1DGRA

Refined crystal structure of canavalin from jack bean
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
178
structure length
178
Chain Sequence
NNPYLFRSNKFLTLFKNQHGSLRLLQRFNEDTEKLENLRDYRVLEYCSKPNTLLLPHHSDSDLLVLVLEGQAILVLVNPDGRDTYKLDQGDAIKIQAGTPFYLINPDNNQNLRILKFAITFRRPGTVEDFFLSSTKRLPSYLSAFSKNFLEASYDSPYDEIEQTLLQEEQEGVIVKMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray diffraction and atomic force microscopy analysis of twinned crystals: rhombohedral canavalin.
pubmed doi rcsb
molecule tags Plant protein
molecule keywords CANAVALIN
total genus 39
structure length 178
sequence length 178
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1999-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00190 Cupin_1 Cupin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1dgrA00
1GQHA 5CADA 1I6XA 5FDBA 3EO6A 4IEYA 2FMYA 5FPXA 5BV6A 1YUDA 3OGJA 1G6NA 3IDCB 1FXZA 4YRDA 2B5HA 4N9IA 3RYRA 5JSPA 1QY4A 1IPKA 3PLQA 3ELNA 2OPKA 1WLTA 2ZCWA 3IWZA 1ZX5A 3U10A 2D5HA 3UKVA 2GC1A 2V09A 4HZFA 1CAXA 3FX3A 3H50A 5LEKA 3E6BA 4L2NA 4YYOA 3I59A 1ZZ9A 5KHHA 4AXOA 3ETQA 5BPXA 3UKNA 5JCTA 5T3NA 5J7MA 1YFYA 4D7TA 4F7ZA 1O4TA 1ZZBA 2I45A 3RPQA 3LA3A 4DINB 1O7FA 2EVXA 2N7GA 4LTAA 1ZREA 1Y9QA 4I02A 2B8MA 5KHJA 2VPVA 4MGZE 4HN1A 2GC0A 3MZHA 2VECA 4E2SA 2XLGA 1VR3A 3BB6A 4TLFA 4YNIA 4XFGA 1DGWA 4R52A 2OYZA 4MGYE 4BH9A 4QGLA 3BCWA 3TNQA 3IIAA 3H3ZA 4AQ6A 3RNSA 1UD1A 3O14A 1NXMA 3QOPA 3CLPA 4Q0QA 5I93A 4XF9A 4LUMA 1X8MA 2PTMA 5F1RA 4HMZA 4A2UA 1RUOA 4I0AA 3SXWA 1LRHA 1CAUB 1CX4A 1ZRFA 3H1WA 3S7EA 5FQ0A 1NZCA 2PHDA 2IC1A 4MX3A 4HVQA 1LB2A 2OA2A 5HI0A 3L2HA 5KHKA 3PVBB 2QNKA 3H1MA 4IEZA 2QCSB 4EWEA 4YSFA 1CAVA 4XFCA 2Z69A 2O1QA 2ZKLA 4UBGA 4JTNA 4KL1A 3RZZA 2D40A 2ATFA 2H6CA 1X82A 4R8HA 2H0VA 1XE8A 3N4MA 3DV8A 3JZVA 4WBBA 2UYBA 4MH0E 2GH2A 1OI6A 4MV2A 4GULA 2IXJA 1J3QA 1YHFA 4LA2A 3OCPA 4HSLA 3SCFA 4PIZA 4Q0SA 1CAXB 2HJIA 5JR7B 1H1IA 3E6DA 3RYKA 2BNMA 3GBFA 3FJSA 1DZRA 2E9QA 2PAKA 2IXLA 2UY9A 1CAVB 4N9HA 4FAGA 1YFUA 4XF3A 1ZZCA 3U0ZA 2VQAA 1EY2A 4EV0A 1V70A 1OFNA 1XRUA 3MYXA 4HSJA 5I0TA 5I8TA 2ET7A 5LEJA 5D1IA 3WW4A 3I59B 1NE4A 2PYTA 2GU9A 3FFQA 3H1YA 5BY5A 4O9GA 5KHIA 4I2OA 2PAEA 1VJ2A 2CAUA 2PQQA 2XLFA 4WZCA 3LAGA 3SMHA 3EQEA 5J3UA 4Z07A 1ZRRA 4QX5A 1RTVA 2ETEA 1ZNPA 3VHRA 4AQ2A 1O5LA 1QWRA 4XFBA 2BNNA 3H7YA 4ORFA 4MUVA 3HT1A 1ZVFA 4WVZA 4Q29A 5E1RA 4KWJA 5E16A 4P9GA 3M70A 4XEZA 1TQ5A 2EAAA 1OD5A 1O3QA 4JVAA 2DCTA 2Q4SA 4J1XA 4H7LA 3E5XA 4XFIA 1WGPA 1LKNA 1RUNA 2Y0OA 3E6CC 1RGSA 2XHKA 3ES4A 4UXAA 1HW5A 1J1LA 2WC2A 3IDBB 4ZU4A 1NE6A 1XE7A 2FQPA 4QM9A 3WW2A 4IEXA 4BIFA 5CU1A 4QGMA 3S0MA 4MZUA 4X6RB 4BYYA 1NYWA 3CO2A 3EJKA 3G7DA 4CYDA 1Q43A 2XL9A 5C8WA 1UIKA 4KU7A 4Q0UA 2C0ZA 4IETA 3EHKA 1EYBA 3LA2A 5FCCA 3ST7A 1SFNA 4KWLA 3RYPA 3CEWA 4LLOA 3D0SA 1WA4A 3KMHA 1GQGA 4AVCA 2OZ6A 1U12A 1X8EA 4FBFA 5I0SA 3ACLA 4ONUA 1Q5OA 4FT8A 3BU7A 2GC3A 4XFFA 3U11A 4XFAA 4D7SA 4OLLA 1RL3A 4MGIE 3OD0A 2MPFA 4EROA 3QACA 1J3RA 1VP6A 1ZRDA 2GAUA 4ZU7A 1Y3TA 5I91A 5KHGA 1J3PA 1LR5A 3KGLA 4JTOA 3BALA 4X6QB 5BXXA 2CAVA 4HVOA 4Q0PA 4QM8A 3SHRA 4RD7A 2OZJA 1DZTA 1ZZ6A 3CF6E 4Q0VA 4HBNA 4LULA 2HKXA 4E2QA 2IXCA 1YWKA 2BGCA 2PAMA 4HN0A 3M3IA 1QXRA 1UCXA 5JAXA 4F8AA 3I54A 4IEPA 3CJXA 5K8SA 3HT2A 4XETA 2UYAA 1PMIA 4OFGA 2K9ZA 3FHIB 2ET1A 2P17A 3NW4A 2GZWA 5LRRA 1Q3EA 4UBHA 2O8QA 5EFUA 3LOIA 3LZZA 5C6CA 1O5UA 2IXHA 2Q30A 3LA7A 3CL1A 5AVPA 4I0BA 4ZU5A 3FZ3A 4I09A 4HLTA 3MPBA 3SCHA 4IEWA 2CGPA 4I01A 2XLAA 4HVRA 1JUHA 1SEFA 3ES1A 4LEJA 2Q1ZB 4QGNA 5FLJA 4AVAA 5FLHA 2IXKA 3H8UA 1PM7A 5J48A 2MHFA 2PA7A 4YARA 2BEOA 3NKTA 3FE5A 4B29A 4I3PA 3E5UA 4JV4A 2KXLA 5JSOA 3FWEA 3WW3A 1O3SA 3I7DA 2K0GA 4QMAA 4IEOA 3WW1A 4EWAA 4KWKA 3NJZA 2GC2A 2QJVA 3D82A 3OF1A 4META 2BYVE 4QXKA 1DGRA 1L3JA 3NSTA 3RDIA 3USSA 3OTFA 1O3RA 3ZDSA 2XL7A 3TNPB 4NVPA 1YLLA 2XKPA 5FLIA 1EP0A 1FT9A 4XF0A 4FAHA 1X7NA 1FI2A 1OMIA 3PNAA 3DKWA 4IEQA 4XF4A 4E2GA 4L11A 2D93A 2Z2SB 3E97A 1CAWB 1RC6A 1ZZ7A 4EWDA 5I8YA 1UW8A 3BPZA 2MNGA 2B9UA 2F4PA 4PIYA 2QVSB 1CAWA 3SCGA 4IEVA 4BHPA 5KBFA 3DL3A 2CV6A 3B02A 4O9EA 1QXJA 2EA7A 4LUKA 2D5FA 3D0JA 2H6BA 1ZZ8A 1EPZA 3GYDA 3DN7A 1CGPA 1CAUA 4IERA 2Q0AA 4XFHA 1ZRCA 3KSCA 1YFXA 3MDPA 3HQXA 4Z82A 3NVCA 5LRSA 1H1MA 5EZWA 2QDRA 5I0RA 1J59A 2IXIA 3HIFA 3LWCA 1UPIA 1J58A 5BUVA 2WFPA 4LA3A 2PHLA 5CVRA 1IPJA 1I5ZA 2XGXA 2PFWA 4AVBA 4K8FA 3E5QA 4PIXA 4J1WA 3H7JA 3KCCA 3NL1A 5JSRA 4IEUA 2UY8A 3S7IA 1O3TA 3R6SA 4IESA 4XF1A 3EBRA 3ROUA 5I8SA 3KGZA 1UIJA 1SQ4A 5I0UA 2BNOA 1YFWA 4PJYA 4KU8A 3IBMA 2XKOA 3H3UA 4MGKE 3UKTA 5FQ0B 3H9AA 5FPZA 3C3VA
chains in the Genus database with same CATH superfamily
