1HQLA

The xenograft antigen in complex with the b4 isolectin of griffonia simplicifolia lectin-1
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
236
structure length
236
Chain Sequence
SVSFTFPNFWSDVEDSIIFQGDANTTAGTLQLCKTNQYGTPLQWSAGRALYSDPVQLWDNKTESVASFYTEFTFFLKITGNGPADGLAFFLAPPDSDVKDAGEYLGLFNKSTATQPSKNQVVAVEFDTWTNPNFPEPSYRHIGINVNSIVSVATKRWEDSDIFSGKIATARISYDGSAEILTVVLSYPDGSDYILSHSVDMRQNLPESVRVGISASTGNNQFLTVYILSWRFSSNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LECTIN
publication title The xenograft antigen bound to Griffonia simplicifolia lectin 1-B(4). X-ray crystal structure of the complex and molecular dynamics characterization of the binding site.
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 53
structure length 236
sequence length 236
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1hqlA00
1AX2A 1LU2A 3PVNA 1GBGA 3WDWA 2A71A 1LOBA 3INAA 2ARXA 4UW3A 2UURA 3M1HA 3NV1A 5EWSA 1C4RA 1GKBA 1SCRA 2JKBA 1MS4A 1DLLA 4FPGA 2EF6A 4P9XA 2GMPA 3FFZA 1BXHA 4P9YA 1UL9A 1ENSA 4YM1A 2D3PA 2E6VA 4NO4A 1LOEA 2WT2A 5F9TA 2DV9A 2RHPA 1DIWA 2WNEA 3AP9A 2ZGOA 3BODA 5IT6A 3V0BA 1GNZA 5SV8A 4DQAA 1UPSA 2EAKA 3R4SA 1A3KA 2JD4A 3WDUA 1GV9A 3H0OA 3OJBA 5CAZA 4CTEA 1SLIA 2WT1A 3B00A 4YW5A 2AUYA 2ENRA 4FPYA 1VIWB 1KQRA 1X50A 2W68A 4Q8LA 1WLCA 3ZYPA 3ZXFA 1Q8OA 4M3CA 4XBQA 3QCWA 3N36A 4R9AA 2DVGA 2DURA 2UWBA 4XOGA 1PZ9A 4CRQA 2AGSA 1FX5A 2ZACA 1MS3A 1QMJA 1VAMA 3N7LA 4M3CE 1ULDA 3WNXA 3B9CA 3OBTA 4PCRA 1JBCA 2A6VA 3WDVA 4ASMB 3VKOA 2VW0A 4LBKA 1G9DA 2YV8A 2JECA 5IK7A 2GN3A 4FOVA 4P14A 5GZFA 1G9BA 2UWAA 1UN1A 3OPZA 2A6ZA 1PZ8A 3AYAA 5GZDA 1S0BA 2W08A 4XJUA 2CNAA 2R1DA 4K21A 3UJQA 1S0GA 2D3SA 4UW4A 5HCAA 4YZ3A 4L8QA 3ILRA 1C1LA 2TEPA 1N3OA 3WCRA 1YRZA 4XJ9A 5CBLA 1V6MA 2R16A 1WBFA 2WLQA 2A3WA 2DTYA 3POYA 3ZXKA 4AGRA 1GYKA 1DFQA 4ISQA 3ILFA 4Y1XA 3RG0A 1I3HA 2OUJA 3POSA 4XYXA 2PHFA 1AJOA 2CYFA 2D6NA 1ULEA 3OY8A 1PZ7A 3AK0A 2A6YA 4FVVA 4FP3A 1W6NB 1WLDA 2NN8A 4YGBA 1NXD1 4HANA 1SBEA 1KITA 1WW4A 1AXZA 1N1SA 1TEIA 1W6MB 5F5QA 4F83A 1GZ9A 1V6LA 4Z8BA 3T1LA 3WG2A 1APNA 3M3OA 2AR6A 3HN1A 1UAIA 3R4UA 2AH2A 4FQ4A 1JUIA 4LBQB 4XE9A 3AFKA 2YXSA 2XG3A 2NP0A 2D6KA 2SBAA 4K20A 4SLIA 4YGDA 1LOCA 1S0DA 3ILNA 2FHRA 5T52A 1LULA 1G9AA 1UZYA 1V6KA 1DYPA 4Y1VA 1QKQA 2WJSA 1LJ7A 3M3QA 5HCBA 2I2SA 1SLTA 1LGNA 2V73A 1QOSA 4NOTA 4FPCA 4FPHA 1AVBA 4YW4A 3RMYA 1G86A 1MS1A 4ITCA 3T2TA 1MVEA 3D5OA 3AX4A 3KQRA 3FBYA 2AREA 2P3IA 1MS5A 1BJQA 3V0BB 4YFWA 5GLUA 5JLVA 3MPPG 4YZ5A 4DRRA 1G9FA 4PF5A 2ZHKA 4GWMA 4ZXKA 3USUA 4IQPA 1MVQA 3RSJA 3WLUA 2A3XA 2CL2A 3MEPA 2ARBA 3ZYRA 3AP5A 1MZ6A 2VU9A 5DZEA 1Q8QA 3WDYA 3AXDA 3OYWB 1CQ9A 2E7QA 2WT0A 3ATGA 5GALA 4UW6A 3WUDA 1W6NA 1BYHA 1QU0A 1NLSA 3SH3A 4XHXA 1I1EA 3PJQA 1IS5A 3NV2A 3W59A 3I4IA 1QDOA 2LTNA 2ES3A 2PHWA 1WD3A 2NMOA 2OUHA 3O5SA 4KBBA 5FREA 3HR9A 5GLVA 1SLLA 3B01A 3SNMA 5T5PA 3ZSMA 2ZHNA 2P37A 5DUVA 4AYUA 2GNDA 2JDZA 1UMZA 4WV8A 2ZHLA 5GLZA 2DVDA 5E89A 1H30A 2DVAA 2GDFA 1LU1A 2WKKA 1IS3A 5GM0A 2YY1A 3CNAA 3U4XA 2GN7A 1GSLA 2D6LX 1RITA 4FPEA 2ZGSA 4M01A 1JHNA 2YZ4A 2C5DA 4XBNA 2VH9A 1FAYA 2GNBA 1GZWA 1S0IA 4YG0A 4TYSA 3AZZA 1HQWA 3OY8B 2NYYA 4XBLA 3FLRA 4YGEA 3ZPYA 2VY0A 1LHNA 4XJZA 1SLCA 1F9KA 2G4IA 3O0WA 4OZXA 2EIGA 1S0JA 2A6XA 3O12A 1OQ1A 3VUOA 1B09A 2HYKA 2ZGPA 4GA9A 2AENA 1ENRA 2NZ9A 3OYWA 5EXOA 1KDKA 2PELA 3APBA 1AX1A 4YW2A 3ZVXA 3T1MA 1W6PA 3LSDA 1Q8PA 2PHTA 3AXEA 5DUXA 3O0VA 3AP6A 1UKGA 3PVOA 2DTWA 3LCPA 3ENRA 5DZGA 1S0EA 4XXAA 1YO8A 5HCFA 2P2KA 4LBOA 2E53A 4XTPA 3WCSA 4DFSA 4P9WA 1O4YA 4GALA 1LCLA 2D6PA 2A7AA 3JUUA 3IN9A 3IKWA 4YZ2A 2DVFA 4U36A 3WG4A 3SH4A 1IS4A 1WLWA 2ZZJA 4LBMA 1DZQA 1URXA 4LBLA 3GALA 2DUQA 2E7TA 1S0FA 2Z42A 2DU0A 3USUB 2FMDA 2VUAA 4U2AA 4BM8A 3JU9A 3WV6A 1ZM1A 1IKPA 1OKQA 4K1YA 1FV3A 2DWRA 5T50A 2Q5TA 2P3JA 1QDCA 3WVJA 1D0HA 1LHUA 2D7FA 2JE9A 4DS0A 1DQ6A 5L73A 4BMEA 2YROA 4FPLA 1CN1A 2W52A 3V0AA 2PHRA 3PVEA 5KXCA 3AZYA 5IK4A 2GNTA 1MS0A 1G9CA 4YW3A 3NWKA 4GKYA 4XJ8A 1IOAA 5JDBA 2ZMLA 5DUWA 5H9PA 5T5LA 2R49A 4FPFA 1ULGA 1DBNA 2CTVA 1V6JA 2GALA 2H0BA 4WZFA 4MYEA 1KRIA 1SBDA 3FLPA 3SISA 1QOOA 1DQ4A 1LESA 4FOWA 1F31A 2LALA 2R0HA 4XJAA 1VALA 2EXJA 4YW1A 1MZ5A 1VLNA 3VKLA 5E8AA 1G7YA 1FNYA 2D44A 1C1FA 4LBNA 4UW5A 3NV4A 1GZWB 3N7JA 2VW1A 1DQ2A 5CB7A 4AVTA 1ULFA 4R9BA 4Y24A 4R9DA 4XHBA 1S1AA 4YLZA 3VV1A 1MACA 5IK8A 1N1VA 3W58A 4XILA 1ULCA 1H9PA 2UU8A 1LOFA 4Q1RA 3DGTA 4Q2FA 4Q27A 1W0PA 1QNWA 3NV3A 5GJ6A 1CESA 1KJLA 3LSEA 2SLIA 1AX0A 5DXDA 2A5ZA 3OGGA 4FOYA 3VKFC 1IS6A 1LOFC 1W6PB 4ATFA 5T55A 1RIRA 3B3QE 2V5YA 2EXIA 3MW3A 5T5JA 4Y26A 1VAVA 3UK9A 1YXWA 2R0FA 3AJZA 2D6OX 2ZKNA 4Y1YA 1BZWA 1HDKA 2EALA 3AP7A 3M2MA 4GWNA 1AJKA 1Q8SA 3N7MA 4XIKA 5H9RA 1AZDA 5DUUA 3N35A 3AJYA 4AWDA 4XMIA 4YM3A 1WCSA 1W6OB 4XTMA 3WDXA 4C1WA 1ZA4A 2PHXA 3ZXLA 1LOGA 1QOTA 2JE7A 1CIWA 1CPNA 2ZGLA 4FOQA 4ISRA 2A75A 1C57A 5DG1A 3Q9OA 4M3CF 2UWCA 1J1TA 3D4KA 3QLQA 1H9WA 1ONAA 2CWMA 4FPJA 4GXLA 5DZFA 2NM1A 2E51A 1LEMA 4Y22A 2DUPA 1GLHA 1GNHA 2XB6C 4PBPA 4WVWA 3ZXJA 4XDQA 4DRVA 5GZCA 3AZWA 5CA6A 1FATA 2OW4A 5JOWA 4Y20B 4ATEA 5T54A 1SACA 4DPNA 3V0AB 1D2SA 1MR5A 1O4ZA 