4Q4V2

Crystal structure of coxsackievirus a24v
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
264
structure length
264
Chain Sequence
GYSDRVRQITLGNSTITTQEAANAVVAYGEWPSYLDDKEANPIDAPTEPDVSSNRFYTLDSVQWKSTSRGWWWKLPDALKDMGMFGQNMYYHYLGRSGYTVHVQCNASKFHQGALGVFAIPEYVMACNTEAKTSYVSYVNANPGEKGGVFDNAYNPSAEASEGRKFAALDYLLGCGVLAGNAFVYPHQIINLRTNNSATLVLPYVNSLAIDCMAKHNNWGLVILPLCKLDYAPNSSTEIPITVTIAPMFTEFNGLRNITVPATQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A sialic Acid binding site in a human picornavirus.
pubmed doi rcsb
molecule tags Virus
molecule keywords Coxsackievirus capsid protein VP1
total genus 61
structure length 264
sequence length 264
ec nomenclature
pdb deposition date 2014-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4q4v200
1R1A3 2R061 4IV1B 1PGW1 4GB31 4N43C 1MEC2 5C4WA 1QJX2 1BEV2 4Z92B 2XBO1 1NA1A 1NCQB 4Q4W3 4SBVA 2XBO2 1R082 2RS52 1C8M1 3J8F2 1RUH3 4GH4C 4GB33 1NCRB 1TMF1 1D4M2 2BFUL 2R073 2R041 3VBHB 5DDJ1 1AR71 1ZBE3 3NAPA 2MEV3 2R062 3HAGA 1PIV1 4FTSA 2HWE2 1AYN2 3TN92 2WZR2 1NCRC 3TN93 4NWVA 1QQP1 5CFDB 1ZBA3 1RVF2 1ND2B 4YVWC 4WM7C 1POV1 2VQ0A 1QJY3 1OOPC 4PDWA 4QPIC 5C8CB 1BBT3 2X5IA 5BNPA 1AYM3 5D8AB 1HX6A 5BNOB 1RUD3 4NWWA 4Q4V3 4RHV2 4WM8A 1VBE1 1HRV3 3ZFEA 4Y4YA 4YVSA 2XBO3 2WFF3 1RUH2 3VBHA 2RR11 2RM22 1BMV1 4N43B 1QJX1 1RUH1 2R063 4EJRA 4CDQC 1RVF3 1AL21 1H8TB 4AEDA 5CFCC 1M06G 4CDXA 2MEV2 3VBRC 4CDXB 1NCRA 5D8AC 1AR91 5BNOC 1FOD1 1VAKA 1RUF2 1VBC2 1COV2 3FBMA 3JB4C 4GMP1 1OOPA 3TN91 5FMOL 1V9U2 4CEWB 2MEV1 1NY72 5AC93 3VBRA 4CEWC 4CEWA 2HWE1 1AYN3 3VBOB 1A6CA 1VBD2 5A32A 2HWD3 1COV1 4N43A 1QQP3 5L7OA 1EAH2 4RR3B 1D4M1 3ZFFC 5BNNC 4WM8C 1AR92 1AR93 3VDDB 3J8F1 3CJIB 1F2NA 4CDQB 5BNPC 4GMP0 1AL22 3ZFEB 3ZFEC 4YVSB 1D4M3 1HRI2 2R072 1PO13 4Q4W2 1FMD3 1R091 1VBB3 1AR81 1C8NA 2WS93 3ZFGB 1ND3A 1RMU3 1VBA1 1Z7S3 2IZWA 1AR61 2HWD2 1EAH3 1NOVA 1RVF1 4WM7A 1VBD1 2HWD1 1RUD2 1RUG2 1ND3C 2WWSA 5C8CA 5ABJB 2PLV1 1FPN1 4QPIB 1IHMA 1ASJ2 5A33A 1RB8G 4QPIA 1CJDA 4JGZA 5D8AA 1HXS3 1RUG1 2X5IC 5BNOA 4WM8B 2HWF2 1Z7S1 1AR63 4N53B 2ZZQA 4IV3A 4RR3C 1R081 2RS51 5C9AC 1B35C 1VB2A 5C4WB 1QJU1 1QJZA 3VBSC 5J98B 3VBFA 2RR12 1NCQA 4QPGC 4QPGB 1OPOA 1R1A1 2HWB2 1PO12 4RS5B 1QJU3 1FMD2 1RHI2 2HWF1 1NA1C 2RMU2 1PGW2 1VRH1 4GB32 1X36A 1HRI3 5CFCB 5CFCA 2WS92 1HXS2 5CFDA 5AC92 4CEYA 2FZ2A 4CEYC 1OOPB 1EV12 4RFT0 1AL0G 4Q4V1 1TME2 4IV3B 3ZFGA 1RMU1 3VBOA 1AR83 2WS91 1V9U3 1VRH3 1RMU2 1VBD3 1POV0 3ZFFA 1QJY1 3ZFFB 1POV3 3CJIC 1HXS1 1RUG3 4YVSC 1FPN3 3LOBA 4Q4Y2 5BNNB 3VBSA 2DF7A 5BNNA 1R083 2RS53 1C8M2 3JBG3 4GH4B 1RUC3 3JB8A 2ZTNA 3VBFB 3VBFC 5FMOS 2FZ1A 2WFF1 1Z7S2 4CDUB 4RHV1 2RR13 1NCQC 1ZBA2 4QPGA 1RUE2 1PVC2 2BFUS 1RUI3 1RUI2 3DPRC 4CDUC 5ABJC 1W39A 4JGYC 2HWB3 4RS5C 2X5IB 2HWC1 4RQPC 2HWF3 3VBUC 3VBOC 5A33B 1FPN2 1VBB1 5J96B 5L7OC 4GMP3 3VBUB 1EV13 5K0UA 1RHI1 3VBUA 2WFF2 3JBG2 1AR62 2HWB1 4IV3C 4RR3A 5AC91 4IV1C 4IV1A 1X33A 1AYN1 1AUYA 1RUC1 1BEV3 1PO23 4CDQA 1TMF3 2R043 1FMD1 4Q4Y3 5DDJ3 5BNPB 5JZGC 4CDWA 3ZXAC 1CD3G 1E57A 1NA1B 3VBSB 5FOJB 1MQTB 3JBG1 4GH4A 1EAH1 1MEC1 1RUC2 4BCUA 4Q4X2 1TME3 1BBT1 1VBB2 2HWC3 2PLV3 1RUJ1 2GH8A 2BPA2 3VBRB 4CDUA 1RUD1 5L7OB 5ACA1 2TBVA 1QQP2 1PIV3 5C8CC 2QQPA 2RS32 4CDXC 1VBA2 1H8TA 1ASJ1 4RQPB 2BUKA 4AEDB 1SMVA 1VRH2 1B35A 1ZBA1 4JGYB 5DDJ2 4CDWB 4N53A 5K0UC 4FTBA 3S6PA 1MQTA 4Q4X1 1MQTC 2R071 1WCDJ 1AR72 1PGL2 1AR73 1ZBE1 5A32B 2RM21 1PO22 1HRV1 3CJIA 1PGL1 5JZGB 3VDDA 5C9AB 1MEC3 1F8VA 1HRI1 2Y26A 2ZAHA 1PO21 1BMV2 1K5MC 1ZBE2 2XPJA 2RS33 3ZFGC 4WM7B 1RUE3 2HWE3 1PVC3 4AEDC 3DPRB 2RS11 1H8TC 1V9U1 2RMU3 5ABJA 3DPRA 1COV3 3M8LA 1VBE2 1K5MB 1ASJ3 5CFDC 1VBE3 2HWC2 1K5MA 4YVWA 1RUF1 1VBC1 4YVWB 2BBVA 1ND2A 1RUJ3 1RUJ2 2RS12 1NY71 1BBT2 1PIV2 2RS31 4PDWB 5ACA3 4JGZC 1NG0A 1FOD3 1AR82 1RUE1 5K0UB 1QJX3 4N53C 5JZGA 1R092 2WZR1 1R1A2 5C9AA 4JGZB 4Q4W1 3VDDC 4LLFA 1AL23 5LK7B 5C4WC 3JD71 1TMF2 1HRV2 2R042 4CDWC 1OHFA 2WLPA 1QJU2 1RHI3 3NAPC 1HQNA 3NAPB 5GKAC 3IDEA 2WZR3 2RM23 4Q4X3 3VBHC 1GFF2 1BEV1 1QJY2 3JD72 4FSJA 3JD73 1ND3B 4Q4Y1 4Y5Z0 2PLV2 1AYM2 3J8F3 4Q4V2 4RHV3 4RS5A 1EV11 1AYM1 4RQPA 4PDWC 1ND2C 1RUI1 1VBA3 4CEYB 1B35B 4FTEA 1DDLA 1PVC1 4JGYA 1RUF3 1VBC3 2RMU1 2RS13 1TME1 5ACA2 1FOD2 1PO11 1VB4A 2GSYA 1C8M3 1R093
chains in the Genus database with same CATH superfamily
1YJKA 2ZACA 1LGNA 1PVXA 1IQDC 1GZWA 2ZGNA 1W9FA 1R64A 2AR6A 4NN0A 1BEV2 4UFKA 5FZKA 3WDWA 4A7YA 1DFQA 3D6EA 1UZZA 3E1F1 4XJUA 2XBO1 4XTPA 5JPMB 2XKOA 1E5HA 3AXEA 3E5XA 5CG9A 3JZVA 1J58A 2K0GA 2XBO2 5FYUA 3WHUA 4ZU4A 3U0ZA 5ANNA 4BIOA 4W65A 1XRUA 3R4DB 1TMF1 4TXWA 4YW6A 4IERA 5DDJ1 4NIIA 4AFAA 3ACIA 4QQ2A 4JRLA 2A73B 4QGMA 5LB6A 2J1EA 1HQLA 2P5BA 2QQKA 2R062 3GNEA 3USSA 5FPXA 4HVQA 4FTSA 1AYN2 5FMBA 2I74A 4LBJA 1XNTA 5FCCA 2BVVA 3PDQA 1QQP1 4NWVA 4Y4RA 3S7EA 4O9GA 3AMQA 1ZRIA 1ODMA 4LKSA 2HKXA 4LMFA 5CFDB 2WSVA 1FI2A 1DBNA 3ROUA 4XABA 2E32A 3J7NA 3WZ1A 5HCHA 1BVP1 1DGLA 2BEOA 4PDWA 2Y38A 3M3IA 4QX0A 2VR4A 4M00A 1G9DA 5C8CB 2YHJA 3LOIA 4AZZA 1UX6A 4IQPA 4Y1VA 5LW9A 1JOPA 2X5IA 1ZZ7A 4I09A 1W8UA 2CTVA 5BNPA 1HX6A 1NUKA 1YJLA 2ETEA 3HNYM 2Q1MA 3KB5A 