1UYYA

Carbohydrate binding module (cbm6cm-2) from cellvibrio mixtus lichenase 5a in complex with cellotriose
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
131
structure length
131
Chain Sequence
MVIATIQAEDHSQQSGTQQETTTDTGGGKNVGYIDAGDWLSYAGTPVNIPSSGSYLIEYRVASQNGGGSLTFEEAGGAPVHGTIAIPATGGWQTWTTIQHTVNLSAGSHQFGIKANAGGWNLNWIRINKTH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELLULASE B
publication title The Crystal Structure of the Family 6 Carbohydrate Binding Module from Cellvibrio Mixtus Endoglucanase 5A in Complex with Oligosaccharides Reveals Two Distinct Binding Sites with Different Ligand Specificities
pubmed doi rcsb
source organism Cellvibrio mixtus
molecule tags Carbohydrate binding module
total genus 28
structure length 131
sequence length 131
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03422 CBM_6 Carbohydrate binding module (family 6)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 1uyyA00
2DCKA 2W1UA 3FN9A 3CQOA 4OMDA 4LHSA 1O8SA 1F4AA 2WUHA 4A42A 1JZ4A 5LA1A 3WF2A 2VMFA 2VZVA 2Y64A 4MO3M 4W8JA 4UOJA 4LKSA 5IHRA 1K42A 4L0PA 2WZ8A 3HNBM 3SEEA 5JXHA 3WNOA 1SG3A 1W8NA 3MV01 4DEQA 2W46A 3BGAA 2XQXA 1KEXA 4XUTA 5I0DA 1JZ2A 2JDAA 2VL4A 3WNPA 2Y6HA 4CUAA 1UYZA 2E31A 3MBWA 2YC2A 1K12A 4DXSA 1EUUA 4CUBA 4JX0A 3HOBA 5LCWL 1OF4A 1XNTA 3GDBA 5C7GA 5CYYA 2W1SA 1DLCA 4QX2A 4CVUA 1I5PA 3WNNA 3JXSA 3FL7A 3WF3A 1F4HA 5JR2A 2DCJA 3OEBA 3THDA 2WQ8A 4D8MA 4XUPA 4QX0A 3K77A 5A1AA 1UY3A 4QDRA 3UNPA 1UYXA 4ARXA 4HG6B 1ULPA 3BN6A 5CZKA 1JZ8A 3HEIA 3HN3A 4JKMA 3T09A 2DDUA 2XHNA 3NQHA 4BDVB 1JZ3A 2VOTA 3K75B 4CU8A 2EIDA 2VZSA 4OUEA 4OYUA 4W50A 4JHZA 5EJZB 3E1F1 2WN3A 1US2A 2WO1A 2VTFA 4A3ZA 3ACGA 4XUOA 3IAQA 3ACHA 5DPNA 2BBAA 4QB6A 3AC0A 1CIYA 3WEZA 4M4PA 3LQCA 2EIBA 4QDQA 4DXTA 2Y6JA 2WYSA 3MO4A 1UMHA 4MGQA 5DQ0A 2W47A 1W9WA 3IIIA 1CX1A 2QQIA 3IB3A 2VZUA 4CU9A 3LEKA 1KGYA 2Y6LA 2VZQA 3LE0A 1K3IA 2XONA 4BXSV 4A4AA 3I2IA 4DUXA 4ARYA 2Y8KA 1J84A 1PMJX 2C4XA 2JE8A 1W99A 2J1SA 2J1TA 2YFUA 2J22A 1IQDC 3CIHA 3OGSA 3C7OA 3CDZB 3I2GA 1K45A 4E8DA 1YQ2A 2C26A 2WZEA 3FHAA 2ZEXA 2HLEA 3ACFA 3WNLA 2VZTA 3DYOA 1LNSA 4KWUA 3F2ZA 1BHGA 1HN1A 2W87A 1UXZA 4MOAA 4UAPA 3K4ZA 3C7EA 3VDCA 4QB1A 3ECQA 2VQTA 4UI9L 3SKVA 3ACIA 2ZEWA 4CU7A 1GOHA 3T0BA 1WCQA 3ABZA 1DP0A 5JXGA 4XUNA 3DYPA 5IYYA 4PT6A 2WDBA 5C71A 1MPXA 2VQUA 3J7HA 1O59A 1W9TA 4QDSA 2KD7A 5IFPA 4FI9A 1JI6A 2R7EB 5HPOA 2BGPA 3CKHA 1GNYA 2W95A 4BK5A 3I97A 2WBKA 2VR4A 4DUVA 1GQPA 4TTGA 2EICA 4A41A 3UETA 3NNGA 2J1VA 2BGOA 5JXJA 3I3BA 5LA2A 2V72A 1JYWA 5FUIA 3PUHA 3OBAA 4A44A 3U37A 2B4KA 1UMIA 3IDAA 3WF1A 4ZY9A 2XOMA 2YB7A 2QQOA 1JYXA 2VMDA 1GUIA 3DYMA 4M4RA 4OMCA 3C7FA 4P08A 5JXIA 3WF4A 1SDDB 2ORXA 3OEAA 3LPGA 4QPWA 3C7HA 3VD9A 4P02B 3P1IA 1W0NA 1NUKA 1UY2A 2JD9A 4A45A 3WQBA 3FHQA 2VZOA 1SHWB 3GM8A 1UY1A 2E26A 1GMMA 3MV11 3UESA 4BK4A 2WO3A 2PQSA 1US3A 4W4ZA 1CZTA 3W5MA 3P6BA 1NAEA 4Z2AA 2VMCA 4GWIA 4CUCA 3A22A 1JZ5A 1TG7A 3LPFA 4ZXEA 1H6YA 1R64A 2W94A 4P5YA 4AG4A 2ZXQA 3I2JA 2V5DA 2CDPA 2J7MA 1GOFA 3MUZ1 3C7GA 4DEVA 3I3DA 2QQNA 3K4AA 5LA0A 4GWJA 3EYPA 4KI5M 1UY4A 2VZRA 5IFTA 1NKGA 4ZZ5A 3D3AA 3W5NA 3NJVA 3VDAA 2X09A 3A7QA 1GU3A 4P00B 2W3JA 1L7RA 1JZ6A 2W9XA 5DN2A 1XC6A 2VC9A 3T0AA 2E33A 4JKKA 3T08A 5JMOA 2W1WA 5B4NA 3K4DA 2LS6A 1XPWA 5F7UA 5C70A 1JYNA 3WNMA 2ZEZA 1NX9A 1UY0A 1W8OA 2VM9A 1JU3A 3VD4A 4PF1A 4XURA 4D0QA 2YG0A 3CZUA 1UYYA 3NRUA 2QQKA 2HYXA 5J1XA 1OD3A 5B4XA 2ZEYA 4QX1A 1UXXX 3DECA 3MUY1 2J1EA 4DUWA 1O8PA 1W9SA 1L7QA 1CZVA 4PQQA 3K46A 3WF0A 1UZ0A 3THCA 1WKYA 2B9VA 2L9LA 2E32A 3SKJE 1EUTA 1UWWA 2J1AA 2X10A 4XZUG 2X05A 3WNKA 3A23A 2YC4A 2CDOA 1GOGA 2OKXA 3HNMA 3HPNA 4RN5A 1PX3A 1P8JA 2J1RA 1OH4A 5EJ1B 1OT5A 2Y6GA 4DXRA 1OF3A 4IUGA 2WAAA 1H6XA 3VD5A 4LPLA 2W91A 2WABA 2BERA 2QQMA 2VCBA 2RV9A 3HNYM 2VMEA 3SEPA 5G04L 4YPJA 2QQJA 4MADA 3ZM8A 5JUVA 2RJ2A 1CZSA 2VJXA 4KMQA 2WAOA 3LEIA 5IJRA 4QX3A 2EIEA 3ETPA 1RYYA 2VZ1A 3I2HA 3VDBA 1XNAA 4TXWA 4LQRA 2ID4A 3I3EA 2Y6KA 4GZ9A 2RVAA 4MGSA 3EB7A 3OG2A 2C9KA 1J83A 1JYVA 3GXUA 3GGLA 3I2KA 4AAXA 3HJRA 1JHJA 5G05L 3LEGA 3CMGA 3NJXA 4CU6A 1JU4A 2J1UA 2W92A 2WN2A 2JKXA 4OZOA 4RYDA 4QAWA 3T2OA 2VO5A 2VZ3A 4XUQA 4ET7A 4QB2A 4A6OA 3IAPA 4E8CA 3T0DA 5DMYA 1UX7A 1D7PM 3A21A 1JZ7A 3VD7A 2VZPA 2W5FA 3PUIA 3C8XA 2WO2A 1ULOA 1PX4A 1PMHX 1TVGA 2ORZA 2Z4FA 3VD3A 2QBXA 4BJ0A 3T2PA 2VCAA 2W1QA 1DYOA 3WSOA 3OGVA 3OGRA 2LW8A 2QQLA 4XVHA 3CZJA 2BZDA 4JKLA 2YFZA 3T2QA 3I2FA 4ZZ8A 3OB8A 1T2XA 5HXMA 2V4VA 5EIYB 2VCCA
chains in the Genus database with same CATH superfamily
2DCKA 3FN9A 1NLRA 3PVEA 4BISA 3GALA 1O8SA 3RZMA 1WZXA 4JDNA 1HB3A 4BMEA 1WMXA 4XF4A 4IEOA 2HWB3 1DQ6A 4P9WA 5LY2A 3VDDC 4A42A 4WM7B 1FMD2 3MGUA 5LK7B 5EZWA 2WT1A 3WDTA 5KBFA 2DURA 2XPJA 4LXLA 3THPA 4IGQA 4W65A 4DFSA 1VRH2 1N1SA 2Y64A 3FWEA 4Y4RA 5CFDB 2PHXA 1UZYA 2ZOEB 4JV4A 2FDKA 5IHRA 4XJZA 2DUPA 4L0PA 1YNAA 5I0DA 1YIPA 5GLWA 4FO9A 2VBPA 3WNOA 1Y9GA 5JI7A 2ZACA 1RUH3 4O9EA 3AYDA 4DEQA 2MPFA 2XH6A 3LZZA 4NHLA 4M3CA 1O4ZA 4URTA 1VBC3 3RYKA 2BNOA 4M00A 3BTAA 4BQXA 2CV6A 2ZX4A 4AFAA 4QU2A 5FZ1A 2JDAA 2VL4A 2Q5TA 2NN8A 5DDJ3 1ZM1A 4AVCA 2WWSA 5FMBA 3E6BA 2QDNA 1AR73 3M3EA 1YC61 4CUAA 1LENA 3U78A 3SITA 4GA9A 4Q4X3 3ETQA 1PGL2 5ACA3 3AM2A 3N7KA 1OF4A 1NCQA 2I2SA 1A8DA 1XNTA 3GDBA 1DLCA 4XTPA 4XILA 4GIQA 5FO9B 3WNNA 1QJY2 1X9TA 4JQRA 1NLQA 4FSJA 2GC2A 1UZWA 1XE0A 3WDWA 3FL7A 2GMEA 3PMSA 1WLTA 5JR2A 3OPWA 3KT4A 3OEBA 4K8RB 1DGWX 1PIV2 3J26N 4AEDA 1HRI1 3CL1A 2WQ8A 4XUPA 1BEV3 2DV9A 1WLDA 4QDRA 3V0BB 1QNWA 1H1MA 1LOAA 2F4LA 1ZA4A 2G9ZA 2ZABA 5SV5A 2WS93 1IG3A 1ULPA 5LEJA 1LOCA 1ZRCA 2WNVB 4I0AA 4XHXA 5BNNA 4NRPA 5FYUA 2QFEA 1DGWA 5EJ3A 3AX4A 4D6QA 4BDVB 2BFUS 3M3IA 2WQ4A 2EIDA 1K5JA 3BALA 1O3SA 4OUEA 1R093 4OYUA 1MR5A 4TZDA 1XE7A 1C1LA 5C3QA 2Y26A 1DLLA 5D8AB 4XFCA 2WO1A 4OQ8A 2PHUA 2D44A 4XJUA 2WZR3 2GH8A 1NQDA 2PHTA 3IAQA 2Q8DA 3ITQA 3ACLA 4COWA 2BJSA 4CP2A 2YGLA 4K8FA 4WBBA 3OBTA 4ISRA 4M3CF 3PUSA 2OPWA 1OUSA 1GSLA 2EIBA 2HWC3 3LQCA 4ZHNA 1PVXA 3MICA 5LB6A 5FQ0B 2YPJA 4CDXB 2DCZA 5FYIA 2WYSA 1LTEA 4LUMA 2ZCWA 5DQ0A 4EQVA 1SPPA 1MS0A 2W47A 1NA1B 5IK7A 3WW3A 2WSUA 1EPZA 2GMPA 1SMVA 1BBT3 2VUJA 3EO6A 2NQYA 2B7YA 5GM0A 1QDOA 4JHTA 3ZSMA 4PIZA 1K3IA 3AJYA 1TME3 2D5FA 3ES1A 3FZ3A 5GJ6A 1YQ8A 2RS51 3DL3A 4ITCA 3H8OA 5JSOA 2ARCA 3VBOA 1UOFA 4HFSA 2HWD2 3HT1A 2EAKA 4YWAA 2XQRA 4PF5A 3EXUA 5A3NA 4DUXA 4QD2A 4YFWA 5FYYA 2ARAA 2Y8KA 4XF3A 2OZJA 2DYCA 1MQTA 1MS5A 3U10A 2C4XA 4AFBA 1UPSA 3J8F1 2FMYA 2J1SA 3O14A 4CEWC 5JPMB 5LEKA 1LOFA 3UL2A 4LE4A 3NNFA 3CIHA 4YVWC 1O3RA 3M70A 2P3IA 5FKBA 1FV2A 1J3QA 4Q29A 5DAVA 2JDYA 3H50A 4KG8A 5LRSA 4XYXA 5LA9A 2ZHNA 2A6WA 4E27A 1IPKA 1B35B 1LEDA 5IK4A 5JZGB 4IW3A 3VB9A 3FHAA 1H2LA 5A7QA 2UURA 1QQP2 3ZMOA 3DYOA 2FHRA 4XFHA 3WP4A 1BHGA 2YDEA 3DV8A 4V1PA 4WM7A 1IS5A 1QJU1 1V9U3 2JG8A 2Q4SA 4UAPA 3AK0A 3NJZA 3VZMA 1ND3B 2QZ2A 1GZ9A 3B9CA 4L11A 4NHYA 1RUOA 2GN3A 2VQTA 4UI9L 2YROA 1KFXL 5BUVA 3NJYA 1ND2C 5CFDA 1C5HA 1C8M2 2EALA 1GOHA 4OHXA 4AHWA 1WCQA 1X50A 2JG9C 2VH9A 1QJX2 4JGZC 4XUNA 1D2QA 3OBRA 4P9GA 1PO21 3VBSC 3VKOA 5DG1A 3LSEA 2WDBA 4PDWC 3UJOA 3VBHC 4RGKA 5FZMA 3ZFFB 3NV4A 1VBD2 2C5DA 4JGYB 2VQUA 1QKQA 1RHI2 1W9TA 5FXXA 1MS3A 4UF0A 5CFCB 2KD7A 2RM21 2OQ6A 5EQUA 1D0GA 1VBE1 3IBMA 2VNGA 5HPOA 2RS11 2XJPA 3NAPB 5J7MA 3WOGA 3I7DA 1GNYA 4AQSA 2CGNA 4BK5A 2RE9A 3OPTA 1W6NB 3I97A 4PBOA 2VR4A 5A7WA 1GQPA 4TTGA 2EICA 1VP6A 3UETA 2ZGNA 1KS5A 3LFIA 4R52A 4JC1A 1GWMA 5FZIA 3RZGA 1ZZCA 1FOD2 4H7LA 2B9UA 1W9FA 1GQGA 5L7OA 2R041 3GZAA 4I02A 5LASA 1K5MC 4GULA 1X8EA 4QKBA 2WFPA 4KG0A 2DU1A 2JDMA 4CDWB 4LKDA 3PUHA 4CCDA 1XXNA 2GZWA 5T5JA 4YW6A 2XL9A 2B4KA 3MW2A 1UMIA 2XJQA 3KQRA 2ERFA 4TLGA 4NIAA 3WF1A 4CXWA 1FYUA 3B94A 2XBO1 4QXBA 4XFAA 1EAH1 4X6QB 4QU1A 3N7MA 4XOGA 5H9PA 3USSA 4NJ4A 5FZ0A 1YJLA 3SCFA 5FY1A 1WWYA 2JDHA 1NE4A 3U14A 4CEYC 5FYZA 5EWSA 3WF4A 1E5IA 5LZ6A 2NP0A 4OHZA 3ILRA 4QPWA 1N3QA 3BU0A 5HCFA 2HEYF 1ZBA1 1PVC3 3P1IA 5F5CA 1UY2A 1X33A 4LITA 5I0UA 3BVCA 3UKTA 4A45A 3BUCA 1LJ7A 1ULGA 1XYPA 3FHQA 4LTAA 4UFLA 2BBVA 3GM8A 2E9QA 1WUVA 5I8SA 1OQDA 1GMMA 1NQJA 1DQ2A 3AFGA 3UESA 2VNVA 2EXHA 3ST7A 1QJZA 2MNGA 2Y34A 4OVEA 2PTMA 2NMNA 2VVDA 3KV5A 4UT5A 3HQUA 1REFA 4OHYA 4YGEA 3PNAA 4Y24A 2V4AA 3E5QA 5HXVA 1OOPC 1GR3A 1HRV1 3DKQA 2ZJCA 4KU7A 2B42B 4WVVA 2WR9A 1W28A 1COV2 1A6CA 1MS1A 2A7AA 2P3YA 3G7DA 4Q26A 3OCPA 3POWA 4GWIA 4AL9A 3QBQA 4OI1A 4BQ4A 4CUCA 2B5HA 2BUKA 3WHUA 2IXHA 1HW5A 1Z78A 1NT0A 1LCLA 2RR13 4NR1A 4QX5A 1TG7A 4RQPC 5KXEA 1AYN2 4OZXA 1RVF2 4IGPA 4P5YA 1DDLA 5FAXA 2V5DA 5FZEA 1GZWB 4S2HA 1PNFA 2FMDA 2CDPA 3S7IA 1Z7S2 5EYXA 5FKCA 1PMIA 4IETA 1ST8A 1S2EA 2PAEA 4Q4Y1 1ACCA 4DEVA 3I3DA 5JSRA 1EV11 2WZPP 2XGXA 3RJ2X 3TEZA 3WDYA 5HV4A 4QQLA 1FATA 4M0NA 3N7JA 4B4QA 4R9CA 2O8QA 4WM7C 4ZZ5A 1NXMA 3POGA 4YM1A 1KRIA 1S1AA 4FPGA 1VBC2 3ZFGA 4TN7A 4CZSA 1KXGA 1RXFA 3RVHA 4Z92B 1GU3A 5K0UA 1ONAA 5IATA 5AC91 1L7RA 3N7LA 2W9XA 1B35A 1FX5A 4EV0A 1YI9A 4Z8BA 5JZGA 3AP7A 1SLCA 4B4PA 2VC9A 4LBMA 5EPAA 4AVAA 1SLLA 1UIKA 2W1WA 4EYUA 5B4NA 5CU1A 5C70A 2PHLA 5KWRA 3WNMA 1RINA 1NX9A 3R4DB 1OPMA 1JU3A 4AR2A 1ZRFA 5JMCA 2DVFA 3JD72 2WLQA 1TMF1 3I3QA 4GWNA 4XURA 2IWGB 2YG0A 2ZGPA 1JUHA 2QQKA 2HYXA 4EWEA 1OD3A 5J1XA 3PJYA 1R1A1 2A6VA 1EP0A 3ZFFA 4YW4A 3MUY1 4D6SA 2XJSA 1W0OA 1DQ4A 3SISA 2PFWA 3SLIA 1VBB1 3AMNA 3LB9A 1XSQA 4YW1A 4AXOA 1O8PA 4DY5A 3L2HA 4AVTA 4CP9B 1CZVA 3H1MA 3K46A 5FMOL 1RUC1 3WF0A 5HV0A 1FMD3 3ROUA 1FV3A 4NIIA 5IAXA 1KQRA 1W6MB 3SKJE 4QMAA 1VRH3 1EUTA 2B46X 3U07A 2X10A 1E5RA 4JVAA 2R49A 1HXS2 1TEIA 1AX2A 3HPNA 4RN5A 1ZREA 1P8JA 3UJQA 1PZ9A 4AQTA 1VAVA 3GNEA 2O8OA 3WUDA 4Q4V1 1OH4A 1OT5A 4D94A 4IUGA 1HQWA 4J6GA 1H6XA 2WNVC 1JYCA 4LPLA 3VD5A 3IWZA 4AI0A 4WM8B 3KD4A 5J98B 4JAAA 1H2MA 3HNYM 5FIXA 3HAGA 3ZDSA 3E6CC 4N53A 3RWKX 2ZGKA 3NVCA 3SEPA 5G04L 3JB8A 4XBLA 3H8RA 4COYA 4BZ4A 4DZGA 2W68A 3ZM8A 4XETA 4K21A 2RJ2A 4HETA 3MZHA 3PU8A 1DU3D 5D8AC 5IJRA 3AVSA 1O6UA 1QJY3 2ZGSA 3K3OA 4FOYA 4NHMA 4TXWA 1VBA1 4UBGA 2YYOA 5FY5A 1TE1B 2QTWB 3R6SA 2X5IA 2XJRA 4GZ9A 4CDXC 2JE9A 4MGSA 1QWRA 2AEZA 1XNCA 2ZAHA 3EB7A 3P3NA 2Y0IA 4B1MA 1JYVA 1YWKA 4HMZA 1PIV3 1QEXA 2EXIA 4E2QA 1NA1C 1S0FA 4MX3A 4Q0VA 1SLTA 5FZGA 1FI2A 5T50A 5G05L 4YM2A 5T5LA 4Y20B 3THCA 1M06G 3LEGA 2KM2A 1NXD1 1H8TB 4RR3A 1OHFA 4A2UA 3CMGA 1PHMA 1W8TA 2VXRA 3ZDVA 4DOUA 5IVJA 1JU4A 4UYBA 5T54A 4IV3B 4H2AA 2W92A 5FZ9A 3RZJA 3T2OA 3AKRA 2YC0A 3JQXA 4FCAA 2VO5A 2VZ3A 3H7YA 2QQWA 4GMP1 3DEMA 4FPYA 5FZKA 4Q1RA 3WR0A 1RUF1 3IAPA 1RITA 4E8CA 4GJYA 1FNYA 1UX7A 5A3TA 3TAYA 4Z2WA 1GZWA 1G86A 4FP3A 3ME2A 3PUIA 2YUEA 3I4IA 