4Q4V2

Crystal structure of coxsackievirus a24v
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
264
structure length
264
Chain Sequence
b'GYSDRVRQITLGNSTITTQEAANAVVAYGEWPSYLDDKEANPIDAPTEPDVSSNRFYTLDSVQWKSTSRGWWWKLPDALKDMGMFGQNMYYHYLGRSGYTVHVQCNASKFHQGALGVFAIPEYVMACNTEAKTSYVSYVNANPGEKGGVFDNAYNPSAEASEGRKFAALDYLLGCGVLAGNAFVYPHQIINLRTNNSATLVLPYVNSLAIDCMAKHNNWGLVILPLCKLDYAPNSSTEIPITVTIAPMFTEFNGLRNITVPATQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coxsackievirus capsid protein VP1
molecule tags Virus
publication title A sialic Acid binding site in a human picornavirus.
pubmed doi rcsb
total genus 61
structure length 264
sequence length 264
ec nomenclature
pdb deposition date 2014-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4q4v200
1AR63 5BNPC 4IV1B 1VB4A 1QJU2 1AR91 2WZR2 4NWVA 4Q4X2 2R063 5C8CA 3HAGA 4N43C 1K5MB 5BNNB 1Z7S2 3JBG1 4CDXB 2X5IB 1AYM3 1RUF2 2XBO2 1HRV1 4Q4W3 4RFT0 1ND3C 2HWB1 4Q4W1 1Z7S1 1AUYA 1BEV3 5AC92 1NCQA 1VBE1 3ZFFC 5D8AB 4GMP3 1ASJ1 1R083 1MQTA 4FTBA 1D4M1 1A6CA 1QJX1 1PGL1 5ACA1 1AR93 1QJU3 1AL0G 5BNPB 1BBT3 1X33A 5C4WB 5ABJB 2BUKA 5A33B 1PVC3 4FTEA 1RUC1 1HRI3 2RS53 4YVWA 1RUF3 2R071 1M06G 1MEC2 2HWE3 1RUI2 3VBHB 3J8F1 4NWWA 1RUH1 5FOJB 4QPIC 4GB31 4AEDA 1RVF1 1ZBA1 1ND3A 1QJY3 4RS5C 5D8AA 4GB33 2MEV3 1F8VA 3VBRA 1VBB2 5DDJ2 5ACA2 1ZBA2 2BPA2 3VDDC 2HWF1 5D8AC 4WM8C 2WFF1 2HWD2 1RUE2 4GH4C 1H8TA 2HWF3 4QPIA 2WS92 4CDWA 1F2NA 1NA1B 2WWSA 1ND3B 1AYM1 2RS33 4Y4YA 4RHV3 1RUC2 4CDUC 1RUJ2 1QQP2 3JBG3 1RUG1 1EAH3 3VBOA 1PIV3 1NCQB 3J8F3 4GMP1 1R092 1COV1 2DF7A 1BEV2 4BCUA 3ZFGB 5C9AB 1AR61 2MEV2 1PGW2 1AR92 2WZR1 5DDJ1 4RQPA 1MQTC 3DPRB 4YVSB 5L7OA 2HWD1 4RR3C 1FPN3 1VB2A 1NCRB 1AYN1 2RR12 1C8M2 1EAH1 1NCRC 1V9U3 1C8NA 4Q4Y1 3VBOB 3DPRC 1BEV1 2RMU3 1TMF1 3JD73 2WZR3 4Q4Y3 3CJIB 1QJX2 3ZFGC 4CDQA 1R1A1 5CFCC 3ZXAC 4RQPB 1RUH3 1VRH2 2RS31 1C8M1 1AYN2 5GKAC 3VBHA 1FMD2 3FBMA 1PO21 2RS32 2BFUS 1AR71 4AEDB 1RVF2 5L7OC 1NY72 3NAPA 5A33A 1DDLA 2RS13 1E57A 2MEV1 2Y26A 1ZBE3 1ZBA3 4SBVA 1FOD2 1COV2 2GSYA 3M8LA 3DPRA 1OHFA 1VBC3 1BMV1 1HQNA 4QPIB 1RUE1 4GMP0 2WFF2 4PDWB 1AL23 1H8TB 1HRI2 1NOVA 1FOD1 2TBVA 3JB4C 1RUC3 1Z7S3 1PO23 2RR11 4RR3A 1X36A 1PO12 1RHI3 1RB8G 1V9U1 1TME1 4Y5Z0 5C4WC 1ASJ2 2X5IA 4CDWC 1QJY1 1QJX3 2RS11 1RUD2 1IHMA 3CJIC 3JD72 5CFDB 5A32B 1VBA2 1WCDJ 1POV3 3ZFFB 1HRI1 5FMOL 4QPGC 3VBOC 2R062 2R072 5FMOS 1B35A 1C8M3 1PVC2 4CDXC 1QQP1 1W39A 4Q4V3 2PLV2 4YVWC 1K5MC 1VAKA 5BNNC 4FSJA 1AYM2 4GH4A 5BNOB 1AYN3 3VBFC 1HXS1 1ASJ3 1R081 3VDDA 2RM22 2BFUL 1AR83 1ZBE2 3ZFEA 5JZGA 4IV1C 1D4M2 3JD71 2RM21 1NY71 1VBB3 5J96B 1AL22 1POV1 3VBRB 1OPOA 1FOD3 4JGYA 3S6PA 4Q4W2 3VBUC 1RUH2 1VRH3 3IDEA 1FMD1 1HRV2 1NCQC 2HWF2 2R042 4JGZB 4Q4V1 4N53B 2QQPA 1R082 1HXS2 1POV0 1TME3 1RHI1 5K0UC 2HWC3 2FZ1A 4Q4Y2 3TN91 4GB32 1B35B 4GH4B 1AR73 1RUG2 5LK7B 4CEYC 5DDJ3 4WM8B 1RUI1 1BBT2 1BMV2 1COV3 4CEYB 1B35C 1TMF2 1SMVA 5BNPA 1RUD3 2WS93 4RS5B 5K0UB 4FTSA 5ABJA 2GH8A 4LLFA 5C9AA 4YVSA 4N53C 4EJRA 4WM8A 2HWE2 3VBHC 4CEWA 1FMD3 3ZFEC 5JZGC 4RHV1 5AC93 3CJIA 1PO13 2XBO1 1QJY2 4N43A 4CDQB 4N53A 4JGZA 1TME2 2RMU1 2ZZQA 2HWC1 4PDWC 4CDXA 1BBT1 1QJU1 1VBC1 4IV3C 1ZBE1 4CEYA 1CD3G 2R061 2WS91 5L7OB 3VBFB 1ND2B 5BNOC 5K0UA 1QQP3 2FZ2A 2HWD3 4YVWB 1VBD1 1MEC3 1NCRA 3NAPB 1HX6A 4Q4X1 4RHV2 1PVC1 1FPN2 5CFDA 2X5IC 1HRV3 2HWC2 3VBUA 4QPGB 1PIV2 2RMU2 4JGYC 1AR81 1EV12 4N43B 3J8F2 5CFDC 4WM7A 1V9U2 1VBA1 5ACA3 1HXS3 1D4M3 1VBA3 2WLPA 4CDWB 1NA1A 1RMU3 4JGYB 1R1A2 3VBSA 5C8CB 2RR13 3VBFA 2HWB3 4Z92B 1EAH2 1K5MA 2WFF3 5BNNA 4IV3A 4Q4V2 1RMU1 1MEC1 1CJDA 2VQ0A 3NAPC 1VBD3 1OOPA 1EV11 1H8TC 1ND2C 4RR3B 1QJZA 1PIV1 4QPGA 1AR72 1RUG3 1VBE2 4IV3B 1RUD1 1PGW1 1AR62 1PGL2 4CEWC 2IZWA 4RS5A 5C9AC 2RS51 4AEDC 1ND2A 4Q4X3 4WM7C 5C4WA 1PO11 2XBO3 4CDQC 2XPJA 5A32A 1AL21 1OOPC 5AC91 3ZFGA 1RUE3 2PLV1 3VBSB 1RUJ1 1PO22 3ZFEB 5JZGB 4RQPC 1VBD2 4CDUB 5J98B 1RVF3 3VBSC 1RUJ3 3JBG2 1OOPB 1EV13 2ZTNA 1NA1C 5CFCB 1GFF2 4WM7B 3TN92 3JB8A 1VBC2 3VDDB 1VBB1 1TMF3 2RM23 4CEWB 2RS12 4CDUA 1RMU2 2RS52 3ZFFA 4PDWA 4JGZC 3LOBA 1VRH1 1R1A3 2PLV3 1FPN1 2ZAHA 4IV1A 2HWB2 2HWE1 3VBUB 5BNOA 1RUF1 2R073 3VBRC 1RHI2 2R043 1RUI3 2BBVA 1VBE3 4YVSC 1R091 5C8CC 1AR82 5CFCA 1MQTB 1NG0A 1R093 5ABJC 3TN93 2R041
chains in the Genus database with same CATH superfamily
1AR63 2Q8CA 4AI8A 2HH9A 1UYXA 1VB4A 1UMIA 2OS2A 5DZFA 1RJ8A 3U11A 4AHZA 1H9WA 1HJFA 1SBDA 4LA2A 2EIBA 4XDOA 4CSWA 4NJ4A 4NWVA 5C3SA 5KWRA 4ZKTB 2R063 1JZ7A 4YZ1A 2E7AA 3RG0A 4N43C 5FMBA 3P6BA 1WZXA 3AFKA 4AVSA 1IGOA 3JBG1 4K21A 3IWZA 5FXWA 1MR5A 4CUGA 2UU8A 3AXEA 2FBEA 2X5IB 4HMZA 3SCHA 4D7TA 2WT2A 3K4AA 2XBO2 2VULA 2JJ6A 3MI8A 4E4ZA 3LAGA 4RFT0 2WO7A 2HWB1 4S2GA 5FZKA 4HSJA 3RI8A 1ULOA 3WINE 2JB8A 1WA6X 3FBYA 2DVBA 3LFIA 4XFAA 3ZFFC 3S5QA 4YZ3A 4LR4A 1K45A 1SG3A 5D8AB 4EZHA 1ZX5A 2XVGA 1DP0A 1R083 4B29A 2C9KA 2ZGMA 1I6XA 4DXZA 2BW8A 3AZYA 1A6CA 1OC1A 4QX1A 4CCOA 1H4GA 1OT5A 5BNPB 1LULA 4HG6B 1BBT3 3DN7A 4ET7A 2XLAA 3EO6A 4YGDA 1C1LA 2E6VA 1FXZA 2B4KA 2ZX2A 4AF9A 3OBRA 3RPQA 3UT0A 2PFWA 3ME2A 4FTEA 3N3HA 2VOWA 2CL2A 3OUHA 5G05L 1JZ8A 4NN0A 