1N3PA

Pterocarpus angolensis lectin in complex with sucrose
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
241
structure length
241
Chain Sequence
QDSLSFGFPTFPSDQKNLIFQGDAQIKNNAVQLTKTDSNGNPVASTVGRILFSAQVHLWEKSSSRVANFQSQFSFSLKSPLSNGADGIAFFIAPPDTTIPSGSGGGLLGLFAPGTAQNTSANQVIAVEFDTFYAQDSNTWDPNYPHIGIDVNSIRSVKTVKWDRRDGQSLNVLVTFNPSTRNLDVVATYSDGTRYEVSYEVDVRSVLPEWVRVGFSAASGEQYQTHTLESWSFTSTLLYTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords lectin PAL
publication title Crystal structure of Pterocarpus angolensis lectin in complex with glucose, sucrose, and turanose
pubmed doi rcsb
total genus 51
structure length 241
sequence length 241
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1n3pA00
4YGCA 3UJQA 1UZZA 1GNHA 1W6QB 2DURA 5T5PA 1W6PA 1MZ6A 3C2UA 3V0BA 1CQ9A 1N3QA 1FX5A 1MS0A 4YM2A 1KRIA 2WQZC 1IS4A 1SCSA 5JMCA 2GNDA 3RG0A 1O4ZA 2D6MA 2H0BA 2D6OX 3ILRA 3WZ1A 2D7FA 1VALA 5JOYA 1LOEA 2D44A 2A6WA 4FPCA 5EYXA 3GALA 1Q8PA 4YW5A 4H55A 2ZGOA 3HN1A 1VAVA 3BOPA 2DYCA 2VY0A 1QF3A 1V6NA 1ZM1A 3L2YA 2ZHMA 2ZAAA 3R05A 2D3SA 5KXBA 1V6MA 1QOTA 1CVNA 4UW6A 1GBGA 1CN1A 1HDKA 4XJUA 5HCBA 1AX1A 3O0VA 1DFQA 1IS6A 4XILA 2DVDA 2AGSA 1ENSA 4UW3A 1AJOA 4ASMB 2PHRA 3PVOA 2VH9A 4WZFA 1UX6A 5T55A 3V0AB 5GZGA 3OBTA 3ZSLA 2XB6C 2AUYA 4BLIA 1KJLA 4FPKA 1G9DA 1DZQA 3W59A 3N7JA 1QKQA 2D6PA 1DQ1A 4ZKTB 3T2TA 1BYHA 4Y1UA 1YRZA 4FPEA 1GANA 5H9QA 4CRQA 3ZSJA 2WSUA 2A75A 3MPPG 3WDXA 1V6KA 5CAZA 1ENQA 2CNAA 3AX4A 5IK7A 4BOWA 3B00A 3FUOA 5DUVA 2PELA 4M3CA 3WOGA 2ZMNA 3M3OA 2VXRA 1AXYA 4Q1PA 1H30A 1X50A 1LTEA 2AR6A 4FPYA 1B09A 4HANA 3ZSMA 1JOJA 1W0PA 2WKKA 2A5ZA 1W6PB 3I8TA 4PQ9A 4XDQA 1OKQA 5E88A 4Y1ZA 4YZ4A 3RMXA 3IKWA 3WV6A 1RIRA 2WT2A 2GNMA 4NO4A 1S0BA 1URXA 2GNTA 4XYXA 4FPLA 1LHWA 2YROA 1JN2P 3INAA 3WUCA 3T1LA 2TEPA 3IMNA 2ZKNA 3QLQA 3B69A 1JBCA 4YZ5A 1Q8SA 2D6KA 1UKGA 4ZXKA 4NOTA 4TZDA 2YV8A 5IK5A 3BIWE 3AFKA 4Q8KA 1WLDA 3JUUA 3NV3A 4XTMA 4K1ZA 5GLWA 5DZGA 4R9DA 2JD4A 4P9YA 3R4UA 4LBQB 4K1YA 1DQ5A 1DYKA 1V6LA 2R1BA 2ZGSA 4ITCA 3ILFA 4AGVA 4U2AA 1W6QA 1ULCA 1DLLA 3OJBA 1JUIA 1UL9A 3PVNA 2W08A 4LBNA 5JOZA 5GJ6A 2D43A 3B9CA 1YYNA 3N3HA 2GMPA 1XQNA 2JE9A 2P37A 1MR5A 3BODA 5IUQA 3MW2A 3SNMA 1AXKA 4DPNA 5T5OA 4BMEA 4Q2FA 2UURA 1WD3A 4K20A 3WG2A 4DRVA 1BXHA 2ZABA 5JLVA 1GKBA 3ZXFA 1Z78A 1SFYA 2P34A 4XIKA 3D4KA 3AYDA 1PZ7A 3ZVXA 3AZWA 3LCPA 4FOQA 1GZCA 4Y1YA 1IKPA 1LESA 2E53A 2PHWA 4PBOA 1JYCA 5GZEA 2Q5TA 1VAMA 2EF6A 1QNYA 2V73A 4MYEA 1ULDA 2DVGA 3VKMA 4C1WA 4XJZA 4BM8A 3V0AA 1V6IA 4HL0A 3D6EA 5FRAA 4UW5A 2AREA 1S0IA 3VKOA 5IT6A 3AXDA 2EXHA 1N47A 2ZBJA 5SV8A 3IPVB 1FNZA 1G86A 2FMDA 2EXKA 2P2KA 5DZEA 3JU9A 3Q9OA 3W58A 3ZXJA 1WW4A 5IK8A 2WNEA 1N3PA 3HMYA 4BMBA 2DVBA 2NP0A 1LOGA 2AENA 2GMEA 4XBLA 4XBQA 4JCKA 1FV2A 1S0FA 3RS6A 2GALA 1F31A 2UWAA 4LBJA 3APBA 1V6JA 4L8QA 5GZCA 1G9BA 1MS1A 4XBNA 2ZGTA 2DVAA 1RINA 2SBAA 5GLVA 2R0FA 1QNWA 1LEMA 4AVSA 2A71A 1MZ5A 1FNYA 1S1AA 2UWBA 2ARXA 1V00A 2EXIA 3UJOA 2AH2A 4Q8LA 4AWDA 4WVVA 2I2SA 5JOXA 2ZHLA 2ZHKA 1JW6A 4XMIA 1C1LA 3WNXA 3A0NA 4LBQA 5GALA 1WUVA 4DS0A 2DTYA 3I4IA 4OZXA 1AX0A 3NV1A 3POWA 1HLCA 1WCSA 4Z8BA 2A3YA 2OW4A 4WV8A 3WUDA 2E7QA 2ZMKA 1G9FA 3FLRA 3LSDA 4GXLA 3NV2A 1LOFC 4XHBA 1ULFA 1CPNA 3U4XA 1MVQA 3WCSA 4I30A 2NZ9A 2ERFA 1S0CA 1GNZA 1SCRA 2D6LX 1GZWB 1SACA 2D3PA 4WVWA 1IOAA 1GZ9A 1KITA 2R49A 4YG0A 1BQPA 2ZGRA 3VKFC 5JDBA 2VW2A 1Q8QA 1SBEA 1S0GA 3FBYA 3VKLA 4JC1A 4Y20B 2WSVA 5LK5A 3ZYPA 5CA6A 3WG3A 2ZGKA 3AXEA 1G8WA 3WG1A 2A3XA 1J1TA 2DVFA 1R1ZA 2A6VA 2R1DA 1LOAA 3KQRA 1LHOA 1PZ9A 2OVUA 4BLJA 2V5YA 2DUPA 2YY1A 3O12A 1H9WA 5CBLA 4DRRA 1Q56A 3PJQA 5DG2A 4PBPA 1Q8OA 1IS5A 1GV9A 2A70A 1MS9A 4GWNA 3IPVA 2DU0A 2Z42A 5GLTA 5F5QA 2VW1A 1CONA 3M2MA 1SBDA 2ZGLA 2A7AA 2D6NA 4W65A 3VUOA 4AVTA 2CYFA 2WLQA 2EAKA 3WCRA 2B7YA 3HR9A 2RHPA 5KXCA 4UW4A 1U0AA 4R9CA 4FVVA 2E51A 1QDCA 4Y22B 3VV1A 1SLTA 5T5JA 3WVJA 1F5FA 3IM0A 4XXPA 1W6MB 3CNAA 5T5LA 1G9CA 4LBLA 4M3CF 1AZDA 1MS8A 2DUOA 3AP6A 1Y7BA 2GN3A 3KM5A 2OUHA 1ONAA 2SLIA 3SH5A 5H9RA 4F83A 1AJKA 1G9AA 1MACA 2E7TA 1CJPA 3H0OA 3TAYA 2NM1A 3O0XA 3R4SA 4XIOA 2PHXA 3FLPA 4R9AA 3O0WA 1ULGA 2P3JA 1UMZA 3M3EA 1CPMA 4AYUA 1DYPA 1DQ4A 3M3CA 3OGGA 1BJQA 3OY8B 3AJYA 2CWSA 1SLAA 2ZHNA 1JYIA 2W52A 4GA9A 1V6OA 3AP7A 3WHUA 4YG3A 2GMMA 3AZVA 3TB0A 4P14A 5EWSA 1C4RA 4XMAA 2ZACA 2DU1A 5CB7A 3OPZA 1W6OB 1SLCA 3POSA 1AF9A 1GZWA 1BKZA 4PF5A 2EALA 4YW4A 1DBNA 2UWCA 1KJRA 1H9PA 3AZYA 1CR7A 3ENRA 4XTPA 2WT0A 5H9SA 1DIWA 3AJZA 4Y20A 2JECA 1S0DA 4YFWA 1S0EA 3A0KA 2C5DA 4GWMA 3NWKA 1SLLA 3PMEA 4LBMA 5GZFA 2EXJA 3WHTA 1D0HA 4TYSA 1FYUA 1LULA 5KXEA 4Y24A 3DUIA 3FLTA 3N35A 2NYYA 2ES3A 1W6NB 4FOWA 1FAYA 5H9PA 1WLWA 3RSJA 4U36A 3RMYA 1WLCA 4FP2A 1KQRA 1WW6A 2XG3A 3IN9A 2BQPA 1LOCA 1WBFA 3B01A 1WW7A 1LHVA 4YFZA 2A6ZA 1FV3A 4AVVA 5E89A 3ZXLA 1TEIA 1OFSA 1GICA 4YGDA 2CL2A 1APNA 1DQ0A 2ZA9A 1LU1A 2PHTA 4GALA 1LCLA 4YG6A 1AVBA 4Y22A 1N1VA 4P9XA 1LENA 5GZDA 1W6MA 5T50A 4AGGA 3USUB 4CZSA 4DQAA 1WD4A 2W68A 1QDOA 2JDZA 1N1YA 2R0HA 3DGTA 3PVEA 3N36A 3MEPA 1YI7A 4XXAA 4YGEA 1UN1A 1HQWA 5DUXA 3V65A 1O4YA 1JXNA 5DXDA 4SLIA 5KXDA 1OQ1A 4FPOB 4LBKA 