4B1MA 3WDTA 5EJ3A 1GQHA 4QQHA 3WY6A 1GUIA 2CDOA 3TEZA 2NMNA 4GKXA 3UGHA 1PMJX 4CDWC 3POGA 4B4RA 1OVPA 2DCYA 2E51A 4HK8A 4Q8KA 1I6XA 1W06A 2WO2A 3THPA 5FDBA 2BOJA 3KQRA 3M3QA 1MVEA 4IEYA 4YVSB 3JD71 3VKMA 3QD6A 3NMBA 5FZMA 2XUEA 2JDNA 4OULA 4WM8C 1FXZA 4YRDA 1RMU3 1Q8OA 3RYRA 4CTEA 2Q1FA 2TUNA 3OGVA 3MIFA 3ELNA 1BEV1 1I3HA 2R16A 1UZZA 2WT1A 3AL6A 4JGYA 2BVVA 4NHMA 4AW7A 2LM3A 3U10A 4B8EA 1C8M3 5LA0A 1QJU1 3UKVA 2OQ7A 3DUIA 1MQTC 2WJSA 1FAYA 4RQPB 1UX7A 3C7HA 3GCXA 4JHZA 1SLAA 5LBBA 1ZZ9A 5KHHA 4UFKA 2WZ8A 3AMHA 1COV3 3HQUA 4LO4B 2LUWA 4NWWA 4TN7A 4Y1YA 2BV4A 1RVF1 4JDMA 5A32A 5CAZA 4N53B 5BPXA 3KT4A 3BOPA 2QQNA 2ZOEB 4E4DX 3APBA 5J7MA 4TWTA 1YFYA 4K1YA 4L0PA 3BTAA 4F7ZA 4PF1A 1ZZBA 4ASLA 5ABJA 4FOYA 4K40A 3AKRA 4QB6A 5KC6A 1AYM2 3B7MA 3NAPA 2WT2A 1CX1A 4I02A 5LWBA 2UURA 1UKGA 4QHZA 2VU9A 2OPWA 4MGZE 2VECA 4E2SA 4GH4B 1ENXA 2VY0A 4DXZA 2Y6KA 5C9AC 3RZLA 3I3QA 2PHTA 1WLCA 1NCQA 1NQJA 3RJ2X 3UYJA 4BK5A 2EXHA 5IK5A 5T5OA 1AR61 2A3WA 4QGLA 4IGQA 4Q4X1 2OX0A 3H3ZA 5L73A 4QDQA 1Z7S1 5ERLA 3VHPA 5F5CA 3O14A 4D3WA 1S0CA 1PX3A 1ZA7A 2VZPA 3L9JT 3PU3A 4L92A 2RS53 1W6QB 2W1WA 3OYWB 2RHPA 4HMZA 1VBC1 4A2UA 1LTEA 1VBD3 1W9TA 1YO8A 4QWNA 5FZGA 3FFZA 3BIWE 4JKKA 1C5IA 3T4VA 5JOXA 3FN9A 3TB0A 1H2MA 2XJUA 2PHDA 5L36A 4W4ZA 4XDPA 4HT1T 1R093 4YLZA 5E88A 5T52A 3VGIA 3JUUA 3IT8A 5HI0A 3L2HA 4YM1A 2B46X 3N7JA 1UYZA 2Y33A 2D3SA 2Y6HA 3B01A 1LOEA 2QNKA 4Y22A 5CFDC 1QJX2 3H1MA 2BW8A 3VZLA 3VZJA 2C26A 1UY4A 1CIYA 2PLV2 5A1LA 3WQ1A 5A70A 3OPTA 1G8WA 4QPGC 2BERA 2R49A 5EP9A 1H4HA 2VVFA 2ZGLA 4YPJA 4WVMB 2ZKLA 5CNAA 1A3KA 2JDHA 4JTNA 3RZZA 4KGGA 5FYBA 2R042 1GNYA 2H6CA 2E53A 1WW5A 4CXWA 4A44A 1K5MB 5LY2A 2G1MA 1CQ9A 1OH3A 4H14A 3DV8A 4M4PA 5C3QA 1DIWA 4WBBA 1Y7BA 2UYBA 2GH2A 1H8VA 5FRAA 5IVEA 3KVAA 4XE9A 5IATA 1YXWA 1GOFA 3VBOB 3MIBA 4CDQC 3KB5A 4CEYC 2IXJA 1YHFA 2Y6JA 4LJHA 4HSLA 1VMHA 4YZ4A 2AENA 5D21A 3VV1A 4PIZA 4LKDA 4PDWA 2VNRA 1RUH3 1O6UA 5SV8A 3I3EA 3Q8AA 4Q4W2 4ZZ8A 2BNMA 2QQMA 1VAKA 2JE8A 3PL0A 4LXLA 2UY9A 2HEVF 3VBSB 1AR62 2D3RA 2VAUA 1X36A 1OT5A 4XAAA 2QZ3A 4EV0A 1QEXA 2WO3A 4LK6A 4E4SA 3MYXA 4PBOA 2ZACA 5C3RA 2PMWB 1R092 2NMOA 4LR4A 2DFBA 4AZZA 4OCTA 2Y34A 4LLFA 5FYCA 1MS5A 1MQTA 5G05L 4UW6A 2CY6A 4MXVA 2FBEA 3FFQA 3RWKX 2NN8A 4MGQA 1ULCA 4LMFA 2CAUA 2XLFA 3BVCA 3CBNA 1GV9A 4PLOA 4YW4A 5FV3A 4CA9A 3TAYA 1GZTA 5J3UA 1ZRRA 1MEC1 3JCIA 1S55A 3VBFB 4IV3C 3I2FA 4ZPIA 4LHSA 1GANA 1O5LA 1TMF3 2JXAA 4XJWA 4AHYA 2NLRA 1UU5A 3FBYA 1R1ZA 4ORFA 4A41A 5LA1A 5GLWA 3PUHA 4BQ4A 5DDJ1 4P9GA 1CZTA 5JOWA 3HVDA 2EAAA 1HJFA 1OD5A 3N35A 4HKWA 4OZOA 4UFJA 5F32A 5FJKA 5HV4A 5DAWA 1T6BX 3WP4A 2Q4SA 4A3XA 5FXZA 3E5XA 2XBO2 4LBKA 3O1RA 2R7EB 3PUAA 1UKRA 2VZTA 2P37A 5JIAA 1RUNA 5HBAA 4E8CA 3N36A 1RGSA 5FMOS 1UY0A 3ES4A 2HWD1 5BNNB 1E5IA 4BISA 4UXAA 4A7YA 1HW5A 1J1LA 1COV1 3IPVA 5DG2A 4MXWB 3KT1A 4NR1A 2BVBA 1XE7A 4Q5OA 5FR3A 3VUOA 1VRH1 5FZDA 3WW2A 5IVCA 3BTZA 3ILRA 5CU1A 4BIFA 1C1FA 4MZUA 3A21A 4KMQA 1NYWA 3CO2A 3EJKA 3NAPB 4Y1VA 4M0NA 2RJLA 3T4HB 2NQYA 4KU7A 4Q0UA 5IVFA 2EIEA 3LA2A 3ST7A 1IG0A 4Z8BA 4OI2A 3WCSA 4AE2A 4BOWA 1ENSA 4YZ2A 3MFAA 2YV8A 4LLOA 3RMYA 1FOD2 3GZTB 1WA4A 4GAZA 5A32B 1LGBA 1ULGA 4AQTA 4RA0A 3LB9A 4AVCA 4YGCA 2BOIA 1ZBE1 3AJZA 2PHRA 5A33B 1U5XA 3CKHA 3JQWA 4QKNA 1AL0G 2IFWA 1Q5OA 5BV6A 1WMEA 5FYMA 4ET7A 5JXGA 1HLCA 2DBIA 4RQPA 4XFFA 3V0BB 1KS4A 3OB8A 3MICA 4OLLA 2NP0A 1RL3A 1XU2A 4MGIE 2MPFA 5FP3A 4LBLA 5FY8A 4CP2A 1XNTA 3N9PA 4XUNA 3VDDB 1UU6A 3PIJA 5BNPC 5FZEA 1VBD2 2ZHMA 2YFZA 3AYEA 1FV3A 4ZU7A 3NJXA 3O1TA 1J3PA 2TNFA 2XWBB 3HJRA 1VBA2 4NIGA 2RDSA 1N3QA 1NCQB 2HEWF 4QX1A 5C3PA 3ME2A 3RWNA 2HWF1 3N9NA 4HPKA 1WD3A 2JIJA 1FMD2 1ST8A 2VZ3A 4N43A 1H9WA 1RVF2 2WQ8A 3C2UA 4LT5A 1JXNA 4IV1B 1ZZ6A 5HCHA 1AL23 1UY3A 4XTPA 3VZNA 2P1BA 4LBQD 2JKXA 1RIRA 4V2WA 4RR3B 4RFT0 2WFF3 2EXKA 1KDKA 1WCDJ 1YWKA 2BGCA 2JG8B 3ZFFB 3O7OA 1EUUA 2DU1A 4XVHA 5JAXA 2BBAA 4KG8A 4NIHA 1AR92 5H9QA 1XYPA 3I54A 3OSDA 1Z78A 3MW4A 2B7YA 2LTNA 5K8SA 2LW8A 4XETA 2VOVA 1QU0A 4MXWA 1F8VA 1W8OA 2ET1A 1DHKB 3ZN5A 3V65A 5A3WA 1JBCA 1GSLA 1O8SA 3MIHA 1REFA 4UBHA 1AUYA 1EV13 3LOIA 5BNNA 1XQNA 3AKPA 3ZFFC 4XZUG 4RL7A 1XXNA 3ATGA 1S0IA 2UU8A 2D6MA 3AMQA 3GALA 3OBRA 4URTA 5A7WA 2XQXA 3WSOA 4CCMA 4IUGA 3RS6A 3V0AA 1SFYA 2JWPA 1CJDA 1GQPA 3IB3A 3MPBA 1RUD2 3WNXA 2JENA 3ZDVA 1ODMA 3VBSA 1FX5A 4I01A 3W5MA 4CVUA 4EYUA 2CGPA 1VMJA 5FKCA 1IZ3A 1JUHA 2VW1A 3ES1A 5A7OA 4LORA 4XZPA 4O61A 4AF9A 1H8TC 2Q1ZB 4Q4V2 5FLJA 1V6IA 5LW9A 1GOHA 3BN6A 2Q8DA 1OUSA 2DDUA 2P3IA 2BEOA 4MGSA 3FE5A 4JGYC 3R4DB 2WLQA 5GJ6A 4FTBA 1I9RA 3H3LA 1RUE2 1C57A 1QQP2 5A3LA 4NE9A 4LBOA 2K0GA 3THTA 4A7ZA 1RUE3 3ACHA 2H0BA 2QKDA 1PGSA 4QMAA 2X09A 3WQ0A 4M3CF 5FWJA 5LK7B 1HQNA 3O5SA 2X8KA 3WW1A 4DMIA 1BZWA 1OLQA 2QJVA 4GQ7A 3IZOA 1DDLA 1F4AA 1UL9A 3AFGA 5CFCC 4QU2A 2BYVE 1AR83 4YM3A 1DGRA 1H2KA 1GFF2 5FZ0A 2EIGA 1SG3A 5H9RA 4QPIB 1HRV3 2G9FA 1LHVA 3CDZB 4CUBA 3LGRA 4L99A 1DQ5A 3ENRA 4WVMA 3USSA 1H4GA 3OTFA 1LHNA 3KZ4C 5EJ1B 1ND3C 4ZXEA 4O7XA 4OHYA 4ZKTB 3DXTA 1CR7A 4Y1UA 4FPHA 4LBQA 1NCRC 1UYPA 3QBQA 1DLLA 4P02B 1V9U1 5JWPA 4GWIA 1DLCA 4K7JA 3TNPB 3VHOA 2XKPA 3Q8EA 4GJYA 5AFBA 4Z1VA 1I1EA 1C28A 3L2YA 1FT9A 5K4LA 4B4QA 5D8AC 1FI2A 2GN7A 4IEQA 1JOPA 3DKWA 4E2GA 2J22A 5JOYA 2VUJA 2VL4A 1V6LA 2VQTA 2Z2SB 1CAWB 3E97A 3AYAA 3WX5A 1UW8A 1AJOA 2P34A 4OHWA 4PLMA 5F5QA 1IGOA 4XHXA 2F4PA 1IG3A 2HBUA 1G7YA 1AYM3 1QJU2 2GMMA 2ZGMA 1R1A2 3SCGA 1ZBA1 1W8HA 2Q8EA 5JMOA 3NV1A 5FYUA 1OA4A 2VZVA 4U36A 3P6BA 3LDRA 3ZMNA 3ZXLA 3M8LA 1XYNA 1R091 3MV11 4TYSA 5DAXA 2JD9A 3ZSEA 1LAJA 2ZX0A 2FDGA 2WNUB 4WM7C 2D5FA 3R05A 1TMF2 1YCIA 2YBKA 1ZZ8A 