1N3PA

Pterocarpus angolensis lectin in complex with sucrose
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
241
structure length
241
Chain Sequence
QDSLSFGFPTFPSDQKNLIFQGDAQIKNNAVQLTKTDSNGNPVASTVGRILFSAQVHLWEKSSSRVANFQSQFSFSLKSPLSNGADGIAFFIAPPDTTIPSGSGGGLLGLFAPGTAQNTSANQVIAVEFDTFYAQDSNTWDPNYPHIGIDVNSIRSVKTVKWDRRDGQSLNVLVTFNPSTRNLDVVATYSDGTRYEVSYEVDVRSVLPEWVRVGFSAASGEQYQTHTLESWSFTSTLLYTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords lectin PAL
publication title Crystal structure of Pterocarpus angolensis lectin in complex with glucose, sucrose, and turanose
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 51
structure length 241
sequence length 241
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1n3pA00
5DZEA 2ZABA 1V6JA 4JC1A 1IS5A 3OBRA 4YGCA 2DURA 1LEDA 3B00A 5DUWA 5T54A 4XBQA 1XQNA 4M01A 1RINA 2PHWA 1WLWA 4XJWA 2GN3A 1LU2A 1SCRA 4YZ2A 1LGBA 2A6YA 2ZGLA 4FQZA 1VIWB 4UW4A 3VKNA 3W58A 4OZXA 2PHXA 2WNEA 4R9CA 3R4UA 3OY8B 3V0AB 3FLTA 1GBGA 1U0AA 2ARXA 1W6QA 4Q1PA 1MS1A 5CBLA 1AJOA 2WLQA 1YYNA 1ULDA 4XXAA 1BYHA 3B69A 1AXKA 4ITCA 4XOGA 5H9RA 1JYCA 4C1XA 1AZDA 1VLNA 5GZGA 4YM0A 2ZGUA 4Y22A 1Z0HA 1JW6A 1N3PA 1F5FA 3V0BB 1N1TA 1GNZA 1Q56A 3MW2A 2PELA 5DUVA 2AGSA 1WBFA 1DYKA 1A3KA 1MACA 5IK5A 3WG2A 1B09A 1FX5A 3HMYA 4H55A 5HCFA 1SCSA 1PZ8A 1W6PB 1Z78A 3TB0A 2ZMKA 1JN2P 4M3CB 1R1ZA 3VV1A 3WCSA 4YW2A 2WSUA 2GALA 5EWSA 2V73A 3N7KA 4FPYA 3R4SA 5T5OA 4FPGA 1FNYA 2DVAA 1V6NA 2EXJA 1QOOA 1W0PA 3PVNA 4U2AA 1MR5A 2HYKA 1W6PA 1A8DA 2D3PA 3AZWA 2ZGPA 4I30A 4WVWA 3Q9OA 4M3CA 2P2KA 4DRVA 4XHXA 3ATGA 3POWA 3FFZA 1ZM1A 4XBLA 5T55A 5IK4A 4DPNA 1ZA4A 2DYCA 2OUHA 1LOGA 2D44A 1V6KA 5IT6A 1LJ7A 2D6OX 3NV3A 4AWDA 1DHKB 1HQWA 1N3OA 1S0CA 5CA6A 3DGTA 5DZGA 1GLHA 3B3QE 1N1YA 5IK8A 1JOJA 1CPNA 5DUUA 3PMEA 1DFQA 3OBTA 3HN1A 3ASIA 1MVEA 4GA9A 1V6MA 4YG6A 5CB7A 1FV3A 3PVEA 4Q1RA 1MZ5A 2VU9A 1G8WA 5H9SA 3VKOA 1SBDA 3T1MA 1WBLA 4P9WA 1UAIA 1KITA 1SLCA 3M3QA 1LGCA 4YW1A 3RMYA 3AZZA 1D0HA 1RIRA 1SFYA 1DYPA 3O5SA 4XJ9A 4HL0A 4YGEA 2A70A 2PHTA 2Z42A 2BQPA 5KXCA 4WZFA 2P3JA 2WKKA 5GLTA 4XIKA 1AX1A 1SLAA 3QLQA 3PVOA 2JD4A 1YI7A 2OVUA 1HKDA 1W6MA 4CZSA 3N7LA 3IMNA 1QNWA 2ZGNA 2JE9A 3RQ0A 1LU1A 5GM0A 4YW4A 4WV8A 2D6MA 3MW3A 1DQ4A 1S0GA 4FQ4A 2A6VA 1WUVA 2ES3A 2FHRA 1S0BA 2AR6A 3AP7A 2A75A 4LBNA 2GN7A 1LENA 3AP6A 3N3HA 4XYXA 4YZ3A 2NZ9A 1SLBA 1CESA 1QF3A 3D6EA 1AF9A 4XE9A 5E88A 2ZZJA 2UWBA 4XJZA 4D69A 4Z8BA 1WW6A 3SH4A 4P9YA 2NP0A 5E89A 2ENRA 2VH9A 1AX0A 1DQ5A 3M3OA 5JDBA 4FPFA 1KQRA 1SLIA 4CRQA 4TYSA 2DUOA 1MS4A 3AYEA 2JJ6A 3WG1A 3BODA 1APNA 2P3IA 4SLIA 3B9CA 3POYA 4Y1UA 4ATFA 3WZ1A 4LBQD 3O12A 2E7QA 2YY1A 4NOTA 4YGBA 1O4ZA 2AYHA 2D3RA 2GNTA 1IS4A 4ISQA 1GZWB 1GZCA 2R49A 4XMAA 4Y20B 4YM2A 1BQPA 2DVDA 1DQ6A 5GLWA 1S0EA 3N7MA 5H9PA 5L73A 1G9AA 4R9DA 4BPZA 1LOAA 2CYFA 4Y1XA 4Q26A 1PZ7A 2AH2A 2GMPA 5CNAA 4PF5A 2PHRA 2DU0A 2WT0A 5IK7A 1GZWA 3BTAA 5T5JA 3OJBA 3T1LA 1SLLA 3UJOA 4AGRA 2A3YA 1CR7A 3WOGA 1MS5A 1S0IA 1YRZA 1CJPA 3RS6A 3FUOA 3OGGA 3OY8A 4YZ5A 3V0AA 2KM2A 1BKZA 2EF6A 1A78A 1ENQA 2ZGSA 1AXYA 3RMXA 4AVSA 3WDXA 1FYUA 2ZMNA 3WUCA 3JUUA 1ULEA 3LSEA 2D43A 1CQ9A 4YW3A 2ZHLA 5DUXA 2DVGA 1LESA 1LHOA 1G9BA 4PBOA 4GKXA 4UW6A 4FOQA 3VKFC 2DV9A 1S0FA 1ENRA 2ZACA 3LCPA 4W65A 3RG0A 5JVVA 1SBEA 2VXRA 5DG2A 4YG0A 3O0VA 5GLUA 3VKMA 2EXIA 2VW1A 3V0BA 2YMZA 1BZWA 4XMIA 1LODA 4LBQB 3WG4A 2NYYA 2RHPA 1UL9A 3MPPG 1GANA 1FV2A 1G9CA 4XILA 4GKYA 4Y26A 2ZAAA 2ERFA 3D4KA 3ZSMA 2NN8A 4RA0A 1GZ9A 4L8QA 4Y1VA 1ULGA 3ZSJA 3CNAA 4KBBA 1AX2A 3ZSLA 1VAMA 4LBQA 1LOBA 5AVAA 3QCWA 1SLTA 3RSJA 4F83A 3ILNA 2EAKA 4FOYA 5GLVA 3TAYA 1LHNA 1QGLA 3LSDA 3R05A 5FREA 1LCLA 4FOVA 1ONAA 4ASMB 5JOYA 4XTPA 1LECA 3M2MA 4K1YA 4FP3A 3KQRA 5GJ6A 1W6OB 3WDVA 1MZ6A 2EIGA 2GMMA 4RL7A 1N1SA 4BLIA 3V65A 3ZXEA 2NM1A 1NXD1 1H9WA 3U4XA 2P3KA 1QDCA 2YZ4A 3I4IA 1UKGA 3SNMA 2V5YA 3IM0A 1JXNA 3VKLA 2YXSA 1S1AA 3HR9A 1CPMA 2AENA 3AZYA 4AGGA 1IS3A 3WUDA 2R1BA 2G4IA 1V6LA 1LTEA 5HCBA 5LK5A 3OYWB 5KXDA 1MS8A 2H0BA 3N36A 5BYNA 5DZFA 2PHUA 3WDYA 4DS0A 2E53A 4M3CE 4FPCA 1FAYA 4PBPA 3M1HA 3FUQA 1DBNA 4YLZA 2GNBA 1GYKA 3O0WA 4GXLA 4FPHA 3OYWA 1UMZA 1DQ2A 1LHUA 1F31A 2PHFA 2C9AA 2ZHNA 4P9XA 1TEIA 1UZYA 5GLZA 3WLUA 3ZVXA 2DTWA 5JOZA 3ZPYA 1S0JA 1KDMA 2ZBJA 3C2UA 1MS0A 4BLJA 4LBJA 2ZGOA 4AVVA 2CWMA 4JCKA 4ATEA 4XBNA 1H30A 2D7FA 3ZYRA 1DIWA 2VW0A 4PQ9A 4YW5A 1WCSA 4R9BA 5EXOA 4ISRA 4YGDA 2EXKA 1WW7A 5GZEA 1ULCA 3ZSKA 4PCRA 1HLCA 1LGNA 2CY6A 4M3CF 5IUQA 1WD4A 5KXEA 4K21A 1SACA 1Q8SA 2A3XA 4FPEA 2R0HA 4Y24A 2UU8A 5FRAA 4BM8A 4FPJA 1JUIA 3VUOA 1MS9A 4YZ1A 1WD3A 4U36A 1YO8A 2WQZC 1CONA 3N35A 1IS6A 3MW4A 1C1LA 1WLDA 2ZGMA 3INAA 5T5LA 2CWSA 5EYXA 1OFSA 1BJQA 3WDUA 3WNXA 1OKQA 1D2SA 5GALA 5JLVA 3APBA 2A71A 4XZPA 5SV8A 5DG1A 4FOWA 3NV4A 3GNEA 3AZVA 2DTYA 2W08A 4P14A 2P37A 4Y1ZA 4XXPA 2D6KA 2W39A 4Q8LA 4DRRA 4HANA 1UN1A 1Q8OA 3IPVB 3WG3A 4CTEA 3AZXA 1IOAA 3AYDA 1O4YA 4FP2A 2LALA 3AP9A 4LBLA 4MYEA 5E8AA 4YFZA 5JMCA 1QDOA 3FLPA 4Y20A 4XTMA 1LOCA 2TEPA 1QU0A 1IKPA 2GNMA 2XG3A 3W59A 4K1ZA 1UX6A 1KJLA 1LHVA 2E51A 2R0FA 1QMJA 1W6QB 4LBMA 4BOWA 3IPVA 1Q8VA 4Y1YA 2ZMLA 