4NOTA 4QXKA 2K46A 1MS8A 1PX4A 4PF5A 3RS6A 5FZEA 2X29A 1SZBA 3POEA 4K21A 4UWDA 4Y1ZA 3M4FA 1YQ6A 4NRQA 4Y4YA 2UYAA 3OBAA 4DXTA 2D3RA 2XBO3 2OUHA 2ZGPA 4IE6A 4A3XA 3R0RA 5M0TA 4QQPA 1NXMA 1ZRFA 5FLJA 2R063 3IIAA 4M0HA 3DN7A 3THDA 1K45A 3WSOA 1XE8A 5A1AA 4CU9A 4XFCA 2CGOA 2E31A 4CDQC 1TNFA 1S0JA 5KWRA 3BYWA 3ES4A 5IAXA 1N47A 4B7EA 1KDKA 1XC6A 1AL21 2GMEA 4IESA 3RPQA 5A3UA 3FFZA 4KBBA 2HEWF 5EQUA 3EHKA 2LALA 5DZEA 2ARCA 1WZXA 4NR1A 4FPHA 1LEMA 3B5LB 2XLFA 3I59A 4LPLA 4C1WA 5A6QA 2MEV2 4B8EA 1JZ8A 3VBRC 3ZR5A 4CDXB 1ZA4A 2V72A 1FOD1 5FWJA 1VBC2 1SLIA 2XVKA 4Q27A 4JDMA 3GBWA 1H2NA 3OJBA 2IVJA 1ZVFA 1GV9A 1V9U2 3MHZA 1HB1A 3TN91 2WN3A 3VBRA 3N4MA 3TOJA 2HWE1 3VBOB 3U14A 3AJZA 4LKEA 4XMIA 2J7MA 3B7MA 2HWD3 1COV1 3C3VA 5I0TA 1QQP3 5GJ6A 4RR3B 1D4M1 3DUIA 3I7DA 2PA7A 3ZSJA 4OI0A 1ULPA 1AR93 2V4VA 3CO2A 2B7YA 3R05A 1HV1A 1N3PA 4KG0A 3CJIB 1BQPA 2WNVB 3J7MA 5EV7A 2JDAA 4DXRA 5FY5A 5JMOA 1OD5A 3MIBA 2H6CA 2WDBA 4EYUA 2AACA 5FY9A 5FPVA 3P6BA 4NPRA 3J26N 3POFA 1AZDA 2EXHA 2YXSA 2KM2A 1QNYA 1Q8OA 4D7YA 2XKPA 5IK7A 2OXBA 5F39A 3T08A 2EIGA 2GNDA 2HBUA 2QNKA 2W68A 1DGRA 1OMIA 3AMNA 4XAEA 2VJXA 3AZVA 1I9RA 4JTNA 4NRMA 4BPZA 3BUCA 4JDNA 5A3WA 1LOFA 4DFSA 2Y6HA 4Q4W2 4N7UA 2E7TA 1EY2A 3H3LA 3L9JT 3CZUA 1R091 4YW1A 4QX3A 5LZ6A 4JHTA 2VE1A 1UYYA 1WLDA 3Q8CA 2G9GA 1O4ZA 5J48A 1C8NA 5FZMA 3M3CA 1C1LA 1UOFA 4UOJA 3PU3A 4Z1VA 4AWDA 4Y24A 3AP5A 5FZGA 4B7KA 1PK6A 1Z7S3 2IZWA 2GNBA 5FZ6A 2HWD2 3O1TA 1ZZBA 2WO2A 3M2MA 2XHKA 4GAZA 4Z07A 4AHWA 1NOVA 1IQAA 3PUSA 3WNLA 4JDOA 3ZDSA 4LK7A 2RVAA 1SPPA 4QPIB 3O1SA 2VZQA 4NAMA 1BJQA 1MR5A 3N36A 1RB8G 4OMDA 1CJDA 1UY3A 5D8AA 1K5JA 1RUG1 3N9QA 4HVRA 4LTAA 3RRDA 3TBDA 5KHKA 3CU7A 1WLWA 3IPVB 4H7LA 1Z7S1 4H3WA 4Q1PA 3TEWA 4COVA 4LUKA 4N53B 2WAOA 2PHLA 3FC0A 4P08A 3MO4A 5J37A 2XLGA 5J7MA 2UWAA 1LHNA 4XTMA 5JUVA 3LA2A 2K9ZA 4XW3A 4HL0A 3ACHA 3BU0A 2ZHMA 2YBPA 1QJZA 4AEKA 5J98B 2C26A 1CJPA 2JDPA 2D97A 2VZTA 4CCJA 4ZHNA 1LULA 4COWA 2OYZA 4W4ZA 5F2SA 4YZ1A 5JVVA 1EPWA 2BW8A 1GZTA 3OD0A 4QPGB 1QF3A 5FV3A 5E1RA 2AH2A 1LKNA 1RITA 3T2TA 4AGVA 1R1A1 1LESA 3LSEA 4FI9A 2OKXA 1PO12 3N9OA 2C9AA 1ZZ6A 3KMHA 4TTGA 4GALA 1LU1A 1RHI2 2WBKA 2YMZA 4OFGA 1NA1C 5C8WA 4NIAA 2ZHLA 3N3HA 5EHDA 5FPZA 1F9KA 1S2EA 3DYMA 2X53S 5CFCA 3VGIA 5DG2A 4CEYA 5HCBA 4I3GA 1UKRA 1OA2A 1OKOA 3HPNA 2ZGSA 4RFT0 3ZPYA 3SH5A 3MGUA 4Q4V1 4IV3B 3LFIA 4Z2WA 3DECA 4UF0B 3WY6A 4XCAA 5FK8A 1AR83 2WS91 1O3TA 5FZ9A 3N7JA 4DEQA 2L9LA 3D82A 3QH7A 5CKMA 1VRH3 3RZJA 1C3HA 1LECA 1VBD3 3HMYA 4IDZA 1JUIA 1QJY1 2PHWA 3CMGA 4ZU7A 4LA2A 3ZFFB 1NE6A 1VAMA 1QJEA 3LFMA 4DXSA 1Y9MA 1GNYA 1HXS1 1ULOA 3P5BA 4NPMA 4X6QB 1J59A 1J1LA 2GNTA 2ILMA 3ME2A 1VPHA 1ZZ8A 2XUMA 2DF7A 5K4LA 3VBSA 2V5YA 3WNXA 2OPKA 5B4NA 5BNNA 5FQ0B 5FP3A 2WYFA 1R083 1OVSA 1C8M2 1Q8VA 3LPGA 4UYBA 4G9SB 2HBTA 1DGWA 3JB8A 4GH4B 4H2AA 4KMQA 5FZCA 3VZNA 2E7QA 4BK4A 3CBNA 3ITQA 2J1VA 2J1SA 4CP1A 3AJYA 2KA3A 3ZMOA 2CDOA 4E4ZA 5FMOS 1CGPA 1Z7S2 4UBGA 3ZXLA 3VHPA 2RR13 2UURA 3GBGA 3V0BB 2WWJA 4QPGA 1JU4A 4XJZA 5FYZA 2VQTA 1PVC2 3POSA 3AFKA 1H6XA 2EAAA 4QM9A 2OUJA 4QKFA 3UGHA 1X9PA 1WMXA 2DVBA 1LJ7A 3WG1A 2HWB3 4BQ4A 3B01A 4C0BA 3TEXA 3UK9A 4XC9A 5FYMA 5KBFA 3DL3A 2TUNA 1GNZA 3NNFA 3O1PA 3I3MA 4HK8A 3VBUC 2VU9A 1H30A 2A75A 2J22A 3DXTA 4MGIE 1G9BA 2D93A 2P4EA 4QHZA 1VBB1 4M3CE 2BNMA 4IE0A 2VTXJ 4YG6A 5A3OA 3ZYGA 4B1LA 4XQWA 1F4HA 2LS6A 4LA3A 1OBNA 3AL6A 2XR4A 4HMZA 3AZZA 3RGBA 1PMHX 1WCQA 2YUEA 1LOEA 3VBUA 2WFF2 3HT1A 3JQWA 1QH6A 1AR62 2HWB1 4RR3A 4YPJA 5AC91 2FDGA 5K7PA 1LNSA 5FZOB 5FZFA 1PNFA 1WD4A 1W0NA 1RUC1 3WF3A 3TEYA 4IEUA 1YI7A 2RE9A 1D4VB 4UFIA 5FZ0A 1TMF3 5C3SA 5IATA 1I1EA 3C7HA 3UKNA 2PQSA 3H3UA 3NSTA 1Q5OA 1U5ZA 3LD8A 3NNLA 2JE8A 5JOYA 3GM8A 4OHYA 5F7UA 1NA1B 3VBSB 2VL4A 2W1SA 3KCYA 4MGTA 5C3QA 3RMYA 3FX3A 3IAPA 3OBTA 2YFZA 1ODNA 2BOJA 3AMMA 3OY8A 2PHTA 4GH4A 1EAH1 3H8UA 1O5LA 2GMPA 1FV2A 3JXSA 2X8KA 4Q4X2 3IIIA 4DQAA 3U10A 5IVYA 2CY6A 3NJVA 3OGVA 1J3PA 3LPFA 3W5NA 4BU2A 2ET1A 3D0SA 1RGSA 3H1MA 1CAVB 3ILNA 2IXJA 4KWJA 3IT8A 3OYWB 4AVTA 1CZSA 4NHYA 1AXKA 5IT6A 1VBA2 1SFPA 4RQPB 1OQ1A 2KXLA 2B8MA 2VPVA 3R4UA 5FWEA 2JB4A 5I8YA 1WA4A 3K75B 1C28A 1W8TA 1QJFA 3TRSB 2P2KA 2QQVA 5KC5A 1JYXA 1ENQA 4XDPA 4LORA 1MQTA 1M4WA 1PZ7A 2XWBB 5FZHA 2B9UA 2TEPA 1B09A 2VBPA 1AR72 4X8PA 4ASLA 1ZBE1 2D3SA 1QOSA 2IFWA 3TB0A 5A32B 2W91A 4IEZA 3A7QA 2GALA 1YFYA 1N3QA 1UPSA 3CJIA 4XZPA 2AEYA 1OD3A 1MS4A 1ZREA 1V6KA 1HRI1 2IXLA 2W52A 1TEIA 2WZPP 3S5QA 2W2IA 2ZAHA 3EMRA 5FTTC 3AFGA 1PO21 4GWIA 2Q8DA 5JAXA 2RJ2A 3AP4A 3DF0A 4HT1T 4FBFA 1K5MC 1YXWA 1ZBE2 5IVCA 2FDFA 2VMGA 5IHRA 2HWE3 1XU1A 3WP5A 4UW4A 4QQLA 3WF1A 3POBA 4S2HA 1H8TC 1GQGA 3W5MA 3DPRA 4P5YA 1IZ3A 1JYTA 1VBE2 2HWC2 4HN1A 4I0WB 5IWFA 1QNWA 3ATGA 1E5RA 1TG7A 4KH9A 4M0NA 4QU2A 4YVWB 3ENRA 3I97A 1PMJX 4J6GA 4OHXA 3OUJA 2XJPA 2MHFA 3BALA 4BQ2A 4LBNA 2PAKA 2GU9A 4MGYE 4XZUG 1BBT2 1E5SA 1NX9A 2WNUC 4CSWA 1NG0A 1RUE1 1AR82 1YWKA 5K0UB 1SBEA 2F4PA 1NLSA 1S0FA 3PU8A 5FXXA 2A6ZA 4P9JA 4WVWA 4D6SA 3DXUA 5A6YA 2EIDA 3ZVXA 1R1A2 5GZEA 4CP2A 2W94A 2P34A 2VZ1A 1HJGA 1KJRA 3VDDC 2QDNA 2Y6LA 2F4LA 1ULGA 1S0DA 1KJLA 2R042 1HRV2 2XVGA 4XBNA 