2GMEA 2P34A 4Q1PA 1BKZA 5H9QA 1N3PA 1MS9A 3SLIA 1U0AA 2VXRA 3WHUA 1W6QA 3VKMA 2NMNA 3FLTA 4JCKA 3UJOA 2WQZC 1SLBA 3M3EA 1DYKA 4BOWA 2GNMA 4AGVA 3D6EA 4RL7A 2ZGNA 3ZSJA 4JC1A 3IPVA 5AVAA 4Q8KA 1SFYA 1QGLA 3FUOA 2A6WA 3WG3A 3ASIA 2OVUA 5JMCA 1R1ZA 4PBOA 1Y7BA 2JJ6A 2PHUA 5H9SA 5KXEA 4LBJA 3V65A 2EXKA 1W6OA 1SCSA 2YMZA 4YG6A 1MS8A 4R9CA 1N1TA 2D43A 2ZMNA 1YI7A 1V00A 2WSVA 2DYCA 3RQ0A 2WSUA 2EXHA 4FQZA 3IM0A 4YZ1A 1A78A 3MW4A 4JRAA 3SH5A 5T5OA 1G8WA 1Q8VA 3MW2A 3WHTA 1YIFA 3BIWE 2W39A 1Z0HA 1LECA 3L2YA 1LHVA 1A8DA 2D3RA 2CY6A 2A70A 3ZSKA 4YM2A 4Y20A 2BQPA 4ZKTB 3B69A 1AXYA 1EPWA 2AYHA 3AYDA 4FPKA 5CNAA 1JOJA 4YZ4A 1SBFA 2CWSA 2ZGRA 1F5FA 1RINA 1WW5A 2A3YA 3I8TA 4M00A 1JN2P 1N47A 1LHWA 1UX6A 3A0KA 1V6NA 4CZSA 4K1ZA 5GZEA 1KDMA 3BOPA 3N3HA 4FP2A 5KXDA 3R05A 2ZGKA 4FPOB 3RS6A 3WOGA 1DQ0A 1AF9A 1LODA 1JYCA 3M3CA 4W65A 1S0CA 2ZGMA 4AGGA 3OBRA 1IKQA 4Y1ZA 4XXPA 3V64A 3HMYA 3O0XA 5IUQA 5FRAA 3A0NA 3RRDA 3UL2A 1YYNA 1UZZA 1QF3A 1CVNA 4LBQD 3PMEA 2ZGQA 1CONA 1HKDA 1JXNA 1DQ5A 1N3QA 2P3KA 3AYEA 4Y22B 5LK5A 5EYYA 5GZGA 4H55A 4XIOA 1JW6A 3WDTA 2ZGUA 1Q56A 5E88A 4Q26A 4BQ1A 1KJRA 1LOAA 3A4UA 4C1XA 4WVVA 3ZXEA 1LTEA 1FNZA 1W0OA 3WUCA 1DHKB 1V6IA 2R1BA 1DQ1A 2DUOA 3WG1A 1FYUA 1WW6A 1W6QB 4I30A 1ENQA 2B7YA 2D6MA 1WBLA 1HLCA 4YG3A 4GKXA 5JVVA 3AYCA 3N7KA 1SLAA 1CR7A 2ZHMA 1FV2A 1WUVA 3IMNA 4TZDA 4BMBA 2ZMKA 4PQ9A 3POWA 1N1YA 2DU1A 5JOZA 5DG2A 1LEDA 4YFZA 5BYNA 1LGCA 5GLTA 3IPVB 1WD4A 3VKNA 4AVSA 5JOXA 1CPMA 1GANA 4RA0A 4YGCA 3KM5A 4BPZA 3FUQA 1AXKA 4BLJA 1GICA 2KM2A 1LENA 3AZVA 3TB0A 3TAYA 2C9AA 4HL0A 1LHOA 3C2UA 4M3CB 5JOYA 5IK5A 1GZCA 1HQLA 1Z78A 2ZABA 4XJWA 4XZPA 4YM0A 4D69A 1CJPA 2ZA9A 1QNYA 2DVBA 2VW2A 1WW7A 3BTAA 2ZGTA 3SITA 1LGBA 3DUIA 2ZAAA 3GNEA 2GMMA 1W6MA 1OFSA 4AVVA 4BLIA 3AZXA 1V6OA 3RMXA 1DGLA 1JYIA 4XMAA 2ERFA 5KXBA 3WZ1A 4LBQA 3AP4A 2ZBJA 3ZSLA 1BQPA 4Y1UA 5GLWA 1XQNA 5EYXA
chains in the Genus database with same CATH superfamily
3E97A 1AX2A 1H2KA 3VZKA 1C3HA 3WDWA 4QPGA 4WVZA 4C90A 1LOBA 1UZWA 1HB2A 5HCHA 5J36A 2EIBA 2HWB3 2UURA 4QX7A 4WM7A 1GKBA 2JKBA 4GMP0 5EWSA 2O8OA 1CAUB 1MS4A 1PK6A 4IE0A 3MDPA 2EF6A 2F4LA 2OKXA 5JCTA 1UL9A 2WR9A 5HV0A 3MF6A 1VBC2 4YM1A 3VBHC 2E6VA 4NO4A 5HPOA 2WT2A 3FWEA 1E5RA 3POFA 2VC9A 1CX4A 1JS9A 3A22A 4JX0A 4Q0SA 2RHPA 2CGNA 1DIWA 5JIAA 4OUEA 5JMOA 2XQXA 1AR92 3V0BA 3UKTA 3MV01 5CU1A 3ZFEB 4DQAA 1UPSA 2XJQA 1O4TA 4G4FA 1A3KA 1JYWA 3CO2A 3WDUA 3NNJA 3EJKA 2Y60A 4LHKA 2WT1A 3JXSA 2ENRA 4LK7A 1VIWB 3N9NA 1NOVA 1WLCA 4XUQA 3RJRA 1Q8OA 4M3CA 3QD6A 3N36A 4CU6A 2DVGA 1RUH2 5C70A 1W2UA 2DURA 4COVA 1PZ9A 1QXRA 1FX5A 1RUE3 2E63A 3G7DA 2ZACA 1MS3A 1NCRA 2HWD3 3N7LA 2R063 4Q4Y3 3TEYA 4RQPB 4QM9A 3HD8B 4PCRA 4EQVA 1RUC2 3IDEA 5C8CB 2VQUA 5F3GA 3WDVA 2W3JA 3FC0A 2AC1A 4L2NA 1G9DA 2YV8A 2XJUA 4H3WA 4JQTA 1Z7S2 4FOVA 4P02B 1C8NA 5GZFA 2O1QA 3RYPA 2UWAA 1G9BA 5A1FA 2A6ZA 1HJGA 4EN7B 3AYAA 1U12A 2Y6HA 3SCGA 4K21A 1S0GA 3URFA 1NX9A 1C1LA 1J3RA 2OQ7A 4IEWA 2TEPA 1N3OA 2QFEA 2VTXJ 3U10A 5CBLA 1W99A 3DV8A 5A7OA 3C7EA 2QZ2A 2XUEA 3ZLIA 4CDUC 2DTYA 4A45A 2JG9B 2ZOEB 1VBD2 3VBSB 4AGRA 5AFBA 4Y4RA 3BALA 3ILFA 3RG0A 3VDDA 2OUJA 4XYXA 3POSA 4A7KA 1ZZCA 2CYFA 2QQPA 2EA7A 5D2AA 5BUVA 2VXJA 2NN8A 4LJHA 1X9PA 3JQWA 1NXD1 4HANA 1SBEA 1KITA 4MGYE 1N1SA 4PI0A 1C5HA 3IDCB 4I0BA 1GQPA 2WNVB 3VDCA 3ZFEC 1V6LA 4ZU5A 1GZTA 3POIA 1ZRCA 5AC93 2WL1A 4FQ4A 3CF6E 1T6GC 3AFKA 4QDSA 2GC3A 1W8ZA 2D6KA 2SBAA 5CISA 4K20A 1JU4A 4QPGB 5T52A 1LULA 2VL4A 1VRH1 4CDWB 4WM7B 3FHAA 5A6QA 2KD7A 1PK6B 4BZ4A 2IXKA 4FPCA 4NOTA 1QH6A 4QQPA 3RMYA 2FDKA 1DGWA 1W9SA 1PVC3 3GDBA 3KWVA 5J48A 3E6DA 2AREA 5IVJA 1BEV2 3J7LA 4L99A 2CV6A 4N7IA 3V0BB 1Y9GA 1GQGA 2VNVA 4NIAA 3WF0A 1HRI3 3MPPG 4TLGA 1RMU3 5LK7B 3ZYFA 1G9FA 1WMXA 1XNBA 2VZ1A 2ZS6B 5CFCB 2FBEA 3USUA 2VE1A 4IQPA 5JSPA 3LA7A 5FO8B 3SCFA 1XSRA 4AVCA 1W8UA 4Q0PA 5DZEA 3OB8A 2E7QA 3ATGA 4NIGA 5A7PA 4DNYA 2FZ1A 3KHCA 5JIUA 3HNMA 1E5HA 1QQP3 1OA4A 4HPKB 1NLSA 2JG9C 2R32A 4XHXA 3VBSC 3VBRA 1CAWA 1DGRA 1OPMA 4IL7A 2ADEA 2VBPA 2NQYA 5F39A 4AZZA 2JB4A 3NJXA 2PHWA 4B1MA 4BQXA 1CZSA 2BVVA 4QX3A 3T2QA 2A73B 5LZ6A 2JDYA 3PHMA 3C7FA 4HZFA 4M0HA 4PI2A 2X5IB 5FY7A 1YQ8A 1W8WA 5FY1A 2RS31 3LD8A 1TE1B 2P5BA 1BLZA 2WQ4A 2GNDA 4I3PA 1LAJA 2CGPA 1YQ2A 3AKQA 4WV8A 4ZZ8A 4W8JA 5GLZA 3ACFA 4AOCA 2Y6JA 3K46A 4TLFA 3P1IA 5GKAC 5GM0A 3CNAA 4JGZA 2GN7A 4QPGC 2VZQA 1QJX1 4GIQA 1RITA 3NRUA 4CCKA 1R64A 1YWKA 3H8UA 5EIYB 4CDWC 4WM7C 3I49A 1PX3A 1PGL1 4TYSA 3IIAA 3AZZA 3FFQA 3EB7A 2WO7A 1VRH2 4Q0UA 5D8AA 2JB8A 4XBLA 4ES8A 2WAAA 3NNMA 3D3AA 4B4QA 4MGZE 2BUKA 4QB1A 4OHVA 1OC1A 2IVIB 4Q4V3 4P9IA 4B8EA 1FMD3 3O0WA 4OZXA 1O8PA 2A6XA 2DCZA 4RHV1 1GNYA 2R071 3VUOA 1OD5A 2ZJCA 1O3TA 2X8KA 2AZ5A 4HKOA 5EXOA 1XYNA 2V5DA 3LZZA 3N9QA 3VHOA 5CFCC 3LFIA 3LEGA 1KFXL 5EJ3A 5I93A 1POV0 3LSDA 4XUTA 3CMGA 1UKGA 1H8VA 2TNFA 3PVOA 5DZGA 4HETA 1YO8A 2VECA 4BJ0A 2VZVA 3MIDA 2E53A 5KHJA 4DFSA 4A3ZA 1HB4A 1OF3A 2VG9A 4GULA 1LRHA 3ST7A 3KV4A 5F37A 5AFEA 1RUJ1 3NKTA 2X5IC 4YZ2A 1YLLA 2IFRA 4Y33A 2XL7A 5FP8A 2J1AA 3GALA 2E7TA 1GOHA 2DU0A 2OPWA 1TG7A 3USUB 3LPFA 1JMUB 2RS32 4KGQA 5FBZA 4DINB 4BM8A 3T09A 1UXXX 3WV6A 3JB4C 