4LBMA 4XUPA 1RUF3 4X8PA 5I93A 1MEC2 1XNDA 2R1DA 4FPGA 3PUHA 1QEXA 1RUI2 5FYTA 1S1AA 3ROUA 3ZLIA 5A7OA 2ETEA 4GB31 1ZBA1 1U5XA 2P34A 2VMHA 2W3JA 1QJY3 4L97A 3OUJA 4RS5C 4BQ5A 5F3CA 4QB1A 4AAXA 3CMGA 3WF2A 1VBB2 4AVVA 5FWEA 2CSGA 1W2OA 4YZ4A 2QE3A 4LMFA 5H9SA 5JPMB 5IVCA 2ZHKA 4KG8A 4PBOA 2HEWF 4W6YA 4XIOA 3ES4A 4OHWA 5FXVA 5C5TA 3CEWA 4GH4C 3U10A 4XBQA 2TEPA 4LT5A 3LCPA 1ND3B 5IK4A 1YEWA 5LA9A 3AMHA 4RHV3 3AYAA 3IMNA 4B3NA 4CDUC 1UWWA 4A45A 2G19A 3ABZA 4L11A 5FIXA 5KC5A 4TN7A 2A75A 4B4RA 1PIV3 1NCQB 1Q8SA 1UIJA 2WYSA 1MZEA 3URFA 4EE2A 1TNRA 1N3QA 2UYBA 2D3SA 2VNRA 3PVBB 4QDQA 3VZOA 3AYDA 4M0HA 4V1PA 3T08A 2OPKA 4BCUA 3SH3A 1EUTA 2V4VA 3VUOA 3VD9A 1UU5A 1W8ZA 1XXNA 3ZXFA 4QAWA 2LM3A 2QQIA 1AR92 1GBGA 4JAAA 5A7WB 4Q1RA 4CP1A 2P2KA 2VBBA 2VBDA 5FLJA 1O3RA 2VQTA 1ZRFA 3SC7X 3A0NA 3OJBA 4XDPA 5FYBA 5JXGA 2NYYA 1W2AX 1GZTA 3MDPA 1IPJA 3PTYA 3MUZ1 3OGJA 3Q8CA 5F32A 2P5BA 4EYUA 2VOVA 1VB2A 2JICA 4H2AA 1KJRA 1C5HA 1FV3A 3OY8B 4G4FA 1AYN1 4JKKA 1O91A 4C0HA 1LAJA 1AXYA 5J3UA 3ES1A 1YI9A 3HOBA 1V9U3 4D7YA 3K3NA 4OLLA 4G3YC 3UETA 1MS5A 1ZRIA 1DGRA 3WCRA 1ZZCA 2RJKA 1PK6B 3JD73 3INAA 3LA2A 4XHBA 5D1IA 1O7FA 3IMMA 4R52A 4UFIA 2YBPA 3VHNA 1W0OA 4CDQA 1BZWA 3GBWA 3U0ZA 1PNGA 4OHVA 1R1A1 1NQJA 5HCHA 3GHMA 2XWBB 2XVKA 2DCJA 3QOPA 4QPYA 2VH9A 2WL1A 2SBAA 2Y34A 3LGRA 1RUH3 4EN7B 2WUHA 4RGGA 4AEKA 1O3SA 4IESA 1JZ4A 2GC3A 3KZ4C 2IXLA 5FO7B 3A7QA 3I3EA 1Y43B 3MV01 1PO21 2Q5TA 1UD1A 3ZKUA 1QMJA 5FJHA 2DU1A 1S0GA 4XFIA 2UWBA 4BQ3A 4QGMA 2J1AA 5DZGA 5L7OC 1NY72 3NAPA 2VU9A 5A33A 5I0SA 1DZRA 2RDRA 3OGSA 4PI2A 2ZGPA 4D69A 1E57A 2MEV1 2Y26A 1FT9A 1HV1A 3LFMA 2ET7A 1KGYA 4XF4A 3DPRA 1BMV1 1ZVFA 1Q43A 3KLSA 2QFEA 2RE9A 2ADEA 1ENSA 4QPIB 2WFF2 2XR4A 5CU1A 5FMDA 3RWNA 3S7IA 4DPNA 1OVSA 1SCSA 3ZSMA 4MSVA 2Y60A 1F9KA 3E6BA 1CZSA 1XE0A 2AUYA 2B39A 3I2DA 1L7LA 1EUUA 1YNAA 3DECA 2JIGA 3MFAA 1LOFC 1PMHX 1V6OA 1X36A 2RR11 1RINA 1L3JA 5GLVA 3S30A 5F5QA 3UKVA 4YFZA 1PZ8A 3ZYGA 5FBZA 1ONAA 3WNPA 5DUVA 5BV6A 1JOJA 1H0BA 5FZHA 3O12A 4D0QA 2X29A 4Z82A 2ADDA 4COWA 3OD4A 4BLIA 4BK5A 2ENRA 3ZIXA 5LBFA 5CFDB 3BI3A 1HJGA 4PJYA 1VBA2 5A32B 3KCCA 5ERLA 1SLIA 3BU7A 4QPGC 3HT1A 1UKGA 4JV4A 4QXCA 5FV3A 3BUCA 1XC6A 2XHNA 5F2WA 3VBOC 3POFA 1ENXA 3RGBA 2ZX3A 5IVYA 3H3UA 1QXJA 1VMJA 5A6QA 1UZ0A 2KM2A 4M3CA 5FMOS 1C8M3 2Q8EA 2EAKA 3ST7A 3UKNA 4QKNA 4CDXC 1VALA 1QQP1 4LBLA 2Z69A 3LWCA 2P6HA 2RG4A 1K5MC 1ZZ6A 2I45A 2VOXA 5BNNC 1W0PA 1OUXA 1S0BA 3V65A 3CLPA 1C57A 4MVTA 4XHXA 1ASJ3 2W87A 2RM22 3C7EA 4AK3A 5GLZA 1WBLA 5HV4A 5EZWA 3DYMA 4O65A 2LUWA 3ZFEA 5JZGA 1G9BA 1YFWA 5JR2A 5FBJA 3FFZA 1KDKA 2C6SA 2HEYF 2Z42A 2ZGLA 3JD71 4I0AA 4XPVA 3B69A 1U5ZA 3L2HA 2Z4FA 4AQTA 4BQYA 1NY71 1U0AA 1AL22 4IGOA 3AKRA 3O1RA 4MG2A 2A3WA 5M0TA 1FOD3 2X10A 5A6ZA 3MUY1 2EVXA 4OQ8A 4FFFA 5IHRA 2QZ3A 1NCQC 5C3RA 1W2NA 5DUWA 4R9BA 1DZTA 3PIGA 2AGSA 1DHKB 3BB6A 3RS6A 3BIWE 1VMFA 2WZ8A 2NN8A 2VUAA 3WZ1A 4F83A 1S2EA 4CXYA 1W9YA 1KXGA 1R082 4XF3A 4ARYA 2ZBJA 1HXS2 3I3BA 5K8SA 2LRPA 1TME3 2ZPXA 1REDA 2DYCA 1IG0A 4CU9A 3HD8B 1F15A 2FZ1A 1DIWA 4AYUA 2P6CA 4XQ4A 4K7JA 2YHJA 4N9IA 1AR73 4CUCA 3GALA 3ON7A 4KWJA 4WM8B 4F7ZA 1OVPA 2A6VA 3ZSEA 5FYMA 2WNVA 1N1YA 3WF0A 3VKMA 5KR7A 3E5XA 2GH2A 3ITQA 4K40A 4LBNA 3OEAA 4JRLA 1P8JA 3GGLA 3AP9A 5FYYA 5FZ7A 2IXIA 3TYJA 5BNPA 2DFCA 1RUD3 4FTSA 4TSVA 3WHTA 4LEJA 3ZYJB 5HCAA 1RUNA 1J3QA 5ABJA 2VCAA 1UX6A 4FPCA 2AC1A 4OMCA 5C9AA 2OZJA 2JDZA 3Q8FA 3VBHC 3VD4A 1G9CA 1UPSA 2P3KA 2WNUC 4HXCA 3U1XA 3ZXLA 4CPBA 4WVWA 1F5JA 5EWSA 3K48A 2ZABA 1GU3A 1Q8VA 3UK9A 4CP0A 3LOIA 4N53A 3OBZA 3ZN5A 5C7GA 1TME2 3LEMA 4LIVA 3MICA 4S2HA 3VD7A 4YSFA 3I2FA 1G6NA 1V6LA 3POJA 1PZ7A 1UY3A 1WBFA 2OUHA 2CGOA 1H1IA 4WVVA 3KV5A 4NHKA 3JXSA 1J1TA 5LASA 2A6YA 2GNTA 2R30A 4P9LA 2WQ4A 5A3NA 1A34A 1GZCA 3B93A 1ND2B 2RDNA 3I3DA 3J7NA 3PU8A 3P5BA 4HONA 5BNOC 4OMDA 1QXRA 3GZTB 1CAXA 2EIGA 4IUGA 2CGNA 3USUA 4A42A 1NCRA 4QWNA 3J7MA 2D40A 4INDA 3HEIA 1LODA 3NKTA 4RHV2 2VXRA 4AOCA 1OLMA 4XTMA 2WINB 1PIV2 2RMU2 2WZPP 2L9LA 2QQKA 2DTYA 2LW8A 2VO5A 1EV12 2K0GA 4AFMA 4EWEA 2ATFA 4KGGA 5CFDC 3O1MA 1VBA1 3TNPB 2QTWB 2WQ8A 2JG9B 3LEKA 4YW7A 2AZ5A 2GMMA 4LJHA 2NQYA 1JYVA 4HZFA 3BGAA 1UY2A 2W1QA 5E88A 4NO4A 2Y38A 3NL1A 4BQWA 4YLZA 1OQDA 1VRBA 3OYWA 1QU0A 1OBNA 2E32A 4JGYB 1WLWA 3QH6A 4YW3A 4YGEA 3ZYPA 3KM5A 4Z92B 1WMEA 4PT6A 3E97A 4CYDA 2CY6A 5DXDA 1XNBA 5FLIA 1WW4A 5EQUA 4Q4V2 1RMU1 1GANA 2GC1A 4DIQA 1MEC1 1IKQA 1ZM1A 2VQ0A 3NNJA 2VE1A 2WO2A 1VBD3 3EHKA 3J4UH 4S2DA 3WDXA 3FFQA 4COUA 4LBOA 1GNZA 2MHFA 2JG8C 1X8EA 5KHGA 5SV5A 3T2TA 1QJZA 2CAUA 5FY7A 1J1LA 4ISRA 1TEIA 1XNKA 2JWPA 1UOFA 1XYPA 3WEZA 2YXSA 4E4SA 3FZ3A 4DQAA 3KF3A 4TXWA 3WNNA 5HXVA 2WNUA 3ZSLA 4BK4A 4CP9B 4ISQA 4GKXA 1YHFA 4CEWC 1DYKA 2OA2A 5FY8A 4G9SB 4LHKA 4Y1YA 4AEDC 2VNOA 4WM7C 3O1OA 2BBAA 3TEYA 1CX1A 3NJZA 4LQRA 3BCWA 4W6WA 2VMFA 3WUDA 4CDQC 5A32A 2XPJA 3OPTA 1GQGA 1OOPC 4AL9A 3GM8A 3I54A 2PLV1 3MHZA 4AVAA 1CESA 1PO22 2FCTA 3DKQA 2WNVC 1TE1B 5T5JA 2WNVB 1QF3A 4CDUB 2XLGA 4WVMA 2VTFA 1MZ6A 4ZPIA 1RUJ3 2ZHMA 2YC4A 2ZEXA 3JBG2 3M7AA 4IL7A 4LOSA 3I3QA 4YRDA 4AGRA 3V0AA 4JQRA 5CFCB 1JU3A 2Z79A 2VMCA 2XKPA 3VDDB 4OZXA 2FCVA 