2Z4FA 2AREA 3GBGA 4XUPA 2JG8A 3DN7A 3LE0A 3O0VA 1CAUA 3GJBA 3POYA 4RS5C 4K8RB 1LENA 3OPWA 1JH5A 1BK1A 2R1BA 1QNYA 3T2TA 4MADA 1ZRCA 2JDKA 5IUQA 5EJZB 4M3CE 3KSCA 1S0JA 4EQVA 4Z82A 4AHXA 3A0NA 4CCOA 4G9SB 3VBRB 1US2A 1LGNA 1NX9A 1R1A3 4HG6B 2L9LA 1ULPA 2WLPA 3OY8B 3PMEA 4JGZC 5FZ4A 1CIWA 1UPIA 4AFCA 1O4YA 1OA2A 2YBPA 5FYTA 2WFPA 4LA3A 2GN3A 2PHLA 3DPRB 5BUVA 4Y5TA 5GLTA 2Y64A 1IPJA 3I2KA 4FOQA 3AZXA 4CU6A 1I5ZA 2X05A 3GGLA 4LOSA 3AZYA 1LULA 4CCKA 1RUJ2 1GZWA 2HWC3 4JHTA 2A6WA 5JUVA 1KFUL 2Y8KA 2CNAA 4L97A 2VMCA 2ZA9A 5CB7A 1ASJ2 1SHWB 3I2JA 3U1XA 2Y6FA 3H7JA 3KCCA 2HLEA 3NL1A 1KQRA 3MFCA 2UY8A 5T5JA 3EYPA 3AZZA 5JVVA 3ZIWA 1CJPA 2ZPXA 1QDOA 1OBNA 3P3PA 1ONAA 4BMEA 2BNOA 1YFWA 3POBA 3WNPA 2W87A 3S30A 3WDUA 1U5ZA 2A75A 2GNBA 1OQDA 2AEYA 2BPA2 2FDHA 3IBMA 2R041 3ZR5A 2HWE3 2WRAA 1GU3A 2YYOA 2ADDA 4XABA 1GNZA 1ND2A 4COYA 2AZ5A 1W8NA 1LOFA 1DYOA 5IFTA 4QX8A 1TNFA 3B5LB 5FPZA 2JDMA 4OHXA 4CEYB 4CDQB 4CU9A 4G3YC 2FD8A 1R64A 3URFA 1BJQA 3WINE 5JOZA 3B9CA 1WLDA 2WNOA 1BKZA 4A42A 4RS5B 1DG6A 4XJ8A 2Y38A 4QX0A 3D6EA 1K5MC 4JX0A 4RGAA 2FMYA 5FPXA 1AR91 2ARCA 3N9MA 1BYHA 1CZVA 3OGJA 4WM7B 5F3EA 2WSUA 1G6NA 5FWEA 4HONA 3IDCB 2WFF1 2VNGA 1QJX3 5T50A 2JEMA 1IPKA 3E1F1 2AEZA 3WLUA 2ZX2A 3POJA 1PVC3 4QPGB 3IWZA 5IVVA 1H2LA 1XOYA 3OEBA 1N47A 4RGGA 4XUTA 1M4WA 3T2QA 3O1OA 4HZFA 1CAXA 1VBE1 4YW2A 4Y1XA 5FP9A 5CBLA 1UXZA 1W8TA 4P9IA 4AK3A 4OUMA 4L8QA 3RQ0A 1ASJ1 4HFSA 3I59A 5FXXA 2A70A 3F95A 4AXOA 4DXRA 3R0RA 4QB1A 3BUCA 2MEV1 2VUAA 1OOPA 4NHLA 2EAKA 3R4SA 5D8AB 2HWF2 3BPSA 1AX2A 4B1LA 1KS5A 2X5IA 5FY5A 5K0UB 1WWYA 1AX1A 2VTXJ 1XC6A 4FOWA 4BWOA 4DINB 2KD7A 3JB4C 4QKDA 4XCAA 1RINA 3HNBM 1O7FA 1RMU1 1KD7A 2D6KA 2W1UA 2R063 4QPGA 3WHTA 4GB32 5T5LA 1POV0 4Y20B 5A6YA 4AR2A 1OURA 2B8MA 1JZ8A 2VVDA 4NUBA 5A1FA 4IDZA 4CP0A 2YC2A 2E7QA 1HV1A 2P3YA 3N9LA 1Q8VA 5FPLA 4TLFA 2W5FA 3BB6A 3KF3A 1QOOA 2F17A 1DQ4A 1W9YA 3POIA 4R52A 4XFGA 3W20A 1ENRA 4GA9A 3VBRA 4CP1A 4MGYE 2DURA 2RS13 5FY0A 1EPWA 2KR2A 4FCAA 1N1SA 1YI7A 1GZ9A 2VC9A 3RNSA 1UD1A 3SEPA 2ZXQA 4PQQA 4XURA 4AQ6A 4R9DA 3RZKA 2QQLA 3ACGA 4XF9A 1NOVA 2RM22 4LUMA 3FLPA 2PTMA 3UT0A 1JU4A 2RS51 1W2AX 5CG9A 2E31A 4S2GA 1Z7S3 1CAUB 4PLNA 1RB8G 1VB4A 3UETA 2RE9A 2A6YA 4LBMA 3T1LA 5FQ0A 3RRDA 1BLZA 1W9FA 2RDQA 4XW3A 5A7QA 3F2ZA 1CESA 3LKJA 1F5FA 1KGYA 1WZXA 2JG9A 3LIGA 4ZZ5A 1OUXA 2YROA 2ZX4A 3H8RA 3EXUA 4Y4YA 1QJY1 4JRAA 1VRH2 4DEQA 3OOXA 3IMMA 4P08A 4YSFA 1VRH3 3O0WA 1CAVA 2K46A 1MZFA 2YC0A 2O1QA 1YYNA 2Z69A 3LFMA 1JOJA 3AXEA 3MEPA 4R9BA 5FZ7A 1CWPA 2ATFA 3ABZA 1X82A 4W6WA 3TEXA 4R8HA 1L7LA 1IS6A 2H0VA 3DECA 4FPFA 4YVSC 3WHUA 4ES8A 1QXPA 4AGRA 3ZN4A 3WNKA 3JZVA 3DXUA 5J09A 1PK6B 2BFUS 2VCAA 3AMNA 4MH0E 4CDWB 2R073 2SLIA 4CDUA 3OY8A 3AM2A 5DQ0A 2ZZQA 3LCPA 5C4WB 4QU1A 1RMU2 5T5PA 1DGRN 3OCPA 5JI9A 4FSJA 1Y9MA 2WNVC 3O1VA 1QJU3 2P2KA 4IV1C 2ADEA 4QXHA 4XYXA 1HN1A 1C8M1 2B45X 2C9KA 2R1DA 3UJQA 4PF5A 5JR7B 1SDDB 1JN2P 4I3GA 3WUDA 3LD8A 2ZGQA 4UW3A 4OI1A 5CA6A 5GLUA 2ZHKA 3ACIA 1DZRA 2Z5WA 1W9WA 3P5BA 2TBVA 3R4UA 4LBNA 2E9QA 2PAKA 3K75B 2IXLA 1A8MA 3OUHA 4K9SA 3ECQA 1CAVB 4N9HA 1Q8SA 2ORZA 3EB7A 4BE3A 4DNYA 4XF3A 1FV2A 2XG3A 1ZZCA 4O65A 2VQAA 3WG2A 1JZ6A 2YHJA 1BHGA 3ON7A 1V70A 3SC7X 3B93A 1OFNA 1XBFA 2FDJA 2QQKA 4QT6A 1E5RA 4DOUA 2E26A 2JG9B 2P4EA 3I97A 4GH4A 4YGDA 4CUGA 5LEJA 4EN7B 3USUB 5M0TA 4P00B 5IK4A 3I59B 5JPMB 3ZX7A 5FIXA 1Y4WA 2HBTA 3K77A 2BJSA 3I3MA 4FFFA 2VGDA 4JDOA 4MGTA 4O9GA 3J8F2 1JZ5A 2PAEA 2YC4A 3PJYA 3S6PA 5CKNA 5A6QA 1R081 2D43A 2QQJA 1OOPC 1QH7A 1IOAA 3NV3A 2R32A 3GNEA 5IYYA 2G4IA 3AP6A 2WZR2 1YC61 3N3HA 3WZ1A 2RJKA 2ETEA 3VBUB 2CL2A 5A3PA 3VD9A 3WUCA 2CGNA 4CUCA 2R30A 1W6PA 4GZ9A 3NAPC 1Q8PA 2BNNA 1FYUA 2Y0IA 3HT1A 1ZVFA 3OBAA 1MZ5A 4KWJA 2MEV3 1SCRA 3ALQA 2RR13 3HBKA 1PM4A 5E16A 3M70A 4YFZA 2W0XA 5LK5A 1RHI2 1V9U3 1W6NA 4QXBA 2WSVA 4P5YA 4RHV2 4WV8A 3RI8A 2X10A 4HOOA 1NLSA 4GMP3 4QKFA 4D8MA 5LZ6A 4LBJA 3WXPA 3OGGA 1GMMA 3VKFC 1MS8A 4Q4Y3 4H7LA 3ZYFA 2XPJA 3NRUA 4Q4V1 4K20A 3ILNA 3SQOA 5DUUA 3MBWA 1AR73 3PVOA 4LIUA 2Y0OA 3GZEA 3E6CC 2YDEA 2XHKA 4OHZA 1COV2 3AL5A 3HPNA 4HPKB 3RVHA 1VBC2 5AFEA 4DB5A 1SLCA 2WC2A 1TNRA 4QD2A 1XSRA 5IW0A 4BZ4A 3IDBB 4Q1PA 5F7UA 2RS31 1RUE1 4KNCA 4IEXA 3QH6A 1PVXA 1OF4A 2DTWA 1D0HA 3S0MA 2UWCA 4Q2FA 1HRI1 2OW4A 4IE6A 5FZ8A 1RUC1 1NY71 2CU5A 5A7SA 4CCLA 1VRBA 2VQUA 1QOTA 2EIDA 2ZGUA 1QQP1 3C7FA 5IVJA 1FNZA 5C70A 3JBG3 1N1TA 1Q43A 5K7PA 4I0WB 2XL9A 1TZOA 4YVWC 3PMSA 3MV01 3NNGA 2R0HA 2XONA 3V64A 3VBFC 1GBGA 2C0ZA 3WDXA 2DF7A 1V6JA 4IETA 2NPIA 3EHKA 3IAQA 5DZEA 5FCCA 3ZXEA 2YU2A 1YQ8A 4CU8A 1WW6A 3CEWA 3D0SA 1D7PM 4XQ4A 1VE0A 3C8XA 1WLWA 3CJIA 1U5IA 1W28A 3FLTA 1RYYA 1T6GC 1PNFA 1BBT3 1DF0A 5I0SA 3ACLA 4CDUB 3J7LA 2P5BA 4ONUA 4M3CA 1J84A 4BMBA 3BU7A 1W39A 2GC3A 2W91A 4CDQA 3U11A 4CEYA 3FUQA 4OMDA 4CU7A 3WNOA 4SBVA 2WAOA 5FFOC 3I2OA 1PMHX 5A7PA 1FPN1 2HWE1 4EROA 3TN93 3QACA 5ISLA 5CKQA 4BPZA 4RYDA 1UO9A 2K2SA 1VLNA 1NT0A 3K51A 1CD3G 5FZCA 2C4XA 3VBSC 5AC93 1Y3TA 1ULOA 3U75A 1RHI1 2WL1A 3ETPA 5KR7A 3O12A 5FY7A 3H0OA 3KGLA 5BXXA 3T0DA 4YM2A 4HVOA 2R071 4Q0PA 4QM8A 4NPLA 4ES9A 4AHZA 2HWB1 2TEPA 2BDRA 1DQ0A 1AR71 4XDOA 