1UYYA

Carbohydrate binding module (cbm6cm-2) from cellvibrio mixtus lichenase 5a in complex with cellotriose
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
131
structure length
131
Chain Sequence
MVIATIQAEDHSQQSGTQQETTTDTGGGKNVGYIDAGDWLSYAGTPVNIPSSGSYLIEYRVASQNGGGSLTFEEAGGAPVHGTIAIPATGGWQTWTTIQHTVNLSAGSHQFGIKANAGGWNLNWIRINKTH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELLULASE B
publication title The Crystal Structure of the Family 6 Carbohydrate Binding Module from Cellvibrio Mixtus Endoglucanase 5A in Complex with Oligosaccharides Reveals Two Distinct Binding Sites with Different Ligand Specificities
pubmed doi rcsb
source organism Cellvibrio mixtus
molecule tags Carbohydrate binding module
total genus 28
structure length 131
sequence length 131
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03422 CBM_6 Carbohydrate binding module (family 6)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 1uyyA00
2ID4A 1CZVA 3HJRA 3U37A 5JXHA 2W87A 2QBXA 2WQ8A 4UAPA 1D7PM 2WBKA 3MBWA 2V4VA 2ORZA 1F4AA 3CZUA 1I5PA 2B4KA 2VC9A 2LS6A 3GXUA 3UETA 2YG0A 3A22A 1K3IA 2L9LA 2JDAA 4W50A 1YQ2A 3NRUA 5IYYA 4QDQA 3VDBA 5JXGA 4XUOA 4DXSA 4QX2A 1GMMA 1XPWA 4QX0A 1L7QA 1US2A 2DCJA 5EIYB 3A7QA 1KGYA 4CU9A 2RVAA 3CZJA 3WSOA 4PT6A 4DUXA 3NNGA 3WEZA 3ACFA 2WABA 3A21A 3JXSA 1JZ2A 1UYXA 2YFUA 3WNOA 1JHJA 2Y6JA 3W5MA 1W9SA 2WO1A 2QQOA 3VD7A 1UYYA 4QDSA 2OKXA 4JKKA 1OF3A 1UY0A 4MOAA 4MGQA 2VJXA 4ZZ8A 5IFPA 2QQIA 2VZ1A 4XURA 2V5DA 2WN3A 1UXZA 3MUY1 3OBAA 3T08A 2VO5A 1OD3A 3VD3A 3FN9A 4A44A 3HEIA 3ZM8A 3PUHA 1UY4A 2HYXA 5CYYA 2W46A 3WNPA 4XVHA 4XUTA 2WDBA 3NJXA 4JX0A 4A3ZA 3I2HA 3THDA 5G04L 4BK4A 2QQLA 2VMFA 1RYYA 3K46A 2E26A 4TXWA 3VD5A 5IHRA 2VM9A 3K75B 3OEAA 3I97A 3UNPA 5JUVA 2BGPA 4OMCA 4OUEA 2W1SA 3EYPA 4OZOA 2WN2A 3MV11 5LA1A 3I2JA 3MV01 4JHZA 2WO3A 1K45A 1UYZA 4D0QA 3I3DA 3GDBA 4FI9A 1W9TA 4UI9L 5HXMA 2VZQA 3OB8A 1JZ6A 1UZ0A 1JZ8A 5DN2A 2VR4A 2BERA 4ET7A 2J1RA 4ARXA 4KWUA 1CZSA 2QQKA 4ZY9A 2VZOA 2BBAA 4KMQA 2VZ3A 1O59A 4GWJA 3P1IA 1K42A 1SHWB 2EIEA 5EJ1B 4XUNA 5F7UA 2J7MA 4CU7A 4W8JA 2J22A 3WF2A 4RYDA 1XNTA 1XNAA 4CU6A 1TG7A 3DYMA 3W5NA 5JXIA 1PMJX 4A4AA 2HLEA 2VZTA 1O8SA 2WAOA 4D8MA 4ARYA 3OGSA 4LQRA 3IAQA 1CZTA 4CUAA 3T09A 2JD9A 2Y64A 3A23A 1OF4A 2PQSA 5G05L 5C71A 2RJ2A 3CKHA 5B4XA 3ECQA 3OG2A 3T0AA 3CQOA 5IFTA 3J7HA 2LW8A 4A45A 3LEGA 2X09A 3ACHA 1W99A 4P00B 4M4PA 1DLCA 2Y6LA 3P6BA 3IB3A 3F2ZA 2YFZA 3ACIA 1CIYA 2J1SA 4P5YA 4BXSV 2VZRA 3CIHA 1UWWA 3MUZ1 2W1UA 5HPOA 1ULPA 1T2XA 3GGLA 2Y6KA 2W47A 2E31A 2Y8KA 2ZEYA 4QB2A 2B9VA 1JU4A 1PX4A 4UOJA 3I3BA 2J1VA 1L7RA 2C9KA 4LPLA 1EUTA 3LEIA 3DYPA 4XUQA 3SEEA 4M4RA 2ZEWA 3C7OA 1UXXX 2W92A 1GU3A 2W94A 3SKVA 3WF3A 3FL7A 2WAAA 2W91A 3LPGA 1SDDB 3VDCA 3E1F1 3PUIA 1US3A 3T0BA 2CDPA 3WNKA 4IUGA 3IAPA 2W1WA 3DECA 3LQCA 4QX1A 3WNMA 4L0PA 3VD9A 3C7GA 4A41A 2W1QA 3GM8A 5C7GA 3EB7A 4Z2AA 2VL4A 2YB7A 4AAXA 2EIBA 4YPJA 3WQBA 3FHQA 1GOFA 1K12A 2WZEA 4PF1A 2ORXA 2VZPA 1GUIA 2DCKA 3K4AA 2VZSA 3C7EA 1CX1A 1MPXA 5C70A 5J1XA 4CUCA 1O8PA 4MGSA 1GOHA 4QX3A 2VCAA 1SG3A 4DXTA 2RV9A 1JYWA 4LHSA 1JZ5A 2VMEA 1JI6A 1JZ4A 4BK5A 2Z4FA 4BDVB 5JXJA 4MO3M 2ZXQA 3VD4A 2QQJA 5CZKA 4QDRA 2W9XA 4CU8A 2CDOA 3LEKA 4PQQA 3SKJE 2XONA 2J1UA 1ULOA 2R7EB 3HN3A 3ABZA 5JMOA 1EUUA 4HG6B 1UY1A 3K4DA 3OEBA 1BHGA 2VCCA 2J1EA 2VCBA 3T0DA 3MO4A 3I2GA 1R64A 3OGRA 5FUIA 3BN6A 2BGOA 1UY2A 3UESA 5DMYA 1OT5A 3K77A 2EICA 3FHAA 3HNBM 1LNSA 5DQ0A 4W4ZA 2W5FA 4A42A 2YC2A 1UX7A 3ACGA 4DXRA 2J1TA 2Y6HA 2EIDA 1HN1A 1UMIA 2W95A 4CUBA 3C7FA 4ZXEA 1JYVA 1KEXA 3C8XA 3AC0A 3LPFA 4TTGA 1NUKA 1F4HA 2XQXA 2QQNA 1JU3A 3OGVA 1W8OA 4OMDA 3HNMA 4JKMA 1J83A 2E33A 1JZ3A 2VTFA 2VQUA 5B4NA 4DEQA 2W3JA 1WCQA 1OH4A 1IQDC 1UY3A 1W0NA 3K4ZA 2VMCA 1DYOA 3I3EA 4RN5A 3NQHA 2VZVA 3NJVA 3VDAA 4P08A 2Y6GA 2XOMA 4BJ0A 4E8DA 2VQTA 2ZEZA 3WNLA 1NKGA 3T2PA 3IDAA 1W9WA 2DDUA 3I2FA 2X05A 4AG4A 1DP0A 1H6YA 4XUPA 2J1AA 1GNYA 3T2OA 3DYOA 2VZUA 3T2QA 3CDZB 3THCA 4GZ9A 1JYXA 3C7HA 2KD7A 4KI5M 1XC6A 1WKYA 2WO2A 3BGAA 4XZUG 4P02B 2JE8A 4OYUA 4DUWA 3WF1A 2WUHA 2WYSA 4DUVA 4DEVA 5EJZB 3CMGA 2XHNA 2ZEXA 2C4XA 5DPNA 2YC4A 4MADA 4ZZ5A 1GQPA 3IIIA 1J84A 3SEPA 5JR2A 2VOTA 5IJRA 1PMHX 5A1AA 4QB6A 3HPNA 3WF0A 2E32A 1NX9A 4GWIA 5LA0A 1UMHA 1H6XA 4JKLA 3HOBA 4LKSA 5LA2A 1P8JA 3I2KA 1W8NA 4CVUA 4QB1A 2WZ8A 3D3AA 4QPWA 2X10A 1GOGA 2QQMA 3ETPA 5I0DA 1NAEA 4QAWA 3WF4A 2V72A 4E8CA 2C26A 2VMDA 3I2IA 1PX3A 2BZDA 3LE0A 5LCWL 4A6OA 3WNNA 2JKXA 1JZ7A 1JYNA 1TVGA 3HNYM
chains in the Genus database with same CATH superfamily
2AUYA 1ENSA 3OOXA 4RL7A 2GZWA 3J7NA 3MPBA 4UAPA 1MZ5A 1LHWA 5A3NA 3FMGA 2WBKA 3U07A 1G9FA 4OUMA 3RZZA 3VBUB 1JOJA 2V73A 5ISLA 2V4VA 2D6NA 1PVC2 1RHI3 3CZUA 3M4FA 1I5PA 2YHJA 3CF6E 5EXOA 5HI0A 5JCTA 5FYSA 1GZ9A 2YG0A 4NHYA 3VDDC 2BWCA 2R072 2L9LA 3INAA 4NHXA 2JDAA 1BVP1 2UWCA 3IDBB 2XBO1 3D0SA 3HWJA 3KSCA 5FP7A 3VN4A 2JECA 2CNAA 2QZ3A 5KHJA 1HRV1 4Z8BA 5T50A 4BXFA 2GC0A 5J7MA 4QPGC 5C3OA 5BNNA 3VDBA 1VBB1 3M3QA 3IMMA 1D2SA 3N9MA 1U5ZA 4BCUA 3BTAA 1ZZ7A 1IKQA 1XPWA 2O8QA 1FMD3 2VVEA 2WQZC 4QX0A 2GNTA 3POGA 3T4VA 3UKVA 3A7QA 4LO6B 1W90A 2WZPP 4COYA 4CU9A 5GZFA 1Y4WA 4AVTA 2YROA 1XE8A 1PGW1 4WBBA 2BTVC 1W3XA 4DUXA 3ACFA 1WMDA 3WQ1A 1QMJA 2Q8EA 4F3JA 5FXWA 1OOPC 1SLCA 3KV9A 1LU1A 4B1LA 1JZ2A 2PHLA 3DL3A 4A7ZA 3WNOA 1JHJA 4F7ZA 1H0BA 1QJU1 5D8AC 1W9SA 1ZBE3 2BWAA 2WO1A 2WNOA 3ZFEB 3POFA 3VBOA 1DGRN 2VW1A 2Y34A 3HQUA 3AZWA 1TQ5A 1OF3A 1YNAA 3WCRA 1MACA 2OT7A 1V6IA 4OHYA 3V65A 4XEZA 2V5DA 4N43B 3VZNA 3MUY1 3RZLA 1LHVA 1APNA 2A7AA 2VO5A 3VBUC 3VKLA 4AI3A 5AVAA 1GZWB 2XVLA 5C9AA 3BPZA 4I0AA 4IEWA 1LCLA 2VNVA 3POJA 4P9GA 4YZ2A 3WUCA 1VBC3 3HEIA 4QPYA 5FZ1A 1S0JA 1C1LA 1CAUB 3PUHA 5FQ0B 4GA9A 3LOBA 1V00A 4J1WA 4I02A 4Q4W3 4IEUA 3OYWA 4Q4X1 5CYYA 5F5IA 3QH7A 4I2OA 3MICA 2CY6A 1POV3 3N9LA 1G9AA 2NM1A 3VGIA 4NWWA 3UV9A 3E6CC 4FQ4A 5KHKA 2B7YA 3JBG1 1VP6A 2QQLA 4Y3OA 2VMFA 3K46A 1QY4A 3VD5A 2R062 2BV4A 5H9QA 5IHRA 2VM9A 2W2IA 3KCCA 4HPKA 4QQ2A 4AVAA 4EN8B 4Y1VA 1V70A 3WG1A 1QJZA 1YFXA 2YXSA 4Q1RA 1R091 4UF0B 4WVMB 5A6ZA 3APBA 3ZFEC 2RE9A 3EYPA 4OZOA 4RS5C 1JS9A 2XJUA 1LOEA 3MV11 3I2JA 2WO3A 1K45A 2UWBA 4H14A 4CCMA 4D0QA 1AXZA 3GDBA 3I3DA 4Y4YA 3VHRA 4MX3A 5IVFA 4UI9L 4DOUA 4MYEA 3OB8A 4Q2FA 5GLWA 1XNCA 2Y33A 1H1AA 1LU2A 1RINA 3AJZA 1RUI1 4QGLA 2HWB3 5EV7A 4XFIA 5CB7A 1OKOA 4UYBA 1AYM2 4DXZA 3FFQA 1UOGA 1LTEA 2GN7A 2R6QA 5JAXA 4ET7A 4TN7A 1QU0A 1ENQA 3ES1A 2Y0OA 4GMP3 2DCTA 4KWUA 2D6MA 5FKBA 1CZSA 5KC6A 4SLIA 4ZY9A 5IVVA 4CDQA 3KZ4C 5FZDA 2HWD3 1S2KA 5FZFA 2WT1A 4Q0SA 4CEWA 4QQOA 1IHMA 3WP4A 3VV1A 2G9ZA 4IERA 5F7UA 1ACCA 3CJXA 4QMAA 1TME1 3HT2A 1QH6A 4EN6B 4DY3A 1AYN1 3E97A 1S2EA 4QHZA 4CU6A 2CGOA 1KFXL 3OY8B 2K0GA 5FXVA 4QPIB 1AF9A 5F5CA 4NIIA 1V0AA 4UFMA 2D97A 5C3RA 1AL0G 4O9EA 4A4AA 1S0CA 5FY5A 3U78A 1YFYA 1RUF2 4PLNA 5HCHA 2UYAA 4D8MA 5M0TA 3JQWA 3ZKYA 4COUA 4AK3A 3AKQA 2P34A 4RQPA 1V9U1 2Y64A 3PUAA 1OF4A 4NUBA 1NY71 1QDOA 2ADDA 4FOQA 5CFCA 3P3NA 2A6ZA 3QBQA 4C8DA 2ARAA 2WZR2 5B4XA 3CKHA 5FWJA 3RZGA 1RUE2 3PVOA 5IFTA 5KR7A 3RDIA 4ASKA 5LW9A 4XILA 2VUJA 5DUWA 4DINB 3OBZA 2AZ5A 1KJLA 5EWSA 3DF0A 5LASA 2NLRA 2OW4A 3R6SA 2RG4A 3N9OA 1SPPA 4RA0A 3P6BA 3IB3A 4LBLA 3QOPA 3IT8A 5F2WA 3LSEA 2WSVA 3QD6A 2DVGA 2G4IA 2XQRA 3Q8BA 5A7NA 4B8EA 3DPRA 5A3LA 4BXSV 2VZRA 1DQ6A 2TUNA 2Y0IA 1W8ZA 3ZYJB 1OFSA 5JSOA 1RUD1 1TEIA 1VIWB 2W1UA 4QKFA 1ULPA 4R9BA 2GC1A 3GGLA 3NKTA 1H2LA 2Q8DA 4CXYA 1JODA 5E89A 1VRH1 4L8QA 4LA3A 1MS4A 1NCRC 3J8F3 4PIXA 1CESA 2WA4A 3ATGA 4QPIC 4QXBA 4XJ8A 2ZEYA 2XR4A 2ETEA 2UU8A 1O7FA 2EF6A 4FFFA 1STMA 5FZ7A 2PLV1 4EWEA 3M7AA 3D5OA 1EV11 1W2OA 2J1VA 1L7RA 1YFUA 3TNPB 2ZGOA 2OPKA 3PU8A 1OLRA 1HQLA 3IKWA 2RS12 3T4HB 3NJZA 2C9AA 1YQ8A 1N1TA 2IFWA 1ZBA1 2OA2A 2R1BA 4JC1A 4XMIA 3CNAA 4XBLA 3RYRA 4OUSA 3RYPA 1PGL2 2HWC1 5FZOB 4N9IA 2GNMA 1BXHA 2B5HA 2VW2A 1BZWA 3SKVA 4MUVA 5FPAA 2ZHLA 4XETA 1JXNA 2W91A 4BLJA 5JZGA 1T6GC 3Q8CA 1SDDB 1F31A 2AEZA 5DAPA 2H6CA 3I3MA 4LHNA 1US3A 2VVDA 5IVBA 4LKFA 1AR93 4PHZA 3TN92 3VL8A 2IXCA 2N7GA 4IUGA 4EZ4A 3IAPA 4UFIA 1CAWA 2JIJA 5IVCA 3O1TA 4Y20B 3RFRA 3VHOA 2LRPA 3OD0A 3DECA 1N3OA 3LQCA 1OC1A 1OVSA 3WW2A 3VBHB 2RR11 4FP2A 4BH9A 1JOBA 1QOSA 2WLQA 1WUVA 3HR9A 3I59B 4KBZA 4IGOA 3VBFA 2W1QA 4QXCA 5E6HA 1OURA 5GZGA 4Z2AA 3FFZA 2NQYA 2VL4A 5JLVA 4Y5Z0 3RNSA 2IZWA 3FHQA 4J1XA 4AL9A 4E9KA 2VNGA 1GOFA 2NPIA 1JBCA 3AMPA 4XIKA 3JQXA 2ZMLA 2O14A 3POBA 5KBFA 3FC0A 1RHI1 2JE7A 4XBNA 4GKXA 2VZPA 1HN0A 3JD71 5A1LA 1MEC2 1V6LA 2DCKA 2X53S 3K4AA 3C7EA 3R4SA 1B35A 1CX1A 4JTNA 3ZN6A 2X5IA 2JEMA 5J1XA 2ENRA 3VZMA 4CUCA 1HV1A 2RDNA 3B7MA 4MGSA 4LHLA 4QX3A 4DPNA 1DYPA 2CL2A 5F3EA 1FPN2 4GB31 5C4WA 2VMEA 1U5XA 1VAMA 4M00A 2Z4FA 1RUJ2 4BIOA 1FMD1 4CXWA 1JYIA 5H9RA 2WFF2 4BDVB 4BE3A 2WWSA 1JUIA 2X8KA 3T1LA 2HJIA 1HIXA 5JXJA 3WZ1A 2FDHA 5CZKA 4AXOA 2CDOA 2PAEA 2PAMA 4K1ZA 3WV6A 3G6JB 3VBHC 1ND2A 2J1UA 1ULOA 2WLPA 5E8AA 3SNMA 3PTYA 5DDJ2 4Q4V2 1ZBE1 1HXS3 1DDLA 1V6KA 5JMOA 2IVJA 1ZZ8A 3WG3A 4FTSA 3QH6A 1SBFA 4Q0VA 4ZHNA 2J1EA 2E63A 3PVNA 1GNHA 2XB6C 3N7JA 3DN7A 5L7OB 1HW5A 3ZMOA 3OGRA 1DZRA 1QXJA 1DGWA 4DMIA 3NV2A 1Z7S2 4ZPIA 5E1RA 4BQ2A 4LBQA 1HB3A 2YV8A 1VBC1 4CP0A 2KXLA 2R49A 1RUC2 2CHHA 5DAQA 2QKDA 3AVSA 4OLLA 4XIOA 4AGRA 1DQ4A 3H1WA 3ZFGB 5DAVA 3S57A 2F4LA 1RVF2 1E5RA 1SCSA 4A3XA 2WQ4A 2W5FA 4RHV3 1POV1 2YC2A 4UFKA 1UF2C 1SFYA 1URXA 2XWBB 5A80A 3UJQA 4Q5OA 2J1TA 1UPIA 4DO0A 4DXRA 1GICA 1XNKA 4R9CA 1UMIA 1Q8QA 2ZGNA 4NPRA 4YYOA 1PK6B 1RJ8A 4LLOA 4DIQA 2R1DA 2NN8A 3VKNA 1NZCA 3C7FA 3PLQA 1T6BX 1G86A 5DZFA 4LTAA 3D4KA 4KNCA 3VKFC 3IBMA 4JVAA 2CYFA 4WM7B 2LUWA 2G9GA 2VH9A 2ZJCA 4N53B 1W03A 3RVHA 3OGVA 2WJSA 3WHUA 1WLCA 2BOIA 3GZAA 3LCPA 2A1XA 1SBDA 1UYPA 2LALA 4GALA 5LBBA 4DQAA 3O0WA 1PIV1 4R4XA 2XVKA 2LTNA 4YZ1A 3H3UA 4HKOA 1J83A 3SLIA 2K46A 3LA7A 2XUMA 4PBOA 3AXEA 4HFSA 1MVQA 2W3JA 3ME2A 4FTBA 5IATA 5FYIA 2HWB1 3S0MA 1AXKA 1QF3A 3M8LA 1YQ6A 3S5AA 4G9SB 1FV2A 1RUH2 4Y1XA 2VAUA 5C8CA 2XJQA 3AXDA 4GMP1 2WS92 3CLPA 1R1A2 1DYOA 1DQ0A 1CD3G 4QKDA 4RN5A 1X9PA 4X6RB 1O4ZA 2HWD1 1YFWA 4XMAA 3HBZA 2Y6GA 1OD5A 5F8PA 5CIRA 4E8DA 4QM9A 1PK6C 1CIWA 1VALA 4JQRA 1PVXA 5BNOC 1UPSA 5EYXA 2D7FA 1Q5OA 3MW4A 4FPCA 1O91A 4P9JA 3IDAA 4KL1A 2FDGA 4I0WB 4QGMA 1O3SA 1F9KA 4YGCA 1O6UA 3AM2A 5EQUA 4IEVA 5FY4A 4AG4A 4CCEA 1DP0A 1H6YA 4WM7C 1ZM1A 2W08A 4XUPA 4AQ2A 4JGZA 4CEYB 2J1AA 4N53C 1LENA 1YC61 1NA1B 3SCGA 1UCXA 4FPOB 1PVC1 1AR62 5IK7A 2VTXA 3UGFA 4IV1B 1QOTA 4Z2WA 3THCA 2WNUA 1HDKA 4D6SA 5KWRA 1POQA 3SITA 1WKYA 3LB9A 2WO2A 4Q4Y2 4UFJA 4D7YA 5J96B 1B09A 5A7PA 5GLZA 4MGKE 4OYUA 5FMCA 4AFCA 1ZRRA 