4Q4V2

Crystal structure of coxsackievirus a24v
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
264
structure length
264
Chain Sequence
GYSDRVRQITLGNSTITTQEAANAVVAYGEWPSYLDDKEANPIDAPTEPDVSSNRFYTLDSVQWKSTSRGWWWKLPDALKDMGMFGQNMYYHYLGRSGYTVHVQCNASKFHQGALGVFAIPEYVMACNTEAKTSYVSYVNANPGEKGGVFDNAYNPSAEASEGRKFAALDYLLGCGVLAGNAFVYPHQIINLRTNNSATLVLPYVNSLAIDCMAKHNNWGLVILPLCKLDYAPNSSTEIPITVTIAPMFTEFNGLRNITVPATQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coxsackievirus capsid protein VP1
publication title A sialic Acid binding site in a human picornavirus.
pubmed doi rcsb
molecule tags Virus
total genus 61
structure length 264
sequence length 264
ec nomenclature
pdb deposition date 2014-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4q4v200
1DDLA 1HRI3 3CJIB 3JBG1 4N53C 1H8TA 1NCRB 4JGZA 4WM7A 2HWD2 1HXS2 4WM8B 1ND3A 2IZWA 2PLV1 3ZFFA 4JGYA 5BNNA 1PO23 3VBOB 4IV1B 4CDUB 4CDQC 2GH8A 4LLFA 1CD3G 5CFCB 1TME3 4RR3A 3VBFB 1FMD2 1AR61 1D4M3 3VDDB 4RHV3 5BNOB 1TMF3 4FTSA 1PO12 3ZFGB 4CEWA 5JZGA 2RR13 2RMU1 1RUF3 1PIV2 4RQPA 1MQTA 4CDXB 1V9U1 5ABJB 3VBUB 2TBVA 1COV2 3NAPA 1R092 1F2NA 1EAH2 1RUI2 1R082 1NCRA 1K5MB 1C8NA 1H8TC 5J98B 1RUG1 1AYM1 4WM7C 3J8F2 2RS32 1C8M3 1HXS1 1VB2A 1AR71 3VBOA 4CDUA 3ZFFC 4CEYB 4JGYC 3JB8A 3LOBA 5BNNC 1HRI2 1AR83 5CFCA 5DDJ2 5C8CB 3VBFA 1QJX3 1PGW1 4EJRA 4RR3C 3ZFGA 2WS93 1AL21 1AYN3 4CEWC 3VBSB 5JZGC 1PO22 1SMVA 5ABJA 3JBG2 4Q4V1 4RQPC 1MQTC 1RVF3 3VBUA 1MEC3 5L7OB 1TME2 2XBO3 1VBE1 1D4M2 4RHV2 3NAPC 1COV1 1TMF2 1BBT3 2PLV2 3ZXAC 1EAH1 1QJU1 3FBMA 1QJY1 2RR12 2RS51 2WWSA 1RUF2 4N43A 4Y5Z0 4NWWA 1K5MA 1AR93 1ND2A 2HWB3 1NCRC 1RUI1 1AR62 1VBA1 1VBD3 5ACA1 1RMU3 1BEV3 1RUC3 1ZBA3 4CEYA 2RMU2 2RS31 1VBB3 1ASJ3 3VBOC 4CDUC 4YVWB 2FZ1A 1RUE3 1OOPA 5C8CA 5CFCC 1HRI1 4BCUA 5C9AB 3VBFC 1POV0 2WFF3 1A6CA 3ZFGC 1C8M2 1QJZA 2QQPA 3VBSA 5A32B 4CDWA 5FMOL 1R1A3 4Q4Y3 5ABJC 1AR82 1PO21 3VBUC 1RUG2 1AYM2 1QJX2 1NY72 1TME1 4GH4B 1D4M1 2WS92 1AR72 1AYN2 4RHV1 1TMF1 4N43C 2MEV3 2RR11 1RVF2 1K5MC 1RUF1 1MEC2 1M06G 1GFF2 1ND2C 4NWVA 1PGW2 2XBO2 1VBC3 1AL22 4QPGA 1BBT2 4Q4W3 2ZZQA 4CEYC 4Q4V2 1X33A 4AEDB 1AR92 1OOPC 2BBVA 2ZAHA 5C9AA 4Y4YA 5C8CC 2X5IB 1VBE2 1HRV3 1VBD2 1RMU2 1NCQB 1BEV2 4Q4X3 1RUC2 5A32A 1QJU2 1QJY2 1NG0A 2RS52 3ZFEA 5K0UB 1C8M1 3VBSC 