1HQLA

The xenograft antigen in complex with the b4 isolectin of griffonia simplicifolia lectin-1
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
236
structure length
236
Chain Sequence
SVSFTFPNFWSDVEDSIIFQGDANTTAGTLQLCKTNQYGTPLQWSAGRALYSDPVQLWDNKTESVASFYTEFTFFLKITGNGPADGLAFFLAPPDSDVKDAGEYLGLFNKSTATQPSKNQVVAVEFDTWTNPNFPEPSYRHIGINVNSIVSVATKRWEDSDIFSGKIATARISYDGSAEILTVVLSYPDGSDYILSHSVDMRQNLPESVRVGISASTGNNQFLTVYILSWRFSSNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords LECTIN
publication title The xenograft antigen bound to Griffonia simplicifolia lectin 1-B(4). X-ray crystal structure of the complex and molecular dynamics characterization of the binding site.
pubmed doi rcsb
total genus 53
structure length 236
sequence length 236
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1hqlA00
3M3OA 1F9KA 1Z78A 3IMNA 1OQ1A 2YV8A 1DQ6A 2ZGRA 4YGEA 2WT1A 2WSUA 4ASMB 3DUIA 4YLZA 2WQZC 3VKLA 1LHOA 1N1TA 2R0FA 1S0FA 4ZKTB 2UWAA 2A3YA 3WLUA 4GALA 4LBNA 1G8WA 1GZ9A 2RHPA 2WLQA 2D6NA 2V5YA 2XB6C 4Y22A 4XTMA 5CBLA 2D6PA 1LGCA 2W68A 3NV3A 4PF5A 1VIWB 4Q26A 2DVFA 1SLBA 1V6MA 1S1AA 2DVGA 3QLQA 4YZ3A 2JECA 2EXIA 2CL2A 1QNYA 2D6LX 3WHUA 4JCKA 1A78A 1BKZA 1N3OA 1RITA 1FV2A 1UN1A 1ONAA 3FFZA 1W6MB 4Y1VA 4Q2FA 4YM3A 2DYCA 3M1HA 1GLHA 4JC1A 1SBFA 1RINA 2XG3A 3POYA 2UWCA 3WV6A 1W6NB 2JDZA 1H9PA 4LBLA 2GMMA 2ZZJA 3OPZA 1LGNA 1NXD1 1LJ7A 3V65A 1X50A 5JVVA 3UJQA 2PHRA 1UMZA 2UURA 4YW4A 3PJQA 1ENRA 2GMEA 2ZGUA 2EALA 1VAVA 2ZAAA 1GBGA 1Q56A 4UW4A 1LODA 4YG3A 2PHXA 1W0PA 3GNEA 1W0OA 4YFZA 5CA6A 3AXDA 3A4UA 5LK5A 4YW2A 4YW5A 1GICA 1SLLA 1W6PB 2DV9A 2JKBA 4XJ9A 3SH4A 3LSDA 4DS0A 1G9DA 1N3QA 1Q8QA 1BXHA 1V6JA 2UU8A 4MYEA 1JXNA 1R1ZA 1YI7A 1V6IA 4F83A 3O5SA 2P2KA 3L2YA 1KJLA 1SLCA 2GNTA 3AJYA 5T50A 3WCSA 2DVAA 4I30A 2DUOA 1LU1A 1Q8OA 1NLSA 4Q1RA 4XBLA 2ZGTA 1Z0HA 4YG0A 1F5FA 1DQ1A 1LU2A 2DVBA 3D5OA 3OJBA 1KDKA 2VU9A 4FPJA 3SH5A 5JDBA 4FP2A 1CJPA 2YMZA 1MZ5A 3PVOA 2PHFA 3B00A 1H9WA 5DG1A 3AJZA 5DZFA 2A6ZA 5T5JA 4FPLA 2DU0A 1QDCA 1QDOA 4DQAA 1V6KA 1V00A 4ISQA 3BOPA 3R05A 2LALA 3FUOA 3NV2A 1JUIA 1DQ4A 2NMNA 4FPGA 2D6OX 3IN9A 3OBTA 5HCAA 1A3KA 5E89A 4NO4A 3BODA 1AXKA 4YFWA 4R9DA 3ZYPA 1IS6A 4BPZA 1DQ2A 1CESA 5T5LA 4TZDA 2YXSA 3AK0A 5IK4A 3ZYRA 1AJKA 2EIGA 5GJ6A 3UK9A 5JLVA 2H0BA 4RL7A 3ZXKA 4AWDA 4BOWA 4AYUA 4BQ1A 4XJ8A 1IS3A 4SLIA 1LOGA 3AFKA 1ZM1A 3POWA 3WDXA 2ZMLA 5DUWA 1N47A 1G9CA 2E51A 4LBKA 3KM5A 3M3EA 2GALA 4FP3A 1I1EA 1LHVA 1WLDA 1VAMA 1WCSA 4BMEA 1G9AA 2WSVA 1QKQA 3ATGA 3U4XA 3OBRA 1DYPA 3A0NA 3N7MA 5GZGA 1Q8SA 1B09A 4Q1PA 3B01A 1DQ5A 1ZA4A 5DZGA 3H0OA 1UPSA 4U2AA 2D3SA 1AXZA 1LENA 4LBOA 4YM1A 3AP4A 2E6VA 4XBNA 2OUHA 2VW0A 3HMYA 1SBDA 2A6YA 3APBA 3M3CA 4XYXA 4P9XA 5CB7A 3WDWA 1MS1A 1XQNA 2EXHA 2KM2A 3IPVA 3WDYA 4FPEA 4GWMA 3R4SA 3WUCA 1S0CA 3B69A 2EAKA 4ATEA 1DZQA 1ENSA 3MEPA 1O4ZA 1CONA 5DG2A 1QMJA 4AVTA 4FOVA 2VUAA 1MS9A 1WUVA 1S0IA 2BQPA 3VKMA 2I2SA 1AZDA 2E7QA 2Z42A 3GALA 5JOZA 3AZVA 2DU1A 5DUUA 5GZEA 4PCRA 1YIFA 3WCRA 1UX6A 4M01A 4YM2A 4FPKA 2ZGNA 5BYNA 2NN8A 4CTEA 1KRIA 2ZHKA 1CN1A 3RS6A 3M2MA 1RIRA 1CR7A 4Y26A 1QU0A 2R1DA 2ZGLA 4R9CA 1VLNA 3SNMA 1MZ6A 1AX2A 2ZGSA 5GZFA 3N36A 4GKXA 1F31A 2PHWA 3AZXA 5T5OA 4XE9A 4H55A 3A0KA 3O0WA 4ISRA 3BIWE 1EPWA 3FLPA 4AGGA 1QNWA 2YZ4A 1GYKA 4YZ5A 1IKPA 2AENA 1IS5A 1Q8PA 1GZCA 1LGBA 1LULA 1LHNA 1OKQA 1G9BA 1AVBA 1AX1A 3N3HA 3SLIA 4YZ1A 5JOXA 2D6KA 1D0HA 1DLLA 1N1VA 3INAA 4GWNA 1ULCA 4XDQA 1JYCA 3T2TA 4FQ4A 2W08A 3V0AB 1PZ9A 2JD4A 3WDVA 1WBLA 1HLCA 4YW3A 4WV8A 4KBBA 2R16A 4FOWA 2PHUA 3AZWA 4RA0A 3ZSJA 1LOCA 1QOOA 5GLWA 3WDUA 2JE7A 5JOWA 4BM8A 1JBCA 4Y1XA 3FUQA 3ZXFA 3WG1A 1WW7A 4XXPA 1LHWA 1AX0A 4XJWA 4Y1YA 2D7FA 1BZWA 3PVNA 5KXDA 2ZKNA 2NZ9A 2TEPA 4XILA 5GALA 2ZGPA 1LOAA 3IPVB 3AP6A 1SCRA 4XHXA 3JU9A 3MPPG 1G9FA 3OYWA 4XMIA 1LTEA 5EWSA 2A6XA 1PZ8A 2DUQA 2NM1A 4BLJA 5KXCA 4HANA 1LOEA 1N1YA 4P9YA 2CNAA 2GN3A 2P37A 1JHNA 2WKKA 4IQPA 1H30A 4LBQD 5GLVA 2ZA9A 1DHKB 2WT0A 3VKFC 1LOFC 1APNA 2G4IA 2GN7A 1WD3A 4P14A 3RMXA 2ARBA 1FNYA 2SLIA 3O0VA 3I4IA 2ZACA 4FQZA 4OZXA 5F5QA 2FHRA 4BMBA 3OY8A 2D43A 4YZ2A 3RMYA 1GZWB 5GZCA 1FYUA 2DTWA 1QGLA 3C2UA 3AYCA 4R9AA 4M3CF 3AYEA 3LSEA 4XHBA 4CZSA 3RRDA 3WZ1A 1WW5A 1BQPA 1G86A 2E7TA 3N7JA 1LCLA 2ZABA 2YROA 4Y20B 3QCWA 1DQ0A 4JRAA 4LBQA 4FOYA 2ERFA 3T1LA 1SLIA 5T54A 1YXWA 1MS4A 1SFYA 4NOTA 4LBMA 2VH9A 5T55A 1OFSA 2AREA 5FRAA 2LTNA 1ENQA 3AP9A 2WT2A 4M00A 4Y1UA 3AP5A 3NV4A 1WLWA 1KJRA 1SBEA 1W6OA 1ULDA 3AYAA 4YGCA 2ZHMA 4YZ4A 3RG0A 3USUA 4AGVA 4Z8BA 2VW1A 3AZYA 1SLTA 2GDFA 5H9PA 1MS0A 1ULEA 4ZXKA 3OGGA 3N7LA 2ES3A 2ZGOA 2ZMKA 2VXRA 1SACA 2SBAA 2W52A 1UAIA 1AXYA 2A71A 1YYNA 2A3WA 2A70A 3D6EA 3JUUA 4YG6A 3ZSMA 2AUYA 2P3JA 4K1ZA 5IK8A 2ZGMA 1CPNA 4XIKA 2AH2A 3O0XA 1BJQA 3W58A 1C1FA 2CWMA 4C1WA 1D2SA 4R9BA 4WVVA 2R1BA 2A75A 1C1LA 4XXAA 1S0BA 1V6OA 2DWRA 2P34A 1N3PA 2V73A 1JW6A 1IKQA 1QF3A 2NYYA 4P9WA 3FLRA 5T5PA 3OYWB 1LESA 3FLTA 2D3RA 2D44A 1TEIA 2EF6A 1LHUA 2CY6A 4GA9A 3TAYA 2A6VA 5JMCA 1GKBA 3WG4A 1MVQA 2W39A 1FV3A 5IUQA 1GZWA 1UKGA 5IK5A 1GANA 5CAZA 3OY8B 2OVUA 1LOFA 1DBNA 1MS8A 2CWSA 4PBOA 4XZPA 3B9CA 3ZSKA 1DGLA 