1UYYA

Carbohydrate binding module (cbm6cm-2) from cellvibrio mixtus lichenase 5a in complex with cellotriose
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
131
structure length
131
Chain Sequence
b'MVIATIQAEDHSQQSGTQQETTTDTGGGKNVGYIDAGDWLSYAGTPVNIPSSGSYLIEYRVASQNGGGSLTFEEAGGAPVHGTIAIPATGGWQTWTTIQHTVNLSAGSHQFGIKANAGGWNLNWIRINKTH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELLULASE B
publication title The Crystal Structure of the Family 6 Carbohydrate Binding Module from Cellvibrio Mixtus Endoglucanase 5A in Complex with Oligosaccharides Reveals Two Distinct Binding Sites with Different Ligand Specificities
pubmed doi rcsb
source organism Cellvibrio mixtus
molecule tags Carbohydrate binding module
total genus 28
structure length 131
sequence length 131
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03422 CBM_6 Carbohydrate binding module (family 6)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 1uyyA00
3I97A 2J1EA 2VTFA 4CU7A 3WF2A 1GNYA 1XNAA 5IJRA 2WBKA 4W50A 1OT5A 2WDBA 4YPJA 2QQNA 1CX1A 4QB2A 2VQTA 4UAPA 4ZZ5A 2VZUA 3VDCA 4LHSA 3P6BA 4TXWA 1PX3A 4A6OA 2W5FA 2YC2A 3ZM8A 1JHJA 4DEVA 2W1SA 2E31A 2WZ8A 2J1SA 4KI5M 2WN2A 4DUXA 2RVAA 3DYOA 1JZ5A 3C7EA 5HPOA 1UY1A 3I3EA 3IDAA 3I2GA 1UY0A 3I2HA 3T09A 2WABA 3FHAA 3FHQA 2V4VA 2XQXA 2QQMA 1JYVA 3UESA 2JD9A 3T0DA 1H6XA 3WNPA 3LPGA 4DXRA 1UY4A 2W94A 4MGSA 4DUWA 1RYYA 1UMHA 3HN3A 2X09A 3LE0A 3MV11 1O59A 3VD9A 1GOHA 1WKYA 1GUIA 1W8NA 3C7FA 3ECQA 2QQOA 2W87A 3BGAA 1JU4A 2QBXA 4XUQA 2VMCA 3GGLA 2YFZA 1L7RA 4W8JA 2VM9A 4CUCA 4JKKA 5CYYA 4HG6B 2LW8A 2ID4A 1XNTA 4QDQA 4CVUA 3T08A 4OUEA 2Z4FA 2J22A 2HYXA 1HN1A 2ORXA 2W92A 3A7QA 5JXIA 3LEGA 1W9SA 2Y8KA 3OEAA 4XUNA 4GWIA 2Y64A 5IYYA 3ACGA 3THCA 2QQLA 5IFTA 1GOFA 3UETA 3DECA 3E1F1 2C26A 3IAQA 3WF1A 4XUTA 1P8JA 4UI9L 2ZEYA 3K4AA 3WQBA 3OGVA 5F7UA 3VD5A 1CZSA 1UY3A 4KMQA 1BHGA 5DN2A 3I3BA 1I5PA 2WZEA 1UX7A 2CDOA 4IUGA 2Y6HA 1OD3A 3EYPA 2VZPA 2J1AA 1EUTA 3VD4A 4A41A 1DP0A 1D7PM 2W95A 4MO3M 1CZVA 3W5NA 4QX1A 4M4RA 3NJVA 3FN9A 3K46A 3CQOA 4LKSA 4QB1A 1DYOA 3ACIA 4QX2A 3IAPA 4A45A 2LS6A 1UXXX 2RV9A 4PQQA 2JDAA 4OYUA 3W5MA 3SEPA 1W8OA 4XZUG 3EB7A 2VCCA 2YG0A 4P00B 3A21A 2ZEWA 4P02B 3C7GA 3UNPA 4FI9A 3A22A 3ACFA 4CU9A 2VZRA 2CDPA 4D8MA 2VZOA 5G04L 1JZ7A 1KEXA 2V72A 4DUVA 2J1UA 2VZSA 2BERA 1MPXA 2VQUA 2ZXQA 2E32A 1R64A 2VMEA 1JYNA 4PT6A 3WNKA 2VZ3A 2WUHA 3ACHA 4MADA 4AG4A 4BDVB 3NQHA 5I0DA 4DEQA 2W1QA 4RN5A 2PQSA 2Y6KA 4CUBA 4OZOA 2B9VA 4XVHA 4ZZ8A 5JMOA 4M4PA 4ARYA 1SHWB 2XONA 3C8XA 1K42A 1UWWA 3A23A 3D3AA 2VL4A 4KWUA 5JXJA 3THDA 2DCKA 4RYDA 5EIYB 1CIYA 3SKVA 1XC6A 2RJ2A 2VMDA 3HPNA 3OB8A 1JI6A 2JKXA 2C4XA 2Y6GA 3IIIA 1OF4A 1UZ0A 3BN6A 3WNLA 3K77A 2WO2A 3OG2A 3OEBA 4QX0A 1J83A 4QDSA 3PUHA 2B4KA 2W46A 5HXMA 1PMJX 3CDZB 1L7QA 2W3JA 4P5YA 2WYSA 3I3DA 2J1TA 2ORZA 3SEEA 1TVGA 3VDBA 1JZ2A 2J1RA 4A42A 2VO5A 2QQJA 1PX4A 4QDRA 5C70A 3C7HA 1GU3A 3I2FA 2BGOA 5LCWL 5J1XA 2EICA 3HEIA 5CZKA 3CIHA 4P08A 2Y6LA 1W9WA 2HLEA 1UYYA 1GMMA 2VMFA 2BGPA 1H6YA 1US2A 4OMDA 1PMHX 2JE8A 3CMGA 2VCBA 5IHRA 3HJRA 3AC0A 3F2ZA 3WNOA 1W9TA 1US3A 1J84A 3CZUA 3DYPA 1UYZA 5C7GA 4CU8A 4CUAA 1JZ6A 3CKHA 1UYXA 3MUZ1 4MOAA 3HOBA 5EJZB 2V5DA 2XHNA 4XURA 3T2OA 1OF3A 3MBWA 4BJ0A 1ULOA 4JKMA 4DXSA 3VD3A 3T0BA 2WQ8A 1ULPA 3K75B 2KD7A 3HNYM 1EUUA 2E33A 2W1WA 4LPLA 3T2PA 2XOMA 4JHZA 4XUPA 1JU3A 3IB3A 3PUIA 3K4DA 1F4AA 3T0AA 4BK5A 1NUKA 4GZ9A 5DMYA 3U37A 5JXGA 1KGYA 3J7HA 1YQ2A 4D0QA 1CZTA 1K3IA 3GDBA 4PF1A 3ETPA 4ZXEA 5IFPA 2ZEXA 4A44A 4JKLA 2W9XA 3LPFA 5LA0A 3LEKA 5G05L 2C9KA 4OMCA 1T2XA 1LNSA 2J7MA 1O8PA 1GQPA 3CZJA 1IQDC 3WNNA 3MV01 5LA2A 1NKGA 4QB6A 4ET7A 3WEZA 3WF3A 2L9LA 3SKJE 3NRUA 2R7EB 1XPWA 5FUIA 2DDUA 4DXTA 3HNBM 3K4ZA 3MO4A 1W99A 2VZTA 2QQIA 1SG3A 2BZDA 2Y6JA 5EJ1B 4BK4A 4E8DA 5LA1A 2EIEA 3VDAA 1TG7A 1K12A 2VJXA 3NNGA 1JZ8A 4ARXA 1JZ4A 4LQRA 2WAAA 2BBAA 2X05A 5B4NA 1F4HA 2E26A 3GXUA 3OBAA 1JZ3A 1W0NA 3C7OA 3T2QA 1K45A 3DYMA 4A3ZA 4ZY9A 2VZQA 2VR4A 2VZ1A 4GWJA 4A4AA 1NX9A 4TTGA 4MGQA 2YB7A 3HNMA 2YFUA 3WF4A 3FL7A 3LEIA 4XUOA 3I2IA 4BXSV 3GM8A 5JXHA 3VD7A 3WNMA 5DPNA 4JX0A 2WO3A 4AAXA 2J1VA 4W4ZA 3ABZA 2EIDA 3OGSA 1UXZA 3I2KA 4CU6A 3P1IA 2DCJA 2WO1A 5A1AA 2VZVA 1JYWA 2W1UA 3WSOA 2OKXA 4QX3A 2VOTA 4L0PA 2X10A 4QAWA 1UMIA 3MUY1 2VCAA 4E8CA 1NAEA 1UY2A 3LQCA 5JR2A 1SDDB 1GOGA 5DQ0A 1WCQA 2EIBA 2VC9A 2WAOA 3WF0A 2W91A 3JXSA 2QQKA 2ZEZA 1O8SA 5B4XA 2WN3A 4UOJA 3I2JA 5JUVA 1JYXA 1DLCA 3OGRA 3NJXA 4Z2AA 5C71A 2W47A 2YC4A 4QPWA 1OH4A
chains in the Genus database with same CATH superfamily
4P9IA 1EV13 3DPRA 1RXFA 3N9LA 3W58A 3MIEA 3HMYA 4NOTA 4AZZA 3KVAA 5DUXA 5JDBA 3I8TA 1LGBA 3M7AA 5IJRA 3S6PA 5JI9A 3RWKX 3ZFGB 2RDNA 3PNAA 5CFDA 1S0DA 2D5HA 5F8PA 4HVRA 4HXCA 4N53A 5BNNA 1AR83 2R16A 3WQ7A 4DXZA 1MQTA 3IKWA 4QB2A 2VQTA 4UAPA 3MEPA 1HXS2 1OLQA 1GNZA 2YBPA 4V1PA 4BLIA 4EN0A 2YU2A 2Y33A 3VDCA 4AGVA 4EJRA 1W0OA 3CL1A 4TXWA 1LGNA 5LY2A 2J42A 2YMZA 3PIJA 1KDKA 1U5ZA 3DF0A 1KS5A 2HKXA 2KXLA 1YEWA 3ZDVA 4P9JA 1W6QB 4KG0A 1EPZA 5A32B 2W1SA 2E31A 2WZ8A 2H0VA 3KCXA 4M0HA 4FPCA 2HWC3 2WN2A 4DFSA 2ZCWA 3POYA 4AEDA 2DURA 1AYM2 1X8EA 3FZ3A 1JZ5A 3ZVXA 5FPUA 4XDPA 1V6MA 1JOPA 3KS7A 4BH9A 1Q8SA 3I3EA 5CB7A 3OBTA 3I2HA 4EQVA 2WABA 4MSVA 2XUEA 2WNOA 3B01A 4URAA 2XQXA 1W8FA 4XFHA 5C3QA 1JYVA 2C5DA 1VB2A 1V6OA 5CKNA 2GP3A 4YVWA 4CCNA 5EP9A 3WNPA 4E2GA 1H1IA 3LPGA 5I0UA 3U4SA 4DXRA 3KB5A 1UY4A 2W94A 4IXLA 2GMPA 4MGSA 1RMU1 5FZMA 1MZFA 4GJZA 3PIGA 4TSVA 3HN3A 1NXD1 3I2DA 2P17A 5J09A 4FQZA 1TMF2 3SCGA 1RUH1 3KCYA 4NRQA 4Y1UA 3BGAA 1QH7A 1WUVA 3Q9OA 2D93A 4MXVA 3ZN6B 4YGBA 3U14A 1OA3A 2EXHA 4RR3A 3PJYA 4DPNA 2D97A 1NE6A 1WLDA 2ID4A 1GICA 1PHMA 2ZX1A 5T5JA 3VDDC 3LA2A 3A4UA 1ALYA 1SBFA 4WVZA 2Z4FA 3ON7A 1Z78A 3M8LA 4N7IA 4QPIB 1S0JA 3R0RA 4ZS3A 3RYPA 1WMEA 5T55A 4NAMA 3KT4A 3B02A 4LOSA 5D1IA 2WZR2 5LATA 1N3QA 4DNYA 4AHZA 2Y64A 4XFIA 3GHMA 4OHXA 3OPTA 3SISA 1YJKA 1ZRIA 4QM9A 1WGPA 2IXJA 3N9QA 4EWAA 3MPPG 3IAQA 4AVVA 4P14A 4NRPA 4PBOA 1YUDA 1UOBA 1Z7S1 3D8CA 5F3CA 3TEYA 2YROA 4JGZC 1ASJ3 2DBIA 2ZEYA 4UI9L 5FMOS 5C8CA 1ZREA 2V4AA 3KF3A 3WQBA 4ZKTB 3BTXA 5DUVA 3OGVA 5CFDB 5F7UA 2MNGA 1UY3A 4KMQA 5FYIA 3I3BA 1W3XA 2CDOA 1PO23 1QMJA 2GNMA 2ZKNA 3NNLA 1QJX2 2A70A 1WMXA 2P5BA 4GD4A 4ORFA 5LK5A 3JD71 3USUB 1GZCA 2J1AA 4RGGA 3UGGA 4UYBA 4E2QA 5IW0A 4RHV2 4GJYA 2GC3A 1POQA 2GP5A 4Z2WA 3TOJA 4XJ9A 1CONA 4I3PA 3H3UA 3TEXA 1Y9GA 3WHTA 4IV1A 2D6PA 2WLQA 3ILRA 1CAWA 2IXHA 2VNVA 2XPJA 5JSPA 1IKQA 4IE0A 5A3TA 1G9BA 1AXZA 4CP2A 5BPXA 1HQLA 4QHOA 3SH4A 2ZGMA 4QPGA 2D6NA 5CISA 4M0NA 1HV0A 2JIJA 1VPHA 1G9DA 4GMP1 1SZBA 1AR73 3VBHB 3TEWA 3K46A 3GZTB 5A7WB 1R082 4QB1A 5FZ0A 2XL9A 1DYOA 1PVC2 2EAKA 2FCVA 2ZHLA 3E5XA 4XCBA 3TAYA 4A45A 4DY5A 1UPSA 4QKNA 3Q8AA 4IESA 4WM8C 1UIJA 5JOYA 3V0AA 1XE8A 2RMU1 5LWBA 2WSUA 1LEDA 1W6PA 3TRSB 3BUCA 5C9AB 2D5FA 1REFA 2WNUB 1POV1 1YHFA 3N7KA 3LFMA 4TWTA 5CIRA 1ZM1A 4Y1XA 1F31A 3EB7A 3ZXFA 2IXLA 2SBAA 2ZEWA 3C7GA 1YC61 2BVBA 4BCUA 2RS31 3A22A 4CU9A 1YRZA 2D3RA 2A3YA 2VZOA 5G04L 2A5ZA 3WINE 1M06G 2C1FA 1KEXA 1WA6X 2LROA 4LBMA 2DUOA 2FDFA 2WL1A 4LKEA 3AYDA 1PGSA 1V00A 2J1UA 2VW1A 2BERA 2K0GA 2VZSA 1C28A 3M3IA 4NPMA 2EA7A 2PHWA 1YJLA 2E32A 3AMNA 5AFBA 5FYVA 2RR11 4KWLA 4CPBA 1Q43A 4Q4V3 4WM7B 4MADA 4AG4A 1E5HA 1J3QA 4E4ZA 4ATEA 1C8M1 5FTTC 4AHWA 4FQ4A 3GJAA 2WT0A 1V70A 4BDVB 1GNHA 2NM1A 4CYDA 3OD4A 4FPLA 2WIIB 2Y6KA 4CUBA 5K8SA 4NHMA 4XVHA 3NJZA 1HRV2 1RUG1 2XWJB 4PDWC 2NZ9A 4HFSA 3AZZA 4M4PA 3AL5A 1SHWB 4ARYA 1D4M2 1AYN2 1Q3EA 3ZFEA 1K42A 2OQ7A 3I4IA 1X8MA 1MZ5A 4AGGA 2R0HA 3PVNA 1R1A3 3D3AA 5EV7A 4KWUA 3J8F2 3THDA 1CN1A 3FX3A 3AKTA 3PTRB 5T5PA 4ZU5A 2GN7A 1UN1A 2JG8B 2WRAA 4CEYA 5TSWA 2RJ2A 3HPNA 2K2SA 4TLGA 3CJIC 5H9QA 3O1VA 1O91A 5IK8A 2ZMNA 2CV6A 1UZ0A 3HAGA 3K2OA 5F39A 4QX8A 5HI0A 1SLLA 3S0MA 1TQ5A 4MZUA 3OG2A 5IVJA 1WCDJ 3TB0A 3RPQA 2AENA 2QFEA 4D6RA 5C6CA 1A8MA 2B4KA 3E6CC 1PMJX 1W9YA 1OVPA 4Y26A 4HN0A 4Y22B 3I7DA 4FPJA 4YW3A 5BUVA 4XHXA 3H8RA 1W2AX 2BBVA 1QIQA 3EXUA 3B9IA 2VBPA 1WBLA 1QY4A 3I3DA 2FD8A 2ORZA 1QJY1 1AR93 3SEEA 2PELA 3O5SA 5LRRA 1RUD1 4I0AA 3VDBA 1DGLA 2P3YA 3VKNA 4GB33 1EV12 4M3CB 2XLAA 4GWNA 2PHRA 2A71A 1XU1A 3OSDA 1PX4A 5FZAA 4QDRA 1RUI3 4L92A 3POWA 3K48A 5L7OC 3ZN4A 3J7NA 1BEV1 3B94A 1RJ8A 4QPGB 2AEZA 2EICA 2WJSA 4Q0UA 5IT6A 1DQ5A 4IV3A 1AR82 3W9AA 3CIHA 1LOCA 2O14A 2Y6LA 1S0IA 2HLEA 2PQQA 3ME2A 4IDZA 4OUMA 3RYRA 4E4HA 1TME3 1GMMA 3QD6A 4AEJA 5IATA 3O14A 2VMFA 1US2A 2PLV1 4OMDA 2VU9A 3AYCA 4OLLA 3V0AB 1PO13 2V5YA 2BDRA 3Q8FA 4UFKA 3SCFA 1W8TA 5KHIA 1EAH3 3CMGA 2R071 4FT8A 2VCBA 5CFCA 1J1LA 1GP5A 1UKRA 3K3OA 3AC0A 1A6CA 1O4TA 1VBB1 4IEPA 1VLNA 4LKFA 5FFOC 2WT1A 2QQWA 2RS53 2YBSA 1W9TA 5A70A 3IT8A 1AL21 1QJU3 1Q8PA 2HWC2 5A3MA 4M00A 4QXKA 3LA7A 1Q56A 3GYDA 2MEV1 5KC5A 1UYXA 2LRPA 4O7XA 1CX4A 3JBG3 4HOOA 2HWF3 4YZ3A 4PCRA 5IVVA 3MIDA 4XQ4A 5CA6A 5ABJC 3T2OA 3UKNA 3N7LA 1O3QA 2GDFA 4RFT0 3E6DA 2ARCA 1V6IA 1PZ7A 2CGNA 2RJKA 2CTVA 1RUF1 4FOVA 4H2AA 1VB4A 2DU0A 2VGDA 3ORJA 3CF6E 5IUQA 4YM1A 3UV9A 5JZGA 4JKMA 1ZNPA 3U1XA 3NJYA 1FOD3 3MW4A 4Q27A 3VD3A 4MH0E 2VBDA 4JGYB 2WQ8A 3VBUB 1HQWA 3AP9A 3PL0A 4A7ZA 3TNQA 4I2OA 2Q30A 2EXKA 2WLPA 1X36A 2WQZC 2RE9A 5J37A 2C24A 3TN93 5FZEA 2BJSA 4C0BA 5F6KA 4HANA 1DYKA 5C4WA 1JH5A 4LPLA 2I07B 3WDYA 1VBE1 2XDVA 1JU3A 3IB3A 1AX2A 1CAVB 1O5UA 1K5JA 5FY7A 1HB4A 5IK7A 3OYWB 1IPJA 1ND3B 1OFNA 3IDBB 5JXGA 4LBOA 4UW3A 2JD4A 1HJGA 1JZ8A 3N9NA 4Q4Y3 2XL7A 2ZGOA 3J4UH 1UIKA 4I0BA 4BPZA 3ZIWA 5FP8A 5HCAA 3AVRA 2VQ0A 3JB4C 1BVVA 2GAUA 5C8WA 5IFPA 1HQNA 2RS13 3MIBA 5DZEA 2EXIA 1X9TA 3C3VA 4JKLA 3ZDSA 4M3CF 1W8HA 3LOIA 5A7SA 4TYSA 2YPDA 2A6WA 4OMCA 4YGCA 3NAPC 5BNOA 1I5ZA 3ZYIB 1O4ZA 1GQPA 2P3JA 3WNNA 3QH6A 3MV01 3L9JT 5LA2A 3U78A 3S5QA 3S57A 3LFIA 4LBQD 1AVBA 1NKGA 4CDUA 3RZMA 3DN7A 1D2SA 3WF3A 1PNFA 1ASJ2 2I45A 2XKOA 3VBFA 2D6KA 2L9LA 1MS3A 4XF0A 1NCQA 3WZ1A 3NRUA 2R7EB 4QKFA 4NIAA 1OOPC 2DDUA 1YFUA 3ELNA 5LB6A 4DXTA 5CADA 3RMYA 2AGSA 1H8TC 1PO22 3NV4A 1FMD1 1H1MA 1SG3A 5EXOA 5L9BA 1KDMA 3VDAA 3AZWA 1TG7A 4XBLA 5E6HA 5J96B 4YM0A 3WX5A 2VJXA 4W6XA 2Q4SA 4NHKA 4OULA 3ZSEA 4F83A 1ONAA 3ILFA 5FP3A 3ZO0B 4D6QA 2RM23 3BOPA 4COZA 1SLAA 5B4NA 1F4HA 2EIGA 2E26A 1OA2A 1JZ3A 5AC93 1W0NA 2R063 4ZU4A 4J1XA 3W21A 5F5QA 3U11A 5C3RA 3DYMA 4AFDA 4ZY9A 4FPOB 4H7LA 1RUNA 5AFEA 1OC1A 4AI8A 4KNCA 5FOBB 1NX9A 1AR72 4MGQA 3APBA 2YB7A 3POJA 2CGPA 1OVSA 4FPHA 3I2IA 3POSA 2BTVC 1PIV1 1OXCA 3DGTA 1RXGA 3GM8A 3ZPOA 2F4PA 2JE9A 4IGPA 4FTBA 1Q5OA 2V09A 3WNMA 1RUE3 1T6GC 3NV3A 3WY6A 5JZGB 3V0BA 1CR7A 5L36A 4AOCA 4DIQA 4AAXA 3JU9A 3AMHA 3NMBA 2B8MA 5FP4A 