1HQLA 4M01A 1LHNA 3AK0A 2ARBA 1YO8A 1A8DA 1LGBA 2HYKA 2NMNA 2D3RA 5DG1A 4FQ4A 3SH3A 2DUQA 3SITA 1NLSA 1WBLA 3WDVA 1RITA 1MS5A 5HCFA 4D69A 1NXD1 1KDMA 2LALA 3B3QE 5E8AA 5DUUA 4C1XA 5T52A 2E6VA 1A3KA 3A4UA 3M1HA 1QGLA 4XZPA 3RRDA 1SBFA 2DV9A 1MVEA 2JJ6A 3AZXA 3OY8A 4FOVA 1ULEA 1HKDA 3VKNA 4YM3A 4YZ1A 2ZGNA 1FATA 4CTEA 3GNEA 4GKYA 1N1SA 1CESA 5AVAA 2PHFA 1YXWA 4XJWA 3SLIA 1SLBA 1UZYA 1W6OA 4P9WA 5HCAA 1C57A 2A6YA 1VLNA 2ZGPA 4FQZA 4Q27A 1UAIA 1KDKA 5DZFA 1D2SA 3AP4A 4FP3A 5EYYA 2JE7A 3WLUA 3UL2A 3SISA 2ZGQA 2KM2A 1N1TA 3OYWB 4GKXA 3WG4A 1DQ2A 1QU0A 2PHUA 4XJ9A 2DTWA 2ZMLA 4RL7A 3OBRA 5GM0A 2CTVA 3FUQA 2A6XA 3LSEA 1W6NA 4JRAA 1MS3A 5BYNA 2ENRA 4Y1VA 4M3CE 3MW4A 4BPZA 3V0BB 1DGLA 1CIWA 1PZ8A 3D5OA 3NV4A 2VW0A 3WDTA 1LGCA 2W39A 2YXSA 3ATGA 4ISRA 3V64A 3WDWA 5GLZA 1LEDA 3FFZA 5DUWA 1JHNA 4FPHA 4YGBA 1C1FA 2ZGMA 4RA0A 1N3OA 2FHRA 2VUAA 2YZ4A 2WT1A 4LBOA 3AYEA 1EPWA 3BTAA 3ZPYA 1GLHA 4YM0A 4ATFA 1I3HA 1GSLA 3WDUA 1WW5A 1GYKA 4YW1A 1LODA 2GDFA 3ZSKA 2GNBA 5T54A 4XOGA 2GN7A 5GLUA 5JVVA 3USUA 1Q8VA 2WJSA 2P3IA 5FREA 3ILNA 1LU2A 1A78A 1QMJA 4ATEA 1LOBA 3AYAA 4YW3A 4BQ1A 2LTNA 1MS4A 2C9AA 4Y1XA 4FPGA 3ZXKA 4IQPA 2G4IA 2JKBA 1DHKB 1LOFA 1QOSA 3ZXEA 2NMOA 1QOOA 1UPSA 1W0OA 1AX2A 2ZGUA 3AZZA 4XE9A 3RQ0A 4K21A 5F9TA 5IK4A 4XJ8A 3AYCA 4DFSA 3QCWA 4YW2A 5JOWA 3N7KA 4FPJA 2EIGA 1AXZA 4XHXA 1S0JA 4PCRA 5CNAA 3SH4A 1IS3A 1F9KA 1IKQA 2CY6A 3M3QA 3N7MA 4M3CB 4YM1A 1LECA 4YLZA 4YZ3A 4AGRA 4M00A 1I1EA 3ZYRA 5L73A 2R16A 3WDYA 2YMZA 1ENRA 2UU8A 3POYA 4XJAA 5EXOA 3MW3A 3AP9A 1VIWB 3O5SA 2P3KA 4KBBA 4Q1RA 2OUJA 1Z0HA 1G7YA 3UK9A 1BZWA 1LGNA 1LHUA 1LJ7A 3ASIA 3N7LA 2DWRA 2AYHA 2ZZJA 4ISQA 1SLIA 4Y26A 3AP5A 2A3WA 4FPFA 4LBQD 4R9BA 3OYWA 3T1MA 1YIFA 2NN8A 2CWMA 4YZ2A 4Q26A 1ZA4A 2VU9A 4FOYA 1DQ6A
chains in the Genus database with same CATH superfamily
1VAKA 1NY71 3UJQA 1W6PA 3C2UA 4EJRA 4JRLA 4CP9A 2JG9B 4WZCA 2VMHA 2C6SA 3GHMA 1FX5A 3N9MA 5FZ1A 4EROA 4FAGA 1SCSA 2B9VA 3ILRA 3WZ1A 2BVVA 2D6OX 3RNSA 5JMCA 1PM7A 3SKVA 4QAWA 2A6WA 5EYXA 1OSGA 1PMJX 1Q8PA 1YJKA 3GALA 3WEZA 5KHJA 3VD4A 2QQIA 2VMIA 2ZGOA 3KV9A 5FZIA 2NPIA 2DYCA 1CAWB 3BOPA 4LO7A 4N9IA 4XUNA 5FO7B 3TEWA 4B4RA 4AAPA 3L2YA 4CPBA 2RG4A 2VCMA 1OVSA 2WR9A 5C33A 3B02A 4N43C 2VNOA 3VDBA 1XPWA 4LQRA 3CJIA 3ZX7A 4HLTA 4OLLA 4X8NA 3LOBA 1IS6A 4Y3OA 1W90A 3GJAA 4DQAA 1AJOA 1ND2B 4AVAA 5GZGA 3ZSLA 2XB6C 3MLKA 3N9PA 1UOBA 4Z2AA 1DCSA 1LAJA 3LEKA 1BEV2 3W59A 1XU1A 1H4GA 2VZSA 1QKQA 4EZ4A 4P02B 1PVXA 1DQ1A 1AYM2 3DYOA 2JDNA 3GM8A 3I2IA 3ZMNA 3NNFA 3T2TA 2JD9A 5FO9B 4AI8A 3O1SA 3AFGA 5FZ3A 1IG0A 1OA4A 4FPEA 4CRQA 2WSUA 4CDXA 3IAQA 3WDXA 4CDQA 4H3WA 1V6KA 1RJ7A 4Y4YA 4M4PA 2PELA 3I49A 4ZPIA 2RR12 3K3OA 4AHXA 3KV6A 3VLBB 1BEV3 2WN3A 1JI6A 1X50A 2AR6A 1B09A 2JG8C 4E8DA 1AYM3 2A5ZA 1W6PB 4IGOA 4CP9B 1I5PA 4I0AA 5J37A 4Y1ZA 1RIRA 4UYBA 4NO4A 4IXLA 2GNTA 3M7AA 1UMHA 4FPLA 4XYXA 3TBDA 1JN2P 5KHGA 1BLZA 1CAXB 1X9TA 3DEMA 5IAVA 3QLQA 5BNNA 2UYAA 2E31A 2FDGA 2RR13 4NOTA 1W8FA 1A8MA 3MHZA 2K0GA 4HZFA 4J6GA 4MOAA 5ISLA 1RUNA 4XTMA 4K1ZA 4GJYA 4GQ7A 4Q0UA 5CKNA 1WGPA 3ETPA 1QJY1 4ES8A 4XFCA 4FFFA 3CJIB 3ILFA 3RZJA 1ULCA 1W39A 3LWCA 4YW7A 2PFWA 1JUIA 1PO23 1UL9A 2L9LA 2QVSB 2W08A 2O1QA 4RGAA 4DEVA 3MF6A 3TN91 4IEZA 4GMP1 1OUXA 2GMPA 3GZAA 3GF6A 4FAHA 3RZZA 5I8TA 5K9YA 4K20A 4DRVA 2XPJA 1BXHA 3NAPA 4JDNA 4XQ4A 1R081 3VBFA 1XJAA 3RJRA 5A3PA 3KZ4C 1HRV2 1MEC2 4XUPA 4C0HA 3NW4A 1IKPA 2E53A 3KLSA 2ZX2A 4L92A 2Q5TA 4WVZA 4YPJA 1RUG2 4ZHNA 4NWVA 2BWAA 1OA3A 1VBB1 1POV3 5JPMB 2DVGA 3VKMA 3M8LA 3WQ7A 4CE8A 4BM8A 2AREA 2J7MA 2JWPA 2RDSA 5IT6A 3AXDA 3E5XA 1D4M2 2EXHA 4L2NA 2X5IC 2ZBJA 4JGYC 3IPVB 1ND3B 1FNZA 1OBNA 1Z7S3 1MEC3 1G86A 3PTRB 4DUXA 5FFOC 2VOTA 5DZEA 2R072 5FBJA 3P1IA 1W8HA 5BNNB 3HMYA 4UF0B 2DVBA 1JZ7A 1RTVA 3J8F3 4CU6A 4XBLA 1U5IA 3K4DA 4XBQA 3SCGA 3WF1A 3DPRC 2D5HA 5FTTC 2VQTA 1T6GC 4D3WA 3S57A 2UWAA 2BNOA 4QHZA 3CZUA 5GZCA 3SEEA 1G9BA 4YRDA 2YBKA 3MO4A 1MS1A 4CP2A 2QDRA 2E26A 4QT6A 3E6CC 3ZYHA 2BPA2 5FYTA 1FMD2 1FOD2 3LKJA 3DV8A 1QNWA 4W4ZA 5CFDA 4L97A 2VM9A 5A1LA 3B9IA 4MLOA 4OHWA 1HRI2 4LR4A 2WS92 3HQUA 1U5YA 4JTOA 4AHWA 5L7OA 4XMIA 2ZHKA 4ASLA 2BP6A 4GB32 1PNFA 2W95A 4QB2A 1NYWA 5F2SA 3VBSC 3T2PA 2VTFA 4LBQA 4XUTA 4D6QA 1NZCA 4QQHA 4DS0A 1VRH1 3ZFFB 4QD2A 4OZXA 3V0AA 5D1IA 1AX0A 1HJFA 1WWYA 3UETA 4IESA 3H3ZA 1GU3A 4LO8A 1IG3A 4KG8A 3SKJE 3FMGA 2WS93 4QGMA 1NZIA 2NZ9A 3KMHA 2ERFA 4CDWA 1GNZA 1JYWA 3POIA 4GB33 5BNQA 2HWF1 5IVJA 2WWUA 1IOAA 4YG0A 2PA7A 4NIDA 4W8JA 1DZRA 4Y4RA 4LLFA 1EUTA 3VKFC 5JDBA 2VW2A 4XDOA 1S0GA 3FBYA 4ZY9A 1OVPA 5JXIA 5LK5A 2Q4SA 5ACA1 1PO12 2XQXA 5DPNA 2NQYA 5CA6A 1PGSA 1G8WA 5KHHA 1BMV2 3W21A 5IW0A 2A3XA 2ZEXA 2VZVA 1J1TA 3FHAA 3BGAA 1R1ZA 2A6VA 2R1DA 2XUEA 4D6RA 4Q29A 1LHOA 4IV3C 1OUSA 4Q4W3 3ZYGA 4BLJA 4GJZA 4DO0A 3POGA 5FCCA 4DRRA 3PJQA 4YYOA 1GV9A 1TMF1 3ZN6A 4M0HA 4YVSC 4CCNA 4KI5M 4BK4A 3M2MA 1PO13 1HRV1 2Y34A 3POEA 4D7TA 3H42B 5CFDB 4A7YA 4BQ4A 4AFBA 3K48A 4BU2A 4OHZA 2ARAA 1P8JA 3NKGA 2XDVA 1HJGA 4DXTA 5L9VA 4KMQA 3AMPA 3KHCA 1F5FA 3IM0A 2XJPA 4EWAA 1CZSA 2JX9A 1EYBA 3PU8A 4LBLA 4SBVA 2XQRA 3T30A 5IATA 1AZDA 2BTVC 1A34A 