1HQLA

The xenograft antigen in complex with the b4 isolectin of griffonia simplicifolia lectin-1
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
236
structure length
236
Chain Sequence
b'SVSFTFPNFWSDVEDSIIFQGDANTTAGTLQLCKTNQYGTPLQWSAGRALYSDPVQLWDNKTESVASFYTEFTFFLKITGNGPADGLAFFLAPPDSDVKDAGEYLGLFNKSTATQPSKNQVVAVEFDTWTNPNFPEPSYRHIGINVNSIVSVATKRWEDSDIFSGKIATARISYDGSAEILTVVLSYPDGSDYILSHSVDMRQNLPESVRVGISASTGNNQFLTVYILSWRFSSNL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LECTIN
publication title The xenograft antigen bound to Griffonia simplicifolia lectin 1-B(4). X-ray crystal structure of the complex and molecular dynamics characterization of the binding site.
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 53
structure length 236
sequence length 236
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1hqlA00
3AJZA 3AP6A 5CA6A 1N1TA 1KRIA 1KDKA 3WDVA 4RL7A 3PJQA 3WG2A 1XQNA 5HCFA 1YYNA 1MZ6A 2GNBA 2JJ6A 3POSA 1DZQA 4HL0A 5DUVA 2NP0A 1W0OA 2AENA 2AUYA 3D5OA 3WUDA 2ARBA 2GMEA 5JOZA 2PHUA 4OZXA 1Q8OA 2JE7A 3N7MA 2GN3A 1BXHA 5GZEA 1C57A 1IS3A 1MS1A 1AJKA 1NXD1 3ZXFA 2ERFA 4FPCA 4FQZA 3IPVA 2YXSA 4FPKA 4AGVA 2GNTA 4LBNA 1TEIA 2A71A 1JBCA 1SBEA 2W68A 4ATEA 1SLAA 2A6WA 3B01A 2UURA 5T54A 5GZGA 2CL2A 3V0BB 2ZGPA 5IK4A 1QOTA 3AFKA 1UKGA 4C1WA 3GALA 3M3OA 1Z0HA 3ZXLA 2GMMA 1SCRA 2WLQA 1EPWA 1W6PA 1KJRA 2OVUA 1PZ7A 2D3RA 2AH2A 2FMDA 4YW5A 1VALA 1VLNA 4BPZA 3R4SA 4BM8A 3L2YA 4FPYA 4UW3A 2D44A 3W59A 4Q8LA 3ZVXA 4BMEA 5JOWA 1SLIA 3WVJA 2EXKA 3WDTA 4FPGA 4YW1A 4AYUA 1G9FA 3ILFA 3AZVA 5F5QA 1ULEA 3I4IA 3QLQA 1LOGA 1Q8PA 5GZFA 2WT2A 5LK5A 5KXCA 1MS8A 3HMYA 3VKMA 2CWMA 4L8QA 1WBFA 1QMJA 2P37A 3KM5A 5JMCA 4W65A 3OYWB 4UW6A 4Y20B 1AZDA 1CONA 3OBRA 2CY6A 3AZXA 2W08A 1LCLA 4Q2FA 4YG3A 1JYIA 1UMZA 2C5DA 2DURA 1WD3A 3O12A 4PQ9A 2EXHA 4DQAA 1A8DA 3M1HA 1YXWA 2A75A 3AJYA 3POWA 4YM1A 4KBBA 1LODA 4FP3A 4XJ8A 5E8AA 3SISA 2DVGA 4Y1VA 1GICA 4AVSA 2Q5TA 4YZ2A 4XXAA 3RQ0A 1QF3A 3QCWA 2D43A 3N35A 1DYPA 3WDWA 4FOQA 4TYSA 2D6KA 4YZ1A 4Y1ZA 3V0AB 4PBOA 1BZWA 1DGLA 1W6MA 4ASMB 1G8WA 4YZ4A 1SLTA 2ZKNA 4XJUA 1N47A 1LHUA 2DU1A 3WG4A 2UWCA 1AXKA 3CNAA 2BQPA 2EIGA 4YGDA 2OW4A 1GV9A 4YFZA 3VKNA 5FREA 1WLWA 1HQLA 3T2TA 1DQ4A 3AP4A 1LGNA 2VW2A 2ARXA 2R16A 3AP7A 4ITCA 2WSVA 2ZGMA 3M3CA 5GLUA 4XOGA 3ASIA 4K1ZA 4AWDA 2D6NA 1G9DA 2D3SA 1HKDA 1VAVA 2OUJA 3AZZA 1UN1A 1UX6A 4ZKTB 3ZYPA 4NO4A 4XMAA 1PZ8A 1RINA 3ZSJA 4DRRA 2DV9A 4MYEA 1BYHA 2ZACA 2AGSA 1Y7BA 2NM1A 3RSJA 3IPVB 4IQPA 3AP5A 4XIOA 2A6YA 2JE9A 5JDBA 1MS3A 4FPFA 2H0BA 1W6QA 4RA0A 1H9PA 4BOWA 4NOTA 1LJ7A 2D3PA 3AYDA 4UW4A 3T1MA 3N36A 1WW5A 3C2UA 5CBLA 4YZ3A 3AYAA 3HN1A 5EWSA 5T5OA 3D6EA 1MS5A 4FQ4A 4M3CA 1GSLA 1C1LA 4SLIA 5DUUA 1LOBA 5CAZA 4ISQA 4XBLA 2ZGTA 4PCRA 5T5PA 5HCAA 1WBLA 5IK5A 1GLHA 1GKBA 2A3YA 3BIWE 1N3OA 2WSUA 1V6JA 1FX5A 1WLDA 3FFZA 2YV8A 4BLJA 1AXZA 1MVQA 4FVVA 1D2SA 2DVFA 4M00A 1HLCA 3ILNA 2CWSA 5KXBA 1KDMA 1QNWA 4DS0A 3OPZA 1CIWA 4F83A 1DQ2A 1JOJA 2ZGNA 1SACA 2VXRA 2FHRA 4YM2A 1W6NA 4GWMA 1BJQA 2ZGSA 1R1ZA 4XE9A 4PBPA 3O0WA 1I1EA 2CTVA 3MW2A 2R1DA 3AP9A 3VKLA 1DFQA 1LOFA 3OY8A 4XILA 1GYKA 1I3HA 2DU0A 2DTYA 4JC1A 1KITA 2YY1A 2EXJA 2NYYA 4HANA 3ZSLA 4XTMA 1S0DA 1QDOA 2ZZJA 3SH5A 4BQ1A 1SLLA 2A7AA 3B9CA 4XDQA 2DUPA 4XZPA 2A3WA 1SBDA 2PHWA 4WVVA 3ILRA 5L73A 3W58A 4YFWA 1Q8VA 1V00A 5H9RA 3RS6A 1ULCA 2A6XA 4FOYA 5DG2A 2GN7A 3MPPG 2ZHNA 2ZMNA 4XIKA 1AX0A 3PVNA 1LESA 1W6MB 3N7LA 1N3QA 4YW4A 2WKKA 2LALA 5GLWA 4GKXA 3PVOA 4WVWA 4ZXKA 4JCKA 1ULDA 5GM0A 2DTWA 2R49A 4H55A 3SH3A 2VU9A 2VY0A 2P2KA 4AGGA 5T5JA 2A5ZA 4FOWA 3O0XA 1LU1A 1NLSA 4XYXA 1QDCA 2PHTA 3AYEA 4FP2A 3SITA 3AX4A 1V6OA 4DRVA 5IUQA 1LOFC 2ZAAA 3B00A 3NWKA 2NN8A 5T55A 5DXDA 1F5FA 2Z42A 3AZWA 4XHBA 4AVTA 2TEPA 3IKWA 1DQ1A 5H9PA 4CZSA 2GNMA 4Y26A 2E7TA 4Q27A 1N1SA 1Q8SA 2JD4A 3BOPA 4P9WA 1LHOA 2WJSA 1IKQA 2GNDA 1U0AA 3OGGA 4AGRA 2LTNA 1JXNA 4XBQA 1W6QB 2VW0A 3Q9OA 2NMNA 4FOVA 1KQRA 1ENSA 5CNAA 3AYCA 1GNZA 5JLVA 3UJQA 3FLPA 1LEDA 2W52A 4Y22A 1LOEA 1UL9A 3IMNA 3APBA 4M3CB 5CB7A 3UK9A 3AXDA 2D6PA 1CQ9A 2WQZC 4PF5A 1GBGA 3UL2A 4Z8BA 1H30A 2VUAA 4TZDA 2P3KA 5IK8A 1LENA 3WNXA 2DWRA 5DZFA 3OBTA 1SLCA 3ENRA 1LU2A 3V0BA 3LSEA 1S0JA 1X50A 5GLTA 3A4UA 3POYA 1O4ZA 2ZBJA 4XJ9A 4Y1UA 2ZGKA 4BLIA 3ATGA 1WLCA 1ULFA 2DVDA 2UWAA 2XB6C 2XG3A 1WW7A 1FNZA 4JRAA 2ENRA 4M3CF 1O4YA 5DUXA 2ZHKA 2E7QA 1V6NA 1W6OA 2PHXA 1LTEA 3FLTA 4DFSA 3B3QE 4XJWA 4FPEA 2D6OX 1MR5A 1N3PA 1S0IA 2PHRA 4R9BA 1W6NB 3O5SA 3MW3A 3TB0A 3R4UA 4LBKA 3LCPA 2D6MA 3D4KA 5H9QA 1G7YA 5T50A 3OY8B 1S0GA 2ZMLA 1G86A 4U36A 1CR7A 3M2MA 1ENRA 1ULGA 2ZGQA 5JVVA 1G9CA 3R05A 1YI7A 4YLZA 5GJ6A 3FUOA 2C9AA 2R0FA 3WLUA 2UWBA 2R1BA 1LGBA 3U4XA 1AVBA 1V6LA 4FPHA 3UJOA 3WDXA 1UAIA 4UW5A 1OFSA 3N7KA 3SNMA 3WHTA 4R9AA 2D6LX 1H9WA 4YM3A 4M01A 2A6ZA 3VKFC 1JN2P 1WUVA 1APNA 2JDZA 3A0KA 1RIRA 4P14A 3OJBA 4YGCA 3WG1A 1YIFA 3IN9A 5EYYA 1WD4A 1MS9A 1WW4A 4GKYA 4P9YA 2R0HA 4YG0A 3ZSKA 1GZWB 4AVVA 3USUB 3TAYA 1D0HA 2GDFA 2CNAA 2OUHA 5IT6A 5GLVA 1UZZA 4XXPA 3FBYA 3VKOA 2I2SA 2ZGUA 5DUWA 1G9AA 4YG6A 4LBOA 1ZM1A 1JUIA 1CPNA 1J1TA 1SCSA 2HYKA 1GZ9A 4XTPA 5HCBA 2B7YA 5T52A 