5L36A 5CADA 1ZM1A 1IKPA 1TQ5A 1IPKA 1S2EA 5LA2A 3HNBM 1E57A 5T50A 5J09A 4AW7A 1I5PA 1US3A 1Y43B 5C6CA 1LHUA 2D7FA 2JE9A 4LK6A 3NAPC 4XFGA 5FZCA 5D21A 2XONA 1CAWB 4BMEA 4FPLA 1CN1A 3PMSA 3V0AA 2PHRA 1QJX2 4LKSA 2HEYF 3KLSA 4YW3A 3SKJE 4EJRA 4XJ8A 1FOD3 4ZPIA 1IOAA 3AKRA 1PO22 1HIXA 2ZMLA 4I01A 3D0JA 4E2SA 4FPFA 1DBNA 1V6JA 4LO8A 4ASLA 1Y4WA 3DYPA 5CKMA 1SBDA 4HN1A 4NROA 1EPZA 5EJZB 2E26A 4KL1A 4EN6B 2PAMA 4FT8A 2VOWA 4QXCA 2ID4A 2R0HA 4RHV2 2R072 5FXXA 2EXJA 3ZX7A 3POJA 4NHKA 1NXMA 3UGGA 5FZ1A 1QY4A 1ZA7A 1C1FA 4UW5A 1WKYA 5A7QA 3S5QA 1D2QA 4A6OA 4NHMA 2BGOA 2P1BA 4AVTA 4R9BA 2Q8OA 5D8AB 3S6PA 4E27A 3J4UH 1R1A3 1GWKA 1MACA 1NQDA 2FDGA 2X53S 3NQHA 4ES9A 1N1VA 4XFIA 4XILA 1ULCA 1GOGA 1RJ7A 3BCWA 5FQ0B 5JI7A 3TEXA 3LWCA 4MG2A 2LRPA 1KJLA 1UMHA 3LSEA 2SLIA 2WS93 1RUJ2 3H9AA 4W4ZA 5A3NA 4QB6A 3UKVA 3UYJA 2HEWF 1AHSA 4ATFA 4XDPA 1RIRA 5T55A 1XXNA 1DG6A 2VQTA 5IVVA 3O1UA 1LB2A 3PIGA 5IVCA 4KH9A 3MW3A 1NQJA 3UK9A 1O91A 4M4PA 1PMIA 4OHWA 3HT2A 4QWNA 4S2GA 1F5JA 3AFGA 3DYOA 4QQ2A 5FZMA 2ZKNA 4Y1YA 2ORZA 2EALA 4XIKA 3WW1A 3N7MA 4IE7A 5H9RA 5DUUA 3WINE 2C26A 3ZXGA 1FT9A 4FBFA 1BK1A 1EAH3 2B42B 3VHRA 4PLMA 2BBAA 1XSQA 3AJYA 2VOKA 3A21A 2F17A 2RR13 4XMIA 1WCSA 3B5LB 3PUQA 4OFGA 4Q29A 3AL6A 3C8XA 1QOTA 2JE7A 1CPNA 2VUCA 1ULPA 3HEIA 3U1XA 4OZOA 3VDBA 1MQTB 2X29A 1RGSA 2J1RA 5DZFA 4QHZA 2AACA 5E6HA 2E51A 4Y5TA 2B45X 4Y22A 4FXGB 1GLHA 1H2LA 3KV6A 5BNPB 4C8DA 4BISA 3H42B 3AMMA 3VD7A 1VBA3 1RB8G 1AL21 4O7XA 1IPJA 1MEC3 1RUF3 2Q0AA 3M4FA 5LB6A 4HG6B 4ZS3A 4YARA 3TBDA 4DPNA 3V0AB 2PFWA 4AXOA 5D8AC 2P34A 3LOIA 1BKZA 2BFUL 3THPA 4IDZA 4CDQA 5A6ZA 3O14A 1W8TA 4LIUA 2DDUA 4QKDA 4JKMA 3CBNA 4JCKA 3LDBA 2RMU1 1E5SA 2WQZC 3BOWA 3M3EA 4JHTA 2BGCA 5KWRA 1HB3A 4KWJA 4Z2WA 1SFPA 3P6BA 3AKTA 4A44A 2W2IA 1UZ0A 4DUWA 4AEDC 1AR63 3TWIA 3WG3A 2B46X 3ITQA 2JE8A 4RS5B 3U37A 1RXGA 2BU9A 3K4DA 3WY6A 1H1MA 3OG2A 5KHGA 1ZZBA 2JJ6A 2PHUA 4QX1A 4NHXA 2VVFA 3I2IA 4LBJA 3H8OA 3V65A 2ADDA 4LHSA 4DIQA 4CXXA 4FSJA 1W6OA 3IDBB 4QKNA 1JYTA 1G6NA 2V72A 3TNQA 4BU2A 5CKQA 2WSUA 1ND2A 2EXHA 2Y6KA 1UYXA 3HBKA 4D8MA 1A78A 2ETEA 3MW4A 4YZ1A 5FUNA 4UFIA 2UY9A 3U4SA 1NCQA 1D4M3 1G8WA 2CGOA 2YU2A 3MW2A 4H7MA 1EUTA 3BIWE 2W39A 3L2YA 4QD2A 3TN91 1LHVA 3MUY1 3TYJA 1MQTC 2GC1A 4YM2A 3N9LA 5BPXA 4QHBA 3B69A 4JRLA 4FPKA 5CNAA 4HK9A 1CAVB 5BNPC 4LITA 2YC4A 5CZKA 3GXUA 1FPN2 1OA3A 3LOBA 2XH6A 1RINA 1QJY1 4PHZA 1HV0A 1UX6A 4A7ZA 1V6NA 2GC0A 3N3HA 3BOPA 1AL22 3QACA 2BDRA 4OMDA 2OXBA 5IAVA 5KXDA 2ARAA 2YB7A 1EUUA 1HN0A 2D93A 2B8MA 5E16A 1UQXA 3ZMNA 1OUXA 2VPVA 5A7WA 5FXZA 1YYNA 5C4WC 1KGYA 1X36A 2RMU2 3JD73 3KCCA 4BK5A 4JDOA 2ZGQA 1ASJ3 4XQ4A 4Y22B 5A7NA 2P3KA 5LK5A 1BMV1 1EV11 3PLQA 3IIIA 5FO7B 5IYYA 3WP6A 4JTOA 3J7MA 4XIOA 1NY71 4RS5C 3SEEA 3BTYA 1Q56A 4FCAA 1BBT3 1OLQA 3PTYA 3KCXA 1NAEA 4NHYA 1F4HA 1LOAA 4UBHA 4C1XA 4NVPA 2BTVC 1LTEA 2HYXA 3ETPA 5L9VA 2VTFA 3Q8BA 1V6IA 1L7RA 2W9XA 4ZU4A 4CDQB 1R091 5FZ9A 4I30A 1PX4A 2VMIA 4KMQA 3AYCA 5C3OA 1CAXA 1J58A 2WFF3 3OUIA 4PQ9A 2Y6FA 4P9GA 1N1YA 5JOZA 2XOMA 5FFOC 1PGSA 3VKNA 5F7UA 3H50A 1GANA 1ZBA1 3D0SA 4NMIA 4YGCA 1PM4A 1X8EA 4JVAA 3FUQA 3U11A 4B4PA 1W03A 3T4VA 4BLJA 4BPZA 5IFTA 3TN92 2C9AA 5FPLA 1LHOA 5JOYA 3MF9A 1GZCA 4XZPA 5A33A 1HXS3 3ZXAC 2YBKA 5IATA 1I5ZA 2DVBA 1ULOA 1WW7A 2ZGTA 3SITA 1LGBA 3DUIA 2ZAAA 3GNEA 3VGIA 1OFSA 2QNKA 2Y26A 3KT1A 1QJY2 1V6OA 4AVVA 5EP9A 4EZHA 1ND2B 1JYIA 5CYYA 2ERFA 2VO5A 5C9AB 2JDPA 3K51A 1NCQB 2XQRA 4Q4W1 1QXPA 1UY3A 3LEIA 3ZSLA 4BXFA 3E5UA 2BVBA 1XQNA 5J3UA 5JXJA 5K9YA 2UY8A 3T0DA 3ZDVA 1POV1 2ARXA 4UW3A 3VBHA 2RDQA 4HKLA 1YFUA 2HWE3 2RDSA 4FPGA 1BXHA 1ENSA 4NPMA 1BMV2 4YW7A 2D3PA 2JDHA 4QXHA 1EV12 1W90A 2WO3A 3AKPA 5F9TA 3WNMA 1NY72 1V9U3 2F6BA 2RV9A 2WNEA 5FP7A 2E7AA 3AP9A 5JUVA 4Q4X3 1GNZA 2EAKA 3HQXA 3R4SA 5HV4A 5CG9A 3HIFA 1GV9A 2ZPXA 3H0OA 4H7LA 4XEZA 5DAPA 3UV9A 3VBFC 4CTEA 4YW5A 1RUG1 5FZGA 2AUYA 1H1IA 4FPYA 1H2MA 2QCSB 2ZX4A 5FP4A 3ZYPA 1YFYA 3ZXFA 4CU8A 4XBQA 2MEV1 3GBWA 4Z1VA 5BY5A 3DPRA 3ES1A 4IEVA 1LNSA 4CRQA 2AGSA 5JWPA 4TSVA 5DN2A 3WNXA 1OFNA 1ZBA2 1TMF1 3J8F3 3GCXA 2KXLA 2PLV2 3IZOA 3OBTA 4GH4B 1YJKA 4HT1T 3P5BA 5T3NA 4A7YA 2FDIA 2WLPA 2I45A 5FZ8A 5FK8A 2GN3A 3JBG3 2RM23 3OPZA 3PDQA 5G05L 5ACA3 2XHKA 3C7HA 4XFFA 1A6CA 2W08A 1CAXB 1ODMA 5C9AC 2R1DA 4CDUA 3UJQA 4NJ4A 1YC61 5J7MA 5C8WA 2RVAA 1CAUA 4NPRA 4XETA 1CIYA 4Q0QA 4K9SA 5FPAA 3H3ZA 5A3PA 4LO5B 3TEZA 1V6MA 4Q4W2 2BWCA 3RZZA 2A3WA 2RS13 3ZXKA 5FZKA 5I0DA 1DFQA 5FCCA 4ISQA 1EP0A 1ACCA 4AFMA 2FDFA 5BNOA 1AJOA 1WCQA 3FBMA 1ULEA 3OY8A 3ZFEA 2VAUA 4MADA 1OKOA 2WWJA 2JXAA 4FP3A 4QGNA 4R4ZA 4Y4YA 1WLDA 5SV5A 3BGAA 4HN0A 4AQSA 4PJYA 4CCNA 4D3WA 2J1TA 1GZ9A 4IGQA 3WG2A 2XBO3 2AR6A 1AR81 3JZVA 4A41A 1V70A 2NP0A 1SMVA 3MUZ1 1VBB3 5KC5A 1NA1B 1UOGA 3OUJA 4M0NA 4SLIA 3ILNA 1US2A 5FK7A 3MHZA 3I54A 2W95A 3AB0A 5JR2A 1RUG2 5HCBA 1O6UA 2WZR1 4IE6A 2I2SA 1SLTA 4AVBA 4JDMA 4LXLA 4W6YA 4UAPA 5BV6A 5JXGA 1W28A 1AVBA 1MS1A 2H6CA 2RS53 1ZZ7A 2MEV2 4DY3A 2FDJA 4QDRA 4GH4C 4XFAA 5FXVA 2I07B 4ARXA 3FBYA 4F7ZA 4A3XA 1NZIA 2P3IA 2Y0IA 1OOPC 1W9YA 1RUH1 2QJVA 2PXJA 1MS5A 1TMF2 1OT5A 2VM9A 3O1TA 4J1XA 3TRSB 4BH9A 1WGPA 3X29B 