1DGRA

Refined crystal structure of canavalin from jack bean
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
178
structure length
178
Chain Sequence
NNPYLFRSNKFLTLFKNQHGSLRLLQRFNEDTEKLENLRDYRVLEYCSKPNTLLLPHHSDSDLLVLVLEGQAILVLVNPDGRDTYKLDQGDAIKIQAGTPFYLINPDNNQNLRILKFAITFRRPGTVEDFFLSSTKRLPSYLSAFSKNFLEASYDSPYDEIEQTLLQEEQEGVIVKMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Plant protein
molecule keywords CANAVALIN
publication title X-ray diffraction and atomic force microscopy analysis of twinned crystals: rhombohedral canavalin.
pubmed doi rcsb
total genus 39
structure length 178
sequence length 178
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1999-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00190 Cupin_1 Cupin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1dgrA00
3SCGA 4XFGA 1OI6A 4I01A 2XGXA 2H6CA 1YFUA 5BV6A 4AQ2A 5K8SA 2GU9A 4O9EA 5JAXA 3U10A 2O8QA 1Y3TA 4IEUA 3ES1A 3IDCB 4XETA 4PIXA 4R52A 5BXXA 4HN0A 1ZVFA 5E16A 3RNSA 5JCTA 1CAUB 3H7JA 3NSTA 4IEXA 4I0AA 3LOIA 4IEZA 1O3SA 1ZNPA 1GQGA 1YWKA 4IEOA 1J59A 3D0JA 2K9ZA 3RYKA 3M70A 4META 5I8TA 3IIAA 4N9IA 3NJZA 1X82A 3ST7A 4QGLA 3JZVA 2HJIA 1ZRRA 2MNGA 2MHFA 4CYDA 3DL3A 1J1LA 3UKTA 4MZUA 4AVBA 3MPBA 3QOPA 5KHGA 1UPIA 3E6DA 2D5HA 2D93A 4MUVA 1FT9A 3BB6A 1LR5A 4OFGA 3SCFA 1QXRA 3RYPA 5CVRA 4WVZA 1YUDA 5FLJA 5KHKA 1O7FA 3ETQA 1RL3A 5FCCA 1DZTA 4MX3A 3NL1A 4QGNA 4I02A 1O4TA 1CAXA 1O5UA 5I0TA 1RTVA 3H1WA 2IXHA 3RZZA 1UIKA 1ZZ8A 1XE8A 2MPFA 4MGZE 1O5LA 5I8YA 3LAGA 3EHKA 3CO2A 4QX5A 3ELNA 4UBGA 5FPXA 1X8MA 1H1MA 2B9UA 2IXJA 4I09A 5I93A 3BU7A 3OGJA 3KCCA 1V70A 4YNIA 1X8EA 2D40A 5I91A 5JSOA 3O14A 3E6BA 3EBRA 4MGKE 4R8HA 3EQEA 1OFNA 1YFXA 3HQXA 3GBFA 1CAWA 4EV0A 3USSA 4FAHA 3LA3A 1QY4A 4J1XA 3H8UA 2BNNA 5KHJA 4LA2A 4HBNA 3B02A 2WC2A 2UYAA 5BUVA 3UKNA 2V09A 2Q30A 2B5HA 3E5XA 3FHIB 4JVAA 2PYTA 2ZKLA 5CU1A 3R6SA 1YLLA 1WGPA 1O3RA 1SEFA 4AVCA 1DGWA 3N4MA 2UY9A 4IEPA 3FX3A 3BCWA 2GH2A 5JR7B 3FJSA 3OF1A 3KSCA 2ETEA 1OMIA 1CAVB 1GQHA 3H3ZA 3ROUA 2OA2A 4QM8A 5JSRA 3IWZA 4K8FA 2VQAA 2KXLA 4YSFA 3DKWA 2XKPA 1VP6A 2PFWA 5FDBA 3CL1A 2CGPA 3D82A 1LB2A 1OD5A 5EZWA 1CAUA 4PIYA 4Z07A 1RUOA 3FE5A 4L11A 4BIFA 2PHDA 5KBFA 1FXZA 2VPVA 4IETA 4XF1A 4HSLA 1CGPA 1ZZBA 1WA4A 2IC1A 3NW4A 3S0MA 5I0RA 5FQ0B 1ZZ9A 3GYDA 4ZU5A 3U11A 4KWKA 4YRDA 1RC6A 2QCSB 3RYRA 5LEKA 3PNAA 4F8AA 1G6NA 3CLPA 1ZZ6A 3H1MA 2BNOA 4HN1A 2P17A 2Q1ZB 3H9AA 3KGZA 4Z82A 4IESA 5I8SA 3CEWA 2GAUA 4D7SA 2XL9A 1PMIA 4RD7A 5HI0A 4L2NA 5FLHA 3MZHA 4LEJA 2XLFA 4HVOA 3KGLA 4ONUA 4JTOA 4XF9A 1YFYA 1DGRA 2ATFA 3HIFA 3H7YA 3RDIA 2DCTA 4N9HA 4AQ6A 2IXCA 2OPKA 1Q43A 4MGYE 1XRUA 4TLFA 5KHIA 3E5UA 4BYYA 5J48A 2QNKA 3LZZA 2PAKA 2XHKA 5I0SA 3ZDSA 4QGMA 3S7EA 5JSPA 1Y9QA 3I54A 3IBMA 4KU7A 4HLTA 1U12A 5C8WA 4ORFA 3HT1A 4XEZA 5KHHA 1H1IA 3EO6A 2XL7A 3WW4A 3DV8A 2XLGA 4LUMA 4UXAA 3C3VA 1HW5A 4EWEA 2PAMA 3FZ3A 4IEQA 2Y0OA 4HZFA 2QJVA 1LKNA 3BALA 2H0VA 2C0ZA 2VECA 4MH0E 4JV4A 4EROA 2QVSB 1Q3EA 1IPKA 3PVBB 5LRRA 3QACA 4UBHA 1ZRCA 4Q0UA 4ZU4A 1XE7A 2OZJA 5LEJA 1RUNA 1ZZCA 1J3PA 3KMHA 1CAVA 3ACLA 4IEYA 5D1IA 5I0UA 3LA7A 4KL1A 3LWCA 3NKTA 1CAXB 5E1RA 4LA3A 2ET1A 4I2OA 3BPZA 3DN7A 4B29A 3HT2A 4FBFA 4XF4A 3SMHA 1FI2A 4ZU7A 5AVPA 3WW2A 2BYVE 2CV6A 4Q0PA 3VHRA 1X7NA 4HVRA 4XF3A 1ZREA 2PQQA 4MV2A 4QXKA 1ZRDA 2GC2A 4WZCA 3M3IA 3UKVA 4XFCA 4MGIE 4IERA 4KU8A 4FAGA 1CAWB 2EVXA 5BY5A 5FQ0A 1YHFA 1J3QA 4XFIA 3OD0A 4JTNA 4GULA 1EP0A 4E2SA 4E2QA 3RPQA 2I45A 2UY8A 2Z2SB 1QXJA 1SQ4A 4XFHA 1NXMA 3LA2A 3PLQA 1ZRFA 1JUHA 4EWAA 3WW1A 2GC1A 5CADA 1UIJA 3OTFA 1NZCA 4J1WA 4LULA 3I59B 3EJKA 3SXWA 1SFNA 5J3UA 2EA7A 1RGSA 2F4PA 3H50A 1IPJA 2WFPA 3SHRA 2BEOA 4HMZA 1I5ZA 3G7DA 4KWJA 1L3JA 2CAVA 4OLLA 1NE6A 5FPZA 3SCHA 4HVQA 2BNMA 1WLTA 4QM9A 2FQPA 3IDBB 4I0BA 4KWLA 1ZZ7A 1O3TA 1LRHA 2GC3A 3OCPA 4PIZA 1UD1A 2Q0AA 2ZCWA 3I7DA 3CF6E 2HKXA 2OYZA 2XLAA 1J3RA 4QMAA 2CAUA 3E5QA 1DZRA 1QWRA 3L2HA 5F1RA 4XFAA 2ET7A 2UYBA 2FMYA 3NVCA 2O1QA 4Q0SA 4P9GA 2OZ6A 2PTMA 5J7MA 3FWEA 1UW8A 2XKOA 1VR3A 2PA7A 3CJXA 5BPXA 4A2UA 4Q0VA 4BHPA 2Z69A 4O9GA 1CX4A 2IXKA 1EPZA 1J58A 4XFFA 5LRSA 2GZWA 3WW3A 5EFUA 1I6XA 3U0ZA 4Q0QA 2PHLA 4NVPA 4FT8A 2H6BA 2BGCA 1TQ5A 4E2GA 1UCXA 3H3UA 3S7IA 3E97A 4YARA 5FLIA 4H7LA 2QDRA 2GC0A 4D7TA 4F7ZA 1EY2A 2IXLA 4WBBA 2B8MA 1VJ2A 4DINB 4EWDA 1NYWA 1PM7A 5T3NA 3MDPA 2N7GA 4Q29A 2PAEA 2D5FA 4IEWA 4HSJA 1Q5OA 2IXIA 4LTAA 4X6QB 4XFBA 4LLOA 4I3PA 3E6CC 1YFWA 1O3QA 3FFQA 4IEVA 4AVAA 4LUKA 4XF0A 4PJYA 2E9QA 5C6CA 3TNPB 4X6RB 1EYBA 4YYOA 2K0GA 2Q4SA 3TNQA 1ZX5A 3MYXA 4BH9A 3D0SA 3H1YA 3I59A 3ES4A 2EAAA 4AXOA 1NE4A
chains in the Genus database with same CATH superfamily