3RG0A 3ZSMA 3ZXJA 4CRQA 2RHPA 4DPNA 1SBFA 5BYNA 4LBMA 1DLLA 2EALA 1LEMA 5DZGA 1N1YA 2ES3A 4XBNA 3KQRA 2P3IA 1CPMA 5E89A 1UPSA 1UZYA 3V64A 3ZYRA 2ZABA 4CTEA 3ZXEA 4D69A 1FYUA 2DVBA 1A78A 3GNEA 2ZGRA 1OKQA 1CVNA 2EF6A 4Y22B 3SH4A 3N7JA 1LGCA 2NMOA 2W39A 3WDUA 2DYCA 3NV1A 1V6IA 1CESA 2GMPA 4FPJA 1JW6A 2CYFA 1W0PA 1F9KA 3DGTA 1GZWA 3USUA 3DUIA 2P34A 2ZMKA 3M3QA 1LHVA 3T1LA 3RMXA 1LULA 1CJPA 1A3KA 4R9CA 5H9SA 4FPOB 4WZFA 3ZPYA 2VH9A 1DHKB 4GA9A 2KM2A 3JUUA 5GALA 2YMZA 3HR9A 2SBAA 5GZCA 1W6OB 3O0VA 4GWNA 4LBQD 3PVEA 3WG3A 1VIWB 3M3EA 4K21A 1Q56A 2EXIA 1URXA 1MS0A 1AX2A 1MVEA 2P3JA 2ZGLA 3NV2A 2ZHMA 4YGBA 3AZYA 3N3HA 5KXDA 1DQ0A 2AREA 3WV6A 1QOSA 1LHNA 1AX1A 4XJZA 4XMIA 4LBJA 2A6VA 1F31A 2JKBA 1JHNA 3NV3A 1DYKA 3B69A 1KJLA 2D7FA 1C4RA 1LHWA 2WT0A 1IS6A 1FV3A 2UU8A 5EYXA 3WUCA 3ZXKA 1AXYA 2NZ9A 1S0CA 1IS4A 1QNYA 1G9BA 1MACA 2WNEA 2E53A 1V6MA 2SLIA 2PELA 5E88A 1HDKA 3IM0A 5JOXA 4Q26A 4R9DA 1CN1A 1DQ5A 2JECA 2ZA9A 3VV1A 1QKQA 1ZA4A 3WZ1A 3MW4A 1S0EA 5DG1A 1QOOA 4YW2A 3WDYA 1QGLA 4YW3A 5JOYA 3VUOA 4YM0A 3BTAA 3JU9A 3WOGA 4WV8A 4Q1RA 2WT1A 1IOAA 2DVAA 3WCSA 5T5LA 1BQPA 5SV8A 2DUQA 4ISRA 4YZ5A 4GXLA 4ATFA 5AVAA 1IS5A 3RRDA 1BKZA 1DQ6A 1LOCA 1AJOA 2AR6A 2VW1A 4LBQB 1WW6A 2AYHA 3PMEA 4YGEA 1MS4A 1B09A 5F9TA 3INAA 4XHXA 4K20A 5KXEA 1N1VA 2DUOA 2E51A 1FNYA 5IK7A 3NV4A 5GZDA 4FPLA 1SLBA 1DBNA 1ENQA 4P9XA 3OYWA 3SLIA 4Y20A 1WCSA 1GNHA 1GZCA 1VAMA 4Y24A 1QU0A 2ZHLA 3I8TA 1C1FA 2YZ4A 3MEPA 1DIWA 2ZGOA 4LBLA 3V65A 3WCRA 1Z78A 4C1XA 1S1AA 5EXOA 2A70A 1LECA 3FUQA 2GALA 3H0OA 4Y1XA 1Q8QA 1IKPA 4GALA 2E6VA 1HQWA 1ONAA 3WHUA 1LOAA 3BODA 2G4IA 2PHFA 5DZEA 1OQ1A 4K1YA 4Q1PA 3A0NA 3V0AA 4U2AA 1MZ5A 3FLRA 1W6PB 4M3CE 1SFYA 2A3XA 4Y1YA 3AXEA 3LSDA 1AF9A 4I30A 1FATA 4Q8KA 4LBQA 4BMBA 5GLZA 1FAYA 1FV2A 4XJAA 3RMYA 1YO8A 2V73A 5FRAA 1S0FA 1YRZA 2YROA 3AK0A 1PZ9A 1S0BA 2EAKA 1JYCA 1V6KA 2V5YA 1RITA 1GANA
chains in the Genus database with same CATH superfamily
2J1SA 2Q0AA 5L9RA 1KRIA 4SBVA 2IUWA 2OZJA 3PLQA 5HCFA 2ZX0A 3ZYGA 1YYNA 2GNBA 5DUVA 4Y5SA 2AENA 4XQWA 5JOZA 1H8TC 2PHUA 3VBFB 1J83A 4X6RB 3KGLA 2GN3A 2HWE3 5GZEA 2X5IA 4COVA 4EWAA 2CU5A 1FOD2 4IERA 5A3LA 1C5IA 2VMIA 1WGPA 3RYRA 2RS12 4LBNA 4O9EA 1TEIA 2WC2A 1JBCA 2W68A 1RUD2 2A6WA 2I07B 1OLQA 4W4ZA 5T54A 5GZGA 5FY7A 4GMP0 2RS31 2QQWA 3N9MA 5FMBA 5JR7B 1OHFA 5A7WB 3AFKA 4C1WA 3M3OA 3ROUA 4FFGA 1SPPB 2VECA 3WY6A 3ZXLA 1UYYA 1X82A 4XF9A 4Q4X2 2VZPA 1PZ7A 1W2AX 1GQHA 2AH2A 2F4PA 2FMDA 3ZMOA 3HBKA 3WNLA 4MGYE 4A7KA 4BPZA 1GQGA 4TN7A 1RXFA 3DYMA 4AEMA 1B35C 4UF0A 1MEC1 3ZVXA 4BMEA 3KLSA 4CCMA 1AR63 1QJU2 3WDTA 4AYUA 1REEA 2FDHA 3W21A 3AZVA 2JG9C 5F5QA 3OTFA 1UKRA 1ND3C 4ZY9A 1W2NA 3DEMA 4LHSA 2XJTA 4RS5B 3RNSA 3HMYA 4XF3A 4COYA 2EA7A 4CXWA 4NJ4A 1ZBA2 4MGQA 3OYWB 4RFRB 2CY6A 1PX4A 2W08A 2Y6HA 3AZXA 3PHMA 3PTRB 4Q2FA 4G4FA 5L19A 4FT8A 1JYIA 2C5DA 1QQP1 1E5IA 3I3BA 3O12A 2J1EA 1S55A 2EXHA 2HWE2 3V0BA 2A75A 1YNAA 1HB4A 4FP3A 3M8LA 5CISA 4DOUA 2Y6FA 4BWOA 4AEDA 1GICA 1AR83 2WNUC 1QF3A 2QFEA 4FXGB 2VBBA 4FOQA 4TYSA 1XNTA 4X6QB 4YZ1A 1ZRFA 5C3SA 2P17A 1PO13 1W6MA 2R071 4YVWA 1QIQA 2CAUA 3SQOA 2IZWA 3RZKA 3IAQA 3NQHA 2ZKNA 4L11A 4N90A 4HK9A 3O1PA 3LOIA 2BPA2 4CDWA 3WG4A 4XFHA 4E8CA 1AXKA 4B1LA 2EIGA 3VBFC 4YGDA 3S5QA 2OW4A 4BE3A 5IAXA 2ZEXA 4OHYA 1WLWA 1X36A 2TNFA 1AR62 4B4PA 4CXXA 1JI6A 5FP9A 2R16A 4ITCA 3SXWA 4XOGA 4UYBA 1IPJA 2D6NA 1W9FA 5ANNA 1WMDA 3SC7X 1G9DA 5CYYA 2OUJA 3AZZA 4HKLA 3NNLA 4ZKTB 3PU8A 1RYYA 4D94A 1T6BX 3I2KA 4MYEA 2ZACA 3I2HA 5I8YA 4F3JA 1O3RA 2NM1A 1VBE1 4J1WA 4NR1A 3IPVB 4EYUA 3HJRA 5D8AA 2QQUA 3JD73 4RA0A 2WO3A 4EWDA 2BWCA 1G6NA 1LJ7A 2D3PA 2CAVA 3T1MA 1XYOA 3EB7A 4DB5A 3C2UA 1UYXA 3AYAA 3ABZA 3HN1A 1QJY1 5D2AA 2Y60A 2HWC1 4Z2AA 5F6KA 1WMEA 1NY71 3LPGA 4RS5C 3UETA 4BU2A 5FR3A 1BBT1 4ISQA 1AR82 1X9PA 4PCRA 4XBLA 4XW3A 3ACGA 3HT1A 5T5PA 4ASLA 1MZFA 1WBLA 2BVBA 2PYTA 3ES1A 4EN9B 1W06A 2JIJA 1IZ3A 1IG0A 4CEYA 1I9RA 1PO12 1U5YA 1V6JA 1FX5A 2WDBA 3ZYIB 2DVFA 2OIIA 2HEYF 3EBRA 4M00A 4BZ4A 1HLCA 2CWSA 5KXBA 2WZEA 1KFUL 2ZXQA 4RGAA 1QNWA 1VBD1 4FFFA 5F2WA 1HB3A 4WM8B 3C3VA 4XF4A 1Y4WA 5BNPC 1JOJA 2WNOA 1RUH1 2FHRA 5LEKA 1W6NA 2HBUA 4CU6A 1BMV1 4XE9A 3WNPA 3ZFGB 1I1EA 3B02A 4H7LA 1U5XA 2CTVA 4UFMA 2WIIB 3AP9A 3T4VA 1CAUB 4D7TA 1GYKA 5FO8B 3ETPA 4QWNA 2DU0A 4D6RA 2BV4A 1GU3A 2NYYA 4XTMA 1S0DA 2ZZJA 4ES8A 2A7AA 3AVRA 5FLIA 5FZ8A 3C7FA 1XC6A 1IQAA 1SBDA 3ILRA 3JD72 4YFWA 4AQ2A 3VL8A 2JD9A 4B4RA 3PDQA 4CCOA 1ZZ7A 2HEVF 4UBGA 1JU3A 2WWSA 1ZZ9A 2ZMNA 3QD6A 4QPIB 1TG7A 3VDDC 1N3QA 4IV1C 2WUHA 2QQVA 3DKWA 3FE5A 2BGPA 2O8OA 4GKXA 4MXWA 2J1RA 2UY8A 3RZZA 2VZOA 3KS7A 5GM0A 3WEZA 3SH3A 1PK6C 3UKNA 4OFGA 2KA3A 4KI5M 3O0XA 5A1AA 1QDCA 3AYEA 2E9QA 3ON7A 5BNNB 1H2MA 3AX4A 3M7AA 3BTXA 3OBAA 1LOFC 2ZAAA 1F35A 4BXFA 4JDNA 3NWKA 4QX5A 4MO3M 2FCTA 2RS33 3ST7A 3ZOIA 4XHBA 4AVTA 2TEPA 3AKTA 4FI9A 1VBC1 4KG0A 4IEVA 4AAXA 3SKJE 4CZSA 5A3NA 2GNMA 4Y26A 4OI0A 1W28A 5LBBA 2JD4A 1Q8SA 4UOJA 3BU0A 1LRHA 2CGPA 1RL3A 4P9WA 4BIFA 2W91A 4AR2A 3TNQA 3LD8A 2V5DA 3ZFEC 5C70A 4AGRA 4CUBA 1MEC3 1R081 3H7YA 4JGYB 2BBAA 2IC1A 3SEEA 1JXNA 2R041 3GJAA 1W6QB 2VMGA 2VW0A 4RSUA 2W94A 1YHFA 4QPGB 