4JV4A 2R041 3J7NA 3AP6A 2ZJCA 3WF4A 1AYN3 1UOGA 3MUY1 4MXWA 2JE8A 3VZKA 1WA6X 1AJKA 4IEOA 1G9AA 1PVC3 1CJPA 3H0OA 3KS7A 1X8EA 3WQ1A 2NM1A 4H7MA 5LW9A 4UFKA 3RZGA 3THDA 4JKLA 1W8ZA 3FLPA 4LA3A 5FYHA 2VNVA 3IB3A 5FLIA 4LE3A 1ULGA 3UV9A 1FPN3 2QQPA 3OD4A 5CU1A 5FP8A 1B35A 3PU3A 3R0RA 2XOMA 1TNRA 4X6RB 2B45X 1DYPA 1DQ4A 3OGGA 5FZOB 3RYPA 1BJQA 1JYIA 1FOD1 1E5SA 1AR81 4UI9L 1SPPA 3Q8CA 4S2DA 5FZ6A 3T4HB 2LRPA 4K40A 2J42A 1NCQC 2GMMA 3WHUA 2BDRA 5EJ3A 2AEYA 1H2KA 1EV11 1O5LA 3O14A 4NAOA 5EWSA 1OMIA 3WR0A 1KGYA 1UZVA 3THTA 4AL9A 4HFSA 1W6OB 1GOHA 3POSA 4PF5A 4QHBA 2OYZA 3BTYA 3O1OA 4YW4A 5CKQA 5DAQA 1H9PA 1QHDA 3LA2A 1PK6A 1VBC1 3ENRA 1NA1A 4DXRA 2EVXA 1S0EA 4GWMA 4RS5C 3AVSA 4XAAA 1SLLA 1PIV1 1SG3A 1NAEA 2EXJA 1D0HA 2JDMA 3OB8A 1AR93 3N35A 2ES3A 4FOWA 2VNGA 4HBNA 2RS52 2ET7A 4U36A 3HT2A 3GGLA 4FP2A 3HEIA 2BQPA 1GWLA 1ZRFA 1QJFA 4CU9A 1FV3A 1UOFA 4MXWB 5A6QA 3ACGA 5A32A 4RHV1 2YHJA 2WFF3 3J7LA 3NL1A 4YGDA 5K0UA 1NCRA 2CL2A 4CPBD 1F2NA 2XONA 1W3VA 2VOXA 3JD71 5F6KA 1BMV1 1DQ0A 1LU1A 4PT6A 2W9XA 1H8TA 4UBHA 1TME2 2VGDA 2RS53 4EYUA 1W6MA 5KC5A 4AGGA 3USUB 5F2WA 1ENXA 4ARXA 4CZSA 3NJZA 4Q0PA 1JYXA 2JKXA 4IV1A 1WD4A 4JX0A 2JDZA 2EIEA 5BNOC 1N1YA 4J1XA 4CEYA 3S5AA 4AI9A 2K2SA 3MEPA 4IDZA 5A1FA 5DUXA 1UN1A 4COZA 2MEV2 5JWPA 5DXDA 1XNCA 4LBKA 3OD0A 1HQLA 3WP6A 3AK0A 4XFAA 1TME3 1SDWA 2F6BA 5DG1A 4DY5A 1CX1A 4V1PA 1WBLA 3PLQA 2HWB2 4RGGA 1MS5A 4COYA 4JHZA 4ZU7A 1NXD1 2LALA 5FZ4A 2Z5WA 4F8AA 5DUUA 2ZTNA 4Y5TA 1A3KA 5DAXA 3M70A 5FQ0A 4L9BA 5JZGB 1UO9A 4RR3C 1SBFA 2JJ6A 3E5UA 3VKNA 1ACCA 3T09A 1RUI2 4YM3A 2DCTA 2WN2A 1OF4A 3VZLA 1OXCA 4YVWB 3ZR6A 1CAUB 4R4ZA 1KD7A 4TXWA 2C0ZA 4P9WA 2EICA 2JICA 5HCAA 3BU0A 4OUEA 4FQZA 1UAIA 2WFPA 4QX1A 2JE7A 1NCRB 2NLRA 2VULA 1KFXL 1LKNA 5FYMA 3SISA 4HETA 2QUOA 5C9AA 1JZ8A 4GKXA 3ZR5A 1H8TB 1OOPA 1VMJA 2PHUA 2DTWA 1QH7A 1KEXA 1JYNA 2CTVA 4QPWA 3VBHA 4G3YC 1GP6A 5A3WA 2WDBA 1AUYA 3ME2A 2ENRA 2RS31 1E5RA 4IV1B 2QDNA 4M3CE 4R8HA 2WUHA 4Y1VA 4JQRA 2ZS6B 3WINE 1PZ8A 3QH6A 1J3RA 1OKOA 2VW0A 2UY8A 4GH4B 2W39A 2WWSA 3V64A 1COV1 3WDWA 4AK3A 5C4WC 1OF3A 3FFZA 5FWJA 1V9U3 2PAEA 1VMHA 1C1FA 2CV6A 4N7IA 4YGBA 3RZKA 2W5FA 2YZ4A 3AYEA 1EPWA 2VZ1A 4YNIA 3VBRA 1GLHA 4C91A 3OUHA 1GOFA 4ATFA 3DXUA 3E5QA 2FDKA 1I3HA 1RB8G 1JS9A 1GYKA 1YQ6A 2BRTA 3MFAA 3AKQA 4YW1A 3UGFA 4AQSA 3ZSKA 2X8KA 5T54A 1HV1A 2PLV2 5JVVA 3RZLA 3KGLA 1T6BX 4R4XA 5FREA 3ILNA 1ZREA 3VDDA 2D40A 4ATEA 3FWEA 1NG0A 2C9AA 4FPGA 4FTSA 1MPXA 4IQPA 2BU9A 2YB7A 3I7DA 4E2GA 2VTXJ 4IL7A 1DHKB 4MGKE 4QPGC 1LOFA 2VZOA 1WMDA 2RDNA 3WF0A 3C7EA 2WNVC 3ES1A 2ZGUA 4XE9A 1W0OA 3AZZA 3VHOA 3ZXEA 5F9TA 4IEYA 4XJ8A 4OFGA 2LROA 3C7HA 1ZZ7A 1PNGA 4QWNA 2BNMA 5LBCA 4DFSA 1HIXA 1RHI2 4QB1A 2MNGA 1RUH2 5JOWA 1GZTA 2YBSA 3NVCA 5FLHA 2EIBA 2R30A 3HVDA 4WVMB 4QKDA 4MG2A 4DXZA 3JQWA 1MQTA 1OC1A 3UYJA 4AF9A 3M3QA 1O8SA 4KL1A 2ADEA 4YM1A 4KGQA 3N9LA 4HKWA 4YLZA 2RS12 4M00A 4YZ3A 3VBOC 1UKRA 3O1VA 3LIHA 3JZVA 3R4DB 2Q8EA 2HEVF 5AFBA 4HONA 2OXBA 1HB3A 4HN1A 4XJAA 5T3NA 2VUJA 1RHI3 1D2QA 3JBG3 3M3IA 1RUH3 3NNGA 3OTFA 2P3KA 5LA9A 1ZBA2 2CAUA 4KBBA 3GYDA 2VVDA 4DZGA 3NMBA 4L0PA 2PXJA 5IAXA 2HWB1 3PNAA 4AEDC 3ALQA 5FZDA 4CXXA 2XJTA 2VVFA 3C7OA 4Y26A 2Z4FA 4G9SB 4LBQD 2XVLA 3OYWA 4XCBA 2DCYA 2BGPA 5A6YA 1H6YA 3D3AA 2RM22 5CFCC 4YZ2A 5HI0A 4AQ2A 1ZA4A 2X09A 3P3PA 5IWFA 3MIGA 2YC2A 3W20A 4E9KA 1DQ6A 1RUD2 4WM7B 1YUDA 4YGCA 1GNHA 1W6QB 3FBMA 1ZBA3 1Y3TA 1MZ6A 4Y5Z0 5EQUA 1BCXA 1N3QA 4XF1A 3TEZA 2YC4A 4YM2A 3ZIXA 4ARYA 3WNLA 1AL0G 4Z1VA 4B1MA 1O4ZA 2YC0A 2H0BA 3QH7A 4AI2A 4EN7B 3BN6A 4ZS3A 2FDJA 4Z07A 2JENA 3VD7A 4F7ZA 4PLOA 1RUC2 1XYNA 4UFIA 2ADDA 1J1LA 2UY9A 1XE0A 2X10A 3I2JA 2VMGA 5HPOA 1ZZ9A 3JXSA 5JAXA 1RUD3 1GWMA 1WLTA 1IQDC 4ZZ8A 1W9YA 1UZ0A 3KF3A 3R05A 2D3SA 1W06A 1V6MA 1QOTA 3G6JB 4UW6A 2FZ2A 2WNUC 5F6LB 1GBGA 1UQXA 4XJUA 1HDKA 2Y38A 4K6BA 4NN0A 3O0VA 3KF5A 2DVDA 2WNOA 2VCAA 3PVOA 3LIGA 5T55A 3OPWA 3R6SA 3OBTA 1RXFA 2GP3A 1TQ5A 2OX0A 1G9DA 1MZFA 5CG9A 3RGBA 1RUC3 3ZFGB 3N7JA 1UIKA 2D6PA 3OUIA 2OKXA 3T3YA 1ZBE3 3JB8A 5FPVA 4C0BA 1GMMA 4CUGA 1YQCA 4Y1UA 4JDMA 3ZSJA 2A75A 5IFPA 3WF3A 3LDRA 2PLV1 1L3JA 4QMAA 5IK7A 3AX4A 1VBA1 4BH9A 3B00A 3DL3A 2KR2A 4M3CA 1PGW2 3M3OA 1A6CA 1K5MB 2VXRA 1AXYA 1ODNA 4Q1PA 1LTEA 4FPYA 1NX9A 4O9GA 1HN0A 2I45A 1W0PA 2WKKA 4XDQA 4MADA 4EE2A 2I07B 1EY2A 1OKQA 5E88A 3B94A 1BBT3 2J1AA 5DQ0A 3RMXA 3WV6A 3MV01 3IKWA 4Q5OA 2G19A 1POV0 2GNMA 1X8MA 3ZFEA 5JSRA 2FDHA 1URXA 1W9SA 2G9ZA 3T1LA 2TEPA 1O5UA 3CU7A 4YZ5A 2O0OA 4ORFA 1UKGA 1YI9A 3U07A 2YV8A 3BIWE 3AFKA 4OI2A 3HNBM 3PUQA 4HG6B 1NT0A 4N8MA 1QJX1 3OPTA 3S7IA 3IBMA 2JD4A 5JSOA 4XQWA 4P9YA 2QQUA 1DQ5A 5FUNA 4DINB 5KHKA 4HK9A 5FP4A 4IEWA 5EHDA 4AGVA 4U2AA 2A73B 1XC6A 1DLLA 4X8PA 4NWWA 2R063 5JR2A 1R1A2 4RGKA 4LBNA 4HOOA 5JIAA 4PJYA 1CX4A 2YPJA 5JOZA 1O7FA 4AW7A 1US3A 3KV4A 2O8QA 3UGHA 2P37A 2JE9A 4CXYA 2WWJA 1CD3G 3P6BA 4Q2FA 2UURA 1QJEA 1WD3A 4XFIA 4S2GA 5ABJB 5JLVA 3HWJA 1Z78A 1SFYA 1RUF2 3ZDVA 3WNPA 1CAWA 4BHPA 2RM21 1PZ7A 4BK5A 4LIVA 1GZCA 1LESA 1X9PA 4PBOA 1R1A3 2XMLA 4XFFA 1VAMA 2EF6A 4GULA 3O1TA 1ULDA 4C1WA 1ND2A 3O7OA 2R7EB 3LQCA 3K3NA 5I0TA 3VKOA 5IVBA 