3RG0A 2VNVA 3RZGA 1DZTA 3ORJA 1KJLA 3FC0A 1K45A 2P3KA 3CF6E 5FPVA 2ZMNA 2WO7A 4LKFA 1QMJA 3ZXFA 1WCKA 1TMF1 2XVKA 5IVYA 3VBOC 1AL22 1QXRA 3HMYA 1MS4A 2QQUA 5GZFA 2ZBJA 2VMFA 1V00A 2YPDA 3OBZA 3BTYA 2BZDA 5H9SA 4YZ1A 1DYKA 4M3CB 3CJXA 2YGMA 2EXIA 1PMIA 1RUC2 4FPLA 3FHIB 2P17A 4LQRA 1JHJA 1LOFC 3P1IA 5JZGC 1W3XA 5FXWA 5EFUA 2O14A 5F8PA 1IS4A 1UYYA 2W46A 4KBBA 3ZYIB 4E4ZA 4CEWC 2Q30A 3CL1A 4I0BA 4ZU5A 5FP7A 4I09A 3PTYA 2J1AA 1D4M1 4MSVA 3VD5A 4QPIA 1PZ7A 1W0PA 4UOJA 3WF4A 2A6ZA 2X29A 2HEYF 2VD7A 2XLAA 3VD7A 5FMOL 1SEFA 5G04L 4UYBA 1FPN2 4AVAA 4DZGA 2JDZA 1LOAA 4XC9A 4PDWC 5FLHA 1ZA4A 2IXKA 4IXLA 3H8UA 4R9AA 5K0UA 5C8CA 1RUI2 5FBJA 3T0BA 5J48A 3UNPA 4Q1RA 2V4AA 4CCJA 2WQ4A 5JIUA 1G9AA 4FP3A 1A8DA 5FZAA 1D2QA 3WW3A 3ZXDA 2HWF3 1WMDA 3GZAA 2W52A 1BMV2 4JAAA 1S2KA 4AEDA 2LALA 4KWKA 3NJZA 4SLIA 2GC2A 3WCRA 5IJRA 2PHFA 2LRPA 1PO13 3I4IA 5C9AB 2C24A 2WWJA 4QXKA 4EN9B 1L3JA 1MEC2 3UK9A 1AYN3 2Z79A 1QIQA 1W6NB 4XCBA 1RJ8A 3PUQA 3J8F3 5C5UA 1VBB2 2ZKNA 1RUF3 2A3YA 2BP6A 4PDWB 4AVTA 5J37A 1O3RA 4UFLA 4Y1ZA 1VBB3 4GXLA 1ASJ3 1AR93 2VXJA 1AHSA 3AMPA 5FZFA 4YZ5A 5LA9A 4MYEA 2QUOA 4AYUA 5KXCA 4BM8A 3PNAA 1OMIA 1B09A 3T09A 2PN5A 1C3HA 2D93A 3KV4A 3POWA 4NAMA 1RC6A 1ZZ7A 4LOTA 2VQ0A 2DUPA 3WVJA 2QTWB 1FOD1 5EYXA 5LBFA 3MIEA 4PIYA 2VBPA 3WD5A 2IZWA 3PDQA 5EV7A 1HB4A 4RQPC 3THCA 1KEXA 4UFIA 1MQTB 1YQCA 1GYKA 2ARAA 5D8AA 2Q8CA 5DUXA 5C7GA 1N3PA 2VW2A 4EJRA 3DKQA 5KBFA 2AH2A 5EYYA 5A6XA 1HQWA 2CV6A 2VCMA 3A22A 4FFIA 5FPBA 3ZFGA 1G9BA 3KCXA 3ASIA 3FL7A 1B35B 4OYUA 3ZOIA 1CONA 1QXJA 5L19A 2EA7A 1H9PA 4LUKA 4Q8LA 3I2HA 3VDCA 5DABA 5F5IA 1RUC3 1EPZA 3I2DA 3VDDA 2E63A 5FKBA 1VBA1 5CISA 1CGPA 1TEIA 2YZ4A 5IAXA 3GHNA 1POQA 3I3BA 4XOGA 1SLIA 1JYXA 4GB31 1R082 4P9YA 4IERA 2AR6A 3KF5A 3SKVA 2VCBA 4CPBD 5IVBA 2VBDA 1OC1A 1KXGA 5FP4A 4CDXA 1L7RA 3MDPA 4V1PA 3SH3A 1RUG1 3WP6A 3H8OA 5HCAA 1UZYA 5IK8A 1ZBE2 2OVUA 1IQAA 3ZMOA 5DDJ3 2Q5TA 4IGPA 5E8AA 1H1MA 5EZWA 1UNBA 5FPUA 4Q4V3 4DPNA 5I0RA 1J59A 3LWCA 1J58A 3OEAA 1LEMA 3Q8CA 1PK6A 1YJLA 1PX4A 2OIIA 2R061 4XFCA 2A1XA 3IKWA 4Q4W3 1VBB1 1F4HA 2PFWA 1HKDA 2RS52 2VUCA 5F5AA 3DEMA 4CCCA 2D44A 4K8FA 1GWMA 3E5QA 5CZKA 1OVSA 3WOGA 4COZA 4NIDA 4PIXA 3ZYBA 4QDSA 4OHVA 3MO4A 1QDCA 2WNUA 4IEUA 1OLRA 3SNMA 2VBBA 1X9TA 5GLZA 3R6SA 2WNEA 3RFRA 4BLJA 3MF6A 2YXSA 3MHZA 3CIHA 4N53A 5I8SA 3KGZA 4A7KA 4Z92B 1WMXA 3HEIA 5GZCA 4FOVA 1IKPA 1AYN2 4PJYA 5GALA 4CDXB 5DZFA 3RJRA 1W8ZA 3M3EA 1VAMA 3SLIA 1V6MA 4KU8A 2C1FA 2XKOA 3UKTA 4MGKE 1H6XA 3AZVA 5FQ0B 3AP4A 4QPWA 4RSUA 5IFPA 5DAVA 4A4AA 5LCWL 2QQOA 2RS33 1K42A 4D94A 2RMU3 3WT3A 4DEVA 2GSYA 1SDWA 1BBT2 3HN1A 1SPPB 3O1MA 1IS5A 3AB0A 5CADA 1OH4A 1XPWA 2VCCA 2WO1A 5J36A 1TE1B 4FTEA 2VH9A 2W2IA 5JXIA 2B4KA 3AZWA 4MOAA 5JLVA 2YY1A 3UJOA 1H30A 1UPSA 2W3JA 1ND3A 1YRZA 3CQOA 3ZFEC 5FZBA 3ZFEB 2FDFA 1EAH3 1C8M2 1GP5A 2B5HA 3GDBA 5JSPA 1O91A 3PLQA 2ENRA 1H6YA 1WW7A 2OPKA 1WLTA 4Y20A 2QQIA 5FZHA 1VALA 5DUVA 4FVVA 1JYIA 4WM8A 2XDVA 1FATA 2ZAHA 5APAA 3T2PA 2JB8A 4BQYA 3E6BA 3C7OA 1US3A 4AGGA 3HBZA 5EPAA 4L2NA 2E6VA 2GP5A 2YGLA 1FOD3 4GD4A 3WNMA 1XNDA 1XNKA 2D6LX 4W6XA 4KBZA 3KQ4B 5T55A 4AI2A 5JCTA 5T3NA 4X8NA 3ACFA 2YFUA 3UGGA 3VBHC 2BRTA 5GZEA 4D7TA 1JI6A 4K1ZA 4XXPA 2W47A 4XPVA 2XOMA 3TBDA 5ACA1 1O4TA 1H0BA 1JYCA 2I45A 3RPQA 3LA3A 1AF9A 2Z42A 2BU9A 3VZOA 2ARBA 2V5YA 3ZFGC 3MUY1 4Y24A 5B2GB 1IS3A 1Y9QA 3NJYA 4UI9L 3ZYJB 4GB33 5KHJA 1AYN1 3ZLIA 4QX7A 4HN1A 3KHBA 2GC0A 3TN91 1VBA3 2QQPA 3WF1A 1A6CA 1TVGA 3SH5A 2RG4A 1W8UA 2O0OA 1UY1A 3NNFA 3AVSA 4YNIA 3LPGA 2VE1A 4H55A 1DGWA 1EV11 2I74A 1LOBA 2BWCA 2FZ2A 1AXKA 1E5SA 2OYZA 4BH9A 3T30A 2ZEYA 3BCWA 2W95A 3TNQA 5KXEA 3IIAA 3ZKYA 1BBT1 3K46A 1NXMA 3CLPA 5F1RA 1GP4A 3KV5A 3VB9A 1W2NA 2C5DA 4I0AA 2WNVA 4JCKA 4OZXA 3SXWA 4BXFA 1LRHA 3AYDA 1UOFA 1HB2A 1S0FA 2QBXA 3S7EA 2WN3A 2IC1A 4MX3A 5C5TA 2QDNA 3AMMA 3ZPOA 4LE3A 3I49A 1XE0A 2LS6A 4YW5A 1POV1 3X29B 2UWBA 2FDKA 1F31A 2GALA 4IEZA 1AXYA 3N7LA 3KV9A 1J83A 4YG6A 4CXXA 2NM1A 3VDBA 4EWEA 3W5NA 5LATA 1RVF3 4K6BA 4M00A 1FMD3 1OPOA 2W1QA 4FXKB 4AFMA 2ZGSA 1NY72 3I8TA 4IGOA 1CPMA 3AKSA 2JD4A 1MPXA 1RUF1 1PO23 2D40A 3K3NA 2CDPA 4B3NA 4OQ8A 1C8NA 1SLBA 3MI8A 3K4ZA 4U2AA 3N4MA 4AEJA 1RUOA 5KXDA 3DPRA 3VD4A 2J1TA 4LHLA 2QZ2A 3NNJA 3UGFA 3ZPYA 3C7GA 3OGSA 3WQBA 5AC92 1HX6A 4LKEA 4RN5A 4LO7A 3CZUA 3SISA 3NV4A 4S2FA 5CYYA 5L9RA 3KHCA 4NRQA 1EV12 1RITA 2XBO3 5F6LB 5FXVA 4DUVA 5F37A 2UWAA 2VULA 3HN3A 3OUJA 2VMIA 1ODNA 4WVWA 1JOBA 4Q0SA 2RM21 2EICA 4H7MA 4DY3A 4CSWA 1KDMA 2PQSA 2DYCA 2WDBA 1UZ0A 3RYKA 5DAQA 4TTGA 3GBFA 3JD72 3IN9A 3ZFFA 3FJSA 5IHRA 2WAAA 1LOGA 1RUH2 1GOGA 1ND2B 2DV9A 5GM0A 2WR9A 2W08A 2D97A 3DYMA 3VKLA 2DVDA 3THDA 1S2BA 1OKOA 3T08A 4YW1A 1FMD1 1YFUA 4N43B 4EN8B 3J7NA 5K9YA 2ERFA 4NOTA 2VZSA 3U0ZA 3N7KA 3O1SA 5ANNA 2XJRA 4ARXA 2I07B 2WA4A 2XBO1 1XRUA 4HSJA 5I0TA 1KFXL 5I8TA 3A4UA 2JDYA 1LHWA 2XHNA 1G9FA 5D1IA 2ZAAA 5FO9B 4N7UA 3ZKUA 5F3GA 3D4KA 1XJAA 1QOSA 2EIBA 2J1EA 5FZ1A 3WW4A 2WQZC 5IAVA 4DIQA 1MEC3 1MS3A 1S0GA 2PYTA 3WNNA 4E27A 3AVRA 1WW4A 1HIXA 1N1YA 1HJGA 5K0UC 3J9SA 2ZTNA 2RDNA 4XACA 2HWB2 1NQDA 1AVBA 1VJ2A 3CZJA 3OD4A 2PQQA 4WZCA 3ZXGA 1DQ6A 1JS9A 