1HB3A 2BW8A 2D43A 2XB6C 2ES3A 3VHRA 3ZSLA 1H9WA 4H3WA 5FZOA 4Z82A 2ZTNA 4XQWA 3RZLA 4R52A 3P1IA 1NCRC 2WO1A 1F8VA 4QU1A 5A1AA 1Y7BA 3OUJA 1CAXA 1J3RA 1QQP3 2VZVA 3I59B 3VN4A 3WSOA 4GWMA 4H55A 4Q4V2 1WMDA 3LSEA 3U07A 4S2GA 2E7TA 4L0PA 2C0ZA 3H1MA 4KWJA 4CCDA 3MICA 4XTMA 3DKQA 2D3SA 4QAWA 2WWUA 2PYTA 2EAAA 1NAEA 3WLUA 5JR2A 2ZGSA 5GJ6A 2UWAA 1W6NA 1VIWB 2Y38A 2EIBA 3OJBA 3PUSA 4ISQA 4R9BA 3WF0A 4CEWA 1WA4A 4E4DX 2WNVA 2QQKA 3P3PA 1PGL1 4BE3A 5BNPB 4CCCA 5C5TA 4K8RB 5FZ8A 3NVCA 1AR61 4FCAA 3JQWA 5DDJ1 1OPMA 4B7EA 2ENRA 3M3QA 2VVEA 4YWAA 2ERFA 2XWBB 4BHPA 1R1A2 4JTOA 3NJXA 4N9HA 4YFWA 1TNRA 4HONA 3JB8A 3ZKYA 4DO0A 4BM8A 1V9U1 4HKLA 4JQTA 5JMCA 3I97A 2Q0AA 5BNOB 4QQHA 3IMNA 2ZGTA 1GNYA 3M70A 3ROUA 1XNAA 3O0XA 4Y20A 1A78A 1W3VA 2OUJA 2R32A 4XPVA 3VBOA 3VBRC 2X5IB 3E97A 4CDUB 3I2OA 1DQ0A 3O12A 5FZIA 1N1SA 5FUPA 4CDXA 1NCQB 4LR4A 2WDBA 5IVEA 5F5CA 2QQNA 4OI1A 2R30A 4G9SB 3AM2A 1NZIA 3KV9A 1ULEA 1VBA1 5FREA 4NIIA 4ZZ5A 4KU8A 2XJQA 3ZX7A 4OHWA 3MF6A 2BWAA 3OTFA 3UT0A 4WVMB 4XJAA 1AR92 2VVDA 4NJ4A 3UKVA 1CD3G 2TNFA 4RQPC 3ZM8A 1LULA 4GB32 4AAPA 4LBQB 3WG2A 4AI9A 4LORA 2B9UA 4XFCA 1JMUB 2VNGA 3GZUC 4I01A 1RUI2 2QZ3A 2GMEA 3M1HA 4IE6A 2RVAA 4DUXA 3AP6A 3VUOA 3AX4A 3B7MA 4AW7A 3GJBA 3WVJA 2AREA 2RDQA 4LIUA 2VUAA 2WNEA 1L7LA 1RTVA 1XJAA 3B00A 3GF6A 1UY0A 2Q1MA 4BMEA 4MGKE 1TME2 3FHAA 2A3WA 3FHQA 1ULGA 2D7FA 4UWDA 5A3OA 3GBFA 5A6ZA 1PO12 1ULDA 2E53A 2JD9A 3LGRA 4LXLA 3WUCA 5K7PA 4A7KA 1EAH2 1IKPA 2W0XA 4ZS2A 4CDQA 4JCKA 1S0BA 3V0BB 5FZ7A 3H3ZA 5D8AA 4YNIA 1RYYA 2RS52 4HVOA 4AQ6A 3LE0A 2ZS6B 1O59A 1OUSA 3AKSA 3CLPA 4XF1A 3VD9A 2D44A 3PVEA 1GOHA 5K0UA 1WKYA 1YXWA 2R0FA 4LJHA 1GUIA 1W8NA 3V56A 4Y4RA 3ECQA 5JIAA 1RMU3 2W87A 1RUJ1 4NN0A 5EHDA 3FWEA 3JBG2 1SLCA 2JDUA 4XUQA 2HWF2 1BCXA 2B5HA 2YFZA 4RS5C 3N9MA 2OYZA 3T3YA 1V6KA 4NIHA 2VY0A 5DABA 4Q0PA 1LOAA 4Q4X2 3EJKA 4JZRA 5CYYA 3TNPB 1A34A 1HW5A 3H9AA 3SLIA 4QDQA 1DQ1A 2A6YA 2BEOA 3T08A 1DQ4A 3VKLA 3WW3A 4XF9A 3MW3A 4CP1A 2E7QA 1FOD2 4UFMA 4YVSC 1VBD1 4HSJA 4N43B 1FPN3 2W92A 4D6SA 3EO6A 5JXIA 2JDHA 1APNA 1GQGA 3EQEA 5EFUA 4RGKA 4AQ2A 2B45X 1AYM1 4S2HA 3TN92 3ZPYA 4AF9A 4AEMA 3AK0A 5F3GA 4K40A 1ZZBA 2JWPA 4LEJA 5DAPA 3IPVB 3UGFA 1O6UA 4IQPA 3UETA 3VBSB 5BNQA 4LTAA 2A1XA 1NA1B 5A3PA 1HRI1 1SFPA 3WF1A 4CRQA 4V2WA 3OBRA 3WD5A 5LW9A 4GKYA 1P8JA 4Q4Y2 2VG9A 5CKQA 5FBJA 5FYTA 1XE0A 2PHTA 3VBOB 3U75A 3AB0A 1Z7S3 1I5PA 2W68A 2WZEA 1CPMA 3O0WA 3PVOA 1KD7A 5GKAC 2RS12 1OD3A 3EYPA 4UBHA 5I0TA 4A41A 5J48A 1QOSA 4JRLA 3SQOA 5J7MA 1DP0A 4PLOA 4V2VA 4JAAA 4Q5OA 3PDQA 4YSFA 4YG3A 4HLTA 5GM0A 2FDIA 4NE9A 2ZAHA 4QX1A 3A0NA 3KZ4C 1JN2P 2O8QA 3OPWA 3DXTA 4XF3A 4K1YA 4C8DA 5CKMA 3ZFGC 3FLPA 4J1WA 3POFA 2ARBA 5FO7B 3RZGA 5JR7B 5JOWA 3POGA 2PHXA 3RQ0A 3CQOA 4LKSA 3VDDA 4QKBA 1DU3D 2P4EA 4CCJA 2QVSB 1UXXX 4XYXA 2ETEA 4P9LA 1F9KA 2UY9A 2XVGA 4GMP3 1OBNA 3GCWA 4PQQA 2G4IA 2JDAA 5JSOA 1B35B 4R8HA 1UZWA 3OY8B 2VUDA 5L9RA 2ZX4A 2Y0OA 2RM22 2VW0A 4P00B 3VHPA 3SCHA 1ENSA 3A21A 4META 4CDQB 3LDRA 4DQAA 4Q8KA 5D8AB 3UNPA 2RMU3 5AC92 5ACA1 3FE5A 2HWE3 2R062 2XUMA 4GH4A 3IIAA 1POV3 3GBGA 1TE1B 4XFAA 2V72A 5K0UB 1W0PA 3FLRA 2VXJA 2VOVA 5T50A 2Q8OA 4FFIA 2NMNA 4JGZA 1VMFA 1OH3A 2RS33 2ZXQA 1DCSA 4RD7A 3KHBA 4XOGA 2VZ3A 5CBLA 5DAWA 1CIWA 1Q8QA 1X9PA 5FMBA 1VJ2A 5A7NA 5KHHA 5H9RA 2ZHNA 5I0DA 3SXWA 1RUE2 1QJZA 5I93A 3RMXA 5LZ6A 3CEWA 2RR13 5FOJB 2RJLA 2B9VA 4CDWA 4NO4A 5SV8A 4ZZ8A 4FTSA 3ZYBA 2ZACA 3HQUA 1GFF2 5A7QA 1S0GA 3HN1A 5GLTA 3ZFFB 2W08A 3C8XA 4MHRA 3M4FA 3FMGA 3IBMA 4HT1T 4YLZA 4HBNA 3MIFA 4FOWA 3RSJA 4LO5B 1RUG3 1QQP2 4BQYA 4RYDA 3BKZA 1C8NA 5EIYB 2IFRA 4PIZA 1XC6A 2PTMA 1LKNA 1SDWA 2VMDA 1LRHA 1TNFA 1JI6A 1XRUA 4W65A 3IIIA 2RDSA 4AVCA 3BN6A 4U36A 5EZWA 1YYNA 2LALA 2WC2A 5T5OA 3AXEA 1U5XA 2WO2A 3WV6A 1W8ZA 4QX0A 3JQXA 4ASKA 4QPIC 2PAMA 3T2TA 3PUHA 1ZZCA 3H0OA 2VQAA 3MLKA 3CDZB 4OZXA 4PIYA 5I0SA 4Q0QA 1L7QA 3POEA 4K21A 2W3JA 3BPZA 4P5YA 3ZXEA 5DAQA 4YARA 4INDA 5EQUA 4D69A 3LAGA 2D3PA 1OPOA 4UFIA 2WT2A 2N7GA 3LSDA 2IXCA 4PLMA 4Y5Z0 4XTPA 5ANQA 3RVHA 1YCIA 3QLQA 2J1RA 4A42A 2H6CA 2VO5A 5JWPA 3Q8EA 4FAHA 1ULCA 3O1UA 3EBRA 3WR0A 3WP3A 5ERLA 4EN7B 1RUD3 1VMHA 4NIGA 1GU3A 1SEFA 3PJQA 3O0VA 4R9CA 4DZGA 5CFDC 5LCWL 3DPRB 4N8MA 1HRV1 1NOVA 3DEMA 1XNKA 4LBKA 4P08A 4Q2FA 2I74A 5CZKA 1W9WA 2DCZA 1D4M1 4LHNA 4LO7A 1E5IA 2XQRA 1WD4A 5L73A 2BGPA 4HZFA 5JAXA 2WA3A 3ZXAC 1BLZA 1NLRA 3BVCA 1YQCA 2JX9A 1COV3 2ZKLA 4N53B 4PDWA 3J8F1 5BNNB 1GWLA 1MQTB 4GALA 5FK7A 2JECA 3INAA 1B09A 2Q8DA 1MR5A 2KM2A 3FBYA 5FPLA 1IGOA 2PLV3 1HV1A 4PHZA 4XABA 3WNOA 1OLME 1O7FA 1VRH1 3ZR5A 4EYUA 1JBCA 5KR7A 3RDIA 4Z92B 3IMMA 3PHMA 3CZUA 4FFFA 3BALA 1UYZA 5C7GA 2ZGRA 4K8FA 4GH4B 1BQPA 4CUAA 5AVAA 2MHFA 1VBB3 2E7AA 2VMGA 3H42B 4JTNA 1IG3A 2NMOA 4NMIA 4FO9A 3RGBA 3VBHC 3ZN5A 1JHNA 1I1EA 4MOAA 4R4ZA 2PMWB 4BQ1A 1UW8A 2XHNA 5LRSA 3ES4A 4NWWA 4XJZA 2DTYA 5F5IA 1W90A 2GC0A 4AEDB 4COWA 2JG9C 2DV9A 3UL2A 2DCYA 2AH2A 4BJ0A 1HLCA 1ULOA 5C9AC 2WNUC 2Z79A 3NSTA 3ZKUA 2XH6A 1AXYA 1REEA 5F3EA 5JI7A 2D6OX 4AEKA 3IN9A 4CPBD 2Q1FA 1ULPA 1RUF3 4FXGB 4HL0A 4CDWB 3KM5A 3WHUA 4YVWB 2FDKA 4EZHA 2G9GA 2GNDA 1U5YA 2W1WA 3THTA 3VZMA 2UURA 1RMU2 5AVPA 3AZVA 1C57A 3EMRA 3T2PA 2XOMA 5L7OA 4JHZA 5IVBA 4WM7C 4GULA 1FV2A 2JDZA 4L11A 2IUWA 1C1FA 2YZ4A 3H8UA 4BK5A 1XU2A 4NVPA 2ZABA 2ZOEB 2AZ5A 2P1BA 4NRMA 3J7HA 3MW2A 1FATA 4DY3A 1VBE3 1YQ2A 3D5OA 1CZTA 1K3IA 4K7JA 4NR1A 4RR3B 3VZKA 4B1LA 1FPN2 3DL3A 4OQ9A 1E5SA 2HBUA 2G9ZA 4X6RB 1UMZA 4LE4A 4KL1A 3MLLA 1YNAA 2IVIB 3N7MA 5JSRA 1MS8A 1OQ1A 2ZMKA 4Y1ZA 3LPFA 4D7YA 1NZCA 2GNBA 3LEKA 1D4VB 1UO9A 4Q1RA 4Q4W1 5FZFA 1GLHA 2JG8C 4X6QB 1LENA 2J7MA 4FP2A 4FOYA 2K46A 3A0KA 5FZ6A 3BU7A 2P37A 2ZGKA 3CZJA 3HT1A 1JYIA 1W28A 1KFXL 2UYBA 1BKZA 1YI9A 2LUWA 3VKOA 4C91A 4QB6A 1K5MA 3N35A 3V65A 5ABJA 5FY8A 5FJKA 4XW3A 2VUJA 4OVEA 1XPWA 1KRIA 3IDCB 1W2OA 4XBQA 5F2WA 3HNBM 3MO4A 1Q8OA 1Z7S2 5A33A 5C8CB 5CNAA 2Y6JA 4BK4A 2CNAA 2LM3A 1Y3TA 1IOAA 5D21A 4NUBA 4UXAA 4QMAA 4J6GA 4ZPIA 3AJZA 2ARAA 1CVNA 1JZ4A 2WAAA 3KV6A 4EROA 1FMD3 3VKMA 4ASLA 1WCUA 1N47A 1E5RA 1EPWA 3OBAA 1SMVA 4Q0VA 2FMYA 4K1ZA 1G7YA 4QQLA 4AYUA 4JDOA 1DLLA 3RZHA 4QD2A 2D6MA 3N7JA 4LLFA 3C7OA 3T2QA 1K45A 3OGJA 2VR4A 3B93A 5DUUA 1ZYBA 5C3SA 4QPGC 2HEYF 4GWJA 1F5FA 4IV1B 5B2GB 3USSA 2AUYA 1CAWB 2VAUA 2YFUA 2WA4A 3QBQA 4CCMA 1N3OA 4QXCA 2HWB1 5FR3A 3H1YA 1MZEA 4MVTA 3AP7A 4Y5TA 4KWKA 2R49A 4Y1VA 5J36A 4YGDA 4IEZA 5FK8A 3LD8A 3AFKA 1H8VA 1OFSA 2OZJA 2WS93 1FYUA 1OQDA 1H0BA 3FFQA 3UGHA 3OUIA 5FXVA 2RMU2 1LOFC 1W6PB 4BWOA 2B42B 3NAPA 2HWE2 3NW4A 4LOTA 1JOBA 3O7OA 4XMAA 1UXZA 3I2KA 1ODNA 4CU6A 2UYAA 3RZJA 2DCJA 4E9KA 1G9CA 4UW6A 4UT5A 3FFZA 3QACA 5FZCA 2UWCA 2W1UA 1PO21 2RS32 2DVAA 4Y33A 3SITA 3LOBA 5FKBA 5L7OB 5DAXA 1AJKA 4QX3A 2VOTA 2FDHA 5FLHA 1LCLA 5FZGA 1S2BA 2X10A 2GU9A 1GWMA 1ZBE1 4A6SA 5FPAA 1RB8G 1H8TA 3ACLA 3KCCA 4YZ1A 2RR12 1SDDB 4JGYC 1GOGA 3QH7A 5DQ0A 5I8TA 3VBUC 3BU0A 3JXSA 1BMV2 2CWMA 1DQ2A 1NQDA 4GIQA 5B4XA 4UOJA 4BQ2A 4ZONA 3ATGA 3H50A 4HKOA 4XIKA 1MEC1 4AI0A 4PIXA 5JUVA 1JYXA 2YUEA 5FLIA 1W05A 5C33A 1H30A 1DZQA 3E5UA 4AVAA 1TZOA 4Z2AA 1RUG2 5EJ3A 5C71A 4DRVA 2R1DA 2YC4A 1Z0HA 3NNFA 4NHYA 1KITA 1OH4A 3HR9A 4QPWA 1AR63 2JE7A 2YDEA 4N9IA 3ZFEB 4RSUA 2DWRA 2VTFA 4CU7A 1GZTA 1WCKA 2A6ZA 3WF2A 1PNGA 1ND3C 4EZ4A 2WBKA 3PMSA 2IC1A 1K5MB 4P9WA 4CEYB 1CAUA 2BNNA 5KHKA 1MZ6A 1BBT3 1KXGA 1XSQA 1RHI1 1OT5A 1JZ6A 4AI2A 1W9FA 2HWD3 2P3IA 3OBZA 3R4DB 3TBDA 1CX1A 2IXKA 5E88A 2HEVF 1CQ9A 1GZWA 4OI4A 2Y6FA 2AR6A 4LHSA 1VAKA 1G9FA 1NE4A 5CG8A 3PUQA 5FYMA 4MXWA 1J58A 1IS5A 1RUC1 1VBA3 2W5FA 2YC2A 1LTEA 3PU3A 4BIOA 1NCRA 2C6SA 1D2QA 5J98B 4AGRA 4DEVA 1NXMA 2E51A 3BYWA 1UD1A 1PK6C 4KI5M 4FPEA 1KFUL 1RUD2 1QH6A 4MV2A 3OPZA 3DYOA 1C5IA 5FXXA 3C7EA 5CVRA 1IS6A 2VMIA 4C1XA 3RI9A 2QDRA 2Y26A 1UY1A 1ACCA 3IDAA 3I2GA 2WYFA 1IPKA 3T09A 2A6XA 2V4VA 1GWKA 2A7AA 2QQMA 5IVCA 4CXYA 1R1A1 3AVSA 3UESA 1COV2 1QF3A 4PQ9A 1H6XA 2WFF3 4IV3B 1YO8A 2W39A 4QPYA 1NYWA 5FLJA 3WP4A 4HVQA 1O3SA 3FUOA 2PLV2 5GZFA 4N90A 2YGLA 3UYJA 2X09A 4L9BA 3G7DA 3SMHA 3BIEA 3LDBA 4YZ5A 1I9RA 3DCQA 4OQ8A 1W6OA 5CFCB 3NAPB 1V0AA 3WOGA 2P34A 3H7YA 3OOXA 1VBB2 3AYEA 4BYYA 1Y9MA 2ZX3A 2VMCA 2VVFA 3K51A 2XJTA 3HWJA 1NY72 1PGW1 3TWIA 3VBRA 3O1OA 5FIXA 4YZ2A 1DIWA 3LKJA 1ZA4A 1VBC1 2AC1A 2VM9A 3WNXA 4CUCA 2VPVA 1F5JA 3AL6A 1RUJ3 1XNTA 4QHZA 5FMDA 2XXZA 3ST7A 2R041 2H0BA 2OIIA 3FBMA 1LAJA 1HN1A 4XFBA 1LHWA 1H2KA 2ORXA 4BMBA 1JUIA 1RUF2 4YM3A 5GLVA 3ITQA 4RQPA 1RUI1 4Z8BA 5FPVA 1DGWX 1VBD3 3ZMOA 2V73A 3BPSA 4ITCA 1RVF1 2XKPA 3ZYHA 1TEIA 1XYNA 3ACGA 3AP4A 3LZZA 2AACA 1WWYA 2QQLA 1HB1A 1GOFA 4AWDA 4MG2A 3E1F1 2FCTA 2C26A 1KJLA 1TME1 3WQ1A 5C5UA 2B46X 3ZSKA 4LUMA 1X82A 1UAIA 5FV3A 4XUTA 5C4WB 5E1RA 4FOQA 4IERA 4XEZA 3WP5A 3MFAA 1VBE2 2XBO1 1J3PA 1HRI3 1BYHA 3VD5A 2RS51 4IEWA 2P6CA 1BHGA 5DN2A 4MYEA 1UNBA 3NO8A 4LIVA 4RL7A 5BNPC 1OURA 4IUGA 3VZLA 1DYPA 1GV9A 4IEOA 3HQXA 2DYCA 2VZPA 1RC6A 2TUNA 1UOJA 3J7MA 4UW5A 3J9SA 2QQUA 1EUTA 2XJPA 3VD4A 1ENXA 3JBG1 5LEJA 4PLNA 4MO3M 1IZ3A 5LA9A 2W52A 3RFRA 2A75A 3NV1A 1XYOA 5K4LA 4AK3A 2X29A 3IZOA 1LHOA 2X8KA 2A73B 4P9YA 4Q4X1 4XJ8A 3S5AA 4P9GA 3W5NA 4RS5A 3IM0A 4CDUC 3M2MA 1GYKA 2X5IC 2ATFA 4BQWA 1R091 2QQVA 4AQTA 4BQ5A 5T3NA 5F6LB 4XE9A 2ZAAA 3ACIA 4YVSA 4QX2A 3IAPA 1LEMA 2HYKA 2ZGQA 4EN8B 3VBFB 2NP0A 2XG3A 5IVYA 5F2SA 3SC7X 4WZFA 2Z2SB 3AJYA 2RV9A 1UU5A 5E89A 1IQAA 4L99A 4OYUA 1ZZ8A 3SEPA 5FQ0A 1W8OA 1BK0A 4XZUG 1FMD2 4Y24A 5CEHA 4C0HA 2YG0A 4AFAA 4DRRA 4PBPA 1VP6A 5FPXA 3BOWA 2VULA 1F2NA 2SLIA 3ACFA 4D8MA 2VZRA 2CDPA 1LOEA 1JZ7A 3KVBA 2UU8A 4MX3A 4TN7A 5FZ4A 5F37A 4DUVA 2ZHKA 1LJ7A 1MPXA 1RUOA 2VQUA 2ZMLA 5ACA3 2RS11 1R64A 5EPAA 1JYNA 3WNKA 1SBEA 2WUHA 3VBRB 1REDA 5DG2A 5HCHA 5FY1A 2FDJA 1ZBA1 4UF0A 5JPMB 3NQHA 4FPGA 2W1QA 4RN5A 2PQSA 4JC1A 1N1TA 4BA6A 2WS92 3WW1A 4OHYA 1QOOA 1MVEA 4OZOA 1LHVA 1W04A 2ET7A 5GLUA 2BOIA 5JMOA 4B7KA 5A6QA 1U12A 3H1WA 4CCEA 2QCSB 3OUHA 3R4UA 4LA2A 1UWWA 4XJWA 4RA0A 3JUUA 1QDCA 2VL4A 2QUOA 5JXJA 2DCKA 4UFLA 1DHKB 1QJU2 4Y4YA 3WXPA 3ZFGA 1VE0A 2ZHMA 1CIYA 5FZOB 2XJSA 3SKVA 1LODA 1FT9A 4XZPA 5J3UA 2VOXA 2JKXA 3N36A 4I0WB 5LASA 2ARXA 2Y6GA 4EN6B 1HXS1 1CAXB 1ZRCA 3MLJA 3BIWE 1ND2C 5DXDA 2ZA9A 2RM21 1RUH3 4N43C 3OEBA 1LESA 1XQNA 1J83A 1UYPA 2GALA 2ZGUA 3RNSA 2W46A 3R4SA 1XNCA 1MACA 5DUWA 5EWSA 3UKTA 4UW4A 2R061 4XETA 5LBCA 2BFUL 3OCPA 5FXZA 4QQPA 5LBFA 3IWZA 4AL9A 1W6QA 1ENRA 5F3IA 4OHVA 5A80A 3AKPA 3WW4A 1W6NB 4TLFA 1JTZX 2CAUA 2WYSA 4XDQA 5KXEA 3KQ4B 3FUQA 2J1TA 4CEWB 4LMFA 3BTZA 1AX0A 2WNVB 4SBVA 1TVGA 1PGL2 1RITA 4JQRA 1JZ2A 2OA2A 3VBSC 1KS4A 1NA1C 1ST8A 1AR62 4K9SA 1T6BX 2FCUA 2EXJA 