1PMHX 1N47A 5A7WB 1LNSA 5SV8A 1C8M1 1F5JA 1GR3A 3ZFEB 3PTYA 5AFEA 1VJ2A 3T4VA 4PI0A 1UMIA 2E7AA 2QQOA 4CDUB 3VD9A 2TNFA 3EHKA 4QB6A 1N3PA 1AL23 1LOGA 2AENA 1C28A 1FV2A 3OGVA 4OUMA 1RUOA 2P17A 3B93A 3T08A 3NJYA 4E4SA 1SMVA 4LBJA 4A6SA 2ILMA 4URTA 4A7KA 3AC0A 4JGZC 2F17A 5HXMA 1H1AA 5LEJA 2SBAA 4RFT0 4XF9A 3GBFA 1ASJ1 3U0ZA 1UD1A 5FMCA 5LA2A 1UU6A 3KQ4B 4AVSA 2A71A 1S1AA 2HWD3 2OS2A 5D8AC 1CAXA 2EXIA 3GHNA 5BPXA 4AWDA 3WQ0A 3KVAA 3UESA 1ST8A 4AXOA 2I2SA 1W3XA 3HIFA 2LM3A 4XURA 4E4DX 1W9TA 1JW6A 5FYYA 1KFUL 2Q8DA 2FBEA 2HWE1 2PMWB 5ANQA 2MPFA 4KWJA 3QBQA 4N43B 5GALA 1Q3EA 2J1VA 4JTNA 4AAXA 4Q0SA 3OGSA 4GMP3 4CEWC 5J36A 1QQP1 1CAVB 2A3YA 3RYKA 2IC1A 2VD7A 5EP9A 3LSDA 1UNBA 3IDCB 3LPFA 1ULFA 1CPNA 4XHBA 3CLPA 3WCSA 1YQ5A 4I30A 3M4FA 4IETA 1S0CA 4QXBA 1GZWB 1HX6A 1YCIA 1SACA 2D3PA 4I3GA 2QJVA 4WVWA 1O3TA 4OHXA 1GZ9A 2R49A 5BNPC 3DN7A 2QQMA 1RMU1 1UU5A 2ZGRA 4WM8C 1NQDA 3WW2A 2HJIA 3VKLA 4JC1A 4Y20B 1JUHA 3NNLA 4A3XA 5FYVA 2ZGKA 4IW3A 1DLCA 4NROA 1XSQA 1SDDB 3WG1A 2QZ3A 4LKSA 5LB6A 4CP0A 5A3OA 2DVFA 1LOAA 3D8CA 4K3UA 3BPSA 2OVUA 4OULA 3T0DA 4X6QB 2DUPA 2YY1A 1H9WA 2JG8B 5FUPA 5CBLA 3I3DA 4B4PA 1Q8OA 1IS5A 1MS9A 1YHFA 4N9HA 4CA9A 4MVTA 4Y5SA 3IPVA 1ND3A 2DU0A 3ACHA 2Z42A 3I2DA 5F5QA 5GLTA 3ZSEA 4COUA 1CONA 1RUF1 1SBDA 2ZGLA 1PO22 3ZDSA 4W65A 5FZGA 3ZYIB 2Q8CA 4AVTA 3OEBA 4UF0A 3WCRA 1SZBA 1NQJA 4MGSA 2RHPA 5KXCA 2YFUA 1U0AA 4FVVA 3DPRA 3K51A 3AMMA 1VBD2 5EFUA 2E51A 1QDCA 1W8WA 4Y22B 5FY7A 2Y60A 5C8WA 2BVBA 3WVJA 2C26A 2RMU2 3D0JA 3KB5A 2VMEA 2PHDA 2WZEA 1GOGA 1XB9A 3MZHA 1C5HA 1QXPA 1WCUA 1Y7BA 4PLMA 4UBGA 2GC2A 1EPZA 2OQ6A 2J1TA 2SLIA 2W91A 3SH5A 2VZRA 1WCQA 3EJKA 4J1WA 1VBD3 1L7RA 5A7NA 5L36A 1DGRN 3LEMA 4K8FA 4XIOA 4N7UA 2RMU3 3POFA 4LIUA 1Z7S2 3CZJA 3VL8A 3O0WA 4NRPA 3SEPA 2P3JA 3VBSA 1UMZA 3M3EA 5J96B 1VRH3 4DUVA 4KQ7A 2XLGA 5LRRA 4FFIA 3M3CA 3K77A 3J8F2 4FXGB 1SLAA 4M4RA 3ZFFA 4GA9A 1W2OA 5AVPA 4YARA 5E1RA 3A21A 5CEHA 4CUAA 4JHTA 2O8OA 4QX5A 3I2FA 2FDIA 1C4RA 1EAH2 4XMAA 4OI0A 2CGPA 2X5IB 4JGYB 3LPGA 4EV0A 1SLCA 5JMOA 1BKZA 4MV2A 3NO8A 3TWIA 3TNQA 4DEQA 1JZ6A 1DBNA 2UWCA 1CR7A 1RYYA 4XTPA 5H9SA 2GU9A 3VBUC 4CDXC 5I0SA 3BUCA 4CDQC 2JECA 1S0DA 3A0KA 1GNYA 4CU8A 3DPRB 4XZUG 1VP6A 4QX3A 3B5LB 4P5HA 1YFXA 1LULA 1W04A 1EAH3 1W6NB 4AEKA 5LEKA 5FWEA 1WLWA 4OHVA 1UOJA 3AM2A 1BEV1 3ZO0B 4XVHA 1QJU3 4FFHA 3BPZA 5SV5A 3VB9A 4DY3A 4CCDA 1AYM1 1C3HA 1LHVA 4B29A 5BUVA 2Y26A 4YFZA 1ZRCA 4AVVA 1JMUB 2Q30A 5K8SA 3ZXLA 1TEIA 1OFSA 1W8UA 4LOTA 4Q4X2 4Q4V2 5FZ0A 1APNA 2ETEA 4XFBA 1ZNPA 2ZA9A 4GALA 1HW5A 4QPIC 4LLOA 4YG6A 4AFDA 2RR11 1LENA 4O65A 3CMGA 3VBSB 5FZMA 5T50A 2R043 3ZKUA 4CVUA 4FT8A 2XR4A 5J3UA 2VL4A 1UYXA 3N36A 3IMMA 3BOWA 4XXAA 4Z82A 4YGEA 4NIIA 1HQWA 4LUKA 4Q4X3 4Q4V3 3V65A 4QXKA 4A3ZA 5A80A 1JXNA 5EZWA 4Q4W2 2B39A 3RZHA 4OCTA 2HYKA 1YO8A 4LO4B 3NAPC 4FQ4A 3VBFC 2DUQA 5F32A 3CHXA 3NQHA 3ZYBA 1RITA 2VXJA 5HCFA 4E4ZA 2XJQA 3BYWA 4D69A 3O1MA 2FDFA 3H7JA 4PDWC 2G1MA 5T52A 3J7MA 1RGSA 5FZOA 3AKRA 1RC6A 2B42B 2DV9A 3RRDA 2XUMA 1E57A 1OFNA 1XNAA 4IV3B 5JSPA 2JDKA 3GNEA 4GKYA 3N4MA 3OEAA 1NCQA 4N53C 5G05L 5FZLA 4A4AA 2IFWA 3U37A 2AEZA 1REFA 4YVSB 1QJZA 1LB2A 1RUE2 1UZYA 1OQDA 1W6OA 2W87A 2XHNA 2ZGPA 2D97A 1MEC1 2XL9A 4Q27A 3L9JT 1D2SA 4FP3A 1XNKA 1AYN2 4LORA 1PIV3 3BTXA 2ZKLA 1RVF2 1W8NA 1IQAA 1W99A 4INDA 3VHRA 2KM2A 1RUG1 4MH0E 2B9UA 1PVC2 1DQ2A 1Q5OA 1QU0A 2B5HA 3J8F1 4NJ4A 4XJ9A 2IZWA 1ZZBA 2X53S 4ZONA 3OOXA 3RJ2X 4MHUA 2A6XA 3I59B 2IFRA 2VECA 3H9AA 3T2OA 1RUE3 3MW4A 3PVBB 1QH6A 1US2A 1D4M1 1DGLA 1CIWA 1FPN2 3KD4A 4UAPA 5HV4A 2VTXA 3V0BB 3WDTA 1LGCA 4AHYA 3D0SA 1REDA 5GLZA 4UFMA 2R071 3USSA 5DUWA 4CYDA 3PIJA 1W2NA 3ROUA 2ZGMA 1RVF3 3CL1A 1N3OA 2FHRA 4LBOA 3BTAA 1QEXA 1J84A 1YWKA 5L7OC 5EIYB 1GSLA 2WA4A 1WW5A 4J25A 5A1AA 5IVCA 2TBVA 4MGQA 5FK7A 1QWRA 5CADA 5F5IA 4LE4A 3BU7A 3WQBA 1W0NA 1I6XA 1PM4A 1R092 2GNBA 2O14A 1QIQA 2IVIB 2W0XA 2WABA 2Y6FA 5GLUA 3USUA 3VL9A 4AEJA 5LWBA 1H8VA 2FMYA 3WW3A 5FY4A 3AVRA 5C8CA 4BQ1A 4B7KA 1FMD1 1QY4A 4HT1T 2G4IA 5FKBA 1NCQB 1AR92 2JKBA 1OHFA 5A7QA 3WNOA 5FV3A 1XNBA 1VR3A 3E6BA 4CDWC 1VE0A 2BJSA 4COVA 1AX2A 1HRI1 2GC1A 2WS91 3UT0A 5DMYA 5IK4A 5A7OA 3AYCA 1R093 4GB31 5F5CA 4PIYA 1L7QA 2WO3A 4QKNA 1AXZA 4RS5B 4XHXA 2BBAA 1O91A 2WFF2 4PCRA 5CNAA 4EZHA 1IS3A 4XUQA 5JZGA 4XETA 3N7MA 1NLRA 4AGRA 3PUIA 5LY1A 1XU2A 1YJLA 3LGRA 4BA6A 2VBPA 2QTWB 2GSYA 1HB1A 2JEMA 3WDYA 5JI7A 2YMZA 1ENRA 4QHOA 2J1SA 2HWC2 4YVWA 5C70A 3POYA 2BNNA 1CAUA 3AP9A 4W6WA 2E63A 4LUMA 5EPAA 4YWAA 1Z0HA 4OMCA 5A6XA 1BZWA 1VB2A 2HEWF 5FY9A 2X05A 2VCCA 4NE9A 1PO11 4BCUA 3MDPA 3S7EA 2AYHA 4HMZA 4RQPC 2A3WA 3MIBA 4GZ9A 3T1MA 2CWMA 5DDJ3 3HBKA 2ZZQA 5FYUA 4FXKB 1H0BA 1NLQA 2HWC3 4ZS2A 1YEWA 2VU9A 4FOYA 3V56A 3LF7A 1COV3 3PURA 1E5IA 1GQPA 1H1MA 2W1QA 4QM9A 5BNOB 4V2WA 1MS0A 1KRIA 4GH4A 4BIOA 3WX5A 2GNDA 5C3QA 2D6MA 1OLQA 2GZWA 2PQSA 4HKLA 4QGNA 2D7FA 1AYN1 1VALA 4XUOA 5JOYA 1LOEA 2D44A 4BDVB 5DAVA 5I0DA 3RYRA 1D4VB 4XF4A 1Y9QA 4O7XA 2XBO2 3HN1A 1VAVA 3EXUA 1H4HA 1S55A 2VY0A 4KWLA 3O1PA 1V6NA 1JU4A 1CJDA 3POBA 4FSJA 2ZHMA 2ZAAA 4Q4Y2 3RZMA 3MGUA 1B35C 2K9ZA 2JIGA 1FPN1 2XVKA 5HCBA 4E2SA 