4Q4V2

Crystal structure of coxsackievirus a24v
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
264
structure length
264
Chain Sequence
GYSDRVRQITLGNSTITTQEAANAVVAYGEWPSYLDDKEANPIDAPTEPDVSSNRFYTLDSVQWKSTSRGWWWKLPDALKDMGMFGQNMYYHYLGRSGYTVHVQCNASKFHQGALGVFAIPEYVMACNTEAKTSYVSYVNANPGEKGGVFDNAYNPSAEASEGRKFAALDYLLGCGVLAGNAFVYPHQIINLRTNNSATLVLPYVNSLAIDCMAKHNNWGLVILPLCKLDYAPNSSTEIPITVTIAPMFTEFNGLRNITVPATQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords Coxsackievirus capsid protein VP1
publication title A sialic Acid binding site in a human picornavirus.
pubmed doi rcsb
total genus 61
structure length 264
sequence length 264
ec nomenclature
pdb deposition date 2014-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4q4v200
1EV12 1AR72 5BNOC 1QJU1 3DPRC 5FMOS 1FMD2 4JGZA 2HWD2 5C4WB 1NA1B 1FPN2 3JBG1 1Z7S3 2HWE3 4NWVA 1VBE1 1RUF2 2BUKA 1QJX3 1V9U3 1PGL2 1AR71 2GSYA 4QPIC 1RB8G 1R092 4RHV2 4WM8B 4CDXC 1RUH2 1FMD1 4PDWC 2HWD1 2QQPA 4GH4C 1ZBA2 1ND3A 3VBRA 1F8VA 1FPN1 2R042 1AR82 1WCDJ 2WFF2 1AR63 1BBT3 5FMOL 1AYM2 3VBHA 4CDUC 5BNNC 4IV3A 1BMV2 1RUF1 3ZFGB 3ZFEB 3NAPB 1RHI2 1RUG2 3CJIC 1PGL1 3VBUA 5J98B 5JZGA 1R091 4RHV1 2RM22 1RUH1 2WZR2 1ZBA1 4YVSA 3JB8A 1AR81 2ZTNA 2WFF1 1AYM1 1RVF3 1BMV1 3VBOA 1VBA3 3VDDA 4Q4V1 4RR3B 1C8M3 1HXS3 2PLV3 1W39A 5L7OB 1RHI1 1RUG1 4Q4X2 1NA1A 3J8F3 2RM21 2WZR1 1HRI1 5A33B 4WM7C 1RUE2 1R082 4QPGC 5CFCA 1PO13 4RQPA 1OHFA 1TMF2 2BBVA 4Q4X1 1HRV3 1CJDA 2BFUS 5BNNB 3ZFGA 2RS53 1RUE1 1AYN3 1VBC2 1TMF1 1QJX2 3VBSB 2WLPA 1PVC3 1F2NA 1H8TC 1Z7S1 4JGYB 4RR3A 1BBT2 1AR62 4CDQC 1VBC1 5BNPC 4N43B 5K0UB 2R063 1QJZA 1QJX1 1V9U1 4CDWB 1NCQA 2XBO3 5CFCC 3TN93 1AR61 1BBT1 1VBE2 1RVF2 1X36A 1VBD3 1RMU3 3ZFFB 1VBA2 1MEC3 4YVWB 3VBFA 1C8M2 5J96B 1POV3 1B35C 1RUI3 4AEDB 1BEV2 3J8F2 1PGW1 5D8AC 5A32B 1C8NA 1MQTC 1ND2C 2FZ1A 5C8CB 1RVF1 5ABJC 1VBA1 5GKAC 4IV1B 1RUJ2 1TME3 1C8M1 5C9AC 2PLV1 1M06G 5AC92 1D4M3 4BCUA 1BEV1 1NCRB 3J8F1 1HRV2 1OOPB 4JGYA 5ACA3 4N43A 2RS52 2RMU3 1ASJ2 1AYN2 4RS5B 2X5IB 1RUJ1 4Q4V2 2R073 1K5MC 1PO11 4CDWA 4CEYA 1EAH3 5AC91 4EJRA 1PIV2 5DDJ3 5CFDB 1HRV1 1PVC2 1X33A 2MEV2 1HRI2 4N53A 4CEWC 4Q4W3 3ZFFA 2RS51 1ASJ1 1AYN1 4JGZC 1R1A3 5BNOB 1HQNA 4AEDA 3DPRB 1PIV1 2HWB2 5A32A 5C4WA 1PVC1 2XBO2 2GH8A 2Y26A 1FOD3 2MEV1 1MQTB 1NOVA 4Y5Z0 1ND2B 1ZBE3 5C8CA 4FSJA 1SMVA 5ABJB 2RS32 1VRH3 5C9AB 1RMU2 1ND3C 3VBRC 2HWF3 2RS12 2R061 4QPIB 4WM8A 1NCRA 1AL22 1RUI2 4CDXB 2HWB1 1EV13 4PDWB 3VBHC 4IV3C 1OOPA 4GH4B 2XBO1 1VB4A 1CD3G 3HAGA 1FMD3 1QQP3 4CEYC 4CDUB 1FPN3 3VBUC 4RS5A 1Z7S2 2X5IA 5JZGC 2RR13 3ZFEA 2RS31 2HWE2 1K5MB 3NAPA 1RMU1 1RUC3 1MEC1 4N53C 3CJIB 1TME2 4YVSC 2RS11 4LLFA 1AL21 1POV1 1V9U2 5CFDA 1RUI1 1VAKA 3VBOC 3VDDC 4CEWB 1POV0 1NG0A 2WS93 1ZBA3 2ZAHA 2R043 5ACA2 1AR83 2WFF3 1NA1C 2HWE1 5BNOA 2BFUL 5L7OA 1TME1 2R072 2VQ0A 1EAH2 1RHI3 4GMP3 1GFF2 1D4M1 1RUG3 1PGW2 5A33A 2IZWA 1AR93 4RQPC 4WM7B 4Q4W2 4QPGB 5ACA1 4FTSA 4QPIA 4CDXA 1HXS2 2R071 4PDWA 2PLV2 1OPOA 1EAH1 3ZFGC 2XPJA 3NAPC 4Q4X3 4CDUA 5BNNA 2FZ2A 1FOD2 1IHMA 4Q4W1 1ZBE2 3CJIA 1VRH2 1R083 5FOJB 1VB2A 4Q4Y3 1R1A1 1HXS1 1PO12 3VBSA 4FTBA 2HWF2 4RR3C 1H8TB 5L7OC 3S6PA 1QJY3 1COV3 1FOD1 1QQP2 1ZBE1 4CDQB 2HWC3 1NCQC 2RR12 5K0UA 5BNPB 1VRH1 1VBC3 1RUC2 2DF7A 1PO23 2HWF1 1DDLA 1EV11 5CFCB 4RQPB 4WM7A 4GB33 1VBB3 3VBFC 4QPGA 4FTEA 1QQP1 2WS92 3JD73 4YVWA 2RR11 4Y4YA 1RUC1 1B35B 2R062 1RUD3 1HX6A 5D8AB 1QJU3 1AR92 2WS91 3VBSC 3TN92 2R041 3JBG3 4IV1A 3LOBA 1NY72 1VBD2 1VBE3 1MEC2 4JGYC 1H8TA 1AUYA 4Z92B 1AR73 4GMP1 4N43C 5K0UC 1BEV3 4CDQA 1AR91 4GMP0 4CDWC 2HWD3 1AL0G 3TN91 3ZXAC 1NCQB 5BNPA 1NY71 1VBD1 1RUF3 4RFT0 1RUJ3 4Q4Y2 3ZFFC 4YVWC 5AC93 1D4M2 3VBFB 1R093 4RHV3 1A6CA 1RUH3 1QJY2 1COV2 4AEDC 4SBVA 3VBOB 4JGZB 2HWC2 5C4WC 1B35A 2TBVA 1AYM3 2RMU2 3DPRA 1ASJ3 1R081 4Q4Y1 4Q4V3 3IDEA 5D8AA 5C8CC 1PO22 4IV1C 1MQTA 1PIV3 1ND2A 5DDJ2 2RM23 4GB32 1VBB2 1QJY1 1COV1 2WZR3 5ABJA 2MEV3 1HRI3 4WM8C 1NCRC 3JD72 5C9AA 2HWC1 2ZZQA 1OOPC 1ND3B 2RMU1 3JB4C 3VBRB 1R1A2 3VBHB 4GH4A 1PO21 4IV3B 4RS5C 1RUD2 2X5IC 3ZFEC 2WWSA 2HWB3 2BPA2 5DDJ1 1QJU2 4CEYB 4GB31 1VBB1 5LK7B 3VBUB 5JZGB 3M8LA 1K5MA 5CFDC 3JD71 3JBG2 4NWWA 4N53B 3FBMA 4YVSB 1RUE3 2RS33 1E57A 4CEWA 1TMF3 2RS13 3VDDB 1RUD1 1AL23
chains in the Genus database with same CATH superfamily
1OVPA 1UZYA 1GICA 1QNYA 1IS5A 4MZUA 4QKBA 2BW8A 5EWSA 1QJU1 5CNAA 3RQ0A 2JE7A 5HXMA 5FMOS 2JD4A 4CE8A 5A3WA 2FDJA 2HWD2 1IG3A 1ACCA 2N7GA 2VZ3A 2YC2A 4I0BA 5GZFA 3WF4A 5C7GA 3OTFA 2GMPA 2CYFA 2PFWA 3EYPA 1O5UA 5LBBA 3CEWA 4GULA 4DS0A 1ENXA 2EVXA 3VZLA 2NP0A 1H2LA 2PHUA 1ZRIA 1RUF2 2DYCA 2XR4A 4GWNA 5CB7A 4DY3A 4YZ5A 1LOFA 4K7JA 3RZGA 4S2FA 3LSDA 4W6WA 3V64A 2BOJA 5A3OA 2IC1A 4XQWA 2GSYA 2W2IA 1RB8G 1S0BA 1WLTA 4E8CA 3HT1A 2BWCA 2JB4A 1RUH2 2XHNA 3LA7A 3NJYA 4YM2A 2A1XA 2HWD1 3GZAA 2RV9A 1ZBA2 3I2KA 4NN0A 2QQPA 3VBRA 1F8VA 2X05A 1CAVB 4MXVA 1E5SA 1AR82 1YLLA 4Y1UA 4ZXEA 2FDFA 4QD2A 2JDKA 5FMOL 1S0CA 5FAXA 1W8WA 3CHXA 1CIYA 2Y34A 4TLGA 1W8ZA 2UWBA 1RUF1 4L0PA 4Y20A 4AF9A 3AYCA 4R9BA 4AL9A 4Q26A 4AGVA 1GYKA 4N7IA 1RHI2 4HPKB 4JRLA 1LJ7A 4ASKA 1YO8A 4XMAA 3N9LA 