1KJRA 2ZGPA 4OFGA 1SBDA 2D40A 4MGTA 2QQJA 2PHDA 2KA3A 1RUE1 1W39A 4M3CE 5C70A 3K3NA 4KG8A 3C7HA 4HKWA 5JIUA 4GKXA 1AF9A 3VBOC 2BGOA 2XMLA 1S2EA 5IAVA 1BBT2 2XGXA 3HEIA 2VBBA 2HWD2 4IEVA 4LO6B 4D7SA 4Q26A 5FYUA 1UYYA 4I09A 1SCSA 2JXAA 3BODA 1EY2A 4Y20B 1OMIA 3ES1A 4HPKA 3GZAA 5D2AA 4YVSB 3BI3A 2JDPA 4K3UA 2IFWA 2PHUA 1G6NA 2DVDA 2JE8A 4AI1A 4CDXB 1YWKA 2F17A 4FVVA 1LU2A 1QQP1 1OD5A 3WDWA 1TMF1 5IHRA 2EALA 2HEWF 1VBA2 1S1AA 5FCCA 4E2SA 3AXDA 3KWVA 1AXKA 1W6MA 3PURA 1X33A 2D98A 4LHKA 3RYKA 3J8F3 1J84A 3DYPA 1E57A 2WFPA 5KXCA 4YW6A 4CU8A 3JD73 4FFHA 2FMDA 5GALA 4QGMA 4Q8LA 1BJQA 3PUAA 2E63A 3MUZ1 4LULA 2VECA 3O1RA 1VRH3 2XJRA 1O3RA 2FQPA 2V5DA 3ZLIA 5FYYA 5F1RA 3GHNA 4LLOA 2VMHA 5A3WA 1OF3A 1V6NA 1XNDA 3B9CA 4MLOA 4QPIA 1DFQA 5GLWA 4U2AA 3MFCA 1W2TA 1B35C 4QM8A 2WFF2 2WZR1 3NV2A 1LECA 3Q8CA 3MHZA 4Q1PA 4Y5SA 3T0BA 1EYBA 1UF2C 1BZWA 1V6LA 5FMOL 4YYOA 4CDQC 4CCKA 2WSVA 1LHUA 5FP7A 3DV8A 2BPA2 3HNYM 1EUUA 4YRDA 3FJSA 3CO2A 3O1TA 4I30A 1PZ8A 2ZZJA 3POBA 1JODA 2HJIA 4MGIE 1W8WA 3VL9A 5FZBA 3VLBB 3H8XA 5SV5A 1G8WA 1VR3A 5DAVA 4QX5A 3U0ZA 3PUIA 3K4DA 1NUKA 4GZ9A 1RUJ2 3U37A 3NKGA 1FNZA 4QWNA 5FAXA 1QJX1 3USUA 5H9SA 3ZIXA 5M0TA 2DFBA 1QNWA 1FAYA 4RHV1 5IK4A 3ZMNA 1QXPA 1GBGA 3GDBA 4IE7A 2QDNA 2BYVE 4ZXEA 5JOZA 3ZXGA 4QT6A 2Q1ZB 4ES9A 1WMFA 4AXOA 2VE1A 3ZFFC 3N4MA 2ZJCA 4O9GA 1WW6A 5FYBA 2FBEA 1VBD2 2XJUA 2ZZQA 3TYJA 4KGQA 2A6VA 1C8M3 1T2XA 4A3XA 5L9VA 1AJOA 1CJDA 2BVVA 1SLTA 4BU2A 1O8PA 3AMPA 1IQDC 3VBHA 4COUA 5EYXA 5A7WA 1XE7A 1R081 3WW2A 3MYXA 2BFUS 1PVC1 4L8QA 4EN9B 1H4HA 5L19A 4Q4W3 3SHRA 5CAZA 4ZU7A 3J26N 1SLIA 1W8UA 2JG9A 2VUCA 3RJ2X 2JEMA 1HRI2 5FUIA 1ZX5A 5C9AA 3K4ZA 2WNUA 4FFGA 2JKBA 4G3YC 2QQIA 4RGAA 4RFRB 4WM8A 4CCLA 4BQ4A 2BZDA 4E8DA 5LA1A 3EHKA 1Y4WA 4HPKB 5FPZA 4LO4B 5LY1A 1OA4A 1ULFA 3HBKA 5DZGA 4C90A 5ANNA 4ARXA 1UL9A 2YBKA 4ISRA 1G86A 2YV8A 2BV4A 3OD0A 5HV0A 1DQ6A 4LQRA 5F9TA 1S55A 5FKCA 5E8AA 2X05A 5BY5A 4QHBA 4Z1VA 2JB4A 4QX7A 4OHZA 4B8EA 3CU7A 1D0GA 2IZWA 1J1TA 2X53S 1W6MB 3NL1A 3V64A 3S7EA 4WM7A 4A3ZA 2VZQA 1PM7A 3HT2A 3B69A 3DPRC 1FPN1 2Q8CA 3U4XA 3TEZA 1QJY3 3HNMA 2DFCA 3WF4A 4K20A 4O61A 4IETA 3LEIA 4ONUA 4CCOA 1VAMA 4QQ2A 3S7IA 2DTWA 2GC1A 3NNJA 4BXSV 2P2KA 1GSLA 1C4RA 1HB2A 4AVSA 5JLVA 3M3CA 3VD7A 2WO7A 3HD8B 1MS1A 4N53C 2VTXJ 5BNNC 2FDGA 1DGWA 1MQTC 1U0AA 1AYN1 3VDDB 4JX0A 1WW5A 2WO3A 5FRAA 2J1VA 4GA9A 2HWB3 1BEV3 3BTAA 3WDXA 4Y3OA 3WG1A 3WDTA 4W4ZA 3ABZA 1ENQA 1ZZ9A 4OCTA 4FXKB 3LF7A 4KGGA 4WVWA 3AKQA 2JG8A 2EIDA 1QOTA 1LOBA 3N9PA 5JVVA 1SPPA 4GH4C 3AYAA 1UQXA 3ENRA 5FZ9A 3KQRA 2QKDA 4EV0A 1ZVFA 2R073 3ZXLA 5ACA2 5IWFA 5H9PA 2YC0A 2YXSA 5KXDA 3L2YA 3QOPA 3CJIA 3X29B 4AEDC 1YFXA 5E16A 3RS6A 1XB9A 4JV4A 3PVBB 5BXXA 4BLJA 4Y22A 1AL23 2O8OA 4JGZB 1DZRA 3I3MA 1GKBA 1ODMA 3JZVA 4E8CA 4NWVA 3LQCA 4BQ3A 1HJFA 3P5BA 3VZNA 1FV3A 1WCQA 1IG0A 2MEV3 1UPIA 3P3NA 2VC9A 3VHNA 5C3PA 1N3PA 1YQ6A 2W91A 4CDWC 1ZBE3 4KQ7A 4OUSA 1O8SA 1QGLA 2WN3A 4YVWC 5T54A 3SH5A 2PAKA 2LTNA 1EV11 2YGMA 4M3CA 3MI8A 1PMIA 1DDLA 1LHNA 3DUIA 1N1VA 5T5LA 4XIOA 1MS9A 3OGRA 4R4XA 4BQXA 4AVTA 4XQDA 2W47A 4NIDA 2CY6A 1UU4A 2OQ6A 2PAEA 1H2LA 2Q5TA 1MEC3 4AHYA 1ZRDA 2J1EA 2PHLA 4DB5A 2WR9A 1AR81 5LK7B 2C9AA 1VAVA 4IW3A 3SNMA 3AP5A 1GANA 4PJYA 5KXBA 4BOWA 3KV5A 4FAGA 1D0HA 1LR5A 3ASIA 1RUH2 2XLGA 4Q29A 2PXJA 4RR3C 5FWJA 4W50A 2H6BA 1FXZA 2VNRA 4YPJA 3D0JA 2JG9B 2TEPA 3KF5A 1S0CA 2HWE1 2WQ4A 3LEMA 4KBZA 2NLRA 4COYA 5HBAA 2PFWA 3R05A 3FHIB 2FZ2A 1H4GA 5FY0A 2VZUA 4WM8B 2A3XA 2BQPA 2ET1A 3MPBA 5DG1A 1ZRFA 2ZBJA 1RHI3 3P6BA 3NKTA 4P5HA 1LOFA 1PX3A 1LU1A 5FZDA 4A6OA 2HWC1 4LE3A 2WWSA 4IEXA 1CGPA 4HK8A 4IEQA 4YGEA 5GZDA 1GQHA 1YQ5A 1YFWA 3T4HB 1JHJA 2YU1A 1JW6A 3OGGA 1WBFA 4YM2A 2J1SA 4CSWA 2DVBA 4HETA 4R9DA 3KT1A 4XACA 5HCBA 2ADDA 4D3WA 4UFJA 2DCTA 1RUC3 3WCRA 1OLRA 3C2UA 4F7ZA 5HPOA 1BMV1 4KU7A 4IE4A 1OHFA 5FYHA 4QKDA 1WW7A 3RWNA 5C8CC 4JGYA 5CU1A 4S2DA 3VBUA 1PM4A 4D7TA 1RGSA 3T0DA 2PA7A 4IL7A 2GH8A 5FUNA 5GZCA 3RI8A 2FZ1A 2KR2A 2NQYA 4IEYA 4X8PA 3VV1A 4BB3A 1NLSA 2JDMA 1ZZ7A 2YHJA 4DUWA 1UMHA 1LB2A 1FX5A 3MV11 3WQ0A 2R6QA 4PDWB 4ES8A 4GXLA 4B1MA 3HBZA 1CAVA 3JD72 5GZEA 5FDBA 3C7FA 1O3TA 2QQOA 4K6BA 4IV1C 5FZ3A 1SPPB 1S0FA 5IAXA 5FZLA 3OYWA 1JU4A 1ND3A 2QBXA 3KT7A 2PN5A 3KLSA 1VRBA 1VRH2 2VTXA 2WINB 3GGLA 4COVA 1L7RA 4W8JA 2Z69A 1CPNA 1SACA 5FP9A 5ISLA 3GNEA 4JKKA 4HG6B 5FO8B 3CJIB 2LW8A 1QNYA 4JDMA 4P9XA 1A8DA 2AEYA 4CVUA 4OUEA 1JUHA 5FJHA 1XSRA 2JIGA 4KH9A 1ZRRA 1C1LA 2HYXA 1VBC3 2J22A 2VH9A 4LK7A 1BVP1 2GSYA 3A7QA 1Q8VA 4R9AA 5FZHA 4B4PA 3URFA 4JRAA 4XF4A 1LGCA 2AYHA 3LEGA 3WG3A 3O1MA 1W9SA 1PIV3 2R043 2Y8KA 3OEAA 4GWIA 1HDKA 1M4WA 1AHSA 2G1MA 1WCSA 4IE5A 4NPRA 4XAEA 4YW1A 4H14A 3WUDA 4ATFA 5IYYA 2Y34A 3THCA 2ZX0A 1ASJ1 1PK6A 3WDVA 3DECA 5IFTA 3PTYA 4YG0A 1GP4A 4BISA 2OX0A 3AFGA 1UOFA 1V6JA 2CYFA 4AE2A 4Q4X3 5FPBA 5JCTA 1X50A 3CBNA 1QXRA 1RVF3 1W06A 1XBFA 2DVFA 1COV1 2G19A 4NHXA 4O65A 5T52A 3RG0A 5APAA 1F35A 5IK5A 1CWPA 5IVFA 2GC2A 2OPWA 3K4AA 3BTYA 4FSJA 1OOPA 3H7JA 5KHGA 5KWRA 3VHOA 4DINB 3MIGA 1CZSA 1FNYA 2K9ZA 1HX6A 3RRDA 3M3EA 1UX7A 3UJOA 4E4SA 2Y6HA 1DG6A 4XILA 3KD4A 1QHDA 2YPJA 5FZ1A 3ZXKA 4AVBA 4Q0SA 3ILNA 2XBO3 4SLIA 1QJFA 1C8M2 2Q8EA 3ZSJA 1D7PM 1NY71 1Y9QA 2W95A 1OUXA 4O9EA 3LCPA 2GN3A 3ZFEC 4PF5A 2BNMA 2W2IA 1AR71 1CZVA 1DZTA 4M4RA 3NJVA 4FPYA 4ZXKA 1DGRN 2VW2A 3JCIA 2JB8A 3KSCA 4Q4W2 1K5MC 4ASMB 5DDJ3 4CEYC 5C3OA 4DS0A 2FHRA 5HCFA 2RHPA 4LBJA 4CUGA 4YZ4A 1OQEA 3PU8A 1QKQA 2DU1A 3FN9A 5A3UA 2NYYA 2UY8A 3PLQA 5ABJB 1AL0G 2IXIA 3ZYJB 2D6LX 1H1AA 1V9U3 5FWEA 3ZYFA 2LS6A 3NNMA 1R093 2HBTA 1OKOA 2E6VA 4PI0A 1OLMA 1WLWA 2QNKA 2BU9A 2CU5A 2VOKA 3GZEA 5BYNA 5LEKA 5F5AA 2ZX2A 2CHHA 1IS4A 3MGUA 4C1WA 3CNAA 5A33B 3W5MA 2GMMA 4XAAA 3BCWA 3OF1A 1IS3A 2VCCA 3MZHA 4P02B 1F15A 2Y60A 2JENA 4FI9A 4MGZE 3ALQA 3I59A 4XFFA 4Q4V1 3T1LA 4FPKA 1O4YA 5F32A 3MIHA 5A7OA 4WBBA 1QJY2 3B3QE 2VNOA 1Y43B 2VMEA 2O1QA 4J25A 4PT6A 1PZ9A 3ACHA 3RJRA 1SFYA 2R1BA 5FY5A 5FYZA 5BNPA 4IV3C 4CTEA 4LITA 2DVGA 3BB6A 4DEQA 1H2MA 2YY1A 2P6HA 3ZYGA 2HWB2 1BEV2 2I2SA 4GAZA 4NHLA 3AZYA 2ZPXA 1NLQA 2B39A 1ZZ6A 2RG4A 1ZBA3 1YFYA 4IGQA 4QXBA 1WZXA 1H9PA 3U10A 4LT5A 1IHMA 3IDEA 2XONA 5GZGA 5CFCC 2JJ6A 2OXBA 1CJPA 1EP0A 4EWDA 1DBNA 3A23A 4EWEA 3MDPA 4HN1A 5HV4A 1NT0A 1HN0A 3D6EA 1A3KA 2MPFA 2QJVA 1KQRA 3Q8BA 2R072 2X5IA 1PK6B 1RINA 4CP0A 5A3LA 4AFCA 4AI3A 3OB8A 2VD7A 2C4XA 3WDUA 1OF4A 2QE3A 2OT7A 1AL22 3WNLA 1ZA7A 3K77A 5KBFA 2UWBA 1YQ8A 4XHBA 1URXA 1UCXA 2EF6A 2MEV2 4QDSA 4CA9A 4WVMA 1OOPB 3G6JB 1AR91 1R1ZA 2DUQA 3N3HA 4A2UA 5HXMA 5JZGC 1ZBE2 5BV6A 1HXS3 4YW7A 2CWSA 1H8TB 3ZXJA 2F6BA 2P3KA 4L97A 4GB31 4LBQA 4LBLA 4YW5A 2Z5WA 1UKGA 1S4CA 1W2NA 2RDRA 3ZR6A 4LBNA 3KV4A 4NPLA 4QGNA 4AR2A 2JICA 1WW4A 1UX6A 3E5QA 3J7LA 2DBNA 4BXFA 4BIFA 1MEC2 5FBZA 2OS2A 4QXHA 1H2NA 5C4WC 4I3GA 3VKFC 4Y1YA 1STMA 2WS91 3I2FA 1AYM3 1QDOA 2E9QA 3LA3A 3VL8A 5J1XA 5DZFA 1PO11 1XNBA 3HQRA 1L3JA 4WZCA 3HVDA 1EAH1 5JPNB 1C5HA 1HKDA 1QU0A 4KBBA 5LBEA 2BRTA 1G9AA 1CAUB 1H6YA 3WP6A 5JOXA 4YG6A 2ILMA 2GH2A 1PMHX 1RHI2 4F8AA 5FZKA 3H8OA 1JOJA 1QJU1 1YIFA 1S0EA 1SLBA 3HJRA 4I02A 4LO8A 1VALA 3F2ZA 3VGIA 1GZWB 5FYCA 4G4FA 1DF0A 4OI0A 2DF7A 1RL3A 2HWF1 1US3A 1OI6A 3ETQA 5HXVA 4S2FA 2OW4A 1TMF3 2JDKA 2OUHA 4MXWB 1RUC2 3CJXA 5BNOC 2EVXA 4WVVA 4AFMA 1AZDA 1NCRB 3CKHA 3LWCA 2BUKA 3HOBA 5EJZB 1FOD1 1ND2A 4XURA 3UK9A 4N43A 3VBFC 3RZKA 2XLFA 1OSGA 1NCQC 4H7MA 5A32A 3MBWA 5FY4A 2BOJA 2OZ6A 1WLCA 3B5LB 4N7UA 5KHJA 3I54A 4DXSA 2XVKA 3TN91 3ZYPA 4AFBA 1O5LA 2PHFA 2BWCA 3K75B 4HK9A 3IPVA 2KD7A 2ZGLA 3LB9A 4XMIA 4YW4A 4YFZA 3T1MA 2WZR3 4NAOA 3VBSA 4CP9A 3VZJA 3H3LA 1NA1A 1GZ9A 1WD3A 2E33A 1BBT1 2HH9A 2HWD1 2CL2A 4XBNA 1QEXA 4Q4Y1 4XUPA 1MVQA 5A1LA 3W59A 2Y0IA 5FO9B 1W6OB 4GQ7A 1I3HA 1F4AA 4B4QA 2Z42A 3T0AA 4XJUA 5DMYA 1X7NA 1KGYA 3VB9A 1RIRA 2WWJA 1PGW2 4LNVA 4WV8A 2F4LA 1XOYA 4D0QA 3PMEA 4W6WA 1VBC2 4JHTA 5CG9A 2GNTA 1JXNA 4PF1A 3ETPA 1AUYA 2ZEXA 1QJX3 1HIXA 2ZGNA 3AMQA 1UZVA 4QGLA 4A44A 4F3JA 5A6YA 1PIV2 2DUPA 2R042 2W9XA 3QCWA 5LA0A 3NWKA 1RJ7A 4RHV3 5G05L 1QJEA 2C9KA 1MS4A 3FC0A 5FXWA 1LNSA 2G9FA 4RQPB 4E27A 2BP6A 2IWGB 2XHKA 3AKRA 1YLLA 3DKWA 2JDYA 4XDOA 2WZPP 1I6XA 1RVF2 3ZOIA 3N9OA 1DGRA 4ET7A 1NG0A 2WFF1 4L2NA 3GBWA 3WEZA 1SQ4A 4B3NA 3LIHA 4GMP0 4LHLA 3T30A 3SKJE 3D82A 4LKDA 3AMMA 1B35A 4XXAA 1R083 4FBFA 5A1FA 3OY8A 3GALA 1PVC3 1W99A 4AQSA 2VZTA 1VMJA 3I3QA 5LBBA 4A7YA 4FTEA 3LDKA 3KMHA 1FI2A 3T4VA 5EJ1B 1AX1A 1NQJA 1XYPA 3O1SA 5FMCA 2EIEA 2XBO2 2NN8A 4MGYE 1K12A 1POV0 4NROA 3R6SA 5AC91 4CEWC 1QXJA 1UOGA 1GR3A 2CSGA 2WNVC 3E6BA 1SFNA 3L2HA 3NNGA 4FP3A 4XXPA 5A3NA 1LOGA 2XR4A 3LIGA 3RZZA 3D4KA 2BBAA 2BGCA 2VXRA 2OVUA 4QU2A 2NPIA 3GXUA 3POIA 4FPFA 1UZYA 4MUVA 4XCAA 1XXNA 3SH3A 4JDNA 1YI7A 4BZ4A 1S2KA 4D94A 2IVJA 2XJVA 3HIFA 4PI2A 5DDJ2 1C3HA 3FLTA 2VZ1A 2O0OA 3KGLA 4QQOA 3WCSA 3WT3A 4CZSA 3VZOA 3AZXA 5A6XA 4A4AA 4AHXA 5A7PA 1JS9A 4B29A 5I8YA 4TTGA 5KC6A 3FL7A 4LUKA 4RS5B 2TBVA 4IEUA 4XUOA 5FYSA 5GLZA 3S30A 1ND2B 1BXHA 1V9U2 3GCXA 4LK6A 5JXHA 2OPKA 1R092 4CDXC 4UBGA 2VOWA 2CAVA 3F95A 2QTWB 5DPNA 3O1PA 3ZFFA 1W03A 2CGOA 5I91A 1PVXA 1IPSA 1MS5A 5I0RA 4OI2A 4CXWA 3ZYRA 1HRV3 4M01A 4XUNA 4HMZA 3W20A 1D4M3 1AYN3 3OGSA 1JYCA 3ZXDA 2WKKA 4TZDA 4EE2A 5FQ0B 4MHUA 4CP9B 3KHCA 4HSLA 3MF9A 4DMIA 1SCRA 2YYOA 2ADEA 3I49A 3ZN6A 1JYWA 2QQPA 1GP6A 4B4RA 1QWRA 1YIPA 2OKXA 3M3OA 2VCMA 4UFHA 3UJQA 3ZSMA 4URTA 4DOUA 1BK1A 4ZHNA 1W2UA 2BNOA 1U5IA 1UMIA 4XC9A 3MUY1 2VCAA 1OKQA 1UY2A 2JDNA 1J59A 3D0SA 3CHXA 2GZWA 4JVAA 5FY9A 1UZZA 2WAOA 4CXXA 4X8NA 2ZEZA 1ZBA2 4UF0B 4XFGA 1WLTA 1MS0A 5I8SA 4Z07A 4LA3A 3I2JA 4W6YA 3WG4A 4CE8A 1JYTA 4IGOA 1CESA 5K9YA 2B7YA 1DLCA 1UU6A 5D8AC 4YW2A 1N1YA 3THPA 3KGZA 5EYYA 2XVLA 2QZ2A 5K0UC 3DXUA
chains in the Genus database with same CATH topology