4BISA 3O0VA 4CDWC 2QQPA 3WDTA 1OT5A 1Q3EA 2WABA 3RZKA 1GOGA 2VCCA 3LA7A 2XL9A 4AL9A 3VN4A 1WBLA 3E5UA 3EO6A 4DPNA 2QE3A 2ADDA 1SQ4A 1RL3A 2J1AA 1WCKA 4Q4X3 4BH9A 2DU0A 5JXGA 3VD5A 4MSVA 5IVFA 4MHRA 2ORXA 5FZ7A 4UXAA 1UU4A 3ES1A 3WF2A 4GZ9A 3JD72 4UF0A 2XOMA 4BLJA 2ZX1A 3V0AA 4QB2A 4Q4Y1 3ASIA 1GSLA 4IEYA 2WO1A 3ETPA 4HSJA 1H9PA 4ES9A 4Y26A 3KT4A 4LR4A 4QB6A 1J3QA 1GMMA 1F4AA 2Y60A 1KS4A 3HVDA 4OQ8A 4RS5A 1UXXX 2ZMKA 2ZEWA 1EV11 4AR2A 1US3A 1GQPA 3JCIA 5CISA 3O1UA 4PDWC 1FXZA 4A6SA 3ZYFA 1RUI1 1SHWB 2JDUA 2ORZA 4P14A 4FPCA 5FZ1A 1B35B 1EYBA 1UX7A 1RUF3 2GP3A 3KVAA 4QKNA 2RS13 2MPFA 4FPOB 1GKBA 1TME1 5T5LA 3UKTA 2ZAAA 4EZHA 3W20A 3N9PA 4AEMA 3M70A 2DUPA 2V09A 1V70A 5ISLA 2XB6C 3PUQA 3LE0A 5CEHA 2XL7A 1NAEA 2D6LX 2J1RA 3H1YA 4FOWA 1XYPA 2QQLA 1R093 1EUTA 5FRAA 1RUNA 2DDUA 4GB31 2Y64A 1JMUB 3VB9A 1X7NA 5ERLA 1X50A 3CNAA 2XWJB 2RV9A 1QJX2 5T52A 2YFUA 4A45A 1L7RA 1CPNA 1J84A 1YFWA 2QDRA 3UT0A 4FT8A 5APAA 3T0AA 2CAUA 4R4XA 4E4HA 4AHZA 1AX2A 3NV3A 4IXLA 4ZXEA 3KV4A 3RZGA 1R082 5HCAA 3ALQA 3NNJA 5JPNB 2V73A 2FCVA 1RUH3 1QU0A 4CZSA 4DIQA 3E6CC 3E5QA 1NCRB 4GB33 2R073 4JZRA 1UPIA 4LNVA 5H9QA 3VBHB 3A0NA 1S0CA 4J1WA 3ZSKA 1DHKB 4YFWA 1VRBA 1LOFC 1BK0A 1PIV1 4JKLA 1QOTA 2CWMA 4PIXA 5FYCA 5FZ8A 2XVLA 3HN1A 4F8AA 5BPXA 2EXKA 1U5XA 2Z42A 1W6PB 2WNUB 4YVWC 1OLME 2VQ0A 4KG8A 4K7JA 1QJY3 1H4HA 3FLTA 1OOPC 4XF3A 1XOYA 4YZ4A 2ZGOA 1A8DA 4QPIC 5D21A 2DTWA 1GUIA 2VZSA 4MH0E 3FHAA 1AYM3 5D8AB 4EN0A 1AVBA 4RHV2 2ZEYA 4TYSA 1YIPA 4LK6A 4LLOA 5GZFA 5FBZA 5I8SA 4B4RA 5BV6A 2JX9A 3NKTA 4D7TA 1OLQA 1H1IA 1HRV3 3DGTA 2VCAA 5A3TA 2FDJA 3SNMA 3S0MA 4YVSA 3NJZA 1SLAA 5FZ4A 4RGKA 1LB2A 4Q0QA 5IK5A 2C6SA 4XVHA 1HJFA 3HN3A 4ZS2A 2WFF3 4NRPA 1RUH2 4ARXA 4LHNA 4EROA 3C7EA 3VBHA 5JI9A 2RR11 2DCJA 1LGBA 1V6IA 1W8WA 2OZ6A 2OX0A 4D7SA 2VZVA 1G9FA 2D6NA 1QJX1 4AG4A 4LUMA 5JXIA 3MYXA 1F31A 2BZDA 4MLOA 2JIJA 5FPUA 4P5HA 1U12A 3GCXA 4YW3A 4WBBA 3T2QA 5C7GA 4O65A 1C1FA 1S0EA 2EXIA 3A21A 5JXJA 2OS2A 3G7DA 3JU9A 4BYYA 3SEPA 1SFYA 5JOWA 1H8TB 2Z2SB 1UOBA 2P3KA 1W8NA 4AEDA 1NXD1 3NV1A 1HDKA 3U1XA 4FXGB 4Y33A 5LASA 2QUOA 4FQ4A 1NCRA 4LQRA 5DQ0A 5D8AC 1AR91 4MO3M 4W50A 3WD5A 1CVNA 1YUDA 2VTFA 5FKCA 1RUF2 4BQYA 1W9SA 4YM0A 4BQXA 1UIJA 4GWNA 4KU8A 3AYDA 3WLUA 2QFEA 4LJHA 3NQHA 2VCBA 1MACA 5FMOL 5E89A 5AC93 1NY72 4QQOA 3KSCA 2GC0A 4FQZA 3NO8A 3WT3A 2C9KA 4FPJA 1A6CA 1CAVA 4KGQA 5A32A 2CYFA 2R16A 2UWCA 4N43A 2LROA 3NNGA 4XUOA 5I0UA 5C70A 2P1BA 1AR92 2WUHA 3AB0A 1XYOA 3VDDB 4KBZA 4CYDA 4Q26A 1T6BX 3LEMA 1W6NB 3PVEA 3OB8A 4GJYA 3SCGA 1G86A 3WQ0A 5IVEA 3ILFA 3FWEA 2Q8CA 5FY8A 4GMP0 3O12A 5EZWA 3ZFEC 4ZS3A 1W06A 3HJRA 4ZPIA 4OHVA 2YGMA 2B39A 4HN0A 2J42A 4YVSB 1UWWA 2R072 2Y6KA 2XG3A 1H2KA 4JQTA 1K3IA 4ES8A 1G6NA 4HSLA 2D5HA 1FMD3 2XDVA 5DG1A 1WCUA 1ZM1A 2C1FA 2D7FA 1DYKA 3ACFA 1EP0A 3IBMA 1GBGA 2GC3A 4NAOA 2QVSB 1N1VA 2FCUA 1AR81 2WS93 3PUIA 1U0AA 2YBKA 4HKWA 2GC2A 1OI6A 2ZPXA 4GWJA 1VBA1 4IGQA 3H8OA 1ENRA 1WGPA 3VKMA 3GGLA 2ERFA 2KD7A 2C5DA 1VBD1 4FPKA 2HWD1 3LF7A 3VDAA 1ND3C 2WWSA 5C8CA 1I5ZA 2PLV1 4NO4A 4QB1A 3APBA 1JW6A 5J36A 2Y6GA 4AE2A 5L9VA 2VVEA 4WM8B 4XXAA 2P6HA 4PQQA 2OW4A 1UMIA 3FJSA 2HWF2 4AHYA 4GKXA 3TYJA 1XNAA 1IOAA 2W46A 5FREA 2ZZQA 4RR3C 1R081 5C9AC 1BZWA 1Y3TA 3BTYA 5D2AA 1DGRN 2LTNA 5DZGA 2O0OA 1N1SA 1VB2A 2QZ3A 2JJ6A 4I2OA 4IE7A 1FATA 2RR12 2P3JA 2VMIA 3M3OA 3BPZA 5F2WA 4YW5A 3WINE 5A7NA 3T4HB 1GNHA 2BGPA 4QPGC 2VNOA 3ZIWA 5DAVA 4DNYA 3K46A 1OF4A 5GLZA 1OPOA 2HWB2 1D2QA 5IVBA 1DQ1A 1BKZA 1CX1A 1K42A 4L97A 5FYSA 4D6QA 2VVFA 5JLVA 5HV4A 1UYXA 2VW1A 1UAIA 1PM7A 3ZXFA 3HBZA 4E9KA 4GB32 1VRH1 2A70A 3BIWE 2WAAA 5CFCB 4BQ5A 2ES3A 1NZCA 3ILRA 5CFDA 5AC92 3K2OA 4LIVA 3KV9A 3WDXA 3UGGA 3D8CA 1R1ZA 3IWZA 3Q8EA 3VD7A 5LA1A 2JE9A 3CQOA 4HK9A 2DCKA 3KT7A 1TME2 2P3IA 5LBEA 5F3GA 1Y9QA 1UY4A 2ZA9A 5JMCA 2WNVC 4FO9A 1DQ5A 2UY8A 1POV0 3CKHA 4LOSA 5JWPA 3CLPA 3D5OA 2R0FA 3MW4A 2FHRA 5DUWA 4BJ0A 1O3SA 2RDQA 1IS4A 4I3PA 5T5JA 3TAYA 1H1MA 1GU3A 3NW4A 5K8SA 2ZGQA 4JHZA 3W58A 4YVSC 2B4KA 5FOBB 2PTMA 4Q4Y2 5DUXA 4DRVA 2VZOA 4XJ9A 1O8SA 4M4PA 2H0VA 4BXSV 3OBZA 4LO6B 1H1AA 5SV8A 4ZU5A 3RNSA 3JBG3 4D0QA 1LCLA 2ZJCA 4H7MA 5GM0A 2H0BA 2D43A 4LE4A 4DXZA 2P6CA 4MHUA 5F5AA 3B69A 1F35A 3I2JA 4PJYA 4A2UA 3AXDA 1DZTA 2JWPA 5LRSA 3BGAA 1QXPA 1ZBA2 3AK0A 5F8PA 2ZGKA 2GP5A 3NRUA 4V2WA 1KFUL 3CEWA 4CCDA 5CA6A 1LGCA 3E6BA 2DBNA 1RUI2 4BB3A 4FOQA 5LBBA 5A3PA 3HD8B 3HIFA 3POIA 4S2FA 1APNA 1PMIA 3ACLA 4XBQA 4SLIA 3KF3A 4E2QA 2UYBA 1J83A 4N9IA 2HWF3 4QHOA 1US2A 3K4ZA 5FBJA 3VBOC 4K3UA 5DAXA 5DZFA 3URFA 1DZQA 3VZMA 3MPPG 3LEGA 1TE1B 2XQRA 2JD9A 3IPVA 3T3YA 1W6PA 2WNUA 1YCIA 4TWTA 3ZKUA 1OPMA 1WUVA 5J96B 5KHJA 1SLCA 4XPVA 5K0UA 1QWRA 1RHI1 4CUBA 3FN9A 4Q5OA 4FPLA 4N8MA 3JBG2 3M3EA 4P9XA 5EWSA 4IV1C 2JKXA 4IV1A 2FMDA 3CF6E 1AYN1 2DURA 3PURA 5FXZA 5GZDA 3C8XA 2NYYA 1YNAA 1GZWB 1UYPA 1EPZA 5KR7A 1Y43B 3LGRA 1PO23 1W6NA 4QX1A 4AK3A 3USUB 4QPWA 5FIXA 5T55A 3S7IA 1J3RA 3IDCB 5DDJ3 4M3CB 5JZGC 1YFUA 4FFHA 1RUOA 1W04A 2O1QA 2BGOA 1CD3G 1RXFA 3MF9A 4AI3A 1SBFA 1REFA 5B2GB 3K48A 5FY0A 2AENA 3ZR6A 4D6RA 1GZCA 4U36A 1Z0HA 4IL7A 3WF0A 2W47A 4O61A 4LBQB 3T30A 4FPEA 