2PMWB 4AOCA 2SBAA 3JZVA 1A8DA 1COV2 4DEVA 5GLVA 3ZFFB 4FBFA 1HRI2 2C4XA 5JOZA 2YC4A 4ZZ5A 1GQPA 1DQ1A 2JG9A 5KHGA 5FYMA 3LA2A 4DZGA 3KV5A 3AL5A 5A1AA 5FZAA 3JBG3 4XAEA 4H2AA 4YW3A 1ZZ9A 4NJ4A 2Q4SA 3NAPA 1Y3TA 2ZPXA 4GWIA 4AEDA 5BNNB 1H6XA 1W8UA 2ZS6B 5FYVA 5LA2A 1P8JA 2MEV3 1GANA 2PHXA 2WZ8A 3H7JA 4QPWA 3ZXAC 4XZPA 4NROA 3EXUA 3J8F1 5I0DA 1YJLA 1EAH2 4E8CA 2V72A 2ZKLA 2C26A 2EXKA 5LCWL 3TEZA 3WUDA 3LE0A 4CEYC 5FMBA 4YVSC 2JKXA 1LOBA 4M01A 1XYOA 5C3QA 1TVGA 3BOPA 2D43A 1W05A 2AYHA 3HJRA 1W2NA 1VBA3 2XDVA 2QBXA 4IV1C 3ZYHA 1Y9QA 2IFRA 4AQ6A 1GZCA 4D7SA 5L36A 3U0ZA 2DVBA 3VBOB 4OQ8A 3ZDSA 2R16A 4CSWA 1F4AA 4Y1YA 1O4TA 3NSTA 3W20A 1ZREA 2ZA9A 2HWF2 2LS6A 3GXUA 1SZBA 3UETA 3MPPG 3RWNA 3WP6A 1K3IA 1BLZA 5JVVA 3AP7A 4MGZE 1V6NA 5C9AB 4W50A 1YQ2A 5T5LA 5TSWA 1ULCA 2RMU2 4JRAA 4WM8B 2B42B 4QDQA 3PIGA 5FKCA 3SMHA 3O1PA 4EN9B 2VD7A 4QX5A 3O1OA 4LT5A 3OYWB 1O5LA 4QX2A 5J98B 4DXSA 2DCZA 4Q27A 3VZOA 4CYDA 5FLIA 4COZA 1AYN3 1MS0A 1OLMA 1KGYA 4HKWA 4J25A 1AR72 4XPVA 5BNNC 1YQ5A 2DWRA 5FYBA 1W8WA 1LHNA 2RVAA 3MFCA 3RGBA 3WEZA 5JSRA 3O1RA 3FWEA 3AZYA 3FBMA 2XL9A 2YFUA 5LRRA 4Y22A 3W5MA 2ZGTA 2CGNA 4I30A 4N90A 2QQOA 4Y1UA 4UBGA 4CCKA 5D21A 1UYYA 4HPKB 1V9U3 3VZKA 4ATFA 2OVUA 1H9PA 4AR2A 2OKXA 1Y43B 3NV1A 4JKKA 4YZ4A 5LK5A 4MOAA 1OPMA 3B93A 3ZXJA 1RUH3 4Z92B 2QQIA 4XQ4A 4XURA 2FDIA 4FFGA 2WKKA 1UXZA 1QJX2 2VBDA 3VBOC 1MVEA 3O5SA 2BFUS 3I7DA 4HLTA 1H1MA 3TEYA 1Z0HA 2VQAA 1S0GA 5CG9A 2AR6A 3ZM8A 3J7LA 4X6QB 1H8VA 3KT1A 4NO4A 2JDMA 3PUQA 3USSA 2BP6A 2YUEA 2WO7A 5C9AC 3U4XA 2R0HA 1RUG3 4COVA 1YCIA 2VCMA 3RG0A 3B69A 1MQTA 3WNPA 3TEXA 1QHDA 5JPMB 4QU2A 2YZ4A 5JWPA 3FZ3A 1YUDA 4A3ZA 4JX0A 4CDQB 3L2YA 3RI9A 3WDYA 1LGBA 4AHYA 1J59A 1RUF1 2GMEA 5G04L 1VRH3 1RYYA 1ZVFA 2E26A 1AX0A 1AL22 1VE0A 2QUOA 4TSVA 3UL2A 2O8OA 4B29A 4LO8A 2OYZA 1E5IA 1DCSA 2PLV3 5A1FA 3I97A 5A3MA 3UNPA 2R042 5EFUA 3ROUA 1ENRA 4S2GA 1EV13 3U1XA 4NAOA 2WZR1 4O7XA 4FP3A 4OUEA 1RUE1 2W1SA 1IGOA 4AI0A 3EHKA 1FT9A 3LA3A 5LA1A 5FYTA 3RZHA 1COV3 3GJBA 1UYZA 2A5ZA 4AEKA 4FI9A 5AC92 4HKLA 1HRI3 5IW0A 2RS52 1RUNA 4GIQA 3VKOA 2B9UA 4RQPB 4BB3A 2VZQA 1JZ8A 1JZ6A 3ES4A 5FZIA 1IS6A 4YW4A 5DN2A 1O3TA 3RS6A 1PO13 2PAKA 5FUNA 4FAGA 4QPGB 4R9DA 4U2AA 5CFCB 1VBE2 3ZO0B 1LHUA 2VR4A 2ZAAA 2ZGSA 5FZGA 1AX2A 1ZX5A 2QQKA 2VZOA 2VUCA 5BYNA 4CCLA 2KM2A 3PVEA 4GWJA 2ZX0A 5T3NA 2QQPA 5IK8A 1K42A 3LKJA 4LBMA 4YW7A 3V0BA 1SHWB 2RJKA 3WY6A 1YEWA 4AI1A 4NRPA 2MNGA 4FVVA 3MLJA 1DGWX 1OOPB 1SPPB 2ZX4A 3BVCA 1W6MA 3MHZA 4IE7A 2XPJA 1H2MA 3OUHA 2E51A 2J7MA 4W6WA 4CEWC 3GHNA 4RFT0 5F9TA 4NIDA 3DPRB 1TG7A 4UWDA 3U10A 4B4QA 2JB4A 4BWOA 2XMLA 2RS11 1WW7A 1RMU2 4IW3A 4AFBA 3Q8FA 4NPMA 5LZ6A 2HLEA 3Q8EA 2WAOA 3HMYA 4FT8A 4AHZA 1C4RA 2XXZA 4RFRB 3OD4A 3FJSA 4EJRA 5DUUA 5L73A 1Y9MA 4CUAA 3T09A 5K0UA 2JD9A 2QE3A 3JD73 1AUYA 3SQOA 1DG6A 3KLSA 4M0HA 2GC3A 3H3LA 3B00A 2IWGB 4INDA 1FXZA 2RJ2A 2RMU3 5GM0A 5LBCA 4IV3A 4MLOA 4RQPC 3T0AA 3WVJA 2H0VA 5BNQA 4KWJA 1R1ZA 1PMIA 4URTA 3TN91 1W8FA 5F1RA 3LEGA 3ACHA 5H9SA 2WL1A 4QU1A 4UFHA 5CKMA 1UZZA 1UKRA 3RJ2X 2HWE2 3USUB 2BUKA 1U5IA 3IDCB 3BIWE 4GB33 5GALA 3BTZA 1LEMA 1KRIA 2P17A 2PHRA 4EYUA 1QQP3 3PTRB 2WNVA 1C8M2 2TNFA 3F2ZA 2WINB 5JZGB 3Q9OA 3BB6A 4JTOA 4MGTA 2J1SA 5FYYA 2VOKA 2TBVA 2XJVA 4P5YA 4AVVA 3RZMA 4BISA 2OUJA 5T54A 1JTZX 1W06A 1WW5A 5HPOA 2RDSA 1QIQA 2H6BA 3AFKA 2D6KA 3DPRC 2W47A 2AGSA 4RS5B 1F15A 3BCWA 1VB2A 4LMFA 5LRSA 4QB2A 2B9VA 1RGSA 2JDPA 4LOTA 4D69A 1OPOA 1PX4A 4GXLA 4HONA 3VBFB 4JDMA 4HVOA 5ACA2 3V0AA 2C9KA 4F8AA 4PLOA 5APAA 3WDUA 2D3RA 4JQTA 5FOJB 4TLFA 1WCKA 5F6LB 3PIJA 3BU7A 5DG1A 3BYWA 4XXPA 4IEZA 4AWDA 1UXXX 1AR83 2A3YA 2QNKA 1HJFA 3B02A 4XFHA 1DYKA 5DUXA 5I0UA 2WFF1 1F5FA 2W39A 3FL7A 2WAAA 4M3CA 5E16A 1DU3D 1PNFA 5GZCA 3ZN6B 3D8CA 3E1F1 4YM1A 5CG8A 2CDPA 2XHKA 2YY1A 1VBD3 5I8YA 1HB2A 1BBT3 5JZGC 4E4DX 5FMOL 2DVDA 3VD4A 3D6EA 1NXMA 3E5QA 3U75A 1YI7A 2MEV1 1QDCA 1X8MA 1WZXA 2A70A 4QX1A 1HB4A 1QKQA 2ES3A 2XUEA 3ZLIA 3R4DB 4RD7A 4HSLA 1MS1A 4YARA 3VD9A 4FTEA 3MIDA 3MGUA 3C7GA 1KXGA 4CTEA 1PIV3 2VOVA 3GM8A 4KGGA 4PCRA 5C7GA 1Z7S1 5FWEA 1L7LA 1YYNA 5I91A 5A7OA 1ND2B 1VBA1 3S6PA 2B39A 5K7PA 1RUC1 1LGCA 1FV3A 1TMF2 4NRQA 4NRMA 3ZIWA 3VBFC 1ENXA 1LJ7A 1MS5A 2MHFA 3WDTA 3ZYFA 1LOFA 1HQWA 1D4M2 1SLIA 4QM8A 2ORXA 3CEWA 4XFGA 5FY7A 1GUIA 3HN1A 2VZSA 1L3JA 2WFPA 5E88A 1MPXA 2E9QA 2H0BA 2XJRA 5C70A 4BPZA 1OA2A 1GWKA 2VCAA 2CAVA 4IE0A 4DFSA 4KBBA 1KS5A 1B35C 3SISA 2VUAA 1GSLA 2QQWA 4DXTA 1IPJA 4ZS2A 4LBOA 2RV9A 1JYWA 3AMQA 4LHSA 2X5IC 4BIFA 1JZ4A 4D3WA 2GNBA 4HN1A 1AVBA 4COWA 4H7LA 2ARXA 1UL9A 2ZXQA 1H2KA 1NCRB 1XXNA 2RS32 5C4WC 1KQRA 3MYXA 3O1MA 3T2TA 4NIHA 5DG2A 2D6PA 3K2OA 1Q8VA 1GYKA 1PVC3 1X8EA 4GQ7A 2VPVA 1H1IA 3HN3A 4HOOA 3KF5A 2R073 1EUUA 3EJKA 3MI8A 1I9RA 4XFBA 1ND2C 1RUH1 3B01A 1BHGA 4LUKA 2EVXA 3HAGA 4MXWB 1UIJA 4TYSA 4Y33A 4G4FA 2IC1A 1LAJA 3T0DA 2WS91 1NT0A 1QJFA 5KXDA 1BVVA 1R64A 1XB9A 2Q30A 4LHKA 5FUIA 1UY2A 3UESA 4NOTA 1J1LA 1BEV2 4QHOA 3HD8B 1VPHA 3THPA 4XE9A 4LO5B 1C8M3 3P3PA 4Q29A 1K5MA 1WMFA 2QQUA 4BQWA 4XF1A 5KHHA 1RUG1 2B45X 3HNBM 2BNNA 2NZ9A 5DQ0A 4EROA 5F37A 4Q0PA 1UN1A 1UNBA 1UX7A 2O1QA 3ACGA 4FPFA 5FRAA 5C8CB 4Y4RA 1NYWA 2EIDA 2W95A 1XSRA 4ONUA 4ZXEA 2P3JA 3BODA 1AR61 5AFEA 3C8XA 4TTGA 3LPFA 3O1UA 1REDA 1H4HA 2IXHA 5FBJA 3WG2A 2VQ0A 2JJ6A 3ZYRA 5BNPA 1NG0A 4LO7A 1NE6A 3LOIA 2RM22 1JU3A 4Z07A 1WD3A 1W8OA 4Q4Y1 3DCQA 1GZTA 1R082 1COV1 2Q1ZB 5I8TA 1JZ3A 1HRI1 2VTFA 4P9WA 1SLLA 2ZCWA 4BOWA 4DEQA 1PM7A 4XF9A 4FPEA 3RSJA 1OH4A 4MZUA 2WNUB 1UY3A 5FZ8A 3K3OA 1O5UA 1PO11 3GZUC 5K9YA 1C8NA 1QJY2 3NKGA 4GH4C 4AI2A 2C5DA 3G7DA 4YLZA 3K4ZA 4K21A 2P1BA 5IAXA 4IQPA 1WW4A 1ODNA 1C57A 4OHXA 2R063 1X36A 5CKNA 3I3EA 4PJYA 3ZN5A 3A0NA 3TNQA 3VDAA 5C8CC 1UU5A 3KV4A 2XOMA 3WW3A 4ASMB 5DZGA 1JHNA 2OPWA 1ODMA 2VQTA 3ZN4A 1Q43A 3UKTA 1BJQA 4PI2A 4UW6A 3T2PA 3AZVA 4GJZA 2DDUA 4LK7A 4MG2A 2X05A 3VBSC 1SDWA 4YGEA 4AEDB 3EBRA 3H8XA 1CAXA 4AVCA 3TRSB 1HRV2 1YI9A 4DY5A 4CDUC 2EALA 1JMUB 1AYM3 1VBB2 1GFF2 1WD4A 1DF0A 4FOYA 4YWAA 4OI0A 1Y7BA 4G3YC 4QQPA 5C5TA 2HWF1 4LBJA 2DVAA 3CDZB 3J9SA 4JV4A 3MF6A 4JGZC 4W6XA 1SACA 3H7YA 2P4EA 5FAXA 1EY2A 4SBVA 3ZXLA 1LGNA 1OQ1A 1XC6A 1DGRA 2UURA 4N7UA 1PGW2 1QNYA 2DFCA 2RMU1 5HCBA 4ORFA 3BGAA 3B9IA 1GZWA 4XJ9A 1MZ6A 1E5HA 2JE8A 3B5LB 2WNUC 1PO22 4XZUG 1VLNA 1LOAA 4DUWA 3AKRA 2FDFA 1QJU2 5FQ0A 5EJZB 3CMGA 2XHNA 1JYCA 2V5YA 5HV4A 1XBFA 4LULA 5DPNA 1QQP1 1AR71 3LIGA 1J84A 1J3PA 2RS33 2P3IA 2VOTA 4NR1A 5JR2A 1GQHA 5JI7A 1PMHX 4QB6A 3AKPA 3ACLA 2JDZA 3RWKX 1RUF3 3NO8A 5KHIA 1X7NA 2JWPA 1W6OA 3VHNA 1NX9A 1YO8A 2AREA 2JG9C 2PHDA 2EXJA 3RMXA 2TEPA 5LA0A 3MLLA 1NCQA 1CAVB 3MLKA 2CGPA 1S0FA 2HEYF 4CVUA 3CBNA 3KMHA 3NAPC 4Q4X2 2DUQA 2WT0A 2WZR3 4AEDC 1HJGA 1RUE3 4YW6A 5FXXA 4FAHA 5FDBA 1PX3A 3AYEA 4A42A 1QJX1 2BDRA 5CEHA 5FZEA 1YJKA 4AEMA 3KQRA 4CCDA 2ZBJA 3IM0A 4BM8A 2ID4A 5JXHA 2ZZQA 3CHXA 2YC0A 4Y22B 2WQ8A 4MXVA 3RI8A 3BKZA 3BTYA 5CFDA 1YLLA 1GP5A 3S7IA 4AQSA 5C33A 3UKNA 4E27A 1Q8SA 2ORZA 4JHTA 4XQDA 5IUQA 3BIEA 3GJAA 2B4KA 1AR81 2BQPA 2GP5A 1NXD1 1GWMA 1R092 3HVDA 4UBHA 2GC2A 2JDYA 3N7LA 1CR7A 4U36A 3IMNA 4JDNA 1FOD2 3KCYA 1MS3A 3NRUA 2W0XA 5IYYA 5BNOB 1LECA 2R30A 4UW3A 5JOXA 3N7MA 5LBFA 1AL21 3F95A 3R05A 1KS4A 1VBD1 4GULA 4HBNA 4XTMA 1BBT1 1Z78A 4HT1T 1YQCA 2DVFA 2VMIA 1GMMA 3FUOA 1WCSA 4IXLA 1MQTB 1US2A 1AJOA 2DCJA 1VMJA 2R041 5EIYB 2Q5TA 1CJPA 1I3HA 1RUI2 5GZDA 3BTXA 3DKQA 2ZKNA 2RS13 1RIRA 4PT6A 2BVVA 3NNGA 3WT3A 3B9CA 1EPZA 5A32A 2PN5A 5FBZA 3H9AA 4Y26A 1JUHA 2CTVA 2XWJB 2NMNA 3MW3A 4FSJA 2DFBA 3B3QE 2Y6JA 3I3QA 2P6HA 4LJHA 3VD7A 4E4SA 1XU2A 4GH4A 3M3IA 1W2TA 4QDSA 1DZTA 2XG3A 4PIYA 5FK8A 2W68A 3KHCA 3VZJA 5EPAA 1UY0A 2I2SA 4ZZ8A 2VU9A 4UT5A 5FZ9A 3ZMNA 5JPNB 2VZ1A 4CPBD 4NAMA 1FNZA 2WN3A 4LEJA 3TN93 3T08A 4LKEA 4FXGB 4YSFA 3AX4A 3CJIA 1OD3A 3VD3A 3W21A 3WW1A 3X29B 3FN9A 2FD8A 4A44A 4O65A 2XKOA 5FMDA 1M4WA 3UJOA 2HYXA 2XJTA 1MZFA 4QT6A 3VBSA 2ZACA 2C6SA 1V6JA 2DUOA 4PDWA 4PIZA 1OKQA 4D7TA 5FO9B 4XUTA 4XDPA 1NY72 4CDUA 4QX7A 1J1TA 3HBKA 3NJXA 1M06G 1W8HA 1MQTC 2DBNA 1BQPA 3I2HA 1SCRA 3AZZA 4BQ1A 5ABJC 4BK4A 4XJUA 1CPMA 2G9FA 3ZYGA 1H8TA 4YVSB 1OHFA 4TXWA 1WA4A 1UAIA 1YXWA 1W6MB 1LOCA 3NNLA 5HV0A 2OS2A 3K75B 1MEC3 3ON7A 4ZXKA 1UZVA 1A78A 3WX5A 2BRTA 5A3PA 1LB2A 2R071 5FCCA 4IEYA 4XFCA 4LORA 3AKSA 1G7YA 2BGPA 4OMCA 2JB8A 3AYCA 4K9SA 4V2WA 4YVWA 1N1VA 5L9BA 1WWYA 2WN2A 2QQVA 1PO23 2Z69A 2VMHA 1ZRFA 3MV01 2PELA 1FPN3 1YIPA 4XAAA 2HWE1 3EO6A 1IPKA 2OZ6A 3KHBA 3V64A 4EQVA 1RUJ3 3I2OA 2YU1A 1ST8A 5HXMA 1QOOA 4FPGA 2WFF3 1UZ0A 1F5JA 1C8M1 4CE8A 3NL1A 2EIGA 2PHTA 4NE9A 4OHWA 4ES8A 2BERA 2NYYA 4C1XA 5A7WA 1J3RA 2J1RA 4ARXA 5KXCA 1CONA 1X50A 5T5PA 1GV9A 1ASJ2 4IGPA 3W58A 2KA3A 2BBAA 2WWUA 4S2DA 3ILRA 4META 1F2NA 2QFEA 2QZ2A 2WIIB 3J26N 3P1IA 4OHVA 2BYVE 4Q4V3 5DDJ3 3SCHA 3OJBA 2VG9A 2V09A 4QXKA 2EIEA 5CA6A 3RYKA 5D1IA 1FATA 3AMMA 1ZBA2 2W52A 3ASIA 2VVFA 4HXCA 4XUNA 3T1MA 2ZMNA 3FUQA 4O9GA 3DXUA 2ZHNA 3N35A 1BMV2 4W8JA 3POSA 4CP2A 4RYDA 1XNTA 2QVSB 3VUOA 1HB1A 3IZOA 4FFIA 3DYMA 3GZEA 1JN2P 1Z7S3 2DU1A 2ET7A 1DFQA 2YU2A 3J7MA 3MFAA 4ZU4A 5KXEA 3TEWA 4W65A 3W59A 1RUC3 3KGZA 3OGGA 2VZTA 4L99A 1O8SA 4XC9A 4ARYA 3OGSA 4IESA 2Q0AA 1RVF3 5J36A 3TB0A 1CZTA 3O0VA 5IT6A 3JU9A 4Q8LA 1HLCA 4XQWA 4E4ZA 3ZSKA 4W6YA 2JD4A 1S55A 5G05L 5J37A 4RR3A 1IG3A 2EXIA 2RR12 3KWVA 5C71A 4FOWA 2HYKA 3ECQA 3OG2A 3V0AB 2ZGLA 3CQOA 4X8NA 4ZS3A 3URFA 5K0UC 3J7HA 5B2GB 1VJ2A 4A45A 2X09A 1SLTA 5FOBB 2R061 4Q8KA 1TZOA 4NHMA 4YW1A 2DF7A 4IV3C 4H3WA 5FYCA 3E5XA 1W99A 4M4PA 2J42A 1PZ8A 4XF0A 4CXXA 2Y6LA 4ZU5A 5HCFA 4TZDA 2DCYA 2HBUA 4EWDA 4M3CB 4YG6A 5A3WA 1F35A 1NLSA 2ADEA 1A34A 1RHI2 2XVGA 1EPWA 1E5SA 1U5YA 3CIHA 5FPXA 4CZSA 1UQXA 2WNVC 4OZXA 3R0RA 5LB6A 1W0OA 1T2XA 4YG0A 2BBVA 2B46X 3H1YA 3LZZA 2Y6KA 3JB8A 3BOWA 2I74A 3CO2A 3DUIA 4BMBA 2AACA 1QWRA 3FLRA 4XJAA 3ZXKA 3ZOIA 5FZHA 1AYM1 1X82A 3WP5A 3SHRA 1ULEA 1G8WA 1DHKB 4XHXA 2GH2A 2WS93 5EHDA 4UOJA 1R1A3 3C2UA 4KU7A 3I3BA 4R4ZA 4BMEA 4LPLA 1AXYA 1EUTA 5FJKA 4LLFA 1MS8A 2OQ7A 3QLQA 1IS5A 3LEIA 3DYPA 1W0PA 2GU9A 1N3QA 4Y1ZA 3WR0A 4XDQA 1DQ5A 3SEEA 3ZR6A 4DB5A 4M4RA 3WXPA 2OQ6A 4ZU7A 3VL9A 2PA7A 3THTA 1ZBE2 2YBKA 1XYNA 3ZFGA 2GP3A 2W94A 3WF3A 5FY9A 5ABJA 5I93A 2VW0A 2RS31 5FPBA 4O61A 3AYDA 1OFNA 2VXJA 3PU3A 3MIGA 1W9YA 5T52A 2WRAA 4BQXA 4B4RA 4EWAA 2P3KA 3T0BA 5I0RA 4CEWB 1UO9A 2QDNA 4CDWA 1AR63 4LO4B 2PXJA 4ISRA 1VBC2 1ZNPA 3E6DA 3MIEA 3U11A 1D0GA 4M0NA 1QXPA 4LR4A 5A70A 4Q4W2 3WNMA 2LM3A 4L0PA 4Q4Y3 2ZGKA 5DAWA 1SQ4A 3UYJA 3RRDA 5CBLA 4CA9A 1W6NA 3T30A 3OPWA 4B7KA 1LESA 3EB7A 1HKDA 1VMFA 1CPNA 2EIBA 5C8WA 3WQBA 2WR9A 