1MVQA 3JCIA 2QQMA 3ETQA 3VBSA 2YPJA 1HQNA 4HFSA 4RD7A 1MZ6A 1Q3EA 2XJRA 3AXDA 1CQ9A 3RI8A 3DPRB 1F8VA 3WUDA 1DP0A 2YDEA 3B94A 2XUMA 5DPNA 1I1EA 1IS5A 4Y5SA 4CCDA 2HJIA 1O3QA 2Y8KA 1RXFA 3O1SA 1REDA 4MXVA 4AQ6A 4MVTA 2BNMA 2CAVA 5T5PA 1VBC3 4AYUA 3WNOA 5F3CA 4N43A 5BNQA 1K5JA 4I02A 1RHI3 5E89A 4CDUB 5A6XA 1L3JA 4CDWA 1H4HA 1V0AA 2R6QA 5K8SA 1NG0A 2WKKA 1IS3A 1NA1C 4L92A 5I8SA 1AR82 1COV1 1GSLA 2QQKA 2D6LX 4Q4Y1 1XYOA 3GZEA 4MGIE 3O1RA 3OCPA 2YZ4A 2B5HA 2C5DA 5FPBA 3LEKA 1S0IA 5FZDA 5FUPA 5BNOB 3U78A 1ZZ6A 3OY8B 2YYOA 1H6YA 1VRBA 5FKBA 4E4DX 2WZR2 4BWOA 3MLJA 3KMHA 5CFCA 1RUC3 2R7EB 2G4IA 2JG8B 3HQUA 2EIGA 3U07A 2DFCA 1S0JA 5FLJA 3WW2A 4BDVB 4X8NA 5I0TA 1Z7S3 1I6XA 4GA9A 3UESA 2AENA 3NJZA 5J98B 1O5UA 4BQ2A 1RVF1 5F1RA 4B29A 4HPKA 1W6PA 1BEV1 5FLHA 1Q8PA 1KS4A 1SDDB 3AXEA 5DUXA 4E9KA 2XKOA 1KS5A 2QQVA 3ENRA 3DPRC 2VNOA 4XXAA 5LWBA 2JICA 3DKWA 3GYDA 2W0XA 2X5IA 4XTPA 1RJ8A 4L97A 1DZTA 1ODNA 3WCSA 1VBD3 4O61A 5K4LA 4GALA 1O3SA 3R6SA 3NKGA 1PIV1 3MLKA 2A7AA 5KC6A 4K3UA 3FX3A 3M70A 2Z69A 4MHRA 4IW3A 2YGMA 3UT0A 3WG4A 4QMAA 3AMQA 2ZZJA 3KGZA 4CVUA 3I2HA 1TNRA 1S0FA 5FLIA 1X7NA 3W21A 4FAGA 1RL3A 4XURA 2VUAA 3NAPA 4GB31 2HWC1 4Y5Z0 2VZRA 2XLAA 4PT6A 5ACA1 5LASA 1FV3A 2DWRA 3K77A 5BXXA 4C0HA 5JXHA 2WYFA 3GGLA 1WMFA 2Q30A 2YFUA 3MLLA 3WW4A 1QDCA 3WVJA 3ZXDA 1DQ6A 5HI0A 4OMCA 1WCUA 1RUE2 3BU7A 3VD5A 1COV2 2W92A 3NW4A 4D7SA 1GP4A 4Q4Y2 5BNOC 5F5AA 3AZYA 5IK4A 2Q4SA 1QJU1 2XWJB 4G9SB 4TN7A 1G9CA 2HBUA 4GKYA 4XFHA 5CG8A 5JDBA 4UFLA 4WZCA 1O5LA 5IVFA 3RWKX 5T5LA 3CEWA 4GAZA 4R52A 2JG8C 4N43B 4Y3OA 3WF2A 2H0BA 3O1VA 1NUKA 1OQDA 3FN9A 1DQ4A 5A1LA 5FZ0A 1F31A 2LALA 4IE4A 2J1UA 4NIDA 4OLLA 5A3OA 3T0AA 1W8FA 1JODA 4XJAA 4JHZA 5B4XA 1MZ5A 3VKLA 5E8AA 1RVF2 4LBNA 5ISLA 2JDNA 3N7JA 5GLVA 4NIHA 1W2OA 4LNVA 2B4KA 4JZRA 1IGOA 2JDUA 4FFGA 3POEA 3T3YA 5M0TA 4XW3A 5FY9A 3W58A 2UU8A 5FY4A 3VDAA 4Q1RA 1POQA 4LHLA 3DGTA 3H7YA 4Q2FA 1PIV2 1UWWA 1W0PA 3NV3A 3KS7A 4DEQA 3U0ZA 4YPJA 4S2DA 3IB3A 4XAAA 1XE8A 3VKFC 1LOFC 1W6PB 4I0AA 3USSA 4BCUA 3ES4A 2OPKA 1UU6A 5T5JA 5F5IA 4LE3A 2QVSB 3U14A 2XVLA 4GB32 2HWC2 2R0FA 5FXWA 4LULA 5LY2A 4AFDA 5ACA2 3LKJA 4IERA 1BZWA 3LIHA 3M2MA 3AP7A 4GWNA 4KQ7A 4W6WA 1Q8SA 5EQUA 2GC2A 2ZKLA 1O8SA 3N35A 1VRH3 5IHRA 4XZUG 5JPNB 4AWDA 2QKDA 5FMOL 2VBBA 3VZJA 4XTMA 1U5XA 1QJU2 2YU1A 4IEQA 4N43C 4AEMA 1JZ6A 4IETA 4META 4KWKA 5FZHA 1B35A 2Q1FA 3NAPB 5I0RA 1J1TA 2C24A 4OVEA 2TUNA 5FJKA 2BW8A 4BQYA 5FMCA 4E4SA 3D82A 1LEMA 2ORXA 1PO21 1UY1A 1XNDA 5A3WA 1GNHA 1Q43A 2XB6C 4PBPA 5GZCA 3ZXJA 3AZWA 5CA6A 3MIEA 4DB5A 4Y20B 1BVVA 2BWAA 2JDKA 5FKCA 3ZYHA 4IGPA 3AMHA 4LOTA 4XABA 1D2SA 2QTWB 1MR5A 1SEFA 1VE0A 4Z07A 5FQ0A 4CEYC 2WO1A 2J22A 1C5IA 5HXMA 1CGPA 2P6CA 1W6QA 3WHUA 3VKMA 2NMNA 3FLTA 5JR7B 5ABJB 4LQRA 4AEDA 5A3LA 4BOWA 1O59A 1TME1 4AFCA 5JZGB 2B9UA 4JC1A 1XU1A 4GJYA 1UNBA 2RJLA 1SFYA 4W6XA 1W05A 2RS33 4ZS2A 3SMHA 2XR4A 1YI9A 2WRAA 3FUOA 2OVUA 1R081 3LB9A 1PGW1 1Y7BA 5FZLA 1UPIA 1RUI1 2XHNA 4EN8B 4RN5A 1SCSA 1UMIA 2YMZA 1MS8A 4NRPA 3K3NA 3CL1A 3VBOC 1BCXA 2D43A 3I2JA 1YI7A 4IV3B 1QJX3 3QBQA 2GZWA 3RYKA 1KFUL 1MQTA 4N9IA 1XPWA 4P5HA 2XKPA 5T5OA 1Q8VA 4OULA 5BNPA 4QDQA 3PUHA 4PDWA 4UBGA 1GMMA 2P3YA 1AXYA 1EPWA 2E9QA 4LEJA 4K8FA 4HSJA 4EROA 4YZ4A 2HWF1 1SBFA 4AI0A 4RHV3 2CWSA 2R073 4QU2A 2ZGRA 1F5FA 2I74A 4M00A 3AVRA 1OLME 5IVBA 1UY0A 1BVP1 1JN2P 3VD3A 4JDNA 4QPIA 1LHWA 1S2KA 4K1ZA 5GZEA 1RUD1 2PQSA 3KVAA 3BPSA 2BOIA 5C4WA 3RS6A 3WOGA 4COZA 1DQ0A 1T6BX 1LODA 3TOJA 2CAUA 4IE5A 3M3CA 4COYA 4W65A 2WZEA 3MI8A 4QQHA 5ABJC 1IKQA 1UF2C 4DO0A 1X33A 4Y1ZA 2OT7A 4NAMA 3HMYA 3O0XA 1B35B 1UCXA 4RS5A 5JZGC 3ZO0B 3WQBA 1UZZA 1QF3A 1YQCA 3KD4A 3PMEA 1UYZA 1RUJ3 1CONA 2R041 1O3RA 2MPFA 4FFIA 1TME2 2VCAA 5EYYA 2G1MA 2KR2A 4H55A 1C8M1 1UO9A 4XAEA 2VOVA 5BNNB 2BFUS 4I3GA 1KJRA 4NWWA 5L7OA 1HN1A 3JQXA 3WUCA 1W0OA 4IGOA 4X6QB 1K12A 4L0PA 2CDPA 1R082 3I3EA 4IV3C 1PGW2 4N8MA 1FYUA 3WG1A 1W6QB 5LBEA 1RUI2 2B7YA 4QAWA 3BI3A 4YG3A 3KT4A 5EJ1B 3N7KA 1CR7A 2ZHMA 1FV2A 1ZBE1 2DCYA 4AEDB 4BIOA 4F3JA 2YC0A 5FOJB 2ZMKA 3CIHA 3PU8A 4QQLA 2DU1A 4AFBA 5DG2A 4EV0A 1CAVA 4GMP1 5BYNA 4ZXEA 5GLTA 1K42A 1WD4A 4O9GA 1OD3A 1CPMA 4RA0A 4AR2A 3DF0A 3R4DB 4AI9A 2YPDA 3KM5A 3E5XA 2RJ2A 1AXKA 1CJDA 4GWIA 4CP2A 1LENA 2JDAA 1GUIA 4QT6A 3RZGA 4NPLA 3MV11 4HL0A 4LTAA 5FAXA 1Z78A 2ZABA 2E33A 1VBE1 2G9FA 2ZA9A 4OI1A 4D7YA 1T2XA 1DZRA 2HWF2 1UZVA 3BTAA 1SHWB 4ZKTB 2GMMA 1GP5A 1H6XA 4XMAA 4ARYA 3DXUA 1FPN1 3OGRA 3WZ1A 1X9TA 1UD1A 2D40A 3UGHA 1PO11 1RUD2 4AE2A 4N9HA 2Q1ZB 1NT0A 4Y1UA 2QQJA 5GLWA 3SXWA 4PDWB 1B35C 2H0VA 2WZ8A 3F95A 4GWJA 1JZ3A 1LU2A 1IZ3A 5CFDA 2VCMA 4UT5A 5G04L 1C4RA 3BUCA 2DBIA 3ZPOA 4LLFA 3H8RA 3ZSEA 1WA6X 1ENXA 4P9XA 3ZOIA 3RZLA 4XFBA 5FYVA 2R042 5BNNC 3WNPA 4CPBA 4V2WA 2YFZA 4QPIB 1LOEA 3VBFA 4PIYA 4LORA 3EBRA 5B2GB 1C8M2 4E8DA 2C1FA 2XJSA 2ZGOA 3BODA 5C4WB 5SV8A 4E2QA 3KQ4B 1F4AA 4UF0B 2XJPA 1W06A 4LR4A 5CAZA 3MFAA 1SLIA 1OLRA 5FR3A 5DMYA 4I0WB 2VZTA 3K75B 2EAAA 4MXWB 1KQRA 1X50A 4Q8LA 2Y6GA 3T2PA 1HJFA 1PMHX 1XRUA 4OQ9A 2PHDA 2PTMA 3MBWA 1ZBE2 4XF1A 5FZBA 3QCWA 3V56A 4OQ8A 5FZ6A 2UWBA 5FYZA 4COUA 4RR3A 1XNCA 4HVQA 1QMJA 4M3CE 5EPAA 