3IDAA 2R0HA 3ZKYA 2Z79A 2G9ZA 1Q8QA 4R9BA 5FY4A 1ZNPA 4WVMA 4XF1A 1XYNA 1W9WA 4WVVA 2Y33A 5DMYA 1V0AA 5HXMA 3ZMNA 1TME3 2R32A 4OCTA 2PMWB 5E6HA 1RUJ1 4HKLA 4OI4A 3VBRB 4CXYA 4CDUA 1U5IA 5J1XA 4RFRB 4YM1A 3GALA 5FPLA 2QJVA 4W8JA 4I02A 4ZXKA 3FHQA 4PLNA 4EWDA 1DQ4A 4DO0A 2CDPA 1JHNA 2E6VA 3POYA 1GR3A 4CDXC 1WW7A 4AF9A 3KVBA 5JI7A 2BUKA 4L92A 3ZYJB 2WN2A 4AFBA 1DIWA 4DUVA 1QKQA 4H14A 1W8FA 3O7OA 4JGYB 2BWAA 5DDJ2 4C90A 1OA3A 1A3KA 1W6QA 2DVAA 3GF6A 3B94A 4CCMA 5JIUA 1JZ6A 3W59A 4Q4X1 4QXBA 3OEBA 5A7WA 5FYIA 5EFUA 2VOXA 2IWGB 4AOCA 1V6LA 1JTZX 2JG9B 4YG0A 2A71A 3AZXA 2ARBA 2EF6A 3RJRA 1XSRA 3DV8A 5FLIA 4ONUA 1CAUA 3EB7A 4DZGA 3QLQA 4BIFA 4AHXA 5FP4A 4CCEA 3LWCA 1O6UA 4MG2A 1JU3A 2Y26A 1CPMA 1DZRA 1SLLA 2GNMA 4M3CA 2YB7A 4XCBA 5FUNA 4QMAA 2VXJA 3RMXA 2GZWA 3H7JA 3I59B 4JCKA 3ZFGC 2VUCA 1RUE3 1V00A 3HOBA 4QU1A 4LO8A 3DPRB 4MV2A 2RS11 1TVGA 1JS9A 4IETA 4PQ9A 2D6MA 1COV3 1KXGA 3WDVA 4CCLA 1NKGA 2XUEA 1MS1A 5A1LA 1K5MA 1ZZCA 4AGGA 1VBC1 2BBVA 3POJA 1JYWA 4GD4A 1ND2A 4IEVA 2OA2A 3ORJA 5EPAA 3SITA 4Y1XA 4AGRA 1DGWX 3ABZA 3VD9A 1I3HA 3VUOA 4D69A 2HLEA 2IXKA 1QIQA 1OQEA 3BKZA 5ACA3 4JGZC 2XLAA 1FOD3 3AKPA 1W6MA 4COYA 1QJX3 3D0JA 4IEWA 5FR3A 4YRDA 5FYYA 2QQIA 4BA6A 5JSRA 3RYRA 5JZGA 2VGDA 1C5HA 2XJSA 1AHSA 3OPZA 4YWAA 5C9AA 5JOZA 4LIUA 1UQXA 4Q4W1 3SH3A 4RD7A 2A3WA 3MIDA 3ECQA 3BN6A 2SLIA 3LDBA 4LLFA 1AL23 1S2BA 5T54A 3N9MA 4EN8B 2ZX4A 3WR0A 4D3WA 3AKTA 2ZGRA 1V6JA 1WW5A 5I0RA 3PMEA 1ENSA 4HPKA 2WLPA 1PNGA 3VL8A 4NHXA 2BV4A 2ZEZA 2WQ8A 1RTVA 3FHIB 3MICA 4ZKTB 5EIYB 5LWBA 1QJU2 5JSOA 1HQNA 3J7HA 5GKAC 5FYTA 2NPIA 3MW2A 2RM23 3FZ3A 4EV0A 1GFF2 3BIEA 1GYKA 4NROA 5EYXA 1QJY2 1UXZA 3M3QA 3RVHA 1CR7A 4FSJA 2GC1A 4E2GA 1LAJA 1NZIA 1DYOA 1KGYA 3A23A 4K9SA 1C57A 3LDRA 2O8OA 4MX3A 3FBYA 3PUAA 2PLV2 3L2YA 5F6LB 4BZ4A 4BQ3A 1AYM2 4RHV3 3WP4A 3BCWA 4K6BA 4CVUA 3KGLA 4M4RA 4EN6B 1UY1A 4A7KA 2Q4SA 1OA4A 2AYHA 4D94A 4XBLA 2QQUA 4QGNA 4Y22A 3SCHA 1BHGA 3OCPA 4R52A 4RQPA 4Z8BA 1ND2C 5FZDA 3MW3A 1AX1A 5C6CA 4FTEA 3B3QE 3DEMA 1PVC1 2XJTA 1D2SA 3E6DA 4GXLA 5AVPA 2RMU1 3ZSMA 2XHNA 3KV6A 2OQ6A 3LKJA 1GICA 1VP6A 1MZFA 1S0GA 2Y34A 3VDBA 1SLTA 2WNEA 4AXOA 5JDBA 3AM2A 3ZSEA 2W1UA 4UFHA 2VNGA 4Z82A 3HQXA 3KS7A 2BNNA 1R1A3 2R061 2Q30A 2QQMA 2EIBA 4IV1B 3AP9A 5FO8B 4N43C 4LEJA 3SHRA 3GDBA 3NVCA 5DABA 3AYAA 2ZX2A 4HVOA 4JX0A 1ZA7A 2AZ5A 1GQHA 4AQSA 4N7IA 1UW8A 1NA1A 4QWNA 3LB9A 1IKQA 3IN9A 3N35A 4YNIA 4Q4W3 4CUGA 5IYYA 4SBVA 5HV0A 3OY8B 4XUNA 4GH4C 5A1FA 2R041 2YBSA 1TNRA 4OHZA 4O9EA 1ST8A 4CXXA 1AR71 2YU2A 3AP6A 5LK5A 1UU6A 3NAPA 3ZXDA 2B9VA 4DUWA 2XQXA 1J1TA 4BHPA 5E16A 3P1IA 4TSVA 2D3PA 2WZR2 3TN93 4BOWA 5KXEA 4IEQA 1FT9A 1ZBA3 3INAA 1RVF2 1UL9A 3KCXA 5GLVA 4WM7C 2ZGMA 4L11A 1PGSA 1WD3A 2WFPA 2ZEXA 4E2SA 1QOOA 3NL1A 5C71A 1H2LA 3OOXA 3OTFA 3WDYA 5HPOA 1W28A 4A3ZA 4M01A 2X10A 4CCCA 2Q1ZB 5FZOA 3WEZA 4Y20A 4UFMA 3Q9OA 4LHKA 2VMDA 1ULFA 2GMMA 3K4DA 3RZHA 1RUD3 4NWWA 4WM8A 2CGPA 2JXAA 5IVJA 2VW0A 1VBE1 2VW2A 5BY5A 2RG4A 3ZFEA 1CN1A 1HLCA 2VZRA 3H7YA 4NE9A 3LSDA 4HZFA 4QDRA 4OUSA 5CKNA 3EBRA 4MGZE 2OQ7A 5FJHA 3MV01 2UY9A 2RM22 3FFQA 1JI6A 2JG9A 2JG9C 1RUH1 2NM1A 5EYYA 1LOBA 2DCTA 5A70A 4EJRA 2R6QA 3B9CA 4MYEA 3I2KA 2VMCA 2GH2A 3BU7A 4Z2AA 1KITA 1RVF3 3H3ZA 3V0AB 2GN3A 3ZX7A 4XDOA 1LOAA 1MS3A 2O8QA 2PHRA 3UL2A 4P9WA 2A7AA 5F3IA 5CFCC 2QCSB 2ZKLA 1OUXA 3PVBB 2W0XA 1M06G 1ZYBA 1URXA 4OUMA 3JUUA 3T09A 3MZHA 2Q5TA 5CIRA 3MIFA 1VAKA 2VOTA 2PELA 1COV2 3FBMA 3JB4C 5A7QA 3CHXA 1ZRCA 2CV6A 1T2XA 2J1UA 4NIGA 2DYCA 2MEV1 1RIRA 1SDDB 4I0BA 4K8FA 4YLZA 4PBPA 5A7WB 3T0BA 3VZJA 4CEWA 4TZDA 3WOGA 3AC0A 1VBD2 3B9IA 3NMBA 4ITCA 1QH7A 1XB9A 5L7OA 1EAH2 3P3PA 5BNNC 4YZ3A 2XGXA 2X05A 3MIGA 4AFMA 4CP0A 3SC7X 3J8F1 4X6RB 1F2NA 4HFSA 1GLHA 4A42A 4ATEA 1GP4A 3OGRA 4AI2A 4QX8A 4O7XA 2XXZA 1XU2A 1AL22 2YGLA 4FP2A 3SLIA 1DQ2A 2JG8B 3ZFEB 2R1DA 3KZ4C 2YROA 2OT7A 2VC9A 4QX5A 2VMHA 3AL5A 5IVVA 4XEZA 1D0GA 1TQ5A 5FZIA 3ZXEA 1CAWB 4FP3A 4JVAA 4FFFA 3ZN5A 1LHOA 1XNBA 4YSFA 5FDBA 2NMNA 5D1IA 1OFSA 4NUBA 1VBB3 4DINB 2AC1A 2RDSA 5CB7A 3ZFGB 5FP9A 4FPYA 4KI5M 1ND3A 1VR3A 3R6SA 3SKVA 1Q56A 3IAQA 4AI8A 5FYVA 4Q8LA 1F5FA 4QQHA 1AR61 3WCRA 1Y4WA 2D6OX 4NJ4A 4NIHA 1EAH3 4QGLA 4XACA 3C2UA 4XHBA 2ZGLA 1RVF1 4WM7A 1VALA 2E26A 1RUD2 2DFCA 1IPJA 1GWKA 5T5OA 2QQNA 3HBKA 4Y3OA 2A5ZA 3VD3A 1FPN1 5ABJB 1IHMA 5A33A 2VO5A 4YGCA 1DG6A 3U75A 4MUVA 1YQCA 4MXWA 5BNOA 1HXS3 1CIWA 2X5IC 3PTRB 2BOIA 3O1VA 1XQNA 1F5JA 1BYHA 1GWMA 2IVIB 1OH3A 5A7OA 3C7GA 5KHHA 3KF5A 1RC6A 1AR63 2RHPA 2IXIA 1CAXB 4IV3A 2A6WA 5H9PA 3ZXGA 1UD1A 4JC1A 3S57A 4IE5A 4CCOA 2D98A 2VBDA 1B35C 5C4WB 1VMHA 3SISA 5L36A 3VBSC 4FAGA 2W5FA 4LO7A 3VBFA 4HBNA 4R4ZA 4YW7A 1JYCA 2BRTA 3GYDA 5F5CA 1YHFA 3WV6A 4DUXA 1DYPA 3MDPA 3OG2A 1NCQA 1CAUB 2VUAA 3B00A 1UMZA 2VVDA 1HKDA 1W6OB 4HG6B 4F83A 1CQ9A 1FMD2 1QJU3 3DYOA 2HWF1 4Y5TA 3MLJA 3ZOIA 3AYCA 2RMU2 4B1MA 1LTEA 1HRI3 1X36A 2KR2A 3B02A 4JRAA 3ZXJA 1JH5A 3KHCA 1LRHA 2Q1FA 1X82A 1HXS2 1BK1A 2WS92 5L9RA 5C33A 1I6XA 1W0PA 2JDZA 2B46X 3POWA 3N7MA 5SV5A 4FPFA 4CEYC 1OOPB 1JZ4A 1G9CA 4YGDA 1LU2A 4Q0SA 1DCSA 3FLRA 3GJBA 4RSUA 4WVZA 5G04L 3ZFGA 4J25A 4IEXA 1RMU1 2H6BA 