2NMOA 4DFSA 2NP0A 4Q27A 1CIWA 1GSLA 1S0GA 1LECA 1DIWA 3B3QE 1GNZA 2DVDA 2P3IA 4FVVA 2P3KA 5EYYA 4Y20A 2VY0A 1AJOA 3AZZA 3ENRA 4WVWA 5KXBA 1QOSA 4WZFA 2JJ6A 2GNBA 1S0JA 3IM0A 3T1MA 4LBQB 1FATA 5L73A 2C9AA 3WG3A 2OW4A 3ZXEA 4L8QA 1CQ9A 2PHTA 4Q8LA 2A7AA 3SISA 3V0AA 2VW2A 3MW3A 5FREA 5T52A 1IS4A 5IT6A 3ZPYA 5E88A 4UW3A 1W6OB 3USUB 2ENRA 4YGDA 2Q5TA 4W65A 1YRZA 2HYKA 1MS3A 3FBYA 2ZMNA 2B7YA 4YGBA 1HQLA 2ZHLA 3SH3A 4D69A 1MVEA 4AGRA 3ZVXA 4YW1A 5H9QA 1I3HA 4M3CB 2R49A 2CTVA 2A3XA 1A8DA 1J1TA 5AVAA 5DUVA 4ITCA 4M3CE 3ILNA 1V6LA 1DFQA 4XOGA 1ULGA 4XTPA 4XJZA 1W6QA 1UZZA 5EYXA 1JOJA 1JYIA 1WW6A 4FPOB 4XBQA 4FPCA 3UJOA 3N35A 2A5ZA 2D3PA 4FOQA 1KQRA 1ULFA 3VUOA 5HCFA 3AP7A 3R4UA 3WVJA 1GV9A 4GXLA 4XJAA 2CYFA 1HKDA 4PQ9A 4Q8KA 1C57A 4ATFA 2OUJA 3MW2A 3WNXA 5DUXA 1YO8A 3ILFA 4FPHA 5GLZA 3BTAA 1LEDA 3DGTA 4FPYA 2EXJA 2JE9A 4K1YA 3V0BB 3ZXLA 4DRVA 4UW5A 3PVEA 3VKOA 3NWKA 4U36A 5GLUA 1SCSA 1VALA 1S0DA 2AGSA 2ARXA 5H9RA 3CNAA 2DUPA 3KQRA 4XMAA 2YY1A 3UL2A 5KXEA 5E8AA 3N7KA 3AXEA 1O4YA 1WLCA 1HQWA 3RSJA 1MACA 4HL0A 2E53A 5CNAA 4CRQA 5F9TA 1MS5A 4GKYA 3VV1A 1CVNA 4PBPA 4TYSA 1UZYA 2ZHNA 3VKNA 2DURA 4Y22B 4YM0A 1IOAA 3WG2A 2GNMA 5EXOA 2DTYA 4BLIA 5H9SA 1URXA 1GNHA 3HN1A 3NV1A 5GM0A 5GZDA 3RQ0A 5DXDA 3WUDA 1FAYA 4Y1ZA 3W59A 3TB0A 1W6MA 2UWBA 2WNEA 2ZGKA 4FPFA 5SV8A 3IKWA 1Y7BA 4AVSA 3HR9A 4XJUA 1U0AA 1W6NA 1CPMA 2ZGQA 4XIOA 3WDTA 1HDKA 4M3CA 1MR5A 1FNZA 1LOBA 4C1XA 5GLTA 4AVVA 4Y24A 2ZBJA 4K20A 3SITA 1Q8VA 3D4KA 1N1SA 4LBJA 1C4RA 2GMPA 3POSA 1V6NA 3ILRA 3ASIA 4UW6A 2D6MA 1PZ7A 3V64A 3ZXJA 2A6WA 1WD4A 1W6QB 3I8TA 3MW4A 5HCBA 1SLAA 1JN2P 3AX4A 1W6PA 3M3QA 3WHTA 3ZSLA 1WW4A 2AR6A 3Q9OA 1KDMA 1AF9A 3WOGA 1DYKA 2R0HA 1BYHA 1WBFA 2EXKA 2GNDA 4K21A 1UL9A 2WJSA 5DZEA 5IK7A 1KITA 4DRRA 2PELA 2AYHA 3AYDA 1QOTA 5JOYA 3PMEA 2FMDA 4DPNA 3V0BA 1G7YA 1S0EA 3O12A 1LEMA 2C5DA 1FX5A 3LCPA
chains in the Genus database with same CATH superfamily
4ZZ5A 1OQ1A 2ZGRA 1DQ6A 4CDWA 3B02A 5SV5A 2WSUA 4XZUG 3DUIA 4ASMB 2IC1A 5CKQA 2IFWA 1LHOA 3T4VA 3P6BA 2IUWA 1QXPA 2A3YA 4HG6B 3WLUA 4CPBD 5IW0A 4NAOA 5KC6A 2R062 2D6NA 4Y4YA 4Y22A 4QU2A 5CBLA 1KFUL 2W68A 4JHTA 5J98B 1CAUB 1WCDJ 1YQ2A 4AAPA 1NAEA 2D5FA 2YG0A 4EWEA 4ZU7A 1O4TA 3JBG2 1C5HA 3WHUA 3JD71 4JCKA 3S57A 1BKZA 1UN1A 3CMGA 3FFZA 3VBSB 1W6MB 1D4M1 4Q2FA 1XB9A 2FCUA 1AYN1 4Y5SA 3OGRA 1NA1A 1GLHA 5F6LB 5FMDA 1SBFA 3SCFA 3NKGA 3POBA 3POYA 2UWCA 3LA7A 5K0UA 2OZJA 3ES4A 1HN0A 3K46A 4BXFA 4CPBA 2PXJA 1REDA 1XRUA 3PIJA 2CGNA 2ZZJA 4PDWA 1LGNA 3OOXA 1RUD1 1X50A 4QQOA 4LHLA 2MEV3 1K5JA 4RS5A 5HV0A 2UURA 2J1VA 2OQ7A 2R072 3HWJA 4MXWB 4PI2A 2ZGUA 4AI1A 4RQPC 3Q8AA 3URFA 3VDBA 5FQ0B 1MQTC 3NKTA 5IVYA 2W1WA 4DOUA 4YG3A 3RWNA 3KGZA 3TN91 4AFMA 5CA6A 4S2DA 4YW2A 1PO12 4XQWA 1SLLA 2Y6FA 3SH4A 2QQJA 3RJ2X 1G9DA 4QGLA 1Q8QA 1MQTB 2DFCA 4OHWA 2UU8A 1V6JA 5E1RA 1VB2A 3TEWA 2Q30A 2WR9A 4DXSA 4GWIA 1YI7A 4IW3A 1JZ5A 4MV2A 5LA9A 1QJFA 3KT7A 1ZRRA 5C8CA 2GNTA 3DECA 3NSTA 5T50A 4CDWC 1DCSA 2DVAA 4I30A 1IQAA 1NQJA 2WBKA 5JAXA 5I91A 2P1BA 3HQXA 4XBLA 4XF0A 2AZ5A 4FPJA 5FIXA 5FBJA 2CHHA 2UY8A 2VU9A 1J84A 3NJVA 4HK9A 3I3MA 1CJPA 1UZVA 4CDWB 3W5NA 1H9WA 3KSCA 1UX7A 3POEA 1SEFA 2JEMA 4N90A 1R081 5DZFA 2DBIA 4K40A 2DU0A 1QDOA 3H1YA 4OHZA 4QKDA 1GOHA 3NV2A 2Q1FA 2RDQA 4Q0PA 5HCAA 2BYVE 1VB4A 2VMHA 1A3KA 1O8PA 1F5JA 4BJ0A 3ELNA 1VMHA 5L19A 3LFIA 5FZBA 4NHYA 3RJRA 4R9DA 3EMRA 3ZYPA 2GP5A 3MI8A 4CCMA 5K0UC 1FMD2 3E6BA 4NIHA 4BPZA 4D94A 4JKLA 1WMDA 1TG7A 2WFPA 1OT5A 3T0AA 5IK4A 2PHLA 1AJKA 1X33A 3HOBA 5FPZA 5GJ6A 4YNIA 3WF4A 5K0UB 3ZXKA 5LBFA 1NYWA 4HBNA 2ZJCA 4YRDA 4FFIA 4NR1A 1LOGA 3MIDA 1ZM1A 2VBBA 1CD3G 2IXKA 3K75B 3KF3A 3POWA 1VRH2 2EIDA 4NHMA 4PDWB 4UOJA 5FO8B 1W03A 3LKJA 2OS2A 3M3EA 4CSWA 2R6QA 1NUKA 4RS5B 4WBBA 5FY1A 1WLDA 1VAMA 5FJKA 4KU8A 4PIXA 1I5PA 1RXGA 1GZTA 2ZOEB 3OBRA 4XFFA 5LRRA 5E16A 5LWBA 4X6RB 1QQP2 1UZ0A 1V70A 3FX3A 2NQYA 4Q1PA 5DAWA 3BTXA 3SC7X 4U2AA 3RFRA 4LBOA 4HFSA 4Q4W2 2RS51 4MGKE 2E6VA 4QX1A 4ZS3A 4PLNA 3F95A 2NLRA 2WZR1 4Q0UA 2XONA 3I97A 4LQRA 3FZ3A 2YPDA 3PTRB 1QXRA 2HBUA 3M3CA 1VP6A 3WDYA 2KXLA 1W2UA 2R042 1V9U2 3NO8A 5FZ3A 1H2LA 3WUCA 3CJIC 4BQ4A 3PUAA 2PQQA 1CONA 5BNPC 1W8OA 2F4LA 3MYXA 1FI2A 3ST7A 2ARCA 1HRI2 1OFNA 2BNNA 2BQPA 1PGL2 3WNMA 1D2QA 2Z79A 5J3UA 2E7QA 4XFHA 4EZ4A 5BNPB 1UXZA 4CDUA 2DU1A 4OVEA 3KGLA 1MEC1 4JAAA 4PI0A 3H1MA 4PCRA 3U14A 1DGRN 1PO13 2XUMA 2ZEZA 1SG3A 1KXGA 3PMSA 3WCRA 3ZR5A 1JOPA 5FPXA 4HKWA 2VM9A 2ZGNA 3I3EA 5C9AA 3KLSA 1YFWA 5F37A 5DAPA 1CN1A 2VE1A 1HRV2 3ABZA 3IZOA 3MV11 4CCKA 3RZKA 2FCTA 3LEMA 2JD9A 2R1DA 5ACA2 5FYHA 3HBZA 4QPWA 1NG0A 2WNVC 1HJGA 3LEKA 1DG6A 3EXUA 1OH3A 1TE1B 1U5IA 4G4FA 4GB31 4GKXA 3H8OA 4XE9A 4JV4A 4EROA 1HXS3 4I01A 5FWEA 4IL7A 5FZKA 3OUJA 1WA6X 2JDNA 3BIWE 1GQGA 3FLPA 5A32A 1AR71 1ZZ7A 3SQOA 5BUVA 1LHNA 1OKQA 4KU7A 1G9BA 1AX1A 4YZ1A 5JOXA 2Y60A 1UWWA 4YYOA 4GWNA 1N1VA 1AL0G 4AFCA 1ULCA 4KH9A 1JYCA 5JPMB 2W08A 4FFHA 4D6QA 2JD4A 3WDVA 1WBLA 1U12A 1Y43B 1J59A 2PHUA 3TWIA 3IT8A 4EWAA 4KNCA 3K48A 4XXPA 3D3AA 1FMD3 1TQ5A 4XJWA 4CP9B 5KHGA 5IYYA 3FHIB 4NRMA 2QVSB 2JDUA 3K51A 1JUHA 1KFXL 3TNPB 2TEPA 5GALA 2BVBA 1OOPC 5CFDA 4XHXA 