1ULDA 2VBDA 3POBA 2BEOA 5ANQA 5C8CC 2VUDA 4PQQA 1JBCA 2A6VA 2CU5A 5L7OB 4JQRA 2VW0A 5C9AA 4J1WA 5FYBA 1JZ7A 5IK7A 4IEUA 1H0BA 4TXWA 4P14A 5J37A 3NSTA 5CKNA 1VBE2 3DEMA 3LAGA 5F3IA 1PZ8A 1YJLA 1AL23 2WN3A 4LIVA 2OA2A 3OEBA 5F6LB 3ZMOA 2CNAA 1U5IA 3HBZA 4UXAA 5HCAA 2D3SA 4MOAA 4YZ3A 4D6QA 1M06G 3B7MA 4PDWC 3WCRA 1YRZA 3ACGA 1SDWA 5A3UA 1GFF2 3HN3A 1WA4A 2RG4A 1PO12 2WLQA 2RMU3 2WN2A 3POYA 3ZKYA 5F32A 3WW3A 1AR62 5KR7A 1IQDC 1DYOA 2OZ6A 5KHIA 2IC1A 1XNTA 1I3HA 4CSWA 2D6NA 1PZ7A 3ALQA 3B02A 1XB9A 3J9SA 3THDA 4A42A 1W6NB 4QPIC 4LKFA 4CDXB 1AXZA 1HRV1 3CHXA 4X8PA 3E1F1 5F5QA 3CLPA 4BQ4A 4LE4A 2C0ZA 2DCJA 4XF0A 5F8PA 3WD5A 4F83A 2VMGA 3B93A 1APNA 1AUYA 3M3OA 3R4UA 1UAIA 2W5FA 2AH2A 3VB9A 1JUIA 1ND3C 2XG3A 2ZEXA 4DXSA 1YIPA 4B1LA 3NL1A 2PAEA 5K0UB 1EYBA 1LOCA 3BTZA 1S0DA 2JENA 2W46A 5CFDB 1PNFA 4GH4A 2JIGA 4Y1VA 2WJSA 5LEKA 4OI2A 4INDA 3KV9A 1OOPA 2V73A 4YW4A 1H1AA 3EXUA 2QZ3A 3K4AA 4AI2A 3T2TA 4OUMA 3IMMA 3TN93 1UOFA 4D0QA 3GF6A 3AX4A 1XNKA 3KQRA 5C3SA 5L7OC 3VBFB 2JIJA 1STMA 1VPHA 1W2AX 2VMCA 3FE5A 5LA9A 5GLUA 2FDHA 2WABA 5DABA 4DRRA 3Q8AA 3RPQA 4PF5A 1QJY3 2ZHKA 4GWMA 2PLV1 4AL9A 4B7EA 1SPPB 3RSJA 2W91A 2A3XA 2CL2A 1F2NA 3W20A 3ZYRA 1TVGA 1Y9QA 3AP5A 4BHPA 3SC7X 3WDYA 2VZ3A 4AI1A 1PHMA 3OYWB 5GALA 3E6CC 4UW6A 3BIEA 1HW5A 4DY5A 1BYHA 1QU0A 4RR3B 3LGRA 2ET1A 4W50A 3PJQA 2QDNA 1D7PM 3NV2A 3LIGA 2ES3A 1LKNA 1UIJA 1WD3A 2NMOA 1BHGA 2OUHA 3O5SA 3HR9A 1WCKA 3HAGA 1XYPA 3QH6A 3SNMA 4COWA 3MPBA 3PTRB 4QHOA 4CDXC 5FYSA 2ZHNA 5FZ7A 2P37A 1EV13 5JI9A 5LY1A 2JDZA 4KU7A 1UMZA 3RVHA 1NA1A 4PIZA 2JX9A 1F35A 2XVGA 5C5TA 1HRV2 1VB4A 4HXCA 4QB2A 2WFF2 4WVMA 2ZEYA 2IZWA 1H30A 2DVAA 2GDFA 5LA0A 1AR71 4LO7A 3MZHA 1YQ6A 2YY1A 5K0UC 3NJYA 4DXTA 3VBUB 2K9ZA 1R093 4AK3A 5CFDC 4FPEA 2Y34A 4M01A 4I2OA 1OA2A 2WIIB 1SQ4A 1VJ2A 1GZWA 5F3EA 2EVXA 3WR0A 1YNAA 2ZX3A 4XC9A 1AYN1 2WNOA 4UFKA 1U5YA 2NYYA 3FL7A 3FLRA 3VZNA 1HXS2 4YGEA 4V2VA 4AHXA 1ZBA3 2UYAA 1AYM1 1LHNA 4G3YC 1UOJA 1W2NA 3ROUA 4FFFA 4RFT0 1F9KA 3H1WA 4D94A 5K7PA 4AAPA 4K7JA 5FYUA 4URAA 4X6RB 4IEXA 1OQ1A 2HYKA 2ZGPA 2JWPA 4A4AA 1ENRA 3ZFGC 1KDKA 2PELA 3APBA 1AX1A 2YHJA 2Z79A 3OF1A 5AVPA 1ZRIA 2PHTA 1IG3A 1H8TB 3I2KA 3AP6A 2DTWA 4IEOA 5I0UA 1S0EA 2Q8EA 5JXIA 2P2KA 1OOPB 3FMGA 4LBOA 4RR3C 3HOBA 4MGKE 3RYRA 4QX2A 1ZNPA 3FZ3A 3WEZA 5CIRA 4EZ4A 5EV7A 4P9WA 1O4YA 5FJHA 1Q5OA 2Q8DA 2J1VA 1LCLA 4GJZA 4AI8A 4RGAA 2YC2A 3C3VA 3JUUA 1POV3 4AQ2A 3IN9A 4LO4B 1C28A 3IKWA 5C7GA 1CD3G 4YRDA 3SH4A 1U5ZA 1WLWA 4YVSA 5FIXA 4EE2A 4LBMA 2YUEA 1YQ5A 1URXA 4LBLA 3ACHA 2Z42A 4KGGA 4NRMA 2BBVA 1RC6A 4UYBA 2DCKA 4BQ5A 4Z92B 3GHMA 5A32B 3IT8A 3JU9A 4CUBA 2DCTA 3LA3A 2E31A 3MFCA 1OKQA 1W9FA 4K1YA 3ZN4A 3WF4A 2VUJA 3VBUC 2Q5TA 3ZFFC 4DS0A 3W5NA 1AR72 3BKZA 4LOSA 2YG0A 2YROA 3NNFA 2QUOA 4CUAA 1NZCA 1RUG3 1OLMA 2JG8A 3PVEA 1XJAA 2GH2A 3J8F2 1GWLA 1MS0A 2W1UA 2MEV3 5FYMA 1WMEA 2XGXA 1AYN2 5DUWA 3Q8FA 4MO3M 4CCJA 2OQ6A 2XLGA 5DDJ1 2BERA 1M4WA 4WZFA 4MYEA 3BU0A 1KRIA 1AYM2 1IHMA 1TMF3 3AL5A 1QOOA 2VULA 4WVMB 4N53B 3ZYIB 4KI5M 4FOWA 5LRRA 4CP1A 3HPNA 4YW1A 1ALYA 1H8TC 2LROA 2BRTA 3S7IA 3I2OA 4CEWB 2OZJA 3B9IA 3VL9A 3NV4A 1GZWB 2RDNA 2VW1A 3I59B 5CB7A 4AF9A 4AI3A 4BQWA 1JZ2A 1ULFA 2ARCA 1S55A 4O65A 1S1AA 4KG0A 3NJVA 3VV1A 2QQOA 3AMNA 3CKHA 3ZIXA 3KF5A 5DAWA 1RHI1 2HWB1 2HKXA 1LOFA 1GP6A 4KWLA 4EWDA 1J84A 2Y64A 1X8MA 3L2HA 5GJ6A 1CESA 2XMLA 3RFRA 2YBPA 2WNUB 3WNNA 2XDVA 2A5ZA 2WZPP 3VHPA 1ZX5A 4PF1A 2XJVA 4RGKA 3PUSA 4GQ7A 4DUXA 2EXIA 1NLRA 1P8JA 2VOXA 5A70A 2CDOA 1AR83 2WYSA 1YXWA 4XUOA 1FI2A 4LO6B 5J96B 5E1RA 1YHFA 2ZEZA 2X09A 3H8XA 1AR93 4MGTA 2B9VA 1OH3A 3OPTA 4QKFA 4YVSB 2WZR3 2VJXA 3PURA 3WDXA 1ZA4A 1RUE1 1CIWA 1E5IA 2HWD1 2R061 4HBNA 3J7HA 1K45A 2A75A 4ISRA 4B3NA 3Q9OA 4N53C 1QWRA 4M3CF 3H7JA 4NWVA 5HCFA 3QLQA 1H9WA 1ONAA 2CWMA 3I2DA 4BXSV 3ACLA 3N9MA 5DDJ2 1RUH3 3O7OA 3KT7A 3P3NA 4QX0A 3W9AA 2XL9A 3GBFA 4HKWA 4CEYA 4DRVA 1ZZ8A 1KD7A 5HXVA 4CEWC 3EQEA 5FBJA 4NRQA 3OD0A 4ATEA 3ABZA 4FTEA 2EIEA 4XCBA 2CHHA 5DAQA 2OYZA 2EIDA 3SEPA 1S4CA 4CCEA 2EICA 3WF3A 1N3PA 1MS9A 3U75A 4N7UA 5C71A 3FHQA 1JHJA 3AVSA 2VR4A 2K46A 5FP3A 2Q8CA 4RYDA 2BOJA 3ZYGA 1DYKA 2GNMA 3D6EA 4JGYA 4RL7A 4E2GA 2ZGNA 3ZSJA 1RHI2 5F6KA 1JOPA 2HWB2 4RSUA 2WNUC 3IPVA 4Q8KA 4BIFA 2KA3A 3ZR5A 4OHYA 3SCHA 4Z82A 4ET7A 2A6WA 1VMHA 5IFPA 3VBOA 3ASIA 1QJZA 1OF4A 3NMBA 5AC91 5JMCA 2VTXA 2Y6LA 3J26N 5H9SA 4EN0A 3CZUA 5KXEA 1SG3A 1NE6A 2J1EA 4AHYA 2EXKA 2PHLA 3S5AA 3I7DA 1WMDA 1VP6A 2ZMNA 1COV3 5LATA 1IQAA 1ZYBA 3TNPB 4FAHA 5JPMB 2DYCA 3RQ0A 1F15A 3IM0A 4CUGA 4YVSC 5ANNA 3ZN6A 4CUCA 3VZLA 4KBZA 1UU4A 4NR1A 2ZX0A 3N4MA 1OI6A 1YIFA 1YFWA 5FV3A 3OGSA 1PVC1 1LECA 1UU5A 1OPOA 4JAAA 2A70A 3PVBB 4Y20A 2QE3A 2BQPA 2AYHA 2HWD2 3AYDA 5IVYA 2R062 4J6GA 4IV1C 1JOJA 1HRI1 1IPSA 2OS2A 1RMU1 3DXTA 3DL3A 3KF3A 2E32A 3I8TA 2A3YA 3Q8EA 1RVF3 5IJRA 3M7AA 5KHKA 1N47A 1BEV3 5ABJA 5FMOS 3HWJA 1KDMA 1KXGA 4IEPA 2YGLA 2BYVE 4HONA 5JZGA 3LPGA 3R05A 2V09A 5EFUA 5FUIA 4BB3A 1JYCA 3I3DA 1QQP1 3RZJA 4UWDA 3MYXA 4AGGA 3HQRA 1XBFA 3M3IA 4FTBA 1OSGA 4NUBA 1PIV3 4MUVA 3C7OA 2VMEA 1HKDA 3AYEA 1DQ5A 1N3QA 5FMBA 2PAKA 1ZRFA 4CEYB 1J1LA 3HVDA 1UOBA 3K2OA 5I91A 