4XDQA 4R9AA 5F9TA 1MS3A 3B01A 2ZGQA 1W0OA 3ILRA 5KXBA 1QOTA 1N1VA 1HQLA 3UK9A 3AP4A 2CTVA 1QKQA 2CNAA 2ZGRA 3ILFA 4M00A 3AXDA 3RRDA 4Q8KA 4DQAA 4Y22B 1G9FA 3AK0A 1HDKA 5T52A 4LBOA 5GZFA 2GNDA 2ZA9A 3IKWA 1VALA 2D6LX 1FNZA 1F9KA 2E6VA 4Q2FA 1WLCA 2SLIA 2UWAA 2JE7A 5DXDA 3L2YA 2A5ZA 2DVBA 4YFWA 5H9QA 1Q8PA 2GDFA 2D3SA 3N7JA 1G7YA 3ZXFA 2DU1A 3BOPA 1EPWA 4FPOB 5T5PA 1ULFA 3JU9A 3ENRA 2A6XA 2EALA 3SH5A 1JBCA 1W6NB 2VUAA 4YM1A 2B7YA 2JECA 4NO4A 4GWMA 1GICA 1N47A 1NLSA 1CIWA 4FVVA 4BMBA 2OW4A 3IN9A 1DZQA 3AYCA 2LTNA 5JOXA 2NMNA 1DLLA 4DFSA 5GZDA 1QNYA 2SBAA 1BXHA 2DUQA 3WHUA 2P34A 2W68A 1ENSA 4LBKA 1VAVA 1W6NA 2C5DA 2AREA 3M3EA 4TZDA 3NV1A 2UWCA 2Q5TA 1J1TA 4IQPA 4GWNA 3WVJA 1C1FA 2VY0A 3KM5A 2EXHA 1G9DA 1I3HA 5F5QA 3O0XA 2W52A 3UJQA 2VW2A 2A7AA 1IKQA 2GMEA 1V00A 2ZGKA 2ZHKA 3PJQA 1LOEA 4YZ4A 1G86A 4GALA 1SBFA 1W6OA 2R1DA 2WT2A 2JKBA 3ZXJA 1PZ9A 3NWKA 1JYIA 1GSLA 2YROA 4K20A 1KDKA 1YXWA 1CN1A 1C57A 1QOSA 2FMDA 3USUB 3WCRA 3A4UA 1MVQA 5JOWA 1FATA 1LULA 1GV9A 2UURA 2E7TA 2AUYA 2WJSA 2WT1A 3SLIA 4WVVA 3AFKA 1WW4A 4FPKA 5CAZA 3POSA 3ZXLA 2DVFA 3ZYPA 4YM3A 1UPSA 2A3WA 5T50A 1H9PA 4BMEA 1WW5A 1W6MB 3USUA 4AGVA 4XIOA 3WHTA 3UL2A 4XHBA 1S0DA 1UZZA 1C4RA 2ZGTA 4UW3A 2NMOA 1AJKA 3OPZA 1N3QA 3ZXKA 4UW5A 1YIFA 3V64A 1KJRA 1OQ1A 4FPLA 3T2TA 3AYAA 3MEPA 1DQ0A 4AYUA 2A6ZA 4Q27A 4XJAA 2ARBA 3A0KA 1KRIA 1RITA 3AP5A 3I8TA 3SISA 4XJUA 4BQ1A 2ZHMA 2DWRA 1CVNA 1AVBA 3D5OA 3WV6A 2WSVA 3M3CA 5HCAA 1DGLA 2I2SA 1AXZA 1V6IA 2ZKNA 4AVTA 2YV8A 4YG3A 4ZXKA 5EYYA 1GKBA 1LEMA 2CL2A 3AXEA 3AJZA 4C1WA 1LOFC 3AJYA 1GNHA 2DUPA 1JHNA 1LOFA 1Q8QA 1DQ1A 3FLRA 3SH3A 2JDZA 4ZKTB 2XB6C 1X50A 3AX4A 2D6NA 2OUJA 3H0OA 3WDTA 3DUIA 1LHWA 4XJ8A 2R16A 1Y7BA 2D6PA 1V6OA 3NV2A 1URXA 2A6WA 3BIWE 3GALA 3A0NA 3SITA 1I1EA 5GZCA 3FBYA 4JRAA 3WDWA
chains in the Genus database with same CATH superfamily
2DFCA 1DGWA 2ZABA 4B1LA 1XNKA 1IS5A 3HNYM 1J3PA 5FP9A 3TNQA 4E8CA 4QB1A 4YW6A 3VD4A 2FMYA 3MIEA 4HONA 5C4WA 4I2OA 2PHWA 1DZRA 3LGRA 1HRV2 1NCQC 2GN3A 3RJRA 5ISLA 2VZPA 2A6YA 3B02A 1VIWB 3RPQA 2VG9A 3ZXDA 1W28A 4UW4A 3VKNA 4OZXA 5L9VA 2WNEA 1TME3 3R4UA 2BBVA 2TNFA 3FZ3A 4YARA 3VDAA 4Q1PA 1NOVA 4S2FA 4CUCA 5BNNA 1JYXA 1OLQA 1AJOA 5FP3A 3CDZB 5KR7A 4P00B 1S55A 4UFJA 1W06A 1ULDA 4QX1A 1HXS3 2FCTA 1BYHA 5LZ6A 5FYMA 2OQ6A 5FMDA 5J37A 3LEMA 3MGUA 3DECA 1SEFA 1ST8A 2VGDA 1JU3A 2YB7A 1ZBA2 3VZKA 3VBOC 3LOBA 2ZX2A 4YM0A 2ZGUA 3ZO0B 4GH4B 2YFUA 3VL9A 1N3PA 2IXKA 4QPGA 1N1TA 1GNZA 4S2HA 5LATA 4PIXA 5ABJA 1DYKA 1A3KA 1W8NA 4KMQA 1B09A 1RVF2 3HMYA 4H55A 3CMGA 4GH4C 4CDXB 3GYDA 5C7GA 5KC5A 1GNYA 4RGAA 2C24A 1F8VA 1W6PB 1E5IA 4HSLA 5DABA 4XQWA 4BZ4A 4FAHA 2ZEZA 2GALA 5CVRA 5FYUA 1IZ3A 5T5OA 4FPGA 1FNYA 4YVWC 4CU9A 3O1TA 5CFDA 4CDXC 2MEV2 3ZYJB 5AC91 2XJQA 4AVAA 1QOOA 4EZ4A 3PTRB 5LBEA 3HNMA 1A8DA 2WYSA 2ZAHA 4FBFA 3N9LA 1CZSA 4EN8B 4DUVA 2YBSA 1AL22 2BDRA 2VD7A 4XHXA 4OYUA 5FZ0A 3POIA 3ZDSA 2DYCA 1OT5A 3GBWA 1LOGA 4A7ZA 2XJSA 2VBDA 2ZCWA 3Q8BA 4KGGA 5EFUA 2W2IA 4C90A 1HW5A 2D6OX 5CA6A 4WVZA 3BUCA 4LO8A 1VB2A 1MZEA 4P9LA 4MGTA 4QKFA 1COV2 1DFQA 1EYBA 2EVXA 4TLGA 1O3RA 4NIIA 3KB5A 4QAWA 4MXWA 3T09A 1EV13 1FV3A 3PVEA 4QDQA 5A1AA 2EAAA 3E1F1 4IEUA 5FZ6A 2ZEWA 5FZEA 1H6YA 2VU9A 4KG8A 4O9EA 5E6HA 4ZU5A 3VKOA 2IFWA 1SLCA 4KL1A 3GCWA 1ZX5A 3RMYA 3EBRA 5FZ7A 2HWB2 4AFDA 4YGEA 2Z42A 2WS92 3DL3A 5KXCA 2Y38A 2JG9B 5FY1A 3LZZA 2B42B 1H2KA 2EIEA 1AX1A 3JQXA 4PDWA 1UYXA 3OGVA 5T3NA 5FO8B 1WA6X 5FY8A 3QLQA 2DCTA 4META 4B4PA 2GH2A 2OVUA 4HT1T 1JTZX 1RUG2 5FMOS 3L9JT 4CZSA 4NHXA 1QNWA 2QZ2A 1LU1A 2WFPA 5IVCA 1YQ5A 3IAPA 5GM0A 3OGSA 4YW4A 3O1RA 4WV8A 2WN2A 2A6VA 1PIV2 1E5HA 4JKKA 1RXFA 4LK7A 3WF3A 2GN7A 3N3HA 2IXCA 3VBFB 1QF3A 4XE9A 1KFUL 2PAKA 3BKZA 1L7QA 3VBRA 1HXS1 2VZUA 1NA1A 2BNMA 3SH4A 1ZRIA 2LUWA 3NSTA 4IERA 4MGIE 4N8MA 1JZ7A 3D82A 4G9SB 5E89A 1QIQA 1AX0A 3M3OA 2XXZA 4GZ9A 1KQRA 5JWPA 1SLIA 3NAPB 3D3AA 3HD8B 3VDDB 3I2DA 3VBFC 1B35A 3K4DA 1OXCA 4BQYA 2ZOEB 2X10A 1CD3G 4N53A 4MGQA 4URTA 4OFGA 3CKHA 4UBHA 5FY7A 3O12A 1TMF3 4YGBA 1O4ZA 4BQWA 2AYHA 3NAPC 1HIXA 2GNTA 4XCBA 4MHUA 4EYUA 2CV6A 4ZZ8A 1GZWB 2R49A 4Y20B 1BQPA 1JOBA 3AC0A 5L73A 4D7TA 3MUY1 4O61A 1LOAA 3Q8CA 5FLIA 2OZ6A 2DBIA 3IWZA 1YEWA 3VBHB 3GJAA 4MOAA 1PZ7A 2QZ3A 2AH2A 4YRDA 3I7DA 5I0DA 1NYWA 5FJKA 3BTAA 5T5JA 5JZGB 5F5IA 3Q8FA 4B8EA 4Q4W2 4HPKB 4GB33 1H0BA 2WNVB 3VBHC 4FTEA 1GZTA 1S0IA 1YRZA 1RUJ3 4LULA 3RS6A 3FUOA 2IWGB 2W1SA 2WN3A 3RNSA 3UV9A 3T0BA 1UIKA 5C71A 3OGJA 1BKZA 2EF6A 1A78A 2ZGSA 2QTWB 5JZGC 3KV4A 3RMXA 2J1EA 4AVSA 2RMU2 2ZMNA 3WUCA 1XPWA 3JUUA 4N9IA 4RHV3 4AK3A 2WNVC 2XQXA 1CWPA 4AQ2A 1AHSA 2MNGA 2ZHLA 3P3NA 1NLRA 5BPXA 4QX8A 4PBOA 4GKXA 4UW6A 1RUI3 2DV9A 3LCPA 4A3ZA 3VD7A 4NJ4A 2XHNA 2BRTA 3S0MA 1MEC3 2VXRA 3LDKA 4DZGA 5GLUA 4WVMB 2WL1A 4CUBA 2VW1A 3V0BA 1RUOA 1BZWA 3O14A 1C8M2 4R8HA 4QU1A 2RR12 3KT4A 1QH6A 1RUF2 5F5CA 2NYYA 3WG4A 2XKPA 3MPPG 1W8FA 5IAVA 1GANA 1C3HA 5JI9A 4XILA 4GWIA 4JGYA 4XUQA 4IV1A 2QBXA 3ACLA 4H14A 3ZSMA 2XWJB 2NN8A 1G6NA 1GZ9A 1F2NA 1KS4A 1ULGA 4L8QA 4W4ZA 4E4SA 3WQBA 5CZKA 1AX2A 1EP0A 1W39A 1I9RA 3ZPOA 2XLGA 2XJUA 3JCIA 5FO7B 1H1MA 3KCYA 2GP3A 4HVOA 1AL0G 