1UYYA

Carbohydrate binding module (cbm6cm-2) from cellvibrio mixtus lichenase 5a in complex with cellotriose
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
131
structure length
131
Chain Sequence
MVIATIQAEDHSQQSGTQQETTTDTGGGKNVGYIDAGDWLSYAGTPVNIPSSGSYLIEYRVASQNGGGSLTFEEAGGAPVHGTIAIPATGGWQTWTTIQHTVNLSAGSHQFGIKANAGGWNLNWIRINKTH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Carbohydrate binding module
molecule keywords CELLULASE B
publication title The Crystal Structure of the Family 6 Carbohydrate Binding Module from Cellvibrio Mixtus Endoglucanase 5A in Complex with Oligosaccharides Reveals Two Distinct Binding Sites with Different Ligand Specificities
pubmed doi rcsb
source organism Cellvibrio mixtus
total genus 28
structure length 131
sequence length 131
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03422 CBM_6 Carbohydrate binding module (family 6)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 1uyyA00
3E1F1 3LEGA 4PT6A 2VMEA 2VQUA 2VJXA 3VD7A 2Y64A 4LKSA 4LQRA 2W1QA 3VDAA 1GUIA 5JXHA 1DYOA 1CZVA 2XOMA 1O59A 2VOTA 3VD4A 1KEXA 3UETA 2J1EA 3MO4A 2JDAA 5DMYA 3ETPA 2J7MA 3MV11 2L9LA 3UNPA 3CMGA 3GDBA 4MGSA 1JZ2A 1UY1A 2EICA 2LS6A 5IHRA 1MPXA 3CIHA 3I2FA 4CU9A 5JMOA 4PQQA 2ZEZA 1US3A 4XUPA 4DXSA 4KWUA 1D7PM 5B4NA 2QQIA 3NRUA 1J83A 2VCCA 3WSOA 4L0PA 3VD3A 4CUAA 1JYWA 1CX1A 1WKYA 2WO1A 4QB6A 4XUQA 3HEIA 3MUZ1 4CUBA 3THDA 3WF4A 1EUTA 1W8OA 3I2GA 4CU8A 1CIYA 1W9TA 3LE0A 1OH4A 3LEKA 3WF0A 4M4PA 3WNNA 2Y6GA 4M4RA 2W9XA 2VZOA 1JZ8A 2VZUA 2YB7A 4D8MA 2VZVA 4FI9A 3VD5A 2E33A 5F7UA 5B4XA 1XNAA 2QQOA 1ULPA 5JXJA 1UWWA 2VC9A 2VZSA 2VCBA 2WYSA 2X09A 2CDPA 3CQOA 3WNKA 3A23A 3A21A 1UY0A 1HN1A 3C7OA 2VQTA 3K77A 2B9VA 3J7HA 4MOAA 3WF3A 2BZDA 3I3DA 2RVAA 3FHQA 1UYXA 3GGLA 4KI5M 5EJZB 1PX4A 3SEEA 4UI9L 2PQSA 1OT5A 3LPFA 2E32A 1OD3A 3I2JA 3NQHA 5IFPA 1L7RA 2QQJA 3OGRA 2XQXA 4DUWA 1OF4A 3JXSA 4P02B 3SKVA 1GOGA 5JXGA 2VZRA 2WDBA 4MO3M 3MUY1 2WN3A 1DP0A 1BHGA 1GOFA 1W9WA 2VMCA 5CZKA 1JI6A 2LW8A 3DYPA 2C4XA 1JYNA 4A45A 4JKMA 2W1SA 2E26A 3C7GA 3C7EA 3GM8A 2W47A 3ECQA 5G05L 1JYXA 2J22A 1SG3A 5FUIA 1UYZA 3VDBA 4DUVA 3C7HA 4CVUA 2CDOA 2KD7A 3OGVA 3ZM8A 2WAAA 4DXTA 2WABA 3DECA 4BK5A 2J1TA 4JKKA 1GNYA 2VR4A 1I5PA 2V5DA 2Y8KA 4P08A 3WQBA 4MGQA 3BN6A 1NAEA 3I2IA 3NJXA 2ZEYA 4QDSA 2ZEXA 3BGAA 5LA2A 5DN2A 4UAPA 3IAQA 2QQLA 2J1AA 1JU4A 2W1UA 5LCWL 2YC4A 4BXSV 1L7QA 2JKXA 3K75B 2QQMA 3T08A 1UXXX 1W0NA 2HLEA 4W50A 1XPWA 4A4AA 2EIEA 4IUGA 3UESA 3LPGA 3HPNA 5IFTA 1H6XA 5C7GA 1O8SA 3OGSA 1EUUA 4P5YA 5DPNA 2J1VA 4A6OA 2YFUA 3OG2A 4QDRA 4OYUA 2JD9A 3CZUA 1K45A 3IB3A 4E8CA 4QX1A 2BBAA 3F2ZA 4PF1A 4XZUG 3WF1A 5DQ0A 3P6BA 4AAXA 1UY2A 3GXUA 3HNMA 4MADA 2V72A 2C26A 1JHJA 1GOHA 1F4HA 4GWJA 4KMQA 2BGPA 2VMFA 2RV9A 1DLCA 4CU7A 2RJ2A 3CDZB 2ID4A 3I2KA 1PMJX 2J1UA 4DXRA 2VZPA 3ACFA 1JZ6A 1IQDC 4ARXA 4HG6B 3THCA 4ZZ5A 4XUTA 2V4VA 3OEAA 2C9KA 3I2HA 2JE8A 4OUEA 3ACHA 4QDQA 2W94A 4P00B 2Y6JA 5J1XA 2QQKA 2YG0A 1XNTA 3SKJE 3W5NA 1JZ7A 1F4AA 1UMHA 2WBKA 1TVGA 3FN9A 4BJ0A 5CYYA 5IYYA 2VM9A 3T0BA 2W92A 3HNYM 1JYVA 3OB8A 1XC6A 1UX7A 2W87A 3MV01 4BK4A 1UYYA 4QX0A 2X05A 4QB2A 5EJ1B 2ORXA 3OBAA 5LA0A 2DDUA 2YFZA 4QAWA 1TG7A 1W99A 3LEIA 4ARYA 1UY3A 1GMMA 1SDDB 3T2OA 3T0DA 2XONA 5JR2A 4TTGA 4BDVB 2R7EB 4A44A 4UOJA 4DEVA 2BERA 5G04L 2VL4A 4OZOA 4DUXA 5I0DA 3HOBA 4JHZA 4ZY9A 2VCAA 3WEZA 1J84A 2YC2A 2HYXA 4OMCA 4QX3A 4RYDA 3VDCA 1UXZA 4QX2A 4AG4A 3HJRA 1K42A 3DYMA 2Y6HA 4XUNA 3WNMA 4LPLA 3K4DA 1UZ0A 4XVHA 1NKGA 4W4ZA 2W5FA 5JXIA 3SEPA 3VD9A 2Y6LA 1OF3A 2ORZA 3IDAA 2EIBA 3IIIA 1SHWB 4TXWA 5JUVA 3HN3A 3NNGA 2VZQA 3WF2A 3OEBA 3EB7A 4GWIA 1UY4A 4E8DA 1GU3A 2DCKA 3ACIA 1CZTA 3K46A 3T0AA 2VO5A 3FHAA 1CZSA 5IJRA 1LNSA 1YQ2A 2QBXA 2W95A 4JX0A 1JZ5A 4A3ZA 1KGYA 2W46A 2VZ1A 4DEQA 2VZ3A 3WNOA 1UMIA 3C7FA 1R64A 2Z4FA 1K3IA 3K4ZA 2VTFA 3P1IA 2OKXA 3U37A 3WNPA 2QQNA 3MBWA 3ABZA 1H6YA 2EIDA 4A41A 4YPJA 1P8JA 3PUHA 2E31A 2ZEWA 1NX9A 3HNBM 3A22A 4Z2AA 4QB1A 1PMHX 1W9SA 1JZ4A 1US2A 3CKHA 1JU3A 5C71A 3I3EA 3T09A 2XHNA 4A42A 1JZ3A 2WO3A 1T2XA 1ULOA 3A7QA 2Y6KA 5LA1A 3EYPA 2W3JA 5C70A 1PX3A 2WAOA 3W5MA 3T2QA 2VMDA 5HPOA 3PUIA 3ACGA 2B4KA 4XUOA 3WNLA 5HXMA 2WN2A 2WUHA 3K4AA 4JKLA 2J1RA 3DYOA 4ZXEA 4OMDA 5A1AA 4RN5A 3C8XA 2BGOA 4D0QA 3T2PA 1O8PA 1WCQA 3I3BA 2DCJA 2VZTA 2X10A 1K12A 2W1WA 2WQ8A 3I97A 2WZEA 4CU6A 3CZJA 5EIYB 3NJVA 2WO2A 3LQCA 3D3AA 2J1SA 3FL7A 4CUCA 2W91A 4W8JA 1W8NA 1RYYA 4LHSA 4ZZ8A 4GZ9A 1GQPA 4XURA 1NUKA 4ET7A 3IAPA 2WZ8A 3AC0A 4QPWA 2ZXQA
chains in the Genus database with same CATH superfamily
2XVKA 3AP6A 3N9OA 3IBMA 3MIBA 3AXEA 3K2OA 4PT6A 4WVMA 2I45A 4E4HA 2CHHA 5A6ZA 2GN3A 5BYNA 3RMXA 3PTYA 1D4M1 1AVBA 1GP6A 2XHKA 1ZVFA 3I59A 3N9MA 3TBDA 3VD7A 3WUDA 5KHHA 4HBNA 3RI9A 2OUHA 3WG4A 4AK3A 5LB6A 2TBVA 5T50A 2W68A 3S5AA 3WQ7A 5A3UA 3VD4A 4IW3A 1AR62 1C8M3 1VRH1 4HETA 5F3EA 1U12A 2J1EA 3DEMA 4CA9A 5FY0A 1X50A 4XPVA 2JDAA 4R52A 4LK6A 5DMYA 3ST7A 1H1IA 2GNBA 5FKBA 4AHZA 3VKFC 2JDHA 4H7MA 2BJSA 1UU5A 4LK7A 1HDKA 2E7AA 1LHWA 2UWBA 3CMGA 1B35A 2OUJA 4IEYA 1DQ4A 5LBCA 2ZBJA 4BQ1A 2VVDA 2ZHNA 3ZFGC 3WLUA 1S4CA 3CIHA 4EWEA 3ES1A 1ZREA 1H4HA 4NHKA 2HWC1 3RYRA 1LU2A 1MS8A 3AL6A 2ZPXA 1AR71 1QOOA 4N9HA 4PQQA 3UKNA 4ASLA 2LRPA 1ZRCA 3B94A 4YVSA 1V9U3 5FZ4A 2VCCA 1V0AA 1WD4A 4X8NA 3WW1A 1D2SA 4L0PA 4CUAA 5EQUA 1RUH1 1VBC1 2RS31 2WO1A 4QB6A 2VXJA 4TSVA 2XJPA 2E51A 2GALA 4CUBA 4MGKE 1JXNA 1VRBA 2ZZQA 5JZGC 4K21A 3ZPOA 1GSLA 3THDA 5H9RA 1VLNA 4LJHA 1FMD1 1RUG1 2ZS6B 3QD6A 1Z7S3 5FTTC 4M4PA 5ABJC 2BFUS 5T55A 5F9TA 4AXOA 1PM7A 2Q5TA 2Y6GA 3ILNA 1PVC1 3M3EA 3VBRB 3RVHA 4IL7A 5JDBA 1KJRA 1B09A 4CCJA 4EWAA 2FD8A 3WCSA 4S2FA 3N7LA 4SBVA 1RJ8A 4N43C 2E33A 3R4DB 5F7UA 3ELNA 4IERA 4MGYE 2DYCA 3CF6E 2ZGRA 4TWTA 4WVZA 3TYJA 4H14A 1SFYA 1HKDA 4JGZA 4XCBA 1LOFC 2RR12 4KBZA 5T5LA 2PHLA 4XMAA 2WNVB 2VZSA 1FPN1 1BMV1 2JB4A 3J8F3 4L9BA 4UFKA 2X09A 2YU1A 1E5SA 1ND2A 3CQOA 5FZKA 5FZ7A 3WNKA 5AC92 1CQ9A 4ONUA 1BBT1 3SITA 3DL3A 2Z2SB 4IGPA 5FZHA 2MNGA 4RR3B 5AFEA 3PVEA 4IEZA 5K9YA 3C7OA 3K77A 2B9VA 2XLAA 1RUJ2 4V2WA 1VBD3 4MOAA 3GJAA 3RMYA 2EXHA 5FP4A 2RHPA 4M3CF 3DUIA 3H8XA 1IZ3A 3I3DA 1UYXA 1RJ7A 3GGLA 4KI5M 4K1YA 1RIRA 3GBFA 4M0HA 1PX4A 4RQPC 5LASA 4CPBD 5CFDB 2AC1A 4D6SA 3SEEA 2VULA 4TLGA 4MGIE 2VBBA 3SC7X 4XETA 4AYUA 3GALA 3HBZA 2IWGB 2CNAA 5DDJ1 4NPMA 4LO4B 3GHMA 3S57A 2ET1A 3VBSA 4EWDA 3M3CA 3RZJA 2CGPA 4X6QB 5AVAA 4P02B 1BYHA 1UNBA 2VZRA 3OBRA 2EALA 2RS51 3EJKA 2QZ3A 1NCRA 3MUY1 2OPKA 3FWEA 4M3CB 1UO9A 3HT1A 3POSA 4AWDA 3ZDSA 1O4ZA 2RMU1 1HJGA 1T6BX 4DB5A 1RUE1 1VBB3 3RZZA 3GHNA 3BOWA 1OUSA 1QNYA 4IEVA 5FXXA 2KR2A 3WQ1A 3ZMOA 3JD71 4DRRA 2E26A 5FYZA 1G8WA 1S0GA 3GM8A 4AOCA 4BPZA 4AQSA 2X5IA 4WVVA 5C5UA 2WLQA 1EV13 5AVPA 3KGLA 5FYHA 4NVPA 1Y7BA 2VOKA 1ENQA 4XFAA 5F6KA 1WW4A 5JIAA 4DUVA 3C7HA 2LM3A 3Q8BA 4CCNA 2CDOA 4HL0A 3MF6A 1O6UA 3MW4A 1NLSA 2CYFA 2DF7A 3SH3A 1ZZ7A 3VBFA 5IATA 5JOYA 2WAAA 1WUVA 3ZIWA 1S0EA 4DXTA 2WLPA 4JKKA 3VBHA 1ND3A 2WNOA 2VR4A 4I0AA 1I5PA 4LITA 2VY0A 3SHRA 5FQ0B 4MGQA 1V6MA 1Z7S2 1MVEA 1ZZ6A 1NAEA 3I2IA 4XIOA 1JUHA 3NJXA 4K6BA 2RJKA 2ZEYA 4QDSA 2VNGA 4QX8A 3I59B 3BGAA 4OI0A 5DUUA 4NIHA 1RHI1 4A7YA 2ZX0A 5BNOA 3WG1A 1RVF1 3CLPA 3HMYA 3G7DA 2ZHMA 3HD8B 3IN9A 3IAQA 3NV2A 4AFDA 2JDYA 3AZYA 2FCUA 2R1DA 2XWBB 1L7QA 3TEWA 2NYYA 2AUYA 1JN2P 3K75B 3LSDA 3O1RA 2WZPP 4E2GA 3JQWA 3J8F2 5EFUA 1JH5A 1MACA 4QWNA 2PHUA 2WQZC 4Y4YA 3T08A 4IQPA 1QF3A 4W50A 3ZSEA 4A4AA 4OZXA 1LOBA 2EIEA 2G9GA 4Q0UA 4OFGA 1WMFA 4URTA 4CXYA 3HPNA 1B35B 1O8SA 1W3VA 1W9FA 3TN91 2BOIA 4Q29A 1ZZBA 3WY6A 5FJHA 1EUUA 4I09A 5LA0A 4A6OA 2J1VA 3PU8A 3VBOA 5C4WC 3FUQA 3M70A 3OG2A 4S2GA 1AR61 1FOD3 1OSGA 4XEZA 3ZYGA 4Q4X3 3RFRA 4ITCA 3AM2A 2ZKLA 5JAXA 2ARBA 1BXHA 4YVSB 1WA4A 3F2ZA 3E6CC 1D4VB 2IUWA 5A7NA 1MZEA 4MGZE 3B02A 3RZHA 2IXLA 4EYUA 4AAXA 1UW8A 1D0GA 1KD7A 1GOHA 2ADDA 3GZUC 5A32A 5K7PA 3BODA 4ZU7A 1DIWA 3QACA 1OD5A 3MLKA 3PIJA 4KMQA 2YUEA 4QQ2A 4QGLA 4DS0A 4MYEA 4D7YA 1HRI1 2UU8A 3POWA 4LBQA 2DCZA 2RJ2A 4B4RA 1VBB2 1JOJA 3CDZB 1JOPA 3T1LA 1QIQA 4W65A 4FOQA 1QJU3 2BRTA 4FAGA 3ACFA 4MSVA 2IXCA 3N4MA 4YGBA 5DXDA 4AEDC 4CCMA 1GV9A 2GC0A 2VOWA 3PIGA 2BEOA 2JDNA 3ITQA 1W2TA 4YM1A 5ANNA 1POQA 4S2DA 2XLFA 4XJZA 4YZ2A 2ZX2A 3N9QA 1G9CA 4B7KA 5FZMA 4CDQA 1ZM1A 1W05A 2ARXA 5BNPC 1REEA 4UT5A 4XHBA 5A3WA 2JE8A 1BKZA 2I2SA 1WLCA 2IVJA 3KCXA 4LOTA 5E8AA 4YVWC 4A6SA 1ND2B 3TAYA 1OQ1A 5FZ0A 5FPXA 2XJUA 2OQ7A 3TEXA 3TEZA 3W5NA 3WV6A 1SCSA 3RJ2X 2XB6C 5FZAA 1UOFA 3FZ3A 3KHCA 2VM9A 1F15A 1LGCA 4H55A 4JRLA 3WDYA 3R0RA 2NQYA 2RR11 4C0HA 3AMHA 3LB9A 2RG4A 3ZYRA 3ZYFA 4AGRA 3AP7A 1RXFA 4CEWA 2SLIA 5GALA 4QX0A 3O0VA 4O9EA 4ISRA 4QB2A 5FMCA 4YM2A 5EJ1B 5I0TA 3ZFEA 1UZZA 1GYKA 2JJ6A 1VAVA 2YGMA 4L11A 4IEXA 2R042 4M3CE 3VBSB 5FBZA 5IW0A 1NCQC 1RUJ1 3AB0A 4ZU5A 5JR2A 2A6YA 1NCRB 4K20A 5D8AB 4K40A 2DTWA 1C57A 1O4YA 1W8ZA 2FMYA 1CN1A 4LORA 4BDVB 3J9SA 4M00A 1OVPA 3Q8CA 2D6LX 4QPGA 3ZXJA 4DEVA 4QXHA 4Y33A 1YIFA 4OZOA 5G04L 5JMCA 3GBGA 4ZY9A 4EZ4A 3CJIA 1FOD2 1PZ8A 3BKZA 2DVGA 2NMNA 4Q4X2 4OMCA 4ISQA 1IG0A 2X5IB 3BCWA 4QX3A 3BU0A 1JHNA 4FFFA 1UXZA 4QX2A 4AI9A 5FAXA 2A5ZA 3DYMA 2Y6HA 4UFLA 3AKQA 4BE3A 5F37A 5LATA 1WMXA 3VBFB 2W5FA 3FLTA 1HB3A 3FE5A 4FPLA 3VD9A 3J7MA 2Y6LA 2BYVE 1YFWA 1ND3B 2ORZA 4R9DA 2CL2A 5GM0A 2VH9A 2EIBA 3R6SA 1SHWB 4Q1PA 1MEC2 4TXWA 1RB8G 3OJBA 5JUVA 3ZIXA 4HONA 1EYBA 1H0BA 3KSCA 4YW7A 4YW6A 5GLWA 2WT0A 1A8MA 2VZQA 4LHKA 3OEBA 4K9SA 1ENXA 1QJU2 3O12A 4GWIA 4MHRA 4Q0VA 4QXCA 1OKQA 5KBFA 1ULCA 4HVOA 4XJUA 1UKRA 1GZWB 1YWKA 1VB2A 2D5HA 2VUCA 2TUNA 4LO5B 5LZ6A 2QCSB 1A34A 5FMOL 4AGGA 1LNSA 5I8YA 1ZX5A 1YQ2A 2NMOA 2R063 4NHLA 3WDUA 1Z7S1 1YFXA 3AFGA 2GAUA 5AFBA 2VZ3A 3SCFA 1XE0A 2XJVA 1R64A 1POV3 3K4ZA 2OKXA 3U37A 4URAA 3H3ZA 4FT8A 1G9BA 1VJ2A 2QQNA 2P3YA 5A3LA 2VNRA 3DN7A 4A41A 5DZFA 3U07A 3PUHA 2A3YA 5I8TA 1JUIA 1V6OA 1LODA 1HB2A 3ORJA 4RGKA 1PNGA 3KWVA 5JI9A 4QQLA 2X8KA 3J8F1 1IG3A 1AF9A 3BTXA 1FXZA 4B3NA 1HX6A 1NZIA 2GMPA 1W9SA 1ZRDA 5H9SA 1ODMA 4ASKA 1C5HA 3RYPA 4XFIA 4CCCA 2WZR3 4U36A 1UIKA 1X8MA 4B1LA 4LBQD 4XQWA 4LT5A 3FC0A 1AR83 4OHVA 5C71A 1FATA 5A32B 3I3QA 3LEMA 4XXAA 1LTEA 4FFHA 5FYYA 1DLLA 5A7WA 5T3NA 4B4QA 1MVQA 2F4PA 3CHXA 4LLFA 5E1RA 3IPVA 5JOXA 2JKBA 3ILFA 2DUOA 1J59A 1IS3A 1NA1A 1POV0 2JG9A 4BB3A 5LA1A 3ES4A 3ZKUA 4LBQB 3GZEA 1PX3A 1GNZA 1AX0A 4COYA 4RFRB 4CDXC 1U5YA 1EY2A 5K8SA 1PO23 2HWD3 4XHXA 1QJZA 1J1TA 4QKBA 4XF3A 2ZGMA 2K0GA 1F35A 4IV3C 2A73B 4CDWC 2XR4A 2J1RA 3W59A 3DYOA 1YC61 3NNFA 4QPIC 4CDQB 4ZXEA 4Q4W2 1COV3 3C8XA 3ATGA 2P17A 1OI6A 4D0QA 2VUJA 4K7JA 1DG6A 1PK6A 1O8PA 1VBB1 1WCQA 2Q1ZB 