1JW6A 2ZGUA 4IV3A 3THCA 4KU8A 2HEVF 3ACIA 4AHWA 3A4UA 3WQ0A 4WVVA 4GB33 1FNZA 1SFNA 2HWC3 4LHNA 2D5FA 2WUHA 1DHKB 4HLTA 4YWAA 2R1BA 5AC92 1DQ1A 2ZZQA 2DUOA 1CZTA 4N90A 1ENQA 4RQPC 4XPVA 4CPBD 2D6MA 5LA1A 4AG4A 5FZIA 1JYXA 1HLCA 4IXLA 4QGMA 5JVVA 4TZDA 2IXJA 1WUVA 3IMNA 5A6YA 4BMBA 4CU9A 2IFWA 2QBXA 4JGYB 2BPA2 3PUIA 3POWA 1QEXA 2ZAHA 1YEWA 1LEDA 1QJU3 4LUKA 5F5CA 1I9RA 1OUSA 3IPVB 4AVSA 5JOXA 2VD7A 4P9JA 2DF7A 4QU1A 3O1PA 4AEKA 4XF4A 2O14A 3OBAA 4HOOA 3QOPA 4Q4V1 1FMD1 1GICA 1PVC2 3AZVA 4XCAA 5APAA 3VBOB 2C6SA 1J3PA 4YW6A 1GU3A 1UX7A 4HMZA 3KSCA 3C2UA 4M3CB 4H14A 1HQLA 5LBCA 4YM0A 4AHZA 4D69A 2G9ZA 5LEJA 1QNYA 2VQ0A 1HRI2 3WNLA 1RMU2 4JTNA 1NCRB 2ZX2A 1W6MA 1Y9MA 4HK8A 4LA2A 3OTFA 3CZJA 3KV5A 5JSOA 5FYHA 3RZHA 2J7MA 2ATFA 3GZUC 2ZCWA 5FPZA 2WWUA 3ZN6B 3I3MA 4LBQA 3VZOA 4QXKA 3AP4A 1BQPA 4O9EA 4AQTA 2K2SA 4BYYA 2ZEWA 2W1WA 2XVKA 2WNVC 5EYXA 4CCOA 2PA7A 3ON7A 1QQP2 1GBGA 3PVNA 2O0OA 2A71A 3INAA 4XQDA 3WF1A 5BNNA 1S2BA 1W04A 3M1HA 3CJIA 3NV1A 1SCRA 5J1XA 4DZGA 1GR3A 1DLLA 2GSYA 3J7NA 3O1OA 4CA9A 2GMPA 3FFZA 4P9YA 4CCMA 2K0GA 2R30A 1HB1A 3T2OA 4PLOA 4ASKA 3H1YA 2DV9A 3CU7A 1GWMA 1PK6C 3VDDB 3WQ1A 2PMWB 5IT6A 2FMYA 3C7GA 4XACA 4DEVA 1GOFA 2JD4A 3OJBA 2ET7A 3K3OA 1WZXA 3B00A 4GD4A 4JGYC 1RTVA 5KHHA 3ZKUA 2HH9A 4QX8A 3KHBA 5FYIA 2Q1MA 2W68A 3LQCA 2VMHA 4MHUA 1MPXA 4CP0A 1DF0A 5C8CA 5L9BA 1FOD1 4R9AA 5D1IA 4KG8A 4LUMA 4XOGA 2RDRA 3JB8A 3KZ4C 2VMFA 3RDIA 1VAMA 3PUAA 1JH5A 4PIXA 3WNKA 3B9CA 3CJXA 2IUWA 3LE0A 4MX3A 3EYPA 4Q4V2 4ASMB 1FMD2 3VKOA 4CP9A 2XPJA 1XE0A 4LBKA 4J25A 2HLEA 2JECA 1PO23 2LM3A 3PIJA 1NCRC 1RUOA 4MGSA 1UN1A 4YYOA 4CCCA 5GZDA 3EHKA 1S0BA 4S2FA 4XJUA 2N7GA 4UW4A 5FZOA 1LR5A 2WBKA 4L8QA 3ILRA 5FMDA 3ELNA 1R1A1 1TZOA 4XJ9A 1K5MA 3O1MA 2R16A 2AEYA 1WBFA 3WSOA 3IAPA 4P00B 2WFPA 1REFA 4CU7A 1GYKA 3KVBA 5FOBB 1W2TA 4Y1XA 4EYUA 2LS6A 1TME3 2PHFA 2X10A 1PM7A 2X05A 2WS91 3EMRA 4K40A 4XVHA 1EY2A 3AK0A 3H3LA 2A6YA 4FVVA 4UF0A 2WA4A 3S7EA 2C9KA 4YGBA 3UNPA 1ND3A 3VBRB 1W9TA 1WW4A 3LDKA 3LDRA 4I09A 1TEIA 1W6MB 1VMJA 4P08A 3VDDC 4ZU7A 4MXWA 2JKXA 4Z8BA 3T1LA 3ZYBA 4XE9A 3HN1A 1R083 4LBQB 2B39A 3RZKA 4H2AA 4M4RA 1RUI3 2YXSA 1PGL2 1UW8A 2VVDA 3GZTB 4D6SA 5FPXA 3CQOA 2BJSA 2GH8A 4XDOA 4F8AA 4YGDA 3BB6A 2DFBA 2W1QA 2FHRA 3GZAA 4BA6A 1EAH1 1G9AA 1UZYA 1V6KA 1DYPA 3CJIB 4OI0A 3I97A 1QKQA 2RR11 1LJ7A 2TBVA 2OIIA 1JUHA 3M3QA 4K6BA 1LGNA 4AEJA 1QOSA 4ZZ5A 4FPHA 4JGZB 1G86A 2IVJA 4QM8A 5F2SA 3MIBA 4ITCA 1FOD2 4CE8A 4JV4A 1MVEA 5IWFA 1W39A 3D5OA 1DGRN 4OHXA 1JU3A 4SBVA 3KB5A 3MIGA 2VQAA 1UY2A 3RJ2X 1BJQA 2F4PA 1AL0G 4XUPA 4GZ9A 4YFWA 2HWF3 1XE7A 5JLVA 4DMIA 4YZ5A 2W47A 1VBA1 1NKGA 1RUF1 1MEC1 2VZOA 1QJFA 1SZBA 4ZXKA 3W5MA 4Q0VA 2IWGB 5I0SA 3S57A 3WLUA 3IBMA 3MEPA 2ARBA 1J83A 1RUD3 2VU9A 3OPWA 1JI6A 1Q8QA 4LKEA 3L9JT 4UFMA 4YVWA 2JDMA 2WT0A 4ORFA 4P9LA 5FY0A 3I2FA 3WP5A 1JZ5A 3SHRA 1W6NA 3SH3A 3LFMA 4CDXA 2FZ2A 1R1A2 2W87A 3W59A 1NE4A 1CZVA 2W1SA 3I4IA 4BE3A 2H6BA 1QDOA 2LTNA 2VVEA 4KBBA 5FREA 1QIQA 4CP9B 1SLLA 3B01A 4HVOA 2GAUA 4UFHA 4IEZA 3VLBB 2R043 3ZSMA 4NHLA 1VAKA 3NVCA 3VBRC 5DUVA 5FY8A 1AR61 2WS92 3ECQA 1H4GA 1OMIA 5K0UA 4FFHA 1ZRRA 1C8M3 1KEXA 2ZHLA 2LUWA 2DVDA 3GCWA 2FQPA 2GP3A 2P17A 2BZDA 2VZSA 5FZOB 1DDLA 1LU1A 5C5UA 1VMFA 3A23A 3UKNA 1K5MB 3U4XA 5LCWL 2WWSA 2PQQA 5FDBA 4YNIA 2ZGSA 2JD9A 3GHNA 1JHNA 2FCTA 3CJIC 4XBNA 1XC6A 2VH9A 1FAYA 2GNBA 1ZBE3 4YG0A 2J42A 2D5HA 4ONUA 1D4M1 1DLCA 1HQWA 3PL0A 4JGZC 1EAH2 4Z2AA 4QKBA 1A34A 4GMP3 4OUSA 4UOJA 2RR12 3ZPYA 4A2UA 2VY0A 1DCSA 1ND3B 3QH7A 4XJZA 3ZFGA 1SLCA 5JAXA 5FZ3A 1SPPA 1HV1A 3OGJA 4LLOA 3OEAA 1WLTA 3O12A 1UYPA 1B09A 1BK0A 3BN6A 2NZ9A 2WQ8A 3OYWA 1VBE3 4L9BA 4YW2A 5FZFA 3ZVXA 3T1MA 3RNSA 1PVXA 3RGBA 4TTGA 2YBSA 4LMFA 2HBTA 1W8OA 1VBA2 3FHIB 1RUF2 1MEC2 2Z5WA 3GBGA 3O0VA 3LCPA 3DN7A 1ZREA 5I8YA 1FPN3 1QHDA 4QPWA 4C0BA 1PO13 1GQHA 3POGA 1DU3D 2GU9A 1OHFA 2DBNA 3S0MA 3MIHA 3VL8A 2D6PA 1A8MA 4YSFA 5FYCA 3JD71 4LT5A 3A7QA 1CWPA 1ASJ1 1X82A 2DVFA 4U36A 3ZM8A 2QQUA 3DKQA 1IS4A 5DQ0A 3PU3A 2BNNA 1DZQA 3VBUA 2DUQA 1BBT1 3P3PA 4EWAA 4MZUA 4URTA 4NIIA 2OX0A 2FMDA 2ZTNA 4U2AA 3ZFFA 1PNGA 3NO8A 4ZY9A 2BP6A 4YVWB 1ZRDA 4WM8A 1K5MC 3H3UA 1PMJX 2P3JA 4EWEA 5DAXA 1D0HA 4OYUA 4TWTA 5B4NA 5L73A 3F2ZA 2Y0OA 1DGWX 2WFF1 2W52A 3VD9A 4IEYA 5FWEA 1RYYA 5KXCA 3E6BA 2GNTA 5A3MA 3NWKA 4XQWA 4DUVA 1VR3A 2PN5A 2G19A 2D98A 2XXZA 1D4M2 3NNLA 4KNCA 4RFRB 1REEA 3BYWA 5H9PA 2R49A 2FD8A 1ULGA 2CTVA 2GALA 4MSVA 1K3IA 5IVEA 3D8CA 1H8TA 1UIKA 3FLPA 3SISA 3N9PA 5C3PA 1LESA 1O7FA 1HXS1 5F2WA 5FPVA 2VNRA 3THTA 3Q8CA 4FO9A 1JYNA 3EO6A 2BGPA 2ILMA 3GM8A 3RI9A 3N9OA 4QGLA 5FPUA 1CX1A 1VALA 3SQOA 2WO2A 1VLNA 4S2HA 5FZAA 3OSDA 1G7YA 1FNYA 3OGVA 2D44A 5FTTC 2VNGA 2BV4A 3K4ZA 4IUGA 1DQ2A 1WCDJ 5L19A 3PJYA 5IW0A 3T08A 2NLRA 2AEZA 4Y24A 2QDRA 4R9DA 1HX6A 1QJEA 3ORJA 4XHBA 3NNGA 4YLZA 3ZFGB 3VN4A 2WDBA 5CVRA 5IK8A 1J59A 1H9PA 1OQEA 4LPLA 2HWE1 5A32A 4XUNA 3T4HB 2UYBA 3VD4A 4QPYA 5C3RA 1MZFA 2JEMA 4Q27A 1QNWA 1UY4A 3JD72 3RWNA 4K8RB 1ASJ2 1AX0A 1D0GA 1YCIA 2WAOA 3OGGA 5DAVA 2ZX1A 2WA3A 1IS6A 2LW8A 2IXCA 4FOYA 5DXDA 2P4EA 4AAXA 1HRV3 1V9U1 3AKSA 4WBBA 5EHDA 3B3QE 1BBT2 2MNGA 2V5YA 