1VMJA 5AVAA 5LW9A 1L7RA 4JQTA 4QMAA 2WQ4A 3RSJA 4F83A 3ILNA 3Q8EA 4UF0A 1HRI2 5FREA 3VBUA 1LCLA 4FOVA 1ONAA 4HFSA 2VVFA 2UYAA 4QXKA 3ZIWA 3ZXAC 1JU4A 1H4GA 1TVGA 3F2ZA 4CP1A 5A33A 5JXHA 2EIGA 4RL7A 5A7NA 2WA3A 1OPMA 3V65A 3ZXEA 5FQ0B 5FP7A 2P3KA 5CKMA 2VMIA 1UKGA 1VR3A 2BERA 2CDPA 2QE3A 1JXNA 3BPSA 3VKLA 1W2OA 4XFAA 5C3OA 1HB3A 2BW8A 2Q8OA 3ZKYA 3ZKUA 4D3WA 3GZUC 3HEIA 3OYWB 5LK5A 1NLQA 2QNKA 4M0NA 4WM7C 1UOBA 2Z5WA 5DQ0A 2PHUA 1STMA 2E53A 3A7QA 5JIUA 4UYBA 1QWRA 1EUUA 5I0RA 2HLEA 4XW3A 2AACA 5A32B 4YLZA 2VJXA 4ARYA 2ATFA 3PLQA 4FPHA 1Q43A 4LKSA 2B5HA 1UMZA 1PHMA 2Y6FA 1PGL1 1LHUA 3RZGA 1AR63 3DXTA 3E97A 5GLZA 2VNOA 2E63A 5C3RA 1S0JA 1KDMA 2A73B 3AKQA 2O0OA 4S2GA 1XYOA 1HQNA 3W20A 3T2PA 5J7MA 4DOUA 4GB31 4LBJA 4Y33A 4AVVA 4MX3A 4JCKA 3FWEA 4ATEA 1H30A 2ZX0A 4TXWA 3NKTA 5BNPB 2OPWA 2QQOA 4QGNA 1ENXA 4ISRA 3SMHA 2EXKA 1ULCA 1K45A 1HLCA 2CY6A 4LHLA 5HXVA 2P6CA 1X9TA 5IUQA 4DEVA 5FPXA 5KXEA 4K21A 1QH7A 1UZVA 1H1AA 4RHV1 4AFBA 4ORFA 2BU9A 2VNRA 4N43B 3SEEA 1R64A 1TZOA 5BNPC 4IEPA 3T0DA 4YZ1A 1ASJ3 4U36A 1YO8A 2K0GA 1RUI1 1CONA 3LOIA 3ZYIB 3N35A 1WLDA 4BWOA 2PQQA 4EN6B 1UY0A 1VB4A 1EUTA 4FOWA 1ZYBA 4Y1ZA 1WA4A 2W39A 4HANA 1AR83 3AZXA 3R0RA 5C4WB 3I2FA 3AYDA 1O4YA 3VN4A 3TYJA 2XBO3 4UFHA 5K7PA 2WZEA 4OHWA 4QPYA 1BEV3 2VTFA 5JMCA 1K5MC 5JXGA 1XNTA 4A2UA 4DUXA 3W59A 1QU0A 4JGZA 4BH9A 1OUXA 4IEWA 4CCOA 1J1LA 1UY2A 4OZOA 4Q4V1 2JB4A 4UXAA 2YPDA 4BOWA 5CEHA 3IPVA 4HBNA 2YC4A 1Q8VA 2VMDA 4DB5A 3E5QA 3NVCA 4XDQA 5IAXA 3ILRA 1W0OA 2AEYA 4FI9A 4JDOA 2EICA 5KXBA 1N1VA 3UK9A 4RR3B 1AR92 1X36A 3AP4A 3TN92 5LA1A 1PVC1 1Z7S2 2CNAA 3JXSA 3AXDA 1US3A 3HAGA 4DQAA 1G9FA 3CEWA 3AK0A 4F7ZA 2WNOA 4QPGB 5I0TA 4BQ4A 2GNDA 4IEYA 4Z2AA 2D5FA 4MXVA 3DV8A 4RR3C 3MFAA 2OA2A 2UWAA 2RM23 1BMV2 2DVBA 3FC0A 1SFPA 2X5IB 2RE9A 1Q8PA 3J8F2 2GDFA 3BN6A 4QKBA 5CFCA 2R063 2D3SA 3WNOA 3FFQA 5LRRA 3NW4A 3VDDC 2KA3A 4IDZA 3BOPA 4QPGC 4FPOB 4MGZE 4S2DA 5T5PA 4NHKA 2HWC2 2B9UA 4MSVA 1NCRB 3MIGA 5LK7B 2JDMA 5DMYA 1H8VA 4MUVA 1BHGA 2DCYA 2X5IC 4MVTA 4V1PA 1N47A 4JKMA 3FN9A 3K48A 3IN9A 2HKXA 5JPNB 4XVHA 3WP5A 2V4AA 2RDQA 1C5HA 4LITA 5C8CB 1AR61 2NMNA 1NCRC 1QNYA 1BXHA 5C5TA 3WHUA 2FDIA 3ZFFB 2VZ3A 1RMU3 1VAVA 2C5DA 2O8OA 3PUSA 4IE5A 3RZZA 4QM8A 3NV1A 3VHNA 5A7WB 1YLLA 2Q5TA 4P9GA 1ZBE1 4A41A 5C8CC 4Z82A 1KS5A 4IQPA 4GWNA 4PI2A 5LBBA 1YWKA 4UFMA 3VBSA 1S4CA 4E2QA 1G9DA 3ZFFC 3ITQA 4I02A 1XNCA 4TWTA 4ZXEA 1KD7A 3O0XA 3ZR5A 2ZGKA 1GFF2 3I49A 3E6CC 1W8WA 1SG3A 3WW3A 2ZTNA 4GALA 1OD3A 1I6XA 2HBTA 5FWEA 1SBFA 2YROA 1ASJ1 4NRQA 1CN1A 3MF6A 3BTYA 3ZDVA 5F7UA 3LDRA 2FMDA 2PA7A 4N7UA 3WCRA 1AR72 3GGLA 1MVQA 3U37A 1XU2A 3I3QA 2P6HA 3VB9A 3BGAA 4QX0A 3OUIA 2E7TA 2C6SA 2ILMA 4A7YA 4PDWB 5C5UA 1A34A 2VMGA 2W9XA 4AFCA 2JG8A 3C7GA 4QX3A 1GQPA 2XBO1 1IPSA 4BMEA 3WNLA 5ACA2 3CJXA 3K2OA 4GULA 4LKDA 4QQOA 3WHTA 1FOD2 5L9RA 4Q4Y3 1MZFA 1X82A 5A70A 4PDWC 3ROUA 4COUA 4FPLA 4I09A 3T2TA 3AYAA 4EN9B 2FDGA 2ARBA 5JR2A 1KRIA 4G3YC 3UKNA 1RITA 3AP5A 3WW4A 3ZYBA 2VULA 3WF4A 2ZHMA 1FPN3 5LY1A 4W6WA 1BVP1 3D5OA 3VBRB 4A45A 2WSVA 5HCAA 1H2LA 1DGLA 1NA1B 2I2SA 2VAUA 2W95A 3MO4A 2PLV3 4JHTA 5CIRA 1UY4A 5DAVA 3RJ2X 2Y6KA 3UESA 4YG3A 5FCCA 5DN2A 3NJYA 3GBFA 1LEMA 2CL2A 2O1QA 3AJZA 1LOFC 3TNPB 2NQYA 3S5QA 1RUC2 1B35B 3N4MA 2QQKA 1NT0A 2JDKA 1Q8QA 2C9KA 4LA2A 3QH6A 4MZUA 1DQ1A 3VZMA 3SH3A 3U1XA 1WKYA 4Y5SA 3LA2A 2HWF2 3QACA 4IEOA 3IZOA 4KH9A 2PAMA 2R061 2FDFA 2YBKA 3ZFGB 2WNUC 1B35C 4MGSA 4XF3A 1PX3A 1RHI3 5IVFA 1U5XA 3LAGA 2RDRA 3A0NA 4P08A 1UOFA 1NKGA 1RUE3 3HPNA 5A7OA 4NHMA 5JR7B 4AQSA 5FXWA 4AEMA 1D4M2 5IVEA 4DINB 1V6JA 4RGKA 3E5UA 3JBG3 3ZFGC 4E27A 1OSGA 2JIGA 3MI8A 5T54A 3KCXA 2FZ2A 4D6QA 3RDIA 3WR0A 1RINA 2ORZA 1WLWA 5J98B 4XJWA 1SCRA 3K3NA 5BUVA 1LGBA 4FQZA 1QHDA 1SPPB 4XFFA 4X8PA 1XE0A 2A1XA 5DDJ2 2PHXA 2UY9A 3N9OA 1NZIA 1XYNA 4XFGA 1GBGA 1U0AA 2Z2SB 4XDPA 1TQ5A 1W6QA 1MS1A 1OOPA 1R1A2 4Y4YA 4CEYA 2BOJA 5LA9A 4QQ2A 3IDCB 2GC1A 3EO6A 5I8YA 1ODMA 4QPWA 4XXAA 1AXKA 1RUD2 2R042 4XOGA 1PX4A 2R073 4LHSA 3O1UA 3F95A 5H9RA 4EQVA 1AZDA 2IZWA 1Z0HA 4QKDA 3T30A 4RQPA 1D7PM 5KHHA 1UX7A 4BK5A 3V0BB 2VZOA 1SDWA 5FKCA 1Q56A 5FXVA 2HWD1 3USSA 5DUVA 3D0SA 3OD4A 5IK5A 1OBNA 2WYFA 4JGYB 3J7MA 4IV1B 1FX5A 3VD5A 1IQAA 4NRPA 5HCFA 1SCSA 5I91A 4IE4A 5KC6A 3JD72 3U10A 4MV2A 1HJGA 4XPVA 3K4ZA 3SHRA 1Z78A 2FDKA 3TEYA 3VV1A 3WCSA 3SKVA 2G9GA 4YW2A 2WSUA 4Y3OA 2VUCA 3M3IA 5DAXA 4D7SA 2V73A 4IV1C 4Q4Y1 2WINB 1L3JA 3O1MA 1V6NA 2P4EA 4R4XA 4UF0B 4XZUG 2EXJA 4Q0VA 4RGGA 5J48A 1XE8A 4U2AA 5CG8A 4ES9A 3LFMA 3AZWA 2ZGPA 4WVWA 1FPN1 3ELNA 3Q9OA 4M3CA 4B7EA 1GOGA 1HB4A 3ATGA 1I5ZA 3KGLA 4J1WA 2Y26A 2PLV1 5LY2A 4BXSV 2WZ8A 4FSJA 2OQ7A 2XPJA 3NV3A 4K8FA 1HQWA 3AL5A 3ZM8A 1SFNA 2E9QA 3B3QE 1N1YA 4PT6A 4QB2A 5A7SA 1CPNA 3PIGA 2X53S 5DUUA 3PMEA 1UXZA 4ZONA 3HN1A 1MVEA 5LB6A 5A80A 1ZRCA 5FUIA 4C0HA 1MZ5A 3PIJA 4OCTA 3G6JB 5H9SA 4QHBA 1UAIA 1KITA 1YFYA 4XQ4A 1RHI1 3UNPA 4Q4X2 1LGCA 4XUPA 3AZZA 1RIRA 1SFYA 1RUE1 1UY1A 5AC92 2PHTA 4QXHA 5LA2A 4WZFA 1GQGA 5FYVA 5FZGA 2WFF3 3JBG1 3M70A 3NNMA 4XIKA 3I3DA 1CIYA 3CF6E 3K4AA 2G19A 2XLAA 1SLAA 1Y43B 3BPZA 3PVOA 2FDJA 2JD4A 4GWJA 1PO13 3ZYFA 1W6MA 