1XBFA 4XUNA 4RHV2 1JHNA 2Y60A 2R16A 2DVGA 3ECQA 4YW1A 1CN1A 5IK8A 4I01A 4QDSA 3GZUC 2CU5A 2XGXA 2H6CA 2XJRA 3A7QA 3SC7X 2XR4A 5L7OA 2CYFA 4QPGA 3J8F3 1OF4A 5BV6A 1AR82 2VZ1A 4WM8B 4JRAA 5FV3A 2EXHA 2Z5WA 5FBZA 1MS5A 3U10A 1OH4A 1WW7A 1ZRIA 3WX5A 1UY4A 1NCQA 2RMU2 3P1IA 1NQDA 3VKNA 5C4WB 1JS9A 4NHKA 2R061 5F7UA 1NKGA 3GCXA 4TXWA 3SITA 2DUPA 1WBFA 4N43B 1C28A 4L8QA 2Y6LA 2CL2A 3UESA 4IV3A 5HV4A 5CYYA 3DPRC 5ABJA 5IT6A 4OUEA 2JB8A 2E32A 3RRDA 4ES8A 2RJLA 1YWKA 5JWPA 3D0JA 4QQOA 4AEDB 1NCRA 2K9ZA 4META 3ACIA 1C5IA 4AE2A 2KR2A 2WO3A 4ASMB 3IIAA 3UGFA 3NJZA 1QJX1 2IZWA 1OD3A 4FFHA 4BPZA 2WNVC 1QDCA 4XTMA 3DXTA 1OA2A 4XHXA 3AK0A 3I2KA 4JDOA 1F15A 1ZRRA 5T50A 3T30A 5H9SA 4P9WA 1IOAA 2VUJA 1W39A 5EPAA 4XBQA 1VBA1 2DVDA 3WXPA 5HCBA 3HN3A 2LW8A 4JKMA 1J1LA 2PLV3 5SV5A 3UKTA 4YM2A 1IS6A 1R1A3 2P3JA 1MZ6A 2ZKNA 3LDBA 1BVVA 5CZKA 4NIGA 4K6BA 3MPBA 3E6DA 3C8XA 1KQRA 5KWRA 3AC0A 4RQPB 5IVJA 2WJSA 4LQRA 3BB6A 5FTTC 4CDWA 4DRVA 2TEPA 5CFCA 1OXCA 5JPNB 1QXRA 3A21A 1B35C 1O7FA 3ETQA 3MIDA 4AFMA 4PLMA 2BV4A 1EAH2 3ZN6B 4ARXA 4OHYA 4QGNA 4KH9A 4QQPA 5FXZA 2X5IA 1UMHA 1URXA 3H1WA 2IXHA 3FFZA 1F31A 1PIV1 3CDZB 3OBZA 4OI2A 1O4ZA 5FMCA 2MPFA 3GM8A 3P6BA 4MGZE 4QX7A 3DYPA 3OPZA 1XPWA 4LITA 1WCUA 1VRH2 3RI9A 1GP6A 4MXWB 5A6QA 1D2SA 4BXSV 1RINA 1STMA 2YXSA 3JBG1 3N7MA 1MPXA 5FFOC 3UETA 4D6RA 3MF9A 2C5DA 3OGJA 4LNVA 2D6KA 2WAOA 1V70A 2J1TA 2NMNA 2EIGA 1WW6A 3VBOA 1W8WA 1UZYA 3O14A 1H4HA 3EBRA 4JHTA 4RHV1 1TZOA 1D4M1 1AR73 1YYNA 3HBKA 3GBFA 4FAHA 2YBSA 2JE9A 2O0OA 4GMP0 2XBO1 3M2MA 5A7PA 4XBNA 2YU1A 4LR4A 4CRQA 3IIIA 4DFSA 2WQZC 5FY1A 2DCYA 4LA2A 4AWDA 3RZJA 3B02A 5EXOA 1F9KA 5LCWL 5F3EA 4U36A 3DYMA 2YROA 4M3CF 4DY3A 5CG9A 3E5XA 2PHRA 3FHIB 4W50A 1DLLA 5LATA 4CCEA 2XWJB 3MW2A 1RUH1 1SEFA 3VGIA 3DXUA 5IW0A 5K4LA 5DUVA 1LOAA 3VBRB 4GWJA 3O5SA 4IEPA 5F2WA 2QFEA 4LBQB 4XJZA 3ACHA 3WNOA 4Q4X2 3T2OA 1JU4A 1S0GA 5DAWA 1H2KA 4YZ5A 3THPA 3K48A 4FPCA 3LF7A 1TNFA 3O1PA 1UQXA 4AQTA 1YIFA 2AYHA 3IWZA 4WM8A 4ATFA 3DYOA 3C7EA 3WP5A 2ZPXA 1UPSA 2VC9A 4PBPA 5IK4A 3B01A 3PUQA 1NLSA 3L9JT 2KXLA 3TN93 4ZKTB 2Y64A 3TYJA 3OBAA 2JKXA 5C4WA 3CL1A 2K2SA 2CGPA 5JZGC 1N1YA 1XB9A 4TYSA 4A45A 4N43A 4A44A 4G9SB 5EZWA 2XJUA 2BTVC 5JMOA 3RJ2X 1LOFA 4L11A 4B7EA 4RR3B 2ZS6B 2JWPA 3PU8A 4B8EA 3OYWB 3POWA 4IETA 3AYAA 5HBAA 4AEDA 4XCBA 3SNMA 4LBNA 4PDWC 1ZZBA 3VHPA 4BIOA 3VBUB 1UZVA 1WA4A 2O8OA 2BW8A 2IC1A 4YW4A 3AP7A 3IPVB 4E4DX 5FYYA 3GYDA 3ZIXA 3K4AA 3VZLA 1SBEA 1F8VA 2QCSB 4UFLA 4MGQA 4N53C 1NT0A 5LEKA 2E31A 1TMF1 3CZUA 2J1RA 4Y3OA 3VZKA 1G6NA 4GWIA 2JDHA 2CTVA 5FMOL 2VZUA 2Q1ZB 3J7MA 4M3CE 4WV8A 4XILA 1QOSA 4L9BA 4BZ4A 4NMIA 4Z2AA 5BNNB 5I8SA 4FPFA 5JI9A 4RQPA 2HWD1 2XL9A 1PMIA 4RD7A 2MEV1 3WDWA 3WVJA 4D7SA 5A3UA 3MHZA 4L2NA 5HI0A 5IJRA 1VRH1 2ARBA 1YIPA 3PHMA 4UFKA 5FLHA 4Y33A 5JDBA 1UMIA 3MZHA 2XLFA 1ASJ3 1IS5A 1I5PA 3WEZA 4A4AA 3IAPA 2R072 2X09A 3ZN6A 1G9DA 1QU0A 1MZEA 4XF9A 5FJKA 3I2IA 2VNGA 4AI8A 1DGRA 1W99A 3HIFA 4UFJA 1ND2B 1YEWA 4AVTA 3OPWA 1H2MA 2IXCA 1Q43A 5FZ0A 2P6HA 5KHIA 3E5UA 3WSOA 4XMAA 3LZZA 1L7QA 5C3RA 2FDFA 1O6UA 2VZ3A 1FMD2 2Y8KA 1GBGA 1XC6A 3I3BA 3OBRA 3TRSB 5JSPA 2FDGA 5DUWA 1BQPA 4JGZB 4MXWA 4EE2A 5ACA1 1HRI1 1WWYA 2DF7A 3AP9A 4HLTA 3NV1A 5C8WA 1BVP1 3BN6A 2DU0A 5A7QA 2E26A 5KHHA 2QZ3A 5F32A 4R4ZA 3TEXA 3PUSA 1RUJ3 3DUIA 5A3WA 1OA3A 1WLWA 2V5DA 2WA4A 3ZSEA 5IHRA 2IUWA 3LSDA 2ZGUA 4UXAA 4URAA 1PNFA 2A3XA 1C1LA 5F3CA 3O0WA 1WCDJ 1LGBA 3ZR6A 2D3SA 2VOKA 4IEQA 2XVKA 5F2SA 2GN7A 2R0FA 5CAZA 4OCTA 4UW6A 5EV7A 4YZ2A 2ZGRA 4D69A 3BALA 4LBMA 2BVVA 3WHUA 5FY0A 4JV4A 2VZPA 2WR9A 5TSWA 2ZZQA 4CDUB 1GMMA 4QKNA 2Q8CA 5AC92 5HCAA 5F6LB 4ZS3A 1IHMA 5LRRA 2XUMA 5AVAA 1ZRCA 3VBRA 2HWF2 4ZU4A 1SFYA 1XE7A 4TSVA 3VV1A 4FCAA 4QX2A 4LBQA 4KNCA 2UWBA 5D1IA 3ACLA 2BGOA 4IEYA 1DCSA 1OHFA 3T1LA 5A1FA 3NKTA 1HRV2 2Y6HA 2P34A 5E1RA 4JRLA 3GALA 4YVSC 3ACGA 4XXPA 2WZR3 4B29A 3HT2A 2DU1A 1YQ8A 2WRAA 4YM3A 5FPLA 1C8NA 1BKZA 4OMDA 1GNHA 5AVPA 3T0BA 4EN6B 4FFGA 4XUQA 3VHRA 1PZ9A 2CNAA 1X7NA 2B4KA 4HVRA 1PGL2 4XDQA 3FBMA 3ZR5A 4RR3A 1ZRDA 3PJYA 4CU9A 2GC2A 3OYWA 2FHRA 4XJAA 4L97A 3UKVA 2E6VA 2XJVA 3BTXA 4UW4A 4HONA 4LKSA 4XFCA 3VBUA 4MGIE 3D6EA 3JD73 4IERA 1MVQA 1BMV2 2YC2A 4QXHA 1Y43B 1RUD3 3IPVA 1J1TA 2E7AA 3JCIA 2GMPA 3WG4A 2W1QA 4N8MA 4D0QA 3OY8B 1YQCA 4XFIA 2A7AA 3OD0A 4D3WA 5SV8A 5FO9B 2ZBJA 1XSQA 5T5LA 1CX1A 4B1MA 1RUG1 2W9XA 4HKOA 5FZ8A 1LHOA 2DFBA 4S2FA 1UXXX 3PTRB 3J26N 4CEWB 1GOHA 1HJFA 1RUI3 2P3YA 1ULOA 5DUUA 4X8PA 3S5QA 4GWMA 4NHMA 4Q4V3 2WBKA 1YI7A 4FPJA 1VB2A 5A70A 2RR13 5FZIA 4YVWC 4CUBA 1WUVA 2R042 2BGPA 2GALA 2WLQA 5A7NA 2YC4A 3GZAA 3PL0A 1W8FA 3AZXA 3WOGA 1R083 4KQ7A 2ORXA 5DG1A 4AGRA 5F1RA 1K45A 1POV1 4M3CB 1CESA 2TNFA 4GB32 1H30A 4C1XA 1Q8PA 4OHWA 3M4FA 2JDYA 4RGAA 3SH5A 5HV0A 5J3UA 1W2NA 2CHHA 3WQ7A 1Y9MA 1PO23 3MV01 1JYTA 4FVVA 1ND3B 4HMZA 3V0AB 5A6ZA 1G9CA 1GZTA 3Q8CA 2B7YA 2JG9B 5FOJB 2EICA 2BVBA 3IKWA 4DRRA 5FPZA 1W9TA 1NE6A 5FYSA 3UNPA 1VBD3 1NG0A 2Z42A 4GH4B 4QM9A 3ZO0B 3RZMA 3IDBB 1H2NA 4C8DA 1ZZ7A 3NNFA 5A3MA 1VAVA 2I07B 1BZWA 4JGZA 1D7PM 3LPFA 4QQHA 1FNZA 4B7KA 2WABA 3KF3A 3I8TA 3PURA 4XE9A 1AUYA 2JDZA 2JJ6A 2ZCWA 1AYN2 2YU2A 3DKQA 2XLAA 2Y6JA 1BEV2 3R0RA 1C57A 1DBNA 1S2BA 2BFUL 2ZGOA 3AM2A 3ASIA 3E5QA 3MLKA 1AYM2 1QGLA 1RUF2 2ADDA 2DDUA 4UW5A 4Y1XA 3UGHA 4AZZA 4YGBA 5FYVA 5CB7A 2VQ0A 5JUVA 2W87A 4QDRA 5JVVA 4PI0A 3GF6A 5A6YA 3RZGA 4IL7A 1QEXA 4BQ4A 1DU3D 1E5HA 1FPN2 1TME3 2TUNA 3FBYA 1BCXA 3LEIA 4AHWA 5J7MA 4A3ZA 2RM22 3HAGA 5M0TA 1C5HA 2VOXA 3OGGA 1UY1A 1VR3A 1YI9A 2J1EA 2W95A 1PGW2 4CDUA 1V6MA 2VUDA 5C5UA 4DMIA 4AFAA 1DIWA 5BPXA 4C0BA 3ZYFA 2W3JA 4RFRB 