3VZOA 1XNKA 4I3GA 1AXYA 3WINE 3P5BA 1LEDA 1CESA 1OA3A 3C2UA 1YJLA 2RDRA 3UKTA 1OQDA 2EVXA 2P3JA 4YSFA 4NRQA 2IFRA 3PU3A 5FIXA 2ARAA 1RL3A 2XPJA 2TEPA 1HJFA 3NJVA 4WM7A 1BK1A 4Y1VA 3H42B 5KHJA 3SCGA 2J1SA 2P4EA 2ZKNA 3FL7A 2YHJA 5E6HA 1FNZA 1XE8A 4W8JA 3ZSKA 1RYYA 4ZZ8A 4GZ9A 1ZA4A 3OBTA 3USSA 3WOGA 1D0HA 3ZN5A 1U5ZA 5J36A 5IAXA 1O5UA 1NUKA 3LKJA 3OSDA 4DXZA 5LWBA 4BMEA 1PGW2 1IOAA 2CAUA 2XBO3 2OT7A 4NIAA 4FOWA 3CNAA 3TOJA 1NG0A 2WNUA 2VQUA 1F31A 1MQTA 2ZABA 4COWA 5CNAA 3U78A 2RS32 5L7OA 4EN6B 4GMP1 3VDAA 1GUIA 2GP5A 2XKOA 1RUD3 4QPGB 1DYOA 5FBJA 1CZVA 5EZWA 4FBFA 4OUSA 2XOMA 2ADEA 1VMFA 2IC1A 4BQ5A 3O1MA 1DGLA 3CJIB 1ZA7A 5BY5A 4XFGA 5FDBA 2VOTA 1KEXA 1GZ9A 5CKNA 5EWSA 5FZ6A 2JX9A 2G4IA 2R49A 3E6DA 4HN1A 2R041 2WWSA 2Y33A 1XNBA 4CCLA 1JOBA 1HB1A 5A70A 4ZS2A 3NNJA 2Z5WA 4PIZA 2WL1A 5DUWA 2VVFA 2C24A 2PXJA 1AR82 2B42B 1FX5A 2WJSA 3WP5A 1GZTA 2BUKA 4C1WA 2RDSA 3GDBA 1QXPA 4MGSA 5FXZA 2QQVA 1JZ2A 5A3TA 2EICA 3GZTB 3KZ4C 1EP0A 1W8WA 3IDCB 3EO6A 3ZO0B 5FY9A 4CCDA 1FOD1 2X53S 2P6HA 3APBA 4F3JA 3VBUC 1XYOA 4Q4X1 4QMAA 3SCHA 4CU9A 5FREA 4ZKTB 1BMV2 3CJXA 5FYCA 2YBPA 2R16A 4AW7A 1DGRA 1D7PM 3VBRA 3NRUA 2HWD2 4GAZA 5CFCC 1D2QA 3WSOA 3NVCA 3VD3A 1GZCA 5IK5A 4JGYA 5D2AA 2E6VA 2DVFA 4YG6A 4UXAA 4XUQA 1GFF2 3HBKA 3MUZ1 2GNMA 5C8CA 5JVVA 1TMF3 5GZDA 3WF4A 2Y0OA 1W8OA 1COV2 1XYPA 1MEC1 2VTXJ 3D82A 5FZDA 1CIYA 2VQ0A 2ZMKA 4CU8A 5KHIA 3OUJA 3WF0A 5DAQA 4BCUA 1TNRA 2YY1A 1IKPA 4P9IA 1ST8A 1ULEA 4MXWA 2Q8OA 5KXDA 4M4RA 1QJU1 1Y9GA 4IEQA 3WCRA 1NLRA 4OI2A 4FTEA 5C9AA 4XAAA 3VDDA 1GLHA 3I7DA 3B9IA 1R093 5FJKA 3IT8A 3VD5A 3AMQA 5BPXA 3MFAA 5HBAA 1K5MC 1ULPA 5JXJA 2ZJCA 2QNKA 1BZWA 1DYKA 3PNAA 1S0CA 4IESA 5CKMA 2CDPA 4KWKA 2SBAA 1IPJA 1RUF3 2XBO2 3D0JA 3A21A 1UY0A 3M4FA 1W6OA 4M01A 3DPRC 3MI8A 3O5SA 5GZFA 4D94A 1QWRA 2FCTA 1O3SA 4RGAA 4Y3OA 3M3OA 3G6JB 4Y4RA 4CEYC 3IPVB 1WW7A 1SLCA 5FO9B 4M3CA 1NA1B 2JG9B 5BNPB 1RUD2 4ATFA 2RVAA 1Z0HA 1G9FA 4MG2A 3DV8A 1Z78A 4AVVA 1LOCA 1RUC3 2AENA 4JGZC 2JG8C 1UF2C 2XLGA 3OGGA 2NPIA 1ZNPA 5DZGA 3GYDA 3MF9A 5FYUA 5GZGA 1W04A 3LPFA 3NKTA 4CDUC 1ZZ9A 2VG9A 4HMZA 4GH4C 1L7RA 2QQJA 4UYBA 2ZAHA 1RITA 3ZFFC 4DUWA 3JXSA 1RGSA 5B2GB 5JSOA 5JXGA 1SLAA 4ZU4A 5H9PA 1XB9A 1H9PA 2FDHA 4K3UA 4ES8A 2DUPA 3LDRA 2P37A 1Y9MA 5FZ8A 1O3RA 5HV4A 4QX5A 2GH8A 1HN0A 2BW8A 4FP2A 2VMCA 2RS13 4XFFA 5F1RA 4DRVA 3KCYA 1QOTA 3T30A 4AI2A 1JYNA 1OOPC 1PK6B 5FY7A 4DPNA 4A45A 5FO7B 4OQ9A 4AEKA 2DBNA 3JUUA 2O14A 4UFJA 2QJVA 5FQ0A 2W1SA 1L3JA 5A6QA 2P3KA 2G9ZA 1JYXA 1SG3A 1XBFA 1N47A 1JBCA 4NOTA 2FDJA 3AYCA 2IXIA 4QXBA 3OD0A 5E88A 4CVUA 3PURA 2KD7A 4JHTA 3A4UA 3OGVA 4QGNA 4WM7B 3ZM8A 3ZVXA 2ZHLA 2GDFA 4LULA 4Q4W1 2WABA 4BA6A 5J09A 3TN92 1HQNA 2ZZJA 4NMIA 5L19A 1TMF2 4WV8A 4AVSA 1GNYA 1UD1A 3WG3A 4FQ4A 3MICA 4HVRA 4B1MA 3VZNA 2Y8KA 5BV6A 3KCCA 4HVQA 1W0PA 5LK7B 2XL7A 2OX0A 2XJRA 1I5ZA 2YU2A 4HT1T 4AFCA 1LOAA 1V6LA 2WNUB 4QT6A 1MQTB 2NN8A 4RHV3 5LA2A 5L7OB 1GWKA 1BLZA 4UAPA 1LGBA 1UL9A 2D97A 1IKQA 2AYHA 2QE3A 1XSQA 2O8OA 3VB9A 4OLLA 1A3KA 1ALYA 4QKNA 1CAXB 1ENSA 4Q0QA 1HRI2 1OPMA 5LY2A 1PGW1 1VE0A 3S0MA 4L97A 4LO7A 1W0NA 2HLEA 4R8HA 4AZZA 1RUF2 2XGXA 1POV1 1SFNA 3CEWA 3M3IA 4IUGA 5IUQA 3EQEA 3QLQA 4JV4A 2K2SA 1UX6A 2BNMA 4JTNA 5IFTA 3J7LA 5GKAC 3IMNA 1FT9A 1H6XA 1W39A 4P9WA 1FV2A 1YNAA 4HK9A 3FJSA 1GQGA 2H6CA 2MEV3 5DPNA 1QEXA 3LIGA 5LBFA 4LHLA 3T4HB 3ZKYA 5I0SA 4XC9A 4I0WB 3JBG3 4YW2A 3HT2A 1RUC2 1UAIA 3POEA 5LRRA 5CB7A 1Q5OA 3MDPA 1KXGA 3CZUA 1ASJ3 3IB3A 2HWF3 1QQP3 2XJQA 3KT7A 4UF0B 4E8CA 2R30A 3IM0A 3LZZA 5C3OA 2C6SA 4CYDA 2BBAA 2WZR1 1VP6A 1LJ7A 3POIA 3OUHA 4LE4A 2WT2A 4PF1A 4XZUG 5DQ0A 3VZMA 3WF1A 1AR81 1XNCA 4JGYB 1UY2A 4GALA 3GXUA 1W8HA 1VALA 2A3XA 2C26A 2JDKA 2PTMA 3HNMA 1K5JA 2DV9A 3ZYHA 5IVEA 1IQAA 3AJYA 4XDQA 5C8CB 3KGZA 3BTYA 1JYTA 4GWJA 4TZDA 1WLTA 2RV9A 1APNA 1RUI3 2RS12 3INAA 4CP2A 3M8LA 4CP0A 4YW3A 3ZXLA 4B8EA 4MXWB 3I2KA 1UU4A 2QUOA 3I49A 4Z07A 3J26N 2J1UA 4DXRA 5FR3A 2HWD1 2JICA 4ARXA 1AL23 2YC0A 1Q56A 4HG6B 2P1BA 1STMA 3THCA 3VDDB 5C9AB 3UV9A 1FV3A 4GKYA 1BVP1 3LOIA 1GR3A 4OULA 1GBGA 3AFKA 4N9IA 1CVNA 2V4VA 1MR5A 1COV1 4UFIA 3UGHA 1FAYA 4IE6A 4AQTA 3I2HA 2WSUA 4NJ4A 2PA7A 4PDWA 1SACA 1WZXA 4BHPA 3O1OA 4HPKA 3LDKA 4BQ3A 1GKBA 3NAPC 4NR1A 2H0BA 5CIRA 1DCSA 1C8M2 1SBDA 2Y6JA 4OQ8A 5D1IA 3MW2A 4FVVA 4TLFA 2QQKA 5FYSA 3OCPA 2YG0A 1W6OB 3SKJE 1G86A 2I07B 4BMBA 4FPHA 4CDWB 5A3PA 4D6QA 2ZX1A 4UW4A 4FP3A 4RHV2 4QPIB 5CYYA 2DFCA 5D8AA 1TQ5A 4XJ8A 2Z42A 1H8TA 4W6XA 1YCIA 5LRSA 1JYVA 3H1MA 1XC6A 5L73A 1J1LA 1QNWA 2VE1A 2W87A 1Y3TA 3Q8FA 4XTPA 4UBGA 4HKLA 3LAGA 4JQTA 2OIIA 4G3YC 2ORXA 5DAVA 2XBO1 3OBAA 3MEPA 4XF4A 4Q8KA 5JCTA 1ACCA 2WRAA 2YFZA 3AZZA 1TEIA 5FLJA 5T5PA 1UY3A 3W58A 1V9U2 3TEYA 2LROA 3GZAA 1OQEA 4JDMA 1PZ9A 2C0ZA 4TTGA 1X8EA 2JIJA 5FK7A 2D7FA 2R7EB 2D3RA 3O0WA 4Q27A 1RUD1 1PO13 4JC1A 4UOJA 1YQCA 5T5JA 1QXRA 5CVRA 2MEV2 1W6QB 2V5YA 4JVAA 4DUXA 5I0DA 3HOBA 4FOYA 4BIOA 5FMDA 3VUOA 1MS3A 1AHSA 3WR0A 2YC2A 3JQXA 1AYM3 2YPDA 1ASJ2 5IK7A 3V0BA 3MLLA 5K0UC 3HJRA 1KS5A 3R05A 4Q5OA 1CR7A 5K4LA 2VUAA 3LGRA 5JWPA 2DFBA 4LPLA 2B5HA 3ILRA 3K4DA 4XVHA 4LBMA 5FYBA 1UZYA 2P3IA 3M2MA 1J58A 1GZWA 3E97A 3QBQA 4GKXA 4EN9B 3SEPA 4J6GA 3RS6A 5JXIA 3I2OA 4YGEA 4FFGA 2YBKA 2FDIA 3ZFGA 3PHMA 3IDAA 4JZRA 1AL0G 1RUI2 4IXLA 4I0BA 4Y26A 3HN3A 2PHDA 1BK0A 4UW5A 5FY1A 3PVNA 1LHUA 3WF2A 3EB7A 4JRAA 5GZEA 2FQPA 4COVA 3ZPYA 2Y38A 2IVIB 5EJ3A 3N9NA 2B7YA 1RINA 1SDWA 3OPZA 1AXKA 1I9RA 1OLME 1W06A 3O1SA 3T0AA 2VO5A 1NXMA 5FP8A 2AGSA 4AQ6A 1VBD2 5IJRA 5JZGA 1TMF1 1C1LA 4COZA 3N3HA 1W8TA 1U5IA 4Q2FA 3SISA 4ZHNA 2W95A 5FCCA 3VBUB 5ABJA 1KGYA 3MW3A 5DABA 1XU1A 2HWB3 3OYWA 4DEQA 2VW2A 2Q8CA 4D7TA 1DGRN 4PI0A 3RZKA 1QDOA 1UMIA 3C7FA 3U10A 2FZ1A 3BU7A 2Z4FA 5F5QA 3T2TA 3P1IA 4F83A 2A6WA 5BNNC 3HR9A 4YZ5A 3ZXAC 3H8UA 1R091 4NRMA 1H6YA 2EIDA 2F4LA 4N43A 1Y9QA 1MZ6A 3MGUA 4YPJA 1P8JA 4R4ZA 5KC5A 1C8NA 4AI0A 3PDQA 5A3NA 1LOFA 3K51A 2NP0A 4LOSA 5IVYA 5SV8A 5GLUA 2Q4SA 2ENRA 4AEJA 1DDLA 3LDBA 1LHVA 4Z2AA 5H9QA 1PMHX 4KWJA 4AF9A 1DZTA 1RUF1 3CKHA 2ZOEB 1WCSA 2BNNA 5FP7A 1EV12 3SXWA 5L9RA 4LA2A 4XF9A 3AVSA 2RJLA 1M4WA 3H7YA 5FKCA 4JAAA 4GWMA 3DXUA 2XHNA 3AMPA 2VOVA 4JDOA 4UW3A 3KQ4B 1JZ3A 5C6CA 4IV1C 1PM4A 4RS5C 2LTNA 2ZHKA 4D7SA 2BP6A 1PO12 2D6MA 2ZX4A 3NO8A 3KLSA 1RUC1 4RQPA 1KJLA 5C70A 1LGNA 5FZ1A 1MS5A 3ON7A 2B8MA 5IAVA 3LOBA 4XCAA 1R083 1WMEA 1GP4A 1AYM2 5L36A 1FYUA 2RM23 1IPKA 1YXWA 3T2QA 3PUQA 2B45X 2VXRA 5HPOA 1SLIA 4DMIA 4MLOA 3PUIA 3WNLA 4CEYB 1WCDJ 4H7LA 2WN2A 1Y4WA 4LUKA 1F9KA 3KV5A 3VL8A 5EXOA 3ZXKA 4OMDA 5A1AA 1E5RA 2RS11 3D8CA 4PDWB 4RSUA 3SMHA 1S0BA 3BALA 3D5OA 3LSEA 5IK8A 2BGOA 4YZ3A 4FPFA 3ZMNA 2OQ6A 5LEJA 3T2PA 4HPKB 4BH9A 3RZLA 4EE2A 5A7SA 2DCJA 3QCWA 4CDUB 4GQ7A 1H1AA 3PJYA 4KQ7A 5IVVA 2R1BA 2XXZA 2FHRA 2WZEA 1BQPA 1SBFA 1H2NA 4CU6A 5GLZA 5GZCA 5CG9A 2HYKA 1NZCA 2ETEA 3CU7A 1H8TB 3B01A 2ZGUA 5A80A 4XZPA 4YYOA 1QGLA 1W6NA 2VW0A 3AP4A 4UWDA 2A6ZA 5EHDA 1UPSA 2XJTA 5F5AA 3T3YA 1W8NA 4F7ZA 3O0XA 4N53C 1VAMA 1HLCA 1C8M1 1JODA 2RE9A 4XQDA 1V00A 4XJWA 4NIGA 2ILMA 2WZ8A 1VB4A 3EBRA 5DUVA 3AP9A 4E9KA 2P5BA 2ZMNA 3E1F1 4P14A 3GCXA 4LR4A 2GZWA 3LEGA 3NWKA 1YJKA 3MYXA 4RHV1 3VKOA 2ZAAA 5C3PA 1GWMA 2JB8A 2VJXA 1VMHA 2Y64A 4LQRA 4C8DA 2HWE3 1YUDA 2PAEA 2Q30A 2W1QA 1UOJA 5J96B 5FOJB 5JXHA 1C5IA 1LHOA 3AKSA 2PHTA 1UCXA 2XDVA 3PVBB 4AHXA 5CG8A 1U5XA 2ARCA 4WM8C 1HQLA 1ZRRA 1XYNA 2PAMA 1Q8OA 1W6PA 4C1XA 2YBSA 2G19A 3KF3A 3V0BB 2A71A 2FBEA 4XF1A 2JDMA 1V9U1 3ETPA 3OPWA 3THPA 2JE7A 3FHIB 3AJZA 3H50A 2D3PA 5GJ6A 1W3XA 4NIDA 3ZSMA 3H8OA 1J3QA 3O1VA 3O14A 1LHNA 4YFWA 4LKFA 2KA3A 3H1YA 1NE6A 1UY1A 3ZFGB 2MEV1 5C4WA 5CADA 1WW5A 5IHRA 1MPXA 1OHFA 3VHNA 2ZGOA 4JCKA 3RWNA 1REDA 3N7JA 1W6MA 2J42A 4NWWA 1O3QA 1ASJ1 2ERFA 1Q43A 2Y60A 5SV5A 1R082 1US3A 2UYAA 4I02A 3D0SA 4XUPA 4FPEA 5J98B 5C5TA 4KWUA 5B4NA 1WBFA 2QQIA 4PQ9A 4Y5TA 4BXFA 4CRQA 2WA4A 4P9GA 1CX1A 3VKMA 1W90A 2ZGKA 5JZGB 1BCXA 2VBDA 3B00A 1URXA 2GN7A 1KS4A 3DKWA 3GF6A 5FLIA 5IVBA 1DBNA 1RUI1 4A7ZA 3KT4A 5JOWA 3UKVA 2X29A 3TNPB 5ABJB 2C1FA 4WBBA 2HWC3 3OYWB 4WZCA 1DHKB 1UN1A 2OYZA 4A2UA 2O1QA 1R1A3 2UURA 2CWSA 2Y6FA 3AYDA 3U1XA 1EPZA 2JEMA 3NV4A 2XUMA 2VMHA 4QU1A 5FZOA 5FRAA 2VZOA 4AEDA 5J3UA 4NE9A 4HANA 3VHRA 4NROA 4D8MA 5EV7A 1VBC3 4N43B 3VZLA 1VBD1 2D6NA 4AHYA 2PHRA 5C3QA 5JLVA 4C0BA 1S2KA 1XNAA 2WSVA 4RL7A 3FX3A 4O61A 3S7EA 5BNPA 1UWWA 2VTXA 4IE7A 2VC9A 5FZGA 4YVWA 2QKDA 2C5DA 2OVUA 1ZBE3 3UGGA 2WNVC 3B93A 2GC1A 5ACA3 4BQXA 1DF0A 3A23A 1HRV3 1PVC3 2IXHA 2MPFA 4BU2A 1S2BA 1UIJA 5LBEA 1HN1A 3OUIA 3U0ZA 4QQOA 1R1ZA 4RR3C 4XMIA 3L9JT 3KMHA 1X82A 2VQTA 3I8TA 1SBEA 1ENRA 4K1ZA 1PMIA 2FDGA 4LIVA 3WF3A 2BZDA 4PBPA 2HWE2 2Y34A 1KQRA 3FHQA 4RQPB 5CA6A 3KD4A 2VECA 5EJZB 4IEUA 3V56A 2D6OX 4UI9L 1RXGA 1FPN3 5CFDC 3MZHA 3R4UA 3T4VA 5E89A 3H3UA 2E32A 3IMMA 3VN4A 4G4FA 4LBJA 1EV11 1BBT3 3GCWA 3BPSA 1IGOA 3OGRA 4BLIA 4UFMA 1NCQA 4EQVA 3SKVA 4J1WA 5FUNA 2R6QA 1XU2A 4MO3M 2IZWA 3WP4A 2WN3A 1QDCA 1H2LA 1PO11 3AZVA 5I8SA 1WMDA 5ISLA 1LKNA 1QJEA 1JI6A 2LW8A 2VVEA 3DYPA 2C4XA 2R062 3RJRA 3ZXFA 4INDA 1OBNA 3HIFA 3X29B 5DAXA 2HEVF 1AYM1 1UPIA 4JKMA 1CAWB 5JR7B 2ZGPA 3C7GA 3AMMA 5I93A 5CKQA 3PMSA 2JIGA 5A1LA 5EP9A 4Q4Y3 3FMGA 1UYZA 4J1XA 5GLTA 5A33B 1JYIA 4QQHA 4GULA 4HKOA 1PNFA 2PQQA 2EXKA 4XFHA 1GQHA 4BK5A 2J1TA 1VBE3 1W6NB 1YHFA 4XBNA 2E63A 2RMU3 1N1VA 1ZYBA 5A6YA 5F2WA 4Y24A 4K8FA 1OLMA 2V5DA 3AP5A 2UY8A 3K3NA 1CAXA 1S0DA 4P08A 4XOGA 5FMOS 1V6IA 4ATEA 1LEMA 1YFUA 2AZ5A 2JDPA 3LA7A 2WZR2 4Y1XA 2ZEXA 4AI1A 2B9UA 4RGGA 1LOGA 1YYNA 2YYOA 1GNHA 4OUMA 1RMU3 1LCLA 3MIHA 5KR7A 1O3TA 3KS7A 4LBLA 1T6GC 1AR93 1S1AA 2E9QA 2W1UA 2XWJB 3UJQA 5A3MA 5LCWL 4LXLA 2BWAA 1W6PB 1UOBA 2CTVA 1GWLA 2IXJA 3GJBA 3RQ0A 2CWMA 1M06G 3ZYIB 1ZBE2 3UL2A 1QH6A 1AJKA 2DU0A 3H0OA 4HXCA 1UMZA 4AI3A 5ACA2 4UF0A 1V70A 3BTZA 3JU9A 1HIXA 4LBKA 3B5LB 1PO22 3HQUA 1KDMA 3WG2A 5HCHA 1HXS3 3SH4A 3U14A 3BOPA 3UESA 2ZGSA 1YLLA 5C33A 3UGFA 4Q4V3 2Z79A 2ZGLA 5FXWA 3M7AA 4GB33 4XILA 1B35C 2E7QA 2DVAA 2WWUA 3P3PA 3OOXA 4CP1A 1AYN3 4NWVA 5C4WB 1W6MB 2YFUA 4V1PA 2EAKA 3K48A 5F5IA 1CONA 4QDRA 1CJDA 4OYUA 4Q26A 4AL9A 2JD9A 1WD3A 1SZBA 3FLRA 4QX1A 1MS9A 4D3WA 5BNNB 1A6CA 1UZWA 2OZ6A 5HI0A 1W2NA 1LECA 2UWAA 2E53A 1F2NA 2B46X 3POYA 4YVSC 5FWEA 4ZXKA 5HCBA 1DFQA 2WINB 5HXVA 3P6BA 2BVVA 4JTOA 4KGGA 4MADA 2V72A 4AVAA 2BBVA 1JHJA 1F4HA 2PN5A 5J37A 1RUOA 4O9GA 2ES3A 2FDFA 1NE4A 2BGPA 2WC2A 1DLCA 2W0XA 3ETQA 4DIQA 1W2AX 2ZACA 5FPBA 1AR63 1LENA 4TYSA 1J3RA 1C4RA 2GH2A 2YMZA 5BUVA 1SFPA 1X7NA 1R081 2GC3A 2ID4A 2WS93 3JZVA 5FPLA 4CDXA 1PMJX 4UFHA 1W8FA 4HOOA 1G6NA 4OHXA 3POGA 1W2UA 1JZ6A 5FZOB 