2Q30A 5BNNC 3M3IA 3ROUA 1LR5A 3MIEA 3DPRB 3CO2A 4OHVA 2Y0OA 3V0BB 4Y20B 1B35A 2WJSA 4AG4A 3ZN4A 1SFNA 2WL1A 3ST7A 1LOBA 1VBE1 1AL0G 1LGNA 4GMP0 5JIAA 5HCFA 3TRSB 1W39A 2VW0A 4BMEA 2XH6A 3NJZA 1RITA 1O5LA 1XNCA 1XYPA 5EYYA 2AZ5A 4YG0A 3WP3A 4B3NA 4HLTA 2BQPA 3UL2A 3K51A 2BWCA 4FT8A 3SITA 3E6CC 1OI6A 5DDJ3 1QJU1 4R4ZA 4MYEA 4OHZA 1B35C 4CDWB 2ZCWA 3POWA 1HXS3 5JSOA 4LNVA 4COYA 4N9HA 3SH5A 4BQ1A 2HJIA 4BLJA 3NWKA 1TMF1 1O3QA 1TME1 1H1IA 1WLDA 3IIAA 1BVVA 2ES3A 1IGOA 5GZGA 5E8AA 1N3OA 1AR82 3OF1A 1F5FA 4L11A 5C9AB 3U10A 3IMNA 4COZA 4ONUA 1R1ZA 4MV2A 4R52A 4H14A 1RUJ2 1FYUA 2OIIA 5ACA3 2QFEA 4HVOA 1Q8PA 1FNYA 4XDQA 5D8AA 3ILFA 2JJ6A 3IT8A 3TNQA 3T1LA 4XHBA 3LGRA 3AMNA 1J3PA 1GZWA 2RS11 3JD72 2PHLA 3APBA 3QACA 2VOXA 1VAMA 2GMEA 5KXDA 5T3NA 1IKQA 2EXIA 1BKZA 2D44A 4AEKA 1JW6A 4BA6A 4JVAA 4AHYA 1MQTB 2A5ZA 5IK5A 2VUJA 3VDDA 2DTWA 4XMAA 5GLZA 4IV3B 2HWB3 5FMOS 3FZ3A 1NE4A 3PMSA 1OLRA 1X50A 1RHI3 5BPXA 1WGPA 3M3EA 1AR93 4XFIA 4PIZA 4FCAA 3KM5A 4Q4W1 2WZR3 3B5LB 4EWDA 1MS9A 2VVDA 4XFAA 2RJKA 3LKJA 4IEXA 2R1DA 2D6PA 5B2GB 1FI2A 2A6WA 1A3KA 1ZYBA 2QJVA 1H2NA 3VDDC 1MS8A 1FXZA 1D0HA 3VBOB 2UWCA 3ZMNA 4Y5Z0 4GULA 4R9BA 2YMZA 1WW4A 1YCIA 1V6IA 1J1TA 1APNA 2R072 3ZXKA 3ZXLA 2OYZA 3RSJA 3FE5A 4Q4W2 1REFA 4IEQA 3ZYJB 4C90A 4L8QA 5A33B 5LRRA 1R1A1 2MEV2 1COV3 4TZDA 4AQSA 3I59B 3AMQA 2DUPA 2V73A 3OBTA 3VBHA 1LOEA 1PIV2 5E88A 2IXLA 1UCXA 1A6CA 2PA7A 3SH3A 1UW8A 4Q4Y2 2NMNA 4HMZA 4E2QA 1KD7A 1FMD3 1PVC3 1AL21 3AKRA 1CGPA 3NV4A 3NL1A 2DCZA 3VHOA 1PO11 2JG9B 5AC91 1QQP3 3DKWA 1EAH2 3RRDA 2NM1A 1J3RA 1AJKA 3WG2A 4BHPA 4ISRA 1NLRA 3VBHC 5BNPA 5KHHA 3MZHA 1BEV2 1U5XA 5HI0A 3D5OA 5E1RA 2AGSA 2VQAA 1R1A2 1VAKA 3AXDA 1WMEA 5I93A 1G9AA 1RIRA 2GNDA 3B7MA 4EN0A 2R1BA 3OTFA 3J9SA 3VZMA 1ENXA 4OI4A 4QMAA 4YVWB 1KFUL 1DLLA 1VALA 4YG6A 