1COV2 3WDTA 1UYYA 1W2TA 5IAXA 3VDBA 3WINE 3BU0A 2HWC3 1GWKA 4NPRA 3LGRA 3ILFA 5LRSA 2OUJA 2VZOA 1F35A 1V9U3 5EFUA 3CBNA 3C7FA 5DDJ3 1RHI2 3BGAA 2J1AA 3DCQA 3I3DA 4MYEA 1UYZA 1DQ6A 1LOBA 3AVSA 1TQ5A 5DAVA 5D8AC 4YARA 4AI9A 1Z78A 1EV11 3HMYA 4BQ2A 4DZGA 2ZHKA 4D7TA 2A6XA 2J1VA 2VQTA 3D8CA 1EY2A 4WBBA 5A1AA 1OKOA 3MIHA 3KM5A 2VXJA 2RS33 4UOJA 2OIIA 2QQPA 4B3NA 4DINB 1IS3A 3KT4A 2R6QA 1ZBA2 2WFF1 3DPRB 3HNMA 5T3NA 5J98B 3QLQA 2YYOA 2WO1A 4GQ7A 4V2VA 4XCAA 1QQP2 3ALQA 4LHSA 5ANNA 3VZJA 1IQAA 1VLNA 1JZ3A 5G04L 4COZA 1LULA 2PAEA 4Q29A 2R49A 1W05A 3MLJA 4L92A 2JDPA 4H7MA 4GB31 2HWE2 4HSJA 3OY8A 3K75B 1SLBA 4LTAA 4X6QB 5EYXA 3ZLIA 1PK6C 4P9YA 4LK6A 4AGGA 2WNVB 2VZVA 4LLOA 1DGLA 4CEYC 2WNUC 1WMXA 3E6CC 4Y20B 3NJXA 4CEWA 1VBC3 2QQMA 4WM7C 1W2AX 3H8XA 4IEVA 2RV9A 4C90A 4XJ9A 4LUKA 4E8DA 4XF0A 1XSRA 1IPSA 1SG3A 3PDQA 4OHVA 1XYOA 4PJYA 4FPGA 5GJ6A 5F3GA 4DOUA 3TNPB 1AL21 1VBB1 1HQWA 1D2QA 2FD8A 5C5TA 2DCJA 1YO8A 1V0AA 2C9AA 1JH5A 1PX3A 2K0GA 4M3CA 1GZ9A 3AL6A 4P08A 3TNQA 1HN0A 2R30A 5H9QA 3NV3A 2P1BA 4MVTA 4Y4YA 3ZXFA 4CTEA 2A6WA 2D43A 3WP4A 1O4YA 1MS0A 3H1YA 1UY2A 1LOGA 4B4RA 3MIGA 4A41A 4QDQA 1RYYA 1CZTA 2Y6FA 1OUSA 4FXGB 4GJZA 1VBE1 1B35B 1ND3A 3ZDVA 3V0AA 3ZMNA 3SCGA 1AR83 2QE3A 3PVNA 5FZ4A 1OI6A 4QPIC 1AYM1 1RUF1 2VD7A 3AP5A 4A7KA 2HBTA 4GH4A 4TZDA 4HANA 4RS5C 3I3QA 1ALYA 2GU9A 2RMU3 1HQNA 3FUOA 4O9EA 4AQ2A 5K8SA 2YFZA 5JAXA 1PVC3 5LA9A 1ZA4A 4FFFA 1PO13 2O8QA 1HXS3 1Y3TA 3ZM8A 2RM21 3ON7A 5FYBA 3T08A 1T6BX 1CPMA 4PIXA 4R52A 3MUZ1 5BXXA 3GNEA 3RNSA 3I49A 1ZBE3 5FZ1A 1CAUB 1LHVA 4IV1C 3RI8A 3VBFC 4DXTA 1XXNA 4WVMB 3H7JA 5BNQA 4IEXA 2CWMA 1COV1 5F9TA 1WD4A 3H8OA 1ZNPA 4AI2A 3CZJA 1UU4A 5H9PA 3RYKA 1S0JA 3M70A 2WT0A 4F3JA 5I8TA 1VALA 4DUWA 4N9IA 4NIDA 5APAA 4XACA 1X82A 4KMQA 3ST7A 4JC1A 5JLVA 1SBDA 3KS7A 1OPOA 2ZGQA 4XBLA 5K7PA 5JIUA 4HK9A 4HKLA 2TBVA 3POJA 4LXLA 1EUUA 2MNGA 2VBDA 3O1OA 4D94A 4IXLA 2NM1A 4CYDA 4IQPA 3EMRA 4H3WA 3T2TA 1KEXA 3T2PA 1MEC1 4NHLA 5CA6A 2R0HA 2A3WA 5GZFA 4MZUA 1AHSA 4LIVA 3ZYIB 4B4PA 4AVBA 1RJ7A 3HJRA 3QOPA 2P5BA 3AZZA 4KG8A 2R062 3VD7A 3HR9A 4K8RB 2D5HA 4AFDA 2ENRA 5BNPC 3AYCA 2CWSA 2D93A 3FHQA 1FT9A 1EAH3 3WD5A 1KDMA 1REEA 4QKFA 2HWE1 3CJIC 5GZEA 1WKYA 5KHKA 1RL3A 4LKEA 5I0DA 1QXPA 2LROA 2JE8A 2E33A 2WO7A 4QB1A 1QJU3 5FCCA 1DZTA 3NL1A 4BM8A 4LIUA 4I02A 2AZ5A 1ULCA 4SBVA 1CAXA 3ZSMA 2YGMA 4QPYA 3AMQA 1AJOA 1QJX2 1UIKA 1JOJA 4NIIA 3DPRA 3ITQA 1NX9A 1ENSA 2VQUA 1S0FA 1O5LA 4Q4W3 4CXYA 5FP7A 3QH6A 2P3IA 1JBCA 2JDAA 3NNJA 3O0VA 3VL9A 4S2HA 3ELNA 2IVIB 1VBA2 1GWMA 5FZCA 1H1MA 2B9UA 3LIGA 1LCLA 5IYYA 1CIWA 2WNVA 4I09A 5LBEA 3BU7A 3KCCA 4Y20A 1SLAA 4YNIA 4A6OA 3VB9A 1X8EA 2Q8OA 3LDKA 4ZXKA 4N53B 2YGLA 4R8HA 4ZS2A 3EQEA 3ZFFC 1HDKA 3HQXA 1Q8SA 1CAWA 3USSA 4OULA 4LE3A 4BLIA 3H8UA 3M1HA 3VKMA 4P9LA 2F17A 1H6XA 4FP2A 3VZOA 4E4SA 3PIGA 5BUVA 2UYAA 1I9RA 1PHMA 1UYPA 4OYUA 5FJHA 3UKNA 4P02B 4Z8BA 3PUHA 4OUMA 5E88A 2ZKLA 5FKBA 5CU1A 2RVAA 3UK9A 1RUNA 2HWB2 5CISA 2BJSA 4Q4X3 2FBEA 1B35A 5CKMA 2Q1FA 4EJRA 3SKJE 4YM0A 1WCKA 4EQVA 2JDUA 3FJSA 1AXKA 3IAQA 5IWFA 1JZ5A 1QH7A 3AXDA 5FPVA 2ETEA 1FYUA 1OT5A 3H3ZA 3WDUA 3W21A 2IFWA 3L2YA 1FX5A 1I1EA 1XNDA 2ZGPA 1H2LA 1SMVA 2VNVA 3KV6A 1S0DA 1W0PA 1KDKA 3NJVA 1WCSA 3K4DA 1VP6A 1YJKA 2PFWA 5G05L 2G19A 1D4M2 3GJAA 4Y26A 4P9XA 1GQPA 4NR1A 2ZGLA 4PCRA 3DEMA 1CAUA 2VY0A 2XBO2 5EP9A 4BK5A 2YC0A 3NMBA 4WVMA 2DBIA 4DQAA 5C33A 4E9KA 4K7JA 5KBFA 4M00A 4SLIA 1ULDA 1UL9A 1RUE1 2NN8A 2VJXA 4XF1A 4Y1ZA 1CGPA 2ID4A 2RG4A 4Q4Y1 2Y0IA 1W9YA 1RUH2 2ARAA 4ISRA 1XE0A 5FQ0B 1ULEA 3U11A 4KWKA 5FZDA 3WF1A 5LK7B 3MI8A 5T5JA 4N7UA 4YRDA 1MQTA 2BP6A 3U4XA 3RYRA 5D21A 5A7OA 1DP0A 5FR3A 2V4VA 2WINB 1N3OA 3KV4A 3LEGA 4F8AA 2ZX2A 2V72A 1SFPA 3LQCA 1LHUA 2BNOA 2Y38A 1QHDA 2P17A 1FOD1 3KGZA 5ANQA 3FLRA 3TWIA 4Z82A 1OOPC 4ISQA 3CEWA 1RXFA 2GAUA 1UXZA 1OF3A 1Z7S3 3PJQA 3BOWA 5FMBA 5J36A 2HEYF 3RS6A 2R073 2KD7A 4OQ9A 1MS3A 4BISA 3VN4A 2VL4A 4LKDA 1DG6A 4YVSB 2WZEA 4DEVA 2R1DA 2WN3A 4FFIA 2WSUA 2DVFA 3B69A 3KGLA 1F4HA 4CPBA 1RUC1 2QQKA 3POSA 1CD3G 1VPHA 1OQDA 1L7RA 2OQ6A 5K9YA 4TWTA 1FAYA 2BRTA 3KHBA 2DCTA 2ZACA 1BK0A 1FMD3 3NNMA 3RDIA 4BJ0A 5JXIA 4HKWA 1XRUA 4IGPA 3VHOA 3GXUA 4YW2A 1PNGA 4FTSA 2XHKA 5FXVA 4NPLA 2BU9A 4KG0A 2A6YA 4NE9A 2A75A 2BZDA 5GZDA 5CFDA 1JZ2A 3S7EA 3W9AA 1C4RA 4YGDA 1TMF2 1WW4A 1SBFA 3VDDC 5IVCA 2Y6KA 3PU3A 5DAXA 1MR5A 4ORFA 2Z79A 1R091 4XEZA 1W0NA 2HWB1 2X53S 2AACA 1C8M3 1JYNA 1W2UA 1MZFA 3J9SA 3EO6A 4QX1A 4N53A 1W6OB 2HWD2 3DV8A 1AR91 4E8CA 2MEV2 3BOPA 2W52A 4LUMA 4D7YA 2NLRA 4PQ9A 2RJKA 3C3VA 2Y33A 4EWEA 2PAMA 3FZ3A 2P6CA 2W46A 5J37A 4G4FA 4YVWB 3AYEA 2PELA 4CCCA 4HZFA 5C9AC 5L19A 2W08A 3P5BA 2OKXA 1LKNA 4LO5B 2P4EA 3ZYPA 1UMZA 5FBJA 2G4IA 2WZ8A 2HWF3 1RMU1 2XWBB 2RS51 1KFXL 1KFUL 1W8ZA 1Q3EA 1W90A 1CVNA 4NROA 3TOJA 3QACA 5CKQA 1SLTA 1V00A 1HRV3 1TNRA 4NIHA 4BA6A 3RZLA 5FUPA 1NA1C 1ZZCA 1MS8A 2HYKA 5A7SA 5ACA2 1W6QB 1W9FA 1HRI2 4P00B 3LA7A 5GKAC 5B4NA 1HJGA 2YG0A 3FHAA 5C3SA 1E5IA 1GR3A 2YDEA 1QNYA 2XVLA 2ET1A 3E1F1 3S5AA 1HIXA 3ZFGC 2E7QA 3BPZA 2OQ7A 2JECA 1BBT1 2VM9A 4XF4A 3SMHA 2AENA 3WW2A 1IKQA 3W5MA 5EJ3A 2BYVE 4YFZA 1GZCA 1E5SA 