3I97A 2J1EA 2VTFA 4CU7A 3WF2A 1GNYA 1XNAA 5IJRA 2WBKA 4W50A 1OT5A 2WDBA 4YPJA 2QQNA 1CX1A 4QB2A 2VQTA 4UAPA 4ZZ5A 2VZUA 3VDCA 4LHSA 3P6BA 4TXWA 1PX3A 4A6OA 2W5FA 2YC2A 3ZM8A 1JHJA 4DEVA 2W1SA 2E31A 2WZ8A 2J1SA 4KI5M 2WN2A 4DUXA 2RVAA 3DYOA 1JZ5A 3C7EA 5HPOA 1UY1A 3I3EA 3IDAA 3I2GA 1UY0A 3I2HA 3T09A 2WABA 3FHAA 3FHQA 2V4VA 2XQXA 2QQMA 1JYVA 3UESA 2JD9A 3T0DA 1H6XA 3WNPA 3LPGA 4DXRA 1UY4A 2W94A 4MGSA 4DUWA 1RYYA 1UMHA 3HN3A 2X09A 3LE0A 3MV11 1O59A 3VD9A 1GOHA 1WKYA 1GUIA 1W8NA 3C7FA 3ECQA 2QQOA 2W87A 3BGAA 1JU4A 2QBXA 4XUQA 2VMCA 3GGLA 2YFZA 1L7RA 4W8JA 2VM9A 4CUCA 4JKKA 5CYYA 4HG6B 2LW8A 2ID4A 1XNTA 4QDQA 4CVUA 3T08A 4OUEA 2Z4FA 2J22A 2HYXA 1HN1A 2ORXA 2W92A 3A7QA 5JXIA 3LEGA 1W9SA 2Y8KA 3OEAA 4XUNA 4GWIA 2Y64A 5IYYA 3ACGA 3THCA 2QQLA 5IFTA 1GOFA 3UETA 3DECA 3E1F1 2C26A 3IAQA 3WF1A 4XUTA 1P8JA 4UI9L 2ZEYA 3K4AA 3WQBA 3OGVA 5F7UA 3VD5A 1CZSA 1UY3A 4KMQA 1BHGA 5DN2A 3I3BA 1I5PA 2WZEA 1UX7A 2CDOA 4IUGA 2Y6HA 1OD3A 3EYPA 2VZPA 2J1AA 1EUTA 3VD4A 4A41A 1DP0A 1D7PM 2W95A 4MO3M 1CZVA 3W5NA 4QX1A 4M4RA 3NJVA 3FN9A 3K46A 3CQOA 4LKSA 4QB1A 1DYOA 3ACIA 4QX2A 3IAPA 4A45A 2LS6A 1UXXX 2RV9A 4PQQA 2JDAA 4OYUA 3W5MA 3SEPA 1W8OA 4XZUG 3EB7A 2VCCA 2YG0A 4P00B 3A21A 2ZEWA 4P02B 3C7GA 3UNPA 4FI9A 3A22A 3ACFA 4CU9A 2VZRA 2CDPA 4D8MA 2VZOA 5G04L 1JZ7A 1KEXA 2V72A 4DUVA 2J1UA 2VZSA 2BERA 1MPXA 2VQUA 2ZXQA 2E32A 1R64A 2VMEA 1JYNA 4PT6A 3WNKA 2VZ3A 2WUHA 3ACHA 4MADA 4AG4A 4BDVB 3NQHA 5I0DA 4DEQA 2W1QA 4RN5A 2PQSA 2Y6KA 4CUBA 4OZOA 2B9VA 4XVHA 4ZZ8A 5JMOA 4M4PA 4ARYA 1SHWB 2XONA 3C8XA 1K42A 1UWWA 3A23A 3D3AA 2VL4A 4KWUA 5JXJA 3THDA 2DCKA 4RYDA 5EIYB 1CIYA 3SKVA 1XC6A 2RJ2A 2VMDA 3HPNA 3OB8A 1JI6A 2JKXA 2C4XA 2Y6GA 3IIIA 1OF4A 1UZ0A 3BN6A 3WNLA 3K77A 2WO2A 3OG2A 3OEBA 4QX0A 1J83A 4QDSA 3PUHA 2B4KA 2W46A 5HXMA 1PMJX 3CDZB 1L7QA 2W3JA 4P5YA 2WYSA 3I3DA 2J1TA 2ORZA 3SEEA 1TVGA 3VDBA 1JZ2A 2J1RA 4A42A 2VO5A 2QQJA 1PX4A 4QDRA 5C70A 3C7HA 1GU3A 3I2FA 2BGOA 5LCWL 5J1XA 2EICA 3HEIA 5CZKA 3CIHA 4P08A 2Y6LA 1W9WA 2HLEA 1UYYA 1GMMA 2VMFA 2BGPA 1H6YA 1US2A 4OMDA 1PMHX 2JE8A 3CMGA 2VCBA 5IHRA 3HJRA 3AC0A 3F2ZA 3WNOA 1W9TA 1US3A 1J84A 3CZUA 3DYPA 1UYZA 5C7GA 4CU8A 4CUAA 1JZ6A 3CKHA 1UYXA 3MUZ1 4MOAA 3HOBA 5EJZB 2V5DA 2XHNA 4XURA 3T2OA 1OF3A 3MBWA 4BJ0A 1ULOA 4JKMA 4DXSA 3VD3A 3T0BA 2WQ8A 1ULPA 3K75B 2KD7A 3HNYM 1EUUA 2E33A 2W1WA 4LPLA 3T2PA 2XOMA 4JHZA 4XUPA 1JU3A 3IB3A 3PUIA 3K4DA 1F4AA 3T0AA 4BK5A 1NUKA 4GZ9A 5DMYA 3U37A 5JXGA 1KGYA 3J7HA 1YQ2A 4D0QA 1CZTA 1K3IA 3GDBA 4PF1A 3ETPA 4ZXEA 5IFPA 2ZEXA 4A44A 4JKLA 2W9XA 3LPFA 5LA0A 3LEKA 5G05L 2C9KA 4OMCA 1T2XA 1LNSA 2J7MA 1O8PA 1GQPA 3CZJA 1IQDC 3WNNA 3MV01 5LA2A 1NKGA 4QB6A 4ET7A 3WEZA 3WF3A 2L9LA 3SKJE 3NRUA 2R7EB 1XPWA 5FUIA 2DDUA 4DXTA 3HNBM 3K4ZA 3MO4A 1W99A 2VZTA 2QQIA 1SG3A 2BZDA 2Y6JA 5EJ1B 4BK4A 4E8DA 5LA1A 2EIEA 3VDAA 1TG7A 1K12A 2VJXA 3NNGA 1JZ8A 4ARXA 1JZ4A 4LQRA 2WAAA 2BBAA 2X05A 5B4NA 1F4HA 2E26A 3GXUA 3OBAA 1JZ3A 1W0NA 3C7OA 3T2QA 1K45A 3DYMA 4A3ZA 4ZY9A 2VZQA 2VR4A 2VZ1A 4GWJA 4A4AA 1NX9A 4TTGA 4MGQA 2YB7A 3HNMA 2YFUA 3WF4A 3FL7A 3LEIA 4XUOA 3I2IA 4BXSV 3GM8A 5JXHA 3VD7A 3WNMA 5DPNA 4JX0A 2WO3A 4AAXA 2J1VA 4W4ZA 3ABZA 2EIDA 3OGSA 1UXZA 3I2KA 4CU6A 3P1IA 2DCJA 2WO1A 5A1AA 2VZVA 1JYWA 2W1UA 3WSOA 2OKXA 4QX3A 2VOTA 4L0PA 2X10A 4QAWA 1UMIA 3MUY1 2VCAA 4E8CA 1NAEA 1UY2A 3LQCA 5JR2A 1SDDB 1GOGA 5DQ0A 1WCQA 2EIBA 2VC9A 2WAOA 3WF0A 2W91A 3JXSA 2QQKA 2ZEZA 1O8SA 5B4XA 2WN3A 4UOJA 3I2JA 5JUVA 1JYXA 1DLCA 3OGRA 3NJXA 4Z2AA 5C71A 2W47A 2YC4A 4QPWA 1OH4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I97 A;  2J1E A;  2VTF A;  4CU7 A;  3WF2 A;  1GNY A;  1XNA A;  5IJR A;  2WBK A;  4W50 A;  1OT5 A;  2WDB A;  4YPJ A;  2QQN A;  1CX1 A;  4QB2 A;  2VQT A;  4UAP A;  4ZZ5 A;  2VZU A;  3VDC A;  4LHS A;  3P6B A;  4TXW A;  1PX3 A;  4A6O A;  2W5F A;  2YC2 A;  3ZM8 A;  1JHJ A;  4DEV A;  2W1S A;  2E31 A;  2WZ8 A;  2J1S A;  4KI5 M;  2WN2 A;  4DUX A;  2RVA A;  3DYO A;  1JZ5 A;  3C7E A;  5HPO A;  1UY1 A;  3I3E A;  3IDA A;  3I2G A;  1UY0 A;  3I2H A;  3T09 A;  2WAB A;  3FHA A;  3FHQ A;  2V4V A;  2XQX A;  2QQM A;  1JYV A;  3UES A;  2JD9 A;  3T0D A;  1H6X A;  3WNP A;  3LPG A;  4DXR A;  1UY4 A;  2W94 A;  4MGS A;  4DUW A;  1RYY A;  1UMH A;  3HN3 A;  2X09 A;  3LE0 A;  3MV1 1;  1O59 A;  3VD9 A;  1GOH A;  1WKY A;  1GUI A;  1W8N A;  3C7F A;  3ECQ A;  2QQO A;  2W87 A;  3BGA A;  1JU4 A;  2QBX A;  4XUQ A;  2VMC A;  3GGL A;  2YFZ A;  1L7R A;  4W8J A;  2VM9 A;  4CUC A;  4JKK A;  5CYY A;  4HG6 B;  2LW8 A;  2ID4 A;  1XNT A;  4QDQ A;  4CVU A;  3T08 A;  4OUE A;  2Z4F A;  2J22 A;  2HYX A;  1HN1 A;  2ORX A;  2W92 A;  3A7Q A;  5JXI A;  3LEG A;  1W9S A;  2Y8K A;  3OEA A;  4XUN A;  4GWI A;  2Y64 A;  5IYY A;  3ACG A;  3THC A;  2QQL A;  5IFT A;  1GOF A;  3UET A;  3DEC A;  3E1F 1;  2C26 A;  3IAQ A;  3WF1 A;  4XUT A;  1P8J A;  4UI9 L;  2ZEY A;  3K4A A;  3WQB A;  3OGV A;  5F7U A;  3VD5 A;  1CZS A;  1UY3 A;  4KMQ A;  1BHG A;  5DN2 A;  3I3B A;  1I5P A;  2WZE A;  1UX7 A;  2CDO A;  4IUG A;  2Y6H A;  1OD3 A;  3EYP A;  2VZP A;  2J1A A;  1EUT A;  3VD4 A;  4A41 A;  1DP0 A;  1D7P M;  2W95 A;  4MO3 M;  1CZV A;  3W5N A;  4QX1 A;  4M4R A;  3NJV A;  3FN9 A;  3K46 A;  3CQO A;  4LKS A;  4QB1 A;  1DYO A;  3ACI A;  4QX2 A;  3IAP A;  4A45 A;  2LS6 A;  1UXX X;  2RV9 A;  4PQQ A;  2JDA A;  4OYU A;  3W5M A;  3SEP A;  1W8O A;  4XZU G;  3EB7 A;  2VCC A;  2YG0 A;  4P00 B;  3A21 A;  2ZEW A;  4P02 B;  3C7G A;  3UNP A;  4FI9 A;  3A22 A;  3ACF A;  4CU9 A;  2VZR A;  2CDP A;  4D8M A;  2VZO A;  5G04 L;  1JZ7 A;  1KEX A;  2V72 A;  4DUV A;  2J1U A;  2VZS A;  2BER A;  1MPX A;  2VQU A;  2ZXQ A;  2E32 A;  1R64 A;  2VME A;  1JYN A;  4PT6 A;  3WNK A;  2VZ3 A;  2WUH A;  3ACH A;  4MAD A;  4AG4 A;  4BDV B;  3NQH A;  5I0D A;  4DEQ A;  2W1Q A;  4RN5 A;  2PQS A;  2Y6K A;  4CUB A;  4OZO A;  2B9V A;  4XVH A;  4ZZ8 A;  5JMO A;  4M4P A;  4ARY A;  1SHW B;  2XON A;  3C8X A;  1K42 A;  1UWW A;  3A23 A;  3D3A A;  2VL4 A;  4KWU A;  5JXJ A;  3THD A;  2DCK A;  4RYD A;  5EIY B;  1CIY A;  3SKV A;  1XC6 A;  2RJ2 A;  2VMD A;  3HPN A;  3OB8 A;  1JI6 A;  2JKX A;  2C4X A;  2Y6G A;  3III A;  1OF4 A;  1UZ0 A;  3BN6 A;  3WNL A;  3K77 A;  2WO2 A;  3OG2 A;  3OEB A;  4QX0 A;  1J83 A;  4QDS A;  3PUH A;  2B4K A;  2W46 A;  5HXM A;  1PMJ X;  3CDZ B;  1L7Q A;  2W3J A;  4P5Y A;  2WYS A;  3I3D A;  2J1T A;  2ORZ A;  3SEE A;  1TVG A;  3VDB A;  1JZ2 A;  2J1R A;  4A42 A;  2VO5 A;  2QQJ A;  1PX4 A;  4QDR A;  5C70 A;  3C7H A;  1GU3 A;  3I2F A;  2BGO A;  5LCW L;  5J1X A;  2EIC A;  3HEI A;  5CZK A;  3CIH A;  4P08 A;  2Y6L A;  1W9W A;  2HLE A;  1UYY A;  1GMM A;  2VMF A;  2BGP A;  1H6Y A;  1US2 A;  4OMD A;  1PMH X;  2JE8 A;  3CMG A;  2VCB A;  5IHR A;  3HJR A;  3AC0 A;  3F2Z A;  3WNO A;  1W9T A;  1US3 A;  1J84 A;  3CZU A;  3DYP A;  1UYZ A;  5C7G A;  4CU8 A;  4CUA A;  1JZ6 A;  3CKH A;  1UYX A;  3MUZ 1;  4MOA A;  3HOB A;  5EJZ B;  2V5D A;  2XHN A;  4XUR A;  3T2O A;  1OF3 A;  3MBW A;  4BJ0 A;  1ULO A;  4JKM A;  4DXS A;  3VD3 A;  3T0B A;  2WQ8 A;  1ULP A;  3K75 B;  2KD7 A;  3HNY M;  1EUU A;  2E33 A;  2W1W A;  4LPL A;  3T2P A;  2XOM A;  4JHZ A;  4XUP A;  1JU3 A;  3IB3 A;  3PUI A;  3K4D A;  1F4A A;  3T0A A;  4BK5 A;  1NUK A;  4GZ9 A;  5DMY A;  3U37 A;  5JXG A;  1KGY A;  3J7H A;  1YQ2 A;  4D0Q A;  1CZT A;  1K3I A;  3GDB A;  4PF1 A;  3ETP A;  4ZXE A;  5IFP A;  2ZEX A;  4A44 A;  4JKL A;  2W9X A;  3LPF A;  5LA0 A;  3LEK A;  5G05 L;  2C9K A;  4OMC A;  1T2X A;  1LNS A;  2J7M A;  1O8P A;  1GQP A;  3CZJ A;  1IQD C;  3WNN A;  3MV0 1;  5LA2 A;  1NKG A;  4QB6 A;  4ET7 A;  3WEZ A;  3WF3 A;  2L9L A;  3SKJ E;  3NRU A;  2R7E B;  1XPW A;  5FUI A;  2DDU A;  4DXT A;  3HNB M;  3K4Z A;  3MO4 A;  1W99 A;  2VZT A;  2QQI A;  1SG3 A;  2BZD A;  2Y6J A;  5EJ1 B;  4BK4 A;  4E8D A;  5LA1 A;  2EIE A;  3VDA A;  1TG7 A;  1K12 A;  2VJX A;  3NNG A;  1JZ8 A;  4ARX A;  1JZ4 A;  4LQR A;  2WAA A;  2BBA A;  2X05 A;  5B4N A;  1F4H A;  2E26 A;  3GXU A;  3OBA A;  1JZ3 A;  1W0N A;  3C7O A;  3T2Q A;  1K45 A;  3DYM A;  4A3Z A;  4ZY9 A;  2VZQ A;  2VR4 A;  2VZ1 A;  4GWJ A;  4A4A A;  1NX9 A;  4TTG A;  4MGQ A;  2YB7 A;  3HNM A;  2YFU A;  3WF4 A;  3FL7 A;  3LEI A;  4XUO A;  3I2I A;  4BXS V;  3GM8 A;  5JXH A;  3VD7 A;  3WNM A;  5DPN A;  4JX0 A;  2WO3 A;  4AAX A;  2J1V A;  4W4Z A;  3ABZ A;  2EID A;  3OGS A;  1UXZ A;  3I2K A;  4CU6 A;  3P1I A;  2DCJ A;  2WO1 A;  5A1A A;  2VZV A;  1JYW A;  2W1U A;  3WSO A;  2OKX A;  4QX3 A;  2VOT A;  4L0P A;  2X10 A;  4QAW A;  1UMI A;  3MUY 1;  2VCA A;  4E8C A;  1NAE A;  1UY2 A;  3LQC A;  5JR2 A;  1SDD B;  1GOG A;  5DQ0 A;  1WCQ A;  2EIB A;  2VC9 A;  2WAO A;  3WF0 A;  2W91 A;  3JXS A;  2QQK A;  2ZEZ A;  1O8S A;  5B4X A;  2WN3 A;  4UOJ A;  3I2J A;  5JUV A;  1JYX A;  1DLC A;  3OGR A;  3NJX A;  4Z2A A;  5C71 A;  2W47 A;  2YC4 A;  4QPW A;  1OH4 A; 
#chains in the Genus database with same CATH topology
 4P9I A;  1EV1 3;  3DPR A;  1RXF A;  3N9L A;  3W58 A;  3MIE A;  3HMY A;  4NOT A;  4AZZ A;  3KVA A;  5DUX A;  5JDB A;  3I8T A;  1LGB A;  3M7A A;  5IJR A;  3S6P A;  5JI9 A;  3RWK X;  3ZFG B;  2RDN A;  3PNA A;  5CFD A;  1S0D A;  2D5H A;  5F8P A;  4HVR A;  4HXC A;  4N53 A;  5BNN A;  1AR8 3;  2R16 A;  3WQ7 A;  4DXZ A;  1MQT A;  3IKW A;  4QB2 A;  2VQT A;  4UAP A;  3MEP A;  1HXS 2;  1OLQ A;  1GNZ A;  2YBP A;  4V1P A;  4BLI A;  4EN0 A;  2YU2 A;  2Y33 A;  3VDC A;  4AGV A;  4EJR A;  1W0O A;  3CL1 A;  4TXW A;  1LGN A;  5LY2 A;  2J42 A;  2YMZ A;  3PIJ A;  1KDK A;  1U5Z A;  3DF0 A;  1KS5 A;  2HKX A;  2KXL A;  1YEW A;  3ZDV A;  4P9J A;  1W6Q B;  4KG0 A;  1EPZ A;  5A32 B;  2W1S A;  2E31 A;  2WZ8 A;  2H0V A;  3KCX A;  4M0H A;  4FPC A;  2HWC 3;  2WN2 A;  4DFS A;  2ZCW A;  3POY A;  4AED A;  2DUR A;  1AYM 2;  1X8E A;  3FZ3 A;  1JZ5 A;  3ZVX A;  5FPU A;  4XDP A;  1V6M A;  1JOP A;  3KS7 A;  4BH9 A;  1Q8S A;  3I3E A;  5CB7 A;  3OBT A;  3I2H A;  4EQV A;  2WAB A;  4MSV A;  2XUE A;  2WNO A;  3B01 A;  4URA A;  2XQX A;  1W8F A;  4XFH A;  5C3Q A;  1JYV A;  2C5D A;  1VB2 A;  1V6O A;  5CKN A;  2GP3 A;  4YVW A;  4CCN A;  5EP9 A;  3WNP A;  4E2G A;  1H1I A;  3LPG A;  5I0U A;  3U4S A;  4DXR A;  3KB5 A;  1UY4 A;  2W94 A;  4IXL A;  2GMP A;  4MGS A;  1RMU 1;  5FZM A;  1MZF A;  4GJZ A;  3PIG A;  4TSV A;  3HN3 A;  1NXD 1;  3I2D A;  2P17 A;  5J09 A;  4FQZ A;  1TMF 2;  3SCG A;  1RUH 1;  3KCY A;  4NRQ A;  4Y1U A;  3BGA A;  1QH7 A;  1WUV A;  3Q9O A;  2D93 A;  4MXV A;  3ZN6 B;  4YGB A;  3U14 A;  1OA3 A;  2EXH A;  4RR3 A;  3PJY A;  4DPN A;  2D97 A;  1NE6 A;  1WLD A;  2ID4 A;  1GIC A;  1PHM A;  2ZX1 A;  5T5J A;  3VDD C;  3LA2 A;  3A4U A;  1ALY A;  1SBF A;  4WVZ A;  2Z4F A;  3ON7 A;  1Z78 A;  3M8L A;  4N7I A;  4QPI B;  1S0J A;  3R0R A;  4ZS3 A;  3RYP A;  1WME A;  5T55 A;  4NAM A;  3KT4 A;  3B02 A;  4LOS A;  5D1I A;  2WZR 2;  5LAT A;  1N3Q A;  4DNY A;  4AHZ A;  2Y64 A;  4XFI A;  3GHM A;  4OHX A;  3OPT A;  3SIS A;  1YJK A;  1ZRI A;  4QM9 A;  1WGP A;  2IXJ A;  3N9Q A;  4EWA A;  3MPP G;  3IAQ A;  4AVV A;  4P14 A;  4NRP A;  4PBO A;  1YUD A;  1UOB A;  1Z7S 1;  3D8C A;  5F3C A;  3TEY A;  2YRO A;  4JGZ C;  1ASJ 3;  2DBI A;  2ZEY A;  4UI9 L;  5FMO S;  5C8C A;  1ZRE A;  2V4A A;  3KF3 A;  3WQB A;  4ZKT B;  3BTX A;  5DUV A;  3OGV A;  5CFD B;  5F7U A;  2MNG A;  1UY3 A;  4KMQ A;  5FYI A;  3I3B A;  1W3X A;  2CDO A;  1PO2 3;  1QMJ A;  2GNM A;  2ZKN A;  3NNL A;  1QJX 2;  2A70 