4HG6B 3AXEA 1RUH1 1NXD1 1DGRN 4A7YA 3UGFA 1ZBA1 2BGCA 1XU2A 4FFIA 2ILMA 5FPXA 1FV2A 1AR81 1CZVA 2ZTNA 3ACFA 3I59A 4HOOA 3RMYA 3ZPOA 4AHYA 5G04L 2RJ2A 4XFIA 4MO3M 1RVF3 2BGOA 1BMV1 3VDDA 1V70A 5H9PA 2DBNA 3PLQA 1HB3A 2QQVA 5FYTA 5LBFA 5T52A 4JKKA 1RHI1 2ZACA 1W8HA 3SCHA 5FZ0A 2H6BA 5M0TA 1CPMA 3D6EA 4GKXA 3GALA 4MHUA 3E5QA 4HKLA 5FY9A 3GNEA 2XJQA 2ET7A 3IMNA 5FJKA 1W2TA 1HDKA 3O1SA 4YZ2A 1E5RA 1SDDB 2VQAA 1AXZA 3M4FA 5DAVA 1QOOA 2JG8A 4R4XA 4XJ9A 2WAAA 4GWMA 2CGNA 1PO13 5DXDA 2YB7A 3FX3A 1HN0A 5FYYA 4V2VA 1I1EA 1PZ9A 2JICA 3VN4A 1W04A 3WG3A 3J7NA 1F31A 1FI2A 1QOSA 2BFUS 4I30A 4QHBA 3KCXA 5HBAA 2VJXA 3V0BB 2LTNA 1Y9QA 2UU8A 3OBRA 5BNNB 2J1RA 2CTVA 4LBJA 3ZVXA 1CAXB 4KH9A 2YGLA 2PHLA 5FZCA 2HEWF 5JSPA 4HKOA 4DUVA 5FZLA 1CESA 5IVVA 4GWIA 1QJX2 4A4AA 4NIDA 3OPWA 3VBSB 3SITA 2VVFA 4BQWA 2ZGRA 2OZJA 1XRUA 4UFLA 3AMMA 4XILA 2G19A 1Z7S1 4AVBA 4JGYB 4M3CA 4RR3A 1AR62 4CDQC 1WMFA 4KG0A 5IHRA 5TSWA 4P9JA 5BNPC 4N43B 3CL1A 5FREA 5K0UB 4YYOA 3GZEA 3APBA 1QJX1 3LDKA 4QX2A 1SFYA 4YM3A 4CDWB 2EAAA 3E6BA 2Y6HA 2VUCA 4UXAA 5FYHA 1YUDA 4HT1T 4XVHA 5CFCC 1DZQA 1D2QA 1ZM1A 5F37A 3HOBA 3LA3A 3KQ4B 2RDSA 3M3EA 2ZZJA 2O1QA 1DGWX 2EIDA 4DXTA 3ZR6A 1AR61 1FXZA 2PQSA 2XJVA 4A7ZA 1X36A 1RMU3 2JXAA 1JODA 1MEC3 3B7MA 1RTVA 3FMGA 1BK1A 4UBGA 4XFFA 3JU9A 4ONUA 5DQ0A 4YW3A 5IAXA 3ZN6B 1XE8A 1OXCA 3AP4A 2BGPA 2VNGA 4IQPA 4OULA 2BVVA 3SCFA 2FD8A 5C70A 2ZKLA 3VKFC 5A32B 5GLVA 5FP4A 4LKSA 3ZKUA 1JZ3A 1C8NA 4CUAA 4HONA 1MQTC 3UL2A 5J09A 2EXJA 2VVDA 1WMEA 1LGBA 3HBZA 3I2DA 2W87A 2ZJCA 1TME3 4XPVA 5FZ8A 3T2TA 1ST8A 4EN8B 1VP6A 4QMAA 1OBNA 3MYXA 4Z2AA 2JIJA 4YW2A 3U4XA 3K2OA 3JZVA 5KHGA 4BCUA 1NCRB 1LODA 1WMDA 2QQLA 3AP9A 3DKQA 3GHNA 1XJAA 3OCPA 4LITA 5CA6A 3BTZA 1S0DA 1HN1A 4XBNA 2B4KA 4O9GA 5ACA3 5HCHA 1W9WA 1W9SA 2NQYA 4I01A 2RMU3 3ITQA 1AYN2 2P6CA 2X5IB 1GBGA 3A0NA 1DIWA 3IWZA 3KHCA 4BQ3A 3CDZB 3MV01 4CEYA 1YI7A 1A3KA 5A7WB 5DG2A 1GNYA 1D7PM 1PVC2 1X33A 4XDPA 5T3NA 4AI9A 2WZ8A 4UWDA 4LBMA 3U75A 4IEXA 2VMEA 3R4SA 3ZFFA 2BOIA 4RN5A 3WHUA 3CIHA 4BZ4A 2WYFA 2Q5TA 1AYN1 3J9SA 4WVWA 1HKDA 3D0JA 3TAYA 4LPLA 2KXLA 1HJGA 1O8PA 1HLCA 2XJUA 1JZ8A 2ARBA 4JCKA 3BB6A 4KWUA 3T4VA 5F5QA 5C4WA 2DCZA 1OA4A 2HH9A 4XIKA 1PVC1 1AX2A 2BP6A 1LOFC 2OS2A 4E2QA 4Q8KA 2BYVE 2V5DA 3ILRA 4Q1PA 2WNVB 5JSRA 4OUSA 1OKQA 1YJLA 2VNRA 5FP9A 4OFGA 1O3TA 2HEVF 2ERFA 3NRUA 3FLRA 1R1ZA 4FQ4A 1DYOA 3K4DA 2NN8A 1YJKA 5JLVA 4LEJA 5C9AB 3GBGA 5EJ1B 3U10A 3VBRC 1JYWA 1G9AA 2R061 1AL22 3BTXA 4XOGA 4UAPA 4EWEA 1PGSA 4PDWB 2CL2A 3SEPA 4K3UA 3RYRA 3VBHC 1SPPA 1OOPA 5LW9A 1J59A 3FLTA 2DVFA 4RGAA 1CD3G 3E6CC 5HXVA 1JOBA 5I93A 3N9QA 2VW2A 3B94A 4FPFA 2RR13 5T5PA 3CLPA 4XAAA 3NAPA 1K5MB 4C0HA 4XF4A 1RUC3 1QY4A 2RJLA 3OEBA 4BQ5A 1S1AA 3H8OA 4EN9B 1AL21 2DVDA 4NMIA 4KWJA 1KDKA 1CAUA 1KITA 1LOBA 2ZCWA 4GWJA 2XLGA 3VDDC 4CEWB 2OA2A 2HBUA 1JYVA 1NLQA 4FBFA 2BERA 4QQPA 2DCTA 3M2MA 2ZAHA 2HEYF 3RVHA 3D3AA 2GH2A 1GOHA 3DN7A 3I3QA 3WDVA 3M3OA 1SHWB 5B4XA 3ZYHA 2SBAA 1WW5A 2FCUA 3RNSA 5BNOA 4QHZA 3ZN5A 1YFUA 1IPJA 3QOPA 2NLRA 4LQRA 5K7PA 1GOGA 3NVCA 4BA6A 4B1LA 2XKPA 3L9JT 1RUG3 2QBXA 4XZUG 3WQBA 2JG8C 1CX1A 1PGW2 3NJXA 4XQDA 1KJLA 1AR93 2XMLA 4JX0A 5FMCA 1UZWA 4WM7B 5AFBA 4DOUA 1OMIA 2D6MA 3N9PA 4Q4W2 4AAPA 4AFBA 1LESA 3ZXJA 4MXWB 3S7EA 5IVYA 4FTSA 2AACA 4Z07A 1DU3D 2LALA 2D3PA 3ZKYA 1BCXA 2XH6A 5JPNB 2GALA 2EALA 2ZGNA 2R0FA 4CDXA 2EAKA 1XE0A 2IXCA 5JOWA 4X6QB 3H8XA 3GYDA 4LO8A 4FPHA 1YWKA 1KRIA 3C7EA 2FHRA 1OPMA 4FFFA 5LA2A 4YARA 5KHKA 3BALA 2XPJA 2XJPA 4NE9A 1WBFA 4X6RB 2JENA 1MS5A 4A3ZA 4CDUA 1OD3A 2XUEA 5LWBA 3ILFA 1FOD2 1RUOA 1DZRA 3WF1A 1Y9GA 2QQIA 4D69A 5AC93 1IHMA 4Q4W1 3NKTA 5FYCA 3N36A 4OHVA 3WNKA 4ATFA 3WDXA 4AHZA 1VRH2 2Y8KA 4UF0A 1C1FA 1VJ2A 3ACHA 2W3JA 2ZAAA 1REEA 1PO12 2Q30A 4P9IA 4UW4A 3WOGA 4AFAA 4XJWA 2W1WA 1X50A 4RR3C 1H8TB 2EIBA 1Y7BA 4LORA 4PQ9A 4Y3OA 2LM3A 5FRAA 3S6PA 5L7OC 1FOD1 2HBTA 1S0IA 4NO4A 4PI2A 2WN3A 5IFTA 1QQP2 1D2SA 5BPXA 4Q8LA 2PA7A 3UETA 1VRH1 2ZMKA 1H1AA 4B8EA 5F1RA 4P5HA 4D7YA 1O8SA 2W52A 3Q9OA 2CV6A 1QWRA 1UY2A 1DDLA 5FZKA 1UX6A 3M3CA 2DTWA 1EV11 4NIHA 2PTMA 1Y4WA 1JH5A 1AXYA 1VBB3 4IEYA 4QPGA 4NHXA 2LRPA 2XWJB 1QQP1 2VOXA 3JD73 4HBNA 5FY8A 3E6DA 1W6NB 4CZSA 4AVCA 4Y4YA 4Q0SA 1XYOA 1O7FA 1YYNA 2XVLA 3POFA 1B35B 4R9AA 1JBCA 2WSVA 1GQGA 1UU4A 2G1MA 1W6QA 3O0VA 4HLTA 5GJ6A 3T1MA 4AFMA 4G4FA 1FAYA 1QJU3 4LO6B 3TYJA 3IZOA 4BISA 4X8PA 5FOBB 5HCAA 5IK5A 2ZHNA 2D3SA 2YZ4A 3RI8A 4MH0E 4XBQA 3WUCA 4AZZA 1QHDA 5DMYA 1ONAA 3AJYA 4IV1A 4JDNA 2E53A 4IEOA 5IW0A 1CX4A 1WW4A 4PI0A 1MEC2 2Z5WA 1YQ6A 1C3HA 4A44A 4F83A 3AL6A 2ZA9A 3HPNA 4C1WA 4UW3A 1JUHA 1DYPA 4I09A 4KWLA 1I5ZA 5KXDA 4D7SA 5K9YA 3V56A 1SLAA 4XFGA 1ODNA 3AYDA 4CUBA 1DYKA 2HWD3 1SCRA 4YSFA 5C3RA 2ATFA 4NR1A 4J1WA 3Q8EA 3BOWA 5DUXA 3ZN4A 4OLLA 3USUB 5J48A 1RUF3 1T6GC 3O1OA 1ZNPA 1X82A 2UWCA 1DF0A 2VUAA 4OMDA 1H1IA 3ZFFC 3HIFA 4YVWC 1ODMA 1SLTA 1W9TA 3NV2A 3IIAA 4BB3A 2XJSA 1GZWA 4MGKE 3VHOA 2WIIB 4QDQA 1A6CA 1RUH3 4Y1VA 4YG0A 1GV9A 1JHNA 1UMHA 4UI9L 4XDQA 5KWRA 4SBVA 1W2NA 5CG8A 1LEMA 4NIIA 2C6SA 2VMIA 2HWC2 5C4WC 4YW4A 2OPWA 3T4HB 2RMU2 5CVRA 1R081 1PX3A 2YYOA 5JSOA 5D8AA 2Q4SA 