1SQ4A 5KHHA 3NVCA 5CNAA 5K0UC 4GH4C 4K7JA 2RVAA 4QKDA 5C71A 3WD5A 3T4HB 4LA3A 4LO7A 1UL9A 4PHZA 3IMNA 1OPMA 4M3CB 2JX9A 3KGZA 3UL2A 5IVFA 1JZ8A 5BPXA 5LK7B 2Q1MA 4M0NA 4WM8C 2P3KA 4EROA 5IK8A 1LENA 5DZFA 3PUAA 1LU2A 3ACLA 4QU2A 4AHZA 4LKFA 5JCTA 4DUXA 4N43B 4E4HA 3ES4A 3KV4A 1YEWA 2ZBJA 1PMIA 3THCA 4AHYA 2ZGKA 1CWPA 1HV1A 3PURA 3H9AA 3ATGA 2BNOA 2D40A 3O1UA 2DVDA 2VCCA 1UIKA 3MF9A 2XG3A 2AEYA 4M3CF 5A33A 1QJZA 1L7RA 2ZOEB 1W6OA 3RZJA 1LTEA 4MOAA 4IGQA 1N3PA 1NCQC 1H1AA 4R9BA 1XNKA 2V4VA 3TB0A 1RHI1 2RS32 3D4KA 2FZ1A 1G7YA 5FZAA 4LE3A 2Q8EA 1H0BA 2R073 5FXZA 3MYXA 3H1MA 4QD2A 2B5HA 4L99A 4QPWA 3EXUA 1GWKA 1CR7A 2RJKA 5IW0A 2C0ZA 4P02B 5IFPA 3R05A 1J3PA 5GJ6A 3D8CA 1MEC2 5EJ3A 2JG8A 2UWBA 3DXUA 5E6HA 3B93A 1AVBA 4PDWB 3WDXA 4UW5A 4LHKA 2ZEZA 4LITA 3URFA 2YGMA 3WHTA 4CCLA 2D6LX 4M01A 5LASA 2AACA 3J26N 2PMWB 2JDZA 1OLME 3A0KA 2FDGA 1RIRA 4YGCA 3IN9A 3MFCA 2W9XA 3NRUA 4Z8BA 4AVVA 3GDBA 4GKYA 4PIYA 5A1LA 4EN0A 5K9YA 2QZ2A 4M0HA 1K5MC 1D0HA 2OUHA 2Z4FA 3BGAA 5FY9A 2ZCWA 1H2KA 3LQCA 2VPVA 5FQ0B 1UU5A 5LBEA 3N9PA 1I6XA 3I2DA 4IW3A 2LRPA 2C4XA 4MH0E 1UU6A 3RJRA 5HCBA 4XDOA 5L9BA 3I59B 3RG0A 2B7YA 2BBVA 1Q5OA 3GBFA 1DGWX 1EUTA 1QJY3 3ACHA 2HWC3 2OT7A 5C4WC 5AVPA 1SBFA 2QQOA 4L0PA 5D21A 1O3QA 1BBT3 4K8FA 1WMFA 4QDRA 4A3ZA 1X33A 5FUNA 2VOTA 5FYIA 3V64A 2AC1A 2R072 1SFNA 1EYBA 1O8SA 2BU9A 1UD1A 3UKVA 2RDNA 4R4ZA 4AI3A 5IVJA 2DCJA 3DYOA 3ECQA 4Y22B 2Q8CA 3SH4A 1EUUA 5I91A 3VDBA 1GR3A 2NMOA 4XFIA 1NCRC 1Y43B 1VBD3 2VMDA 2DYCA 4RR3B 1D4M1 4Y4RA 1JYXA 4FPJA 1JW6A 1RUH3 1ZNPA 1GZWA 4LTAA 5CFCB 2K46A 2ZMKA 1LHVA 1BK1A 2LM3A 1QXRA 3ZYHA 5I0DA 2PN5A 2B45X 4Q0PA 5ISLA 3AMMA 4LXLA 1KGYA 1CX1A 4HFSA 2HBTA 4MZUA 3ME2A 5C8CA 1XNDA 1UZVA 4QQOA 2IVJA 3VBSC 1NG0A 4JQTA 2OX0A 3D82A 1URXA 3AKRA 1VE0A 1VRBA 5A7NA 2E7AA 5KXDA 3AZYA 4PDWC 1NQDA 4P00B 1DQ0A 2DCZA 1S2BA 4IEWA 2IXJA 2AREA 1HRV1 3NAPA 4HBNA 1QJY2 3N9OA 3WV6A 1IHMA 1QOSA 1LHNA 2ADEA 2A73B 2HWC2 2ZJCA 4XMIA 5CZKA 1JZ5A 1NY72 2JKBA 4WM7A 1RMU1 1BBT2 1DYKA 3NV3A 5FZ4A 5CBLA 1FV3A 4PLNA 2G9GA 5EYXA 2IXIA 3I2IA 4DEVA 3POIA 1QNYA 1G9BA 1MACA 2CGNA 2XLFA 4V1PA 2E31A 5A1FA 2SLIA 3O1SA 2VQ0A 3IB3A 3CLPA 4IEQA 4J6GA 1HDKA 2DCTA 1KS5A 4LQRA 5FTTC 5C9AA 5JOXA 4CXYA 3TEXA 5LEJA 4QKBA 2D93A 2JECA 2RJLA 2XHKA 1VBD2 1VBC3 1D7PM 2W5FA 5FK7A 2I74A 2ATFA 2HWD1 2JE8A 1RUH2 4YVSB 1QGLA 4YW3A 3CJIA 2VMFA 3TOJA 1BMV2 1R083 4Q1RA 2DVAA 1OLRA 5F6LB 3S30A 4CCCA 3DPRC 1F4HA 5T5LA 2ID4A 3OGJA 1JZ3A 4HOOA 4HT1T 3PUQA 3H50A 5LW9A 2WBKA 3RRDA 3AVSA 4P9IA 2VW1A 4LBQB 3THTA 4CDXB 2JDKA 4NIGA 4MVTA 3OOXA 1YQCA 1UO9A 1UOFA 4RR3C 2XBO1 2XKOA 5IWFA 2DUOA 2E51A 2VG9A 4NIAA 5B4NA 3LF7A 5GZDA 5CG9A 4FPLA 1SLBA 2WQ4A 1DBNA 4CDQB 4O9GA 2YC4A 4DIQA 3DV8A 2YBKA 5FY8A 1GZCA 2Q1FA 2V72A 3NNFA 1SEFA 2YZ4A 1F4AA 1DIWA 2Y38A 4A6OA 1XYNA 4EN7B 3V65A 2NQYA 3WCRA 5IJRA 4JGZA 5IVEA 1Z78A 1C3HA 2QDNA 4MUVA 4QXCA 5EXOA 5CKNA 4MGTA 1LECA 3FUQA 3H0OA 3ZN6A 1RHI3 4GALA 1REFA 1HQWA 1ONAA 1NOVA 4I09A 1VBC2 4K1YA 2XUEA 1OVPA 3A0NA 4U2AA 4AFDA 4AE2A 4XUTA 5B4XA 3V0AA 1ASJ1 1JODA 2VTXJ 5CFDB 1KEXA 2A3XA 1HN1A 2VQAA 1AF9A 4I30A 3DECA 4Q8KA 3FFQA 1R082 4CDUA 5FYUA 1AR93 4AEJA 5FYMA 5BNQA 1FAYA 2Q8DA 4LLFA 5A6ZA 3I2JA 1R64A 5DABA 1YO8A 3DYPA 2VUJA 5JPNB 4CCNA 1YC61 2VZUA 1OC1A 5LRRA 1JZ2A 4OMCA 3KCCA 1ZZBA 1V6KA 3FL7A 5FPVA 1HRI3 2HEWF 3RZHA 3AP6A 1R1A1 1N1TA 4HN0A 1ZA7A 4N7IA 5CA6A 3OGSA 2HLEA 3POSA 1MZ6A 1DZQA 4BQWA 2NP0A 2ZAHA 1W0OA 4I0BA 3H7JA 4JAAA 5FZHA 4BK4A 1VBA1 4NUBA 3VGIA 1RUC1 4B1MA 2JE7A 2QQLA 1W9SA 3N7MA 4JDOA 1BXHA 1C57A 1IS3A 1MS1A 1AJKA 1DP0A 1XXNA 1VBB1 3C7GA 4L97A 4RYDA 3ZXFA 4AGVA 1UYZA 3S0MA 3Q8CA 4ATEA 1SLAA 3B01A 2UURA 4BCUA 4BIOA 2XUMA 4A44A 4K6BA 2WAAA 2KR2A 3V0BB 2ZGPA 1QOTA 3TYJA 1UKGA 3PU3A 4CDXC 3O1TA 2GMMA 1BVVA 3GZAA 3WQ7A 4COUA 4AEDB 2WLQA 2BRTA 1J84A 1YFXA 5FO7B 1EPWA 1W6PA 3GBGA 1KJRA 2OVUA 3NNMA 4BQYA 3TEWA 1RHI2 2D3RA 4YW5A 4URTA 3VD7A 1AUYA 3R4SA 4BM8A 2YBSA 3L2YA 4FPYA 4UW3A 3K4DA 3W59A 4FFHA 3K4AA 1AL0G 1SLIA 4QAWA 3ZSEA 3BTZA 1CD3G 2Y26A 1W04A 4KMQA 4YW1A 4DNYA 2XR4A 3ILFA 1AR81 3UGFA 4CDWB 1ND2B 3QLQA 2VNRA 1RGSA 4IL7A 4LEJA 5BXXA 4BB3A 1D4M3 1OQEA 5LK5A 1YCIA 4NIIA 1AR92 1WMXA 4HETA 2X5IC 2CWMA 1QMJA 2E26A 3VBOA 5LBCA 5A6XA 5JMCA 1S2EA 1U5IA 4N53A 1JUHA 1HRI2 1ZYBA 1ZBE1 2VNGA 4HVOA 4UW6A 2BERA 5K8SA 2JB8A 3O1RA 4JRLA 3T0AA 4EN8B 1LCLA 4PT6A 4URAA 4YG3A 2V09A 1XU2A 1EY2A 2BZDA 2Y0IA 1H1MA 3OSDA 5FXXA 5LY1A 1WD3A 4PI2A 4XUNA 5I8TA 4PQ9A 4DQAA 3FWEA 1A8DA 3M1HA 4YM1A 1OURA 4KBBA 1LODA 2VCMA 5FLHA 2WA4A 2X8KA 1H8TB 2L9LA 4HN1A 4HMZA 4QQHA 3RFRA 3GF6A 5FY5A 4XURA 2Q5TA 4YZ2A 4XXAA 5TSWA 4BXSV 1RUE1 5A3TA 2VMHA 3TN91 2EICA 3QCWA 2MNGA 2D43A 1Y9GA 3BU7A 3K75B 1HRV3 3N35A 2D6KA 4LMFA 1NA1A 3VBRA 5FLJA 1J1LA 3OGRA 3PVBB 5FPBA 4XFBA 1G8WA 4YZ4A 2YYOA 1RMU3 5FOBB 4XJUA 1N47A 5B2GB 2DU1A 4NPMA 2JKXA 3ZN4A 1UMIA 2JDAA 2P6HA 4NRPA 4CEYB 4CP1A 1GV9A 1WZXA 2LW8A 2HJIA 3NNGA 1MQTA 4BHPA 4KBZA 4HVQA 5A3WA 3VZKA 3O1OA 3E1F1 4A45A 3AP4A 1LGNA 5LA2A 1B35B 2ARXA 4A42A 2WSVA 2ZGMA 2K0GA 5A7QA 3ASIA 2BP6A 1DCSA 1D4M2 3K3NA 3WINE 4AWDA 4OHWA 3Q8FA 3KD4A 2JG9B 1HKDA 1VAVA 2XJUA 2HWD3 1GWLA 