2WRAA 3MV01 3IIAA 3RQ0A 3PVBB 5FLHA 3RI8A 1UIJA 3ACIA 4QQLA 2D6MA 1O5UA 2E26A 4FQ4A 1WUVA 2ES3A 1S0BA 2AR6A 1JYWA 3AP7A 4L0PA 4TTGA 1ZZ9A 2VOWA 1LENA 3AP6A 4XYXA 1SLBA 4AF9A 1CAXA 3D6EA 2ZZJA 4E4HA 4Z8BA 4K6BA 5EJ1B 2VUJA 2Q1MA 2R071 3THPA 2NP0A 3VLBB 3O1PA 2VH9A 5BNOA 1DQ5A 2Y34A 3BU7A 4HVRA 4FPFA 4AW7A 5JDBA 1ZZCA 1W9YA 4PJYA 3FMGA 1NZCA 4ONUA 4TYSA 4AG4A 2DDUA 3AM2A 1T6BX 2VBPA 5BY5A 4WM8A 1CAUA 3WG1A 4D7YA 4LBQD 4CEWA 2E7QA 2YY1A 2VECA 2ZPXA 2WO2A 3S6PA 4ISQA 1GZCA 3P1IA 5C8WA 1ZRFA 4JGZB 4H2AA 1S0EA 5L7OC 1G9AA 1OKOA 4BPZA 3ZYHA 1BBT1 4Q26A 2GMPA 1UU4A 4PF5A 4YPJA 3T08A 3CJIA 1VE0A 3C3VA 4CDWA 4JGZC 3RZJA 1XU1A 1HXS2 1DZTA 1PK6A 1OURA 4X8NA 4W8JA 1OC1A 1RXGA 4W50A 1GWKA 3WOGA 1KEXA 1CJPA 1FMD2 4QPIB 3OGGA 4CU7A 2J7MA 4YZ5A 3H3LA 4CA9A 4AFAA 2WIIB 4EE2A 3WDXA 3LA3A 3A23A 3KT1A 4FO9A 5D21A 5I0SA 3LSEA 3MLLA 5J36A 1WGPA 3IDBB 1CQ9A 1T2XA 4HKWA 4QPIC 4YW3A 3WP6A 4UFKA 1G9BA 3VKFC 3HOBA 1S0FA 2ZACA 5JVVA 1IPKA 4XUNA 2V72A 3S7EA 3UKVA 1SBEA 2E32A 4UOJA 3S30A 2EXIA 4LO6B 2YMZA 1PO23 3H1WA 4Q29A 4LBQB 1GU3A 2VC9A 5CKNA 3H8UA 1IG3A 2RHPA 4NAOA 2CGNA 1W90A 3M7AA 1VBB3 3MIBA 2BVBA 2JKXA 4B29A 2ERFA 3D4KA 1ZBA3 2IXIA 3MF9A 4CU6A 4Y5TA 4Y1VA 3CNAA 1PO11 1F15A 3ZFEA 4IEQA 5FYCA 1VAMA 3K51A 1OH4A 1SLTA 5FKBA 1PGW1 2JICA 3ES4A 2WZR2 4B1MA 1IQDC 4HG6B 3WDWA 3LSDA 1NY72 1EAH1 5JOYA 5FPVA 1LECA 1OMIA 1Y9QA 3M2MA 1H8TA 1GMMA 1WMDA 4RYDA 4FP3A 3WDVA 5FZOA 2GMMA 4BLIA 1N1SA 5KHIA 2O14A 2NM1A 2J1UA 2Y6JA 3DXUA 3U4XA 3U11A 4NROA 2V5YA 3IM0A 2LS6A 3U07A 1AYM3 4BISA 1K42A 3HR9A 3CQOA 3AZYA 4AGGA 1LB2A 4FFHA 3N9MA 2R1BA 2G4IA 5FIXA 1LTEA 2GU9A 2QQIA 3UGFA 3B94A 5KXDA 2XJRA 2Y6GA 3KD4A 2H0BA 5DZFA 3WDYA 2CHHA 1V70A 4M3CE 4PI0A 4V2WA 5HCHA 2VOTA 3KLSA 3GF6A 5DAWA 1OD5A 5FZKA 3UGHA 3FUQA 2XR4A 2RS33 3U78A 2VR4A 5G05L 1COV3 5A3MA 5F39A 1YFUA 1JOPA 2JG9C 1TME1 4FTBA 3WLUA 3S57A 3BI3A 3LIGA 1P8JA 2FDHA 3C2UA 5F3IA 4OVEA 3BYWA 3EYPA 3H7YA 2FCUA 3EQEA 4BLJA 2KR2A 2ZGOA 3TEWA 2CWMA 2HWB3 4LQRA 1VRH2 3ZYRA 1CX1A 1DIWA 2Y8KA 3KV9A 2WS93 3OB8A 3THDA 5EZWA 2I45A 1RYYA 2G9FA 4EJRA 1WW7A 5GZEA 1V9U3 2RS12 2B4KA 4LR4A 1T6GC 2A3XA 3WF2A 4FPEA 1RUG3 3J7NA 2RVAA 3DPRB 2ID4A 1XB9A 1ND3A 5FRAA 5A6ZA 1M06G 3NJZA 5FY0A 2JXAA 1WMXA 1JI6A 3ZR6A 2WQZC 4Q0QA 2BPA2 1OFNA 4GJZA 4LO5B 4E9KA 4LTAA 2JD9A 2ZGMA 3ZLIA 2LM3A 5AFBA 3AMNA 4COWA 2ZS6B 1XNBA 5JLVA 3OOXA 1IGOA 2A71A 2JIJA 4GIQA 4XZPA 3GM8A 3KS7A 5DG1A 3DPRC 3GNEA 5SV8A 3VHOA 1PO21 5JSRA 1ZRDA 1DGWX 4XXPA 1VBD2 3ES1A 3ZYGA 4DRRA 5KWRA 1Q8OA 3WG3A 1VBB1 2X29A 2YDEA 4K7JA 4KNCA 1QJY2 3I2OA 1W8HA 3AL6A 1JZ3A 3VDBA 2V09A 1QDOA 4BU2A 4NIGA 2WZPP 3PURA 2Y0OA 3ACHA 4IGOA 4K1ZA 1UX6A 1KJLA 1LHVA 3B9IA 2E51A 2R0FA 1W6QB 4LBMA 3SQOA 5F3EA 4Y1YA 2WO1A 1YNAA 2JDPA 4ET7A 4R9AA 4Z2WA 4OHVA 2ZGQA 4JTOA 4BJ0A 5FBZA 2F4PA 2CTVA 4HLTA 4PQQA 4DEQA 2ZGRA 4KU7A 4M00A 3WQ0A 1AYN2 4XAEA 3RRDA 5EQUA 1O4TA 2R7EB 5JPMB 1XRUA 1E5RA 5C6CA 3OG2A 1HDKA 5T52A 1EV11 4RQPB 5LWBA 4E2GA 2ZA9A 1AYM1 3IKWA 2E6VA 3OCPA 4Q2FA 3EJKA 2SLIA 3POFA 4H7MA 4Q4W3 1ND2B 3ON7A 2BGCA 2OT7A 4D6SA 3JB4C 4IEVA 4A7KA 1O5LA 3PHMA 1OPOA 3IAQA 4RQPC 3LQCA 1FXZA 2DU1A 2VOXA 4AI1A 2W94A 1UPIA 1VMHA 2VZSA 3ENRA 4RD7A 5F32A 4Q4V2 3SH5A 4Q5OA 2RMU3 1ND2C 2RS31 2JECA 1ZA7A 4YM1A 4LXLA 5IVBA 1GICA 1NLSA 1CIWA 2OW4A 4LLFA 3AYCA 4AEDA 2ORXA 1DLLA 1O3TA 2TBVA 3LPFA 5HI0A 2GC3A 3KMHA 4XF4A 4ZHNA 1HX6A 2DUQA 5FO9B 1PVC2 1ENSA 4LOSA 4RN5A 5FP4A 3ZIXA 1W6NA 3H9AA 2AREA 5HXMA 4TZDA 1POV0 1ULOA 5C3QA 1C8M3 2UWCA 3MBWA 2WO7A 2RR13 3BCWA 3MIDA 1RUF3 4DXTA 3WVJA 5C9AB 2VY0A 3KM5A 2RJ2A 3LFIA 1E5SA 2JEMA 1I3HA 3J9SA 5FMOL 3T4VA 1V9U1 1W99A 2W52A 3UJQA 2IXJA 2ZHKA 3ACFA 3LD8A 1QJX3 4YZ4A 1RUG1 1QQP2 4NRMA 2R1DA 2WT2A 2XUMA 2JKBA 5C9AC 1PZ9A 1H6XA 1GSLA 2PXJA 3DN7A 1JZ5A 1VJ2A 1TMF1 3W9AA 1C57A 1UF2C 1DG6A 1QOSA 1S2KA 1HRI3 4V2VA 1XYPA 2FBEA 2XMLA 4YNIA 3A4UA 4YVSA 4PLMA 3DKQA 4CU8A 5LBFA 3T3YA 2CGOA 3SLIA 5I8TA 4WVVA 2IXLA 2WBKA 4IGPA 2D97A 3FE5A 5G04L 1E57A 1CAWA 2JX9A 2P5BA 3ZYPA 4YM3A 1KXGA 2XUEA 1PM4A 4GMP0 4HETA 5T50A 1OF4A 1WW5A 1W6MB 3USUA 4AGVA 4KU8A 1ZBE2 3UL2A 1XBFA 1UZZA 2W87A 3ORJA 2RV9A 2ZGTA 4LOTA 2NMOA 1HN1A 4UW3A 3ZMNA 3ZMOA 3OPZA 1YUDA 4NHYA 3I59A 3JZVA 4UW5A 3WW2A 3ZN6B 3S5AA 3GZTB 1RUJ1 2EIBA 4NWWA 4CDQB 1VBA2 4AYUA 2A6ZA 2WDBA 4NIAA 2ZX4A 5APAA 4DMIA 5ANNA 3SISA 2B39A 1R083 3K77A 2DWRA 3WP3A 5L19A 5FPLA 1AXZA 1V6IA 3LDBA 1DGRN 5BNOB 4CDQC 5EYYA 1XNDA 1GKBA 3SC7X 2B45X 3AXEA 5JCTA 3AJYA 4NHLA 4N9HA 3VZNA 5IHRA 1MEC1 4BQ5A 2DBNA 2JDZA 4ZY9A 3GHNA 4CCJA 2NPIA 4N43C 4QWNA 1XE7A 5FZIA 3HIFA 5FZ8A 1KFXL 2LRPA 2XBO2 4W6XA 4XUOA 1W3XA 3I2KA 4URAA 4Y4RA 1PNGA 1Y7BA 2R32A 5A3WA 1GWMA 2BJSA 1URXA 3BIWE 3UKTA 2GH8A 5ANQA 3SITA 5GZCA 2ZX1A 3FBYA 3WNPA 1ZRRA 5DZEA 3WNNA 2BNNA 3OEBA 3NNJA 4JC1A 4DXZA 5SV5A 3OBRA 4YGCA 2VVDA 2DURA 1NE6A 1LEDA 4XFCA 5C4WC 4D94A 5BNNB 4JAAA 4XBQA 5JXJA 4M01A 2PTMA 1LAJA 1PK6B 1LU2A 4CUGA 2OKXA 4YZ2A 2ZGLA 1NCQA 4KWLA 3VZOA 1NE4A 4AZZA 3W58A 1C8NA 4R9CA 4CXWA 3FLTA 2RR11 1RUF1 1UXXX 5BNNC 3MLJA 2VPVA 2HWE3 3LKJA 4N7IA 3W5MA 2XKOA 5FLJA 1REFA 4NVPA 5CBLA 5FWJA 2Z4FA 2EIDA 5A3PA 4MHRA 2BWAA 1SQ4A 