4I0WB 5K8SA 1U5ZA 1LODA 1OLRA 1CIWA 2Q1MA 1F2NA 2OYZA 2WO2A 3TYJA 3ZVXA 5BNPB 5C6CA 3WW1A 2ORZA 2Z4FA 3ZXLA 1IG0A 3UV9A 5JZGC 5F1RA 2DTWA 4RS5B 4O7XA 1JH5A 3AB0A 4SBVA 3WSOA 2HBUA 4F83A 2Y38A 4NIGA 2LW8A 4K20A 2HWE2 2QQLA 4D6RA 3CZJA 4UFIA 5C5TA 1GV9A 1WBFA 2YZ4A 4FP2A 3RWNA 1G8WA 3JZVA 1W2UA 3I2FA 1W05A 3MW3A 4GXLA 4LR4A 1ND3C 3HT2A 3J7MA 3OB8A 5DAQA 2D6MA 4ZZ8A 1J1LA 3AMPA 4LKEA 5EXOA 4XMIA 1YEWA 1XU1A 1VB4A 1S0BA 5E6HA 1F4AA 2E63A 4KNCA 1J1TA 2HWD3 4NAOA 3MFCA 1NZIA 2RDSA 1YQ6A 1I3HA 2ZHLA 1JZ4A 3J9SA 4JGYC 2GP3A 5J48A 2WQZC 3CU7A 1G9FA 5FPZA 3VBFC 5LA1A 1OI6A 5CB7A 4Q1PA 2VZVA 3GJBA 1W90A 3PTRB 4MO3M 5CFCC 1E5HA 5IVBA 1U5XA 1K42A 4UFHA 3UT0A 3VDDA 2ZS6B 3NAPC 3OSDA 4QGNA 4XPVA 3MIHA 4QQHA 3NWKA 1VR3A 2W0XA 2WJSA 2BVVA 1JW6A 2ZPXA 2VUCA 3E5UA 1DF0A 5A7OA 1AX0A 1X8MA 1MS9A 1QQP3 2DUOA 2XLFA 4I01A 4GAZA 4XUTA 2RS52 1Q5OA 2TUNA 5GALA 3SH5A 1N1TA 5T52A 4PDWB 1WMFA 3WNPA 1DBNA 2Y6FA 4NE9A 1CJPA 4BQ3A 2Y6HA 4NPLA 1UYZA 3OJBA 3OYWB 3TN93 4CDWC 2YC2A 3LDKA 2KXLA 3KZ4C 1EUUA 3ES4A 4AF9A 2JICA 4P9YA 2XJTA 1WLWA 1ZBE2 3HOBA 5T5PA 3TB0A 1W8FA 4FXGB 3BOPA 4B29A 2IXLA 1QJX3 2W1SA 2VTXA 3PVOA 3AYCA 5EP9A 3O1SA 5JOYA 2GC3A 3MLJA 5DABA 1HB1A 4NOTA 4ASKA 1UL9A 3JXSA 3KVAA 2ZGUA 4MG2A 4O9GA 1RHI3 1HIXA 1HQNA 2DWRA 2XHKA 3DF0A 1F4HA 1AR62 3WDUA 1WGPA 3MPBA 1K5MB 4AI9A 4GQ7A 3HBKA 1W8HA 1SFPA 5KXCA 4PHZA 1RMU1 2Z5WA 3N4MA 1MEC1 1QJU2 2VGDA 1QIQA 4D8MA 4AE2A 2VAUA 3RZLA 2WWUA 4XC9A 5A3UA 4HPKA 3MPPG 2HWB1 2RS33 1AR81 1QOSA 4BQWA 2CU5A 4FFHA 1FOD3 1PM4A 1QH7A 3H3UA 5CZKA 3HEIA 4QKNA 3HN3A 1O5LA 5FLIA 1JOBA 1OQEA 2IUWA 3UGGA 4LKFA 3T09A 2DDUA 4P9LA 1F8VA 1PO22 3ILNA 3QACA 1QJEA 1Y43B 4XCBA 1AVBA 1LGCA 5K4LA 1YFYA 2JIJA 5FO7B 4CCLA 1GZTA 4C8DA 2VZSA 3RI8A 2A3XA 2BP6A 2YHJA 4BLIA 2BOJA 3OBZA 2BEOA 1RUH1 3VHNA 5FK7A 2W52A 1XBFA 4FPEA 2VTFA 5FZ8A 2BTVC 2RS12 4NWVA 4XUOA 5FMOS 3UKNA 1L3JA 5CNAA 5TSWA 5A6QA 3ACHA 5AVAA 2VTXJ 5D1IA 3DXUA 1CAUB 1JTZX 1LHVA 1BVP1 4QB6A 5DDJ1 3N35A 1W8ZA 3AC0A 4Q5OA 2GDFA 4M4PA 1AHSA 4QXCA 3T1LA 3NV3A 3M2MA 4PLMA 3WCRA 1JODA 4DXTA 4Q4X1 5DZEA 3KVBA 1MZ5A 3FLRA 2R042 3S30A 1UMHA 3ZN6A 2Q8EA 5ACA1 4XW3A 4YVSB 2FCVA 1W9WA 1SFNA 1U0AA 2JE7A 3PU3A 4DIQA 1CX1A 4N90A 3IB3A 2B8MA 3KS7A 2RMU1 1U12A 2VZUA 4CU9A 5I93A 5CG8A 1RUI2 2Y6LA 3IDEA 2VZQA 3LE0A 3WLUA 1DHKB 1LKNA 4YGBA 3Q9OA 3ZYGA 4KBZA 4KU8A 1XSRA 2R1DA 2ETEA 3ASIA 4RQPB 4A4AA 5FOJB 2DTYA 1VMFA 4XIKA 3PTYA 3RSJA 2XBO2 4N9IA 1EAH2 4XJ8A 3O5SA 4FOQA 4Q8KA 4IV1B 1Q8OA 3I2IA 4TWTA 2P5BA 4IEZA 4LJHA 3JBG1 4KGQA 4RS5A 1SBFA 1W0PA 1PMJX 2D5HA 2UWCA 1W99A 1COV3 4ZPIA 5FY0A 5FPXA 1OPOA 1ASJ1 3M3CA 1BEV1 2A75A 3OGSA 2PXJA 4LLFA 3I2DA 2BNMA 1AX1A 2R30A 3CDZB 5FYSA 3TNPB 4CDUB 1NLSA 1AYN3 5C3PA 1CJDA 1V6LA 4OCTA 1RVF3 4HN1A 4LBQB 5C3RA 1JBCA 1ZBA2 4OHWA 5JIAA 3ZKYA 4CEWA 1H2KA 4Q2FA 2R0HA 3V0AA 3BKZA 4YM3A 5CAZA 1UZVA 2ZEXA 2R062 3MW4A 3OY8B 1Z7S3 2PYTA 4IESA 1LESA 2PLV1 4YVWA 3MLLA 5FZ3A 1F9KA 3X29B 2VZTA 3TEYA 3F2ZA 4QHZA 1RUE2 1UXZA 1MACA 4FQ4A 4O65A 4EN7B 4CXYA 1OUXA 4I3GA 1RXGA 3C7EA 1U5YA 4B4RA 1CAXA 2ET1A 1N1VA 1HX6A 1W3XA 3IIAA 4NROA 3WD5A 4B1LA 3G6JB 4CTEA 3ABZA 1AXKA 3O1PA 2JDPA 1NY71 4BXFA 4OI2A 1KJRA 4CPBA 3EJKA 1ND2A 4N43B 3ORJA 3H8XA 2UWAA 4I3PA 4V2VA 3RYPA 3VUOA 1Q56A 2JG9A 1CAVA 3KWVA 4JGZA 1YQCA 3RZKA 2KR2A 4XACA 1GANA 3VBSA 1QY4A 1ZRIA 2R7EB 3GCXA 1YLLA 4PDWA 3VBHA 4P9JA 4HVRA 3ZYBA 2C0ZA 4G3YC 2BGPA 3PLQA 5IWFA 3CKHA 1MS4A 4BMBA 2HH9A 2RDRA 4Q27A 4WM8C 4YG6A 2P17A 2WBKA 4NIDA 1W6QB 3ZXDA 2EXJA 4XAEA 3JD73 1YRZA 3IZOA 2VXJA 4COZA 1XNBA 2XMLA 1WCKA 2ZMKA 5GZGA 1BKZA 3OUJA 1YUDA 5LA2A 1ZZ8A 5ANQA 1POV1 1JYWA 2JENA 5FUIA 2ZX1A 5DAXA 5AC92 4UW6A 1SCSA 3FE5A 3WXPA 4UXAA 2BDRA 2IXJA 4A44A 4MHRA 3U37A 3U4SA 3N9QA 3D5OA 1IGOA 3POJA 3CLPA 3WY6A 3O1MA 5JVVA 3T2TA 5GZCA 1OFSA 1BXHA 1K5MA 2WFF2 1FPN1 3KCYA 1W2NA 2QQOA 4AHXA 1F5JA 1X36A 1DZQA 1X9PA 3DYMA 5FJKA 3N3HA 5L73A 3SC7X 3FFQA 1OKQA 4CP1A 4E2SA 2EA7A 4MH0E 4OMCA 4ZS3A 3BTYA 4P08A 4XJAA 1DCSA 1HXS3 2Y0OA 1W6PB 5JXIA 5HCHA 1V9U1 2RDNA 5FZBA 2ORXA 3OEAA 1F5FA 3ZR5A 2IFWA 1H8TC 3VD9A 3E5XA 5F3EA 4R8HA 1W0NA 1NUKA 4IV3C 4AFCA 3VKLA 1VBB2 5FP8A 4CP0A 4CEYA 2ATFA 4ES9A 3LA3A 2GC0A 1UY1A 5JSPA 1E5SA 1O7FA 1VB2A 4EZ4A 3GZUC 3AZVA 3T4HB 4BK4A 1R081 3EBRA 2ADEA 4H55A 3VL8A 1CZTA 2PHWA 2VECA 3B5LB 3LSDA 4C1WA 2MHFA 1CAUA 4Z2AA 2FDJA 4JZRA 2AUYA 5BNPC 3ATGA 3SCHA 3I3MA 2CNAA 3CHXA 3SHRA 3WQ7A 4COVA 5FLJA 3KM5A 4RS5C 2ZMLA 4CDQB 3LPFA 1Y7BA 4ZU5A 5T5OA 1OBNA 1OOPA 1POQA 1W04A 2JDNA 4AG4A 3BPZA 2LRPA 2XG3A 1TNRA 2ZMNA 4XDQA 4U36A 4GB31 4XBNA 3S5QA 1DQ0A 2PAKA 3VGIA 3BODA 4S2GA 4A7KA 5HBAA 4QWNA 2IVIB 3O0VA 4RQPA 1UU4A 4KWKA 3C7GA 1QH6A 3UGFA 5IW0A 4XQDA 4DXZA 1BVVA 3C3VA 2LUWA 4B7KA 2GH2A 3K4AA 5LA0A 1GNZA 3MYXA 3EYPA 4KI5M 4XZPA 1YCIA 4CCEA 4PIYA 4W6WA 4YW2A 3ZPOA 3D82A 5A3LA 1OC1A 5BNQA 3O1RA 5EHDA 5IFTA 3ZX7A 5KHKA 2X09A 3ZR6A 4CCNA 3A7QA 3BPSA 1VBA2 3WNXA 2YU1A 2QJVA 1RUG1 3NW4A 3RYRA 4C91A 2WNUB 3MLKA 4FQZA 5DN2A 2ZA9A 4LIVA 1UMZA 3OY8A 4WVZA 1KS4A 3TN92 4MXWB 4R9DA 1HKDA 2AENA 1UU6A 1RC6A 1YJKA 3WDXA 2E33A 4JKKA 1HJGA 1HRI3 1IQAA 4META 3U75A 5J09A 1AYM1 1LRHA 2OX0A 2LS6A 1XPWA 1H9PA 3VKNA 5FY8A 5FZ6A 1CAWB 4NPMA 3URFA 5LBEA 3U11A 1JYNA 2GALA 3POSA 1UY0A 1W8OA 2HWE3 2OIIA 3VD4A 4PF1A 5I0TA 3OUIA 1GBGA 1GLHA 4L8QA 3CZUA 1UYYA 3NRUA 4Y22B 1GP6A 2DVDA 5KHIA 3VBFB 4ONUA 4FFGA 1RUD1 5FYTA 1RUF2 1UX6A 3DECA 5IVFA 1DZTA 3IDCB 2K0GA 4WV8A 4N43A 1DGLA 5A7PA 3DPRB 3ZO0B 1X7NA 4PBPA 2BV4A 3AXDA 4Q0UA 4UWDA 1FXZA 4QGMA 3VZKA 2TBVA 1L7QA 3MF6A 4HZFA 5FR3A 5KHGA 1UZ0A 3FC0A 2BRTA 2RS32 2FZ2A 3PVBB 2DBIA 2E32A 5T3NA 4A3XA 4AI2A 4CCMA 1YO8A 3POEA 5KXDA 2X05A 1W6OB 3WNKA 5JDBA 1WD4A 1W6QA 1SLAA 2C9AA 3Q8EA 1GOGA 2Q0AA 1IS4A 2PELA 2OKXA 1LHNA 1H4GA 3KLSA 4Y1VA 4Y5TA 4IQPA 1YYNA 2YXSA 4Q4W1 5ABJB 4DXRA 4Y33A 1QDCA 1SLIA 2P1BA 4LE3A 3TNQA 4CSWA 5JWPA 2VOKA 2W91A 3RNSA 4DQAA 2QNKA 2R071 1S2BA 2WABA 4E2GA 2RS53 2D6LX 3WQ1A 1RUJ2 2A1XA 3WCSA 3AP5A 3V0BA 4AFMA 5FXZA 4JDOA 4YPJA 1QXJA 3LF7A 4IE4A 1DQ5A 2ZGOA 5B2GB 3LOIA 2WNVA 1CZSA 3RMXA 1ZBE3 4CRQA 4HXCA 4NUBA 1V6JA 2GNBA 3LEIA 3F95A 5FZLA 1T6GC 3IKWA 3ETPA 1RYYA 3I2HA 4BOWA 5LBBA 3WG2A 1APNA 2ZGQA 3LD8A 3N36A 3VDBA 4C0HA 4OI0A 5FZOB 1W06A 2D3PA 1YXWA 2ZX2A 4GKYA 3WDVA 1V70A 2Y60A 2OA2A 5D8AA 1AR63 3T30A 5L19A 1H30A 2C9KA 2CHHA 5AFBA 1J83A 3GXUA 2DFCA 4EE2A 4YVSC 3VBUB 4EROA 4NHKA 1OH3A 2P4EA 1QJU3 4IEVA 5GLZA 5BNOB 4KWLA 5FXWA 4CDXA 5FQ0A 5FYHA 1KDMA 4LK7A 3NJXA 2J1UA 2JB4A 2FDHA 5C9AB 5A7NA 3HQRA 3RDIA 1NA1A 2TEPA 4XF1A 1XNDA 2JKXA 3V64A 4CCOA 3CBNA 4RYDA 4IV1C 3KF3A 1VRH1 4YSFA 4ET7A 1PO23 3MIGA 4QB2A 5FBJA 3T0DA 2IC1A 5DMYA 3TEWA 4CCCA 4DRRA 1JN2P 4XMAA 3LKJA 1CPNA 2VZPA 2W5FA 1UNBA 4DPNA 1QU0A 4CDUC 4RGAA 1VBE3 2HWF2 3RQ0A 1PMHX 2GC1A 2HEVF 5I8TA 2JEMA 2RS13 3KB5A 4AW7A 3VD3A 5FDBA 2QBXA 1J59A 1MEC2 3MDPA 1SACA 2W1QA 1DYOA 5IK5A 2DUQA 5A1LA 1IKQA 2EIGA 1BK0A 4QHOA 4Y3OA 5F3CA 4G4FA 3PIJA 1AR82 4QXKA 1ZNPA 4XVHA 1E57A 2WSVA 1RGSA 2R043 1LGNA 4NRQA 5F39A 1G9BA 1VMJA 1HV0A 3PVNA 4GKXA 3WT3A 3WP6A 1RUI3 4QPGB 3CQOA 4AYUA 1ZYBA 1ZZ6A 2JD4A 3DGTA 3ENRA 4LHSA 4FTBA 4V2WA 2XBO3 2WUHA 1ND3A 1EAH3 5FRAA 4ZXKA 1LB2A 1AR91 4N43C 2IZWA 4Q8LA 1RUNA 4LMFA 2VMIA 2WL1A 5F3IA 3OF1A 2G19A 3HR9A 4W8JA 4LKSA 4FPHA 1SCRA 4FFIA 3TEXA 2WC2A 3S7EA 4X8NA 1XE8A 3H1YA 5F5AA 2WZ8A 1DFQA 2JXAA 2V09A 4JGYA 3SEEA 1W2TA 1ZBA3 1AUYA 2QQUA 3VBFA 2F6BA 5CFCA 5C8WA 1CGPA 1BQPA 2RMU2 2Z42A 3BGAA 3LFMA 2R063 1FT9A 5DUVA 3NAPA 4AOCA 1WCDJ 1Q8QA 1JZ2A 4G9SB 4ISQA 5CBLA 2VULA 1RUE3 3A0NA 1W6NA 4MXVA 4QPIB 2E31A 3MBWA 2UY8A 5GZFA 4LBKA 3FBYA 1PZ7A 3GBFA 3JBG2 4CUBA 4QKFA 1OA3A 5FYMA 4JX0A 1WW5A 5LCWL 5L9VA 1SBDA 5A70A 4RHV1 5E16A 5DAWA 4DS0A 4GMP0 5C7GA 2BYVE 3VL9A 1I5PA 4HOOA 3J7LA 4CDWA 4AVVA 4BH9A 4BA6A 4TYSA 4FBFA 1DZRA 2WO7A 3GJAA 1CPMA 1V6KA 1YFWA 1Q8PA 4PI2A 5J96B 5A3OA 2PLV2 1A8MA 2B45X 2HYKA 2JWPA 1GYKA 3THDA 2ZHMA 2ZKLA 5BV6A 3GBGA 4Y5Z0 1BMV1 1EV13 1JS9A 3W21A 2YU2A 3OD4A 1UY3A 1MVEA 5IAVA 5A3WA 3WZ1A 3W58A 4NWWA 4ZU4A 3UNPA 1UYXA 1W2OA 1NCRB 4KQ7A 2HWD1 3WV6A 5J3UA 3BN6A 5E89A 5KHJA 1PGSA 2VW0A 4KWJA 3USUB 3LDBA 1QXPA 4JQTA 2VUDA 2WWJA 2BWAA 3ZFEB 4JKMA 1LR5A 3KV4A 3JU9A 2GSYA 2VQAA 1QGLA 2FQPA 3AYAA 4H14A 4XBQA 5FZOA 1OSGA 1O91A 3AKTA 3NQHA 5AC93 1ULDA 4FPKA 1JZ3A 2P34A 2RJLA 3K2OA 3AZWA 4AHZA 4LHLA 1UOBA 4AEMA 3PHMA 3B01A 3B3QE 2CY6A 3DKWA 3E1F1 5EJZB 3M3OA 2VNRA 2WFF3 4BQ2A 1US2A 4CDQC 1HDKA 3B02A 4GD4A 3VBUA 3N9PA 2Q8OA 3ACGA 4D7TA 4S2DA 2AH2A 1LGBA 1PO11 3JUUA 1QQP1 5DPNA 3IN9A 3VBRB 1REEA 1GFF2 1DQ1A 1NE6A 2NLRA 3IPVB 3I59B 3NSTA 4QDQA 4BLJA 1OLME 4WZFA 3ZYJB 5C8CB 3ZN5A 4XABA 2Y6JA 3MO4A 4LBLA 1MVQA 4OHVA 5A80A 1KJLA 1F35A 4MGQA 4MGZE 5FJHA 5FREA 2G1MA 1C8M1 3FLPA 3IIIA 4EN9B 5C4WB 4XFFA 1VBB3 3LEKA 1SFYA 4GWMA 1D4M1 1HRI2 2LROA 4AHYA 2XONA 1WCUA 3I54A 2EVXA 1IPJA 3H7JA 2GNTA 4BCUA 4BXSV 3INAA 1DGRN 1VBD1 1IKPA 1FPN2 3Q8FA 4GJZA 3K3NA 2A6XA 1IHMA 2WNUC 4ARYA 1J84A 1AL21 2I45A 1LOBA 5A32B 2JE8A 2WKKA 3LA7A 1A78A 1VAKA 3IM0A 4EWDA 3E6DA 1UOGA 4CUGA 2YFUA 2J22A 3AXEA 3VV1A 3MIEA 1IQDC 1WCSA 3M7AA 3C7OA 2MEV1 4L97A 5F8PA 1UW8A 3TBDA 3LAGA 2XJUA 1KD7A 3ZSEA 4E4DX 5LRRA 1GZCA 1S0CA 4I09A 1YQ2A 4SLIA 1DGRA 2C26A 2K46A 2WZEA 2HLEA 2ZGLA 3VLBB 3D0JA 3AMHA 3NO8A 2BGCA 2BQPA 1V00A 2JJ6A 1LNSA 4KWUA 1HN1A 2W87A 5FYBA 3KV9A 1Q8VA 3K4ZA 3DPRC 3VDCA 2CAVA 2R1BA 1H8VA 3SKVA 2JIGA 5FV3A 2CWMA 3M4FA 3T0BA 3ZSJA 2F17A 4LO7A 3ZXAC 3OOXA 1DP0A 1Q3EA 3Q8BA 2OUHA 4UFJA 4LBJA 1VBA3 2E7TA 2GP5A 4X8PA 4PLNA 4CP9A 5BPXA 1QOTA 3J7HA 4GB32 5LW9A 1XU2A 3R0RA 4N9HA 5FK8A 4NRMA 4QDSA 5LBFA 4CA9A 4YW3A 3SQOA 1V6MA 1PGW1 1QNYA 5IFPA 1W6MA 4M3CB 4FI9A 3BI3A 5ABJC 2AACA 3J8F2 2OW4A 4FPCA 4YZ4A 1Z0HA 4F7ZA 2WA3A 3D8CA 3CEWA 1I1EA 1CWPA 2JX9A 2W95A 4AAPA 2CAUA 4HVQA 2GN7A 3ZYFA 3RRDA 4A41A 2O0OA 2E53A 3NNGA 1CX4A 2J1VA 3QD6A 1JYIA 1VE0A 3D6EA 2BGOA 4GMP3 4XFIA 5FUNA 5JXJA 1G9CA 3I3BA 5FZAA 3KHBA 4BWOA 1NCQB 1RUF3 1UZZA 1F15A 2V72A 3AMQA 4WM8A 4XF9A 3O0XA 5SV8A 3NMBA 2Q1ZB 3OBAA 4BB3A 3RS6A 3HVDA 4XFBA 1XNKA 3J4UH 4YZ2A 4D69A 5I8YA 4IE7A 4O61A 3AL5A 3BIEA 5GZDA 1AYM2 2EXKA 4W6YA 5FPUA 1UKRA 1GUIA 2G9FA 2ZGMA 5CEHA 1SBEA 1Z7S1 3LWCA 4H7MA 1Q8SA 3LGRA 2VQ0A 4M4RA 4AEDB 3C7FA 1ENXA 3EMRA 5D21A 2A70A 5GKAC 2P6HA 4HONA 3VBUC 1ENSA 1ULCA 2ARXA 3UKVA 1M4WA 1VJ2A 2UYAA 3CNAA 2ADDA 5BNOC 2LALA 3LPGA 4JCKA 5JOWA 1O3TA 4K40A 1ODNA 1RUD2 4P02B 5BNNB 2RM22 3JB4C 4DINB 1VBE2 4FOVA 5C9AC 2BU9A 2NZ9A 1SHWB 2VZOA 3AP6A 1VBC1 2JKBA 3KSCA 3OGGA 1LAJA 2E26A 1RUJ3 1AZDA 1BZWA 4Y20A 4XF0A 3AZZA 3AKPA 4WZCA 2DCYA 1H8TA 2BWCA 1KDKA 1BLZA 3U0ZA 3MI8A 1AR71 