3SMHA 3EQEA 4NPMA 4Z07A 4Y4RA 4QX5A 1RUJ3 5IT6A 1HRV2 4OMCA 1NUKA 2C9AA 3VN4A 1RTVA 4AEDC 3DCQA 2J1UA 5L9BA 1S1AA 1B35A 4CCNA 5C33A 1YIFA 3WF0A 4XFBA 4I30A 2VM9A 1ZM1A 3H7YA 4MUVA 3K48A 3T2OA 2YMZA 3ZVXA 1BK0A 4MHUA 4Q29A 3IDAA 4XXAA 1PIV2 4AG4A 4CEWB 2OT7A 1TQ5A 1O3QA 2VZRA 3JXSA 4ASMB 1UYXA 2J7MA 1RHI3 1S0EA 2VOKA 5JZGB 1X33A 5AC91 1AZDA 2A3XA 4FPYA 4XBQA 2X53S 1OKQA 1QJZA 5EQUA 5FZKA 1WGPA 1LKNA 3PUIA 3ZYGA 1UZWA 1BEV3 3SEEA 1EUTA 1VMFA 1PVC2 3K3OA 4CP9A 2ZGOA 4Q27A 4UFHA 1CN1A 4XJUA 1MZ6A 4ZU4A 1LNSA 1NE6A 3TRSB 5JPNB 1F5JA 2A6XA 2IFRA 2D7FA 4FQ4A 4QGMA 3RZHA 4RGKA 2R043 4NIIA 3D8CA 1YNAA 1QJY3 1HXS1 3MUZ1 4M01A 3IM0A 4X6RB 5EHDA 5J1XA 5A3MA 2DVGA 4BYYA 1YI9A 1NA1C 3G7DA 1PO21 4CYDA 1PIV3 5FAXA 5C8WA 5C9AA 4ZXKA 3POFA 5GZGA 1VPHA 1S0DA 3LPFA 2WZR1 3AFKA 1ZBE3 4UW5A 5DDJ2 1EYBA 2GP3A 4AI1A 1SFNA 2X5IC 3INAA 2WUHA 5A3NA 4D6SA 4V2VA 4KG0A 4LITA 3V56A 1RXGA 2W92A 4PI0A 3A0KA 4Y33A 3KMHA 4N90A 5FO8B 2V4VA 4LK7A 2XWJB 2OZ6A 1X8EA 3S57A 2OXBA 4CDUC 1WD4A 1JZ2A 1WCUA 2DVAA 3K2OA 1JMUB 1UMIA 2JECA 5C8CB 2FDIA 3DPRC 3PIGA 3MF9A 1PIV1 3PUSA 1ALYA 4FT8A 5F6KA 1JZ7A 1ULEA 3GJAA 3OGRA 4XFAA 4HXCA 3M7AA 4D7SA 2ZGNA 2XJPA 4JGZB 4C1WA 2KA3A 2DU0A 3OD0A 4E8DA 1MS0A 3B9IA 2GDFA 1J3RA 1VP6A 1W8WA 2A5ZA 4RR3A 1ZRDA 1F9KA 4OVEA 5I91A 5KHGA 1DU3D 3FHAA 3LSEA 2W39A 2HWD3 2WYSA 3BALA 3QCWA 4AVVA 2CAVA 1AR72 1XNBA 4XQWA 5CIRA 2W9XA 1OQ1A 1AXZA 3TYJA 1G9CA 4RD7A 4LKSA 4Y3OA 1AR81 1UQXA 4CDWA 1PZ9A 1H2NA 2YPJA 4FP2A 4Q0VA 2WNUC 4PT6A 4LO8A 3T0AA 4HBNA 2B39A 2HKXA 4XMAA 2IXCA 1JTZX 2OKXA 3NO8A 4NRMA 4F83A 1UMZA 2ZX1A 4JQRA 2KM2A 1GR3A 5BNOC 1LU2A 4DRRA 4QX2A 3GZUC 2DWRA 5A7WB 1AJKA 4IEPA 4XTMA 3HT2A 2XVLA 4DS0A 1V0AA 2DCZA 2UYAA 2K9ZA 1K12A 3GHMA 3NW4A 2GZWA 1RUG3 2EXJA 3PJQA 4AI8A 5F3CA 4CRQA 5C6CA 1UOJA 1UOGA 1NLRA 1F15A 4FI9A 1O5UA 4BK4A 5AVPA 1DZQA 1V6OA 3HD8B 3FZ3A 3SCHA 4HLTA 1LGCA 1SBDA 1VBD1 4IEWA 2VXRA 4J6GA 2CWSA 2WWSA 2EF6A 4YWAA 4HVRA 5DG1A 4ZHNA 4W50A 4LEJA 4JKMA 1NCRB 1GZCA 4XILA 4TZDA 3VL8A 5JXHA 2RV9A 1ND3B 2YUEA 3MPPG 5IWFA 1HXS2 3ZFEA 2OUJA 2MHFA 4P14A 4YARA 5FZOA 3JD73 3NKTA 4RHV1 4JV4A 4FPEA 5FBZA 4QPIC 1F2NA 1LJ7A 2KXLA 3HQRA 3CJIB 5C3SA 2WYFA 3IPVB 2P6HA 1C1LA 3UV9A 5CFCB 4AI3A 2PHWA 3I7DA 1QNWA 1JYNA 4H2AA 1O3SA 2IUWA 1AX0A 3U14A 3IMNA 4QQPA 1Y9GA 2HWD2 1IPSA 1SPPA 2W1SA 3RI9A 4IW3A 3D82A 3OF1A 4MHRA 4UAPA 4DY5A 1PGL1 3OYWA 4OUEA 2ZGKA 4NN0A 4BQ2A 3AP7A 2Y60A 2RS32 4HKLA 4JGYB 4C1XA 3RDIA 2A71A 4Q4Y1 2IWGB 5SV5A 2X5IB 2Y6GA 5CFCA 1QF3A 4EE2A 2ZEZA 1F35A 2XL7A 5FYSA 3K4DA 4QXCA 4AHWA 4FPGA 1YLLA 1MS1A 1K5JA 1EP0A 1O59A 1NXD1 4XF0A 1X7NA 2PXJA 4XF4A 3O1PA 1DP0A 4L11A 5C4WA 5FMCA 3W9AA 3SKJE 1JZ3A 1OXCA 4QB2A 1BXHA 3G6JB 3WF3A 4EWDA 1OLMA 1SCSA 3DYOA 3HAGA 3GXUA 2B9UA 1U5YA 3NKGA 5ABJB 4GKYA 2MEV2 4K21A 1PK6C 3JBG1 2VG9A 5H9PA 3T1MA 3HNYM 4H3WA 3LF7A 2IVJA 1UF2C 2ZZJA 5GKAC 4UF0A 5BYNA 3TEYA 4CCEA 4K3UA 4BHPA 1ULFA 3J7HA 4DQAA 4YZ3A 3N9QA 1AYM1 2PHUA 3MGUA 1WUVA 5FUPA 2JG8C 3A23A 1U0AA 4JC1A 1O8PA 2FCUA 4XAEA 1HRI2 1SFPA 3MLKA 1W2TA 2JE7A 2XMLA 4LNVA 2RMU1 3N7MA 3LIHA 1IHMA 1SZBA 5LY1A 2YG0A 3AXDA 3LFIA 3U07A 2CYFA 5EWSA 3WNLA 2RM23 1DFQA 3GYDA 4QX3A 1S4CA 1W6MA 4ZONA 1MR5A 2W94A 5ANQA 1NCQC 5DMYA 2A73B 1KRIA 1MVQA 4XFHA 3MW2A 2SBAA 1OSGA 3KCYA 2RVAA 4LHNA 4R9CA 4AEDB 2ZMKA 2RJ2A 3USUA 2F6BA 4YVSA 3NVCA 2VMGA 1WKYA 3C7EA 4B4PA 3KM5A 4CPBA 3S5QA 2BGOA 4QKBA 4ITCA 5LRSA 2XR4A 4E9KA 3VD3A 4COUA 2FCTA 3RZMA 2Y6LA 3VBFA 3HIFA 5A6ZA 5CEHA 2ZABA 3GF6A 4LO5B 5FYYA 3DYPA 2GMEA 2VOXA 5CVRA 1SLTA 5DXDA 4Q4W1 2R0FA 3H42B 5FMDA 4AVSA 2AACA 5DN2A 1OPMA 4FQZA 2J42A 3MLJA 4KWUA 3LEIA 1VBE3 4IE7A 1D4M3 4GMP0 1TME3 3POSA 4BQ5A 3LDBA 4NJ4A 1YQ6A 4N43C 4FPJA 2B42B 3ZSKA 1POV3 1HQLA 3AYCA 4PBPA 3ZXAC 1O3TA 1PGL2 1PGW1 2XVGA 3EBRA 4XF1A 1XNCA 2WA3A 5CKMA 2NYYA 4MLOA 4OI4A 1JZ4A 4AEKA 4BU2A 4CZSA 4E4HA 3NQHA 1PO12 3PURA 1RJ7A 1AR82 4R4ZA 4OI0A 2JB4A 2YB7A 1RUF2 5DPNA 2WINB 3VZKA 3W59A 2LROA 1D0GA 3H9AA 1Z0HA 3VBHA 2DVBA 4D6RA 4A3ZA 4IE4A 5BNNC 4KI5M 4A45A 5FY1A 5FYZA 2YU1A 4YG3A 4ZY9A 1DCSA 2QQWA 3HWJA 4S2DA 1K3IA 3EO6A 4P9LA 3VBOA 2WS91 2ORXA 4UWDA 3WG4A 3BOWA 1W0OA 1YUDA 5FK8A 3VZMA 1DQ1A 4G4FA 5F2SA 5BNQA 1W03A 1V6NA 3M2MA 4N9IA 1GICA 4COVA 1QY4A 2ZJCA 4M4RA 4YW7A 2WABA 4DFSA 4L9BA 1RUD3 2ZCWA 4XBNA 1E57A 4NWVA 1ZX5A 2OUHA 1BEV2 2BQPA 2D5HA 5A1AA 5JZGA 1FPN3 3B69A 2GC1A 5LB6A 1URXA 1OA3A 2V09A 3FX3A 3H50A 1RUI1 4LIVA 4DRVA 5LEKA 3BU0A 3WQ7A 4XJ9A 4YYOA 4GMP1 4XJAA 5ABJC 4QQ2A 2JE9A 3WEZA 1BVVA 4P5HA 3J8F1 3ETQA 1TME2 4QPYA 3I2GA 2A7AA 3UKNA 4XMIA 2BUKA 1S2EA 4FPCA 2ZGTA 4RFRB 3WG3A 2HWC2 4B7EA 4JRLA 2XB6C 4AL9A 1GP6A 1V9U2 3KV6A 4NO4A 1EAH1 1LCLA 5A3UA 1QKQA 3HR9A 4Y26A 3WP3A 2EVXA 1NZIA 2N7GA 4LTAA 1OFSA 3O1UA 2DFCA 1W6QA 2BGPA 2XUMA 4DO0A 1ZREA 3KLSA 2FZ1A 1S0BA 2VPVA 4EZHA 1VIWB 2AC1A 3NNMA 1KJRA 3ZYRA 3MZHA 3P3NA 1LESA 3RSJA 2XLGA 1VR3A 4ATFA 5FREA 4YVWA 1REDA 2ARXA 2WZR3 1GWLA 1NA1A 4LO6B 1C4RA 3ZFGB 4XUQA 4OUSA 3VDAA 2OS2A 2WS92 2ES3A 3DF0A 3LQCA 4FTSA 5DUWA 2FMDA 2NZ9A 3QOPA 4P9WA 1ZBA2 4Q0QA 4PHZA 5I93A 2P6CA 2R6QA 1X8MA 2C6SA 3CJIC 1XB9A 5FPAA 1ZBA3 3VBHB 5FY9A 3VBRC 4D6QA 4RHV3 1HV0A 