4ITCA 3OD4A 1PO22 4UW6A 3CKHA 4YPJA 4AI3A 1S2BA 5BY5A 4KG8A 3PURA 1V6IA 3N4MA 2AZ5A 3HN3A 1Y3TA 5DZFA 4GB32 4QXHA 4CA9A 5KHIA 3N7LA 3VZNA 1REFA 1UIKA 4IGQA 4XFHA 1QDCA 4QDRA 3AZZA 1ZZ8A 1DBNA 2UY8A 2HWC1 2ZZQA 5FZMA 3Q8BA 1LOEA 1OOPC 3DXUA 5J7MA 3I2OA 2RMU1 1DGWA 3JQWA 2DU0A 3I3EA 1W0PA 3KV9A 1UX7A 5E6HA 1N1TA 4IESA 2WZPP 2QQKA 1PO21 1RUD2 1QKQA 3JCIA 2WWSA 2IUWA 3DV8A 5T50A 4YG3A 4GB31 3W9AA 5IK4A 1HV1A 4NIGA 3O1MA 3VBUB 4RFRB 2XVKA 5EQUA 2DU1A 3ZYGA 2XUMA 3B3QE 4N9IA 4YZ1A 3NV3A 1FNZA 3B00A 4R9CA 5FK8A 5FZEA 4NWWA 5EHDA 4A3XA 2I2SA 3FBMA 2KR2A 4IGOA 2DTYA 4A41A 1EUUA 2W1UA 2ES3A 2X09A 3R0RA 1UZZA 2NMNA 4LIVA 3VBOB 1RUD1 3S5AA 2BNMA 4HN0A 2E9QA 3E5UA 3J4UH 5BNOC 4TTGA 2YBSA 2WQ8A 3DPRC 4QHOA 3POBA 4AE2A 4YFZA 2R49A 5F32A 3WF3A 3KF5A 2Y0OA 4XW3A 1C5IA 1E5IA 1UIJA 5C71A 3AMHA 1FV3A 2GC2A 1Z7S3 4XJAA 1D4VB 2OT7A 2C26A 1XU1A 2HWE3 2QTWB 4PIZA 5FR3A 5F9TA 4CXYA 3RZKA 1ZRDA 5LB6A 3H3UA 4MGQA 4CU6A 5JXHA 1SQ4A 2W5FA 1QJX3 1E5HA 4TXWA 1PGL2 4CCNA 1LGCA 4QB6A 4E4SA 1R092 4WM8B 3HR9A 3TEXA 4CDXC 4A7KA 1HV0A 5EYYA 1DCSA 1ND3A 3WP6A 3IPVB 1TVGA 3C7HA 4DQAA 5LA9A 2WUHA 1AR63 3VUOA 4XE9A 4CDUC 1H4GA 1JZ4A 2K46A 1Q8VA 4HVRA 2GN7A 3ZFGB 3ZFEB 4F3JA 3UJQA 4UBHA 2W9XA 4QGMA 2PHDA 1RUG2 3SNMA 1PGL1 5LY1A 5J98B 2D6OX 5F3CA 4X8NA 1LULA 1R091 4G3YC 1MZ5A 3W20A 2K0GA 1JU4A 1CIWA 5DUVA 1A34A 4YVSA 4NRMA 5LASA 4QQ2A 5I8YA 2D6LX 2DDUA 3H7YA 1W3XA 5FZOB 5JVVA 4PLOA 2Y6JA 2XHKA 3KGZA 3GJBA 2Y6GA 3VGIA 4BK4A 3VBHA 5L73A 2QQUA 4Q4V1 2Q8DA 2Q1ZB 4KNCA 1V0AA 2VMFA 3AYEA 2IVIB 1DZTA 1KQRA 3WNOA 2H0BA 1RUG1 1W6PB 1W0OA 4BQ4A 4LBOA 4QGLA 3C7OA 3TEZA 3LPFA 1HRI1 3EB7A 2XJRA 5EP9A 5AVPA 2EXIA 5JOYA 3LPGA 1RUE2 2LUWA 4O9EA 4QPGC 4D0QA 3PTRB 2JKBA 5CFCA 4WVMA 2D98A 4UFJA 4QGNA 3S30A 3MF6A 3VZJA 1UY0A 3VDAA 2DCYA 2VOVA 3LIGA 4AG4A 2BBVA 1CONA 4FP3A 3SCGA 3DUIA 1GWKA 1YEWA 1CJDA 1XNKA 3FHQA 4QB1A 4S2HA 5FZDA 2Z2SB 1S0GA 4FI9A 4E27A 1NYWA 3OBTA 5KXBA 2BDRA 2RJKA 4AOCA 4CP9B 2VGDA 2E26A 1RUE1 2VO5A 1AYN3 3UYJA 2ZGTA 2H0VA 2BTVC 1AXKA 1N1YA 4HPKA 2QFEA 3MIGA 2XL7A 5DAXA 1R64A 1V6KA 2ZX0A 3LOIA 4DZGA 1OFSA 2MPFA 1HB2A 1JW6A 1UAIA 2OUHA 2ZX4A 4WZCA 3R6SA 3R05A 4LR4A 3A4UA 4FXKB 1PVC3 1F2NA 2WQ4A 4TN7A 1DLLA 3I54A 4XCBA 5FLHA 5D1IA 1RIRA 1ZZCA 3FFQA 4HMZA 3UGHA 1JS9A 4NHKA 5L19A 4O65A 2Y6LA 3N3HA 2W0XA 4JDMA 4EN6B 4ET7A 4P9YA 5A3NA 2OIIA 4IXLA 1RJ7A 2R063 3P3NA 1PMJX 2YDEA 1LOGA 3WQ1A 5JXJA 1G9FA 2GC1A 2ORXA 1JN2P 4A6SA 3RRDA 4DINB 1OLME 3WZ1A 5JDBA 3BU7A 3NW4A 3VHNA 2ZEXA 3K48A 1WGPA 5IWFA 4QDSA 2A6XA 4J1XA 1VBA2 3OGSA 4L92A 1C8M2 3OY8A 4QPWA 2GMEA 4AVVA 1X7NA 5J96B 3LEIA 5A7NA 5FPVA 1OFNA 4AEDB 3H1MA 4Q29A 1MVQA 2EIEA 5D8AC 1OQDA 1W6MB 1LKNA 1CAXA 3T0BA 3KS7A 3AK0A 2I74A 5EV7A 2FZ1A 4TSVA 1GZTA 2A5ZA 1TEIA 5C8CB 4AQTA 1UYPA 1VBA1 2JDMA 2P3JA 4MX3A 5GKAC 3J7LA 3GCXA 4BHPA 1IKPA 5APAA 1C8M1 2BV4A 2FBEA 2PLV1 1OUSA 1MVEA 3MV11 4OHWA 5KXCA 1M06G 2E63A 3EMRA 3K75B 4NHLA 1ULGA 4Y33A 3ROUA 3NV1A 4COVA 3C2UA 4M4PA 4DRRA 4GIQA 1HRV2 5LBEA 1JZ2A 4P00B 4JGYA 1JUIA 1Q8QA 4XF3A 1AVBA 1H2MA 4JTNA 1W8FA 3ZSKA 2J1TA 4NPLA 4Q0UA 4IE7A 4N43A 2XQRA 2RS52 5FP8A 1PMIA 5FYVA 3WCRA 5C8WA 1K3IA 4LO5B 4MLOA 5FXVA 5C33A 4CDWA 1EUTA 3N9OA 3OBAA 5LCWL 3OF1A 5I8TA 2JDHA 5IK8A 1WUVA 2Y33A 4TYSA 5JIAA 1HRV1 4FPOB 1C57A 2Y6FA 2YU1A 3FFZA 4Q4W3 3KVAA 1Y43B 2V4VA 3M1HA 4MGIE 4RSUA 1VRBA 1TQ5A 2I07B 1SFPA 3OEAA 2RS51 3OUHA 4N90A 4HK9A 1NLSA 1W8NA 5E16A 4ISRA 5FIXA 4ZPIA 3AKQA 1MZ6A 1UF2C 3SLIA 3PVNA 5FO7B 5A32A 1AJKA 1HIXA 1SFNA 1TNFA 2QZ3A 3ACLA 1LRHA 4XYXA 3FUQA 5T54A 1FOD3 1LHUA 1LCLA 1MQTB 2W95A 2YU2A 3LDBA 3BVCA 3OUIA 4ZU7A 2WN2A 3VL9A 1H4HA 2XLFA 2XKOA 2RE9A 1N3QA 1VRH3 5FUPA 2R1BA 3MW4A 3MDPA 4MSVA 4QX7A 3ZDVA 3NWKA 2WBKA 1ND3C 1MACA 3IB3A 4QPIB 3VV1A 1NCRA 4UFHA 2VXJA 1RUI2 1EV13 3DGTA 3LCPA 4OI2A 3S5QA 1N3OA 1G9CA 2R32A 4GH4B 3ZSJA 3VD3A 2VMHA 1FMD3 1QQP3 1L7LA 2P3YA 3T09A 3J7MA 5LRSA 1SLIA 2GNMA 4K6BA 5C5UA 1FPN3 1ENSA 1Z7S2 2X5IA 2OW4A 3WXPA 1VMJA 1W90A 2HWE2 1YNAA 4LOSA 3Q8CA 3OBZA 5A7WA 3UK9A 3IM0A 4N53C 3CJIB 4YVSC 2UYAA 4B3NA 2DUPA 2P5BA 1HQLA 1UOJA 4LLFA 2PAMA 5AFEA 1JZ7A 3D8CA 2GN3A 5FMBA 1RUI1 1VAKA 3WINE 1J84A 4YZ3A 4LA2A 4F8AA 4OZXA 3WW1A 3IAQA 4Y5SA 4CUGA 4EZHA 3I97A 5FY1A 3BI3A 1NG0A 2VMCA 2XXZA 4HVOA 3I49A 2VZPA 4HETA 1V6JA 5A3TA 5KC6A 2WFF3 3EHKA 4QX3A 2HWE1 3ZO0B 2BFUL 5E88A 2RDRA 5L7OA 4P9WA 3SXWA 4WV8A 2G4IA 5BV6A 4NOTA 5JUVA 3E97A 4IE6A 2VZVA 1GFF2 1D4M1 2B5HA 3C7GA 2ZBJA 2VMDA 2WNOA 5A33A 3V65A 1I6XA 3ALQA 5DABA 3TNQA 5FUIA 2EA7A 2L9LA 5GM0A 2YG0A 1N3PA 1ZZBA 3KHBA 4R52A 3SC7X 1FX5A 2YC0A 1IOAA 2E32A 4FT8A 4C91A 1G6NA 2IXLA 3CMGA 5JMCA 1O4TA 1LU2A 3JUUA 4UW5A 4DUWA 5IT6A 4PDWA 4J6GA 5GZEA 4BMEA 2JDYA 4Y20B 4BPZA 3KV6A 5L9VA 4XJZA 3PIGA 2WL1A 3PTYA 3NV4A 4ZZ5A 2WYSA 1WZXA 4Q4X3 4DPNA 5EIYB 3AZYA 2K9ZA 1L7QA 2CY6A 1DG6A 3H50A 4URTA 4XF0A 4IEWA 2W47A 4D8MA 1H6YA 4KBBA 5A7QA 5FO9B 1BK0A 2ARCA 1R083 2WRAA 1XE7A 2H6CA 3I59B 4XF1A 3POIA 4LJHA 5IVBA 3VD7A 1EYBA 3AZWA 4HZFA 4HXCA 2PHTA 1PVXA 1F15A 2JG9B 2VE1A 3THCA 1WCSA 5BYNA 1NLRA 4Y1YA 3KF3A 1OA2A 4IETA 1UNBA 4V2WA 4M3CE 4CSWA 1U5ZA 3H8RA 2HWC3 4LUKA 1ZZ7A 1EPZA 