4BDVB 4C90A 1ND3B 4NO4A 2RDQA 2VOVA 2F6BA 4XMAA 4AEDC 4RD7A 2DV9A 1OF4A 5JI9A 3CO2A 2RMU1 4KWLA 1Y7BA 4BQXA 3OB8A 4ONUA 4IQPA 5GKAC 3ZYFA 2JE9A 2ORXA 4FPFA 2H0BA 4YVWC 1UF2C 3VHNA 4BOWA 1HJFA 3F2ZA 4OUEA 4GJYA 3MUZ1 5FMCA 4A6SA 4CDWC 5FZOA 5F5CA 5EHDA 2VOWA 1VJ2A 2VTFA 4TLFA 2ZX3A 4JV4A 5FXVA 3MFAA 2GSYA 1CGPA 1C1LA 2XBO3 5DUUA 5CAZA 5F8PA 5FYYA 1OQDA 5CIRA 4CUAA 5HCAA 1S2KA 4NPLA 3HD8B 1HRV2 1GLHA 3M70A 4LO6B 4M4PA 4N7UA 5A3PA 4BK5A 3S5AA 2WSUA 4RQPA 3LDKA 2HH9A 3AM2A 3FFZA 5FKCA 2YV8A 4NN0A 2WNUB 4S2HA 1AXZA 1W3XA 1RMU2 5A7SA 3N4MA 1COV1 1D2SA 3BIEA 4Q4W1 5FMDA 1UY4A 4MHUA 3OPZA 2E33A 3LKJA 3MICA 2TBVA 5F5IA 5D8AC 1XE0A 2QZ3A 1VP6A 1SACA 2VXRA 3CF6E 3U10A 2VD7A 2JIGA 3O0WA 4GZ9A 4WVMB 1JYTA 3MW2A 2YU2A 2WFF1 1ASJ3 4XILA 3VDCA 2HWD2 5F3CA 1JH5A 4OMDA 4JC1A 1KITA 3TBDA 5FWJA 1SLLA 3B7MA 4IE0A 2JDMA 3W5NA 2BOJA 2A3WA 4CEYC 5G05L 3DF0A 3W58A 1X8EA 5H9RA 3VD9A 2I45A 1PM7A 1ULCA 5DG2A 3U1XA 1CZVA 1XRUA 1W8OA 1R1A3 2OPKA 1AX0A 1ENXA 3GZTB 4OUMA 4XIKA 4EQVA 2N7GA 3CL1A 2OKXA 3H8OA 2XQXA 4YW4A 5A3MA 4LO8A 2B4KA 2LALA 2XBO2 3MGUA 3PVOA 4XC9A 1VBA3 4ZU5A 5GLWA 4AFBA 4JCKA 1RUC3 4KGGA 4XUQA 2VY0A 2A5ZA 1VBB3 2ORZA 4FOWA 3I2OA 1BEV1 4FP2A 2RG4A 3U78A 1GWMA 5IUQA 3KV6A 3BPZA 4QB1A 3WF3A 1IPSA 4YPJA 1D2QA 4XQ4A 2Z42A 3AC0A 4H2AA 1C5HA 4F7ZA 4D7YA 1CAVB 2VL4A 3MV11 4XZUG 4NIHA 5IATA 2BWAA 1KS4A 3ZM8A 4Q27A 2GC3A 3BUCA 3U75A 4O61A 1IKQA 3VBUA 5BNPB 2VE1A 4MG2A 4K40A 1L3JA 3BVCA 3HT2A 4B8EA 1CIYA 3Q9OA 1ASJ2 3POBA 5IFTA 4ZHNA 1O7FA 1W8TA 2XOMA 1KQRA 5FCCA 5JR2A 1NT0A 4OCTA 5JLVA 4ZONA 3UJQA 3WNOA 1QXPA 2BGCA 3Q8BA 1LOEA 1QH7A 2RM21 5FAXA 3UK9A 5JWPA 2VUCA 3A21A 1CQ9A 2WQZC 3KT1A 5C3RA 4TZDA 2F4LA 2FBEA 4GMP1 5ANQA 4HPKB 1SLCA 1ZBE3 2LS6A 3MIFA 5I0TA 1R1A2 2J7MA 5GLTA 1RUF1 5FBZA 5C6CA 4XJ9A 4Y1UA 2MPFA 4IV3A 5JIAA 4GULA 3G6JB 3POFA 4QX8A 5JZGA 1VBA2 1ULFA 2Z5WA 3VDDB 1RUC2 3OEBA 4JHTA 4K8RB 3W9AA 2UWAA 2XB6C 3IDCB 2VR4A 3JBG1 1US3A 2QQKA 1O5LA 1POV0 2B9VA 2GP5A 2ILMA 1O4YA 3KB5A 1VBB2 5CEHA 1V6NA 2QDRA 2WWJA 1NLRA 1OMIA 2PAMA 2X09A 2WFPA 3B3QE 4DFSA 1PIV1 1PK6B 1RUE3 3O5SA 1PNGA 3M3IA 2WN2A 3TN93 5KR7A 5F2SA 1CAXB 1UXXX 2D6MA 5HI0A 5H9QA 5T50A 4BYYA 4R4XA 5I0RA 3OY8B 4CP2A 3E6DA 1S0GA 2WNVA 3ALQA 3S6PA 5EIYB 1EAH1 1W0NA 1G9CA 3HPNA 1YI7A 3D0JA 4YWAA 2DBIA 2WO7A 4NHYA 3HEIA 1LGBA 2OZ6A 3OF1A 5JI7A 3UJOA 1UAIA 1OFSA 3ZFEB 1CAWB 1H9WA 2WWUA 4QQ2A 4YM3A 1SDWA 2A6ZA 5FYCA 1JN2P 2WLPA 1WUVA 1UZ0A 5FZ0A 5FZCA 2Y6JA 4A3XA 5EJZB 1OA4A 3VB9A 3WG1A 4BQ4A 4IEUA 5K0UB 1WD4A 1MS9A 1WW4A 4G3YC 4GH4B 2R0HA 4P9YA 4XEZA 1GZWB 1NE4A 3EYPA 4YG0A 4COWA 1FT9A 1WKYA 3ZFFA 4QB2A 3R6SA 4EN6B 2QNKA 1ZBE2 3NKTA 4MGKE 2RMU3 4N9IA 1UZZA 2YHJA 4UFHA 4XAAA 4D0QA 5KC6A 5FZDA 3KVAA 2ZGUA 1OD3A 1CZSA 1XNAA 4UFIA 4LBOA 1SMVA 2NLRA 1H6XA 1CPNA 1SCSA 2HYKA 1XPWA 3ZXJA 5CKQA 1HX6A 3ZSMA 4KL1A 5LA9A 1K42A 3K51A 2D5HA 4GWJA 3ZYJB 2XLGA 3OD4A 4NROA 4UFJA 2JG8C 1OOPA 1LEMA 5FPZA 1RUE2 3IBMA 2ES3A 3POJA 4XBNA 3TN92 3L9JT 4B7EA 2KXLA 3ZLIA 1UPSA 1UZYA 4V2WA 3VHOA 3S57A 2Y33A 2JDHA 3MIHA 2XH6A 1NCQB 2ZABA 4QXKA 4CTEA 4D69A 5J48A 4XAEA 2XJRA 1A78A 3GNEA 4UWDA 1COV3 4LPLA 5C5UA 4Q4W3 4S2DA 1CVNA 2C26A 3WDUA 1JZ4A 3H3ZA 3BALA 3EMRA 5KHKA 3C7HA 4M4RA 1HXS1 4MGSA 5C9AB 4AOCA 1YI9A 1DZTA 3DGTA 2XJVA 1RUOA 1BLZA 2GU9A 3FHAA 3KHCA 4A4AA 4TLGA 2VOXA 3E5QA 4WBBA 1I5ZA 3VZOA 2WFF3 4KQ7A 4OLLA 1UW8A 4GB31 5JXHA 1GOHA 3R0RA 4FPOB 5FZ6A 3CJIB 4FAHA 3ZPYA 2R061 1DHKB 2KM2A 2R32A 3JUUA 3LGRA 4H3WA 5GALA 2RMU2 3HVDA 3E6CC 1PM4A 5BNOA 3BTYA 3P1IA 1VMFA 1VIWB 5JSRA 1K5MB 1YQ5A 4K21A 1Q56A 1KFXL 2EXIA 3VLBB 4HONA 2P3JA 4G9SB 2EIBA 3N3HA 2VO5A 2YFUA 5FZKA 1YFYA 2XQRA 3SCFA 3JCIA 1QH6A 2C6SA 4Q0VA 3K2OA 3NJYA 3WP3A 4LBJA 4AI8A 2W3JA 1WWYA 1HN0A 1KJLA 3PIGA 2UU8A 4IE6A 2ZX2A 3THPA 5C4WB 3KMHA 4INDA 4ZZ5A 2RR11 1BEV3 2WNEA 3CJXA 4UI9L 1RTVA 5E88A 4IDZA 3KSCA 1COV2 5FZ7A 3BOWA 1FMD1 5JXGA 4Q4W2 1F15A 1F2NA 1CN1A 1DQ5A 2DCYA 2R6QA 2ZA9A 1OH4A 1QKQA 4JGZB 5C8CC 5LRSA 3BI3A 4W6WA 5FJHA 3PUHA 2HYXA 1LAJA 3W5MA 5DG1A 2CV6A 5F5AA 1SPPA 4D6SA 1DLCA 5FDBA 1M4WA 5EP9A 4V2VA 1NCRB 5IVBA 4L92A 1O6UA 2EVXA 3VUOA 3J7LA 2YUEA 1GMMA 3WOGA 3I3QA 3WCSA 3I7DA 2JB4A 2WFF2 3NAPC 4XUPA 1ZRDA 1PGW1 4I01A 5KBFA 2RDSA 5FBJA 3ZR5A 4ATFA 4WM7C 3SKVA 1IS5A 4FSJA 1BKZA 1LOCA 2RS51 5FYVA 5FPAA 2KD7A 1OUSA 1H8VA 4ASKA 3PMEA 3B9IA 2CDPA 2B9UA 1RUG1 1VPHA 1B09A 2RM23 2IVIB 2WINB 4XHXA 4K20A 4YGEA 3WDWA 2ETEA 4GMP3 1UXZA 2K2SA 2VVDA 3RWNA 1XYPA 1FNYA 3LA3A 3VBSB 3ZN5A 5C9AC 2WAOA 1VRH1 1QJFA 1RUF3 3MIBA 1IG3A 4QDQA 1F8VA 1AR91 1ALYA 3OYWA 3SLIA 5AC91 1WCSA 1GNHA 3NJZA 1WCUA 4IGPA 2O14A 3MEPA 1HRI1 4CA9A 2W95A 3CJIC 3JBG3 4CEWA 5F37A 1BEV2 4QX2A 2A70A 3JQWA 4OI4A 1Z7S3 1ULPA 5KHJA 4D6QA 1PIV3 2WS91 5JAXA 1IKPA 4P08A 1OVSA 4CP9B 1LOAA 4X8PA 2G4IA 3K48A 2GC1A 2E63A 2UYBA 4DMIA 1OD5A 1W6PB 3LIGA 2LROA 4Y1YA 1EAH3 1VB2A 2PFWA 4NMIA 1H4HA 3MF6A 1TZOA 5FZBA 2XWBB 1FV2A 4XJAA 3WF0A 1E57A 2ZZQA 4CE8A 4EWEA 5FRAA 4QX7A 1O5UA 3MLKA 3T0BA 3HN3A 2G9FA 3DPRB 4IE7A 1RITA 1GANA 4O65A 2X10A 5FZMA 2WZPP 3HQXA 4CUCA 1KDKA 2RM22 4JQRA 3POGA 4QHBA 3JQXA 1I5PA 4JGZC 1XQNA 1JS9A 2J22A 3RI8A 2JJ6A 4HL0A 4QKNA 