2BNOA 4Q4X1 4XF3A 4YVWC 3UETA 5TSWA 3WP4A 4Y26A 2GP5A 2PYTA 2RE9A 1VAVA 5FWJA 4XFCA 3AJZA 2D6OX 2FCVA 4MGQA 1HDKA 3HJRA 1AJKA 5LW9A 4NAOA 1AZDA 3ZYJB 1RUNA 5FYYA 2L9LA 4V1PA 3I3BA 1JYVA 4CXYA 5A3TA 4FXKB 4AFAA 1YFXA 4N53A 1W3XA 3OOXA 4YM3A 3OBZA 2D97A 4A6SA 1W6OB 4C1WA 5CEHA 1IG0A 2PHXA 3ZXLA 1LOGA 2V4AA 3H1MA 2ZGLA 4FOQA 1NYWA 3I2GA 4QX5A 1C57A 3J8F1 5DG1A 4CEWA 3ZFFB 4DOUA 1OVSA 2Z4FA 2UWCA 2WC2A 3D4KA 4FPJA 4GXLA 5C33A 3I59A 4QXBA 2NM1A 1ZVFA 4WM8B 1UKRA 2DUPA 4ZONA 5LBBA 3JBG1 4OI4A 4WVWA 4XDQA 3LEMA 2RM21 2G9GA 1W0NA 2V4VA 4D7TA 1FATA 2OW4A 5JOWA 2PLV3 3KGLA 2FCUA 1SACA 5T54A 5IAXA 1O4ZA 4UFJA 1W3VA 2GMEA 4OHZA 1JTZX 4Q1PA 5H9QA 5LBFA 3SLIA 1W9WA 3WXPA 3WT3A 4BK4A 5C3QA 1U0AA 2VXRA 3VZMA 1ZZ9A 2WNUA 3UJOA 2RS11 3R0RA 4R8HA 4AVAA 1SLBA 4MLOA 4AGVA 2RJKA 1XU2A 4CDQC 2XLFA 3M8LA 3IDAA 5L9RA 5ERLA 2HWE2 2IXHA 3BVCA 5AVAA 3HT1A 1WWYA 4Q4W3 2CSGA 1QXJA 3MIFA 5HBAA 4LA3A 5A7WB 1QGLA 1QH7A 1R092 5LRSA 2XBO1 1R1ZA 4PBOA 5FZ4A 3BTXA 3AM2A 1V9U2 4XF9A 3T0BA 4Q4X2 3K48A 1MZEA 1VBB1 4YG6A 1AR73 4R9CA 1VB2A 4Q5OA 4IESA 1N1TA 1OH4A 2J1SA 1V00A 2WSVA 1NLQA 2O8QA 2C4XA 1FXZA 4FQZA 1ST8A 1J3QA 2NPIA 2VZUA 4CXWA 1D4VB 2VMDA 3HNYM 4JRAA 3SH5A 2ZXQA 3LA2A 3SKVA 4B4RA 3WHTA 4IV1A 1AYN3 2RS51 3GJAA 3WX5A 3T30A 1Z0HA 1A8DA 2D3RA 3G6JB 1ND2C 2QQIA 2CY6A 2W94A 3ZSKA 1AYM3 4CCLA 4PLNA 4CYDA 5I8TA 4P5YA 1NCQC 5FYTA 3OD4A 4WM8C 4C91A 4NE9A 3PNAA 1XNAA 3MICA 3BPZA 4ZHNA 3MGUA 4DXRA 1UXZA 2QQLA 4MV2A 1WW5A 4KWUA 1L7QA 2VZPA 3JBG2 3A0KA 2RM22 2VGDA 3IAQA 4CZSA 2WINB 2Z2SB 2MHFA 3MO4A 4FP2A 1JZ4A 4FI9A 4R4XA 2ZGKA 1OURA 3CDZB 3DYMA 4FPOB 4UI9L 1AF9A 5FZEA 3WQ7A 5A33B 4NN0A 2XJTA 2QQNA 3GJBA 1S0CA 2ZGMA 3OBRA 4B7KA 4XXPA 4JKLA 3V64A 5IUQA 1OVPA 3S30A 5FRAA 1YUDA 3A0NA 3RRDA 1W8HA 1CVNA 1UYYA 2QQWA 2RS12 4LBQD 4FTSA 3ZDSA 2VCCA 2A1XA 3DCQA 3DECA 1JXNA 2IXLA 1VBC1 3AMPA 4JKKA 3TEWA 3RZMA 2VOTA 5GZGA 3WP3A 2VCBA 3WDTA 4E8CA 2Y33A 3IWZA 5E88A 4Q26A 1AR91 3ZN5A 4RQPA 5FY5A 4BQ1A 3OUHA 3VBHB 3ZXEA 4QQOA 3ME2A 3I3QA 2XBO2 1OBNA 5A7SA 3ZR6A 1WW6A 4DXZA 1WBLA 1W8NA 4GKXA 1VBB2 4OCTA 4HVRA 1SLAA 3LF7A 3AC0A 2P6HA 5JSRA 1TNFA 4YFZA 1LGCA 4D6RA 1JZ8A 5A80A 1RUC1 2RS52 2JG9A 2KM2A 5DDJ3 1XOYA 3TB0A 3TAYA 1L7LA 4BQ3A 1Z7S1 3KCYA 5EZWA 5FP9A 3VHNA 5IK5A 4XJWA 2XWBB 3UGFA 5FO9B 1CJPA 2Y38A 1H2NA 4RGGA 4E4HA 3E5QA 4E4ZA 2VW2A 1Y3TA 4BLIA 3FJSA 4EN9B 1OXCA 3AZXA 2WNVA 3RMXA 4HSLA 4MH0E 1DGLA 2IXIA 5A1AA 4LKDA 5KXBA 3ZIWA 5KBFA 2ZBJA 4IV1B 1JOBA 1VBD1 3UL2A 4L11A
chains in the Genus database with same CATH topology
3E97A 1AX2A 1H2KA 3VZKA 1C3HA 3WDWA 4QPGA 4WVZA 4C90A 1LOBA 5J36A 2HWB3 2UURA 4WM7A 5EWSA 1GKBA 2JKBA 4GMP0 2O8OA 1CAUB 1MS4A 1PK6A 3MDPA 2EF6A 5JCTA 1UL9A 3MF6A 1VBC2 4YM1A 3VBHC 2E6VA 4NO4A 2WT2A 3FWEA 4BIOA 4Q0SA 1CX4A 5JIAA 2RHPA 2CGNA 1DIWA 1AR92 3V0BA 3UKTA 5CU1A 3ZFEB 4DQAA 1UPSA 2XJQA 1O4TA 4G4FA 1A3KA 3CO2A 3WDUA 3EJKA 4LHKA 2WT1A 2ENRA 1VIWB 1NOVA 1WLCA 3RJRA 1Q8OA 4M3CA 3QD6A 3N36A 2DVGA 1RUH2 1W2UA 2DURA 4COVA 1PZ9A 1QXRA 1FX5A 1RUE3 2E63A 3G7DA 2ZACA 1MS3A 1NCRA 2HWD3 3N7LA 2R063 4Q4Y3 4RQPB 4QM9A 3HD8B 4PCRA 1RUC2 3IDEA 3WDVA 3FC0A 4L2NA 1G9DA 2YV8A 2XJUA 4H3WA 1Z7S2 4FOVA 5GZFA 1C8NA 2O1QA 3RYPA 2UWAA 1G9BA 2A6ZA 4EN7B 3AYAA 1U12A 3SCGA 4K21A 1S0GA 3URFA 1C1LA 1J3RA 4IEWA 2TEPA 1N3OA 2QFEA 3U10A 5CBLA 3DV8A 2QZ2A 4CDUC 2DTYA 2JG9B 2ZOEB 1VBD2 3VBSB 4AGRA 5AFBA 3BALA 3ILFA 3RG0A 3VDDA 2OUJA 4XYXA 3POSA 4A7KA 1ZZCA 2CYFA 2QQPA 2EA7A 5BUVA 2NN8A 3JQWA 1NXD1 4HANA 1SBEA 1KITA 4MGYE 1N1SA 1C5HA 3IDCB 4I0BA 2WNVB 3ZFEC 1V6LA 4ZU5A 1ZRCA 5AC93 2WL1A 4FQ4A 3CF6E 1T6GC 3AFKA 2GC3A 2D6KA 2SBAA 4K20A 4QPGB 5T52A 1LULA 1VRH1 4CDWB 4WM7B 1PK6B 4BZ4A 2IXKA 4FPCA 4NOTA 1QH6A 4QQPA 3RMYA 1DGWA 1PVC3 5J48A 3E6DA 2AREA 1BEV2 4L99A 2CV6A 4N7IA 3V0BB 1GQGA 1HRI3 3MPPG 1RMU3 5LK7B 1G9FA 1XNBA 2ZS6B 5CFCB 2FBEA 3USUA 4IQPA 5JSPA 3LA7A 5FO8B 3SCFA 4AVCA 4Q0PA 5DZEA 2E7QA 3ATGA 4DNYA 2FZ1A 5JIUA 1QQP3 1OA4A 4HPKB 1NLSA 2JG9C 2R32A 4XHXA 3VBSC 3VBRA 1CAWA 1DGRA 1OPMA 4IL7A 2NQYA 2PHWA 2BVVA 2A73B 3PHMA 4M0HA 4HZFA 2X5IB 2RS31 1TE1B 4I3PA 2WQ4A 2CGPA 2GNDA 3AKQA 4WV8A 5GLZA 4TLFA 5GKAC 5GM0A 3CNAA 4JGZA 2GN7A 4QPGC 1QJX1 4GIQA 1RITA 1YWKA 3H8UA 4CDWC 4WM7C 1PGL1 4TYSA 3IIAA 3AZZA 3FFQA 5D8AA 4Q0UA 1VRH2 4XBLA 4ES8A 4B4QA 4MGZE 2BUKA 4OHVA 4Q4V3 4P9IA 4B8EA 1FMD3 3O0WA 4OZXA 2A6XA 2DCZA 4RHV1 2R071 3VUOA 1OD5A 2ZJCA 1O3TA 2X8KA 2AZ5A 4HKOA 5EXOA 1XYNA 3VHOA 3LZZA 5CFCC 1KFXL 5EJ3A 5I93A 1POV0 3LSDA 1UKGA 1H8VA 2TNFA 3PVOA 5DZGA 4HETA 1YO8A 2VECA 3MIDA 2E53A 5KHJA 4DFSA 2VG9A 4GULA 1LRHA 3ST7A 5AFEA 1RUJ1 3NKTA 2X5IC 4YZ2A 1YLLA 2IFRA 2XL7A 3GALA 2E7TA 2DU0A 3USUB 2RS32 4KGQA 5FBZA 4DINB 4BM8A 3WV6A 3JB4C 5L36A 5CADA 1ZM1A 1IKPA 1TQ5A 1IPKA 1E57A 5T50A 5J09A 4AW7A 1Y43B 5C6CA 1LHUA 2D7FA 2JE9A 4XFGA 3NAPC 1CAWB 4BMEA 4FPLA 1CN1A 3PMSA 3V0AA 2PHRA 1QJX2 2HEYF 3KLSA 4YW3A 4EJRA 4XJ8A 1FOD3 1IOAA 3AKRA 1PO22 1HIXA 2ZMLA 4I01A 3D0JA 4E2SA 4FPFA 1DBNA 1V6JA 4LO8A 4ASLA 1SBDA 4HN1A 1EPZA 4KL1A 4EN6B 2PAMA 4FT8A 2VOWA 4RHV2 2R0HA 2R072 2EXJA 3ZX7A 4NHKA 1NXMA 1QY4A 1C1FA 4UW5A 1D2QA 4NHMA 4AVTA 4R9BA 2Q8OA 5D8AB 3S6PA 4E27A 3J4UH 