5B2GB 2R062 3AB0A 5E16A 2BGPA 5ABJB 3B69A 3I2JA 1QJX1 4ITCA 2H6CA 3AMHA 1L7LA 2QQNA 4Q0SA 5I0UA 5GZGA 1J84A 3OTFA 4L92A 4OMDA 1W03A 1OVSA 3C7FA 3VBOA 3FX3A 4DXSA 4K40A 2CU5A 5ABJC 2L9LA 3MW2A 3BTXA 1DLCA 2PELA 1YFXA 3P5BA 3RYPA 4AHXA 4COYA 1IG0A 4EWAA 4I3GA 1OA3A 1Z7S3 1SZBA 1VBE2 3V56A 5CFDB 2QQJA 4GMP3 1CGPA 4GH4A 1PZ8A 3WINE 3VL8A 2E33A 3ZFEB 2ZMKA 1JN2P 2VMEA 4LHNA 4FPYA 3N7KA 3NO8A 2GSYA 3R4SA 4XC9A 5DAPA 5CFDC 5LRSA 4CP0A 3LWCA 4YVWA 4NWVA 1JZ2A 2AZ5A 4CDXA 2BNOA 3PVNA 3NQHA 4DY3A 4JRLA 4EV0A 5J09A 2HYKA 1W6PA 2HWC3 3WD5A 2CGPA 2JE8A 1R081 4IV3A 2D93A 2P2KA 3POWA 3POGA 3FFZA 1ZM1A 5T55A 4OI4A 4MXWB 5BV6A 1ZA4A 3LPGA 1RGSA 1BVVA 4XF9A 2D44A 1V6KA 4CDUA 2BGOA 5K8SA 1W9SA 4O9GA 4P9JA 4H3WA 3QH7A 1LJ7A 2HWD2 4OUEA 1UZWA 1W8TA 1DHKB 1N3OA 5FYIA 3DGTA 5DZGA 1O8SA 5IK8A 4I0AA 1JH5A 2Q8DA 3OBTA 5AVPA 3G7DA 3ASIA 3PJYA 4QDRA 1WLTA 2VZVA 4LUMA 1VP6A 3OUJA 4IW3A 4MGYE 1G8WA 3AKSA 1AR81 4JHZA 3T1MA 1WBLA 2VQAA 4P5YA 4P9WA 4B3NA 5A3TA 2VCAA 4Q4Y2 4YWAA 1BEV1 2LW8A 2RDNA 3AMPA 4CE8A 4D6RA 4CXYA 2YGMA 3HT1A 2BOIA 1GR3A 2P3JA 4IESA 2WKKA 3OEAA 3IDEA 5GLTA 1M4WA 5EP9A 1O3QA 2W1UA 2KD7A 3MFCA 1HKDA 2W91A 3N7LA 1AR73 4Q0PA 4LEJA 1BK0A 2JE9A 5I93A 3BOWA 3E5XA 4R52A 4Z07A 4ZS3A 3DCQA 3WNMA 3DYPA 1MPXA 3HBKA 2DFBA 1UWWA 3MW3A 3MYXA 4IE6A 2HWE1 3M4FA 2HEWF 2VOKA 5E1RA 1HB2A 4B4RA 4KGQA 4XF1A 4CPBA 4LIUA 2HJIA 1UW8A 5ACA3 4IEXA 1AF9A 3CLPA 1ND3B 5E88A 4IETA 4N53B 3VBRC 1NA1C 5A3UA 1FOD3 2RM21 1OA2A 1WW6A 5D1IA 2TUNA 1F5JA 1RHI2 2AC1A 2ENRA 3BVCA 3HNBM 4CRQA 3VBFA 2DUOA 4N53C 4BA6A 1TNRA 3JBG2 4BXFA 2JDUA 3BODA 2YG0A 1APNA 3FHIB 1SHWB 4SLIA 2J1AA 3POYA 2ZZQA 4Y1UA 3SEPA 3WZ1A 1Z7S1 4NOTA 1QJU3 4JVAA 3POBA 2VTXA 1RUH3 4K8RB 2DCKA 2GC2A 4XMAA 4YM2A 4QM9A 1R093 4AQTA 3N7MA 3HJRA 5H9PA 3WQ7A 4R9DA 3I3EA 1RMU1 2IVIB 4A3XA 2JDAA 3AKRA 2W5FA 4DO0A 3CBNA 2HWF3 4Y1XA 3OUHA 3VGIA 4INDA 2PQSA 2PHRA 2WT0A 1DYOA 2MPFA 1GZWA 2P3YA 3UJOA 4KWJA 4M0HA 2GC0A 1MS5A 5FZCA 1D4M3 3VBHA 3OY8A 1D4VB 3V0AA 5J1XA 2KM2A 4ARXA 2Z79A 2YUEA 4MLOA 5EJZB 5FXZA 4XURA 4TSVA 5JZGA 4XAAA 1NUKA 1PGSA 2WWJA 3Q8AA 1ULEA 4HPKA 3LEIA 2WNVA 3TRSB 5DUXA 4PLOA 1LHOA 4OUMA 5M0TA 1HN0A 3IDAA 3K75B 3LE0A 3AMMA 4FOQA 2XDVA 3T0AA 2RS53 1UCXA 5LCWL 1O59A 1OF3A 4FFGA 1JUHA 1SMVA 4YG0A 4CYDA 1R1A3 4EWDA 3VKMA 3VZJA 4I0WB 4UBGA 5J96B 4JQRA 5IWFA 1BBT2 2XVKA 4PIZA 2B9VA 2W0XA 5K0UA 1UL9A 4KI5M 4JGYC 4AEDB 3RZMA 1RUD3 2R043 1JZ8A 4P9IA 2ZAAA 2ZEXA 3KVAA 1OLME 1BK1A 3VBUB 4NPLA 1X7NA 3E6BA 3O1OA 5A6YA 5C33A 2V4VA 4WVMA 4IXLA 3ZSJA 1YC61 3HT2A 2VZRA 4OLLA 4ZPIA 3ZSLA 5A33B 4AEDC 2W1QA 4E8DA 3J4UH 3QCWA 4ZZ5A 2Y6HA 3T4HB 4AHZA 4GAZA 1YQ8A 2Y60A 3VBUC 1CAVA 2QDNA 3TAYA 1QGLA 1YQ2A 1XC6A 2B8MA 4W6YA 4JDNA 4BYYA 1OVPA 4LT5A 3JD73 4XTPA 5F3CA 1J59A 4K1YA 3KQRA 2XLFA 1MZ6A 5FK7A 5FV3A 1FOD1 4LMFA 4CCKA 1JYTA 1NXD1 1QDCA 3UGGA 2VMCA 2YZ4A 3I4IA 3RWNA 3SNMA 2Y6LA 2BWCA 1KGYA 2BYVE 2ZEYA 2YXSA 4E2SA 1NQDA 1S1AA 2BP6A 3AKTA 2WA4A 3H3ZA 3SCHA 3WUDA 1OA4A 4YW7A 1V6LA 2PN5A 4QXBA 5A3LA 4OI0A 5LEKA 4CP9A 1HV0A 2W47A 3DYMA 1RJ7A 4WM7A 3AKPA 1CAWB 5DPNA 2YC0A 3NJVA 1QJU1 2WC2A 1PO12 1HB1A 1RUH1 1VBC3 4PBPA 3M1HA 4HK9A 5FZ9A 3VZLA 1DBNA 3E6DA 2BZDA 5FOJB 1R091 2GNBA 3O0WA 3PDQA 4C91A 3LEGA 3MIHA 3OYWA 3I2GA 1DQ2A 3CZJA 1W04A 5GKAC 1EAH2 3MUZ1 2PHFA 2YU1A 2BFUS 4J6GA 1JHJA 4D8MA 1TEIA 1H2NA 1UZYA 2ADEA 2XOMA 2Q30A 4XF0A 5FUNA 2DTWA 2YHJA 5JOZA 2J1VA 5J3UA 1YCIA 2OX0A 4NN0A 1PVXA 3KCCA 4Q4X3 4XACA 2ARAA 1ZREA 5FY9A 5IFTA 4AR2A 3H3UA 5AC93 2D7FA 4YW5A 1D4M1 1WCSA 4BIFA 4JZRA 1YJKA 3ALQA 4YGDA 2X05A 3ZSKA 1LGNA 2J22A 4M3CF 2I07B 1W9FA 1SACA 1Q8SA 4EZHA 4Z92B 2R0HA 4BM8A 2UU8A 4FPJA 1JUIA 2Y64A 3VUOA 1MS9A 2G1MA 1WD3A 3PUAA 5FUPA 1UU5A 1WZXA 5LA0A 1IS6A 2RS51 2Y0IA 4LJHA 1WMFA 4ZS2A 2WLPA 4LNVA 2CWSA 3GDBA 4YYOA 3WDUA 3POEA 1BJQA 3H8XA 2JWPA 1OKQA 5GALA 4BQXA 4ASKA 3NV4A 3H8RA 1GOHA 1TME2 2JENA 2W08A 1US2A 4NUBA 3ETPA 2D6KA 4Q8LA 3IPVB 1RUD1 4CTEA 1GP5A 1Y9GA 4HVQA 4N90A 2Q8CA 2VUDA 5E8AA 4MYEA 2K9ZA 4YFZA 3IB3A 1NCQB 4F3JA 4COVA 5CADA 2TEPA 2GNMA 1K5MA 2XG3A 4B4QA 4QU2A 5A1FA 4AXOA 5BXXA 2W92A 1VAKA 2VOVA 3KF5A 1QMJA 3EXUA 4ZU7A 1XSRA 2PHLA 3GJBA 5HV4A 4OULA 2ZMLA 2WR9A 2CAVA 2MHFA 2R30A 2YC2A 5F9TA 3B01A 5FPZA 3JD71 1QOTA 1HQLA 3ZN5A 1HRV3 2EA7A 5FTTC 3KQ4B 5F6LB 1JZ4A 5CFCB 3NKGA 3AVRA 2XVGA 1H4HA 4BQ3A 3BB6A 5AFEA 3VBOB 2Y33A 3C7OA 3WNKA 4LBOA 5A1LA 3KSCA 1PO22 3VHPA 3WQ1A 3KGZA 3H7JA 3T2OA 3FL7A 4XCAA 1JYNA 2JE7A 5DXDA 4RR3A 2A5ZA 4GQ7A 4QGLA 1VBB2 4YFWA 5CFCC 3CU7A 1POQA 5EJ3A 4XEZA 1G7YA 1W0NA 5CYYA 1FMD3 1EPWA 3VDDA 3WW1A 5A3NA 1ULFA 1W2AX 2WFF1 3JU9A 5KBFA 5KHGA 5JMOA 3ME2A 1VBC1 1JBCA 4UWDA 3VHRA 3EHKA 5FZLA 2B7YA 2IUWA 4EROA 2X5IA 2RDSA 1NAEA 2Z69A 4YVWB 5JOXA 4DFSA 3VBSB 5HBAA 2SBAA 1RVF3 5FZAA 1NCRA 2P34A 5I8SA 4IV3B 3MZHA 3O7OA 5F5AA 4KBZA 3B93A 1O7FA 4CPBD 2GZWA 5FYTA 4Q4X1 4KQ7A 1EV12 2HH9A 1J1TA 3ZX7A 1DF0A 1A6CA 1O6UA 5FOBB 4RS5A 3VBSC 4D0QA 1AYM2 4OHYA 5C8CA 1C1FA 1Q3EA 1CX4A 1UY3A 4AAPA 2EXHA 1OUSA 2ZKLA 2MEV3 4IV3C 1JYVA 4JTNA 1DGRA 3ZFFA 4AI3A 3U0ZA 2PFWA 3D0JA 2A7AA 2GMEA 1V00A 3IT8A 3PJQA 1LOEA 4ZU4A 5A7WA 5FAXA 1OHFA 1W6OA 3ZXJA 