2VNOA 4MGIE 1DYPA 4C90A 4IV3A 5HI0A 3ZKUA 3W5MA 5JCTA 3A0KA 3P6BA 2A3YA 1OURA 4Q0SA 4B3NA 1CVNA 2QE3A 1U5IA 2PA7A 4IEPA 5FP9A 2VMCA 2ZAAA 1JHNA 2OZ6A 3HBZA 3AZXA 3VHPA 3QLQA 4MGYE 1L7LA 1JZ5A 4J1XA 2D40A 4Q4W2 3N9LA 3GBWA 2WA4A 2H6BA 5CKMA 1H6YA 1R64A 2RHPA 2W94A 5APAA 2ZXQA 4QM8A 5L9RA 3LA2A 2GNMA 2X53S 3WP5A 4E9KA 2R16A 4URAA 1C1FA 5BNPA 3P5BA 4YG0A 3KV6A 1SPPB 2PN5A 2R072 1QHDA 3MUZ1 1UQXA 3ZXGA 4WVMB 4M01A 5CADA 4LO4B 5EV7A 5F37A 3MIFA 2WLPA 2H0VA 3U4XA 3LCPA 2QQNA 4QPGC 2GMMA 3UGHA 4GWJA 3WP3A 1AJOA 1NG0A 1D4VB 2VCMA 3VBOB 2HJIA 1OQ1A 2SBAA 4BYYA 2WS91 3O1OA 4LHNA 5E88A 3ZLIA 4LLOA 1I5ZA 2VW2A 4PCRA 1MQTB 1C57A 3D3AA 4Y1UA 5GLUA 4YZ3A 3Q8AA 3NJVA 5DG2A 3W5NA 3VDAA 4XTMA 1SZBA 4DMIA 4DY3A 1PK6B 2XVGA 4P00B 4BQ1A 4EWAA 1C8NA 2NPIA 3KQ4B 2W3JA 3LEMA 3N9NA 1JZ6A 5J37A 1S4CA 3T4VA 3PURA 3H1WA 1R091 1WD3A 4XFGA 2HWF3 4HANA 3HIFA 1WLCA 2D98A 5IUQA 1HRV2 3T08A 5JMOA 4L99A 1RMU3 3K4DA 1MEC3 3QCWA 3SH3A 2QQVA 2BOIA 2QZ3A 4MHUA 2N7GA 2WZR1 2A3WA 4CXXA 5FOBB 4Y1ZA 2ZEZA 5FZCA 2XLGA 4NN0A 2WIIB 1AR83 5CIRA 2VM9A 5KC6A 2JG8B 2XDVA 1AXYA 3WQ0A 2AZ5A 2HWC1 1ZZBA 3MF9A 4OUMA 4QPIC 4F8AA 1QF3A 4COUA 5B4XA 3DCQA 1N47A 2E51A 2ZEYA 2AR6A 1V0AA 3HN1A 3UK9A 4LOTA 1UXXX 5H9QA 4I0BA 4AQ2A 5FZHA 1BBT1 3FUQA 2XUMA 2BW8A 4PIXA 3VHRA 3ZXJA 4Q4Y2 4DUWA 5DAPA 3OYWA 4HK9A 1EV12 5DUUA 1TME1 5K7PA 2FDIA 1CR7A 4PQQA 4XXAA 4E4ZA 3H42B 2L9LA 2B9VA 1VAMA 1IZ3A 3OGJA 4FPFA 4UF0B 4FPOB 4K1ZA 5F3GA 4AQ6A 1AL0G 4HKWA 5FPVA 3VN4A 1H1AA 1X82A 4LA2A 4YG3A 2DBNA 1UWWA 2J1AA 2D97A 3ZYRA 5F32A 5JOXA 4C0BA 1EY2A 3A23A 5FMDA 1BCXA 1YFUA 2D6NA 2YC4A 2LM3A 3HNMA 4UW5A 4OFGA 5A7WB 5A6XA 1GWKA 2DVGA 4ZONA 4XEZA 1I9RA 1HB4A 5FZ7A 2VBBA 5EJ1B 1NCRC 2RMU3 3P3PA 2Y6GA 1H4HA 5L7OB 4QT6A 1WW6A 5FZDA 4P9IA 1RJ8A 5FYVA 1LECA 4ZKTB 4LEJA 1H1IA 3KGLA 1ZA7A 2BERA 2QQMA 4MV2A 4PI0A 3ZFEC 5ISLA 1H9WA 2VMEA 1ZRRA 1LU1A 1TZOA 2WRAA 3DXTA 4S2FA 3VZJA 4ZS2A 1AR92 3SNMA 1HN0A 1QJFA 2DCTA 3KCXA 1UN1A 4B8EA 1TMF2 5FY7A 4MADA 3GHMA 3JBG3 5JLVA 4IDZA 1ULFA 2AYHA 2VJXA 2ZKNA 5L9BA 4YGCA 4KMQA 2K9ZA 1ASJ3 1R1A2 4RFRB 4AGGA 5C5UA 1QOOA 1UD1A 4QX3A 1HJFA 2WT0A 2CTVA 3NL1A 2VOXA 2VZ1A 4AGRA 1GP4A 3KF5A 4ES8A 2HWE1 3ZXKA 2D7FA 4LQRA 1EYBA 1O3QA 1JMUB 1S0IA 1S0EA 1A3KA 4IXLA 3VBRC 3B00A 5C8CC 3I3EA 1OA2A 1RUC2 2Y6KA 3MIBA 3T3YA 2RVAA 3GZEA 4IEUA 2PLV3 5FLHA 1J3PA 2EAAA 3J7NA 3KMHA 4AVSA 1CESA 4BIFA 2J42A 5F6KA 1S55A 5KC5A 4GH4B 4INDA 5C4WC 4KBBA 4RD7A 2OPKA 1LHOA 1GNHA 2I07B 1D0HA 3D4KA 4HN0A 5GZEA 3RI9A 3RPQA 4E4SA 2FDGA 4HKLA 5IVEA 4EN6B 5F2SA 1TNFA 2PMWB 3FFZA 4WVWA 2A6YA 4Q4V2 4YVSA 4RHV2 1XRUA 1J58A 2WN2A 1RB8G 3CJIB 1ALYA 1LU2A 4QAWA 2E7QA 3ELNA 1C4RA 4L9BA 4XUQA 1AJKA 4A6OA 4N8MA 4QX8A 5A3MA 1OKOA 2VVFA 1D7PM 1JZ7A 4MLOA 3VD7A 2ZX3A 3C8XA 1ZVFA 3BIWE 4IV1A 5EYYA 4WVMA 1ULOA 1HLCA 4HK8A 2XVLA 2FBEA 3BCWA 3WG1A 4BJ0A 4MUVA 1BMV2 3T2PA 4QGLA 4K3UA 5LBCA 3OGVA 4NHXA 4JRAA 4CDUA 2UYBA 4HLTA 1I6XA 4H3WA 4YNIA 4LBQA 4JKLA 3RZZA 5C3SA 5LWBA 2RDQA 1WMDA 3GHNA 4HT1T 1S0JA 3L9JT 1POV3 1UCXA 1ZBE1 2VPVA 4Z82A 3MIDA 1T2XA 4BQYA 1PK6A 5EIYB 1PVC1 4D0QA 2W1UA 4ASMB 3ZFGB 1UOJA 4OMDA 4Y1YA 3I8TA 4K1YA 3HQXA 4QQPA 5K0UB 3W9AA 4IEYA 5BY5A 4HVOA 1FPN3 2IVJA 4FPJA 5FYCA 5AFEA 1AR61 1PO12 1WA4A 4TLFA 1DG6A 2OT7A 2A71A 3HD8B 3WF2A 2VMFA 3R4SA 3I49A 4UOJA 2DVBA 5FUPA 4RL7A 3PJQA 3PUQA 1PNGA 2Q1FA 1QMJA 3ZMNA 1O5UA 2P3JA 3FUOA 3HNBM 4KH9A 1JOPA 2H0BA 2RR11 4RA0A 3V56A 5JXHA 4AI3A 1R1ZA 1YHFA 4FAGA 1OFNA 1SG3A 1W8NA 2CSGA 2QDRA 3MV01 2W46A 2CL2A 4M3CE 1D4M2 2XQXA 3M3QA 1KEXA 2NYYA 4Z07A 3BU7A 1ZRDA 3BTXA 5ERLA 5IVYA 1R083 2ZZJA 3B9IA 1NCQC 2CGOA 3Q8CA 3AFKA 1IOAA 5AVPA 2C6SA 1K12A 4DXSA 5H9RA 1IPSA 1ODMA 4UW3A 4CPBD 3IDBB 1AL22 3AKSA 4DNYA 4PJYA 4FTSA 1OD5A 4XDPA 3RJRA 5FPLA 4LK6A 5J36A 3H8UA 5CYYA 4QX2A 4CVUA 1LHWA 2MEV2 5JR7B 4RGGA 1Y4WA 1ZZ7A 3AP4A 4CCJA 4ATFA 4AEDC 4LO8A 3BB6A 1SLBA 3APBA 4GB33 4AEJA 5A3PA 4FFFA 1DIWA 4K9SA 3WF3A 5EFUA 3ZIWA 3S0MA 1VPHA 2XKPA 5LY1A 3CO2A 3QOPA 3T1MA 4DRVA 2DCJA 1V6OA 3J8F3 3PDQA 5BNNC 5F2WA 1RUI1 3ZSLA 4QX0A 3K77A 1W6PA 3POBA 5DZFA 3IT8A 5A1AA 2JDUA 1IS3A 4N53B 5IVVA 3S5AA 1VIWB 4ARXA 4FTEA 1LULA 4HG6B 5FFOC 4MZUA 4K6BA 4RFT0 4BE3A 4LT5A 1REDA 1QXRA 1ENRA 2D93A 1JZ8A 1WW4A 4I2OA 4R9BA 1C5IA 3ALQA 4BU2A 2C24A 1JXNA 1UPIA 1RUG3 2JB8A 2VY0A 2XHNA 3NNMA 4QHBA 4DB5A 4JRLA 2VOTA 4A6SA 3K75B 2BNNA 4CU8A 4XHBA 5BYNA 3SH4A 4AI1A 4UFKA 4W50A 5FWEA 4LBNA 4JHZA 2Q30A 1PGW2 1VRBA 2WN3A 2X5IB 1G9AA 2FDFA 3PIGA 4QQ2A 1AYM3 3B93A 1W8UA 2OS2A 4A3ZA 1T6BX 2ZGRA 1FMD1 2R061 3OTFA 4HBNA 4IL7A 3ZXFA 4GH4A 2QQPA 1B09A 1PZ8A 2BBAA 2VUAA 3SCGA 4UBHA 1G6NA 1CIYA 3O7OA 3WEZA 1RUE1 4Q0QA 1V6NA 4CDQA 1OLQA 1OLMA 4RR3B 4XIOA 4FVVA 3CJIA 2CWSA 3PL0A 4D3WA 1PM7A 3ZIXA 2ARBA 1LEMA 1RUD3 3VBOC 2RM23 2D6OX 3NKGA 5FY4A 2G4IA 2QQIA 2A5ZA 2VMHA 1HQLA 1KGYA 3LDRA 1RMU2 3RGBA 2V5YA 1MQTC 2VE1A 3NKTA 3OD0A 4W6XA 4Z1VA 5GLVA 1LOFC 2ZTNA 1PK6C 5CISA 2HWB2 3KCCA 3NNJA 1H2NA 1UIJA 2VOVA 3GYDA 3ON7A 2DF7A 2VBDA 1LOGA 1PGL1 2R6QA 4YFZA 4HSJA 4LHKA 5JPNB 2J1TA 3HMYA 2IFRA 4AGVA 4EN8B 4L92A 1OMIA 3LIHA 2QKDA 5K9YA 2WNOA 2E7AA 2WNUA 5HCBA 3RG0A 2D3SA 4Q4W3 1QJY1 3I2GA 1K45A 3H9AA 2YBKA 4MXWA 1RUH2 2JG8C 4E8DA 2R073 4K7JA 5I0RA 3ACFA 2BVBA 3WNLA 1G7YA 1OXCA 1W03A 1WBLA 2VVEA 2YPDA 4IEQA 5CFDC 1CAWA 2X8KA 5DDJ2 4IE6A 3FX3A 4XQ4A 1PIV1 2QUOA 5CVRA 4MOAA 1AR72 3RMYA 2W08A 4LULA 2ZGTA 3GZTB 2RJKA 1JOJA 3POYA 2VW1A 2XWJB 4LBQD 4Q4X2 5D2AA 4QB1A 3ECQA 1RTVA 5LK5A 2ENRA 2WFF1 1GKBA 4Y22A 1O4YA 5ACA2 2XB6C 3ACIA 4AVBA 2CGPA 3B7MA 2ZEWA 4CU7A 3C2UA 4Y5SA 3O1TA 3FJSA 1LOEA 2X29A 4HSLA 5JXGA 4NVPA 3DYPA 4ATEA 3POFA 3DPRA 4PT6A 5IYYA 3VDDB 1JUIA 5C71A 4RSUA 1A34A 2ZHKA 1MPXA 3W20A 1O59A 1SQ4A 4XCAA 5K0UC 2PAMA 2XLAA 1OA4A 1HRV3 5A33B 3U1XA 3IMMA 5L36A 1JI6A 1WW7A 2PQQA 4XJ9A 3QH7A 1W6OA 4N7IA 4A7ZA 5L7OC 4ORFA 4HKOA 3ZN4A 1ASJ2 4P14A 1XJAA 1KITA 1MZ6A 1BEV2 3ZYPA 1MS8A 2YGMA 1HB2A 3FHIB 4QXHA 4DUVA 3ZSKA 1VLNA 1OVSA 2WS92 2ZBJA 3M8LA 3VKFC 4OI4A 1V6IA 3VKMA 4F3JA 4XDOA 5LATA 5ABJA 1FNZA 1XYNA 2LTNA 3FLTA 3OPZA 5I91A 5DZGA 1JYTA 2YBPA 5M0TA 1H0BA 2OXBA 5GLTA 4YLZA 3JQWA 5FP7A 3AYEA 4Y26A 4Q4Y3 2IXIA 4XXPA 1MZFA 3EHKA 4IEXA 5JIUA 1MZEA 1R092 3IDAA 1URXA 4ZU7A 2V73A 4QQOA 2W39A 4ZY9A 2XOMA 2YB7A 1YIFA 5IT6A 2D3RA 4L2NA 1JYXA 2VMDA 2PHDA 2WZR2 1G9DA 2AC1A 1LHUA 1BK1A 5JI9A 4LUKA 2Q8CA 1CN1A 1NY72 3SXWA 5C33A 4R9AA 4Q0PA 3ZYHA 1CD3G 2GAUA 2HWC2 3E97A 4AWDA 3KT7A 4GH4C 4HPKB 1SDDB 2VG9A 2Y33A 3C7HA 1YQ5A 3OUHA 4IEWA 1KFUL 2YV8A 3QH6A 3LIGA 2JD9A 4NAMA 2K2SA 1BBT2 3WQBA 2E6VA 3TOJA 4LBOA 4QM9A 4EN0A 3CJIC 4FOWA 5BXXA 3R05A 3UYJA 4DO0A 5KXBA 1Y9QA 5BNOA 1TME2 2DVAA 3MV11 3ILFA 3AKQA 4YW5A 1AR93 2AEYA 5FZFA 3VZOA 2WO3A 2PQSA 2FD8A 3O1UA 2BPA2 1TMF3 1US3A 2FZ1A 2VMGA 4YGDA 4W4ZA 3HWJA 4FPLA 3TN91 3ZPYA 4BM8A 5C9AA 3KHCA 3S57A 2QCSB 2D6PA 4A7YA 2Z69A 1NAEA 1R1A3 4LNVA 5H9SA 1S0GA 1WA6X 1Y9MA 1IS6A 4IERA 4UFMA 2P3KA 3MHZA 2GU9A 1N3PA 1W39A 1QJX1 3A22A 3AZYA 5FCCA 2WINB 5FY9A 5ANNA 3AVRA 5FTTC 2OUJA 4ZXEA 2YY1A 2ILMA 4PQ9A 4FAHA 3I2JA 3O12A 1RUC3 3N9OA 3H3ZA 2B39A 3ZN6B 1RHI1 3BYWA 2J7MA 1GOFA 3PMEA 4D7YA 5FWJA 2XUEA 4YM0A 2RG4A 1RL3A 3BOWA 4JTNA 4MYEA 1D2SA 5DUXA 4M0HA 2XR4A 2PHRA 5F5QA 1UO9A 4KL1A 5FPBA 4IGOA 3AP9A 4B7EA 4JDMA 1V9U2 3ZFGC 1N3OA 1W9YA 2D6KA 2D43A 1UY4A 2NMOA 1S2KA 2O1QA 1ULEA 1WMEA 4YW7A 3AJZA 2VZRA 3D0SA 4Q4V3 3RFRA 1B35C 2RS31 2OVUA 1ENQA 4RHV3 2IXCA 3GCWA 3KGZA 3RZHA 1FOD1 1NKGA 2P2KA 2P6CA 1GWLA 4QPGA 3IMNA 4BHPA 2JECA 5CG9A 3MEPA 5DXDA 1TQ5A 4CYDA 5A7SA 1ZZ9A 1R082 3POIA 3NV2A 5IVCA 2NM1A 3H0OA 4BQ5A 2XL7A 1XC6A 4J25A 3DN7A 5FXVA 3WVJA 5T55A 4CEWB 3W59A 2UY9A 3T0AA 4YZ1A 1BJQA 1UYPA 1UU5A 3O0WA 3V0AB 5F6LB 4YVWB 2I74A 2PHFA 4QX7A 2ET7A 3A4UA 2F4PA 5F7UA 4XE9A 1XB9A 1RUJ1 2G9GA 5KHHA 3GF6A 5FZ4A 4PLOA 3K51A 5HCAA 3ZFFC 2AGSA 4QKDA 4BIOA 2WYFA 4YZ5A 3NV1A 1XOYA 1CAXB 1CQ9A 2W2IA 2KA3A 4CCKA 4LA3A 4XQWA 4QX1A 2BFUL 1XYOA 2FCTA 5E1RA 3WW2A 4AEKA 1N1YA 3AL6A 4LORA 2J1EA 4LOSA 5A6ZA 2XWBB 4AZZA 1UAIA 5E8AA 2XKOA 1W3VA 3L2YA 4LO6B 4P5HA 4QPIA 3TRSB 3WUCA 2UWBA 5A6YA 2IXKA 1W9SA 1ND2B 4AI8A 4YARA 2YBSA 1RIRA 2EF6A 4NMIA 1WKYA 2JG9B 1J3RA 1CAVB 2A6ZA 1BYHA 1PO13 4JGZB 2FCUA 3EQEA 1GQHA 3VBSB 2ZX0A 4FT8A 4OUSA 5FMCA 3S6PA 4XZUG 3LOBA 4UW4A 3VBHB 1COV1 2CDOA 1RUG2 4AK3A 3H3LA 4R4XA 2H6CA 1PX3A 3ZOIA 2J1RA 3VHOA 1C8M3 4N53C 1AYN1 1RVF1 2VU9A 1C3HA 2UU8A 1PVC2 4AFDA 4MGTA 1OF3A 1D4M3 2WAAA 4LIUA 1GP5A 4OQ9A 3FBMA 1S0DA 2QVSB 4X6RB 2VCBA 4QPYA 1NOVA 2RV9A 4Y1XA 1VBD3 5FPAA 1YI7A 4IE5A 3WG4A 1UF2C 1AXZA 3ZXEA 1NCRA 2ZZQA 2QQJA 3PUAA 1XQNA 5FBZA 4YRDA 5JUVA 1AL23 1DYKA 3USUA 2HWF1 4HL0A 2DU0A 2X5IC 3ZFEA 1VMHA 4OULA 2WAOA 4D7SA 1HV1A 3BTZA 1W2AX 2HKXA 2EIEA 4MVTA 5A33A 3WW4A 2MEV3 4R4ZA 4CE8A 2WT2A 4IE0A 4FXKB 2RR12 1O4TA 1XNAA 5IK8A 4OLLA 1ZX5A 4EZHA 4ASLA 4KGGA 2ID4A 2VD7A 4Y4YA 3N9MA 4N7UA 3KT1A 1Q43A 3V65A 5F5IA 1GICA 2GNDA 4RR3C 1YFXA 2DFBA 3OG2A 2CYFA 2TNFA 3I2KA 3GGLA 3B69A 4AAXA 2C1FA 3HJRA 1JHJA 1RJ7A 4YYOA 4CEYB 3VBRA 5I0SA 1FAYA 1F31A 3CF6E 3DUIA 5C8CA 1Y3TA 3I59A 3IPVA 3R4UA 2OQ7A 2YMZA 4CU6A 5C3OA 2AREA 3WHTA 2R0FA 3WG3A 4MSVA 3JD71 3JCIA 5CKQA 2Z79A 3O1VA 5JAXA 4OZOA 3I2OA 4TSVA 1UKGA 2SLIA 2WNEA 5C4WA 2ES3A 3WX5A 2A73B 2HEWF 2XVKA 4I30A 4BPZA 1AF9A 3THTA 3VZNA 1STMA 3A21A 4LO5B 3WINE 1NYWA 4U2AA 5CKNA 2JDZA 1OOPB 2JDKA 1SDWA 3K48A 1EPWA 2XXZA 3VZLA 4E4HA 1PX4A 4GALA 4EJRA 5FP4A 1SEFA 1TVGA 4MGKE 4NPRA 5A32A 4NIHA 3M1HA 1W8WA 2VCAA 3MFAA 3CJXA 3SMHA 4C1XA 5A1FA 3TWIA 5F9TA 3ZYIB 1VALA 2P37A 1POV0 3OGRA 1NZCA 2HBTA 2O14A 2XJVA 2Z2SB 3AMMA 3FMGA 4J1WA 5JOZA 5FP3A 1C28A 4P9XA 1HXS1 2BZDA 2R32A 4JTOA 2YFZA 4XAAA 1OVPA 5FO8B 3T2QA 5DUWA 5CA6A 4NO4A 3NNLA 5HXMA 2V4VA 5KR7A 1CONA 4XJWA 2VOWA 2VCCA
chains in the Genus database with same CATH topology