5FYHA 3S7EA 2O0OA 2JG8A 2YPDA 4E2GA 3BI3A 2WZEA 1XYPA 3SH4A 5DAXA 3OUJA 4K8RB 4QWNA 1DQ2A 2PHUA 5CKQA 2ZGRA 4P9IA 1SMVA 2D3SA 2GDFA 1PM4A 3AL6A 3DEMA 1W3VA 3AB0A 5FO7B 3SH3A 1LOFC 2JDUA 1OQDA 2YYOA 3HQXA 1Q8OA 1DIWA 3R4UA 1LEDA 2GN3A 1O8PA 1PGSA 3K51A 1GOHA 3LDBA 1N3PA 2ZGPA 1SG3A 4CDXA 1EAH3 1WCDJ 2ET1A 4LE3A 4YM2A 2X29A 1JZ5A 2ARCA 1RXGA 5EYYA 2A73B 4L11A 2VMGA 2RM21 4GKYA 2ZZJA 1DGLA 2HWB2 3AYAA 3IDEA 5FPVA 2VBPA 3AP6A 3ZIXA 5C5UA 3KGLA 1WLTA 3WW4A 2W9XA 5GJ6A 3LEKA 4IDZA 5I0TA 2DTYA 1UU4A 3SKJE 2RHPA 5FLHA 1RITA 3N9PA 1PGL1 1KFUL 2HWD2 2HWF3 4MHRA 3J4UH 4AVSA 3ABZA 3ST7A 4JZRA 4HK8A 4HG6B 5BNPB 4NHLA 5FV3A 1SEFA 1V6OA 5JR7B 4BQ5A 4GD4A 1QJY1 2FMDA 2XJSA 1VRBA 3CU7A 4FQZA 1BK1A 3GZTB 3MO4A 3I2GA 4YFZA 4C0HA 2SLIA 3DV8A 3BN6A 5EP9A 1ZZBA 4QKBA 4EZHA 5F3IA 2WA3A 1ONAA 5JI9A 4R52A 2JENA 1OT5A 4J6GA 4MGYE 4M3CE 4CUGA 1S2BA 1AR73 3QCWA 2FMYA 4XJWA 3ZFFA 5A6QA 4YG3A 2GALA 1OH3A 2EICA 4H55A 1X9TA 2GNDA 5LK7B 1OUSA 3PDQA 2VOXA 2Z42A 3AFGA 5L19A 3WDWA 1QEXA 2B8MA 5J3UA 3KQ4B 5JIUA 2FBEA 1K5MC 2Y6HA 1VR3A 3WCSA 2VNOA 1O3QA 1HN1A 1RL3A 2XL7A 2IXLA 4YRDA 3SCFA 4LBKA 3H8UA 4K40A 2YGMA 1CAWB 1GBGA 4PLMA 2GMPA 5LBEA 2Q8OA 1LOGA 3L2HA 4AHXA 4CP9A 3NV4A 3AC0A 2ZAHA 2EXHA 3NNFA 2GSYA 1FI2A 1OA4A 1Y9GA 3GYDA 1QJX3 1OSGA 1QJEA 1MEC1 2HEVF 3H50A 3UGGA 5FMOS 1A3KA 1F4HA 4JGYA 2QQNA 1ZRIA 3GCWA 5T5OA 5L9RA 1JH5A 2WT2A 4JKMA 2IUWA 2P2KA 3LEMA 4Q1PA 5FPLA 1CAXB 5BNPC 2E53A 1PO21 5J09A 1GP4A 3KS7A 5FIXA 4KGQA 5IAVA 1FPN1 1GWLA 5CISA 2QJVA 2KR2A 1IS3A 3BPSA 2MPFA 2VQUA 2ZHKA 5B4NA 2ZX1A 4XOGA 1RUJ1 1NOVA 1UW8A 4XYXA 2XGXA 3FLTA 3J8F2 4FPJA 1KJRA 1O4YA 3I4IA 1CGPA 1B35B 3IPVA 3PUSA 3H42B 1IQAA 4AGGA 2X5IB 5DUVA 3KT7A 2QTWB 2BJSA 2VMCA 4I09A 4ITCA 5DXDA 1AL23 5FYZA 4BZ4A 5BUVA 5FYUA 3ZYBA 4WM8A 1NLRA 5F5QA 3PMSA 5DDJ1 5SV8A 1C5HA 2VZVA 3NQHA 3NJVA 4Q4V1 1WCUA 3RPQA 3SXWA 4AHWA 4HVQA 2R043 4P08A 2UY9A 4ISQA 5IVYA 3AMNA 1G9BA 1NQDA 5T55A 1H2NA 1TNFA 4HK9A 3GALA 4HMZA 2JIGA 3P5BA 4KH9A 1W6OB 3I2FA 5AC93 2RS53 1W9FA 3LDKA 2ILMA 5LY1A 3VBRA 3ZXGA 1NCQB 2Z5WA 3WNXA 1AR92 1GNYA 1HV0A 1GNZA 1REFA 3T2OA 4XACA 4HETA 3WF2A 4BQYA 1VBE3 1RVF1 2EA7A 1NLQA 3T2QA 4XFFA 4XHBA 4GZ9A 2CU5A 2D98A 1WA6X 5FY8A 3C7HA 1UMZA 4YM3A 1JYTA 5LEJA 1FOD1 4KI5M 4Y24A 4HZFA 3W9AA 4AEJA 1Q8PA 1S0BA 4FPHA 4LBQB 1WW6A 3O1VA 4LIUA 5CFDB 1RB8G 1UKGA 2BGCA 4N43C 1ND3A 2ZEXA 4NIAA 3VZLA 2BEOA 2A6YA 3ZYPA 5A7SA 1QNWA 2VULA 3IIIA 1UIKA 3SEPA 3N36A 2Z2SB 4GWNA 1CQ9A 3RMYA 1RMU3 3ZDVA 4OI4A 3POIA 3HPNA 2FZ1A 3POWA 1N1SA 1KDMA 2E32A 1UOFA 2BNOA 3RQ0A 2G19A 3VB9A 3WF0A 4TLGA 3N4MA 3I49A 2JICA 3OCPA 4L97A 4XCBA 2BOJA 1U12A 2C24A 3HOBA 4JKLA 3I2KA 1W8NA 4CCJA 4QB1A 2X10A 1GOGA 2A71A 3D82A 4JDOA 2JDHA 3WF4A 4IEQA 1H4GA 3AP5A 5F6KA 5C6CA 5GKAC 1YWKA 1NCQC 2UYBA 3I2IA 2CAUA 2BZDA 3KVBA 4D94A 1C5IA 3WNNA 5A32B 1JYNA 3I2DA 3EMRA 1SBEA 3ZYIB 1R1A1 1CZVA 1WMEA 2HWE3 2LROA 2W87A 4LBQD 3U37A 2XH6A 2OXBA 2YMZA 4YZ3A 1VAKA 1IZ3A 3LWCA 1D7PM 4GH4B 3VDDA 3MBWA 4AGVA 3MDPA 3JUUA 1W6QA 1XQNA 3BALA 4YNIA 5LEKA 2VC9A 4D6RA 5CFDC 2D5HA 1OQEA 5CADA 1HXS2 2D40A 2Y60A 3E5UA 1DZQA 3A22A 1REEA 1GKBA 4QPGA 1OI6A 3CJIB 3V56A 1W6PA 4DNYA 4MV2A 4R9AA 4WZCA 3L9JT 2D44A 3OUIA 2JXAA 5ANQA 3KCXA 4CCCA 2EAKA 1ULDA 4KU8A 2D5FA 3JB4C 4TWTA 3H1MA 3NW4A 1BYHA 2A6XA 5JXGA 5HBAA 4YM0A 4LA2A 3NV3A 5KC5A 1WMXA 3OGJA 5I0SA 3VBSB 3EQEA 5CAZA 4PDWB 5A33A 1L7QA 4L9BA 1OOPA 1C28A 2A3WA 4JAAA 5ACA3 5KXBA 5HXVA 1UD1A 1LULA 5D8AA 5F3GA 4CDUB 3CZJA 1OUXA 4QXHA 3WSOA 4Q0QA 1XSQA 2ZHMA 2FHRA 2YBSA 5A3UA 2VNRA 2WABA 1IOAA 3A21A 3JXSA 5IVEA 4RHV2 5FZCA 1XE0A 3OPTA 3LIHA 1UYXA 5K4LA 4JGZB 1H8TB 3UGHA 4KG0A 4LKDA 4XF4A 4WVZA 1MZEA 1IKPA 5FP4A 3IN9A 4AYUA 4AAPA 2CWSA 4XF3A 3VBUA 1GQGA 2Z79A 3PURA 1SLBA 2VJXA 3GBWA 3POEA 4MGQA 5IFPA 5JIAA 1VB4A 2Q1MA 2V4AA 3ZXFA 4YVWB 2IXJA 3TBDA 3OBAA 3O1SA 3N9QA 1ASJ1 1WGPA 4XDOA 5JOWA 4D6QA 3VKMA 4PI0A 4P14A 1JW6A 2VXRA 4XJZA 4ES9A 4BLIA 5FP9A 5FLJA 1UY4A 3USUA 4RGKA 4BYYA 3CJIC 5JMCA 2RDRA 1J3QA 2HH9A 5FTTC 4AQTA 5K8SA 1K5JA 1EAH1 4C90A 5I8SA 2W46A 3BUCA 3OSDA 5C3SA 3M3EA 2JG9B 1BMV1 4OCTA 4XVHA 4UFLA 5A7WB 4GAZA 1S0IA 4Y5TA 2WDBA 3NAPB 2ZGQA 2XBO2 4RGAA 4PDWC 3UK9A 2DV9A 1TMF3 3KM5A 3THDA 4EN7B 3HQRA 2A6WA 1BK0A 1FYUA 4Q26A 5IVJA 5LATA 1AX1A 1D4M3 3QACA 4DRRA 3K3NA 3ZFEA 3ILFA 1EP0A 5ANNA 5FPUA 1J58A 1MS9A 1ZYBA 2D6LX 3OEAA 4RS5A 3ZXEA 5L9VA 5JUVA 1H8TC 1LRHA 2DURA 4RSUA 4N43A 2HBTA 2ZMKA 4K20A 4QD2A 2ZGUA 4P9XA 3VHPA 1O3RA 4JHZA 1TNRA 1C1FA 5DZEA 4NMIA 2JX9A 4QGNA 1W9TA 1ZZ6A 1CAUA 2IXIA 4YVWC 5IK4A 4KG8A 1JOPA 2IXKA 2I45A 4ZONA 1D2QA 1OMIA 3A4UA 4RR3B 3O7OA 2Y26A 4HL0A 4FPYA 4QX8A 1UOJA 1WBFA 2BW8A 2F4PA 5A6XA 3FX3A 3GBGA 1G6NA 4AE2A 3OTFA 4A2UA 4OULA 4KMQA 4B1MA 2VZ3A 1O59A 3N9NA 4X8PA 2JDNA 4OHZA 1NZIA 2VUDA 1ZZCA 5FZMA 4IEOA 2VGDA 1H30A 1GLHA 1ZA4A 5DABA 4AVBA 3KT4A 4QHBA 5EJ1B 3ITQA 4PF5A 4A7YA 4UF0A 5A7QA 4CU7A 1YRZA 2DUPA 2J22A 2IVIB 2UY8A 1E57A 3GNEA 1XNAA 4IETA 4WVMA 2FQPA 3PNAA 1DBNA 3W5NA 5JXIA 1F8VA 3WLUA 4XFAA 4YZ5A 4HSJA 4LK6A 4BQ3A 1BEV3 1PMJX 4K7JA 2K2SA 2YGLA 3JBG2 3VLBB 3I54A 3ZPYA 1S4CA 4IE5A 1CVNA 4LQRA 3H8RA 3JCIA 3IAQA 2YPJA 1AZDA 3LGRA 4LIVA 4OI2A 4BQ4A 4LOSA 4R8HA 3TOJA 3A23A 2MEV2 2PQSA 1DLLA 4XCAA 3FHIB 3U14A 4UW4A 2CWMA 3H3ZA 4I3GA 1IPSA 3KVAA 1UZWA 1VAVA 4HANA 2ERFA 3WOGA 1BCXA 3WG4A 2LW8A 5FP8A 3A0KA 4L92A 2ARBA 4RR3C 2VY0A 2RDQA 1VBA2 5A3OA 1RTVA 4HVRA 5FFOC 2DYCA 1I1EA 4P00B 4XABA 2WC2A 1DLCA 4DS0A 2RM23 4Q4W1 1TE1B 5EZWA 1PHMA 5ABJB 1LR5A 4HN0A 2YFZA 5FY1A 3ACIA 4QQLA 4NWVA 1CIYA 2ZOEB 1OBNA 2OUHA 1R083 1G9DA 2NMOA 3OY8A 4K3UA 1PZ7A 5IWFA 1NCRA 4QPIA 1UWWA 4AFMA 1X33A 3PHMA 3MUZ1 2AENA 3LFMA 3GBFA 5SV5A 2RS51 4CDWB 2E7QA 5AC91 3GHMA 3ETQA 5GLUA 4FOVA 3AZXA 1XRUA 4IEPA 2UWAA 3MZHA 1ZRDA 5BY5A 2E31A 2CSGA 2PTMA 2Y8KA 2R0FA 5CU1A 1FAYA 3M3OA 1QJY3 1VBE1 1TME2 2D93A 1AYN2 1JU4A 1W6NB 4MXWA 4AFAA 1OVPA 2JDKA 5A6YA 1W04A 1A8MA 1CJDA 3PJQA 1W2AX 4MSVA 5JSPA 4XUQA 1S0DA 4RGGA 4OFGA 1FNYA 2A6VA 2JG8B 1UZYA 2ZEWA 3C7OA 2OZJA 5L7OC 2W92A 2P5BA 1V9U2 1XOYA 1GU3A 3LPGA 1UOBA 4WVVA 3WD5A 5JDBA 1FX5A 2XBO3 2ZGMA 2BVBA 4Z82A 3AK0A 3MIFA 3VDCA 4N9HA 1RMU1 3AJYA 4A6SA 3PUIA 1HRV3 3S5QA 4AI8A 2E7AA 3AMHA 3ZFGC 5CVRA 3V0BB 1VBB3 3WNKA 4MHUA 1CN1A 4GWMA 4CDXB 1YHFA 1POV0 2GAUA 1LKNA 1D4VB 2W1WA 4C1WA 4A7KA 3RJRA 3NVCA 2DBIA 2P3YA 4MH0E 4AF9A 1W28A 4N8MA 3RZJA 1W2UA 4KWLA 1EYBA 4CDWC 2XKPA 1RUG2 5JOYA 4JRLA 4PQ9A 1W8TA 2OX0A 4A41A 4K6BA 3ZPOA 2YBPA 1PZ9A 1ZA7A 4P9LA 4IE4A 3OPZA 2WYFA 1QJU3 2YB7A 1RUD2 3T3YA 4AAXA 2A3XA 2PHFA 4YPJA 3WP3A 4P5HA 3DXTA 4I01A 1KD7A 3MIBA 2Q1FA 1ZRCA 3SH5A 3WINE 5FR3A 5K0UB 1K12A 1WLWA 1VRH2 5D2AA 3SC7X 5F3CA 3KB5A 5FZOA 4PF1A 2AH2A 3WQ7A 3E6BA 2XJPA 1H9WA 2EAAA 3MF9A 4F83A 4IV3B 2PLV2 3Q8AA 5GZEA 2JG8C 1N1YA 1EV12 2VBBA 4WZFA 3HIFA 2XLAA 3N3HA 4H7MA 4C0BA 4ZKTB 4YW2A 4EN0A 5ERLA 3LSDA 5F32A 4B4PA 2E6VA 1OLME 5BXXA 5LWBA 1KITA 5FO8B 4LBNA 3LFIA 4Q4X3 4Y5SA 4CCNA 4GMP0 3HT1A 1JI6A 2WNVB 2GMMA 4Y20A 5LY2A 1HX6A 4ATEA 2D6OX 2RJLA 2HWC2 1U0AA 1S0EA 3OBRA 4BK5A 2BPA2 2ZX3A 3DKWA 4XW3A 1Q56A 4MO3M 3U4SA 2C1FA 3DGTA 3VBHA 4CDXC 4MVTA 1RUOA 2VTXJ 5ACA1 2HKXA 1PO12 3I59A 4FFHA 4EV0A 1IS4A 3H0OA 3LAGA 4XTPA 2VOWA 2QQJA 4WVWA 4WV8A 4QDRA 2P37A 4YGBA 4I0BA 1N47A 4CU8A 5C4WB 4I3PA 3MW2A 4K1YA 4PQQA 2QCSB 1PNGA 3ZVXA 1VMHA 4NN0A 1D0HA 2XONA 4V1PA 4CP9B 4CCOA 4LE4A 2PQQA 3GF6A 2R7EB 4FPLA 3TAYA 4K8FA 1OXCA 1R093 5FUPA 1ALYA 3TWIA 1YIFA 1QH7A 1UY1A 2ZABA 3K4DA 1FOD3 2OIIA 3OEBA 4JGYB 5FREA 4BA6A 4DRVA 5IK5A 4ASLA 2AEYA 2VCCA 3POYA 5FP3A 1LHOA 2VCBA 1RXFA 3I8TA 1S1AA 3NNMA 4YFWA 5BV6A 3BU0A 1NA1C 3ZXDA 1Q3EA 4NHKA 3H8OA 3LDRA 2BGOA 3WDVA 2C0ZA 2NP0A 1OA3A 4Z1VA 5FZ0A 5DMYA 2CV6A 3NNJA 5F5AA 2FCVA 3K77A 1RUI3 4XBQA 4JCKA 4B3NA 4CP1A 4URAA 5C3PA 3FHAA 4MGIE 1GR3A 1LNSA 3IPVB 3O14A 3WHTA 4W4ZA 3JD72 3ZFFC 4EE2A 3OBTA 3KD4A 3WDXA 4XUOA 1W39A 4CUBA 1TMF1 4KQ7A 3UT0A 2K9ZA 2A75A 1GP6A 2AC1A 1AR91 1XNBA 4E4HA 2HEWF 1JYVA 4FPKA 1KEXA 1D4M1 1XJAA 2R32A 5BPXA 1CAVA 1I6XA 1TME3 3ZX7A 4GB32 1XE7A 1NUKA 4GJYA 5FPZA 1NE4A 1KDKA 3ZSMA 4FCAA 4B7EA 4P9YA 3NMBA 1FMD2 1QQP2 3M2MA 5FY0A 5GLTA 4AZZA 2XQXA 3OF1A 4M3CF 3WQ0A 3ILNA 4OMDA 4S2HA 4QKNA 4OQ9A 3HNMA 3MIHA 4PBPA 4XXAA 1OLQA 2JE9A 4IE6A 2I07B 5F39A 5FXZA 5L7OA 4C91A 2WWJA 2DU0A 3VBRB 2BU9A 4YW5A 5A3TA 4S2FA 4LITA 4JGYC 1HQNA 2PFWA 2DTWA 3C3VA 2E33A 5CNAA 1AJKA 5FZ6A 2YDEA 2Q8CA 1AHSA 5AFBA 1QGLA 1WBLA 3LD8A 1WCQA 2D3PA 4IGQA 3LF7A 2ATFA 2VECA 1IQDC 4E2QA 1W0NA 3ELNA 1UX6A 1WLDA 3FBYA 4CPBA 2FZ2A 3GCXA 3TYJA 4OI1A 2XLFA 3M1HA 4NVPA 1C3HA 2QDRA 4LXLA 5H9PA 1G9CA 1PK6A 4AW7A 4NIGA 4NPLA 1SLAA 5BNOA 1BKZA 1ND3B 2VE1A 1ULFA 3AVRA 3FE5A 1MR5A 5EJ3A 5J48A 3NWKA 4YGDA 5FZ3A 4BJ0A 5HCAA 2FDJA 5LA9A 3AP4A 4WM8C 5FZ4A 4WM7A 1AR82 2ZEZA 4UW5A 3WNLA 5FZLA 2WNEA 1NKGA 2WSUA 4N53A 3D0JA 1W9WA 1RUD3 3CL1A 3PMEA 4V2VA 3ZSLA 1CX4A 2F6BA 2GH8A 1BEV1 3K48A 3PJYA 4QQHA 2JKBA 4CRQA 1SFPA 5T5JA 1VBD2 1BBT2 4KWKA 2BFUL 3DYOA 3ZKUA 2VZUA 3VBRC 1HXS1 3IIAA 5FJHA 1JYXA 1ASJ3 3M70A 2E7TA 2KD7A 1RJ7A 4FO9A 1V6MA 2Y38A 4LUMA 5FK7A 5CFCC 2G1MA 2BNMA 3RZKA 2FCTA 4Q0UA 4P02B 1ZBA3 1PIV2 5F2SA 3O0XA 3WF1A 4E2SA 3VDDB 2WUHA 2WYSA 4DUVA 2P6CA 1K5MB 2HWC3 2F17A 4AI9A 2Y6FA 1W6QB 3PL0A 3AKTA 3NJYA 2PHWA 5AVPA 3KV6A 4MADA 3N7KA 1CWPA 1QXRA 3ENRA 5IJRA 5FZBA 2XLGA 4L2NA 2ZX2A 1ND3C 2PYTA 1W6PB 3B94A 3FLPA 1ULGA 1RC6A 4RHV1 1IG0A 1I5ZA 1R081 3AP9A 2FCUA 3MEPA 4BHPA 4OVEA 4BU2A 1UMHA 3O12A 2ZTNA 5FZKA 1SFNA 4LKSA 4CEYA 1LODA 1NQJA 4YVSA 4IEXA 4N7IA 5A33B 3D3AA 3M3CA 3ZR5A 1NA1A 3PVBB 2QQMA 4LNVA 3ZSEA 4CDQC 3ETPA 2RR13 4AFDA 1NAEA 4QAWA 3S30A 4IV1A 4UXAA 3ZSJA 3ORJA 3IWZA 1UU6A 2VMDA 3ALQA 5D8AB 1XNDA 4FXKB 2FDKA 4A6OA 1XU1A 1JZ7A 1A6CA 4IL7A 3HNYM 3KF3A
chains in the Genus database with same CATH topology