3CU7A 2R16A 3FJSA 5J98B 4AEDA 2RM23 3OY8A 3WG4A 2A7AA 3O12A 5BNPC 5AC92 1UZYA 1CAWA 5FO9B 3VL9A 2ZGKA 3TN93 2H6BA 3J8F2 4XOGA 4LUMA 5BUVA 1SLAA 1YIPA 1C57A 1S0BA 2AUYA 5HBAA 3ZSLA 4WM7A 5JIUA 2JG8B 3D0SA 5BNNB 1SQ4A 4BOWA 4HSJA 4K1YA 3VZNA 4AEDC 5JLVA 5H9SA 3KCCA 4C0BA 3NW4A 3DUIA 1ALYA 1GQHA 1HRI2 1DG6A 2A6XA 1HXS1 4CDQA 2VPVA 4Q0PA 2CWSA 4WM7C 4M3CB 1Z7S2 1HQLA 5A32A 2QNKA 1SEFA 2GC0A 4NHMA 1XE7A 1LGBA 3RMXA 1AR73 4AHZA 2D5HA 1B35B 1DFQA 1V70A 1VBD3 2B45X 4AHXA 2HWC1 3AYEA 4QHBA 1RUI3 1WMFA 2YHJA 4UBGA 2GMPA 5EFUA 4CTEA 4ITCA 3ETQA 4LT5A 3NAPA 5ACA1 4XJ8A 2RMU1 1N1SA 4QPYA 4CDQC 3RNSA 4DZGA 1JHNA 3OPZA 3E5QA 3FLRA 4R9DA 3VBSA 3ZXFA 2PTMA 5C8WA 1KJRA 4GH4A 4GKYA 1KS5A 1GZ9A 1VBA3 3ZSMA 1LCLA 2D5FA 1O3RA 1WMDA 4R9AA 3EQEA 4MH0E 4HFSA 4NN0A 4AGVA 4CEWA 1GANA 1O3TA 3FHIB 1QOOA 3WP5A 1G9CA 3NAPC 4WVWA 2HWC2 3H9AA 4K40A 1SBFA 3VBSC 1ZRCA 1JUIA 4LLOA 1LHOA 2F4PA 4EROA 2HWB1 2RMU2 2GH8A 5T5PA 2ZTNA 4FSJA 3D8CA 1RHI1 2XJPA 4GH4C 1I9RA 5FMOL 5IT6A 1AR91 2QVSB 1GSLA 3AB0A 4NHLA 1AR62 2WZR1 2PQQA 4IQPA 3WX5A 1U0AA 3H1MA 3SISA 4CEWC 2EA7A 2XJUA 1WLWA 5FRAA 3USSA 3AJYA 4H55A 4OHWA 3ZXAC 4GB33 1V6OA 2E7AA 5J37A 5T54A 4PLOA 3ZXDA 2ARXA 4BH9A 3B3QE 1GZWB 5HCBA 2DURA 4Y1YA 3W58A 3UJOA 5CFCB 1LOAA 1NQJA 5DUUA 5JSPA 5DUWA 2ZGTA 3CJIA 5JWPA 4FOYA 1QJY3 1Q8OA 3VDDB 1ND2B 4I0WB 1LHUA 1VRH2 1W6MA 5J09A 1COV1 3WZ1A 3CLPA 3M2MA 3JBG3 3O14A 4GQ7A 4PBPA 1REDA 4OI2A 1QGLA 4LHKA 1RUD3 3HIFA 3THTA 4YW4A 1FMD1 1R081 1PVC1 2ZGMA 5KXBA 1VBC2 3CJIC 4FBFA 4OI0A 3LAGA 3VHPA 3VHNA 4B7EA 1AYN3 5CVRA 1KDMA 1O4TA 3MF6A 1G9DA 1ZZCA 4GXLA 4E4SA 3V0BA 4Y20A 1JUHA 1ONAA 3H0OA 3NKTA 1PGW1 1V9U2 3MEPA 1D4VB 2V09A 4QPGA 1BQPA 2XBO1 4OLLA 4QQLA 1H30A 2ZX2A 1R082 2GSYA 2JENA 3HT1A 2P3JA 1DIWA 1Y9QA 4WM8A 3GHMA 1O3SA 4AEJA 3OBRA 4TSVA 3E6BA 4HSLA 3WXPA