2BFUL 1JMUB 1AL23 2XJPA 3NWKA 2QUOA 4QDSA 1KDKA 2JG8B 5A7QA 2CSGA 5FXXA 5JIAA 2RS32 2WZR3 4MO3M 2D40A 5IVVA 1LKNA 1XNAA 5A7PA 2GP5A 3KT7A 1FATA 1LULA 1GV9A 4JKLA 4AVCA 2AUYA 1F35A 2BEOA 2WJSA 2WT1A 4G4FA 4I3PA 1BLZA 4PIYA 2IFRA 3VD3A 2JG8C 3NL1A 5CAZA 3RI9A 3ZXLA 3GCXA 2OZJA 3LEKA 3KHBA 4MG2A 1YQCA 2FQPA 2VMFA 2ZX3A 4XIOA 4XHBA 1C4RA 2VVEA 4RSUA 5FK8A 1AJKA 4M4RA 3UT0A 3RYRA 3ZXKA 5EV7A 3RWKX 1OQ1A 2Q1FA 3MEPA 1DQ0A 2GAUA 1U5IA 1V9U2 4Q27A 3A21A 4AOCA 4K9SA 3TOJA 3I54A 4XJUA 4BQ1A 1UYYA 2ZXQA 1AVBA 1RC6A 1PMJX 1IPJA 1BCXA 1HRV1 5CISA 3MLKA 4AVTA 1TMF2 3MPBA 2YV8A 4ZXKA 1ZZ6A 3MHZA 4C8DA 3KV5A 1X8MA 3FBMA 3EMRA 1JHNA 1LOFA 4L97A 1PIV3 2XWBB 3FLRA 4WZCA 1PGL2 4H7LA 2X8KA 4IGQA 4ZKTB 3URFA 2XB6C 4A6SA 2VE1A 4CUAA 4FFFA 3ZN4A 3VD9A 1VRH3 3AX4A 2OUJA 1J83A 1U5YA 3WDTA 1LHWA 1FMD1 2FCVA 3KVBA 4GD4A 1ZZ8A 4K3UA 2WNUA 2D6PA 3NV2A 4IE0A 3RVHA 1ZBA1 3GALA 5F3GA 4GB32 4A6OA 5ERLA 1I1EA 2RS13 4JRAA 5IVYA 1RUJ2 4ASLA 1PMHX 5JSPA 1OH3A 2WWSA 4B7KA 4HKLA 3B00A 3PU3A 5DUWA 3ZFGA 1RB8G 3POJA 1OOPB 1XQNA 4CEYB 4KWKA 4RHV2 1Q5OA 1RVF1 2VZ1A 2K2SA 4PHZA 5L9BA 3ST7A 3U14A 1ZNPA 3OBAA 3DEMA 2DF7A 4Z1VA 3BTZA 4BCUA 5EHDA 4QHZA 3M8LA 1RUI2 3OY8B 3V0AB 2Q4SA 5FBJA 1VBD3 1W05A 3P6BA 1UZ0A 1OOPC 2ARXA 3RYKA 2VL4A 3WF0A 1MEC2 4CEYC 4UI9L 4X6QB 2VO5A 4EWEA 2MEV1 1QJY3 3J26N 2WLQA 1X33A 2WAOA 2D5HA 1YYNA 4XDOA 1SPPA 5K4LA 4AI0A 5LEJA 2CDOA 3HQUA 4FTSA 2ET1A 1AUYA 2JDHA 4C1XA 1JYCA 1AL21 1VLNA 1SDDB 3KV6A 4Y22A 2J1SA 5TSWA 1JW6A 4AFMA 1F5FA 2DCZA 2PHDA 2WZR1 1X8EA 2AEZA 1JODA 1NY71 2VNVA 5A6QA 3GHMA 2AGSA 1WBFA 3I97A 3N9NA 3QBQA 5K0UB 4TN7A 3TEXA 1MACA 2QKDA 2VXJA 3WG2A 1COV1 1W8ZA 1AYN3 1CZVA 3CZUA 2VCBA 5IATA 5JSOA 3CIHA 5D8AA 3OPWA 2G9ZA 3RZLA 2YBPA 3TB0A 5K0UC 2N7GA 4M3CB 1R1ZA 5D2AA 4AAXA 5EWSA 4FAGA 5FDBA 4A44A 4AI9A 1J3RA 2DVAA 1CAVB 2HWB1 3U75A 5F8PA 2OS2A 1IHMA 2WS91 3IMMA 4MADA 4AE2A 1W0PA 3W21A 3SCFA 5FYYA 1ULPA 1MR5A 5HPOA 2D3PA 1QJX2 1O3SA 4FCAA 4NIDA 2PMWB 4I30A 4Q4V3 4OQ8A 4DRVA 4XBLA 5IK4A 3OSDA 2HEVF 4BIOA 4CCLA 4BHPA 4DPNA 2OUHA 3AVSA 2F4LA 5KHJA 5IT6A 3C7HA 2W1WA 3IIIA 4AWDA 3W5NA 1S0CA 2WO3A 3ZSEA 1GLHA 4QGMA 1UYPA 1PIV1 1JOJA 1PVC3 2J42A 4WBBA 4AEJA 4CCCA 3H8OA 4NAMA 3OD0A 1RUNA 4CP9B 3AFGA 1AR62 4GA9A 4WM7B 1V6MA 4YG6A 5CB7A 1XOYA 4CDUB 4PLNA 4Q1RA 1VRH1 1NG0A 4O65A 1SBDA 2BUKA 1VRBA 1W8UA 2VZTA 2J1RA 2C26A 3M3QA 1C5IA 5FYHA 2QQMA 5B4XA 4EN0A 4YW1A 1D0HA 3O5SA 1DYPA 1WMEA 3J7HA 4XJ9A 2RS11 4HL0A 3SKJE 4QB6A 2A70A 4OHXA 3VDCA 4CDUC 2BQPA 3H50A 1JZ6A 1W3VA 5JI7A 2XJVA 1QQP3 4DXRA 2XL7A 5FYBA 4DIQA 4UFIA 3L2HA 1R082 1MQTA 1REEA 4XETA 4P02B 3ACGA 1YI7A 3PNAA 1FI2A 1CAXB 1UU6A 1VPHA 1UNBA 5EIYB 3O1VA 3IMNA 2ZGNA 1EPZA 3PU8A 2P1BA 1ASJ2 4RFT0 1DQ4A 1VBD1 3I2HA 1S0GA 3NRUA 2FHRA 4AHYA 2YU2A 2A75A 4LBNA 4I0BA 3SXWA 4YZ3A 1QJY1 2NZ9A 1CESA 4WM8B 1ZBE3 1UYZA 1CAUB 2UWBA 4XJZA 5FJHA 4D69A 4Q4W1 1AR82 2RG4A 5BNOC 2I74A 4P9YA 4CEWB 2YFZA 3FHQA 1BEV2 1CJDA 2C4XA 4QX2A 1VBA3 2WAAA 3FHAA 3HBZA 4WM8C 1MS4A 3AYEA 3NNGA 2JJ6A 2Q0AA 2RMU1 2QVSB 2P3IA 4ATFA 4CEWC 3B9CA 4QT6A 4AQ6A 1PNFA 1AYN1 1GOFA 3CJIB 2C1FA 2D3RA 3BIEA 4CCEA 1PM7A 1IS4A 4CDWB 2H6BA 2DVDA 1DQ6A 1K5MB 5GLWA 1POV3 5F2SA 2ZJCA 5FZFA 5L7OA 2CYFA 2HWE2 3C7EA 3PL0A 1C8M1 4E4DX 2C0ZA 3CJIC 5CNAA 2PYTA 5FZ4A 2DU0A 4CDWC 1V0AA 5IK7A 3UETA 3B7MA 3OJBA 1PK6C 1SLLA 4FFIA 3T1LA 3WF1A 1I5PA 2RM22 4AGRA 1Y3TA 4O7XA 2A3YA 4SBVA 3ECQA 1J3QA 1CR7A 4AI8A 1OLMA 2O8QA 1TG7A 3HWJA 4NPMA 5F2WA 1RJ8A 1U12A 3C8XA 1ENQA 3MDPA 3D8CA 1AXYA 1TNFA 4MH0E 4Y5Z0 1FYUA 1Y4WA 5JAXA 4NIHA 2D43A 4LLOA 1HRI1 1Y9MA 5FY5A 4J1XA 2DVGA 1LESA 4QPIA 1AR93 3TN93 2VCMA 2OPKA 2VQTA 4PF1A 5FMBA 3RG0A 4UFLA 1ENRA 1W2UA 4W65A 2X09A 4XUTA 3KWVA 5CG9A 2VTXJ 1OQEA 2IVJA 2XH6A 1RMU2 3O0VA 5DG2A 1UOGA 5FZMA 2P17A 3RZHA 4CSWA 4XMIA 1ZZBA 1LODA 4LKFA 1W9WA 2OXBA 5F6KA 2DCJA 4J25A 1FV2A 3DYOA 4L11A 1G9CA 2JDYA 5FYZA 4AI2A 4GKYA 1QQP1 2CAUA 1VMFA 3J8F3 2JDNA 4JX0A 4Y26A 1EY2A 3OBZA 3TWIA 5CU1A 4RA0A 4LE3A 2WUHA 3ZFEC 4KBBA 3JQWA 1H8TB 1UKRA 1F4AA 3PTYA 1UD1A 4LBQA 5FZOB 1LOBA 1WWYA 1X9PA 4RS5B 1ZVFA 3JB8A 3I3BA 3X29B 2WABA 1YIPA 1VBE3 2EAKA 4FOYA 5GLVA 2F6BA 4IE7A 4F8AA 1LHNA 3R05A 4HOOA 1J58A 1S2EA 4ASMB 3FJSA 4MGKE 4CXXA 1H8TC 3PMSA 3PUHA 1O8PA 5B4NA 2YYOA 5GJ6A 4RS5C 1W6OB 4OMCA 3N9PA 5LASA 2OYZA 2IC1A 2UYBA 1W2NA 1H9WA 1QXJA 4KG0A 4BK4A 1VBA1 4BE3A 4YSFA 1CPMA 2AENA 4QQHA 1IS3A 4QX7A 4COZA 3QD6A 2HEYF 2QCSB 5HCBA 1XXNA 1O91A 3OF1A 4L9BA 3GZAA 1OQDA 1MS8A 4HKOA 3N36A 4AHWA 5BYNA 5L36A 3B5LB 5EPAA 4DS0A 2Q8EA 4FPCA 1FAYA 3RGBA 2B46X 2QFEA 1DU3D 1FPN2 1H1IA 2HWD3 1GYKA 4GXLA 2PLV2 1POV1 3R6SA 3THTA 2VQUA 3CL1A 2XONA 1F31A 5A6XA 3WSOA 2C9AA 2ZHNA 4P9XA 1YI9A 2JG9A 2VM9A 3ZVXA 1RTVA 3ZPYA 2WQ8A 2ZBJA 1HJFA 2IXHA 3GXUA 5FZ1A 1DDLA 3OPTA 1GP4A 1MS0A 4XFHA 5FZBA 2PAEA 5C3SA 4XBNA 5IW0A 2VW0A 4PQ9A 4R9BA 5EXOA 2D98A 4AEKA 4QX5A 3NNFA 4BB3A 4PCRA 2NLRA 3WY6A 2W3JA 1WD4A 1RUE2 1QJZA 2YGLA 3WX5A 1OI6A 2VBBA 4XQDA 1QEXA 3PUQA 1ND3C 3NMBA 2RJKA 4Y24A 4TLFA 5FY4A 2FD8A 1QJU2 2VQ0A 3THCA 1DP0A 1RUH2 3RZKA 1WCQA 1AR91 3TN91 3A22A 2WNUB 3H1YA 3MW4A 1C1LA 1R092 2WWUA 1QJFA 3INAA 5T5LA 4GMP1 1D2QA 