3IIAA 4ZS3A 5KBFA 2IFWA 1I9RA 5A3PA 1W8NA 5IVVA 5BUVA 2VMDA 4CCJA 1DYOA 3TB0A 1E5IA 2ZKLA 4BISA 5CIRA 5GZGA 4FQZA 3W9AA 1UAIA 2DVAA 3KCXA 5LCWL 5FPUA 3BIEA 1R1A3 5KXCA 2YU1A 4P5HA 5L9RA 4CCDA 2BERA 1CJPA 3VBUB 1TNFA 5FPAA 1RUF1 2WT1A 3K4ZA 3ZSKA 4AEJA 3VZLA 2ZGKA 4KGQA 5FZ3A 4BJ0A 5C8CC 1VPHA 1OLQA 1IG3A 1QOOA 3B9IA 1NG0A 3HQXA 5DAQA 3RYPA 4J25A 3N9QA 2GDFA 4QXKA 4AFDA 5BNPC 3MPBA 2VCBA 1VLNA 3KS7A 4OI2A 1W9FA 5LRRA 3RJ2X 1W04A 2GP3A 5FKBA 2VJXA 1AR91 1DG6A 3N9PA 4Q4X2 2DDUA 2OVUA 3DUIA 3PMEA 2WKKA 1SLTA 4ES8A 1Z7S2 4CCLA 2EXJA 4CDXB 3N9NA 5DABA 1UL9A 1AYM3 1OLME 4O9GA 1O4TA 3WP3A 3VHRA 3WUCA 4N7IA 4DXTA 3E5QA 3IDCB 5KC6A 1AUYA 2YPJA 1H1MA 1NCQA 2H6BA 4M4RA 1SHWB 2G9GA 3H8UA 1CVNA 3E6DA 5EXOA 4GMP3 4M00A 5I0DA 1IS6A 5B2GB 3SLIA 4DFSA 1O4YA 5FYZA 3K75B 4JX0A 4MOAA 1XRUA 4O9EA 1MS1A 1AR93 1QJU3 1V0AA 3GBFA 1BVVA 3HQUA 5FO8B 2WLQA 1E5SA 2B5HA 3LB9A 4JKLA 1FYUA 4JHZA 3V64A 4LBJA 4YZ2A 4P5YA 2F17A 2ARXA 3WQBA 2ZA9A 4M3CF 1H8VA 1UMZA 1W06A 5A7PA 2RS53 2KXLA 1IS5A 5IAXA 1YQ8A 2UY8A 1Z0HA 1M06G 1MVEA 1KQRA 3JU9A 1JU4A 3AJYA 3SH4A 1GQHA 1NAEA 3FHQA 5IATA 3VBHB 3HBZA 1OH3A 5FOJB 2VZ1A 3AP4A 5FREA 3JCIA 3K3OA 1VAVA 2A6XA 2EIDA 4L8QA 1ND3A 1LU2A 1R1ZA 2VTXJ 5D8AA 4GB33 1F8VA 1CAWB 3AMNA 5FY0A 3AKPA 2EIEA 3NJYA 3D82A 4AVTA 1ZBA2 4META 3VDDC 4HPKA 2HWF1 3N36A 1Y9GA 4CEYA 3EQEA 3WF3A 2HWD2 3ILRA 1RUE2 2W2IA 1H8TA 4QPIA 2JECA 1LTEA 4BXSV 1NA1B 3D5OA 3WG1A 2Y6HA 2A3XA 3C2UA 4CCEA 4CRQA 4EZ4A 4FI9A 1OF3A 2D98A 5K7PA 5L9BA 1K5JA 1XNCA 1RUG1 4MHRA 1EAH3 5FCCA 2Q8DA 3POGA 1O4ZA 1CPNA 1DQ1A 4XXPA 4NRMA 4AHYA 3ZXEA 4U2AA 3J8F3 1W8TA 4Q0UA 2XOMA 3U07A 3ALQA 3PJYA 2BOIA 5C9AB 1AR61 2H0BA 2MEV2 1PGW2 3DL3A 5JWPA 3ECQA 5F5AA 2XJRA 4NIIA 2ERFA 4Q26A 5DDJ1 1G86A 4H7MA 4WZCA 2XWJB 4XYXA 5CKMA 3ZN6A 5CA6A 1UO9A 1O3TA 4PLNA 3ZN4A 1Q8PA 3P1IA 2BEOA 3DPRB 1GLHA 5JLVA 3ZXJA 1RYYA 4HKLA 2BGOA 5I0TA 4BIOA 1W6QA 3H3LA 4RR3C 2WBKA 3VHOA 3ZYFA 4P14A 3C7HA 4QHZA 5FUNA 4Q8KA 1XJAA 2Z5WA 4H7LA 1LRHA 5A7WA 3WW4A 1WLDA 2P3IA 2UWAA 1EAH1 1GUIA 1NCRC 2DCKA 2PN5A 5LATA 5B4NA 1HB3A 1GKBA 1WLCA 4DOUA 1U5IA 3HPNA 3WNKA 1YJLA 3JQXA 3O1PA 5JMCA 1C8NA 4MGKE 3VBOB 4K1ZA 3RZKA 2Q8OA 4IEZA 3QACA 1GP6A 2HLEA 2C24A 2C5DA 1V00A 1TMF1 1IPSA 4EQVA 4Q4Y3 4QM9A 5A6YA 3AC0A 4MGSA 2W1UA 3CJIB 1LNSA 4ZXKA 4GWIA 3WLUA 2BWAA 3AJZA 3RMXA 3MZHA 2EALA 5F3IA 3KT1A 2E33A 4FFHA 3J9SA 2GMEA 2KR2A 1FATA 4Q1PA 3I2OA 2AYHA 3TRSB 4NE9A 3WW1A 3H8OA 1S55A 2J1EA 1DCSA 4QX7A 5DAPA 2XJQA 5IYYA 1QNYA 4PI0A 2HEVF 1C28A 2RS31 3POWA 2OYZA 4S2FA 1AYN2 4RN5A 3OGGA 2JG9A 4QX3A 5CEHA 1FMD2 2BWCA 5F3EA 1W2TA 3E6CC 3KMHA 1WMXA 3C8XA 5FY4A 1W6OA 1LKNA 1SACA 3RFRA 4KU7A 1QKQA 4XMIA 4P9JA 4AQ6A 1WCSA 1HN0A 3WDWA 4M0NA 4JRAA 4UYBA 1DDLA 3N7LA 3NMBA 2AENA 4LUMA 1LHVA 2BNMA 2CDPA 2YU2A 1ZBA3 2FDIA 3D6EA 1W8WA 3U78A 1CAVB 1FOD2 4UW3A 2RVAA 3WT3A 5FZ9A 1YUDA 5LA2A 1LOEA 2H6CA 1W6MA 3MIHA 5FUIA 1RUE1 2JDMA 4CE8A 3AZXA 5FYSA 1AL23 3CJXA 3IB3A 4QGLA 4WZFA 3D0JA 2R49A 1UIKA 1V70A 3R4SA 4LUKA 4XFGA 3VKLA 4FP3A 4ZZ8A 1VP6A 3J7HA 1Z7S3 3U37A 2QQWA 4TLGA 3IPVA 4RR3A 1TZOA 1RHI3 2JDYA 4UT5A 2VNVA 1RIRA 2WNOA 4WVMB 5EJZB 5T3NA 3MYXA 5FP4A 2OQ7A 4BQ1A 4F3JA 3ZYHA 2W52A 1Y3TA 2VQUA 4XW3A 1QJY1 3TEXA 4GD4A 1W9SA 1RTVA 2VL4A 1QJX3 3FUQA 1DYPA 1IHMA 4YG3A 3THPA 1LGNA 3A23A 5F9TA 3CJIC 4XUNA 2QQOA 4Z8BA 4BLJA 3R4DB 1QIQA 4XFFA 3T09A 1HQWA 1WCDJ 2D6NA 5HCFA 1W6NB 4QU1A 3GZAA 1SPPA 5FUPA 4GALA 4J6GA 5LBCA 4IE4A 4Y24A 2J1SA 4LO4B 4X6RB 5T5OA 1DQ0A 2Y8KA 3ZXGA 1NLRA 2ZHNA 4FSJA 1AYM2 5BNOB 3HVDA 1AYN3 1L7QA 2B42B 2WDBA 1ZZ7A 2ARCA 3I59A 2YFZA 2OKXA 1UKRA 1KEXA 4FAHA 2BFUL 2DTWA 2QNKA 1AR83 2PHLA 3B3QE 1ZBE2 1US3A 3IN9A 1LB2A 4JC1A 2FMYA 5DMYA 5LK5A 3ZPOA 1XNAA 2PTMA 4P9WA 3KSCA 5FZ8A 5EYXA 1N3OA 1NKGA 2TNFA 2W91A 4OCTA 4YM0A 5JPNB 1T6BX 4XF0A 1FV2A 1DGRN 4QHBA 4N90A 2R6QA 4ZY9A 2ZMNA 5FZEA 5FXXA 3HNBM 4FOWA 1H2LA 5CBLA 5IVEA 1RUH2 1PK6A 2MNGA 2VZPA 3TEWA 3QD6A 3GJBA 2HWF2 1REEA 3KF5A 4UFLA 3PVEA 1ULFA 1XSRA 1ZRCA 3J7LA 3KD4A 4KNCA 4BM8A 5KHJA 3PURA 1S0DA 2JD9A 5FZAA 1CIYA 3HJRA 4N53B 5ISLA 2QQPA 1KFUL 1H6XA 1WMDA 5B4XA 1QJEA 3O1VA 2ZGSA 5FY5A 2HWC3 4NIGA 1S0JA 3M4FA 1B35B 1CGPA 5F39A 3LDRA 5LK7B 5ANQA 4UFHA 2DCYA 2E31A 3MLKA 5CVRA 5A3OA 5T50A 1D2SA 3TBDA 1L7RA 1XNTA 2WA4A 2JDPA 4PLOA 3T0AA 3NVCA 2JE9A 2ORZA 4V2VA 1COV3 3LDKA 4AXOA 1JZ3A 4OULA 4E9KA 1B35C 1DGWX 1MS4A 1SMVA 3KT4A 2OPWA 4IE6A 4P9YA 4RS5B 5K0UB 3GXUA 1UY1A 2FDHA 4YM1A 4QHOA 5F5IA 5FWJA 2GH8A 2W1SA 4LLFA 4XQDA 4WM8A 2HWE2 2J1RA 1ULEA 1CWPA 4CP2A 4B1MA 2WN2A 5T55A 5AC93 3UGGA 1UZWA 2HJIA 5KXDA 2WWJA 3PUIA 5FAXA 2OXBA 4NUBA 5GLUA 2A73B 2Y6JA 1QJY2 2QBXA 2XL7A 5FZFA 5ANNA 1GICA 2ES3A 4ZU4A 4HBNA 4AFBA 3AZVA 5JOWA 1SFPA 2ZZQA 1VE0A 2J42A 1DLCA 3WG3A 2LS6A 4E8DA 2DCTA 3ACHA 2I07B 3ETQA 3HNYM 4JDNA 3W58A 1BBT1 5FPXA 2AEYA 5EYYA 4XJAA 1JHNA 4DUXA 3GYDA 4DMIA 1QJU1 1YWKA 3O1UA 3TOJA 4IV3C 4QQLA 3M70A 4C8DA 1QXPA 4LKFA 3FX3A 5F6LB 3BN6A 4GIQA 3VBFB 1Q8QA 2YDEA 4AI9A 5JXIA 2Y6FA 2HWD3 4HK8A 5FPVA 1VBD1 4LK6A 4H55A 2VVEA 3THCA 4AEMA 3WP6A 4Q4X1 1UOJA 2VMEA 3OB8A 4D8MA 4YW6A 2B45X 1AF9A 1FPN2 2W08A 3MF9A 1GP5A 3N9MA 3WDVA 2X5IC 5IVFA 