4X8NA 2WN3A 5EWSA 4BLJA 4OI2A 2BOJA 1SHWB 1NLQA 1STMA 2CNAA 4LBQD 1H30A 2Y26A 3WF3A 4CDUC 4IE6A 1OOPB 2Y8KA 3E5XA 5L9VA 1LOFC 2HWE2 4QX5A 1UOFA 4P14A 2VZSA 4WM8C 3RMXA 3CZUA 4XFGA 2SLIA 1H1AA 1FOD2 1PX3A 3MPBA 4FQZA 4ZPIA 5D8AA 1POV1 2FHRA 5F5QA 2D97A 2XOMA 4O65A 5GZCA 4JTOA 3ZXGA 4CDUB 2XDVA 3AYCA 4Q4Y2 1QQP3 2EVXA 3RGBA 3LSEA 1JYTA 1F4AA 4XHBA 4JDNA 4ZU4A 4BB3A 3RRDA 1O59A 5FZGA 4AQ2A 3DN7A 2GP3A 2HWB1 1BQPA 1G86A 3N7JA 3KCCA 5LB6A 4IEYA 5J36A 1ZBA2 4QPIC 1ND3A 2ZABA 4IERA 5A3LA 1C8M2 3ZFFC 4LBQA 4URTA 2D5HA 3T1LA 1XYOA 1UYZA 3AMPA 2XQRA 1ZZ8A 4A7YA 2IVJA 5DAVA 1RUG1 1OPOA 4D8MA 2R043 1OFSA 1V9U3 5FUNA 1R092 2LTNA 3DKQA 3AP9A 3ZFFB 1OUSA 4DXZA 2WT2A 2PAMA 3AP5A 4XDPA 2FZ1A 3PU8A 2Y0IA 3USUA 1ULDA 4AGVA 1H8VA 2F6BA 1RMU2 2VVDA 4AFDA 3AZYA 3CEWA 2QTWB 1HRI3 1RXFA 2LRPA 5LEJA 1PMJX 1W2OA 5LA2A 5A3TA 1GQHA 3J8F2 4QT6A 4L11A 1OUXA 1BEV2 1PVC1 2Y0OA 5LATA 1GOGA 3DEMA 3I59B 1X8EA 5DN2A 1YI9A 4YG6A 2AUYA 5G05L 2AH2A 1J3QA 2W92A 4C1WA 1C1FA 1AR62 1HRV3 3FE5A 2A75A 3K3NA 4B8EA 3KV6A 4H7MA 1S0BA 3D0JA 5LASA 4AI0A 4CUGA 4TN7A 3LOBA 4P9WA 2B8MA 3MHZA 3FLRA 5CFDB 4B7EA 4CDXA 4SBVA 2MHFA 1LESA 4OUMA 4A3ZA 3HQRA 4KWJA 1UY4A 4PLOA 1QJY1 4GMP0 1LHUA 5FMOS 4K8RB 1JU3A 3TBDA 5JMCA 2B9VA 1ZBE2 2W9XA 2PLV3 1GZWA 1YFUA 2WLPA 3NMBA 2TUNA 4C8DA 1EY2A 1OSGA 2OVUA 1W2TA 4PBOA 3VBUC 2BERA 4A7KA 1EAH3 4QQPA 3UKVA 1CIWA 5JZGC 1GSLA 3QD6A 5C7GA 2V5DA 1GNZA 2X29A 5FZMA 1S2EA 4QD2A 5EYYA 4DXRA 3AVSA 1AJOA 5F5AA 3ENRA 1OA4A 1PX4A 3VBUB 5HXMA 2JJ6A 2GNBA 3T1MA 4LBQB 2FDIA 3RI9A 4CUCA 2Q0AA 2XVGA 3AKRA 2B45X 2JIGA 4EN0A 4FXKB 4IEQA 2VW2A 5T52A 1AR92 1NXMA 2UYAA 5DDJ1 3ZPYA 5E88A 2JWPA 3KV4A 5J09A 3USUB 2GC3A 1E5RA 3FMGA 4EE2A 1XNBA 5A6YA 2Q5TA 4IV1A 1AYM3 4QX2A 4W65A 3V56A 1YRZA 1UIJA 4P08A 4B4RA 1MS3A 3FBYA 4XVHA 3IDBB 4YGBA 2ZHLA 4C0BA 5F39A 4OHYA 1FOD3 3MZHA 3KHBA 5H9QA 3ZVXA 1I3HA 3ACHA 4Q4Y3 2HWD2 3AKPA 2A3XA 1SQ4A 2BUKA 4HPKA 2FDHA 3U1XA 3BTZA 4LTAA 1QJX3 5M0TA 1JYXA 1W28A 3ILNA 5A6QA 5A1AA 3QACA 1ZBA3 1SFNA 4GH4A 4CVUA 1YFXA 4XOGA 1XYPA 4DIQA 5A3WA 1CZTA 1C8M3 1DP0A 1RJ8A 2Y33A 1W6QA 1UZZA 5E6HA 1JYIA 3E6CC 2RM23 4UBHA 1NE6A 3ZYBA 4YARA 1UOJA 2GC1A 4FPOB 4UBGA 4CDXB 4GJZA 5IVFA 4FPCA 3N35A 1ODMA 2IXJA 2D3PA 5FYMA 1RB8G 3MIEA 1R093 4MVTA 4WVMA 2VZOA 3UKTA 1VBE3 5HCFA 1BMV2 2YHJA 4XJAA 4CEWA 2CYFA 1HKDA 1C57A 4AL9A 3WNXA 2HYXA 4IEOA 4W8JA 5FWJA 5IVEA 1RMU3 4MGSA 4BHPA 3BTAA 5CG9A 3ECQA 3OG2A 2JE9A 4Y4RA 1RUC2 4AW7A 4AI9A 3DPRA 4LO6B 1YCIA 3J8F3 4IUGA 5FZEA 4U36A 1VALA 2AGSA 1BEV3 3U78A 3W20A 4BIFA 5E8AA 4IEZA 1J83A 4LA2A 4QX7A 1WLCA 2VULA 4RHV1 2WA3A 4HL0A 3VZMA 5BNNC 4FAGA 1AR63 1UYPA 2OPWA 4PBPA 4CU9A 2W5FA 2ZHNA 1RUOA 2LW8A 2GNMA 4I2OA 4AHYA 2DTYA 1WZXA 5BNNB 4MHUA 4IV1C 1TNRA 4UYBA 3WUDA 5GZDA 4N7IA 5A7OA 4FAHA 2QUOA 3IKWA 2W0XA 3QBQA 4AVSA 2B5HA 1U0AA 1O3QA 1O5UA 1EPZA 1RUH2 2R061 3LIGA 4HK8A 4CP1A 4IV1B 2PMWB 3VB9A 5FO7B 4CYDA 3TYJA 5C8CB 1IGOA 1RUI2 4COWA 2YUEA 5EJ3A 2RS32 1SZBA 5L9BA 2ZEYA 4GH4C 5GLTA 3JBG1 1HQNA 3D4KA 3MIFA 1JZ4A 1E57A 1BLZA 1SPPA 4HPKB 4L2NA 1WCQA 1HN1A 1NX9A 2VZRA 5FXXA 3POSA 3WNNA 1PO22 4A4AA 3VHPA 1RC6A 4GH4B 3ZXJA 1VBA2 1GFF2 1W6QB 3I8TA 1SLAA 1H4HA 3T08A 4NRQA 4S2HA 4CEWC 3WHTA 4BCUA 2XJVA 3OGVA 2WFF3 2Z2SB 1CZVA 1DYKA 2R0HA 4BH9A 2PN5A 2EXKA 1D4VB 2R071 2VG9A 2YYOA 4WVMB 1AR93 2JENA 5IK7A 4LLFA 4CEWB 1POV0 2PELA 4BXSV 4CXWA 3AYDA 1QWRA 2BW8A 5C70A 3T0BA 4S2GA 1PO11 1W2NA 2C5DA 3BVCA 1FX5A 4W4ZA 4OFGA 1F9KA 3DPRB 3IMNA 4YGEA 1RUE2 4RGAA 3UV9A 4E4HA 4R4ZA 4YLZA 2D98A 2VJXA 2WQZC 4LORA 3VKLA 1N1TA 2HWD3 4WM7A 2YDEA 1LNSA 4AI3A 4ZKTB 4TLGA 5FYYA 4KWKA 3WP6A 1AR83 1TME2 3WNPA 2WA4A 2WS92 2V5YA 2XB6C 5FXWA 3VBOC 4XTMA 4BQ5A 4F8AA 4PF5A 3LE0A 5ABJC 4AHZA 2VTXA 2VR4A 4M4RA 2HWF1 5FR3A 4YZ3A 5A3PA 1CX4A 2JECA 1K5MA 2CL2A 2ZCWA 1WLTA 3AB0A 4XF9A 4YVSC 3VHOA 3THCA 1D0GA 5ABJB 4YM3A 3I2HA 4NHLA 2RDSA 2DYCA 3M1HA 4JC1A 3GJBA 3EYPA 5JR7B 3HNBM 3AMQA 2VCCA 2VQTA 4FT8A 4MX3A 3WF0A 2VD7A 4GD4A 4XF3A 4E8CA 4OMDA 3A23A 5JVVA 3UJQA 2CGPA 4TXWA 2JDKA 3LZZA 1SPPB 4YW4A 5IWFA 2C4XA 2GMEA 3MO4A 5FMBA 2XLGA 2EALA 4LT5A 2HWC3 3ACIA 3NJYA 2RR13 3B93A 4UW4A 1YJKA 1RUJ2 1UPIA 5FZHA 2PHXA 4ONUA 1UY1A 3I49A 4OQ8A 1W0OA 5JI9A 4YFZA 2VMIA 5BV6A 4IEXA 4LO5B 5C3QA 1VRH1 2JKBA 4XJ9A 3P3NA 1WMFA 3VD3A 1N3QA 4NWWA 5JXHA 1BXHA 4ASLA 1JXNA 3IIAA 2GAUA 3E5UA 5CZKA 5ISLA 2BBAA 3WQ7A 5JSPA 2O8QA 3WSOA 4AQTA 1LU1A 1W8WA 5K7PA 3LDBA 4B7KA 3I2OA 3H50A 4JKMA 4YG0A 4JQRA 4WM7C 2D40A 4HVOA 4OI1A 1DQ1A 3SH5A 1K42A 4HETA 1UMHA 1COV1 2MEV2 2VOKA 4CUAA 4O9EA 5JDBA 1WMXA 1ZRIA 2RS33 1MZ5A 1YHFA 4Q4W1 4DY5A 5APAA 3P3PA 4JX0A 2GH8A 5A7QA 3WNKA 4WM7B 2FBEA 5T5JA 3BUCA 2OKXA 4FPLA 4D6RA 2QFEA 1OMIA 3LPGA 1V00A 1K5MC 1Z7S3 3BOPA 2QQUA 2I74A 5LBEA 1CAUA 1VBA3 2NMNA 1V9U1 4ET7A 2XJPA 5FYTA 3LA3A 5E89A 3BODA 4W6YA 4NUBA 1K5MB 1AXKA 3KQ4B 4MADA 4YFWA 3MFAA 3Q8BA 1TMF1 1IS6A 1L3JA 1RL3A 2K46A 2WWJA 4L9BA 3CKHA 4MHRA 4S2FA 4BK5A 1NE4A 4TZDA 3IDEA 2ZZQA 3DL3A 1PGL1 5B4NA 2BWCA 3EJKA 3UK9A 4ZZ8A 4LO4B 4BQ1A 2FCVA 3GHNA 4XJ8A 2Q8DA 1P8JA 3AFKA 1E5SA 3GBWA 3UGHA 2FD8A 1G9CA 1N47A 4ZONA 3W9AA 4LLOA 3KM5A 5I8TA 3OB8A 1RUE3 3HEIA 2GALA 