5IJRA 5EYXA 1OFSA 4KWUA 4X6RB 3NAPA 1D2SA 1XJAA 2BVVA 3APBA 4NPRA 3WNXA 1RUC3 3AZVA 2DTYA 4IEZA 4P14A 2P37A 4QXCA 3DPRA 5FPBA 4XABA 1S2BA 1YFWA 2W46A 2QQLA 1UN1A 1BMV1 1IOAA 3LA7A 1ODNA 3J8F1 3S7IA 5IYYA 4FP2A 1GWLA 2LALA 2XHKA 2VZQA 3AP9A 3GZEA 4HXCA 4LBLA 5CKQA 3FLPA 4Y20A 5BNQA 4XTMA 1LOCA 5C70A 1IKPA 5IFPA 2HWC1 3DF0A 2R072 1H2MA 3H1MA 3I2IA 3WP4A 1GUIA 1C28A 3HQXA 1YHFA 4NMIA 4LORA 2RJLA 3WXPA 1VBE1 5F37A 1LNSA 1K3IA 3P3PA 1MS3A 4DNYA 1YJLA 5KHKA 1ZZ7A 2BTVC 5F1RA 2QQPA 1ALYA 4A42A 4C0BA 1QKQA 2BV4A 2QQUA 2RS52 1HV1A 3ILFA 4FXKB 4LE4A 2F17A 4Q8KA 2JB8A 2K46A 2Q1ZB 1NX9A 3KF3A 4LPLA 5DDJ3 4QD2A 4Y22B 3ABZA 2HYXA 5FP8A 5GZFA 3U4SA 5LBCA 1VALA 1NXMA 1FNZA 1F9KA 2D6LX 2H0VA 4LK6A 1WLCA 4OUSA 4JV4A 5FPUA 3L2YA 1UOJA 5H9QA 1UMHA 1WCUA 3N7JA 4XFBA 2YPJA 3ZXFA 3DKWA 4LA3A 5D8AB 4OI2A 2UY8A 2HBUA 1UO9A 4GJYA 5A3OA 2A6XA 4XFIA 2EALA 1U5ZA 4QKNA 3O1SA 3KZ4C 4HK8A 1W8OA 1W6NB 3SCGA 2VUAA 1WCKA 3LB9A 4LO7A 4NO4A 3R4DB 4GWMA 4Q0UA 1ND2A 4FVVA 2XGXA 1AR71 4BMBA 4LKEA 1DZQA 5D8AC 3KHCA 1K5JA 3ZOIA 2LTNA 1REDA 5FYSA 5GZDA 4P5HA 3J7LA 5FZ3A 2E31A 3H42B 4OHZA 4CP2A 1RL3A 2R6QA 2W68A 4NE9A 1A8MA 1FT9A 4FT8A 3OGRA 4LBKA 1OLRA 1TE1B 3HVDA 3M3EA 1UMIA 3NNLA 4OQ9A 5FR3A 4A4AA 1BBT3 4DY5A 5ACA1 2BBAA 1QXRA 5FFOC 1YQ6A 4OI1A 4BDVB 4HMZA 1GP6A 4I01A 4IL7A 4YVSB 2V5DA 5F5QA 2VW2A 4ES8A 1IKQA 2QDRA 1G86A 3WEZA 2WFF2 4LIVA 1JYIA 1VBC2 1QJEA 2ADDA 2VMHA 4K20A 5FMCA 5C9AA 1YXWA 1XSQA 3I3MA 2XL9A 5FQ0A 4CCDA 4HN0A 1PMIA 4YVSC 4IUGA 3K3OA 3USUB 5JXIA 4AVBA 3WT3A 4CCNA 1W2TA 5JOWA 1RUC1 2UURA 4DUWA 1NQJA 1PGW2 3GBGA 3NJXA 3I59B 3AFKA 1WW4A 4FPKA 5IVJA 3POSA 1MQTB 1WCDJ 2HWF1 2E7AA 2DVFA 4M4PA 1UPSA 2A3WA 2XJTA 1H9PA 4L99A 1F4HA 4HN1A 3TBDA 2XQRA 4UAPA 4RFRB 5A32A 1DCSA 1UQXA 1S0DA 2ETEA 2QJVA 3HN3A 3MV11 3T2QA 1CZTA 3K46A 1N3QA 3RFRA 4EN7B 2QQWA 1YIFA 1ACCA 1KJRA 3V64A 1MQTC 3EB7A 3UYJA 3BALA 4QHOA 4LHKA 5DAQA 4LO4B 4XJAA 3CO2A 3A0KA 2J1TA 3N9QA 3CHXA 4JDMA 5C3PA 3I8TA 5HV0A 4E4ZA 2QQVA 1CVNA 4CVUA 3WV6A 3M3CA 1K12A 2VCCA 2LROA 3QOPA 1QY4A 2XVLA 2ZKNA 4BQ2A 1D0GA 1GQHA 4HZFA 3ZN6A 1QXPA 5DDJ1 3PUIA 5BNPA 1EAH3 3AMQA 4C1WA 4CDQA 4L2NA 3TEZA 2ARCA 1GNHA 2DUPA 4HSJA 3HQRA 4QQPA 2OIIA 2FZ1A 4CCMA 3BU0A 3ETQA 1R1A1 4NR1A 3ZXGA 3IBMA 5JUVA 1JS9A 5FZHA 4N43A 1X50A 2VNGA 4LUKA 4R4ZA 5K9YA 2D6NA 3H0OA 3DUIA 4XJ8A 2R041 3MIFA 2R16A 4FXGB 2ET7A 1LR5A 1V6OA 4UT5A 3MICA 5FPAA 3LIHA 5FZDA 2A6WA 4AL9A 1W9TA 5L7OB 3LF7A 2KXLA 1LRHA
chains in the Genus database with same CATH topology
2DFCA 1DGWA 2ZABA 1XNKA 1IS5A 1J3PA 3TNQA 2FMYA 3MIEA 5C4WA 4I2OA 2PHWA 1DZRA 3LGRA 1HRV2 1NCQC 2GN3A 3RJRA 2A6YA 3B02A 1VIWB 3RPQA 2VG9A 3ZXDA 4UW4A 3VKNA 4OZXA 2WNEA 1TME3 3R4UA 2BBVA 2TNFA 3FZ3A 4YARA 4Q1PA 1NOVA 4S2FA 5BNNA 1OLQA 1AJOA 1S55A 1ULDA 5J37A 1HXS3 1BYHA 3MGUA 1SEFA 2VGDA 3VZKA 1ZBA2 3VBOC 3LOBA 2ZX2A 4YM0A 2ZGUA 3ZO0B 4GH4B 3VL9A 1N3PA 2IXKA 4QPGA 1N1TA 1GNZA 4S2HA 4PIXA 5ABJA 1DYKA 1A3KA 1B09A 1RVF2 3HMYA 4H55A 4GH4C 4CDXB 3GYDA 5KC5A 4RGAA 1F8VA 1W6PB 4HSLA 4XQWA 4BZ4A 4FAHA 2GALA 5CVRA 1IZ3A 5T5OA 4FPGA 1FNYA 4YVWC 5CFDA 4CDXC 2MEV2 3ZYJB 5AC91 2XJQA 4AVAA 1QOOA 1A8DA 2ZAHA 4FBFA 4EN8B 1AL22 4XHXA 3ZDSA 2DYCA 3GBWA 1LOGA 4A7ZA 2XJSA 2ZCWA 4KGGA 5EFUA 4C90A 1HW5A 2D6OX 5CA6A 4WVZA 4LO8A 1VB2A 1MZEA 4P9LA 1COV2 1DFQA 1EYBA 2EVXA 1O3RA 3KB5A 4MXWA 1EV13 1FV3A 3PVEA 2EAAA 4IEUA 2VU9A 4KG8A 4O9EA 4ZU5A 3VKOA 2IFWA 1SLCA 4KL1A 1ZX5A 3RMYA 3EBRA 2HWB2 4AFDA 4YGEA 2Z42A 2WS92 3DL3A 5KXCA 2Y38A 2JG9B 3LZZA 2B42B 1H2KA 1AX1A 3JQXA 4PDWA 5T3NA 5FO8B 4B4PA 3QLQA 2DCTA 4META 2GH2A 2OVUA 4HT1T 1JTZX 1RUG2 5FMOS 3L9JT 4CZSA 1QNWA 2QZ2A 1LU1A 2WFPA 5GM0A 4YW4A 4WV8A 2A6VA 1PIV2 2GN7A 3N3HA 2IXCA 3VBFB 1QF3A 4XE9A 1KFUL 2PAKA 3VBRA 1HXS1 1NA1A 2BNMA 3SH4A 3NSTA 2LUWA 4IERA 4MGIE 3D82A 4G9SB 5E89A 1AX0A 3M3OA 1KQRA 5JWPA 1SLIA 3NAPB 3HD8B 3I2DA 3VBFC 1B35A 2ZOEB 1CD3G 4N53A 4URTA 4OFGA 4UBHA 3O12A 1TMF3 4YGBA 1O4ZA 2AYHA 3NAPC 1HIXA 2GNTA 2CV6A 1GZWB 2R49A 4Y20B 1BQPA 5L73A 4D7TA 1LOAA 5FLIA 2OZ6A 3IWZA 3VBHB 1PZ7A 2QZ3A 2AH2A 4YRDA 3I7DA 1NYWA 3BTAA 5T5JA 5JZGB 4B8EA 4Q4W2 4HPKB 4GB33 1H0BA 2WNVB 3VBHC 4FTEA 1S0IA 1YRZA 1RUJ3 4LULA 3RS6A 3FUOA 2IWGB 3UV9A 3RNSA 1UIKA 3OGJA 1BKZA 2EF6A 1A78A 2ZGSA 5JZGC 3RMXA 4AVSA 2RMU2 2ZMNA 3WUCA 3JUUA 4N9IA 4RHV3 4AK3A 2WNVC 4AQ2A 1AHSA 2MNGA 2ZHLA 3P3NA 1NLRA 5BPXA 4PBOA 4GKXA 4UW6A 1RUI3 2DV9A 3LCPA 3S0MA 1MEC3 2VXRA 4DZGA 5GLUA 4WVMB 2WL1A 2VW1A 3V0BA 1RUOA 1BZWA 3O14A 1C8M2 4R8HA 2RR12 3KT4A 1QH6A 1RUF2 3WG4A 2NYYA 4E2QA 2XKPA 3MPPG 1GANA 1C3HA 5JI9A 4XILA 4JGYA 4IV1A 3ACLA 4H14A 3ZSMA 2XWJB 2NN8A 1G6NA 1GZ9A 1F2NA 1KS4A 1ULGA 4L8QA 4E4SA 1AX2A 1EP0A 1W39A 1I9RA 2XLGA 2XJUA 3JCIA 5FO7B 1H1MA 3KCYA 4HVOA 5AVAA 1AL0G 3RSJA 4QMAA 2WQ4A 4F83A 3ILNA 1HRI2 5FREA 3VBUA 1LCLA 4FOVA 1ONAA 4HFSA 2VVFA 2UYAA 4QXKA 3ZIWA 3ZXAC 1H4GA 4CP1A 5A33A 2EIGA 4RL7A 2WA3A 1OPMA 3V65A 3ZXEA 5FQ0B 2P3KA 2VMIA 1UKGA 1VR3A 2QE3A 1JXNA 3VKLA 4XFAA 2BW8A 2Q8OA 4D3WA 3GZUC 5LK5A 3OYWB 2QNKA 4M0NA 4WM7C 2Z5WA 2PHUA 2E53A 5JIUA 1QWRA 5I0RA 4XW3A 5A32B 4YLZA 2ATFA 3PLQA 4FPHA 1Q43A 2B5HA 1UMZA 1PHMA 1PGL1 1LHUA 