1VAVA 1CX4A 4JZRA 3FMGA 1ZRFA 4GWNA 4Q4X3 3H1WA 1NZCA 1UN1A 2ZGPA 1LB2A 4HVQA 1FNYA 1X50A 5FO7B 2OA2A 3AJYA 1PHMA 1DBNA 3LSDA 3AX4A 2FCVA 3VLBB 5KHKA 5FK7A 5HXMA 1PNGA 3PVBB 1NG0A 4WM7A 5EXOA 2VOWA 5JXJA 2OQ6A 1W99A 2QCSB 4IE5A 5FYVA 4QHBA 3HOBA 3VBUA 5B4NA 3A7QA 2WKKA 4KL1A 3OG2A 4QHOA 4JKLA 4UBGA 5JI7A 4BCUA 1QHDA 4ARYA 1UWWA 5ACA3 5LBCA 1QJEA 4MO3M 1OF3A 3TWIA 3ZR6A 1BVP1 3ZO0B 1R083 1OHFA 4AAXA 1HRI3 4UT5A 5F3IA 1XE8A 5CFDB 5FZLA 3TN92 4BQWA 2JKBA 5BNOB 2D6PA 4IV1A 1OI6A 4WVVA 2I2SA 3Q8BA 3H8XA 4MV2A 1RUJ1 4ISQA 4GULA 1J3QA 1EAH2 3FBMA 4LA2A 1JYVA 3M3OA 5J98B 1AL21 2WZEA 3SCFA 4AFBA 4XBLA 5J96B 3U4SA 4TLGA 2R062 5F39A 2Q8OA 1LHOA 5BNOA 5FYIA 1A34A 5FOBB 1CAXB 2HJIA 3PHMA 1H1IA 3E6DA 4INDA 1W6MB 1XYOA 4NAOA 2GNDA 4XJZA 4CDXC 1Q8QA 2VZOA 4AQSA 2ZGRA 3VKOA 1AR63 4CXYA 3ZM8A 4XUOA 5A3OA 1UZVA 1QQP3 5FYHA 1UU4A 2J1VA 4GH4C 4C8DA 4FAGA 4NPRA 3JBG2 4F3JA 1EY2A 5A33A 1W6OA 5E6HA 4X8PA 5L7OA 4NRPA 2ET7A 5FOJB 4NIAA 1T2XA 2QFEA 4AGVA 3U78A 1MACA 5C8CC 3D3AA 5LASA 3N9OA 1NE4A 1G86A 2DBNA 2GU9A 4C91A 3H1YA 3WDYA 5BY5A 4D7YA 5KHIA 1YEWA 3M1HA 4AFDA 4I2OA 4AOCA 3J26N 3PVNA 4N53C 4AI0A 3M3CA 3AKTA 3KWVA 3LAGA 1WBLA 5JDBA 3I2IA 1LOCA 5FZ3A 1H8TB 2FHRA 1ZNPA 2CTVA 2V72A 4Q26A 3PVEA 3VHRA 3ITQA 4AQ2A 1W0NA 1WMFA 1QWRA 1M06G 2E33A 5E89A 3QH7A 1NA1B 3VHNA 4TXWA 2CSGA 1RXFA 2G19A 1JU3A 1TG7A 3PTRB 2DCJA 4DXSA 1VBE2 2BTVC 1DQ2A 3NWKA 3IDEA 4WVZA 3J4UH 2VZUA 2ZX3A 1W3VA 3PU8A 5E1RA 3W21A 2VZ1A 2XH6A 4QAWA 4XEZA 1Z7S2 3GCWA 2QE3A 3BKZA 2BBVA 4WM8B 4DUWA 4JVAA 2DCTA 1B35C 3AC0A 3K4AA 2J1RA 3U4XA 4J1XA 1O4ZA 3GM8A 4YFWA 1W8FA 3BODA 4XFIA 2XXZA 4BA6A 5C71A 4D0QA 2PLV1 4AWDA 4HKOA 1PVC1 2HWB3 3KT7A 1BMV1 2W68A 1UAIA 4BXSV 3I3DA 5C4WC 5F9TA 5EIYB 4EZ4A 4FFGA 1OLME 2VUDA 5LA2A 4BDVB 1QJFA 2D6OX 3T3YA 3BTXA 4RR3C 1DGLA 4C90A 5L7OB 5IK7A 4LBQB 3LOBA 1W6OB 2FQPA 4QM9A 3SH4A 1HB3A 4EN6B 3M4FA 1VBC3 4LE4A 5A3TA 2WWUA 4NHXA 5A80A 2CWMA 1LODA 4BQ1A 4IV3A 3AP5A 4A6OA 1XNAA 3JQXA 4PI2A 1H1AA 1STMA 4XIKA 3ZYHA 3WR0A 2XJTA 1HB1A 4D69A 1PZ8A 2QQVA 1UIKA 3RMXA 2JIGA 4KH9A 2VTFA 3DGTA 2ZHNA 5GLVA 5BNPB 2WZPP 4KWLA 3VDDC 3RYPA 1SACA 3POEA 5A7NA 1OD3A 4NROA 1W05A 5DZGA 4AI9A 1UXXX 2ZHLA 3OPZA 2J1SA 1GQGA 2P3JA 4IL7A 1U12A 3KD4A 5B4XA 4FBFA 3RZJA 4Z2AA 3Q8FA 1LU1A 3MLLA 4N8MA 1Y43B 4W65A 4XQDA 4ISRA 5KWRA 5HCFA 4LPLA 1N1VA 1W2UA 3NV2A 5AVAA 2VOTA 5CFDA 1RUI3 1DGWX 4COWA 1J1TA 3MIDA 1XU1A 2VO5A 2WT0A 2ZEWA 1CVNA 1E5HA 3KVBA 1MZEA 1YIPA 2JDUA 2GAUA 3WDVA 5HCBA 2V5DA 4S2HA 3GBWA 4J25A 5HV0A 1ND2C 1LR5A 1UMHA 3CNAA 1YQ2A 4IQPA 1W04A 4JTOA 4X6QB 2PELA 3AK0A 3SHRA 4BQXA 1JYWA 3UL2A 2GMPA 1RUH1 3ZSMA 2JICA 2OZJA 2PLV3 2XJVA 3BGAA 3B3QE 3ILFA 2E7AA 1TME1 4XDQA 3WV6A 4CUAA 2E7TA 4UF0B 4BLIA 4URAA 3NNLA 2DTYA 4FPOB 3U37A 3AKQA 5FUNA 4FFHA 2HWC1 1HDKA 2G9GA 3Q9OA 4FO9A 4LULA 2VMEA 2AGSA 3VKNA 3ZIXA 1K5MA 1XSQA 4HN0A 4CCDA 2PAMA 1D4VB 3M3IA 4E2QA 3OUIA 1UY2A 1UCXA 4NMIA 2E32A 4N7IA 4QQLA 2WN2A 1GWKA 4PQ9A 1C5HA 4Y5SA 4KQ7A 4W8JA 4CE8A 3AP9A 4F8AA 4HANA 3JB8A 3J7MA 4CEWA 4OFGA 3SITA 2JX9A 5JMCA 5LRRA 2RS11 1IQDC 1LEDA 1Q3EA 1CZSA 4FPKA 2CGOA 1BQPA 2O8QA 3LZZA 1W9SA 2VNOA 4GJZA 4Y22B 5DAPA 3D5OA 3MIGA 4HETA 1GLHA 1IKQA 2ILMA 2IXHA 2VTXA 3LA7A 4GWJA 5FTTC 1ZYBA 2HH9A 1MS9A 4FXGB 1LECA 3WP5A 5BNPA 3IAPA 2IVIB 3ZXKA 1WA6X 2VMHA 4IE0A 4YGBA 4AEMA 2XQRA 2XJSA 1UOBA 1RUD1 1GZWB 2B9VA 1WCQA 4IV3B 3V0AB 3V0BA 4KGQA 4QGNA 1SBFA 1KITA 3TEWA 3BIEA 4AAPA 4UW4A 1LHUA 4XIOA 1PM7A 2PA7A 4A6SA 1HXS3 4B29A 4I3PA 3E5UA 4DUXA 1NAEA 2YBSA 1WCSA 5I0DA 1W6PB 5JSOA 3FWEA 4HK9A 4HL0A 2RR12 5T54A 1PO11 1W90A 4IEOA 4YG0A 1N3OA 3CU7A 4EWAA 1PGW2 1V6KA 2DUQA 1NCRA 4META 3ZSJA 1YQ5A 1DYPA 2ZS6B 4LHKA 3ZSLA 1HRV1 2A6VA 3LEMA 3NSTA 4M0HA 2CHHA 3UESA 3LEKA 5JR2A 1APNA 1JUIA 1W2OA 1P8JA 2Q1MA 3FLRA 1JODA 5ACA2 3RGBA 3ZDSA 2GH8A 4P9JA 1D4M2 4NVPA 4YVWB 5FLIA 5LBEA 2AUYA 2WS93 3O0XA 1UX6A 2RS12 2EALA 4FAHA 2RDRA 5CG8A 1H8TA 2G9ZA 3B00A 4WZFA 1RUG2 4JQTA 2ZMLA 1WBFA 3NJVA 5I8YA 1GKBA 5FZIA 2DCKA 1ENQA 2D3PA 3BPZA 2MNGA 1ULDA 2F4LA 4DXTA 2D98A 1JW6A 1QJX1 2DVFA 4B7KA 2QVSB 1Q56A 1CAWA 2VW0A 5HPOA 4NHYA 4ZS2A 2V73A 3EMRA 1SLLA 1A78A 4IEVA 1D2SA 3LDKA 1R1A1 5FMBA 4TSVA 1OQEA 2HWE2 3DL3A 4GIQA 1L7QA 4Y5Z0 3B02A 4O9EA 2D6NA 5L9VA 3S5AA 3WG1A 5FZ9A 2O8OA 3ZYPA 5FZOB 2RMU2 3VL9A 5KC5A 2AYHA 4NHKA 3TOJA 1JHNA 4YM0A 1BCXA 2ID4A 5FZ6A 4BB3A 3D0JA 3FUOA 1SBEA 1PO22 1X9PA 2H6BA 2R072 2VJXA 2VR4A 3HNMA 4QDRA 3CMGA 4GALA 4UFMA 4MG2A 4R4XA 3BYWA 4JGZA 3WF2A 2Y26A 4Q4Y2 4YW6A 2JDPA 5FP8A 2Q0AA 2JJ6A 1I5PA 4OQ9A 5TSWA 3VBUC 1YFXA 3CHXA 2VZQA 1ZRIA 5FUIA 3HQXA 4GWMA 3JU9A 3BI3A 4C0HA 3ZXJA 1OOPB 2VMDA 4C0BA 4JDNA 1YJKA 2QDRA 3ZN6A 1VB2A 1QGLA 2IXIA 2VVEA 2BWAA 4BIOA 4YW3A 2WFF2 4ZS3A 4MVTA 5HXVA 4ASKA 4BJ0A 4YGEA 2DUOA 2XGXA 3LEGA 1G9DA 1QJY2 4AVBA 2GNMA 2RR11 3MW3A 2JG9C 3FHQA 1SMVA 4AFAA 1ACCA 2ZEXA 5F2WA 4EN0A 4Z2WA 4Q4X2 4XHBA 4J1WA 5KXBA 4W6YA 5JSRA 3KS7A 5D2AA 3S7IA 2BFUL 2WIIB 3ZN6B 1JYTA 4IESA 5GZDA 3ROUA 1CPNA 4QQOA 1UIJA 3OBTA 1SQ4A 5I0UA 2WBKA 3W58A 4RS5A 2PHXA 2JDAA 4ATEA 4CP9B 2XJQA 1NKGA 3B94A 2HYKA 3WDWA 3QLQA 3H3UA 5C3OA 1QH6A 1GNHA 1REEA 4P9XA 2HYXA 2WNVB 5FY4A 4PCRA 5L7OC 1HN0A 2GNTA 4BQ3A 5FJHA 3IIIA 3OJBA 3C3VA 1NLQA