1AX1A 4NPLA 2GP5A 4XILA 4RR3B 5FZHA 1ZRDA 2AGSA 1ENSA 1UY3A 4UW3A 4NMIA 4P08A 3V0AB 3P3NA 4HPKB 4QDSA 4BLIA 3AKPA 4A45A 1DZQA 3CO2A 1CWPA 2Q1ZB 3OF1A 2XBO3 4QQLA 5FBZA 1BVVA 3J7HA 4LTAA 1BYHA 3KCYA 4Q4Y3 2RV9A 1PK6C 2WO1A 1YRZA 5H9QA 4OMDA 2V5DA 2ZX3A 1NA1C 3LE0A 1UZWA 4ONUA 3MPPG 2HBTA 4FFGA 1V9U2 2PN5A 4WVMA 5CAZA 1ENQA 1NE4A 2CNAA 4PLNA 4BOWA 5HV0A 5C3SA 5HXVA 5FP3A 3WOGA 2YBPA 3BVCA 1W03A 3A22A 2Y6JA 1PX4A 3HOBA 3CDZB 3LD8A 4PIXA 3DYMA 3ZSMA 5FO8B 2ET1A 1TG7A 4IE6A 3HNYM 2XJVA 2YGMA 4P9LA 1NE6A 1W8TA 2QNKA 4QXCA 2QCSB 5C4WB 2VUCA 4TN7A 2WO7A 5C3RA 3I3MA 1LHWA 5DAWA 3WUCA 4O61A 1XYPA 4MSVA 3IMNA 5A3TA 2ZKNA 5K0UC 3QOPA 2Q1MA 4OI1A 3WF2A 1JBCA 3ZPOA 1J3PA 2GH2A 1Q8SA 2XKPA 2WFF1 5IK5A 5LATA 5IJRA 1WLDA 3NV3A 3O1RA 3GZEA 4R9DA 2LS6A 2WINB 1U12A 3R4UA 2RS51 5E6HA 2N7GA 1V6LA 4K1YA 1HN1A 1X36A 3S6PA 4WM7A 5JPNB 1W6QA 2PAMA 4CEYC 2F4PA 3PVNA 1I5ZA 4AFMA 3NNMA 3B9CA 2JB8A 1L7LA 2BOJA 4EWDA 5IUQA 1MR5A 2P1BA 1CZVA 1QXJA 3BODA 1X82A 3SNMA 4DPNA 4QPGB 1SFNA 4QQOA 5T5OA 3WSOA 2WNVB 3KSCA 3WG2A 2CDOA 2JDPA 4CCMA 1GKBA 5FYBA 1CZTA 1TME1 2W1UA 4L11A 3JBG2 1JOPA 3AYDA 4XIKA 5K4LA 1XOYA 3ZVXA 4XCAA 3PHMA 2VNRA 4FOQA 3THPA 5GZEA 3ETQA 1H1IA 1YLLA 4EN9B 2Z79A 1QNYA 2V73A 4MYEA 3VBOB 2B8MA 5IYYA 2H6BA 4QM8A 4NPRA 3EYPA 1V6IA 2MEV1 3FL7A 5FRAA 3D6EA 3IDAA 4AHZA 4UW5A 1ZA7A 1S0IA 3ZXAC 1XYOA 3DF0A 2XJRA 4LULA 4GMP0 3ZFGA 3KHBA 2P2KA 4LHNA 5FPBA 3W58A 3K75B 4AEDB 2WNEA 3H3LA 2PYTA 5IK8A 1VBA3 3ZXGA 2RVAA 3KT7A 3HQRA 5C9AC 1UYZA 2D5FA 4JCKA 1OOPC 3K4ZA 4ET7A 2Y6HA 5F3IA 4LMFA 1RUI1 2DCJA 5A33A 1K5MA 3VBHC 5CFCB 4CXWA 5I93A 3ECQA 2ZGTA 4BQ3A 5EV7A 4XDPA 1RINA 4I3PA 5J1XA 1RUJ2 2ZOEB 5GLVA 4JVAA 1NUKA 5D2AA 2R0FA 4FI9A 4P9GA 5FZ9A 3KV5A 1MZ5A 2VR4A 4MZUA 4JZRA 2ARXA 5FAXA 3VBRC 4AEMA 2AH2A 4E4HA 2BGCA 3FHIB 1R64A 1QJX3 4HN0A 5LASA 3IDBB 5JOXA 5DAPA 5IVYA 2WC2A 1C1LA 4GIQA 1ZBE2 1WZXA 3NNJA 4CCKA 5A3MA 3MIFA 3OGRA 3A0NA 3RPQA 3WNXA 1XE7A 1RUJ3 1AR62 2WNUB 1HXS2 1WUVA 3IWZA 4LNVA 1UYPA 3TEXA 5HCHA 4CCJA 3VDDC 4BJ0A 2OW4A 3UNPA 1Y9GA 2E7QA 2ZMKA 4H14A 4LKFA 4DXSA 1G9FA 4GXLA 5IVEA 1LOFC 4W6XA 4LK7A 3JCIA 1UYYA 4QDRA 2JDYA 2D6LX 4Q0QA 3W5MA 2RDRA 4QKFA 5ABJA 1KITA 2KA3A 2KD7A 3FC0A 1BBT2 1VBE2 4B4QA 1KS4A 1AR63 1Q8QA 3RI8A 1HXS3 4XF0A 4AI0A 3ZYPA 2WSVA 3LAGA 1IPSA 1TVGA 3MF9A 2XXZA 5FY8A 1UXZA 2CU5A 2OIIA 1MQTC 4DB5A 4NIHA 5CZKA 2WZR2 2XVGA 5FP9A 5A33B 5AC92 2IXIA 4UT5A 4K7JA 3ZXDA 3I3BA 3H8RA 1YNAA 5JCTA 1ZZ6A 2CAVA 5FPUA 2A70A 4KBZA 2QFEA 5A7WA 1VBE3 4GWNA 5I0RA 1SEFA 2C9KA 2VW1A 5FXWA 1W8OA 1RHI1 2R062 3POJA 1PMIA 1RUH1 2A7AA 2D6NA 2IXHA 4PHZA 4UOJA 3ZYFA 4CDUA 3VUOA 2JIJA 1UY2A 2CYFA 1O6UA 2EAKA 2B7YA 2WZR3 2EAAA 3LOIA 5AC93 1AR73 4P5YA 4NIGA 3VV1A 3TRSB 1SLTA 5T5JA 2RS11 4XXPA 1KS5A 4GWIA 5CVRA 5T5LA 4DNYA 1G9CA 1OQEA 2GC3A 3FFQA 1MS8A 2VO5A 4OZOA 3PUHA 3VZOA 1O59A 2ARCA 2DUOA 1WMFA 5LZ6A 5F39A 1ZBA1 4QKBA 4QQ2A 3KM5A 1Y43B 1ONAA 4D94A 2W2IA 1MACA 4ASKA 2WO2A 2E7TA 1UXXX 5EJZB 5JR7B 3MIHA 3TAYA 1F15A 2XJSA 3O0XA 2XH6A 3R4SA 1J58A 3KT1A 3IT8A 4A44A 5C8CC 4IE0A 3J9SA 5J48A 2GC0A 3H1WA 4TWTA 1CPMA 4BB3A 4OQ8A 1RUD1 5EJ1B 3T0AA 4N43A 2P3YA 3ZKYA 1AL22 2H6CA 3OY8B 4CEWA 2ZHNA 5JIUA 1V6OA 2HYXA 3MLJA 1CAVA 1ZRRA 2Z2SB 4NAMA 2VZUA 3I2KA 1UWWA 4YG3A 3AZVA 2BYVE 3TB0A 2ZX0A 3CJXA 4RFRB 4E2QA 2DU1A 1UY0A 5CB7A 3VDAA 2MHFA 3OPZA 1GZWA 1H2LA 1J3QA 1RUC1 2EALA 2JDUA 2R32A 4W50A 3THCA 3AZYA 2WT0A 2XLFA 4NR1A 1DIWA 1J83A 5L9RA 3AJZA 4Y20A 4YFWA 5A3LA 2C5DA 4YSFA 1EUUA 2HWD2 3CF6E 4IEVA 2RJKA 4TYSA 3WHTA 1FYUA 1KXGA 1OI6A 2VPVA 3DUIA 4Y24A 5FZCA 1TE1B 1POQA 1FAYA 1HV0A 4JGZB 1QJY2 2HBUA 2JG8A 2IVJA 2QQVA 1KQRA 3GJBA 5FR3A 5KHIA 2XG3A 3FHQA 4BQ2A 3KCXA 2BGOA 4EQVA 3E6DA 4IEPA 3PL0A 3B01A 2A6ZA 3TN92 1K5JA 3AKSA 3FJSA 1O3SA 5TSWA 4I2OA 3U4SA 2V72A 5D8AB 5A7PA 4IGPA 3DKWA 2VOWA 5B2GB 1BK1A 2W92A 2WQ8A 2GH8A 1Y9MA 2XL7A 3LDBA 2ZX4A 4MO3M 4QX2A 2PHTA 4B3NA 4MX3A 1R082 1LCLA 1AVBA 1PGW1 4Y22A 4A7ZA 1QJY3 1N1VA 4IERA 4P9XA 3DXTA 5C5UA 3VDCA 5FXVA 2W3JA 5K7PA 3HT1A 4GD4A 2W68A 1FXZA 2P6CA 4LO5B 2BEOA 3TN93 2JG9C 5FKCA 4CEWB 3WY6A 1VBB2 1YI7A 4P9IA 2R061 2DF7A 1ZZ8A 1JZ4A 2YUEA 4SLIA 1OQ1A 1OA2A 4FPOB 4M01A 2IXJA 5FLJA 3BI3A 1R083 2ARBA 1LGBA 2NMNA 4I09A 3HAGA 3IIIA 5CISA 3SH3A 3G7DA 2DBIA 3SITA 5BNPB 1NLSA 1WCKA 3LFMA 2RE9A 1ZZCA 4WM8B 4D8MA 3OBAA 4S2FA 4LHLA 2H0VA 4CCOA 1KDMA 3B3QE 3H1MA 2WIIB 4C1XA 1HB2A 2VAUA 4DIQA 1VBB3 2E6VA 4IUGA 3A4UA 2E9QA 3M1HA 1QGLA 5G04L 1R1A1 3JQXA 5FXXA 3VZNA 1MVEA 3AZXA 3HJRA 5F3GA 2Q8OA 4WBBA 1ND2C 1ULOA 4CTEA 2PAKA 1VMFA 1N1SA 4PQQA 5C3PA 5F3EA 4XJWA 3SLIA 2HEYF 4EN0A 2X5IA 4JGYA 2QZ2A 2OT7A 2VG9A 3TYJA 1K3IA 2IXKA 2VE1A 1EP0A 4LHSA 2A6YA 1VLNA 3ES4A 5EYYA 3SC7X 3X29B 3GZTB 3NSTA 3VBUA 2YU1A 4AZZA 3WLUA 4AOCA 3SQOA 2VZTA 2ZGQA 2FQPA 1N1TA 1AL21 3GXUA 3J4UH 4KG0A 3O1UA 4LJHA 5FYSA 4LT5A 1I9RA 4W6YA 2WQ4A 2QE3A 3OBRA 5GM0A 5IVVA 5LRSA 3AMQA 3FUQA 5FMOL 4JRAA 1W6NA 3ZM8A 3CQOA 1PHMA 4ZZ5A 5BYNA 3BIEA 3PJYA 3GCWA 4URAA 1VRH2 3ST7A 4ISRA 2C24A 4QXHA 1LEDA 1OH3A 1K12A 4FPHA 3RVHA 2OPWA 3WXPA 2VUAA 5I8YA 1W2UA 2WT1A 2YPDA 2F4LA 4YM0A 3ZYJB 2HWD1 1JOBA 2PQQA 2HWF2 5C6CA 