2ID4A 1CZVA 3HJRA 3U37A 5JXHA 2W87A 2QBXA 2WQ8A 4UAPA 1D7PM 2WBKA 3MBWA 2V4VA 2ORZA 1F4AA 3CZUA 1I5PA 2B4KA 2VC9A 2LS6A 3GXUA 3UETA 2YG0A 3A22A 1K3IA 2L9LA 2JDAA 4W50A 1YQ2A 3NRUA 5IYYA 4QDQA 3VDBA 5JXGA 4XUOA 4DXSA 4QX2A 1GMMA 1XPWA 4QX0A 1L7QA 1US2A 2DCJA 5EIYB 3A7QA 1KGYA 4CU9A 2RVAA 3CZJA 3WSOA 4PT6A 4DUXA 3NNGA 3WEZA 3ACFA 2WABA 3A21A 3JXSA 1JZ2A 1UYXA 2YFUA 3WNOA 1JHJA 2Y6JA 3W5MA 1W9SA 2WO1A 2QQOA 3VD7A 1UYYA 4QDSA 2OKXA 4JKKA 1OF3A 1UY0A 4MOAA 4MGQA 2VJXA 4ZZ8A 5IFPA 2QQIA 2VZ1A 4XURA 2V5DA 2WN3A 1UXZA 3MUY1 3OBAA 3T08A 2VO5A 1OD3A 3VD3A 3FN9A 4A44A 3HEIA 3ZM8A 3PUHA 1UY4A 2HYXA 5CYYA 2W46A 3WNPA 4XVHA 4XUTA 2WDBA 3NJXA 4JX0A 4A3ZA 3I2HA 3THDA 5G04L 4BK4A 2QQLA 2VMFA 1RYYA 3K46A 2E26A 4TXWA 3VD5A 5IHRA 2VM9A 3K75B 3OEAA 3I97A 3UNPA 5JUVA 2BGPA 4OMCA 4OUEA 2W1SA 3EYPA 4OZOA 2WN2A 3MV11 5LA1A 3I2JA 3MV01 4JHZA 2WO3A 1K45A 1UYZA 4D0QA 3I3DA 3GDBA 4FI9A 1W9TA 4UI9L 5HXMA 2VZQA 3OB8A 1JZ6A 1UZ0A 1JZ8A 5DN2A 2VR4A 2BERA 4ET7A 2J1RA 4ARXA 4KWUA 1CZSA 2QQKA 4ZY9A 2VZOA 2BBAA 4KMQA 2VZ3A 1O59A 4GWJA 3P1IA 1K42A 1SHWB 2EIEA 5EJ1B 4XUNA 5F7UA 2J7MA 4CU7A 4W8JA 2J22A 3WF2A 4RYDA 1XNTA 1XNAA 4CU6A 1TG7A 3DYMA 3W5NA 5JXIA 1PMJX 4A4AA 2HLEA 2VZTA 1O8SA 2WAOA 4D8MA 4ARYA 3OGSA 4LQRA 3IAQA 1CZTA 4CUAA 3T09A 2JD9A 2Y64A 3A23A 1OF4A 2PQSA 5G05L 5C71A 2RJ2A 3CKHA 5B4XA 3ECQA 3OG2A 3T0AA 3CQOA 5IFTA 3J7HA 2LW8A 4A45A 3LEGA 2X09A 3ACHA 1W99A 4P00B 4M4PA 1DLCA 2Y6LA 3P6BA 3IB3A 3F2ZA 2YFZA 3ACIA 1CIYA 2J1SA 4P5YA 4BXSV 2VZRA 3CIHA 1UWWA 3MUZ1 2W1UA 5HPOA 1ULPA 1T2XA 3GGLA 2Y6KA 2W47A 2E31A 2Y8KA 2ZEYA 4QB2A 2B9VA 1JU4A 1PX4A 4UOJA 3I3BA 2J1VA 1L7RA 2C9KA 4LPLA 1EUTA 3LEIA 3DYPA 4XUQA 3SEEA 4M4RA 2ZEWA 3C7OA 1UXXX 2W92A 1GU3A 2W94A 3SKVA 3WF3A 3FL7A 2WAAA 2W91A 3LPGA 1SDDB 3VDCA 3E1F1 3PUIA 1US3A 3T0BA 2CDPA 3WNKA 4IUGA 3IAPA 2W1WA 3DECA 3LQCA 4QX1A 3WNMA 4L0PA 3VD9A 3C7GA 4A41A 2W1QA 3GM8A 5C7GA 3EB7A 4Z2AA 2VL4A 2YB7A 4AAXA 2EIBA 4YPJA 3WQBA 3FHQA 1GOFA 1K12A 2WZEA 4PF1A 2ORXA 2VZPA 1GUIA 2DCKA 3K4AA 2VZSA 3C7EA 1CX1A 1MPXA 5C70A 5J1XA 4CUCA 1O8PA 4MGSA 1GOHA 4QX3A 2VCAA 1SG3A 4DXTA 2RV9A 1JYWA 4LHSA 1JZ5A 2VMEA 1JI6A 1JZ4A 4BK5A 2Z4FA 4BDVB 5JXJA 4MO3M 2ZXQA 3VD4A 2QQJA 5CZKA 4QDRA 2W9XA 4CU8A 2CDOA 3LEKA 4PQQA 3SKJE 2XONA 2J1UA 1ULOA 2R7EB 3HN3A 3ABZA 5JMOA 1EUUA 4HG6B 1UY1A 3K4DA 3OEBA 1BHGA 2VCCA 2J1EA 2VCBA 3T0DA 3MO4A 3I2GA 1R64A 3OGRA 5FUIA 3BN6A 2BGOA 1UY2A 3UESA 5DMYA 1OT5A 3K77A 2EICA 3FHAA 3HNBM 1LNSA 5DQ0A 4W4ZA 2W5FA 4A42A 2YC2A 1UX7A 3ACGA 4DXRA 2J1TA 2Y6HA 2EIDA 1HN1A 1UMIA 2W95A 4CUBA 3C7FA 4ZXEA 1JYVA 1KEXA 3C8XA 3AC0A 3LPFA 4TTGA 1NUKA 1F4HA 2XQXA 2QQNA 1JU3A 3OGVA 1W8OA 4OMDA 3HNMA 4JKMA 1J83A 2E33A 1JZ3A 2VTFA 2VQUA 5B4NA 4DEQA 2W3JA 1WCQA 1OH4A 1IQDC 1UY3A 1W0NA 3K4ZA 2VMCA 1DYOA 3I3EA 4RN5A 3NQHA 2VZVA 3NJVA 3VDAA 4P08A 2Y6GA 2XOMA 4BJ0A 4E8DA 2VQTA 2ZEZA 3WNLA 1NKGA 3T2PA 3IDAA 1W9WA 2DDUA 3I2FA 2X05A 4AG4A 1DP0A 1H6YA 4XUPA 2J1AA 1GNYA 3T2OA 3DYOA 2VZUA 3T2QA 3CDZB 3THCA 4GZ9A 1JYXA 3C7HA 2KD7A 4KI5M 1XC6A 1WKYA 2WO2A 3BGAA 4XZUG 4P02B 2JE8A 4OYUA 4DUWA 3WF1A 2WUHA 2WYSA 4DUVA 4DEVA 5EJZB 3CMGA 2XHNA 2ZEXA 2C4XA 5DPNA 2YC4A 4MADA 4ZZ5A 1GQPA 3IIIA 1J84A 3SEPA 5JR2A 2VOTA 5IJRA 1PMHX 5A1AA 4QB6A 3HPNA 3WF0A 2E32A 1NX9A 4GWIA 5LA0A 1UMHA 1H6XA 4JKLA 3HOBA 4LKSA 5LA2A 1P8JA 3I2KA 1W8NA 4CVUA 4QB1A 2WZ8A 3D3AA 4QPWA 2X10A 1GOGA 2QQMA 3ETPA 5I0DA 1NAEA 4QAWA 3WF4A 2V72A 4E8CA 2C26A 2VMDA 3I2IA 1PX3A 2BZDA 3LE0A 5LCWL 4A6OA 3WNNA 2JKXA 1JZ7A 1JYNA 1TVGA 3HNYM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ID4 A;  1CZV A;  3HJR A;  3U37 A;  5JXH A;  2W87 A;  2QBX A;  2WQ8 A;  4UAP A;  1D7P M;  2WBK A;  3MBW A;  2V4V A;  2ORZ A;  1F4A A;  3CZU A;  1I5P A;  2B4K A;  2VC9 A;  2LS6 A;  3GXU A;  3UET A;  2YG0 A;  3A22 A;  1K3I A;  2L9L A;  2JDA A;  4W50 A;  1YQ2 A;  3NRU A;  5IYY A;  4QDQ A;  3VDB A;  5JXG A;  4XUO A;  4DXS A;  4QX2 A;  1GMM A;  1XPW A;  4QX0 A;  1L7Q A;  1US2 A;  2DCJ A;  5EIY B;  3A7Q A;  1KGY A;  4CU9 A;  2RVA A;  3CZJ A;  3WSO A;  4PT6 A;  4DUX A;  3NNG A;  3WEZ A;  3ACF A;  2WAB A;  3A21 A;  3JXS A;  1JZ2 A;  1UYX A;  2YFU A;  3WNO A;  1JHJ A;  2Y6J A;  3W5M A;  1W9S A;  2WO1 A;  2QQO A;  3VD7 A;  1UYY A;  4QDS A;  2OKX A;  4JKK A;  1OF3 A;  1UY0 A;  4MOA A;  4MGQ A;  2VJX A;  4ZZ8 A;  5IFP A;  2QQI A;  2VZ1 A;  4XUR A;  2V5D A;  2WN3 A;  1UXZ A;  3MUY 1;  3OBA A;  3T08 A;  2VO5 A;  1OD3 A;  3VD3 A;  3FN9 A;  4A44 A;  3HEI A;  3ZM8 A;  3PUH A;  1UY4 A;  2HYX A;  5CYY A;  2W46 A;  3WNP A;  4XVH A;  4XUT A;  2WDB A;  3NJX A;  4JX0 A;  4A3Z A;  3I2H A;  3THD A;  5G04 L;  4BK4 A;  2QQL A;  2VMF A;  1RYY A;  3K46 A;  2E26 A;  4TXW A;  3VD5 A;  5IHR A;  2VM9 A;  3K75 B;  3OEA A;  3I97 A;  3UNP A;  5JUV A;  2BGP A;  4OMC A;  4OUE A;  2W1S A;  3EYP A;  4OZO A;  2WN2 A;  3MV1 1;  5LA1 A;  3I2J A;  3MV0 1;  4JHZ A;  2WO3 A;  1K45 A;  1UYZ A;  4D0Q A;  3I3D A;  3GDB A;  4FI9 A;  1W9T A;  4UI9 L;  5HXM A;  2VZQ A;  3OB8 A;  1JZ6 A;  1UZ0 A;  1JZ8 A;  5DN2 A;  2VR4 A;  2BER A;  4ET7 A;  2J1R A;  4ARX A;  4KWU A;  1CZS A;  2QQK A;  4ZY9 A;  2VZO A;  2BBA A;  4KMQ A;  2VZ3 A;  1O59 A;  4GWJ A;  3P1I A;  1K42 A;  1SHW B;  2EIE A;  5EJ1 B;  4XUN A;  5F7U A;  2J7M A;  4CU7 A;  4W8J A;  2J22 A;  3WF2 A;  4RYD A;  1XNT A;  1XNA A;  4CU6 A;  1TG7 A;  3DYM A;  3W5N A;  5JXI A;  1PMJ X;  4A4A A;  2HLE A;  2VZT A;  1O8S A;  2WAO A;  4D8M A;  4ARY A;  3OGS A;  4LQR A;  3IAQ A;  1CZT A;  4CUA A;  3T09 A;  2JD9 A;  2Y64 A;  3A23 A;  1OF4 A;  2PQS A;  5G05 L;  5C71 A;  2RJ2 A;  3CKH A;  5B4X A;  3ECQ A;  3OG2 A;  3T0A A;  3CQO A;  5IFT A;  3J7H A;  2LW8 A;  4A45 A;  3LEG A;  2X09 A;  3ACH A;  1W99 A;  4P00 B;  4M4P A;  1DLC A;  2Y6L A;  3P6B A;  3IB3 A;  3F2Z A;  2YFZ A;  3ACI A;  1CIY A;  2J1S A;  4P5Y A;  4BXS V;  2VZR A;  3CIH A;  1UWW A;  3MUZ 1;  2W1U A;  5HPO A;  1ULP A;  1T2X A;  3GGL A;  2Y6K A;  2W47 A;  2E31 A;  2Y8K A;  2ZEY A;  4QB2 A;  2B9V A;  1JU4 A;  1PX4 A;  4UOJ A;  3I3B A;  2J1V A;  1L7R A;  2C9K A;  4LPL A;  1EUT A;  3LEI A;  3DYP A;  4XUQ A;  3SEE A;  4M4R A;  2ZEW A;  3C7O A;  1UXX X;  2W92 A;  1GU3 A;  2W94 A;  3SKV A;  3WF3 A;  3FL7 A;  2WAA A;  2W91 A;  3LPG A;  1SDD B;  3VDC A;  3E1F 1;  3PUI A;  1US3 A;  3T0B A;  2CDP A;  3WNK A;  4IUG A;  3IAP A;  2W1W A;  3DEC A;  3LQC A;  4QX1 A;  3WNM A;  4L0P A;  3VD9 A;  3C7G A;  4A41 A;  2W1Q A;  3GM8 A;  5C7G A;  3EB7 A;  4Z2A A;  2VL4 A;  2YB7 A;  4AAX A;  2EIB A;  4YPJ A;  3WQB A;  3FHQ A;  1GOF A;  1K12 A;  2WZE A;  4PF1 A;  2ORX A;  2VZP A;  1GUI A;  2DCK A;  3K4A A;  2VZS A;  3C7E A;  1CX1 A;  1MPX A;  5C70 A;  5J1X A;  4CUC A;  1O8P A;  4MGS A;  1GOH A;  4QX3 A;  2VCA A;  1SG3 A;  4DXT A;  2RV9 A;  1JYW A;  4LHS A;  1JZ5 A;  2VME A;  1JI6 A;  1JZ4 A;  4BK5 A;  2Z4F A;  4BDV B;  5JXJ A;  4MO3 M;  2ZXQ A;  3VD4 A;  2QQJ A;  5CZK A;  4QDR A;  2W9X A;  4CU8 A;  2CDO A;  3LEK A;  4PQQ A;  3SKJ E;  2XON A;  2J1U A;  1ULO A;  2R7E B;  3HN3 A;  3ABZ A;  5JMO A;  1EUU A;  4HG6 B;  1UY1 A;  3K4D A;  3OEB A;  1BHG A;  2VCC A;  2J1E A;  2VCB A;  3T0D A;  3MO4 A;  3I2G A;  1R64 A;  3OGR A;  5FUI A;  3BN6 A;  2BGO A;  1UY2 A;  3UES A;  5DMY A;  1OT5 A;  3K77 A;  2EIC A;  3FHA A;  3HNB M;  1LNS A;  5DQ0 A;  4W4Z A;  2W5F A;  4A42 A;  2YC2 A;  1UX7 A;  3ACG A;  4DXR A;  2J1T A;  2Y6H A;  2EID A;  1HN1 A;  1UMI A;  2W95 A;  4CUB A;  3C7F A;  4ZXE A;  1JYV A;  1KEX A;  3C8X A;  3AC0 A;  3LPF A;  4TTG A;  1NUK A;  1F4H A;  2XQX A;  2QQN A;  1JU3 A;  3OGV A;  1W8O A;  4OMD A;  3HNM A;  4JKM A;  1J83 A;  2E33 A;  1JZ3 A;  2VTF A;  2VQU A;  5B4N A;  4DEQ A;  2W3J A;  1WCQ A;  1OH4 A;  1IQD C;  1UY3 A;  1W0N A;  3K4Z A;  2VMC A;  1DYO A;  3I3E A;  4RN5 A;  3NQH A;  2VZV A;  3NJV A;  3VDA A;  4P08 A;  2Y6G A;  2XOM A;  4BJ0 A;  4E8D A;  2VQT A;  2ZEZ A;  3WNL A;  1NKG A;  3T2P A;  3IDA A;  1W9W A;  2DDU A;  3I2F A;  2X05 A;  4AG4 A;  1DP0 A;  1H6Y A;  4XUP A;  2J1A A;  1GNY A;  3T2O A;  3DYO A;  2VZU A;  3T2Q A;  3CDZ B;  3THC A;  4GZ9 A;  1JYX A;  3C7H A;  2KD7 A;  4KI5 M;  1XC6 A;  1WKY A;  2WO2 A;  3BGA A;  4XZU G;  4P02 B;  2JE8 A;  4OYU A;  4DUW A;  3WF1 A;  2WUH A;  2WYS A;  4DUV A;  4DEV A;  5EJZ B;  3CMG A;  2XHN A;  2ZEX A;  2C4X A;  5DPN A;  2YC4 A;  4MAD A;  4ZZ5 A;  1GQP A;  3III A;  1J84 A;  3SEP A;  5JR2 A;  2VOT A;  5IJR A;  1PMH X;  5A1A A;  4QB6 A;  3HPN A;  3WF0 A;  2E32 A;  1NX9 A;  4GWI A;  5LA0 A;  1UMH A;  1H6X A;  4JKL A;  3HOB A;  4LKS A;  5LA2 A;  1P8J A;  3I2K A;  1W8N A;  4CVU A;  4QB1 A;  2WZ8 A;  3D3A A;  4QPW A;  2X10 A;  1GOG A;  2QQM A;  3ETP A;  5I0D A;  1NAE A;  4QAW A;  3WF4 A;  2V72 A;  4E8C A;  2C26 A;  2VMD A;  3I2I A;  1PX3 A;  2BZD A;  3LE0 A;  5LCW L;  4A6O A;  3WNN A;  2JKX A;  1JZ7 A;  1JYN A;  1TVG A;  3HNY M; 
#chains in the Genus database with same CATH topology
 2AUY A;  1ENS A;  3OOX A;  4RL7 A;  2GZW A;  3J7N A;  3MPB A;  4UAP A;  1MZ5 A;  1LHW A;  5A3N A;  3FMG A;  2WBK A;  3U07 A;  1G9F A;  4OUM A;  3RZZ A;  3VBU B;  1JOJ A;  2V73 A;  5ISL A;  2V4V A;  2D6N A;  1PVC 2;  1RHI 3;  3CZU A;  3M4F A;  1I5P A;  2YHJ A;  3CF6 E;  5EXO A;  5HI0 A;  5JCT A;  5FYS A;  1GZ9 A;  2YG0 A;  4NHY A;  3VDD C;  2BWC A;  2R07 2;  2L9L A;  3INA A;  4NHX A;  2JDA A;  1BVP 1;  2UWC A;  3IDB B;  2XBO 1;  3D0S A;  3HWJ A;  3KSC A;  5FP7 A;  3VN4 A;  2JEC A;  2CNA A;  2QZ3 A;  5KHJ A;  1HRV 1;  4Z8B A;  5T50 A;  4BXF A;  2GC0 A;  5J7M A;  4QPG C;  5C3O A;  5BNN A;  3VDB A;  1VBB 1;  3M3Q A;  3IMM A;  1D2S A;  3N9M A;  1U5Z A;  4BCU A;  3BTA A;  1ZZ7 A;  1IKQ A;  1XPW A;  2O8Q A;  1FMD 3;  2VVE A;  2WQZ C;  4QX0 A;  2GNT A;  3POG A;  3T4V A;  3UKV A;  3A7Q A;  4LO6 B;  1W90 A;  2WZP P;  4COY A;  4CU9 A;  5GZF A;  1Y4W A;  4AVT A;  2YRO A;  1XE8 A;  1PGW 1;  4WBB A;  2BTV C;  1W3X A;  4DUX A;  3ACF A;  1WMD A;  3WQ1 A;  1QMJ A;  2Q8E A;  4F3J A;  5FXW A;  1OOP C;  1SLC A;  3KV9 A;  1LU1 A;  4B1L A;  1JZ2 A;  2PHL A;  3DL3 A;  4A7Z A;  3WNO A;  1JHJ A;  4F7Z A;  1H0B A;  1QJU 1;  5D8A C;  1W9S A;  1ZBE 3;  2BWA A;  2WO1 A;  2WNO A;  3ZFE B;  3POF A;  3VBO A;  1DGR N;  2VW1 A;  2Y34 A;  3HQU A;  3AZW A;  1TQ5 A;  1OF3 A;  1YNA A;  3WCR A;  1MAC A;  2OT7 A;  1V6I A;  4OHY A;  3V65 A;  4XEZ A;  2V5D A;  4N43 B;  3VZN A;  3MUY 1;  3RZL A;  1LHV A;  1APN A;  2A7A A;  2VO5 A;  3VBU C;  3VKL A;  4AI3 A;  5AVA A;  1GZW B;  2XVL A;  5C9A A;  3BPZ A;  4I0A A;  4IEW A;  1LCL A;  2VNV A;  3POJ A;  4P9G A;  4YZ2 A;  3WUC A;  1VBC 3;  3HEI A;  4QPY A;  5FZ1 A;  1S0J A;  1C1L A;  1CAU B;  3PUH A;  5FQ0 B;  4GA9 A;  3LOB A;  1V00 A;  4J1W A;  4I02 A;  4Q4W 3;  4IEU A;  3OYW A;  4Q4X 1;  5CYY A;  5F5I A;  3QH7 A;  4I2O A;  3MIC A;  2CY6 A;  1POV 3;  3N9L A;  1G9A A;  2NM1 A;  3VGI A;  4NWW A;  3UV9 A;  3E6C C;  4FQ4 A;  5KHK A;  2B7Y A;  3JBG 1;  1VP6 A;  2QQL A;  4Y3O A;  2VMF A;  3K46 A;  1QY4 A;  3VD5 A;  2R06 2;  2BV4 A;  5H9Q A;  5IHR A;  2VM9 A;  2W2I A;  3KCC A;  4HPK A;  4QQ2 A;  4AVA A;  4EN8 B;  4Y1V A;  1V70 A;  3WG1 A;  1QJZ A;  1YFX A;  2YXS A;  4Q1R A;  1R09 1;  4UF0 B;  4WVM B;  5A6Z A;  3APB A;  3ZFE C;  2RE9 A;  3EYP A;  4OZO A;  4RS5 C;  1JS9 A;  2XJU A;  1LOE A;  3MV1 1;  3I2J A;  2WO3 A;  1K45 A;  2UWB A;  4H14 A;  4CCM A;  4D0Q A;  1AXZ A;  3GDB A;  3I3D A;  4Y4Y A;  3VHR A;  4MX3 A;  5IVF