4CDWC 1RUE2 3CJIA 1AUYA 1RUJ3 4RS5B 4PDWB 1AR81 1VBA2 5ACA2 1FOD3 4JGZC 3VBHB 4WM8A 1QJX1 2R073 1NY71 4GB33 1PVC3 2WS91 1ND3C 4IV1A 1AYN1 1OHFA 5FOJB 1RVF1 1MEC1 1NA1B 3VDDA 2XBO1 5BNOA 4CDQB 1RUH3 4QPGC 1EV13 5AC93 1BBT1 4AEDA 2HWF3 3JB4C 4CDXA 2R063 1VB4A 2WZR3 2X5IA 2FZ2A 1AR91 1B35B 5C9AC 2HWB1 1F8VA 1RB8G 1ZBE3 1HX6A 1Z7S3 1VBD1 1RUD3 1RMU1 4GMP3 4QPIB 3S6PA 4FTBA 1BEV1 3ZFEC 1RUC1 1ZBA1 2HWD3 1VBB1 1ASJ1 3CJIC 4RS5A 4PDWA 1RUE1 1POV3 2RS13 1PGL2 3VBHA 1AL0G 2HWE3 5FMOS 1VAKA 1HQNA 4WM8C 5CFDB 2ZTNA 2WFF1 1RHI3 1FMD3 1FPN3 4IV1C 1VRH3 2Y26A 1R1A1 4Q4Y1 1PO13 1RUJ2 1NA1A 1PIV3 1QQP3 3DPRB 3VDDC 4JGYB 5BNOC 4GB32 5LK7B 4AEDC 5C4WB 1R093 4CDXC 1E57A 1B35A 2BUKA 5L7OA 2RM23 2MEV1 2X5IC 4YVSB 4QPIA 5D8AB 1R083 1MQTB 1RUH2 1VBC1 5AC92 2HWF2 2R062 2WZR2 4Q4W1 3J8F3 3NAPB 4RS5C 4PDWC 5BNPB 2HWC3 3VBHC 5CFDA 1PGL1 3TN93 1ZBE2 1Z7S2 1HRV1 1RUD2 5DDJ3 3JD73 4Q4X1 4YVWA 2R043 3IDEA 2RS12 3HAGA 2HWB2 1NA1C 5GKAC 3VBRB 3DPRA 1RUJ1 2HWE2 3JBG3 1FOD1 2R071 1ZBA2 5C4WA 4GB31 4Z92B 1RHI2 1ASJ2 1VBB2 1FPN2 1PVC1 1BMV1 1VRH2 4IV3B 4YVSA 1B35C 2PLV3 5L7OC 1OPOA 1QQP2 5D8AA 4GH4A 5J96B 2WFF2 4QPIC 2BPA2 4N53B 5A33B 1AR63 1RUH1 1EV11 5AC91 2DF7A 1R1A2 4Q4Y2 5BNPA 2HWF1 2R061 2WZR1 2RM22 2RMU3 1V9U3 4N43B 5CFDC 4FSJA 1IHMA 1ND2B 1ZBE1 1Z7S1 3M8LA 1RUD1 4GMP1 4YVWC 2MEV2 3VBRA 2HWD1 2HWC2 1POV1 2RS11 3DPRC 2WLPA 1NCQA 3TN92 4SBVA 1X36A 2HWE1 1VBC2 1OOPB 5K0UA 3JD72 1RUG3 1AYM3 4Q4W2 1WCDJ 5C4WC 4IV3A 2R042 1RHI1 2GSYA 1HXS3 1FMD1 1FPN1 1AR73 1VRH1 4YVSC 2VQ0A 1PO11 1W39A 4CDWB 5D8AC 4GH4C 1HRV2 1PIV1 1QQP1 2BFUS 4N53A 5A33A 4Q4X2 4FTEA 1H8TB 4JGZB 1AL23 5BNPC 1R091 4WM7B 2RM21 4Q4V3 1ND3B 1FOD2 3ZFFB 4CDQA 2R072 5BNNB 1R081 1VBE3 1PVC2 1BMV2 1COV3 2BFUL 4RR3B 1CJDA 4RFT0 1EAH3 1QJU3 3VBRC 1QJY3 2RS53 3J8F1 4QPGB 4CEWB 1V9U2 2HWC1 4GMP0 5JZGB 1NCQC 1RUI3 4RQPB 3TN91 5K0UC 1NOVA 1EV12 1VBA3 5DDJ1 5ACA3 3JD71 4IV3C 2XPJA 2R041 2RS33 3ZFEB
chains in the Genus database with same CATH superfamily