2Y6KA 2VVDA 4XBNA 3FC0A 3KV4A 4LHSA 2QUOA 2QDNA 1LESA 4N43B 4P9IA 4WM7A 5FRAA 5FK7A 4NPRA 1O59A 5ACA3 3S57A 5IJRA 1KS5A 1D4M3 2CHHA 4YG6A 1VBA3 2R0HA 4XMAA 4BXFA 2OW4A 2QQNA 4ASMB 1LCLA 3APBA 4KBBA 3BU0A 2X05A 2ARAA 3OF1A 4UFKA 3WQ7A 1RMU3 4H14A 4E2QA 2VUCA 1UNBA 3HWJA 5JUVA 1W6MB 1JOPA 2A1XA 5DN2A 3VL9A 3POYA 2W95A 1K5MA 2WFF3 5BNNA 4IEPA 3M3EA 1CJDA 3AL5A 2HBUA 2J7MA 3T0BA 4MGTA 2WJSA 5FZ1A 1YLLA 4Y5TA 5DUUA 4QDRA 2JDAA 3F2ZA 1BCXA 1EV11 1NYWA 3CBNA 1W6PA 2Q1MA 1H8TC 1ND2C 5FY9A 5FZ4A 1PIV1 1YC61 4AI0A 4QPGA 5AVPA 4AQ2A 5BNQA 1RUG3 4K3UA 3ILNA 1YIPA 1WLTA 2ORXA 3AX4A 1SLCA 2PAMA 5F6KA 4DB5A 2LALA 4IV3B 4NOTA 5EJ3A 3H8XA 1S0FA 1REFA 3AZZA 3ZYBA 4IEQA 1LENA 2FDGA 1YFYA 3NSTA 1PGL2 1WKYA 2NZ9A 1C1FA 2WQZC 3MIBA 2PXJA 1RGSA 3IDBB 5JI7A 4AQSA 3VDCA 1ND2A 4LITA 2VQAA 1OKOA 1PO11 2XBO3 1GWLA 4YM2A 3T2OA 1Z78A 4Y3OA 3B94A 5AVAA 1G8WA 1A3KA 3ZFGA 3ZM8A 4CU6A 4MXWA 4B4PA 1ACCA 1RUJ1 2IC1A 2WNUB 3EBRA 3WR0A 2B9VA 2ZGNA 4RQPC 4CP9A 5J98B 1OFNA 1JXNA 5J09A 1RVF3 2B8MA 4NROA 5H9PA 1H1AA 4BU2A 4ZONA 4IE5A 2NLRA 3N9OA 1CAUA 2AREA 4CXXA 3TN92 4W65A 4AFCA 2DBIA 1LHUA 1FX5A 1Q56A 4W4ZA 3AL6A 3Q8EA 4P9GA 4D6QA 2XUEA 2RM23 4CEWB 2RS12 1LHOA 3PIJA 1WWYA 3UYJA 1FNYA 3HN3A 1ZA4A 1RMU2 4LHLA 3K77A 1W8OA 4IXLA 3U4XA 2E53A 3DEMA 4LE3A 3PTRB 4JZRA 5EP9A 4FBFA 5CKNA 5L9VA 2IXJA 1TVGA 2JDKA 2JG8B 1LGBA 3HQRA 4HN0A 1FPN1 2VUJA 4IV1A 3O1SA 1XU1A 1SQ4A 1UW8A 4LBQD 4LOTA 1K3IA 4FQ4A 1ZREA 5JMOA 1OQEA 1OD3A 5IFTA 2R043 2BBVA 2V5YA 5JSRA 4RGAA 4YWAA 3BYWA 5F37A 4R9DA 5ABJC 5LW9A 4JVAA 5J37A 1RC6A 3VZNA 2YGMA 2WN3A 3FWEA 2RJLA 1JW6A 3DXTA 2E51A 1HB4A 2D5FA 2IVIB 1QJU2 4BIFA 2WZR2 2PQSA 4YARA 3L9JT 4O61A 3KGZA 4LE4A 2Q4SA 4ZXEA 4HVRA 5C8CA 5IWFA 5DZEA 4E4HA 2IVJA 3C7GA 4DEVA 1W8UA 1UN1A 2JDNA 4OUMA 4LKDA 1EPWA 3MLLA 4GKYA 4ARXA 1EY2A 1KJLA 2VOTA 2GU9A 4OFGA 4Y20A 1HN1A 5CG9A 4NMIA 5CB7A 4M3CE 4I01A 1OA4A 3HT2A 3JUUA 3O0XA 1PMJX 5FZCA 4I3GA 1BEV3 2PHDA 1NXD1 3SITA 5AC92 1GOFA 1UU4A 2N7GA 4IEXA 5FO9B 1UPIA 3NV2A 1BK1A 3OPWA 1QOSA 4A4AA 1SDWA 4E8CA 4AZZA 5LY1A 1ASJ1 1BXHA 1H6YA 1LGCA 4FTBA 5T5PA 2VZOA 1QJX1 2VZQA 4UWDA 5ACA1 2DVGA 4Y22B 5K4LA 4BZ4A 1UYPA 1W3VA 5A6XA 1PZ9A 5IAVA 2HKXA 4ONUA 1ZZBA 1X33A 1EP0A 4YW4A 5C4WB 1MS9A 1ST8A 3DXUA 3E1F1 5ABJB 5FZ0A 2CWSA 2BUKA 2Z2SB 4ZZ5A 4LA3A 5E8AA 2VZUA 3MGUA 5A33B 1S2BA 3KHBA 4Q0PA 4FPKA 4HT1T 4LKEA 4MZUA 4SLIA 1JYWA 2V09A 1HRI3 3MF6A 4OUSA 4BH9A 3ENRA 1G9AA 5BYNA 2O8OA 3EJKA 1XQNA 3CZJA 3O0VA 3LEIA 2HWE3 2YC0A 3BOWA 3OCPA 4AAPA 2XMLA 5LEJA 3H8RA 4LPLA 2ZX0A 4NWWA 1RUH1 3AK0A 4XUTA 3W21A 4YW2A 4QPIC 3B9CA 5EPAA 3I2JA 4AEDA 1RVF1 5IFPA 3W5NA 2VW2A 1S0IA 1OD5A 3WD5A 1O5UA 2VCCA 4PF5A 2MEV3 1J3RA 1JUHA 3LPGA 3D8CA 2EAAA 3VBRA 4DO0A 1W90A 1DGLA 3AZWA 3WP5A 1UZYA 3VD3A 4UW4A 4A2UA 1OFSA 5D8AC 3RSJA 1AX2A 4UFJA 2WFF1 1KDMA 4OYUA 1J3PA 2IXCA 4C0BA 1N1SA 2X09A 2HWF3 4NIHA 2WS92 5JOXA 1NX9A 1F2NA 5GJ6A 4FOYA 2I2SA 4P00B 1K12A 2WWSA 5FYVA 1LOCA 1AYM1 2DUOA 2EICA 4Y4YA 2O8QA 4BOWA 4L92A 1RUC2 5I8SA 5A3WA 1RUJ2 3JBG3 5FYCA 4TZDA 3NWKA 2J1VA 4URAA 1CZVA 2DWRA 4YFWA 1QDOA 5FLHA 2D3PA 2WAAA 3PLQA 4TWTA 3JZVA 4XF1A 3ZYRA 3WXPA 1EPZA 4KU8A 3PDQA 4GMP1 3SMHA 1W6OB 2AEZA 2PHFA 4FXGB 4COZA 2JXAA 4KI5M 2DF7A 4Q0QA 4ASKA 5GZCA 2W46A 2YB7A 3LQCA 1G9DA 1J58A 2BOJA 5IK7A 1ODNA 5BY5A 5IUQA 4RQPA 3UGHA 4TYSA 4XJ9A 4KH9A 4BA6A 1IZ3A 4YVSB 2XQXA 2A6WA 3IIIA 5GZFA 5L7OA 2HWD1 4KWUA 5FFOC 4P9XA 4QD2A 1FPN3 1MS3A 1NCRB 2EXKA 2R16A 4U36A 4I2OA 4GA9A 5FP8A 1OF4A 4QU2A 3V0BB 2VMIA 2D44A 2Y0IA 4B1LA 2XH6A 3H1MA 5EHDA 3SNMA 3VB9A 4HOOA 1POQA 1HB1A 2F4PA 4QXHA 4ZS2A 4Q4Y1 5HXMA 2Y0OA 1MZFA 1A8DA 1BEV1 4NAMA 3K46A 4LXLA 4QB2A 5C6CA 3KB5A 3GF6A 2CDOA 3CQOA 1PM7A 2A71A 2WZR3 1CAUB 2BNNA 4MXVA 1FNZA 4A7KA 4JTOA 5JSPA 3BKZA 1QJX2 3SKJE 5C71A 2PHXA 1OURA 2PHTA 1AJOA 1NT0A 2WFPA 4OHYA 4XFHA 1OH4A 4IEYA 5LZ6A 5FP9A 5I8YA 2QQMA 4FPHA 2XVLA 3O1TA 3ZSJA 3NKGA 2FDJA 3LA7A 2CWMA 2XUMA 2RHPA 2A3YA 2WT0A 5F5CA 4PBPA 3ILFA 4OI1A 1OXCA 1VRH2 1C8M1 4LBQB 1V6JA 2Q0AA 1SEFA 1STMA 5GKAC 3V56A 1DLLA 3Q8AA 3VBHA 4NPMA 4AGVA 2FCUA 2I74A 2RS32 1HQLA 2BFUS 1GZWA 2BU9A 1AR71 4F8AA 4P08A 5FZIA 2F4LA 4XBLA 3RWKX 2UURA 2WRAA 4Y1ZA 3ZKYA 4H3WA 2Y6LA 3QH7A 2RS13 1YQ6A 4MV2A 4PF1A 1E5RA 5FZDA 3D4KA 3NJVA 4SBVA 3TNQA 4CUAA 1COV2 2GSYA 1WW7A 2EXIA 4FPOB 1VBC3 3LSEA 4Y1XA 3SQOA 3I2KA 1H9PA 2GC2A 4W8JA 3DF0A 4GMP0 1F4AA 1WCQA 4OHXA 4PDWB 2XQRA 4QKBA 1H8TB 1NOVA 2B7YA 1ULCA 4NAOA 1FOD1 3CHXA 4MGIE 1XOYA 3SEEA 2P1BA 3AVRA 3AXDA 3JB4C 3KT7A 1RUC3 2WSUA 4XEZA 4WV8A 2CGPA 2ZS6B 1MVQA 2A7AA 3DYOA 4AHXA 4FP2A 5DG1A 2F6BA 2YGLA 4HPKB 1RB8G 1OSGA 1X7NA 1V9U1 1TME1 2CTVA 3IAPA 1LEDA 4Y5Z0 1XYNA 4J1WA 4RA0A 1UX7A 3RZHA 4B8EA 1AX0A 1BYHA 2PHUA 2YMZA 2BP6A 4KQ7A 4NVPA 2RS11 1RUD2 4ATFA 2PAKA 2AR6A 4IQPA 3POSA 3R4UA 1HW5A 1OA2A 3BVCA 4PLMA 2VZRA 1W9WA 3I2HA 3ZFFB 1W6QB 1HRI1 5FMOL 2J22A 2XKOA 4UF0A 4YGBA 2V5DA 2WR9A 3ETPA 4LNVA 3AKQA 4AI2A 2R072 2DUPA 4FOQA 4Q27A 1B35A 5FOBB 3CL1A 3GNEA 1PVC2 3AP7A 1W39A 2YZ4A 4AI3A 5A70A 1DQ2A 1XYOA 4YVWC 3WF4A 4BYYA 2GAUA 4GH4A 4NHXA 4QKFA 2Y6GA 5JVVA 3UJOA 4LULA 1HXS1 1Y7BA 1QNWA 1R081 3MIFA 3VDDA 4UBHA 3ZOIA 