1AR63 3E97A 5GLZA 2VNOA 2E63A 1S0JA 1KDMA 2A73B 3AKQA 2O0OA 4S2GA 1XYOA 1HQNA 5J7MA 4DOUA 4GB31 4LBJA 4AVVA 4MX3A 4JCKA 3FWEA 4ATEA 1H30A 2ZX0A 3NKTA 5BNPB 4QGNA 1ENXA 4ISRA 3SMHA 2EXKA 1ULCA 5IUQA 1HLCA 2CY6A 4LHLA 5HXVA 5FPXA 5KXEA 4K21A 1QH7A 1H1AA 4RHV1 4AFBA 4ORFA 2VNRA 4N43B 5BNPC 4IEPA 4YZ1A 1ASJ3 4U36A 1YO8A 2K0GA 1RUI1 1CONA 3LOIA 3ZYIB 3N35A 1WLDA 4BWOA 2PQQA 4EN6B 1VB4A 4FOWA 1ZYBA 4Y1ZA 1WA4A 2W39A 4HANA 1AR83 3AZXA 3R0RA 5C4WB 3AYDA 1O4YA 3VN4A 3TYJA 2XBO3 5K7PA 4OHWA 4QPYA 1BEV3 5JMCA 1K5MC 4A2UA 3W59A 1QU0A 4JGZA 4BH9A 4IEWA 1J1LA 4Q4V1 4UXAA 4BOWA 3IPVA 4HBNA 1Q8VA 4DB5A 3E5QA 3NVCA 4XDQA 3ILRA 1W0OA 4JDOA 5KXBA 1N1VA 3UK9A 4RR3B 1AR92 1X36A 3AP4A 3TN92 1PVC1 1Z7S2 2CNAA 3AXDA 3HAGA 4DQAA 1G9FA 3CEWA 3AK0A 4F7ZA 4QPGB 5I0TA 2GNDA 4IEYA 2D5FA 4MXVA 3DV8A 4RR3C 3MFAA 2OA2A 2UWAA 2RM23 1BMV2 2DVBA 3FC0A 2X5IB 2RE9A 1Q8PA 3J8F2 2GDFA 5CFCA 2R063 2D3SA 3FFQA 5LRRA 3NW4A 3VDDC 2KA3A 3BOPA 4QPGC 4FPOB 4MGZE 4S2DA 5T5PA 4NHKA 2HWC2 2B9UA 4MSVA 1NCRB 3MIGA 5LK7B 1H8VA 4MUVA 2X5IC 2DCYA 4MVTA 4V1PA 1N47A 3K48A 3IN9A 2HKXA 5JPNB 3WP5A 1C5HA 5C8CB 1AR61 2NMNA 1NCRC 1QNYA 1BXHA 3WHUA 3ZFFB 1RMU3 1VAVA 2C5DA 2O8OA 3RZZA 4QM8A 3NV1A 3VHNA 1YLLA 2Q5TA 4P9GA 1ZBE1 5C8CC 4Z82A 1KS5A 4IQPA 4GWNA 1YWKA 3VBSA 1G9DA 3ZFFC 4I02A 1XNCA 4TWTA 1KD7A 3O0XA 2ZGKA 1GFF2 3E6CC 3WW3A 2ZTNA 4GALA 1I6XA 1SBFA 2YROA 1ASJ1 1CN1A 3MF6A 2FMDA 2PA7A 4N7UA 3WCRA 1AR72 1MVQA 1XU2A 2E7TA 2ILMA 4A7YA 4PDWB 2VMGA 4AFCA 2JG8A 2XBO1 4BMEA 5ACA2 3CJXA 3WHTA 4GULA 4QQOA 1FOD2 4Q4Y3 1MZFA 1X82A 4PDWC 3ROUA 4COUA 4FPLA 4I09A 3T2TA 3AYAA 4EN9B 2ARBA 1KRIA 4G3YC 3UKNA 1RITA 3AP5A 3WW4A 2VULA 2ZHMA 1FPN3 4W6WA 1BVP1 3D5OA 3VBRB 2WSVA 5HCAA 1H2LA 1DGLA 1NA1B 2I2SA 1ZREA 5CIRA 3RJ2X 2PLV3 4YG3A 5FCCA 3GBFA 1LEMA 2CL2A 2O1QA 3AJZA 1LOFC 3TNPB 2NQYA 1RUC2 1B35B 3N4MA 1Q8QA 4LA2A 4MZUA 3QH6A 3VZMA 1DQ1A 3SH3A 3LA2A 2HWF2 3QACA 4IEOA 4KH9A 2PAMA 2R061 3ZFGB 2WNUC 1B35C 4XF3A 1RHI3 1U5XA 3LAGA 3A0NA 4AQSA 1RUE3 4NHMA 5JR7B 4AEMA 1D4M2 4DINB 1V6JA 3E5UA 3JBG3 3ZFGC 4E27A 1OSGA 3MI8A 5T54A 3KCXA 2FZ2A 3RDIA 3WR0A 1RINA 1WLWA 5J98B 4XJWA 1SCRA 5BUVA 1LGBA 4FQZA 1QHDA 4XFFA 4X8PA 5DDJ2 2PHXA 2UY9A 1XYNA 4XFGA 1GBGA 1U0AA 2Z2SB 1TQ5A 1W6QA 1MS1A 1OOPA 1R1A2 4Y4YA 4CEYA 4QQ2A 3IDCB 2GC1A 3EO6A 5I8YA 4XXAA 1AXKA 1RUD2 2R042 4XOGA 2R073 5H9RA 1AZDA 2IZWA 1Z0HA 4RQPA 5KHHA 3V0BB 1SDWA 1Q56A 2HWD1 3USSA 5DUVA 3D0SA 3OD4A 5IK5A 4JGYB 4IV1B 1FX5A 1IQAA 5HCFA 1SCSA 5I91A 5KC6A 3JD72 3U10A 4MV2A 4XPVA 3SHRA 1Z78A 3VV1A 3WCSA 2G9GA 4YW2A 2WSUA 3M3IA 4D7SA 2V73A 4IV1C 4Q4Y1 2WINB 1L3JA 1V6NA 4R4XA 2EXJA 4Q0VA 4RGGA 5J48A 1XE8A 4U2AA 5CG8A 4ES9A 3AZWA 2ZGPA 4WVWA 1FPN1 3ELNA 3Q9OA 4M3CA 4B7EA 3ATGA 1I5ZA 3KGLA 4J1WA 2Y26A 2PLV1 4FSJA 2XPJA 3NV3A 4K8FA 1HQWA 1SFNA 2E9QA 3B3QE 1N1YA 1CPNA 5DUUA 2X53S 3PMEA 3HN1A 1MVEA 1ZRCA 4C0HA 1MZ5A 5H9SA 3G6JB 4QHBA 1UAIA 1KITA 1YFYA 4XQ4A 1RHI1 4Q4X2 1LGCA 3AZZA 1RIRA 1SFYA 1RUE1 5AC92 2PHTA 4CDUA 4WZFA 1GQGA 2WFF3 3JBG1 3M70A 4XIKA 3CF6E 2XLAA 1SLAA 1Y43B 3BPZA 3PVOA 2JD4A 1PO13 1W6MA 3IIAA 3RQ0A 3PVBB 5FLHA 3RI8A 1UIJA 4QQLA 2D6MA 1O5UA 4FQ4A 1WUVA 2ES3A 1S0BA 2AR6A 3AP7A 1ZZ9A 2VOWA 1LENA 3AP6A 4XYXA 1SLBA 4AF9A 1CAXA 3D6EA 2ZZJA 4Z8BA 4K6BA 2VUJA 2Q1MA 2R071 3THPA 2NP0A 3VLBB 2VH9A 5BNOA 1DQ5A 3BU7A 4HVRA 4FPFA 4AW7A 5JDBA 1ZZCA 4PJYA 3FMGA 1NZCA 4ONUA 4TYSA 4AG4A 3AM2A 5BY5A 4WM8A 1CAUA 3WG1A 4D7YA 4LBQD 4CEWA 2E7QA 2YY1A 2VECA 2ZPXA 3S6PA 4ISQA 1GZCA 5C8WA 1ZRFA 4JGZB 1S0EA 5L7OC 1G9AA 4BPZA 1BBT1 4Q26A 2GMPA 1UU4A 4PF5A 3CJIA 3C3VA 4CDWA 4JGZC 1XU1A 1HXS2 1DZTA 1PK6A 4X8NA 3WOGA 1CJPA 1FMD2 4QPIB 3OGGA 4YZ5A 4AFAA 2WIIB 3WDXA 3LA3A 3KT1A 4FO9A 5I0SA 3LSEA 3MLLA 5J36A 1WGPA 3IDBB 1CQ9A 4HKWA 4QPIC 4YW3A 3WP6A 1G9BA 3VKFC 1S0FA 2ZACA 5JVVA 1IPKA 3UKVA 3S7EA 1SBEA 3S30A 2EXIA 4LO6B 2YMZA 1PO23 3H1WA 4Q29A 4LBQB 3H8UA 2RHPA 2CGNA 3M7AA 1VBB3 3MIBA 2BVBA 4B29A 2ERFA 3D4KA 1ZBA3 2IXIA 3MF9A 4Y1VA 3CNAA 1PO11 3ZFEA 4IEQA 1VAMA 3K51A 1SLTA 1PGW1 2JICA 3ES4A 2WZR2 3LSDA 1NY72 1EAH1 5JOYA 1LECA 1OMIA 1Y9QA 3M2MA 1H8TA 1WMDA 4FP3A 3WDVA 2GMMA 4BLIA 1N1SA 5KHIA 2NM1A 3U4XA 3U11A 2V5YA 3IM0A 3U07A 1AYM3 3HR9A 4AGGA 3AZYA 1LB2A 2R1BA 2G4IA 1LTEA 2GU9A 3B94A 5KXDA 2XJRA 3KD4A 2H0BA 5DZFA 3WDYA 1V70A 4M3CE 3KLSA 3GF6A 1OD5A 3FUQA 2RS33 1COV3 5A3MA 1YFUA 2JG9C 1TME1 4FTBA 3WLUA 3C2UA 4OVEA 3H7YA 3EQEA 4BLJA 2ZGOA 2CWMA 2HWB3 1VRH2 3ZYRA 1DIWA 2WS93 5EZWA 2I45A 2G9FA 4EJRA 1WW7A 5GZEA 1V9U3 2RS12 4LR4A 1T6GC 2A3XA 4FPEA 1RUG3 1M06G 3DPRB 5FRAA 1ND3A 3NJZA 2JXAA 2WQZC 4Q0QA 2BPA2 1OFNA 4LO5B 4E9KA 4LTAA 2ZGMA 2LM3A 5AFBA 3AMNA 4COWA 2ZS6B 1XNBA 5JLVA 1IGOA 2A71A 4GIQA 4XZPA 5DG1A 3KS7A 5SV8A 3VHOA 3DPRC 3GNEA 5JSRA 1PO21 1ZRDA 1DGWX 4XXPA 1VBD2 3ES1A 3ZYGA 4DRRA 5KWRA 1Q8OA 3WG3A 1VBB1 2X29A 2YDEA 4K7JA 4KNCA 1QJY2 2V09A 1QDOA 2WZPP 2Y0OA 4K1ZA 1UX6A 1KJLA 1LHVA 3B9IA 2E51A 2R0FA 1W6QB 4LBMA 4Y1YA 1YNAA 4Z2WA 4R9AA 4OHVA 2ZGQA 4JTOA 5FBZA 2F4PA 2CTVA 4HLTA 2ZGRA 4KU7A 4M00A 3WQ0A 1AYN2 3RRDA 5JPMB 1O4TA 1XRUA 5C6CA 5T52A 1HDKA 1EV11 4RQPB 4E2GA 2ZA9A 1AYM1 3IKWA 2E6VA 3OCPA 4Q2FA 3EJKA 2SLIA 4H7MA