1HJFA 5FUIA 3TNQA 3CJIB 2AH2A 2UY8A 2PTMA 4LHNA 5FFOC 1OD5A 2E31A 4Y1YA 2D7FA 3APBA 3EQEA 2XG3A 2W1UA 2NYYA 2SBAA 2WQZC 4R9AA 5FLIA 4W6YA 5FY5A 5LB6A 1CZSA 1JUHA 4BMBA 4BXFA 4CDUB 4CCNA 5JUVA 2K9ZA 3H3UA 2GH8A 2GALA 4YGBA 2YB7A 5CVRA 5E88A 3ZYPA 2P3JA 4AVCA 5SV5A 4CUGA 1HKDA 1CQ9A 4LKEA 1OQDA 1DFQA 2JDUA 2J1SA 4QQOA 4LEJA 2VW1A 2Y6LA 1VJ2A 4OI2A 5CKMA 3BYWA 3GJBA 4LQRA 2VC9A 3FC0A 1RUF3 1PIV2 3CLPA 4A42A 1OA3A 5JXJA 3LD8A 1WWYA 3WD5A 5HV4A 3B02A 4EZHA 2GNBA 1LHVA 3WF3A 1ONAA 5FY9A 3WNNA 5J37A 3CEWA 5BUVA 3CHXA 1COV2 2Y6HA 4TN7A 1R092 4JAAA 1QF3A 3CDZB 1BJQA 2BV4A 2WNVB 2DVGA 3LF7A 1ZZCA 3FUOA 4P08A 2JDNA 1J3PA 3N7MA 4CPBD 4AHXA 3VZOA 2VTXJ 1WA4A 3HR9A 1DLCA 2OKXA 3WNMA 4EROA 5F5CA 5EXOA 3IIAA 4YW5A 2E6VA 4NRMA 1UU5A 4OUSA 3RZMA 3BOWA 1GYKA 2FQPA 4WM7C 4AGGA 4LBOA 3BPSA 3POWA 4AGRA 5EQUA 2XJPA 1UXXX 5FYMA 2AUYA 1AR71 2V4VA 2VW0A 5FXWA 2IC1A 3V64A 4NIHA 4YW2A 3WNKA 4DXSA 1LOFA 5FCCA 3LOBA 1PK6B 2WNEA 5CFCA 2F4LA 4XFFA 3ZYHA 3DYPA 1O4TA 5D2AA 4EYUA 1K3IA 2ETEA 3VBFA 5C8CB 1OBNA 1QJX3 2G19A 5K9YA 4I0BA 4MOAA 3G7DA 2A6XA 3WQ7A 5LY1A 3ZFGA 2YC2A 3SKVA 4INDA 2Q8OA 3KVBA 4A41A 2GC0A 3LSEA 3U37A 4BJ0A 3PDQA 5JXIA 1O4YA 2Z42A 1BXHA 2A6VA 4XUOA 2CHHA 3VBSB 4PHZA 4IEVA 1LENA 4Q4V1 1SFPA 2YPDA 1RVF3 3EHKA 1JU4A 1MEC3 3K51A 4IQPA 1QDOA 3MV11 4UW4A 4WVVA 4DUVA 3ACIA 1O3SA 3TEYA 4GJZA 2YROA 3RQ0A 2XBO3 1GZ9A 3EXUA 4MHUA 1VBE1 3WG3A 4IEUA 4AHYA 3ACFA 3ZYRA 5FLHA 3T0BA 1COV1 2B7YA 4OCTA 2PLV2 4QKNA 4FOYA 4Q26A 1WMXA 2DYCA 2B46X 1QJU1 3FBMA 4ZY9A 2RS51 4E8DA 1RUF2 2KR2A 4XQWA 2EF6A 2A7AA 4NWWA 2JG8B 4XIOA 1LAJA 4CP2A 2HWB3 1NCRC 4XAAA 4O65A 1W2AX 3OGRA 1XU1A 3FFZA 2YHJA 1RMU3 1J1LA 1BEV3 4KWJA 3J9SA 5FZ3A 3VHRA 5C70A 2VCMA 4N7IA 2QVSB 1RINA 5J48A 4O7XA 1ASJ3 5H9QA 2BTVC 3VBOC 4YVWB 2WNUB 2NN8A 3UETA 4DY5A 4E4ZA 2A6YA 4C90A 5A7SA 2LALA 1L3JA 3FUQA 1NXD1 3J7HA 4L11A 1JZ4A 4FFGA 3AMQA 4Q5OA 5DMYA 5FBZA 4BMEA 3UV9A 3K46A 4CXXA 2Y6KA 4GWNA 4IL7A 2HKXA 2E7QA 4FFIA 3VD7A 3SEEA 3WCRA 4COYA 1QJZA 3P1IA 2Z2SB 2QQPA 3WR0A 3HQXA 5A32B 4CDWA 4EZ4A 5LK5A 1R1A3 4OI1A 4Q4Y3 1EPZA 5ABJC 1DYKA 4Y20A 1CAUA 1W04A 4G4FA 3WF2A 3R4SA 1RUG2 1M4WA 1AYM2 1QJX2 1NY72 3S30A 4QM8A 5D21A 2VG9A 5I93A 1ZVFA 2IXIA 2Y64A 1O6UA 4LOSA 2FCTA 5EZWA 2V4AA 1V70A 4BXSV 1SG3A 3KT1A 5DZFA 3NNLA 4FOQA 3TNPB 4CSWA 5FXZA 2XVKA 5E16A 2UYBA 1RVF2 1K5MC 1RUF1 1MEC2 5FIXA 1GFF2 5T55A 3THCA 4NWVA 1PGW2 4FFHA 5DXDA 3UT0A 2XBO2 2QQOA 4IDZA 2Q8CA 1W9YA 4LO7A 4MO3M 4H7LA 1AL22 4QGNA 4QPGA 4AAXA 2B42B 4LTAA 1OF4A 4Z2WA 4XJ9A 2DBNA 3POFA 1MZEA 2H6CA 3MPBA 5G04L 3WX5A 2FDIA 4L2NA 4PIYA 1OKOA 1LULA 2X05A 5HCFA 2R1BA 1GP6A 1QH6A 