4LXLA 4I0BA 4QPIA 1HB4A 4ZU5A 1JYVA 3RFRA 1E5HA 1DGWA 1LODA 2Y0IA 3NJVA 2GDFA 4K9SA 3VD3A 5ACA2 4XOGA 3EB7A 2Y6GA 1Q8VA 2WJSA 5C3OA 3CJIC 1JZ3A 1QXRA 2P3IA 5CG8A 2GAUA 2A1XA 2W1SA 1A78A 1QMJA 2HLEA 1LOBA 3AYAA 1DP0A 2LTNA 1MS4A 1YFYA 2PHLA 2OQ7A 3AMHA 4AG4A 1PGL2 1OLRA 3MICA 2HWF3 1QOSA 2P6HA 2FD8A 5FPXA 2AACA 1QOOA 1TMF2 3RQ0A 4BYYA 4R52A 1QJU2 5FMOS 4TLGA 5ACA3 2WZ8A 1IGOA 5JI9A 4KU7A 1DG6A 3U78A 3VBUB 4CDXB 4P00B 3ZIWA 4CDQB 2YFZA 2EIGA 4PDWA 4KWUA 1LR5A 3ELNA 1IKQA 1K42A 3F2ZA 4AI1A 4NHMA 1LECA 3I97A 3GBGA 1I1EA 3GZUC 1H6XA 4IV3A 4QU1A 2R16A 3U10A 1IPKA 1TMF3 3JB4C 4N53A 2ZCWA 1REEA 4AVCA 1V70A 2IXCA 5EXOA 1YQ2A 1ND3C 2R042 1HRV3 2OZJA 1VIWB 4YVSA 3O5SA 4IEXA 5LBBA 1O3RA 4Q1RA 3IIAA 1G7YA 3UK9A 1LGNA 1LHUA 2WA3A 5JXHA 1LJ7A 3WP5A 1WKYA 2B4KA 1V0AA 2DBNA 4LKDA 3N7LA 5BNNC 1RUG3 4A6OA 5I8SA 2DWRA 2JDAA 1W28A 1ZVFA 3IZOA 3AP5A 1LRHA 3T0BA 3MBWA 1ULPA 4QPIB 2NN8A 5B4NA 4BQXA 3S5QA 1M4WA 2VMFA 5I0UA 4NUBA 1D4M3 3OSDA 1RXGA 3I59A 1BHGA 1OD3A 1UZZA 2DURA 5T5PA 4D7YA 3H1YA 1T2XA 4E8CA 3V0BA 2R073 1CQ9A 1F8VA 4OVEA 3I2OA 2WQZC 3VZMA 3U1XA 1AR82 1IS4A 1F35A 1PO21 3RG0A 2BERA 3PUSA 1EV12 3H8OA 4FPCA 4XFHA 5FPLA 4YW5A 4OQ9A 5F5AA 4H55A 3NAPB 3VBFB 1VBD1 1TZOA 2VOKA 2VQ0A 4ZU4A 1QF3A 1ZM1A 1VBC2 3WW1A 4HVRA 2RMU1 2XGXA 5KXBA 1CVNA 3EBRA 4PDWB 1CN1A 2D98A 3B7MA 1FMD3 1GWKA 1FOD3 1PIV2 1AR83 1Q43A 3I3QA 4N90A 1DFQA 3ZFFC 4NHYA 3OGJA 4ASMB 4Z92B 2PHRA 4WZFA 2VH9A 5C7GA 1UX6A 2HH9A 3EQEA 1EV13 1U5XA 2AUYA 4JKMA 1KJLA 1POV1 1OT5A 1HRI3 3BALA 4FPKA 4N53B 4CCCA 1S4CA 2ZXQA 5LY2A 3H8XA 4XPVA 3MLLA 4KNCA 4ZKTB 1VBC3 4PIZA 2LW8A 1Z7S1 5BY5A 1NKGA 1GANA 1WMEA 5LK7B 4RHV2 4BQYA 5FOJB 4G4FA 2VZQA 3JD72 4QU2A 4RS5A 3FUOA 4XAEA 3C7GA 5DUVA 4D7SA 4BQWA 2ZMNA 4MGYE 1H30A 1PGL1 1O4TA 4HANA 5FZFA 5FYZA 3RWNA 1JOJA 2J1EA 1EAH1 1XE8A 2P5BA 3I8TA 4PQ9A 4XEZA 3KT4A 4YZ4A 2WT2A 3W5NA 1QJU1 4RHV3 5J09A 1S0BA 1JYTA 4H7LA 2YROA 4PF1A 3INAA 4NHLA 3JD73 5CFDC 1H2NA 3PIGA 4QDQA 3B69A 2D6KA 2CSGA 4RQPA 4ZXKA 4DMIA 5L7OB 4TZDA 1FT9A 2W47A 1XSRA 2CGNA 4Q8KA 3JUUA 2XWJB 3CBNA 3PDQA 5GLWA 3UKNA 3WNMA 5DZGA 4C90A 2E33A 2WL1A 4LBQB 1DYKA 2ZGSA 3H8UA 2R1BA 4ITCA 1VPHA 1UY1A 2FZ1A 2ZEWA 1W9WA 4RSUA 2Z69A 3OJBA 5BNOA 1OPMA 1W2TA 1GP5A 3LFIA 1W2AX 1HQNA 3I54A 2QQWA 2D43A 5GJ6A 3TOJA 1YYNA 3N3HA 1XQNA 2VMCA 4I01A 5LCWL 2VMDA 3MW2A 2DCZA 1AXKA 4Q4X1 4Q4V1 5ANNA 4BMEA 4CDWB 4HVQA 2JXAA 2XJUA 2BZDA 1G6NA 2ZABA 2WZPP 1AHSA 3HBZA 3ZXFA 3CIHA 3A7QA 1S2BA 2BUKA 2CGOA 2P34A 4LK6A 3D4KA 5A3UA 1F4AA 3MUZ1 3AZWA 3MYXA 1FI2A 3LCPA 3Q8EA 4Y1YA 2PHWA 2VUDA 1JYCA 4EN8B 4NRQA 4AFAA 3Q8FA 5FIXA 4RR3A 5FY1A 3L2HA 2Y33A 5IHRA 1X7NA 4XJZA 4CU7A 2YYOA 4ZXEA 1Y4WA 4HPKA 1OLME 4HL0A 3T2QA 5DDJ2 4Q4W1 2RS32 1O3QA 3N9OA 2DDUA 3ZN6B 2FMDA 2EXKA 1COV2 4LHKA 5KC6A 1RL3A 3JU9A 4HSLA 3Q9OA 2QQLA 3ZXJA 1WW4A 2VZ3A 1DF0A 3U14A 2YDEA 2CDPA 3N9NA 4BMBA 4O9EA 4E27A 3KWVA 2NP0A 2GMEA 4RQPB 5BV6A 2WRAA 4UXAA 1S0FA 3RDIA 2GALA 3RS6A 3VZJA 2V09A 1XBFA 1F31A 3AL5A 1JZ2A 3K4AA 4Q0VA 5FMBA 2BFUL 2RS33 3APBA 1V6JA 4L8QA 5FOBB 4FTEA 4XBNA 2VCBA 2DVAA 4TLFA 2RJLA 3J26N 5FXZA 1RUE1 4UFHA 4COWA 5CKMA 3GCXA 3Q8AA 5C4WA 3WP3A 3WT3A 1LEMA 1SFPA 3CKHA 2UWBA 3UJOA 1FNYA 2WBKA 1V00A 5FY5A 4Q8LA 3IDEA 4QQPA 3SCHA 4B7EA 1RVF1 4WVVA 4IGQA 2ORZA 2QQNA 1PVC1 3KGZA 4UWDA 2ZHLA 2C1FA 4LOSA 2TUNA 2VVEA 5F8PA 3TEYA 3FX3A 2WYFA 4KU8A 5FK8A 5FZ8A 1B35B 5BXXA 3S0MA 3RWKX 4CP1A 2DTYA 3I4IA 4FBFA 3POWA 2Y0OA 3NV1A 1IPJA 1HLCA 1WCSA 4Z8BA 4WV8A 1SPPB 2WAOA 3WUDA 5FYIA 3FLRA 3NV2A 4AVBA 4HSJA 3U4XA 1MVQA 4QPGA 2I74A 3IAPA 4YW6A 3WD5A 5A70A 1S2EA 1SCRA 2BW8A 2WNVA 2V4VA 2BFUS 3FZ3A 4AFCA 2J1UA 3OBZA 1IHMA 1BQPA 1CGPA 1PK6B 1OH4A 1JU3A 1SBEA 1NA1B 4AI3A 2ZAHA 1YC61 2C4XA 1R091 3SMHA 3HN3A 1UX7A 4K8RB 3WG3A 2LUWA 3AXEA 3OUJA 1PX3A 4I02A 3ZLIA 4FTBA 2W46A 5JZGC 1D7PM 2VQAA 5FZ7A 2Y6LA 2MEV3 4XABA 2XKOA 4MHRA 3KQRA 4OI4A 3FN9A 1PZ9A 3LDKA 4GWJA 3VBOA 2V5YA 3O12A 1AR91 4IE7A 2Q0AA 4YVWC 1Q56A 2RDQA 5DG2A 3VGIA 4PBPA 2AC1A 3EMRA 4PI2A 2ZX1A 2R6QA 1DYOA 2HWB3 3E1F1 5JXGA 3QACA 4QX0A 2WYSA 4MGZE 5A32B 3ITQA 3OG2A 4AEDA 5K0UB 1NCRC 2ORXA 2WLQA 3HR9A 4UW4A 4R9CA 1RUI3 2DCKA 2XWBB 4H2AA 1H8TC 5B4XA 2FCVA 3TNPB 4BWOA 5C5TA 5FPZA 3NRUA 2G9GA 4D6SA 1W6MB 3CNAA 3DKQA 5CFCA 3HQXA 3QD6A 4M3CF 5DDJ1 5FJHA 4OUSA 3C7FA 4IV1C 2HWC1 3LA7A 2BV4A 2ZEYA 4MUVA 1CIYA 3C8XA 4CEYB 5JUVA 2VQUA 4GH4C 2IUWA 2GN3A 2OUHA 2W94A 3OCPA 3U75A 5ERLA 5H9RA 3SXWA 4F83A 4RD7A 3DCQA 1SHWB 5KBFA 4C8DA 4S2HA 1ZYBA 2WAAA 4L99A 3HPNA 2PHXA 3HNMA 3LEIA 4R9AA 3LEGA 4OHYA 3P5BA 2WNUA 4AR2A 5FQ0B 1VBA2 4KH9A 1OLMA 1ZRIA 4AYUA 3AJYA 2CWSA 3NJXA 2AZ5A 2W52A 4NHXA 1VB4A 4MGTA 3AP7A 1M06G 3MIDA 5FDBA 1UF2C 4B1LA 2VJXA 4XF3A 1OD5A 1UPIA 3ON7A 4P14A 5L19A 2ZACA 1W05A 4DOUA 1AF9A 1GQGA 3LB9A 1H2MA 3VHNA 3MIEA 2XBO1 2IWGB 2VBBA 3ABZA 4LPLA 1KJRA 5FZAA 2PLV3 4CCEA 1DDLA 2OPKA 2X29A 3E97A 4Q4Y1 5A7SA 3VN4A 4BIFA 4FCAA 1TNFA 5C9AB 3NWKA 1WCDJ 1OOPB 3PMEA 3KCCA 4LBMA 5GZFA 5IFTA 4EN6B 4A2UA 1GFF2 1QJX2 2VBDA 5KXEA 3VBHB 5H9PA 1BVP1 3FLTA 2NYYA 1JTZX 1UIJA 3RSJA 3UKVA 3RMYA 1WLCA 1GP4A 1UU4A 1WW6A 4NVPA 4NPMA 2IXLA 3FE5A 3MFCA 3IN9A 1LOCA 