A;  4UI9 L;  4DOU A;  4MYE A;  3OB8 A;  4Q2F A;  5GLW A;  1XNC A;  2Y33 A;  1H1A A;  1LU2 A;  1RIN A;  3AJZ A;  1RUI 1;  4QGL A;  2HWB 3;  5EV7 A;  4XFI A;  5CB7 A;  1OKO A;  4UYB A;  1AYM 2;  4DXZ A;  3FFQ A;  1UOG A;  1LTE A;  2GN7 A;  2R6Q A;  5JAX A;  4ET7 A;  4TN7 A;  1QU0 A;  1ENQ A;  3ES1 A;  2Y0O A;  4GMP 3;  2DCT A;  4KWU A;  2D6M A;  5FKB A;  1CZS A;  5KC6 A;  4SLI A;  4ZY9 A;  5IVV A;  4CDQ A;  3KZ4 C;  5FZD A;  2HWD 3;  1S2K A;  5FZF A;  2WT1 A;  4Q0S A;  4CEW A;  4QQO A;  1IHM A;  3WP4 A;  3VV1 A;  2G9Z A;  4IER A;  5F7U A;  1ACC A;  3CJX A;  4QMA A;  1TME 1;  3HT2 A;  1QH6 A;  4EN6 B;  4DY3 A;  1AYN 1;  3E97 A;  1S2E A;  4QHZ A;  4CU6 A;  2CGO A;  1KFX L;  3OY8 B;  2K0G A;  5FXV A;  4QPI B;  1AF9 A;  5F5C A;  4NII A;  1V0A A;  4UFM A;  2D97 A;  5C3R A;  1AL0 G;  4O9E A;  4A4A A;  1S0C A;  5FY5 A;  3U78 A;  1YFY A;  1RUF 2;  4PLN A;  5HCH A;  2UYA A;  4D8M A;  5M0T A;  3JQW A;  3ZKY A;  4COU A;  4AK3 A;  3AKQ A;  2P34 A;  4RQP A;  1V9U 1;  2Y64 A;  3PUA A;  1OF4 A;  4NUB A;  1NY7 1;  1QDO A;  2ADD A;  4FOQ A;  5CFC A;  3P3N A;  2A6Z A;  3QBQ A;  4C8D A;  2ARA A;  2WZR 2;  5B4X A;  3CKH A;  5FWJ A;  3RZG A;  1RUE 2;  3PVO A;  5IFT A;  5KR7 A;  3RDI A;  4ASK A;  5LW9 A;  4XIL A;  2VUJ A;  5DUW A;  4DIN B;  3OBZ A;  2AZ5 A;  1KJL A;  5EWS A;  3DF0 A;  5LAS A;  2NLR A;  2OW4 A;  3R6S A;  2RG4 A;  3N9O A;  1SPP A;  4RA0 A;  3P6B A;  3IB3 A;  4LBL A;  3QOP A;  3IT8 A;  5F2W A;  3LSE A;  2WSV A;  3QD6 A;  2DVG A;  2G4I A;  2XQR A;  3Q8B A;  5A7N A;  4B8E A;  3DPR A;  5A3L A;  4BXS V;  2VZR A;  1DQ6 A;  2TUN A;  2Y0I A;  1W8Z A;  3ZYJ B;  1OFS A;  5JSO A;  1RUD 1;  1TEI A;  1VIW B;  2W1U A;  4QKF A;  1ULP A;  4R9B A;  2GC1 A;  3GGL A;  3NKT A;  1H2L A;  2Q8D A;  4CXY A;  1JOD A;  5E89 A;  1VRH 1;  4L8Q A;  4LA3 A;  1MS4 A;  1NCR C;  3J8F 3;  4PIX A;  1CES A;  2WA4 A;  3ATG A;  4QPI C;  4QXB A;  4XJ8 A;  2ZEY A;  2XR4 A;  2ETE A;  2UU8 A;  1O7F A;  2EF6 A;  4FFF A;  1STM A;  5FZ7 A;  2PLV 1;  4EWE A;  3M7A A;  3D5O A;  1EV1 1;  1W2O A;  2J1V A;  1L7R A;  1YFU A;  3TNP B;  2ZGO A;  2OPK A;  3PU8 A;  1OLR A;  1HQL A;  3IKW A;  2RS1 2;  3T4H B;  3NJZ A;  2C9A A;  1YQ8 A;  1N1T A;  2IFW A;  1ZBA 1;  2OA2 A;  2R1B A;  4JC1 A;  4XMI A;  3CNA A;  4XBL A;  3RYR A;  4OUS A;  3RYP A;  1PGL 2;  2HWC 1;  5FZO B;  4N9I A;  2GNM A;  1BXH A;  2B5H A;  2VW2 A;  1BZW A;  3SKV A;  4MUV A;  5FPA A;  2ZHL A;  4XET A;  1JXN A;  2W91 A;  4BLJ A;  5JZG A;  1T6G C;  3Q8C A;  1SDD B;  1F31 A;  2AEZ A;  5DAP A;  2H6C A;  3I3M A;  4LHN A;  1US3 A;  2VVD A;  5IVB A;  4LKF A;  1AR9 3;  4PHZ A;  3TN9 2;  3VL8 A;  2IXC A;  2N7G A;  4IUG A;  4EZ4 A;  3IAP A;  4UFI A;  1CAW A;  2JIJ A;  5IVC A;  3O1T A;  4Y20 B;  3RFR A;  3VHO A;  2LRP A;  3OD0 A;  3DEC A;  1N3O A;  3LQC A;  1OC1 A;  1OVS A;  3WW2 A;  3VBH B;  2RR1 1;  4FP2 A;  4BH9 A;  1JOB A;  1QOS A;  2WLQ A;  1WUV A;  3HR9 A;  3I59 B;  4KBZ A;  4IGO A;  3VBF A;  2W1Q A;  4QXC A;  5E6H A;  1OUR A;  5GZG A;  4Z2A A;  3FFZ A;  2NQY A;  2VL4 A;  5JLV A;  4Y5Z 0;  3RNS A;  2IZW A;  3FHQ A;  4J1X A;  4AL9 A;  4E9K A;  2VNG A;  1GOF A;  2NPI A;  1JBC A;  3AMP A;  4XIK A;  3JQX A;  2ZML A;  2O14 A;  3POB A;  5KBF A;  3FC0 A;  1RHI 1;  2JE7 A;  4XBN A;  4GKX A;  2VZP A;  1HN0 A;  3JD7 1;  5A1L A;  1MEC 2;  1V6L A;  2DCK A;  2X53 S;  3K4A A;  3C7E A;  3R4S A;  1B35 A;  1CX1 A;  4JTN A;  3ZN6 A;  2X5I A;  2JEM A;  5J1X A;  2ENR A;  3VZM A;  4CUC A;  1HV1 A;  2RDN A;  3B7M A;  4MGS A;  4LHL A;  4QX3 A;  4DPN A;  1DYP A;  2CL2 A;  5F3E A;  1FPN 2;  4GB3 1;  5C4W A;  2VME A;  1U5X A;  1VAM A;  4M00 A;  2Z4F A;  1RUJ 2;  4BIO A;  1FMD 1;  4CXW A;  1JYI A;  5H9R A;  2WFF 2;  4BDV B;  4BE3 A;  2WWS A;  1JUI A;  2X8K A;  3T1L A;  2HJI A;  1HIX A;  5JXJ A;  3WZ1 A;  2FDH A;  5CZK A;  4AXO A;  2CDO A;  2PAE A;  2PAM A;  4K1Z A;  3WV6 A;  3G6J B;  3VBH C;  1ND2 A;  2J1U A;  1ULO A;  2WLP A;  5E8A A;  3SNM A;  3PTY A;  5DDJ 2;  4Q4V 2;  1ZBE 1;  1HXS 3;  1DDL A;  1V6K A;  5JMO A;  2IVJ A;  1ZZ8 A;  3WG3 A;  4FTS A;  3QH6 A;  1SBF A;  4Q0V A;  4ZHN A;  2J1E A;  2E63 A;  3PVN A;  1GNH A;  2XB6 C;  3N7J A;  3DN7 A;  5L7O B;  1HW5 A;  3ZMO A;  3OGR A;  1DZR A;  1QXJ A;  1DGW A;  4DMI A;  3NV2 A;  1Z7S 2;  4ZPI A;  5E1R A;  4BQ2 A;  4LBQ A;  1HB3 A;  2YV8 A;  1VBC 1;  4CP0 A;  2KXL A;  2R49 A;  1RUC 2;  2CHH A;  5DAQ A;  2QKD A;  3AVS A;  4OLL A;  4XIO A;  4AGR A;  1DQ4 A;  3H1W A;  3ZFG B;  5DAV A;  3S57 A;  2F4L A;  1RVF 2;  1E5R A;  1SCS A;  4A3X A;  2WQ4 A;  2W5F A;  4RHV 3;  1POV 1;  2YC2 A;  4UFK A;  1UF2 C;  1SFY A;  1URX A;  2XWB B;  5A80 A;  3UJQ A;  4Q5O A;  2J1T A;  1UPI A;  4DO0 A;  4DXR A;  1GIC A;  1XNK A;  4R9C A;  1UMI A;  1Q8Q A;  2ZGN A;  4NPR A;  4YYO A;  1PK6 B;  1RJ8 A;  4LLO A;  4DIQ A;  2R1D A;  2NN8 A;  3VKN A;  1NZC A;  3C7F A;  3PLQ A;  1T6B X;  1G86 A;  5DZF A;  4LTA A;  3D4K A;  4KNC A;  3VKF C;  3IBM A;  4JVA A;  2CYF A;  4WM7 B;  2LUW A;  2G9G A;  2VH9 A;  2ZJC A;  4N53 B;  1W03 A;  3RVH A;  3OGV A;  2WJS A;  3WHU A;  1WLC A;  2BOI A;  3GZA A;  3LCP A;  2A1X A;  1SBD A;  1UYP A;  2LAL A;  4GAL A;  5LBB A;  4DQA A;  3O0W A;  1PIV 1;  4R4X A;  2XVK A;  2LTN A;  4YZ1 A;  3H3U A;  4HKO A;  1J83 A;  3SLI A;  2K46 A;  3LA7 A;  2XUM A;  4PBO A;  3AXE A;  4HFS A;  1MVQ A;  2W3J A;  3ME2 A;  4FTB A;  5IAT A;  5FYI A;  2HWB 1;  3S0M A;  1AXK A;  1QF3 A;  3M8L A;  1YQ6 A;  3S5A A;  4G9S B;  1FV2 A;  1RUH 2;  4Y1X A;  2VAU A;  5C8C A;  2XJQ A;  3AXD A;  4GMP 1;  2WS9 2;  3CLP A;  1R1A 2;  1DYO A;  1DQ0 A;  1CD3 G;  4QKD A;  4RN5 A;  1X9P A;  4X6R B;  1O4Z A;  2HWD 1;  1YFW A;  4XMA A;  3HBZ A;  2Y6G A;  1OD5 A;  5F8P A;  5CIR A;  4E8D A;  4QM9 A;  1PK6 C;  1CIW A;  1VAL A;  4JQR A;  1PVX A;  5BNO C;  1UPS A;  5EYX A;  2D7F A;  1Q5O A;  3MW4 A;  4FPC A;  1O91 A;  4P9J A;  3IDA A;  4KL1 A;  2FDG A;  4I0W B;  4QGM A;  1O3S A;  1F9K A;  4YGC A;  1O6U A;  3AM2 A;  5EQU A;  4IEV A;  5FY4 A;  4AG4 A;  4CCE A;  1DP0 A;  1H6Y A;  4WM7 C;  1ZM1 A;  2W08 A;  4XUP A;  4AQ2 A;  4JGZ A;  4CEY B;  2J1A A;  4N53 C;  1LEN A;  1YC6 1;  1NA1 B;  3SCG A;  1UCX A;  4FPO B;  1PVC 1;  1AR6 2;  5IK7 A;  2VTX A;  3UGF A;  4IV1 B;  1QOT A;  4Z2W A;  3THC A;  2WNU A;  1HDK A;  4D6S A;  5KWR A;  1POQ A;  3SIT A;  1WKY A;  3LB9 A;  2WO2 A;  4Q4Y 2;  4UFJ A;  4D7Y A;  5J96 B;  1B09 A;  5A7P A;  5GLZ A;  4MGK E;  4OYU A;  5FMC A;  4AFC A;  1ZRR A;  2PMW B;  4AOC A;  2SBA A;  3JZV A;  1A8D A;  1COV 2;  4DEV A;  5GLV A;  3ZFF B;  4FBF A;  1HRI 2;  2C4X A;  5JOZ A;  2YC4 A;  4ZZ5 A;  1GQP A;  1DQ1 A;  2JG9 A;  5KHG A;  5FYM A;  3LA2 A;  4DZG A;  3KV5 A;  3AL5 A;  5A1A A;  5FZA A;  3JBG 3;  4XAE A;  4H2A A;  4YW3 A;  1ZZ9 A;  4NJ4 A;  2Q4S A;  3NAP A;  1Y3T A;  2ZPX A;  4GWI A;  4AED A;  5BNN B;  1H6X A;  1W8U A;  2ZS6 B;  5FYV A;  5LA2 A;  1P8J A;  2MEV 3;  1GAN A;  2PHX A;  2WZ8 A;  3H7J A;  4QPW A;  3ZXA C;  4XZP A;  4NRO A;  3EXU A;  3J8F 1;  5I0D A;  1YJL A;  1EAH 2;  4E8C A;  2V72 A;  2ZKL A;  2C26 A;  2EXK A;  5LCW L;  3TEZ A;  3WUD A;  3LE0 A;  4CEY C;  5FMB A;  4YVS C;  2JKX A;  1LOB A;  4M01 A;  1XYO A;  5C3Q A;  1TVG A;  3BOP A;  2D43 A;  1W05 A;  2AYH A;  3HJR A;  1W2N A;  1VBA 3;  2XDV A;  2QBX A;  4IV1 C;  3ZYH A;  1Y9Q A;  2IFR A;  4AQ6 A;  1GZC A;  4D7S A;  5L36 A;  3U0Z A;  2DVB A;  3VBO B;  4OQ8 A;  3ZDS A;  2R16 A;  4CSW A;  1F4A A;  4Y1Y A;  1O4T A;  3NST A;  3W20 A;  1ZRE A;  2ZA9 A;  2HWF 2;  2LS6 A;  3GXU A;  1SZB A;  3UET A;  3MPP G;  3RWN A;  3WP6 A;  1K3I A;  1BLZ A;  5JVV A;  3AP7 A;  4MGZ E;  1V6N A;  5C9A B;  4W50 A;  1YQ2 A;  5T5L A;  5TSW A;  1ULC A;  2RMU 2;  4JRA A;  4WM8 B;  2B42 B;  4QDQ A;  3PIG A;  5FKC A;  3SMH A;  3O1P A;  4EN9 B;  2VD7 A;  4QX5 A;  3O1O A;  4LT5 A;  3OYW B;  1O5L A;  4QX2 A;  5J98 B;  4DXS A;  2DCZ A;  4Q27 A;  3VZO A;  4CYD A;  5FLI A;  4COZ A;  1AYN 3;  1MS0 A;  1OLM A;  1KGY A;  4HKW A;  4J25 A;  1AR7 2;  4XPV A;  5BNN C;  1YQ5 A;  2DWR A;  5FYB A;  1W8W A;  1LHN A;  2RVA A;  3MFC A;  3RGB A;  3WEZ A;  5JSR A;  3O1R A;  3FWE A;  3AZY A;  3FBM A;  2XL9 A;  2YFU A;  5LRR A;  4Y22 A;  3W5M A;  2ZGT A;  2CGN A;  4I30 A;  4N90 A;  2QQO A;  4Y1U A;  4UBG A;  4CCK A;  5D21 A;  1UYY A;  4HPK B;  1V9U 3;  3VZK A;  4ATF A;  2OVU A;  1H9P A;  4AR2 A;  2OKX A;  1Y43 B;  3NV1 A;  4JKK A;  4YZ4 A;  5LK5 A;  4MOA A;  1OPM A;  3B93 A;  3ZXJ A;  1RUH 3;  4Z92 B;  2QQI A;  4XQ4 A;  4XUR A;  2FDI A;  4FFG A;  2WKK A;  1UXZ A;  1QJX 2;  2VBD A;  3VBO C;  1MVE A;  3O5S A;  2BFU S;  3I7D A;  4HLT A;  1H1M A;  3TEY A;  1Z0H A;  2VQA A;  1S0G A;  5CG9 A;  2AR6 A;  3ZM8 A;  3J7L A;  4X6Q B;  1H8V A;  3KT1 A;  4NO4 A;  2JDM A;  3PUQ A;  3USS A;  2BP6 A;  2YUE A;  2WO7 A;  5C9A C;  3U4X A;  2R0H A;  1RUG 3;  4COV A;  1YCI A;  2VCM A;  3RG0 A;  3B69 A;  1MQT A;  3WNP A;  3TEX A;  1QHD A;  5JPM B;  4QU2 A;  2YZ4 A;  5JWP A;  3FZ3 A;  1YUD A;  4A3Z A;  4JX0 A;  4CDQ B;  3L2Y A;  3RI9 A;  3WDY A;  1LGB A;  4AHY A;  1J59 A;  1RUF 1;  2GME A;  5G04 L;  1VRH 3;  1RYY A;  1ZVF A;  2E26 A;  1AX0 A;  1AL2 2;  1VE0 A;  2QUO A;  4TSV A;  3UL2 A;  2O8O A;  4B29 A;  4LO8 A;  2OYZ A;  1E5I A;  1DCS A;  2PLV 3;  5A1F A;  3I97 A;  5A3M A;  3UNP A;  2R04 2;  5EFU A;  3ROU A;  1ENR A;  4S2G A;  1EV1 3;  3U1X A;  4NAO A;  2WZR 1;  4O7X A;  4FP3 A;  4OUE A;  1RUE 1;  2W1S A;  1IGO A;  4AI0 A;  3EHK A;  1FT9 A;  3LA3 A;  5LA1 A;  5FYT A;  3RZH A;  1COV 3;  3GJB A;  1UYZ A;  2A5Z A;  4AEK A;  4FI9 A;  5AC9 2;  4HKL A;  1HRI 3;  5IW0 A;  2RS5 2;  1RUN A;  4GIQ A;  3VKO A;  2B9U A;  4RQP B;  4BB3 A;  2VZQ A;  1JZ8 A;  1JZ6 A;  3ES4 A;  5FZI A;  1IS6 A;  4YW4 A;  5DN2 A;  1O3T A;  3RS6 A;  1PO1 3;  2PAK A;  5FUN A;  4FAG A;  4QPG B;  4R9D A;  4U2A A;  5CFC B;  1VBE 2;  3ZO0 B;  1LHU A;  2VR4 A;  2ZAA A;  2ZGS A;  5FZG A;  1AX2 A;  1ZX5 A;  2QQK A;  2VZO A;  2VUC A;  5BYN A;  4CCL A;  2KM2 A;  3PVE A;  4GWJ A;  2ZX0 A;  5T3N A;  2QQP A;  5IK8 A;  1K42 A;  3LKJ A;  4LBM A;  4YW7 A;  3V0B A;  1SHW B;  2RJK A;  3WY6 A;  1YEW A;  4AI1 A;  4NRP A;  2MNG A;  4FVV A;  3MLJ A;  1DGW X;  1OOP B;  1SPP B;  2ZX4 A;  3BVC A;  1W6M A;  3MHZ A;  4IE7 A;  2XPJ A;  1H2M A;  3OUH A;  2E51 A;  2J7M A;  4W6W A;  4CEW C;  3GHN A;  4RFT 0;  5F9T A;  4NID A;  3DPR B;  1TG7 A;  4UWD A;  3U10 A;  4B4Q A;  2JB4 A;  4BWO A;  2XML A;  2RS1 1;  1WW7 A;  1RMU 2;  4IW3 A;  4AFB A;  3Q8F A;  4NPM A;  5LZ6 A;  2HLE A;  3Q8E A;  2WAO A;  3HMY