2O1QA 2EIBA 1CESA 1RMU2 5ISLA 1BEV2 2WDBA 5FO9B 3ACGA 3QOPA 4XZPA 3RNSA 3ZFEA 1UXZA 5CIRA 1GZCA 1WCKA 1LHWA 1W6MA 5DG2A 2WZPP 3WDTA 4NMIA 1ODMA 2WWUA 1KJLA 1AUYA 2AACA 1YNAA 5F3GA 5F37A 1RUJ3 1Y3TA 4PDWB 4AZZA 3HWJA 1VE0A 3KVAA 5GLZA 3LCPA 2ARAA 1QJX1 3MEPA 1NY71 4IE4A 4Q0PA 4GB33 3SH4A 5IFTA 1RJ8A 1JZ3A 1KRIA 2JDAA 2GP3A 1W6PB 3RZHA 4IV1A 4KBZA 2FCUA 2WKKA 1JHJA 5IWFA 5T50A 5ANNA 2RJLA 1H9PA 4XUPA 1RVF1 4QQPA 1MEC1 4ES8A 3O1MA 1ULDA 3I4IA 1V6MA 4QXKA 3VDDA 3I8TA 4U36A 3H3LA 3M3EA 2XBO1 1WUVA 4C1XA 4CDQB 1FNYA 1OH3A 1MS8A 1RUH3 3C7FA 3VD3A 5AC93 2QTWB 4P9XA 2A3XA 3N9QA 2TEPA 5A70A 2HWF3 2W68A 2BDRA 2XXZA 2BYVE 4P9YA 2SLIA 5FMCA 4CDXA 5JXHA 3HNYM 2JDMA 3LKJA 3VZNA 3KD4A 4H2AA 2X5IA 4DXZA 3V0AB 4CYDA 5C9AC 3CL1A 2NPIA 4EWEA 2HWB1 2CWSA 2FBEA 4ZU5A 4B3NA 1LEMA 1REDA 1ZA7A 4MXWB 2AR6A 2DCZA 2A5ZA 2GC1A 3AMHA 3B00A 4H55A 4UFJA 4CVUA 1UCXA 1RUD3 1RMU1 3OGSA 2OA2A 4GMP3 3PL0A 1YUDA 3S6PA 1BEV1 2GNTA 1S0IA 3KS7A 4IETA 4HKLA 4WZFA 5FZOB 3HVDA 2QE3A 4COUA 1W0PA 1ASJ1 4YYOA 1NLRA 3CJIC 2D40A 4ITCA 5GLTA 2EIEA 3ZXJA 2E9QA 3VBHA 3H8XA 3MBWA 1FAYA 1QNYA 2FDJA 3VKOA 1VAKA 3O1SA 1MS4A 4OHWA 4ASMB 3L9JT 1MS5A 2Z5WA 3GJAA 4HOOA 3AVSA 4Q1PA 3O1OA 1J3QA 2VL4A 1R1A1 3AL6A 3KCCA 4Q4Y1 1PO13 1RUJ2 3GZTB 1BHGA 3SCFA 1STMA 4EN6B 1CZTA 1IS5A 1SZBA 2D97A 3DPRB 5F32A 1BLZA 3CZUA 3ZM8A 2CGOA 4CA9A 2O14A 4GB32 3MIFA 4QMAA 5LK7B 4HZFA 1F15A 4L97A 3ZXEA 1GP4A 4AEDC 4NIAA 2YPJA 3RI9A 2D93A 4LOTA 2UYAA 2QQKA 4RSUA 3D4KA 4AW7A 4BIFA 3Q8FA 4ZXKA 4I0WB 5L36A 4AK3A 3ZMNA 4QPIA 4OUMA 3LB9A 1YI7A 4ARYA 4XFCA 1RUH2 3AP4A 2C24A 1O8PA 1QU0A 2VZPA 5AC92 5K8SA 3UGHA 2GH2A 1CIWA 1GP5A 2P3YA 4AQ2A 2HWF2 1QOOA 1L7RA 2BZDA 1JYVA 2ZGMA 5F7UA 3J8F3 3RWNA 2DUQA 3T2PA 1UX7A 4B1LA 5BNPB 3Q8EA 1W3VA 1Y4WA 1BKZA 3RZKA 2J1AA 1OA4A 2VOWA 5A3LA 5JDBA 3H0OA 3TN93 1U12A 3LDKA 3SNMA 1RUD2 3K4DA 1NE6A 3PHMA 5C3SA 1CN1A 1FATA 4F3JA 5CYYA 1AJKA 1AZDA 1MZFA 3M7AA 4XJZA 3R4UA 2VVFA 3DN7A 4UFMA 4YRDA 3NKTA 4NHKA 1PK6C 2JG9B 2H0VA 3IDEA 1NZIA 4GJYA 3D0JA 4LULA 4BB3A 2RE9A 3VBRB 1IPSA 1UY2A 3ZXLA 3ZR5A 1RUJ1 4M0NA 4HPKA 3JBG3 1YJKA 4IEOA 1DGLA 5LBEA 4XCBA 2A1XA 3QH6A 4FPLA 5H9PA 1MS3A 3MUY1 4GB31 4CUCA 1NUKA 1W8ZA 1QXPA 3LWCA 4UXAA 1QOTA 4B7KA 1RUOA 3HBZA 3GM8A 2VUJA 1YRZA 5IW0A 3OUJA 1U5YA 2XL7A 5FPUA 4IUGA 4JQRA 4AWDA 2VZ3A 