1OUXA 3APBA 4Q0PA 1BLZA 3UL2A 4XDPA 5B4XA 1OLME 4AW7A 1ZREA 4I0WB 1MVEA 1OLRA 5F5QA 4MV2A 3K46A 1W6MB 1WW5A 1YNAA 3MUY1 4ZONA 4C0HA 3LFMA 3ABZA 1IZ3A 1OFSA 1S0CA 3AJZA 3M8LA 5A3NA 1S4CA 2BDRA 3RVHA 2VTXA 2EVXA 5BY5A 4XQ4A 5FQ0A 4TLGA 1J3QA 3ORJA 3DF0A 3CIHA 3B9IA 4N90A 1DQ0A 3QBQA 2YBKA 4XUPA 4QU2A 2R043 1QJY1 3OGSA 3O12A 4QB2A 2XQXA 2W91A 3HBZA 4FOWA 4HOOA 5F5AA 2NZ9A 4R9DA 1NXMA 2JKBA 3OJBA 3ZXGA 3LA2A 4OI1A 3T3YA 3TBDA 5AFEA 5L9VA 1CZVA 4EWAA 2PHUA 4NRQA 2AEZA 3WW1A 2GC1A 2VZTA 3OTFA 3X29B 3M3OA 2D6PA 4FPHA 1QOOA 4GKYA 3Q8EA 1POQA 1QMJA 5JXGA 2WT2A 2ARCA 4YVSA 3I59B 3EJKA 3CKHA 5EQUA 2W1WA 2VW2A 2DUOA 4NN0A 5L73A 4D6SA 5D8AB 4UWDA 3RZHA 2F4PA 2WFPA 2QTWB 3MGUA 5FREA 5FP9A 1I5ZA 3KCYA 3KCXA 4Z2WA 4JKKA 4LE4A 2DVAA 4OLLA 2EIDA 1S0IA 1W03A 2X8KA 4FPKA 1JYIA 2QKDA 3V0BB 4DEQA 1R1ZA 1RUG2 3JU9A 4R4XA 5JIAA 4AVSA 1AX2A 1O3TA 1SZBA 2D97A 5GLTA 3S30A 1AYN3 5T52A 1BEV3 5CBLA 3MIEA 1UD1A 2Q0AA 4AHXA 3I7DA 3MLLA 1KD7A 3I3EA 1JHJA 5IVYA 2OYZA 2UURA 3RWNA 3O7OA 5JMCA 3O1TA 5H9RA 3WCRA 1PK6B 4QMAA 1B09A 4XQDA 5FZ6A 4GXLA 2WSVA 5C7GA 1DZRA 2JG8C 1W6OA 2FZ1A 2IVJA 2WNUB 4CEYB 2P3KA 1AR63 1FPN3 2UYBA 2ZHLA 4OVEA 1KJRA 4WM7B 4LOSA 1REDA 3ZKUA 1RITA 5CEHA 1RVF1 1US3A 4CU8A 3DGTA 2A71A 3H8RA 1S2KA 4Y22B 1KITA 2JICA 4NO4A 4XMIA 2XXZA 4YVWA 1VB4A 5KR7A 3ZN4A 1JZ7A 2YPDA 5T54A 2A73B 1UW8A 2XKOA 3CJXA 4KI5M 1IQDC 1W3XA 1UO9A 1ULPA 2HEWF 2J1UA 2J7MA 1LEMA 2GMEA 4CXWA 2Z69A 3VD5A 1JODA 2VW1A 1RHI3 2GMMA 1PZ7A 2VZQA 1W6QA 3F95A 4XFFA 1WD3A 3LSEA 2GZWA 2OPWA 3Q9OA 1I6XA 4QPIB 4QAWA 3WW3A 2JB4A 3U0ZA 4NVPA 2FZ2A 5GALA 4XJUA 3AJYA 5IVVA 3MW3A 2BGCA 2WN2A 4RS5B 4L0PA 3ZYGA 3H3UA 3S7IA 4HPKB 1SACA 5LB6A 2WS91 4Y24A 2V73A 3AP4A 3RMYA 3MBWA 3U37A 1ZBA3 4LBQD 4W6XA 1GYKA 3VDAA 4DXRA 1JYWA 4B4QA 1QQP3 3MFAA 4ES9A 4GMP1 4BMBA 4XDOA 1FV3A 4EWDA 1W6MA 4IV1B 4KWUA 3VBFB 1V6IA 5LA1A 4NWVA 2HLEA 2VGDA 1BHGA 3MEPA 1PMJX 4H55A 3Q8AA 4CP1A 4UFMA 1UOGA 3ZFEC 4MG2A 2C26A 2IWGB 2VCCA 4XYXA 1UU5A 2W1SA 2JX9A 1O59A 4QXBA 4KBBA 5FYMA 4TN7A 1Q5OA 1SLIA 2IXIA 4DXZA 1EUTA 2GP3A 4XFBA 1AR72 1F5JA 1XNAA 4GA9A 3WCSA 4BDVB 4XVHA 4IE7A 3WUDA 5A3PA 3LFIA 3J8F1 4OUSA 3AKQA 3IT8A 4AVAA 4BQ3A 3NWKA 3SKVA 4JZRA 2DBNA 1BYHA 1DQ4A 2CDOA 2JIGA 3MIFA 5C6CA 2VU9A 4MLOA 5IFPA 3O1UA 1QOTA 5LASA 2Q8DA 4IGOA 2YMZA 4AHYA 1EYBA 1EV12 4K9SA 5IFTA 2DV9A 2Q4SA 2DFCA 2VCAA 3MF6A 1WBLA 5LZ6A 1W0OA 4LHNA 3MV11 4IGQA 3P3NA 4BH9A 5ISLA 5FMDA 3VKFC 3I59A 2W39A 5IAVA 3R4DB 2VNRA 2UWAA 2WFF2 1G9FA 5D8AA 2EAAA 3CJIB 1U5IA 4XW3A 4AXOA 1UNBA 3I2DA 5T55A 5BNNA 1G86A 4XFGA 5ERLA 1UU6A 4P9JA 2F4LA 1E5RA 3AKSA 1K12A 1OLQA 2QBXA 2XJPA 4FPOB 2VBBA 4RN5A 1K5MC 5F8PA 3TN92 3V0BA 5A3TA 2G1MA 1YQ6A 3O1MA 5EYYA 4O7XA 1DQ2A 2K46A 2ZHMA 1OH3A 1W6NB 2ZXQA 2QDNA 4AAPA 4QKDA 3VD9A 1IKPA 3IDCB 4LMFA 2PHTA 1ND2A 5L9BA 1MS1A 3GHNA 2PLV1 1JYXA 1ZVFA 1R1A1 2E7TA 2GNDA 2D3PA 2RJ2A 3Q8FA 5E16A 1PK6A 4CCJA 4COVA 1AL22 1VBB2 5JCTA 1UN1A 1WLDA 5GLZA 4CEYA 2WNUA 4I0AA 3LOIA 4IEZA 1O3SA 1REFA 2RS13 4WM7A 5JI7A 3ZKYA 1J59A 3JQXA 5FWJA 3U07A 4DY5A 4CUAA 4AR2A 3N35A 3ZFFB 1C3HA 1X9PA 4Y22A 3VD4A 5CG8A 2ZAAA 3H3LA 2DCKA 4FPLA 5FO7B 1DGWX 1ST8A 1VBE2 1WMEA 2BERA 1JXNA 3JZVA 3WV6A 3T4HB 3BYWA 2VH9A 1JW6A 1W2OA 4C1WA 3AKPA 1N1TA 4LKFA 4Q2FA 5FXWA 3VBHC 2PHFA 1CJDA 1C8M1 1HB4A 4AHZA 3ZPYA 1LU1A 4AVVA 3DL3A 3AMMA 2R063 3KV5A 4XUOA 4JKLA 1G8WA 1NAEA 2LUWA 4FPEA 4QPIA 1N3QA 4I3GA 4UI9L 2GH8A 3OSDA 5FY4A 3VKOA 4E4ZA 4MUVA 2NQYA 4IW3A 4UFHA 1W28A 3K2OA 4RS5A 4Y5SA 2CY6A 1LR5A 2G9ZA 2BWAA 4OFGA 3A4UA 4HPKA 5B2GB 4NAMA 3J7HA 3KVAA 3W58A 3OGVA 2B39A 1H0BA 1Q56A 1KXGA 3WNXA 3NAPC 2J22A 1GZWB 4YG3A 1AR71 1QJX3 4GALA 4P5YA 5KC6A 4FTBA 4MX3A 1CZSA 4FOYA 1YXWA 4XIOA 2VUCA 1O5UA 4CCLA 3AMNA 1OA4A 1RTVA 2ARXA 5I0TA 5J09A 4W65A 1W04A 1U5XA 2AREA 4IV1A 3VBFA 4COYA 1SPPB 1WZXA 2O14A 1LJ7A 4YG6A 1KS5A 2W68A 2Y34A 1OLMA 1XE8A 2CGOA 1VBA3 2ES3A 5I8YA 3ZN5A 1N1VA 1H4GA 3LAGA 2EF6A 3VBUC 2JDKA 4OHZA 2WO2A 3KVBA 4QX5A 4UBGA 5FPXA 1V6LA 4K3UA 1UF2C 5A7WB 3KT1A 3ZPOA 1DYKA 1MEC2 4AQSA 3T4VA 4Y5TA 1WMFA 1XYNA 3POEA 2ZMLA 5FZAA 1GNZA 2D40A 1XU1A 5A80A 5JSOA 2A3YA 2QQUA 3RSJA 2EALA 2GNTA 2VULA 1ACCA 1OFNA 2WDBA 4EV0A 1W6PB 3LA3A 1A6CA 3TN91 3ZMOA 4J1XA 1H8TC 3USUB 3AKTA 3LD8A 5LK5A 3WQ1A 1AJKA 2RDRA 1PIV3 3SEPA 1OOPB 3WLUA 3TB0A 4BMEA 2V09A 2Q30A 4IDZA 1H1AA 1XJAA 3NO8A 4JVAA 2PYTA 4Q8LA 3R6SA 5FOBB 3K4ZA 1S0EA 1YLLA 1WGPA 2AEYA 4QXCA 3CJIA 5CNAA 3KT7A 3K77A 3JBG3 3FLTA 2YUEA 5FZHA 3ZYBA 1ULFA 2GH2A 5JR7B 3C7OA 3OF1A 4CA9A 1LEDA 5FAXA 1OMIA 2RDQA 1GQHA 5FK8A 4YFWA 3ROUA 1QF3A 1LHWA 5JSRA 5L36A 4ARYA 4EZHA 3POYA 4RHV3 4JDNA 1D4M3 4K8FA 4C91A 4COWA 1W6NA 5FRAA 2VQAA 4YSFA 1JU3A 2XHNA 2ZHNA 5LA0A 1JI6A 2YPJA 3THDA 2XBO3 2ADEA 3OPTA 4ZHNA 5FDBA 1JZ8A 4Q27A 4R9CA 1VMHA 2JG9A 3J7NA 3B00A 3K51A 5EJZB 3ZIWA 4DS0A 2ZX0A 5IVFA 3VDDB 2VCMA 1BJQA 1UOJA 3LKJA 4PIYA 4Z07A 1RUOA 3FE5A 4XC9A 5FIXA 3URFA 2PHDA 2W0XA 4UAPA 2WNEA 4AEKA 4FTEA 2VPVA 2PQSA 1RUH3 1X50A 4UF0B 4HSLA 3JQWA 2KA3A 4ZZ5A 3ZFFA 2DTYA 4J25A 5AFBA 1ASJ1 4CP2A 1MS4A 4DIQA 3NW4A 2Q5TA 4RGKA 4CU7A 4BQXA 1RUI2 1ZZ9A 4XTPA 4ZU5A 5I0RA 5C9AB 4Q4V2 1A8MA 3WNMA 1RC6A 4HG6B 