A;  1WMX A;  2P5B A;  4GD4 A;  4ORF A;  5LK5 A;  3JD7 1;  3USU B;  1GZC A;  2J1A A;  4RGG A;  3UGG A;  4UYB A;  4E2Q A;  5IW0 A;  4RHV 2;  4GJY A;  2GC3 A;  1POQ A;  2GP5 A;  4Z2W A;  3TOJ A;  4XJ9 A;  1CON A;  4I3P A;  3H3U A;  3TEX A;  1Y9G A;  3WHT A;  4IV1 A;  2D6P A;  2WLQ A;  3ILR A;  1CAW A;  2IXH A;  2VNV A;  2XPJ A;  5JSP A;  1IKQ A;  4IE0 A;  5A3T A;  1G9B A;  1AXZ A;  4CP2 A;  5BPX A;  1HQL A;  4QHO A;  3SH4 A;  2ZGM A;  4QPG A;  2D6N A;  5CIS A;  4M0N A;  1HV0 A;  2JIJ A;  1VPH A;  1G9D A;  4GMP 1;  1SZB A;  1AR7 3;  3VBH B;  3TEW A;  3K46 A;  3GZT B;  5A7W B;  1R08 2;  4QB1 A;  5FZ0 A;  2XL9 A;  1DYO A;  1PVC 2;  2EAK A;  2FCV A;  2ZHL A;  3E5X A;  4XCB A;  3TAY A;  4A45 A;  4DY5 A;  1UPS A;  4QKN A;  3Q8A A;  4IES A;  4WM8 C;  1UIJ A;  5JOY A;  3V0A A;  1XE8 A;  2RMU 1;  5LWB A;  2WSU A;  1LED A;  1W6P A;  3TRS B;  3BUC A;  5C9A B;  2D5F A;  1REF A;  2WNU B;  1POV 1;  1YHF A;  3N7K A;  3LFM A;  4TWT A;  5CIR A;  1ZM1 A;  4Y1X A;  1F31 A;  3EB7 A;  3ZXF A;  2IXL A;  2SBA A;  2ZEW A;  3C7G A;  1YC6 1;  2BVB A;  4BCU A;  2RS3 1;  3A22 A;  4CU9 A;  1YRZ A;  2D3R A;  2A3Y A;  2VZO A;  5G04 L;  2A5Z A;  3WIN E;  1M06 G;  2C1F A;  1KEX A;  1WA6 X;  2LRO A;  4LBM A;  2DUO A;  2FDF A;  2WL1 A;  4LKE A;  3AYD A;  1PGS A;  1V00 A;  2J1U A;  2VW1 A;  2BER A;  2K0G A;  2VZS A;  1C28 A;  3M3I A;  4NPM A;  2EA7 A;  2PHW A;  1YJL A;  2E32 A;  3AMN A;  5AFB A;  5FYV A;  2RR1 1;  4KWL A;  4CPB A;  1Q43 A;  4Q4V 3;  4WM7 B;  4MAD A;  4AG4 A;  1E5H A;  1J3Q A;  4E4Z A;  4ATE A;  1C8M 1;  5FTT C;  4AHW A;  4FQ4 A;  3GJA A;  2WT0 A;  1V70 A;  4BDV B;  1GNH A;  2NM1 A;  4CYD A;  3OD4 A;  4FPL A;  2WII B;  2Y6K A;  4CUB A;  5K8S A;  4NHM A;  4XVH A;  3NJZ A;  1HRV 2;  1RUG 1;  2XWJ B;  4PDW C;  2NZ9 A;  4HFS A;  3AZZ A;  4M4P A;  3AL5 A;  1SHW B;  4ARY A;  1D4M 2;  1AYN 2;  1Q3E A;  3ZFE A;  1K42 A;  2OQ7 A;  3I4I A;  1X8M A;  1MZ5 A;  4AGG A;  2R0H A;  3PVN A;  1R1A 3;  3D3A A;  5EV7 A;  4KWU A;  3J8F 2;  3THD A;  1CN1 A;  3FX3 A;  3AKT A;  3PTR B;  5T5P A;  4ZU5 A;  2GN7 A;  1UN1 A;  2JG8 B;  2WRA A;  4CEY A;  5TSW A;  2RJ2 A;  3HPN A;  2K2S A;  4TLG A;  3CJI C;  5H9Q A;  3O1V A;  1O91 A;  5IK8 A;  2ZMN A;  2CV6 A;  1UZ0 A;  3HAG A;  3K2O A;  5F39 A;  4QX8 A;  5HI0 A;  1SLL A;  3S0M A;  1TQ5 A;  4MZU A;  3OG2 A;  5IVJ A;  1WCD J;  3TB0 A;  3RPQ A;  2AEN A;  2QFE A;  4D6R A;  5C6C A;  1A8M A;  2B4K A;  3E6C C;  1PMJ X;  1W9Y A;  1OVP A;  4Y26 A;  4HN0 A;  4Y22 B;  3I7D A;  4FPJ A;  4YW3 A;  5BUV A;  4XHX A;  3H8R A;  1W2A X;  2BBV A;  1QIQ A;  3EXU A;  3B9I A;  2VBP A;  1WBL A;  1QY4 A;  3I3D A;  2FD8 A;  2ORZ A;  1QJY 1;  1AR9 3;  3SEE A;  2PEL A;  3O5S A;  5LRR A;  1RUD 1;  4I0A A;  3VDB A;  1DGL A;  2P3Y A;  3VKN A;  4GB3 3;  1EV1 2;  4M3C B;  2XLA A;  4GWN A;  2PHR A;  2A71 A;  1XU1 A;  3OSD A;  1PX4 A;  5FZA A;  4QDR A;  1RUI 3;  4L92 A;  3POW A;  3K48 A;  5L7O C;  3ZN4 A;  3J7N A;  1BEV 1;  3B94 A;  1RJ8 A;  4QPG B;  2AEZ A;  2EIC A;  2WJS A;  4Q0U A;  5IT6 A;  1DQ5 A;  4IV3 A;  1AR8 2;  3W9A A;  3CIH A;  1LOC A;  2O14 A;  2Y6L A;  1S0I A;  2HLE A;  2PQQ A;  3ME2 A;  4IDZ A;  4OUM A;  3RYR A;  4E4H A;  1TME 3;  1GMM A;  3QD6 A;  4AEJ A;  5IAT A;  3O14 A;  2VMF A;  1US2 A;  2PLV 1;  4OMD A;  2VU9 A;  3AYC A;  4OLL A;  3V0A B;  1PO1 3;  2V5Y A;  2BDR A;  3Q8F A;  4UFK A;  3SCF A;  1W8T A;  5KHI A;  1EAH 3;  3CMG A;  2R07 1;  4FT8 A;  2VCB A;  5CFC A;  1J1L A;  1GP5 A;  1UKR A;  3K3O A;  3AC0 A;  1A6C A;  1O4T A;  1VBB 1;  4IEP A;  1VLN A;  4LKF A;  5FFO C;  2WT1 A;  2QQW A;  2RS5 3;  2YBS A;  1W9T A;  5A70 A;  3IT8 A;  1AL2 1;  1QJU 3;  1Q8P A;  2HWC 2;  5A3M A;  4M00 A;  4QXK A;  3LA7 A;  1Q56 A;  3GYD A;  2MEV 1;  5KC5 A;  1UYX A;  2LRP A;  4O7X A;  1CX4 A;  3JBG 3;  4HOO A;  2HWF 3;  4YZ3 A;  4PCR A;  5IVV A;  3MID A;  4XQ4 A;  5CA6 A;  5ABJ C;  3T2O A;  3UKN A;  3N7L A;  1O3Q A;  2GDF A;  4RFT 0;  3E6D A;  2ARC A;  1V6I A;  1PZ7 A;  2CGN A;  2RJK A;  2CTV A;  1RUF 1;  4FOV A;  4H2A A;  1VB4 A;  2DU0 A;  2VGD A;  3ORJ A;  3CF6 E;  5IUQ A;  4YM1 A;  3UV9 A;  5JZG A;  4JKM A;  1ZNP A;  3U1X A;  3NJY A;  1FOD 3;  3MW4 A;  4Q27 A;  3VD3 A;  4MH0 E;  2VBD A;  4JGY B;  2WQ8 A;  3VBU B;  1HQW A;  3AP9 A;  3PL0 A;  4A7Z A;  3TNQ A;  4I2O A;  2Q30 A;  2EXK A;  2WLP A;  1X36 A;  2WQZ C;  2RE9 A;  5J37 A;  2C24 A;  3TN9 3;  5FZE A;  2BJS A;  4C0B A;  5F6K A;  4HAN A;  1DYK A;  5C4W A;  1JH5 A;  4LPL A;  2I07 B;  3WDY A;  1VBE 1;  2XDV A;  1JU3 A;  3IB3 A;  1AX2 A;  1CAV B;  1O5U A;  1K5J A;  5FY7 A;  1HB4 A;  5IK7 A;  3OYW B;  1IPJ A;  1ND3 B;  1OFN A;  3IDB B;  5JXG A;  4LBO A;  4UW3 A;  2JD4 A;  1HJG A;  1JZ8 A;  3N9N A;  4Q4Y 3;  2XL7 A;  2ZGO A;  3J4U H;  1UIK A;  4I0B A;  4BPZ A;  3ZIW A;  5FP8 A;  5HCA A;  3AVR A;  2VQ0 A;  3JB4 C;  1BVV A;  2GAU A;  5C8W A;  5IFP A;  1HQN A;  2RS1 3;  3MIB A;  5DZE A;  2EXI A;  1X9T A;  3C3V A;  4JKL A;  3ZDS A;  4M3C F;  1W8H A;  3LOI A;  5A7S A;  4TYS A;  2YPD A;  2A6W A;  4OMC A;  4YGC A;  3NAP C;  5BNO A;  1I5Z A;  3ZYI B;  1O4Z A;  1GQP A;  2P3J A;  3WNN A;  3QH6 A;  3MV0 1;  3L9J T;  5LA2 A;  3U78 A;  3S5Q A;  3S57 A;  3LFI A;  4LBQ D;  1AVB A;  1NKG A;  4CDU A;  3RZM A;  3DN7 A;  1D2S A;  3WF3 A;  1PNF A;  1ASJ 2;  2I45 A;  2XKO A;  3VBF A;  2D6K A;  2L9L A;  1MS3 A;  4XF0 A;  1NCQ A;  3WZ1 A;  3NRU A;  2R7E B;  4QKF A;  4NIA A;  1OOP C;  2DDU A;  1YFU A;  3ELN A;  5LB6 A;  4DXT A;  5CAD A;  3RMY A;  2AGS A;  1H8T C;  1PO2 2;  3NV4 A;  1FMD 1;  1H1M A;  1SG3 A;  5EXO A;  5L9B A;  1KDM A;  3VDA A;  3AZW A;  1TG7 A;  4XBL A;  5E6H A;  5J96 B;  4YM0 A;  3WX5 A;  2VJX A;  4W6X A;  2Q4S A;  4NHK A;  4OUL A;  3ZSE A;  4F83 A;  1ONA A;  3ILF A;  5FP3 A;  3ZO0 B;  4D6Q A;  2RM2 3;  3BOP A;  4COZ A;  1SLA A;  5B4N A;  1F4H A;  2EIG A;  2E26 A;  1OA2 A;  1JZ3 A;  5AC9 3;  1W0N A;  2R06 3;  4ZU4 A;  4J1X A;  3W21 A;  5F5Q A;  3U11 A;  5C3R A;  3DYM A;  4AFD A;  4ZY9 A;  4FPO B;  4H7L A;  1RUN A;  5AFE A;  1OC1 A;  4AI8 A;  4KNC A;  5FOB B;  1NX9 A;  1AR7 2;  4MGQ A;  3APB A;  2YB7 A;  3POJ A;  2CGP A;  1OVS A;  4FPH A;  3I2I A;  3POS A;  2BTV C;  1PIV 1;  1OXC A;  3DGT A;  1RXG A;  3GM8 A;  3ZPO A;  2F4P A;  2JE9 A;  4IGP A;  4FTB A;  1Q5O A;  2V09 A;  3WNM A;  1RUE 3;  1T6G C;  3NV3 A;  3WY6 A;  5JZG B;  3V0B A;  1CR7 A;  5L36 A;  4AOC A;  4DIQ A;  4AAX A;  3JU9 A;  3AMH A;  3NMB A;  2B8M A;  5FP4 A;  1HB3 A;  2BW8 A;  2D43 A;  2XB6 C;  2ES3 A;  3VHR A;  3ZSL A;  1H9W A;  4H3W A;  5FZO A;  4Z82 A;  2ZTN A;  4XQW A;  3RZL A;  4R52 A;  3P1I A;  1NCR C;  2WO1 A;  1F8V A;  4QU1 A;  5A1A A;  1Y7B A;  3OUJ A;  1CAX A;  1J3R A;  1QQP 3;  2VZV A;  3I59 B;  3VN4 A;  3WSO A;  4GWM A;  4H55 A;  4Q4V 2;  1WMD A;  3LSE A;  3U07 A;  4S2G A;  2E7T A;  4L0P A;  2C0Z A;  3H1M A;  4KWJ A;  4CCD A;  3MIC A;  4XTM A;  3DKQ A;  2D3S A;  4QAW A;  2WWU A;  2PYT A;  2EAA A;  1NAE A;  3WLU A;  5JR2 A;  2ZGS A;  5GJ6 A;  2UWA A;  1W6N A;  1VIW B;  2Y38 A;  2EIB A;  3OJB A;  3PUS A;  4ISQ A;  4R9B A;  3WF0 A;  4CEW A;  1WA4 A;  4E4D X;  2WNV A;  2QQK A;  3P3P A;  1PGL 1;  4BE3 A;  5BNP B;  4CCC A;  5C5T A;  4K8R B;  5FZ8 A;  3NVC A;  1AR6 1;  4FCA A;  3JQW A;  5DDJ 1;  1OPM A;  4B7E A;  2ENR A;  3M3Q A;  2VVE A;  4YWA A;  2ERF A;  2XWB B;  4BHP A;  1R1A 2;  4JTO A;  3NJX A;  4N9H A;  4YFW A;  1TNR A;  4HON A;  3JB8 A;  3ZKY A;  4DO0 A;  4BM8 A;  1V9U 1;  4HKL A;  4JQT A;  5JMC A;  3I97 A;  2Q0A A;  5BNO B;  4QQH A;  3IMN A;  2ZGT A;  1GNY A;  3M70 A;  3ROU A;  1XNA A;  3O0X A;  4Y20 A;  1A78 A;  1W3V A;  2OUJ A;  2R32 A;  4XPV A;  3VBO A;  3VBR C;  2X5I B;  3E97 A;  4CDU B;  3I2O A;  1DQ0 A;  3O12 A;  5FZI A;  1N1S A;  5FUP A;  4CDX A;  1NCQ B;  4LR4 A;  2WDB A;  5IVE A;  5F5C A;  2QQN A;  4OI1 A;  2R30 A;  4G9S B;  3AM2 A;  1NZI A;  3KV9 A;  1ULE A;  1VBA 1;  5FRE A;  4NII A;  4ZZ5 A;  4KU8 A;  2XJQ A;  3ZX7 A;  4OHW A;  3MF6 A;  2BWA A;  3OTF A;  3UT0 A;  4WVM B;  4XJA A;  1AR9 2;  2VVD A;  4NJ4 A;  3UKV A;  1CD3 G;  2TNF A;  4RQP C;  3ZM8 A;  1LUL A;  4GB3 2;  4AAP A;  4LBQ B;  3WG2 A;  4AI9 A;  4LOR A;  2B9U A;  4XFC A;  1JMU B;  2VNG A;  3GZU C;  4I01 A;  1RUI 2;  2QZ3 A;  2GME A;  3M1H A;  4IE6 A;  2RVA A;  4DUX A;  3AP6 A;  3VUO A;  3AX4 A;  3B7M A;  4AW7 A;  3GJB A;  3WVJ A;  2ARE A;  2RDQ A;  4LIU A;  2VUA A;  2WNE A;  1L7L A;  1RTV A;  1XJA A;  3B00 A;  3GF6 A;  1UY0 A;  2Q1M A;  4BME A;  4MGK E;  1TME 2;  3FHA A;  2A3W A;  3FHQ A;  1ULG A;  2D7F A;  4UWD A;  5A3O A;  3GBF A;  5A6Z A;  1PO1 2;  1ULD A;  2E53 A;  2JD9 A;  3LGR A;  4LXL A;  3WUC A;  5K7P A;  4A7K A;  1EAH 2;  1IKP A;  2W0X A;  4ZS2 A;  4CDQ A;  4JCK A;  1S0B A;  3V0B B;  5FZ7 A;  3H3Z A;  5D8A A;  4YNI A;  1RYY A;  2RS5 2;  4HVO A;  4AQ6 A;  3LE0 A;  2ZS6 B;  1O59 A;  1OUS A;  3AKS A;  3CLP A;  4XF1 A;  3VD9 A;  2D44 A;  3PVE A;  1GOH A;  5K0U A;  1WKY A;  1YXW A;  2R0F A;  4LJH A;  1GUI A;  1W8N A;  3V56 A;  4Y4R A;  3ECQ A;  5JIA A;  1RMU 3;  2W87 A;  1RUJ 1;  4NN0 A;  5EHD A;  3FWE A;  3JBG 2;  1SLC A;  2JDU A;  4XUQ A;  2HWF 2;  1BCX A;  2B5H A;  2YFZ A;  4RS5 C;  3N9M A;  2OYZ A;  3T3Y A;  1V6K A;  4NIH A;  2VY0 A;  5DAB A;  4Q0P A;  1LOA A;  4Q4X 2;  3EJK A;  4JZR A;  5CYY A;  3TNP B;  1A34 A;  1HW5 A;  3H9A A;  3SLI A;  4QDQ A;  1DQ1 A;  2A6Y A;  2BEO A;  3T08 A;  1DQ4 A;  3VKL A;  3WW3 A;  4XF9 A;  3MW3 A;  4CP1 A;  2E7Q A;  1FOD 2;  4UFM A;  4YVS C;  1VBD 1;  4HSJ A;  4N43 B;  1FPN 3;  2W92 A;  4D6S A;  3EO6 A;  5JXI A;  2JDH A;  1APN A;  1GQG A;  3EQE A;  5EFU A;  4RGK A;  4AQ2 A;  2B45 X;  1AYM 1;  4S2H A;  3TN9 2;  3ZPY A;  4AF9 A;  4AEM A;  3AK0 A;  5F3G A;  4K40 A;  1ZZB A;  2JWP A;  4LEJ A;  5DAP A;  3IPV B;  3UGF A;  1O6U A;  4IQP A;  3UET A;  3VBS B;  5BNQ A;  4LTA A;  2A1X A;  1NA1 B;  5A3P A;  1HRI 1;  1SFP A;  3WF1 A;  4CRQ A;  4V2W A;  3OBR A;  3WD5 A;  5LW9 A;  4GKY A;  1P8J A;  4Q4Y 2;  2VG9 A;  5CKQ A;  5FBJ A;  5FYT A;  1XE0 A;  2PHT A;  3VBO B;  3U75 A;  3AB0 A;  1Z7S 3;  1I5P A;  2W68 A;  2WZE A;  1CPM A;  3O0W A;  3PVO A;  1KD7 A;  5GKA C;  2RS1 2;  1OD3 A;  3EYP A;  4UBH A;  5I0T A;  4A41 A;  5J48 A;  1QOS A;  4JRL A;  3SQO A;  5J7M A;  1DP0 A;  4PLO A;  4V2V A;  4JAA A;  4Q5O A;  3PDQ A;  4YSF A;  4YG3 A;  4HLT A;  5GM0 A;  2FDI A;  4NE9 A;  2ZAH A;  4QX1 A;  3A0N A;  3KZ4 C;  1JN2 P;  2O8Q A;  3OPW A;  3DXT A;  4XF3 A;  4K1Y A;  4C8D A;  5CKM A;  3ZFG C;  3FLP A;  4J1W A;  3POF A;  2ARB A;  5FO7 