3RDIA 1UU4A 2GU9A 4IDZA 5AVPA 1H4GA 4NIAA 2IFRA 3KV5A 1HRV1 1WCSA 4OI0A 2R30A 2WSVA 1QKQA 3WQ0A 1RJ7A 4QXBA 5ACA1 4C90A 3AKSA 3AMHA 5A80A 1DYPA 2WS93 3A0NA 4RQPA 1Q8SA 5GZGA 1B09A 3I2JA 3B01A 4AAXA 5FZ8A 5J96B 2QDRA 4ARXA 3N9NA 1XNKA 2EIEA 4YM1A 1LENA 3AP4A 4I0WB 4BQWA 2OUHA 2VW0A 4XQ4A 3WP3A 4BYYA 2E31A 2DCKA 3C8XA 3U0ZA 2X53S 3LAGA 4I3GA 4XYXA 1S55A 1MS1A 1XQNA 2KM2A 4FPEA 4HSJA 3MLLA 4CP0A 1QEXA 2BDRA 3MBWA 4FFFA 3VZLA 5AFBA 4DUVA 3HQUA 3LGRA 5C33A 1JH5A 4XUPA 4AVTA 2QNKA 2VGDA 1OA3A 4RFRB 4K3UA 1WUVA 4J25A 3VKMA 3SCHA 2YBSA 3USSA 1U5XA 2I2SA 3GALA 1QJU3 1RUJ3 2VXJA 2ZX4A 4INDA 3OUHA 1B35C 4B1MA 2Z69A 4XFIA 5FZIA 1HB3A 3VGIA 3OCPA 4YM2A 1UIKA 3I2DA 2RS12 4AEKA 2ZHKA 3RS6A 1Q5OA 2HWE1 1B35B 3BYWA 3AC0A 1RIRA 4UFLA 3OPTA 1EV12 3A7QA 1V0AA 1A8MA 1VLNA 2XVLA 3E5QA 2OX0A 3J7HA 1UNBA 1OBNA 4Q4Y1 5T5OA 3GJAA 1F31A 2GSYA 3AZXA 5EFUA 4AOCA 4ISRA 3RI8A 2UY9A 1EPWA 4AGGA 1T2XA 2WNUC 1IKPA 1IS5A 1GZCA 1Q8PA 3FL7A 1PK6C 4LKSA 5EHDA 2DF7A 3S0MA 2BPA2 2D6KA 4XACA 1DLLA 2EICA 4BISA 2QZ2A 5BPXA 3T2TA 4B1LA 2FZ2A 2WNUB 1W3VA 4EYUA 1CAWB 4RQPB 1HLCA 4NWVA 4YW3A 4OULA 1PK6B 4FOWA 3AZWA 5FJHA 1UY2A 2QQOA 5EJ1B 2JE7A 3EB7A 1BK1A 4NIDA 3KCYA 4FBFA 2XHKA 3WG1A 1WW7A 1LHWA 2VO5A 1RMU1 4PT6A 1BZWA 3BCWA 3RPQA 1OF3A 5A7NA 5EZWA 4AQSA 4IETA 2P6CA 4FSJA 2Y6JA 1LOAA 1HXS2 3J8F1 2XQXA 1SCRA 3OYWA 2BGPA 2VCMA 3CU7A 1LTEA 1QJZA 2XJUA 2DUQA 5FZ4A 5F5IA 2WZ8A 3PIGA 2WKKA 3GBFA 1LR5A 4JVAA 5GLVA 2ZA9A 2WABA 2WRAA 1DHKB 3VKFC 1OHFA 4X8PA 1CAXA 3CJIA 3NNMA 4BU2A 3L2HA 2ARBA 5LZ6A 1CIYA 1FNYA 5BNPA 3NQHA 3OY8A 2V09A 2GC0A 4YZ2A 1FYUA 2JB4A 2X8KA 2ZS6B 3C2UA 4IE7A 4QHOA 3AYEA 4YPJA 4QPGA 1DU3D 2J42A 4L99A 4E4DX 4XAEA 3WZ1A 2VVFA 1XOYA 1WW5A 3PJYA 5KWRA 2ZXQA 2J1TA 1LCLA 3PUQA 1LRHA 1O8SA 5C71A 2YROA 4QM8A 3QCWA 1UKRA 1ZBE1 1GP4A 2XKPA 3AFGA 3E6DA 4R4XA 4Y20B 1D7PM 5EJZB 2QJVA 1K45A 2VMDA 1YXWA 4NOTA 5IVCA 2RG4A 3GZEA 2VOWA 1YJLA 1ENQA 1HX6A 2WNVA 4M00A 2RMU3 4ORFA 3LDKA 5C5UA 2W1UA 3K4AA 4LMFA 3AYAA 5FUPA 4YGCA 5A3NA 2QZ3A 2ZHMA 2LM3A 3LEGA 4MGYE 4YZ4A 2ZKLA 4A2UA 1ZRFA 2VW1A 2BFUS 3PL0A 4DMIA 2AACA 5H9PA 1JZ3A 3SKJE 3DYOA 4QGMA 4ZXKA 3OGGA 5JI7A 3I2IA 3NAPC 2ADEA 1IHMA 5LY1A 5HV4A 1SACA 3M3IA 3TRSB 1UAIA 3EO6A 2LROA 3B94A 5FY9A 4Q4V2 2ORXA 1PIV2 2P3JA 2VCAA 4K1ZA 2JDPA 2ZGMA 4CP9A 2ZEXA 3NAPB 5LA1A 2RS13 4E4SA 1VBB2 3H7YA 1RHI1 4P9LA 3IDCB 2ARAA 4WVVA 1ZZ9A 2Z4FA 2ZAHA 1EV13 2DWRA 2C1FA 4LOTA 3DYPA 1N3PA 2V73A 1JW6A 1IKQA 3NL1A 1Q3EA 2KR2A 2C9KA 5FZ6A 1ZX5A 1CZSA 5FP8A 1KS4A 3OYWB 4CDQC 4TSVA 2P4EA 3FLTA 2HWD1 3ON7A 1ULPA 1TEIA 1JI6A 1OOPA 2JX9A 3VLBB 4H7LA 4L0PA 2XMLA 2XJQA 1ND2C 4RN5A 1OQEA 2DFBA 3KCXA 2WWSA 3ZYJB 1CAXB 1W99A 3CJIB 1W9FA 1MVQA 3KB5A 5FFOC 4QPGC 1GU3A 2YC0A 4CDQB 3H1WA 2DCTA 1GANA 5FYVA 3OY8B 4EN8B 1LOFA 2CWSA 3ZSKA 4WM8A 3FC0A 2WO7A 4L92A 2NP0A 4Q0SA 3I54A 4QPGB 1F15A 1HV0A 5JMOA 4DNYA 3VHRA 4OYUA 5F6KA 1DIWA 4WVZA 5KHJA 1BMV1 2DVDA 4QKFA 2P3KA 3MIGA 5AC92 5KXBA 4WVWA 5F3CA 2JXAA 1S0JA 3IM0A 3J7LA 5BXXA 5LK7B 4FO9A 3S6PA 1FATA 5J1XA 1KD7A 1IPSA 5L73A 2RVAA 4QPIA 1RUC1 2AC1A 1GWLA 3ZFFA 4AF9A 1CQ9A 4B4QA 5A1LA 2C6SA 3SISA 2WNVB 1IS4A 1UW8A 4G3YC 4UW3A 2PLV2 4DZGA 5JIUA 4ZY9A 1ST8A 1W9SA 2ENRA 2CGOA 1H1IA 4DEQA 3OD4A 4XETA 3UNPA 2WZEA 1O6UA 2B7YA 1HQLA 4EN6B 1EAH2 1OPMA 4AEJA 1UYXA 3GM8A 3I59A 1DDLA 1R1A1 3C7HA 2R49A 3N4MA 2XL9A 3PNAA 3N9LA 2WQ8A 4QQHA 5AVAA 4AVCA 4MGIE 5FKCA 1JOBA 4ITCA 5IVVA 3PURA 3NNLA 1V6LA 1YWKA 1RUH1 3FWEA 4MOAA 1VPHA 2WC2A 1JZ7A 2KD7A 1RUI1 1JOJA 3ZLIA 1O3RA 2RS31 1WW6A 4P5HA 3UJOA 1AL21 5LCWL 1XNTA 2DCZA 2ZX0A 3CL1A 2BGCA 4Z1VA 3AMNA 1PO21 1AYM2 3WVJA 4LHNA 4DUXA 3BU0A 4ATFA 3MW2A 1VBA1 2XBO3 2R7EB 1YO8A 3ILFA 2VVEA 3U4SA 4CE8A 1UF2C 4WM8B 4GWJA 4ASKA 3PVEA 3VKOA 4P00B 1UYYA 1W3XA 1QJX2 1S0DA 4LEJA 2ADDA 5FPBA 2VMFA 3JB8A 3NW4A 3TEXA 5KXEA 2YY1A 1M4WA 1T6GC 1Y9GA 3IDAA 1VMJA 3AXEA 3JD72 3KMHA 4ZXEA 3VBUA 4Q4V3 1HQWA 1PIV3 4IEUA 4IE4A 2QQMA 5JZGA 1DLCA 2RM22 1XC6A 5F9TA 4GKYA 4QDQA 1VBB3 1Y9MA 1UZYA 4XUQA 2DURA 4YM0A 2QQVA 1RUF3 4QPIB 1NT0A 2X10A 4BIOA 3CJXA 1RUE1 4BLIA 3DCQA 4MGQA 4QX8A 5H9SA 4CU7A 1VBE2 1OA2A 1URXA 5B4XA 1GNHA 3HN1A 3NV1A 3A22A 5GM0A 5DXDA 4ES8A 4Y1ZA 3TB0A 1J3PA 5HPOA 2ZGKA 2JB8A 3S5QA 1W9WA 2RJKA 4LOSA 1TME1 4XJUA 1DGWA 2WS91 3NVCA 4XW3A 4OUSA 4N9IA 4KL1A 1Q43A 1OKOA 4LJHA 1FPN3 2G9ZA 2IXCA 2IXHA 5FZ9A 4BWOA 4NE9A 5FMCA 3TN92 1C3HA 1LOBA 4QU1A 5FY0A 4HVQA 2ZBJA 4RGGA 3SITA 4NIIA 2QCSB 1NQDA 2EAAA 4XDOA 1JYVA 4COZA 5JIAA 2GMPA 3RNSA 3HD8B 3PUSA 4CCOA 4BK4A 5B2GB 4UW6A 3ASIA 3FN9A 3V64A 4C0HA 5AC93 5G04L 4JGZA 3RYKA 5KHKA 4XABA 1H6YA 2O14A 2Y34A 3M3QA 3ZSLA 1KDMA 3LWCA 1BYHA 1WBFA 2BJSA 3P5BA 3MGUA 4MXVA 1BBT3 2WZPP 1ZZ6A 3CDZB 2PQSA 4NJ4A 2WJSA 5DZEA 1X9TA 4F7ZA 2W1SA 5CFCC 3ZN6A 3BIEA 4K9SA 4DPNA 3JQWA 1GMMA 3O12A 1LEMA 1H2NA 1ZA7A 4CEYA 4AEMA 4MSVA 1O3SA 5CVRA 3ZFGA 2WT1A 1GR3A 4QHBA 5A3OA 1W8HA 5CFCB 1MPXA 2E33A 5CYYA 2VECA 2VZUA 2BU9A 1E5HA 2XJRA 4GIQA 5FPVA 2Q8OA 5AFEA 3RZHA 4GALA 5IFPA 1TVGA 2RHPA 5JZGB 3MUY1 2JE8A 3NV3A 2WFF2 4Q26A 2DCJA 4NPRA 2DVFA 2MEV1 4A42A 1NZCA 2A1XA 5FZ0A 5BNNA 4CP2A 1S1AA 3DV8A 3QLQA 4META 3BOWA 1QH7A 4LPLA 