4CUGA 5C8CC 4OHXA 3PIJA 4JQTA 5JOYA 1PVXA 4NWWA 3PNAA 2QQVA 2WNOA 4Z1VA 4LO4B 5DMYA 2FDJA 1UX7A 4LHLA 1ONAA 3GZTB 3H9AA 3WF2A 2RDNA 3HEIA 4DNYA 3POBA 4A42A 1NA1B 1S0BA 1X33A 4OI0A 3ILNA 3T0AA 2CDPA 1RUJ1 3EXUA 4LEJA 3ZFGB 5FP8A 1GZWA 3JB4C 1XNTA 1RUE2 4OMCA 5FMOS 5JR2A 4ONUA 4JTOA 3WY6A 3KWVA 5DQ0A 2XG3A 1M06G 1YFYA 1PM4A 3M3QA 2ORZA 3H7YA 4Q4Y2 4BQ5A 2VCBA 4N9HA 5LBCA 4AQ6A 3ZXEA 1SPPA 2YZ4A 4AG4A 3IN9A 1TMF3 4BYYA 1K3IA 5J48A 1UOBA 3ZDSA 4ET7A 2EIBA 2VMGA 3QH7A 1OQEA 4DUXA 3B93A 1Y9QA 4NHYA 4ASKA 1YJLA 1D4VB 1U12A 5JZGB 1AXZA 1W9SA 5A7WA 2BOIA 4YG0A 5CIRA 3VZNA 2HWD3 2BOJA 4ASLA 2MEV3 1HLCA 4CDQC 3HOBA 1XYPA 1FOD2 1VRH3 5C71A 1JN2P 3S57A 3WW4A 2XL7A 3T0DA 1SCRA 2WAAA 5A32B 2EAKA 4PDWB 1W6PA 4CDXC 2WZR1 5K0UC 3WNLA 3USUA 2J42A 4WVVA 4Y1YA 1K42A 4FXKB 3NQHA 4AFCA 2W92A 2J1SA 2Y0OA 2XPJA 3K3OA 1RUC2 2QJVA 1NLRA 5DZGA 2W1UA 1OURA 2H0VA 2C0ZA 4MH0E 4Y5Z0 5FXXA 2B46X 5A33B 3I3MA 3MW4A 4EROA 4QQLA 4MSVA 3KHCA 3Q8BA 1XU2A 5FY7A 5C3PA 5ACA3 4IUGA 1V9U2 1HRI3 3C2UA 4UBHA 4YLZA 3U4SA 4PLNA 4Q0UA 3JD71 4LT5A 3OGRA 3TEWA 5LEJA 1J3PA 5I0UA 3F2ZA 1RUD1 3WG1A 5DG2A 3AYDA 3LWCA 3V64A 2VAUA 2VW0A 4LA3A 1X36A 3VBSC 3ZXAC 1R092 4I2OA 5FYUA 3DN7A 1CQ9A 1VMJA 1RUI1 1W3VA 1FI2A 1UZ0A 1IGOA 3OUJA 3PVOA 1AR92 4ZU7A 1W8HA 1GKBA 4Q4V1 5C3OA 3RGBA 2CV6A 1U5ZA 2RR11 3VDDA 4FP3A 5E8AA 4O65A 4P9IA 4WZFA 4XF3A 3BTAA 4Q26A 3AXEA 1R081 3D3AA 4LO6B 2X10A 3CMGA 4QXKA 3GJBA 1S2EA 3TEZA 4UF0A 4WZCA 4JQRA 1NY71 3M3IA 3PMEA 2JG8B 1FNYA 1UWWA 1RMU2 2GNBA 2RS52 4KU8A 2YV8A 4FAGA 3I2HA 4JX0A 1TG7A 1Y7BA 5GLWA 1CWPA 1PO21 4LLFA 2OS2A 4JHZA 4AEJA 4BQ1A 1S1AA 1H6YA 2VE1A 5C9AA 1OQ1A 1Q8OA 1DHKB 1ZYBA 3VD3A 5IATA 3I97A 4XPVA 4E2SA 1CIYA 3BODA 4E2QA 1VBD1 3RPQA 2Z2SB 5GM0A 2ZOEB 2UU8A 3WDXA 4A3XA 1EPWA 3M7AA 4JGYC 3ZVXA 3BVCA 1BBT2 4JCKA 1ZRFA 5F5CA 5IK7A 2D6MA 1ENQA 1PX4A 3LIHA 3VUOA 1NA1A 3WP6A 2Q1MA 5CADA 1W8TA 4K20A 2VVEA 4XURA 5DN2A 4CZSA 1YC61 5FYHA 2NP0A 5KXEA 5FY8A 3VHNA 4NPMA 4LULA 3ZFGA 4AYUA 4R9AA 3SXWA 4W8JA 1DLCA 3SISA 1RGSA 2ZEXA 2YHJA 4RA0A 3H50A 5FZMA 3SQOA 4XIKA 2QQOA 2ZJCA 5FKCA 3ZYHA 3AFKA 4KWJA 3AKRA 2P2KA 1PVC2 1TME1 2CAVA 1RUG3 4MADA 4ZY9A 1PO12 2QQWA 1TE1B 1HXS2 2R7EB 2C4XA 2VTXJ 3HNBM 4IE6A 3SCHA 4BCUA 4FI9A 4DUVA 2BNMA 1A8DA 1WLTA 2JD4A 2JIJA 3C7HA 2YBPA 1KS4A 3ZXLA 1T6GC 3N9OA 4KWLA 1VE0A 2SBAA 3IB3A 2FDHA 3WZ1A 1H9WA 1ZBE2 3ZFEB 1HQLA 1F2NA 1QJY2 1LRHA 1ZM1A 2EXKA 4GZ9A 2GC3A 3OCPA 4PIZA 4CPBD 5JZGA 3THTA 2HWC1 1POV3 2ZEWA 2DCZA 4YZ3A 4AI3A 5BNOC 3BI3A 2D6LX 4HVQA 2QQNA 1J3RA 1GOFA 5EJ1B 1V9U1 1SDWA 2CAUA 2CSGA 4AK3A 4OZOA 5A3OA 1QWRA 3L2HA 5DDJ1 4CCOA 5A32A 2ET7A 5T5PA 3N9LA 3R4UA 4AI1A 3PUAA 4PDWA 2VMFA 1DGRN 2W94A 4BU2A 1IS4A 3VL8A 4OQ8A 1JTZX 3KQ4B 4P9GA 4PF1A 3QCWA 4M0HA 4BXFA 1VIWB 4HK8A 5HXVA 3VKLA 2Q8EA 3LCPA 3FWEA 3LEMA 2FDKA 3HD8B 4CP0A 2BFUS 1MS9A 5A33A 2PA7A 3ZYJB 4QX0A 4EN8B 2RS31 2E63A 2XH6A 3N9QA 3ATGA 2XJQA 4A2UA 5C3QA 4Q0VA 4UYBA 4G3YC 5FY5A 4BHPA 4O9GA 1CX4A 5D2AA 4N7IA 5HCHA 1EPZA 1CJPA 5AC93 2VOWA 1OSGA 2XMLA 1GICA 1GUIA 1GFF2 4PLOA 4Q0QA 5F39A 2WWUA 4EN0A 1K5MB 5FZ7A 1QJU2 2H6BA 3HVDA 3A0NA 3POFA 3ZXJA 3FL7A 4E2GA 1O8SA 1VBC1 4NUBA 4PT6A 1W8NA 5F6KA 4CVUA 3BPSA 4CSWA 4H7LA 2QDRA 3NV2A 4LORA 1RVF2 1PGSA 5CKNA 2IXLA 1LODA 5IK5A 2B8MA 1ODMA 4Q4W2 2RHPA 1Q8VA 2Y6GA 4IE5A 5FO8B 5L7OC 4QPGC 1VMFA 1NYWA 3V65A 1PM7A 2NPIA 2JG8A 5J96B 4BK4A 3H42B 1HN1A 3MDPA 4M4PA 1IG3A 4R9BA 2WWJA 1NCQC 1HB2A 3AL5A 4URTA 3TAYA 4FOVA 3NNLA 4MOAA 1G9AA 4IEWA 1OKQA 4RFT0 1AR81 1GSLA 5LA2A 2YFUA 4IV3C 2LALA 1SHWB 2A5ZA 4KGQA 4I3PA 5E89A 5ABJC 4H2AA 1MQTC 5GZGA 1LGCA 1A78A 2ZEZA 5JXJA 4MGTA 4IE4A 2OVUA 3IMNA 3O1SA 5FPUA 2RMU1 1EV13 2JENA 2ZMNA 5DPNA 3VBHB 1NCRC 2BUKA 1WMDA 5DAQA 3CU7A 1GANA 1PVC1 4AGVA 5EIYB 2NYYA 4YZ4A 1PO11 2EXJA 1F4AA 1HXS1 3N7LA 4HL0A 3WNKA 3BTYA 1N3PA 2C6SA 1SLCA 2AC1A 2WS92 4X6RB 2GDFA 1XNCA 2WUHA 2LS6A 3K3NA 4AEMA 1LESA 3CQOA 1BK1A 1T2XA 2WFF3 1JMUB 3UJOA 3MYXA 1D0GA 1QNWA 2FCUA 3SLIA 1ZBE1 5GZCA 2C9KA 4BB3A 4QB6A 3O1VA 3N9NA 1HKDA 1UZZA 3ES4A 1LOEA 2PHWA 3RZKA 2OXBA 3PMSA 4GB33 3AB0A 3NAPB 4F83A 5FUNA 1XNBA 2E51A 3OBTA 3H0OA 4NRMA 1AX0A 2ZGNA 4M0NA 4DXSA 1K5JA 3WQBA 2VO5A 1GP5A 1YFUA 5J1XA 1QIQA 1FATA 1JZ6A 1V6JA 2L9LA 2GNMA 5FZ9A 2BBAA 1G7YA 2WWSA 4CDWC 5CFCC 5HPOA 4AOCA 4OI4A 2VR4A 3ZFEA 2WYFA 5CFDC 4NHXA 2FMDA 3J8F2 4IEUA 3CHXA 3JXSA 1NLQA 1GU3A 1AL23 1VBB3 2X05A 3ES1A 1POV0 2XUEA 4LOTA 2ZGSA 3NV4A 2A6ZA 2EXIA 2PHXA 4XETA 2X5IC 2PN5A 4HN0A 4NOTA 1OC1A 1V6KA 3ME2A 4M01A 3ZXKA 4QHOA 3NSTA 5GLVA 3GHMA 1GQGA 1U5YA 4IEOA 2OUHA 3KQRA 1EAH1 1VBE3 4O61A 1JOPA 3A0KA 4FQ4A 3I2OA 1D0HA 5LBBA 1UZWA 4GIQA 3D4KA 1AYM3 1YQ5A 1RUF3 2QQIA 3M3CA 4QX8A 1H8TB 4S2DA 2DVBA 1QJU1 4XOGA 3ZXDA 4CCDA 1YRZA 4Q1RA 3VLBB 4QGLA 1NZIA 3KB5A 4INDA 5L9RA 1GNYA 2QUOA 2ZEYA 2HJIA 3VBOC 3UJQA 2D3RA 5GLUA 2MHFA 2RM23 5IVEA 5FP3A 1Z7S2 4Y1UA 3NJYA 4Q4W1 3WG2A 4L99A 3HNYM 4HETA 4LJHA 4MHRA 2HH9A 3HN1A 1DQ1A 3WUCA 2ZTNA 4X8NA 5KHGA 4WVWA 1UPIA 1COV3 2D6NA 3JUUA 1K5MA 1WA6X 2CGNA 2PLV2 1R1A2 1E57A 3W20A 3ETPA 2ZGMA 5JOXA 3SCFA 2WL1A 4YWAA 3RYPA 5CVRA 4AL9A 1DDLA 4WVZA 1YUDA 5FLJA 4LBKA 3I2GA 5C70A 3GGLA 3AVRA 