4AEDB 4QKDA 4Q4Y2 1DGWA 2XJSA 2DVDA 1ZRFA 4C90A 4IV3A 2GU9A 3AZXA 4RS5B 4CDWA 4AFBA 5BNQA 4QPIA 4XUTA 2O0OA 1MZFA 2C9KA 2QQWA 3USUB 1VBE2 2BFUL 2ZGNA 2QTWB 3OPTA 4NRPA 1QJX3 2D6PA 4YVWB 4E4ZA 4COUA 4D6RA 4OUEA 3RZMA 3FLPA 4IE0A 4P00B 3VLBB 3C3VA 1ZRIA 4MUVA 4XE9A 4AI8A 1XJAA 2PFWA 1ND2C 5J1XA 1V6JA 3AKPA 4KU7A 2PELA 4YRDA 2AREA 2GMEA 5EPAA 1JZ7A 1F4AA 3ZXDA 2WFF3 4Q1RA 4TN7A 3TB0A 2WBKA 4L2NA 3FN9A 1GANA 5FOBB 5IYYA 3NSTA 2W92A 5JSPA 2DCYA 1RMU2 3HNYM 4YWAA 1AR92 4K8RB 1UX7A 4FPOB 1W6QA 3ZXEA 5E16A 1KRIA 3KM5A 5T52A 4LBNA 1UYYA 3E5UA 1W03A 5FZIA 3PJQA 4XJAA 1HB4A 4QAWA 3B3QE 4PIYA 1TG7A 1W99A 4Z8BA 3EMRA 1GP5A 1NCQB 3LD8A 1OVSA 4BM8A 3VBSC 1I6XA 1BJQA 1HXS2 1SDDB 2YPJA 5FY4A 2XONA 4I2OA 4B29A 3SQOA 4Q4V2 1C28A 1NCRC 2HWE1 5FPAA 4DFSA 5HV0A 4RA0A 2D6KA 4GB32 4XBLA 4DQAA 3IWZA 2VL4A 2ZGQA 1NXD1 1X36A 4KU8A 4JHZA 3WEZA 1QKQA 2HYXA 4B7EA 3E6BA 1YQ6A 2BOJA 4PIXA 2BPA2 3S5QA 3WUCA 4RYDA 2X5IC 3VDCA 4E2QA 5FZBA 2FDKA 1K42A 4XUNA 3WNMA 1H1MA 1RUJ3 1UZ0A 2D93A 3WNXA 2WYFA 1NKGA 4W4ZA 1R092 4YG3A 3VBFC 3E5XA 1L7LA 2DU1A 2OA2A 4KBBA 3ROUA 5FPUA 1Q3EA 2GC2A 4WM8B 3VBHC 4EJRA 1ND3C 2R061 3NNLA 3AZWA 2PHXA 1QU0A 4BWOA 5T54A 4B4PA 3O7OA 2VD7A 2YV8A 3VBUA 3NNGA 3JCIA 4L8QA 4XXPA 4MXVA 1W28A 2WS92 2WWJA 3KB5A 3KF5A 3KVAA 3MIDA 1DGWX 4MVTA 4BIFA 3B7MA 3I4IA 5IWFA 5CFCA 4L99A 2EA7A 2NM1A 1GU3A 3MPPG 2D44A 4E27A 4E8DA 5C3SA 5EYYA 1H4GA 1H9WA 1DQ2A 3K46A 2V73A 4QX7A 3UK9A 3FHAA 2IFWA 4M0NA 2BNOA 2GNDA 4O65A 4FXKB 4AQ2A 4L92A 1QJX2 4JDNA 1AX1A 1CD3G 1PIV3 2XH6A 3RGBA 4YFZA 2W2IA 5C3RA 1JZ5A 2W46A 4UW6A 4EN7B 4W6WA 1R1A1 1YFYA 3WDTA 1E5HA 1YO8A 1W8UA 2GSYA 3WNOA 5JIUA 1JW6A 3POJA 4PF5A 5LK5A 4CUGA 4Y20A 1WLDA 2WFF2 2R0FA 5DUXA 5L9BA 2A70A 5D21A 3ZOIA 3RRDA 1OPOA 2YZ4A 2R0HA 1VIWB 1K5MA 4IE4A 1OC1A 1V6NA 2ZEWA 3AX4A 1YQ5A 4QM9A 5HCFA 3VBOC 2NZ9A 1LR5A 1NX9A 1ZBE1 3VZJA 2G9FA 3HNBM 3LWCA 5ACA1 4RD7A 2R32A 4XJ9A 1JZ4A 1W0OA 4FTBA 1US2A 1HRV1 3MHZA 1PO21 3EXUA 2LUWA 4PLMA 5IK4A 3DPRA 1CWPA 3VHPA 1OUXA 1S0JA 1OFNA 1LB2A 2PAKA 1TME3 1Q8VA 1WA6X 4XW3A 1TNFA 4CEYA 4A42A 1SEFA 5HCAA 3TRSB 2WO3A 1YI9A 1BEV3 1AUYA 1ULDA 3PL0A 2Y6KA 3H8RA 2RDNA 1YEWA 2JG8A 4XAEA 3EYPA 1O7FA 3SLIA 4BOWA 3MIFA 3H1WA 4HZFA 4BZ4A 2A6VA 4CDXB 1DQ0A 5FZFA 3VZKA 3SNMA 4CDUA 4I01A 5JI7A 4LKEA 3VKLA 1RC6A 5F3IA 5FFOC 3ZR5A 4GH4A 3O1PA 2H0VA 2V09A 3ZFFA 4YW1A 5CBLA 1HV0A 4BQWA 1G7YA 4IV3B 2B4KA 2WT1A 2WUHA 4JKLA 4YM3A 1JYCA 3NL1A 4GIQA 3V0AA 3AYEA 3FUOA 4CDQC 4CSWA 2QVSB 3FFQA 1OOPA 3AYAA 3BIEA 4X8PA 2VW1A 2QZ2A 1ZZCA 2D40A 3I3BA 5I91A 4GWNA 4XF0A 4BLJA 4SLIA 3L2HA 2X10A 1K12A 1DYPA 1UQXA 3I97A 4GJZA 4Q4Y1 4RFT0 1QY4A 3N7KA 4XFBA 3V65A 4OHYA 3IDEA 1A8DA 5DG1A 1ZBA3 5EIYB 1J3PA 2PLV3 3NJYA 3VKNA 3F95A 1UYPA 4P9XA 2B39A 3JB8A 1SCRA 1VBE1 5F6LB 3WW2A 2W91A 3S30A 3IIAA 3RWKX 4CEWC 3A0KA 3JBG2 5FPZA 1QHDA 4BISA 1PIV2 4XURA 2DWRA 4ASMB 1NQDA 3IAPA 2HWF2 1QQP2 2OXBA 5BNOC 3ZFEC 2BV4A 4GA9A 2ZXQA 3PUAA 3AK0A 4QPWA 4D69A 2VU9A 1F5JA 3UYJA 1IS6A 2BGCA 2VMEA 4CCOA 3P3NA 4LHNA 4LO8A 1FNYA 1X9PA 3LFMA 1H30A 3N9LA 4LKSA 1RMU1 1SLBA 4OI1A 1AR91 4QPGC 4IEPA 5FY8A 1S55A 3B9CA 4Y1YA 1O59A 3UT0A 1QJY3 4R9BA 3VHOA 3CJIC 4E4DX 3UETA 4YARA 4PLOA 2KM2A 4Y22A 4AFAA 3MO4A 5FZEA 4BQ4A 1EPWA 3Q9OA 2I74A 2EAAA 1ODNA 3HVDA 3AKRA 1HXS1 4WVMB 1AL22 2J7MA 3MV11 4O7XA 4LKDA 2L9LA 3QH7A 1NT0A 3FBMA 1O4TA 1S2EA 1TME2 4Q4V1 3UNPA 3U75A 5KHGA 1MS0A 4GB31 4GMP3 4NPLA 4P9YA 3O1UA 1AYN1 4NAOA 1BEV2 2LS6A 3V64A 2UY9A 2UYBA 2QDNA 3I2FA 2DTYA 5JMOA 4ZS3A 5KXEA 4LTAA 1N3QA 2ZEZA 4FFIA 5CFCB 4DXSA 2R043 4XTMA 2K46A 3GBWA 1J83A 2Q1MA 4J25A 4YGCA 3NMBA 4G9SB 2JWPA 5LY1A 4NIIA 1JYWA 2JE9A 2VAUA 4CP9A 1WKYA 5KXCA 1OA2A 2HKXA 3HEIA 3A0NA 4CTEA 3HAGA 2YROA 4A3XA 1EAH3 3WXPA 5GLVA 1EUTA 5F39A 1FI2A 4LIUA 4NO4A 3I2GA 1W9TA 3LA3A 3LE0A 1OH4A 2E7TA 2XMLA 3LEKA 4HFSA 3ZLIA 1VBA3 2WS91 3KV9A 3LF7A 4FPKA 3WNNA 4KWLA 4Z1VA 2Y26A 3RSJA 4GMP0 4DY5A 1G9AA 5FZLA 3JB4C 2OS2A 3WP6A 2W9XA 3BUCA 4PI2A 4NAMA 5DG2A 4Y20B 2UWCA 1XNDA 2JXAA 5L9VA 3PMEA 1JZ8A 5ERLA 2VZUA 2YB7A 3I2DA 1ZBA2 4IEOA 2VZVA 4FI9A 3UJOA 2PLV2 1K5MB 1UOGA 2VBPA 1NLQA 2W08A 3LA2A 4XDOA 3J7NA 5B4XA 3K3OA 2QQOA 1W2OA 4X6RB 4MV2A 1MEC3 1QJX1 2CGOA 4I30A 4NHMA 1Y43B 3RI8A 3DGTA 3KV4A 3WD5A 3NAPA 1VPHA 2WA3A 1YI7A 2VCBA 2WYSA 3PTRB 4HN0A 2JDUA 1ZZ8A 4XACA 3DPRB 4BYYA 2PHFA 5TSWA 3LCPA 4EV0A 2WFF1 5LBBA 1WCKA 2R073 5FWJA 4NPRA 3VGIA 4P9LA 2OPWA 3WP3A 3J7HA 1N3OA 5FYMA 3POFA 5FZCA 2G1MA 3BVCA 5KXBA 2MHFA 4R9CA 4XBQA 1NY72 3ZSLA 4R4XA 4CCEA 4JGZB 3TWIA 5KWRA 5JSRA 1DU3D 1NA1C 2JG9C 2JG8B 2VUDA 4MHUA 4AVTA 5FO8B 3ZR6A 2HEYF 2QQPA 1QJY2 1F8VA 1HQWA 4Z82A 3DKQA 4MX3A 1DQ1A 2WR9A 3BYWA 1CAVA 2PQSA 1OT5A 2F6BA 1CAWA 4GH4B 1OD3A 5FY5A 2D5FA 4I3PA 3I2JA 4FPCA 3NQHA 4N7IA 4OHWA 4P5HA 3ZFFB 3HQRA 3N9PA 4YM0A 5AC91 5IFPA 2XQXA 1DQ6A 4N8MA 3PLQA 5KC6A 1OF4A 5FXVA 4LNVA 2VMIA 1GOGA 5FP3A 1WLWA 2WDBA 1AJOA 5A33A 5DZEA 5M0TA 4NN0A 3V0AB 2HJIA 2ZX3A 1DP0A 1BHGA 2HBTA 1GOFA 1W9WA 1OOPB 1XXNA 5CZKA 4E2SA 4OI4A 2OW4A 2XG3A 1OLRA 3OTFA 3VV1A 2BQPA 5I0RA 1PK6C 3DXTA 4QU2A 1PGL2 4EROA 4KL1A 3OF1A 5I0UA 2HWB2 3C7EA 3W20A 1S0FA 3I3MA 2W47A 3ECQA 5G05L 4Y1ZA 2J22A 1H2KA 1V6KA 2YGLA 4P9JA 4XIKA 4LLOA 3M1HA 4CXXA 1NYWA 4LEJA 1WCUA 5FUIA 1NQJA 2QDRA 3HN1A 3VDBA 3O1TA 5F3CA 4S2HA 3MPBA 4W6YA 5ANQA 2ET7A 3U4SA 4BQYA 3NV3A 3HWJA 2K9ZA 4LMFA 3DECA 4WM7C 3U11A 1EAH2 3RYKA 5LA9A 3S6PA 4BQ2A 2ATFA 4R9AA 3WQBA 4DOUA 1CPNA 1E5IA 1VBA2 3BN6A 1WW6A 4AFMA 3L2YA 5J48A 3ZYBA 2VGDA 4KG0A 4ZONA 2D43A 5LW9A 4V2VA 3AKTA 1CAUA 2WNUC 4IGQA 2PMWB 3WVJA 1MZ5A 2CV6A 1D4M3 1MQTC 5DN2A 2WFPA 4U2AA 3ZYJB 1AZDA 2A7AA 5CISA 5L7OC 3VL9A 1N1TA 3VBHB 4Q4W3 2QQLA 1SMVA 2J1AA 1JU4A 4CCKA 5DAPA 1C3HA 2AR6A 2RDQA 3W9AA 3JBG1 2YC4A 4BXSV 1PIV1 2JKXA 2EF6A 4OCTA 4Y22B 2VNVA 2HWF1 1VRH3 1QQP1 2QQMA 1OURA 4KNCA 1UXXX 2FCVA 2RM22 1XPWA 3U4XA 5BNNA 1SQ4A 1NOVA 2V4AA 2F17A 3IDBB 1ULFA 1QXJA 5F2SA 3LPGA 5FLHA 4PCRA 2VNOA 2P2KA 2R072 4QHBA 3H9AA 3R4SA 4H3WA 2VPVA 3IKWA 5FYVA 5C7GA 2QFEA 3MLJA 1SPPA 2AEZA 3AL5A 4YZ4A 3OGSA 1PVXA 1N1YA 4P5YA 2PHWA 3FFZA 2W39A 3OGJA 4YLZA 1DZQA 5T5OA 3QH6A 5A3OA 3TNQA 3ENRA 5DAWA 1DZRA 1JS9A 1ULGA 4MH0E 1K45A 2EXJA 5FZ9A 4AAPA 3MIGA 1AR73 4AVCA 2CSGA 4N90A 1PHMA 1H2MA 3NW4A 1REFA 1CX4A 2DUQA 3VBRC 1AL21 3H3LA 4Y1UA 3ZXGA 1AX2A 5FYIA 4CP9B 2XL9A 3Q8AA 1TME1 3E5QA 4JGYC 1RUH3 3BTAA 2RS33 4IV1A 4RS5A 1LRHA 3WDVA 3ZN6A 3OY8A 4ES9A 3ASIA 1BEV1 1XQNA 3KQRA 3ME2A 4FPGA 3OBZA 3VBOB 3RDIA 2VMFA 3M3QA 4AVBA 2CAVA 5C8CC 1I1EA 4QGMA 2ZCWA 3USUA 4QQPA 1MS1A 4GXLA 2P6CA 5APAA 1FMD3 1RUG3 4CU7A 2A3WA 1UU6A 2CY6A 2QQUA 3NV1A 4HSLA 4CXWA 4MGTA 1CPMA 1CGPA 2PYTA 4NUBA 1HV1A 2VOXA 1LAJA 5FK8A 2A1XA 3D4KA 2VZPA 5JOZA 3N7MA 1IQDC 4PJYA 3IZOA 1IPSA 2H6BA 4ZZ5A 5C9AC 4Q0PA 2WQ4A 3VDDC 5LEKA 3T1MA 2BDRA 3KV6A 2W52A 3OEAA 4GJYA 3AMNA 2D98A 4META 4JQRA 1Q8PA 3FBYA 3KVBA 3NAPB 4H2AA 4MZUA 3ACHA 2BTVC 4QDQA 2W94A 4QXKA 2XUEA 1YQ8A 1TE1B 2WIIB 4KGQA 5FYTA 4E4SA 1IS5A 1IS4A 2WKKA 3SH5A 2NLRA 1XNTA 4IE5A 4EN8B 3S7IA 2ZA9A 2AACA 1UMHA 1XRUA 1ZBA1 5FMBA 2PLV1 3RPQA 1TVGA 4EN0A 1VMJA 2DVBA 1D4M2 4BJ0A 3ACLA 4KH9A 3T0BA 4FPYA 1S0IA 1UZVA 2Q0AA 2FMDA 2ZMLA 3CO2A 3MFCA 5K0UA 5CAZA 1XSRA 3OB8A 3MV01 3ZSJA 4N53A 2WNEA 4BK4A 3WW4A 1CAVB 1E57A 4IGOA 2X05A 5DDJ3 4IETA 3W21A 4DNYA 1VRH2 1O91A 4WVWA 2BU9A 2DDUA 3ALQA 5FP9A 3LEIA 4ARYA 4DINB 2HBUA 4LE3A 1GMMA 4QD2A 5F3GA 3T2OA 3T0DA 1KFUL 2RS53 3POBA 3BB6A 1X9TA 1XOYA 3WDXA 4A44A 2XQRA 1CJPA 1NY71 2WO7A 3WX5A 3AVRA 2BERA 3GNEA 4CEWB 4FSJA 1QOSA 4WM8A 1GICA 1QJY1 2VCAA 1RUE3 1J84A 5BNOB 2HWC2 3ZDVA 3ZFEB 3JD73 3Q8EA 5IVJA 1N3PA 1AR72 1R1A2 2JD4A 3WQ0A 3PVOA 3ZX7A 1RTVA 4AG4A 5FZ3A 1MS4A 3N35A 5A6XA 1QH7A 1RUH2 1VBC2 1I3HA 2KXLA 1UKGA 2P34A 1LULA 1OF3A 4HKWA 1YIPA 1KDKA 3IIIA 1F5FA 1XE7A 2VQAA 1PGL1 2JDZA 1FMD2 1RUG2 3NJZA 4Z2WA 3BIWE 2HWB1 4LA3A 5JPNB 2ZTNA 2Q8DA 3WZ1A 2OZJA 1HRV2 1PVC2 1JTZX 2A75A 1X33A 1W9YA 1KFXL 1UY4A 1RUNA 2GMMA 1CAUB 2DCKA 2DURA 3ACIA 4OVEA 3THTA 3EHKA 1CZTA 1Q8SA 3WHUA 1RHI3 1C1FA 1CIWA 1RVF3 3I54A 1CZSA 1VR3A 4XYXA 4PLNA 5FV3A 4XFCA 1EAH1 4Y5Z0 4C91A 2N7GA 3CBNA 4AHWA 3CL1A 1WBLA 2QBXA 1SLLA 4FAHA 4JX0A 4N7UA 5F5CA 2Y0IA 4A3ZA 1VBA1 2VMGA 1FPN2 2VZ1A 2YDEA 3N36A 4FXGB 4AR2A 5IT6A 3ZN4A 4IDZA 1OH3A 3DF0A 3WHTA 1BBT2 1K3IA 1LU1A 2VTFA 5A7QA 5IVFA 1OFSA 3RZGA 3WNPA 4AGVA 5KHKA 3J4UH 4QKFA 4IEWA 3MBWA 1OMIA 3ABZA 4LBOA 3MIEA 1SPPB 2E31A 3TN93 4YZ1A 4PBOA 2AH2A 5JPMB 1BVVA 2XVGA 1OLQA 5IVCA 5J7MA 4FTSA 4PHZA 5FPVA 2HH9A 2WNVA 3B69A 5F8PA 3A22A 2Q8EA 4QB1A 1OA4A 5DDJ2 5C8WA 2RM21 2ZGTA 2O8QA 3NKGA 2AEYA 1IHMA 5F32A 3DCQA 1JU3A 1QMJA 4HLTA 4LO6B 4Q8LA 5A1FA 4RR3A 3I3EA 2R071 1QJFA 4QM8A 1DQ5A 5A7OA 3D6EA 4IV1B 3T09A 1LESA 3ZN6B 3OD4A 3OY8B 2RS52 4FPJA 3LFIA 1H8VA 3KT1A 1T2XA 3AXDA 1ULOA 2IXKA 3A7QA 2GP3A 4QHOA 5EYXA 4ORFA 2RMU2 1HRI3 2W3JA 3LIHA 5CFDA 4OHZA 1WWYA 2DCTA 1RUE2 4HSJA 1JMUB 2DBIA 2WAOA 4LUMA 3BPZA 1OKOA 4XDPA 3W5MA 3JD72 4YGDA 4CZSA 1VAKA 4YW5A 2VMDA 3H7JA 1PZ7A 2XKPA 2GNTA 4NHXA 3QOPA 1HW5A 1KITA 3URFA 3ACGA 4AE2A 4DZGA 4XUOA 1OXCA 2YXSA 4NHYA 5A7WB 4CPBA 5HXMA 1LOEA 3K4AA 3PUSA 3RNSA 1O5LA 3WT3A 2BVBA 1Q8QA 4FOVA 1G9DA 4RN5A 4YG0A 5FUPA 4KG8A 2EXIA 2XVLA 4PDWC 2A6XA 3WDWA 2LALA 3HQXA 1WGPA 2VZTA 4QHZA 4CE8A 4DO0A 1YRZA 2BWCA 2JENA 3ZYPA 5CEHA 4Z92B 2WQ8A 2W1WA 4GD4A 5A7PA 2HEWF 4FQZA 1PGSA 3CZJA 4HK8A 4Q0SA 4A7KA 2CU5A 2VCMA 4ZPIA 1A78A 2D3SA 4FO9A 3NNMA 4EZHA 4XQ4A 1RHI2 3RG0A 5D8AC 1ONAA 1RVF2 2TNFA 5K0UB 2WO2A 4WZFA 1H8TC 1TZOA 2Q1FA 3D3AA 3LQCA 4Y5SA 1AYN2 1U0AA 2RR13 2EIGA 2CGNA 4N53B 3WW3A 4QPYA 4CUCA 4F8AA 4DY3A 4FCAA 4LHSA 1SLTA 4AEMA 2FZ2A 3BI3A 1GQPA 5CU1A 1N1SA 5BXXA 1AXZA 4YW4A 4UBHA 4ET7A 2C9AA 4XABA 5AC93 2JECA 3KHBA 3AC0A 2Z69A 4YNIA
chains in the Genus database with same CATH topology