1VBC3 2DUOA 2WKKA 2YBKA 1RXGA 3AMQA 3FUOA 4MYEA 4OYUA 3MGUA 4Q0QA 5IAVA 4ARYA 1PO23 2OKXA 1UOBA 3ZSLA 2P17A 2JE8A 2VBBA 4WM7A 2TEPA 3OOXA 4GB33 1J3PA 5CBLA 2JJ6A 1IQDC 5LRRA 3HBKA 2Y6KA 4E2GA 2WS92 3DECA 3LEMA 1W28A 4XUPA 3ZSMA 1I3HA 3OGJA 4YVWA 1KS5A 2VUJA 1N47A 2BEOA 5DUUA 3MLKA 2ARXA 4CUCA 4XTMA 3WV6A 3K4AA 4ES8A 1EY2A 1W03A 2R062 1RUD3 4KQ7A 4FPGA 4FFHA 2WINB 4COYA 3IAPA 4XJUA 5FP3A 2D44A 3ZM8A 2XGXA 2FDGA 2VG9A 1W9YA 2WS91 5F3GA 4FCAA 3VBSC 3RZZA 1L3JA 1IKQA 2R041 2XB6C 3LQCA 4FOQA 1O6UA 4KU7A 1S2EA 5FYIA 1CAWA 3DCQA 2EXHA 4BQXA 4CP1A 4JGYC 1ENQA 1H8TA 5JXGA 3O1PA 3LZZA 1H0BA 1X9PA 4SLIA 2WNUA 1IPKA 4YLZA 4ZZ8A 4GMP1 2JDUA 1PM7A 2PHWA 2X29A 4N43C 5A7PA 3WUDA 4COUA 5K0UC 2QQJA 3MIDA 3A22A 4GMP0 1LEDA 3WT3A 4CDWC 1AJOA 1UZ0A 3FWEA 5HPOA 5EYXA 4QX0A 1UMZA 3AL5A 3H9AA 3VZMA 1O4YA 1NQDA 3NKGA 5F5AA 4NHYA 5IVJA 5FY7A 2AREA 1WW6A 2D93A 1S0EA 4PJYA 4Q4Y2 3KSCA 4XHXA 5CKMA 1V6NA 2VBDA 3KM5A 4XUNA 5DAQA 4BXFA 4M01A 2E7AA 1R093 5I8SA 2CHHA 5FFOC 1GNHA 3L2YA 1FNYA 1QJY2 3M7AA 4PQQA 2SLIA 2OQ6A 3WNLA 4LXLA 5FZ3A 3AX4A 3E1F1 4MGYE 3H1YA 5FZ1A 4JGZB 2YPDA 4QXCA 1B35A 2TBVA 2ZXQA 3OUJA 3ECQA 2FMYA 3DPRA 3GHMA 2VR4A 1OQEA 3GJAA 4HN1A 3HQXA 4Q4Y1 4Q4V3 1DQ6A 3IDEA 2PN5A 3WP4A 1TNRA 2ORZA 3NMBA 3QCWA 1UKGA 1O3SA 2OZ6A 1PIV3 3T2OA 2D5FA 1WD4A 1ND2A 3R4DB 4KMQA 3POWA 2CU5A 5IVEA 3IBMA 5JOXA 3AMNA 5FO8B 1QJY1 4K40A 5ABJA 2MEV3 1HRI3 4KGGA 2BZDA 1NCRC 2F4LA 2CDPA 2QQOA 4W6XA 1RXFA 3IDAA 3D4KA 3CO2A 2WNEA 5T5LA 1GU3A 1WCQA 2R6QA 2NZ9A 4IEZA 5FV3A 4ARXA 5A1LA 5HV4A 4IW3A 4IV3B 3KT7A 3HJRA 4MGSA 2VL4A 2X5IC 4WVVA 5F3IA 5A80A 5GZDA 2HWB3 1ZX5A 3NO8A 4IE4A 1S0FA 1YC61 4CEYB 3MIEA 1Q8OA 1W8OA 1NZCA 4QQHA 4AEMA 5JZGB 4P5YA 1WCUA 3M8LA 1OD5A 4R8HA 5T5OA 3USUA 2QDRA 2YY1A 3WDYA 1ULCA 3D5OA 2VPVA 5GALA 3JBG2 3SKJE 1RUE3 1X8MA 2ZEZA 4CCKA 3ACGA 3VZKA 2LS6A 4Q2FA 4CCMA 4I2OA 4JHZA 3HT2A 2OX0A 3WW4A 1N1VA 1EV12 1AR72 2ADDA 1BVVA 2VTXA 5CISA 3LF7A 1JYNA 2CWSA 1G7YA 4Y4RA 1OA3A 3SH4A 1FMD2 3CQOA 3INAA 1SBDA 4LE4A 4LIUA 5C4WB 3HNBM 1NA1B 1FPN2 1UY4A 2AEZA 2FCVA 3JBG1 3MI8A 2WNVC 3O1RA 3M3QA 2XVGA 4EWDA 1QEXA 4CVUA 1VBE1 5GLTA 1GZ9A 4Q5OA 3LAGA 1JYTA 1J1TA 4WVZA 1KS4A 3QACA 4ASLA 1AR71 5BXXA 3C8XA 2YUEA 2PAEA 3VD4A 1FMD1 2D7FA 2BJSA 4PDWC 3O0XA 3FBYA 1Q8SA 1SPPB 2QJVA 2WSUA 1GKBA 1FPN1 1WW7A 3I2GA 1LR5A 4LBNA 1WCDJ 2WFF2 4YZ4A 5A3LA 1GQPA 3J7HA 1O59A 2VOTA 4K1ZA 3WX5A 4M0HA 1UWWA 4OI1A 2C9AA 1QMJA 4AQSA 1U5XA 1OQ1A 4L97A 4CP0A 3NAPB 1DFQA 1KFUL 3LEGA 4DXSA 1WLDA 2D43A 4AVTA 2AH2A 4OMCA 3EBRA 3VBUA 1A8MA 3BIWE 4YWAA 1SEFA 5LA0A 2XOMA 4NHMA 1BZWA 1ULPA 1YQ2A 4LKEA 4ZONA 1U12A 4DEVA 1H6XA 3OYWB 4QB2A 5A3PA 3JB8A 3UKVA 1JYCA 3GXUA 2VW1A 2WFF1 3DYPA 1GMMA 3GF6A 4P9XA 2E6VA 2VZ1A 1UOFA 2A6YA 2JEMA 4GD4A 3VBOA 1VBA3 2VULA 1QXPA 1H2NA 4LBQB 1C8M3 2PLV3 1CZTA 1UKRA 2RG4A 4MOAA 5FKCA 4Q4X2 2V09A 4HFSA 4PBPA 1X9TA 1UYYA 1W6OA 2Y60A 2YXSA 3MLJA 1CGPA 1UY3A 3BKZA 5FUNA 4WM7C 2JDAA 2Y64A 2QUOA 3OB8A 1R082 2UYBA 3T30A 1MZEA 1SBEA 4OI4A 4XETA 2WLQA 4XUTA 2WT1A 2C0ZA 4RQPA 2R30A 4M3CF 4RYDA 5C3OA 1TMF2 3RJRA 3PVOA 2ZX1A 4IEVA 3Q8FA 3AKSA 3MW3A 2J1SA 2JDPA 4Q4X1 1PX4A 1YQ8A 4JQRA 3O14A 1HRV3 1UL9A 1QF3A 4QWNA 3U4SA 1GUIA 2ZABA 2A6WA 1O4ZA 1AF9A 1W2AX 4W50A 5FP7A 2VH9A 2ZGMA 3ZFGA 2RS53 5FZ7A 2ZHKA 1VBC2 3L2HA 2G9GA 4FAGA 3WP5A 1TMF1 2VQTA 4BWOA 4ISQA 3VKOA 5L9RA 4C90A 4FXGB 2P4EA 4UFKA 1UPIA 5FXXA 1US2A 3FC0A 4AWDA 1H8TC 3ZXFA 3OGGA 1HB1A 5C3QA 3LB9A 2WNUC 3ATGA 5FY0A 3ZLIA 1XPWA 3WG4A 3BTAA 4D6SA 1DHKB 2WT0A 4AFCA 3GDBA 3THTA 1UU6A 1BBT2 5C3PA 3OJBA 4URAA 1VBC1 1LAJA 2JDNA 3E5XA 1W6PA 4L11A 5KR7A 1JHJA 4AVAA 3GM8A 2UURA 5FYBA 5FQ0A 5A6YA 2VCMA 4E4DX 1PK6B 4AVSA 4HVQA 1QJZA 1V9U1 3BPSA 2BRTA 1NCQA 1XNBA 3USSA 4AAXA 1BLZA 3POGA 4LBKA 2CGPA 4AYUA 3CBNA 1UXXX 3KT1A 3TN93 1RC6A 2VXRA 2W1QA 3WQ0A 1BBT1 3HQRA 1MS4A 3KV5A 3DYOA 2WABA 2YMZA 4YGCA 1UYXA 3U37A 3NQHA 1B09A 5EJ3A 3WNXA 4CP2A 4DIQA 1T2XA 1AX1A 3HMYA 3O5SA 4K21A 3VBFA 2GC0A 5KHHA 5FLJA 1MS0A 3WG1A 1F5JA 1B35C 1RUI3 3SQOA 3BU0A 1UYZA 1SZBA 3UNPA 1S0JA 2GP3A 3B5LB 3J8F2 5ANQA 5FYSA 1V00A 1WWYA 3ASIA 3A7QA 4CP9A 4YW6A 3FHIB 1J58A 3WDUA 1QU0A 3I4IA 2ZGUA 4CCJA 5CG9A 1J83A 5L36A 1ND2C 1UXZA 5JOZA 3POJA 1WKYA 1JOPA 1XOYA 5ABJC 4ZS3A 2ZEWA 4RD7A 4EQVA 4IV1B 2QQMA 1CWPA 3VHPA 4QM9A 4HKWA 3RFRA 3QLQA 4DFSA 3OG2A 5FDBA 1D4M3 1DQ2A 2J1AA 3LE0A 3ORJA 4PIYA 4W4ZA 1FATA 4EN7B 4EV0A 3RI9A 3O1UA 3J8F1 4L2NA 3MBWA 1KEXA 4XUQA 2VZRA 4Y22B 5GZCA 4B29A 3V0AB 4IE0A 4YM1A 4B1MA 3N7JA 3POEA 5J3UA 1ZVFA 4Q1RA 4PIXA 5FXWA 2LROA 5LA1A 1APNA 2VY0A 3THPA 4LKFA 3RYKA 4BDVB 2CSGA 4RS5B 1H8VA 1DQ4A 1Q3EA 4Q4V2 4S2DA 3VDCA 2R0HA 3O12A 1QGLA 4GALA 3MIBA 4JTOA 2B42B 3WW2A 5CYYA 1ALYA 1QH6A 2J1UA 5GZGA 5CKQA 4QPYA 1PIV2 5B2GB 2YHJA 3CZUA 5CFDB 1JTZX 3N9NA 1C5HA 2MEV2 1HRI2 4N53A 1UU5A 5JR7B 1FYUA 4XUOA 3DF0A 4HL0A 4FOWA 2F17A 4Y1XA 2I45A 3NNMA 4R4ZA 3DKWA 4XFCA 2A71A 2Q8EA 2OPKA 4FQZA 2XDVA 5CAZA 5A1AA 1G9DA 2FCTA 2V73A 5E89A 3N9MA 1G8WA 5IVCA 1DQ1A 2XLAA 2DVAA 3EJKA 4AEDA 3I3MA 2BNNA 1PIV1 2HWB2 1SDWA 4GKYA 3W21A 4XJ8A 2XBO2 2Y26A 2MEV1 1NOVA 2PELA 3AKTA 4Y5Z0 1ZZ9A 5JI9A 5C8CA 4FSJA 1OC1A 2A73B 