3WG2A 1X9TA 4IESA 4AI0A 5JSPA 5DAQA 3WUDA 2AUYA 4YNIA 2ARBA 2GMEA 2FDKA 4CCDA 4LUKA 4OZXA 1Q8OA 3B5LB 2VZ1A 1HB2A 1RUF2 5E1RA 1NXD1 4XVHA 3U37A 5K7PA 1JU4A 2VTXA 3MDPA 1GUIA 4FQZA 4FPCA 3IPVA 2YXSA 3R4DB 4FPKA 2GNTA 2WYFA 2A71A 3AMNA 1SBEA 5FP4A 2GP3A 1W2TA 1AHSA 4JX0A 1UQXA 2CL2A 2JDUA 3JBG2 3OD0A 4MHRA 4LHNA 1W8FA 4AI2A 2B46X 4XFAA 3OPWA 3I2FA 4GQ7A 3C7EA 4CDUC 5J7MA 3NL1A 2P4EA 3P3PA 1Z7S2 3IIAA 1H1IA 1PIV2 1OUXA 4ET7A 4C0HA 5FP3A 1VLNA 4XCAA 3UNPA 2XJSA 1NA1B 3MO4A 4L2NA 4D7SA 2D44A 1V9U3 4A2UA 3T2OA 3WVJA 2XKPA 3ZPOA 4FPGA 4I3GA 4PJYA 2J1TA 1G9FA 2VMEA 2AZ5A 1EAH2 4CUGA 4HG6B 1LOGA 5L9VA 1Q8PA 3QACA 4XF0A 2X53S 5KXCA 2MHFA 1HXS3 1A8MA 1WBFA 4AW7A 3WQBA 3O1VA 2P37A 3KM5A 1LB2A 3ITQA 3LE0A 3AKQA 3HNYM 3MIDA 3VZMA 3P5BA 1AZDA 1CONA 3OCPA 3OBRA 4Y20B 3ZFGA 4B3NA 3ZKYA 4GB33 1CAUA 1NXMA 4AI9A 1RXGA 2DURA 4LHLA 5EV7A 1TNRA 2R063 3H1WA 3KCXA 1W9WA 1AR71 1YXWA 3AJYA 5A32B 3I54A 2DVGA 4TSVA 2VZVA 4I0WB 1YJLA 4AVSA 5J96B 3RQ0A 1NUKA 2Q8OA 4QPIA 1ZRCA 4AEKA 4YYOA 4ASMB 4EE2A 1ZVFA 4Q0UA 4JTNA 4COZA 1LHUA 4YARA 4FTBA 1PO21 1X8MA 2GH8A 1BHGA 1VMHA 2VXJA 3P3NA 4N53C 1V9U2 4E2SA 2RR13 4K9SA 4YFZA 3VKNA 1H4GA 3PNAA 5FREA 5ABJA 5HBAA 3KCYA 1DQ4A 2O0OA 2PHLA 1FMD3 2ADDA 5BNNA 1J59A 5HPOA 3AP7A 3I49A 4QMAA 3M3CA 4K1ZA 1R093 1K3IA 4HLTA 3IIIA 3RZLA 1NE6A 1MZEA 2D3SA 1RJ8A 1HXS2 3KQ4B 3VD3A 4KNCA 2WZR1 1UN1A 1UNBA 2WR9A 3VHRA 4ZS2A 3ZSJA 4CP0A 4DRRA 1XSQA 2BVVA 3E6BA 5JSOA 1BYHA 2X5IB 2ZX1A 4RFT0 2AGSA 4QHOA 2BTVC 2IXHA 2RV9A 1ZZ6A 3NO8A 4E4ZA 3VBRC 1NA1C 2TUNA 2A6YA 3K4ZA 4JGYA 3WQ0A 5JDBA 4GB32 1A34A 2G19A 1W6QA 1HQNA 1H9PA 1ZRRA 3GHNA 2OXBA 4QPGA 2RS53 2R062 4AXOA 3NNJA 4LIUA 3AYDA 4NOTA 4UW4A 1O3TA 3D0SA 2PHDA 1E5SA 3RGBA 1RUG3 4K3UA 4YZ3A 2ZEWA 4FQ4A 4M3CA 3AFGA 1GSLA 4MSVA 5A6YA 1MQTC 4QM9A 3MBWA 1LOBA 4SLIA 2ZGTA 2W0XA 4KH9A 1OH3A 5FV3A 5FY4A 4DO0A 5IK5A 4UF0B 1VRH3 3N9NA 4OZOA 5EQUA 3BKZA 1J3QA 3BIWE 5AC93 2VVFA 4N43A 5F32A 1WLDA 3LPFA 4KU8A 3U0ZA 1E5RA 2WA3A 3ZXDA 1MVQA 1L7QA 1WCKA 2YGLA 3MLLA 4UXAA 3KV9A 4DY5A 5C3PA 4FTEA 1HW5A 4C91A 1YWKA 4R8HA 1KDMA 1PGL1 1MPXA 5DPNA 3CKHA 2RR12 4AI1A 4GJZA 3GCXA 1UU4A 4QPYA 4MGZE 5FKBA 5HV0A 2WS93 1JOPA 4F83A 1DU3D 1PVC1 4MX3A 1FMD2 5JMOA 1UY2A 4YM2A 1BJQA 1R1ZA 1R092 1STMA 5LATA 3LOBA 3HNBM 4E4SA 3VKLA 3PJYA 4DXSA 2OA2A 2GC0A 5M0TA 1I3HA 4OI1A 2EXJA 1K45A 3UYJA 3D3AA 3VD5A 2W92A 1QDOA 1SDDB 2HWF1 3H3LA 4FO9A 4GD4A 2DUPA 1YQ8A 3J7NA 4XPVA 3HIFA 2PHWA 1PGW2 4RQPC 2ZPXA 3CZJA 4WZCA 2FQPA 5DAVA 5L73A 3IDBB 2RS52 3RS6A 2GN7A 3AL6A 2ZHNA 1SHWB 3CU7A 3AKPA 5LY2A 1ZRIA 1LESA 1W6MB 1RUG2 3N7LA 3ACFA 3GCWA 4YVWB 5L7OA 4RHV3 3ZO0B 4QDSA 4ZXKA 4JDMA 2W47A 1GFF2 4UFLA 1NKGA 1DDLA 1C8M3 1ULDA 2ET1A 3ZX7A 2R49A 4H55A 1IGOA 1VRH2 4HXCA 1Y3TA 2P2KA 5T5JA 3GYDA 3WNKA 3LFMA 5AC92 2JWPA 3OBZA 5FQ0A 1LU1A 4XYXA 2PHTA 3SITA 3VBHA 5J1XA 5JZGB 1T2XA 5FPLA 3B00A 4I3PA 5ERLA 3H3UA 4AHWA 4AK3A 2ZS6B 1F5FA 4LA2A 3I59A 1JYVA 3AZWA 2Z69A 5J98B 5A80A 3IKWA 4MLOA 4E4DX 5FPUA 4E8DA 2WS92 2E7TA 1N1SA 3BOPA 2IWGB 3ZIWA 4PI0A 2IXCA 1LHOA 2WJSA 4XFCA 2YG0A 5A7PA 1U0AA 4Z07A 5D8AB 2LTNA 5CU1A 3BN6A 5J36A 5JPMB 1Q3EA 4FOVA 1KD7A 4I0AA 4OI2A 5F3GA 4BA6A 5FYTA 4XQDA 3IT8A 3AYCA 4Y4YA 1OBNA 1PNFA 3LWCA 2W52A 4Y22A 4Q4V1 1SG3A 4FXKB 3AXDA 2D6PA 3T0DA 2VUAA 3N9LA 1PHMA 3WNXA 2AEZA 2DWRA 4P9JA 3OBTA 3ENRA 2QCSB 3LSEA 1X50A 4KWJA 1YUDA 4MXVA 5CFCA 2YPDA 3POYA 5FIXA 1O4ZA 5HCHA 3SCHA 1JMUB 4RHV2 2OPWA 2VBPA 4LORA 4GIQA 1WLCA 1QEXA 3IDEA 4JRAA 2GZWA 1FNZA 3OEAA 1AR73 1XU1A 2ENRA 3VBUC 3DKQA 2BJSA 2E7QA 2ZHKA 3AL5A 2PHXA 3FLTA 4XJWA 3BCWA 2PTMA 4FPEA 4TWTA 1MR5A 1S0IA 4XACA 1ZZ8A 1O4TA 1F5JA 2PHRA 1W6NB 3LEIA 3P6BA 1H6YA 4LBKA 3LCPA 1PGSA 1PVXA 2J42A 1JYNA 1EPZA 2QVSB 4QX0A 3BYWA 2YC0A 3H8XA 3J4UH 4AVBA 2ZMLA 4META 4AG4A 1OOPB 3TEZA 3WXPA 3FHIB 2P1BA 5LBFA 2ZGQA 1PO23 5JVVA 3O7OA 1XNCA 2XLAA 4KGQA 4YLZA 3FUOA 2R0FA 1NZIA 1Q43A 3U4XA 2W1WA 4FPHA 2EIDA 2RS13 3S7EA 4IV3C 3SNMA 3N7KA 4YW7A 4EZ4A 1FPN1 2XONA 3ZDSA 5JZGC 3VKFC 4CCKA 1APNA 4AL9A 5I93A 1YIFA 2JEMA 1RC6A 5EYYA 2FD8A 1OSGA 2WZR3 2D98A 4MXWB 3ZSKA 2FCVA 1TVGA 3CMGA 5F39A 3WW1A 4IEOA 3TAYA 2GDFA 5IT6A 3QH6A 2QQIA 3F95A 3HOBA 4YVSA 3J7MA 5GLVA 4F8AA 5LCWL 1XBFA 2QQNA 4QGMA 3FBYA 3DCQA 4EV0A 3VKOA 5DUWA 1G9AA 4YG6A 5IVCA 3UGGA 2ZTNA 4XABA 1JUIA 2WN3A 4IXLA 1GZ9A 4CRQA 5C3OA 2BUKA 5BNOB 3GBWA 1AR72 2GC2A 2RHPA 4DPNA 1TMF1 4QB6A 1XE7A 1YJKA 1EV11 3CIHA 5FWEA 1N1YA 3KQRA 5E89A 1CPMA 4RGGA 3T2QA 1UOGA 3LFIA 2PXJA 2QQMA 3ZYRA 4QQPA 5A6QA 3I97A 1GNYA 3ZXEA 4CDQA 4Z1VA 1FYUA 1W8ZA 2F17A 4FBFA 2QE3A 4OHXA 4HSJA 2EF6A 4PQQA 1PO22 4IE4A 4LO5B 3N7JA 1LGCA 3ZFFC 4NRQA 1UPIA 1CZTA 2OS2A 2W39A 1RUI1 3KF3A 4HKOA 3NV1A 4JZRA 4UFKA 4FTSA 1V6IA 1CESA 1OKOA 3G7DA 4LK6A 5IAVA 1PVC3 2C9KA 1W0PA 3FMGA 3JB8A 5I0UA 2YDEA 3OGVA 1XE8A 3USUA 1XSRA 3WW4A 3DUIA 4AFCA 5KHIA 4H14A 1US2A 4B7KA 4E2GA 4R52A 4Q29A 3PUSA 4XF1A 4HZFA 3RMXA 1CJPA 1A3KA 3WX5A 5IYYA 2IXLA 5H9SA 2WZR2 2Y6GA 4WZFA 3WF1A 2YBPA 4S2FA 5CFDA 2VH9A 4NWVA 1OA3A 1UIJA 2RDRA 4GA9A 3RYKA 1OOPC 3I3MA 2BDRA 1QY4A 2B42B 2VNVA 2SBAA 5F3EA 2HWF3 4OULA 1C28A 4MGIE 5A33B 1W6OB 4LNVA 3PVEA 3KT7A 4QKFA 1AX2A 1AL21 