2PN5A 1QXJA 2FMYA 4A41A 3BI3A 1V9U3 1XJAA 2X09A 2WLQA 1RMU2 1VE0A 2HH9A 3LIHA 3BOPA 3A0KA 3PIJA 1MZ5A 2ZMNA 4PCRA 5LCWL 3RFRA 2Q8OA 5FZBA 2VY0A 3J9SA 2LRPA 2YZ4A 3RWKX 4DS0A 1GOHA 1K12A 1POV3 2UU8A 5CKQA 3RI9A 3OGGA 1RUG3 3IB3A 3EQEA 1LR5A 4P00B 1FPN3 3LOBA 4OMCA 3AX4A 1DP0A 2PAEA 2G19A 1W6OA 3G6JB 4HETA 4PT6A 1IPSA 4Y1UA 2RS53 4ORFA 4QDQA 2PFWA 4HPKB 4BLIA 3ZSLA 5FPAA 5FP7A 1ULDA 4CEWC 5B4XA 1CWPA 1Q8SA 5CBLA 3VBFB 3T4VA 3VBFC 4E4DX 3U4XA 2FDIA 2FZ1A 4E8DA 1W9YA 4RHV1 5C5TA 4PIYA 4RGGA 4CU6A 3X29B 3H0OA 3RDIA 3ZPOA 1HIXA 1H2MA 3M7AA 1YRZA 3BPSA 4KWKA 2WA3A 1RUI3 3I2FA 1X8MA 2E7AA 3DPRC 5F37A 4CDUC 5A6ZA 1SEFA 3RWNA 4JGYC 3ZDVA 2DTYA 4RS5C 4XJWA 2ID4A 1SDWA 4BMBA 3NWKA 5DN2A 4DY5A 2WJSA 2HEYF 1FPN2 1O8PA 4LHSA 4I0AA 2VNRA 4AW7A 1LHWA 5HI0A 4AVBA 3K3NA 4GMP3 4CCNA 1D0HA 1EV13 1LENA 3OSDA 2BBAA 1A34A 4RA0A 1YO8A 4XQ4A 2LM3A 1X33A 2FD8A 2GDFA 2BTVC 1LHVA 4Y1YA 2BWCA 1AUYA 5JSPA 4ISQA 3DKQA 3U78A 5GZGA 2R043 4Q4Y3 4XOGA 2VAUA 1OH4A 2Q8EA 3JQXA 4XFHA 3VZKA 4CDWA 1WWYA 3WF4A 2ATFA 4HOOA 5CU1A 1YQ5A 3ZXAC 5CYYA 3O0WA 1KEXA 2W39A 3GXUA 4FPGA 4I01A 4A4AA 3VHRA 1E57A 4CCKA 3I3QA 2VNVA 4Q0VA 5A7PA 5FOJB 1WLTA 1MQTB 5A3NA 3MFAA 2YC4A 1MS5A 1Q43A 1SCRA 4EE2A 5CAZA 3AKQA 4BM8A 2J1TA 4XILA 1MEC1 1IS5A 1YC61 1JOBA 3LDKA 3PUHA 1RUC2 2A6YA 4L8QA 4XIOA 5FUIA 5A6XA 2P3YA 1VBB2 3W9AA 4AQ2A 4ASMB 2OVUA 1Y7BA 2GH8A 1HB2A 4AFDA 2Y6FA 1NLRA 5L7OB 2DVGA 4COZA 3ZXKA 2FDHA 1WMFA 4DB5A 2BJSA 5ACA1 2TBVA 4QDSA 4UT5A 1L3JA 3WUCA 4QKDA 1PIV3 1UN1A 1W99A 2RS32 4P9IA 2CSGA 4YGBA 5FFOC 3LQCA 1BLZA 1H8TA 1ASJ1 2HEVF 1MZEA 4UW5A 4QT6A 4AEDB 3I8TA 1VRH2 4MXWB 1JHJA 4CDWB 1P8JA 2OZJA 4Q8KA 4LBKA 3O14A 2XJVA 4L0PA 3OBRA 3GBFA 4A44A 1SCSA 2Y0OA 5FKBA 3BTZA 4LKFA 1ZRDA 4FTBA 3S6PA 3I49A 5FXVA 1MQTC 4YG3A 2R071 3NV2A 3DYPA 1PGL2 2WIIB 3S5AA 4FAHA 2EAKA 1NQDA 2RM21 1PO22 5LY1A 5H9RA 1HRV1 2Z69A 1UKGA 3ZN6B 3I2OA 3VDDA 5A3MA 1ACCA 1MEC3 2JIGA 1F8VA 4CUAA 2MNGA 4XFIA 3SMHA 2ZBJA 3N9LA 3I54A 3VLBB 4CE8A 4B3NA 4IW3A 1DLLA 3KGZA 1W2TA 2DVDA 5FO9B 1OLMA 1SPPB 2RS33 1W8OA 1DQ0A 3LIGA 1PZ8A 3NJXA 4Q2FA 5T3NA 3THCA 4AI1A 1PVC3 4AEDC 4XFBA 2RMU3 1VMFA 2ZHNA 2AGSA 2W08A 2WT2A 3RZMA 3M8LA 5CFDC 1K5MB 1ASJ3 4NMIA 5FAXA 3MFCA 3S30A 3N7LA 2YV8A 2Z4FA 5DPNA 1RUF1 5HXVA 1CAXA 4CTEA 3NKGA 4L2NA 5LATA 2VCMA 2WT1A 3F2ZA 1V6MA 3GZAA 4ATFA 1RUJ2 1JXNA 2R49A 3O0XA 2YC0A 4EQVA 1NY71 2ZZJA 4BQWA 5F5IA 1JN2P 2RS31 4PDWB 1JODA 4Q1RA 5CVRA 2WO7A 3I2DA 4A6OA 1N1TA 3VKFC 1S1AA 3UESA 3AZWA 3WDUA 3K51A 1UCXA 4MXVA 1W2UA 4N53C 4RL7A 4ARYA 3O1MA 4OYUA 5FZAA 2WZR1 3UKVA 2LW8A 2VG9A 4QPYA 3J7LA 1YLLA 3WG2A 3K4AA 5CG8A 3MLLA 3NJYA 3RG0A 4ISRA 4NHLA 1UY0A 1PX3A 5JOXA 1TMF2 1OHFA 3H8RA 2E63A 2JG8A 3WNOA 1BVVA 2DUOA 4GULA 3UJOA 5C3OA 3THTA 4LOTA 5F5QA 1QDCA 2VH9A 1F15A 2PHFA 2WZR3 3IDEA 5G05L 4DRRA 1HV0A 4LO4B 1CAWA 1MZ6A 3MEPA 2VM9A 1WLCA 3VKLA 1G8WA 1W03A 4C91A 1UOGA 1BEV1 2ET7A 4RGAA 1JUHA 3MI8A 4BDVB 3ZYIB 3LCPA 2AREA 2ZS6B 1UZYA 1GOFA 2NP0A 4RN5A 3EJKA 3WW3A 3AKSA 2ZGUA 4EWAA 4MADA 1XNCA 2WNOA 5JR7B 2R7EB 4IEOA 1PK6B 3C7FA 3J8F3 4Q0PA 2VD7A 4XFAA 5DAQA 1YI9A 2EICA 2PHXA 3AMPA 1OLRA 3GZEA 2VUJA 2VBBA 3MIHA 1AYM1 1KQRA 1OKQA 4XHXA 1ZZ9A 3MIEA 3LAGA 4PI2A 3RZLA 1VBA3 1H0BA 4CEYB 5LEKA 5IFPA 3KT1A 1DDLA 4JGYA 1LHUA 5AFEA 4AAPA 1W2OA 5FY1A 3SXWA 1SLBA 5ACA2 4YZ2A 1GWLA 2ADEA 1IG3A 1FOD2 1A78A 4V1PA 5J3UA 2QKDA 3H9AA 1JYVA 4JTOA 4JKKA 4Q29A 4QM8A 4XFGA 4XMAA 3UV9A 1BCXA 4FVVA 2V4AA 2GSYA 5DXDA 5FYBA 4OULA 1NT0A 1Z78A 2WQZC 4XJ8A 3UNPA 3I2IA 1PGW1 1W9TA 3I4IA 3BB6A 2D6PA 3K3OA 2QQWA 3T1LA 2Y6JA 3UYJA 1MEC2 1NE4A 3KCCA 5C4WA 3WNKA 4EZ4A 1S55A 2W92A 2WO3A 4YGEA 4Z92B 2DV9A 3B93A 4X8NA 4AVCA 1ALYA 2JICA 3AVRA 3CJXA 5HCFA 4FXKB 1O59A 2ARAA 4XE9A 4XUQA 5EJ3A 1OSGA 2NQYA 5FK7A 4EN9B 1NCQB 4LBQA 3IM0A 1U5YA 4KGGA 5C3PA 2RS52 3C7OA 4S2GA 4CRQA 1W0OA 1C8M1 3J8F2 3OPTA 3MBWA 2QQJA 3GZTB 3HEIA 4CUCA 2BFUL 1D4M2 1CONA 1BXHA 2PYTA 3PIGA 4AVAA 4WZFA 1ZBE3 4C1XA 1YEWA 4ASKA 3TEZA 2EVXA 2MEV3 3HAGA 4OVEA 2JKBA 2HWE2 4HLTA 4C0HA 2JDYA 3TN92 1NCRC 3KWVA 3GHNA 1PM4A 4P9LA 4R9AA 4CU8A 4COUA 1ND2B 1S0BA 5EXOA 1POV1 1VIWB 1UZWA 3WG3A 4PIZA 1LODA 5C5UA 4U2AA 2A3XA 2WWUA 1Y9GA 1H8VA 4Y20B 1UU5A 5IAVA 1BBT3 1FNYA 2Y0IA 3PNAA 5BNOB 4MGQA 3PJQA 1QHDA 4Q4V3 1JYNA 5K9YA 4FFIA 4XDQA 3OUIA 4I30A 1AJKA 1YQ8A 2DU1A 4GQ7A 4QKBA 3UJQA 3WW4A 3HQRA 3VD4A 4JQRA 4QAWA 4TLGA 1NQJA 1IGOA 3ZLIA 4DEVA 2SBAA 4KWUA 5DUVA 2DUQA 5LA9A 4XUPA 3H50A 2ZABA 4CXWA 3WNPA 1MVQA 3Q8AA 1BMV1 1O5UA 4N43B 2CU5A 1VLNA 1H6YA 4AVSA 2ARXA 1OVPA 4W6YA 2F6BA 3VZOA 1LEDA 3ZN6A 2YYOA 4FOYA 4IGOA 3AVSA 4XUTA 3CZJA 1SACA 4IEPA 2XMLA 4IUGA 3V65A 2VQUA 3WG4A 1XNDA 5F9TA 2BQPA 3ST7A 1JZ3A 3BTXA 1H4GA 1W3VA 4LHLA 1O4TA 2BNOA 2VOKA 2YY1A 4CDXA 3QOPA 1GP6A 1O4YA 3VV1A 5BNOC 3U37A 3RYPA 1S4CA 2E51A 4HONA 4NHMA 4GJZA 4D8MA 1ONAA 3W21A 4GMP1 1OOPA 5IK4A 3KD4A 5KC6A 4AFCA 1WW6A 2IXCA 4CEWB 5L19A 3H8XA 1DU3D 1SG3A 4UI9L 4BQ1A 1AYN3 3ZO0B 1QXRA 2DCZA 2WKKA 3ZFFC 4WM8C 3NNMA 2VQAA 3PVNA 3WUDA 1QY4A 2QZ2A 1QEXA 2YG0A 3WX5A 2FDKA 1UNBA 4HANA 3GZUC 3PTYA 4CDQB 4CP9B 1NLQA 5BNPC 4CA9A 2ZX3A 1RJ8A 4INDA 2HJIA 2PQQA 1SBDA 2WR9A 5FO7B 