3AP6A 4AEKA 2WZEA 2DBIA 4ZU5A 5FMDA 2Q8OA 2XJTA 5FTTC 1GQHA 4FPCA 5F5IA 2ET1A 3MLLA 3F95A 5FZIA 3WNPA 5JI7A 5HI0A 1OH4A 1VE0A 1WD3A 1QJEA 1JYXA 2CAVA 2HWB1 3AVRA 4ASMB 3BOPA 3WNMA 5JXIA 1CAVA 2QDNA 2XBO1 4P9LA 5I0SA 3RGBA 1F5FA 3ZXDA 1BJQA 2Q8CA 3B9IA 5A3MA 2GAUA 5IFPA 3VBUC 2GDFA 2YFZA 3IKWA 4IEPA 3GZUC 4EWAA 1QJFA 1O91A 4JZRA 2ZGKA 3UGGA 4Z2WA 5IUQA 1POV1 4EN0A 1PM4A 1GANA 3VDBA 3VBOC 3X29B 1POV0 3RWNA 2WO7A 2WS93 4DXZA 2VTXJ 1VAMA 5FYUA 3UV9A 4AK3A 3TNPB 4DB5A 4I0AA 2R043 3T3YA 4N9HA 3ZMOA 1L7RA 5IK7A 1QOTA 3I8TA 3DEMA 4NPMA 3WW3A 1D0GA 3CNAA 4LUMA 4W8JA 3RMXA 2CNAA 2B45X 2R072 2VQ0A 2HLEA 4FOYA 1EAH2 1QIQA 4IUGA 4GMP3 3IN9A 3A23A 5F7UA 4KL1A 3U07A 4RGGA 5CADA 4RQPC 3S0MA 5H9QA 4QU2A 2J1VA 4QKFA 4U36A 3J26N 3T2QA 2ZGQA 4ZS2A 4HSLA 4JQTA 3FLPA 3HWJA 2IXJA 4QPIA 3PDQA 1O3RA 1CN1A 2R071 3DYMA 2J7MA 2AGSA 2PLV2 1OPOA 1YI9A 2ZS6B 4CU8A 3H42B 1JI6A 4M4RA 1EAH1 1YFXA 2W39A 2O14A 2XWBB 5FYZA 3ZFGC 3V0BA 3WP3A 2VUDA 3SH3A 1LGNA 3BN6A 1HW5A 4EYUA 3RJ2X 3UT0A 5A6ZA 5BNNA 2VU9A 2BQPA 3PVEA 3TB0A 1QH7A 3KWVA 4JV4A 4L8QA 1JZ6A 1NKGA 1ZBE2 4MGZE 3MZHA 4XACA 4LT5A 1Q8PA 4FO9A 4L99A 1IPSA 2W92A 3CJIA 3MW2A 1LOAA 5AVAA 2D6KA 3NJZA 5FOJB 4XBLA 1VB2A 4Q4Y3 1R1A1 1MZFA 1T6BX 3VBSA 4FTBA 2HWF2 2Y38A 5EFUA 1NE4A 2WQZC 2X8KA 4YW5A 3UJOA 2IWGB 3BIEA 3PL0A 3PJYA 1RJ8A 3ME2A 4LTAA 3QD6A 4MVTA 4J25A 3VKNA 4I3GA 1QJY3 1OF3A 2JWPA 2GMMA 1QXRA 4TLFA 5LEJA 2MNGA 5F5CA 1ZBE1 4CDQB 1TZOA 3KGLA 1H30A 1NCQC 1MS9A 2DVGA 3GCWA 5DPNA 5K0UA 5BNPB 2TNFA 3ZXEA 3I7DA 3EQEA 1KXGA 1DQ5A 2IXHA 4M0NA 2HWF1 4UFIA 1VLNA 1JU3A 1HB4A 4IEQA 5FY4A 5CFCB 5FLIA 1NT0A 3QH6A 4WVMB 2WO1A 2CGOA 4ZXKA 1RINA 2QQWA 2E7QA 3VBFC 1IZ3A 3MUZ1 3UESA 4BQ1A 4FTEA 3WVJA 3HEIA 1SLCA 4XHBA 2QNKA 4CPBD 1WLCA 1H9PA 1HQWA 1C4RA 1W99A 4BU2A 3S57A 4ZHNA 5KHJA 3ZN6A 1JZ5A 3HD8B 3H3LA 3U11A 5A7SA 2A3XA 1ULFA 2WWUA 4EZ4A 5CKNA 3WEZA 4FAHA 5KC5A 1NQJA 2WAOA 1WLWA 1GLHA 1LHNA 1HX6A 1OVSA 2JECA 2XG3A 1K12A 3R4UA 5FBZA 3U78A 2W94A 5BUVA 3BODA 4AXOA 5DAPA 5F6KA 4E8DA 3GGLA 2JX9A 4PCRA 3TN92 4BLIA 4QT6A 1K45A 3JBG3 1NY72 3H8UA 4JKLA 2FDKA 2HKXA 1UO9A 5ERLA 4DEQA 1XYPA 1VBE3 3DXTA 2D5HA 3P5BA 1XNTA 2JG9A 2Q1FA 2XONA 1GP6A 1JXNA 4GJYA 3RDIA 2QZ2A 3WG2A 3MUY1 1AR73 3PU8A 5JWPA 3ENRA 4PLNA 4LMFA 1LTEA 1UZVA 2BBAA 4XFAA 1BEV3 1AHSA 2DUQA 2QVSB 1S55A 1AL0G 2W08A 3HQUA 3TN91 1M4WA 3KCCA 5EXOA 2Z69A 3ZXAC 4FFGA 2B8MA 1NY71 2VZOA 4D7TA 5JPMB 3TEYA 2XL9A 4F7ZA 4V1PA 1V6OA 3WQ7A 1RUJ3 1ZRCA 4I02A 1EP0A 3H7JA 4LOTA 4BM8A 1D4M2 4GQ7A 4LA3A 1GWLA 2EICA 2WC2A 4PF5A 5LY2A 1YFYA 3OY8B 4LK6A 2YFUA 3KLSA 4O7XA 2NYYA 5JIUA 4A6OA 1COV2 4COWA 4AEDC 1KDMA 1S2KA 3I2IA 4GZ9A 3I3BA 4AEJA 4PBOA 1XC6A 3RWKX 3EXUA 5I0UA 5FZFA 3AP7A 2J42A 4H7LA 2WFPA 2VW0A 4JKMA 4BYYA 1ASJ3 2Z4FA 3PU3A 5FWJA 1U0AA 5C8CC 4OZOA 2V72A 3MPPG 4XF9A 5FXZA 5A70A 3FE5A 2WNVA 3C7FA 4BQYA 5SV5A 2A7AA 2MHFA 4NAOA 2C9KA 1XSQA 4YM0A 3NNGA 1PMHX 1COV1 2C4XA 2Q1MA 4OUEA 4XCAA 5DN2A 5GLZA 1WA6X 4D3WA 3D0SA 3MPBA 3ZYIB 3FN9A 4BXSV 4XTPA 5C9AA 2YGMA 3AKRA 3N7MA 5FKBA 5JCTA 5A6QA 3VBRB 5JAXA 3GZTB 4OHYA 1BXHA 1UPSA 1CZSA 3H1WA 3PUQA 4BMBA 1QDOA 1J1LA 3VBHB 1DQ0A 3PHMA 3B02A 1BYHA 1DGLA 2G9FA 5FPLA 3SH5A 2D3RA 2JKXA 4Q0VA 1W0NA 1Z0HA 2D40A 2DWRA 4IE5A 3SMHA 3K3NA 3VB9A 4D94A 1WA4A 5DZGA 4XXPA 1K5MA 3AYAA 4IERA 4UT5A 3CJXA 5HCFA 4W6YA 3BUCA 5CEHA 5ISLA 3CF6E 3AZVA 2YPJA 5GLWA 1MS3A 2RS33 4JDOA 4BIOA 5K8SA 2X10A 1GP5A 4YW1A 2WO2A 2VNVA 4CEWA 1TMF3 3KVBA 2RS13 3VDDB 3RZJA 3ZIXA 3FL7A 2V5YA 2TUNA 4BJ0A 5A6XA 4A45A 2GNDA 1BMV2 4NRQA 4JGZA 1W8TA 2NMOA 2A75A 3MFAA 4CU9A 3TEWA 3MO4A 2J1EA 2VBPA 2UY9A 2IXKA 1BKZA 3KB5A 5I0TA 1W2UA 1XNAA 1IG0A 3AM2A 3P1IA 4XC9A 3AFGA 4K9SA 4XURA 1QNWA 5DUWA 4NWVA 4I0WB 2GZWA 1W8UA 3HNYM 1C1LA 1LNSA 2JE9A 1LB2A 2ZMLA 2BUKA 2QQNA 3WDWA 2JG8B 3MF9A 5FWEA 1V9U3 1XSRA 1RUNA 3WSOA 4KU8A 1OSGA 4QPIC 3WHTA 4RHV2 4AI1A 4U2AA 2LW8A 2WWJA 4BK5A 4LHKA 4HANA 2B7YA 4FPJA 4MXWA 2JD9A 4QX5A 4GH4C 3SEEA 3LD8A 3VKMA 1ZA4A 2R042 4PT6A 3IIIA 1LHVA 1BBT3 4QKDA 1AYM2 5BNNC 3OSDA 1UN1A 4IV3A 3H3ZA 4MGTA 2OUJA 3O7OA 4DXRA 4XMIA 2P3KA 2O8QA 3ETQA 4OUMA 4K20A 2VZTA 3AXDA 1UQXA 4AHXA 3SKVA 3CJIC 4O61A 2VVEA 4K1YA 4KGQA 5JZGA 4KWKA 5FBJA 2PHXA 4RHV1 1F4AA 3FZ3A 2PMWB 2RM22 1K42A 3ZXLA 1PNFA 3HVDA 2WZR2 1URXA 2ARAA 1YQCA 1KGYA 3MHZA 3W58A 2E51A 2DFBA 2VM9A 3VHRA 1VALA 2QE3A 4BE3A 5IATA 1GOFA 3O1TA 3W5NA 1AYM1 1REDA 4LHLA 1LENA 1US3A 2HJIA 2GNTA 3B01A 4M3CB 4RR3B 2K2SA 1HXS3 1YIFA 3OD0A 3JQXA 1W39A 3POSA 5L7OB 1IS6A 4NAMA 1AZDA 1CR7A 4H55A 3M70A 1NA1A 3IT8A 3J8F3 2RM21 4C8DA 5C5TA 5I91A 4NUBA 5J37A 2PHRA 1Q43A 1XBFA 2WZR1 4D6RA 4D6QA 5I0RA 2ZPXA 5A33B 3QH7A 5BNQA 1VPHA 1CVNA 4B4QA 3A21A 3M3IA 4K8FA 5DZEA 3RYPA 1OHFA 3KMHA 3K3OA 2P34A 2VECA 5FCCA 3THDA 2AYHA 5CU1A 4R9DA 2VOWA 5FYMA 1W6NA 3F2ZA 4YFWA 1RYYA 2IVJA 2O8OA 1YIPA 2IXIA 4Q0PA 2A6VA 4E9KA 3PNAA 2W91A 4MHRA 1F35A 1PHMA 1G86A 4QQOA 3ZMNA 4NPRA 1U5YA 2QCSB 1XNDA 2Y0IA 4XABA 4OCTA 3WLUA 5T5JA 4GJZA 5E8AA 4OQ8A 3GBWA 2WLPA 3OYWA 5E1RA 4ZU4A 2JG9C 4I3PA 5F2WA 3WF0A 5IYYA 2ZHMA 3BGAA 5H9RA 3VKLA 3MFCA 3ABZA 3O0WA 3WF2A 1VMHA 1YCIA 3UKNA 4CCOA 4NROA 4LBQA 4YGDA 1OH3A 