2ZGLA 2QTWB 2ZHMA 4YGBA 4H7MA 4IEYA 4OVEA 4AQTA 3M4FA 3HNMA 1WLTA 1AX1A 4XJZA 1F31A 3WW3A 4A41A 2XPJA 3B69A 1GOFA 1IPKA 1LHWA 1IS6A 2G9ZA 4ZXEA 3WUCA 1AXYA 4CYDA 1IS4A 2XL9A 2JG8B 4DXRA 1WA6X 3IMMA 3IWZA 2E53A 1V6MA 2O1QA 2ZX4A 4W6YA 3U11A 5JIUA 3IM0A 4CU7A 4Q26A 4FAGA 2HKXA 5DDJ1 1QJX3 3OG2A 4AHXA 4CEWB 1ZA4A 4BJ0A 1YFUA 2OQ7A 3WZ1A 4JHZA 1W03A 4DXZA 1PGL2 5BNOC 5FFOC 2C1FA 4NIDA 1QOOA 1PVC2 4IE5A 5J37A 3ZDVA 4YM0A 3BTAA 3JU9A 4AF9A 4BISA 4HVRA 2J1VA 3U4SA 4CVUA 5CG8A 1FXZA 1Z7S1 4GXLA 2XGXA 5AVAA 2R30A 2Y6LA 2OQ6A 1E5HA 2AR6A 3T3YA 3WT3A 2LUWA 3K3OA 2W1UA 1ODMA 2GAUA 2VNOA 3NSTA 4NHMA 1ND2A 2HWF2 2QKDA 4NRMA 4Q4V3 4YSFA 5F9TA 1HIXA 3INAA 1ZREA 5KXEA 3WR0A 4OUSA 1UY3A 1N1VA 1DG6A 2GH2A 5IK7A 3LAGA 4C8DA 2XL7A 1ENQA 4P9XA 3FC0A 3RVHA 5A70A 5CVRA 1S4CA 5FMOS 3MHZA 1QU0A 3WSOA 1UX7A 3ZXAC 2EAAA 5F7UA 4N8MA 2XHNA 3PMSA 2ZGOA 4C1XA 2QUOA 1WCQA 1S1AA 2VOKA 5LB6A 3MI8A 4OQ9A 4B29A 1V70A 3PUIA 1JZ6A 2GALA 1H8TA 3ZIXA 4ZS3A 1TME1 1C8NA 2E6VA 3LB9A 1QJX2 3NJVA 3WHUA 2VZRA 3H42B 4LE4A 2H0VA 4Q5OA 4Q1PA 5AFEA 5C5TA 2E32A 2YC2A 4M3CE 4D8MA 2YFZA 4RGKA 2Y34A 1PMHX 5C8CB 1JOBA 1FATA 5EJ1B 3C7OA 2VAUA 2VQUA 4NHKA 5FYHA 5GLZA 1FI2A 4CPBD 3DL3A 4KU7A 4UT5A 2YPJA 4QU1A 5AFBA 2VQTA 3IDAA 2YROA 4CCJA 2CHHA 3KV5A 4AVAA 5IVVA 1FPN3 1O8PA 1JYCA 3PTYA 3RPQA 1OA2A 5E16A 1POV1 3NAPB 1B35A 4LKDA 2WO2A 3AJZA 4Q0QA 2DDUA 3TEYA 1V9U1 3ACIA 5EFUA 3WDVA 4Q4V2 3PJQA 4RL7A 4WM7B 4CEWC 3QOPA 2JG9A 1LKNA 3D5OA 1RUJ3 5FUIA 2Y6KA 1ND3A 2JDPA 5I8SA 1PMJX 3T30A 3J8F3 5IHRA 3ELNA 1NYWA 2ERFA 4LIVA 2XVLA 3VZNA 5J3UA 1CX4A 4KWUA 1ODNA 4QQLA 1VB4A 1D4VB 3MLJA 2B8MA 5T3NA 1RVF3 1UOBA 3HQRA 5IK4A 3GALA 1TMF3 1Z0HA 5LA1A 1SCRA 3VL9A 3HAGA 1EV13 2YU1A 3E97A 1YFWA 2RJ2A 2EIEA 1VALA 4S2GA 5DN2A 5F3IA 5JOWA 2VZSA 4Q8LA 4KG8A 1OI6A 1AYM1 2EXKA 4PF1A 3LDBA 2WNUA 1ULEA 3I4IA 5GZFA 1RUI3 2WT2A 3CHXA 1MS8A 5ABJB 3VKMA 5CKMA 4ZZ8A 4L8QA 1OPOA 3L2HA 2PQSA 5L36A 1FPN2 3I3EA 4XDPA 1GQPA 4W65A 3VBFA 2PA7A 1W3VA 2V4AA 3FX3A 5FO9B 4FCAA 1W9TA 1BVP1 3IAPA 4WVMA 3FN9A 3MIGA 1W8WA 3THDA 4O7XA 1UMZA 1U5ZA 4B4QA 4CU9A 5DMYA 1RUJ2 4NE9A 3LIHA 3UESA 4NPRA 4ARXA 1VR3A 5FMOL 1R091 5LWBA 3H8RA 4YRDA 5A7WA 3J8F2 2J1UA 3SISA 3POWA 5E8AA 4XJ8A 1GP4A 5C33A 1ST8A 3ZN6B 1O59A 2J1AA 4Y1VA 1AL23 2K9ZA 4X8NA 3BB6A 1UZWA 4LK7A 4LJHA 4Q4Y1 4XCBA 3RZGA 4IETA 2RE9A 1DYPA 1RVF2 1YLLA 3GXUA 4Y1ZA 4UAPA 4PBOA 1BZWA 2WQ8A 3V0AB 1DGLA 1H2LA 1TMF2 4QXHA 3CDZB 2WRAA 4XFGA 5A3OA 2Q1ZB 1EV12 1SLTA 5CADA 2WZ8A 3LEKA 1W2OA 2UWCA 3QBQA 4CDUB 3CNAA 3KF5A 1UCXA 2BQPA 1HB1A 3DXTA 4CPBA 4BH9A 1NLQA 4RS5A 3KHBA 3ZFGC 2QQPA 1HQLA 4DUWA 3T2TA 4JKLA 1QQP3 5DDJ3 2VW2A 4Y5TA 1J58A 5GLUA 2H6BA 1RUI2 3PIJA 1CAVA 5A3UA 3RDIA 1UX6A 4QGNA 2MEV1 2QQJA 2ZKLA 3ZYPA 5FPXA 1PZ8A 1RINA 1U12A 4ZU4A 1OT5A 1W99A 1D0GA 3UV9A 1GP6A 1TE1B 3JZVA 3LEMA 4Z82A 3AP5A 4QPIC 4XIOA 3RSJA 3ZYBA 4Z2WA 5BNPA 1MS3A 2CDOA 2XVKA 5DQ0A 3Q8AA 2FDJA 3N36A 4P9LA 1WW5A 2FCUA 5EWSA 5FZ1A 5SV5A 5T5OA 4IEZA 3D6EA 1MS5A 1J3RA 1GOGA 3MPBA 3ZR6A 2VJXA 1RJ7A 3WNMA 1AL22 5FXWA 3CEWA 4JVAA 5ABJC 2B39A 1GP5A 3AKSA 5BNNC 3AMPA 3WF4A 1AYN1 4HPKA 3UKTA 5FZFA 1GKBA 2A3YA 4ZU7A 5L7OB 1N3OA 1W8UA 3KVBA 3LZZA 2OYZA 4BLJA 4AAPA 1DGWA 1QXJA 2BNMA 1ZZCA 4FVVA 2Y0OA 1O91A 3E5XA 3ILNA 3N9QA 3VDDA 5ACA1 1VBE3 4IV1A 2ET7A 4DS0A 2BOIA 1CIWA 3VBHB 4DEQA 4EZHA 3VBOB 1UOJA 4J1XA 4RHV1 1DQ2A 2DFBA 4JGYC 5FJKA 1TME3 2ZGNA 1QQP2 4IEXA 4N53B 3GZEA 5DDJ2 2VVEA 1PK6A 1C8M1 1XJAA 4QPGC 4GWMA 2P6CA 2ZGSA 5FP7A 3TWIA 1CAXA 2D97A 4PBPA 5EPAA 2R1DA 5FZLA 1DFQA 1LOFA 2FMYA 3OY8A 4AFMA 3EQEA 4LLOA 2DTYA 2WO1A 3ORJA 2YY1A 3USSA 1QWRA 4HANA 1W9YA 3ZSLA 1UY0A 1WCDJ 3SH5A 4BQ1A 3B9CA 4XDQA 4XZPA 1HJGA 3KWVA 4WVVA 4N43C 3EHKA 1Q8VA 4QX1A 1V00A 3RYPA 2A6XA 3ZFEA 1CAWA 1POV3 3B94A 3MPPG 4FOYA 5APAA 3VBRB 3V56A 2W1SA 3PVNA 3WP6A 1UWWA 2FZ2A 1L7LA 1SFPA 3GJBA 1X7NA 2WKKA 2P5BA 5K0UA 4GH4A 4WVWA 4EJRA 4LKSA 5FYSA 3GHMA 4QX3A 5FZIA 2DTWA 3J7HA 1W39A 1UYPA 1YIPA 2VU9A 3T2PA 1LNSA 4AGGA 1MQTB 4YW6A 5DAPA 1NLSA 4WM8A 3QH7A 2D5FA 1V6OA 4Y5Z0 3TRSB 1XNBA 4DRVA 3WP4A 4P5YA 3VDAA 1DGRA 3U14A 2NN8A 5T55A 5DXDA 2JDNA 3HWJA 1QHDA 4NHXA 1VBE2 5KHGA 1ACCA 1DQ1A 2PLV1 4E9KA 5JXIA 5H9PA 4Q0SA 5FYBA 1TME2 2CSGA 3NMBA 2HWB1 4DINB 3VZLA 3U07A 2GNDA 2BW8A 3OGGA 5LA0A 3ZMNA 4XBQA 4W50A 4XETA 1AYM3 1NCQA 2WABA 1K5JA 5L7OC 5LZ6A 2NMNA 4LUMA 2DCKA 3VHPA 1ENSA 5KC5A 3AMHA 3K46A 4IV1B 4QGLA 1GNZA 5FZOB 3FLPA 1JTZX 1LEDA 5HXMA 3VD4A 1W8NA 3J9SA 2XVGA 4BQ3A 5FOJB 1A6CA 3APBA 5CB7A 2DFCA 4PF5A 3A22A 1GBGA 4QM8A 1H30A 3VBHC 1DF0A 2XMLA 3VBOC 5C7GA 4NWWA 4E2QA 3CQOA 1S0JA 4RQPB 3A4UA 2WYSA 4BQ5A 4CSWA 4MADA 1FOD1 3FHQA 2JICA 4BLIA 2XJPA 2RS11 4AQSA 1RUD1 1POQA 2XJQA 3GM8A 1TQ5A 2UY9A 4OHZA 4LOSA 1WW7A 1NAEA 2Z79A 4JKMA 2JENA 4PIZA 4ZPIA 5DUXA 1NX9A 1RB8G 2JDYA 2R043 3JB4C 4PLOA 4XUOA 1REDA 3CZUA 4AVCA 1K5MA 2D6OX 5FZ9A 4Q4X1 4WVZA 3GGLA 1EP0A 4LR4A 4Q4Y3 3MW3A 3E5UA 3RJ2X 3R4UA 3GZUC 4IUGA 1UY1A 2G1MA 3C8XA 4LULA 4QXBA 2P3YA 2ZEYA 1M06G 2PQQA 2W1QA 3MUY1 3X29B 1Y9QA 1QJU1 1G86A 4U36A 3K77A 3M2MA 1ENRA 1ULGA 1DZRA 2H6CA 2IFRA 2VZQA 3KT4A 3UT0A 2C9AA 5C4WA 4BQ2A 3WLUA 5CFCC 2YB7A 2R1BA 3Q8EA 