A;  4FT8 A;  4AHZ A;  1C4R A;  2XXZ A;  4RFR B;  3OD4 A;  3FJS A;  4EJR A;  5DUU A;  5L73 A;  1Y9M A;  4CUA A;  3T09 A;  5K0U A;  2JD9 A;  2QE3 A;  3JD7 3;  1AUY A;  3SQO A;  1DG6 A;  3KLS A;  4M0H A;  2GC3 A;  3H3L A;  3B00 A;  2IWG B;  4IND A;  1FXZ A;  2RJ2 A;  2RMU 3;  5GM0 A;  5LBC A;  4IV3 A;  4MLO A;  4RQP C;  3T0A A;  3WVJ A;  2H0V A;  5BNQ A;  4KWJ A;  1R1Z A;  1PMI A;  4URT A;  3TN9 1;  1W8F A;  5F1R A;  3LEG A;  3ACH A;  5H9S A;  2WL1 A;  4QU1 A;  4UFH A;  5CKM A;  1UZZ A;  1UKR A;  3RJ2 X;  2HWE 2;  3USU B;  2BUK A;  1U5I A;  3IDC B;  3BIW E;  4GB3 3;  5GAL A;  3BTZ A;  1LEM A;  1KRI A;  2P17 A;  2PHR A;  4EYU A;  1QQP 3;  3PTR B;  2WNV A;  1C8M 2;  2TNF A;  3F2Z A;  2WIN B;  5JZG B;  3Q9O A;  3BB6 A;  4JTO A;  4MGT A;  2J1S A;  5FYY A;  2VOK A;  2TBV A;  2XJV A;  4P5Y A;  4AVV A;  3RZM A;  4BIS A;  2OUJ A;  5T54 A;  1JTZ X;  1W06 A;  1WW5 A;  5HPO A;  2RDS A;  1QIQ A;  2H6B A;  3AFK A;  2D6K A;  3DPR C;  2W47 A;  2AGS A;  4RS5 B;  1F15 A;  3BCW A;  1VB2 A;  4LMF A;  5LRS A;  4QB2 A;  2B9V A;  1RGS A;  2JDP A;  4LOT A;  4D69 A;  1OPO A;  1PX4 A;  4GXL A;  4HON A;  3VBF B;  4JDM A;  4HVO A;  5ACA 2;  3V0A A;  2C9K A;  4F8A A;  4PLO A;  5APA A;  3WDU A;  2D3R A;  4JQT A;  5FOJ B;  4TLF A;  1WCK A;  5F6L B;  3PIJ A;  3BU7 A;  5DG1 A;  3BYW A;  4XXP A;  4IEZ A;  4AWD A;  1UXX X;  1AR8 3;  2A3Y A;  2QNK A;  1HJF A;  3B02 A;  4XFH A;  1DYK A;  5DUX A;  5I0U A;  2WFF 1;  1F5F A;  2W39 A;  3FL7 A;  2WAA A;  4M3C A;  5E16 A;  1DU3 D;  1PNF A;  5GZC A;  3ZN6 B;  3D8C A;  3E1F 1;  4YM1 A;  5CG8 A;  2CDP A;  2XHK A;  2YY1 A;  1VBD 3;  5I8Y A;  1HB2 A;  1BBT 3;  5JZG C;  4E4D X;  5FMO L;  2DVD A;  3VD4 A;  3D6E A;  1NXM A;  3E5Q A;  3U75 A;  1YI7 A;  2MEV 1;  1QDC A;  1X8M A;  1WZX A;  2A70 A;  4QX1 A;  1HB4 A;  1QKQ A;  2ES3 A;  2XUE A;  3ZLI A;  3R4D B;  4RD7 A;  4HSL A;  1MS1 A;  4YAR A;  3VD9 A;  4FTE A;  3MID A;  3MGU A;  3C7G A;  1KXG A;  4CTE A;  1PIV 3;  2VOV A;  3GM8 A;  4KGG A;  4PCR A;  5C7G A;  1Z7S 1;  5FWE A;  1L7L A;  1YYN A;  5I91 A;  5A7O A;  1ND2 B;  1VBA 1;  3S6P A;  2B39 A;  5K7P A;  1RUC 1;  1LGC A;  1FV3 A;  1TMF 2;  4NRQ A;  4NRM A;  3ZIW A;  3VBF C;  1ENX A;  1LJ7 A;  1MS5 A;  2MHF A;  3WDT A;  3ZYF A;  1LOF A;  1HQW A;  1D4M 2;  1SLI A;  4QM8 A;  2ORX A;  3CEW A;  4XFG A;  5FY7 A;  1GUI A;  3HN1 A;  2VZS A;  1L3J A;  2WFP A;  5E88 A;  1MPX A;  2E9Q A;  2H0B A;  2XJR A;  5C70 A;  4BPZ A;  1OA2 A;  1GWK A;  2VCA A;  2CAV A;  4IE0 A;  4DFS A;  4KBB A;  1KS5 A;  1B35 C;  3SIS A;  2VUA A;  1GSL A;  2QQW A;  4DXT A;  1IPJ A;  4ZS2 A;  4LBO A;  2RV9 A;  1JYW A;  3AMQ A;  4LHS A;  2X5I C;  4BIF A;  1JZ4 A;  4D3W A;  2GNB A;  4HN1 A;  1AVB A;  4COW A;  4H7L A;  2ARX A;  1UL9 A;  2ZXQ A;  1H2K A;  1NCR B;  1XXN A;  2RS3 2;  5C4W C;  1KQR A;  3MYX A;  3O1M A;  3T2T A;  4NIH A;  5DG2 A;  2D6P A;  3K2O A;  1Q8V A;  1GYK A;  1PVC 3;  1X8E A;  4GQ7 A;  2VPV A;  1H1I A;  3HN3 A;  4HOO A;  3KF5 A;  2R07 3;  1EUU A;  3EJK A;  3MI8 A;  1I9R A;  4XFB A;  1ND2 C;  1RUH 1;  3B01 A;  1BHG A;  4LUK A;  2EVX A;  3HAG A;  4MXW B;  1UIJ A;  4TYS A;  4Y33 A;  4G4F A;  2IC1 A;  1LAJ A;  3T0D A;  2WS9 1;  1NT0 A;  1QJF A;  5KXD A;  1BVV A;  1R64 A;  1XB9 A;  2Q30 A;  4LHK A;  5FUI A;  1UY2 A;  3UES A;  4NOT A;  1J1L A;  1BEV 2;  4QHO A;  3HD8 B;  1VPH A;  3THP A;  4XE9 A;  4LO5 B;  1C8M 3;  3P3P A;  4Q29 A;  1K5M A;  1WMF A;  2QQU A;  4BQW A;  4XF1 A;  5KHH A;  1RUG 1;  2B45 X;  3HNB M;  2BNN A;  2NZ9 A;  5DQ0 A;  4ERO A;  5F37 A;  4Q0P A;  1UN1 A;  1UNB A;  1UX7 A;  2O1Q A;  3ACG A;  4FPF A;  5FRA A;  5C8C B;  4Y4R A;  1NYW A;  2EID A;  2W95 A;  1XSR A;  4ONU A;  4ZXE A;  2P3J A;  3BOD A;  1AR6 1;  5AFE A;  3C8X A;  4TTG A;  3LPF A;  3O1U A;  1RED A;  1H4H A;  2IXH A;  5FBJ A;  3WG2 A;  2VQ0 A;  2JJ6 A;  3ZYR A;  5BNP A;  1NG0 A;  4LO7 A;  1NE6 A;  3LOI A;  2RM2 2;  1JU3 A;  4Z07 A;  1WD3 A;  1W8O A;  4Q4Y 1;  3DCQ A;  1GZT A;  1R08 2;  1COV 1;  2Q1Z B;  5I8T A;  1JZ3 A;  1HRI 1;  2VTF A;  4P9W A;  1SLL A;  2ZCW A;  4BOW A;  4DEQ A;  1PM7 A;  4XF9 A;  4FPE A;  3RSJ A;  1OH4 A;  4MZU A;  2WNU B;  1UY3 A;  5FZ8 A;  3K3O A;  1O5U A;  1PO1 1;  3GZU C;  5K9Y A;  1C8N A;  1QJY 2;  3NKG A;  4GH4 C;  4AI2 A;  2C5D A;  3G7D A;  4YLZ A;  3K4Z A;  4K21 A;  2P1B A;  5IAX A;  4IQP A;  1WW4 A;  1ODN A;  1C57 A;  4OHX A;  2R06 3;  1X36 A;  5CKN A;  3I3E A;  4PJY A;  3ZN5 A;  3A0N A;  3TNQ A;  3VDA A;  5C8C C;  1UU5 A;  3KV4 A;  2XOM A;  3WW3 A;  4ASM B;  5DZG A;  1JHN A;  2OPW A;  1ODM A;  2VQT A;  3ZN4 A;  1Q43 A;  3UKT A;  1BJQ A;  4PI2 A;  4UW6 A;  3T2P A;  3AZV A;  4GJZ A;  2DDU A;  4LK7 A;  4MG2 A;  2X05 A;  3VBS C;  1SDW A;  4YGE A;  4AED B;  3EBR A;  3H8X A;  1CAX A;  4AVC A;  3TRS B;  1HRV 2;  1YI9 A;  4DY5 A;  4CDU C;  2EAL A;  1JMU B;  1AYM 3;  1VBB 2;  1GFF 2;  1WD4 A;  1DF0 A;  4FOY A;  4YWA A;  4OI0 A;  1Y7B A;  4G3Y C;  4QQP A;  5C5T A;  2HWF 1;  4LBJ A;  2DVA A;  3CDZ B;  3J9S A;  4JV4 A;  3MF6 A;  4JGZ C;  4W6X A;  1SAC A;  3H7Y A;  2P4E A;  5FAX A;  1EY2 A;  4SBV A;  3ZXL A;  1LGN A;  1OQ1 A;  1XC6 A;  1DGR A;  2UUR A;  4N7U A;  1PGW 2;  1QNY A;  2DFC A;  2RMU 1;  5HCB A;  4ORF A;  3BGA A;  3B9I A;  1GZW A;  4XJ9 A;  1MZ6 A;  1E5H A;  2JE8 A;  3B5L B;  2WNU C;  1PO2 2;  4XZU G;  1VLN A;  1LOA A;  4DUW A;  3AKR A;  2FDF A;  1QJU 2;  5FQ0 A;  5EJZ B;  3CMG A;  2XHN A;  1JYC A;  2V5Y A;  5HV4 A;  1XBF A;  4LUL A;  5DPN A;  1QQP 1;  1AR7 1;  3LIG A;  1J84 A;  1J3P A;  2RS3 3;  2P3I A;  2VOT A;  4NR1 A;  5JR2 A;  1GQH A;  5JI7 A;  1PMH X;  4QB6 A;  3AKP A;  3ACL A;  2JDZ A;  3RWK X;  1RUF 3;  3NO8 A;  5KHI A;  1X7N A;  2JWP A;  1W6O A;  3VHN A;  1NX9 A;  1YO8 A;  2ARE A;  2JG9 C;  2PHD A;  2EXJ A;  3RMX A;  2TEP A;  5LA0 A;  3MLL A;  1NCQ A;  1CAV B;  3MLK A;  2CGP A;  1S0F A;  2HEY F;  4CVU A;  3CBN A;  3KMH A;  3NAP C;  4Q4X 2;  2DUQ A;  2WT0 A;  2WZR 3;  4AED C;  1HJG A;  1RUE 3;  4YW6 A;  5FXX A;  4FAH A;  5FDB A;  1PX3 A;  3AYE A;  4A42 A;  1QJX 1;  2BDR A;  5CEH A;  5FZE A;  1YJK A;  4AEM A;  3KQR A;  4CCD A;  2ZBJ A;  3IM0 A;  4BM8 A;  2ID4 A;  5JXH A;  2ZZQ A;  3CHX A;  2YC0 A;  4Y22 B;  2WQ8 A;  4MXV A;  3RI8 A;  3BKZ A;  3BTY A;  5CFD A;  1YLL A;  1GP5 A;  3S7I A;  4AQS A;  5C33 A;  3UKN A;  4E27 A;  1Q8S A;  2ORZ A;  4JHT A;  4XQD A;  5IUQ A;  3BIE A;  3GJA A;  2B4K A;  1AR8 1;  2BQP A;  2GP5 A;  1NXD 1;  1GWM A;  1R09 2;  3HVD A;  4UBH A;  2GC2 A;  2JDY A;  3N7L A;  1CR7 A;  4U36 A;  3IMN A;  4JDN A;  1FOD 2;  3KCY A;  1MS3 A;  3NRU A;  2W0X A;  5IYY A;  5BNO B;  1LEC A;  2R30 A;  4UW3 A;  5JOX A;  3N7M A;  5LBF A;  1AL2 1;  3F95 A;  3R05 A;  1KS4 A;  1VBD 1;  4GUL A;  4HBN A;  4XTM A;  1BBT 1;  1Z78 A;  4HT1 T;  1YQC A;  2DVF A;  2VMI A;  1GMM A;  3FUO A;  1WCS A;  4IXL A;  1MQT B;  1US2 A;  1AJO A;  2DCJ A;  1VMJ A;  2R04 1;  5EIY B;  2Q5T A;  1CJP A;  1I3H A;  1RUI 2;  5GZD A;  3BTX A;  3DKQ A;  2ZKN A;  2RS1 3;  1RIR A;  4PT6 A;  2BVV A;  3NNG A;  3WT3 A;  3B9C A;  1EPZ A;  5A32 A;  2PN5 A;  5FBZ A;  3H9A A;  4Y26 A;  1JUH A;  2CTV A;  2XWJ B;  2NMN A;  3MW3 A;  4FSJ A;  2DFB A;  3B3Q E;  2Y6J A;  3I3Q A;  2P6H A;  4LJH A;  3VD7 A;  4E4S A;  1XU2 A;  4GH4 A;  3M3I A;  1W2T A;  4QDS A;  1DZT A;  2XG3 A;  4PIY A;  5FK8 A;  2W68 A;  3KHC A;  3VZJ A;  5EPA A;  1UY0 A;  2I2S A;  4ZZ8 A;  2VU9 A;  4UT5 A;  5FZ9 A;  3ZMN A;  5JPN B;  2VZ1 A;  4CPB D;  4NAM A;  1FNZ A;  2WN3 A;  4LEJ A;  3TN9 3;  3T08 A;  4LKE A;  4FXG B;  4YSF A;  3AX4 A;  3CJI A;  1OD3 A;  3VD3 A;  3W21 A;  3WW1 A;  3X29 B;  3FN9 A;  2FD8 A;  4A44 A;  4O65 A;  2XKO A;  5FMD A;  1M4W A;  3UJO A;  2HYX A;  2XJT A;  1MZF A;  4QT6 A;  3VBS A;  2ZAC A;  2C6S A;  1V6J A;  2DUO A;  4PDW A;  4PIZ A;  1OKQ A;  4D7T A;  5FO9 B;  4XUT A;  4XDP A;  1NY7 2;  4CDU A;  4QX7 A;  1J1T A;  3HBK A;  3NJX A;  1M06 G;  1W8H A;  1MQT C;  2DBN A;  1BQP A;  3I2H A;  1SCR A;  3AZZ A;  4BQ1 A;  5ABJ C;  4BK4 A;  4XJU A;  1CPM A;  2G9F A;  3ZYG A;  1H8T A;  4YVS B;  1OHF A;  4TXW A;  1WA4 A;  1UAI A;  1YXW A;  1W6M B;  1LOC A;  3NNL A;  5HV0 A;  2OS2 A;  3K75 B;  1MEC 3;  3ON7 A;  4ZXK A;  1UZV A;  1A78 A;  3WX5 A;  2BRT A;  5A3P A;  1LB2 A;  2R07 1;  5FCC A;  4IEY A;  4XFC A;  4LOR A;  3AKS A;  1G7Y A;  2BGP A;  4OMC A;  2JB8 A;  3AYC A;  4K9S A;  4V2W A;  4YVW A;  1N1V A;  5L9B A;  1WWY A;  2WN2 A;  2QQV A;  1PO2 3;  2Z69 A;  2VMH A;  1ZRF A;  3MV0 1;  2PEL A;  1FPN 3;  1YIP A;  4XAA A;  2HWE 1;  3EO6 A;  1IPK A;  2OZ6 A;  3KHB A;  3V64 A;  4EQV A;  1RUJ 3;  3I2O A;  2YU1 A;  1ST8 A;  5HXM A;  1QOO A;  4FPG A;  2WFF 3;  1UZ0 A;  1F5J A;  1C8M 1;  4CE8 A;  3NL1 A;  2EIG A;  2PHT A;  4NE9 A;  4OHW A;  4ES8 A;  2BER A;  2NYY A;  4C1X A;  5A7W A;  1J3R A;  2J1R A;  4ARX A;  5KXC A;  1CON A;  1X50 A;  5T5P A;  1GV9 A;  1ASJ 2;  4IGP A;  3W58 A;  2KA3 A;  2BBA A;  2WWU A;  4S2D A;  3ILR A;  4MET A;  1F2N A;  2QFE A;  2QZ2 A;  2WII B;  3J26 N;  3P1I A;  4OHV A;  2BYV E;  4Q4V 3;  5DDJ 3;  3SCH A;  3OJB A;  2VG9 A;  2V09 A;  4QXK A;  2EIE A;  5CA6 A;  3RYK A;  5D1I A;  1FAT A;  3AMM A;  1ZBA 2;  2W52 A;  3ASI A;  2VVF A;  4HXC A;  4XUN A;  3T1M A;  2ZMN A;  3FUQ A;  4O9G A;  3DXU A;  2ZHN A;  3N35 A;  1BMV 2;  4W8J A;  3POS A;  4CP2 A;  4RYD A;  1XNT A;  2QVS B;  3VUO A;  1HB1 A;  3IZO A;  4FFI A;  3DYM A;  3GZE A;  1JN2 P;  1Z7S 3;  2DU1 A;  2ET7 A;  1DFQ A;  2YU2 A;  3J7M A;  3MFA A;  4ZU4 A;  5KXE A;  3TEW A;  4W65 A;  3W59 A;  1RUC 3;  3KGZ A;  3OGG A;  2VZT A;  4L99 A;  1O8S A;  4XC9 A;  4ARY A;  3OGS A;  4IES A;  2Q0A A;  1RVF 3;  5J36 A;  3TB0 A;  1CZT A;  3O0V A;  5IT6 A;  3JU9 A;  4Q8L A;  1HLC A;  4XQW A;  4E4Z A;  3ZSK A;  4W6Y A;  2JD4 A;  1S55 A;  5G05 L;  5J37 A;  4RR3 A;  1IG3 A;  2EXI A;  2RR1 2;  3KWV A;  5C71 A;  4FOW A;  2HYK A;  3ECQ A;  3OG2 A;  3V0A B;  2ZGL A;  3CQO A;  4X8N A;  4ZS3 A;  3URF A;  5K0U C;  3J7H A;  5B2G B;  1VJ2 A;  4A45 A;  2X09 A;  1SLT A;  5FOB B;  2R06 1;  4Q8K A;  1TZO A;  4NHM A;  4YW1 A;  2DF7 A;  4IV3 C;  4H3W A;  5FYC A;  3E5X A;  1W99 A;  4M4P A;  2J42 A;  1PZ8 A;  4XF0 A;  4CXX A;  2Y6L A;  4ZU5 A;  5HCF A;  4TZD A;  2DCY A;  2HBU A;  4EWD A;  4M3C B;  4YG6 A;  5A3W A;  1F35 A;  1NLS A;  2ADE A;  1A34 A;  1RHI 2;  2XVG A;  1EPW A;  1E5S A;  1U5Y A;  3CIH A;  5FPX A;  4CZS A;  1UQX A;  2WNV C;  4OZX A;  3R0R A;  5LB6 A;  1W0O A;  1T2X A;  4YG0 A;  2BBV A;  2B46 X;  3H1Y A;  3LZZ A;  2Y6K A;  3JB8 A;  3BOW A;  2I74 