chains in the Genus database with same CATH topology
3WDTA 5EJ3A 1GQHA 4QQHA 3WY6A 2NMNA 4GKXA 4CDWC 4B4RA 2DCYA 2E51A 4HK8A 4Q8KA 1I6XA 3THPA 5FDBA 3KQRA 3M3QA 1MVEA 4IEYA 4YVSB 3JD71 3VKMA 3QD6A 4OULA 4WM8C 1FXZA 4YRDA 1RMU3 1Q8OA 3RYRA 4CTEA 2TUNA 4FOVA 3MIFA 3ELNA 1BEV1 1I3HA 2R16A 1UZZA 2WT1A 4JGYA 4NHMA 2BVVA 4AW7A 2LM3A 3U10A 4B8EA 1C8M3 1QJU1 3UKVA 3DUIA 1MQTC 2WJSA 1FAYA 4RQPB 1SLAA 1ZZ9A 5KHHA 3AMHA 1COV3 4LO4B 2LUWA 4NWWA 4Y1YA 5CAZA 1RVF1 4JDMA 5A32A 4N53B 5BPXA 3KT4A 3BOPA 2ZOEB 4E4DX 3APBA 5J7MA 4TWTA 1YFYA 4K1YA 3BTAA 4F7ZA 1ZZBA 4ASLA 5ABJA 4FOYA 4K40A 3AKRA 5KC6A 1AYM2 3B7MA 3NAPA 2WT2A 4I02A 2UURA 1UKGA 2VU9A 4MGZE 2VECA 4E2SA 4GH4B 1ENXA 2VY0A 4DXZA 5C9AC 2PHTA 1WLCA 1NCQA 1NQJA 3RJ2X 2EXHA 5IK5A 5T5OA 1AR61 2A3WA 4QGLA 4Q4X1 3H3ZA 5L73A 4D3WA 1Z7S1 3VHPA 3O14A 1S0CA 4L92A 3L9JT 2RS53 1W6QB 3OYWB 2RHPA 4HMZA 1VBC1 4A2UA 1LTEA 1VBD3 1YO8A 1RUOA 3FFZA 3BIWE 1C5IA 5JOXA 3TB0A 1H2MA 2XJUA 2PHDA 5L36A 4HT1T 1R093 4YLZA 5E88A 5T52A 3VGIA 3JUUA 3IT8A 5HI0A 3L2HA 4YM1A 2B46X 3N7JA 2D3SA 4Y22A 3B01A 1LOEA 2QNKA 5CFDC 1QJX2 3H1MA 2BW8A 3VZLA 3VZJA 2PLV2 3WQ1A 1G8WA 4QPGC 2R49A 1H4HA 2VVFA 2ZGLA 4WVMB 2ZKLA 5CNAA 1A3KA 4JTNA 3RZZA 4KGGA 2R042 2H6CA 2E53A 1WW5A 1K5MB 1CQ9A 4H14A 3DV8A 1DIWA 4WBBA 1Y7BA 2UYBA 2GH2A 1H8VA 5FRAA 4XE9A 1YXWA 3VBOB 3MIBA 4CDQC 3KB5A 4CEYC 2IXJA 1YHFA 4HSLA 4YZ4A 3VV1A 2AENA 4PIZA 4PDWA 2VNRA 1RUH3 5SV8A 4Q4W2 2BNMA 1VAKA 2UY9A 2HEVF 3VBSB 1AR62 2D3RA 1X36A 2QZ3A 4EV0A 4E4SA 3MYXA 4PBOA 2ZACA 1R092 2NMOA 4LR4A 2DFBA 4LLFA 1MS5A 1MQTA 4UW6A 2CY6A 4MXVA 2FBEA 3FFQA 2NN8A 1ULCA 2CAUA 2XLFA 1GV9A 4PLOA 4YW4A 5J3UA 3TAYA 1ZRRA 1MEC1 3JCIA 1S55A 3VBFB 4IV3C 1GANA 1O5LA 1TMF3 2JXAA 4XJWA 4AHYA 2NLRA 1UU5A 3FBYA 1R1ZA 4ORFA 5GLWA 5DDJ1 4P9GA 5JOWA 2EAAA 1OD5A 3N35A 4HKWA 3WP4A 2Q4SA 4A3XA 3E5XA 2XBO2 4LBKA 1UKRA 2P37A 5JIAA 1RUNA 5HBAA 3N36A 1RGSA 5FMOS 3ES4A 2HWD1 5BNNB 4UXAA 4A7YA 1HW5A 1J1LA 1COV1 3IPVA 5DG2A 4MXWB 3KT1A 4NR1A 2BVBA 1XE7A 3VUOA 1VRH1 3WW2A 3ILRA 5CU1A 4BIFA 1C1FA 4MZUA 1NYWA 3CO2A 3EJKA 3NAPB 4Y1VA 4M0NA 2RJLA 2NQYA 4KU7A 4Q0UA 3LA2A 3ST7A 4Z8BA 4OI2A 3WCSA 4AE2A 4BOWA 1ENSA 4YZ2A 3MFAA 2YV8A 4LLOA 3RMYA 1FOD2 3GZTB 1WA4A 5A32B 1LGBA 1ULGA 4AQTA 4RA0A 3LB9A 4AVCA 4YGCA 1ZBE1 3AJZA 2PHRA 5A33B 1U5XA 3JQWA 1AL0G 2IFWA 1Q5OA 1WMEA 1HLCA 4RQPA 4XFFA 3V0BB 1KS4A 2NP0A 3MICA 4OLLA 1RL3A 1XU2A 4MGIE 2MPFA 4CP2A 4LBLA 3VDDB 1UU6A 5BNPC 1VBD2 2ZHMA 3AYEA 4ZU7A 1FV3A 1J3PA 2TNFA 2XWBB 1VBA2 1N3QA 1NCQB 2HEWF 3ME2A 3RWNA 2HWF1 4HPKA 1WD3A 1FMD2 4N43A 1H9WA 1RVF2 3C2UA 4LT5A 1JXNA 4IV1B 1ZZ6A 1AL23 4XTPA 3VZNA 4LBQD 1RIRA 4RR3B 4RFT0 2WFF3 2EXKA 1KDKA 1WCDJ 1YWKA 2BGCA 2JG8B 3ZFFB 3O7OA 2DU1A 5JAXA 4KG8A 1AR92 5H9QA 1XYPA 3I54A 1Z78A 3MW4A 2B7YA 2LTNA 5K8SA 4XETA 2VOVA 1QU0A 4MXWA 1F8VA 2ET1A 1DHKB 3ZN5A 3V65A 1JBCA 1GSLA 3MIHA 4UBHA 1REFA 1AUYA 1EV13 3LOIA 5BNNA 1XQNA 3AKPA 3ZFFC 4RL7A 1XXNA 3ATGA 2UU8A 1S0IA 2D6MA 3AMQA 3GALA 3OBRA 4URTA 3RS6A 3V0AA 1SFYA 1CJDA 3WNXA 3MPBA 1RUD2 2JENA 3VBSA 2CGPA 1FX5A 4I01A 1IZ3A 1JUHA 2VW1A 3ES1A 4XZPA 4AF9A 1H8TC 2Q1ZB 4Q4V2 5FLJA 1V6IA 2P3IA 2BEOA 3FE5A 4JGYC 3R4DB 2WLQA 5GJ6A 4FTBA 1I9RA 1RUE2 1C57A 1QQP2 5A3LA 4LBOA 2K0GA 3THTA 4A7ZA 1RUE3 2H0BA 2QKDA 1PGSA 4QMAA 3WQ0A 4M3CF 5LK7B 1HQNA 3O5SA 2X8KA 3WW1A 4DMIA 1BZWA 1OLQA 2QJVA 4GQ7A 1DDLA 1UL9A 3AFGA 5CFCC 4QU2A 2BYVE 1AR83 4YM3A 1DGRA 1H2KA 1GFF2 2EIGA 5H9RA 4QPIB 1HRV3 2G9FA 1LHVA 3LGRA 4L99A 1DQ5A 3ENRA 4WVMA 3USSA 1H4GA 3OTFA 1LHNA 3KZ4C 1ND3C 4OHYA 4ZKTB 4Y1UA 1CR7A 4FPHA 4LBQA 1NCRC 3QBQA 1DLLA 1V9U1 5JWPA 3VHOA 4K7JA 3TNPB 2XKPA 5AFBA 4Z1VA 1I1EA 1C28A 3L2YA 1FT9A 4B4QA 5D8AC 1FI2A 2GN7A 4IEQA 3DKWA 4E2GA 5JOYA 2VUJA 1V6LA 2Z2SB 3E97A 1CAWB 3AYAA 3WX5A 1UW8A 1AJOA 2P34A 4OHWA 4PLMA 5F5QA 1IGOA 4XHXA 2F4PA 1G7YA 1AYM3 1QJU2 2GMMA 2ZGMA 1R1A2 3SCGA 1ZBA1 3NV1A 1OA4A 4U36A 3ZMNA 3ZXLA 3M8LA 1XYNA 1R091 4TYSA 3ZSEA 2ZX0A 2WNUB 4WM7C 2D5FA 3R05A 1TMF2 1YCIA 3GBGA 1ZZ8A 2AREA 2JG8A 3DN7A 3O0VA 3POYA 1CAUA 4RS5C 1LENA 1JH5A 1BK1A 2R1BA 1QNYA 3T2TA 1ZRCA 5IUQA 4M3CE 3KSCA 1S0JA 4Z82A 4AHXA 3A0NA 4G9SB 3VBRB 1LGNA 1R1A3 2WLPA 3OY8B 3PMEA 4JGZC 1CIWA 1UPIA 4AFCA 1O4YA 1OA2A 5BUVA 2WFPA 4LA3A 2GN3A 2PHLA 3DPRB 5GLTA 1IPJA 4FOQA 3AZXA 1I5ZA 3AZYA 1LULA 1RUJ2 1GZWA 2HWC3 2A6WA 1KFUL 2CNAA 4L97A 2ZA9A 5CB7A 1ASJ2 3H7JA 3KCCA 3NL1A 1KQRA 3MFCA 2UY8A 5T5JA 3AZZA 5JVVA 3ZIWA 1CJPA 2ZPXA 1QDOA 3P3PA 1ONAA 4BMEA 2BNOA 1YFWA 3S30A 3WDUA 1U5ZA 2A75A 2GNBA 1OQDA 2BPA2 3IBMA 2R041 2HWE3 2YYOA 4COYA 1GNZA 1ND2A 2AZ5A 1LOFA 1TNFA 3B5LB 5FPZA 4OHXA 4CEYB 4CDQB 4G3YC 3URFA 1BJQA 3WINE 5JOZA 3B9CA 1WLDA 1BKZA 4RS5B 1DG6A 4XJ8A 2Y38A 3D6EA 1K5MC 4RGAA 2FMYA 5FPXA 1AR91 4WM7B 5BV6A 1BYHA 3OGJA 2WSUA 1G6NA 3IDCB 2WFF1 2VNGA 1QJX3 5T50A 2JEMA 1IPKA 3WLUA 2ZX2A 1PVC3 4QPGB 3IWZA 1H2LA 1N47A 4RGGA 1M4WA 4HZFA 1CAXA 1VBE1 4YW2A 4Y1XA 5CBLA 4P9IA 4AK3A 4OUMA 4L8QA 3RQ0A 1ASJ1 4HFSA 3I59A 2A70A 4AXOA 3R0RA 2MEV1 2VUAA 1OOPA 4NHLA 2EAKA 3R4SA 5D8AB 2HWF2 1AX2A 1KS5A 2X5IA 5K0UB 1AX1A 4FOWA 4BWOA 4DINB 3JB4C 