1GNZA 2Z42A 5J36A 4CDQA 2ZGSA 5A3UA 1ENRA 2RDNA 2PXJA 1GZCA 3AKPA 1XYNA 4DO0A 2RHPA 3G6JB 2VQUA 5F39A 2VC9A 5IJRA 2VAUA 2XBO3 2WT2A 4G9SB 4OQ9A 2OQ7A 2VCCA 4XEZA 3WD5A 5EPAA 2FDIA 2B46X 3LA2A 4B4RA 4DMIA 5KBFA 4BIFA 2JIGA 3W5MA 1VBE2 1RVF2 4HSJA 1VBD3 1H2KA 4JVAA 3ZFFB 2CWMA 4YVWB 1OKOA 2JDZA 3P6BA 1V6MA 4DNYA 4ZKTB 5LEKA 2YROA 1POV3 4JAAA 4AI2A 5LATA 3IMMA 3LGRA 3SHRA 2XQXA 2D97A 3VLBB 2CDOA 3B93A 1OUXA 1CJPA 2GU9A 1BEV2 3JXSA 5H9SA 1PGW1 2CAUA 2GP5A 2Z79A 4META 4A2UA 3BTYA 1YFWA 1VAVA 3PMSA 4HK8A 1ZRFA 2ADEA 3ZOIA 2DCJA 3NSTA 4OVEA 2GNBA 3QBQA 4WZFA 5F8PA 4AI8A 3AB0A 3AJZA 3ES4A 1V6LA 1RVF1 1STMA 3TWIA 1RUJ2 1LOCA 2B39A 3PVBB 1ULDA 4L9BA 5C9AC 5AC92 2WO3A 1CAWB 2DCKA 3H0OA 3KCYA 4AQ2A 1BEV1 1NZIA 3TOJA 1W05A 1N1SA 2WNUB 2ZOEB 2ZX3A 1VR3A 1OOPB 4UOJA 1D0HA 1ULEA 2OXBA 2X53S 4LHNA 5LBCA 1XXNA 2P6HA 4QAWA 3KT4A 4CPBA 4IGPA 5T55A 4LULA 5FPUA 1ASJ2 1W3VA 1PK6A 1RUJ1 2WR9A 1NUKA 2R073 1K5MC 3T1LA 1PO11 4ES9A 2P2KA 1S4CA 1EAH3 1CPNA 5AC91 4EJRA 2VD7A 3MIHA 5JMOA 2D6PA 5DDJ3 4QXKA 3TBDA 3T08A 3ZDSA 2FDHA 4E4ZA 1CAUB 4P02B 5DG1A 5A1FA 3W59A 4CEWC 4UFMA 4LLOA 3LSEA 4MV2A 1IQAA 1NAEA 3NNJA 1AX0A 4XZPA 1ASJ1 1DGRA 2E31A 4JGZC 1SLLA 1WMXA 2UWAA 1R1A3 5BNOB 2W68A 2VCBA 1HQNA 2DFCA 2KM2A 1GWMA 3DPRB 3PJQA 4MUVA 3ZYRA 3I2FA 3K46A 1PZ8A 3OPTA 2O0OA 3PMEA 4ORFA 2C5DA 2GH8A 2P1BA 4IDZA 4QX1A 4UYBA 1TE1B 4EROA 1ND2B 3ZYFA 1ZBE3 3POYA 1SMVA 3VD9A 1OURA 1SLBA 5FK7A 4M00A 5ABJB 1YQ5A 3RZHA 3IDBB 2RS32 4NVPA 5ANNA 2BWAA 1RMU2 2RDQA 4CXXA 2HWF3 2RS12 4WM8A 1NX9A 4K8RB 4Y22A 3V0AA 2VZUA 4GA9A 4CDXB 3KQRA 4CXWA 4IV3C 3IPVA 4QKNA 1VB4A 3HAGA 5FZ9A 5HCBA 1PNGA 3ZXKA 4CEYC 4CDUB 5I0DA 3LIHA 3K51A 1YXWA 4RS5A 5JZGC 5A7OA 3ZFEA 5G05L 2RS31 3ZSEA 2NPIA 4AW7A 1IGOA 1XB9A 4YW7A 1RMU1 1HJFA 1MEC1 3GBFA 1Z78A 5KXEA 1TME2 2J22A 2WA3A 1Y9MA 4ZY9A 2RS11 4BH9A 4UF0B 1V9U2 4LNVA 5CFDA 4JRAA 5DAWA 4NJ4A 2R1DA 2KD7A 4PF1A 1PZ7A 4B7EA 3LDRA 1Q56A 3Q8AA 3I2HA 4AI0A 4B7KA 3MEPA 5FZOA 1YHFA 5C6CA 3CU7A 1ZBA3 3ST7A 3BCWA 5ACA2 3RZMA 1AR83 4QX8A 1NA1C 4CCEA 2EF6A 2AENA 3WNNA 4CYDA 3NL1A 4BLJA 1TME1 3ZPYA 3N35A 5FZAA 2C1FA 2W1SA 1BQPA 1OLQA 1RHI3 3C3VA 3VD5A 4H14A 2IZWA 1EPWA 1O5LA 2VOKA 1KFXL 1GSLA 2F6BA 3HN1A 1Q5OA 4YG6A 1ZRRA 4QPGB 3ZIWA 5ACA1 4TWTA 3URFA 4OHXA 1UY1A 5JR2A 1MS1A 1I5PA 2AEYA 3ZYPA 3VZOA 1HXS2 3D82A 1ZA7A 3PUSA 3RPQA 4Y5TA 4RL7A 1W2OA 3LKJA 3U14A 3NAPC 2VCAA 2HYXA 3KD4A 1W6QB 5FPBA 2A6ZA 3FJSA 2YV8A 2FZ2A 2A70A 4NIAA 5FZHA 4BOWA 4C0BA 5CIRA 4NRPA 2DV9A 1WCKA 5F3EA 2JB8A 3ILNA 2WA4A 3ZX7A 4GAZA 1ZYBA 2A3YA 2C24A 3G7DA 2ETEA 2VNOA 4LHSA 2WJSA 4JC1A 2ZGOA 5F6LB 1HXS1 2V4AA 1UCXA 2R16A 4LKDA 5FZ6A 2HYKA 4Q27A 3PUAA 4FPKA 5FPZA 1ZREA 4MG2A 1COV3 1U5IA 4A42A 3ZXGA 3ZR5A 4YGBA 3BYWA 4OHZA 1G9BA 4P14A 1OT5A 1UD1A 2IFRA 1XQNA 1DP0A 3NNFA 1W6OB 2RR12 2EXKA 4Z8BA 1LHOA 1OI6A 1RUC2 4FVVA 2B9UA 2DF7A 3OGVA 1MS8A 3T0AA 2VTFA 3U1XA 5B4NA 3O1VA 1MR5A 4CU7A 3EO6A 2E7TA 3LFMA 1WBLA 4C1XA 4RQPB 5EJZB 4CCLA 3T0DA 3DL3A 1GZWB 3PUIA 1KD7A 3LWCA 3MIFA 2Q0AA 4LE3A 3K4ZA 4INDA 1SCSA 3A0KA 2F4PA 2ZX2A 2RR11 4W65A 1RL3A 5J1XA 4MADA 4AQ6A 2YBPA 1NE6A 1RUC1 2QKDA 4BQ2A 1JMUB 1OF4A 4PHZA 3NNLA 4QM8A 5FPAA 1POQA 4AFDA 4XDOA 1W6MA 3AFKA 5D8AB 2GC3A 1J3QA 1H9WA 1OLRA 4AGGA 5GLUA 4H7MA 4WBBA 2ZKNA 1C28A 1AR92 2IFWA 1CQ9A 2EIGA 1LHWA 2B9VA 2PQQA 5LK5A 5K4LA 4LO4B 4QXBA 3LOBA 3T2PA 4FP2A 4DUXA 4AHWA 1VIWB 5L9BA 2PHFA 1VBD2 3BPZA 4YGEA 3WCSA 2E33A 4AR2A 4EE2A 3K77A 4KBZA 4QU1A 4RGKA 1AUYA 1P8JA 3PIJA 2AUYA 4N8MA 3U0ZA 4Z92B 4LO7A 2D6NA 1JOJA 4XQ4A 1F9KA 4IEUA 1I9RA 4LK7A 2PYTA 3NJVA 5FQ0B 1PK6C 4DRVA 4CTEA 2YC4A 5IVFA 2BNOA 1GR3A 2P37A 3ON7A 1AR91 3ETPA 4Y26A 4YNIA 2VZSA 4B4PA 2OVUA 1W06A 1NCQB 4S2GA 1J3RA 5BNPA 1OLMA 1XNCA 4DY5A 2A3WA 5CZKA 4Y1ZA 1VBD1 5HV0A 2VMGA 4RFT0 2FMDA 1RITA 3B69A 4KI5M 5D21A 1KJRA 3KZ4C 3PUHA 2ZEYA 4N7UA 4CRQA 3UKTA 3WR0A 2P3IA 4JHTA 4XXAA 5FY5A 3VBFB 4RHV3 1IS3A 2W46A 2ZMNA 4COZA 5FZBA 1SACA 1NXMA 5FZ4A 1BHGA 4FPEA 2WDBA 1VMFA 5FZGA 4AGRA 4H2AA 3MICA 3B9CA 3ZYJB 1RGSA 2R7EB 1AYM3 3OGRA 5D2AA 3ELNA 5F2SA 4Z1VA 2ZGPA 3CZJA 3N7KA 1O3QA 1X8EA 1GP4A 4XAEA 3FHAA 4H3WA 4ATEA 4CCCA 3AVSA 4FOVA 1K5JA 1A8DA 4IV1C 4XIOA 1MQTA 2DURA 1JYIA 4E4HA 5C3SA 2OYZA 5DDJ2 5EZWA 4OI0A 1FT9A 2RM23 4GXLA 1DLCA 1QXJA 1VBB2 1UW8A 4IL7A 4YRDA 2WZR3 3RG0A 5LZ6A 4WM8C 4Z82A 3TRSB 1UOGA 3I2JA 4FPLA 4RA0A 3AZXA 1BVP1 3JD72 2ZHLA 4FPYA 4Y24A 2PAKA 3S7IA 4LBQD 1ZZ6A 2BU9A 3RZLA 1ULOA 1ND3B 3JB4C 3P3PA 1R1A2 1SG3A 3ES1A 1MPXA 3WY6A 4P9GA 2ID4A 3ACIA 4GH4A 4RS5C 2FQPA 3AMPA 3ZFEC 3OPZA 2NM1A 2BVBA 2ZGLA 3SISA 1IS4A 2BPA2 5DDJ1 3RS6A 1UMIA 1QJU2 1LECA 3LEKA 3RSJA 1VBB1 3ZYBA 5LK7B 1LU1A 1YRZA 3AP5A 3HNMA 5FJHA 5SV8A 2AC1A 2AR6A 3AC0A 3VL8A 3I3DA 3WDTA 5CFDC 1SBFA 3JD71 4QQLA 2DVBA 4CCDA 2G9ZA 4XFBA 4LBLA 4N53B 4P08A 4YVSB 1H1MA 2RVAA 1F4HA 2ENRA 3LFIA 4TZDA 1A78A 2VZQA 3IDCB 4PLMA 4E2SA 1E57A 3KV4A 1W9FA 2KA3A 1TG7A 1AL23
chains in the Genus database with same CATH topology