B;  3RZG A;  5JR7 B;  5JOW A;  3POG A;  2PHX A;  3RQ0 A;  3CQO A;  4LKS A;  3VDD A;  4QKB A;  1DU3 D;  2P4E A;  4CCJ A;  2QVS B;  1UXX X;  4XYX A;  2ETE A;  4P9L A;  1F9K A;  2UY9 A;  2XVG A;  4GMP 3;  1OBN A;  3GCW A;  4PQQ A;  2G4I A;  2JDA A;  5JSO A;  1B35 B;  4R8H A;  1UZW A;  3OY8 B;  2VUD A;  5L9R A;  2ZX4 A;  2Y0O A;  2RM2 2;  2VW0 A;  4P00 B;  3VHP A;  3SCH A;  1ENS A;  3A21 A;  4MET A;  4CDQ B;  3LDR A;  4DQA A;  4Q8K A;  5D8A B;  3UNP A;  2RMU 3;  5AC9 2;  5ACA 1;  3FE5 A;  2HWE 3;  2R06 2;  2XUM A;  4GH4 A;  3IIA A;  1POV 3;  3GBG A;  1TE1 B;  4XFA A;  2V72 A;  5K0U B;  1W0P A;  3FLR A;  2VXJ A;  2VOV A;  5T50 A;  2Q8O A;  4FFI A;  2NMN A;  4JGZ A;  1VMF A;  1OH3 A;  2RS3 3;  2ZXQ A;  1DCS A;  4RD7 A;  3KHB A;  4XOG A;  2VZ3 A;  5CBL A;  5DAW A;  1CIW A;  1Q8Q A;  1X9P A;  5FMB A;  1VJ2 A;  5A7N A;  5KHH A;  5H9R A;  2ZHN A;  5I0D A;  3SXW A;  1RUE 2;  1QJZ A;  5I93 A;  3RMX A;  5LZ6 A;  3CEW A;  2RR1 3;  5FOJ B;  2RJL A;  2B9V A;  4CDW A;  4NO4 A;  5SV8 A;  4ZZ8 A;  4FTS A;  3ZYB A;  2ZAC A;  3HQU A;  1GFF 2;  5A7Q A;  1S0G A;  3HN1 A;  5GLT A;  3ZFF B;  2W08 A;  3C8X A;  4MHR A;  3M4F A;  3FMG A;  3IBM A;  4HT1 T;  4YLZ A;  4HBN A;  3MIF A;  4FOW A;  3RSJ A;  4LO5 B;  1RUG 3;  1QQP 2;  4BQY A;  4RYD A;  3BKZ A;  1C8N A;  5EIY B;  2IFR A;  4PIZ A;  1XC6 A;  2PTM A;  1LKN A;  1SDW A;  2VMD A;  1LRH A;  1TNF A;  1JI6 A;  1XRU A;  4W65 A;  3III A;  2RDS A;  4AVC A;  3BN6 A;  4U36 A;  5EZW A;  1YYN A;  2LAL A;  2WC2 A;  5T5O A;  3AXE A;  1U5X A;  2WO2 A;  3WV6 A;  1W8Z A;  4QX0 A;  3JQX A;  4ASK A;  4QPI C;  2PAM A;  3T2T A;  3PUH A;  1ZZC A;  3H0O A;  2VQA A;  3MLK A;  3CDZ B;  4OZX A;  4PIY A;  5I0S A;  4Q0Q A;  1L7Q A;  3POE A;  4K21 A;  2W3J A;  3BPZ A;  4P5Y A;  3ZXE A;  5DAQ A;  4YAR A;  4IND A;  5EQU A;  4D69 A;  3LAG A;  2D3P A;  1OPO A;  4UFI A;  2WT2 A;  2N7G A;  3LSD A;  2IXC A;  4PLM A;  4Y5Z 0;  4XTP A;  5ANQ A;  3RVH A;  1YCI A;  3QLQ A;  2J1R A;  4A42 A;  2H6C A;  2VO5 A;  5JWP A;  3Q8E A;  4FAH A;  1ULC A;  3O1U A;  3EBR A;  3WR0 A;  3WP3 A;  5ERL A;  4EN7 B;  1RUD 3;  1VMH A;  4NIG A;  1GU3 A;  1SEF A;  3PJQ A;  3O0V A;  4R9C A;  4DZG A;  5CFD C;  5LCW L;  3DPR B;  4N8M A;  1HRV 1;  1NOV A;  3DEM A;  1XNK A;  4LBK A;  4P08 A;  4Q2F A;  2I74 A;  5CZK A;  1W9W A;  2DCZ A;  1D4M 1;  4LHN A;  4LO7 A;  1E5I A;  2XQR A;  1WD4 A;  5L73 A;  2BGP A;  4HZF A;  5JAX A;  2WA3 A;  3ZXA C;  1BLZ A;  1NLR A;  3BVC A;  1YQC A;  2JX9 A;  1COV 3;  2ZKL A;  4N53 B;  4PDW A;  3J8F 1;  5BNN B;  1GWL A;  1MQT B;  4GAL A;  5FK7 A;  2JEC A;  3INA A;  1B09 A;  2Q8D A;  1MR5 A;  2KM2 A;  3FBY A;  5FPL A;  1IGO A;  2PLV 3;  1HV1 A;  4PHZ A;  4XAB A;  3WNO A;  1OLM E;  1O7F A;  1VRH 1;  3ZR5 A;  4EYU A;  1JBC A;  5KR7 A;  3RDI A;  4Z92 B;  3IMM A;  3PHM A;  3CZU A;  4FFF A;  3BAL A;  1UYZ A;  5C7G A;  2ZGR A;  4K8F A;  4GH4 B;  1BQP A;  4CUA A;  5AVA A;  2MHF A;  1VBB 3;  2E7A A;  2VMG A;  3H42 B;  4JTN A;  1IG3 A;  2NMO A;  4NMI A;  4FO9 A;  3RGB A;  3VBH C;  3ZN5 A;  1JHN A;  1I1E A;  4MOA A;  4R4Z A;  2PMW B;  4BQ1 A;  1UW8 A;  2XHN A;  5LRS A;  3ES4 A;  4NWW A;  4XJZ A;  2DTY A;  5F5I A;  1W90 A;  2GC0 A;  4AED B;  4COW A;  2JG9 C;  2DV9 A;  3UL2 A;  2DCY A;  2AH2 A;  4BJ0 A;  1HLC A;  1ULO A;  5C9A C;  2WNU C;  2Z79 A;  3NST A;  3ZKU A;  2XH6 A;  1AXY A;  1REE A;  5F3E A;  5JI7 A;  2D6O X;  4AEK A;  3IN9 A;  4CPB D;  2Q1F A;  1ULP A;  1RUF 3;  4FXG B;  4HL0 A;  4CDW B;  3KM5 A;  3WHU A;  4YVW B;  2FDK A;  4EZH A;  2G9G A;  2GND A;  1U5Y A;  2W1W A;  3THT A;  3VZM A;  2UUR A;  1RMU 2;  5AVP A;  3AZV A;  1C57 A;  3EMR A;  3T2P A;  2XOM A;  5L7O A;  4JHZ A;  5IVB A;  4WM7 C;  4GUL A;  1FV2 A;  2JDZ A;  4L11 A;  2IUW A;  1C1F A;  2YZ4 A;  3H8U A;  4BK5 A;  1XU2 A;  4NVP A;  2ZAB A;  2ZOE B;  2AZ5 A;  2P1B A;  4NRM A;  3J7H A;  3MW2 A;  1FAT A;  4DY3 A;  1VBE 3;  1YQ2 A;  3D5O A;  1CZT A;  1K3I A;  4K7J A;  4NR1 A;  4RR3 B;  3VZK A;  4B1L A;  1FPN 2;  3DL3 A;  4OQ9 A;  1E5S A;  2HBU A;  2G9Z A;  4X6R B;  1UMZ A;  4LE4 A;  4KL1 A;  3MLL A;  1YNA A;  2IVI B;  3N7M A;  5JSR A;  1MS8 A;  1OQ1 A;  2ZMK A;  4Y1Z A;  3LPF A;  4D7Y A;  1NZC A;  2GNB A;  3LEK A;  1D4V B;  1UO9 A;  4Q1R A;  4Q4W 1;  5FZF A;  1GLH A;  2JG8 C;  4X6Q B;  1LEN A;  2J7M A;  4FP2 A;  4FOY A;  2K46 A;  3A0K A;  5FZ6 A;  3BU7 A;  2P37 A;  2ZGK A;  3CZJ A;  3HT1 A;  1JYI A;  1W28 A;  1KFX L;  2UYB A;  1BKZ A;  1YI9 A;  2LUW A;  3VKO A;  4C91 A;  4QB6 A;  1K5M A;  3N35 A;  3V65 A;  5ABJ A;  5FY8 A;  5FJK A;  4XW3 A;  2VUJ A;  4OVE A;  1XPW A;  1KRI A;  3IDC B;  1W2O A;  4XBQ A;  5F2W A;  3HNB M;  3MO4 A;  1Q8O A;  1Z7S 2;  5A33 A;  5C8C B;  5CNA A;  2Y6J A;  4BK4 A;  2CNA A;  2LM3 A;  1Y3T A;  1IOA A;  5D21 A;  4NUB A;  4UXA A;  4QMA A;  4J6G A;  4ZPI A;  3AJZ A;  2ARA A;  1CVN A;  1JZ4 A;  2WAA A;  3KV6 A;  4ERO A;  1FMD 3;  3VKM A;  4ASL A;  1WCU A;  1N47 A;  1E5R A;  1EPW A;  3OBA A;  1SMV A;  4Q0V A;  2FMY A;  4K1Z A;  1G7Y A;  4QQL A;  4AYU A;  4JDO A;  1DLL A;  3RZH A;  4QD2 A;  2D6M A;  3N7J A;  4LLF A;  3C7O A;  3T2Q A;  1K45 A;  3OGJ A;  2VR4 A;  3B93 A;  5DUU A;  1ZYB A;  5C3S A;  4QPG C;  2HEY F;  4GWJ A;  1F5F A;  4IV1 B;  5B2G B;  3USS A;  2AUY A;  1CAW B;  2VAU A;  2YFU A;  2WA4 A;  3QBQ A;  4CCM A;  1N3O A;  4QXC A;  2HWB 1;  5FR3 A;  3H1Y A;  1MZE A;  4MVT A;  3AP7 A;  4Y5T A;  4KWK A;  2R49 A;  4Y1V A;  5J36 A;  4YGD A;  4IEZ A;  5FK8 A;  3LD8 A;  3AFK A;  1H8V A;  1OFS A;  2OZJ A;  2WS9 3;  1FYU A;  1OQD A;  1H0B A;  3FFQ A;  3UGH A;  3OUI A;  5FXV A;  2RMU 2;  1LOF C;  1W6P B;  4BWO A;  2B42 B;  3NAP A;  2HWE 2;  3NW4 A;  4LOT A;  1JOB A;  3O7O A;  4XMA A;  1UXZ A;  3I2K A;  1ODN A;  4CU6 A;  2UYA A;  3RZJ A;  2DCJ A;  4E9K A;  1G9C A;  4UW6 A;  4UT5 A;  3FFZ A;  3QAC A;  5FZC A;  2UWC A;  2W1U A;  1PO2 1;  2RS3 2;  2DVA A;  4Y33 A;  3SIT A;  3LOB A;  5FKB A;  5L7O B;  5DAX A;  1AJK A;  4QX3 A;  2VOT A;  2FDH A;  5FLH A;  1LCL A;  5FZG A;  1S2B A;  2X10 A;  2GU9 A;  1GWM A;  1ZBE 1;  4A6S A;  5FPA A;  1RB8 G;  1H8T A;  3ACL A;  3KCC A;  4YZ1 A;  2RR1 2;  1SDD B;  4JGY C;  1GOG A;  3QH7 A;  5DQ0 A;  5I8T A;  3VBU C;  3BU0 A;  3JXS A;  1BMV 2;  2CWM A;  1DQ2 A;  1NQD A;  4GIQ A;  5B4X A;  4UOJ A;  4BQ2 A;  4ZON A;  3ATG A;  3H50 A;  4HKO A;  4XIK A;  1MEC 1;  4AI0 A;  4PIX A;  5JUV A;  1JYX A;  2YUE A;  5FLI A;  1W05 A;  5C33 A;  1H30 A;  1DZQ A;  3E5U A;  4AVA A;  1TZO A;  4Z2A A;  1RUG 2;  5EJ3 A;  5C71 A;  4DRV A;  2R1D A;  2YC4 A;  1Z0H A;  3NNF A;  4NHY A;  1KIT A;  1OH4 A;  3HR9 A;  4QPW A;  1AR6 3;  2JE7 A;  2YDE A;  4N9I A;  3ZFE B;  4RSU A;  2DWR A;  2VTF A;  4CU7 A;  1GZT A;  1WCK A;  2A6Z A;  3WF2 A;  1PNG A;  1ND3 C;  4EZ4 A;  2WBK A;  3PMS A;  2IC1 A;  1K5M B;  4P9W A;  4CEY B;  1CAU A;  2BNN A;  5KHK A;  1MZ6 A;  1BBT 3;  1KXG A;  1XSQ A;  1RHI 1;  1OT5 A;  1JZ6 A;  4AI2 A;  1W9F A;  2HWD 3;  2P3I A;  3OBZ A;  3R4D B;  3TBD A;  1CX1 A;  2IXK A;  5E88 A;  2HEV F;  1CQ9 A;  1GZW A;  4OI4 A;  2Y6F A;  2AR6 A;  4LHS A;  1VAK A;  1G9F A;  1NE4 A;  5CG8 A;  3PUQ A;  5FYM A;  4MXW A;  1J58 A;  1IS5 A;  1RUC 1;  1VBA 3;  2W5F A;  2YC2 A;  1LTE A;  3PU3 A;  4BIO A;  1NCR A;  2C6S A;  1D2Q A;  5J98 B;  4AGR A;  4DEV A;  1NXM A;  2E51 A;  3BYW A;  1UD1 A;  1PK6 C;  4KI5 M;  4FPE A;  1KFU L;  1RUD 2;  1QH6 A;  4MV2 A;  3OPZ A;  3DYO A;  1C5I A;  5FXX A;  3C7E A;  5CVR A;  1IS6 A;  2VMI A;  4C1X A;  3RI9 A;  2QDR A;  2Y26 A;  1UY1 A;  1ACC A;  3IDA A;  3I2G A;  2WYF A;  1IPK A;  3T09 A;  2A6X A;  2V4V A;  1GWK A;  2A7A A;  2QQM A;  5IVC A;  4CXY A;  1R1A 1;  3AVS A;  3UES A;  1COV 2;  1QF3 A;  4PQ9 A;  1H6X A;  2WFF 3;  4IV3 B;  1YO8 A;  2W39 A;  4QPY A;  1NYW A;  5FLJ A;  3WP4 A;  4HVQ A;  1O3S A;  3FUO A;  2PLV 2;  5GZF A;  4N90 A;  2YGL A;  3UYJ A;  2X09 A;  4L9B A;  3G7D A;  3SMH A;  3BIE A;  3LDB A;  4YZ5 A;  1I9R A;  3DCQ A;  4OQ8 A;  1W6O A;  5CFC B;  3NAP B;  1V0A A;  3WOG A;  2P34 A;  3H7Y A;  3OOX A;  1VBB 2;  3AYE A;  4BYY A;  1Y9M A;  2ZX3 A;  2VMC A;  2VVF A;  3K51 A;  2XJT A;  3HWJ A;  1NY7 2;  1PGW 1;  3TWI A;  3VBR A;  3O1O A;  5FIX A;  4YZ2 A;  1DIW A;  3LKJ A;  1ZA4 A;  1VBC 1;  2AC1 A;  2VM9 A;  3WNX A;  4CUC A;  2VPV A;  1F5J A;  3AL6 A;  1RUJ 3;  1XNT A;  4QHZ A;  5FMD A;  2XXZ A;  3ST7 A;  2R04 1;  2H0B A;  2OII A;  3FBM A;  1LAJ A;  1HN1 A;  4XFB A;  1LHW A;  1H2K A;  2ORX A;  4BMB A;  1JUI A;  1RUF 2;  4YM3 A;  5GLV A;  3ITQ A;  4RQP A;  1RUI 1;  4Z8B A;  5FPV A;  1DGW X;  1VBD 3;  3ZMO A;  2V73 A;  3BPS A;  4ITC A;  1RVF 1;  2XKP A;  3ZYH A;  1TEI A;  1XYN A;  3ACG A;  3AP4 A;  3LZZ A;  2AAC A;  1WWY A;  2QQL A;  1HB1 A;  1GOF A;  4AWD A;  4MG2 A;  3E1F 1;  2FCT A;  2C26 A;  1KJL A;  1TME 1;  3WQ1 A;  5C5U A;  2B46 X;  3ZSK A;  4LUM A;  1X82 A;  1UAI A;  5FV3 A;  4XUT A;  5C4W B;  5E1R A;  4FOQ A;  4IER A;  4XEZ A;  3WP5 A;  3MFA A;  1VBE 2;  2XBO 1;  1J3P A;  1HRI 3;  1BYH A;  3VD5 A;  2RS5 1;  4IEW A;  2P6C A;  1BHG A;  5DN2 A;  4MYE A;  1UNB A;  3NO8 A;  4LIV A;  4RL7 A;  5BNP C;  1OUR A;  4IUG A;  3VZL A;  1DYP A;  1GV9 A;  4IEO A;  3HQX A;  2DYC A;  2VZP A;  1RC6 A;  2TUN A;  1UOJ A;  3J7M A;  4UW5 A;  3J9S A;  2QQU A;  1EUT A;  2XJP A;  3VD4 A;  1ENX A;  3JBG 1;  5LEJ A;  4PLN A;  4MO3 M;  1IZ3 A;  5LA9 A;  2W52 A;  3RFR A;  2A75 A;  3NV1 A;  1XYO A;  5K4L A;  4AK3 A;  2X29 A;  3IZO A;  1LHO A;  2X8K A;  2A73 B;  4P9Y A;  4Q4X 1;  4XJ8 A;  3S5A A;  4P9G A;  3W5N A;  4RS5 A;  3IM0 A;  4CDU C;  3M2M A;  1GYK A;  2X5I C;  2ATF A;  4BQW A;  1R09 1;  2QQV A;  4AQT A;  4BQ5 A;  5T3N A;  5F6L B;  4XE9 A;  2ZAA A;  3ACI A;  4YVS A;  4QX2 A;  3IAP A;  1LEM A;  2HYK A;  2ZGQ A;  4EN8 B;  3VBF B;  2NP0 A;  2XG3 A;  5IVY A;  5F2S A;  3SC7 X;  4WZF A;  2Z2S B;  3AJY A;  2RV9 A;  1UU5 A;  5E89 A;  1IQA A;  4L99 A;  4OYU A;  1ZZ8 A;  3SEP A;  5FQ0 A;  1W8O A;  1BK0 A;  4XZU G;  1FMD 2;  4Y24 A;  5CEH A;  4C0H A;  2YG0 A;  4AFA A;  4DRR A;  4PBP A;  1VP6 A;  5FPX A;  3BOW A;  2VUL A;  1F2N A;  2SLI A;  3ACF A;  4D8M A;  2VZR A;  2CDP A;  1LOE A;  1JZ7 A;  3KVB A;  2UU8 A;  4MX3 A;  4TN7 A;  5FZ4 A;  5F37 A;  4DUV A;  2ZHK A;  1LJ7 A;  1MPX A;  1RUO A;  2VQU A;  2ZML A;  5ACA 3;  2RS1 1;  1R64 A;  5EPA A;  1JYN A;  3WNK A;  1SBE A;  2WUH A;  3VBR B;  1RED A;  5DG2 A;  5HCH A;  5FY1 A;  2FDJ A;  1ZBA 1;  4UF0 A;  5JPM B;  3NQH A;  4FPG A;  2W1Q A;  4RN5 A;  2PQS A;  4JC1 A;  1N1T A;  4BA6 A;  2WS9 2;  