1S2KA 1OLMA 2D6LX 5FCCA 1JZ8A 2B46X 1RITA 4IV3C 3ZDVA 3HAGA 5FDBA 2OXBA 4HONA 1RINA 4XUTA 2XG3A 2J1SA 1KS5A 4O7XA 4FTEA 2QQIA 1H9PA 2OZ6A 3K2OA 4WZCA 4LBLA 2K9ZA 2GMMA 5A1FA 4A41A 3VD4A 1NXD1 2Y6GA 5FZOB 3V65A 5J37A 4JGZC 3VBFC 1AR82 2YU1A 4BQYA 3PJQA 4CA9A 1ENRA 4EZHA 4QXHA 3THPA 4CCEA 1VAVA 2ZAAA 2WZR2 3JD73 3T3YA 1GBGA 3RZMA 2CAVA 1LODA 3NJXA 5FP3A 4Q29A 1D4M3 1W8NA 2JICA 3CHXA 4IEVA 1TNFA 2J7MA 2YGLA 3GNEA 3NNGA 4JGZB 4J1XA 1JZ2A 3LA2A 3A4UA 5LK5A 1AUYA 4YW5A 3B5LB 1GICA 1UO9A 2DV9A 2G9GA 1C28A 3LSDA 4YW7A 5JWPA 4LHSA 2JDAA 4V2WA 4MYEA 5LY2A 1UXXX 1GWKA 1R1ZA 2FMYA 1QHDA 1V6IA 4F83A 5IAVA 2P2KA 3L2YA 1OQDA 3BB6A 1KJLA 4CEYC 4ZHNA 4GAZA 5EPAA 3ZFGC 3WCSA 1CX1A 4NN0A 3ZN6B 5IFTA 1Q8OA 1NLSA 3ES1A 3LDRA 1RVF2 1Z0HA 2ZGTA 4GQ7A 4LXLA 5FZAA 1F5FA 2DVBA 3VZNA 1KDKA 3ZMOA 3C7EA 1EUUA 4CEYB 4FP2A 1YUDA 2YMZA 3ZFGB 2VZQA 2PHFA 3TN93 5J7MA 3HVDA 5ANNA 2HWC2 2F17A 5JSOA 2RR12 4QB6A 2IVIB 3B9IA 4EN7B 5J48A 4YVWC 2GC2A 1QDCA 2J1EA 5FTTC 4ISQA 4LE4A 2PAKA 1XNCA 3WP4A 3R05A 3WR0A 4NROA 5HI0A 1XJAA 2LALA 1WKYA 1ZNPA 2WAAA 1Y4WA 2WUHA 3BALA 4FPGA 4BQXA 2D6OX 3IN9A 4JHZA 4P9IA 4YVWB 1OD3A 4NO4A 5I8YA 4V2VA 3TNQA 3VBOA 3ETPA 3O1RA 5ABJA 3FHQA 5I0TA 5FPUA 2W1QA 3GZUC 4UFKA 3TEYA 4PIYA 1CESA 1OVPA 1SMVA 5T5LA 1PMHX 1A34A 5CKNA 1XBFA 2FDFA 2YXSA 3AK0A 3ZYRA 3H9AA 3ZXDA 1ASJ2 1OH4A 2EIGA 4YVSA 1M06G 4LO8A 3IBMA 5FPLA 2ORZA 1F35A 4RL7A 4BOWA 4AYUA 5F3IA 1IS3A 4GMP3 4O9GA 4SLIA 3WF2A 4YWAA 1X8MA 3WDXA 1VMFA 2ZMLA 4UAPA 2Y6HA 3IAPA 2E51A 4HKLA 5CU1A 4N9HA 5DUWA 3WD5A 3O1VA 4FP3A 1I1EA 2VC9A 2P17A 3U37A 1LHVA 1Z7S2 4GULA 3KD4A 2P6HA 2DCYA 3H7JA 3T2QA 4TLFA 1ALYA 4EQVA 2JG8C 3U4XA 3UKNA 3EQEA 1YNAA 5C4WC 3N7MA 1H1MA 1PVXA 3MIHA 2YGMA 1ZA4A 4QPYA 3H0OA 5EQUA 2D3SA 1AXZA 2BNOA 2JG8B 4PHZA 4XBNA 3GCXA 3KWVA 3MUZ1 5I0UA 4D0QA 3FJSA 1ZREA 1SBDA 2A6YA 1PNGA 4HXCA 2EXHA 3VBHC 1W90A 4Q4X2 4JDMA 5LEKA 3NJZA 1S0CA 1YQ5A 1ENSA 1UY3A 3MEPA 1O4ZA 4N8MA 1CJDA 3VBHB 2XJTA 4CUBA 2LS6A 2VUAA 1MS9A 3IIIA 1S0IA 5IJRA 3ZKYA 3JZVA 5FAXA 5FP4A 2WZR3 1VBC2 1AZDA 1RTVA 1W8FA 4I09A 4QXCA 5L9RA 1HXS1 1H8TC 3AZVA 1LKNA 3CIHA 3HPNA 3Q8FA 4IGPA 4XURA 1G6NA 3RWKX 4GJYA 3WNLA 5GZEA 4N7UA 1UX6A 1W06A 3VBOB 3SHRA 5FLJA 3J7MA 1GWMA 4D7TA 4CTEA 3F2ZA 1IG0A 3VBRC 1ODNA 3QOPA 5JCTA 2GH2A 4X6QB 3EHKA 4JKKA 4MGZE 1CR7A 4YVSB 1QU0A 2ZGLA 1NCQC 1SDWA 3JXSA 1JYNA 5F1RA 3SNMA 4CU6A 2VQUA 1F8VA 1AX2A 1VE0A 4AI8A 1RVF3 3VBRB 4OLLA 5C3OA 1FMD1 3O0WA 3B7MA 1NCQB 3KT4A 4ZU5A 5K8SA 2W2IA 4XAAA 2VBDA 1W8ZA 4FFGA 4YZ5A 1LULA 1U5ZA 1LGBA 4J6GA 4LA3A 4A45A 5L36A 1QJU2 4Z82A 1AHSA 1D0HA 1DGRA 2VUJA 3INAA 4XDQA 5FO9B 1PHMA 3ZOIA 5A33B 5LW9A 1W0NA 5A7SA 5EIYB 4WV8A 2Y6KA 4AQ6A 3ZSJA 1QOOA 2WIIB 3WP5A 1WA4A 5JOWA 4BM8A 5JXIA 3ZN5A 4GB33 3RZZA 5D1IA 4JGYC 2VOXA 4LKEA 1QJY2 3W5MA 5D2AA 4AG4A 1IZ3A 2W3JA 2XUEA 2D7FA 2Y38A 3PVNA 4HLTA 1AR73 3O1SA 5KXDA 1QQP1 1UY0A 1ASJ3 2P3YA 2NZ9A 1K12A 2C0ZA 5FLIA 1UOGA 1W2AX 3ZYHA 4HVRA 3ZFEC 1HW5A 1PZ8A 5IVBA 4RR3C 4HANA 1LOEA 3GXUA 2GN3A 2P37A 2ATFA 1JHNA 5FK8A 5F32A 4UT5A 3T2PA 2BOIA 3H42B 3I3DA 2G4IA 2GN7A 1VBB1 3MV01 1WD3A 3HIFA 3N9MA 2MPFA 4E2QA 4UFJA 3O0VA 4R8HA 3I4IA 2ZACA 2R041 3WW1A 2D43A 5FXZA 1YIPA 3MLKA 1QGLA 3POJA 3Q8CA 2WO3A 4KI5M 4PLMA 3OEBA 4R9AA 4Z2WA 2CAUA 2VOTA 4AVBA 5HCHA 4W50A 3ZMNA 1B35A 1HRI1 1JYWA 1PM4A 2RDRA 2WWUA 1NCRC 1DQ0A 4K8FA 5A7WA 5LBCA 1XSQA 2ERFA 5CEHA 2OQ6A 1VAKA 4QQLA 4YSFA 1SLIA 2KA3A 2V4VA 5T54A 2PYTA 1PGW2 1CGPA 1ZRDA 1MS4A 4LBMA 5JR2A 3S5AA 3LFMA 1HV1A 1POV3 4Q4X3 3UESA 1UU6A 4Y1UA 3NNFA 1YQ8A 1ZZBA 3NV4A 1JODA 1SFPA 1WGPA 2JKXA 2V72A 1SBEA 1W6OA 4IESA 4P9JA 3WW3A 4Z8BA 5F7UA 3N9QA 2HWB3 3LF7A 1HB4A 1FT9A 1SLTA 2WYSA 4UF0A 4EV0A 2WNUA 2ZPXA 1MS0A 3MDPA 1ULEA 1CAWA 4M4PA 4PJYA 5F3GA 1VBC3 1O7FA 4E4ZA 1PK6A 3N7LA 3U11A 1WMEA 2Q8EA 1JS9A 2ES3A 2ZGOA 2ZMKA 2K2SA 2VXRA 2SBAA 2W52A 1AXYA 2A3WA 2A71A 2IZWA 1RUG3 2O8OA 3D6EA 2JDYA 3GCWA 3LPFA 5IK8A 4NRPA 5CG8A 2PLV1 3WX5A 1CPNA 3O0XA 5CISA 1BJQA 3W58A 2CWMA 2IXLA 3I3BA 1D2SA 4FI9A 4PQQA 1R64A 1C1LA 1GNYA 4NHXA 5CKMA 1EAH1 1QF3A 2NYYA 5FZ1A 2RMU2 2JIJA 1L7LA 2D44A 4KWUA 4Y33A 1W9YA 2CY6A 2WL1A 3VD7A 5D21A 2A6VA 4NVPA 1LB2A 3ACLA 1GKBA 3WG4A 4LK7A 1C5IA 4RHV2 2YC4A 3IMMA 4O61A 5F2WA 3AL5A 2C26A 2EIBA 3K4DA 5FOBB 2FDKA 4AHXA 3RZLA 4XZPA 1DBNA 1HB1A 1MS8A 3T0DA 2YB7A 1DGLA 3RYPA 2NMOA 1BVVA 4A6OA 3KS7A 1UU5A 2QQNA 2YBPA 4HKOA 4Q27A 4UWDA 3LEIA 4BQ3A 4CXXA 1I6XA 2B4KA 3MLJA 1BK0A 4JQTA 4J1WA 1AYM1 4COVA 3ZYFA 4Y20A 2VY0A 3AZZA 5EP9A 3ZX7A 3BI3A 1QOSA 1FOD1 1QJY3 4CCNA 1NLRA 5A7WB 4LITA 1VBD2 4QKNA 3OPWA 1T6BX 3VBSC 3JCIA 5FYZA 1W04A 2OW4A 3MF6A 3ZXEA 4YW6A 4Q8LA 1QJX1 2A7AA 2ILMA 2WNOA 5FP9A 3MW3A 5IT6A 1A6CA 1IG3A 1ZBA1 2OIIA 2Y64A 3OEAA 4P9GA 3S7IA 4QGNA 3WF1A 1C8M1 3VDCA 1W6OB 3MIBA 2HEYF 3SCGA 2HJIA 4Q5OA 2RM21 4YGDA 5C3RA 3SEPA 4QXKA 5IVJA 2HYKA 2ZX2A 3WNOA 4UF0B 1XNDA 4D69A 5JXGA 4AGRA 5C6CA 1R091 2QE3A 1NY72 3IB3A 4M3CB 4V1PA 1VBE1 2CTVA 4MZUA 1JMUB 3VDDC 1A8DA 2EA7A 3NAPA 5FBZA 5HBAA 5DUVA 2H6BA 2BWAA 1MZEA 2VNGA 2J1RA 3ZM8A 1POQA 2OA2A 5DDJ3 1DFQA 3UGGA 4NMIA 1ULGA 4XTPA 3VDDB 5HXVA 1HIXA 5KC5A 2PFWA 2RE9A 4QWNA 5FY7A 1BEV1 5TSWA 