1TNFA 1REFA 1OPOA 1WLDA 3ZXKA 3I2GA 5D8AA 3D6EA 1DQ4A 4ONUA 4DXRA 2XQXA 2GN7A 1C3HA 3IMMA 3PTRB 4RL7A 2P3KA 4E4DX 3RJ2X 1AR63 2QZ2A 1RUH1 2QFEA 1CJPA 2EXKA 3THDA 5AC91 4IGQA 2DF7A 2WO2A 1UZ0A 1UZZA 2JG8C 3AZZA 5J36A 5C8WA 2HWF1 4Q1RA 1WZXA 2IXHA 2YBSA 2Y38A 2ZPXA 3RSJA 3I3MA 5BPXA 2RMU3 4LO8A 2PHLA 4P9GA 1SHWB 2GC3A 3WP6A 3FLPA 2XUMA 1JTZX 1V9U3 5LWBA 1W90A 2ZX4A 3QLQA 4FSJA 1V6LA 2QCSB 5D1IA 4MADA 4D7SA 5DZGA 1MS9A 4LHSA 4CP9A 3AMMA 1PVXA 2I07B 1YI9A 2VTXA 4A3ZA 1RUD1 4GMP1 3MIHA 1W2UA 2H0BA 3PU3A 4I30A 3QCWA 3LEGA 4XUNA 4UFIA 3LGRA 4YVWC 3T4VA 5A6QA 1SLAA 1CAXB 2EXHA 5GZFA 3SISA 2AYHA 2VZ1A 1O3TA 1VPHA 4NPLA 1WLCA 3KWVA 4FXKB 3AJYA 2WLPA 1NCQA 3TN92 4SBVA 2RDRA 4XIKA 3WVJA 2AGSA 1V6OA 2XH6A 4HSJA 5FYSA 1VRBA 4I02A 1UYPA 4QPWA 1WCDJ 5C4WC 4PI2A 5HBAA 4IESA 1LU2A 2J1EA 1F9KA 2GSYA 2QQVA 3LOIA 4IGPA 4QHBA 1QMJA 5EJ3A 1PO11 2W91A 3V0BB 2D6PA 2E33A 5I0TA 4CDWB 4LBMA 1ZZ9A 5IVVA 2DVDA 4QHOA 4N53A 4UF0A 1MR5A 4Q4X2 5DAQA 1PX3A 3BODA 3T30A 1UL9A 1VLNA 1OKQA 1CIYA 1QXRA 1N47A 3E97A 4XBQA 2BJSA 3N35A 1A8MA 3DKWA 4WM7B 1F5JA 1HB2A 2VOTA 1S0GA 4UBHA 2WYSA 4YARA 1FOD2 1OC1A 5LY2A 3ELNA 2WWJA 4YW6A 3VHOA 3ZSJA 5CISA 3ILFA 5JSRA 2HYKA 3CU7A 4XOGA 1OLRA 3E5XA 1ALYA 3AP9A 2XLAA 3IIIA 4IGOA 4LK7A 3UKNA 5TSWA 3J7MA 1AXZA 2Q0AA 2VPVA 1OFSA 4RFT0 1A78A 1W8OA 1QJY3 3J8F1 2QZ3A 3AB0A 3N3HA 1JN2P 4IW3A 4QPGB 3WNPA 5LW9A 3CBNA 1V9U2 3IAPA 4RYDA 4GMP0 3LIHA 5A3NA 2WLQA 1I5PA 3NJXA 3ZN6A 1UW8A 4FPOB 4EN0A 3JZVA 4NPMA 4LIUA 3TN91 3ZSLA 4K1YA 4AQSA 3VHPA 1VBA3 2JD4A 2XMLA 5DPNA 4EN8B 5F6LB 2VAUA 4YGEA 2ZJCA 2Y0IA 5CBLA 5GZGA 1XJAA 3PUSA 3TEXA 4S2GA 5KHHA 3LQCA 3ZN4A 5F2WA 4YWAA 5IAVA 3ZFEB 4J25A 3GF6A 1SLLA 3GALA 2WNOA 1T2XA 3ENRA 3JBG1 2BBAA 1N1SA 1GZTA 1WLTA 4XF4A 2VXRA 1NCRB 3AZWA 4JGZA 4YZ5A 1B09A 2JDYA 4YGCA 3T09A 2HWD2 1GBGA 3KGZA 2DTWA 3LPGA 3INAA 4AI9A 2WYFA 5KXBA 1ND3A 4FAHA 1OQ1A 2W0XA 1W6QA 3ZFFA 3WNOA 4B4RA 5A3PA 4URTA 3MLJA 3BUCA 5BNNA 1PO23 4R9DA 4IV1B 2WL1A 1HIXA 3VBOB 4CDQC 1AXKA 1JYTA 4C1WA 4LITA 3OB8A 1CD3G 1TME3 4XDOA 5FYVA 3H9AA 3I59A 4CCLA 1FMD2 1AR61 3VDDB 1D2QA 1DG6A 2YYOA 5JVVA 3ST7A 1Y43B 4FTSA 1ZA4A 4CEWA 1S2BA 3NV1A 4RN5A 1N3OA 1XB9A 4UFKA 5FDBA 1RUNA 5JZGA 4FPKA 2RMU1 1YHFA 2XJVA 2DUOA 3ILRA 4BM8A 3JUUA 2ZGQA 3ZKYA 4CDXB 1V6NA 1V9U1 5BXXA 5ABJB 2IFWA 3MHZA 2EIDA 