1M4WA 1MS0A 2ID4A 2QCSB 1C4RA 2QVSB 2V73A 4XACA 4CCNA 3R05A 3DGTA 4IV1C 4MO3M 4N7UA 3VLBB 1D4M2 3BODA 3LZZA 3G7DA 4XCBA 1OLRA 5J96B 2R1BA 2W47A 2Q1ZB 3IKWA 3W20A 1O5LA 2Q1FA 3M3IA 2OQ6A 1SLBA 1PVXA 4BMEA 4Z1VA 3S6PA 4Q4W2 3VBUC 3GZUC 4EROA 1SPPB 3IDEA 1SDDB 1HRV2 3ZR6A 4KWKA 1IS3A 4LBKA 2P17A 2G9FA 4JKMA 2C4XA 4LIUA 4LKSA 4JGZB 3RJRA 2O1QA 3CDZB 4ITCA 1ZZ9A 5FZMA 1ULPA 2QQJA 1W05A 2GN7A 3I2IA 4A3ZA 5J1XA 1W9TA 3TWIA 1W6PB 3RMYA 3VKOA 1B09A 3RZZA 4GB32 4MGQA 2BRTA 4GH4B 5I0RA 1RUG2 3NJXA 3H1WA 4PHZA 4XJZA 4Y1VA 1D7PM 4MXWB 5FZOB 1RUI1 4AGGA 3P3NA 4PQ9A 3RRDA 5GALA 1Y9QA 4UI9L 2C0ZA 3F95A 3THDA 1T6GC 3OGRA 1A78A 4CEYB 2VC9A 3UV9A 1DBNA 1C5IA 3NV1A 5H9RA 3AYCA 1K42A 3C7FA 1UCXA 1I1EA 4DY5A 2WABA 4C1WA 2DU0A 4CPBD 2J1UA 1NUKA 4N53C 2GC0A 4YVSA 3A21A 4XF9A 5C70A 1SFYA 1KITA 2BQPA 3T1MA 2YFUA 1PHMA 1JYNA 1CZTA 2ZGOA 3ACGA 5A80A 4DXRA 3CJIA 1GWKA 3VGIA 3VZMA 3T0DA 2P37A 3NQHA 3DCQA 3WW2A 1V6NA 3LPFA 1ZNPA 4JGZA 4XAEA 3LA3A 1UYYA 2GALA 1H30A 2GNDA 2RMU1 2RJ2A 2ZHLA 1EYBA 3A22A 1S4CA 3PUQA 3PU3A 5JR7B 3RZMA 1HKDA 2YPDA 3POBA 3H7JA 3LIHA 1KFXL 1VBC1 3FJSA 3OYWB 1LOBA 4KBZA 4B4QA 3POEA 2QQLA 5DPNA 4QQHA 3RZLA 3CNAA 2R061 2ZMLA 2BYVE 1IQDC 1GNYA 5K0UA 1QQP3 4UW5A 5JI9A 2XJPA 1ZA7A 4YVWB 4GJYA 4BMBA 1SLAA 4MADA 5J36A 2PQQA 1MEC3 1WD4A 1HX6A 3A4UA 3NW4A 1GZ9A 4IEUA 2WC2A 1NQDA 1PVC1 4MYEA 2VD7A 4JCKA 3Q9OA 4FXKB 4DZGA 4LORA 3AFGA 1HRV3 1CN1A 3H50A 3PL0A 4XZPA 3SCGA 4QPGB 1AX1A 5JSOA 3KQ4B 4HL0A 1AR81 2BVVA 3J8F2 2QQUA 3H7YA 1GOGA 2E7TA 1ZRDA 2QKDA 4HSLA 1HXS3 2XDVA 2FD8A 2WSVA 2ZGQA 1UMHA 5FZLA 3RZJA 4Y5SA 3VZJA 1NE6A 1ULDA 2WLPA 4KWLA 5T5LA 1N47A 4CDWB 1NA1A 1X50A 3GDBA 4BHPA 5IVBA 1R1A2 4L2NA 2JB4A 2UYAA 3N7JA 5C8CB 3VBFA 4UXAA 3HBKA 1RITA 2HWB3 5LBEA 4HVOA 1EAH2 1OKQA 3IZOA 4IV3A 3ZVXA 3ZX7A 3WG4A 4QDSA 2KA3A 4R4XA 3KV6A 1A8MA 1OOPA 1C3HA 4I09A 3WV6A 4B7KA 2LROA 3ZIWA 2VZTA 4QQ2A 4Y4RA 3SEPA 4V2WA 3FHAA 1QJFA 3KGLA 5FMCA 4Z2WA 5A1AA 2W39A 3ORJA 3K51A 3ZDVA 1V6MA 3ZO0B 1VBE2 3NNMA 4A41A 3I3MA 4XAAA 1PM4A 3FLRA 5FQ0B 1RUD1 1JZ2A 5E6HA 4I3PA 2W94A 3M3OA 1JTZX 1PGW1 1YFUA 1AR62 5APAA 3ZXDA 4CU8A 1YXWA 4M01A 4AVCA 2R0FA 2XJTA 3GHNA 4L9BA 4IETA 4RS5A 5CNAA 5A3MA 2VZVA 3AMMA 4BQ4A 4DUVA 1TQ5A 1SCRA 1QDCA 2PA7A 5C4WA 5LA0A 3KV9A 3D3AA 1AL21 3FL7A 5IVJA 5AC91 1WCKA 3RNSA 1VAMA 1V6KA 5EFUA 1I5PA 1DQ6A 3M3CA 1CONA 4Q5OA 1DU3D 1NE4A 4MHUA 2GMPA 5EV7A 3T2PA 3VBSC 2PMWB 5F2SA 4COVA 1F31A 4EN0A 2BGCA 1OOPB 2IWGB 2JE7A 3MW2A 4X8NA 5IW0A 2G9ZA 1D2QA 4A6OA 4WM7B 4OUEA 5EIYB 2VNGA 2YBSA 3X29B 1VBC2 3OBTA 2WA3A 1TMF3 4HK9A 1LR5A 5C8WA 1KRIA 4UBGA 4DNYA 1IPKA 1J83A 4QB6A 1H2KA 1PK6C 2BGPA 2DURA 3DYPA 4XFCA 5BPXA 4XABA 4D6RA 3U14A 4EWDA 3ASIA 3WX5A 5F8PA 3ZFFA 1LEMA 3AYEA 4XURA 4PDWA 4QMAA 4I0BA 4D94A 1LJ7A 2FQPA 3LIGA 2ZACA 4MH0E 4JGZC 5C5UA 5FY1A 1VRH1 3ZN6B 4EN6B 5JAXA 2PLV3 1GP4A 4CCKA 2BVBA 3TAYA 3QLQA 2FDKA 4L0PA 1HIXA 3VBRC 3WNXA 4XVHA 1AHSA 4GWJA 5BNOA 1RHI2 5CG8A 5L73A 1RUI3 3I59B 3NV3A 1R091 3NV4A 5JCTA 1GNHA 1R093 4B7EA 3V0AB 3FE5A 4GJZA 2R041 3TN93 5LEKA 2PELA 4JQTA 2C26A 4AHWA 4IV1B 3NRUA 2ZGTA 4A3XA 4XE9A 3MPPG 2YUEA 3NNGA 4CTEA 1R64A 1YQCA 4FVVA 2XB6C 3S0MA 1RL3A 4IE0A 2YG0A 5DAXA 2D6OX 1W6NA 3HAGA 4NRPA 1I3HA 5EJ1B 1K5MB 1S0EA 2A5ZA 3B5LB 3THTA 4DINB 3VHPA 1UXXX 5BNNB 2PYTA 4BDVB 3ZMOA 2CYFA 3WQ1A 4DUWA 5FK8A 1UU6A 3G6JB 4DRVA 1JYXA 3N35A 3SKVA 4E4DX 4Y22A 1RUF2 3KVBA 4NHMA 1HRV1 3EB7A 2B9UA 4Q4W3 2ZX4A 1ND3C 3ZDSA 1GV9A 1KS4A 1WMFA 4Q4W1 1Z7S1 4R9AA 2ZGUA 4Y26A 2JX9A 3EMRA 4ZU5A 1H4HA 1VBE1 4KL1A 2DFBA 2VUDA 2AH2A 4MX3A 4YW5A 3S5AA 4W50A 4A6SA 4ZU7A 2DVDA 2XLFA 4Z07A 1XPWA 4CVUA 2RDSA 1MQTA 3R0RA 4UW6A 2XGXA 1D4M1 1GMMA 2DV9A 3HR9A 1YO8A 3MIDA 4WBBA 1W3XA 1D4VB 4PIZA 5FZGA 1PGL1 3OD0A 2W68A 5IK5A 3AM2A 1OPMA 2G1MA 2CU5A 3RYRA 4M3CB 1AL0G 1NLSA 5L19A 3GCWA 3OUIA 4XQWA 3MBWA 1E5HA 2FHRA 4FPJA 2EF6A 1F35A 2BZDA 4M4PA 4KG0A 3M3QA 1O6UA 2VM9A 3WDUA 1PVC3 2B46X 4XCAA 1AVBA 1JHJA 1RUC1 1YQ2A 2ZEYA 5DAWA 4EN8B 1JZ6A 4YVWA 2H0VA 4AFAA 2R071 3T30A 1ZYBA 2VBPA 4JTNA 5J7MA 4IEVA 3I49A 3FMGA 4FO9A 4NRQA 2VVFA 3J8F1 2JD4A 4Y33A 1ZRRA 3GCXA 1WGPA 1UYZA 1RJ7A 2JDHA 3KHCA 5KXEA 1GQPA 4DY3A 4URTA 5H9QA 2E9QA 4DEQA 5DDJ2 2W9XA 4A44A 4EN9B 4Q29A 1W0NA 1D0HA 2QZ2A 5ACA2 1J59A 2WYFA 1MZ5A 4D6SA 2BPA2 1ENQA 4K8FA 1ULGA 1FAYA 4LK7A 4WM8C 4DXSA 5DQ0A 5C3OA 4IE7A 1UQXA 3DV8A 3RVHA 3WSOA 1QGLA 3ZXKA 4GULA 4CCCA 2CNAA 4CDWA 4HVQA 3H1YA 3OY8A 4IERA 1CIWA 1YFXA 3OG2A 3I97A 1GWMA 2RS33 5FYHA 2G4IA 4K1YA 5T52A 2O0OA 5FDBA 4N8MA 4COYA 4QX2A 1CR7A 4IGQA 1QQP2 4ES9A 2JEMA 1H2MA 3FUOA 3VBOA 1OMIA 4DS0A 2VTXA 4QQPA 5E1RA 3GJAA 3AMPA 4NPLA 5GZEA 2V72A 1AZDA 5GLTA 1R092 4ZHNA 3BTZA 2YROA 1COV1 1BEV2 4XIKA 1GOHA 2RDQA 3ZFGB 3PUSA 3ZR5A 3LE0A 3USSA 4O7XA 1OQ1A 4AI1A 2ZEZA 4GQ7A 4QX5A 2WZR1 1F4HA 1SBEA 1U12A 3B02A 1N1TA 4Q2FA 2TUNA 1MQTC 3VN4A 1W8HA 2XONA 5JXJA 5JDBA 2VGDA 4OVEA 2D97A 3T4VA 4GWMA 4FAGA 2HBTA 5FYUA 3WG2A 4BQXA 1WCUA 3LSDA 2PHWA 3DKWA 2D93A 2WO1A 3AVSA 1AXZA 3WNLA 2W0XA 2ZX1A 1JUIA 2RR12 1C8M2 2ILMA 2J1TA 2ZGRA 3CZUA 2WAOA 4W6XA 4FCAA 5LY2A 5A7NA 5CISA 4WVZA 1WW5A 4QX0A 3DPRC 2KD7A 4FT8A 4A7ZA 2BTVC 1JS9A 