3WW1 A;  4OHY A;  1QOO A;  1MVE A;  4OZO A;  1LHV A;  1W04 A;  2ET7 A;  5GLU A;  2BOI A;  5JMO A;  4B7K A;  5A6Q A;  1U12 A;  3H1W A;  4CCE A;  2QCS B;  3OUH A;  3R4U A;  4LA2 A;  1UWW A;  4XJW A;  4RA0 A;  3JUU A;  1QDC A;  2VL4 A;  2QUO A;  5JXJ A;  2DCK A;  4UFL A;  1DHK B;  1QJU 2;  4Y4Y A;  3WXP A;  3ZFG A;  1VE0 A;  2ZHM A;  1CIY A;  5FZO B;  2XJS A;  3SKV A;  1LOD A;  1FT9 A;  4XZP A;  5J3U A;  2VOX A;  2JKX A;  3N36 A;  4I0W B;  5LAS A;  2ARX A;  2Y6G A;  4EN6 B;  1HXS 1;  1CAX B;  1ZRC A;  3MLJ A;  3BIW E;  1ND2 C;  5DXD A;  2ZA9 A;  2RM2 1;  1RUH 3;  4N43 C;  3OEB A;  1LES A;  1XQN A;  1J83 A;  1UYP A;  2GAL A;  2ZGU A;  3RNS A;  2W46 A;  3R4S A;  1XNC A;  1MAC A;  5DUW A;  5EWS A;  3UKT A;  4UW4 A;  2R06 1;  4XET A;  5LBC A;  2BFU L;  3OCP A;  5FXZ A;  4QQP A;  5LBF A;  3IWZ A;  4AL9 A;  1W6Q A;  1ENR A;  5F3I A;  4OHV A;  5A80 A;  3AKP A;  3WW4 A;  1W6N B;  4TLF A;  1JTZ X;  2CAU A;  2WYS A;  4XDQ A;  5KXE A;  3KQ4 B;  3FUQ A;  2J1T A;  4CEW B;  4LMF A;  3BTZ A;  1AX0 A;  2WNV B;  4SBV A;  1TVG A;  1PGL 2;  1RIT A;  4JQR A;  1JZ2 A;  2OA2 A;  3VBS C;  1KS4 A;  1NA1 C;  1ST8 A;  1AR6 2;  4K9S A;  1T6B X;  2FCU A;  2EXJ A;  1KJR A;  2ZGP A;  4OFG A;  1SBD A;  2D40 A;  4MGT A;  2QQJ A;  2PHD A;  2KA3 A;  1RUE 1;  1W39 A;  4M3C E;  5C70 A;  3K3N A;  4KG8 A;  3C7H A;  4HKW A;  5JIU A;  4GKX A;  1AF9 A;  3VBO C;  2BGO A;  2XML A;  1S2E A;  5IAV A;  1BBT 2;  2XGX A;  3HEI A;  2VBB A;  2HWD 2;  4IEV A;  4LO6 B;  4D7S A;  4Q26 A;  5FYU A;  1UYY A;  4I09 A;  1SCS A;  2JXA A;  3BOD A;  1EY2 A;  4Y20 B;  1OMI A;  3ES1 A;  4HPK A;  3GZA A;  5D2A A;  4YVS B;  3BI3 A;  2JDP A;  4K3U A;  2IFW A;  2PHU A;  1G6N A;  2DVD A;  2JE8 A;  4AI1 A;  4CDX B;  1YWK A;  2F17 A;  4FVV A;  1LU2 A;  1QQP 1;  1OD5 A;  3WDW A;  1TMF 1;  5IHR A;  2EAL A;  2HEW F;  1VBA 2;  1S1A A;  5FCC A;  4E2S A;  3AXD A;  3KWV A;  1AXK A;  1W6M A;  3PUR A;  1X33 A;  2D98 A;  4LHK A;  3RYK A;  3J8F 3;  1J84 A;  3DYP A;  1E57 A;  2WFP A;  5KXC A;  4YW6 A;  4CU8 A;  3JD7 3;  4FFH A;  2FMD A;  5GAL A;  4QGM A;  4Q8L A;  1BJQ A;  3PUA A;  2E63 A;  3MUZ 1;  4LUL A;  2VEC A;  3O1R A;  1VRH 3;  2XJR A;  1O3R A;  2FQP A;  2V5D A;  3ZLI A;  5FYY A;  5F1R A;  3GHN A;  4LLO A;  2VMH A;  5A3W A;  1OF3 A;  1V6N A;  1XND A;  3B9C A;  4MLO A;  4QPI A;  1DFQ A;  5GLW A;  4U2A A;  3MFC A;  1W2T A;  1B35 C;  4QM8 A;  2WFF 2;  2WZR 1;  3NV2 A;  1LEC A;  3Q8C A;  3MHZ A;  4Q1P A;  4Y5S A;  3T0B A;  1EYB A;  1UF2 C;  1BZW A;  1V6L A;  5FMO L;  4YYO A;  4CDQ C;  4CCK A;  2WSV A;  1LHU A;  5FP7 A;  3DV8 A;  2BPA 2;  3HNY M;  1EUU A;  4YRD A;  3FJS A;  3CO2 A;  3O1T A;  4I30 A;  1PZ8 A;  2ZZJ A;  3POB A;  1JOD A;  2HJI A;  4MGI E;  1W8W A;  3VL9 A;  5FZB A;  3VLB B;  3H8X A;  5SV5 A;  1G8W A;  1VR3 A;  5DAV A;  4QX5 A;  3U0Z A;  3PUI A;  3K4D A;  1NUK A;  4GZ9 A;  1RUJ 2;  3U37 A;  3NKG A;  1FNZ A;  4QWN A;  5FAX A;  1QJX 1;  3USU A;  5H9S A;  3ZIX A;  5M0T A;  2DFB A;  1QNW A;  1FAY A;  4RHV 1;  5IK4 A;  3ZMN A;  1QXP A;  1GBG A;  3GDB A;  4IE7 A;  2QDN A;  2BYV E;  4ZXE A;  5JOZ A;  3ZXG A;  4QT6 A;  2Q1Z B;  4ES9 A;  1WMF A;  4AXO A;  2VE1 A;  3ZFF C;  3N4M A;  2ZJC A;  4O9G A;  1WW6 A;  5FYB A;  2FBE A;  1VBD 2;  2XJU A;  2ZZQ A;  3TYJ A;  4KGQ A;  2A6V A;  1C8M 3;  1T2X A;  4A3X A;  5L9V A;  1AJO A;  1CJD A;  2BVV A;  1SLT A;  4BU2 A;  1O8P A;  3AMP A;  1IQD C;  3VBH A;  4COU A;  5EYX A;  5A7W A;  1XE7 A;  1R08 1;  3WW2 A;  3MYX A;  2BFU S;  1PVC 1;  4L8Q A;  4EN9 B;  1H4H A;  5L19 A;  4Q4W 3;  3SHR A;  5CAZ A;  4ZU7 A;  3J26 N;  1SLI A;  1W8U A;  2JG9 A;  2VUC A;  3RJ2 X;  2JEM A;  1HRI 2;  5FUI A;  1ZX5 A;  5C9A A;  3K4Z A;  2WNU A;  4FFG A;  2JKB A;  4G3Y C;  2QQI A;  4RGA A;  4RFR B;  4WM8 A;  4CCL A;  4BQ4 A;  2BZD A;  4E8D A;  5LA1 A;  3EHK A;  1Y4W A;  4HPK B;  5FPZ A;  4LO4 B;  5LY1 A;  1OA4 A;  1ULF A;  3HBK A;  5DZG A;  4C90 A;  5ANN A;  4ARX A;  1UL9 A;  2YBK A;  4ISR A;  1G86 A;  2YV8 A;  2BV4 A;  3OD0 A;  5HV0 A;  1DQ6 A;  4LQR A;  5F9T A;  1S55 A;  5FKC A;  5E8A A;  2X05 A;  5BY5 A;  4QHB A;  4Z1V A;  2JB4 A;  4QX7 A;  4OHZ A;  4B8E A;  3CU7 A;  1D0G A;  2IZW A;  1J1T A;  2X53 S;  1W6M B;  3NL1 A;  3V64 A;  3S7E A;  4WM7 A;  4A3Z A;  2VZQ A;  1PM7 A;  3HT2 A;  3B69 A;  3DPR C;  1FPN 1;  2Q8C A;  3U4X A;  3TEZ A;  1QJY 3;  3HNM A;  2DFC A;  3WF4 A;  4K20 A;  4O61 A;  4IET A;  3LEI A;  4ONU A;  4CCO A;  1VAM A;  4QQ2 A;  3S7I A;  2DTW A;  2GC1 A;  3NNJ A;  4BXS V;  2P2K A;  1GSL A;  1C4R A;  1HB2 A;  4AVS A;  5JLV A;  3M3C A;  3VD7 A;  2WO7 A;  3HD8 B;  1MS1 A;  4N53 C;  2VTX J;  5BNN C;  2FDG A;  1DGW A;  1MQT C;  1U0A A;  1AYN 1;  3VDD B;  4JX0 A;  1WW5 A;  2WO3 A;  5FRA A;  2J1V A;  4GA9 A;  2HWB 3;  1BEV 3;  3BTA A;  3WDX A;  4Y3O A;  3WG1 A;  3WDT A;  4W4Z A;  3ABZ A;  1ENQ A;  1ZZ9 A;  4OCT A;  4FXK B;  3LF7 A;  4KGG A;  4WVW A;  3AKQ A;  2JG8 A;  2EID A;  1QOT A;  1LOB A;  3N9P A;  5JVV A;  1SPP A;  4GH4 C;  3AYA A;  1UQX A;  3ENR A;  5FZ9 A;  3KQR A;  2QKD A;  4EV0 A;  1ZVF A;  2R07 3;  3ZXL A;  5ACA 2;  5IWF A;  5H9P A;  2YC0 A;  2YXS A;  5KXD A;  3L2Y A;  3QOP A;  3CJI A;  3X29 B;  4AED C;  1YFX A;  5E16 A;  3RS6 A;  1XB9 A;  4JV4 A;  3PVB B;  5BXX A;  4BLJ A;  4Y22 A;  1AL2 3;  2O8O A;  4JGZ B;  1DZR A;  3I3M A;  1GKB A;  1ODM A;  3JZV A;  4E8C A;  4NWV A;  3LQC A;  4BQ3 A;  1HJF A;  3P5B A;  3VZN A;  1FV3 A;  1WCQ A;  1IG0 A;  2MEV 3;  1UPI A;  3P3N A;  2VC9 A;  3VHN A;  5C3P A;  1N3P A;  1YQ6 A;  2W91 A;  4CDW C;  1ZBE 3;  4KQ7 A;  4OUS A;  1O8S A;  1QGL A;  2WN3 A;  4YVW C;  5T54 A;  3SH5 A;  2PAK A;  2LTN A;  1EV1 1;  2YGM A;  4M3C A;  3MI8 A;  1PMI A;  1DDL A;  1LHN A;  3DUI A;  1N1V A;  5T5L A;  4XIO A;  1MS9 A;  3OGR A;  4R4X A;  4BQX A;  4AVT A;  4XQD A;  2W47 A;  4NID A;  2CY6 A;  1UU4 A;  2OQ6 A;  2PAE A;  1H2L A;  2Q5T A;  1MEC 3;  4AHY A;  1ZRD A;  2J1E A;  2PHL A;  4DB5 A;  2WR9 A;  1AR8 1;  5LK7 B;  2C9A A;  1VAV A;  4IW3 A;  3SNM A;  3AP5 A;  1GAN A;  4PJY A;  5KXB A;  4BOW A;  3KV5 A;  4FAG A;  1D0H A;  1LR5 A;  3ASI A;  1RUH 2;  2XLG A;  4Q29 A;  2PXJ A;  4RR3 C;  5FWJ A;  4W50 A;  2H6B A;  1FXZ A;  2VNR A;  4YPJ A;  3D0J A;  2JG9 B;  2TEP A;  3KF5 A;  1S0C A;  2HWE 1;  2WQ4 A;  3LEM A;  4KBZ A;  2NLR A;  4COY A;  5HBA A;  2PFW A;  3R05 A;  3FHI B;  2FZ2 A;  1H4G A;  5FY0 A;  2VZU A;  4WM8 B;  2A3X A;  2BQP A;  2ET1 A;  3MPB A;  5DG1 A;  1ZRF A;  2ZBJ A;  1RHI 3;  3P6B A;  3NKT A;  4P5H A;  1LOF A;  1PX3 A;  1LU1 A;  5FZD A;  4A6O A;  2HWC 1;  4LE3 A;  2WWS A;  4IEX A;  1CGP A;  4HK8 A;  4IEQ A;  4YGE A;  5GZD A;  1GQH A;  1YQ5 A;  1YFW A;  3T4H B;  1JHJ A;  2YU1 A;  1JW6 A;  3OGG A;  1WBF A;  4YM2 A;  2J1S A;  4CSW A;  2DVB A;  4HET A;  4R9D A;  3KT1 A;  4XAC A;  5HCB A;  2ADD A;  4D3W A;  4UFJ A;  2DCT A;  1RUC 3;  3WCR A;  1OLR A;  3C2U A;  4F7Z A;  5HPO A;  1BMV 1;  4KU7 A;  4IE4 A;  1OHF A;  5FYH A;  4QKD A;  1WW7 A;  3RWN A;  5C8C C;  4JGY A;  5CU1 A;  4S2D A;  3VBU A;  1PM4 A;  4D7T A;  1RGS A;  3T0D A;  2PA7 A;  4IL7 A;  2GH8 A;  5FUN A;  5GZC A;  3RI8 A;  2FZ1 A;  2KR2 A;  2NQY A;  4IEY A;  4X8P A;  3VV1 A;  4BB3 A;  1NLS A;  2JDM A;  1ZZ7 A;  2YHJ A;  4DUW A;  1UMH A;  1LB2 A;  1FX5 A;  3MV1 1;  3WQ0 A;  2R6Q A;  4PDW B;  4ES8 A;  4GXL A;  4B1M A;  3HBZ A;  1CAV A;  3JD7 2;  5GZE A;  5FDB A;  3C7F A;  1O3T A;  2QQO A;  4K6B A;  4IV1 C;  5FZ3 A;  1SPP B;  1S0F A;  5IAX A;  5FZL A;  3OYW A;  1JU4 A;  1ND3 A;  2QBX A;  3KT7 A;  2PN5 A;  3KLS A;  1VRB A;  1VRH 2;  2VTX A;  2WIN B;  3GGL A;  4COV A;  1L7R A;  4W8J A;  2Z69 A;  1CPN A;  1SAC A;  5FP9 A;  5ISL A;  3GNE A;  4JKK A;  4HG6 B;  5FO8 B;  3CJI B;  2LW8 A;  1QNY A;  4JDM A;  4P9X A;  1A8D A;  2AEY A;  4CVU A;  4OUE A;  1JUH A;  5FJH A;  1XSR A;  2JIG A;  4KH9 A;  1ZRR A;  1C1L A;  2HYX A;  1VBC 3;  2J22 A;  2VH9 A;  4LK7 A;  1BVP 1;  2GSY A;  3A7Q A;  1Q8V A;  4R9A A;  5FZH A;  4B4P A;  3URF A;  4JRA A;  4XF4 A;  1LGC A;  2AYH A;  3LEG A;  3WG3 A;  3O1M A;  1W9S A;  1PIV 3;  2R04 3;  2Y8K A;  3OEA A;  4GWI A;  1HDK A;  1M4W A;  1AHS A;  2G1M A;  1WCS A;  4IE5 A;  4NPR A;  4XAE A;  4YW1 A;  4H14 A;  3WUD A;  4ATF A;  5IYY A;  2Y34 A;  3THC A;  2ZX0 A;  1ASJ 1;  1PK6 A;  3WDV A;  3DEC A;  5IFT A;  3PTY A;  4YG0 A;  1GP4 A;  4BIS A;  2OX0 A;  3AFG A;  1UOF A;  1V6J A;  2CYF A;  4AE2 A;  4Q4X 3;  5FPB A;  5JCT A;  1X50 A;  3CBN A;  1QXR A;  1RVF 3;  1W06 A;  1XBF A;  2DVF A;  1COV 1;  2G19 A;  4NHX A;  4O65 A;  5T52 A;  3RG0 A;  5APA A;  1F35 A;  5IK5 A;  1CWP A;  5IVF A;  2GC2 A;  2OPW A;  3K4A A;  3BTY A;  4FSJ A;  1OOP A;  3H7J A;  5KHG A;  5KWR A;  3VHO A;  4DIN B;  3MIG A;  1CZS A;  1FNY A;  2K9Z A;  1HX6 A;  3RRD A;  3M3E A;  1UX7 A;  3UJO A;  4E4S A;  2Y6H A;  1DG6 A;  4XIL A;  3KD4 A;  1QHD A;  2YPJ A;  5FZ1 A;  3ZXK A;  4AVB A;  4Q0S A;  3ILN A;  2XBO 3;  4SLI A;  1QJF A;  1C8M 2;  2Q8E A;  3ZSJ A;  1D7P M;  1NY7 1;  1Y9Q A;  2W95 A;  1OUX A;  4O9E A;  3LCP A;  2GN3 A;  3ZFE C;  4PF5 A;  2BNM A;  2W2I A;  1AR7 1;  1CZV A;  1DZT A;  4M4R A;  3NJV A;  4FPY A;  4ZXK A;  1DGR N;  2VW2 A;  3JCI A;  2JB8 A;  3KSC A;  4Q4W 2;  1K5M C;  4ASM B;  5DDJ 3;  4CEY C;  5C3O A;  4DS0 A;  2FHR A;  5HCF A;  2RHP A;  4LBJ A;  4CUG A;  4YZ4 A;  1OQE A;  3PU8 A;  1QKQ A;  2DU1 A;  3FN9 A;  5A3U A;  2NYY A;  2UY8 A;  3PLQ A;  5ABJ B;  1AL0 G;  2IXI A;  3ZYJ B;  2D6L X;  1H1A A;  1V9U 3;  5FWE A;  3ZYF A;  2LS6 A;  3NNM A;  1R09 3;  2HBT A;  1OKO A;  2E6V A;  4PI0 A;  1OLM A;  1WLW A;  2QNK A;  2BU9 A;  2CU5 A;  2VOK A;  3GZE A;  5BYN A;  5LEK A;  5F5A A;  2ZX2 A;  2CHH A;  1IS4 A;  3MGU A;  4C1W A;  3CNA A;  5A33 B;  3W5M A;  2GMM A;  4XAA A;  3BCW A;  3OF1 A;  1IS3 A;  2VCC A;  3MZH A;  4P02 B;  1F15 A;  2Y60 A;  2JEN A;  4FI9 A;  4MGZ E;  3ALQ A;  3I59 A;  4XFF A;  4Q4V 1;  3T1L A;  4FPK A;  1O4Y A;  5F32 A;  3MIH A;  5A7O A;  4WBB A;  1QJY 2;  3B3Q E;  2VNO A;  1Y43 B;  2VME A;  2O1Q A;  4J25 A;  4PT6 A;  1PZ9 A;  3ACH A;  3RJR A;  1SFY A;  2R1B A;  5FY5 A;  5FYZ A;  5BNP A;  4IV3 C;  4CTE A;  4LIT A;  2DVG A;  3BB6 A;  4DEQ A;  1H2M A;  2YY1 A;  2P6H A;  3ZYG A;  2HWB 2;  1BEV 2;  2I2S A;  4GAZ A;  4NHL A;  3AZY A;  2ZPX A;  1NLQ A;  2B39 A;  1ZZ6 A;  2RG4 A;  1ZBA 3;  1YFY A;  4IGQ A;  4QXB A;  1WZX A;  1H9P A;  3U10 A;  4LT5 A;  1IHM A;  3IDE A;  2XON A;  5GZG A;  5CFC C;  2JJ6 A;  2OXB A;  1CJP A;  1EP0 A;  4EWD A;  1DBN A;  3A23 A;  4EWE A;  3MDP A;  4HN1 A;  