3E1F1 3LEGA 4PT6A 2VMEA 2VQUA 2VJXA 3VD7A 2Y64A 4LKSA 4LQRA 2W1QA 3VDAA 1GUIA 5JXHA 1DYOA 1CZVA 2XOMA 1O59A 2VOTA 3VD4A 1KEXA 3UETA 2J1EA 3MO4A 2JDAA 5DMYA 3ETPA 2J7MA 3MV11 2L9LA 3UNPA 3CMGA 3GDBA 4MGSA 1JZ2A 1UY1A 2EICA 2LS6A 5IHRA 1MPXA 3CIHA 3I2FA 4CU9A 5JMOA 4PQQA 2ZEZA 1US3A 4XUPA 4DXSA 4KWUA 1D7PM 5B4NA 2QQIA 3NRUA 1J83A 2VCCA 3WSOA 4L0PA 3VD3A 4CUAA 1JYWA 1CX1A 1WKYA 2WO1A 4QB6A 4XUQA 3HEIA 3MUZ1 4CUBA 3THDA 3WF4A 1EUTA 1W8OA 3I2GA 4CU8A 1CIYA 1W9TA 3LE0A 1OH4A 3LEKA 3WF0A 4M4PA 3WNNA 2Y6GA 4M4RA 2W9XA 2VZOA 1JZ8A 2VZUA 2YB7A 4D8MA 2VZVA 4FI9A 3VD5A 2E33A 5F7UA 5B4XA 1XNAA 2QQOA 1ULPA 5JXJA 1UWWA 2VC9A 2VZSA 2VCBA 2WYSA 2X09A 2CDPA 3CQOA 3WNKA 3A23A 3A21A 1UY0A 1HN1A 3C7OA 2VQTA 3K77A 2B9VA 3J7HA 4MOAA 3WF3A 2BZDA 3I3DA 2RVAA 3FHQA 1UYXA 3GGLA 4KI5M 5EJZB 1PX4A 3SEEA 4UI9L 2PQSA 1OT5A 3LPFA 2E32A 1OD3A 3I2JA 3NQHA 5IFPA 1L7RA 2QQJA 3OGRA 2XQXA 4DUWA 1OF4A 3JXSA 4P02B 3SKVA 1GOGA 5JXGA 2VZRA 2WDBA 4MO3M 3MUY1 2WN3A 1DP0A 1BHGA 1GOFA 1W9WA 2VMCA 5CZKA 1JI6A 2LW8A 3DYPA 2C4XA 1JYNA 4A45A 4JKMA 2W1SA 2E26A 3C7GA 3C7EA 3GM8A 2W47A 3ECQA 5G05L 1JYXA 2J22A 1SG3A 5FUIA 1UYZA 3VDBA 4DUVA 3C7HA 4CVUA 2CDOA 2KD7A 3OGVA 3ZM8A 2WAAA 4DXTA 2WABA 3DECA 4BK5A 2J1TA 4JKKA 1GNYA 2VR4A 1I5PA 2V5DA 2Y8KA 4P08A 3WQBA 4MGQA 3BN6A 1NAEA 3I2IA 3NJXA 2ZEYA 4QDSA 2ZEXA 3BGAA 5LA2A 5DN2A 4UAPA 3IAQA 2QQLA 2J1AA 1JU4A 2W1UA 5LCWL 2YC4A 4BXSV 1L7QA 2JKXA 3K75B 2QQMA 3T08A 1UXXX 1W0NA 2HLEA 4W50A 1XPWA 4A4AA 2EIEA 4IUGA 3UESA 3LPGA 3HPNA 5IFTA 1H6XA 5C7GA 1O8SA 3OGSA 1EUUA 4P5YA 5DPNA 2J1VA 4A6OA 2YFUA 3OG2A 4QDRA 4OYUA 2JD9A 3CZUA 1K45A 3IB3A 4E8CA 4QX1A 2BBAA 3F2ZA 4PF1A 4XZUG 3WF1A 5DQ0A 3P6BA 4AAXA 1UY2A 3GXUA 3HNMA 4MADA 2V72A 2C26A 1JHJA 1GOHA 1F4HA 4GWJA 4KMQA 2BGPA 2VMFA 2RV9A 1DLCA 4CU7A 2RJ2A 3CDZB 2ID4A 3I2KA 1PMJX 2J1UA 4DXRA 2VZPA 3ACFA 1JZ6A 1IQDC 4ARXA 4HG6B 3THCA 4ZZ5A 4XUTA 2V4VA 3OEAA 2C9KA 3I2HA 2JE8A 4OUEA 3ACHA 4QDQA 2W94A 4P00B 2Y6JA 5J1XA 2QQKA 2YG0A 1XNTA 3SKJE 3W5NA 1JZ7A 1F4AA 1UMHA 2WBKA 1TVGA 3FN9A 4BJ0A 5CYYA 5IYYA 2VM9A 3T0BA 2W92A 3HNYM 1JYVA 3OB8A 1XC6A 1UX7A 2W87A 3MV01 4BK4A 1UYYA 4QX0A 2X05A 4QB2A 5EJ1B 2ORXA 3OBAA 5LA0A 2DDUA 2YFZA 4QAWA 1TG7A 1W99A 3LEIA 4ARYA 1UY3A 1GMMA 1SDDB 3T2OA 3T0DA 2XONA 5JR2A 4TTGA 4BDVB 2R7EB 4A44A 4UOJA 4DEVA 2BERA 5G04L 2VL4A 4OZOA 4DUXA 5I0DA 3HOBA 4JHZA 4ZY9A 2VCAA 3WEZA 1J84A 2YC2A 2HYXA 4OMCA 4QX3A 4RYDA 3VDCA 1UXZA 4QX2A 4AG4A 3HJRA 1K42A 3DYMA 2Y6HA 4XUNA 3WNMA 4LPLA 3K4DA 1UZ0A 4XVHA 1NKGA 4W4ZA 2W5FA 5JXIA 3SEPA 3VD9A 2Y6LA 1OF3A 2ORZA 3IDAA 2EIBA 3IIIA 1SHWB 4TXWA 5JUVA 3HN3A 3NNGA 2VZQA 3WF2A 3OEBA 3EB7A 4GWIA 1UY4A 4E8DA 1GU3A 2DCKA 3ACIA 1CZTA 3K46A 3T0AA 2VO5A 3FHAA 1CZSA 5IJRA 1LNSA 1YQ2A 2QBXA 2W95A 4JX0A 1JZ5A 4A3ZA 1KGYA 2W46A 2VZ1A 4DEQA 2VZ3A 3WNOA 1UMIA 3C7FA 1R64A 2Z4FA 1K3IA 3K4ZA 2VTFA 3P1IA 2OKXA 3U37A 3WNPA 2QQNA 3MBWA 3ABZA 1H6YA 2EIDA 4A41A 4YPJA 1P8JA 3PUHA 2E31A 2ZEWA 1NX9A 3HNBM 3A22A 4Z2AA 4QB1A 1PMHX 1W9SA 1JZ4A 1US2A 3CKHA 1JU3A 5C71A 3I3EA 3T09A 2XHNA 4A42A 1JZ3A 2WO3A 1T2XA 1ULOA 3A7QA 2Y6KA 5LA1A 3EYPA 2W3JA 5C70A 1PX3A 2WAOA 3W5MA 3T2QA 2VMDA 5HPOA 3PUIA 3ACGA 2B4KA 4XUOA 3WNLA 5HXMA 2WN2A 2WUHA 3K4AA 4JKLA 2J1RA 3DYOA 4ZXEA 4OMDA 5A1AA 4RN5A 3C8XA 2BGOA 4D0QA 3T2PA 1O8PA 1WCQA 3I3BA 2DCJA 2VZTA 2X10A 1K12A 2W1WA 2WQ8A 3I97A 2WZEA 4CU6A 3CZJA 5EIYB 3NJVA 2WO2A 3LQCA 3D3AA 2J1SA 3FL7A 4CUCA 2W91A 4W8JA 1W8NA 1RYYA 4LHSA 4ZZ8A 4GZ9A 1GQPA 4XURA 1NUKA 4ET7A 3IAPA 2WZ8A 3AC0A 4QPWA 2ZXQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E1F 1;  3LEG A;  4PT6 A;  2VME A;  2VQU A;  2VJX A;  3VD7 A;  2Y64 A;  4LKS A;  4LQR A;  2W1Q A;  3VDA A;  1GUI A;  5JXH A;  1DYO A;  1CZV A;  2XOM A;  1O59 A;  2VOT A;  3VD4 A;  1KEX A;  3UET A;  2J1E A;  3MO4 A;  2JDA A;  5DMY A;  3ETP A;  2J7M A;  3MV1 1;  2L9L A;  3UNP A;  3CMG A;  3GDB A;  4MGS A;  1JZ2 A;  1UY1 A;  2EIC A;  2LS6 A;  5IHR A;  1MPX A;  3CIH A;  3I2F A;  4CU9 A;  5JMO A;  4PQQ A;  2ZEZ A;  1US3 A;  4XUP A;  4DXS A;  4KWU A;  1D7P M;  5B4N A;  2QQI A;  3NRU A;  1J83 A;  2VCC A;  3WSO A;  4L0P A;  3VD3 A;  4CUA A;  1JYW A;  1CX1 A;  1WKY A;  2WO1 A;  4QB6 A;  4XUQ A;  3HEI A;  3MUZ 1;  4CUB A;  3THD A;  3WF4 A;  1EUT A;  1W8O A;  3I2G A;  4CU8 A;  1CIY A;  1W9T A;  3LE0 A;  1OH4 A;  3LEK A;  3WF0 A;  4M4P A;  3WNN A;  2Y6G A;  4M4R A;  2W9X A;  2VZO A;  1JZ8 A;  2VZU A;  2YB7 A;  4D8M A;  2VZV A;  4FI9 A;  3VD5 A;  2E33 A;  5F7U A;  5B4X A;  1XNA A;  2QQO A;  1ULP A;  5JXJ A;  1UWW A;  2VC9 A;  2VZS A;  2VCB A;  2WYS A;  2X09 A;  2CDP A;  3CQO A;  3WNK A;  3A23 A;  3A21 A;  1UY0 A;  1HN1 A;  3C7O A;  2VQT A;  3K77 A;  2B9V A;  3J7H A;  4MOA A;  3WF3 A;  2BZD A;  3I3D A;  2RVA A;  3FHQ A;  1UYX A;  3GGL A;  4KI5 M;  5EJZ B;  1PX4 A;  3SEE A;  4UI9 L;  2PQS A;  1OT5 A;  3LPF A;  2E32 A;  1OD3 A;  3I2J A;  3NQH A;  5IFP A;  1L7R A;  2QQJ A;  3OGR A;  2XQX A;  4DUW A;  1OF4 A;  3JXS A;  4P02 B;  3SKV A;  1GOG A;  5JXG A;  2VZR A;  2WDB A;  4MO3 M;  3MUY 1;  2WN3 A;  1DP0 A;  1BHG A;  1GOF A;  1W9W A;  2VMC A;  5CZK A;  1JI6 A;  2LW8 A;  3DYP A;  2C4X A;  1JYN A;  4A45 A;  4JKM A;  2W1S A;  2E26 A;  3C7G A;  3C7E A;  3GM8 A;  2W47 A;  3ECQ A;  5G05 L;  1JYX A;  2J22 A;  1SG3 A;  5FUI A;  1UYZ A;  3VDB A;  4DUV A;  3C7H A;  4CVU A;  2CDO A;  2KD7 A;  3OGV A;  3ZM8 A;  2WAA A;  4DXT A;  2WAB A;  3DEC A;  4BK5 A;  2J1T A;  4JKK A;  1GNY A;  2VR4 A;  1I5P A;  2V5D A;  2Y8K A;  4P08 A;  3WQB A;  4MGQ A;  3BN6 A;  1NAE A;  3I2I A;  3NJX A;  2ZEY A;  4QDS A;  2ZEX A;  3BGA A;  5LA2 A;  5DN2 A;  4UAP A;  3IAQ A;  2QQL A;  2J1A A;  1JU4 A;  2W1U A;  5LCW L;  2YC4 A;  4BXS V;  1L7Q A;  2JKX A;  3K75 B;  2QQM A;  3T08 A;  1UXX X;  1W0N A;  2HLE A;  4W50 A;  1XPW A;  4A4A A;  2EIE A;  4IUG A;  3UES A;  3LPG A;  3HPN A;  5IFT A;  1H6X A;  5C7G A;  1O8S A;  3OGS A;  1EUU A;  4P5Y A;  5DPN A;  2J1V A;  4A6O A;  2YFU A;  3OG2 A;  4QDR A;  4OYU A;  2JD9 A;  3CZU A;  1K45 A;  3IB3 A;  4E8C A;  4QX1 A;  2BBA A;  3F2Z A;  4PF1 A;  4XZU G;  3WF1 A;  5DQ0 A;  3P6B A;  4AAX A;  1UY2 A;  3GXU A;  3HNM A;  4MAD A;  2V72 A;  2C26 A;  1JHJ A;  1GOH A;  1F4H A;  4GWJ A;  4KMQ A;  2BGP A;  2VMF A;  2RV9 A;  1DLC A;  4CU7 A;  2RJ2 A;  3CDZ B;  2ID4 A;  3I2K A;  1PMJ X;  2J1U A;  4DXR A;  2VZP A;  3ACF A;  1JZ6 A;  1IQD C;  4ARX A;  4HG6 B;  3THC A;  4ZZ5 A;  4XUT A;  2V4V A;  3OEA A;  2C9K A;  3I2H A;  2JE8 A;  4OUE A;  3ACH A;  4QDQ A;  2W94 A;  4P00 B;  2Y6J A;  5J1X A;  2QQK A;  2YG0 A;  1XNT A;  3SKJ E;  3W5N A;  1JZ7 A;  1F4A A;  1UMH A;  2WBK A;  1TVG A;  3FN9 A;  4BJ0 A;  5CYY A;  5IYY A;  2VM9 A;  3T0B A;  2W92 A;  3HNY M;  1JYV A;  3OB8 A;  1XC6 A;  1UX7 A;  2W87 A;  3MV0 1;  4BK4 A;  1UYY A;  4QX0 A;  2X05 A;  4QB2 A;  5EJ1 B;  2ORX A;  3OBA A;  5LA0 A;  2DDU A;  2YFZ A;  4QAW A;  1TG7 A;  1W99 A;  3LEI A;  4ARY A;  1UY3 A;  1GMM A;  1SDD B;  3T2O A;  3T0D A;  2XON A;  5JR2 A;  4TTG A;  4BDV B;  2R7E B;  4A44 A;  4UOJ A;  4DEV A;  2BER A;  5G04 L;  2VL4 A;  4OZO A;  4DUX A;  5I0D A;  3HOB A;  4JHZ A;  4ZY9 A;  2VCA A;  3WEZ A;  1J84 A;  2YC2 A;  2HYX A;  4OMC A;  4QX3 A;  4RYD A;  3VDC A;  1UXZ A;  4QX2 A;  4AG4 A;  3HJR A;  1K42 A;  3DYM A;  2Y6H A;  4XUN A;  3WNM A;  4LPL A;  3K4D A;  1UZ0 A;  4XVH A;  1NKG A;  4W4Z A;  2W5F A;  5JXI A;  3SEP A;  3VD9 A;  2Y6L A;  1OF3 A;  2ORZ A;  3IDA A;  2EIB A;  3III A;  1SHW B;  4TXW A;  5JUV A;  3HN3 A;  3NNG A;  2VZQ A;  3WF2 A;  3OEB A;  3EB7 A;  4GWI A;  1UY4 A;  4E8D A;  1GU3 A;  2DCK A;  3ACI A;  1CZT A;  3K46 A;  3T0A A;  2VO5 A;  3FHA A;  1CZS A;  5IJR A;  1LNS A;  1YQ2 A;  2QBX A;  2W95 A;  4JX0 A;  1JZ5 A;  4A3Z A;  1KGY A;  2W46 A;  2VZ1 A;  4DEQ A;  2VZ3 A;  3WNO A;  1UMI A;  3C7F A;  1R64 A;  2Z4F A;  1K3I A;  3K4Z A;  2VTF A;  3P1I A;  2OKX A;  3U37 A;  3WNP A;  2QQN A;  3MBW A;  3ABZ A;  1H6Y A;  2EID A;  4A41 A;  4YPJ A;  1P8J A;  3PUH A;  2E31 A;  2ZEW A;  1NX9 A;  3HNB M;  3A22 A;  4Z2A A;  4QB1 A;  1PMH X;  1W9S A;  1JZ4 A;  1US2 A;  3CKH A;  1JU3 A;  5C71 A;  3I3E A;  3T09 A;  2XHN A;  4A42 A;  1JZ3 A;  2WO3 A;  1T2X A;  1ULO A;  3A7Q A;  2Y6K A;  5LA1 A;  3EYP A;  2W3J A;  5C70 A;  1PX3 A;  2WAO A;  3W5M A;  3T2Q A;  2VMD A;  5HPO A;  3PUI A;  3ACG A;  2B4K A;  4XUO A;  3WNL A;  5HXM A;  2WN2 A;  2WUH A;  3K4A A;  4JKL A;  2J1R A;  3DYO A;  4ZXE A;  4OMD A;  5A1A A;  4RN5 A;  3C8X A;  2BGO A;  4D0Q A;  3T2P A;  1O8P A;  1WCQ A;  3I3B A;  2DCJ A;  2VZT A;  2X10 A;  1K12 A;  2W1W A;  2WQ8 A;  3I97 A;  2WZE A;  4CU6 A;  3CZJ A;  5EIY B;  3NJV A;  2WO2 A;  3LQC A;  3D3A A;  2J1S A;  3FL7 A;  4CUC A;  2W91 A;  4W8J A;  1W8N A;  1RYY A;  4LHS A;  4ZZ8 A;  4GZ9 A;  1GQP A;  4XUR A;  1NUK A;  4ET7 A;  3IAP A;  2WZ8 A;  3AC0 A;  4QPW A;  2ZXQ A; 
#chains in the Genus database with same CATH topology
 2XVK A;  3AP6 A;  3N9O A;  3IBM A;  3MIB A;  3AXE A;  3K2O A;  4PT6 A;  4WVM A;  2I45 A;  4E4H A;  2CHH A;  5A6Z A;  2GN3 A;  5BYN A;  3RMX A;  3PTY A;  1D4M 1;  1AVB A;  1GP6 A;  2XHK A;  1ZVF A;  3I59 A;  3N9M A;  3TBD A;  3VD7 A;  3WUD A;  5KHH A;  4HBN A;  3RI9 A;  2OUH A;  3WG4 A;  4AK3 A;  5LB6 A;  2TBV A;  5T50 A;  2W68 A;  3S5A A;  3WQ7 A;  5A3U A;  3VD4 A;  4IW3 A;  1AR6 2;  1C8M 3;  1VRH 1;  4HET A;  5F3E A;  1U12 A;  2J1E A;  3DEM A;  4CA9 A;  5FY0 A;  1X50 A;  4XPV A;  2JDA A;  4R52 A;  4LK6 A;  5DMY A;  3ST7 A;  1H1I A;  2GNB A;  5FKB A;  4AHZ A;  3VKF C;  2JDH A;  4H7M A;  2BJS A;  1UU5 A;  4LK7 A;  1HDK A;  2E7A A;  1LHW A;  2UWB A;  3CMG A;  1B35 A;  2OUJ A;  4IEY A;  1DQ4 A;  5LBC A;  2ZBJ A;  4BQ1 A;  2VVD A;  2ZHN A;  3ZFG C;  3WLU A;  1S4C A;  3CIH A;  4EWE A;  3ES1 A;  1ZRE A;  1H4H A;  4NHK A;  2HWC 1;  3RYR A;  1LU2 A;  1MS8 A;  3AL6 A;  2ZPX A;  1AR7 1;  1QOO A;  4N9H A;  4PQQ A;  3UKN A;  4ASL A;  2LRP A;  1ZRC A;  3B94 A;  4YVS A;  1V9U 3;  5FZ4 A;  2VCC A;  1V0A A;  1WD4 A;  4X8N A;  3WW1 A;  1D2S A;  4L0P A;  4CUA A;  5EQU A;  1RUH 1;  1VBC 1;  2RS3 1;  2WO1 A;  4QB6 A;  2VXJ A;  4TSV A;  2XJP A;  2E51 A;  2GAL A;  4CUB A;  4MGK E;  1JXN A;  1VRB A;  2ZZQ A;  5JZG C;  4K21 A;  3ZPO A;  1GSL A;  3THD A;  5H9R A;  1VLN A;  4LJH A;  1FMD 1;  1RUG 1;  2ZS6 B;  3QD6 A;  1Z7S 3;  5FTT C;  4M4P A;  5ABJ C;  2BFU S;  5T55 A;  5F9T A;  4AXO A;  1PM7 A;  2Q5T A;  2Y6G A;  3ILN A;  1PVC 1;  3M3E A;  3VBR B;  3RVH A;  4IL7 A;  5JDB A;  1KJR A;  1B09 A;  4CCJ A;  4EWA A;  2FD8 A;  3WCS A;  4S2F A;  3N7L A;  4SBV A;  1RJ8 A;  4N43 C;  2E33 A;  3R4D B;  5F7U A;  3ELN A;  4IER A;  4MGY E;  2DYC A;  3CF6 E;  2ZGR A;  4TWT A;  4WVZ A;  3TYJ A;  4H14 A;  1SFY A;  1HKD A;  4JGZ A;  4XCB A;  1LOF C;  2RR1 2;  4KBZ A;  5T5L A;  2PHL A;  4XMA A;  2WNV B;  2VZS A;  1FPN 1;  1BMV 1;  2JB4 A;  3J8F 3;  4L9B A;  4UFK A;  2X09 A;  2YU1 A;  1E5S A;  1ND2 A;  3CQO A;  5FZK A;  5FZ7 A;  3WNK A;  5AC9 2;  1CQ9 A;  4ONU A;  1BBT 1;  3SIT A;  3DL3 A;  2Z2S B;  4IGP A;  5FZH A;  2MNG A;  4RR3 B;  5AFE A;  3PVE A;  4IEZ A;  5K9Y A;  3C7O A;  3K77 A;  2B9V A;  2XLA A;  1RUJ 2;  4V2W A;  1VBD 3;  4MOA A;  3GJA A;  3RMY A;  2EXH A;  5FP4 A;  2RHP A;  4M3C F;  3DUI A;  3H8X A;  1IZ3 A;  3I3D A;  1UYX A;  1RJ7 A;  3GGL A;  4KI5 M;  4K1Y A;  1RIR A;  3GBF A;  4M0H A;  1PX4 A;  4RQP C;  5LAS A;  4CPB D;  5CFD B;  2AC1 A;  4D6S