2DCKA 2W1UA 3FN9A 3CQOA 4OMDA 4LHSA 1O8SA 1F4AA 2WUHA 4A42A 1JZ4A 5LA1A 3WF2A 2VMFA 2VZVA 2Y64A 4MO3M 4W8JA 4UOJA 4LKSA 5IHRA 1K42A 4L0PA 2WZ8A 3HNBM 3SEEA 5JXHA 3WNOA 1SG3A 1W8NA 3MV01 4DEQA 2W46A 3BGAA 2XQXA 1KEXA 4XUTA 5I0DA 1JZ2A 2JDAA 2VL4A 3WNPA 2Y6HA 4CUAA 1UYZA 2E31A 3MBWA 2YC2A 1K12A 4DXSA 1EUUA 4CUBA 4JX0A 3HOBA 5LCWL 1OF4A 1XNTA 3GDBA 5C7GA 5CYYA 2W1SA 1DLCA 4QX2A 4CVUA 1I5PA 3WNNA 3JXSA 3FL7A 3WF3A 1F4HA 5JR2A 2DCJA 3OEBA 3THDA 2WQ8A 4D8MA 4XUPA 4QX0A 3K77A 5A1AA 1UY3A 4QDRA 3UNPA 1UYXA 4ARXA 4HG6B 1ULPA 3BN6A 5CZKA 1JZ8A 3HEIA 3HN3A 4JKMA 3T09A 2DDUA 2XHNA 3NQHA 4BDVB 1JZ3A 2VOTA 3K75B 4CU8A 2EIDA 2VZSA 4OUEA 4OYUA 4W50A 4JHZA 5EJZB 3E1F1 2WN3A 1US2A 2WO1A 2VTFA 4A3ZA 3ACGA 4XUOA 3IAQA 3ACHA 5DPNA 2BBAA 4QB6A 3AC0A 1CIYA 3WEZA 4M4PA 3LQCA 2EIBA 4QDQA 4DXTA 2Y6JA 2WYSA 3MO4A 1UMHA 4MGQA 5DQ0A 2W47A 1W9WA 3IIIA 1CX1A 2QQIA 3IB3A 2VZUA 4CU9A 3LEKA 1KGYA 2Y6LA 2VZQA 3LE0A 1K3IA 2XONA 4BXSV 4A4AA 3I2IA 4DUXA 4ARYA 2Y8KA 1J84A 1PMJX 2C4XA 2JE8A 1W99A 2J1SA 2J1TA 2YFUA 2J22A 1IQDC 3CIHA 3OGSA 3C7OA 3CDZB 3I2GA 1K45A 4E8DA 1YQ2A 2C26A 2WZEA 3FHAA 2ZEXA 2HLEA 3ACFA 3WNLA 2VZTA 3DYOA 1LNSA 4KWUA 3F2ZA 1BHGA 1HN1A 2W87A 1UXZA 4MOAA 4UAPA 3K4ZA 3C7EA 3VDCA 4QB1A 3ECQA 2VQTA 4UI9L 3SKVA 3ACIA 2ZEWA 4CU7A 1GOHA 3T0BA 1WCQA 3ABZA 1DP0A 5JXGA 4XUNA 3DYPA 5IYYA 4PT6A 2WDBA 5C71A 1MPXA 2VQUA 3J7HA 1O59A 1W9TA 4QDSA 2KD7A 5IFPA 4FI9A 1JI6A 2R7EB 5HPOA 2BGPA 3CKHA 1GNYA 2W95A 4BK5A 3I97A 2WBKA 2VR4A 4DUVA 1GQPA 4TTGA 2EICA 4A41A 3UETA 3NNGA 2J1VA 2BGOA 5JXJA 3I3BA 5LA2A 2V72A 1JYWA 5FUIA 3PUHA 3OBAA 4A44A 3U37A 2B4KA 1UMIA 3IDAA 3WF1A 4ZY9A 2XOMA 2YB7A 2QQOA 1JYXA 2VMDA 1GUIA 3DYMA 4M4RA 4OMCA 3C7FA 4P08A 5JXIA 3WF4A 1SDDB 2ORXA 3OEAA 3LPGA 4QPWA 3C7HA 3VD9A 4P02B 3P1IA 1W0NA 1NUKA 1UY2A 2JD9A 4A45A 3WQBA 3FHQA 2VZOA 1SHWB 3GM8A 1UY1A 2E26A 1GMMA 3MV11 3UESA 4BK4A 2WO3A 2PQSA 1US3A 4W4ZA 1CZTA 3W5MA 3P6BA 1NAEA 4Z2AA 2VMCA 4GWIA 4CUCA 3A22A 1JZ5A 1TG7A 3LPFA 4ZXEA 1H6YA 1R64A 2W94A 4P5YA 4AG4A 2ZXQA 3I2JA 2V5DA 2CDPA 2J7MA 1GOFA 3MUZ1 3C7GA 4DEVA 3I3DA 2QQNA 3K4AA 5LA0A 4GWJA 3EYPA 4KI5M 1UY4A 2VZRA 5IFTA 1NKGA 4ZZ5A 3D3AA 3W5NA 3NJVA 3VDAA 2X09A 3A7QA 1GU3A 4P00B 2W3JA 1L7RA 1JZ6A 2W9XA 5DN2A 1XC6A 2VC9A 3T0AA 2E33A 4JKKA 3T08A 5JMOA 2W1WA 5B4NA 3K4DA 2LS6A 1XPWA 5F7UA 5C70A 1JYNA 3WNMA 2ZEZA 1NX9A 1UY0A 1W8OA 2VM9A 1JU3A 3VD4A 4PF1A 4XURA 4D0QA 2YG0A 3CZUA 1UYYA 3NRUA 2QQKA 2HYXA 5J1XA 1OD3A 5B4XA 2ZEYA 4QX1A 1UXXX 3DECA 3MUY1 2J1EA 4DUWA 1O8PA 1W9SA 1L7QA 1CZVA 4PQQA 3K46A 3WF0A 1UZ0A 3THCA 1WKYA 2B9VA 2L9LA 2E32A 3SKJE 1EUTA 1UWWA 2J1AA 2X10A 4XZUG 2X05A 3WNKA 3A23A 2YC4A 2CDOA 1GOGA 2OKXA 3HNMA 3HPNA 4RN5A 1PX3A 1P8JA 2J1RA 1OH4A 5EJ1B 1OT5A 2Y6GA 4DXRA 1OF3A 4IUGA 2WAAA 1H6XA 3VD5A 4LPLA 2W91A 2WABA 2BERA 2QQMA 2VCBA 2RV9A 3HNYM 2VMEA 3SEPA 5G04L 4YPJA 2QQJA 4MADA 3ZM8A 5JUVA 2RJ2A 1CZSA 2VJXA 4KMQA 2WAOA 3LEIA 5IJRA 4QX3A 2EIEA 3ETPA 1RYYA 2VZ1A 3I2HA 3VDBA 1XNAA 4TXWA 4LQRA 2ID4A 3I3EA 2Y6KA 4GZ9A 2RVAA 4MGSA 3EB7A 3OG2A 2C9KA 1J83A 1JYVA 3GXUA 3GGLA 3I2KA 4AAXA 3HJRA 1JHJA 5G05L 3LEGA 3CMGA 3NJXA 4CU6A 1JU4A 2J1UA 2W92A 2WN2A 2JKXA 4OZOA 4RYDA 4QAWA 3T2OA 2VO5A 2VZ3A 4XUQA 4ET7A 4QB2A 4A6OA 3IAPA 4E8CA 3T0DA 5DMYA 1UX7A 1D7PM 3A21A 1JZ7A 3VD7A 2VZPA 2W5FA 3PUIA 3C8XA 2WO2A 1ULOA 1PX4A 1PMHX 1TVGA 2ORZA 2Z4FA 3VD3A 2QBXA 4BJ0A 3T2PA 2VCAA 2W1QA 1DYOA 3WSOA 3OGVA 3OGRA 2LW8A 2QQLA 4XVHA 3CZJA 2BZDA 4JKLA 2YFZA 3T2QA 3I2FA 4ZZ8A 3OB8A 1T2XA 5HXMA 2V4VA 5EIYB 2VCCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DCK A;  2W1U A;  3FN9 A;  3CQO A;  4OMD A;  4LHS A;  1O8S A;  1F4A A;  2WUH A;  4A42 A;  1JZ4 A;  5LA1 A;  3WF2 A;  2VMF A;  2VZV A;  2Y64 A;  4MO3 M;  4W8J A;  4UOJ A;  4LKS A;  5IHR A;  1K42 A;  4L0P A;  2WZ8 A;  3HNB M;  3SEE A;  5JXH A;  3WNO A;  1SG3 A;  1W8N A;  3MV0 1;  4DEQ A;  2W46 A;  3BGA A;  2XQX A;  1KEX A;  4XUT A;  5I0D A;  1JZ2 A;  2JDA A;  2VL4 A;  3WNP A;  2Y6H A;  4CUA A;  1UYZ A;  2E31 A;  3MBW A;  2YC2 A;  1K12 A;  4DXS A;  1EUU A;  4CUB A;  4JX0 A;  3HOB A;  5LCW L;  1OF4 A;  1XNT A;  3GDB A;  5C7G A;  5CYY A;  2W1S A;  1DLC A;  4QX2 A;  4CVU A;  1I5P A;  3WNN A;  3JXS A;  3FL7 A;  3WF3 A;  1F4H A;  5JR2 A;  2DCJ A;  3OEB A;  3THD A;  2WQ8 A;  4D8M A;  4XUP A;  4QX0 A;  3K77 A;  5A1A A;  1UY3 A;  4QDR A;  3UNP A;  1UYX A;  4ARX A;  4HG6 B;  1ULP A;  3BN6 A;  5CZK A;  1JZ8 A;  3HEI A;  3HN3 A;  4JKM A;  3T09 A;  2DDU A;  2XHN A;  3NQH A;  4BDV B;  1JZ3 A;  2VOT A;  3K75 B;  4CU8 A;  2EID A;  2VZS A;  4OUE A;  4OYU A;  4W50 A;  4JHZ A;  5EJZ B;  3E1F 1;  2WN3 A;  1US2 A;  2WO1 A;  2VTF A;  4A3Z A;  3ACG A;  4XUO A;  3IAQ A;  3ACH A;  5DPN A;  2BBA A;  4QB6 A;  3AC0 A;  1CIY A;  3WEZ A;  4M4P A;  3LQC A;  2EIB A;  4QDQ A;  4DXT A;  2Y6J A;  2WYS A;  3MO4 A;  1UMH A;  4MGQ A;  5DQ0 A;  2W47 A;  1W9W A;  3III A;  1CX1 A;  2QQI A;  3IB3 A;  2VZU A;  4CU9 A;  3LEK A;  1KGY A;  2Y6L A;  2VZQ A;  3LE0 A;  1K3I A;  2XON A;  4BXS V;  4A4A A;  3I2I A;  4DUX A;  4ARY A;  2Y8K A;  1J84 A;  1PMJ X;  2C4X A;  2JE8 A;  1W99 A;  2J1S A;  2J1T A;  2YFU A;  2J22 A;  1IQD C;  3CIH A;  3OGS A;  3C7O A;  3CDZ B;  3I2G A;  1K45 A;  4E8D A;  1YQ2 A;  2C26 A;  2WZE A;  3FHA A;  2ZEX A;  2HLE A;  3ACF A;  3WNL A;  2VZT A;  3DYO A;  1LNS A;  4KWU A;  3F2Z A;  1BHG A;  1HN1 A;  2W87 A;  1UXZ A;  4MOA A;  4UAP A;  3K4Z A;  3C7E A;  3VDC A;  4QB1 A;  3ECQ A;  2VQT A;  4UI9 L;  3SKV A;  3ACI A;  2ZEW A;  4CU7 A;  1GOH A;  3T0B A;  1WCQ A;  3ABZ A;  1DP0 A;  5JXG A;  4XUN A;  3DYP A;  5IYY A;  4PT6 A;  2WDB A;  5C71 A;  1MPX A;  2VQU A;  3J7H A;  1O59 A;  1W9T A;  4QDS A;  2KD7 A;  5IFP A;  4FI9 A;  1JI6 A;  2R7E B;  5HPO A;  2BGP A;  3CKH A;  1GNY A;  2W95 A;  4BK5 A;  3I97 A;  2WBK A;  2VR4 A;  4DUV A;  1GQP A;  4TTG A;  2EIC A;  4A41 A;  3UET A;  3NNG A;  2J1V A;  2BGO A;  5JXJ A;  3I3B A;  5LA2 A;  2V72 A;  1JYW A;  5FUI A;  3PUH A;  3OBA A;  4A44 A;  3U37 A;  2B4K A;  1UMI A;  3IDA A;  3WF1 A;  4ZY9 A;  2XOM A;  2YB7 A;  2QQO A;  1JYX A;  2VMD A;  1GUI A;  3DYM A;  4M4R A;  4OMC A;  3C7F A;  4P08 A;  5JXI A;  3WF4 A;  1SDD B;  2ORX A;  3OEA A;  3LPG A;  4QPW A;  3C7H A;  3VD9 A;  4P02 B;  3P1I A;  1W0N A;  1NUK A;  1UY2 A;  2JD9 A;  4A45 A;  3WQB A;  3FHQ A;  2VZO A;  1SHW B;  3GM8 A;  1UY1 A;  2E26 A;  1GMM A;  3MV1 1;  3UES A;  4BK4 A;  2WO3 A;  2PQS A;  1US3 A;  4W4Z A;  1CZT A;  3W5M A;  3P6B A;  1NAE A;  4Z2A A;  2VMC A;  4GWI A;  4CUC A;  3A22 A;  1JZ5 A;  1TG7 A;  3LPF A;  4ZXE A;  1H6Y A;  1R64 A;  2W94 A;  4P5Y A;  4AG4 A;  2ZXQ A;  3I2J A;  2V5D A;  2CDP A;  2J7M A;  1GOF A;  3MUZ 1;  3C7G A;  4DEV A;  3I3D A;  2QQN A;  3K4A A;  5LA0 A;  4GWJ A;  3EYP A;  4KI5 M;  1UY4 A;  2VZR A;  5IFT A;  1NKG A;  4ZZ5 A;  3D3A A;  3W5N A;  3NJV A;  3VDA A;  2X09 A;  3A7Q A;  1GU3 A;  4P00 B;  2W3J A;  1L7R A;  1JZ6 A;  2W9X A;  5DN2 A;  1XC6 A;  2VC9 A;  3T0A A;  2E33 A;  4JKK A;  3T08 A;  5JMO A;  2W1W A;  5B4N A;  3K4D A;  2LS6 A;  1XPW A;  5F7U A;  5C70 A;  1JYN A;  3WNM A;  2ZEZ A;  1NX9 A;  1UY0 A;  1W8O A;  2VM9 A;  1JU3 A;  3VD4 A;  4PF1 A;  4XUR A;  4D0Q A;  2YG0 A;  3CZU A;  1UYY A;  3NRU A;  2QQK A;  2HYX A;  5J1X A;  1OD3 A;  5B4X A;  2ZEY A;  4QX1 A;  1UXX X;  3DEC A;  3MUY 1;  2J1E A;  4DUW A;  1O8P A;  1W9S A;  1L7Q A;  1CZV A;  4PQQ A;  3K46 A;  3WF0 A;  1UZ0 A;  3THC A;  1WKY A;  2B9V A;  2L9L A;  2E32 A;  3SKJ E;  1EUT A;  1UWW A;  2J1A A;  2X10 A;  4XZU G;  2X05 A;  3WNK A;  3A23 A;  2YC4 A;  2CDO A;  1GOG A;  2OKX A;  3HNM A;  3HPN A;  4RN5 A;  1PX3 A;  1P8J A;  2J1R A;  1OH4 A;  5EJ1 B;  1OT5 A;  2Y6G A;  4DXR A;  1OF3 A;  4IUG A;  2WAA A;  1H6X A;  3VD5 A;  4LPL A;  2W91 A;  2WAB A;  2BER A;  2QQM A;  2VCB A;  2RV9 A;  3HNY M;  2VME A;  3SEP A;  5G04 L;  4YPJ A;  2QQJ A;  4MAD A;  3ZM8 A;  5JUV A;  2RJ2 A;  1CZS A;  2VJX A;  4KMQ A;  2WAO A;  3LEI A;  5IJR A;  4QX3 A;  2EIE A;  3ETP A;  1RYY A;  2VZ1 A;  3I2H A;  3VDB A;  1XNA A;  4TXW A;  4LQR A;  2ID4 A;  3I3E A;  2Y6K A;  4GZ9 A;  2RVA A;  4MGS A;  3EB7 A;  3OG2 A;  2C9K A;  1J83 A;  1JYV A;  3GXU A;  3GGL A;  3I2K A;  4AAX A;  3HJR A;  1JHJ A;  5G05 L;  3LEG A;  3CMG A;  3NJX A;  4CU6 A;  1JU4 A;  2J1U A;  2W92 A;  2WN2 A;  2JKX A;  4OZO A;  4RYD A;  4QAW A;  3T2O A;  2VO5 A;  2VZ3 A;  4XUQ A;  4ET7 A;  4QB2 A;  4A6O A;  3IAP A;  4E8C A;  3T0D A;  5DMY A;  1UX7 A;  1D7P M;  3A21 A;  1JZ7 A;  3VD7 A;  2VZP A;  2W5F A;  3PUI A;  3C8X A;  2WO2 A;  1ULO A;  1PX4 A;  1PMH X;  1TVG A;  2ORZ A;  2Z4F A;  3VD3 A;  2QBX A;  4BJ0 A;  3T2P A;  2VCA A;  2W1Q A;  1DYO A;  3WSO A;  3OGV A;  3OGR A;  2LW8 A;  2QQL A;  4XVH A;  3CZJ A;  2BZD A;  4JKL A;  2YFZ A;  3T2Q A;  3I2F A;  4ZZ8 A;  3OB8 A;  1T2X A;  5HXM A;  2V4V A;  5EIY B;  2VCC A; 
#chains in the Genus database with same CATH topology
 2DCK A;  3FN9 A;  1NLR A;  3PVE A;  4BIS A;  3GAL A;  1O8S A;  3RZM A;  1WZX A;  4JDN A;  1HB3 A;  4BME A;  1WMX A;  4XF4 A;  4IEO A;  2HWB 3;  1DQ6 A;  4P9W A;  5LY2 A;  3VDD C;  4A42 A;  4WM7 B;  1FMD 2;  3MGU A;  5LK7 B;  5EZW A;  2WT1 A;  3WDT A;  5KBF A;  2DUR A;  2XPJ A;  4LXL A;  3THP A;  4IGQ A;  4W65 A;  4DFS A;  1VRH 2;  1N1S A;  2Y64 A;  3FWE A;  4Y4R A;  5CFD B;  2PHX A;  1UZY A;  2ZOE B;  4JV4 A;  2FDK A;  5IHR A;  4XJZ A;  2DUP A;  4L0P A;  1YNA A;  5I0D A;  1YIP A;  5GLW A;  4FO9 A;  2VBP A;  3WNO A;  1Y9G A;  5JI7 A;  2ZAC A;  1RUH 3;  4O9E A;  3AYD A;  4DEQ A;  2MPF A;  2XH6 A;  3LZZ A;  4NHL A;  4M3C A;  1O4Z A;  4URT A;  1VBC 3;  3RYK A;  2BNO A;  4M00 A;  3BTA A;  4BQX A;  2CV6 A;  2ZX4 A;  4AFA A;  4QU2 A;  5FZ1 A;  2JDA A;  2VL4 A;  2Q5T A;  2NN8 A;  5DDJ 3;  1ZM1 A;  4AVC A;  2WWS A;  5FMB A;  3E6B A;  2QDN A;  1AR7 3;  3M3E A;  1YC6 1;  4CUA A;  1LEN A;  3U78 A;  3SIT A;  4GA9 A;  4Q4X 3;  3ETQ A;  1PGL 2;  5ACA 3;  3AM2 A;  3N7K A;  1OF4 A;  1NCQ A;  2I2S A;  1A8D A;  1XNT A;  3GDB A;  1DLC A;  4XTP A;  4XIL A;  4GIQ A;  5FO9 B;  3WNN A;  1QJY 2;  1X9T A;  4JQR A;  1NLQ A;  4FSJ A;  2GC2 A;  1UZW A;  1XE0 A;  3WDW A;  3FL7 A;  2GME A;  3PMS A;  1WLT A;  5JR2 A;  3OPW A;  3KT4 A;  3OEB A;  4K8R B;  1DGW X;  1PIV 2;  3J26 N;  4AED A;  1HRI 1;  3CL1 A;  2WQ8 A;  4XUP A;  1BEV 3;  2DV9 A;  1WLD A;  4QDR A;  3V0B B;  1QNW A;  1H1M A;  1LOA A;  2F4L A;  1ZA4 A;  2G9Z A;  2ZAB A;  5SV5 A;  2WS9 3;  1IG3 A;  1ULP A;  5LEJ A;  1LOC A;  1ZRC A;  2WNV B;  4I0A A;  4XHX A;  5BNN A;  4NRP A;  5FYU A;  2QFE A;  1DGW A;  5EJ3 A;  3AX4 A;  4D6Q A;  4BDV B;  2BFU S;  3M3I A;  2WQ4 A;  2EID A;  1K5J A;  3BAL A;  1O3S A;  4OUE A;  1R09 3;  4OYU A;  1MR5 A;  4TZD A;  1XE7 A;  1C1L A;  5C3Q A;  2Y26 A;  1DLL A;  5D8A B;  4XFC A;  2WO1 A;  4OQ8 A;  2PHU A;  2D44 A;  4XJU A;  2WZR 3;  2GH8 A;  1NQD A;  2PHT A;  3IAQ A;  2Q8D A;  3ITQ A;  3ACL A;  4COW A;  2BJS A;  4CP2 A;  2YGL A;  4K8F A;  4WBB A;  3OBT A;  4ISR A;  4M3C F;  3PUS A;  2OPW A;  1OUS A;  1GSL A;  2EIB A;  2HWC 3;  3LQC A;  4ZHN A;  1PVX A;  3MIC A;  5LB6 A;  5FQ0 B;  2YPJ A;  4CDX B;  2DCZ A;  5FYI A;  2WYS A;  1LTE A;  4LUM A;  2ZCW A;  5DQ0 A;  4EQV A;  1SPP A;  1MS0 A;  2W47 A;  1NA1 B;  5IK7 A;  3WW3 A;  2WSU A;  1EPZ A;  2GMP A;  1SMV A;  1BBT 3;  2VUJ A;  3EO6 A;  2NQY A;  2B7Y A;  5GM0 A;  1QDO A;  4JHT A;  3ZSM A;  4PIZ A;  1K3I A;  3AJY