4MOAA 2A3YA 1DF0A 5IW0A 4UFJA 1KRIA 2G4IA 2G1MA 2C0ZA 2R30A 1IKPA 4YYOA 3WP3A 1W6QB 1D4M3 1DLCA 1HRI2 2HYXA 4XQDA 1V6NA 4Y5SA 2EALA 3OUHA 4L99A 4OUEA 1FAYA 1PO13 5CNAA 2BVBA 3FMGA 3UETA 3PL0A 3WXPA 1ULEA 5F3EA 5F6KA 3WNMA 3D3AA 2QBXA 2WL1A 5IJRA 3GCWA 5JR2A 3SEEA 3J4UH 5F3CA 3KQRA 3ZYRA 1Q8PA 1ZRRA 2PAMA 2WINB 2XJQA 2TNFA 4K40A 2ZX0A 2GN7A 1FNZA 3OEAA 4B29A 1RMU3 2QTWB 2Y8KA 3N7KA 2V5DA 4PBOA 2WZ8A 1W6MB 4GIQA 2PHDA 2IC1A 4KQ7A 5F1RA 4YW2A 5DAPA 3VZLA 4DMIA 1RUG2 4XAAA 3BVCA 1JZ2A 3T2OA 1JZ5A 1HB3A 5HBAA 4YM3A 1ASJ2 2DVFA 3MUZ1 3H1WA 4PI0A 4QPIA 5CZKA 4AQ6A 2DBIA 4JGZA 4YW4A 2AEZA 3MF6A 2RJLA 4ZONA 2P37A 2NZ9A 1H9WA 1X8EA 1OUSA 2A6XA 3VKOA 3O1RA 4UAPA 2RS51 5LBFA 1DQ6A 1PHMA 5KXCA 1GZ9A 5GZCA 5IK8A 5BXXA 5ANQA 1OXCA 1QJU1 1XPWA 1O3QA 2C4XA 3UGFA 1OURA 4LBMA 4QXCA 2CHHA 4UBHA 3HNBM 4C8DA 5BNQA 2XJUA 5CADA 4E4SA 2ZHKA 1OQDA 3IMNA 4TLFA 1W8HA 1FYUA 3AYEA 5GALA 3VKNA 3OGSA 2K2SA 3RSJA 2G9FA 1S2KA 3WVJA 2B45X 4OHWA 1HQWA 2ZXQA 4NVPA 4DY3A 3FL7A 4RS5B 5I93A 1JBCA 3ZIXA 5E8AA 1UY2A 1RJ7A 3I2GA 3FLPA 2WYSA 3TNPB 4HXCA 1PGW2 2JDHA 4AI0A 4PLOA 4WZCA 2JB8A 2W1QA 1WW4A 1C4RA 5AFBA 1UIKA 2FZ2A 4E27A 5FXWA 1T6GC 1WKYA 5KHIA 4LBLA 4B4PA 2JECA 3MV11 2PHUA 5FZ3A 1EV12 5FMDA 1TZOA 2ZCWA 3V64A 1AL0G 1IPKA 1LOCA 1YIFA 2Q0AA 2VOWA 3LEIA 1YQ2A 3O5SA 3TNQA 3WHTA 3FUQA 4N9HA 4J1XA 2WC2A 2CGNA 1QDOA 2A6VA 3VBOA 4K1ZA 5LBCA 2JDKA 2WSUA 3I3EA 3EYPA 4V2VA 2JD4A 2C24A 2VXRA 3OF1A 3P3NA 2OPWA 1POQA 3ACGA 3OPWA 4LKDA 4MVTA 4XURA 3ZFFA 1IG0A 1G7YA 4LE3A 2E33A 4XYXA 5JIAA 3PMSA 3KLSA 4JV4A 3CJIC 4Y22B 4CPBA 1KFXL 4XFFA 2D44A 2JENA 4FFGA 1STMA 5BNNB 1OFNA 5I0SA 2B42B 5LA2A 4AQTA 4BE3A 2RJKA 2YPJA 4LT5A 1FV3A 2YU1A 1RUC3 5GLWA 5JCTA 4BMEA 1RXGA 1GP5A 2CL2A 2IUWA 2ZTNA 2WT0A 1W8ZA 1RINA 4IGPA 4B4QA 3T0DA 3ZYBA 3ZYPA 1L7QA 2WFF1 3USUA 5L9BA 4CDUB 2BERA 3ZN4A 5E88A 2R1BA 3V0BA 3IKWA 3TWIA 1NCQC 3U4SA 2A1XA 1RUE2 4YARA 1AF9A 1PZ9A 4RYDA 2I45A 4NPLA 2BFUS 3OD4A 5EP9A 3K77A 2WA4A 4Q0UA 5ABJC 1UMHA 1W39A 4NHKA 2BYVE 3VHOA 1WMDA 1HW5A 5GLTA 2X5IB 4CPBD 1CZTA 3MLKA 2HWC1 2RDRA 4RQPC 5A33B 1CESA 1EUUA 2O14A 2WZEA 2I07B 3KM5A 4QXHA 4EWEA 3SKJE 4LO5B 3LA3A 3HWJA 1ULCA 1O7FA 3BOWA 3CIHA 3QBQA 5L7OC 5LEJA 5EJZB 2UWBA 3VBUB 5LY2A 3FUOA 3PHMA 2FCTA 4LBOA 4FOVA 2VOVA 4IV3C 4BXFA 1WCSA 4KWLA 2EXJA 2ENRA 4GKYA 2EA7A 3HR9A 4UW6A 3U07A 1BEV3 2BP6A 2DFBA 3WQ1A 4PLMA 1AXYA 2Z5WA 1CIYA 1X9TA 4CDQA 1LOGA 2YC2A 1FMD1 2BU9A 2W87A 4LXLA 4BWOA 4CP9A 5BNPB 1UZ0A 5FMCA 4AYUA 2CNAA 4OI1A 3WNNA 4P02B 5KXDA 4L9BA 3F95A 1HN0A 3LEKA 4QX7A 3PVOA 4F3JA 4JAAA 4URAA 1W90A 1O3RA 2DWRA 4KU7A 4A7ZA 5FPBA 4ZZ5A 3MPBA 4LULA 4F7ZA 2N7GA 2W3JA 1W05A 3JBG1 3SQOA 3SCFA 3IZOA 5IUQA 5KXBA 2B5HA 3DCQA 4IE4A 4N90A 3THPA 4ET7A 3O1OA 1VJ2A 4BCUA 2CWSA 2F17A 2I2SA 1D7PM 4OZXA 1BBT1 5EJ1B 2HWC3 5T5PA 2PLV3 1CZVA 1W2NA 2PXJA 1OF3A 2BPA2 1RUD1 4R9DA 3VL9A 3V56A 1MVEA 3A22A 3KQ4B 3A4UA 3RZZA 3QD6A 5F32A 3RYKA 3E97A 3ZYHA 4PF1A 1SFNA 1YYNA 1QQP2 2AUYA 2VUDA 2WRAA 5C8CC 5FP8A 3L2HA 3H42B 3WP6A 3NV4A 2WNVA 2D40A 2QQOA 4XJAA 1SMVA 1B35A 1ZBA1 2VZUA 4R9CA 1XXNA 3KHBA 4XF9A 3WCSA 4OLLA 5LRRA 2BDRA 5FUPA 4AVVA 4N53A 5K0UC 1REEA 1ENXA 4WV8A 1V6OA 1HN1A 3KV5A 2VECA 1UOJA 3LZZA 2GAUA 1MS0A 2RDNA 4META 2LUWA 2FBEA 3SH4A 4PHZA 4XIKA 1YFXA 5FQ0A 3WQBA 2IFRA 1WCDJ 3GHMA 3T1MA 1AR73 2P17A 3IDBB 4KL1A 4WVMB 4XF0A 4DOUA 1JZ7A 1IS6A 3QH6A 1PGL1 5JZGB 1KDMA 1MPXA 2BGCA 2HYKA 5C9AB 1UZVA 4E8CA 5IFTA 4GWMA 5FJKA 4W6XA 5FLHA 3RQ0A 5C3RA 1HB4A 1O91A 2ZGTA 3DKWA 1FX5A 1BMV2 4K20A 4MZUA 2OIIA 3VDCA 5FZLA 1GANA 2JDMA 2XPJA 5TSWA 5DAWA 2NN8A 3BODA 3MUY1 4WM7B 4CU7A 4R8HA 5KHGA 3QCWA 3AKRA 1V9U1 2YPDA 5ABJA 2JEMA 1E5IA 1VBE3 5A80A 4YFZA 4UFLA 1N3OA 1IS3A 4YVWA 1VAVA 2EIEA 1W3XA 5FYHA 5FY7A 3WW2A 4S2DA 1RUJ3 2VMFA 1RYYA 2DCYA 2RS12 3PJYA 3VHNA 1PIV2 5LA0A 4JKMA 5H9SA 5BYNA 4YM2A 1L7LA 1XBFA 2XONA 3I2HA 1S0IA 1UO9A 1REDA 1XNKA 1W2AX 1I5PA 4OZOA 2XH6A 4G3YC 2XJRA 3I3BA 4QX2A 1R092 4ZZ8A 3I3DA 2YDEA 1UF2C 4AI9A 1KS5A 4JGZB 4P9GA 4G4FA 3IMMA 2D6KA 2NMOA 3OGJA 1OC1A 3CL1A 4QD2A 3U11A 5LK7B 1NYWA 1CX4A 2VTXA 3GJAA 5C4WC 3JD71 4TN7A 4XF4A 3ON7A 5A7SA 5I91A 2W9XA 3HNMA 4AEJA 4MGSA 5BUVA 3RJ2X 1QGLA 3T2PA 2ZKNA 5GLUA 2VZ3A 1MS9A 5I8TA 1JYIA 1RHI3 3Q8BA 2E53A 3FE5A 3NAPC 3Q8FA 1AXZA 2VZPA 3M1HA 3N9NA 3NAPB 3PLQA 5A3LA 1G9AA 3EXUA 1KD7A 1N1YA 4H55A 1AJOA 2FQPA 1XSQA 3ELNA 3VBHC 1UYZA 2VMEA 4HKOA 2NLRA 2E9QA 2W1WA 3AP7A 4MGKE 4BK5A 2IXHA 1VMJA 3ETQA 1C5IA 4P9YA 3ZM8A 4M3CF 3RI8A 1WMEA 3JD73 5J09A 2W95A 1XE0A 1ND3B 4ZY9A 4EN7B 2CAVA 1A8MA 5JXHA 4Y5Z0 5L73A 4OQ9A 2VULA 3R4SA 4K1YA 1PK6C 3HQUA 2JE7A 3OYWA 4Q4V2 4UW3A 5I0DA 1WBFA 3D4KA 3QACA 1QMJA 5AVAA 4GA9A 4OI2A 4XXPA 3BTAA 3WW1A 1AX0A 4LITA 5DUUA 4URTA 3WQ7A 4AAXA 1JOJA 1VBC3 4FCAA 3AMHA 4KNCA 5T50A 2ZOEB 3AZYA 4K8RB 3HT2A 1ZX5A 3POGA 4LBQD 4QHBA 4XETA 4NIDA 1PO11 4W6WA 2JDNA 1WA6X 1VB4A 2WQ4A 2D5FA 2JG8C 2ZMLA 3CDZB 1C8M3 1XE7A 4YZ5A
chains in the Genus database with same CATH topology