1WBFA 3AL6A 5C71A 1WW7A 2EA7A 2YU2A 4KWKA 3MV11 5FP7A 2QQJA 5E89A 3NKTA 2OZ6A 1GICA 2DFCA 4QX8A 3VBRB 3N9QA 1V9U1 4JKKA 3HD8B 5DN2A 4HK8A 2RS13 5FYCA 3ZN4A 1JH5A 1OPOA 3I2HA 3ACLA 2QBXA 3GBWA 4XACA 3ACIA 5GZDA 4BXSV 3AB0A 5JXJA 4UFJA 5F37A 3AKTA 2FCTA 3DYPA 4FO9A 4RYDA 4WM7C 5FUIA 3UKTA 2PTMA 5GKAC 4CUCA 1QDOA 2RJ2A 1NOVA 3VDDB 2R0HA 3LZZA 4LKEA 3DGTA 3PVEA 1DGRA 5CIRA 5DABA 1JZ5A 5LBEA 1O4YA 2ID4A 2K46A 1BK0A 1ALYA 5KXDA 4CUBA 5J7MA 1JHJA 4Y33A 1LHNA 1A8DA 4QX7A 2D3RA 1C8M2 1F4HA 2VZPA 3BB6A 4AQ6A 3BCWA 2RM23 1YQ8A 1J59A 4OYUA 3PMSA 3WDVA 2G9FA 3GDBA 4GAZA 2XHKA 1YIPA 2BBVA 4META 5E8AA 3SHRA 1MQTB 3H3UA 3AMNA 4RN5A 2E32A 2EIDA 3WP4A 1DU3D 4XZPA 5F1RA 3OY8A 3S30A 1O8PA 4FOVA 1ULEA 1HKDA 1AR72 4EWEA 2WLPA 4YZ1A 3D82A 2ZGNA 1FATA 4LA2A 1OURA 5LA0A 5LBFA 2XLAA 4F3JA 1C8M3 1W9FA 1CESA 5AVAA 1NY72 1STMA 1YXWA 2PHFA 3ZFGC 1SLBA 2Y64A 5A6ZA 1ASJ2 1C57A 5LA1A 4IE4A 5FY0A 3JBG1 1SQ4A 3KVBA 1KDKA 2W1WA 3AP4A 3LA3A 1K45A 3MPBA 2Y6KA 5DZFA 3UGGA 4NHKA 3UL2A 3Q8BA 2Q1FA 4JDOA 5D21A 1WMXA 4IEUA 3OYWB 3VD5A 2ZMLA 4RL7A 4NIAA 1K5MC 2Y8KA 3K2OA 2HWE2 2J1RA 3LSEA 5E16A 3WNKA 2YGLA 1MS3A 3ORJA 4JGZA 4AQTA 4CSWA 3A23A 3RI9A 5CYYA 2QKDA 4BPZA 2HKXA 4DUWA 1ASJ3 3D5OA 3NV4A 4AE2A 1ZX5A 1S2KA 4HVOA 1QQP2 1UCXA 2J22A 2YXSA 3ATGA 4XQDA 2B46X 5FMDA 2JDHA 1JHNA 4IEQA 4NRMA 3WNNA 3WG4A 4RA0A 4JQTA 5FZKA 1C8NA 5D8AA 3ZPYA 1UY4A 4ES9A 3U11A 3K46A 4M0NA 5M0TA 2DFBA 3WDUA 1JODA 3W9AA 2HWE3 4UFLA 3BTZA 1RMU2 4JAAA 5C8CB 1X33A 4CCLA 4LITA 2OA2A 4P9JA 4QGLA 2GN7A 4A41A 4BQ5A 1MZEA 2P4EA 1QQP3 3H7YA 1RUJ1 1LU2A 3C3VA 5I91A 5L9BA 2JG9A 1D0GA 4YW3A 4Y1XA 1XRUA 3PUAA 3URFA 3H50A 3ZXKA 5APAA 1DGWX 3WW4A 2BOIA 1XNDA 4QPYA 3ACFA 4BE3A 4KGGA 4MGIE 1WA4A 2NMOA 1C5IA 2QQKA 5FZEA 1UPSA 4D0QA 2FCUA 2VC9A 1RMU3 3EO6A 4K21A 3ZOIA 3I2GA 5J98B 5ABJC 4LEJA 4Z2WA 4A42A 3ZMOA 5BNPA 3QCWA 1ZBE1 4WM8A 4YW2A 1IZ3A 4MXVA 2YG0A 3ZN5A 2BWCA 3N7KA 1AR61 4FPJA 3MI8A 1DZTA 1RJ8A 1HXS1 2JB4A 1S0JA 4HXCA 3SH4A 4TSVA 1F9KA 2CY6A 4M3CB 5F3CA 4I0WB 3ZYRA 2VOVA 5L73A 1XNTA 2D93A 1YFWA 5F7UA 4XFGA 5KR7A 2CHHA 2KXLA 5FJKA 4B8EA 1XXNA 1NXMA 2UU8A 4BZ4A 3BKZA 1RUF3 3MW3A 3ZFEC 3SCFA 4LO6B 1VRBA 2OUJA 4XC9A 1BBT1 1VBE1 4V2VA 1YFUA 2ZPXA 4BXFA 5IVFA 3ASIA 3CEWA 5FPAA 4CDUC 1ODMA 4BISA 1UW8A 3F95A 5A3NA 5FZBA 1U5ZA 2ZZJA 4ISQA 5KWRA 1SLIA 2UYBA 2V4AA 4TTGA 4FPFA 3I3EA 4HKOA 4IE5A 4R9BA 2WZR1 3VHPA 1GQHA 1YIFA 2ATFA 5AC91 1AR71 1GUIA 4Q26A 3DECA 5HBAA 4XW3A 2ZEZA
chains in the Genus database with same CATH topology
1VAKA 1NY71 3UJQA 1W6PA 3C2UA 4EJRA 4JRLA 2JG9B 4WZCA 2VMHA 4EROA 3GHMA 1FX5A 4FAGA 1SCSA 3ILRA 3WZ1A 2BVVA 2D6OX 3RNSA 1PM7A 2A6WA 5EYXA 1OSGA 3GALA 1Q8PA 1YJKA 5KHJA 2VMIA 2ZGOA 2NPIA 2DYCA 1CAWB 3BOPA 4LO7A 4N9IA 5FO7B 4B4RA 3L2YA 5C33A 3B02A 4N43C 2VNOA 3CJIA 3ZX7A 4HLTA 4OLLA 4X8NA 3LOBA 1IS6A 4DQAA 1AJOA 1ND2B 4AVAA 5GZGA 3ZSLA 2XB6C 3MLKA 3W59A 1BEV2 1XU1A 1H4GA 1QKQA 1PVXA 1DQ1A 1AYM2 3ZMNA 5FO9B 3T2TA 4AI8A 3AFGA 1OA4A 4FPEA 4CRQA 2WSUA 4CDXA 3WDXA 4CDQA 4H3WA 1V6KA 1RJ7A 4Y4YA 2PELA 2RR12 4AHXA 3VLBB 1BEV3 1X50A 2AR6A 1B09A 2JG8C 1AYM3 2A5ZA 1W6PB 4I0AA 5J37A 4Y1ZA 1RIRA 4NO4A 4IXLA 2GNTA 3M7AA 4XYXA 4FPLA 3TBDA 1JN2P 5KHGA 1CAXB 5BNNA 3QLQA 2UYAA 2RR13 4NOTA 1A8MA 4HZFA 2K0GA 4J6GA 1RUNA 4XTMA 4K1ZA 4GQ7A 4Q0UA 1WGPA 1QJY1 4ES8A 4XFCA 3CJIB 3ILFA 1ULCA 1W39A 3LWCA 2PFWA 1JUIA 1PO23 1UL9A 2W08A 2QVSB 4RGAA 2O1QA 3MF6A 3TN91 4IEZA 4GMP1 2GMPA 3GZAA 3GF6A 4FAHA 3RZZA 5I8TA 5K9YA 4K20A 4DRVA 2XPJA 1BXHA 3NAPA 4JDNA 4XQ4A 1R081 3VBFA 3RJRA 3KZ4C 1HRV2 1MEC2 4C0HA 3NW4A 1IKPA 2E53A 3KLSA 2ZX2A 4L92A 2Q5TA 4WVZA 1RUG2 4NWVA 2BWAA 1OA3A 1VBB1 1POV3 5JPMB 2DVGA 3VKMA 3M8LA 3WQ7A 4BM8A 2AREA 5IT6A 3AXDA 3E5XA 1D4M2 2EXHA 4L2NA 2X5IC 2ZBJA 4JGYC 3IPVB 1ND3B 1FNZA 1Z7S3 4QHBA 1MEC3 1G86A 5FFOC 5DZEA 2R072 5BNNB 3HMYA 2DVBA 1RTVA 3J8F3 4XBLA 1U5IA 4XBQA 3SCGA 3DPRC 2D5HA 5FTTC 1T6GC 4D3WA 2UWAA 2BNOA 5GZCA 1G9BA 4YRDA 1MS1A 4CP2A 2QDRA 4QT6A 3E6CC 2BPA2 1FMD2 1FOD2 3LKJA 3DV8A 1QNWA 5CFDA 4L97A 3B9IA 4MLOA 4OHWA 1HRI2 4LR4A 2WS92 4AHWA 1U5YA 4JTOA 5L7OA 4XMIA 2ZHKA 4ASLA 4GB32 1PNFA 3VBSC 1NYWA 4LBQA 1NZCA 4QQHA 4DS0A 1VRH1 3ZFFB 4QD2A 4OZXA 5D1IA 1AX0A 4IESA 3H3ZA 4LO8A 4KG8A 3FMGA 2WS93 4QGMA 3KMHA 2NZ9A 2ERFA 4CDWA 1GNZA 5BNQA 4GB33 2HWF1 1IOAA 4YG0A 2PA7A 1DZRA 4LLFA 3VKFC 5JDBA 2VW2A 1S0GA 3FBYA 5LK5A 2Q4SA 5ACA1 1PO12 5CA6A 2NQYA 1PGSA 1G8WA 5KHHA 1BMV2 2A3XA 1J1TA 1R1ZA 2A6VA 2R1DA 4Q29A 1LHOA 4IV3C 4Q4W3 3ZYGA 4BLJA 5FCCA 4DRRA 3PJQA 4YYOA 1GV9A 1TMF1 3ZN6A 4M0HA 4YVSC 3M2MA 1PO13 1HRV1 4D7TA 5CFDB 4A7YA 4AFBA 3K48A 4OHZA 3NKGA 3AMPA 1F5FA 3IM0A 2XJPA 4EWAA 2JX9A 4SBVA 1EYBA 5FOJB 4LBLA 1AZDA 2BTVC 4JV4A 2R041 3AP6A 2ZJCA 1AYN3 4MXWA 3VZKA 1AJKA 4IEOA 1G9AA 1PVC3 1CJPA 3H0OA 3KS7A 1X8EA 3WQ1A 2NM1A 4H7MA 3FLPA 4LA3A 5FLIA 3UV9A 4LE3A 1ULGA 1FPN3 2QQPA 3OD4A 5CU1A 1B35A 3R0RA 1TNRA 4X6RB 2B45X 1DYPA 1DQ4A 3OGGA 3RYPA 1BJQA 1JYIA 1FOD1 1AR81 4S2DA 4K40A 3WHUA 1NCQC 2GMMA 5EJ3A 1H2KA 1EV11 1O5LA 3O14A 5EWSA 3WR0A 1OMIA 3THTA 4HFSA 1W6OB 3POSA 2OYZA 4PF5A 4YW4A 1H9PA 1QHDA 3LA2A 1PK6A 1VBC1 3ENRA 1NA1A 2EVXA 1S0EA 4GWMA 