1UZYA 1GICA 1QNYA 1IS5A 4MZUA 5EWSA 2BW8A 1QJU1 5CNAA 3RQ0A 2JE7A 5FMOS 2JD4A 2HWD2 2N7GA 5GZFA 4I0BA 3OTFA 2GMPA 2CYFA 2PFWA 4DS0A 1O5UA 3CEWA 4GULA 1ENXA 2EVXA 3VZLA 2NP0A 1H2LA 2PHUA 5CB7A 1RUF2 2DYCA 4DY3A 4GWNA 4YZ5A 1LOFA 4K7JA 4S2FA 3LSDA 4W6WA 3V64A 2IC1A 4XQWA 2GSYA 1RB8G 1S0BA 1WLTA 3HT1A 2BWCA 1RUH2 3LA7A 4YM2A 2HWD1 2QQPA 3GZAA 1ZBA2 4NN0A 3VBRA 1F8VA 1CAVB 4MXVA 1AR82 1YLLA 4Y1UA 4QD2A 5FMOL 1S0CA 5FAXA 4YM1A 4Y20A 3VBHA 1BMV2 2UWBA 1RUF1 4AF9A 3AYCA 4R9BA 4Q26A 4AGVA 1GYKA 4N7IA 1RHI2 4HPKB 4JRLA 1LJ7A 1YO8A 4XMAA 3AXEA 1RUH1 1NXD1 1DGRN 4A7YA 1ZBA1 2BGCA 1XU2A 5FPXA 2ILMA 1FV2A 1AR81 2ZTNA 3I59A 3RMYA 4AHYA 4XFIA 1RVF3 1BMV1 3VDDA 1V70A 5H9PA 3PLQA 5T52A 1RHI1 2ZACA 3SCHA 2H6BA 1CPMA 3D6EA 4GKXA 3GALA 3E5QA 4HKLA 3GNEA 2XJQA 2ET7A 3IMNA 1HDKA 4YZ2A 2VQAA 1AXZA 3M4FA 1QOOA 2JG8A 4R4XA 4XJ9A 4GWMA 2CGNA 1PO13 5DXDA 3FX3A 1I1EA 1PZ9A 2JICA 3VN4A 3WG3A 1F31A 1FI2A 1QOSA 2BFUS 4I30A 4QHBA 3KCXA 5HBAA 3V0BB 2LTNA 1Y9QA 2UU8A 3OBRA 5BNNB 4LBJA 2CTVA 3ZVXA 1CAXB 4KH9A 2YGLA 2PHLA 2HEWF 5JSPA 4HKOA 1CESA 1QJX2 3VBSB 3SITA 2VVFA 2ZGRA 2OZJA 1XRUA 3AMMA 4XILA 1Z7S1 4AVBA 4JGYB 4M3CA 4RR3A 1AR62 4CDQC 1WMFA 4KG0A 5TSWA 4P9JA 5BNPC 4N43B 3CL1A 5FREA 5K0UB 4YYOA 3APBA 1QJX1 4YM3A 1SFYA 4CDWB 2EAAA 3E6BA 4UXAA 1YUDA 4HT1T 5CFCC 1DZQA 1D2QA 1ZM1A 3LA3A 3M3EA 2ZZJA 2O1QA 1DGWX 1AR61 1FXZA 2XJVA 4A7ZA 1X36A 1RMU3 2JXAA 3FMGA 1MEC3 3B7MA 1RTVA 4UBGA 1BK1A 4XFFA 4YW3A 3JU9A 4ONUA 3ZN6B 1XE8A 3AP4A 4IQPA 2VNGA 4OULA 2BVVA 3SCFA 2ZKLA 3VKFC 5A32B 5GLVA 1C8NA 3UL2A 1MQTC 5J09A 2EXJA 2VVDA 1WMEA 1LGBA 3HBZA 3I2DA 2ZJCA 1TME3 4XPVA 3T2TA 4EN8B 1VP6A 4QMAA 3MYXA 4YW2A 3U4XA 3JZVA 5KHGA 4BCUA 1NCRB 1LODA 1WMDA 3AP9A 3GHNA 3OCPA 5CA6A 1S0DA 4XBNA 4O9GA 5ACA3 2NQYA 4I01A 2RMU3 1AYN2 2X5IB 1GBGA 3A0NA 1DIWA 3IWZA 4CEYA 1YI7A 1A3KA 5DG2A 1PVC2 1X33A 5T3NA 4LBMA 4IEXA 3R4SA 3ZFFA 3WHUA 4BZ4A 2Q5TA 1AYN1 3J9SA 4WVWA 1HKDA 3D0JA 3TAYA 2KXLA 1HLCA 2XJUA 2ARBA 4JCKA 3BB6A 5F5QA 5C4WA 2DCZA 1OA4A 4XIKA 1PVC1 1AX2A 4Q8KA 1LOFC 4E2QA 2BYVE 3ILRA 4Q1PA 2WNVB 5JSRA 4OUSA 1OKQA 1YJLA 2VNRA 1O3TA 4OFGA 2HEVF 2ERFA 3FLRA 1R1ZA 4FQ4A 2NN8A 1YJKA 5JLVA 4LEJA 5C9AB 3GBGA 3U10A 3VBRC 1G9AA 2R061 1AL22 4XOGA 4EWEA 1PGSA 4PDWB 2CL2A 3VBHC 4K3UA 3RYRA 1J59A 1OOPA 3FLTA 2DVFA 4RGAA 1CD3G 3E6CC 5HXVA 5I93A 2VW2A 3B94A 4FPFA 2RR13 5T5PA 3CLPA 3NAPA 1K5MB 4C0HA 4XF4A 1RUC3 1QY4A 2RJLA 1S1AA 4EN9B 1AL21 2DVDA 4KWJA 1KDKA 1CAUA 1KITA 1LOBA 2ZCWA 2XLGA 3VDDC 4CEWB 2OA2A 4FBFA 4QQPA 2DCTA 3M2MA 2ZAHA 2HEYF 2GH2A 3DN7A 3WDVA 3M3OA 5BNOA 2SBAA 1WW5A 3RNSA 3ZN5A 1YFUA 1IPJA 3QOPA 2NLRA 5K7PA 3NVCA 4BA6A 2XKPA 3L9JT 1RUG3 2JG8C 1PGW2 4XQDA 1KJLA 1AR93 4WM7B 5AFBA 4DOUA 1OMIA 2D6MA 4Q4W2 4AFBA 1LESA 3ZXJA 4MXWB 3S7EA 4FTSA 4Z07A 1DU3D 2LALA 2D3PA 1BCXA 2XH6A 5JPNB 2GALA 2EALA 2ZGNA 2R0FA 4CDXA 2EAKA 5JOWA 2IXCA 4X6QB 3GYDA 4LO8A 4FPHA 1YWKA 1KRIA 2FHRA 1OPMA 4YARA 5KHKA 3BALA 2XPJA 2XJPA 1WBFA 4X6RB 2JENA 1MS5A 4CDUA 3ILFA 1FOD2 1RUOA 1DZRA 4D69A 1IHMA 4Q4W1 3NKTA 3N36A 4OHVA 4ATFA 3WDXA 4AHZA 1VRH2 1C1FA 1VJ2A 2ZAAA 1REEA 1PO12 2Q30A 4P9IA 4UW4A 3WOGA 4AFAA 4XJWA 1X50A 4RR3C 1H8TB 1Y7BA 4PQ9A 2LM3A 5FRAA 3S6PA 5L7OC 1FOD1 4NO4A 1S0IA 1QQP2 1D2SA 5BPXA 4Q8LA 2PA7A 1VRH1 2ZMKA 1H1AA 4B8EA 5F1RA 4P5HA 4D7YA 2W52A 3Q9OA 2CV6A 1QWRA 1DDLA 1UX6A 3M3CA 2DTWA 1EV11 2PTMA 1JH5A 1AXYA 1VBB3 4IEYA 4QPGA 2XWJB 1QQP1 2VOXA 3JD73 4HBNA 3E6DA 1W6NB 4CZSA 4AVCA 4Y4YA 4Q0SA 1XYOA 1O7FA 1YYNA 2XVLA 4R9AA 1B35B 1JBCA 2WSVA 1GQGA 1UU4A 1W6QA 3O0VA 4HLTA 5GJ6A 3T1MA 4AFMA 4G4FA 1FAYA 1QJU3 4LO6B 3TYJA 5HCAA 4X8PA 5FOBB 5IK5A 2ZHNA 2D3SA 2YZ4A 3RI8A 4MH0E 4XBQA 3WUCA 1QHDA 1ONAA 3AJYA 4IV1A 4JDNA 2E53A 4IEOA 1CX4A 1WW4A 1MEC2 2Z5WA 1C3HA 4F83A 2ZA9A 4C1WA 4UW3A 1JUHA 1DYPA 4I09A 4KWLA 1I5ZA 5KXDA 4D7SA 5K9YA 3V56A 1SLAA 4XFGA 3AYDA 1DYKA 2HWD3 1SCRA 4YSFA 2ATFA 4NR1A 4J1WA 3BOWA 5DUXA 3ZN4A 4OLLA 3USUB 5J48A 1RUF3 1T6GC 1ZNPA 1X82A 2UWCA 1DF0A 2VUAA 3ZFFC 1H1IA 3HIFA 4YVWC 1SLTA 3NV2A 3IIAA 2XJSA 1GZWA 4MGKE 3VHOA 2WIIB 1A6CA 1RUH3 4Y1VA 4YG0A 1GV9A 1JHNA 4XDQA 5KWRA 4SBVA 5CG8A 1LEMA 2VMIA 2HWC2 5C4WC 4YW4A 2RMU2 5CVRA 1R081 2YYOA 5JSOA 5D8AA 2Q4SA 4ITCA 3OD4A 1PO22 4UW6A 5BY5A 4AI3A 1S2BA 4KG8A 1V6IA 3N4MA 2AZ5A 1Y3TA 5DZFA 4GB32 5KHIA 3N7LA 3VZNA 1REFA 1UIKA 4XFHA 1QDCA 3AZZA 1ZZ8A 1DBNA 2UY8A 2HWC1 2ZZQA 1LOEA 1OOPC 5J7MA 2RMU1 1DGWA 3JQWA 2DU0A 1W0PA 1N1TA 4IESA 2WZPP 1PO21 1RUD2 1QKQA 3JCIA 2WWSA 3DV8A 5T50A 4YG3A 4GB31 3W9AA 5IK4A 1HV1A 3VBUB 2XVKA 2DU1A 3ZYGA 2XUMA 3B3QE 4N9IA 4YZ1A 3NV3A 1FNZA 3B00A 4R9CA 4NWWA 4A3XA 2I2SA 3FBMA 2DTYA 2ES3A 3R0RA 1UZZA 2NMNA 3VBOB 1RUD1 2BNMA 4HN0A 2E9QA 3E5UA 3J4UH 5BNOC 3DPRC 4AE2A 4YFZA 2R49A 2Y0OA 4XW3A 1C5IA 1UIJA 3AMHA 1FV3A 2GC2A 1Z7S3 4XJAA 1D4VB 2HWE3 1XU1A 4PIZA 1ZRDA 5F9TA 3H3UA 1SQ4A 1QJX3 1PGL2 1LGCA 4E4SA 1R092 4WM8B 3HR9A 4CDXC 4A7KA 1HV0A 5EYYA 1ND3A 3WP6A 3IPVB 4DQAA 3VUOA 1AR63 4XE9A 4CDUC 1H4GA 1Q8VA 4HVRA 2GN7A 3ZFGB 3ZFEB 4F3JA 3UJQA 4UBHA 4QGMA 2PHDA 1RUG2 3SNMA 1PGL1 5J98B 2D6OX 4X8NA 1LULA 1R091 4G3YC 1MZ5A 2K0GA 1CIWA 5DUVA 4YVSA 4QQ2A 5I8YA 2D6LX 3H7YA 5JVVA 4PLOA 2XHKA 3KGZA 3VGIA 5L73A 4Q4V1 2Q1ZB 4KNCA 3AYEA 1DZTA 1KQRA 2H0BA 1RUG1 1W6PB 1W0OA 4LBOA 4QGLA 1HRI1 2XJRA 5AVPA 2EXIA 5JOYA 1RUE2 2LUWA 4O9EA 4QPGC 2JKBA 5CFCA 4WVMA 