3S6PA 5KXDA 4ZZ8A 2VUAA 1TEIA 4QD2A 5JOZA 1O4TA 3SEEA 1ENXA 2HYXA 5FYZA 3RZZA 4OZXA 4MGSA 4WM8C 1NXD1 3UT0A 3SH3A 1ZZ8A 1OPMA 4ZPIA 5F3IA 4EYUA 1MEC3 1RJ8A 2W2IA 3U78A 2ZAHA 2BBVA 5C4WC 1C8M2 4Q4X1 3EHKA 3CO2A 2XJSA 4QHZA 3AFGA 4QX3A 2ZA9A 4W4ZA 3UYJA 1X8MA 4N43C 4NRPA 3WDYA 1PMHX 3ZOIA 3ZSJA 4AF9A 5LWBA 2IXJA 5I93A 4GWNA 1LOFC 3T1MA 5JPMB 2WKKA 2HWE3 4AAXA 2AGSA 1OVPA 4P14A 5FZLA 5I91A 3VBHA 1SLLA 3E6BA 4MGKE 3RMXA 4AEDC 5C8CB 2VVDA 1YFXA 3EYPA 1G9BA 4MHUA 4XAAA 2VVFA 2ZGKA 5T5OA 1QY4A 1X9TA 4DO0A 4CUCA 1JZ4A 2BNNA 4QQ2A 1OVSA 4QU1A 5KHJA 2KM2A 4HBNA 2WC2A 3D5OA 2B5HA 2VG9A 5DXDA 3WT3A 4HT1T 4QPWA 4LK7A 1O3RA 1QJZA 3MPPG 4AVCA 2A70A 4JAAA 1UAIA 3NAPA 1DGWA 4CP9B 2UY9A 3N4MA 2B9VA 3HPNA 3FX3A 3BCWA 4Q5OA 3KSCA 2Y26A 1CAVB 4RQPC 2LTNA 5BNPB 1QKQA 2HEVF 2OA2A 4QM8A 3N3HA 4BQYA 1QJFA 1YQ2A 4Z92B 3DKWA 5DZEA 2XKPA 5FWEA 3I2FA 1L7LA 3HQRA 3P3PA 3D82A 1LB2A 1OD5A 4V2WA 5HXMA 4ATEA 3AX4A 1UYXA 5DAPA 5FYTA 1ULGA 4CDQB 4QWNA 4BIFA 1Z7S1 3EB7A 1FXZA 4XZUG 1US2A 2R071 1GWLA 1DYOA 3OG2A 5F37A 4UT5A 2DTWA 2VBPA 4CDXB 1MACA 5K0UB 1M4WA 1GOGA 3B7MA 1H8TA 3S0MA 3LOBA 3N9PA 5F5IA 4UW3A 1S55A 1FMD1 1JYCA 2A1XA 1CONA 2QQLA 4YGEA 4YW7A 3UV9A 3VZMA 3ENRA 3FN9A 3T2QA 1VAKA 5KXBA 3GZEA 2VNOA 3MO4A 3OOXA 2WIIB 3HWJA 3U75A 3ZSLA 2NMOA 2PXJA 1ZZ6A 3CLPA 3H1MA 4HN1A 3POIA 1QJEA 3NKGA 2C24A 3ZX7A 1J84A 2JXAA 4IESA 1TVGA 3WR0A 5FYCA 5A6XA 3V56A 3GBWA 1NQJA 1RUE3 2JEMA 4CCMA 3RJRA 1DZQA 1OBNA 3QD6A 2R1BA 3VBSB 3G6JB 1Y4WA 1N47A 4Q4Y3 4RGGA 4HVOA 3VBRC 2XJTA 4XZPA 3J4UH 5FZKA 2G9FA 2DUQA 3OEAA 4NIAA 2F6BA 2ATFA 1ASJ2 2FCTA 1W8UA 3B3QE 2G9GA 2OPKA 3THCA 4MGYE 4AI0A 3A23A 4CE8A 4K40A 2XVGA 2QQJA 4TLFA 5AC91 4XABA 2QNKA 2VMHA 4EZ4A 2ERFA 2PAKA 5I0SA 3WNNA 2AUYA 5EHDA 2HWF1 4BQWA 3BIWE 4QGMA 3WQ0A 1LGNA 1P8JA 2HBUA 2LRPA 4CU6A 2D7FA 4P5HA 3I54A 4XJWA 1FOD3 2B45X 3B9CA 3IBMA 3RFRA 1XQNA 4PI2A 1KGYA 4KU7A 3U14A 4Q8KA 2JD9A 1HRV1 4BE3A 5HCFA 1AR62 4XUTA 4YW6A 1UY3A 3HT1A 4RR3C 1H1IA 1O8PA 1LAJA 2LM3A 2RDSA 3PVEA 5C8CA 1HV1A 2JDMA 2XLGA 3N36A 4J6GA 3VDCA 4FQZA 1RUC3 1AXYA 4RYDA 4B1LA 3FUQA 1HW5A 4MO3M 1RUJ2 2Z4FA 3GBGA 3RG0A 1PGL1 2BWCA 4JGYB 3ZSKA 1UKGA 2I2SA 5FPAA 3A22A 4PQQA 2VECA 4QKBA 1O91A 4BOWA 3B94A 1AVBA 2W5FA 2QVSB 1BMV1 4PHZA 1IPKA 1CR7A 3PVBB 4NAOA 4CP9A 4ZXEA 5LW9A 1DFQA 1VRBA 4DPNA 1GLHA 2OZJA 3HQUA 2WQ4A 5BNNC 4D6QA 1R093 1SDDB 2HWB3 2ZABA 1CAVA 3KMHA 2YB7A 2I74A 4KL1A 4NJ4A 5BNPA 1CAXB 3OUHA 2PMWB 4CCKA 2VMCA 4YZ1A 1AR93 1LTEA 3AZVA 4FPYA 4LBLA 3BIEA 1LHNA 5FZOB 4FBFA 2R041 1W8OA 1HB3A 3T09A 3JB8A 2GP5A 5FZGA 3NNGA 5FP4A 3UGGA 1ND2C 2WZR2 4E27A 1NOVA 1UY0A 2ZX4A 4Y4RA 2IFRA 2V5YA 2YY1A 3ZYRA 4CDQA 4E4HA 5BNOB 1RMU3 5LY1A 4IE0A 2RS53 2PQQA 5FYIA 2GSYA 4PBOA 4V1PA 3OUIA 4Q1PA 1WLCA 4YW3A 1JOBA 4CXXA 2OX0A 4JGZC 4FSJA 1YCIA 3IDAA 1J83A 2D98A 2VZSA 3MIBA 5K0UA 3PTYA 2VMEA 4I30A 2UWCA 4LO8A 4CDXA 1CAWB 4A7ZA 4W6YA 1YHFA 5FUIA 2AR6A 2BPA2 3JD72 4YM1A 5LY2A 3OD4A 4JTNA 4GULA 3W5NA 1EP0A 3LDRA 2DWRA 1RUD2 3IDEA 2V4AA 3IMMA 2DURA 4KGGA 4RL7A 1BBT3 3IM0A 2I45A 2UY8A 3BTZA 1QXJA 1SQ4A 1V6OA 4XFHA 1QH6A 4LHKA 3J7LA 2A6VA 4PF5A 4QHBA 1AYN1 2WA3A 3PLQA 1JYVA 5KC5A 1JUHA 1BEV1 1FV2A 1AX1A 4YGCA 3AZYA 1QDOA 2FDIA 2RR12 1UIJA 1RXGA 2OT7A 3LB9A 4CDUC 1NZCA 3VBSA 2XOMA 4J1WA 2VOTA 5IUQA 3WF3A 1R082 3B5LB 3PUIA 4XHBA 3WNPA 1SFNA 1ZA7A 2WZPP 1AR61 2EA7A 1FPN1 2OW4A 2EIEA 3AMHA 1NY72 1IPJA 3SHRA 3KZ4C 1DQ5A 2BEOA 1MZ5A 4H14A 3RWKX 2D44A 2XB6C 3G7DA 1AL0G 1L3JA 1LENA 4FOQA 5IVBA 1LU2A 2ZGTA 4BWOA 4Y1VA 1PGW1 1PO22 1UKRA 3FC0A 1UOFA 1PZ8A 5EWSA 5L7OB 2R32A 1RB8G 1H8VA 4QPGB 1QJY3 2JDNA 2FQPA 5JXHA 2B42B 3MFCA 3N9MA 4I0BA 3W59A 3AMPA 1LECA 1CPNA 3IZOA 2ILMA 1VBD2 4YW5A 2P37A 4LBOA 1ENRA 1NCQB 4AFBA 2XQRA 2RS12 1KJLA 1Z0HA 1DYPA 1RHI1 1ODNA 3C7GA 3CF6E 4GD4A 2HKXA 5BYNA 4UFIA 4DB5A 4KBZA 1Q8QA 1XOYA 4IV3B 5ABJB 2QZ2A 1MQTB 2FCVA 1GP4A 4XFAA 1C1FA 1W06A 2ZX3A 2VMIA 3OB8A 5FZBA 5JOWA 2FMYA 4HFSA 3I2JA 3NVCA 4GKXA 4COUA 1NCRB 2O1QA 4JDMA 4XXAA 4Q0SA 2OZ6A 4JGYA 3BUCA 2PTMA 2WQ8A 4GJYA 3RQ0A 5FPBA 3R4SA 1IG0A 1ZBA1 3MICA 3FLPA 3WDVA 5DABA 1QQP1 4CEWC 1Y9GA 1TME2 5E6HA 5LBFA 3WHTA 1A34A 1W9WA 4LPLA 4S2GA 3LE0A 3BKZA 3TEYA 2WYSA 2IXKA 4A6SA 3POGA 5FY9A 3U1XA 3AZWA 1HB1A 2W47A 1OOPA 2VOVA 3N7KA 2D6OX 1J58A 4M4RA 5FZ3A 3DECA 1R64A 2ZZJA 2X29A 5DZFA 4LBJA 2PHLA 2HWC2 2H0BA 4FT8A 2GN3A 4CCNA 1KRIA 1LOCA 1RVF3 4CDWB 5CFCB 3O1RA 1V6NA 1UCXA 3R05A 5FZOA 1AF9A 1HV0A 2E53A 3E97A 1I3HA 4XAEA 5DDJ2 5FLIA 5FZFA 4EN9B 1ND3C 4A7YA 5CFDB 2C1FA 1NUKA 2GC0A 4K21A 1DF0A 4F7ZA 2DYCA 2JG9C 4RSUA 4QT6A 5A3LA 1VJ2A 3WP3A 5BNOA 3FMGA 2X5IB 3I4IA 4FO9A 2XDVA 4GH4C 3KV9A 4YPJA 4ITCA 4TTGA 3SH4A 1RIRA 3OEBA 2VZRA 1JUIA 2RS32 1HX6A 2JE7A 3ILRA 1VAMA 2N7GA 1LNSA 3LPGA 3WF0A 4XQWA 2WT1A 2VMDA 2VTFA 3M3EA 2D5FA 2RE9A 4HXCA 1A3KA 3LEKA 4GAZA 5FZEA 1BXHA 3INAA 1F5FA 3GCWA 4XJ8A 3KD4A 2ZMKA 2VXRA 1GV9A 1YFWA 2ZX1A 1O3QA 3GDBA 4U2AA 3NRUA 2WS93 3CNAA 3VBOB 3FFQA 3WG3A 3ACFA 4MXVA 1PIV2 1APNA 3O0XA 4K1YA 3WF4A 2E9QA 1N1SA 3KF5A 1VBC2 3KLSA 5FK7A 1SCSA 1U0AA 2SLIA 4GMP3 4YYOA 5KXCA 4D8MA 1UX6A 1AZDA 2BQPA 1WCQA 4K1ZA 4LO7A 1ZX5A 1XNKA 3N7JA 5A1LA 4W6WA 3JBG2 3D0SA 2AH2A 2WLPA 2RS11 3AP6A 2XONA 1H9PA 5DUXA 1NE4A 4EN7B 4BLJA