4COYA 5I0RA 1NZIA 1H2MA 3VHNA 2O0OA 4LIVA 4XCAA 4FOQA 1ULFA 5K4LA 3VUOA 4NPMA 1W8UA 3AP7A 1AR61 2E32A 3R4UA 1GV9A 5F3EA 5FYCA 4CDQA 5L7OC 2HBTA 5EV7A 4H2AA 2ZX3A 2IXIA 5DUXA 2YC2A 1ND2A 4CCCA 1O3TA 4UI9L 4K1YA 3V0BB 1X36A 5L7OB 4UW5A 4XQDA 3BPZA 2WYFA 5H9RA 1SCSA 2ARXA 2HWF2 2E9QA 4IXLA 4AR2A 3CNAA 4XMAA 3UL2A 3N7KA 1O4YA 3VZOA 3RSJA 5FUIA 5CNAA 4E2SA 3RZGA 2HH9A 4AK3A 2BZDA 4GMP1 1QJEA 3VV1A 1CVNA 2K0GA 3O7OA 1UZWA 1XYNA 3R4DB 4Y22B 1IOAA 2JDHA 2VOVA 3WG2A 4XUNA 5EXOA 1Y9QA 3AVRA 1EYBA 1NA1C 3AMMA 1RGSA 2HLEA 1ZRCA 3MICA 4I02A 1IPJA 1DZRA 2VZ3A 1FAYA 3RQ0A 2CU5A 3W59A 2PTMA 3POGA 4QKBA 2UWBA 2RJ2A 2VQAA 2XBO2 4FPFA 4AFBA 3HR9A 4QX0A 2CDPA 3BU7A 3BGAA 1NA1B 4PDWC 5DPNA 3VN4A 5A6ZA 1W6NA 2XLAA 1CPMA 2ZGQA 4RHV3 4XIOA 2WFF1 2F4PA 4RS5C 1HDKA 3C7OA 3RYRA 4CCDA 3WW2A 1W05A 1OXCA 2J1AA 1FNZA 1AR91 3HT1A 2W95A 2XR4A 1GP6A 4Y24A 3I2GA 3KVBA 3H3LA 1Q8VA 3UETA 5A7PA 4N43A 1N1SA 4W6WA 5A6XA 4KWLA 4URAA 1V6NA 2UYBA 3AKQA 3ILRA 1GQPA 2D6MA 4FTSA 1PZ7A 1RUF2 4HOOA 4AVAA 2A6WA 3K77A 2C24A 3POIA 5FZLA 5DMYA 1VBD3 4BQ2A 5FYIA 1JN2P 3LQCA 2R063 1W6PA 2I07B 1WW4A 3FBMA 3ZO0B 3HT2A 4UFHA 1COV2 5CIRA 2Y6LA 1AR81 2H0VA 2YBKA 2GNDA 4DO0A 1YFYA 2HEVF 3JBG3 4HMZA 4JRLA 1Y3TA 2AYHA 4I0BA 5C3SA 1FPN2 1YEWA 1ULOA 3PMEA 2FMDA 4GZ9A 3H3UA 2OPKA 1ND2B 4L97A 2MNGA 2J1UA 2QQLA 3LCPA 3M3OA 1Z78A 1KEXA 2YV8A 3GYDA 1YQCA 3O1OA 4RFT0 3U75A 1DZTA 2R0FA 3LIHA 3THTA 1S0FA 2UWAA 5FZCA 1TMF2 4LBNA 3SXWA 1G8WA 1GZ9A 2R073 2WLQA 4D3WA 1QY4A 4MUVA 3JB4C 4XEZA 2VPVA 5BY5A 2D6PA 1RVF1 1LGCA 1XU2A 4LIUA 2X5IA 1VIWB 2HEWF 4Q0QA 4RGKA 1SLBA 4ES9A 1V6MA 1BBT2 4F3JA 2DVGA 3JQXA 2EXIA 1QNYA 3DXUA 2HWC1 1A78A 1N3OA 2RR11 1FV2A 4KG0A 1NOVA 1ONAA 4Y1VA 3CF6E 5FYSA 3WXPA 4MGTA 4LUMA 3ZDSA 3BPSA 2O1QA 2BV4A 1W6NB 3WV6A 4N43C 2JDZA 3W21A 4AE2A 4K6BA 3M7AA 3S30A 2VZ1A 3KV9A 3OPZA 5FYUA 1LJ7A 2XLFA 3LD8A 3PU3A 3DXTA 2PHRA 3SMHA 1UMZA 2HWF3 4N43B 3VL8A 1BCXA 1O5LA 3PLQA 2W94A 2VMEA 3T2OA 1ASJ1 1Q56A 2E26A 2AEZA 2B39A 5LRSA 5FV3A 1W0PA 3AXDA 4G9SB 2ZEWA 3QH7A 3UGFA 1W6PB 4DS0A 4MH0E 1OD5A 3K4ZA 1Z7S1 5FLHA 3GZTB 2HKXA 3PUIA 3O5SA 5LBBA 1SLCA 3AJYA 3VZJA 4QDSA 4A6SA 3PUHA 3LB9A 2DUOA 4Q1RA 2RJLA 3GGLA 4IGQA 1KGYA 5IATA 1LU2A 3OJBA 3D5OA 4H14A 4RYDA 2Z5WA 1BHGA 5FKBA 5FOJB 5CFCA 3PVOA 4PF1A 3B00A 3O1TA 4Z07A 5DG1A 3AJZA 1VRH3 4Z92B 1EP0A 2X5IC 2A6ZA 5I8SA 2XPJA 1UCXA 1D4M2 2W46A 3UYJA 1AYN2 4DQAA 1HB2A 1V6KA 2FQPA 3SEEA 3FUOA 1JUIA 1DQ4A 1H0BA 5C9AC 3ZR6A 2X5IB 3OBTA 4Q4X1 4CXYA 3UT0A 1VRBA 2G1MA 1J1LA 1RUD2 1COV3 4JTNA 5KBFA 1C8NA 5C9AB 2TNFA 1DQ2A 5AC91 2QBXA 2PHDA 4Q4W3 3POFA 3E1F1 1OLME 2QDNA 1VBC1 3M8LA 1XPWA 2H0BA 3J26N 5JLVA 4AWDA 4IV3A 3U07A 2Q4SA 2XVKA 3ORJA 1UQXA 3DKWA 4JZRA 5FZOA 1TZOA 1H2KA 4KG8A 2XKOA 4LBKA 4E2GA 3BKZA 4COUA 5LA0A 2J22A 3KT1A 2BRTA 4BMEA 1G9AA 4OMCA 5A32B 3ATGA 4FCAA 1TMF3 4XFCA 3VBFA 4W6XA 3D0SA 4KGQA 1S4CA 2VUCA 1ZZCA 2BGOA 3C7GA 1DQ5A 5DZGA 3ZIWA 1UPSA 4QQ2A 3S7EA 2FDJA 2YU2A 4LKFA 2BTVC 3DYMA 4E9KA 4QB2A 1R082 2Q8CA 3HMYA 5CFDC 1QJU1 1RUJ1 1XE0A 1W39A 2QQKA 4FXGB 5FZDA 3IWZA 3PTYA 3O1UA 3APBA 1GP5A 3OD0A 4P9XA 5CB7A 5JXJA 3WDWA 2RDNA 3IPVA 4OCTA 4GWMA 2JG9A 2XJSA 2VUDA 3R4SA 1E5IA 5ACA3 4MO3M 3CQOA 3VD9A 3B69A 1ENXA 2EAKA 4ATEA 1DZQA 1CAVA 3I2FA 3WQ1A 3NNJA 5DG2A 1QMJA 1WCKA 2GZWA 5D8AC 2VZVA 3ME2A 4FOVA 1O91A 4M0NA 2IWGB 3ZYGA 2CSGA 3G6JB 2W87A 2Z42A 2L9LA 3PVBB 4HZFA 3R6SA 5JOZA 4OI4A 2A73B 5D8AB 4YVWA 4IE5A 5FY8A 5JSRA 3NRUA 5DUUA 2RV9A 1YIFA 2QQWA 4M01A 4OQ9A 1ND3C 3K3OA 4FPKA 4OHXA 2TBVA 4A7ZA 2NN8A 1OVSA 5BYNA 1KRIA 3OBZA 4HT1T 4XC9A 3VZKA 5C8WA 3M2MA 1U5YA 5IHRA 1J3RA 3O1PA 2XGXA 1ND3B 4QAWA 4Y26A 4R9CA 4UFMA 4IV3B 1ZVFA 1MZ6A 4D7SA 5GZFA 2BFUL 2ZGSA 4BDVB 3N36A 2PHWA 5KHIA 4IEPA 4DXTA 2AEYA 4H55A 3A0KA 3OBAA 5FP7A 2RS52 3H8XA 1QNWA 2YZ4A 1GYKA 4I0AA 2W47A 2AENA 1REFA 4KMQA 1AVBA 3N3HA 5FZFA 3HNYM 4QM9A 3SLIA 5CADA 1AYN3 3PDQA 3VBFB 1UMIA 3KZ4C 2HWE3 1RHI2 1GOFA 3H3ZA 4XPVA 4XF1A 4FQ4A 3ZIXA 1PGW1 4TTGA 1PZ9A 3ETQA 3N9PA 1MZFA 3OGJA 4KBBA 2R16A 2JG8A 1QIQA 2ZTNA 3CBNA 3CZJA 4RA0A 1LOCA 3WDUA 5GLWA 4RSUA 5DAXA 4FTBA 1US2A 3AL6A 1JBCA 3CLPA 3M70A 4I3PA 1ACCA 1RUD3 4Y1XA 3FUQA 5C4WA 1YC61 3G7DA 3ZXFA 1OI6A 4D7YA 2JG9C 1AX0A 4Y1YA 5C5TA 4AFAA 2V4AA 1WCUA 4CDXC 4B29A 1OC1A 4DY3A 2ZKNA 3E97A 4XILA 2ZGPA 4OZOA 3GBGA 3IPVB 3AP6A 2JG9B 2G19A 3JU9A 3MPPG 1G9FA 4QX3A 4XMIA 1MEC2 2A6XA 4NIGA 5KXCA 2NM1A 1VR3A 2YFZA 3M4FA 1N1YA 4P9YA 4IQPA 4XUOA 1CAVB 3VBHA 3HN3A 3H8RA 1I5ZA 1WWYA 3ACFA 3HNMA 2WT0A 3VL9A 1US3A 1APNA 2YPJA 3KF5A 4XF4A 1YLLA 1XE7A 3HBKA 4Y3OA 1F2NA 4BMBA 1DF0A 2W91A 4OZXA 3WY6A 3BN6A 3RMYA 1GZWB 2VMGA 2DTWA 4E8DA 4Z2AA 3AM2A 2RMU1 3MF9A 1LAJA 4M3CF 4GB32 3ZSEA 5BNOA 3ZN4A 4CZSA 2XH6A 4LHKA 1S2BA 1H8TA 4A44A 2P5BA 4LUKA 4XFBA 2E7TA 1AR72 3WW4A 3SKVA 2B42B 2BVVA 3VDAA 1R083 4JRAA 4AI2A 4FOYA 1I9RA 4XFAA 4KGGA 3GDBA 4LNVA 3VBRA 3GZAA 1OLQA 1JTZX 1SFYA 1XE8A 2VH9A 5T55A 2AREA 5FRAA 1NCQA 1R1A2 2RS11 4QHZA 3P1IA 2DBNA 3U10A 1WLWA 5C8CC 1UD1A 2NPIA 3RZJA 1HJFA 1KJRA 1XNAA 3RG0A 1EV11 2X09A 2VNOA 3KVAA 5C3PA 3CO2A 4E27A 4AEDA 1VBD1 4HN0A 1IPKA 2GDFA 4H3WA 1H6XA 4OHVA 2QKDA 5A33A 2VTXJ 2ETEA 1JZ6A 