1MACA 2RMU3 4XETA 3PUAA 5LBBA 1Q3EA 4I02A 3UJQA 3Q8BA 3ACFA 5AFBA 1UZZA 2ZEWA 1APNA 3S7EA 1ODMA 5FJKA 4Y20B 1QOTA 2WIIB 4R4ZA 5GZDA 2MPFA 3ZFGC 2JDUA 2VCMA 4BWOA 5A7QA 1US2A 5C33A 3FHIB 4YPJA 1LOGA 3O7OA 3VL8A 5JOZA 1QH6A 3WNMA 4E2SA 5FP7A 5CFCC 2WZEA 1Y9MA 2OIIA 3ZXAC 3PVOA 2GP5A 3ACIA 3QBQA 3FLTA 4RQPB 5FTTC 5DAVA 5KHKA 2R32A 2K46A 1OI6A 1UY0A 1YYNA 3WNOA 3FBMA 1VMHA 3WF1A 2CV6A 4XXAA 4R8HA 1BKZA 4LO7A 1W8FA 3O14A 4BE3A 4AEDB 3CF6E 2D6MA 5KHIA 2JG8A 4NIAA 1QWRA 3WY6A 4ASLA 4QM8A 4GAZA 3W5MA 1RVF2 3J26N 2UY9A 1SZBA 4UF0B 5FYIA 4OI0A 1LOFA 3HMYA 3BALA 4LBQA 1ZBE3 5HPOA 3I2GA 2C1FA 4FOVA 3M8LA 2VXJA 3OBAA 1OHFA 1LECA 1JYTA 5JIUA 1BVP1 1HQNA 3N7KA 3NO8A 1URXA 3POIA 2ZMKA 1HRI2 1RXGA 1X82A 1JN2P 3MIGA 4XTPA 3LKJA 2OX0A 2TBVA 4C90A 1SBFA 3VKNA 5A1FA 2D43A 4L99A 3D0SA 1NXMA 1BQPA 3W59A 5HCBA 3IM0A 1U5YA 4FFIA 1PO23 1SFNA 1PO12 4ORFA 4FPYA 3ATGA 4DRRA 2ARBA 4YYOA 1VJ2A 2VZSA 4AR2A 1Q5OA 2VG9A 5C4WC 1ASJ2 2X5IA 4CDWC 1QY4A 4K6BA 1XB9A 1GR3A 4J1XA 4RD7A 3IDAA 5A3TA 1UY4A 4XJ8A 5C3PA 4YM3A 2CAVA 2JG9C 3E5UA 1O3QA 3MLJA 2GZWA 1IQAA 2YY1A 1GZWB 3A0KA 3JD72 3MW3A 1LOAA 4HLTA 3MEPA 4PCRA 5FP3A 5D2AA 1H2NA 4Q0VA 4TLFA 3K2OA 1POV3 2OT7A 2P3JA 5HBAA 4BB3A 2A70A 3N4MA 4EV0A 2HYKA 4C91A 1AXKA 1NLQA 3H0OA 3OPZA 3I4IA 3PHMA 4XJWA 3UGFA 2R062 1CAXB 2V4AA 3USUB 1S2KA 2VECA 5A7SA 1PX4A 3SISA 5F3GA 1F5FA 2W5FA 4Q4V3 2PLV2 4Q0SA 5LWBA 1VAKA 2YV8A 4FFGA 2JENA 2YC2A 4R9CA 2QJVA 2D7FA 5JIAA 3VBFC 1XU2A 2XXZA 5J48A 3ZPYA 3EYPA 1W03A 4C1XA 2PHRA 5KXBA 1X9PA 4IW3A 4OQ9A 5I8TA 1YRZA 3C3VA 3M1HA 2VW0A 5CYYA 2GNMA 4CCMA 2JIJA 3WDTA 2RM21 2A6ZA 1VBB3 3RZGA 1POV1 5CKQA 3OTFA 2JKBA 3LD8A 3VBRB 1OPOA 4JGYA 2IFRA 4RGKA 2WWUA 1VRH3 2ZKNA 1CX4A 1GSLA 3IAQA 1FMD1 4FPLA 4YW1A 2R042 4Z2AA 4Q4V1 4CXWA 1BJQA 1UZVA 3KQRA 5AFEA 1HLCA 1POV0 3KWVA 3N9LA 1RHI1 5K0UC 2BNOA 4Q4Y2 3TN91 4EWAA 4PIYA 3SHRA 1NZIA 4CEYC 5DDJ3 4E27A 4HFSA 1XE7A 1BBT2 2NPIA 2FDFA 2P3YA 1BMV2 1N1VA 1NZCA 2K2SA 4LHNA 5IK8A 1W2UA 3OSDA 4QT6A 4CUBA 3HNMA 1TMF2 1LHNA 3AP6A 5CZKA 5FZBA 5G04L 2IXHA 3IBMA 2WS93 2ZAAA 2C9AA 1MPXA 2VMGA 3B01A 3IT8A 1VIWB 3NNFA 4X6QB 5SV8A 3WQ0A 4TTGA 3PNAA 4FPEA 4LLOA 1DQ5A 4EJRA 3AKSA 5FKCA 5FZOA 5F7UA 4NHYA 1TG7A 5I91A 5K9YA 4CEWA 1FMD3 1YI7A 2XJVA 5FPZA 3ZFEC 5HI0A 2VY0A 3O0WA 4K20A 4RHV1 1YCIA 5JZGC 4UAPA 2OZ6A 1PMIA 3WCSA 1IS4A 1PO13 2WO3A 2XBO1 3EXUA 1T2XA 1ENRA 4NR1A 3AB0A 2Y64A 3PMSA 4QXBA 4N43A 1DGWA 5TSWA 4CDQB 3BTYA 4BPZA 1IKPA 3FN9A 3B00A 2VW1A 3AMQA 3UL2A 2GNBA 1JYCA 1IOAA 3B7MA 4PDWC 2HWC1 1Y4WA 3CU7A 1QHDA 4CDXA 2E26A 3VZKA 4HKOA 2ZOEB 4JDMA 4NIDA 3T4HB 3U75A 1JI6A 1GYKA 1BHGA 1YQ5A 2D6PA 2K9ZA 4KMQA 2D5HA 3LDBA 5C3QA 2NMOA 3WW3A 4HN1A 3P3PA 5I0UA 4D7SA 1ZBE1 1X9TA 2BJSA 1SLLA 3OGVA 4IEWA 1CD3G 4UFMA 1QH7A 4P02B 4K9SA 2WS91 4XUQA 3ELNA 3WVJA 4AE2A 5L7OB 2RV9A 3H42B 3CO2A 1JYIA 2XG3A 2XHKA 2ZCWA 3LEGA 4K8RB 4IDZA 2FZ2A 3MW4A 3RQ0A 3UKTA 5DG2A 4MGYE 3NAPB 4MGZE 4GWNA 4LTAA 3RYKA 4A7YA 2DUQA 1HV0A 5LRSA 2QDRA 1JBCA 2XJSA 2BDRA 4GZ9A 1AJKA 1OA3A 2VOKA 3GBGA 5L36A 1CAWA 1CPMA 1Q8OA 3MIEA 4YNIA 5CFDA 3WP4A 2D6LX 2JE8A 3VDAA 2XL9A 2HWC2 4OI4A 3VBUA 1HB2A 3H3ZA 4GXLA 3WHUA 4JGYC 2IXKA 2VPVA 2E63A 4QGNA 4YGCA 5E16A 5GLWA 2VAUA 3MFCA 1JZ5A 1I5ZA 3AKTA 3BPZA 2WNEA 1PNFA 1VR3A 3NNLA 2R7EB 5A1LA 1V9U2 4Q8LA 4LO8A 1S0CA 2PAEA 1XSQA 5BXXA 2Y33A 4CU7A 4Y1UA 1W99A 1D0GA 4AG4A 5DUXA 1WUVA 1BK0A 2GN3A 3SCFA 1V6IA 3UESA 1YJKA 2O14A 3I8TA 5FXZA 3WOGA 2ZJCA 4XFBA 3WDYA 2E7QA 3VBSA 2RR13 2X8KA 4HKWA 4XOGA 2EA7A 1WA4A 1WW6A 4CA9A 4BQ2A 1W28A 1G9FA 4HETA 3BTXA 3JQWA 2AACA 4PQQA 2D3RA 2DBNA 2UWCA 3T2QA 3CKHA 1UF2C 2D6KA 3R6SA 3NAPC 4OZOA 1MS8A 2NP0A 3U4SA 4QPWA 1PGSA 1JODA 1CQ9A 3IPVB 2IUWA 1XBFA 4RR3B 4FPFA 2ZZJA 3H9AA 5A3UA 4MUVA 1AR72 1ALYA 4PIXA 4AW7A 5D21A 1RUOA 2SLIA 4XILA 1X8MA 2P4EA 4QQOA 5CAZA 5KHHA 1FI2A 3VKFC 2W92A 1G7YA 1JMUB 1ZZ8A 3HN1A 4JHTA 2IZWA 3LF7A 4E2GA 1DF0A 5C9AC 3OEBA 2VZ3A 2RS51 4XC9A 1DZQA 4Q4X3 1LU1A 4LO6B 4LO5B 3FLPA 2X53S 4QX8A 3VV1A 3I7DA 2VR4A 3VDBA 3KVAA 1DQ4A 4YZ5A 4JDOA 1RUE3 3RI9A 3T3YA 2Q30A 2W1WA 3VBSB 1OUSA 1JOBA 3ZFEB 5JZGB 5FPLA 1RXFA 3PJQA 3GZEA 1BLZA 3L2YA 3PVNA 1VBD2 4OHZA 4D3WA 5GM0A 1N3PA 4XUOA 2OUJA 1JH5A 4NHLA 3T1LA 4XZUG 4RSUA 4RFRB 2DCZA 2HYXA 3ACLA 1EV13 2ZTNA 1NA1C 1GFF2 1XE8A 3MV11 3HIFA 5T54A 3AP5A 3M2MA 4XDQA 1LHWA 3JB8A 2EXHA 1VBB1 3TEZA 1PX3A 1KD7A 2NM1A 2ZXQA 1UOBA 3SH5A 3UNPA 2BV4A 1HDKA 5FPBA 4CDUA 5JXHA 3C7OA 1CAVA 2FMDA 3O5SA 1WD3A 4I0WB 5FZ6A 5IT6A 4IGPA 2LTNA 1J84A 1UOGA 2NMNA 2RS52 3OOXA 4XJUA 3CIHA 5CADA 3RDIA 1O8PA 2JKXA 3SXWA 1YIFA 5FR3A 4QKDA 4CZSA 2YBKA 2XJUA 3N7MA 3QCWA 3ZYIB 5A3LA 5E89A 1O8SA 3LOBA 4MLOA 2QQVA 2YYOA 4I30A 2ZAHA 3BOPA 4RYDA 2DVFA 3K4DA 5LB6A 3KCYA 2HWB2 2HWE1 4ATEA 4AVBA 3BTAA 5F1RA 5LA1A 2R073 3MO4A 4YG0A 1DFQA 3VD5A 5HV0A 1UXZA 1VBE3 3BPSA 4YVSC 4AWDA 1AR82 2ET1A 3ZMNA 5JOYA 5CFCA 1MQTB 4HANA 4N9HA 3V0BA 4IEOA 4UOJA 5FQ0A 4RL7A
chains in the Genus database with same CATH topology