2D98A 4QGNA 3S30A 3MF6A 3VZJA 2BBVA 2DCYA 2VOVA 4AG4A 1CONA 4FP3A 3SCGA 3DUIA 1CJDA 1XNKA 4S2HA 2Z2SB 1S0GA 4E27A 1NYWA 3OBTA 5KXBA 2RJKA 2VGDA 1RUE1 1AYN3 2ZGTA 2H0VA 2BTVC 1AXKA 1N1YA 4HPKA 2QFEA 3MIGA 2XL7A 1V6KA 2ZX0A 3LOIA 4DZGA 1OFSA 2MPFA 1JW6A 1UAIA 2OUHA 2ZX4A 4WZCA 3R6SA 3R05A 4LR4A 3A4UA 4FXKB 1PVC3 1F2NA 2WQ4A 1DLLA 3I54A 5FLHA 5D1IA 1RIRA 1ZZCA 3FFQA 4HMZA 4NHKA 5L19A 3N3HA 2W0XA 4JDMA 4EN6B 4P9YA 2OIIA 4IXLA 1RJ7A 2R063 3P3NA 2YDEA 1LOGA 3WQ1A 1G9FA 2GC1A 4OHYA 1JN2P 4DINB 3RRDA 5JDBA 3WZ1A 3BU7A 3NW4A 3VHNA 3K48A 1WGPA 2A6XA 4J1XA 1VBA2 4L92A 1C8M2 3OY8A 2GMEA 4AVVA 1X7NA 5J96B 1OFNA 4AEDB 3H1MA 4Q29A 1MVQA 5D8AC 1OQDA 1W6MB 1LKNA 1CAXA 3KS7A 3AK0A 2I74A 5EV7A 2FZ1A 4TSVA 2A5ZA 1TEIA 5C8CB 4AQTA 1VBA1 4MX3A 5GKAC 2P3JA 4BHPA 1IKPA 1C8M1 2FBEA 2PLV1 4OHWA 1MVEA 1M06G 5KXCA 2E63A 4NHLA 1ULGA 3ROUA 3NV1A 4COVA 3C2UA 4DRRA 4GIQA 1HRV2 4JGYA 1JUIA 1Q8QA 4XF3A 1AVBA 1H2MA 4JTNA 3ZSKA 4Q0UA 4N43A 2RS52 3WCRA 1PMIA 5C8WA 4LO5B 4MLOA 5C33A 4CDWA 3OF1A 5I8TA 5IK8A 1WUVA 4TYSA 5JIAA 1HRV1 4FPOB 1C57A 3FFZA 4Q4W3 1Y43B 3M1HA 4MGIE 4RSUA 2I07B 1TQ5A 2RS51 4N90A 4HK9A 1NLSA 5E16A 4ISRA 3AKQA 1MZ6A 1UF2C 3SLIA 3PVNA 5FO7B 5A32A 1AJKA 1HIXA 1SFNA 1TNFA 2QZ3A 3ACLA 1LRHA 4XYXA 3FUQA 5T54A 1FOD3 1LHUA 1LCLA 1MQTB 4ZU7A 3VL9A 1H4HA 2XLFA 2XKOA 2RE9A 1N3QA 1VRH3 2R1BA 3MW4A 3MDPA 4MSVA 3NWKA 1ND3C 1MACA 4QPIB 3VV1A 1NCRA 1RUI2 1EV13 3DGTA 3LCPA 4OI2A 1N3OA 1G9CA 2R32A 4GH4B 3ZSJA 2VMHA 1FMD3 1QQP3 5LRSA 1SLIA 2GNMA 4K6BA 1FPN3 1ENSA 1Z7S2 2X5IA 2OW4A 3WXPA 2HWE2 1YNAA 3UK9A 3IM0A 4N53C 3CJIB 4YVSC 2UYAA 4B3NA 2DUPA 5AFEA 1HQLA 4LLFA 2PAMA 3D8CA 2GN3A 1RUI1 1VAKA 3WINE 4YZ3A 4LA2A 4F8AA 4OZXA 3WW1A 1NG0A 4HVOA 4HETA 1V6JA 5KC6A 2WFF3 3EHKA 2HWE1 3ZO0B 2BFUL 5E88A 5L7OA 4P9WA 3SXWA 4WV8A 2G4IA 5BV6A 4NOTA 3E97A 1GFF2 1D4M1 2B5HA 2ZBJA 3V65A 5A33A 1I6XA 3ALQA 3TNQA 2EA7A 5GM0A 1N3PA 1ZZBA 4R52A 1FX5A 2YC0A 1IOAA 4FT8A 4C91A 1G6NA 2IXLA 5JMCA 1O4TA 1LU2A 3JUUA 4UW5A 5IT6A 4PDWA 4J6GA 5GZEA 4BMEA 4Y20B 4BPZA 4XJZA 2WL1A 3PTYA 3NV4A 4Q4X3 4DPNA 3AZYA 2K9ZA 2CY6A 1DG6A 3H50A 4URTA 4XF0A 4IEWA 4KBBA 5FO9B 1R083 1XE7A 2H6CA 3I59B 4XF1A 1EYBA 3AZWA 4HZFA 2PHTA 1PVXA 2JG9B 5BYNA 1WCSA 1NLRA 4Y1YA 1OA2A 4IETA 4M3CE 1U5ZA 2HWC3 4LUKA 1ZZ7A 1EPZA 1VBC3 2DUOA 2WKKA 3AMQA 3FUOA 4Q0QA 4MYEA 3MGUA 1PO23 3ZSLA 2P17A 4WM7A 2TEPA 4GB33 5CBLA 1J3PA 2JJ6A 5LRRA 4E2GA 2WS92 3ZSMA 1I3HA 3OGJA 4YVWA 1KS5A 2VUJA 1N47A 2BEOA 5DUUA 3MLKA 2ARXA 4XTMA 3WV6A 4ES8A 1EY2A 2R062 1RUD3 4KQ7A 4FPGA 2WINB 4COYA 4XJUA 2D44A 2XGXA 2VG9A 2WS91 3VBSC 4FCAA 3RZZA 1L3JA 1IKQA 2R041 2XB6C 4FOQA 4KU7A 1CAWA 4CP1A 2EXHA 4JGYC 1ENQA 1H8TA 3LZZA 1H0BA 4SLIA 2WNUA 1IPKA 4YLZA 4GMP1 2X29A 1PM7A 2PHWA 4N43C 3WUDA 5K0UC 4COUA 3MIDA 4GMP0 1LEDA 3WT3A 4CDWC 1AJOA 3FWEA 5EYXA 1UMZA 3H9AA 3VZMA 1O4YA 1NQDA 3NKGA 2AREA 1WW6A 2D93A 1S0EA 4PJYA 4Q4Y2 3KSCA 4XHXA 1V6NA 3KM5A 4M01A 2E7AA 1R093 5I8SA 5FFOC 1GNHA 3L2YA 1FNYA 1QJY2 3M7AA 2SLIA 3AX4A 4MGYE 3H1YA 4JGZB 1B35A 2TBVA 3ECQA 2FMYA 3DPRA 3GHMA 4HN1A 1OQEA 3HQXA 4Q4Y1 4Q4V3 1DQ6A 3IDEA 2PN5A 3WP4A 1TNRA 3QCWA 1UKGA 1O3SA 2OZ6A 1PIV3 2D5FA 1WD4A 1ND2A 3R4DB 5JOXA 3POWA 3IBMA 3AMNA 5FO8B 1QJY1 4K40A 5ABJA 2MEV3 1HRI3 4KGGA 1NCRC 4W6XA 3D4KA 3CO2A 2WNEA 5T5LA 2NZ9A 2R6QA 4IEZA 4IV3B 3KT7A 2X5IC 4WVVA 5GZDA 2HWB3 1ZX5A 3NO8A 1S0FA 4CEYB 3MIEA 1Q8OA 4QQHA 1NZCA 4AEMA 5JZGB 5T5OA 3M8LA 1OD5A 4R8HA 3USUA 2QDRA 2YY1A 3WDYA 1ULCA 3D5OA 2VPVA 5GALA 3JBG2 1RUE3 1X8MA 3VZKA 4Q2FA 4I2OA 3HT2A 3WW4A 1N1VA 1EV12 1AR72 1BVVA 2CWSA 1G7YA 1OA3A 3SH4A 1FMD2 3INAA 4LE4A 1SBDA 5C4WB 1NA1B 1FPN2 3JBG1 3MI8A 2WNVC 3M3QA 2XVGA 4EWDA 1VBE1 5GLTA 1GZ9A 3LAGA 1J1TA 4WVZA 1KS4A 3QACA 4ASLA 1AR71 5BXXA 2YUEA 2PAEA 1FMD1 2D7FA 4PDWC 3O0XA 3FBYA 1Q8SA 2WSUA 2QJVA 1GKBA 1FPN1 1WW7A 4LBNA 1LR5A 1WCDJ 2WFF2 4YZ4A 5A3LA 4K1ZA 3WX5A 4M0HA 4OI1A 2C9AA 1QMJA 4AQSA 1U5XA 1OQ1A 4L97A 4CP0A 3NAPB 1DFQA 1KFUL 1WLDA 2D43A 4AVTA 2AH2A 3VBUA 3EBRA 1A8MA 3BIWE 1SEFA 4NHMA 1BZWA 1U12A 3OYWB 3JB8A 3UKVA 1JYCA 2VW1A 2WFF1 3GF6A 4P9XA 2E6VA 2A6YA 2JEMA 3VBOA 1VBA3 2VULA 1QXPA 1H2NA 4LBQB 1C8M3 2PLV3 1UKRA 4Q4X2 2V09A 4HFSA 4PBPA 1W6OA 3MLJA 2YXSA 1CGPA 4WM7C 2QUOA 1R082 2UYBA 1MZEA 1SBEA 4OI4A 4XETA 2WLQA 2WT1A 2C0ZA 4RQPA 2R30A 4M3CF 1TMF2 3RJRA 3PVOA 2ZX1A 4IEVA 3AKSA 3MW3A 4Q4X1 4JQRA 3O14A 1HRV3 1UL9A 1QF3A 2ZABA 2A6WA 1O4ZA 1AF9A 2VH9A 2ZGMA 3ZFGA 2RS53 2ZHKA 1VBC2 3L2HA 2G9GA 4FAGA 3WP5A 1TMF1 4BWOA 4ISQA 3VKOA 4C90A 4FXGB 1UPIA 3FC0A 4AWDA 1H8TC 3ZXFA 3OGGA 3LB9A 2WNUC 3ATGA 3WG4A 3BTAA 1DHKB 2WT0A 4AFCA 3THTA 1UU6A 1BBT2 3OJBA 1VBC1 3E5XA 1W6PA 4L11A 4AVAA 2UURA 5FQ0A 4E4DX 1PK6B 4AVSA 4HVQA 1QJZA 1V9U1 1NCQA 1XNBA 3USSA 4LBKA 2CGPA 4AYUA 3KT1A 3TN93 1RC6A 2VXRA 3WQ0A 1BBT1 1MS4A 3ZMNA 3WNXA 2YMZA 4YGCA 1B09A 5EJ3A 4CP2A 4K21A 1AX1A 3HMYA 3O5SA 3VBFA 3WG1A 2GC0A 5KHHA 5FLJA 1MS0A 1F5JA 1B35C 1RUI3 1S0JA 3B5LB 3J8F2 1V00A 3ASIA 3FHIB 1J58A 3WDUA 1QU0A 3I4IA 2ZGUA 5CG9A 5L36A 1ND2C 5JOZA 5ABJC 4RD7A 4IV1B 3VHPA 4QM9A 4HKWA 3QLQA 4DFSA 5FDBA 1D4M3 1DQ2A 4PIYA 1FATA 4EN7B 4EV0A 3RI9A 3J8F1 4L2NA 4Y22B 5GZCA 3V0AB 4B29