A;  3CO2 A;  3DUI A;  4BMB A;  2AAC A;  1QWR A;  3FLR A;  4XJA A;  3ZXK A;  3ZOI A;  5FZH A;  1AYM 1;  1X82 A;  3WP5 A;  3SHR A;  1ULE A;  1G8W A;  1DHK B;  4XHX A;  2GH2 A;  2WS9 3;  5EHD A;  4UOJ A;  1R1A 3;  3C2U A;  4KU7 A;  3I3B A;  4R4Z A;  4BME A;  4LPL A;  1AXY A;  1EUT A;  5FJK A;  4LLF A;  1MS8 A;  2OQ7 A;  3QLQ A;  1IS5 A;  3LEI A;  3DYP A;  1W0P A;  2GU9 A;  1N3Q A;  4Y1Z A;  3WR0 A;  4XDQ A;  1DQ5 A;  3SEE A;  3ZR6 A;  4DB5 A;  4M4R A;  3WXP A;  2OQ6 A;  4ZU7 A;  3VL9 A;  2PA7 A;  3THT A;  1ZBE 2;  2YBK A;  1XYN A;  3ZFG A;  2GP3 A;  2W94 A;  3WF3 A;  5FY9 A;  5ABJ A;  5I93 A;  2VW0 A;  2RS3 1;  5FPB A;  4O61 A;  3AYD A;  1OFN A;  2VXJ A;  3PU3 A;  3MIG A;  1W9Y A;  5T52 A;  2WRA A;  4BQX A;  4B4R A;  4EWA A;  2P3K A;  3T0B A;  5I0R A;  4CEW B;  1UO9 A;  2QDN A;  4CDW A;  1AR6 3;  4LO4 B;  2PXJ A;  4ISR A;  1VBC 2;  1ZNP A;  3E6D A;  3MIE A;  3U11 A;  1D0G A;  4M0N A;  1QXP A;  4LR4 A;  5A70 A;  4Q4W 2;  3WNM A;  2LM3 A;  4L0P A;  4Q4Y 3;  2ZGK A;  5DAW A;  1SQ4 A;  3UYJ A;  3RRD A;  5CBL A;  4CA9 A;  1W6N A;  3T30 A;  3OPW A;  4B7K A;  1LES A;  3EB7 A;  1HKD A;  1VMF A;  1CPN A;  2EIB A;  5C8W A;  3WQB A;  2WR9 A;  5FYH A;  3S7E A;  2O0O A;  2JG8 A;  2YPD A;  4E2G A;  3BI3 A;  2WZE A;  1XYP A;  3SH4 A;  5DAX A;  3OUJ A;  4K8R B;  4QWN A;  1DQ2 A;  2PHU A;  5CKQ A;  2ZGR A;  4P9I A;  1SMV A;  2D3S A;  2GDF A;  1PM4 A;  3AL6 A;  3DEM A;  1W3V A;  3AB0 A;  5FO7 B;  3SH3 A;  1LOF C;  2JDU A;  1OQD A;  2YYO A;  3HQX A;  1Q8O A;  1DIW A;  3R4U A;  1LED A;  2GN3 A;  1O8P A;  1PGS A;  3K51 A;  1GOH A;  3LDB A;  1N3P A;  2ZGP A;  1SG3 A;  4CDX A;  1EAH 3;  1WCD J;  2ET1 A;  4LE3 A;  4YM2 A;  2X29 A;  1JZ5 A;  2ARC A;  1RXG A;  5EYY A;  2A73 B;  4L11 A;  2VMG A;  2RM2 1;  4GKY A;  2ZZJ A;  1DGL A;  2HWB 2;  3AYA A;  3IDE A;  5FPV A;  2VBP A;  3AP6 A;  3ZIX A;  5C5U A;  3KGL A;  1WLT A;  3WW4 A;  2W9X A;  5GJ6 A;  3LEK A;  4IDZ A;  5I0T A;  2DTY A;  1UU4 A;  3SKJ E;  2RHP A;  5FLH A;  1RIT A;  3N9P A;  1PGL 1;  1KFU L;  2HWD 2;  2HWF 3;  4MHR A;  3J4U H;  4AVS A;  3ABZ A;  3ST7 A;  4JZR A;  4HK8 A;  4HG6 B;  5BNP B;  4NHL A;  5FV3 A;  1SEF A;  1V6O A;  5JR7 B;  4BQ5 A;  4GD4 A;  1QJY 1;  2FMD A;  2XJS A;  1VRB A;  3CU7 A;  4FQZ A;  1BK1 A;  3GZT B;  3MO4 A;  3I2G A;  4YFZ A;  4C0H A;  2SLI A;  3DV8 A;  3BN6 A;  5EP9 A;  1ZZB A;  4QKB A;  4EZH A;  5F3I A;  2WA3 A;  1ONA A;  5JI9 A;  4R52 A;  2JEN A;  1OT5 A;  4J6G A;  4MGY E;  4M3C E;  4CUG A;  1S2B A;  1AR7 3;  3QCW A;  2FMY A;  4XJW A;  3ZFF A;  5A6Q A;  4YG3 A;  2GAL A;  1OH3 A;  2EIC A;  4H55 A;  1X9T A;  2GND A;  5LK7 B;  1OUS A;  3PDQ A;  2VOX A;  2Z42 A;  3AFG A;  5L19 A;  3WDW A;  1QEX A;  2B8M A;  5J3U A;  3KQ4 B;  5JIU A;  2FBE A;  1K5M C;  2Y6H A;  1VR3 A;  3WCS A;  2VNO A;  1O3Q A;  1HN1 A;  1RL3 A;  2XL7 A;  2IXL A;  4YRD A;  3SCF A;  4LBK A;  3H8U A;  4K40 A;  2YGM A;  1CAW B;  1GBG A;  4PLM A;  2GMP A;  5LBE A;  2Q8O A;  1LOG A;  3L2H A;  4AHX A;  4CP9 A;  3NV4 A;  3AC0 A;  2ZAH A;  2EXH A;  3NNF A;  2GSY A;  1FI2 A;  1OA4 A;  1Y9G A;  3GYD A;  1QJX 3;  1OSG A;  1QJE A;  1MEC 1;  2HEV F;  3H50 A;  3UGG A;  5FMO S;  1A3K A;  1F4H A;  4JGY A;  2QQN A;  1ZRI A;  3GCW A;  5T5O A;  5L9R A;  1JH5 A;  2WT2 A;  4JKM A;  2IUW A;  2P2K A;  3LEM A;  4Q1P A;  5FPL A;  1CAX B;  5BNP C;  2E53 A;  1PO2 1;  5J09 A;  1GP4 A;  3KS7 A;  5FIX A;  4KGQ A;  5IAV A;  1FPN 1;  1GWL A;  5CIS A;  2QJV A;  2KR2 A;  1IS3 A;  3BPS A;  2MPF A;  2VQU A;  2ZHK A;  5B4N A;  2ZX1 A;  4XOG A;  1RUJ 1;  1NOV A;  1UW8 A;  4XYX A;  2XGX A;  3FLT A;  3J8F 2;  4FPJ A;  1KJR A;  1O4Y A;  3I4I A;  1CGP A;  1B35 B;  3IPV A;  3PUS A;  3H42 B;  1IQA A;  4AGG A;  2X5I B;  5DUV A;  3KT7 A;  2QTW B;  2BJS A;  2VMC A;  4I09 A;  4ITC A;  5DXD A;  1AL2 3;  5FYZ A;  4BZ4 A;  5BUV A;  5FYU A;  3ZYB A;  4WM8 A;  1NLR A;  5F5Q A;  3PMS A;  5DDJ 1;  5SV8 A;  1C5H A;  2VZV A;  3NQH A;  3NJV A;  4Q4V 1;  1WCU A;  3RPQ A;  3SXW A;  4AHW A;  4HVQ A;  2R04 3;  4P08 A;  2UY9 A;  4ISQ A;  5IVY A;  3AMN A;  1G9B A;  1NQD A;  5T55 A;  1H2N A;  1TNF A;  4HK9 A;  3GAL A;  4HMZ A;  2JIG A;  3P5B A;  4KH9 A;  1W6O B;  3I2F A;  5AC9 3;  2RS5 3;  1W9F A;  3LDK A;  2ILM A;  5LY1 A;  3VBR A;  3ZXG A;  1NCQ B;  2Z5W A;  3WNX A;  1AR9 2;  1GNY A;  1HV0 A;  1GNZ A;  1REF A;  3T2O A;  4XAC A;  4HET A;  3WF2 A;  4BQY A;  1VBE 3;  1RVF 1;  2EA7 A;  1NLQ A;  3T2Q A;  4XFF A;  4XHB A;  4GZ9 A;  2CU5 A;  2D98 A;  1WA6 X;  5FY8 A;  3C7H A;  1UMZ A;  4YM3 A;  1JYT A;  5LEJ A;  1FOD 1;  4KI5 M;  4Y24 A;  4HZF A;  3W9A A;  4AEJ A;  1Q8P A;  1S0B A;  4FPH A;  4LBQ B;  1WW6 A;  3O1V A;  4LIU A;  5CFD B;  1RB8 G;  1UKG A;  2BGC A;  4N43 C;  1ND3 A;  2ZEX A;  4NIA A;  3VZL A;  2BEO A;  2A6Y A;  3ZYP A;  5A7S A;  1QNW A;  2VUL A;  3III A;  1UIK A;  3SEP A;  3N36 A;  2Z2S B;  4GWN A;  1CQ9 A;  3RMY A;  1RMU 3;  3ZDV A;  4OI4 A;  3POI A;  3HPN A;  2FZ1 A;  3POW A;  1N1S A;  1KDM A;  2E32 A;  1UOF A;  2BNO A;  3RQ0 A;  2G19 A;  3VB9 A;  3WF0 A;  4TLG A;  3N4M A;  3I49 A;  2JIC A;  3OCP A;  4L97 A;  4XCB A;  2BOJ A;  1U12 A;  2C24 A;  3HOB A;  4JKL A;  3I2K A;  1W8N A;  4CCJ A;  4QB1 A;  2X10 A;  1GOG A;  2A71 A;  3D82 A;  4JDO A;  2JDH A;  3WF4 A;  4IEQ A;  1H4G A;  3AP5 A;  5F6K A;  5C6C A;  5GKA C;  1YWK A;  1NCQ C;  2UYB A;  3I2I A;  2CAU A;  2BZD A;  3KVB A;  4D94 A;  1C5I A;  3WNN A;  5A32 B;  1JYN A;  3I2D A;  3EMR A;  1SBE A;  3ZYI B;  1R1A 1;  1CZV A;  1WME A;  2HWE 3;  2LRO A;  2W87 A;  4LBQ D;  3U37 A;  2XH6 A;  2OXB A;  2YMZ A;  4YZ3 A;  1VAK A;  1IZ3 A;  3LWC A;  1D7P M;  4GH4 B;  3VDD A;  3MBW A;  4AGV A;  3MDP A;  3JUU A;  1W6Q A;  1XQN A;  3BAL A;  4YNI A;  5LEK A;  2VC9 A;  4D6R A;  5CFD C;  2D5H A;  1OQE A;  5CAD A;  1HXS 2;  2D40 A;  2Y60 A;  3E5U A;  1DZQ A;  3A22 A;  1REE A;  1GKB A;  4QPG A;  1OI6 A;  3CJI B;  3V56 A;  1W6P A;  4DNY A;  4MV2 A;  4R9A A;  4WZC A;  3L9J T;  2D44 A;  3OUI A;  2JXA A;  5ANQ A;  3KCX A;  4CCC A;  2EAK A;  1ULD A;  4KU8 A;  2D5F A;  3JB4 C;  4TWT A;  3H1M A;  3NW4 A;  1BYH A;  2A6X A;  5JXG A;  5HBA A;  4YM0 A;  4LA2 A;  3NV3 A;  5KC5 A;  1WMX A;  3OGJ A;  5I0S A;  3VBS B;  3EQE A;  5CAZ A;  4PDW B;  5A33 A;  1L7Q A;  4L9B A;  1OOP A;  1C28 A;  2A3W A;  4JAA A;  5ACA 3;  5KXB A;  5HXV A;  1UD1 A;  1LUL A;  5D8A A;  5F3G A;  4CDU B;  3CZJ A;  1OUX A;  4QXH A;  3WSO A;  4Q0Q A;  1XSQ A;  2ZHM A;  2FHR A;  2YBS A;  5A3U A;  2VNR A;  2WAB A;  1IOA A;  3A21 A;  3JXS A;  5IVE A;  4RHV 2;  5FZC A;  1XE0 A;  3OPT A;  3LIH A;  1UYX A;  5K4L A;  4JGZ B;  1H8T B;  3UGH A;  4KG0 A;  4LKD A;  4XF4 A;  4WVZ A;  1MZE A;  1IKP A;  5FP4 A;  3IN9 A;  4AYU A;  4AAP A;  2CWS A;  4XF3 A;  3VBU A;  1GQG A;  2Z79 A;  3PUR A;  1SLB A;  2VJX A;  3GBW A;  3POE A;  4MGQ A;  5IFP A;  5JIA A;  1VB4 A;  2Q1M A;  2V4A A;  3ZXF A;  4YVW B;  2IXJ A;  3TBD A;  3OBA A;  3O1S A;  3N9Q A;  1ASJ 1;  1WGP A;  4XDO A;  5JOW A;  4D6Q A;  3VKM A;  4PI0 A;  4P14 A;  1JW6 A;  2VXR A;  4XJZ A;  4ES9 A;  4BLI A;  5FP9 A;  5FLJ A;  1UY4 A;  3USU A;  4RGK A;  4BYY A;  3CJI C;  5JMC A;  2RDR A;  1J3Q A;  2HH9 A;  5FTT C;  4AQT A;  5K8S A;  1K5J A;  1EAH 1;  4C90 A;  5I8S A;  2W46 A;  3BUC A;  3OSD A;  5C3S A;  3M3E A;  2JG9 B;  1BMV 1;  4OCT A;  4XVH A;  4UFL A;  5A7W B;  4GAZ A;  1S0I A;  4Y5T A;  2WDB A;  3NAP B;  2ZGQ A;  2XBO 2;  4RGA A;  4PDW C;  3UK9 A;  2DV9 A;  1TMF 3;  3KM5 A;  3THD A;  4EN7 B;  3HQR A;  2A6W A;  1BK0 A;  1FYU A;  4Q26 A;  5IVJ A;  5LAT A;  1AX1 A;  1D4M 3;  3QAC A;  4DRR A;  3K3N A;  3ZFE A;  3ILF A;  1EP0 A;  5ANN A;  5FPU A;  1J58 A;  1MS9 A;  1ZYB A;  2D6L X;  3OEA A;  4RS5 A;  3ZXE A;  5L9V A;  5JUV A;  1H8T C;  1LRH A;  2DUR A;  4RSU A;  4N43 A;  2HBT A;  2ZMK A;  4K20 A;  4QD2 A;  2ZGU A;  4P9X A;  3VHP A;  1O3R A;  4JHZ A;  1TNR A;  1C1F A;  5DZE A;  4NMI A;  2JX9 A;  4QGN A;  1W9T A;  1ZZ6 A;  1CAU A;  2IXI A;  4YVW C;  5IK4 A;  4KG8 A;  1JOP A;  2IXK A;  2I45 A;  4ZON A;  1D2Q A;  1OMI A;  3A4U A;  4RR3 B;  3O7O A;  2Y26 A;  4HL0 A;  4FPY A;  4QX8 A;  1UOJ A;  1WBF A;  2BW8 A;  2F4P A;  5A6X A;  3FX3 A;  3GBG A;  1G6N A;  4AE2 A;  3OTF A;  4A2U A;  4OUL A;  4KMQ A;  4B1M A;  2VZ3 A;  1O59 A;  3N9N A;  4X8P A;  2JDN A;  4OHZ A;  1NZI A;  2VUD A;  1ZZC A;  5FZM A;  4IEO A;  2VGD A;  1H30 A;  1GLH A;  1ZA4 A;  5DAB A;  4AVB A;  3KT4 A;  4QHB A;  5EJ1 B;  3ITQ A;  4PF5 A;  4A7Y A;  4UF0 A;  5A7Q A;  4CU7 A;  1YRZ A;  2DUP A;  2J22 A;  2IVI B;  2UY8 A;  1E57 A;  3GNE A;  1XNA A;  4IET A;  4WVM A;  2FQP A;  3PNA A;  1DBN A;  3W5N A;  5JXI A;  1F8V A;  3WLU A;  4XFA A;  4YZ5 A;  4HSJ A;  4LK6 A;  4BQ3 A;  1BEV 3;  1PMJ X;  4K7J A;  2K2S A;  2YGL A;  3JBG 2;  3VLB B;  3I54 A;  3ZPY A;  1S4C A;  4IE5 A;  1CVN A;  4LQR A;  3H8R A;  3JCI A;  3IAQ A;  2YPJ A;  1AZD A;  3LGR A;  4LIV A;  4OI2 A;  4BQ4 A;  4LOS A;  4R8H A;  3TOJ A;  3A23 A;  2MEV 2;  2PQS A;  1DLL A;  4XCA A;  3FHI B;  3U14 A;  4UW4 A;  2CWM A;  3H3Z A;  4I3G A;  1IPS A;  3KVA A;  1UZW A;  1VAV A;  4HAN A;  2ERF A;  3WOG A;  1BCX A;  3WG4 A;  2LW8 A;  5FP8 A;  3A0K A;  4L92 A;  2ARB A;  4RR3 C;  2VY0 A;  2RDQ A;  1VBA 2;  5A3O A;  1RTV A;  4HVR A;  5FFO C;  2DYC A;  1I1E A;  4P00 B;  4XAB A;  2WC2 A;  1DLC A;  4DS0 A;  2RM2 3;  4Q4W 1;  1TE1 B;  5EZW A;  1PHM A;  5ABJ B;  1LR5 A;  4HN0 A;  2YFZ A;  5FY1 A;  3ACI A;  4QQL A;  4NWV A;  1CIY A;  2ZOE B;  1OBN A;  2OUH A;  1R08 3;  1G9D A;  2NMO A;  3OY8 A;  4K3U A;  1PZ7 A;  5IWF A;  1NCR A;  4QPI A;  1UWW A;  4AFM A;  1X33 A;  3PHM A;  3MUZ 1;  2AEN A;  3LFM A;  3GBF A;  5SV5 A;  2RS5 1;  4CDW B;  2E7Q A;  5AC9 1;  3GHM A;  3ETQ A;  5GLU A;  4FOV A;  3AZX A;  1XRU A;  4IEP A;  2UWA A;  3MZH A;  1ZRD A;  5BY5 A;  2E31 A;  2CSG A;  2PTM A;  2Y8K A;  2R0F A;  5CU1 A;  1FAY A;  3M3O A;  1QJY 3;  1VBE 1;  1TME 2;  2D93 A;  1AYN 2;  1JU4 A;  1W6N B;  4MXW A;  4AFA A;  1OVP A;  2JDK A;  5A6Y A;  1W04 A;  1A8M A;  1CJD A;  3PJQ A;  1W2A X;  4MSV A;  5JSP A;  4XUQ A;  1S0D A;  4RGG A;  4OFG A;  1FNY A;  2A6V A;  2JG8 B;  1UZY A;  2ZEW A;  3C7O A;  2OZJ A;  5L7O C;  2W92 A;  2P5B A;  1V9U 2;  1XOY A;  1GU3 A;  3LPG A;  1UOB A;  4WVV A;  3WD5 A;  5JDB A;  1FX5 A;  2XBO 3;  2ZGM A;  2BVB A;  4Z82 A;  3AK0 A;  3MIF A;  3VDC A;  4N9H A;  1RMU 1;  3AJY A;  4A6S A;  3PUI A;  1HRV 3;  3S5Q A;  4AI8 A;  2E7A A;  3AMH A;  3ZFG C;  5CVR A;  3V0B B;  1VBB 3;  3WNK A;  4MHU A;  1CN1 A;  4GWM A;  4CDX B;  