1AR63 4AI8A 1VB4A 5DZFA 1RJ8A 3U11A 4AHZA 1H9WA 1SBDA 4LA2A 4NWVA 5KWRA 2R063 4YZ1A 2E7AA 3RG0A 4N43C 3AFKA 4AVSA 1IGOA 3JBG1 4K21A 3IWZA 1MR5A 2UU8A 3AXEA 2FBEA 2X5IB 4HMZA 3SCHA 4D7TA 2WT2A 2XBO2 2VULA 2JJ6A 3MI8A 4E4ZA 3LAGA 4RFT0 4S2GA 2HWB1 4HSJA 3RI8A 3WINE 3FBYA 2DVBA 4XFAA 3ZFFC 4YZ3A 4LR4A 5D8AB 1ZX5A 2XVGA 1R083 4B29A 2ZGMA 1I6XA 4DXZA 2BW8A 3AZYA 1A6CA 1H4GA 5BNPB 1LULA 1BBT3 3DN7A 2XLAA 3EO6A 4YGDA 1C1LA 2E6VA 1FXZA 2ZX2A 4AF9A 3OBRA 3RPQA 2PFWA 3ME2A 4FTEA 3N3HA 2VOWA 2CL2A 4NN0A 4LBMA 1RUF3 4X8PA 5I93A 1MEC2 1XNDA 2R1DA 4FPGA 1RUI2 1S1AA 3ROUA 2ETEA 4GB31 1ZBA1 1U5XA 2P34A 2VMHA 4L97A 1QJY3 4RS5C 1VBB2 4AVVA 4YZ4A 2QE3A 5H9SA 5JPMB 2ZHKA 4KG8A 4PBOA 2HEWF 4W6YA 4XIOA 3ES4A 4OHWA 3CEWA 4GH4C 3U10A 4XBQA 2TEPA 4LT5A 3LCPA 1ND3B 5IK4A 3AMHA 4RHV3 3AYAA 3IMNA 4B3NA 4CDUC 4L11A 5KC5A 2A75A 4B4RA 1PIV3 1NCQB 1Q8SA 1UIJA 3URFA 1MZEA 1TNRA 1N3QA 2UYBA 2D3SA 2VNRA 3PVBB 3VZOA 3AYDA 4M0HA 4V1PA 2OPKA 4BCUA 3SH3A 3VUOA 1UU5A 1XXNA 3ZXFA 2LM3A 1AR92 1GBGA 4JAAA 4Q1RA 4CP1A 2P2KA 5FLJA 1O3RA 1ZRFA 3A0NA 3OJBA 2NYYA 3MDPA 1IPJA 3PTYA 3OGJA 2VOVA 1VB2A 2JICA 1KJRA 1C5HA 1FV3A 3OY8B 4G4FA 1AYN1 1O91A 4C0HA 1AXYA 5J3UA 3ES1A 1YI9A 1V9U3 4D7YA 4OLLA 4G3YC 1MS5A 1DGRA 3WCRA 1ZZCA 2RJKA 1PK6B 3JD73 3INAA 3LA2A 4XHBA 5D1IA 1O7FA 4R52A 3VHNA 1W0OA 4CDQA 1BZWA 3GBWA 3U0ZA 1PNGA 4OHVA 1R1A1 1NQJA 3GHMA 2XWBB 2XVKA 2DCJA 3QOPA 4QPYA 2VH9A 2WL1A 2SBAA 3LGRA 1RUH3 4EN7B 1O3SA 4RGGA 4AEKA 4IESA 2GC3A 3KZ4C 2IXLA 5FO7B 1Y43B 1PO21 2Q5TA 1UD1A 1QMJA 2DU1A 1S0GA 4XFIA 2UWBA 4QGMA 5L7OC 5DZGA 1NY72 3NAPA 2VU9A 5A33A 5I0SA 1DZRA 2ZGPA 4D69A 1E57A 2MEV1 2Y26A 1FT9A 1HV1A 2ET7A 4XF4A 3DPRA 1BMV1 1ZVFA 1Q43A 3KLSA 2QFEA 2RE9A 4QPIB 1ENSA 5CU1A 2WFF2 3S7IA 4DPNA 3RWNA 1SCSA 3ZSMA 4MSVA 1F9KA 3E6BA 2AUYA 2B39A 3I2DA 1YNAA 3MFAA 1LOFC 2RR11 1V6OA 1X36A 1RINA 1L3JA 5GLVA 3S30A 5F5QA 3UKVA 4YFZA 1PZ8A 3ZYGA 5FBZA 1ONAA 5DUVA 5BV6A 1JOJA 1H0BA 3O12A 2X29A 4Z82A 4COWA 3OD4A 4BLIA 2ENRA 3ZIXA 5CFDB 4PJYA 5A32B 1VBA2 3KCCA 1SLIA 3BU7A 4QPGC 3HT1A 1UKGA 4JV4A 3VBOC 1ENXA 2ZX3A 3H3UA 1QXJA 2KM2A 4M3CA 5FMOS 1C8M3 2EAKA 3ST7A 3UKNA 4CDXC 1VALA 1QQP1 4LBLA 2Z69A 3LWCA 2VOXA 1K5MC 1ZZ6A 2I45A 5BNNC 1W0PA 1S0BA 3V65A 3CLPA 1C57A 4MVTA 4XHXA 1ASJ3 2RM22 4AK3A 5GLZA 1WBLA 5EZWA 2LUWA 3ZFEA 5JZGA 1G9BA 1YFWA 3FFZA 1KDKA 2HEYF 2Z42A 3JD71 2ZGLA 4I0AA 4XMIA 4XPVA 3B69A 1U5ZA 3L2HA 4AQTA 1NY71 1U0AA 1AL22 3AKRA 2A3WA 1FOD3 2EVXA 2QZ3A 1NCQC 5DUWA 4R9BA 1DZTA 2AGSA 1DHKB 3BB6A 3RS6A 3BIWE 2NN8A 2VUAA 3WZ1A 4F83A 1KXGA 1R082 4XF3A 2ZBJA 1HXS2 5K8SA 2ZPXA 1TME3 1REDA 2DYCA 3HD8B 2FZ1A 1DIWA 4AYUA 4XQ4A 4K7JA 2YHJA 4N9IA 1AR73 3GALA 4KWJA 4F7ZA 4WM8B 2A6VA 3ZSEA 2WNVA 1N1YA 3VKMA 3E5XA 2GH2A 4K40A 4LBNA 4JRLA 3TYJA 3AP9A 2IXIA 5BNPA 2DFCA 1RUD3 4FTSA 4TSVA 3WHTA 4LEJA 3ZYJB 5HCAA 1RUNA 1J3QA 5ABJA 1UX6A 4FPCA 5C9AA 2OZJA 2JDZA 3VBHC 1G9CA 1UPSA 2P3KA 2WNUC 3ZXLA 4WVWA 1F5JA 5EWSA 3K48A 2ZABA 1Q8VA 3UK9A 4CP0A 3LOIA 4N53A 3ZN5A 1TME2 3MICA 4S2HA 4YSFA 1G6NA 1V6LA 1PZ7A 1WBFA 2OUHA 2CGOA 1H1IA 4WVVA 4NHKA 1J1TA 2A6YA 2GNTA 2R30A 4P9LA 2WQ4A 1GZCA 3B93A 1ND2B 5BNOC 1QXRA 3GZTB 1CAXA 2EIGA 3USUA 2CGNA 1NCRA 2D40A 4INDA 1LODA 3NKTA 4RHV2 2VXRA 4XTMA 2WINB 1PIV2 2RMU2 2WZPP 2DTYA 4AFMA 1EV12 2K0GA 4EWEA 2ATFA 4KGGA 5CFDC 1VBA1 3TNPB 2JG9B 2AZ5A 2GMMA 2NQYA 4HZFA 5E88A 4NO4A 2Y38A 3NL1A 4YLZA 1OQDA 3OYWA 1QU0A 4JGYB 1WLWA 3QH6A 4YW3A 4YGEA 3ZYPA 3KM5A 4Z92B 1WMEA 4CYDA 3E97A 2CY6A 5DXDA 1XNBA 5FLIA 1WW4A 4Q4V2 1RMU1 1GANA 2GC1A 1MEC1 1IKQA 1ZM1A 2VQ0A 1VBD3 3EHKA 3J4UH 4S2DA 3WDXA 3FFQA 4COUA 4LBOA 1GNZA 2MHFA 2JG8C 1X8EA 5KHGA 5SV5A 3T2TA 1QJZA 2CAUA 1J1LA 4ISRA 1TEIA 1XNKA 1XYPA 2YXSA 4E4SA 3FZ3A 4DQAA 5HXVA 2WNUA 3ZSLA 4ISQA 4GKXA 1YHFA 4CEWC 1DYKA 2OA2A 4G9SB 4LHKA 4Y1YA 4AEDC 2VNOA 4WM7C 3NJZA 3BCWA 4W6WA 4CDQC 3WUDA 2XPJA 5A32A 1GQGA 1OOPC 3I54A 2PLV1 4AVAA 1CESA 1PO22 2WNVC 1TE1B 5T5JA 2WNVB 1QF3A 4CDUB 2XLGA 4WVMA 1MZ6A 1RUJ3 2ZHMA 3JBG2 3M7AA 4IL7A 4AGRA 3V0AA 4YRDA 4JQRA 5CFCB 2Z79A 2XKPA 3VDDB 4OZXA 3IIAA 5KBFA 2IFWA 1I9RA 5BUVA 3TB0A 2ZKLA 5CIRA 5GZGA 4FQZA 3W9AA 1UAIA 2DVAA 3KCXA 1R1A3 5KXCA 4P5HA 1CJPA 3VBUB 1TNFA 1RUF1 2WT1A 3ZSKA 4AEJA 3VZLA 2ZGKA 4KGQA 5C8CC 1OLQA 1QOOA 3B9IA 3HQXA 1NG0A 3RYPA 2GDFA 4QXKA 4AFDA 5BNPC 3MPBA 5LRRA 1VLNA 3KS7A 4OI2A 3RJ2X 1AR91 1DG6A 4Q4X2 2OVUA 3DUIA 3PMEA 2WKKA 1SLTA 4ES8A 1Z7S2 2EXJA 4CDXB 1UL9A 1AYM3 4O9GA 1O4TA 3WP3A 3VHRA 3WUCA 4N7IA 3E5QA 3IDCB 5KC6A 1AUYA 2YPJA 1H1MA 1NCQA 2H6BA 2G9GA 3H8UA 1CVNA 3E6DA 5EXOA 4GMP3 4M00A 1IS6A 5B2GB 3SLIA 4DFSA 1O4YA 1XRUA 4O9EA 1MS1A 1AR93 1QJU3 3GBFA 1BVVA 5FO8B 2WLQA 2B5HA 3LB9A 1FYUA 3V64A 4LBJA 4YZ2A 2ARXA 2ZA9A 4M3CF 1H8VA 1UMZA 2RS53 2KXLA 1IS5A 2UY8A 1Z0HA 1M06G 1MVEA 1KQRA 3JU9A 3AJYA 3SH4A 1GQHA 3VBHB 3HBZA 5FOJB 3AP4A 5FREA 3JCIA 1VAVA 2A6XA 4L8QA 1ND3A 1LU2A 1R1ZA 5D8AA 4GB33 1F8VA 1CAWB 3AMNA 3AKPA 3D82A 4AVTA 1ZBA2 4META 3VDDC 4HPKA 2HWF1 3N36A 3EQEA 2HWD2 3ILRA 1RUE2 1H8TA 4QPIA 2JECA 1LTEA 1NA1B 3D5OA 3WG1A 2A3XA 3C2UA 4CRQA 2D98A 5K7PA 1XNCA 1RUG1 5FCCA 1EAH3 1O4ZA 1CPNA 1DQ1A 4XXPA 4AHYA 3ZXEA 4U2AA 3J8F3 4Q0UA 3U07A 3ALQA 3PJYA 5C9AB 1AR61 2H0BA 2MEV2 1PGW2 3DL3A 5JWPA 3ECQA 2XJRA 2ERFA 4Q26A 5DDJ1 1G86A 4H7MA 4WZCA 2XWJB 4XYXA 3ZN6A 5CA6A 1O3TA 4PLNA 3ZN4A 1Q8PA 2BEOA 3DPRB 