A;  1TME 3;  2D5F A;  3ES1 A;  3FZ3 A;  5GJ6 A;  1YQ8 A;  2RS5 1;  3DL3 A;  4ITC A;  3H8O A;  5JSO A;  2ARC A;  3VBO A;  1UOF A;  4HFS A;  2HWD 2;  3HT1 A;  2EAK A;  4YWA A;  2XQR A;  4PF5 A;  3EXU A;  5A3N A;  4DUX A;  4QD2 A;  4YFW A;  5FYY A;  2ARA A;  2Y8K A;  4XF3 A;  2OZJ A;  2DYC A;  1MQT A;  1MS5 A;  3U10 A;  2C4X A;  4AFB A;  1UPS A;  3J8F 1;  2FMY A;  2J1S A;  3O14 A;  4CEW C;  5JPM B;  5LEK A;  1LOF A;  3UL2 A;  4LE4 A;  3NNF A;  3CIH A;  4YVW C;  1O3R A;  3M70 A;  2P3I A;  5FKB A;  1FV2 A;  1J3Q A;  4Q29 A;  5DAV A;  2JDY A;  3H50 A;  4KG8 A;  5LRS A;  4XYX A;  5LA9 A;  2ZHN A;  2A6W A;  4E27 A;  1IPK A;  1B35 B;  1LED A;  5IK4 A;  5JZG B;  4IW3 A;  3VB9 A;  3FHA A;  1H2L A;  5A7Q A;  2UUR A;  1QQP 2;  3ZMO A;  3DYO A;  2FHR A;  4XFH A;  3WP4 A;  1BHG A;  2YDE A;  3DV8 A;  4V1P A;  4WM7 A;  1IS5 A;  1QJU 1;  1V9U 3;  2JG8 A;  2Q4S A;  4UAP A;  3AK0 A;  3NJZ A;  3VZM A;  1ND3 B;  2QZ2 A;  1GZ9 A;  3B9C A;  4L11 A;  4NHY A;  1RUO A;  2GN3 A;  2VQT A;  4UI9 L;  2YRO A;  1KFX L;  5BUV A;  3NJY A;  1ND2 C;  5CFD A;  1C5H A;  1C8M 2;  2EAL A;  1GOH A;  4OHX A;  4AHW A;  1WCQ A;  1X50 A;  2JG9 C;  2VH9 A;  1QJX 2;  4JGZ C;  4XUN A;  1D2Q A;  3OBR A;  4P9G A;  1PO2 1;  3VBS C;  3VKO A;  5DG1 A;  3LSE A;  2WDB A;  4PDW C;  3UJO A;  3VBH C;  4RGK A;  5FZM A;  3ZFF B;  3NV4 A;  1VBD 2;  2C5D A;  4JGY B;  2VQU A;  1QKQ A;  1RHI 2;  1W9T A;  5FXX A;  1MS3 A;  4UF0 A;  5CFC B;  2KD7 A;  2RM2 1;  2OQ6 A;  5EQU A;  1D0G A;  1VBE 1;  3IBM A;  2VNG A;  5HPO A;  2RS1 1;  2XJP A;  3NAP B;  5J7M A;  3WOG A;  3I7D A;  1GNY A;  4AQS A;  2CGN A;  4BK5 A;  2RE9 A;  3OPT A;  1W6N B;  3I97 A;  4PBO A;  2VR4 A;  5A7W A;  1GQP A;  4TTG A;  2EIC A;  1VP6 A;  3UET A;  2ZGN A;  1KS5 A;  3LFI A;  4R52 A;  4JC1 A;  1GWM A;  5FZI A;  3RZG A;  1ZZC A;  1FOD 2;  4H7L A;  2B9U A;  1W9F A;  1GQG A;  5L7O A;  2R04 1;  3GZA A;  4I02 A;  5LAS A;  1K5M C;  4GUL A;  1X8E A;  4QKB A;  2WFP A;  4KG0 A;  2DU1 A;  2JDM A;  4CDW B;  4LKD A;  3PUH A;  4CCD A;  1XXN A;  2GZW A;  5T5J A;  4YW6 A;  2XL9 A;  2B4K A;  3MW2 A;  1UMI A;  2XJQ A;  3KQR A;  2ERF A;  4TLG A;  4NIA A;  3WF1 A;  4CXW A;  1FYU A;  3B94 A;  2XBO 1;  4QXB A;  4XFA A;  1EAH 1;  4X6Q B;  4QU1 A;  3N7M A;  4XOG A;  5H9P A;  3USS A;  4NJ4 A;  5FZ0 A;  1YJL A;  3SCF A;  5FY1 A;  1WWY A;  2JDH A;  1NE4 A;  3U14 A;  4CEY C;  5FYZ A;  5EWS A;  3WF4 A;  1E5I A;  5LZ6 A;  2NP0 A;  4OHZ A;  3ILR A;  4QPW A;  1N3Q A;  3BU0 A;  5HCF A;  2HEY F;  1ZBA 1;  1PVC 3;  3P1I A;  5F5C A;  1UY2 A;  1X33 A;  4LIT A;  5I0U A;  3BVC A;  3UKT A;  4A45 A;  3BUC A;  1LJ7 A;  1ULG A;  1XYP A;  3FHQ A;  4LTA A;  4UFL A;  2BBV A;  3GM8 A;  2E9Q A;  1WUV A;  5I8S A;  1OQD A;  1GMM A;  1NQJ A;  1DQ2 A;  3AFG A;  3UES A;  2VNV A;  2EXH A;  3ST7 A;  1QJZ A;  2MNG A;  2Y34 A;  4OVE A;  2PTM A;  2NMN A;  2VVD A;  3KV5 A;  4UT5 A;  3HQU A;  1REF A;  4OHY A;  4YGE A;  3PNA A;  4Y24 A;  2V4A A;  3E5Q A;  5HXV A;  1OOP C;  1GR3 A;  1HRV 1;  3DKQ A;  2ZJC A;  4KU7 A;  2B42 B;  4WVV A;  2WR9 A;  1W28 A;  1COV 2;  1A6C A;  1MS1 A;  2A7A A;  2P3Y A;  3G7D A;  4Q26 A;  3OCP A;  3POW A;  4GWI A;  4AL9 A;  3QBQ A;  4OI1 A;  4BQ4 A;  4CUC A;  2B5H A;  2BUK A;  3WHU A;  2IXH A;  1HW5 A;  1Z78 A;  1NT0 A;  1LCL A;  2RR1 3;  4NR1 A;  4QX5 A;  1TG7 A;  4RQP C;  5KXE A;  1AYN 2;  4OZX A;  1RVF 2;  4IGP A;  4P5Y A;  1DDL A;  5FAX A;  2V5D A;  5FZE A;  1GZW B;  4S2H A;  1PNF A;  2FMD A;  2CDP A;  3S7I A;  1Z7S 2;  5EYX A;  5FKC A;  1PMI A;  4IET A;  1ST8 A;  1S2E A;  2PAE A;  4Q4Y 1;  1ACC A;  4DEV A;  3I3D A;  5JSR A;  1EV1 1;  2WZP P;  2XGX A;  3RJ2 X;  3TEZ A;  3WDY A;  5HV4 A;  4QQL A;  1FAT A;  4M0N A;  3N7J A;  4B4Q A;  4R9C A;  2O8Q A;  4WM7 C;  4ZZ5 A;  1NXM A;  3POG A;  4YM1 A;  1KRI A;  1S1A A;  4FPG A;  1VBC 2;  3ZFG A;  4TN7 A;  4CZS A;  1KXG A;  1RXF A;  3RVH A;  4Z92 B;  1GU3 A;  5K0U A;  1ONA A;  5IAT A;  5AC9 1;  1L7R A;  3N7L A;  2W9X A;  1B35 A;  1FX5 A;  4EV0 A;  1YI9 A;  4Z8B A;  5JZG A;  3AP7 A;  1SLC A;  4B4P A;  2VC9 A;  4LBM A;  5EPA A;  4AVA A;  1SLL A;  1UIK A;  2W1W A;  4EYU A;  5B4N A;  5CU1 A;  5C70 A;  2PHL A;  5KWR A;  3WNM A;  1RIN A;  1NX9 A;  3R4D B;  1OPM A;  1JU3 A;  4AR2 A;  1ZRF A;  5JMC A;  2DVF A;  3JD7 2;  2WLQ A;  1TMF 1;  3I3Q A;  4GWN A;  4XUR A;  2IWG B;  2YG0 A;  2ZGP A;  1JUH A;  2QQK A;  2HYX A;  4EWE A;  1OD3 A;  5J1X A;  3PJY A;  1R1A 1;  2A6V A;  1EP0 A;  3ZFF A;  4YW4 A;  3MUY 1;  4D6S A;  2XJS A;  1W0O A;  1DQ4 A;  3SIS A;  2PFW A;  3SLI A;  1VBB 1;  3AMN A;  3LB9 A;  1XSQ A;  4YW1 A;  4AXO A;  1O8P A;  4DY5 A;  3L2H A;  4AVT A;  4CP9 B;  1CZV A;  3H1M A;  3K46 A;  5FMO L;  1RUC 1;  3WF0 A;  5HV0 A;  1FMD 3;  3ROU A;  1FV3 A;  4NII A;  5IAX A;  1KQR A;  1W6M B;  3SKJ E;  4QMA A;  1VRH 3;  1EUT A;  2B46 X;  3U07 A;  2X10 A;  1E5R A;  4JVA A;  2R49 A;  1HXS 2;  1TEI A;  1AX2 A;  3HPN A;  4RN5 A;  1ZRE A;  1P8J A;  3UJQ A;  1PZ9 A;  4AQT A;  1VAV A;  3GNE A;  2O8O A;  3WUD A;  4Q4V 1;  1OH4 A;  1OT5 A;  4D94 A;  4IUG A;  1HQW A;  4J6G A;  1H6X A;  2WNV C;  1JYC A;  4LPL A;  3VD5 A;  3IWZ A;  4AI0 A;  4WM8 B;  3KD4 A;  5J98 B;  4JAA A;  1H2M A;  3HNY M;  5FIX A;  3HAG A;  3ZDS A;  3E6C C;  4N53 A;  3RWK X;  2ZGK A;  3NVC A;  3SEP A;  5G04 L;  3JB8 A;  4XBL A;  3H8R A;  4COY A;  4BZ4 A;  4DZG A;  2W68 A;  3ZM8 A;  4XET A;  4K21 A;  2RJ2 A;  4HET A;  3MZH A;  3PU8 A;  1DU3 D;  5D8A C;  5IJR A;  3AVS A;  1O6U A;  1QJY 3;  2ZGS A;  3K3O A;  4FOY A;  4NHM A;  4TXW A;  1VBA 1;  4UBG A;  2YYO A;  5FY5 A;  1TE1 B;  2QTW B;  3R6S A;  2X5I A;  2XJR A;  4GZ9 A;  4CDX C;  2JE9 A;  4MGS A;  1QWR A;  2AEZ A;  1XNC A;  2ZAH A;  3EB7 A;  3P3N A;  2Y0I A;  4B1M A;  1JYV A;  1YWK A;  4HMZ A;  1PIV 3;  1QEX A;  2EXI A;  4E2Q A;  1NA1 C;  1S0F A;  4MX3 A;  4Q0V A;  1SLT A;  5FZG A;  1FI2 A;  5T50 A;  5G05 L;  4YM2 A;  5T5L A;  4Y20 B;  3THC A;  1M06 G;  3LEG A;  2KM2 A;  1NXD 1;  1H8T B;  4RR3 A;  1OHF A;  4A2U A;  3CMG A;  1PHM A;  1W8T A;  2VXR A;  3ZDV A;  4DOU A;  5IVJ A;  1JU4 A;  4UYB A;  5T54 A;  4IV3 B;  4H2A A;  2W92 A;  5FZ9 A;  3RZJ A;  3T2O A;  3AKR A;  2YC0 A;  3JQX A;  4FCA A;  2VO5 A;  2VZ3 A;  3H7Y A;  2QQW A;  4GMP 1;  3DEM A;  4FPY A;  5FZK A;  4Q1R A;  3WR0 A;  1RUF 1;  3IAP A;  1RIT A;  4E8C A;  4GJY A;  1FNY A;  1UX7 A;  5A3T A;  3TAY A;  4Z2W A;  1GZW A;  1G86 A;  4FP3 A;  3ME2 A;  3PUI A;  2YUE A;  3I4I A;  4I0W B;  5K8S A;  1U5Z A;  1LOD A;  1OLR A;  1CIW A;  2Q1M A;  1F2N A;  2OYZ A;  2WO2 A;  3TYJ A;  3ZVX A;  5BNP B;  5C6C A;  3WW1 A;  2ORZ A;  2Z4F A;  3ZXL A;  1IG0 A;  3UV9 A;  5JZG C;  5F1R A;  2DTW A;  4RS5 B;  4O7X A;  1JH5 A;  3AB0 A;  4SBV A;  3WSO A;  2HBU A;  4F83 A;  2Y38 A;  4NIG A;  2LW8 A;  4K20 A;  2HWE 2;  2QQL A;  4D6R A;  3CZJ A;  4UFI A;  5C5T A;  1GV9 A;  1WBF A;  2YZ4 A;  4FP2 A;  3RWN A;  1G8W A;  3JZV A;  1W2U A;  3I2F A;  1W05 A;  3MW3 A;  4GXL A;  4LR4 A;  1ND3 C;  3HT2 A;  3J7M A;  3OB8 A;  5DAQ A;  2D6M A;  4ZZ8 A;  1J1L A;  3AMP A;  4LKE A;  5EXO A;  4XMI A;  1YEW A;  1XU1 A;  1VB4 A;  1S0B A;  5E6H A;  1F4A A;  2E63 A;  4KNC A;  1J1T A;  2HWD 3;  4NAO A;  3MFC A;  1NZI A;  2RDS A;  1YQ6 A;  1I3H A;  2ZHL A;  1JZ4 A;  3J9S A;  4JGY C;  2GP3 A;  5J48 A;  2WQZ C;  3CU7 A;  1G9F A;  5FPZ A;  3VBF C;  5LA1 A;  1OI6 A;  5CB7 A;  4Q1P A;  2VZV A;  3GJB A;  1W90 A;  3PTR B;  4MO3 M;  5CFC C;  1E5H A;  5IVB A;  1U5X A;  1K42 A;  4UFH A;  3UT0 A;  3VDD A;  2ZS6 B;  3NAP C;  3OSD A;  4QGN A;  4XPV A;  3MIH A;  4QQH A;  3NWK A;  1VR3 A;  2W0X A;  2WJS A;  2BVV A;  1JW6 A;  2ZPX A;  2VUC A;  3E5U A;  1DF0 A;  5A7O A;  1AX0 A;  1X8M A;  1MS9 A;  1QQP 3;  2DUO A;  2XLF A;  4I01 A;  4GAZ A;  4XUT A;  2RS5 2;  1Q5O A;  2TUN A;  5GAL A;  3SH5 A;  1N1T A;  5T52 A;  4PDW B;  1WMF A;  3WNP A;  1DBN A;  2Y6F A;  4NE9 A;  1CJP A;  4BQ3 A;  2Y6H A;  4NPL A;  1UYZ A;  3OJB A;  3OYW B;  3TN9 3;  4CDW C;  2YC2 A;  3LDK A;  2KXL A;  3KZ4 C;  1EUU A;  3ES4 A;  4AF9 A;  2JIC A;  4P9Y A;  2XJT A;  1WLW A;  1ZBE 2;  3HOB A;  5T5P A;  3TB0 A;  1W8F A;  4FXG B;  3BOP A;  4B29 A;  2IXL A;  1QJX 3;  2W1S A;  2VTX A;  3PVO A;  3AYC A;  5EP9 A;  3O1S A;  5JOY A;  2GC3 A;  3MLJ A;  5DAB A;  1HB1 A;  4NOT A;  4ASK A;  1UL9 A;  3JXS A;  3KVA A;  2ZGU A;  4MG2 A;  4O9G A;  1RHI 3;  1HIX A;  1HQN A;  2DWR A;  2XHK A;  3DF0 A;  1F4H A;  1AR6 2;  3WDU A;  1WGP A;  3MPB A;  1K5M B;  4AI9 A;  4GQ7 A;  3HBK A;  1W8H A;  1SFP A;  5KXC A;  4PHZ A;  1RMU 1;  2Z5W A;  3N4M A;  1MEC 1;  1QJU 2;  2VGD A;  1QIQ A;  4D8M A;  4AE2 A;  2VAU A;  3RZL A;  2WWU A;  4XC9 A;  5A3U A;  4HPK A;  3MPP G;  2HWB 1;  2RS3 3;  1AR8 1;  1QOS A;  4BQW A;  2CU5 A;  4FFH A;  1FOD 3;  1PM4 A;  1QH7 A;  3H3U A;  5CZK A;  3HEI A;  4QKN A;  3HN3 A;  1O5L A;  5FLI A;  1JOB A;  1OQE A;  2IUW A;  3UGG A;  4LKF A;  3T09 A;  2DDU A;  4P9L A;  1F8V A;  1PO2 2;  3ILN A;  3QAC A;  1QJE A;  1Y43 B;  4XCB A;  1AVB A;  1LGC A;  5K4L A;  1YFY A;  2JIJ A;  5FO7 B;  4CCL A;  1GZT A;  4C8D A;  2VZS A;  3RI8 A;  2A3X A;  2BP6 A;  2YHJ A;  4BLI A;  2BOJ A;  3OBZ A;  2BEO A;  1RUH 1;  3VHN A;  5FK7 A;  2W52 A;  1XBF A;  4FPE A;  2VTF A;  5FZ8 A;  2BTV C;  2RS1 2;  4NWV A;  4XUO A;  5FMO S;  3UKN A;  1L3J A;  5CNA A;  5TSW A;  5A6Q A;  3ACH A;  5AVA A;  2VTX J;  5D1I A;  3DXU A;  1CAU B;  1JTZ X;  1LHV A;  1BVP 1;  4QB6 A;  5DDJ 1;  3N35 A;  1W8Z A;  3AC0 A;  4Q5O A;  2GDF A;  4M4P A;  1AHS A;  4QXC A;  3T1L A;  3NV3 A;  3M2M A;  4PLM A;  3WCR A;  1JOD A;  4DXT A;  4Q4X 1;  5DZE A;  3KVB A;  1MZ5 A;  3FLR A;  2R04 2;  3S30 A;  1UMH A;  3ZN6 A;  2Q8E A;  5ACA 1;  4XW3 A;  4YVS B;  2FCV A;  1W9W A;  1SFN A;  1U0A A;  2JE7 A;  3PU3 A;  4DIQ A;  1CX1 A;  4N90 A;  3IB3 A;  2B8M A;  3KS7 A;  2RMU 1;  1U12 A;  2VZU A;  4CU9 A;  5I93 A;  5CG8 A;  1RUI 2;  2Y6L A;  3IDE A;  2VZQ A;  3LE0 A;  3WLU A;  1DHK B;  1LKN A;  4YGB A;  3Q9O A;  3ZYG A;  4KBZ A;  4KU8 A;  1XSR A;  2R1D A;  2ETE A;  3ASI A;  4RQP B;  4A4A A;  5FOJ B;  2DTY A;  1VMF A;  4XIK A;  3PTY A;  3RSJ A;  2XBO 2;  4N9I A;  1EAH 2;  4XJ8 A;  3O5S A;  4FOQ A;  4Q8K A;  4IV1 B;  1Q8O A;  3I2I A;  4TWT A;  2P5B A;  4IEZ A;  4LJH A;  3JBG 1;  4KGQ A;  4RS5 A;  1SBF A;  1W0P A;  1PMJ X;  2D5H A;  2UWC A;  1W99 A;  1COV 3;  4ZPI A;  5FY0 A;  5FPX A;  1OPO A;  1ASJ 1;  3M3C A;  1BEV 1;  2A75 A;  3OGS A;  2PXJ A;  4LLF A;  3I2D A;  2BNM A;  1AX1 A;  2R30 A;  3CDZ B;  5FYS A;  3TNP B;  4CDU