A;  3SEE A;  2VUL A;  4TLG A;  4MGI E;  2VBB A;  3SC7 X;  4XET A;  4AYU A;  3GAL A;  3HBZ A;  2IWG B;  2CNA A;  5DDJ 1;  4NPM A;  4LO4 B;  3GHM A;  3S57 A;  2ET1 A;  3VBS A;  4EWD A;  3M3C A;  3RZJ A;  2CGP A;  4X6Q B;  5AVA A;  4P02 B;  1BYH A;  1UNB A;  2VZR A;  3OBR A;  2EAL A;  2RS5 1;  3EJK A;  2QZ3 A;  1NCR A;  3MUY 1;  2OPK A;  3FWE A;  4M3C B;  1UO9 A;  3HT1 A;  3POS A;  4AWD A;  3ZDS A;  1O4Z A;  2RMU 1;  1HJG A;  1T6B X;  4DB5 A;  1RUE 1;  1VBB 3;  3RZZ A;  3GHN A;  3BOW A;  1OUS A;  1QNY A;  4IEV A;  5FXX A;  2KR2 A;  3WQ1 A;  3ZMO A;  3JD7 1;  4DRR A;  2E26 A;  5FYZ A;  1G8W A;  1S0G A;  3GM8 A;  4AOC A;  4BPZ A;  4AQS A;  2X5I A;  4WVV A;  5C5U A;  2WLQ A;  1EV1 3;  5AVP A;  3KGL A;  5FYH A;  4NVP A;  1Y7B A;  2VOK A;  1ENQ A;  4XFA A;  5F6K A;  1WW4 A;  5JIA A;  4DUV A;  3C7H A;  2LM3 A;  3Q8B A;  4CCN A;  2CDO A;  4HL0 A;  3MF6 A;  1O6U A;  3MW4 A;  1NLS A;  2CYF A;  2DF7 A;  3SH3 A;  1ZZ7 A;  3VBF A;  5IAT A;  5JOY A;  2WAA A;  1WUV A;  3ZIW A;  1S0E A;  4DXT A;  2WLP A;  4JKK A;  3VBH A;  1ND3 A;  2WNO A;  2VR4 A;  4I0A A;  1I5P A;  4LIT A;  2VY0 A;  3SHR A;  5FQ0 B;  4MGQ A;  1V6M A;  1Z7S 2;  1MVE A;  1ZZ6 A;  1NAE A;  3I2I A;  4XIO A;  1JUH A;  3NJX A;  4K6B A;  2RJK A;  2ZEY A;  4QDS A;  2VNG A;  4QX8 A;  3I59 B;  3BGA A;  4OI0 A;  5DUU A;  4NIH A;  1RHI 1;  4A7Y A;  2ZX0 A;  5BNO A;  3WG1 A;  1RVF 1;  3CLP A;  3HMY A;  3G7D A;  2ZHM A;  3HD8 B;  3IN9 A;  3IAQ A;  3NV2 A;  4AFD A;  2JDY A;  3AZY A;  2FCU A;  2R1D A;  2XWB B;  1L7Q A;  3TEW A;  2NYY A;  2AUY A;  1JN2 P;  3K75 B;  3LSD A;  3O1R A;  2WZP P;  4E2G A;  3JQW A;  3J8F 2;  5EFU A;  1JH5 A;  1MAC A;  4QWN A;  2PHU A;  2WQZ C;  4Y4Y A;  3T08 A;  4IQP A;  1QF3 A;  4W50 A;  3ZSE A;  4A4A A;  4OZX A;  1LOB A;  2EIE A;  2G9G A;  4Q0U A;  4OFG A;  1WMF A;  4URT A;  4CXY A;  3HPN A;  1B35 B;  1O8S A;  1W3V A;  1W9F A;  3TN9 1;  2BOI A;  4Q29 A;  1ZZB A;  3WY6 A;  5FJH A;  1EUU A;  4I09 A;  5LA0 A;  4A6O A;  2J1V A;  3PU8 A;  3VBO A;  5C4W C;  3FUQ A;  3M70 A;  3OG2 A;  4S2G A;  1AR6 1;  1FOD 3;  1OSG A;  4XEZ A;  3ZYG A;  4Q4X 3;  3RFR A;  4ITC A;  3AM2 A;  2ZKL A;  5JAX A;  2ARB A;  1BXH A;  4YVS B;  1WA4 A;  3F2Z A;  3E6C C;  1D4V B;  2IUW A;  5A7N A;  1MZE A;  4MGZ E;  3B02 A;  3RZH A;  2IXL A;  4EYU A;  4AAX A;  1UW8 A;  1D0G A;  1KD7 A;  1GOH A;  2ADD A;  3GZU C;  5A32 A;  5K7P A;  3BOD A;  4ZU7 A;  1DIW A;  3QAC A;  1OD5 A;  3MLK A;  3PIJ A;  4KMQ A;  2YUE A;  4QQ2 A;  4QGL A;  4DS0 A;  4MYE A;  4D7Y A;  1HRI 1;  2UU8 A;  3POW A;  4LBQ A;  2DCZ A;  2RJ2 A;  4B4R A;  1VBB 2;  1JOJ A;  3CDZ B;  1JOP A;  3T1L A;  1QIQ A;  4W65 A;  4FOQ A;  1QJU 3;  2BRT A;  4FAG A;  3ACF A;  4MSV A;  2IXC A;  3N4M A;  4YGB A;  5DXD A;  4AED C;  4CCM A;  1GV9 A;  2GC0 A;  2VOW A;  3PIG A;  2BEO A;  2JDN A;  3ITQ A;  1W2T A;  4YM1 A;  5ANN A;  1POQ A;  4S2D A;  2XLF A;  4XJZ A;  4YZ2 A;  2ZX2 A;  3N9Q A;  1G9C A;  4B7K A;  5FZM A;  4CDQ A;  1ZM1 A;  1W05 A;  2ARX A;  5BNP C;  1REE A;  4UT5 A;  4XHB A;  5A3W A;  2JE8 A;  1BKZ A;  2I2S A;  1WLC A;  2IVJ A;  3KCX A;  4LOT A;  5E8A A;  4YVW C;  4A6S A;  1ND2 B;  3TAY A;  1OQ1 A;  5FZ0 A;  5FPX A;  2XJU A;  2OQ7 A;  3TEX A;  3TEZ A;  3W5N A;  3WV6 A;  1SCS A;  3RJ2 X;  2XB6 C;  5FZA A;  1UOF A;  3FZ3 A;  3KHC A;  2VM9 A;  1F15 A;  1LGC A;  4H55 A;  4JRL A;  3WDY A;  3R0R A;  2NQY A;  2RR1 1;  4C0H A;  3AMH A;  3LB9 A;  2RG4 A;  3ZYR A;  3ZYF A;  4AGR A;  3AP7 A;  1RXF A;  4CEW A;  2SLI A;  5GAL A;  4QX0 A;  3O0V A;  4O9E A;  4ISR A;  4QB2 A;  5FMC A;  4YM2 A;  5EJ1 B;  5I0T A;  3ZFE A;  1UZZ A;  1GYK A;  2JJ6 A;  1VAV A;  2YGM A;  4L11 A;  4IEX A;  2R04 2;  4M3C E;  3VBS B;  5FBZ A;  5IW0 A;  1NCQ C;  1RUJ 1;  3AB0 A;  4ZU5 A;  5JR2 A;  2A6Y A;  1NCR B;  4K20 A;  5D8A B;  4K40 A;  2DTW A;  1C57 A;  1O4Y A;  1W8Z A;  2FMY A;  1CN1 A;  4LOR A;  4BDV B;  3J9S A;  4M00 A;  1OVP A;  3Q8C A;  2D6L X;  4QPG A;  3ZXJ A;  4DEV A;  4QXH A;  4Y33 A;  1YIF A;  4OZO A;  5G04 L;  5JMC A;  3GBG A;  4ZY9 A;  4EZ4 A;  3CJI A;  1FOD 2;  1PZ8 A;  3BKZ A;  2DVG A;  2NMN A;  4Q4X 2;  4OMC A;  4ISQ A;  1IG0 A;  2X5I B;  3BCW A;  4QX3 A;  3BU0 A;  1JHN A;  4FFF A;  1UXZ A;  4QX2 A;  4AI9 A;  5FAX A;  2A5Z A;  3DYM A;  2Y6H A;  4UFL A;  3AKQ A;  4BE3 A;  5F37 A;  5LAT A;  1WMX A;  3VBF B;  2W5F A;  3FLT A;  1HB3 A;  3FE5 A;  4FPL A;  3VD9 A;  3J7M A;  2Y6L A;  2BYV E;  1YFW A;  1ND3 B;  2ORZ A;  4R9D A;  2CL2 A;  5GM0 A;  2VH9 A;  2EIB A;  3R6S A;  1SHW B;  4Q1P A;  1MEC 2;  4TXW A;  1RB8 G;  3OJB A;  5JUV A;  3ZIX A;  4HON A;  1EYB A;  1H0B A;  3KSC A;  4YW7 A;  4YW6 A;  5GLW A;  2WT0 A;  1A8M A;  2VZQ A;  4LHK A;  3OEB A;  4K9S A;  1ENX A;  1QJU 2;  3O12 A;  4GWI A;  4MHR A;  4Q0V A;  4QXC A;  1OKQ A;  5KBF A;  1ULC A;  4HVO A;  4XJU A;  1UKR A;  1GZW B;  1YWK A;  1VB2 A;  2D5H A;  2VUC A;  2TUN A;  4LO5 B;  5LZ6 A;  2QCS B;  1A34 A;  5FMO L;  4AGG A;  1LNS A;  5I8Y A;  1ZX5 A;  1YQ2 A;  2NMO A;  2R06 3;  4NHL A;  3WDU A;  1Z7S 1;  1YFX A;  3AFG A;  2GAU A;  5AFB A;  2VZ3 A;  3SCF A;  1XE0 A;  2XJV A;  1R64 A;  1POV 3;  3K4Z A;  2OKX A;  3U37 A;  4URA A;  3H3Z A;  4FT8 A;  1G9B A;  1VJ2 A;  2QQN A;  2P3Y A;  5A3L A;  2VNR A;  3DN7 A;  4A41 A;  5DZF A;  3U07 A;  3PUH A;  2A3Y A;  5I8T A;  1JUI A;  1V6O A;  1LOD A;  1HB2 A;  3ORJ A;  4RGK A;  1PNG A;  3KWV A;  5JI9 A;  4QQL A;  2X8K A;  3J8F 1;  1IG3 A;  1AF9 A;  3BTX A;  1FXZ A;  4B3N A;  1HX6 A;  1NZI A;  2GMP A;  1W9S A;  1ZRD A;  5H9S A;  1ODM A;  4ASK A;  1C5H A;  3RYP A;  4XFI A;  4CCC A;  2WZR 3;  4U36 A;  1UIK A;  1X8M A;  4B1L A;  4LBQ D;  4XQW A;  4LT5 A;  3FC0 A;  1AR8 3;  4OHV A;  5C71 A;  1FAT A;  5A32 B;  3I3Q A;  3LEM A;  4XXA A;  1LTE A;  4FFH A;  5FYY A;  1DLL A;  5A7W A;  5T3N A;  4B4Q A;  1MVQ A;  2F4P A;  3CHX A;  4LLF A;  5E1R A;  3IPV A;  5JOX A;  2JKB A;  3ILF A;  2DUO A;  1J59 A;  1IS3 A;  1NA1 A;  1POV 0;  2JG9 A;  4BB3 A;  5LA1 A;  3ES4 A;  3ZKU A;  4LBQ B;  3GZE A;  1PX3 A;  1GNZ A;  1AX0 A;  4COY A;  4RFR B;  4CDX C;  1U5Y A;  1EY2 A;  5K8S A;  1PO2 3;  2HWD 3;  4XHX A;  1QJZ A;  1J1T A;  4QKB A;  4XF3 A;  2ZGM A;  2K0G A;  1F35 A;  4IV3 C;  2A73 B;  4CDW C;  2XR4 A;  2J1R A;  3W59 A;  3DYO A;  1YC6 1;  3NNF A;  4QPI C;  4CDQ B;  4ZXE A;  4Q4W 2;  1COV 3;  3C8X A;  3ATG A;  2P17 A;  1OI6 A;  4D0Q A;  2VUJ A;  4K7J A;  1DG6 A;  1PK6 A;  1O8P A;  1VBB 1;  1WCQ A;  2Q1Z B;  3VZO A;  1XNK A;  4I3G A;  1AXY A;  3WIN E;  3P5B A;  1LED A;  1CES A;  1OA3 A;  3C2U A;  1YJL A;  2RDR A;  3UKT A;  1OQD A;  2EVX A;  2P3J A;  4YSF A;  4NRQ A;  2IFR A;  3PU3 A;  5FIX A;  2ARA A;  1RL3 A;  2XPJ A;  2TEP A;  1HJF A;  3NJV A;  4WM7 A;  1BK1 A;  4Y1V A;  3H42 B;  5KHJ A;  3SCG A;  2J1S A;  2P4E A;  2ZKN A;  3FL7 A;  2YHJ A;  5E6H A;  1FNZ A;  1XE8 A;  4W8J A;  3ZSK A;  1RYY A;  4ZZ8 A;  4GZ9 A;  1ZA4 A;  3OBT A;  3USS A;  3WOG A;  1D0H A;  3ZN5 A;  1U5Z A;  5J36 A;  5IAX A;  1O5U A;  1NUK A;  3LKJ A;  3OSD A;  4DXZ A;  5LWB A;  4BME A;  1PGW 2;  1IOA A;  2CAU A;  2XBO 3;  2OT7 A;  4NIA A;  4FOW A;  3CNA A;  3TOJ A;  1NG0 A;  2WNU A;  2VQU A;  1F31 A;  1MQT A;  2ZAB A;  4COW A;  5CNA A;  3U78 A;  2RS3 2;  5L7O A;  4EN6 B;  4GMP 1;  3VDA A;  1GUI A;  2GP5 A;  2XKO A;  1RUD 3;  4QPG B;  1DYO A;  5FBJ A;  1CZV A;  5EZW A;  4FBF A;  4OUS A;  2XOM A;  2ADE A;  1VMF A;  2IC1 A;  4BQ5 A;  3O1M A;  1DGL A;  3CJI B;  1ZA7 A;  5BY5 A;  4XFG A;  5FDB A;  2VOT A;  1KEX A;  1GZ9 A;  5CKN A;  5EWS A;  5FZ6 A;  2JX9 A;  2G4I A;  2R49 A;  3E6D A;  4HN1 A;  2R04 1;  2WWS A;  2Y33 A;  1XNB A;  4CCL A;  1JOB A;  1HB1 A;  5A70 A;  4ZS2 A;  3NNJ A;  2Z5W A;  4PIZ A;  2WL1 A;  5DUW A;  2VVF A;  2C24 A;  2PXJ A;  1AR8 2;  2B42 B;  1FX5 A;  2WJS A;  3WP5 A;  1GZT A;  2BUK A;  4C1W A;  2RDS A;  3GDB A;  1QXP A;  4MGS A;  5FXZ A;  2QQV A;  1JZ2 A;  5A3T A;  2EIC A;  3GZT B;  3KZ4 C;  1EP0 A;  1W8W A;  3IDC B;  3EO6 A;  3ZO0 B;  5FY9 A;  4CCD A;  1FOD 1;  2X53 S;  2P6H A;  3APB A;  4F3J A;  3VBU C;  1XYO A;  4Q4X 1;  4QMA A;  3SCH A;  4CU9 A;  5FRE A;  4ZKT B;  1BMV 2;  3CJX A;  5FYC A;  2YBP A;  2R16 A;  4AW7 A;  1DGR A;  1D7P M;  3VBR A;  3NRU A;  2HWD 2;  4GAZ A;  5CFC C;  1D2Q A;  3WSO A;  3NVC A;  3VD3 A;  1GZC A;  5IK5 A;  4JGY A;  5D2A A;  2E6V A;  2DVF A;  4YG6 A;  4UXA A;  4XUQ A;  1GFF 2;  3HBK A;  3MUZ 1;  2GNM A;  5C8C A;  5JVV A;  1TMF 3;  5GZD A;  3WF4 A;  2Y0O A;  1W8O A;  1COV 2;  1XYP A;  1MEC 1;  2VTX J;  3D82 A;  5FZD A;  1CIY A;  2VQ0 A;  2ZMK A;  4CU8 A;  5KHI A;  3OUJ A;  3WF0 A;  5DAQ A;  4BCU A;  1TNR A;  2YY1 A;  1IKP A;  4P9I A;  1ST8 A;  1ULE A;  4MXW A;  2Q8O A;  5KXD A;  4M4R A;  1QJU 1;  1Y9G A;  4IEQ A;  3WCR A;  1NLR A;  4OI2 A;  4FTE A;  5C9A A;  4XAA A;  3VDD A;  1GLH A;  3I7D A;  3B9I A;  1R09 3;  5FJK A;  3IT8 A;  3VD5 A;  3AMQ A;  5BPX A;  3MFA A;  5HBA A;  1K5M C;  1ULP A;  5JXJ A;  2ZJC A;  2QNK A;  1BZW A;  1DYK A;  3PNA A;  1S0C A;  4IES A;  5CKM A;  2CDP A;  4KWK A;  2SBA A;  1IPJ A;  1RUF 3;  2XBO 2;  3D0J A;  3A21 A;  1UY0 A;  3M4F A;  1W6O A;  4M01 A;  3DPR C;  3MI8 A;  3O5S A;  5GZF A;  4D94 A;  1QWR A;  2FCT A;  1O3S A;  4RGA A;  4Y3O A;  3M3O A;  3G6J B;  4Y4R A;  4CEY C;  3IPV B;  1WW7 A;  1SLC A;  5FO9 B;  4M3C A;  1NA1 B;  2JG9 B;  5BNP B;  1RUD 2;  4ATF A;  2RVA A;  1Z0H A;  1G9F A;  4MG2 A;  3DV8 A;  1Z78 A;  4AVV A;  1LOC A;  1RUC 3;  2AEN A;  4JGZ C;  2JG8 C;  1UF2 C;  2XLG A;  3OGG A;  2NPI A;  1ZNP A;  5DZG A;  3GYD A;  3MF9 A;  5FYU A;  5GZG A;  1W04 A;  3LPF A;  3NKT A;  4CDU C;  1ZZ9 A;  2VG9 A;  4HMZ A;  4GH4 C;  1L7R A;  2QQJ A;  4UYB A;  2ZAH A;  1RIT A;  3ZFF C;  4DUW A;  3JXS A;  1RGS A;  5B2G B;  5JSO A;  5JXG A;  1SLA A;  4ZU4 A;  5H9P A;  1XB9 A;  1H9P A;  2FDH A;  4K3U A;  4ES8 A;  2DUP A;  3LDR A;  2P37 A;  1Y9M A;  5FZ8 A;  1O3R A;  5HV4 A;  4QX5 A;  2GH8 A;  1HN0 A;  2BW8 A;  4FP2 A;  2VMC A;  2RS1 3;  4XFF A;  5F1R A;  4DRV A;  3KCY A;  1QOT A;  3T30 A;  4AI2 A;  1JYN A;  1OOP C;  1PK6 B;  5FY7 A;  4DPN A;  4A45 A;  5FO7 B;  4OQ9 A;  4AEK A;  2DBN A;  3JUU A;  2O14 A;  4UFJ A;  2QJV A;  5FQ0 A;  2W1S A;  1L3J A;  5A6Q A;  2P3K A;  2G9Z A;  1JYX A;  1SG3 A;  1XBF A;  1N47 A;  1JBC A;  4NOT A;  2FDJ A;  3AYC A;  2IXI A;  4QXB A;  3OD0 A;  5E88 A;  4CVU A;  3PUR A;  2KD7 A;  4JHT A;  3A4U A;  3OGV A;  4QGN A;  4WM7 B;  3ZM8 A;  3ZVX A;  2ZHL A;  2GDF A;  4LUL A;  4Q4W 1;  2WAB A;  4BA6 A;  5J09 A;  3TN9 2;  1HQN A;  