1YJKA 2ZACA 1LGNA 1PVXA 2ZGNA 1GZWA 2AR6A 4A7YA 4NN0A 1BEV2 3WDWA 1DFQA 3D6EA 1UZZA 4XJUA 2XBO1 4XTPA 5JPMB 2XKOA 3AXEA 3E5XA 5CG9A 3JZVA 1J58A 2K0GA 2XBO2 3WHUA 4ZU4A 3U0ZA 4BIOA 4W65A 1XRUA 3R4DB 1TMF1 4IERA 5DDJ1 4AFAA 4QQ2A 4JRLA 2A73B 4QGMA 5FPXA 1HQLA 2R062 3GNEA 3USSA 4HVQA 4FTSA 1AYN2 2I74A 4LBJA 5FCCA 2BVVA 4NWVA 1QQP1 3S7EA 5CFDB 4O9GA 3AMQA 2HKXA 2WSVA 1FI2A 1DBNA 3ROUA 3WZ1A 1BVP1 1DGLA 2BEOA 4PDWA 2Y38A 3M3IA 4M00A 1G9DA 5C8CB 2YHJA 3LOIA 1UX6A 4IQPA 4Y1VA 2X5IA 1ZZ7A 4I09A 5BNPA 2CTVA 1HX6A 1YJLA 2ETEA 4QXKA 2Q1MA 3KB5A 4NOTA 3RS6A 1MS8A 4PF5A 2X29A 4K21A 4Y1ZA 3M4FA 4Y4YA 2UYAA 2D3RA 2XBO3 2OUHA 2ZGPA 4A3XA 3R0RA 4QQPA 1NXMA 1ZRFA 5FLJA 2R063 3IIAA 4M0HA 3DN7A 1XE8A 4XFCA 2CGOA 4CDQC 1TNFA 1S0JA 5KWRA 3ES4A 1N47A 4B7EA 1KDKA 2GMEA 1AL21 4IESA 3RPQA 3FFZA 4KBBA 2HEWF 3EHKA 2LALA 5DZEA 4NR1A 4FPHA 1LEMA 3B5LB 2XLFA 3I59A 4C1WA 2MEV2 4B8EA 3VBRC 4CDXB 1ZA4A 1FOD1 1VBC2 1SLIA 2XVKA 4Q27A 4JDMA 3GBWA 1H2NA 3OJBA 3TN91 1ZVFA 1GV9A 1V9U2 3N4MA 3VBRA 3TOJA 2HWE1 3VBOB 3AJZA 4XMIA 3B7MA 2HWD3 1COV1 3C3VA 5I0TA 1QQP3 5GJ6A 4RR3B 1D4M1 3DUIA 3I7DA 2PA7A 3ZSJA 4OI0A 1AR93 3CO2A 2B7YA 3R05A 1HV1A 1N3PA 4KG0A 3CJIB 1BQPA 2WNVB 5EV7A 1OD5A 3MIBA 2H6CA 4NPRA 3J26N 1AZDA 2EXHA 2YXSA 2KM2A 1QNYA 1Q8OA 4D7YA 2XKPA 5IK7A 2EIGA 2GNDA 2QNKA 3AMNA 1DGRA 1OMIA 2W68A 3AZVA 1I9RA 4JTNA 4BPZA 4JDNA 4DFSA 1LOFA 4Q4W2 4N7UA 2E7TA 1EY2A 4YW1A 3L9JT 1R091 1WLDA 2G9GA 1O4ZA 5J48A 1C8NA 3M3CA 1C1LA 4Z1VA 4AWDA 4Y24A 3AP5A 4B7KA 1PK6A 1Z7S3 2IZWA 2GNBA 2HWD2 1ZZBA 3M2MA 4Z07A 2XHKA 4AHWA 1NOVA 1IQAA 4JDOA 3ZDSA 4QPIB 1BJQA 1MR5A 3N36A 1RB8G 1CJDA 5D8AA 1RUG1 4HVRA 4LTAA 3RRDA 3TBDA 5KHKA 3CU7A 1WLWA 3IPVB 4H7LA 1Z7S1 4H3WA 4Q1PA 4COVA 4LUKA 4N53B 2PHLA 3FC0A 5J37A 2XLGA 5J7MA 2UWAA 1LHNA 4XTMA 3LA2A 2K9ZA 4XW3A 4HL0A 2ZHMA 1QJZA 4AEKA 5J98B 1CJPA 2D97A 1LULA 4COWA 2OYZA 4YZ1A 5JVVA 1EPWA 2BW8A 3OD0A 4QPGB 1QF3A 5E1RA 2AH2A 1LKNA 1RITA 3T2TA 4AGVA 1R1A1 1LESA 3LSEA 1PO12 2C9AA 1ZZ6A 3KMHA 4GALA 1LU1A 1RHI2 2YMZA 4OFGA 1NA1C 5C8WA 2ZHLA 3N3HA 5FPZA 1F9KA 2X53S 5CFCA 3VGIA 5DG2A 4CEYA 5HCBA 4I3GA 1UKRA 1OA2A 2ZGSA 4RFT0 3ZPYA 3SH5A 3MGUA 4Q4V1 4IV3B 4Z2WA 3WY6A 1AR83 2WS91 1O3TA 3N7JA 3D82A 3QH7A 1VRH3 1C3HA 1LECA 1VBD3 3HMYA 1JUIA 1QJY1 2PHWA 4ZU7A 4LA2A 3ZFFB 1NE6A 1VAMA 1HXS1 4X6QB 1J59A 1J1LA 2GNTA 2ILMA 3ME2A 1ZZ8A 2XUMA 2DF7A 3VBSA 3WNXA 2V5YA 2OPKA 5BNNA 5FQ0B 1R083 1C8M2 1Q8VA 4G9SB 4GH4B 1DGWA 3JB8A 3VZNA 2E7QA 4CP1A 3AJYA 2KA3A 3ZMOA 4E4ZA 5FMOS 1CGPA 1Z7S2 4UBGA 3ZXLA 3VHPA 2RR13 2UURA 3GBGA 3V0BB 4QPGA 4XJZA 1PVC2 3POSA 3AFKA 2EAAA 4QM9A 2OUJA 2DVBA 1LJ7A 3WG1A 2HWB3 3B01A 4C0BA 3UK9A 5KBFA 3DL3A 2TUNA 1GNZA 4HK8A 3VBUC 2VU9A 1H30A 2A75A 1G9BA 4MGIE 2D93A 1VBB1 4M3CE 2BNMA 4YG6A 3ZYGA 4XQWA 4LA3A 4HMZA 3AZZA 2YUEA 1LOEA 3VBUA 2WFF2 3HT1A 3JQWA 1QH6A 1AR62 2HWB1 4RR3A 5AC91 5K7PA 1PNFA 1WD4A 1RUC1 4IEUA 1YI7A 2RE9A 1D4VB 1TMF3 1I1EA 3UKNA 3H3UA 3NSTA 1Q5OA 1U5ZA 5JOYA 4OHYA 1NA1B 3VBSB 3KCYA 3RMYA 3FX3A 3OBTA 3AMMA 3OY8A 2PHTA 4GH4A 1EAH1 3H8UA 1O5LA 2GMPA 1FV2A 2X8KA 4Q4X2 4DQAA 3U10A 2CY6A 1J3PA 2ET1A 3D0SA 1RGSA 3H1MA 1CAVB 3ILNA 2IXJA 4KWJA 3IT8A 3OYWB 4AVTA 5IT6A 1AXKA 1VBA2 4RQPB 1OQ1A 2KXLA 2B8MA 2VPVA 3R4UA 5I8YA 1WA4A 1C28A 3TRSB 2P2KA 5KC5A 1ENQA 1MQTA 1M4WA 1PZ7A 2XWBB 2B9UA 2TEPA 1B09A 4X8PA 1AR72 4ASLA 1ZBE1 2D3SA 1QOSA 2IFWA 3TB0A 5A32B 4IEZA 2GALA 1YFYA 1N3QA 1UPSA 3CJIA 4XZPA 1MS4A 1ZREA 1V6KA 1HRI1 2IXLA 2W52A 1TEIA 2WZPP 2ZAHA 5FTTC 3AFGA 1PO21 5JAXA 3AP4A 3DF0A 4HT1T 4FBFA 1K5MC 1YXWA 1ZBE2 2VMGA 2HWE3 1XU1A 3WP5A 4UW4A 4QQLA 4S2HA 1H8TC 1GQGA 3DPRA 1IZ3A 1VBE2 2HWC2 4HN1A 4I0WB 1QNWA 3ATGA 4KH9A 4M0NA 4QU2A 4YVWB 3ENRA 4J6GA 4OHXA 2XJPA 2MHFA 3BALA 4LBNA 2PAKA 2GU9A 4MGYE 1BBT2 2WNUC 1NG0A 1RUE1 1AR82 1YWKA 5K0UB 1SBEA 2F4PA 1NLSA 1S0FA 2A6ZA 4P9JA 4WVWA 3ZVXA 1R1A2 5GZEA 4CP2A 2P34A 1KJRA 3VDDC 2QDNA 1ULGA 1S0DA 1KJLA 2R042 1HRV2 2XVGA 4XBNA 4CDWC 3O0VA 3WDTA 1Q3EA 3LA7A 2XL9A 3VN4A 1WBLA 3E5UA 3EO6A 4DPNA 2QE3A 1SQ4A 1RL3A 1WCKA 4BH9A 4Q4X3 2DU0A 4MSVA 4UXAA 1UU4A 3ES1A 3JD72 4BLJA 3V0AA 2ZX1A 4Q4Y1 3ASIA 1GSLA 4IEYA 4HSJA 1H9PA 4ES9A 4Y26A 3KT4A 4LR4A 1J3QA 1KS4A 4RS5A 2ZMKA 1EV11 3JCIA 4PDWC 1FXZA 1RUI1 4P14A 4FPCA 1B35B 1EYBA 1RUF3 3UKTA 2RS13 2MPFA 4FPOB 1GKBA 1TME1 5T5LA 2ZAAA 4AEMA 3M70A 2DUPA 2V09A 1V70A 2XB6C 2XL7A 2D6LX 3H1YA 4FOWA 1XYPA 1R093 5FRAA 1RUNA 4GB31 1X7NA 1X50A 3CNAA 2XWJB 5T52A 1QJX2 1CPNA 1YFWA 2QDRA 4FT8A 2CAUA 4R4XA 4AHZA 1AX2A 3NV3A 4IXLA 1R082 5HCAA 3ALQA 5JPNB 2V73A 1RUH3 1QU0A 4CZSA 3E6CC 3E5QA 1NCRB 4GB33 2R073 5H9QA 1UPIA 4LNVA 3VBHB 3A0NA 1S0CA 4J1WA 3ZSKA 1DHKB 4YFWA 1LOFC 1PIV1 1QOTA 2CWMA 4PIXA 2XVLA 3HN1A 4F8AA 5BPXA 2EXKA 1U5XA 2Z42A 1W6PB 2WNUB 4YVWC 2VQ0A 4KG8A 4K7JA 1QJY3 1H4HA 3FLTA 1OOPC 4XF3A 4YZ4A 2ZGOA 1A8DA 4QPIC 2DTWA 4MH0E 1AYM3 5D8AB 4EN0A 1AVBA 4RHV2 4TYSA 1YIPA 5I8SA 4LLOA 5GZFA 5FBZA 4B4RA 5BV6A 2JX9A 3NKTA 4D7TA 1OLQA 1H1IA 1HRV3 3DGTA 3SNMA 3S0MA 4YVSA 3NJZA 1SLAA 1LB2A 4Q0QA 5IK5A 4EROA 2WFF3 1RUH2 4LHNA 3VBHA 5JI9A 2RR11 2DCJA 1LGBA 1V6IA 2OZ6A 4D7SA 1G9FA 2D6NA 1QJX1 4AG4A 4LUMA 3MYXA 1F31A 4MLOA 4P5HA 1U12A 4YW3A 4WBBA 1C1FA 1S0EA 2EXIA 3G7DA 3JU9A 4BYYA 1SFYA 5JOWA 1H8TB 2Z2SB 2P3KA 4AEDA 1NXD1 3NV1A 1HDKA 4FXGB 2QUOA 4FQ4A 1NCRA 3WD5A 5D8AC 1AR91 1CVNA 1YUDA 