B;  1NLS A;  1AYN 3;  5C3P A;  1CJD A;  1V6L A;  4OCT A;  1RVF 3;  4HN1 A;  4LBQ B;  5C3R A;  1JBC A;  1ZBA 2;  4OHW A;  5JIA A;  3ZKY A;  4CEW A;  1H2K A;  4Q2F A;  2R0H A;  3V0A A;  3BKZ A;  4YM3 A;  5CAZ A;  1UZV A;  2ZEX A;  2R06 2;  3MW4 A;  3OY8 B;  1Z7S 3;  2PYT A;  4IES A;  1LES A;  2PLV 1;  4YVW A;  3MLL A;  5FZ3 A;  1F9K A;  3X29 B;  2VZT A;  3TEY A;  3F2Z A;  4QHZ A;  1RUE 2;  1UXZ A;  1MAC A;  4FQ4 A;  4O65 A;  4EN7 B;  4CXY A;  1OUX A;  4I3G A;  1RXG A;  3C7E A;  1U5Y A;  4B4R A;  1CAX A;  2ET1 A;  1N1V A;  1HX6 A;  1W3X A;  3IIA A;  4NRO A;  3WD5 A;  4B1L A;  3G6J B;  4CTE A;  3ABZ A;  1AXK A;  3O1P A;  2JDP A;  1NY7 1;  4BXF A;  4OI2 A;  1KJR A;  4CPB A;  3EJK A;  1ND2 A;  4N43 B;  3ORJ A;  3H8X A;  2UWA A;  4I3P A;  4V2V A;  3RYP A;  3VUO A;  1Q56 A;  2JG9 A;  1CAV A;  3KWV A;  4JGZ A;  1YQC A;  3RZK A;  2KR2 A;  4XAC A;  1GAN A;  3VBS A;  1QY4 A;  1ZRI A;  2R7E B;  3GCX A;  1YLL A;  4PDW A;  3VBH A;  4P9J A;  4HVR A;  3ZYB A;  2C0Z A;  4G3Y C;  2BGP A;  3PLQ A;  5IWF A;  3CKH A;  1MS4 A;  4BMB A;  2HH9 A;  2RDR A;  4Q27 A;  4WM8 C;  4YG6 A;  2P17 A;  2WBK A;  4NID A;  1W6Q B;  3ZXD A;  2EXJ A;  4XAE A;  3JD7 3;  1YRZ A;  3IZO A;  2VXJ A;  4COZ A;  1XNB A;  2XML A;  1WCK A;  2ZMK A;  5GZG A;  1BKZ A;  3OUJ A;  1YUD A;  5LA2 A;  1ZZ8 A;  5ANQ A;  1POV 1;  1JYW A;  2JEN A;  5FUI A;  2ZX1 A;  5DAX A;  5AC9 2;  4UW6 A;  1SCS A;  3FE5 A;  3WXP A;  4UXA A;  2BDR A;  2IXJ A;  4A44 A;  4MHR A;  3U37 A;  3U4S A;  3N9Q A;  3D5O A;  1IGO A;  3POJ A;  3CLP A;  3WY6 A;  3O1M A;  5JVV A;  3T2T A;  5GZC A;  1OFS A;  1BXH A;  1K5M A;  2WFF 2;  1FPN 1;  3KCY A;  1W2N A;  2QQO A;  4AHX A;  1F5J A;  1X36 A;  1DZQ A;  1X9P A;  3DYM A;  5FJK A;  3N3H A;  5L73 A;  3SC7 X;  3FFQ A;  1OKQ A;  4CP1 A;  4E2S A;  2EA7 A;  4MH0 E;  4OMC A;  4ZS3 A;  3BTY A;  4P08 A;  4XJA A;  1DCS A;  1HXS 3;  2Y0O A;  1W6P B;  5JXI A;  5HCH A;  1V9U 1;  2RDN A;  5FZB A;  2ORX A;  3OEA A;  1F5F A;  3ZR5 A;  2IFW A;  1H8T C;  3VD9 A;  3E5X A;  5F3E A;  4R8H A;  1W0N A;  1NUK A;  4IV3 C;  4AFC A;  3VKL A;  1VBB 2;  5FP8 A;  4CP0 A;  4CEY A;  2ATF A;  4ES9 A;  3LA3 A;  2GC0 A;  1UY1 A;  5JSP A;  1E5S A;  1O7F A;  1VB2 A;  4EZ4 A;  3GZU C;  3AZV A;  3T4H B;  4BK4 A;  1R08 1;  3EBR A;  2ADE A;  4H55 A;  3VL8 A;  1CZT A;  2PHW A;  2VEC A;  3B5L B;  3LSD A;  4C1W A;  2MHF A;  1CAU A;  4Z2A A;  2FDJ A;  4JZR A;  2AUY A;  5BNP C;  3ATG A;  3SCH A;  3I3M A;  2CNA A;  3CHX A;  3SHR A;  3WQ7 A;  4COV A;  5FLJ A;  3KM5 A;  4RS5 C;  2ZML A;  4CDQ B;  3LPF A;  1Y7B A;  4ZU5 A;  5T5O A;  1OBN A;  1OOP A;  1POQ A;  1W04 A;  2JDN A;  4AG4 A;  3BPZ A;  2LRP A;  2XG3 A;  1TNR A;  2ZMN A;  4XDQ A;  4U36 A;  4GB3 1;  4XBN A;  3S5Q A;  1DQ0 A;  2PAK A;  3VGI A;  3BOD A;  4S2G A;  4A7K A;  5HBA A;  4QWN A;  2IVI B;  3O0V A;  4RQP A;  1UU4 A;  4KWK A;  3C7G A;  1QH6 A;  3UGF A;  5IW0 A;  4XQD A;  4DXZ A;  1BVV A;  3C3V A;  2LUW A;  4B7K A;  2GH2 A;  3K4A A;  5LA0 A;  1GNZ A;  3MYX A;  3EYP A;  4KI5 M;  4XZP A;  1YCI A;  4CCE A;  4PIY A;  4W6W A;  4YW2 A;  3ZPO A;  3D82 A;  5A3L A;  1OC1 A;  5BNQ A;  3O1R A;  5EHD A;  5IFT A;  3ZX7 A;  5KHK A;  2X09 A;  3ZR6 A;  4CCN A;  3A7Q A;  3BPS A;  1VBA 2;  3WNX A;  2YU1 A;  2QJV A;  1RUG 1;  3NW4 A;  3RYR A;  4C91 A;  2WNU B;  3MLK A;  4FQZ A;  5DN2 A;  2ZA9 A;  4LIV A;  1UMZ A;  3OY8 A;  4WVZ A;  1KS4 A;  3TN9 2;  4MXW B;  4R9D A;  1HKD A;  2AEN A;  1UU6 A;  1RC6 A;  1YJK A;  3WDX A;  2E33 A;  4JKK A;  1HJG A;  1HRI 3;  1IQA A;  4MET A;  3U75 A;  5J09 A;  1AYM 1;  1LRH A;  2OX0 A;  2LS6 A;  1XPW A;  1H9P A;  3VKN A;  5FY8 A;  5FZ6 A;  1CAW B;  4NPM A;  3URF A;  5LBE A;  3U11 A;  1JYN A;  2GAL A;  3POS A;  1UY0 A;  1W8O A;  2HWE 3;  2OII A;  3VD4 A;  4PF1 A;  5I0T A;  3OUI A;  1GBG A;  1GLH A;  4L8Q A;  3CZU A;  1UYY A;  3NRU A;  4Y22 B;  1GP6 A;  2DVD A;  5KHI A;  3VBF B;  4ONU A;  4FFG A;  1RUD 1;  5FYT A;  1RUF 2;  1UX6 A;  3DEC A;  5IVF A;  1DZT A;  3IDC B;  2K0G A;  4WV8 A;  4N43 A;  1DGL A;  5A7P A;  3DPR B;  3ZO0 B;  1X7N A;  4PBP A;  2BV4 A;  3AXD A;  4Q0U A;  4UWD A;  1FXZ A;  4QGM A;  3VZK A;  2TBV A;  1L7Q A;  3MF6 A;  4HZF A;  5FR3 A;  5KHG A;  1UZ0 A;  3FC0 A;  2BRT A;  2RS3 2;  2FZ2 A;  3PVB B;  2DBI A;  2E32 A;  5T3N A;  4A3X A;  4AI2 A;  4CCM A;  1YO8 A;  3POE A;  5KXD A;  2X05 A;  1W6O B;  3WNK A;  5JDB A;  1WD4 A;  1W6Q A;  1SLA A;  2C9A A;  3Q8E A;  1GOG A;  2Q0A A;  1IS4 A;  2PEL A;  2OKX A;  1LHN A;  1H4G A;  3KLS A;  4Y1V A;  4Y5T A;  4IQP A;  1YYN A;  2YXS A;  4Q4W 1;  5ABJ B;  4DXR A;  4Y33 A;  1QDC A;  1SLI A;  2P1B A;  4LE3 A;  3TNQ A;  4CSW A;  5JWP A;  2VOK A;  2W91 A;  3RNS A;  4DQA A;  2QNK A;  2R07 1;  1S2B A;  2WAB A;  4E2G A;  2RS5 3;  2D6L X;  3WQ1 A;  1RUJ 2;  2A1X A;  3WCS A;  3AP5 A;  3V0B A;  4AFM A;  5FXZ A;  4JDO A;  4YPJ A;  1QXJ A;  3LF7 A;  4IE4 A;  1DQ5 A;  2ZGO A;  5B2G B;  3LOI A;  2WNV A;  1CZS A;  3RMX A;  1ZBE 3;  4CRQ A;  4HXC A;  4NUB A;  1V6J A;  2GNB A;  3LEI A;  3F95 A;  5FZL A;  1T6G C;  3IKW A;  3ETP A;  1RYY A;  3I2H A;  4BOW A;  5LBB A;  3WG2 A;  1APN A;  2ZGQ A;  3LD8 A;  3N36 A;  3VDB A;  4C0H A;  4OI0 A;  5FZO B;  1W06 A;  2D3P A;  1YXW A;  2ZX2 A;  4GKY A;  3WDV A;  1V70 A;  2Y60 A;  2OA2 A;  5D8A A;  1AR6 3;  3T30 A;  5L19 A;  1H30 A;  2C9K A;  2CHH A;  5AFB A;  1J83 A;  3GXU A;  2DFC A;  4EE2 A;  4YVS C;  3VBU B;  4ERO A;  4NHK A;  1OH3 A;  2P4E A;  1QJU 3;  4IEV A;  5GLZ A;  5BNO B;  4KWL A;  5FXW A;  4CDX A;  5FQ0 A;  5FYH A;  1KDM A;  4LK7 A;  3NJX A;  2J1U A;  2JB4 A;  2FDH A;  5C9A B;  5A7N A;  3HQR A;  3RDI A;  1NA1 A;  2TEP A;  4XF1 A;  1XND A;  2JKX A;  3V64 A;  4CCO A;  3CBN A;  4RYD A;  4IV1 C;  3KF3 A;  1VRH 1;  4YSF A;  4ET7 A;  1PO2 3;  3MIG A;  4QB2 A;  5FBJ A;  3T0D A;  2IC1 A;  5DMY A;  3TEW A;  4CCC A;  4DRR A;  1JN2 P;  4XMA A;  3LKJ A;  1CPN A;  2VZP A;  2W5F A;  1UNB A;  4DPN A;  1QU0 A;  4CDU C;  4RGA A;  1VBE 3;  2HWF 2;  3RQ0 A;  1PMH X;  2GC1 A;  2HEV F;  5I8T A;  2JEM A;  2RS1 3;  3KB5 A;  4AW7 A;  3VD3 A;  5FDB A;  2QBX A;  1J59 A;  1MEC 2;  3MDP A;  1SAC A;  2W1Q A;  1DYO A;  5IK5 A;  2DUQ A;  5A1L A;  1IKQ A;  2EIG A;  1BK0 A;  4QHO A;  4Y3O A;  5F3C A;  4G4F A;  3PIJ A;  1AR8 2;  4QXK A;  1ZNP A;  4XVH A;  1E57 A;  2WSV A;  1RGS A;  2R04 3;  1LGN A;  4NRQ A;  5F39 A;  1G9B A;  1VMJ A;  1HV0 A;  3PVN A;  4GKX A;  3WT3 A;  3WP6 A;  1RUI 3;  4QPG B;  3CQO A;  4AYU A;  1ZYB A;  1ZZ6 A;  2JD4 A;  3DGT A;  3ENR A;  4LHS A;  4FTB A;  4V2W A;  2XBO 3;  2WUH A;  1ND3 A;  1EAH 3;  5FRA A;  4ZXK A;  1LB2 A;  1AR9 1;  4N43 C;  2IZW A;  4Q8L A;  1RUN A;  4LMF A;  2VMI A;  2WL1 A;  5F3I A;  3OF1 A;  2G19 A;  3HR9 A;  4W8J A;  4LKS A;  4FPH A;  1SCR A;  4FFI A;  3TEX A;  2WC2 A;  3S7E A;  4X8N A;  1XE8 A;  3H1Y A;  5F5A A;  2WZ8 A;  1DFQ A;  2JXA A;  2V09 A;  4JGY A;  3SEE A;  1W2T A;  1ZBA 3;  1AUY A;  2QQU A;  3VBF A;  2F6B A;  5CFC A;  5C8W A;  1CGP A;  1BQP A;  2RMU 2;  2Z42 A;  3BGA A;  3LFM A;  2R06 3;  1FT9 A;  5DUV A;  3NAP A;  4AOC A;  1WCD J;  1Q8Q A;  1JZ2 A;  4G9S B;  4ISQ A;  5CBL A;  2VUL A;  1RUE 3;  3A0N A;  1W6N A;  4MXV A;  4QPI B;  2E31 A;  3MBW A;  2UY8 A;  5GZF A;  4LBK A;  3FBY A;  1PZ7 A;  3GBF A;  3JBG 2;  4CUB A;  4QKF A;  1OA3 A;  5FYM A;  4JX0 A;  1WW5 A;  5LCW L;  5L9V A;  1SBD A;  5A70 A;  4RHV 1;  5E16 A;  5DAW A;  4DS0 A;  4GMP 0;  5C7G A;  2BYV E;  3VL9 A;  1I5P A;  4HOO A;  3J7L A;  4CDW A;  4AVV A;  4BH9 A;  4BA6 A;  4TYS A;  4FBF A;  1DZR A;  2WO7 A;  3GJA A;  1CPM A;  1V6K A;  1YFW A;  1Q8P A;  4PI2 A;  5J96 B;  5A3O A;  2PLV 2;  1A8M A;  2B45 X;  2HYK A;  2JWP A;  1GYK A;  3THD A;  2ZHM A;  2ZKL A;  5BV6 A;  3GBG A;  4Y5Z 0;  1BMV 1;  1EV1 3;  1JS9 A;  3W21 A;  2YU2 A;  3OD4 A;  1UY3 A;  1MVE A;  5IAV A;  5A3W A;  3WZ1 A;  3W58 A;  4NWW A;  4ZU4 A;  3UNP A;  1UYX A;  1W2O A;  1NCR B;  4KQ7 A;  2HWD 1;  3WV6 A;  5J3U A;  3BN6 A;  5E89 A;  5KHJ A;  1PGS A;  2VW0 A;  4KWJ A;  3USU B;  3LDB A;  1QXP A;  4JQT A;  2VUD A;  2WWJ A;  2BWA A;  3ZFE B;  4JKM A;  1LR5 A;  3KV4 A;  3JU9 A;  2GSY A;  2VQA A;  1QGL A;  2FQP A;  3AYA A;  4H14 A;  4XBQ A;  5FZO A;  1OSG A;  1O91 A;  3AKT A;  3NQH A;  5AC9 3;  1ULD A;  4FPK A;  1JZ3 A;  2P34 A;  2RJL A;  3K2O A;  3AZW A;  4AHZ A;  4LHL A;  1UOB A;  4AEM A;  3PHM A;  3B01 A;  3B3Q E;  2CY6 A;  3DKW A;  3E1F 1;  5EJZ B;  3M3O A;  2VNR A;  2WFF 3;  4BQ2 A;  1US2 A;  4CDQ C;  1HDK A;  3B02 A;  4GD4 A;  3VBU A;  3N9P A;  2Q8O A;  3ACG A;  4D7T A;  4S2D A;  2AH2 A;  1LGB A;  1PO1 1;  3JUU A;  1QQP 1;  5DPN A;  3IN9 A;  3VBR B;  1REE A;  1GFF 2;  1DQ1 A;  1NE6 A;  2NLR A;  3IPV B;  3I59 B;  3NST A;  4QDQ A;  4BLJ A;  1OLM E;  4WZF A;  3ZYJ B;  5C8C B;  3ZN5 A;  4XAB A;  2Y6J A;  3MO4 A;  4LBL A;  1MVQ A;  4OHV A;  5A80 A;  1KJL A;  1F35 A;  4MGQ A;  4MGZ E;  5FJH A;  5FRE A;  2G1M A;  1C8M 1;  3FLP A;  3III A;  4EN9 B;  5C4W B;  4XFF A;  1VBB 3;  3LEK A;  1SFY A;  4GWM A;  1D4M 1;  1HRI 2;  2LRO A;  4AHY A;  2XON A;  1WCU A;  3I54 A;  2EVX A;  1IPJ A;  3H7J A;  2GNT A;  4BCU A;  4BXS V;  3INA A;  1DGR N;  1VBD 1;  1IKP A;  1FPN 2;  3Q8F A;  4GJZ A;  3K3N A;  2A6X A;  1IHM A;  2WNU C;  4ARY A;  1J84 A;  1AL2 1;  2I45 A;  1LOB A;  5A32 B;  2JE8 A;  2WKK A;  3LA7 A;  1A78 A;  1VAK A;  3IM0 A;  4EWD A;  3E6D A;  1UOG A;  4CUG A;  2YFU A;  2J22 A;  3AXE A;  3VV1 A;  3MIE A;  1IQD C;  1WCS A;  3M7A A;  3C7O A;  2MEV 1;  4L97 A;  5F8P A;  1UW8 A;  3TBD A;  3LAG A;  2XJU A;  1KD7 A;  3ZSE A;  4E4D X;  5LRR A;  1GZC A;  1S0C A;  4I09 A;  1YQ2 A;  4SLI A;  1DGR A;  2C26 A;  2K46 A;  2WZE A;  2HLE A;  2ZGL A;  3VLB B;  3D0J A;  3AMH A;  3NO8 A;  2BGC A;  2BQP A;  1V00 A;  2JJ6 A;  1LNS A;  4KWU A;  1HN1 A;  2W87 A;  5FYB A;  3KV9 A;  1Q8V A;  3K4Z A;  3DPR C;  3VDC A;  2CAV A;  2R1B A;  1H8V A;  3SKV A;  2JIG A;  5FV3 A;  2CWM A;  3M4F A;  3T0B A;  3ZSJ A;  2F17 A;  4LO7 A;  3ZXA C;  3OOX A;  1DP0 A;  1Q3E A;  3Q8B A;  2OUH A;  4UFJ A;  4LBJ A;  1VBA 3;  2E7T A;  2GP5 A;  4X8P A;  4PLN A;  4CP9 A;  5BPX A;  1QOT A;  3J7H A;  4GB3 2;  5LW9 A;  1XU2 A;  3R0R A;  4N9H A;  5FK8 A;  4NRM A;  4QDS A;  5LBF A;  4CA9 A;  4YW3 A;  3SQO A;  1V6M A;  1PGW 1;  1QNY A;  5IFP A;  1W6M A;  4M3C B;  4FI9 A;  3BI3 A;  5ABJ C;  2AAC A;  3J8F 2;  2OW4 A;  4FPC A;  4YZ4 A;  1Z0H A;  4F7Z A;  2WA3 A;  3D8C A;  3CEW A;  1I1E A;  1CWP A;  2JX9 A;  2W95 A;  4AAP A;  2CAU A;  4HVQ A;  2GN7 A;  3ZYF A;  