1RINA 1O7FA 1RMU1 1KD7A 2D6KA 2R063 4QPGA 3WHTA 4GB32 5T5LA 1POV0 4Y20B 2B8MA 2VVDA 4CP0A 2E7QA 1HV1A 1Q8VA 4TLFA 3BB6A 1QOOA 1DQ4A 4XFGA 4R52A 1ENRA 4GA9A 3VBRA 4CP1A 4MGYE 2DURA 2RS13 1EPWA 4FCAA 1N1SA 1YI7A 1GZ9A 4AQ6A 3RNSA 1UD1A 4R9DA 4XF9A 1NOVA 2RM22 4LUMA 3FLPA 2PTMA 2RS51 5CG9A 4S2GA 1Z7S3 1CAUB 4PLNA 1RB8G 1VB4A 2RE9A 2A6YA 4LBMA 3T1LA 5FQ0A 3RRDA 4XW3A 1CESA 3LKJA 1F5FA 2JG9A 2YROA 2ZX4A 3EXUA 4Y4YA 1QJY1 4JRAA 1VRH2 4YSFA 1VRH3 3O0WA 1CAVA 4XFCA 1MZFA 2YC0A 2O1QA 1YYNA 2Z69A 3MEPA 1JOJA 3AXEA 4R9BA 2ATFA 1X82A 4W6WA 4R8HA 1IS6A 2H0VA 4FPFA 4YVSC 3WHUA 4ES8A 1QXPA 4AGRA 3ZN4A 3JZVA 5J09A 1PK6B 2BFUS 3AMNA 4MH0E 4CDWB 2R073 2SLIA 4CDUA 3OY8A 3AM2A 2ZZQA 3LCPA 1RMU2 5T5PA 1DGRN 3OCPA 5JI9A 4FSJA 2WNVC 1QJU3 2P2KA 4IV1C 4XYXA 2R1DA 1C8M1 2B45X 3UJQA 4PF5A 5JR7B 4I3GA 1JN2P 3WUDA 2ZGQA 4UW3A 4OI1A 5CA6A 5GLUA 2ZHKA 3R4UA 1DZRA 2Z5WA 4LBNA 2TBVA 2E9QA 2PAKA 2IXLA 1A8MA 4K9SA 3ECQA 1CAVB 4N9HA 1Q8SA 4BE3A 4DNYA 4XF3A 1FV2A 2XG3A 1ZZCA 3WG2A 2VQAA 2YHJA 1V70A 3B93A 1OFNA 4QT6A 4DOUA 2JG9B 5LEJA 4YGDA 4GH4A 4EN7B 3USUB 5IK4A 3I59B 5JPMB 3ZX7A 2VGDA 4JDOA 4O9GA 3J8F2 2PAEA 3PJYA 3S6PA 1R081 2D43A 1OOPC 1QH7A 1IOAA 3NV3A 2R32A 3GNEA 2G4IA 3AP6A 2WZR2 3N3HA 3WZ1A 2RJKA 2ETEA 3VBUB 2CL2A 3WUCA 2CGNA 2R30A 1W6PA 3NAPC 1Q8PA 2BNNA 1FYUA 2Y0IA 3HT1A 1ZVFA 1MZ5A 4KWJA 2MEV3 1SCRA 3ALQA 2RR13 5E16A 4YFZA 3M70A 2W0XA 5LK5A 1RHI2 1V9U3 1W6NA 4WV8A 2WSVA 3RI8A 4RHV2 1NLSA 4GMP3 4LBJA 3WXPA 3OGGA 3VKFC 1MS8A 4Q4Y3 4H7LA 2XPJA 4Q4V1 4K20A 3ILNA 5DUUA 1AR73 3PVOA 2Y0OA 3E6CC 2YDEA 2XHKA 4OHZA 1COV2 4HPKB 1VBC2 5AFEA 4DB5A 1SLCA 2WC2A 1TNRA 4QD2A 4BZ4A 3IDBB 4Q1PA 2RS31 1RUE1 4KNCA 4IEXA 3QH6A 1PVXA 2DTWA 1D0HA 3S0MA 2UWCA 4Q2FA 1HRI1 2OW4A 1RUC1 1NY71 1QOTA 2ZGUA 1QQP1 1FNZA 3JBG3 1N1TA 1Q43A 5K7PA 4I0WB 2XL9A 4YVWC 3PMSA 2R0HA 3V64A 3VBFC 1GBGA 2C0ZA 3WDXA 2DF7A 1V6JA 4IETA 2NPIA 3EHKA 5DZEA 5FCCA 3ZXEA 1WW6A 3CEWA 3D0SA 4XQ4A 1WLWA 3CJIA 1U5IA 3FLTA 1T6GC 1PNFA 1BBT3 1DF0A 5I0SA 3ACLA 4CDUB 4ONUA 4M3CA 4BMBA 3BU7A 1W39A 2GC3A 4CDQA 4CEYA 3U11A 3FUQA 4SBVA 5FFOC 1FPN1 2HWE1 4EROA 3TN93 3QACA 4BPZA 2K2SA 1VLNA 3K51A 1CD3G 3VBSC 5AC93 1Y3TA 1RHI1 2WL1A 3O12A 3H0OA 3KGLA 5BXXA 4YM2A 4HVOA 2R071 4Q0PA 4QM8A 4ES9A 4AHZA 2HWB1 2TEPA 1DQ0A 1AR71 3RG0A 1DZTA 1KJLA 3FC0A 2P3KA 3CF6E 2ZMNA 1QMJA 3ZXFA 1WCKA 1TMF1 2XVKA 3VBOC 1AL22 1QXRA 3HMYA 1MS4A 5GZFA 2ZBJA 1V00A 5H9SA 4YZ1A 1DYKA 4M3CB 3CJXA 2YGMA 2EXIA 1PMIA 1RUC2 4FPLA 3FHIB 2P17A 5JZGC 1LOFC 5EFUA 1IS4A 3ZYIB 4KBBA 4E4ZA 4CEWC 2Q30A 3CL1A 4I0BA 4ZU5A 4I09A 3PTYA 4MSVA 1D4M1 4QPIA 1PZ7A 1W0PA 2A6ZA 2X29A 2HEYF 2XLAA 5FMOL 1SEFA 1FPN2 4AVAA 4DZGA 2JDZA 1LOAA 4PDWC 5FLHA 1ZA4A 2IXKA 4IXLA 3H8UA 4R9AA 5K0UA 5C8CA 1RUI2 5J48A 4Q1RA 2WQ4A 5JIUA 1G9AA 4FP3A 1A8DA 1D2QA 3WW3A 3ZXDA 2HWF3 1WMDA 3GZAA 2W52A 1BMV2 4JAAA 1S2KA 4AEDA 2LALA 4KWKA 3NJZA 4SLIA 2GC2A 3WCRA 2PHFA 1PO13 3I4IA 5C9AB 4EN9B 4QXKA 1L3JA 1MEC2 3UK9A 1AYN3 2Z79A 1W6NB 1RJ8A 3J8F3 1VBB2 2ZKNA 1RUF3 2A3YA 4PDWB 4AVTA 5J37A 1O3RA 4Y1ZA 1VBB3 4GXLA 1ASJ3 1AR93 1AHSA 3AMPA 4YZ5A 4MYEA 2QUOA 4AYUA 5KXCA 4BM8A 3PNAA 1OMIA 1B09A 2PN5A 1C3HA 2D93A 3POWA 1RC6A 1ZZ7A 2VQ0A 2DUPA 3WVJA 1FOD1 5EYXA 3MIEA 4PIYA 3WD5A 2IZWA 5EV7A 4RQPC 5C4WB 1MQTB 1GYKA 5D8AA 5DUXA 1N3PA 2VW2A 4EJRA 5KBFA 2AH2A 5EYYA 1HQWA 2CV6A 3ZFGA 1G9BA 3KCXA 3ASIA 1B35B 1CONA 1QXJA 5L19A 2EA7A 1H9PA 4LUKA 4Q8LA 1RUC3 1EPZA 3I2DA 3VDDA 2E63A 1VBA1 1CGPA 1TEIA 2YZ4A 3GHNA 4XOGA 1SLIA 4GB31 1R082 4P9YA 4IERA 2AR6A 1KXGA 4CDXA 3MDPA 4V1PA 3SH3A 1RUG1 3WP6A 5HCAA 1UZYA 5IK8A 1ZBE2 2OVUA 1IQAA 3ZMOA 5DDJ3 2Q5TA 5E8AA 1H1MA 5EZWA 4Q4V3 4DPNA 5I0RA 1J59A 3LWCA 1J58A 1LEMA 1PK6A 1YJLA 2OIIA 2R061 3IKWA 4Q4W3 1VBB1 2PFWA 1HKDA 2RS52 2D44A 4K8FA 3E5QA 3WOGA 4COZA 4PIXA 4OHVA 1QDCA 2WNUA 4IEUA 1OLRA 3SNMA 5GLZA 3R6SA 2WNEA 4BLJA 3MF6A 2YXSA 4N53A 4A7KA 5I8SA 3KGZA 4Z92B 5GZCA 1IKPA 1AYN2 4PJYA 5GALA 4CDXB 5DZFA 3RJRA 3M3EA 1VAMA 3SLIA 1V6MA 4KU8A 2C1FA 2XKOA 3UKTA 4MGKE 3AZVA 5FQ0B 3AP4A 4RSUA 2RS33 4D94A 2RMU3 3WT3A 2GSYA 1SDWA 1BBT2 3HN1A 1IS5A 3AB0A 5CADA 5J36A 1TE1B 4FTEA 2VH9A 3AZWA 5JLVA 2YY1A 3UJOA 1H30A 1UPSA 1ND3A 1YRZA 3ZFEC 3ZFEB 1EAH3 1C8M2 2B5HA 5JSPA 1O91A 3PLQA 2ENRA 1WW7A 2OPKA 1WLTA 4Y20A 1VALA 5DUVA 4FVVA 1JYIA 4WM8A 2ZAHA 1FATA 3E6BA 4AGGA 3HBZA 4L2NA 2E6VA 2YGLA 1FOD3 1XNDA 1XNKA 2D6LX 4W6XA 5T55A 4AI2A 5JCTA 5T3NA 4X8NA 3VBHC 5GZEA 4D7TA 4K1ZA 4XXPA 3TBDA 4XPVA 5ACA1 1O4TA 1H0BA 1JYCA 2I45A 3RPQA 3LA3A 1AF9A 2Z42A 3VZOA 2ARBA 2V5YA 3ZFGC 4Y24A 5B2GB 1IS3A 1Y9QA 3ZYJB 5KHJA 4GB33 1AYN1 4HN1A 2QQPA 2GC0A 3TN91 1VBA3 1A6CA 3SH5A 2O0OA 4YNIA 4H55A 1DGWA 1EV11 2I74A 1LOBA 2BWCA 2FZ2A 1AXKA 2OYZA 4BH9A 3BCWA 3TNQA 5KXEA 3IIAA 1BBT1 1NXMA 3CLPA 5F1RA 2C5DA 4I0AA 2WNVA 4JCKA 4OZXA 3SXWA 1LRHA 3AYDA 3S7EA 1S0FA 2IC1A 4MX3A 2QDNA 3AMMA 4LE3A 4YW5A 1POV1 3X29B 2UWBA 1F31A 2GALA 4IEZA 1AXYA 3N7LA 4YG6A 2NM1A 4EWEA 1RVF3 4K6BA 4M00A 1FMD3 1OPOA 4FXKB 4AFMA 2ZGSA 1NY72 3I8TA 1CPMA 3AKSA 2JD4A 1RUF1 1PO23 2D40A 4B3NA 1C8NA 1SLBA 3MI8A 4U2AA 3N4MA 4AEJA 5KXDA 3DPRA 4LHLA 2QZ2A 3ZPYA 5AC92 1HX6A 4LO7A 3SISA 3NV4A 4S2FA 1EV12