1GLHA 5JLVA 3ZXJA 4HKLA 5I0TA 4BIOA 1W6QA 4RR3C 3VHOA 4P14A 4Q8KA 2Z5WA 4H7LA 1LRHA 3WW4A 1WLDA 2P3IA 2UWAA 1EAH1 2DCKA 1NCRC 2PN5A 1GKBA 1WLCA 4DOUA 1U5IA 1YJLA 3JQXA 5JMCA 1C8NA 4MGKE 3VBOB 4K1ZA 2Q8OA 4IEZA 3QACA 2C5DA 1V00A 1TMF1 4Q4Y3 4QM9A 3CJIB 4ZXKA 3WLUA 2BWAA 3AJZA 3RMXA 3MZHA 2EALA 3KT1A 3J9SA 2GMEA 1FATA 4Q1PA 2AYHA 3TRSB 3WW1A 1S55A 2XJQA 1QNYA 2HEVF 1C28A 2RS31 3POWA 2OYZA 4S2FA 1AYN2 3OGGA 2JG9A 1FMD2 2BWCA 3E6CC 3KMHA 1W6OA 1LKNA 1SACA 4KU7A 1QKQA 4AQ6A 4P9JA 1WCSA 3WDWA 4M0NA 4JRAA 1DDLA 3N7LA 2AENA 4LUMA 1LHVA 2BNMA 1ZBA3 3D6EA 1CAVB 1FOD2 4UW3A 3WT3A 1YUDA 1LOEA 2H6CA 1W6MA 3MIHA 1RUE1 3AZXA 1AL23 3CJXA 4QGLA 4WZFA 3D0JA 2R49A 1UIKA 1V70A 3R4SA 4LUKA 4XFGA 3VKLA 4FP3A 1VP6A 1Z7S3 3IPVA 4RR3A 1RHI3 1RIRA 4WVMB 5T3NA 3MYXA 4BQ1A 4F3JA 2W52A 1Y3TA 4XW3A 1QJY1 1RTVA 1QJX3 3FUQA 1DYPA 1IHMA 4YG3A 3THPA 1LGNA 5F9TA 3CJIC 4Z8BA 4BLJA 3R4DB 4XFFA 1HQWA 1WCDJ 2D6NA 5HCFA 1W6NB 3GZAA 4GALA 4J6GA 4Y24A 4LO4B 4X6RB 5T5OA 1DQ0A 3ZXGA 1NLRA 2ZHNA 4FSJA 1AYM2 5BNOB 1AYN3 2B42B 1ZZ7A 3I59A 1UKRA 4FAHA 2BFUL 2DTWA 2QNKA 1AR83 2PHLA 3B3QE 1ZBE2 3IN9A 1LB2A 4JC1A 2FMYA 5LK5A 2PTMA 4P9WA 3KSCA 5EYXA 1N3OA 2TNFA 4YM0A 5JPNB 4XF0A 1FV2A 1DGRN 4QHBA 4N90A 2R6QA 2ZMNA 5CBLA 4FOWA 1H2LA 1RUH2 1PK6A 2MNGA 3QD6A 2HWF2 1REEA 3PVEA 1ULFA 1ZRCA 3KD4A 4KNCA 4BM8A 5KHJA 1S0DA 4N53B 2QQPA 1KFUL 1WMDA 2ZGSA 2HWC3 1S0JA 3M4FA 1B35B 1CGPA 5LK7B 5T50A 2DCYA 3MLKA 5CVRA 3TBDA 1D2SA 2WA4A 4PLOA 3NVCA 2JE9A 1COV3 4AXOA 4OULA 4E9KA 1B35C 1DGWX 1MS4A 1SMVA 3KT4A 4RS5B 5K0UB 4P9YA 4YM1A 2GH8A 4LLFA 4XQDA 4WM8A 2HWE2 1ULEA 4CP2A 5T55A 5AC93 2HJIA 5KXDA 5FAXA 5GLUA 2A73B 1QJY2 2XL7A 1GICA 2ES3A 4ZU4A 4HBNA 4AFBA 3AZVA 5JOWA 2ZZQA 3WG3A 2DCTA 4JDNA 2I07B 3ETQA 3W58A 5FPXA 1BBT1 5EYYA 4XJAA 1JHNA 3GYDA 4DMIA 1QJU1 1YWKA 3TOJA 4IV3C 4QQLA 3M70A 1QXPA 3FX3A 5F6LB 4GIQA 3VBFB 1Q8QA 2YDEA 2HWD3 4HK8A 1VBD1 4H55A 2VVEA 4AEMA 4Q4X1 2B45X 1AF9A 1FPN2 2W08A 3MF9A 3WDVA 2X5IC 2VVDA 4XBNA 3FC0A 2QUOA 2QDNA 1LESA 4N43B 4P9IA 4WM7A 5FRAA 4NPRA 5ACA3 1KS5A 1D4M3 4YG6A 1VBA3 2R0HA 4XMAA 2OW4A 4ASMB 1LCLA 3APBA 4KBBA 3OF1A 3WQ7A 1RMU3 4H14A 4E2QA 3HWJA 1W6MB 3VL9A 3POYA 1K5MA 2WFF3 5BNNA 4IEPA 3M3EA 1CJDA 2WJSA 1YLLA 5DUUA 1BCXA 1EV11 1NYWA 1W6PA 2Q1MA 1H8TC 1ND2C 1PIV1 4AI0A 4QPGA 5AVPA 4AQ2A 5BNQA 1RUG3 4K3UA 3ILNA 1YIPA 1WLTA 3AX4A 5F6KA 1SLCA 2PAMA 4DB5A 2LALA 4IV3B 4NOTA 5EJ3A 1S0FA 1REFA 3AZZA 4IEQA 1LENA 1YFYA 3NSTA 1PGL2 2NZ9A 1C1FA 2WQZC 3MIBA 1RGSA 3IDBB 5JI7A 4AQSA 1ND2A 2VQAA 1PO11 2XBO3 4YM2A 1Z78A 3B94A 5AVAA 1G8WA 1A3KA 3ZFGA 4MXWA 4B4PA 1RUJ1 2IC1A 2WNUB 3EBRA 3WR0A 2ZGNA 4RQPC 5J98B 1OFNA 1JXNA 5J09A 1RVF3 2B8MA 5H9PA 1H1AA 2NLRA 1CAUA 2AREA 3TN92 4W65A 4AFCA 1LHUA 1FX5A 1Q56A 4P9GA 2RM23 4CEWB 2RS12 1LHOA 1FNYA 1ZA4A 1RMU2 4LHLA 4IXLA 3U4XA 2E53A 4LE3A 4FBFA 2IXJA 2JG8B 1LGBA 4HN0A 1FPN1 2VUJA 4IV1A 1XU1A 1SQ4A 1UW8A 4LBQD 4FQ4A 1ZREA 1OQEA 2R043 2BBVA 2V5YA 5JSRA 4RGAA 4R9DA 5ABJC 4JVAA 5J37A 1RC6A 3VZNA 2YGMA 3FWEA 2RJLA 1JW6A 2E51A 2D5FA 1QJU2 4BIFA 2WZR2 4YARA 3L9JT 3KGZA 4LE4A 2Q4SA 4HVRA 5C8CA 5DZEA 1UN1A 4OUMA 1EPWA 3MLLA 4GKYA 1EY2A 1KJLA 2GU9A 4OFGA 4Y20A 5CG9A 5CB7A 4M3CE 4I01A 1OA4A 3HT2A 3JUUA 3O0XA 4I3GA 1BEV3 2PHDA 1NXD1 3SITA 5AC92 1UU4A 2N7GA 4IEXA 5FO9B 1UPIA 3NV2A 1BK1A 1QOSA 1SDWA 1ASJ1 1BXHA 1LGCA 4FTBA 5T5PA 1QJX1 5ACA1 2DVGA 4Y22B 4BZ4A 1PZ9A 2HKXA 4ONUA 1ZZBA 1X33A 1EP0A 4YW4A 5C4WB 1MS9A 5ABJB 2CWSA 2BUKA 2Z2SB 4LA3A 5E8AA 3MGUA 5A33B 1S2BA 4Q0PA 4SLIA 4FPKA 4HT1T 4MZUA 2V09A 1HRI3 3MF6A 4OUSA 4BH9A 3ENRA 1G9AA 5BYNA 2O8OA 3EJKA 1XQNA 3O0VA 2HWE3 2YC0A 3BOWA 3OCPA 5LEJA 4NWWA 2ZX0A 1RUH1 3AK0A 4YW2A 4QPIC 3B9CA 4AEDA 1RVF1 2VW2A 1S0IA 1OD5A 3WD5A 1O5UA 4PF5A 2MEV3 1J3RA 1JUHA 3VBRA 3D8CA 2EAAA 3AZWA 1DGLA 3WP5A 1UZYA 4UW4A 4A2UA 1OFSA 5D8AC 3RSJA 1AX2A 2WFF1 1KDMA 4C0BA 1J3PA 2IXCA 1N1SA 2HWF3 2WS92 5JOXA 5GJ6A 1F2NA 4FOYA 2I2SA 2WWSA 1LOCA 1AYM1 2DUOA 4Y4YA 2O8QA 4BOWA 4L92A 1RUC2 5I8SA 1RUJ2 3JBG3 3NWKA 2DWRA 4YFWA 1QDOA 5FLHA 2D3PA 3PLQA 4TWTA 4XF1A 3JZVA 3ZYRA 3WXPA 1EPZA 4KU8A 4GMP1 3SMHA 1W6OB 2PHFA 4COZA 4FXGB 2JXAA 2DF7A 4Q0QA 5GZCA 1G9DA 1J58A 5IK7A 5BY5A 5IUQA 4RQPA 4TYSA 4XJ9A 4KH9A 4BA6A 1IZ3A 4YVSB 5GZFA 2A6WA 5L7OA 2HWD1 5FFOC 4P9XA 4QD2A 1FPN3 1MS3A 1NCRB 2EXKA 2R16A 4U36A 4I2OA 4GA9A 4QU2A 3V0BB 2VMIA 2D44A 2Y0IA 2XH6A 3H1MA 3SNMA 2F4PA 4Q4Y1 2Y0OA 1MZFA 1A8DA 1BEV1 5C6CA 3KB5A 3GF6A 1PM7A 2A71A 2WZR3 1CAUB 2BNNA 4MXVA 1FNZA 4A7KA 4JTOA 5JSPA 1QJX2 2PHXA 2PHTA 1AJOA 2WFPA 4OHYA 4XFHA 4IEYA 5I8YA 4FPHA 2XVLA 3ZSJA 3NKGA 3LA7A 2CWMA 2XUMA 2RHPA 2A3YA 2WT0A 4OI1A 4PBPA 3ILFA 1VRH2 1C8M1 4LBQB 1V6JA 2Q0AA 1SEFA 5GKAC 3V56A 1DLLA 3VBHA 4AGVA 2I74A 2RS32 1HQLA 2BFUS 1GZWA 1AR71 4F8AA 4XBLA 2UURA 4Y1ZA 4H3WA 3QH7A 2RS13 4MV2A 3D4KA 4SBVA 3TNQA 4TZDA 1COV2 1WW7A 2EXIA 2GSYA 4FPOB 1VBC3 3LSEA 4Y1XA 1H9PA 2GC2A 3DF0A 4GMP0 5A3MA 4OHXA 4PDWB 1H8TB 1NOVA 2B7YA 1ULCA 1FOD1 4MGIE 3AXDA 3JB4C 3KT7A 1RUC3 2WSUA 4XEZA 4WV8A 2CGPA 2ZS6B 1MVQA 2A7AA 4AHXA 4FP2A 5DG1A 2F6BA 2YGLA 4HPKB 1RB8G 1OSGA 1X7NA 1V9U1 1TME1 2CTVA 1LEDA 4Y5Z0 1XYNA 4J1WA 4RA0A 4B8EA 1AX0A 1BYHA