2ZZJ A;  4NMI A;  5L19 A;  1TMF 2;  4WV8 A;  4AVS A;  1GNY A;  1UD1 A;  3WG3 A;  4FQ4 A;  3MIC A;  4HVR A;  4B1M A;  3VZN A;  2Y8K A;  5BV6 A;  3KCC A;  4HVQ A;  1W0P A;  5LK7 B;  2XL7 A;  2OX0 A;  2XJR A;  1I5Z A;  2YU2 A;  4HT1 T;  4AFC A;  1LOA A;  1V6L A;  2WNU B;  4QT6 A;  1MQT B;  2NN8 A;  4RHV 3;  5LA2 A;  5L7O B;  1GWK A;  1BLZ A;  4UAP A;  1LGB A;  1UL9 A;  2D97 A;  1IKQ A;  2AYH A;  2QE3 A;  1XSQ A;  2O8O A;  3VB9 A;  4OLL A;  1A3K A;  1ALY A;  4QKN A;  1CAX B;  1ENS A;  4Q0Q A;  1HRI 2;  1OPM A;  5LY2 A;  1PGW 1;  1VE0 A;  3S0M A;  4L97 A;  4LO7 A;  1W0N A;  2HLE A;  4R8H A;  4AZZ A;  1RUF 2;  2XGX A;  1POV 1;  1SFN A;  3CEW A;  3M3I A;  4IUG A;  5IUQ A;  3EQE A;  3QLQ A;  4JV4 A;  2K2S A;  1UX6 A;  2BNM A;  4JTN A;  5IFT A;  3J7L A;  5GKA C;  3IMN A;  1FT9 A;  1H6X A;  1W39 A;  4P9W A;  1FV2 A;  1YNA A;  4HK9 A;  3FJS A;  1GQG A;  2H6C A;  2MEV 3;  5DPN A;  1QEX A;  3LIG A;  5LBF A;  4LHL A;  3T4H B;  3ZKY A;  5I0S A;  4XC9 A;  4I0W B;  3JBG 3;  4YW2 A;  3HT2 A;  1RUC 2;  1UAI A;  3POE A;  5LRR A;  5CB7 A;  1Q5O A;  3MDP A;  1KXG A;  3CZU A;  1ASJ 3;  3IB3 A;  2HWF 3;  1QQP 3;  2XJQ A;  3KT7 A;  4UF0 B;  4E8C A;  2R30 A;  3IM0 A;  3LZZ A;  5C3O A;  2C6S A;  4CYD A;  2BBA A;  2WZR 1;  1VP6 A;  1LJ7 A;  3POI A;  3OUH A;  4LE4 A;  2WT2 A;  4PF1 A;  4XZU G;  5DQ0 A;  3VZM A;  3WF1 A;  1AR8 1;  1XNC A;  4JGY B;  1UY2 A;  4GAL A;  3GXU A;  1W8H A;  1VAL A;  2A3X A;  2C26 A;  2JDK A;  2PTM A;  3HNM A;  1K5J A;  2DV9 A;  3ZYH A;  5IVE A;  1IQA A;  3AJY A;  4XDQ A;  5C8C B;  3KGZ A;  3BTY A;  1JYT A;  4GWJ A;  4TZD A;  1WLT A;  2RV9 A;  1APN A;  1RUI 3;  2RS1 2;  3INA A;  4CP2 A;  3M8L A;  4CP0 A;  4YW3 A;  3ZXL A;  4B8E A;  4MXW B;  3I2K A;  1UU4 A;  2QUO A;  3I49 A;  4Z07 A;  3J26 N;  2J1U A;  4DXR A;  5FR3 A;  2HWD 1;  2JIC A;  4ARX A;  1AL2 3;  2YC0 A;  1Q56 A;  4HG6 B;  2P1B A;  1STM A;  3THC A;  3VDD B;  5C9A B;  3UV9 A;  1FV3 A;  4GKY A;  1BVP 1;  3LOI A;  1GR3 A;  4OUL A;  1GBG A;  3AFK A;  4N9I A;  1CVN A;  2V4V A;  1MR5 A;  1COV 1;  4UFI A;  3UGH A;  1FAY A;  4IE6 A;  4AQT A;  3I2H A;  2WSU A;  4NJ4 A;  2PA7 A;  4PDW A;  1SAC A;  1WZX A;  4BHP A;  3O1O A;  4HPK A;  3LDK A;  4BQ3 A;  1GKB A;  3NAP C;  4NR1 A;  2H0B A;  5CIR A;  1DCS A;  1C8M 2;  1SBD A;  2Y6J A;  4OQ8 A;  5D1I A;  3MW2 A;  4FVV A;  4TLF A;  2QQK A;  5FYS A;  3OCP A;  2YG0 A;  1W6O B;  3SKJ E;  1G86 A;  2I07 B;  4BMB A;  4FPH A;  4CDW B;  5A3P A;  4D6Q A;  2ZX1 A;  4UW4 A;  4FP3 A;  4RHV 2;  4QPI B;  5CYY A;  2DFC A;  5D8A A;  1TQ5 A;  4XJ8 A;  2Z42 A;  1H8T A;  4W6X A;  1YCI A;  5LRS A;  1JYV A;  3H1M A;  1XC6 A;  5L73 A;  1J1L A;  1QNW A;  2VE1 A;  2W87 A;  1Y3T A;  3Q8F A;  4XTP A;  4UBG A;  4HKL A;  3LAG A;  4JQT A;  2OII A;  4G3Y C;  2ORX A;  5DAV A;  2XBO 1;  3OBA A;  3MEP A;  4XF4 A;  4Q8K A;  5JCT A;  1ACC A;  2WRA A;  2YFZ A;  3AZZ A;  1TEI A;  5FLJ A;  5T5P A;  1UY3 A;  3W58 A;  1V9U 2;  3TEY A;  2LRO A;  3GZA A;  1OQE A;  4JDM A;  1PZ9 A;  2C0Z A;  4TTG A;  1X8E A;  2JIJ A;  5FK7 A;  2D7F A;  2R7E B;  2D3R A;  3O0W A;  4Q27 A;  1RUD 1;  1PO1 3;  4JC1 A;  4UOJ A;  1YQC A;  5T5J A;  1QXR A;  5CVR A;  2MEV 2;  1W6Q B;  2V5Y A;  4JVA A;  4DUX A;  5I0D A;  3HOB A;  4FOY A;  4BIO A;  5FMD A;  3VUO A;  1MS3 A;  1AHS A;  3WR0 A;  2YC2 A;  3JQX A;  1AYM 3;  2YPD A;  1ASJ 2;  5IK7 A;  3V0B A;  3MLL A;  5K0U C;  3HJR A;  1KS5 A;  3R05 A;  4Q5O A;  1CR7 A;  5K4L A;  2VUA A;  3LGR A;  5JWP A;  2DFB A;  4LPL A;  2B5H A;  3ILR A;  3K4D A;  4XVH A;  4LBM A;  5FYB A;  1UZY A;  2P3I A;  3M2M A;  1J58 A;  1GZW A;  3E97 A;  3QBQ A;  4GKX A;  4EN9 B;  3SEP A;  4J6G A;  3RS6 A;  5JXI A;  3I2O A;  4YGE A;  4FFG A;  2YBK A;  2FDI A;  3ZFG A;  3PHM A;  3IDA A;  4JZR A;  1AL0 G;  1RUI 2;  4IXL A;  4I0B A;  4Y26 A;  3HN3 A;  2PHD A;  1BK0 A;  4UW5 A;  5FY1 A;  3PVN A;  1LHU A;  3WF2 A;  3EB7 A;  4JRA A;  5GZE A;  2FQP A;  4COV A;  3ZPY A;  2Y38 A;  2IVI B;  5EJ3 A;  3N9N A;  2B7Y A;  1RIN A;  1SDW A;  3OPZ A;  1AXK A;  1I9R A;  1OLM E;  1W06 A;  3O1S A;  3T0A A;  2VO5 A;  1NXM A;  5FP8 A;  2AGS A;  4AQ6 A;  1VBD 2;  5IJR A;  5JZG A;  1TMF 1;  1C1L A;  4COZ A;  3N3H A;  1W8T A;  1U5I A;  4Q2F A;  3SIS A;  4ZHN A;  2W95 A;  5FCC A;  3VBU B;  5ABJ A;  1KGY A;  3MW3 A;  5DAB A;  1XU1 A;  2HWB 3;  3OYW A;  4DEQ A;  2VW2 A;  2Q8C A;  4D7T A;  1DGR N;  4PI0 A;  3RZK A;  1QDO A;  1UMI A;  3C7F A;  3U10 A;  2FZ1 A;  3BU7 A;  2Z4F A;  5F5Q A;  3T2T A;  3P1I A;  4F83 A;  2A6W A;  5BNN C;  3HR9 A;  4YZ5 A;  3ZXA C;  3H8U A;  1R09 1;  4NRM A;  1H6Y A;  2EID A;  2F4L A;  4N43 A;  1Y9Q A;  1MZ6 A;  3MGU A;  4YPJ A;  1P8J A;  4R4Z A;  5KC5 A;  1C8N A;  4AI0 A;  3PDQ A;  5A3N A;  1LOF A;  3K51 A;  2NP0 A;  4LOS A;  5IVY A;  5SV8 A;  5GLU A;  2Q4S A;  2ENR A;  4AEJ A;  1DDL A;  3LDB A;  1LHV A;  4Z2A A;  5H9Q A;  1PMH X;  4KWJ A;  4AF9 A;  1DZT A;  1RUF 1;  3CKH A;  2ZOE B;  1WCS A;  2BNN A;  5FP7 A;  1EV1 2;  3SXW A;  5L9R A;  4LA2 A;  4XF9 A;  3AVS A;  2RJL A;  1M4W A;  3H7Y A;  5FKC A;  4JAA A;  4GWM A;  3DXU A;  2XHN A;  3AMP A;  2VOV A;  4JDO A;  4UW3 A;  3KQ4 B;  1JZ3 A;  5C6C A;  4IV1 C;  1PM4 A;  4RS5 C;  2LTN A;  2ZHK A;  4D7S A;  2BP6 A;  1PO1 2;  2D6M A;  2ZX4 A;  3NO8 A;  3KLS A;  1RUC 1;  4RQP A;  1KJL A;  5C70 A;  1LGN A;  5FZ1 A;  1MS5 A;  3ON7 A;  2B8M A;  5IAV A;  3LOB A;  4XCA A;  1R08 3;  1WME A;  1GP4 A;  1AYM 2;  5L36 A;  1FYU A;  2RM2 3;  1IPK A;  1YXW A;  3T2Q A;  3PUQ A;  2B45 X;  2VXR A;  5HPO A;  1SLI A;  4DMI A;  4MLO A;  3PUI A;  3WNL A;  4CEY B;  1WCD J;  4H7L A;  2WN2 A;  1Y4W A;  4LUK A;  1F9K A;  3KV5 A;  3VL8 A;  5EXO A;  3ZXK A;  4OMD A;  5A1A A;  1E5R A;  2RS1 1;  3D8C A;  4PDW B;  4RSU A;  3SMH A;  1S0B A;  3BAL A;  3D5O A;  3LSE A;  5IK8 A;  2BGO A;  4YZ3 A;  4FPF A;  3ZMN A;  2OQ6 A;  5LEJ A;  3T2P A;  4HPK B;  4BH9 A;  3RZL A;  4EE2 A;  5A7S A;  2DCJ A;  3QCW A;  4CDU B;  4GQ7 A;  1H1A A;  3PJY A;  4KQ7 A;  5IVV A;  2R1B A;  2XXZ A;  2FHR A;  2WZE A;  1BQP A;  1SBF A;  1H2N A;  4CU6 A;  5GLZ A;  5GZC A;  5CG9 A;  2HYK A;  1NZC A;  2ETE A;  3CU7 A;  1H8T B;  3B01 A;  2ZGU A;  5A80 A;  4XZP A;  4YYO A;  1QGL A;  1W6N A;  2VW0 A;  3AP4 A;  4UWD A;  2A6Z A;  5EHD A;  1UPS A;  2XJT A;  5F5A A;  3T3Y A;  1W8N A;  4F7Z A;  3O0X A;  4N53 C;  1VAM A;  1HLC A;  1C8M 1;  1JOD A;  2RE9 A;  4XQD A;  1V00 A;  4XJW A;  4NIG A;  2ILM A;  2WZ8 A;  1VB4 A;  3EBR A;  5DUV A;  3AP9 A;  4E9K A;  2P5B A;  2ZMN A;  3E1F 1;  4P14 A;  3GCX A;  4LR4 A;  2GZW A;  3LEG A;  3NWK A;  1YJK A;  3MYX A;  4RHV 1;  3VKO A;  2ZAA A;  5C3P A;  1GWM A;  2JB8 A;  2VJX A;  1VMH A;  2Y64 A;  4LQR A;  4C8D A;  2HWE 3;  1YUD A;  2PAE A;  2Q30 A;  2W1Q A;  1UOJ A;  5J96 B;  5FOJ B;  5JXH A;  1C5I A;  1LHO A;  3AKS A;  2PHT A;  1UCX A;  2XDV A;  3PVB B;  4AHX A;  5CG8 A;  1U5X A;  2ARC A;  4WM8 C;  1HQL A;  1ZRR A;  1XYN A;  2PAM A;  1Q8O A;  1W6P A;  4C1X A;  2YBS A;  2G19 A;  3KF3 A;  3V0B B;  2A71 A;  2FBE A;  4XF1 A;  2JDM A;  1V9U 1;  3ETP A;  3OPW A;  3THP A;  2JE7 A;  3FHI B;  3AJZ A;  3H50 A;  2D3P A;  5GJ6 A;  1W3X A;  4NID A;  3ZSM A;  3H8O A;  1J3Q A;  3O1V A;  3O14 A;  1LHN A;  4YFW A;  4LKF A;  2KA3 A;  3H1Y A;  1NE6 A;  1UY1 A;  3ZFG B;  2MEV 1;  5C4W A;  5CAD A;  1WW5 A;  5IHR A;  1MPX A;  1OHF A;  3VHN A;  2ZGO A;  4JCK A;  3RWN A;  1RED A;  3N7J A;  1W6M A;  2J42 A;  4NWW A;  1O3Q A;  1ASJ 1;  2ERF A;  1Q43 A;  2Y60 A;  5SV5 A;  1R08 2;  1US3 A;  2UYA A;  4I02 A;  3D0S A;  4XUP A;  4FPE A;  5J98 B;  5C5T A;  4KWU A;  5B4N A;  1WBF A;  2QQI A;  4PQ9 A;  4Y5T A;  4BXF A;  4CRQ A;  2WA4 A;  4P9G A;  1CX1 A;  3VKM A;  1W90 A;  2ZGK A;  5JZG B;  1BCX A;  2VBD A;  3B00 A;  1URX A;  2GN7 A;  1KS4 A;  3DKW A;  3GF6 A;  5FLI A;  5IVB A;  1DBN A;  1RUI 1;  4A7Z A;  3KT4 A;  5JOW A;  3UKV A;  2X29 A;  3TNP B;  5ABJ B;  2C1F A;  4WBB A;  2HWC 3;  3OYW B;  4WZC A;  1DHK B;  1UN1 A;  2OYZ A;  4A2U A;  2O1Q A;  1R1A 3;  2UUR A;  2CWS A;  2Y6F A;  3AYD A;  3U1X A;  1EPZ A;  2JEM A;  3NV4 A;  2XUM A;  2VMH A;  4QU1 A;  5FZO A;  5FRA A;  2VZO A;  4AED A;  5J3U A;  4NE9 A;  4HAN A;  3VHR A;  4NRO A;  4D8M A;  5EV7 A;  1VBC 3;  4N43 B;  3VZL A;  1VBD 1;  2D6N A;  4AHY A;  2PHR A;  5C3Q A;  5JLV A;  4C0B A;  1S2K A;  1XNA A;  2WSV A;  4RL7 A;  3FX3 A;  4O61 A;  3S7E A;  5BNP A;  1UWW A;  2VTX A;  4IE7 A;  2VC9 A;  5FZG A;  4YVW A;  2QKD A;  2C5D A;  2OVU A;  1ZBE 3;  3UGG A;  2WNV C;  3B93 A;  2GC1 A;  5ACA 3;  4BQX A;  1DF0 A;  3A23 A;  1HRV 3;  1PVC 3;  2IXH A;  2MPF A;  4BU2 A;  1S2B A;  1UIJ A;  5LBE A;  1HN1 A;  3OUI A;  3U0Z A;  4QQO A;  1R1Z A;  4RR3 C;  4XMI A;  3L9J T;  3KMH A;  1X82 A;  2VQT A;  3I8T A;  1SBE A;  1ENR A;  4K1Z A;  1PMI A;  2FDG A;  4LIV A;  3WF3 A;  2BZD A;  4PBP A;  2HWE 2;  2Y34 A;  1KQR A;  3FHQ A;  4RQP B;  5CA6 A;  3KD4 A;  2VEC A;  5EJZ B;  4IEU A;  3V56 A;  2D6O X;  4UI9 L;  1RXG A;  1FPN 3;  5CFD C;  3MZH A;  3R4U A;  3T4V A;  5E89 A;  3H3U A;  2E32 A;  3IMM A;  3VN4 A;  4G4F A;  4LBJ A;  1EV1 1;  1BBT 3;  3GCW A;  3BPS A;  1IGO A;  3OGR A;  4BLI A;  4UFM A;  1NCQ A;  4EQV A;  3SKV A;  4J1W A;  5FUN A;  2R6Q A;  1XU2 A;  4MO3 M;  2IZW A;  3WP4 A;  2WN3 A;  1QDC A;  1H2L A;  1PO1 1;  3AZV A;  5I8S A;  1WMD A;  5ISL A;  1LKN A;  1QJE A;  1JI6 A;  2LW8 A;  2VVE A;  3DYP A;  2C4X A;  2R06 2;  3RJR A;  3ZXF A;  4IND A;  1OBN A;  3HIF A;  3X29 B;  5DAX A;  2HEV F;  1AYM 1;  1UPI A;  4JKM A;  1CAW B;  5JR7 B;  2ZGP A;  3C7G A;  3AMM A;  5I93 A;  5CKQ A;  3PMS A;  2JIG A;  5A1L A;  5EP9 A;  4Q4Y 3;  3FMG A;  1UYZ A;  4J1X A;  5GLT A;  5A33 B;  1JYI A;  4QQH A;  4GUL A;  4HKO A;  1PNF A;  2PQQ A;  2EXK A;  4XFH A;  1GQH A;  4BK5 A;  2J1T A;  1VBE 3;  1W6N B;  1YHF A;  4XBN A;  2E63 A;  2RMU 3;  1N1V A;  1ZYB A;  5A6Y A;  5F2W A;  4Y24 A;  4K8F A;  1OLM A;  2V5D A;  3AP5 A;  2UY8 A;  3K3N A;  1CAX A;  1S0D A;  4P08 A;  4XOG A;  5FMO S;  1V6I A;  4ATE A;  1LEM A;  1YFU A;  2AZ5 A;  2JDP A;  3LA7 A;  2WZR 2;  4Y1X A;  2ZEX A;  4AI1 A;  2B9U A;  4RGG A;  1LOG A;  1YYN A;  2YYO A;  1GNH A;  4OUM A;  1RMU 3;  1LCL A;  3MIH A;  5KR7 A;  1O3T A;  3KS7 A;  4LBL A;  1T6G C;  1AR9 3;  1S1A A;  2E9Q A;  2W1U A;  2XWJ B;  3UJQ A;  5A3M A;  5LCW L;  4LXL A;  2BWA A;  1W6P B;  1UOB A;  2CTV A;  1GWL A;  2IXJ A;  3GJB A;  3RQ0 A;  2CWM A;  1M06 G;  3ZYI B;  1ZBE 2;  3UL2 A;  1QH6 A;  1AJK A;  2DU0 A;  3H0O A;  4HXC A;  1UMZ A;  4AI3 A;  5ACA 2;  4UF0 A;  