3NWKA 5FYUA 3LEIA 2XVLA 1UZYA 3WSOA 4DINB 1PZ7A 3SKJE 3NAPA 2PAMA 3UNPA 1F2NA 1NLQA 3O12A 1UY4A 1UF2C 2X8KA 4HANA 2BGOA 4JTNA 3B5LB 4L0PA 3U75A 3M3OA 3SEPA 4FFFA 1YIFA 2ARXA 3ROUA 1FNZA 5FZ8A 1CPMA 4BK4A 1R082 1K5MB 2XJTA 4FP2A 4FPGA 5J98B 1LESA 3AKQA 1S2EA 4P9JA 1ST8A 3NL1A 1UU4A 1CAWA 2DWRA 5JAXA 4XMIA 1C8M3 1G9FA 4LJHA 1IPJA 5LASA 1U5XA 3POGA 5DDJ2 3PUAA 1JHNA 3AJZA 3LEMA 4B1MA 2AEZA 2HLEA 4JCKA 5EJZB 1W28A 3WP3A 3PUHA 3AFKA 3WDWA 3DGTA 4BPZA 5C3RA 5IVCA 1Q8SA 4KG8A 2LUWA 3IAQA 1SACA 3WW4A 3WF4A 4N9IA 1GOFA 5FYZA 3WDVA 1SDWA 2PFWA 1PO22 1SMVA 1YCIA 2HEVF 3CKHA 4CUAA 2QQUA 5LA0A 3VBUA 5C5TA 1BCXA 1XNBA 2WRAA 2JKXA 2BNMA 1ULCA 3NW4A 5SV8A 1TME2 4KQ7A 2QBXA 3RMYA 2JDZA 3NKGA 4HKWA 1QH7A 5JWPA 3J7NA 5FZ9A 3PUQA 4BK5A 5C71A 5IVBA 5FPVA 5FP8A 3ZXAC 2ZHKA 2JX9A 1R1ZA 4MLOA 1QJY1 1FXZA 2VUDA 3C7EA 3LEKA 1SLTA 1UQXA 3IDCB 4QD2A 2XONA 4JC1A 2CAVA 2ET7A 5I0DA 1ND2A 1HB3A 1HJGA 2WZEA 1Q56A 1IPKA 3THPA 4A7YA 3DCQA 1VBA1 3EMRA 3LA2A 4XQ4A 5C33A 2IXKA 2Q4SA 1UOFA 2OPKA 3OGJA 1RUC3 1ZBA3 4CEYA 3ZSMA 2W5FA 4EN7B 3KCYA 2B39A 5BNQA 1LOFC 2UWBA 1OOPA 4QKFA 4ASKA 3OD0A 3KV6A 4HK9A 1NQDA 5CFCC 5LRSA 4OHYA 3PIJA 4A3XA 3DXTA 1UMHA 5C9AB 3NJVA 3ZSEA 4JKKA 3VBFC 3KT7A 2DV9A 4R9BA 1POV0 2WFF3 3ZFGC 4PJYA 1C8M2 4TTGA 3WCSA 3R0RA 3T1MA 5EPAA 2BWAA 2WFPA 4MGIE 2DU1A 3KCXA 5FY7A 1UOJA 4AFMA 1T6GC 1XU2A 4HETA 1PO21 2OW4A 2JE8A 1G9CA 1OT5A 2C9KA 3AM2A 3P3NA 4NAOA 1AX1A 4WZCA 1I9RA 3OGGA 1Q3EA 4AFDA 3MW3A 1TME1 3DYOA 2WT2A 4Y24A 3S5QA 3WDUA 4BIOA 2RJKA 4QGLA 5A7WB 3WLUA 3GXUA 3BTAA 1UD1A 4W4ZA 1AR72 4HT1T 1ENRA 4LLOA 5FTTC 3N9OA 3MV01 4QT6A 3SH5A 4JVAA 2MEV3 2E51A 3AKRA 2B9UA 3DL3A 1KDMA 4YW4A 1JH5A 1VALA 3IPVB 4F83A 1M06G 2UY9A 3BIWE 3DV8A 4Y1XA 3O0VA 5A3WA 4A6SA 1JZ7A 4FAGA 3SCHA 1H2NA 4MXVA 1S2KA 1VBC3 1RL3A 5ANQA 1N3PA 2WO3A 1OUSA 2VZRA 4CP9B 1JOBA 2ZZQA 3MYXA 4X8PA 3I49A 2WAOA 1V00A 4K6BA 4Q4V2 3K48A 2Z69A 4A4AA 4AEDB 3VZMA 1W8UA 2OQ7A 4LBNA 3PMSA 2ZAHA 3S7EA 4Y4YA 4UI9L 4DUXA 4Z2AA 1VBE2 2VBPA 2YDEA 4LK6A 1JMUB 5DUWA 2W47A 1ZZ8A 1QDCA 2XWJB 1NCQB 1QXJA 2JB8A 3GNEA 1RUC2 3A22A 5FZHA 1QJU2 2RS52 3OBAA 2Y0OA 1C8M1 3A0NA 4HONA 3ECQA 4SLIA 5HI0A 4CDWC 4HVRA 4NHMA 2D6MA 2RV9A 1I1EA 3O1TA 3ZSKA 4QXCA 1L7QA 2F4PA 2HJIA 1JS9A 2Q5TA 2D3RA 3W20A 2R073 1RTVA 2QQMA 2ZHMA 2NM1A 4WVMA 4UF0B 1OURA 