5HV4 A;  1NT0 A;  1HN0 A;  3D6E A;  1A3K A;  2MPF A;  2QJV A;  1KQR A;  3Q8B A;  2R07 2;  2X5I A;  1PK6 B;  1RIN A;  4CP0 A;  5A3L A;  4AFC A;  4AI3 A;  3OB8 A;  2VD7 A;  2C4X A;  3WDU A;  1OF4 A;  2QE3 A;  2OT7 A;  1AL2 2;  3WNL A;  1ZA7 A;  3K77 A;  5KBF A;  2UWB A;  1YQ8 A;  4XHB A;  1URX A;  1UCX A;  2EF6 A;  2MEV 2;  4QDS A;  4CA9 A;  4WVM A;  1OOP B;  3G6J B;  1AR9 1;  1R1Z A;  2DUQ A;  3N3H A;  4A2U A;  5HXM A;  5JZG C;  1ZBE 2;  5BV6 A;  1HXS 3;  4YW7 A;  2CWS A;  1H8T B;  3ZXJ A;  2F6B A;  2P3K A;  4L97 A;  4GB3 1;  4LBQ A;  4LBL A;  4YW5 A;  2Z5W A;  1UKG A;  1S4C A;  1W2N A;  2RDR A;  3ZR6 A;  4LBN A;  3KV4 A;  4NPL A;  4QGN A;  4AR2 A;  2JIC A;  1WW4 A;  1UX6 A;  3E5Q A;  3J7L A;  2DBN A;  4BXF A;  4BIF A;  1MEC 2;  5FBZ A;  2OS2 A;  4QXH A;  1H2N A;  5C4W C;  4I3G A;  3VKF C;  4Y1Y A;  1STM A;  2WS9 1;  3I2F A;  1AYM 3;  1QDO A;  2E9Q A;  3LA3 A;  3VL8 A;  5J1X A;  5DZF A;  1PO1 1;  1XNB A;  3HQR A;  1L3J A;  4WZC A;  3HVD A;  1EAH 1;  5JPN B;  1C5H A;  1HKD A;  1QU0 A;  4KBB A;  5LBE A;  2BRT A;  1G9A A;  1CAU B;  1H6Y A;  3WP6 A;  5JOX A;  4YG6 A;  2ILM A;  2GH2 A;  1PMH X;  1RHI 2;  4F8A A;  5FZK A;  3H8O A;  1JOJ A;  1QJU 1;  1YIF A;  1S0E A;  1SLB A;  3HJR A;  4I02 A;  4LO8 A;  1VAL A;  3F2Z A;  3VGI A;  1GZW B;  5FYC A;  4G4F A;  1DF0 A;  4OI0 A;  2DF7 A;  1RL3 A;  2HWF 1;  1US3 A;  1OI6 A;  3ETQ A;  5HXV A;  4S2F A;  2OW4 A;  1TMF 3;  2JDK A;  2OUH A;  4MXW B;  1RUC 2;  3CJX A;  5BNO C;  2EVX A;  4WVV A;  4AFM A;  1AZD A;  1NCR B;  3CKH A;  3LWC A;  2BUK A;  3HOB A;  5EJZ B;  1FOD 1;  1ND2 A;  4XUR A;  3UK9 A;  4N43 A;  3VBF C;  3RZK A;  2XLF A;  1OSG A;  1NCQ C;  4H7M A;  5A32 A;  3MBW A;  5FY4 A;  2BOJ A;  2OZ6 A;  1WLC A;  3B5L B;  4N7U A;  5KHJ A;  3I54 A;  4DXS A;  2XVK A;  3TN9 1;  3ZYP A;  4AFB A;  1O5L A;  2PHF A;  2BWC A;  3K75 B;  4HK9 A;  3IPV A;  2KD7 A;  2ZGL A;  3LB9 A;  4XMI A;  4YW4 A;  4YFZ A;  3T1M A;  2WZR 3;  4NAO A;  3VBS A;  4CP9 A;  3VZJ A;  3H3L A;  1NA1 A;  1GZ9 A;  1WD3 A;  2E33 A;  1BBT 1;  2HH9 A;  2HWD 1;  2CL2 A;  4XBN A;  1QEX A;  4Q4Y 1;  4XUP A;  1MVQ A;  5A1L A;  3W59 A;  2Y0I A;  5FO9 B;  1W6O B;  4GQ7 A;  1I3H A;  1F4A A;  4B4Q A;  2Z42 A;  3T0A A;  4XJU A;  5DMY A;  1X7N A;  1KGY A;  3VB9 A;  1RIR A;  2WWJ A;  1PGW 2;  4LNV A;  4WV8 A;  2F4L A;  1XOY A;  4D0Q A;  3PME A;  4W6W A;  1VBC 2;  4JHT A;  5CG9 A;  2GNT A;  1JXN A;  4PF1 A;  3ETP A;  1AUY A;  2ZEX A;  1QJX 3;  1HIX A;  2ZGN A;  3AMQ A;  1UZV A;  4QGL A;  4A44 A;  4F3J A;  5A6Y A;  1PIV 2;  2DUP A;  2R04 2;  2W9X A;  3QCW A;  5LA0 A;  3NWK A;  1RJ7 A;  4RHV 3;  5G05 L;  1QJE A;  2C9K A;  1MS4 A;  3FC0 A;  5FXW A;  1LNS A;  2G9F A;  4RQP B;  4E27 A;  2BP6 A;  2IWG B;  2XHK A;  3AKR A;  1YLL A;  3DKW A;  2JDY A;  4XDO A;  2WZP P;  1I6X A;  1RVF 2;  3ZOI A;  3N9O A;  1DGR A;  4ET7 A;  1NG0 A;  2WFF 1;  4L2N A;  3GBW A;  3WEZ A;  1SQ4 A;  4B3N A;  3LIH A;  4GMP 0;  4LHL A;  3T30 A;  3SKJ E;  3D82 A;  4LKD A;  3AMM A;  1B35 A;  4XXA A;  1R08 3;  4FBF A;  5A1F A;  3OY8 A;  3GAL A;  1PVC 3;  1W99 A;  4AQS A;  2VZT A;  1VMJ A;  3I3Q A;  5LBB A;  4A7Y A;  4FTE A;  3LDK A;  3KMH A;  1FI2 A;  3T4V A;  5EJ1 B;  1AX1 A;  1NQJ A;  1XYP A;  3O1S A;  5FMC A;  2EIE A;  2XBO 2;  2NN8 A;  4MGY E;  1K12 A;  1POV 0;  4NRO A;  3R6S A;  5AC9 1;  4CEW C;  1QXJ A;  1UOG A;  1GR3 A;  2CSG A;  2WNV C;  3E6B A;  1SFN A;  3L2H A;  3NNG A;  4FP3 A;  4XXP A;  5A3N A;  1LOG A;  2XR4 A;  3LIG A;  3RZZ A;  3D4K A;  2BBA A;  2BGC A;  2VXR A;  2OVU A;  4QU2 A;  2NPI A;  3GXU A;  3POI A;  4FPF A;  1UZY A;  4MUV A;  4XCA A;  1XXN A;  3SH3 A;  4JDN A;  1YI7 A;  4BZ4 A;  1S2K A;  4D94 A;  2IVJ A;  2XJV A;  3HIF A;  4PI2 A;  5DDJ 2;  1C3H A;  3FLT A;  2VZ1 A;  2O0O A;  3KGL A;  4QQO A;  3WCS A;  3WT3 A;  4CZS A;  3VZO A;  3AZX A;  5A6X A;  4A4A A;  4AHX A;  5A7P A;  1JS9 A;  4B29 A;  5I8Y A;  4TTG A;  5KC6 A;  3FL7 A;  4LUK A;  4RS5 B;  2TBV A;  4IEU A;  4XUO A;  5FYS A;  5GLZ A;  3S30 A;  1ND2 B;  1BXH A;  1V9U 2;  3GCX A;  4LK6 A;  5JXH A;  2OPK A;  1R09 2;  4CDX C;  4UBG A;  2VOW A;  2CAV A;  3F95 A;  2QTW B;  5DPN A;  3O1P A;  3ZFF A;  1W03 A;  2CGO A;  5I91 A;  1PVX A;  1IPS A;  1MS5 A;  5I0R A;  4OI2 A;  4CXW A;  3ZYR A;  1HRV 3;  4M01 A;  4XUN A;  4HMZ A;  3W20 A;  1D4M 3;  1AYN 3;  3OGS A;  1JYC A;  3ZXD A;  2WKK A;  4TZD A;  4EE2 A;  5FQ0 B;  4MHU A;  4CP9 B;  3KHC A;  4HSL A;  3MF9 A;  4DMI A;  1SCR A;  2YYO A;  2ADE A;  3I49 A;  3ZN6 A;  1JYW A;  2QQP A;  1GP6 A;  4B4R A;  1QWR A;  1YIP A;  2OKX A;  3M3O A;  2VCM A;  4UFH A;  3UJQ A;  3ZSM A;  4URT A;  4DOU A;  1BK1 A;  4ZHN A;  1W2U A;  2BNO A;  1U5I A;  1UMI A;  4XC9 A;  3MUY 1;  2VCA A;  1OKQ A;  1UY2 A;  2JDN A;  1J59 A;  3D0S A;  3CHX A;  2GZW A;  4JVA A;  5FY9 A;  1UZZ A;  2WAO A;  4CXX A;  4X8N A;  2ZEZ A;  1ZBA 2;  4UF0 B;  4XFG A;  1WLT A;  1MS0 A;  5I8S A;  4Z07 A;  4LA3 A;  3I2J A;  4W6Y A;  3WG4 A;  4CE8 A;  1JYT A;  4IGO A;  1CES A;  5K9Y A;  2B7Y A;  1DLC A;  1UU6 A;  5D8A C;  4YW2 A;  1N1Y A;  3THP A;  3KGZ A;  5EYY A;  2XVL A;  2QZ2 A;  5K0U C;  3DXU A; 
#chains in the Genus database with same CATH homology
 3I97 A;  2J1E A;  2VTF A;  4CU7 A;  3WF2 A;  1GNY A;  1XNA A;  5IJR A;  2WBK A;  4W50 A;  1OT5 A;  2WDB A;  4YPJ A;  2QQN A;  1CX1 A;  4QB2 A;  2VQT A;  4UAP A;  4ZZ5 A;  2VZU A;  3VDC A;  4LHS A;  3P6B A;  4TXW A;  1PX3 A;  4A6O A;  2W5F A;  2YC2 A;  3ZM8 A;  1JHJ A;  4DEV A;  2W1S A;  2E31 A;  2WZ8 A;  2J1S A;  4KI5 M;  2WN2 A;  4DUX A;  2RVA A;  3DYO A;  1JZ5 A;  3C7E A;  5HPO A;  1UY1 A;  3I3E A;  3IDA A;  3I2G A;  1UY0 A;  3I2H A;  3T09 A;  2WAB A;  3FHA A;  3FHQ A;  2V4V A;  2XQX A;  2QQM A;  1JYV A;  3UES A;  2JD9 A;  3T0D A;  1H6X A;  3WNP A;  3LPG A;  4DXR A;  1UY4 A;  2W94 A;  4MGS A;  4DUW A;  1RYY A;  1UMH A;  3HN3 A;  2X09 A;  3LE0 A;  3MV1 1;  1O59 A;  3VD9 A;  1GOH A;  1WKY A;  1GUI A;  1W8N A;  3C7F A;  3ECQ A;  2QQO A;  2W87 A;  3BGA A;  1JU4 A;  2QBX A;  4XUQ A;  2VMC A;  3GGL A;  2YFZ A;  1L7R A;  4W8J A;  2VM9 A;  4CUC A;  4JKK A;  5CYY A;  4HG6 B;  2LW8 A;  2ID4 A;  1XNT A;  4QDQ A;  4CVU A;  3T08 A;  4OUE A;  2Z4F A;  2J22 A;  2HYX A;  1HN1 A;  2ORX A;  2W92 A;  3A7Q A;  5JXI A;  3LEG A;  1W9S A;  2Y8K A;  3OEA A;  4XUN A;  4GWI A;  2Y64 A;  5IYY A;  3ACG A;  3THC A;  2QQL A;  5IFT A;  1GOF A;  3UET A;  3DEC A;  3E1F 1;  2C26 A;  3IAQ A;  3WF1 A;  4XUT A;  1P8J A;  4UI9 L;  2ZEY A;  3K4A A;  3WQB A;  3OGV A;  5F7U A;  3VD5 A;  1CZS A;  1UY3 A;  4KMQ A;  1BHG A;  5DN2 A;  3I3B A;  1I5P A;  2WZE A;  1UX7 A;  2CDO A;  4IUG A;  2Y6H A;  1OD3 A;  3EYP A;  2VZP A;  2J1A A;  1EUT A;  3VD4 A;  4A41 A;  1DP0 A;  1D7P M;  2W95 A;  4MO3 M;  1CZV A;  3W5N A;  4QX1 A;  4M4R A;  3NJV A;  3FN9 A;  3K46 A;  3CQO A;  4LKS A;  4QB1 A;  1DYO A;  3ACI A;  4QX2 A;  3IAP A;  4A45 A;  2LS6 A;  1UXX X;  2RV9 A;  4PQQ A;  2JDA A;  4OYU A;  3W5M A;  3SEP A;  1W8O A;  4XZU G;  3EB7 A;  2VCC A;  2YG0 A;  4P00 B;  3A21 A;  2ZEW A;  4P02 B;  3C7G A;  3UNP A;  4FI9 A;  3A22 A;  3ACF A;  4CU9 A;  2VZR A;  2CDP A;  4D8M A;  2VZO A;  5G04 L;  1JZ7 A;  1KEX A;  2V72 A;  4DUV A;  2J1U A;  2VZS A;  2BER A;  1MPX A;  2VQU A;  2ZXQ A;  2E32 A;  1R64 A;  2VME A;  1JYN A;  4PT6 A;  3WNK A;  2VZ3 A;  2WUH A;  3ACH A;  4MAD A;  4AG4 A;  4BDV B;  3NQH A;  5I0D A;  4DEQ A;  2W1Q A;  4RN5 A;  2PQS A;  2Y6K A;  4CUB A;  4OZO A;  2B9V A;  4XVH A;  4ZZ8 A;  5JMO A;  4M4P A;  4ARY A;  1SHW B;  2XON A;  3C8X A;  1K42 A;  1UWW A;  3A23 A;  3D3A A;  2VL4 A;  4KWU A;  5JXJ A;  3THD A;  2DCK A;  4RYD A;  5EIY B;  1CIY A;  3SKV A;  1XC6 A;  2RJ2 A;  2VMD A;  3HPN A;  3OB8 A;  1JI6 A;  2JKX A;  2C4X A;  2Y6G A;  3III A;  1OF4 A;  1UZ0 A;  3BN6 A;  3WNL A;  3K77 A;  2WO2 A;  3OG2 A;  3OEB A;  4QX0 A;  1J83 A;  4QDS A;  3PUH A;  2B4K A;  2W46 A;  5HXM A;  1PMJ X;  3CDZ B;  1L7Q A;  2W3J A;  4P5Y A;  2WYS A;  3I3D A;  2J1T A;  2ORZ A;  3SEE A;  1TVG A;  3VDB A;  1JZ2 A;  2J1R A;  4A42 A;  2VO5 A;  2QQJ A;  1PX4 A;  4QDR A;  5C70 A;  3C7H A;  1GU3 A;  3I2F A;  2BGO A;  5LCW L;  5J1X A;  2EIC A;  3HEI A;  5CZK A;  3CIH A;  4P08 A;  2Y6L A;  1W9W A;  2HLE A;  1UYY A;  1GMM A;  2VMF A;  2BGP A;  1H6Y A;  1US2 A;  4OMD A;  1PMH X;  2JE8 A;  3CMG A;  2VCB A;  5IHR A;  3HJR A;  3AC0 A;  3F2Z A;  3WNO A;  1W9T A;  1US3 A;  1J84 A;  3CZU A;  3DYP A;  1UYZ A;  5C7G A;  4CU8 A;  4CUA A;  1JZ6 A;  3CKH A;  1UYX A;  3MUZ 1;  4MOA A;  3HOB A;  5EJZ B;  2V5D A;  2XHN A;  4XUR A;  3T2O A;  1OF3 A;  3MBW A;  4BJ0 A;  1ULO A;  4JKM A;  4DXS A;  3VD3 A;  3T0B A;  2WQ8 A;  1ULP A;  3K75 B;  2KD7 A;  3HNY M;  1EUU A;  2E33 A;  2W1W A;  4LPL A;  3T2P A;  2XOM A;  4JHZ A;  4XUP A;  1JU3 A;  3IB3 A;  3PUI A;  3K4D A;  1F4A A;  3T0A A;  4BK5 A;  1NUK A;  4GZ9 A;  5DMY A;  3U37 A;  5JXG A;  1KGY A;  3J7H A;  1YQ2 A;  4D0Q A;  1CZT A;  1K3I A;  3GDB A;  4PF1 A;  3ETP A;  4ZXE A;  5IFP A;  2ZEX A;  4A44 A;  4JKL A;  2W9X A;  3LPF A;  5LA0 A;  3LEK A;  5G05 L;  2C9K A;  4OMC A;  1T2X A;  1LNS A;  2J7M A;  1O8P A;  1GQP A;  3CZJ A;  1IQD C;  3WNN A;  3MV0 1;  5LA2 A;  1NKG A;  4QB6 A;  4ET7 A;  3WEZ A;  3WF3 A;  2L9L A;  3SKJ E;  3NRU A;  2R7E B;  1XPW A;  5FUI A;  2DDU A;  4DXT A;  3HNB M;  3K4Z A;  3MO4 A;  1W99 A;  2VZT A;  2QQI A;  1SG3 A;  2BZD A;  2Y6J A;  5EJ1 B;  4BK4 A;  4E8D A;  5LA1 A;  2EIE A;  3VDA A;  1TG7 A;  1K12 A;  2VJX A;  3NNG A;  1JZ8 A;  4ARX A;  1JZ4 A;  4LQR A;  2WAA A;  2BBA A;  2X05 A;  5B4N A;  1F4H A;  2E26 A;  3GXU A;  3OBA A;  1JZ3 A;  1W0N A;  3C7O A;  3T2Q A;  1K45 A;  3DYM A;  4A3Z A;  4ZY9 A;  2VZQ A;  2VR4 A;  2VZ1 A;  4GWJ A;  4A4A A;  1NX9 A;  4TTG A;  4MGQ A;  2YB7 A;  3HNM A;  2YFU A;  3WF4 A;  3FL7 A;  3LEI A;  4XUO A;  3I2I A;  4BXS V;  3GM8 A;  5JXH A;  3VD7 A;  3WNM A;  5DPN A;  4JX0 A;  2WO3 A;  4AAX A;  2J1V A;  4W4Z A;  3ABZ A;  2EID A;  3OGS A;  1UXZ A;  3I2K A;  4CU6 A;  3P1I A;  2DCJ A;  2WO1 A;  5A1A A;  2VZV A;  1JYW A;  2W1U A;  3WSO A;  2OKX A;  4QX3 A;  2VOT A;  4L0P A;  2X10 A;  4QAW A;  1UMI A;  3MUY 1;  2VCA A;  4E8C A;  1NAE A;  1UY2 A;  3LQC A;  5JR2 A;  1SDD B;  1GOG A;  5DQ0 A;  1WCQ A;  2EIB A;  2VC9 A;  2WAO A;  3WF0 A;  2W91 A;  3JXS A;  2QQK A;  2ZEZ A;  1O8S A;  5B4X A;  2WN3 A;  4UOJ A;  3I2J A;  5JUV A;  1JYX A;  1DLC A;  3OGR A;  3NJX A;  4Z2A A;  5C71 A;  2W47 A;  2YC4 A;  4QPW A;  1OH4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...