1AYM2 1V6LA 2VMCA 2Y8KA 2VCAA 3ETQA 4LOTA 1ZBA1 3KZ4C 4IEPA 4R9AA 3NW4A 2VULA 3ZKUA 1P8JA 3WP5A 2VC9A 1ZX5A 1VAKA 4P14A 3OJBA 2BNNA 2X05A 1K12A 2PAKA 2BYVE 2MEV3 3USUB 3MIEA 2CNAA 1NCRA 1WA4A 2W87A 3MZHA 5C3QA 4GWIA 2HWE1 4XXPA 1W2UA 2I2SA 4E27A 3HQUA 1W05A 1YQ6A 1ZM1A 3T09A 4D3WA 4XTPA 1J1TA 5T52A 4LT5A 3OPTA 4KWKA 2Z2SB 3WNNA 4NVPA 1DYOA 2R042 3RZMA 4OQ8A 4NAOA 5BYNA 4QT6A 4LBMA 3VN4A 1DLLA 1W8HA 2EALA 4Q4Y2 5DZGA 3VBUB 1ULOA 2QBXA 2P3IA 1AYN3 5FYZA 3VBSA 2VZTA 4AZZA 2VZ3A 4TXWA 3CBNA 2DVBA 1PX3A 1AR61 4PDWA 4HKWA 4I2OA 3VZJA 2ZGRA 1OKQA 2FDIA 2JXAA 3FJSA 5ACA3 4YVSC 3H1YA 3EO6A 4ORFA 4ES9A 4N9HA 2VGDA 4Y3OA 2GMPA 4NAMA 2CYFA 3T08A 3LA7A 1F9KA 1OXCA 1VMJA 4CU8A 3AB0A 3LDRA 2O8QA 2P34A 1IQDC 3ZXGA 3M3QA 3T1LA 4DUVA 2X29A 1LULA 4IGOA 4IV3B 3H8UA 4R9CA 4XFFA 4Y33A 3SCGA 4CP9A 3FBMA 5EZWA 5C8WA 4ARYA 2XWJB 1OF3A 2MEV2 2C24A 5A7OA 5D1IA 2Q4SA 2WL1A 4J25A 1QJX1 5JUVA 2YMZA 3HR9A 4LO4B 4DZGA 5GZCA 3OUHA 4W6XA 3O0VA 4LBQD 4GWNA 3WG3A 3M3EA 2W46A 4PLMA 2BFUS 5FZGA 2DF7A 2Y64A 5HXVA 3NJXA 3SHRA 4CDQC 1BCXA 1MS0A 1MVEA 3NV2A 1JHJA 4MV2A 4C0BA 3PL0A 1LR5A 3AMQA 3DPRA 3A23A 1Y9MA 1XB9A 5IVYA 4DXTA 1QJEA 2WNVB 3LA2A 5J09A 1PO11 3LEGA 2A6VA 1JHNA 1XOYA 2ARAA 4JKKA 3MV01 2D7FA 1C4RA 1KXGA 2WT0A 2QJVA 1AYN2 4LKEA 2NZ9A 3ZXKA 1S0CA 5KWRA 2R7EB 4RR3A 4OHVA 2VUDA 4RN5A 3OUIA 1BK0A 2PELA 3DN7A 2FDFA 2DBNA 2VM9A 3BPSA 3WF2A 1JZ7A 1YQ2A 4R9DA 2VBDA 4P5HA 5FY0A 3WQ1A 5CFDC 3VV1A 5ACA2 2W2IA 3MW4A 5K4LA 2PLV3 1S0EA 3NKGA 3OUJA 4PIXA 4YW2A 3ZFFB 3WDYA 2Q30A 2CGOA 4L9BA 4NHLA 2HWB3 5JOYA 1RUNA 1C8M2 2VCBA 3O1MA 1SZBA 4WV8A 4HK8A 5DAXA 2WT1A 1IOAA 5I0SA 1BQPA 5SV8A 1DGRN 2DUQA 4ISRA 1HV0A 4YZ5A 3JD71 4UBHA 2NPIA 4CCEA 1V0AA 5BUVA 1DQ6A 1TNFA 1AJOA 1WW6A 5F1RA 2AYHA 3EJKA 1MS4A 4A7YA 4I02A 1H2NA 5G04L 3HBZA 3FZ3A 2IFWA 5FK8A 3TNPB 5JXJA 4TTGA 5BY5A 4OYUA 2XDVA 3NV4A 2IXKA 3SMHA 1OFNA 1FOD3 3IZOA 4Y20A 3POEA 4A7ZA 5DAWA 1O3SA 4W8JA 5FY1A 1CJDA 3JXSA 4Z92B 2BEOA 1VAMA 2BGOA 3RWKX 1T6GC 4Y24A 1RUD3 2ZHLA 3I8TA 3SEPA 1C1FA 3I2GA 1GZTA 2UYAA 1OLMA 4LBLA 2XXZA 5A32A 4Y1XA 1Q8QA 4Q4X3 1NZCA 2PAEA 1RUJ1 3UGHA 5BV6A 5FUPA 3A7QA 4P9GA 3WW2A 4HSLA 3W20A 3BODA 4JTOA 3J8F1 2PHFA 4QHZA 1OQ1A 5DZEA 4FFIA 1ND2C 3RI9A 2PLV2 1MZ5A 3FLRA 1QJU3 4DY3A 5FZ3A 2WNVC 5FZEA 1W90A 1SFYA 1JYWA 3AXEA 3LSDA 2HWB2 1NQJA 2ARCA 3I3DA 4GAZA 4AQ6A 1RVF1 4LBQA 4BMBA 3O14A 4CDXA 2A1XA 3S7IA 3RMYA 2V73A 1S0FA 1YRZA 3AK0A 1UMHA 5FP8A 1PZ9A 1ZBA3 4AFAA 1S0BA 2EAKA 5HV4A 2BFUL 2V5YA
chains in the Genus database with same CATH topology
2Q0AA 1KRIA 4SBVA 3PLQA 2OZJA 5HCFA 2ZX0A 3ZYGA 1YYNA 2GNBA 5DUVA 2AENA 4XQWA 5JOZA 1H8TC 2PHUA 3VBFB 4X6RB 3KGLA 2GN3A 2HWE3 5GZEA 2X5IA 4COVA 4EWAA 1FOD2 4IERA 5A3LA 1C5IA 2VMIA 1WGPA 3RYRA 2RS12 4LBNA 4O9EA 1TEIA 2WC2A 1JBCA 2W68A 1RUD2 2A6WA 2I07B 1OLQA 5T54A 5GZGA 4GMP0 2RS31 5JR7B 1OHFA 3AFKA 4C1WA 3M3OA 3ROUA 3ZXLA 2VECA 3WY6A 1X82A 4XF9A 4Q4X2 1PZ7A 1GQHA 2AH2A 2F4PA 2FMDA 3ZMOA 4A7KA 4MGYE 4BPZA 1GQGA 4AEMA 1B35C 3ZVXA 1MEC1 4BMEA 3KLSA 1AR63 1QJU2 3WDTA 4AYUA 1REEA 3AZVA 2JG9C 5F5QA 3OTFA 1UKRA 1ND3C 2XJTA 4RS5B 3RNSA 3HMYA 4XF3A 4COYA 2EA7A 1ZBA2 3OYWB 2CY6A 3AZXA 2W08A 3PHMA 4Q2FA 5L19A 4G4FA 4FT8A 1JYIA 2C5DA 1QQP1 3O12A 1S55A 2EXHA 2HWE2 3V0BA 2A75A 1YNAA 4FP3A 3M8LA 4DOUA 4BWOA 4AEDA 1GICA 1AR83 2WNUC 1QF3A 2QFEA 4FXGB 4FOQA 4TYSA 4X6QB 4YZ1A 1ZRFA 2P17A 1PO13 1W6MA 2R071 4YVWA 2CAUA 2IZWA 2ZKNA 4L11A 4N90A 4HK9A 3LOIA 2BPA2 4CDWA 3WG4A 4XFHA 1AXKA 2EIGA 3VBFC 4YGDA 2OW4A 4BE3A 4OHYA 1WLWA 1X36A 2TNFA 1AR62 4B4PA 2R16A 4ITCA 3SXWA 4XOGA 1IPJA 2D6NA 1WMDA 1G9DA 2OUJA 3AZZA 4HKLA 4ZKTB 4D94A 4MYEA 2ZACA 5I8YA 4F3JA 1O3RA 2NM1A 1VBE1 4J1WA 4NR1A 3IPVB 5D8AA 3JD73 4RA0A 4EWDA 2BWCA 1G6NA 1LJ7A 2D3PA 2CAVA 3T1MA 1XYOA 4DB5A 3C2UA 3AYAA 3HN1A 1QJY1 2HWC1 5F6KA 1WMEA 1NY71 4RS5C 1BBT1 4ISQA 1AR82 4PCRA 4XBLA 4XW3A 5T5PA 4ASLA 3HT1A 1MZFA 1WBLA 2BVBA 2PYTA 3ES1A 4EN9B 1IZ3A 4CEYA 1I9RA 1PO12 1U5YA 1V6JA 1FX5A 3ZYIB 2DVFA 2OIIA 2HEYF 3EBRA 4M00A 4BZ4A 1HLCA 2CWSA 5KXBA 4RGAA 1KFUL 1QNWA 1VBD1 4WM8B 3C3VA 4XF4A 5BNPC 1JOJA 1RUH1 2FHRA 5LEKA 1W6NA 1BMV1 4XE9A 3ZFGB 1I1EA 3B02A 4H7LA 1U5XA 2CTVA 2WIIB 3AP9A 1CAUB 4D7TA 1GYKA 5FO8B 2DU0A 2NYYA 4XTMA 1S0DA 2ZZJA 4ES8A 2A7AA 5FLIA 1IQAA 1SBDA 3ILRA 3JD72 4YFWA 4AQ2A 3VL8A 4B4RA 1ZZ7A 2HEVF 4UBGA 2WWSA 1ZZ9A 2ZMNA 3QD6A 4QPIB 3VDDC 1N3QA 4IV1C 3DKWA 3FE5A 2O8OA 4GKXA 4MXWA 2UY8A 3RZZA 3KS7A 5GM0A 3SH3A 1PK6C 3UKNA 4OFGA 2KA3A 3O0XA 1QDCA 3AYEA 2E9QA 5BNNB 1H2MA 3AX4A 3M7AA 1LOFC 2ZAAA 4JDNA 3NWKA 4QX5A 2RS33 3ST7A 4XHBA 4AVTA 2TEPA 3AKTA 4KG0A 1VBC1 4IEVA 4CZSA 2GNMA 4Y26A 4OI0A 2JD4A 1Q8SA 2CGPA 1LRHA 1RL3A 4P9WA 4BIFA 3TNQA 3ZFEC 4AGRA 1MEC3 1R081 3H7YA 4JGYB 2IC1A 1JXNA 2R041 1W6QB 2VMGA 2VW0A 4RSUA 1YHFA 4QPGB 1SQ4A 5KHHA 3NVCA 5CNAA 5K0UC 4GH4C 4K7JA 3WD5A 4LA3A 4LO7A 1UL9A 3IMNA 1OPMA 4M3CB 2JX9A 3KGZA 3UL2A 5BPXA 5LK7B 2Q1MA 4M0NA 4WM8C 2P3KA 4EROA 5IK8A 1LENA 5DZFA 1LU2A 3ACLA 4QU2A 4AHZA 5JCTA 4N43B 3ES4A 4AHYA 2ZBJA 1PMIA 2ZGKA 1HV1A 3H9AA 3ATGA 2BNOA 2D40A 2DVDA 1UIKA 3MF9A 2XG3A 4M3CF 5A33A 1QJZA 2ZOEB 1W6OA 1LTEA 1N3PA 1NCQC 1H1AA 4R9BA 1XNKA 3TB0A 