4AAPA 3VKFC 3LAGA 4PLMA 1DCSA 1A8DA 2BQPA 4CXWA 1ENXA 2G1MA 3ZYIB 3O0WA 3ZLIA 1UMIA 4DY3A 3GCXA 1Q5OA 4B8EA 1GANA 3HNBM 2QDNA 4XF3A 3VD9A 1S0BA 4E4SA 1PMIA 1S4CA 2QDRA 4EWAA 4JHTA 4UOJA 2VQUA 4YG0A 1KS5A 3KT4A 4QPGC 4C0BA 4CCDA 1Q43A 1XNTA 5JR2A 4QQHA 2J22A 2WT1A 1AX0A 1I5ZA 2IWGB 3GHNA 3MFCA 3N7JA 4Y22A 2JE9A 4XC9A 4Z1VA 1HW5A 5A6XA 2ZMLA 2J1RA 4LPLA 5F5QA 1F8VA 3T1LA 1LEDA 1ZBE3 3F2ZA 3OY8B 4NROA 5K4LA 5CEHA 3B7MA 3CMGA 3X29B 3BTZA 1VIWB 3GYDA 1HQWA 4KGQA 2OIIA 1RUC1 3ZFEC 2ZX2A 1ZBA1 4WVZA 3MW4A 1XBFA 2ZMNA 4JHZA 5EYXA 5LBFA 5LA1A 1KITA 1LJ7A 4RS5A 4ATEA 4COZA 2ZKNA 2RS13 3DKQA 5BV6A 3PIGA 3ITQA 4AEJA 1AL0G 1HN1A 4GAZA 2VY0A 5B4NA 1OFNA 4V2WA 1HV1A 1HN0A 5A80A 3E6DA 1K12A 2WFF1 4LBJA 1N1VA 1MS1A 1HB4A 1RHI3 4KMQA 1W06A 4KG0A 2AC1A 4AFAA 5LCWL 4IV1C 3C8XA 1QWRA 1VRH3 3GDBA 4IEQA 4AI8A 2AREA 4G9SB 1H8VA 1NA1A 3UKVA 3KB5A 4LXLA 1IKPA 1SBDA 4HFSA 3HN1A 1YQ2A 2BOJA 4FPHA 3KHCA 2ZZJA 1W6QB 4A2UA 4W6XA 2XJQA 3VDDC 2FDKA 1HDKA 1D7PM 4FVVA 5E89A 1XSRA 1SFYA 4LBQB 1W05A 1HB1A 2BVVA 1IQAA 2BRTA 4X8NA 1MACA 1X8MA 2A73B 3I59B 4RA0A 5C4WB 4NVPA 4CDXC 1B35A 1GLHA 2BUKA 2Y6JA 3LFIA 3QD6A 2WABA 4FOVA 3AXEA 2MEV1 2X5IC 2ZA9A 4XF1A 1WCSA 4KWKA 2GNMA 1WW5A 3HEIA 1DQ2A 1WGPA 3MIGA 4OMCA 1C5IA 3WQ0A 2W9XA 4GZ9A 1XC6A 4YZ1A 2ADDA 3WXPA 1VBC1 3ZXDA 2VOKA 1SBFA 4CZSA 2RG4A 2OZJA 5FREA 1J3RA 3NAPB 4ZXEA 2ADEA 2KD7A 3FL7A 3ZYGA 4C91A 2VCCA 3VBHC 2X29A 5CFDA 3J26N 1OH4A 4AR2A 2I2SA 1ZZBA 1IS6A 1ZBE2 3U11A 2P6CA 3WOGA 3CIHA 3HQRA 3S0MA 4LKFA 5A7PA 4JV4A 2ES3A 3VDAA 4AHWA 1EY2A 2VU9A 5GZEA 3RYKA 3O1UA 3CQOA 1CAWB 2RS12 2W3JA 4FO9A 5A7OA 2ERFA 4A6OA 1JZ6A 2HWB2 2AENA 5F8PA 2VMDA 2WO7A 2IUWA 3B3QE 1GQPA 1QJEA 5GJ6A 3T3YA 1O8SA 4ZZ5A 2R071 2YC0A 4FCAA 3LPFA 4Z92B 5FZ6A 1X50A 1RHI2 1W6OB 1ASJ2 1UY3A 5L9VA 1ULEA 3N9MA 1VRH2 5FZ4A 4R4ZA 3NVCA 2FHRA 2GDFA 3PNAA 4YVSA 4Q8KA 1BVVA 2PYTA 2VQAA 2ZGOA 4K8FA 1ULGA 1K45A 5FK7A 3I2OA 2EALA 2OXBA 4GH4A 5A3UA 1YQ5A 5J96B 3K4AA 3V65A 4FPEA 4QPIC 3D0SA 4XFAA 4MUVA 2VULA 5A33B 5IFPA 5LBBA 5A3OA 2IFRA 3NJYA 1H2KA 3MIEA 1R1A2 2BNOA 1OLMA 1E5IA 4GULA 4Q4Y2 4RD7A 3WP4A 1W03A 1IS4A 5FR3A 3GZUC 5HCAA 1QOSA 2IVJA 3SCGA 1QIQA 1X82A 4PBPA 5FYCA 2A6WA 4XXAA 2DURA 5FWJA 1CAVA 3M4FA 1ND2B 3POJA 1ZBE1 2R16A 5EWSA 1PZ8A 3M8LA 1XOYA 4DZGA 3VL9A 1GZWA 1W9WA 3VV1A 2Q8DA 