3RRD A;  4A41 A;  2O0O A;  2E53 A;  3NNG A;  1CX4 A;  2J1V A;  3QD6 A;  1JYI A;  1VE0 A;  3D6E A;  2BGO A;  4GMP 3;  4XFI A;  5FUN A;  5JXJ A;  1G9C A;  3I3B A;  5FZA A;  3KHB A;  4BWO A;  1NCQ B;  1RUF 3;  1UZZ A;  1F15 A;  2V72 A;  3AMQ A;  4WM8 A;  4XF9 A;  3O0X A;  5SV8 A;  3NMB A;  2Q1Z B;  3OBA A;  4BB3 A;  3RS6 A;  3HVD A;  4XFB A;  1XNK A;  3J4U H;  4YZ2 A;  4D69 A;  5I8Y A;  4IE7 A;  4O61 A;  3AL5 A;  3BIE A;  5GZD A;  1AYM 2;  2EXK A;  4W6Y A;  5FPU A;  1UKR A;  1GUI A;  2G9F A;  2ZGM A;  5CEH A;  1SBE A;  1Z7S 1;  3LWC A;  4H7M A;  1Q8S A;  3LGR A;  2VQ0 A;  4M4R A;  4AED B;  3C7F A;  1ENX A;  3EMR A;  5D21 A;  2A70 A;  5GKA C;  2P6H A;  4HON A;  3VBU C;  1ENS A;  1ULC A;  2ARX A;  3UKV A;  1M4W A;  1VJ2 A;  2UYA A;  3CNA A;  2ADD A;  5BNO C;  2LAL A;  3LPG A;  4JCK A;  5JOW A;  1O3T A;  4K40 A;  1ODN A;  1RUD 2;  4P02 B;  5BNN B;  2RM2 2;  3JB4 C;  4DIN B;  1VBE 2;  4FOV A;  5C9A C;  2BU9 A;  2NZ9 A;  1SHW B;  2VZO A;  3AP6 A;  1VBC 1;  2JKB A;  3KSC A;  3OGG A;  1LAJ A;  2E26 A;  1RUJ 3;  1AZD A;  1BZW A;  4Y20 A;  4XF0 A;  3AZZ A;  3AKP A;  4WZC A;  2DCY A;  1H8T A;  2BWC A;  1KDK A;  1BLZ A;  3U0Z A;  3MI8 A;  1AR7 1;  2VNO A;  4MGI E;  1DYP A;  4C90 A;  4IV3 A;  5HI0 A;  3ZKU A;  3W5M A;  5JCT A;  3A0K A;  3P6B A;  2A3Y A;  1OUR A;  4Q0S A;  4B3N A;  1CVN A;  2QE3 A;  1U5I A;  2PA7 A;  4IEP A;  5FP9 A;  2VMC A;  2ZAA A;  1JHN A;  2OZ6 A;  3HBZ A;  3AZX A;  3VHP A;  3QLQ A;  4MGY E;  1L7L A;  1JZ5 A;  4J1X A;  2D40 A;  4Q4W 2;  3N9L A;  3GBW A;  2WA4 A;  2H6B A;  5CKM A;  1H6Y A;  1R64 A;  2RHP A;  2W94 A;  5APA A;  2ZXQ A;  4QM8 A;  5L9R A;  3LA2 A;  2GNM A;  2X53 S;  3WP5 A;  4E9K A;  2R16 A;  4URA A;  1C1F A;  5BNP A;  3P5B A;  4YG0 A;  3KV6 A;  1SPP B;  2PN5 A;  2R07 2;  1QHD A;  3MUZ 1;  1UQX A;  3ZXG A;  4WVM B;  4M01 A;  5CAD A;  4LO4 B;  5EV7 A;  5F37 A;  3MIF A;  2WLP A;  2H0V A;  3U4X A;  3LCP A;  2QQN A;  4QPG C;  2GMM A;  3UGH A;  4GWJ A;  3WP3 A;  1AJO A;  1NG0 A;  1D4V B;  2VCM A;  3VBO B;  2HJI A;  1OQ1 A;  2SBA A;  4BYY A;  2WS9 1;  3O1O A;  4LHN A;  5E88 A;  3ZLI A;  4LLO A;  1I5Z A;  2VW2 A;  4PCR A;  1MQT B;  1C57 A;  3D3A A;  4Y1U A;  5GLU A;  4YZ3 A;  3Q8A A;  3NJV A;  5DG2 A;  3W5N A;  3VDA A;  4XTM A;  1SZB A;  4DMI A;  4DY3 A;  1PK6 B;  2XVG A;  4P00 B;  4BQ1 A;  4EWA A;  1C8N A;  2NPI A;  3KQ4 B;  2W3J A;  3LEM A;  3N9N A;  1JZ6 A;  5J37 A;  1S4C A;  3T4V A;  3PUR A;  3H1W A;  1R09 1;  1WD3 A;  4XFG A;  2HWF 3;  4HAN A;  3HIF A;  1WLC A;  2D98 A;  5IUQ A;  1HRV 2;  3T08 A;  5JMO A;  4L99 A;  1RMU 3;  3K4D A;  1MEC 3;  3QCW A;  3SH3 A;  2QQV A;  2BOI A;  2QZ3 A;  4MHU A;  2N7G A;  2WZR 1;  2A3W A;  4CXX A;  5FOB B;  4Y1Z A;  2ZEZ A;  5FZC A;  2XLG A;  4NN0 A;  2WII B;  1AR8 3;  5CIR A;  2VM9 A;  5KC6 A;  2JG8 B;  2XDV A;  1AXY A;  3WQ0 A;  2AZ5 A;  2HWC 1;  1ZZB A;  3MF9 A;  4OUM A;  4QPI C;  4F8A A;  1QF3 A;  4COU A;  5B4X A;  3DCQ A;  1N47 A;  2E51 A;  2ZEY A;  2AR6 A;  1V0A A;  3HN1 A;  3UK9 A;  4LOT A;  1UXX X;  5H9Q A;  4I0B A;  4AQ2 A;  5FZH A;  1BBT 1;  3FUQ A;  2XUM A;  2BW8 A;  4PIX A;  3VHR A;  3ZXJ A;  4Q4Y 2;  4DUW A;  5DAP A;  3OYW A;  4HK9 A;  1EV1 2;  5DUU A;  1TME 1;  5K7P A;  2FDI A;  1CR7 A;  4PQQ A;  4XXA A;  4E4Z A;  3H42 B;  2L9L A;  2B9V A;  1VAM A;  1IZ3 A;  3OGJ A;  4FPF A;  4UF0 B;  4FPO B;  4K1Z A;  5F3G A;  4AQ6 A;  1AL0 G;  4HKW A;  5FPV A;  3VN4 A;  1H1A A;  1X82 A;  4LA2 A;  4YG3 A;  2DBN A;  1UWW A;  2J1A A;  2D97 A;  3ZYR A;  5F32 A;  5JOX A;  4C0B A;  1EY2 A;  3A23 A;  5FMD A;  1BCX A;  1YFU A;  2D6N A;  2YC4 A;  2LM3 A;  3HNM A;  4UW5 A;  4OFG A;  5A7W B;  5A6X A;  1GWK A;  2DVG A;  4ZON A;  4XEZ A;  1I9R A;  1HB4 A;  5FZ7 A;  2VBB A;  5EJ1 B;  1NCR C;  2RMU 3;  3P3P A;  2Y6G A;  1H4H A;  5L7O B;  4QT6 A;  1WW6 A;  5FZD A;  4P9I A;  1RJ8 A;  5FYV A;  1LEC A;  4ZKT B;  4LEJ A;  1H1I A;  3KGL A;  1ZA7 A;  2BER A;  2QQM A;  4MV2 A;  4PI0 A;  3ZFE C;  5ISL A;  1H9W A;  2VME A;  1ZRR A;  1LU1 A;  1TZO A;  2WRA A;  3DXT A;  4S2F A;  3VZJ A;  4ZS2 A;  1AR9 2;  3SNM A;  1HN0 A;  1QJF A;  2DCT A;  3KCX A;  1UN1 A;  4B8E A;  1TMF 2;  5FY7 A;  4MAD A;  3GHM A;  3JBG 3;  5JLV A;  4IDZ A;  1ULF A;  2AYH A;  2VJX A;  2ZKN A;  5L9B A;  4YGC A;  4KMQ A;  2K9Z A;  1ASJ 3;  1R1A 2;  4RFR B;  4AGG A;  5C5U A;  1QOO A;  1UD1 A;  4QX3 A;  1HJF A;  2WT0 A;  2CTV A;  3NL1 A;  2VOX A;  2VZ1 A;  4AGR A;  1GP4 A;  3KF5 A;  4ES8 A;  2HWE 1;  3ZXK A;  2D7F A;  4LQR A;  1EYB A;  1O3Q A;  1JMU B;  1S0I A;  1S0E A;  1A3K A;  4IXL A;  3VBR C;  3B00 A;  5C8C C;  3I3E A;  1OA2 A;  1RUC 2;  2Y6K A;  3MIB A;  3T3Y A;  2RVA A;  3GZE A;  4IEU A;  2PLV 3;  5FLH A;  1J3P A;  2EAA A;  3J7N A;  3KMH A;  4AVS A;  1CES A;  4BIF A;  2J42 A;  5F6K A;  1S55 A;  5KC5 A;  4GH4 B;  4IND A;  5C4W C;  4KBB A;  4RD7 A;  2OPK A;  1LHO A;  1GNH A;  2I07 B;  1D0H A;  3D4K A;  4HN0 A;  5GZE A;  3RI9 A;  3RPQ A;  4E4S A;  2FDG A;  4HKL A;  5IVE A;  4EN6 B;  5F2S A;  1TNF A;  2PMW B;  3FFZ A;  4WVW A;  2A6Y A;  4Q4V 2;  4YVS A;  4RHV 2;  1XRU A;  1J58 A;  2WN2 A;  1RB8 G;  3CJI B;  1ALY A;  1LU2 A;  4QAW A;  2E7Q A;  3ELN A;  1C4R A;  4L9B A;  4XUQ A;  1AJK A;  4A6O A;  4N8M A;  4QX8 A;  5A3M A;  1OKO A;  2VVF A;  1D7P M;  1JZ7 A;  4MLO A;  3VD7 A;  2ZX3 A;  3C8X A;  1ZVF A;  3BIW E;  4IV1 A;  5EYY A;  4WVM A;  1ULO A;  1HLC A;  4HK8 A;  2XVL A;  2FBE A;  3BCW A;  3WG1 A;  4BJ0 A;  4MUV A;  1BMV 2;  3T2P A;  4QGL A;  4K3U A;  5LBC A;  3OGV A;  4NHX A;  4JRA A;  4CDU A;  2UYB A;  4HLT A;  1I6X A;  4H3W A;  4YNI A;  4LBQ A;  4JKL A;  3RZZ A;  5C3S A;  5LWB A;  2RDQ A;  1WMD A;  3GHN A;  4HT1 T;  1S0J A;  3L9J T;  1POV 3;  1UCX A;  1ZBE 1;  2VPV A;  4Z82 A;  3MID A;  1T2X A;  4BQY A;  1PK6 A;  5EIY B;  1PVC 1;  4D0Q A;  2W1U A;  4ASM B;  3ZFG B;  1UOJ A;  4OMD A;  4Y1Y A;  3I8T A;  4K1Y A;  3HQX A;  4QQP A;  5K0U B;  3W9A A;  4IEY A;  5BY5 A;  4HVO A;  1FPN 3;  2IVJ A;  4FPJ A;  5FYC A;  5AFE A;  1AR6 1;  1PO1 2;  1WA4 A;  4TLF A;  1DG6 A;  2OT7 A;  2A71 A;  3HD8 B;  3WF2 A;  2VMF A;  3R4S A;  3I49 A;  4UOJ A;  2DVB A;  5FUP A;  4RL7 A;  3PJQ A;  3PUQ A;  1PNG A;  2Q1F A;  1QMJ A;  3ZMN A;  1O5U A;  2P3J A;  3FUO A;  3HNB M;  4KH9 A;  1JOP A;  2H0B A;  2RR1 1;  4RA0 A;  3V56 A;  5JXH A;  4AI3 A;  1R1Z A;  1YHF A;  4FAG A;  1OFN A;  1SG3 A;  1W8N A;  2CSG A;  2QDR A;  3MV0 1;  2W46 A;  2CL2 A;  4M3C E;  1D4M 2;  2XQX A;  3M3Q A;  1KEX A;  2NYY A;  4Z07 A;  3BU7 A;  1ZRD A;  3BTX A;  5ERL A;  5IVY A;  1R08 3;  2ZZJ A;  3B9I A;  1NCQ C;  2CGO A;  3Q8C A;  3AFK A;  1IOA A;  5AVP A;  2C6S A;  1K12 A;  4DXS A;  5H9R A;  1IPS A;  1ODM A;  4UW3 A;  4CPB D;  3IDB B;  1AL2 2;  3AKS A;  4DNY A;  4PJY A;  4FTS A;  1OD5 A;  4XDP A;  3RJR A;  5FPL A;  4LK6 A;  5J36 A;  3H8U A;  5CYY A;  4QX2 A;  4CVU A;  1LHW A;  2MEV 2;  5JR7 B;  4RGG A;  1Y4W A;  1ZZ7 A;  3AP4 A;  4CCJ A;  4ATF A;  4AED C;  4LO8 A;  3BB6 A;  1SLB A;  3APB A;  4GB3 3;  4AEJ A;  5A3P A;  4FFF A;  1DIW A;  4K9S A;  3WF3 A;  5EFU A;  3ZIW A;  3S0M A;  1VPH A;  2XKP A;  5LY1 A;  3CO2 A;  3QOP A;  3T1M A;  4DRV A;  2DCJ A;  1V6O A;  3J8F 3;  3PDQ A;  5BNN C;  5F2W A;  1RUI 1;  3ZSL A;  4QX0 A;  3K77 A;  1W6P A;  3POB A;  5DZF A;  3IT8 A;  5A1A A;  2JDU A;  1IS3 A;  4N53 B;  5IVV A;  3S5A A;  1VIW B;  4ARX A;  4FTE A;  1LUL A;  4HG6 B;  5FFO C;  4MZU A;  4K6B A;  4RFT 0;  4BE3 A;  4LT5 A;  1RED A;  1QXR A;  1ENR A;  2D93 A;  1JZ8 A;  1WW4 A;  4I2O A;  4R9B A;  1C5I A;  3ALQ A;  4BU2 A;  2C24 A;  1JXN A;  1UPI A;  1RUG 3;  2JB8 A;  2VY0 A;  2XHN A;  3NNM A;  4QHB A;  4DB5 A;  4JRL A;  2VOT A;  4A6S A;  3K75 B;  2BNN A;  4CU8 A;  4XHB A;  5BYN A;  3SH4 A;  4AI1 A;  4UFK A;  4W50 A;  5FWE A;  4LBN A;  4JHZ A;  2Q30 A;  1PGW 2;  1VRB A;  2WN3 A;  2X5I B;  1G9A A;  2FDF A;  3PIG A;  4QQ2 A;  1AYM 3;  3B93 A;  1W8U A;  2OS2 A;  4A3Z A;  1T6B X;  2ZGR A;  1FMD 1;  2R06 1;  3OTF A;  4HBN A;  4IL7 A;  3ZXF A;  4GH4 A;  2QQP A;  1B09 A;  1PZ8 A;  2BBA A;  2VUA A;  3SCG A;  4UBH A;  1G6N A;  1CIY A;  3O7O A;  3WEZ A;  1RUE 1;  4Q0Q A;  1V6N A;  4CDQ A;  1OLQ A;  1OLM A;  4RR3 B;  4XIO A;  4FVV A;  3CJI A;  2CWS A;  3PL0 A;  4D3W A;  1PM7 A;  3ZIX A;  2ARB A;  1LEM A;  1RUD 3;  3VBO C;  2RM2 3;  2D6O X;  3NKG A;  5FY4 A;  2G4I A;  2QQI A;  2A5Z A;  2VMH A;  1HQL A;  1KGY A;  3LDR A;  1RMU 2;  3RGB A;  2V5Y A;  1MQT C;  2VE1 A;  3NKT A;  3OD0 A;  4W6X A;  4Z1V A;  5GLV A;  1LOF C;  2ZTN A;  1PK6 C;  5CIS A;  2HWB 2;  3KCC A;  3NNJ A;  1H2N A;  1UIJ A;  2VOV A;  3GYD A;  3ON7 A;  2DF7 A;  2VBD A;  1LOG A;  1PGL 1;  2R6Q A;  4YFZ A;  4HSJ A;  4LHK A;  5JPN B;  2J1T A;  3HMY A;  2IFR A;  4AGV A;  4EN8 B;  4L92 A;  1OMI A;  3LIH A;  2QKD A;  5K9Y A;  2WNO A;  2E7A A;  2WNU A;  5HCB A;  3RG0 A;  2D3S A;  4Q4W 3;  1QJY 1;  3I2G A;  1K45 A;  3H9A A;  2YBK A;  4MXW A;  1RUH 2;  2JG8 C;  4E8D A;  2R07 3;  4K7J A;  5I0R A;  3ACF A;  2BVB A;  3WNL A;  1G7Y A;  1OXC A;  1W03 A;  1WBL A;  2VVE A;  2YPD A;  4IEQ A;  5CFD C;  1CAW A;  2X8K A;  5DDJ 2;  4IE6 A;  3FX3 A;  4XQ4 A;  1PIV 1;  2QUO A;  5CVR A;  4MOA A;  1AR7 2;  3RMY A;  2W08 A;  4LUL A;  2ZGT A;  3GZT B;  2RJK A;  1JOJ A;  3POY A;  2VW1 A;  2XWJ B;  4LBQ D;  4Q4X 2;  5D2A A;  4QB1 A;  3ECQ A;  1RTV A;  5LK5 A;  2ENR A;  2WFF 1;  1GKB A;  4Y22 A;  1O4Y A;  5ACA 2;  2XB6 C;  3ACI A;  4AVB A;  2CGP A;  3B7M A;  2ZEW A;  4CU7 A;  3C2U A;  4Y5S A;  3O1T A;  3FJS A;  1LOE A;  2X29 A;  4HSL A;  5JXG A;  4NVP A;  3DYP A;  4ATE A;  3POF A;  3DPR A;  4PT6 A;  5IYY A;  3VDD B;  1JUI A;  5C71 A;  4RSU A;  1A34 A;  2ZHK A;  1MPX A;  3W20 A;  1O59 A;  1SQ4 A;  4XCA A;  5K0U C;  2PAM A;  2XLA A;  1OA4 A;  1HRV 3;  5A33 B;  3U1X A;  3IMM A;  5L36 A;  1JI6 A;  1WW7 A;  2PQQ A;  4XJ9 A;  3QH7 A;  1W6O A;  4N7I A;  4A7Z A;  5L7O C;  4ORF A;  4HKO A;  3ZN4 A;  1ASJ 2;  4P14 A;  1XJA A;  1KIT A;  1MZ6 A;  1BEV 2;  3ZYP A;  1MS8 A;  2YGM A;  1HB2 A;  3FHI B;  4QXH A;  4DUV A;  3ZSK A;  1VLN A;  1OVS A;  2WS9 2;  2ZBJ A;  3M8L A;  3VKF C;  4OI4 A;  1V6I A;  3VKM A;  4F3J A;  4XDO A;  5LAT A;  5ABJ A;  1FNZ A;  1XYN A;  2LTN A;  3FLT A;  3OPZ A;  5I91 A;  5DZG A;  1JYT A;  2YBP A;  5M0T A;  1H0B A;  2OXB A;  5GLT A;  4YLZ A;  3JQW A;  5FP7 A;  3AYE A;  4Y26 A;  4Q4Y 3;  2IXI A;  4XXP A;  1MZF A;  3EHK A;  4IEX A;  5JIU A;  1MZE A;  1R09 2;  3IDA A;  1URX A;  4ZU7 A;  2V73 A;  4QQO A;  2W39 A;  4ZY9 A;  2XOM A;  2YB7 A;  1YIF A;  