1V70 A;  3BTZ A;  3JU9 A;  1HIX A;  4LBK A;  3B5L B;  1PO2 2;  3HQU A;  1KDM A;  3WG2 A;  5HCH A;  1HXS 3;  3SH4 A;  3U14 A;  3BOP A;  3UES A;  2ZGS A;  1YLL A;  5C33 A;  3UGF A;  4Q4V 3;  2Z79 A;  2ZGL A;  5FXW A;  3M7A A;  4GB3 3;  4XIL A;  1B35 C;  2E7Q A;  2DVA A;  2WWU A;  3P3P A;  3OOX A;  4CP1 A;  1AYN 3;  4NWV A;  5C4W B;  1W6M B;  2YFU A;  4V1P A;  2EAK A;  3K48 A;  5F5I A;  1CON A;  4QDR A;  1CJD A;  4OYU A;  4Q26 A;  4AL9 A;  2JD9 A;  1WD3 A;  1SZB A;  3FLR A;  4QX1 A;  1MS9 A;  4D3W A;  5BNN B;  1A6C A;  1UZW A;  2OZ6 A;  5HI0 A;  1W2N A;  1LEC A;  2UWA A;  2E53 A;  1F2N A;  2B46 X;  3POY A;  4YVS C;  5FWE A;  4ZXK A;  5HCB A;  1DFQ A;  2WIN B;  5HXV A;  3P6B A;  2BVV A;  4JTO A;  4KGG A;  4MAD A;  2V72 A;  4AVA A;  2BBV A;  1JHJ A;  1F4H A;  2PN5 A;  5J37 A;  1RUO A;  4O9G A;  2ES3 A;  2FDF A;  1NE4 A;  2BGP A;  2WC2 A;  1DLC A;  2W0X A;  3ETQ A;  4DIQ A;  1W2A X;  2ZAC A;  5FPB A;  1AR6 3;  1LEN A;  4TYS A;  1J3R A;  1C4R A;  2GH2 A;  2YMZ A;  5BUV A;  1SFP A;  1X7N A;  1R08 1;  2GC3 A;  2ID4 A;  2WS9 3;  3JZV A;  5FPL A;  4CDX A;  1PMJ X;  4UFH A;  1W8F A;  4HOO A;  1G6N A;  4OHX A;  3POG A;  1W2U A;  1JZ6 A;  5FZO B;  4AED B;  4QKD A;  4Q4Y 2;  1DGW A;  2XJS A;  2DVD A;  1ZRF A;  4C90 A;  4IV3 A;  2GU9 A;  3AZX A;  4RS5 B;  4CDW A;  4AFB A;  5BNQ A;  4QPI A;  4XUT A;  2O0O A;  1MZF A;  2C9K A;  2QQW A;  3USU B;  1VBE 2;  2BFU L;  2ZGN A;  2QTW B;  3OPT A;  4NRP A;  1QJX 3;  2D6P A;  4YVW B;  4E4Z A;  4COU A;  4D6R A;  4OUE A;  3RZM A;  3FLP A;  4IE0 A;  4P00 B;  3VLB B;  3C3V A;  1ZRI A;  4MUV A;  4XE9 A;  4AI8 A;  1XJA A;  2PFW A;  1ND2 C;  5J1X A;  1V6J A;  3AKP A;  4KU7 A;  2PEL A;  4YRD A;  2ARE A;  2GME A;  5EPA A;  1JZ7 A;  1F4A A;  3ZXD A;  2WFF 3;  4Q1R A;  4TN7 A;  3TB0 A;  2WBK A;  4L2N A;  3FN9 A;  1GAN A;  5FOB B;  5IYY A;  3NST A;  2W92 A;  5JSP A;  2DCY A;  1RMU 2;  3HNY M;  4YWA A;  1AR9 2;  4K8R B;  1UX7 A;  4FPO B;  1W6Q A;  3ZXE A;  5E16 A;  1KRI A;  3KM5 A;  5T52 A;  4LBN A;  1UYY A;  3E5U A;  1W03 A;  5FZI A;  3PJQ A;  4XJA A;  1HB4 A;  4QAW A;  3B3Q E;  4PIY A;  1TG7 A;  1W99 A;  4Z8B A;  3EMR A;  1GP5 A;  1NCQ B;  3LD8 A;  1OVS A;  4BM8 A;  3VBS C;  1I6X A;  1BJQ A;  1HXS 2;  1SDD B;  2YPJ A;  5FY4 A;  2XON A;  4I2O A;  4B29 A;  3SQO A;  4Q4V 2;  1C28 A;  1NCR C;  2HWE 1;  5FPA A;  4DFS A;  5HV0 A;  4RA0 A;  2D6K A;  4GB3 2;  4XBL A;  4DQA A;  3IWZ A;  2VL4 A;  2ZGQ A;  1NXD 1;  1X36 A;  4KU8 A;  4JHZ A;  3WEZ A;  1QKQ A;  2HYX A;  4B7E A;  3E6B A;  1YQ6 A;  2BOJ A;  4PIX A;  2BPA 2;  3S5Q A;  3WUC A;  4RYD A;  2X5I C;  3VDC A;  4E2Q A;  5FZB A;  2FDK A;  1K42 A;  4XUN A;  3WNM A;  1H1M A;  1RUJ 3;  1UZ0 A;  2D93 A;  3WNX A;  2WYF A;  1NKG A;  4W4Z A;  1R09 2;  4YG3 A;  3VBF C;  3E5X A;  1L7L A;  2DU1 A;  2OA2 A;  4KBB A;  3ROU A;  5FPU A;  1Q3E A;  2GC2 A;  4WM8 B;  3VBH C;  4EJR A;  1ND3 C;  2R06 1;  3NNL A;  3AZW A;  2PHX A;  1QU0 A;  4BWO A;  5T54 A;  4B4P A;  3O7O A;  2VD7 A;  2YV8 A;  3VBU A;  3NNG A;  3JCI A;  4L8Q A;  4XXP A;  4MXV A;  1W28 A;  2WS9 2;  2WWJ A;  3KB5 A;  3KF5 A;  3KVA A;  3MID A;  1DGW X;  4MVT A;  4BIF A;  3B7M A;  3I4I A;  5IWF A;  5CFC A;  4L99 A;  2EA7 A;  2NM1 A;  1GU3 A;  3MPP G;  2D44 A;  4E27 A;  4E8D A;  5C3S A;  5EYY A;  1H4G A;  1H9W A;  1DQ2 A;  3K46 A;  2V73 A;  4QX7 A;  3UK9 A;  3FHA A;  2IFW A;  4M0N A;  2BNO A;  2GND A;  4O65 A;  4FXK B;  4AQ2 A;  4L92 A;  1QJX 2;  4JDN A;  1AX1 A;  1CD3 G;  1PIV 3;  2XH6 A;  3RGB A;  4YFZ A;  2W2I A;  5C3R A;  1JZ5 A;  2W46 A;  4UW6 A;  4EN7 B;  4W6W A;  1R1A 1;  1YFY A;  3WDT A;  1E5H A;  1YO8 A;  1W8U A;  2GSY A;  3WNO A;  5JIU A;  1JW6 A;  3POJ A;  4PF5 A;  5LK5 A;  4CUG A;  4Y20 A;  1WLD A;  2WFF 2;  2R0F A;  5DUX A;  5L9B A;  2A70 A;  5D21 A;  3ZOI A;  3RRD A;  1OPO A;  2YZ4 A;  2R0H A;  1VIW B;  1K5M A;  4IE4 A;  1OC1 A;  1V6N A;  2ZEW A;  3AX4 A;  1YQ5 A;  4QM9 A;  5HCF A;  3VBO C;  2NZ9 A;  1LR5 A;  1NX9 A;  1ZBE 1;  3VZJ A;  2G9F A;  3HNB M;  3LWC A;  5ACA 1;  4RD7 A;  2R32 A;  4XJ9 A;  1JZ4 A;  1W0O A;  4FTB A;  1US2 A;  1HRV 1;  3MHZ A;  1PO2 1;  3EXU A;  2LUW A;  4PLM A;  5IK4 A;  3DPR A;  1CWP A;  3VHP A;  1OUX A;  1S0J A;  1OFN A;  1LB2 A;  2PAK A;  1TME 3;  1Q8V A;  1WA6 X;  4XW3 A;  1TNF A;  4CEY A;  4A42 A;  1SEF A;  5HCA A;  3TRS B;  2WO3 A;  1YI9 A;  1BEV 3;  1AUY A;  1ULD A;  3PL0 A;  2Y6K A;  3H8R A;  2RDN A;  1YEW A;  2JG8 A;  4XAE A;  3EYP A;  1O7F A;  3SLI A;  4BOW A;  3MIF A;  3H1W A;  4HZF A;  4BZ4 A;  2A6V A;  4CDX B;  1DQ0 A;  5FZF A;  3VZK A;  3SNM A;  4CDU A;  4I01 A;  5JI7 A;  4LKE A;  3VKL A;  1RC6 A;  5F3I A;  5FFO C;  3ZR5 A;  4GH4 A;  3O1P A;  2H0V A;  2V09 A;  3ZFF A;  4YW1 A;  5CBL A;  1HV0 A;  4BQW A;  1G7Y A;  4IV3 B;  2B4K A;  2WT1 A;  2WUH A;  4JKL A;  4YM3 A;  1JYC A;  3NL1 A;  4GIQ A;  3V0A A;  3AYE A;  3FUO A;  4CDQ C;  4CSW A;  2QVS B;  3FFQ A;  1OOP A;  3AYA A;  3BIE A;  4X8P A;  2VW1 A;  2QZ2 A;  1ZZC A;  2D40 A;  3I3B A;  5I91 A;  4GWN A;  4XF0 A;  4BLJ A;  4SLI A;  3L2H A;  2X10 A;  1K12 A;  1DYP A;  1UQX A;  3I97 A;  4GJZ A;  4Q4Y 1;  4RFT 0;  1QY4 A;  3N7K A;  4XFB A;  3V65 A;  4OHY A;  3IDE A;  1A8D A;  5DG1 A;  1ZBA 3;  5EIY B;  1J3P A;  2PLV 3;  3NJY A;  3VKN A;  3F95 A;  1UYP A;  4P9X A;  2B39 A;  3JB8 A;  1SCR A;  1VBE 1;  5F6L B;  3WW2 A;  2W91 A;  3S30 A;  3IIA A;  3RWK X;  4CEW C;  3A0K A;  3JBG 2;  5FPZ A;  1QHD A;  4BIS A;  1PIV 2;  4XUR A;  2DWR A;  4ASM B;  1NQD A;  3IAP A;  2HWF 2;  1QQP 2;  2OXB A;  5BNO C;  3ZFE C;  2BV4 A;  4GA9 A;  2ZXQ A;  3PUA A;  3AK0 A;  4QPW A;  4D69 A;  2VU9 A;  1F5J A;  3UYJ A;  1IS6 A;  2BGC A;  2VME A;  4CCO A;  3P3N A;  4LHN A;  4LO8 A;  1FNY A;  1X9P A;  3LFM A;  1H30 A;  3N9L A;  4LKS A;  1RMU 1;  1SLB A;  4OI1 A;  1AR9 1;  4QPG C;  4IEP A;  5FY8 A;  1S55 A;  3B9C A;  4Y1Y A;  1O59 A;  3UT0 A;  1QJY 3;  4R9B A;  3VHO A;  3CJI C;  4E4D X;  3UET A;  4YAR A;  4PLO A;  2KM2 A;  4Y22 A;  4AFA A;  3MO4 A;  5FZE A;  4BQ4 A;  1EPW A;  3Q9O A;  2I74 A;  2EAA A;  1ODN A;  3HVD A;  3AKR A;  1HXS 1;  4WVM B;  1AL2 2;  2J7M A;  3MV1 1;  4O7X A;  4LKD A;  2L9L A;  3QH7 A;  1NT0 A;  3FBM A;  1O4T A;  1S2E A;  1TME 2;  4Q4V 1;  3UNP A;  3U75 A;  5KHG A;  1MS0 A;  4GB3 1;  4GMP 3;  4NPL A;  4P9Y A;  3O1U A;  1AYN 1;  4NAO A;  1BEV 2;  2LS6 A;  3V64 A;  2UY9 A;  2UYB A;  2QDN A;  3I2F A;  2DTY A;  5JMO A;  4ZS3 A;  5KXE A;  4LTA A;  1N3Q A;  2ZEZ A;  4FFI A;  5CFC B;  4DXS A;  2R04 3;  4XTM A;  2K46 A;  3GBW A;  1J83 A;  2Q1M A;  4J25 A;  4YGC A;  3NMB A;  4G9S B;  2JWP A;  5LY1 A;  4NII A;  1JYW A;  2JE9 A;  2VAU A;  4CP9 A;  1WKY A;  5KXC A;  1OA2 A;  2HKX A;  3HEI A;  3A0N A;  4CTE A;  3HAG A;  2YRO A;  4A3X A;  1EAH 3;  3WXP A;  5GLV A;  1EUT A;  5F39 A;  1FI2 A;  4LIU A;  4NO4 A;  3I2G A;  1W9T A;  3LA3 A;  3LE0 A;  1OH4 A;  2E7T A;  2XML A;  3LEK A;  4HFS A;  3ZLI A;  1VBA 3;  2WS9 1;  3KV9 A;  3LF7 A;  4FPK A;  3WNN A;  4KWL A;  4Z1V A;  2Y26 A;  3RSJ A;  4GMP 0;  4DY5 A;  1G9A A;  5FZL A;  3JB4 C;  2OS2 A;  3WP6 A;  2W9X A;  3BUC A;  4PI2 A;  4NAM A;  5DG2 A;  4Y20 B;  2UWC A;  1XND A;  2JXA A;  5L9V A;  3PME A;  1JZ8 A;  5ERL A;  2VZU A;  2YB7 A;  3I2D A;  1ZBA 2;  4IEO A;  2VZV A;  4FI9 A;  3UJO A;  2PLV 2;  1K5M B;  1UOG A;  2VBP A;  1NLQ A;  2W08 A;  3LA2 A;  4XDO A;  3J7N A;  5B4X A;  3K3O A;  2QQO A;  1W2O A;  4X6R B;  4MV2 A;  1MEC 3;  1QJX 1;  2CGO A;  4I30 A;  4NHM A;  1Y43 B;  3RI8 A;  3DGT A;  3KV4 A;  3WD5 A;  3NAP A;  1VPH A;  2WA3 A;  1YI7 A;  2VCB A;  2WYS A;  3PTR B;  4HN0 A;  2JDU A;  1ZZ8 A;  4XAC A;  3DPR B;  4BYY A;  2PHF A;  5TSW A;  3LCP A;  4EV0 A;  2WFF 1;  5LBB A;  1WCK A;  2R07 3;  5FWJ A;  4NPR A;  3VGI A;  4P9L A;  2OPW A;  3WP3 A;  3J7H A;  1N3O A;  5FYM A;  3POF A;  5FZC A;  2G1M A;  3BVC A;  5KXB A;  2MHF A;  4R9C A;  4XBQ A;  1NY7 2;  3ZSL A;  4R4X A;  4CCE A;  4JGZ B;  3TWI A;  5KWR A;  5JSR A;  1DU3 D;  1NA1 C;  2JG9 C;  2JG8 B;  2VUD A;  4MHU A;  4AVT A;  5FO8 B;  3ZR6 A;  2HEY F;  2QQP A;  1QJY 2;  1F8V A;  1HQW A;  4Z82 A;  3DKQ A;  4MX3 A;  1DQ1 A;  2WR9 A;  3BYW A;  1CAV A;  2PQS A;  1OT5 A;  2F6B A;  1CAW A;  4GH4 B;  1OD3 A;  5FY5 A;  2D5F A;  4I3P A;  3I2J A;  4FPC A;  3NQH A;  4N7I A;  4OHW A;  4P5H A;  3ZFF B;  3HQR A;  3N9P A;  4YM0 A;  5AC9 1;  5IFP A;  2XQX A;  1DQ6 A;  4N8M A;  3PLQ A;  5KC6 A;  1OF4 A;  5FXV A;  4LNV A;  2VMI A;  1GOG A;  5FP3 A;  1WLW A;  2WDB A;  1AJO A;  5A33 A;  5DZE A;  5M0T A;  4NN0 A;  3V0A B;  2HJI A;  2ZX3 A;  1DP0 A;  1BHG A;  2HBT A;  1GOF A;  1W9W A;  1OOP B;  1XXN A;  5CZK A;  4E2S A;  4OI4 A;  2OW4 A;  2XG3 A;  1OLR A;  3OTF A;  3VV1 A;  2BQP A;  5I0R A;  1PK6 C;  3DXT A;  4QU2 A;  1PGL 2;  4ERO A;  4KL1 A;  3OF1 A;  5I0U A;  2HWB 2;  3C7E A;  3W20 A;  1S0F A;  3I3M A;  2W47 A;  3ECQ A;  5G05 L;  4Y1Z A;  2J22 A;  1H2K A;  1V6K A;  2YGL A;  4P9J A;  4XIK A;  4LLO A;  3M1H A;  4CXX A;  1NYW A;  4LEJ A;  1WCU A;  5FUI A;  1NQJ A;  2QDR A;  3HN1 A;  3VDB A;  3O1T A;  5F3C A;  4S2H A;  3MPB A;  4W6Y A;  5ANQ A;  2ET7 A;  3U4S A;  4BQY A;  3NV3 A;  3HWJ A;  2K9Z A;  4LMF A;  3DEC A;  4WM7 C;  3U11 A;  1EAH 2;  3RYK A;  5LA9 A;  3S6P A;  4BQ2 A;  2ATF A;  4R9A A;  3WQB A;  4DOU A;  1CPN A;  1E5I A;  1VBA 2;  3BN6 A;  1WW6 A;  4AFM A;  3L2Y A;  5J48 A;  3ZYB A;  2VGD A;  4KG0 A;  4ZON A;  2D43 A;  5LW9 A;  4V2V A;  3AKT A;  1CAU A;  2WNU C;  4IGQ A;  2PMW B;  3WVJ A;  1MZ5 A;  2CV6 A;  1D4M 3;  1MQT C;  5DN2 A;  2WFP A;  4U2A A;  3ZYJ B;  1AZD A;  2A7A A;  5CIS A;  5L7O C;  3VL9 A;  1N1T A;  3VBH B;  4Q4W 3;  2QQL A;  1SMV A;  2J1A A;  1JU4 A;  4CCK A;  5DAP A;  1C3H A;  2AR6 A;  2RDQ A;  3W9A A;  3JBG 1;  2YC4 A;  4BXS V;  1PIV 1;  2JKX A;  2EF6 A;  4OCT A;  4Y22 B;  2VNV A;  2HWF 1;  1VRH 3;  1QQP 1;  2QQM A;  1OUR A;  4KNC A;  1UXX X;  2FCV A;  2RM2 2;  1XPW A;  3U4X A;  5BNN A;  1SQ4 A;  1NOV A;  2V4A A;  2F17 A;  3IDB B;  1ULF A;  1QXJ A;  5F2S A;  3LPG A;  5FLH A;  4PCR A;  2VNO A;  2P2K A;  2R07 2;  4QHB A;  3H9A A;  3R4S A;  4H3W A;  2VPV A;  3IKW A;  5FYV A;  5C7G A;  2QFE A;  3MLJ A;  1SPP A;  2AEZ A;  3AL5 A;  4YZ4 A;  3OGS A;  1PVX A;  1N1Y A;  4P5Y A;  2PHW A;  3FFZ A;  2W39 A;  3OGJ A;  4YLZ A;  1DZQ A;  5T5O A;  3QH6 A;  5A3O A;  3TNQ A;  3ENR A;  5DAW A;  1DZR A;  1JS9 A;  1ULG A;  4MH0 E;  1K45 A;  2EXJ A;  5FZ9 A;  4AAP A;  3MIG A;  1AR7 3;  4AVC A;  2CSG A;  4N90 A;  1PHM A;  1H2M A;  3NW4 A;  1REF A;  1CX4 A;  