1RUF2 4YM0A 1UIJA 4GWNA 4KU8A 3AYDA 3WLUA 2QFEA 1MACA 5FMOL 5E89A 5AC93 1NY72 4QQOA 3KSCA 2GC0A 4FQZA 3NO8A 3WT3A 4FPJA 1A6CA 1CAVA 4KGQA 5A32A 2CYFA 2R16A 2UWCA 4N43A 5I0UA 1AR92 3AB0A 1XYOA 3VDDB 4CYDA 4Q26A 1W6NB 3PVEA 3SCGA 1G86A 3WQ0A 3ILFA 3FWEA 4GMP0 3O12A 5EZWA 3ZFEC 4OHVA 2YGMA 2B39A 4HN0A 4YVSB 2R072 2XG3A 1H2KA 4ES8A 1G6NA 4HSLA 2D5HA 1FMD3 5DG1A 1ZM1A 2C1FA 2D7FA 1DYKA 3IBMA 1EP0A 1GBGA 2GC3A 2QVSB 1N1VA 1AR81 2WS93 1U0AA 4HKWA 2GC2A 1OI6A 2ZPXA 1VBA1 1ENRA 1WGPA 3VKMA 2ERFA 2C5DA 1VBD1 4FPKA 2HWD1 1ND3C 2WWSA 5C8CA 1I5ZA 2PLV1 4NO4A 3APBA 1JW6A 5J36A 4AE2A 2VVEA 4WM8B 4XXAA 2OW4A 3FJSA 2HWF2 4AHYA 4GKXA 3TYJA 1IOAA 5FREA 2ZZQA 4RR3C 1R081 5C9AC 1BZWA 1Y3TA 1DGRN 2LTNA 5DZGA 2O0OA 1N1SA 1VB2A 2QZ3A 2JJ6A 4I2OA 1FATA 2RR12 2P3JA 2VMIA 3M3OA 3BPZA 3WINE 4YW5A 1GNHA 4QPGC 2VNOA 3ZIWA 4DNYA 5GLZA 1OPOA 2HWB2 1D2QA 1DQ1A 1BKZA 4L97A 5JLVA 2VVFA 2VW1A 1UAIA 1PM7A 3ZXFA 3HBZA 4E9KA 4GB32 1VRH1 2A70A 3BIWE 5CFCB 2ES3A 1NZCA 3ILRA 5CFDA 5AC92 3WDXA 3D8CA 1R1ZA 3IWZA 2JE9A 4HK9A 2DCKA 3KT7A 1TME2 2P3IA 1Y9QA 2ZA9A 5JMCA 2WNVC 4FO9A 1DQ5A 2UY8A 1POV0 5JWPA 3CLPA 3D5OA 2R0FA 3MW4A 2FHRA 5DUWA 1O3SA 4I3PA 1IS4A 5T5JA 3TAYA 1H1MA 3NW4A 5K8SA 2ZGQA 3W58A 4YVSC 5FOBB 2PTMA 4Q4Y2 5DUXA 4DRVA 4XJ9A 2H0VA 4LO6B 1H1AA 5SV8A 4ZU5A 3RNSA 3JBG3 1LCLA 2ZJCA 4H7MA 5GM0A 2H0BA 2D43A 4LE4A 4DXZA 3B69A 4PJYA 4A2UA 3AXDA 1DZTA 5LRSA 1QXPA 1ZBA2 3AK0A 2ZGKA 1KFUL 3CEWA 5CA6A 1LGCA 3E6BA 1RUI2 4FOQA 3HD8B 3HIFA 4S2FA 1APNA 1PMIA 3ACLA 4XBQA 4SLIA 4E2QA 2UYBA 4N9IA 2HWF3 3VBOC 4K3UA 5DZFA 3URFA 1DZQA 3VZMA 3MPPG 1TE1B 3IPVA 1W6PA 2WNUA 1YCIA 4TWTA 1OPMA 1WUVA 5J96B 5KHJA 1SLCA 4XPVA 5K0UA 1QWRA 1RHI1 4FPLA 3JBG2 3M3EA 4P9XA 5EWSA 4IV1C 4IV1A 2FMDA 3CF6E 1AYN1 2DURA 5GZDA 2NYYA 1YNAA 1GZWB 1EPZA 1Y43B 3LGRA 1PO23 1W6NA 4AK3A 3USUB 3S7IA 5T55A 1J3RA 3IDCB 5DDJ3 4M3CB 5JZGC 1YFUA 1RUOA 2O1QA 3MF9A 1CD3G 4AI3A 1SBFA 1REFA 5B2GB 3K48A 2AENA 1GZCA 4U36A 1Z0HA 4IL7A 4LBQB 4FPEA 2R0HA 2Z79A 1Q8QA 4R9BA 1ZNPA 4WVMA 4XF1A 1XYNA 4WVVA 3ZMNA 1TME3 2R32A 1RUJ1 4HKLA 4OI4A 3VBRB 4CDUA 1U5IA 4YM1A 3GALA 2QJVA 4ZXKA 4I02A 4PLNA 4EWDA 1DQ4A 1JHNA 2E6VA 3POYA 1GR3A 4CDXC 1WW7A 4AF9A 5JI7A 2BUKA 4L92A 3ZYJB 4AFBA 1DIWA 1QKQA 4H14A 3O7OA 4JGYB 2BWAA 5DDJ2 4C90A 1OA3A 1A3KA 1W6QA 2DVAA 3GF6A 3B94A 5JIUA 3W59A 4Q4X1 5EFUA 2VOXA 2IWGB 1V6LA 1JTZX 2JG9B 4YG0A 2A71A 3AZXA 2ARBA 2EF6A 3RJRA 3DV8A 5FLIA 4ONUA 1CAUA 4DZGA 3QLQA 4BIFA 4AHXA 3LWCA 2Y26A 1CPMA 1DZRA 1SLLA 2GNMA 4M3CA 4QMAA 3RMXA 2GZWA 3H7JA 3I59B 4JCKA 3ZFGC 1RUE3 1V00A 4LO8A 3DPRB 4MV2A 2RS11 4IETA 4PQ9A 1COV3 1KXGA 2D6MA 3WDVA 1MS1A 1K5MA 1ZZCA 4AGGA 1VBC1 2BBVA 1ND2A 4IEVA 2OA2A 3SITA 4AGRA 4Y1XA 1DGWX 1I3HA 3VUOA 4D69A 2IXKA 1OQEA 5ACA3 4JGZC 2XLAA 3AKPA 1FOD3 1W6MA 4COYA 1QJX3 3D0JA 4IEWA 4YRDA 4BA6A 5JSRA 3RYRA 5JZGA 2VGDA 1C5HA 2XJSA 1AHSA 3OPZA 5C9AA 5JOZA 4Q4W1 3SH3A 4RD7A 2A3WA 3MIDA 3ECQA 4LLFA 2SLIA 5T54A 1AL23 1S2BA 4EN8B 2ZX4A 3WR0A 4D3WA 3AKTA 2ZGRA 1V6JA 1WW5A 5I0RA 3PMEA 1ENSA 4HPKA 2WLPA 1PNGA 3VL8A 1RTVA 3FHIB 3MICA 4ZKTB 1QJU2 5JSOA 1HQNA 5GKAC 2NPIA 3MW2A 2RM23 3FZ3A 4EV0A 1GFF2 1GYKA 5EYXA 1QJY2 3M3QA 1CR7A 4FSJA 2GC1A 4E2GA 4K9SA 1C57A 2O8OA 4MX3A 3FBYA 2PLV2 3L2YA 5F6LB 4BZ4A 1AYM2 4RHV3 3WP4A 3BCWA 4K6BA 3KGLA 4EN6B 4D94A 4A7KA 2Q4SA 1OA4A 2AYHA 4XBLA 3SCHA 4QGNA 4Y22A 4Z8BA 3OCPA 4R52A 4RQPA 1ND2C 3MW3A 1AX1A 5C6CA 4FTEA 3B3QE 1PVC1 2XJTA 1D2SA 3E6DA 4GXLA 5AVPA 2RMU1 3ZSMA 3LKJA 1GICA 1VP6A 1MZFA 1S0GA 1SLTA 2WNEA 4AXOA 5JDBA 3AM2A 3ZSEA 2VNGA 4Z82A 3HQXA 3KS7A 2BNNA 1R1A3 2R061 2Q30A 4IV1B 3AP9A 5FO8B 4N43C 4LEJA 3SHRA 3NVCA 3AYAA 2ZX2A 4HVOA 2AZ5A 1GQHA 4AQSA 4N7IA 1UW8A 1NA1A 4YNIA 3LB9A 1IKQA 3IN9A 3N35A 4Q4W3 4SBVA 3OY8B 4GH4C 2R041 1TNRA 4OHZA 4O9EA 1AR71 5LK5A 3AP6A 1UU6A 3NAPA 3ZXDA 1J1TA 4BHPA 5E16A 4TSVA 2D3PA 2WZR2 3TN93 4BOWA 5KXEA 4IEQA 1FT9A 1ZBA3 3INAA 1RVF2 1UL9A 3KCXA 5GLVA 4WM7C 2ZGMA 4L11A 1PGSA 1WD3A 2WFPA 4E2SA 1QOOA 3NL1A 1H2LA 3OTFA 3WDYA 4M01A 2Q1ZB 4Y20A 3Q9OA 4LHKA 1ULFA 2GMMA 1RUD3 4NWWA 4WM8A 2CGPA 2JXAA 2VW0A 1VBE1 2VW2A 5BY5A 3ZFEA 1CN1A 1HLCA 3H7YA 3LSDA 4HZFA 4OUSA 3EBRA 4MGZE 2UY9A 2RM22 3FFQA 2JG9A 2JG9C 1RUH1 2NM1A 5EYYA 1LOBA 2DCTA 4EJRA 2R6QA 3B9CA 4MYEA 2GH2A 3BU7A 1KITA 1RVF3 3H3ZA 3V0AB 2GN3A 3ZX7A 1LOAA 1MS3A 2O8QA 2PHRA 3UL2A 4P9WA 2A7AA 5CFCC 2QCSB 2ZKLA 3PVBB 1M06G 2W0XA 1ZYBA 1URXA 4OUMA 3JUUA 3MZHA 2Q5TA 5CIRA 3MIFA 1VAKA 2PELA 1COV2 3FBMA 3JB4C 1ZRCA 2CV6A 2DYCA 2MEV1 1RIRA 4I0BA 4K8FA 4CEWC 4YLZA 4PBPA 3VZJA 4CEWA 4TZDA 3WOGA 3B9IA 1VBD2 4ITCA 1QH7A 5L7OA 1EAH2 3P3PA 5BNNC 4YZ3A 2XGXA 3MIGA 4AFMA 4CP0A 3J8F1 4X6RB 1F2NA 4HFSA 1GLHA 4ATEA 4AI2A 1XU2A 1AL22 2YGLA 4FP2A 3SLIA 1DQ2A 2JG8B 3ZFEB 2R1DA 3KZ4C 2YROA 4QX5A 2VMHA 4XEZA 1D0GA 1TQ5A 3ZXEA 1CAWB 4FP3A 4JVAA 3ZN5A 1LHOA 1XNBA 4YSFA 5FDBA 2NMNA 5D1IA 1OFSA 1VBB3 4DINB 5CB7A 3ZFGB 4FPYA 3R6SA 1ND3A 1VR3A 1Q56A 4AI8A 4Q8LA 1F5FA 4QQHA 1AR61 3WCRA 2D6OX 1EAH3 4QGLA 3C2UA 4XHBA 2ZGLA 1RVF1 4WM7A 1VALA 1RUD2 2DFCA 1IPJA 5T5OA 2A5ZA 5ABJB 1FPN1 1IHMA 5A33A 4YGCA 1DG6A 4MUVA 4MXWA 5BNOA 1HXS3 1CIWA 2X5IC 1XQNA 1F5JA 1BYHA 5KHHA