5IT6 A;  2D3R A;  4L2N A;  1JYX A;  2VMD A;  2PHD A;  2WZR 2;  1G9D A;  2AC1 A;  1LHU A;  1BK1 A;  5JI9 A;  4LUK A;  2Q8C A;  1CN1 A;  1NY7 2;  3SXW A;  5C33 A;  4R9A A;  4Q0P A;  3ZYH A;  1CD3 G;  2GAU A;  2HWC 2;  3E97 A;  4AWD A;  3KT7 A;  4GH4 C;  4HPK B;  1SDD B;  2VG9 A;  2Y33 A;  3C7H A;  1YQ5 A;  3OUH A;  4IEW A;  1KFU L;  2YV8 A;  3QH6 A;  3LIG A;  2JD9 A;  4NAM A;  2K2S A;  1BBT 2;  3WQB A;  2E6V A;  3TOJ A;  4LBO A;  4QM9 A;  4EN0 A;  3CJI C;  4FOW A;  5BXX A;  3R05 A;  3UYJ A;  4DO0 A;  5KXB A;  1Y9Q A;  5BNO A;  1TME 2;  2DVA A;  3MV1 1;  3ILF A;  3AKQ A;  4YW5 A;  1AR9 3;  2AEY A;  5FZF A;  3VZO A;  2WO3 A;  2PQS A;  2FD8 A;  3O1U A;  2BPA 2;  1TMF 3;  1US3 A;  2FZ1 A;  2VMG A;  4YGD A;  4W4Z A;  3HWJ A;  4FPL A;  3TN9 1;  3ZPY A;  4BM8 A;  5C9A A;  3KHC A;  3S57 A;  2QCS B;  2D6P A;  4A7Y A;  2Z69 A;  1NAE A;  1R1A 3;  4LNV A;  5H9S A;  1S0G A;  1WA6 X;  1Y9M A;  1IS6 A;  4IER A;  4UFM A;  2P3K A;  3MHZ A;  2GU9 A;  1N3P A;  1W39 A;  1QJX 1;  3A22 A;  3AZY A;  5FCC A;  2WIN B;  5FY9 A;  5ANN A;  3AVR A;  5FTT C;  2OUJ A;  4ZXE A;  2YY1 A;  2ILM A;  4PQ9 A;  4FAH A;  3I2J A;  3O12 A;  1RUC 3;  3N9O A;  3H3Z A;  2B39 A;  3ZN6 B;  1RHI 1;  3BYW A;  2J7M A;  1GOF A;  3PME A;  4D7Y A;  5FWJ A;  2XUE A;  4YM0 A;  2RG4 A;  1RL3 A;  3BOW A;  4JTN A;  4MYE A;  1D2S A;  5DUX A;  4M0H A;  2XR4 A;  2PHR A;  5F5Q A;  1UO9 A;  4KL1 A;  5FPB A;  4IGO A;  3AP9 A;  4B7E A;  4JDM A;  1V9U 2;  3ZFG C;  1N3O A;  1W9Y A;  2D6K A;  2D43 A;  1UY4 A;  2NMO A;  1S2K A;  2O1Q A;  1ULE A;  1WME A;  4YW7 A;  3AJZ A;  2VZR A;  3D0S A;  4Q4V 3;  3RFR A;  1B35 C;  2RS3 1;  2OVU A;  1ENQ A;  4RHV 3;  2IXC A;  3GCW A;  3KGZ A;  3RZH A;  1FOD 1;  1NKG A;  2P2K A;  2P6C A;  1GWL A;  4QPG A;  3IMN A;  4BHP A;  2JEC A;  5CG9 A;  3MEP A;  5DXD A;  1TQ5 A;  4CYD A;  5A7S A;  1ZZ9 A;  1R08 2;  3POI A;  3NV2 A;  5IVC A;  2NM1 A;  3H0O A;  4BQ5 A;  2XL7 A;  1XC6 A;  4J25 A;  3DN7 A;  5FXV A;  3WVJ A;  5T55 A;  4CEW B;  3W59 A;  2UY9 A;  3T0A A;  4YZ1 A;  1BJQ A;  1UYP A;  1UU5 A;  3O0W A;  3V0A B;  5F6L B;  4YVW B;  2I74 A;  2PHF A;  4QX7 A;  2ET7 A;  3A4U A;  2F4P A;  5F7U A;  4XE9 A;  1XB9 A;  1RUJ 1;  2G9G A;  5KHH A;  3GF6 A;  5FZ4 A;  4PLO A;  3K51 A;  5HCA A;  3ZFF C;  2AGS A;  4QKD A;  4BIO A;  2WYF A;  4YZ5 A;  3NV1 A;  1XOY A;  1CAX B;  1CQ9 A;  2W2I A;  2KA3 A;  4CCK A;  4LA3 A;  4XQW A;  4QX1 A;  2BFU L;  1XYO A;  2FCT A;  5E1R A;  3WW2 A;  4AEK A;  1N1Y A;  3AL6 A;  4LOR A;  2J1E A;  4LOS A;  5A6Z A;  2XWB B;  4AZZ A;  1UAI A;  5E8A A;  2XKO A;  1W3V A;  3L2Y A;  4LO6 B;  4P5H A;  4QPI A;  3TRS B;  3WUC A;  2UWB A;  5A6Y A;  2IXK A;  1W9S A;  1ND2 B;  4AI8 A;  4YAR A;  2YBS A;  1RIR A;  2EF6 A;  4NMI A;  1WKY A;  2JG9 B;  1J3R A;  1CAV B;  2A6Z A;  1BYH A;  1PO1 3;  4JGZ B;  2FCU A;  3EQE A;  1GQH A;  3VBS B;  2ZX0 A;  4FT8 A;  4OUS A;  5FMC A;  3S6P A;  4XZU G;  3LOB A;  4UW4 A;  3VBH B;  1COV 1;  2CDO A;  1RUG 2;  4AK3 A;  3H3L A;  4R4X A;  2H6C A;  1PX3 A;  3ZOI A;  2J1R A;  3VHO A;  1C8M 3;  4N53 C;  1AYN 1;  1RVF 1;  2VU9 A;  1C3H A;  2UU8 A;  1PVC 2;  4AFD A;  4MGT A;  1OF3 A;  1D4M 3;  2WAA A;  4LIU A;  1GP5 A;  4OQ9 A;  3FBM A;  1S0D A;  2QVS B;  4X6R B;  2VCB A;  4QPY A;  1NOV A;  2RV9 A;  4Y1X A;  1VBD 3;  5FPA A;  1YI7 A;  4IE5 A;  3WG4 A;  1UF2 C;  1AXZ A;  3ZXE A;  1NCR A;  2ZZQ A;  2QQJ A;  3PUA A;  1XQN A;  5FBZ A;  4YRD A;  5JUV A;  1AL2 3;  1DYK A;  3USU A;  2HWF 1;  4HL0 A;  2DU0 A;  2X5I C;  3ZFE A;  1VMH A;  4OUL A;  2WAO A;  4D7S A;  1HV1 A;  3BTZ A;  1W2A X;  2HKX A;  2EIE A;  4MVT A;  5A33 A;  3WW4 A;  2MEV 3;  4R4Z A;  4CE8 A;  2WT2 A;  4IE0 A;  4FXK B;  2RR1 2;  1O4T A;  1XNA A;  5IK8 A;  4OLL A;  1ZX5 A;  4EZH A;  4ASL A;  4KGG A;  2ID4 A;  2VD7 A;  4Y4Y A;  3N9M A;  4N7U A;  3KT1 A;  1Q43 A;  3V65 A;  5F5I A;  1GIC A;  2GND A;  4RR3 C;  1YFX A;  2DFB A;  3OG2 A;  2CYF A;  2TNF A;  3I2K A;  3GGL A;  3B69 A;  4AAX A;  2C1F A;  3HJR A;  1JHJ A;  1RJ7 A;  4YYO A;  4CEY B;  3VBR A;  5I0S A;  1FAY A;  1F31 A;  3CF6 E;  3DUI A;  5C8C A;  1Y3T A;  3I59 A;  3IPV A;  3R4U A;  2OQ7 A;  2YMZ A;  4CU6 A;  5C3O A;  2ARE A;  3WHT A;  2R0F A;  3WG3 A;  4MSV A;  3JD7 1;  3JCI A;  5CKQ A;  2Z79 A;  3O1V A;  5JAX A;  4OZO A;  3I2O A;  4TSV A;  1UKG A;  2SLI A;  2WNE A;  5C4W A;  2ES3 A;  3WX5 A;  2A73 B;  2HEW F;  2XVK A;  4I30 A;  4BPZ A;  1AF9 A;  3THT A;  3VZN A;  1STM A;  3A21 A;  4LO5 B;  3WIN E;  1NYW A;  4U2A A;  5CKN A;  2JDZ A;  1OOP B;  2JDK A;  1SDW A;  3K48 A;  1EPW A;  2XXZ A;  3VZL A;  4E4H A;  1PX4 A;  4GAL A;  4EJR A;  5FP4 A;  1SEF A;  1TVG A;  4MGK E;  4NPR A;  5A32 A;  4NIH A;  3M1H A;  1W8W A;  2VCA A;  3MFA A;  3CJX A;  3SMH A;  4C1X A;  5A1F A;  3TWI A;  5F9T A;  3ZYI B;  1VAL A;  2P37 A;  1POV 0;  3OGR A;  1NZC A;  2HBT A;  2O14 A;  2XJV A;  2Z2S B;  3AMM A;  3FMG A;  4J1W A;  5JOZ A;  5FP3 A;  1C28 A;  4P9X A;  1HXS 1;  2BZD A;  2R32 A;  4JTO A;  2YFZ A;  4XAA A;  1OVP A;  5FO8 B;  3T2Q A;  5DUW A;  5CA6 A;  4NO4 A;  3NNL A;  5HXM A;  2V4V A;  5KR7 A;  1CON A;  4XJW A;  2VOW A;  2VCC A; 
#chains in the Genus database with same CATH homology
 2DCK A;  2W1U A;  3FN9 A;  3CQO A;  4OMD A;  4LHS A;  1O8S A;  1F4A A;  2WUH A;  4A42 A;  1JZ4 A;  5LA1 A;  3WF2 A;  2VMF A;  2VZV A;  2Y64 A;  4MO3 M;  4W8J A;  4UOJ A;  4LKS A;  5IHR A;  1K42 A;  4L0P A;  2WZ8 A;  3HNB M;  3SEE A;  5JXH A;  3WNO A;  1SG3 A;  1W8N A;  3MV0 1;  4DEQ A;  2W46 A;  3BGA A;  2XQX A;  1KEX A;  4XUT A;  5I0D A;  1JZ2 A;  2JDA A;  2VL4 A;  3WNP A;  2Y6H A;  4CUA A;  1UYZ A;  2E31 A;  3MBW A;  2YC2 A;  1K12 A;  4DXS A;  1EUU A;  4CUB A;  4JX0 A;  3HOB A;  5LCW L;  1OF4 A;  1XNT A;  3GDB A;  5C7G A;  5CYY A;  2W1S A;  1DLC A;  4QX2 A;  4CVU A;  1I5P A;  3WNN A;  3JXS A;  3FL7 A;  3WF3 A;  1F4H A;  5JR2 A;  2DCJ A;  3OEB A;  3THD A;  2WQ8 A;  4D8M A;  4XUP A;  4QX0 A;  3K77 A;  5A1A A;  1UY3 A;  4QDR A;  3UNP A;  1UYX A;  4ARX A;  4HG6 B;  1ULP A;  3BN6 A;  5CZK A;  1JZ8 A;  3HEI A;  3HN3 A;  4JKM A;  3T09 A;  2DDU A;  2XHN A;  3NQH A;  4BDV B;  1JZ3 A;  2VOT A;  3K75 B;  4CU8 A;  2EID A;  2VZS A;  4OUE A;  4OYU A;  4W50 A;  4JHZ A;  5EJZ B;  3E1F 1;  2WN3 A;  1US2 A;  2WO1 A;  2VTF A;  4A3Z A;  3ACG A;  4XUO A;  3IAQ A;  3ACH A;  5DPN A;  2BBA A;  4QB6 A;  3AC0 A;  1CIY A;  3WEZ A;  4M4P A;  3LQC A;  2EIB A;  4QDQ A;  4DXT A;  2Y6J A;  2WYS A;  3MO4 A;  1UMH A;  4MGQ A;  5DQ0 A;  2W47 A;  1W9W A;  3III A;  1CX1 A;  2QQI A;  3IB3 A;  2VZU A;  4CU9 A;  3LEK A;  1KGY A;  2Y6L A;  2VZQ A;  3LE0 A;  1K3I A;  2XON A;  4BXS V;  4A4A A;  3I2I A;  4DUX A;  4ARY A;  2Y8K A;  1J84 A;  1PMJ X;  2C4X A;  2JE8 A;  1W99 A;  2J1S A;  2J1T A;  2YFU A;  2J22 A;  1IQD C;  3CIH A;  3OGS A;  3C7O A;  3CDZ B;  3I2G A;  1K45 A;  4E8D A;  1YQ2 A;  2C26 A;  2WZE A;  3FHA A;  2ZEX A;  2HLE A;  3ACF A;  3WNL A;  2VZT A;  3DYO A;  1LNS A;  4KWU A;  3F2Z A;  1BHG A;  1HN1 A;  2W87 A;  1UXZ A;  4MOA A;  4UAP A;  3K4Z A;  3C7E A;  3VDC A;  4QB1 A;  3ECQ A;  2VQT A;  4UI9 L;  3SKV A;  3ACI A;  2ZEW A;  4CU7 A;  1GOH A;  3T0B A;  1WCQ A;  3ABZ A;  1DP0 A;  5JXG A;  4XUN A;  3DYP A;  5IYY A;  4PT6 A;  2WDB A;  5C71 A;  1MPX A;  2VQU A;  3J7H A;  1O59 A;  1W9T A;  4QDS A;  2KD7 A;  5IFP A;  4FI9 A;  1JI6 A;  2R7E B;  5HPO A;  2BGP A;  3CKH A;  1GNY A;  2W95 A;  4BK5 A;  3I97 A;  2WBK A;  2VR4 A;  4DUV A;  1GQP A;  4TTG A;  2EIC A;  4A41 A;  3UET A;  3NNG A;  2J1V A;  2BGO A;  5JXJ A;  3I3B A;  5LA2 A;  2V72 A;  1JYW A;  5FUI A;  3PUH A;  3OBA A;  4A44 A;  3U37 A;  2B4K A;  1UMI A;  3IDA A;  3WF1 A;  4ZY9 A;  2XOM A;  2YB7 A;  2QQO A;  1JYX A;  2VMD A;  1GUI A;  3DYM A;  4M4R A;  4OMC A;  3C7F A;  4P08 A;  5JXI A;  3WF4 A;  1SDD B;  2ORX A;  3OEA A;  3LPG A;  4QPW A;  3C7H A;  3VD9 A;  4P02 B;  3P1I A;  1W0N A;  1NUK A;  1UY2 A;  2JD9 A;  4A45 A;  3WQB A;  3FHQ A;  2VZO A;  1SHW B;  3GM8 A;  1UY1 A;  2E26 A;  1GMM A;  3MV1 1;  3UES A;  4BK4 A;  2WO3 A;  2PQS A;  1US3 A;  4W4Z A;  1CZT A;  3W5M A;  3P6B A;  1NAE A;  4Z2A A;  2VMC A;  4GWI A;  4CUC A;  3A22 A;  1JZ5 A;  1TG7 A;  3LPF A;  4ZXE A;  1H6Y A;  1R64 A;  2W94 A;  4P5Y A;  4AG4 A;  2ZXQ A;  3I2J A;  2V5D A;  2CDP A;  2J7M A;  1GOF A;  3MUZ 1;  3C7G A;  4DEV A;  3I3D A;  2QQN A;  3K4A A;  5LA0 A;  4GWJ A;  3EYP A;  4KI5 M;  1UY4 A;  2VZR A;  5IFT A;  1NKG A;  4ZZ5 A;  3D3A A;  3W5N A;  3NJV A;  3VDA A;  2X09 A;  3A7Q A;  1GU3 A;  4P00 B;  2W3J A;  1L7R A;  1JZ6 A;  2W9X A;  5DN2 A;  1XC6 A;  2VC9 A;  3T0A A;  2E33 A;  4JKK A;  3T08 A;  5JMO A;  2W1W A;  5B4N A;  3K4D A;  2LS6 A;  1XPW A;  5F7U A;  5C70 A;  1JYN A;  3WNM A;  2ZEZ A;  1NX9 A;  1UY0 A;  1W8O A;  2VM9 A;  1JU3 A;  3VD4 A;  4PF1 A;  4XUR A;  4D0Q A;  2YG0 A;  3CZU A;  1UYY A;  3NRU A;  2QQK A;  2HYX A;  5J1X A;  1OD3 A;  5B4X A;  2ZEY A;  4QX1 A;  1UXX X;  3DEC A;  3MUY 1;  2J1E A;  4DUW A;  1O8P A;  1W9S A;  1L7Q A;  1CZV A;  4PQQ A;  3K46 A;  3WF0 A;  1UZ0 A;  3THC A;  1WKY A;  2B9V A;  2L9L A;  2E32 A;  3SKJ E;  1EUT A;  1UWW A;  2J1A A;  2X10 A;  4XZU G;  2X05 A;  3WNK A;  3A23 A;  2YC4 A;  2CDO A;  1GOG A;  2OKX A;  3HNM A;  3HPN A;  4RN5 A;  1PX3 A;  1P8J A;  2J1R A;  1OH4 A;  5EJ1 B;  1OT5 A;  2Y6G A;  4DXR A;  1OF3 A;  4IUG A;  2WAA A;  1H6X A;  3VD5 A;  4LPL A;  2W91 A;  2WAB A;  2BER A;  2QQM A;  2VCB A;  2RV9 A;  3HNY M;  2VME A;  3SEP A;  5G04 L;  4YPJ A;  2QQJ A;  4MAD A;  3ZM8 A;  5JUV A;  2RJ2 A;  1CZS A;  2VJX A;  4KMQ A;  2WAO A;  3LEI A;  5IJR A;  4QX3 A;  2EIE A;  3ETP A;  1RYY A;  2VZ1 A;  3I2H A;  3VDB A;  1XNA A;  4TXW A;  4LQR A;  2ID4 A;  3I3E A;  2Y6K A;  4GZ9 A;  2RVA A;  4MGS A;  3EB7 A;  3OG2 A;  2C9K A;  1J83 A;  1JYV A;  3GXU A;  3GGL A;  3I2K A;  4AAX A;  3HJR A;  1JHJ A;  5G05 L;  3LEG A;  3CMG A;  3NJX A;  4CU6 A;  1JU4 A;  2J1U A;  2W92 A;  2WN2 A;  2JKX A;  4OZO A;  4RYD A;  4QAW A;  3T2O A;  2VO5 A;  2VZ3 A;  4XUQ A;  4ET7 A;  4QB2 A;  4A6O A;  3IAP A;  4E8C A;  3T0D A;  5DMY A;  1UX7 A;  1D7P M;  3A21 A;  1JZ7 A;  3VD7 A;  2VZP A;  2W5F A;  3PUI A;  3C8X A;  2WO2 A;  1ULO A;  1PX4 A;  1PMH X;  1TVG A;  2ORZ A;  2Z4F A;  3VD3 A;  2QBX A;  4BJ0 A;  3T2P A;  2VCA A;  2W1Q A;  1DYO A;  3WSO A;  3OGV A;  3OGR A;  2LW8 A;  2QQL A;  4XVH A;  3CZJ A;  2BZD A;  4JKL A;  2YFZ A;  3T2Q A;  3I2F A;  4ZZ8 A;  3OB8 A;  1T2X A;  5HXM A;  2V4V A;  5EIY B;  2VCC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...