2DUQ A;  3VBR C;  1AL2 1;  3H3L A;  4Y1U A;  3ZXG A;  1AX2 A;  5FYI A;  4CP9 B;  2XL9 A;  3Q8A A;  1TME 1;  3E5Q A;  4JGY C;  1RUH 3;  3BTA A;  2RS3 3;  4IV1 A;  4RS5 A;  1LRH A;  3WDV A;  3ZN6 A;  3OY8 A;  4ES9 A;  3ASI A;  1BEV 1;  1XQN A;  3KQR A;  3ME2 A;  4FPG A;  3OBZ A;  3VBO B;  3RDI A;  2VMF A;  3M3Q A;  4AVB A;  2CAV A;  5C8C C;  1I1E A;  4QGM A;  2ZCW A;  3USU A;  4QQP A;  1MS1 A;  4GXL A;  2P6C A;  5APA A;  1FMD 3;  1RUG 3;  4CU7 A;  2A3W A;  1UU6 A;  2CY6 A;  2QQU A;  3NV1 A;  4HSL A;  4CXW A;  4MGT A;  1CPM A;  1CGP A;  2PYT A;  4NUB A;  1HV1 A;  2VOX A;  1LAJ A;  5FK8 A;  2A1X A;  3D4K A;  2VZP A;  5JOZ A;  3N7M A;  1IQD C;  4PJY A;  3IZO A;  1IPS A;  2H6B A;  4ZZ5 A;  5C9A C;  4Q0P A;  2WQ4 A;  3VDD C;  5LEK A;  3T1M A;  2BDR A;  3KV6 A;  2W52 A;  3OEA A;  4GJY A;  3AMN A;  2D98 A;  4MET A;  4JQR A;  1Q8P A;  3FBY A;  3KVB A;  3NAP B;  4H2A A;  4MZU A;  3ACH A;  2BTV C;  4QDQ A;  2W94 A;  4QXK A;  2XUE A;  1YQ8 A;  1TE1 B;  2WII B;  4KGQ A;  5FYT A;  4E4S A;  1IS5 A;  1IS4 A;  2WKK A;  3SH5 A;  2NLR A;  1XNT A;  4IE5 A;  4EN8 B;  3S7I A;  2ZA9 A;  2AAC A;  1UMH A;  1XRU A;  1ZBA 1;  5FMB A;  2PLV 1;  3RPQ A;  1TVG A;  4EN0 A;  1VMJ A;  2DVB A;  1D4M 2;  4BJ0 A;  3ACL A;  4KH9 A;  3T0B A;  4FPY A;  1S0I A;  1UZV A;  2Q0A A;  2FMD A;  2ZML A;  3CO2 A;  3MFC A;  5K0U A;  5CAZ A;  1XSR A;  3OB8 A;  3MV0 1;  3ZSJ A;  4N53 A;  2WNE A;  4BK4 A;  3WW4 A;  1CAV B;  1E57 A;  4IGO A;  2X05 A;  5DDJ 3;  4IET A;  3W21 A;  4DNY A;  1VRH 2;  1O91 A;  4WVW A;  2BU9 A;  2DDU A;  3ALQ A;  5FP9 A;  3LEI A;  4ARY A;  4DIN B;  2HBU A;  4LE3 A;  1GMM A;  4QD2 A;  5F3G A;  3T2O A;  3T0D A;  1KFU L;  2RS5 3;  3POB A;  3BB6 A;  1X9T A;  1XOY A;  3WDX A;  4A44 A;  2XQR A;  1CJP A;  1NY7 1;  2WO7 A;  3WX5 A;  3AVR A;  2BER A;  3GNE A;  4CEW B;  4FSJ A;  1QOS A;  4WM8 A;  1GIC A;  1QJY 1;  2VCA A;  1RUE 3;  1J84 A;  5BNO B;  2HWC 2;  3ZDV A;  3ZFE B;  3JD7 3;  3Q8E A;  5IVJ A;  1N3P A;  1AR7 2;  1R1A 2;  2JD4 A;  3WQ0 A;  3PVO A;  3ZX7 A;  1RTV A;  4AG4 A;  5FZ3 A;  1MS4 A;  3N35 A;  5A6X A;  1QH7 A;  1RUH 2;  1VBC 2;  1I3H A;  2KXL A;  1UKG A;  2P34 A;  1LUL A;  1OF3 A;  4HKW A;  1YIP A;  1KDK A;  3III A;  1F5F A;  1XE7 A;  2VQA A;  1PGL 1;  2JDZ A;  1FMD 2;  1RUG 2;  3NJZ A;  4Z2W A;  3BIW E;  2HWB 1;  4LA3 A;  5JPN B;  2ZTN A;  2Q8D A;  3WZ1 A;  2OZJ A;  1HRV 2;  1PVC 2;  1JTZ X;  2A75 A;  1X33 A;  1W9Y A;  1KFX L;  1UY4 A;  1RUN A;  2GMM A;  1CAU B;  2DCK A;  2DUR A;  3ACI A;  4OVE A;  3THT A;  3EHK A;  1CZT A;  1Q8S A;  3WHU A;  1RHI 3;  1C1F A;  1CIW A;  1RVF 3;  3I54 A;  1CZS A;  1VR3 A;  4XYX A;  4PLN A;  5FV3 A;  4XFC A;  1EAH 1;  4Y5Z 0;  4C91 A;  2N7G A;  3CBN A;  4AHW A;  3CL1 A;  1WBL A;  2QBX A;  1SLL A;  4FAH A;  4JX0 A;  4N7U A;  5F5C A;  2Y0I A;  4A3Z A;  1VBA 1;  2VMG A;  1FPN 2;  2VZ1 A;  2YDE A;  3N36 A;  4FXG B;  4AR2 A;  5IT6 A;  3ZN4 A;  4IDZ A;  1OH3 A;  3DF0 A;  3WHT A;  1BBT 2;  1K3I A;  1LU1 A;  2VTF A;  5A7Q A;  5IVF A;  1OFS A;  3RZG A;  3WNP A;  4AGV A;  5KHK A;  3J4U H;  4QKF A;  4IEW A;  3MBW A;  1OMI A;  3ABZ A;  4LBO A;  3MIE A;  1SPP B;  2E31 A;  3TN9 3;  4YZ1 A;  4PBO A;  2AH2 A;  5JPM B;  1BVV A;  2XVG A;  1OLQ A;  5IVC A;  5J7M A;  4FTS A;  4PHZ A;  5FPV A;  2HH9 A;  2WNV A;  3B69 A;  5F8P A;  3A22 A;  2Q8E A;  4QB1 A;  1OA4 A;  5DDJ 2;  5C8W A;  2RM2 1;  2ZGT A;  2O8Q A;  3NKG A;  2AEY A;  1IHM A;  5F32 A;  3DCQ A;  1JU3 A;  1QMJ A;  4HLT A;  4LO6 B;  4Q8L A;  5A1F A;  4RR3 A;  3I3E A;  2R07 1;  1QJF A;  4QM8 A;  1DQ5 A;  5A7O A;  3D6E A;  4IV1 B;  3T09 A;  1LES A;  3ZN6 B;  3OD4 A;  3OY8 B;  2RS5 2;  4FPJ A;  3LFI A;  1H8V A;  3KT1 A;  1T2X A;  3AXD A;  1ULO A;  2IXK A;  3A7Q A;  2GP3 A;  4QHO A;  5EYX A;  4ORF A;  2RMU 2;  1HRI 3;  2W3J A;  3LIH A;  5CFD A;  4OHZ A;  1WWY A;  2DCT A;  1RUE 2;  4HSJ A;  1JMU B;  2DBI A;  2WAO A;  4LUM A;  3BPZ A;  1OKO A;  4XDP A;  3W5M A;  3JD7 2;  4YGD A;  4CZS A;  1VAK A;  4YW5 A;  2VMD A;  3H7J A;  1PZ7 A;  2XKP A;  2GNT A;  4NHX A;  3QOP A;  1HW5 A;  1KIT A;  3URF A;  3ACG A;  4AE2 A;  4DZG A;  4XUO A;  1OXC A;  2YXS A;  4NHY A;  5A7W B;  4CPB A;  5HXM A;  1LOE A;  3K4A A;  3PUS A;  3RNS A;  1O5L A;  3WT3 A;  2BVB A;  1Q8Q A;  4FOV A;  1G9D A;  4RN5 A;  4YG0 A;  5FUP A;  4KG8 A;  2EXI A;  2XVL A;  4PDW C;  2A6X A;  3WDW A;  2LAL A;  3HQX A;  1WGP A;  2VZT A;  4QHZ A;  4CE8 A;  4DO0 A;  1YRZ A;  2BWC A;  2JEN A;  3ZYP A;  5CEH A;  4Z92 B;  2WQ8 A;  2W1W A;  4GD4 A;  5A7P A;  2HEW F;  4FQZ A;  1PGS A;  3CZJ A;  4HK8 A;  4Q0S A;  4A7K A;  2CU5 A;  2VCM A;  4ZPI A;  1A78 A;  2D3S A;  4FO9 A;  3NNM A;  4EZH A;  4XQ4 A;  1RHI 2;  3RG0 A;  5D8A C;  1ONA A;  1RVF 2;  2TNF A;  5K0U B;  2WO2 A;  4WZF A;  1H8T C;  1TZO A;  2Q1F A;  3D3A A;  3LQC A;  4Y5S A;  1AYN 2;  1U0A A;  2RR1 3;  2EIG A;  2CGN A;  4N53 B;  3WW3 A;  4QPY A;  4CUC A;  4F8A A;  4DY3 A;  4FCA A;  4LHS A;  1SLT A;  4AEM A;  2FZ2 A;  3BI3 A;  1GQP A;  5CU1 A;  1N1S A;  5BXX A;  1AXZ A;  4YW4 A;  4UBH A;  4ET7 A;  2C9A A;  4XAB A;  5AC9 3;  2JEC A;  3KHB A;  3AC0 A;  2Z69 A;  4YNI A; 
#chains in the Genus database with same CATH homology
 3E1F 1;  3LEG A;  4PT6 A;  2VME A;  2VQU A;  2VJX A;  3VD7 A;  2Y64 A;  4LKS A;  4LQR A;  2W1Q A;  3VDA A;  1GUI A;  5JXH A;  1DYO A;  1CZV A;  2XOM A;  1O59 A;  2VOT A;  3VD4 A;  1KEX A;  3UET A;  2J1E A;  3MO4 A;  2JDA A;  5DMY A;  3ETP A;  2J7M A;  3MV1 1;  2L9L A;  3UNP A;  3CMG A;  3GDB A;  4MGS A;  1JZ2 A;  1UY1 A;  2EIC A;  2LS6 A;  5IHR A;  1MPX A;  3CIH A;  3I2F A;  4CU9 A;  5JMO A;  4PQQ A;  2ZEZ A;  1US3 A;  4XUP A;  4DXS A;  4KWU A;  1D7P M;  5B4N A;  2QQI A;  3NRU A;  1J83 A;  2VCC A;  3WSO A;  4L0P A;  3VD3 A;  4CUA A;  1JYW A;  1CX1 A;  1WKY A;  2WO1 A;  4QB6 A;  4XUQ A;  3HEI A;  3MUZ 1;  4CUB A;  3THD A;  3WF4 A;  1EUT A;  1W8O A;  3I2G A;  4CU8 A;  1CIY A;  1W9T A;  3LE0 A;  1OH4 A;  3LEK A;  3WF0 A;  4M4P A;  3WNN A;  2Y6G A;  4M4R A;  2W9X A;  2VZO A;  1JZ8 A;  2VZU A;  2YB7 A;  4D8M A;  2VZV A;  4FI9 A;  3VD5 A;  2E33 A;  5F7U A;  5B4X A;  1XNA A;  2QQO A;  1ULP A;  5JXJ A;  1UWW A;  2VC9 A;  2VZS A;  2VCB A;  2WYS A;  2X09 A;  2CDP A;  3CQO A;  3WNK A;  3A23 A;  3A21 A;  1UY0 A;  1HN1 A;  3C7O A;  2VQT A;  3K77 A;  2B9V A;  3J7H A;  4MOA A;  3WF3 A;  2BZD A;  3I3D A;  2RVA A;  3FHQ A;  1UYX A;  3GGL A;  4KI5 M;  5EJZ B;  1PX4 A;  3SEE A;  4UI9 L;  2PQS A;  1OT5 A;  3LPF A;  2E32 A;  1OD3 A;  3I2J A;  3NQH A;  5IFP A;  1L7R A;  2QQJ A;  3OGR A;  2XQX A;  4DUW A;  1OF4 A;  3JXS A;  4P02 B;  3SKV A;  1GOG A;  5JXG A;  2VZR A;  2WDB A;  4MO3 M;  3MUY 1;  2WN3 A;  1DP0 A;  1BHG A;  1GOF A;  1W9W A;  2VMC A;  5CZK A;  1JI6 A;  2LW8 A;  3DYP A;  2C4X A;  1JYN A;  4A45 A;  4JKM A;  2W1S A;  2E26 A;  3C7G A;  3C7E A;  3GM8 A;  2W47 A;  3ECQ A;  5G05 L;  1JYX A;  2J22 A;  1SG3 A;  5FUI A;  1UYZ A;  3VDB A;  4DUV A;  3C7H A;  4CVU A;  2CDO A;  2KD7 A;  3OGV A;  3ZM8 A;  2WAA A;  4DXT A;  2WAB A;  3DEC A;  4BK5 A;  2J1T A;  4JKK A;  1GNY A;  2VR4 A;  1I5P A;  2V5D A;  2Y8K A;  4P08 A;  3WQB A;  4MGQ A;  3BN6 A;  1NAE A;  3I2I A;  3NJX A;  2ZEY A;  4QDS A;  2ZEX A;  3BGA A;  5LA2 A;  5DN2 A;  4UAP A;  3IAQ A;  2QQL A;  2J1A A;  1JU4 A;  2W1U A;  5LCW L;  2YC4 A;  4BXS V;  1L7Q A;  2JKX A;  3K75 B;  2QQM A;  3T08 A;  1UXX X;  1W0N A;  2HLE A;  4W50 A;  1XPW A;  4A4A A;  2EIE A;  4IUG A;  3UES A;  3LPG A;  3HPN A;  5IFT A;  1H6X A;  5C7G A;  1O8S A;  3OGS A;  1EUU A;  4P5Y A;  5DPN A;  2J1V A;  4A6O A;  2YFU A;  3OG2 A;  4QDR A;  4OYU A;  2JD9 A;  3CZU A;  1K45 A;  3IB3 A;  4E8C A;  4QX1 A;  2BBA A;  3F2Z A;  4PF1 A;  4XZU G;  3WF1 A;  5DQ0 A;  3P6B A;  4AAX A;  1UY2 A;  3GXU A;  3HNM A;  4MAD A;  2V72 A;  2C26 A;  1JHJ A;  1GOH A;  1F4H A;  4GWJ A;  4KMQ A;  2BGP A;  2VMF A;  2RV9 A;  1DLC A;  4CU7 A;  2RJ2 A;  3CDZ B;  2ID4 A;  3I2K A;  1PMJ X;  2J1U A;  4DXR A;  2VZP A;  3ACF A;  1JZ6 A;  1IQD C;  4ARX A;  4HG6 B;  3THC A;  4ZZ5 A;  4XUT A;  2V4V A;  3OEA A;  2C9K A;  3I2H A;  2JE8 A;  4OUE A;  3ACH A;  4QDQ A;  2W94 A;  4P00 B;  2Y6J A;  5J1X A;  2QQK A;  2YG0 A;  1XNT A;  3SKJ E;  3W5N A;  1JZ7 A;  1F4A A;  1UMH A;  2WBK A;  1TVG A;  3FN9 A;  4BJ0 A;  5CYY A;  5IYY A;  2VM9 A;  3T0B A;  2W92 A;  3HNY M;  1JYV A;  3OB8 A;  1XC6 A;  1UX7 A;  2W87 A;  3MV0 1;  4BK4 A;  1UYY A;  4QX0 A;  2X05 A;  4QB2 A;  5EJ1 B;  2ORX A;  3OBA A;  5LA0 A;  2DDU A;  2YFZ A;  4QAW A;  1TG7 A;  1W99 A;  3LEI A;  4ARY A;  1UY3 A;  1GMM A;  1SDD B;  3T2O A;  3T0D A;  2XON A;  5JR2 A;  4TTG A;  4BDV B;  2R7E B;  4A44 A;  4UOJ A;  4DEV A;  2BER A;  5G04 L;  2VL4 A;  4OZO A;  4DUX A;  5I0D A;  3HOB A;  4JHZ A;  4ZY9 A;  2VCA A;  3WEZ A;  1J84 A;  2YC2 A;  2HYX A;  4OMC A;  4QX3 A;  4RYD A;  3VDC A;  1UXZ A;  4QX2 A;  4AG4 A;  3HJR A;  1K42 A;  3DYM A;  2Y6H A;  4XUN A;  3WNM A;  4LPL A;  3K4D A;  1UZ0 A;  4XVH A;  1NKG A;  4W4Z A;  2W5F A;  5JXI A;  3SEP A;  3VD9 A;  2Y6L A;  1OF3 A;  2ORZ A;  3IDA A;  2EIB A;  3III A;  1SHW B;  4TXW A;  5JUV A;  3HN3 A;  3NNG A;  2VZQ A;  3WF2 A;  3OEB A;  3EB7 A;  4GWI A;  1UY4 A;  4E8D A;  1GU3 A;  2DCK A;  3ACI A;  1CZT A;  3K46 A;  3T0A A;  2VO5 A;  3FHA A;  1CZS A;  5IJR A;  1LNS A;  1YQ2 A;  2QBX A;  2W95 A;  4JX0 A;  1JZ5 A;  4A3Z A;  1KGY A;  2W46 A;  2VZ1 A;  4DEQ A;  2VZ3 A;  3WNO A;  1UMI A;  3C7F A;  1R64 A;  2Z4F A;  1K3I A;  3K4Z A;  2VTF A;  3P1I A;  2OKX A;  3U37 A;  3WNP A;  2QQN A;  3MBW A;  3ABZ A;  1H6Y A;  2EID A;  4A41 A;  4YPJ A;  1P8J A;  3PUH A;  2E31 A;  2ZEW A;  1NX9 A;  3HNB M;  3A22 A;  4Z2A A;  4QB1 A;  1PMH X;  1W9S A;  1JZ4 A;  1US2 A;  3CKH A;  1JU3 A;  5C71 A;  3I3E A;  3T09 A;  2XHN A;  4A42 A;  1JZ3 A;  2WO3 A;  1T2X A;  1ULO A;  3A7Q A;  2Y6K A;  5LA1 A;  3EYP A;  2W3J A;  5C70 A;  1PX3 A;  2WAO A;  3W5M A;  3T2Q A;  2VMD A;  5HPO A;  3PUI A;  3ACG A;  2B4K A;  4XUO A;  3WNL A;  5HXM A;  2WN2 A;  2WUH A;  3K4A A;  4JKL A;  2J1R A;  3DYO A;  4ZXE A;  4OMD A;  5A1A A;  4RN5 A;  3C8X A;  2BGO A;  4D0Q A;  3T2P A;  1O8P A;  1WCQ A;  3I3B A;  2DCJ A;  2VZT A;  2X10 A;  1K12 A;  2W1W A;  2WQ8 A;  3I97 A;  2WZE A;  4CU6 A;  3CZJ A;  5EIY B;  3NJV A;  2WO2 A;  3LQC A;  3D3A A;  2J1S A;  3FL7 A;  4CUC A;  2W91 A;  4W8J A;  1W8N A;  1RYY A;  4LHS A;  4ZZ8 A;  4GZ9 A;  1GQP A;  4XUR A;  1NUK A;  4ET7 A;  3IAP A;  2WZ8 A;  3AC0 A;  4QPW A;  2ZXQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...