4RS5C 1SLLA 1PIV1 2EXJA 1D0HA 1AR93 3N35A 2ES3A 4FOWA 2VNGA 4HBNA 2RS52 2ET7A 4U36A 3HT2A 4FP2A 2BQPA 1ZRFA 1FV3A 4MXWB 5A32A 4RHV1 2YHJA 2WFF3 3NL1A 4YGDA 5K0UA 1NCRA 2CL2A 1F2NA 2VOXA 3JD71 5F6KA 1BMV1 1DQ0A 1LU1A 1H8TA 4UBHA 1TME2 2VGDA 2RS53 1W6MA 5KC5A 4AGGA 3USUB 1ENXA 4CZSA 3NJZA 4Q0PA 4IV1A 1WD4A 2JDZA 5BNOC 1N1YA 4J1XA 4CEYA 2K2SA 3MEPA 5DUXA 1UN1A 4COZA 2MEV2 5JWPA 5DXDA 1XNCA 4LBKA 3OD0A 1HQLA 3WP6A 3AK0A 4XFAA 1TME3 1SDWA 2F6BA 5DG1A 4DY5A 4V1PA 1WBLA 3PLQA 2HWB2 4RGGA 1MS5A 4COYA 4ZU7A 1NXD1 2LALA 2Z5WA 4F8AA 5DUUA 2ZTNA 1A3KA 3M70A 5FQ0A 4L9BA 5JZGB 4RR3C 1SBFA 2JJ6A 3E5UA 3VKNA 1RUI2 4YM3A 2DCTA 3VZLA 4YVWB 1CAUB 4R4ZA 1KD7A 2C0ZA 4P9WA 2JICA 5HCAA 4FQZA 1UAIA 2WFPA 2JE7A 1NCRB 2NLRA 2VULA 1KFXL 1LKNA 3SISA 4HETA 2QUOA 5C9AA 4GKXA 1H8TB 1OOPA 2PHUA 2DTWA 1QH7A 2CTVA 3VBHA 4G3YC 1AUYA 3ME2A 2ENRA 2RS31 4IV1B 4M3CE 2QDNA 4R8HA 4Y1VA 2WZPP 4JQRA 2ZS6B 3WINE 1PZ8A 3QH6A 1J3RA 2VW0A 2UY8A 4GH4B 2W39A 2WWSA 3V64A 1COV1 3WDWA 4AK3A 5C4WC 3FFZA 1V9U3 2PAEA 2CV6A 1C1FA 4N7IA 4YGBA 2YZ4A 3AYEA 1EPWA 4YNIA 3VBRA 4C91A 1GLHA 4ATFA 3E5QA 1I3HA 1RB8G 1GYKA 3MFAA 3AKQA 4YW1A 4AQSA 3ZSKA 2X8KA 5T54A 1HV1A 2PLV2 5JVVA 3KGLA 4R4XA 5FREA 3ILNA 3VDDA 2D40A 4ATEA 3FWEA 1NG0A 2C9AA 4FPGA 4FTSA 4IQPA 4E2GA 3I7DA 4IL7A 1DHKB 4MGKE 4QPGC 1LOFA 1WMDA 3ZXEA 3ES1A 2WNVC 2ZGUA 4XE9A 1W0OA 3AZZA 3VHOA 5F9TA 4IEYA 4XJ8A 4OFGA 1ZZ7A 1PNGA 2BNMA 4DFSA 1HIXA 1RHI2 2MNGA 1RUH2 5JOWA 3NVCA 5FLHA 4WVMB 2R30A 4DXZA 3JQWA 1MQTA 4AF9A 3M3QA 4KL1A 4YM1A 4KGQA 4YLZA 4HKWA 4YZ3A 2RS12 4M00A 3VBOC 1UKRA 3JZVA 3R4DB 5AFBA 2HEVF 4HN1A 4XJAA 5T3NA 2VUJA 1RHI3 1D2QA 3JBG3 3M3IA 1RUH3 3OTFA 2P3KA 1ZBA2 2CAUA 4KBBA 3GYDA 2VVDA 4DZGA 2HWB1 3PNAA 4AEDC 3ALQA 2XJTA 2VVFA 4Y26A 4G9SB 4LBQD 2XVLA 3OYWA 2DCYA 2RM22 5CFCC 4YZ2A 5HI0A 4AQ2A 1ZA4A 3P3PA 3MIGA 4E9KA 1DQ6A 1RUD2 4WM7B 1YUDA 4YGCA 1GNHA 1W6QB 3FBMA 1ZBA3 1Y3TA 1MZ6A 4Y5Z0 1BCXA 1N3QA 4XF1A 4YM2A 3ZIXA 1AL0G 4Z1VA 1O4ZA 2YC0A 2H0BA 3QH7A 4AI2A 4EN7B 4Z07A 2JENA 4F7ZA 4PLOA 1RUC2 1XYNA 1J1LA 2UY9A 2VMGA 1ZZ9A 5JAXA 1RUD3 5C8CA 1WLTA 3R05A 2FZ2A 2D3SA 1V6MA 1QOTA 3G6JB 4UW6A 2WNUC 5F6LB 1GBGA 4XJUA 1HDKA 2Y38A 4K6BA 4NN0A 3O0VA 2DVDA 3PVOA 5T55A 3R6SA 3OBTA 1G9DA 1TQ5A 1MZFA 5CG9A 1RUC3 3ZFGB 3N7JA 1UIKA 2D6PA 1ZBE3 3JB8A 4C0BA 4Y1UA 4JDMA 3ZSJA 2A75A 2PLV1 1L3JA 4QMAA 5IK7A 3AX4A 1VBA1 4BH9A 3B00A 3DL3A 4M3CA 1PGW2 3M3OA 1A6CA 1K5MB 2VXRA 1AXYA 4Q1PA 1LTEA 4FPYA 4O9GA 2I45A 1W0PA 2WKKA 4XDQA 2I07B 1EY2A 1OKQA 5E88A 3B94A 1BBT3 3RMXA 3WV6A 3IKWA 3ZFEA 1POV0 2GNMA 1X8MA 5JSRA 1URXA 3T1LA 2TEPA 1O5UA 3CU7A 4YZ5A 2O0OA 4ORFA 1UKGA 1YI9A 3U07A 2YV8A 3BIWE 3AFKA 4OI2A 1QJX1 3S7IA 3IBMA 2JD4A 5JSOA 4XQWA 4P9YA 1DQ5A 4DINB 5KHKA 4HK9A 4IEWA 4AGVA 4U2AA 2A73B 1DLLA 4X8PA 4NWWA 2R063 3S0MA 1R1A2 5JIAA 4LBNA 5JOZA 4PJYA 1CX4A 2YPJA 1O7FA 4AW7A 2O8QA 2P37A 2JE9A 1CD3G 4Q2FA 2UURA 1WD3A 4XFIA 4S2GA 5ABJB 5JLVA 3HWJA 1Z78A 1SFYA 1RUF2 1CAWA 4BHPA 2RM21 1PZ7A 1GZCA 1LESA 4PBOA 1R1A3 4XFFA 1VAMA 2EF6A 4GULA 1ULDA 4C1WA 1ND2A 3O7OA 5I0TA 3VKOA 1N47A 5SV8A 1C8M1 1F5JA 1GR3A 3ZFEB 3PTYA 5AFEA 1VJ2A 2E7AA 4CDUB 2TNFA 3EHKA 1N3PA 1AL23 1LOGA 2AENA 1C28A 1FV2A 4OUMA 1RUOA 2P17A 3B93A 4E4SA 1SMVA 4LBJA 2ILMA 4URTA 4A7KA 4JGZC 1H1AA 5LEJA 2SBAA 4RFT0 4XF9A 3GBFA 1ASJ1 3U0ZA 1UD1A 1UU6A 4AVSA 2A71A 1S1AA 2HWD3 5D8AC 5BPXA 1CAXA 2EXIA 3GHNA 4AWDA 3WQ0A 4AXOA 2I2SA 3HIFA 2LM3A 4E4DX 1JW6A 1KFUL 2FBEA 2HWE1 2MPFA 4KWJA 3QBQA 4N43B 5GALA 1Q3EA 4JTNA 4Q0SA 4CEWC 4GMP3 5J36A 1QQP1 1CAVB 2A3YA 3RYKA 2IC1A 3LSDA 3IDCB 4XHBA 1ULFA 1CPNA 3CLPA 3WCSA 4I30A 3M4FA 4IETA 1S0CA 1GZWB 1HX6A 1YCIA 1SACA 2D3PA 4I3GA 2QJVA 4WVWA 1O3TA 4OHXA 1GZ9A 2R49A 5BNPC 3DN7A 1RMU1 1UU5A 2ZGRA 4WM8C 1NQDA 3WW2A 2HJIA 3VKLA 4JC1A 4Y20B 1JUHA 4A3XA 2ZGKA 3WG1A 2QZ3A 4CP0A 2DVFA 1LOAA 3D8CA 4K3UA 4OULA 2OVUA 4X6QB 2DUPA 2YY1A 1H9WA 2JG8B 5CBLA 4B4PA 1Q8OA 1IS5A 1MS9A 1YHFA 4N9HA 4MVTA 3IPVA 1ND3A 2DU0A 3I2DA 2Z42A 5GLTA 5F5QA 3ZSEA 4COUA 1CONA 1RUF1 1SBDA 2ZGLA 1PO22 3ZDSA 4W65A 3ZYIB 4AVTA 3WCRA 1NQJA 2RHPA 5KXCA 1U0AA 4FVVA 3DPRA 3K51A 3AMMA 1VBD2 5EFUA 2E51A 1QDCA 4Y22B 5C8WA 2BVBA 3WVJA 2RMU2 3D0JA 3KB5A 2PHDA 3MZHA 1C5HA 1QXPA 1Y7BA 4PLMA 4UBGA 2GC2A 1EPZA 2SLIA 3SH5A 3EJKA 4J1WA 1VBD3 5L36A 1DGRN 4K8FA 4XIOA 4N7UA 2RMU3 1Z7S2 3VL8A 3O0WA 2P3JA 3VBSA 1UMZA 3M3EA 5J96B 1VRH3 4KQ7A 2XLGA 5LRRA 3M3CA 3J8F2 4FXGB 1SLAA 3ZFFA 4GA9A 5AVPA 4YARA 5E1RA 2O8OA 4QX5A 1C4RA 1EAH2 4XMAA 4OI0A 2CGPA 2X5IB 4JGYB 4EV0A 1SLCA 1BKZA 4MV2A 3NO8A 3TWIA 3TNQA 1DBNA 2UWCA 1CR7A 4XTPA 3VBUC 5H9SA 2GU9A 4CDXC 5I0SA 4CDQC 2JECA 1S0DA 3A0KA 3DPRB 1VP6A 3B5LB 4P5HA 1YFXA 1LULA 1W6NB 1EAH3 4AEKA 5LEKA 1WLWA 4OHVA 3AM2A 1BEV1 3ZO0B 1QJU3 3BPZA 5SV5A 4DY3A 1AYM1 1C3HA 1LHVA 4B29A 5BUVA 2Y26A 4YFZA 1ZRCA 4AVVA 2Q30A 5K8SA 3ZXLA 1TEIA 1OFSA 4Q4X2 4Q4V2 1APNA 2ETEA 4XFBA 1ZNPA 2ZA9A 4GALA 1HW5A 4QPIC 4LLOA 4YG6A 4AFDA 2RR11 1LENA 3VBSB 5T50A 2R043 4FT8A 5J3UA 3N36A 3BOWA 4XXAA 4Z82A 4YGEA 1HQWA 4LUKA 4Q4X3 4Q4V3 3V65A 4QXKA 1JXNA 5EZWA 4Q4W2 2B39A 1YO8A 2HYKA 4LO4B 3NAPC 4FQ4A 3VBFC 2DUQA 1RITA 5HCFA 4E4ZA 2XJQA 4D69A 3H7JA