1ZBE3 4Q0VA 4LO7A 4IE0A 3THDA 4EN9B 2BEOA 1X9PA 5KR7A 5I0DA 5GKAC 1YYNA 2A70A 1AL22 1XU1A 3JUUA 5C4WB 3ZSMA 2VAUA 1PMIA 4Y5Z0 1NKGA 4XIKA 1DYOA 2WINB 3N9OA 1QXJA 3D82A 5T3NA 2VZPA 2WQ4A 4R9BA 4K7JA 2R1BA 5FYBA 5A70A 4P5YA 4XXAA 1V6OA 4JGYA 2P34A 3WQBA 3OSDA 3OF1A 5FY4A 5T5PA 3J7NA 1NY71 2E7AA 4IGOA 3TEZA 4MLOA 2Q1MA 2D3RA 2VQ0A 3ZPOA 2EF6A 2WO1A 2ET7A 5A3MA 2HWB2 4GA9A 3TAYA 3ZFEA 2RS53 4EJRA 3GHMA 4RR3A 3KHCA 5BNOC 2VTFA 3DPRC 4LK6A 5I93A 2W39A 4KQ7A 1FV3A 2LUWA 5IUQA 4NHKA 1UKGA 5IK5A 4N53A 3WINE 5CAZA 1RHI3 4HN1A 4B4PA 5DABA 3B9CA 5JPNB 1OLRA 4DFSA 1RUG2 3O1MA 5BNOB 3TOJA 2R32A 1JU4A 2E63A 3R0RA 1S0GA 1H8TB 1LECA 2ZX1A 3B3QE 4FVVA 2P3IA 4KBZA 2PAEA 2I45A 3ITQA 3OTFA 1RUNA 4WZFA 3ZXAC 5A3UA 4DINB 2BNMA 5F2SA 4CCJA 2WN2A 2C9AA 3WG3A 4LKDA 4CU8A 1NCRA 2VBPA 4L8QA 2PHTA 1PVC2 2Q1ZB 4AEDC 3ALQA 3V0AA 1MEC3 3QH6A 1CWPA 5FREA 2BP6A 2XWBB 2JDMA 3C3VA 2D93A 3J9SA 5K9YA 3I3QA 4ARYA 4AHWA 1PGSA 4AEDB 1DGWX 2VNRA 1L7QA 3Q8EA 2ZMNA 3SH3A 1MVEA 5FZ7A 2G9FA 5IAXA 4YW1A 4TWTA 4NAMA 4NPLA 4BZ4A 1RUC3 1J1TA 3FFQA 1PNFA 4DEVA 3VD5A 4UFIA 5BNQA 2XBO1 5DQ0A 1XSRA 2WDBA 4M3CE 4RD7A 5FMOL 5FK7A 4D6SA 2QQPA 1J58A 4CCLA 4XJZA 4C91A 2YFUA 3GF6A 3T4HB 5I0SA 4JGYB 5EYXA 2XHNA 5FPAA 1EUTA 4QB1A 4XBQA 3X29B 3DF0A 2A5ZA 4AZZA 4Q4V1 1PIV1 2XL7A 1KQRA 1ZYBA 1R1A3 4N53C 1W8TA 2ID4A 2OT7A 4GXLA 4LULA 3ZFEB 3L9JT 4PQ9A 4DB5A 2DDUA 4Q8KA 2FDGA 4RR3B 2OUJA 1OURA 1RUF1 3J4UH 3IAQA 3T30A 3O14A 4C1XA 1OF4A 4M0HA 3I2KA 4FPHA 4ZS2A 3C7FA 5GLZA 2WO2A 1LEDA 1RUH3 3DGTA 4FPYA 4N53B 2EXJA 3ZKUA 2CV6A 2VL4A 3ZXLA 4DRVA 1REEA 2BBVA 3NWKA 1RUI3 1IQDC 5KHHA 5GLUA 2PA7A 5DAQA 3WEZA 4MG2A 2DUPA 3KQRA 5DDJ2 1VJ2A 3HJRA 3AKTA 1PM7A 1AL23 4Y5TA 1YQ6A 1MACA 2XWJB 1FPN1 2E53A 4CRQA 1MS5A 3RVHA 1PO23 4OUEA 4TYSA 3VKNA 3ZYIB 2VMCA 1NCRB 3T09A 1UOBA 5F5CA 3BTYA 3V0AB 2VCBA 3VBSA 4AXOA 5JUVA 4BA6A 3FHAA 1W6MA 1BVP1 4P02B 2WNEA 5ERLA 5F8PA 2H6CA 5SV8A 1JHJA 1Y7BA 4EWDA 2VNVA 3OUIA 2OYZA 1K3IA 4QMAA 2CDOA 3WDTA 4M3CA 1X7NA 1BBT1 4PIZA 2X05A 5FXVA 1MR5A 4LE3A 4AVVA 1L7RA 1SDDB 3EBRA 4JDOA 4K20A 3ACGA 4LBJA 3OGSA 4MXWA 1C4RA 2WAOA 4IEWA 2XXZA 3D8CA 5FQ0A 3VDDA 4B3NA 2B9UA 1WD4A 2ET1A 3MW4A 5HCBA 3I7DA 4A3XA 1TME3 3AX4A 4XCBA 1GUIA 2VZTA 1X82A 2AR6A 3Q9OA 3WOGA 1AF9A 4R52A 1MQTA 1FXZA 1XXNA 1PVC3 1QH6A 3A21A 3ROUA 4K21A 1UL9A 1W9TA 3PHMA 4UXAA 5ANQA 4BE3A 1KITA 4QDRA 4DRRA 1RYYA 4HSLA 5FY5A 1QOTA 5JOYA 3WT3A 4DUWA 2N7GA 1F4HA 3V0BA 1G7YA 1S0EA 3MFCA 3H8UA 4LR4A 5L7OA 3LOIA
chains in the Genus database with same CATH topology
1OQ1A 2ZGRA 1DQ6A 4CDWA 3B02A 5SV5A 2WSUA 4ASMB 3DUIA 2IC1A 2IFWA 1LHOA 1QXPA 2A3YA 3WLUA 5KC6A 2R062 2D6NA 4Y4YA 4Y22A 4QU2A 5CBLA 1KFUL 2W68A 5J98B 1CAUB 1WCDJ 2D5FA 4EWEA 4ZU7A 1O4TA 3JBG2 1C5HA 3WHUA 3JD71 4JCKA 1BKZA 1UN1A 3FFZA 3VBSB 1W6MB 1D4M1 4Q2FA 1AYN1 1NA1A 1GLHA 5F6LB 1SBFA 3SCFA 3NKGA 3POYA 2UWCA 3LA7A 5K0UA 2OZJA 3ES4A 1REDA 1XRUA 2CGNA 2ZZJA 4PDWA 1LGNA 1RUD1 1X50A 4QQOA 4LHLA 2MEV3 4RS5A 2UURA 2R072 3HWJA 4MXWB 2ZGUA 4AI1A 4RQPC 3URFA 5FQ0B 1MQTC 3NKTA 4DOUA 4YG3A 3RWNA 3KGZA 3TN91 4AFMA 5CA6A 4S2DA 4YW2A 1PO12 4XQWA 1SLLA 3SH4A 1G9DA 3RJ2X 4QGLA 1Q8QA 1MQTB 2DFCA 4OHWA 2UU8A 1V6JA 5E1RA 1VB2A 2Q30A 1YI7A 4MV2A 3KT7A 1ZRRA 2GNTA 3NSTA 5T50A 4CDWC 2DVAA 4I30A 1IQAA 1NQJA 5JAXA 5I91A 3HQXA 4XBLA 4XF0A 2AZ5A 4FPJA 2UY8A 2VU9A 4HK9A 1CJPA 4CDWB 1H9WA 3KSCA 1SEFA 2JEMA 4N90A 1R081 5DZFA 4K40A 2DU0A 1QDOA 3H1YA 4OHZA 3NV2A 5HCAA 4Q0PA 2BYVE 1VB4A 2VMHA 1A3KA 5L19A 1F5JA 3ELNA 3RJRA 5K0UC 4R9DA 3ZYPA 3MI8A 1FMD2 3E6BA 4BPZA 4D94A 1WMDA 2WFPA 5IK4A 2PHLA 1AJKA 1X33A 5FPZA 5GJ6A 4YNIA 5K0UB 3ZXKA 1NYWA 4HBNA 2ZJCA 4YRDA 4NR1A 1LOGA 3MIDA 1ZM1A 3POWA 1CD3G 2IXKA 5FO8B 1VRH2 4PDWB 4NHMA 3LKJA 3M3EA 2R6QA 4RS5B 4WBBA 1WLDA 1VAMA 4KU8A 4PIXA 2ZOEB 3OBRA 4XFFA 5LRRA 5E16A 4X6RB 1QQP2 1V70A 3FX3A 2NQYA 4Q1PA 4U2AA 4LBOA 4HFSA 4Q4W2 2RS51 4MGKE 2E6VA 4PLNA 2NLRA 2WZR1 4Q0UA 3FZ3A 1QXRA 3M3CA 1VP6A 3WDYA 2KXLA 1W2UA 2R042 1V9U2 3NO8A 1H2LA 3WUCA 3CJIC 2PQQA 1CONA 5BNPC 3MYXA 1FI2A 3ST7A 1HRI2 1OFNA 2BNNA 2BQPA 1PGL2 1D2QA 2Z79A 5J3UA 2E7QA 4XFHA 5BNPB 4CDUA 2DU1A 4OVEA 3KGLA 1MEC1 4JAAA 3H1MA 4PCRA 3WCRA 1DGRN 1PO13 2XUMA 3PMSA 1KXGA 5FPXA 4HKWA 2ZGNA 5C9AA 3KLSA 1YFWA 1CN1A 1HRV2 2R1DA 5ACA2 3HBZA 1NG0A 2WNVC 1DG6A 3EXUA 1TE1B 1U5IA 4G4FA 4GB31 4GKXA 4XE9A 4JV4A 1HXS3 4I01A 4IL7A 3BIWE 1GQGA 3FLPA 5A32A 1AR71 1ZZ7A 5BUVA 1LHNA 1OKQA 4KU7A 1G9BA 1AX1A 4YZ1A 5JOXA 4YYOA 4GWNA 1N1VA 1AL0G 4AFCA 1ULCA 4KH9A 1JYCA 2W08A 2JD4A 3WDVA 1WBLA 1U12A 1Y43B 1J59A 2PHUA 3TWIA 3IT8A 4EWAA 4KNCA 3K48A 4XXPA 1FMD3 1TQ5A 4XJWA 5KHGA 3FHIB 2QVSB 3K51A 1JUHA 1KFXL 3TNPB 2TEPA 5GALA 2BVBA 1OOPC 5CFDA 4XHXA 4X8NA 5EWSA 4BLJA 4OI2A 2CNAA 4LBQD 1H30A 2Y26A 4CDUC 1OOPB 3E5XA 1LOFC 2HWE2 4QX5A 4WM8C 4P14A 3RMXA 4XFGA 2SLIA 1H1AA 1FOD2 3MPBA 5D8AA 4FQZA 5JPMB 5F5QA 1POV1 2FHRA 5GZCA 2D97A 4JTOA 3ZXGA 4CDUB 3AYCA 4Q4Y2 1QQP3 2EVXA 3LSEA 4XHBA 4ZU4A 4JDNA 3RRDA 4AQ2A 3DN7A 2HWB1 1BQPA 1G86A 3N7JA 3KCCA 5J36A 4IEYA 1ZBA2 4QPIC 1ND3A 2ZABA 4IERA 5A3LA 1C8M2 3ZFFC 4LBQA 4URTA 2D5HA 3T1LA 1XYOA 3AMPA 4A7YA 1ZZ8A 1RUG1 1OPOA 2R043 1OFSA 1V9U3 