1R1A3 1MACA 1NQDA 2X53S 4ES9A 1N1VA 4XFIA 4XILA 1ULCA 1RJ7A 3BCWA 5FQ0B 5JI7A 3LWCA 1KJLA 3LSEA 2SLIA 2WS93 1RUJ2 3H9AA 3UKVA 2HEWF 1AHSA 4ATFA 1RIRA 1XXNA 1DG6A 1LB2A 4KH9A 3MW3A 1NQJA 3UK9A 1O91A 1PMIA 4OHWA 3HT2A 4S2GA 1F5JA 3AFGA 4QQ2A 2ZKNA 4Y1YA 2EALA 4XIKA 3WW1A 3N7MA 5H9RA 5DUUA 3WINE 3ZXGA 1FT9A 4FBFA 1BK1A 1EAH3 2B42B 3VHRA 4PLMA 3AJYA 2VOKA 2RR13 4XMIA 1WCSA 3B5LB 4OFGA 4Q29A 1QOTA 2JE7A 1CPNA 1MQTB 2X29A 1RGSA 5DZFA 2E51A 2B45X 4Y22A 4FXGB 1GLHA 1H2LA 5BNPB 3AMMA 1VBA3 1RB8G 1AL21 1IPJA 1MEC3 1RUF3 2Q0AA 3M4FA 4YARA 3TBDA 4DPNA 3V0AB 2PFWA 4AXOA 5D8AC 2P34A 3LOIA 1BKZA 2BFUL 3THPA 4CDQA 3O14A 4JCKA 2RMU1 2WQZC 3BOWA 3M3EA 2BGCA 5KWRA 4KWJA 4Z2WA 3AKTA 4AEDC 1AR63 3TWIA 3WG3A 2B46X 4RS5B 3WY6A 5KHGA 1H1MA 1ZZBA 2JJ6A 2PHUA 2VVFA 4LBJA 3V65A 4FSJA 1W6OA 3IDBB 1G6NA 3TNQA 2WSUA 1ND2A 2EXHA 4YZ1A 1A78A 2ETEA 3MW4A 2UY9A 1NCQA 1D4M3 1G8WA 2CGOA 3MW2A 4H7MA 3BIWE 2W39A 3L2YA 4QD2A 3TN91 1LHVA 3TYJA 1MQTC 2GC1A 4YM2A 5BPXA 4QHBA 3B69A 4JRLA 4FPKA 5CNAA 4HK9A 1CAVB 5BNPC 1FPN2 1OA3A 3LOBA 2XH6A 1RINA 1QJY1 1HV0A 1UX6A 4A7ZA 1V6NA 2GC0A 3N3HA 3BOPA 1AL22 3QACA 5KXDA 2D93A 2B8MA 5E16A 3ZMNA 2VPVA 5C4WC 1YYNA 3KCCA 1X36A 2RMU2 3JD73 4JDOA 2ZGQA 1ASJ3 4XQ4A 4Y22B 1BMV1 2P3KA 5LK5A 1EV11 3PLQA 5FO7B 3WP6A 4JTOA 4XIOA 1NY71 4RS5C 1Q56A 4FCAA 1BBT3 1OLQA 3PTYA 3KCXA 1LOAA 4UBHA 4C1XA 4NVPA 2BTVC 1LTEA 1V6IA 4ZU4A 4CDQB 1R091 4I30A 2VMIA 3AYCA 1CAXA 1J58A 2WFF3 4PQ9A 4P9GA 1N1YA 5JOZA 5FFOC 1PGSA 3VKNA 3H50A 1GANA 1ZBA1 3D0SA 4YGCA 1X8EA 4B4PA 4JVAA 3FUQA 3U11A 4BPZA 4BLJA 3TN92 2C9AA 1LHOA 5JOYA 3MF9A 1GZCA 4XZPA 5A33A 1HXS3 3ZXAC 1I5ZA 2DVBA 1WW7A 3SITA 2ZGTA 1LGBA 3DUIA 2ZAAA 3GNEA 3VGIA 1OFSA 2QNKA 2Y26A 3KT1A 1QJY2 1V6OA 4AVVA 1ND2B 1JYIA 2ERFA 5C9AB 3K51A 1NCQB 4Q4W1 1QXPA 3ZSLA 3E5UA 2BVBA 1XQNA 5J3UA 5K9YA 2UY8A 1POV1 2ARXA 4UW3A 3VBHA 4HKLA 1YFUA 2HWE3 4FPGA 1BXHA 1ENSA 1BMV2 2D3PA 1EV12 3AKPA 5F9TA 1NY72 1V9U3 2F6BA 2WNEA 2E7AA 3AP9A 4Q4X3 1GNZA 2EAKA 3HQXA 3R4SA 5CG9A 3HIFA 1GV9A 2ZPXA 3H0OA 4H7LA 4XEZA 3UV9A 3VBFC 4CTEA 4YW5A 1RUG1 2AUYA 1H1IA 4FPYA 1H2MA 2QCSB 2ZX4A 3ZYPA 3ZXFA 1YFYA 4Z1VA 4XBQA 2MEV1 3GBWA 5BY5A 3DPRA 3ES1A 4IEVA 4CRQA 2AGSA 5JWPA 4TSVA 3WNXA 1OFNA 1ZBA2 1TMF1 3J8F3 4HT1T 2KXLA 2PLV2 3OBTA 4GH4B 5T3NA 1YJKA 4A7YA 2WLPA 2I45A 2GN3A 3JBG3 2RM23 3OPZA 2XHKA 4XFFA 1A6CA 2W08A 1CAXB 5C9AC 2R1DA 4CDUA 3UJQA 5J7MA 5C8WA 1CAUA 4NPRA 4XETA 4Q0QA 4K9SA 3H3ZA 4LO5B 1V6MA 4Q4W2 2BWCA 3RZZA 2A3WA 2RS13 3ZXKA 1DFQA 5FCCA 4ISQA 1EP0A 4AFMA 5BNOA 1AJOA 3ZFEA 3FBMA 1ULEA 3OY8A 2JXAA 4FP3A 4QGNA 4R4ZA 4Y4YA 1WLDA 5SV5A 4HN0A 4AQSA 4PJYA 4D3WA 1GZ9A 3WG2A 2XBO3 2AR6A 1AR81 3JZVA 1V70A 2NP0A 1SMVA 1VBB3 5KC5A 1NA1B 4M0NA 4SLIA 3ILNA 3I54A 3AB0A 1RUG2 5HCBA 4AVBA 2WZR1 2I2SA 1SLTA 4JDMA 4W6YA 5BV6A 1AVBA 1MS1A 2H6CA 2RS53 1ZZ7A 2MEV2 4DY3A 4GH4C 4XFAA 2I07B 3FBYA 4F7ZA 4A3XA 2P3IA 2Y0IA 1OOPC 1RUH1 2QJVA 1MS5A 1TMF2 4J1XA 3TRSB 4BH9A 1WGPA 3X29B 1MVQA 3JCIA 3ETQA 3VBSA 2YPJA 1HQNA 4HFSA 4RD7A 1MZ6A 1Q3EA 2XJRA 3AXDA 1CQ9A 3RI8A 3DPRB 1F8VA 3WUDA 2YDEA 3B94A 2XUMA 1I1EA 1IS5A 2HJIA 1O3QA 1REDA 4MXVA 4AQ6A 4MVTA 2BNMA 2CAVA 5T5PA 1VBC3 4AYUA 4N43A 5BNQA 4I02A 1RHI3 5E89A 4CDUB 1L3JA 4CDWA 1H4HA 2R6QA 5K8SA 1NG0A 2WKKA 1IS3A 1NA1C 4L92A 5I8SA 1AR82 1COV1 1GSLA 2D6LX 4Q4Y1 1XYOA 4MGIE 3OCPA 2YZ4A 2B5HA 2C5DA 1S0IA 5BNOB 1ZZ6A 3OY8B 2YYOA 4E4DX 2WZR2 4BWOA 3MLJA 3KMHA 5CFCA 1RUC3 2G4IA 2JG8B 2EIGA 3U07A 2DFCA 1S0JA 5FLJA 3WW2A 4X8NA 5I0TA 1Z7S3 1I6XA 4GA9A 2AENA 3NJZA 5J98B 1O5UA 1RVF1 5F1RA 4B29A 4HPKA 1W6PA 1BEV1 5FLHA 1Q8PA 1KS4A 3AXEA 5DUXA 4E9KA 2XKOA 1KS5A 3ENRA 3DPRC 2VNOA 4XXAA 2JICA 3DKWA 3GYDA 2W0XA 2X5IA 4XTPA 1RJ8A 4L97A 1DZTA 3WCSA 1VBD3 4GALA 1O3SA 3R6SA 3NKGA 1PIV1 3MLKA 2A7AA 5KC6A 4K3UA 3FX3A 3M70A 2Z69A 3WG4A 2YGMA 4QMAA 3AMQA 2ZZJA 3KGZA 1TNRA 1S0FA 5FLIA 1X7NA 4FAGA 1RL3A 2VUAA 3NAPA 4GB31 2HWC1 4Y5Z0 2XLAA 5ACA1 1FV3A 2DWRA 5BXXA 4C0HA 3WW4A 1WMFA 2Q30A 3MLLA 3ZXDA 1QDCA 3WVJA 1DQ6A 5HI0A 1RUE2 3BU7A 1COV2 3NW4A 4D7SA 5BNOC 4Q4Y2 3AZYA 5IK4A 2Q4SA 1QJU1 2XWJB 4G9SB 1G9CA 4GKYA 4XFHA 5CG8A 5JDBA 4WZCA 1O5LA 5T5LA 3CEWA 4R52A 2JG8C 4N43B 2H0BA 1OQDA 1DQ4A 1F31A 2LALA 4OLLA 4XJAA 1MZ5A 3VKLA 5E8AA 1RVF2 4LBNA 3N7JA 4LNVA 1IGOA 4XW3A 3W58A 2UU8A 4Q1RA 4LHLA 3DGTA 3H7YA 4Q2FA 1PIV2 1W0PA 3NV3A 3KS7A 3U0ZA 4S2DA 3VKFC 1XE8A 1LOFC 1W6PB 4I0AA 3USSA 4BCUA 3ES4A 2OPKA 1UU6A 5T5JA 4LE3A 2QVSB 2XVLA 4GB32 2HWC2 2R0FA 4LULA 4AFDA 5ACA2 3LKJA 4IERA 1BZWA 3M2MA 3AP7A 4GWNA 4KQ7A 4W6WA 1Q8SA 2GC2A 2ZKLA 3N35A 1VRH3 5JPNB 4AWDA 2QKDA 5FMOL 3VZJA 4XTMA 1U5XA 1QJU2 4IEQA 4N43C 4AEMA 4IETA 4META 4KWKA 1B35A 3NAPB 5I0RA 1J1TA 4OVEA 2TUNA 2BW8A 4E4SA 3D82A 1LEMA 1PO21 1XNDA 1GNHA 1Q43A 2XB6C 4PBPA 5GZCA 3ZXJA 3AZWA 5CA6A 3MIEA 4DB5A 4Y20B 1BVVA 2BWAA 3AMHA 1D2SA 1MR5A 1SEFA 4Z07A 5FQ0A 4CEYC 1C5IA 1CGPA 3WHUA 1W6QA 3VKMA 2NMNA 3FLTA 5JR7B 5ABJB 4AEDA 5A3LA 4BOWA 1TME1 4AFCA 5JZGB 2B9UA 4JC1A 1XU1A 2RJLA 1SFYA 4W6XA 2RS33 3SMHA 3FUOA 1YI9A 2OVUA 1R081 3LB9A 1PGW1 1Y7BA 1UPIA 1RUI1 4EN8B 1SCSA 2YMZA 1MS8A 3CL1A 3VBOC 1BCXA 2D43A 4IV3B 1YI7A 1QJX3 3QBQA 2GZWA 3RYKA 1KFUL