chains in the Genus database with same CATH topology
4RHV2 1JHNA 2R16A 2DVGA 3ECQA 4YW1A 1CN1A 5IK8A 4I01A 3GZUC 2XGXA 2H6CA 2XJRA 5L7OA 2CYFA 4QPGA 3J8F3 5BV6A 1AR82 4WM8B 4JRAA 2EXHA 2Z5WA 5FBZA 1MS5A 3U10A 1WW7A 3WX5A 1NCQA 2RMU2 1NQDA 3VKNA 5C4WB 4NHKA 2R061 3SITA 2DUPA 1WBFA 4N43B 1C28A 4L8QA 2CL2A 4IV3A 3DPRC 5ABJA 5IT6A 3RRDA 4ES8A 2RJLA 1YWKA 5JWPA 3D0JA 4QQOA 4AEDB 1NCRA 2K9ZA 4META 1C5IA 4AE2A 4ASMB 3IIAA 4BPZA 3NJZA 1QJX1 2IZWA 2WNVC 1QDCA 4XTMA 1OA2A 4XHXA 3AK0A 4JDOA 1ZRRA 5T50A 5H9SA 4P9WA 1IOAA 2VUJA 1W39A 4XBQA 1VBA1 2DVDA 3WXPA 5HCBA 1J1LA 2PLV3 5SV5A 3UKTA 4YM2A 1IS6A 1R1A3 2P3JA 1MZ6A 2ZKNA 1BVVA 4K6BA 3MPBA 3E6DA 5KWRA 1KQRA 4RQPB 2WJSA 5JPNB 3BB6A 5FTTC 4CDWA 4DRVA 2TEPA 5CFCA 1QXRA 1B35C 1O7FA 3ETQA 3MIDA 4AFMA 4PLMA 1EAH2 3ZN6B 4OHYA 4QGNA 4KH9A 4QQPA 2X5IA 1URXA 3H1WA 2IXHA 3FFZA 1F31A 1PIV1 4OI2A 1O4ZA 2MPFA 4MGZE 3OPZA 1VRH2 3RI9A 4MXWB 1D2SA 1RINA 2YXSA 3JBG1 3N7MA 5FFOC 3MF9A 2C5DA 3OGJA 4LNVA 2D6KA 1V70A 2NMNA 2EIGA 1WW6A 3VBOA 1UZYA 3O14A 1H4HA 3EBRA 4RHV1 1D4M1 1AR73 1YYNA 3GBFA 4FAHA 2JE9A 2O0OA 4GMP0 2XBO1 3M2MA 4XBNA 4LR4A 4CRQA 4DFSA 2WQZC 2DCYA 4LA2A 4AWDA 3B02A 5EXOA 1F9KA 4U36A 2YROA 4M3CF 4DY3A 5CG9A 3E5XA 2PHRA 3FHIB 1DLLA 2XWJB 3MW2A 1RUH1 1SEFA 3VGIA 5DUVA 1LOAA 3VBRB 4IEPA 3O5SA 2QFEA 4LBQB 4XJZA 4Q4X2 1S0GA 1H2KA 4YZ5A 3THPA 3K48A 4FPCA 1TNFA 4AQTA 1YIFA 2AYHA 3IWZA 4WM8A 4ATFA 3WP5A 2ZPXA 1UPSA 5IK4A 4PBPA 3B01A 1NLSA 3L9JT 2KXLA 3TN93 4ZKTB 3TYJA 5C4WA 3CL1A 2K2SA 2CGPA 5JZGC 1N1YA 4TYSA 4N43A 4G9SB 5EZWA 2XJUA 2BTVC 3RJ2X 1LOFA 4L11A 4B7EA 4RR3B 2ZS6B 4B8EA 3OYWB 3POWA 4IETA 3AYAA 5HBAA 4AEDA 3VHPA 3SNMA 4LBNA 4PDWC 1ZZBA 4BIOA 3VBUB 1WA4A 2O8OA 2BW8A 2IC1A 4YW4A 3AP7A 3IPVB 4E4DX 3GYDA 3ZIXA 3VZLA 1SBEA 1F8VA 2QCSB 4N53C 5LEKA 1TMF1 3VZKA 1G6NA 5FMOL 2CTVA 4M3CE 2Q1ZB 4WV8A 4XILA 1QOSA 4L9BA 4BZ4A 5BNNB 5I8SA 4FPFA 5JI9A 4RQPA 2HWD1 2XL9A 1PMIA 4RD7A 2MEV1 3WDWA 3WVJA 4D7SA 5HI0A 4L2NA 1VRH1 2ARBA 1YIPA 3PHMA 5FLHA 5JDBA 3MZHA 2XLFA 1ASJ3 1IS5A 2R072 3ZN6A 1G9DA 1QU0A 1MZEA 4XF9A 2VNGA 4AI8A 1DGRA 3HIFA 1ND2B 4AVTA 1H2MA 2IXCA 1Q43A 5KHIA 3E5UA 4XMAA 3LZZA 1FMD2 1GBGA 3OBRA 5JSPA 3TRSB 5DUWA 1BQPA 4JGZB 4MXWA 5ACA1 1HRI1 2DF7A 3AP9A 4HLTA 3NV1A 5C8WA 1BVP1 2DU0A 5KHHA 2QZ3A 4R4ZA 1RUJ3 3DUIA 1OA3A 1WLWA 2WA4A 3ZSEA 3LSDA 2ZGUA 4UXAA 1PNFA 2A3XA 1C1LA 3O0WA 1WCDJ 1LGBA 2D3SA 2VOKA 4IEQA 2XVKA 2GN7A 2R0FA 5CAZA 4UW6A 5EV7A 4YZ2A 2ZGRA 4D69A 3BALA 4LBMA 2BVVA 3WHUA 4JV4A 5TSWA 2ZZQA 4CDUB 5AC92 5HCAA 5F6LB 1IHMA 5LRRA 2XUMA 5AVAA 1ZRCA 3VBRA 2HWF2 4ZU4A 1SFYA 1XE7A 4TSVA 3VV1A 4FCAA 4LBQA 4KNCA 2UWBA 5D1IA 3ACLA 4IEYA 1OHFA 3T1LA 3NKTA 1HRV2 2P34A 5E1RA 4JRLA 3GALA 4YVSC 4XXPA 2WZR3 4B29A 3HT2A 2DU1A 4YM3A 1C8NA 1BKZA 1GNHA 5AVPA 4EN6B 3VHRA 1PZ9A 2CNAA 1X7NA 4HVRA 1PGL2 4XDQA 3FBMA 4RR3A 1ZRDA 3PJYA 2GC2A 3OYWA 2FHRA 4XJAA 4L97A 3UKVA 2E6VA 2XJVA 4UW4A 4XFCA 3VBUA 4MGIE 3D6EA 3JD73 4IERA 1MVQA 1BMV2 1Y43B 1RUD3 3IPVA 1J1TA 2E7AA 3JCIA 2GMPA 3WG4A 3OY8B 4XFIA 4D3WA 2A7AA 3OD0A 5FO9B 5SV8A 2ZBJA 5T5LA 1RUG1 4HKOA 1LHOA 2DFBA 4S2FA 3J26N 4CEWB 1RUI3 5DUUA 4X8PA 4GWMA 4NHMA 4Q4V3 1YI7A 4FPJA 1VB2A 2RR13 4YVWC 1WUVA 2R042 2GALA 2WLQA 3GZAA 3AZXA 3WOGA 1R083 4KQ7A 5DG1A 4AGRA 1POV1 4M3CB 1CESA 2TNFA 4GB32 1H30A 4C1XA 1Q8PA 4OHWA 3M4FA 4RGAA 3SH5A 5J3UA 3WQ7A 1PO23 4FVVA 1ND3B 4HMZA 3V0AB 1G9CA 2B7YA 2JG9B 5FOJB 2BVBA 3IKWA 4DRRA 5FPZA 1NE6A 1VBD3 1NG0A 2Z42A 4GH4B 4QM9A 3ZO0B 3IDBB 1H2NA 1ZZ7A 1VAVA 2I07B 1BZWA 4JGZA 4QQHA 1FNZA 4B7KA 3I8TA 4XE9A 1AUYA 2JDZA 2JJ6A 2ZCWA 1AYN2 2XLAA 1BEV2 3R0RA 1C57A 1DBNA 1S2BA 2BFUL 2ZGOA 3AM2A 3ASIA 3E5QA 3MLKA 1AYM2 1QGLA 1RUF2 4UW5A 5F1RA 4Y1XA 4YGBA 5CB7A 2VQ0A 5JVVA 3GF6A 4IL7A 1DU3D 2TUNA 1FPN2 1TME3 4AHWA 3FBYA 1BCXA 5J7MA 2RM22 3HAGA 1C5HA 2VOXA 3OGGA 1VR3A 1YI9A 1PGW2 4CDUA 1V6MA 4DMIA 4AFAA 1DIWA 5BPXA 4C0BA 1COV2 3WDTA 3WINE 2HWC3 4NPRA 3LGRA 3ILFA 5LRSA 2OUJA 1V9U3 5EFUA 5DDJ3 1RHI2 4MYEA 1DQ6A 1LOBA 1TQ5A 5D8AC 4YARA 1Z78A 1EV11 3HMYA 4DZGA 2ZHKA 4D7TA 2A6XA 3D8CA 1EY2A 4WBBA 3MIHA 3KM5A 2RS33 2OIIA 2QQPA 4B3NA 4DINB 1IS3A 3KT4A 2R6QA 1ZBA2 2WFF1 3DPRB 5T3NA 5J98B 3QLQA 2YYOA 4GQ7A 1QQP2 3ALQA 3VZJA 1IQAA 1VLNA 4COZA 1LULA 2PAEA 4Q29A 2R49A 3MLJA 4L92A 4H7MA 4GB31 2HWE2 4HSJA 3OY8A 4LTAA 1SLBA 4X6QB 5EYXA 1PK6C 4P9YA 4AGGA 2WNVB 4LLOA 1DGLA 4CEYC 2WNUC 3E6CC 4Y20B 4CEWA 1VBC3 4WM7C 4IEVA 4C90A 4XJ9A 4LUKA 4XF0A 4PJYA 4OHVA 1XYOA 4FPGA 5GJ6A 4DOUA 3TNPB 1AL21 1VBB1 1HQWA 1D2QA 2DCJA 1YO8A 2C9AA 2K0GA 1JH5A 4M3CA 1GZ9A 3TNQA 2R30A 5H9QA 3NV3A 4MVTA 4Y4YA 3ZXFA 4CTEA 2A6WA 2D43A 3WP4A 1O4YA 1MS0A 3H1YA 1LOGA 4B4RA 3MIGA 4FXGB 1VBE1 1B35B 1ND3A 3V0AA 3ZMNA 3SCGA 1AR83 2QE3A 3PVNA 1OI6A 4QPIC 1AYM1 1RUF1 3AP5A 4A7KA 4GH4A 4TZDA 4HANA 4RS5C 4AQ2A 1ALYA 2GU9A 2RMU3 1HQNA 3FUOA 4O9EA 5K8SA 5JAXA 1PVC3 1ZA4A 1PO13 2O8QA 1HXS3 1Y3TA 2RM21 1CPMA 4PIXA 4R52A 5BXXA 3GNEA 3RNSA 1ZBE3 3RI8A 1CAUB 1LHVA 4IV1C 3VBFC 1XXNA 4WVMB 3H7JA 5BNQA 4IEXA 2CWMA 1COV1 5F9TA 1WD4A 1ZNPA 4AI2A 1UU4A 5H9PA 3RYKA 1S0JA 3M70A 2WT0A 4F3JA 5I8TA 1VALA 