1RHI1 2RS32 3D4KA 2FZ1A 1G7YA 4LE3A 1H0BA 2R073 3MYXA 3H1MA 4QD2A 2B5HA 4L99A 3EXUA 1CR7A 2RJKA 2C0ZA 3R05A 1J3PA 5GJ6A 3D8CA 1MEC2 5EJ3A 2JG8A 2UWBA 3B93A 1AVBA 4PDWB 3WDXA 4UW5A 4LHKA 3WHTA 3URFA 2YGMA 2D6LX 4M01A 3J26N 2JDZA 3A0KA 1RIRA 4YGCA 3IN9A 3MFCA 4Z8BA 4AVVA 4GKYA 4PIYA 4EN0A 5K9YA 2QZ2A 4M0HA 1K5MC 1D0HA 2OUHA 2ZCWA 1H2KA 5FQ0B 2VPVA 1UU5A 1I6XA 3I2DA 4MH0E 1UU6A 3RJRA 5HCBA 3I59B 3RG0A 2B7YA 2BBVA 1Q5OA 3GBFA 1DGWX 1QJY3 2HWC3 5C4WC 5AVPA 1SBFA 1O3QA 1BBT3 4K8FA 1WMFA 1X33A 3V64A 2R072 1SFNA 1EYBA 1UD1A 3UKVA 4R4ZA 4AI3A 2DCJA 3ECQA 4Y22B 3SH4A 5I91A 1GR3A 2NMOA 4XFIA 1NCRC 1Y43B 1VBD3 4RR3B 2DYCA 1D4M1 4FPJA 1JW6A 1RUH3 1ZNPA 1GZWA 4LTAA 5CFCB 2ZMKA 1LHVA 1BK1A 2LM3A 1QXRA 2PN5A 2B45X 4Q0PA 3AMMA 4HFSA 4MZUA 3ME2A 5C8CA 1XNDA 4QQOA 3VBSC 1NG0A 3D82A 1URXA 3AKRA 2E7AA 5KXDA 3AZYA 4PDWC 1NQDA 1DQ0A 2DCZA 1S2BA 4IEWA 2IXJA 2AREA 1HRV1 3NAPA 4HBNA 1QJY2 3WV6A 1IHMA 1QOSA 1LHNA 2HWC2 2A73B 2ZJCA 4XMIA 1NY72 2JKBA 4WM7A 1RMU1 1BBT2 1DYKA 3NV3A 5CBLA 1FV3A 4PLNA 2G9GA 5EYXA 2IXIA 1QNYA 1G9BA 1MACA 2CGNA 2XLFA 4V1PA 2SLIA 2VQ0A 4IEQA 3CLPA 4J6GA 5FTTC 1HDKA 2DCTA 1KS5A 5C9AA 5JOXA 5LEJA 2D93A 2JECA 2RJLA 2XHKA 1VBD2 1VBC3 2I74A 2ATFA 2HWD1 1RUH2 4YVSB 1QGLA 4YW3A 3CJIA 3TOJA 1BMV2 1R083 4Q1RA 2DVAA 1OLRA 5F6LB 3S30A 3DPRC 5T5LA 3OGJA 4HT1T 3H50A 3RRDA 4P9IA 2VW1A 4LBQB 3THTA 4CDXB 4MVTA 4RR3C 2XBO1 2XKOA 2DUOA 2E51A 2VG9A 5GZDA 5CG9A 4FPLA 1SLBA 2WQ4A 1DBNA 4CDQB 4O9GA 3DV8A 1GZCA 1SEFA 2YZ4A 1DIWA 2Y38A 1XYNA 4EN7B 3V65A 2NQYA 3WCRA 4JGZA 1Z78A 1C3HA 2QDNA 4MUVA 5EXOA 1LECA 3FUQA 3H0OA 3ZN6A 1RHI3 4GALA 1REFA 1HQWA 1ONAA 1NOVA 4I09A 1VBC2 4K1YA 3A0NA 4AFDA 4U2AA 4AE2A 3V0AA 1ASJ1 5CFDB 2A3XA 2VQAA 1AF9A 4I30A 4Q8KA 3FFQA 1R082 4CDUA 1AR93 4AEJA 5BNQA 1FAYA 4LLFA 1YO8A 5JPNB 2VUJA 5LRRA 3KCCA 1ZZBA 1V6KA 1HRI3 2HEWF 3AP6A 1R1A1 1N1TA 4HN0A 4N7IA 5CA6A 3POSA 1MZ6A 1DZQA 2NP0A 2ZAHA 1W0OA 4I0BA 3H7JA 4JAAA 1VBA1 3VGIA 1RUC1 2JE7A 3N7MA 4JDOA 1BXHA 1C57A 1IS3A 1MS1A 1AJKA 1XXNA 4L97A 1VBB1 3ZXFA 4AGVA 3S0MA 4ATEA 1SLAA 3B01A 2UURA 4BCUA 4BIOA 2XUMA 4K6BA 3V0BB 2ZGPA 1QOTA 3TYJA 1UKGA 4CDXC 2GMMA 1BVVA 3GZAA 3WQ7A 4COUA 4AEDB 2WLQA 5FO7B 1YFXA 1EPWA 1W6PA 3GBGA 1KJRA 2OVUA 1RHI2 2D3RA 4YW5A 4URTA 1AUYA 3R4SA 4BM8A 3L2YA 4FPYA 4UW3A 3W59A 1AL0G 1SLIA 3ZSEA 1CD3G 2Y26A 4YW1A 4DNYA 3ILFA 1AR81 4CDWB 1ND2B 3QLQA 2VNRA 1RGSA 4IL7A 4LEJA 5BXXA 1D4M3 1OQEA 5LK5A 1YCIA 1AR92 4HETA 2X5IC 2CWMA 1QMJA 3VBOA 5JMCA 1U5IA 4N53A 1JUHA 1HRI2 1ZYBA 1ZBE1 2VNGA 4HVOA 4UW6A 5K8SA 4JRLA 4EN8B 1LCLA 4YG3A 2V09A 1XU2A 1EY2A 2Y0IA 1H1MA 1WD3A 5I8TA 4PQ9A 4DQAA 3FWEA 1A8DA 3M1HA 4YM1A 4KBBA 1LODA 5FLHA 2WA4A 2X8KA 1H8TB 4HN1A 4HMZA 4QQHA 3GF6A 2Q5TA 4YZ2A 4XXAA 5TSWA 1RUE1 2VMHA 3TN91 3QCWA 2MNGA 2D43A 3BU7A 3N35A 3WDWA 1HRV3 2D6KA 3VBRA 1NA1A 5FLJA 1J1LA 3PVBB 4XFBA 1G8WA 4YZ4A 2YYOA 1RMU3 5FOBB 4XJUA 1N47A 5B2GB 2DU1A 3ZN4A 4CP1A 4CEYB 1GV9A 4HVQA 2HJIA 4BHPA 1MQTA 3VZKA 3AP4A 1LGNA 1B35B 2ARXA 2WSVA 2ZGMA 2K0GA 3ASIA 4AWDA 1D4M2 3WINE 4OHWA 3KD4A 2JG9B 1HKDA 1VAVA 2XJUA 2HWD3 4C90A 1ND3B 4NO4A 2VOVA 4XMAA 2F6BA 4AEDC 4RD7A 2DV9A 5JI9A 3CO2A 2RMU1 4KWLA 1Y7BA 4ONUA 4IQPA 5GKAC 2JE9A 4FPFA 2H0BA 4YVWC 1UF2C 3VHNA 4BOWA 4CDWC 2VOWA 1VJ2A 1CGPA 4TLFA 2ZX3A 4JV4A 3MFAA 2GSYA 1C1LA 2XBO3 5DUUA 5CAZA 1OQDA 5CIRA 5HCAA 1S2KA 3HD8B 1GLHA 1HRV2 3M70A 4LO6B 4N7UA 2WSUA 4RQPA 3AM2A 3FFZA 2YV8A 4NN0A 2WNUB 4S2HA 1AXZA 1RMU2 3N4MA 1COV1 1D2SA 4Q4W1 3OPZA 3LKJA 3MICA 2TBVA 5D8AC 2QZ3A 1VP6A 1SACA 2VXRA 3CF6E 3U10A 3O0WA 4WVMB 3MW2A 2WFF1 1ASJ3 4XILA 2HWD2 1JH5A 4JC1A 1KITA 3TBDA 1SLLA 3B7MA 2A3WA 4CEYC 3DF0A 3W58A 1X8EA 5H9RA 2I45A 1PM7A 1ULCA 5DG2A 1XRUA 2OPKA 1R1A3 4OUMA 1AX0A 1ENXA 3GZTB 4XIKA 2N7GA 3CL1A 4YW4A 5A3MA 4LO8A 2LALA 2XBO2 3MGUA 4ZU5A 3PVOA 5GLWA 1VBA3 4AFBA 4JCKA 1RUC3 4KGGA 2VY0A 2A5ZA 1VBB3 4FOWA 1BEV1 4FP2A 5IUQA 3BPZA 1D2QA 4XQ4A 2Z42A 1C5HA 4F7ZA 4D7YA 1CAVB 2BWAA 1KS4A 4Q27A 2GC3A 1IKQA 3VBUA 5BNPB 4K40A 1L3JA 3HT2A 4B8EA 3Q9OA 1ASJ2 1O7FA 1KQRA 5FCCA 5JLVA 3UJQA 1QXPA 2BGCA 1LOEA 1QH7A 2RM21 5FAXA 3UK9A 5JWPA 1CQ9A 2WQZC 3KT1A 4TZDA 2FBEA 4GMP1 4HPKB 1SLCA 1ZBE3 3MIFA 5I0TA 1R1A2 5GLTA 1RUF1 5FBZA 5C6CA 4XJ9A 4Y1UA 2MPFA 4IV3A 5JIAA 4GULA 3G6JB 5JZGA 1VBA2 1ULFA 2Z5WA 3VDDB 1RUC2 3W9AA 2UWAA 2XB6C 3IDCB 4IV1B 3JBG1 3VHRA 1O5LA 1POV0 2ILMA 1O4YA 3KB5A 1VBB2 1V6NA 2QDRA 1NLRA 1OMIA 2PAMA 4DFSA 2WFPA 3B3QE 1PIV1 1PK6B 1RUE3 3O5SA 1PNGA 3M3IA 3TN93 1CAXB 2D6MA 5H9QA 5T50A 4BYYA 4R4XA 5I0RA 3OY8B 4CP2A 3E6DA 1S0GA 2WNVA 3ALQA 3S6PA 1EAH1 1G9CA 1YI7A 3D0JA 1LGBA 2OZ6A 3OF1A 5JI7A 3UJOA 1UAIA 1OFSA 3ZFEB 1CAWB 1H9WA 4QQ2A 4YM3A 1SDWA 2A6ZA 1JN2P 2WLPA 1WUVA 4A3XA 1OA4A 3WG1A 4IEUA 5K0UB 1WD4A 1MS9A 1WW4A 4G3YC 4GH4B 2R0HA 4P9YA 4XEZA 1GZWB 1NE4A 4YG0A 4COWA 1FT9A 4EN6B 3ZFFA 3R6SA 2QNKA 1ZBE2 3NKTA 4MGKE 2RMU3 4N9IA 1UZZA 2YHJA 5KC6A 2ZGUA 4LBOA 1SMVA 2NLRA 1CPNA 1SCSA 2HYKA 3ZXJA 3ZSMA 1HX6A 4KL1A 3K51A 2D5HA 3ZYJB 2XLGA 3OD4A 2JG8C 1OOPA 1LEMA 5FPZA 1RUE2 3IBMA 2ES3A 4XBNA 3TN92 3L9JT 4B7EA 2KXLA 1UPSA 1UZYA 3VHOA 3MIHA 2XH6A 1NCQB 2ZABA 4QXKA 4CTEA 4D69A 5J48A 2XJRA 1A78A 3GNEA 1COV3