4DXZA 1R092 2LTNA 3ZFFB 3AP9A 2WT2A 2PAMA 3AP5A 2FZ1A 2Y0IA 3USUA 1ULDA 4AGVA 1H8VA 2F6BA 1RMU2 2VVDA 4AFDA 3AZYA 3CEWA 1HRI3 5LEJA 1GQHA 3J8F2 4QT6A 4L11A 1BEV2 1PVC1 2Y0OA 3I59B 1X8EA 1YI9A 4YG6A 2AUYA 2AH2A 1J3QA 4C1WA 1C1FA 1AR62 1HRV3 3FE5A 2A75A 4B8EA 4H7MA 1S0BA 3D0JA 4AI0A 3LOBA 4P9WA 2B8MA 3FLRA 5CFDB 4B7EA 4CDXA 4SBVA 2MHFA 1LESA 4OUMA 4KWJA 4PLOA 1QJY1 4GMP0 1LHUA 5FMOS 3TBDA 5JMCA 1ZBE2 2PLV3 1GZWA 1YFUA 2WLPA 2TUNA 1EY2A 1OSGA 2OVUA 4PBOA 3VBUC 4A7KA 1EAH3 4QQPA 3UKVA 1CIWA 5JZGC 1GSLA 3QD6A 1GNZA 2X29A 4QD2A 5EYYA 1AJOA 3ENRA 1OA4A 3VBUB 2JJ6A 2GNBA 3T1MA 4LBQB 3RI9A 2Q0AA 2XVGA 3AKRA 2B45X 4EN0A 4FXKB 4IEQA 2VW2A 5T52A 1AR92 1NXMA 2UYAA 5DDJ1 3ZPYA 5E88A 5J09A 3USUB 2GC3A 3FMGA 1XNBA 2Q5TA 4IV1A 1AYM3 4W65A 3V56A 4B4RA 1YRZA 1UIJA 5C8CA 1ZRCA 1MS3A 3FBYA 4C0BA 3IDBB 4YGBA 2ZHLA 4OHYA 1FOD3 3MZHA 3ZVXA 5H9QA 1I3HA 4Q4Y3 2HWD2 3AKPA 2A3XA 1SQ4A 2BUKA 4HPKA 4LTAA 1QJX3 3ILNA 3QACA 1ZBA3 1SFNA 4GH4A 1YFXA 4XOGA 1XYPA 1C8M3 1RJ8A 1W6QA 1UZZA 1JYIA 3E6CC 2RM23 4UBHA 1NE6A 4YARA 2GC1A 4FPOB 4UBGA 4CDXB 4FPCA 3N35A 2IXJA 2D3PA 1RB8G 3MIEA 1R093 4MVTA 4WVMA 3UKTA 1VBE3 5HCFA 1BMV2 2YHJA 4XJAA 4CEWA 2CYFA 1HKDA 1C57A 3WNXA 4IEOA 1RMU3 4BHPA 3BTAA 5CG9A 3ECQA 2JE9A 4AW7A 1RUC2 3DPRA 4LO6B 1YCIA 3J8F3 4U36A 1VALA 2AGSA 1BEV3 4BIFA 5E8AA 4IEZA 4LA2A 1WLCA 2VULA 4RHV1 2WA3A 4HL0A 3VZMA 5BNNC 4FAGA 1AR63 4PBPA 2ZHNA 1RUOA 2GNMA 4I2OA 4AHYA 2DTYA 5BNNB 4IV1C 1TNRA 3WUDA 5GZDA 4N7IA 4FAHA 2QUOA 3IKWA 2W0XA 3QBQA 4AVSA 2B5HA 1U0AA 1O3QA 1O5UA 1EPZA 1RUH2 2R061 4HK8A 4CP1A 4IV1B 5FO7B 4CYDA 3TYJA 5C8CB 1IGOA 1RUI2 4COWA 2YUEA 5EJ3A 2RS32 4GH4C 5GLTA 3JBG1 1HQNA 3D4KA 3MIFA 1E57A 4HPKB 4L2NA 3POSA 1PO22 3VHPA 1RC6A 4GH4B 3ZXJA 1VBA2 1GFF2 1W6QB 3I8TA 1SLAA 1H4HA 4S2HA 4CEWC 3WHTA 4BCUA 2XJVA 2WFF3 2Z2SB 1DYKA 2R0HA 4BH9A 2PN5A 2EXKA 1D4VB 2R071 2VG9A 2YYOA 4WVMB 1AR93 2JENA 5IK7A 4LLFA 4CEWB 1POV0 2PELA 3AYDA 1QWRA 2BW8A 4S2GA 1PO11 2C5DA 1FX5A 4OFGA 1F9KA 3DPRB 3IMNA 4YGEA 1RUE2 4RGAA 3UV9A 4R4ZA 4YLZA 2D98A 2WQZC 3VKLA 1N1TA 2HWD3 4WM7A 2YDEA 4AI3A 4ZKTB 4KWKA 3WP6A 1AR83 1TME2 2WA4A 2WS92 2V5YA 2XB6C 3VBOC 4XTMA 4F8AA 4PF5A 5ABJC 4AHZA 2HWF1 4YZ3A 1CX4A 2JECA 1K5MA 2CL2A 2ZCWA 1WLTA 3AB0A 4XF9A 4YVSC 3VHOA 1D0GA 5ABJB 4YM3A 4NHLA 2DYCA 3M1HA 4JC1A 5JR7B 3AMQA 4FT8A 4MX3A 4XF3A 5JVVA 3UJQA 2CGPA 3LZZA 4YW4A 2GMEA 2XLGA 2EALA 4LT5A 2HWC3 2RR13 3B93A 4UW4A 1YJKA 1RUJ2 1UPIA 2PHXA 4ONUA 1W0OA 5JI9A 4YFZA 2VMIA 5BV6A 4IEXA 4LO5B 1VRH1 2JKBA 4XJ9A 3P3NA 1WMFA 1N3QA 4NWWA 1BXHA 4ASLA 1JXNA 3IIAA 2GAUA 3E5UA 3WQ7A 5JSPA 2O8QA 4AQTA 1LU1A 5K7PA 4B7KA 3H50A 4YG0A 4JQRA 4WM7C 2D40A 4HVOA 4OI1A 1DQ1A 3SH5A 4HETA 5JDBA 1COV1 2MEV2 2VOKA 4O9EA 2RS33 1MZ5A 1YHFA 4Q4W1 4DY5A 3P3PA 2GH8A 4WM7B 2FBEA 5T5JA 4FPLA 2QFEA 1OMIA 1V00A 1K5MC 1Z7S3 3BOPA 2I74A 1CAUA 1VBA3 2NMNA 1V9U1 2XJPA 3LA3A 5E89A 3BODA 4W6YA 1K5MB 1AXKA 4YFWA 3MFAA 1TMF1 1IS6A 1L3JA 1RL3A 4L9BA 4S2FA 4TZDA 1NE4A 3IDEA 2ZZQA 3DL3A 1PGL1 2BWCA 3EJKA 3UK9A 4LO4B 4BQ1A 3GHNA 4XJ8A 3AFKA 3GBWA 1G9CA 1N47A 3W9AA 4LLOA 3KM5A 5I8TA 1RUE3 2GALA 3RDIA 1UU4A 2GU9A 5AVPA 1H4GA 4OI0A 2IFRA 1HRV1 1WCSA 2R30A 2WSVA 1QKQA 3WQ0A 1RJ7A 5ACA1 4C90A 3AKSA 3AMHA 1DYPA 2WS93 3A0NA 4RQPA 1Q8SA 5GZGA 1B09A 3B01A 5J96B 2QDRA 1XNKA 4YM1A 1LENA 3AP4A 4I0WB 2OUHA 2VW0A 4XQ4A 3WP3A 4BYYA 2DCKA 3U0ZA 2X53S 3LAGA 4I3GA 4XYXA 1S55A 1MS1A 1XQNA 2KM2A 4FPEA 4HSJA 3MLLA 4CP0A 3VZLA 5AFBA 3LGRA 5C33A 1JH5A 4AVTA 2QNKA 2VGDA 1OA3A 4K3UA 1WUVA 3VKMA 3SCHA 3USSA 1U5XA 2I2SA 3GALA 1QJU3 1RUJ3 2ZX4A 4INDA 1B35C 2Z69A 4XFIA 3VGIA 3OCPA 4YM2A 1UIKA 3I2DA 2RS12 4AEKA 2ZHKA 3RS6A 1Q5OA 2HWE1 1B35B 1RIRA 1EV12 1A8MA 1VLNA 2XVLA 3E5QA 4Q4Y1 5T5OA 1F31A 2GSYA 3AZXA 5EFUA 4ISRA 3RI8A 2UY9A 1EPWA 4AGGA 2WNUC 1IKPA 1IS5A 1GZCA 1Q8PA 1PK6C 2DF7A 3S0MA 2BPA2 2D6KA 1DLLA 2QZ2A 5BPXA 3T2TA 2FZ2A 2WNUB 1CAWB 4RQPB 1HLCA 4NWVA 4YW3A 4OULA 1PK6B 4FOWA 3AZWA 2JE7A 1BK1A 3KCYA 4FBFA 2XHKA 3WG1A 1WW7A 1LHWA 1RMU1 1BZWA 3BCWA 3RPQA 5EZWA 4AQSA 4IETA 4FSJA 1LOAA 1HXS2 3J8F1 1SCRA 3OYWA 3CU7A 1LTEA 1QJZA 2XJUA 2DUQA 2WKKA 3GBFA 1LR5A 4JVAA 5GLVA 2ZA9A 1DHKB 3VKFC 1OHFA 4X8PA 1CAXA 3CJIA 3L2HA 2ARBA 1FNYA 5BNPA 3OY8A 2V09A 2GC0A 4YZ2A 1FYUA 3C2UA 2X8KA 2ZS6B 3AYEA 4QPGA 1DU3D 4L99A 4E4DX 3WZ1A 2VVFA 5KWRA 1WW5A 3PJYA 1LCLA 1LRHA 2YROA 4QM8A 3QCWA 1UKRA 1ZBE1 2XKPA 3AFGA 3E6DA 4R4XA 4Y20B 2QJVA 1YXWA 4NOTA 2VOWA 1YJLA 1ENQA 1HX6A 2WNVA 4M00A 2RMU3 4ORFA 3AYAA 5KHJA 4YGCA 2QZ3A 2ZHMA 2LM3A 4YZ4A 4MGYE 4A2UA 2ZKLA 1ZRFA 2VW1A 2BFUS 4DMIA 5H9PA 4QGMA 4ZXKA 3OGGA 5JI7A 3NAPC 1IHMA 1SACA 3M3IA 3TRSB 1UAIA 3EO6A 3B94A 4Q4V2 4EROA 1PIV2 2P3JA 4K1ZA 2ZGMA 3NAPB 2RS13 4E4SA 1VBB2 3H7YA 1RHI1 4P9LA 3IDCB 4WVVA 1ZZ9A 2ZAHA 1EV13 2DWRA 2C1FA 1N3PA 2V73A 1JW6A 1IKQA 3NL1A 1Q3EA 1ZX5A 1KS4A 3OYWB 4CDQC 4TSVA 3FLTA 2HWD1 1TEIA 1OOPA 2JX9A 3VLBB 4H7LA 2XJQA 1ND2C 1OQEA 2DFBA 3KCXA 2WWSA 3ZYJB 1CAXB 3CJIB 4CDQB 5FFOC 1MVQA 3KB5A 4QPGC 2YC0A 3H1WA 2DCTA 1GANA 3OY8B 4EN8B 1LOFA 2CWSA 3ZSKA 4WM8A 3FC0A 4L92A 2NP0A 4Q0SA 3I54A 4QPGB 1HV0A 4DNYA 3VHRA 5F6KA 1DIWA 4WVZA 1BMV1 2DVDA 2P3KA 3MIGA 5AC92 5KXBA 4WVWA