4N9IA 1X82A 3ST7A 4JC1A 5JLVA 1SBDA 3KS7A 1OPOA 2ZGQA 4XBLA 5K7PA 5JIUA 4HK9A 4HKLA 2TBVA 2MNGA 4D94A 4IXLA 2NM1A 4CYDA 4IQPA 4H3WA 3T2TA 1MEC1 4NHLA 5CA6A 2R0HA 2A3WA 5GZFA 4MZUA 1AHSA 3ZYIB 4B4PA 4AVBA 1RJ7A 3QOPA 3AZZA 4KG8A 2R062 3HR9A 4AFDA 2D5HA 2ENRA 5BNPC 3AYCA 2CWSA 2D93A 1FT9A 1EAH3 3WD5A 1KDMA 1REEA 2HWE1 3CJIC 5GZEA 5KHKA 1RL3A 1QXPA 1QJU3 5FCCA 1DZTA 3NL1A 4BM8A 4I02A 2AZ5A 1ULCA 4SBVA 1CAXA 3ZSMA 2YGMA 4QPYA 3AMQA 1AJOA 1QJX2 1UIKA 1JOJA 3DPRA 1ENSA 1S0FA 1O5LA 4Q4W3 3QH6A 2P3IA 1JBCA 3O0VA 3VL9A 4S2HA 3ELNA 1VBA2 1H1MA 2B9UA 1LCLA 1CIWA 2WNVA 4I09A 3BU7A 3KCCA 4Y20A 1SLAA 4YNIA 1X8EA 2Q8OA 4ZXKA 4N53B 2YGLA 4R8HA 3EQEA 3ZFFC 1HDKA 3HQXA 1Q8SA 1CAWA 3USSA 4OULA 4LE3A 4BLIA 3H8UA 3M1HA 3VKMA 4P9LA 4FP2A 3VZOA 4E4SA 5BUVA 2UYAA 1I9RA 1PHMA 3UKNA 4Z8BA 4OUMA 5E88A 2ZKLA 3UK9A 5CU1A 2HWB2 4Q4X3 2FBEA 1B35A 4EJRA 4YM0A 1WCKA 3FJSA 1AXKA 1QH7A 3AXDA 2ETEA 1FYUA 3H3ZA 3WDUA 2IFWA 3L2YA 1FX5A 1I1EA 1XNDA 2ZGPA 1H2LA 1SMVA 1S0DA 1W0PA 1KDKA 1WCSA 1VP6A 1YJKA 2PFWA 1D4M2 4Y26A 4P9XA 4NR1A 2ZGLA 4PCRA 1CAUA 2VY0A 2XBO2 2YC0A 4WVMA 4DQAA 5C33A 4E9KA 4K7JA 5KBFA 4M00A 4SLIA 1ULDA 1UL9A 1RUE1 2NN8A 4XF1A 4Y1ZA 1CGPA 4Q4Y1 2Y0IA 1RUH2 4ISRA 5FQ0B 1ULEA 3U11A 4KWKA 5LK7B 3MI8A 5T5JA 4N7UA 4YRDA 1MQTA 3U4XA 3RYRA 2WINB 1N3OA 4F8AA 2ZX2A 1LHUA 2BNOA 2Y38A 1QHDA 2P17A 1FOD1 3KGZA 3FLRA 3TWIA 4Z82A 1OOPC 4ISQA 3CEWA 2GAUA 1Z7S3 3PJQA 3BOWA 5J36A 2HEYF 3RS6A 2R073 1MS3A 3VN4A 1DG6A 4YVSB 2R1DA 2WSUA 2DVFA 3B69A 3KGLA 1RUC1 3POSA 1CD3G 1OQDA 5K9YA 4TWTA 1FAYA 3RDIA 2DCTA 2ZACA 1FMD3 4HKWA 1XRUA 3VHOA 4YW2A 1PNGA 4FTSA 2XHKA 4KG0A 2A6YA 2A75A 5GZDA 5CFDA 3S7EA 3W9AA 1C4RA 4YGDA 1TMF2 1WW4A 1SBFA 3VDDC 1MR5A 4ORFA 2Z79A 1R091 4XEZA 2HWB1 2X53S 1C8M3 1W2UA 1MZFA 3J9SA 3EO6A 4N53A 1W6OB 2HWD2 3DV8A 1AR91 2MEV2 3BOPA 2W52A 4LUMA 4D7YA 2NLRA 4PQ9A 2RJKA 3C3VA 4EWEA 2PAMA 3FZ3A 5J37A 4G4FA 4YVWB 3AYEA 2PELA 4HZFA 5C9AC 5L19A 2W08A 1LKNA 4LO5B 3ZYPA 1UMZA 2G4IA 2HWF3 1RMU1 2XWBB 2RS51 1KFXL 1KFUL 1Q3EA 1CVNA 3TOJA 3QACA 1SLTA 1V00A 1HRV3 1TNRA 4BA6A 1RUNA 1NA1C 1ZZCA 1MS8A 2HYKA 5ACA2 1W6QB 1HRI2 5GKAC 3LA7A 1GR3A 2YDEA 1QNYA 2XVLA 2ET1A 1HIXA 3ZFGC 2E7QA 3BPZA 2JECA 1BBT1 4XF4A 3SMHA 2AENA 3WW2A 1IKQA 5EJ3A 2BYVE 4YFZA 1GZCA 3APBA 4Q0PA 3UL2A 4AW7A 1ZREA 4I0WB 1MVEA 1OLRA 5F5QA 4MV2A 1W6MB 1WW5A 1YNAA 4C0HA 1IZ3A 1OFSA 1S0CA 3AJZA 3M8LA 2EVXA 5BY5A 4XQ4A 5FQ0A 1J3QA 3DF0A 3B9IA 4N90A 1DQ0A 3QBQA 4QU2A 2R043 1QJY1 3O12A 4FOWA 3HBZA 2NZ9A 4R9DA 1NXMA 2JKBA 3OJBA 3ZXGA 3LA2A 4OI1A 3TBDA 5AFEA 4EWAA 2PHUA 3WW1A 2GC1A 3OTFA 3X29B 3M3OA 2D6PA 4FPHA 1QOOA 4GKYA 1QMJA 2WT2A 4YVSA 3I59B 3EJKA 2VW2A 5L73A 2DUOA 4NN0A 5D8AB 2F4PA 2WFPA 3MGUA 5FREA 1I5ZA 3KCYA 3KCXA 4Z2WA 4LE4A 2DVAA 4OLLA 1S0IA 2X8KA 4FPKA 1JYIA 2QKDA 3V0BB 1R1ZA 1RUG2 3JU9A 4R4XA 5JIAA 4AVSA 1AX2A 1O3TA 3S30A 2D97A 5GLTA 1AYN3 5T52A 1BEV3 5CBLA 3MIEA 1UD1A 2Q0AA 4AHXA 3I7DA 3MLLA 1KD7A 3RWNA 2OYZA 5JMCA 2UURA 3O7OA 5H9RA 3WCRA 1PK6B 4QMAA 1B09A 4XQDA 4GXLA 2WSVA 2JG8C 1DZRA 2WNUB 1W6OA 2FZ1A 4CEYB 2P3KA 1AR63 1FPN3 2UYBA 2ZHLA 4OVEA 1KJRA 4WM7B 1REDA 1RITA 1RVF1 3DGTA 2A71A 1S2KA 4Y22B 1KITA 2JICA 4NO4A 4XMIA 4YVWA 1VB4A 3ZN4A 5T54A 2A73B 1UW8A 2XKOA 3CJXA 2HEWF 1LEMA 2GMEA 2Z69A 2VW1A 1RHI3 2GMMA 1PZ7A 1W6QA 4XFFA 1WD3A 3LSEA 2GZWA 3Q9OA 3WW3A 1I6XA 4QPIB 3U0ZA 2FZ2A 4NVPA 5GALA 4XJUA 3AJYA 3MW3A 2BGCA 4RS5B 3ZYGA 3H3UA 3S7IA 4HPKB 1SACA 2WS91 4Y24A 2V73A 3AP4A 3RMYA 1ZBA3 4LBQD 4W6XA 1GYKA 4B4QA 1QQP3 3MFAA 4ES9A 4GMP1 4BMBA 1FV3A 4EWDA 1W6MA 4IV1B 3VBFB 1V6IA 4NWVA 2VGDA 4CP1A 3MEPA 4H55A 3ZFEC 2IWGB 4XYXA 1UU5A 2JX9A 4KBBA 1Q5OA 1SLIA 2IXIA 4DXZA 4XFBA 1AR72 1F5JA 4GA9A 3WCSA 3WUDA 3J8F1 4OUSA 3AKQA 3IT8A 4AVAA 3NWKA 1BYHA 1DQ4A 3MIFA 5C6CA 2VU9A 4MLOA 1QOTA 2YMZA 4AHYA 1EYBA 1EV12 4K9SA 2DV9A 2Q4SA 2DFCA 3MF6A 1WBLA 1W0OA 4LHNA 3P3NA 4BH9A 3VKFC 3I59A 2W39A 3R4DB 2VNRA 2UWAA 2WFF2 1G9FA 5D8AA 2EAAA 3CJIB 1U5IA 4XW3A 4AXOA 3I2DA 5T55A 5BNNA 1G86A 4XFGA 1UU6A 4P9JA 4FPOB 3AKSA 1OLQA 2XJPA 3TN92 1K5MC 3V0BA 5EYYA 1DQ2A 2ZHMA 1W6NB 2QDNA 1IKPA 3IDCB 2PHTA 1ND2A 1MS1A 3GHNA 2PLV1 1ZVFA 1R1A1 2E7TA 2GNDA 2D3PA 5E16A 1PK6A 4COVA 5JCTA 1AL22 1VBB2 1UN1A 1WLDA 5GLZA 4CEYA 2WNUA 4I0AA 3LOIA 4IEZA 1O3SA 1REFA 2RS13 4WM7A 5JI7A 1J59A 3JQXA 3U07A 4DY5A 3N35A 3ZFFB 1C3HA 4Y22A 5CG8A 2ZAAA 2DCKA 4FPLA 5FO7B 1DGWX 1VBE2 1WMEA 1JXNA 3JZVA 3WV6A 2VH9A 1JW6A 4C1WA 3AKPA 1N1TA 4Q2FA 3VBHC 2PHFA 1CJDA 1C8M1 4AHZA 1LU1A 4AVVA 3DL3A 3AMMA 2R063 1G8WA 2LUWA 4FPEA 4QPIA 1N3QA 4I3GA 2GH8A 3VKOA 4E4ZA 4MUVA 2NQYA 4RS5A 2CY6A 1LR5A 2BWAA 4OFGA 3A4UA 4HPKA 5B2GB 3W58A 2B39A 1H0BA 1Q56A 1KXGA 3WNXA 3NAPC 1GZWB 4YG3A 1AR71 1QJX3 4GALA 5KC6A 4FTBA 4MX3A 4FOYA 1YXWA 4XIOA 1O5UA 3AMNA 1OA4A 1RTVA 2ARXA 5I0TA 5J09A 4W65A 1U5XA 2AREA 4IV1A 3VBFA 4COYA 4YG6A 1LJ7A 1KS5A 2W68A 1XE8A 2CGOA 1VBA3 2ES3A 5I8YA 3ZN5A 1N1VA 1H4GA 3LAGA 2EF6A 3VBUC 4OHZA 4QX5A 4UBGA 5FPXA 1V6LA 4K3UA 1UF2C 3KT1A 1DYKA 1MEC2 4AQSA 1WMFA 1XYNA 2ZMLA 1GNZA 2D40A 1XU1A 5JSOA 2A3YA 3RSJA 2EALA 2GNTA 2VULA 1OFNA 4EV0A 1W6PB 3LA3A 1A6CA 3TN91 3ZMOA 4J1XA 1H8TC 3USUB 3AKTA 5LK5A 3WQ1A 1AJKA