1YHF A;  1POV 0;  2GAU A;  1LKN A;  1D4V B;  2W1W A;  4C1W A;  4A7K A;  3RJR A;  3NVC A;  2DBI A;  2P3Y A;  4MH0 E;  4AF9 A;  1W28 A;  4N8M A;  3RZJ A;  1W2U A;  4KWL A;  1EYB A;  4CDW C;  2XKP A;  1RUG 2;  5JOY A;  4JRL A;  4PQ9 A;  1W8T A;  2OX0 A;  4A41 A;  4K6B A;  3ZPO A;  2YBP A;  1PZ9 A;  1ZA7 A;  4P9L A;  4IE4 A;  3OPZ A;  2WYF A;  1QJU 3;  2YB7 A;  1RUD 2;  3T3Y A;  4AAX A;  2A3X A;  2PHF A;  4YPJ A;  3WP3 A;  4P5H A;  3DXT A;  4I01 A;  1KD7 A;  3MIB A;  2Q1F A;  1ZRC A;  3SH5 A;  3WIN E;  5FR3 A;  5K0U B;  1K12 A;  1WLW A;  1VRH 2;  5D2A A;  3SC7 X;  5F3C A;  3KB5 A;  5FZO A;  4PF1 A;  2AH2 A;  3WQ7 A;  3E6B A;  2XJP A;  1H9W A;  2EAA A;  3MF9 A;  4F83 A;  4IV3 B;  2PLV 2;  3Q8A A;  5GZE A;  2JG8 C;  1N1Y A;  1EV1 2;  2VBB A;  4WZF A;  3HIF A;  2XLA A;  3N3H A;  4H7M A;  4C0B A;  4ZKT B;  4YW2 A;  4EN0 A;  5ERL A;  3LSD A;  5F32 A;  4B4P A;  2E6V A;  1OLM E;  5BXX A;  5LWB A;  1KIT A;  5FO8 B;  4LBN A;  3LFI A;  4Q4X 3;  4Y5S A;  4CCN A;  4GMP 0;  3HT1 A;  1JI6 A;  2WNV B;  2GMM A;  4Y20 A;  5LY2 A;  1HX6 A;  4ATE A;  2D6O X;  2RJL A;  2HWC 2;  1U0A A;  1S0E A;  3OBR A;  4BK5 A;  2BPA 2;  2ZX3 A;  3DKW A;  4XW3 A;  1Q56 A;  4MO3 M;  3U4S A;  2C1F A;  3DGT A;  3VBH A;  4CDX C;  4MVT A;  1RUO A;  2VTX J;  5ACA 1;  2HKX A;  1PO1 2;  3I59 A;  4FFH A;  4EV0 A;  1IS4 A;  3H0O A;  3LAG A;  4XTP A;  2VOW A;  2QQJ A;  4WVW A;  4WV8 A;  4QDR A;  2P37 A;  4YGB A;  4I0B A;  1N47 A;  4CU8 A;  5C4W B;  4I3P A;  3MW2 A;  4K1Y A;  4PQQ A;  2QCS B;  1PNG A;  3ZVX A;  1VMH A;  4NN0 A;  1D0H A;  2XON A;  4V1P A;  4CP9 B;  4CCO A;  4LE4 A;  2PQQ A;  3GF6 A;  2R7E B;  4FPL A;  3TAY A;  4K8F A;  1OXC A;  1R09 3;  5FUP A;  1ALY A;  3TWI A;  1YIF A;  1QH7 A;  1UY1 A;  2ZAB A;  3K4D A;  1FOD 3;  2OII A;  3OEB A;  4JGY B;  5FRE A;  4BA6 A;  4DRV A;  5IK5 A;  4ASL A;  2AEY A;  2VCC A;  3POY A;  5FP3 A;  1LHO A;  2VCB A;  1RXF A;  3I8T A;  1S1A A;  3NNM A;  4YFW A;  5BV6 A;  3BU0 A;  1NA1 C;  3ZXD A;  1Q3E A;  4NHK A;  3H8O A;  3LDR A;  2BGO A;  3WDV A;  2C0Z A;  2NP0 A;  1OA3 A;  4Z1V A;  5FZ0 A;  5DMY A;  2CV6 A;  3NNJ A;  5F5A A;  2FCV A;  3K77 A;  1RUI 3;  4XBQ A;  4JCK A;  4B3N A;  4CP1 A;  4URA A;  5C3P A;  3FHA A;  4MGI E;  1GR3 A;  1LNS A;  3IPV B;  3O14 A;  3WHT A;  4W4Z A;  3JD7 2;  3ZFF C;  4EE2 A;  3OBT A;  3KD4 A;  3WDX A;  4XUO A;  1W39 A;  4CUB A;  1TMF 1;  4KQ7 A;  3UT0 A;  2K9Z A;  2A75 A;  1GP6 A;  2AC1 A;  1AR9 1;  1XNB A;  4E4H A;  2HEW F;  1JYV A;  4FPK A;  1KEX A;  1D4M 1;  1XJA A;  2R32 A;  5BPX A;  1CAV A;  1I6X A;  1TME 3;  3ZX7 A;  4GB3 2;  1XE7 A;  1NUK A;  4GJY A;  5FPZ A;  1NE4 A;  1KDK A;  3ZSM A;  4FCA A;  4B7E A;  4P9Y A;  3NMB A;  1FMD 2;  1QQP 2;  3M2M A;  5FY0 A;  5GLT A;  4AZZ A;  2XQX A;  3OF1 A;  4M3C F;  3WQ0 A;  3ILN A;  4OMD A;  4S2H A;  4QKN A;  4OQ9 A;  3HNM A;  3MIH A;  4PBP A;  4XXA A;  1OLQ A;  2JE9 A;  4IE6 A;  2I07 B;  5F39 A;  5FXZ A;  5L7O A;  4C91 A;  2WWJ A;  2DU0 A;  3VBR B;  2BU9 A;  4YW5 A;  5A3T A;  4S2F A;  4LIT A;  4JGY C;  1HQN A;  2PFW A;  2DTW A;  3C3V A;  2E33 A;  5CNA A;  1AJK A;  5FZ6 A;  2YDE A;  2Q8C A;  1AHS A;  5AFB A;  1QGL A;  1WBL A;  3LD8 A;  1WCQ A;  2D3P A;  4IGQ A;  3LF7 A;  2ATF A;  2VEC A;  1IQD C;  4E2Q A;  1W0N A;  3ELN A;  1UX6 A;  1WLD A;  3FBY A;  4CPB A;  2FZ2 A;  3GCX A;  3TYJ A;  4OI1 A;  2XLF A;  3M1H A;  4NVP A;  1C3H A;  2QDR A;  4LXL A;  5H9P A;  1G9C A;  1PK6 A;  4AW7 A;  4NIG A;  4NPL A;  1SLA A;  5BNO A;  1BKZ A;  1ND3 B;  2VE1 A;  1ULF A;  3AVR A;  3FE5 A;  1MR5 A;  5EJ3 A;  5J48 A;  3NWK A;  4YGD A;  5FZ3 A;  4BJ0 A;  5HCA A;  2FDJ A;  5LA9 A;  3AP4 A;  4WM8 C;  5FZ4 A;  4WM7 A;  1AR8 2;  2ZEZ A;  4UW5 A;  3WNL A;  5FZL A;  2WNE A;  1NKG A;  2WSU A;  4N53 A;  3D0J A;  1W9W A;  1RUD 3;  3CL1 A;  3PME A;  4V2V A;  3ZSL A;  1CX4 A;  2F6B A;  2GH8 A;  1BEV 1;  3K48 A;  3PJY A;  4QQH A;  2JKB A;  4CRQ A;  1SFP A;  5T5J A;  1VBD 2;  1BBT 2;  4KWK A;  2BFU L;  3DYO A;  3ZKU A;  2VZU A;  3VBR C;  1HXS 1;  3IIA A;  5FJH A;  1JYX A;  1ASJ 3;  3M70 A;  2E7T A;  2KD7 A;  1RJ7 A;  4FO9 A;  1V6M A;  2Y38 A;  4LUM A;  5FK7 A;  5CFC C;  2G1M A;  2BNM A;  3RZK A;  2FCT A;  4Q0U A;  4P02 B;  1ZBA 3;  1PIV 2;  5F2S A;  3O0X A;  3WF1 A;  4E2S A;  3VDD B;  2WUH A;  2WYS A;  4DUV A;  2P6C A;  1K5M B;  2HWC 3;  2F17 A;  4AI9 A;  2Y6F A;  1W6Q B;  3PL0 A;  3AKT A;  3NJY A;  2PHW A;  5AVP A;  3KV6 A;  4MAD A;  3N7K A;  1CWP A;  1QXR A;  3ENR A;  5IJR A;  5FZB A;  2XLG A;  4L2N A;  2ZX2 A;  1ND3 C;  2PYT A;  1W6P B;  3B94 A;  3FLP A;  1ULG A;  1RC6 A;  4RHV 1;  1IG0 A;  1I5Z A;  1R08 1;  3AP9 A;  2FCU A;  3MEP A;  4BHP A;  4OVE A;  4BU2 A;  1UMH A;  3O12 A;  2ZTN A;  5FZK A;  1SFN A;  4LKS A;  4CEY A;  1LOD A;  1NQJ A;  4YVS A;  4IEX A;  4N7I A;  5A33 B;  3D3A A;  3M3C A;  3ZR5 A;  1NA1 A;  3PVB B;  2QQM A;  4LNV A;  3ZSE A;  4CDQ C;  3ETP A;  2RR1 3;  4AFD A;  1NAE A;  4QAW A;  3S30 A;  4IV1 A;  4UXA A;  3ZSJ A;  3ORJ A;  3IWZ A;  1UU6 A;  2VMD A;  3ALQ A;  5D8A B;  1XND A;  4FXK B;  2FDK A;  4A6O A;  1XU1 A;  1JZ7 A;  1A6C A;  4IL7 A;  3HNY M;  3KF3 A; 
#chains in the Genus database with same CATH homology
 2ID4 A;  1CZV A;  3HJR A;  3U37 A;  5JXH A;  2W87 A;  2QBX A;  2WQ8 A;  4UAP A;  1D7P M;  2WBK A;  3MBW A;  2V4V A;  2ORZ A;  1F4A A;  3CZU A;  1I5P A;  2B4K A;  2VC9 A;  2LS6 A;  3GXU A;  3UET A;  2YG0 A;  3A22 A;  1K3I A;  2L9L A;  2JDA A;  4W50 A;  1YQ2 A;  3NRU A;  5IYY A;  4QDQ A;  3VDB A;  5JXG A;  4XUO A;  4DXS A;  4QX2 A;  1GMM A;  1XPW A;  4QX0 A;  1L7Q A;  1US2 A;  2DCJ A;  5EIY B;  3A7Q A;  1KGY A;  4CU9 A;  2RVA A;  3CZJ A;  3WSO A;  4PT6 A;  4DUX A;  3NNG A;  3WEZ A;  3ACF A;  2WAB A;  3A21 A;  3JXS A;  1JZ2 A;  1UYX A;  2YFU A;  3WNO A;  1JHJ A;  2Y6J A;  3W5M A;  1W9S A;  2WO1 A;  2QQO A;  3VD7 A;  1UYY A;  4QDS A;  2OKX A;  4JKK A;  1OF3 A;  1UY0 A;  4MOA A;  4MGQ A;  2VJX A;  4ZZ8 A;  5IFP A;  2QQI A;  2VZ1 A;  4XUR A;  2V5D A;  2WN3 A;  1UXZ A;  3MUY 1;  3OBA A;  3T08 A;  2VO5 A;  1OD3 A;  3VD3 A;  3FN9 A;  4A44 A;  3HEI A;  3ZM8 A;  3PUH A;  1UY4 A;  2HYX A;  5CYY A;  2W46 A;  3WNP A;  4XVH A;  4XUT A;  2WDB A;  3NJX A;  4JX0 A;  4A3Z A;  3I2H A;  3THD A;  5G04 L;  4BK4 A;  2QQL A;  2VMF A;  1RYY A;  3K46 A;  2E26 A;  4TXW A;  3VD5 A;  5IHR A;  2VM9 A;  3K75 B;  3OEA A;  3I97 A;  3UNP A;  5JUV A;  2BGP A;  4OMC A;  4OUE A;  2W1S A;  3EYP A;  4OZO A;  2WN2 A;  3MV1 1;  5LA1 A;  3I2J A;  3MV0 1;  4JHZ A;  2WO3 A;  1K45 A;  1UYZ A;  4D0Q A;  3I3D A;  3GDB A;  4FI9 A;  1W9T A;  4UI9 L;  5HXM A;  2VZQ A;  3OB8 A;  1JZ6 A;  1UZ0 A;  1JZ8 A;  5DN2 A;  2VR4 A;  2BER A;  4ET7 A;  2J1R A;  4ARX A;  4KWU A;  1CZS A;  2QQK A;  4ZY9 A;  2VZO A;  2BBA A;  4KMQ A;  2VZ3 A;  1O59 A;  4GWJ A;  3P1I A;  1K42 A;  1SHW B;  2EIE A;  5EJ1 B;  4XUN A;  5F7U A;  2J7M A;  4CU7 A;  4W8J A;  2J22 A;  3WF2 A;  4RYD A;  1XNT A;  1XNA A;  4CU6 A;  1TG7 A;  3DYM A;  3W5N A;  5JXI A;  1PMJ X;  4A4A A;  2HLE A;  2VZT A;  1O8S A;  2WAO A;  4D8M A;  4ARY A;  3OGS A;  4LQR A;  3IAQ A;  1CZT A;  4CUA A;  3T09 A;  2JD9 A;  2Y64 A;  3A23 A;  1OF4 A;  2PQS A;  5G05 L;  5C71 A;  2RJ2 A;  3CKH A;  5B4X A;  3ECQ A;  3OG2 A;  3T0A A;  3CQO A;  5IFT A;  3J7H A;  2LW8 A;  4A45 A;  3LEG A;  2X09 A;  3ACH A;  1W99 A;  4P00 B;  4M4P A;  1DLC A;  2Y6L A;  3P6B A;  3IB3 A;  3F2Z A;  2YFZ A;  3ACI A;  1CIY A;  2J1S A;  4P5Y A;  4BXS V;  2VZR A;  3CIH A;  1UWW A;  3MUZ 1;  2W1U A;  5HPO A;  1ULP A;  1T2X A;  3GGL A;  2Y6K A;  2W47 A;  2E31 A;  2Y8K A;  2ZEY A;  4QB2 A;  2B9V A;  1JU4 A;  1PX4 A;  4UOJ A;  3I3B A;  2J1V A;  1L7R A;  2C9K A;  4LPL A;  1EUT A;  3LEI A;  3DYP A;  4XUQ A;  3SEE A;  4M4R A;  2ZEW A;  3C7O A;  1UXX X;  2W92 A;  1GU3 A;  2W94 A;  3SKV A;  3WF3 A;  3FL7 A;  2WAA A;  2W91 A;  3LPG A;  1SDD B;  3VDC A;  3E1F 1;  3PUI A;  1US3 A;  3T0B A;  2CDP A;  3WNK A;  4IUG A;  3IAP A;  2W1W A;  3DEC A;  3LQC A;  4QX1 A;  3WNM A;  4L0P A;  3VD9 A;  3C7G A;  4A41 A;  2W1Q A;  3GM8 A;  5C7G A;  3EB7 A;  4Z2A A;  2VL4 A;  2YB7 A;  4AAX A;  2EIB A;  4YPJ A;  3WQB A;  3FHQ A;  1GOF A;  1K12 A;  2WZE A;  4PF1 A;  2ORX A;  2VZP A;  1GUI A;  2DCK A;  3K4A A;  2VZS A;  3C7E A;  1CX1 A;  1MPX A;  5C70 A;  5J1X A;  4CUC A;  1O8P A;  4MGS A;  1GOH A;  4QX3 A;  2VCA A;  1SG3 A;  4DXT A;  2RV9 A;  1JYW A;  4LHS A;  1JZ5 A;  2VME A;  1JI6 A;  1JZ4 A;  4BK5 A;  2Z4F A;  4BDV B;  5JXJ A;  4MO3 M;  2ZXQ A;  3VD4 A;  2QQJ A;  5CZK A;  4QDR A;  2W9X A;  4CU8 A;  2CDO A;  3LEK A;  4PQQ A;  3SKJ E;  2XON A;  2J1U A;  1ULO A;  2R7E B;  3HN3 A;  3ABZ A;  5JMO A;  1EUU A;  4HG6 B;  1UY1 A;  3K4D A;  3OEB A;  1BHG A;  2VCC A;  2J1E A;  2VCB A;  3T0D A;  3MO4 A;  3I2G A;  1R64 A;  3OGR A;  5FUI A;  3BN6 A;  2BGO A;  1UY2 A;  3UES A;  5DMY A;  1OT5 A;  3K77 A;  2EIC A;  3FHA A;  3HNB M;  1LNS A;  5DQ0 A;  4W4Z A;  2W5F A;  4A42 A;  2YC2 A;  1UX7 A;  3ACG A;  4DXR A;  2J1T A;  2Y6H A;  2EID A;  1HN1 A;  1UMI A;  2W95 A;  4CUB A;  3C7F A;  4ZXE A;  1JYV A;  1KEX A;  3C8X A;  3AC0 A;  3LPF A;  4TTG A;  1NUK A;  1F4H A;  2XQX A;  2QQN A;  1JU3 A;  3OGV A;  1W8O A;  4OMD A;  3HNM A;  4JKM A;  1J83 A;  2E33 A;  1JZ3 A;  2VTF A;  2VQU A;  5B4N A;  4DEQ A;  2W3J A;  1WCQ A;  1OH4 A;  1IQD C;  1UY3 A;  1W0N A;  3K4Z A;  2VMC A;  1DYO A;  3I3E A;  4RN5 A;  3NQH A;  2VZV A;  3NJV A;  3VDA A;  4P08 A;  2Y6G A;  2XOM A;  4BJ0 A;  4E8D A;  2VQT A;  2ZEZ A;  3WNL A;  1NKG A;  3T2P A;  3IDA A;  1W9W A;  2DDU A;  3I2F A;  2X05 A;  4AG4 A;  1DP0 A;  1H6Y A;  4XUP A;  2J1A A;  1GNY A;  3T2O A;  3DYO A;  2VZU A;  3T2Q A;  3CDZ B;  3THC A;  4GZ9 A;  1JYX A;  3C7H A;  2KD7 A;  4KI5 M;  1XC6 A;  1WKY A;  2WO2 A;  3BGA A;  4XZU G;  4P02 B;  2JE8 A;  4OYU A;  4DUW A;  3WF1 A;  2WUH A;  2WYS A;  4DUV A;  4DEV A;  5EJZ B;  3CMG A;  2XHN A;  2ZEX A;  2C4X A;  5DPN A;  2YC4 A;  4MAD A;  4ZZ5 A;  1GQP A;  3III A;  1J84 A;  3SEP A;  5JR2 A;  2VOT A;  5IJR A;  1PMH X;  5A1A A;  4QB6 A;  3HPN A;  3WF0 A;  2E32 A;  1NX9 A;  4GWI A;  5LA0 A;  1UMH A;  1H6X A;  4JKL A;  3HOB A;  4LKS A;  5LA2 A;  1P8J A;  3I2K A;  1W8N A;  4CVU A;  4QB1 A;  2WZ8 A;  3D3A A;  4QPW A;  2X10 A;  1GOG A;  2QQM A;  3ETP A;  5I0D A;  1NAE A;  4QAW A;  3WF4 A;  2V72 A;  4E8C A;  2C26 A;  2VMD A;  3I2I A;  1PX3 A;  2BZD A;  3LE0 A;  5LCW L;  4A6O A;  3WNN A;  2JKX A;  1JZ7 A;  1JYN A;  1TVG A;  3HNY M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...