4ATFA 3RZJA 2NP0A 4S2HA 1DQ1A 4H3WA 4XZUG 2RS11 1ENQA 4J1XA 4XFGA 1GQHA 3N7LA 3IBMA 4IERA 3OPTA 3USUA 2RDSA 4IXLA 1OOPB 3KZ4C 5I0SA 3D5OA 3C2UA 4XHXA 2QUOA 4IV3A 2VMCA 5EJ1B 2YU2A 4URAA 5F9TA 1ZRCA 1JYIA 3N9LA 1GQGA 1RHI1 4FPFA 4PIXA 2RJ2A 3O7OA 1VRH1 2JB4A 5FRAA 1WD3A 2RDQA 2CYFA 2V5YA 1SBEA 2VQ0A 1WA6X 3H50A 1YQCA 1W8HA 4Y3OA 5D8AC 1G9AA 3RRDA 4GIQA 1PGSA 2BFUS 1JUIA 4M3CA 1EYBA 2BNNA 3BU7A 3L2YA 2CDOA 4TLGA 1LB2A 2YFUA 2HH9A 2ZGTA 4FPJA 5HXMA 1D0GA 5T5OA 1GNYA 4M4PA 4JTOA 5FJHA 4DNYA 2YU1A 2D6NA 3VZJA 5A6ZA 3FHAA 3RPQA 4ASLA 2J42A 4X6QB 4IEZA 5CG9A 1OLME 3EB7A 4AQ6A 1UO9A 1W9SA 2ZHNA 3JCIA 4P5YA 5J3UA 1VMFA 2PQQA 2ZX3A 4FOWA 5FQ0A 4LIVA 1RITA 3SXWA 1AX2A 2DFCA 2HEWF 3NO8A 4CRQA 4DIQA 3P5BA 1Y9MA 2ZGRA 4UYBA 3VD4A 2JICA 2YBKA 1BMV2 2DVBA 1XE0A 5FZFA 1G86A 2JENA 2XDVA 3AX4A 1ZRFA 2VOVA 4K9SA 4E2SA 4AQTA 2AZ5A 4XXPA 1NCQC 3MW2A 1RUI3 3A7QA 5LA9A 3DYMA 3OPZA 1I6XA 2XVGA 1KFXL 5ACA3 5IUQA 4JKLA 4LUMA 3C7HA 3VKNA 1NT0A 2Q1MA 5I8TA 3QH7A 4OI0A 2RS33 2ET1A 2VTFA 2LS6A 3F95A 3H7JA 3BOPA 4F8AA 3SH3A 2ZMKA 3I3EA 4BA6A 3LIGA 4P5HA 4ZZ8A 2ZACA 3OD4A 4YZ3A 3POYA 4N53C 4KH9A 5KHGA 3P6BA 2V72A 1H8TA 5E1RA 5EP9A 5IHRA 4BE3A 4Q0SA 4M3CE 3WINE 3KF5A 2BVBA 3PVBB 1NKGA 3OEBA 3N36A 2IZWA 4FI9A 5F3CA 1LECA 4ZPIA 2VNVA 1UWWA 5KHKA 4JGYA 4MYEA 2R32A 4KWUA 3HBKA 3NNFA 2GN3A 1LU1A 4LUKA 3U4SA 5CFCB 1XNKA 2D6OX 1WBLA 3OPWA 4RR3A 3I2KA 5T54A 3RDIA 1D4M3 5FXVA 3H3ZA 3VBFB 5IK5A 2D6LX 2I74A 4RHV3 1N1YA 5KHJA 1ZX5A 1PO12 2GAUA 3ZFGB 2FDFA 3D8CA 5GZDA 2RR13 5F3IA 2ZGUA 4RQPA 4LO5B 1MQTA 1QEXA 2W46A 3ASIA 3TWIA 2E7TA 2MPFA 2YY1A 1KXGA 1ZNPA 4Y22B 1V6KA 3H8UA 2TBVA 3WZ1A 2XKPA 2XGXA 4XYXA 1WMDA 2ILMA 4XURA 2YG0A 1JYCA 2Z79A 4BHPA 5FO8B 4XDPA 4LNVA 3LDBA 1A3KA 4UFLA 2OZ6A 4DMIA 4UW6A 2QQLA 4E4HA 4JZRA 2GC2A 1VMHA 2X10A 2VMHA 1RUI2 1UPSA 3R4DB 2NMOA 4Z07A 1JYNA 2E26A 2QKDA 3AVRA 1Z78A 1YEWA 3OBRA 1C8NA 3PU8A 4XMAA 5FZMA 4HSLA 1H2LA 3HJRA 1JOPA 4PLOA 5HV0A 2XJRA 3M1HA 4BWOA 2R49A 1W8TA 2BEOA 3DUIA 2RS32 3J8F2 4QXHA 4A44A 1DQ0A 2VOXA 3TB0A 1DF0A 2GU9A 1VB2A 4CDUA 3ZFFC 2LM3A 5DABA 1O59A 3JB8A 4PCRA 5BNNC 5I8YA 3FX3A 4D7TA 3AZXA 4MGYE 1AR83 3I3QA 2O8OA 5JR7B 5LZ6A 4TLFA 1XRUA 5F39A 1UOGA 2C5DA 3LE0A 4K21A 4PT6A 4EJRA 2LTNA 1Y9GA 3OBZA 4E8CA 1W8FA 4QDRA 2WS93 1S0DA 4XETA 1DP0A 4CEWC 1Y7BA 5FKBA 3USSA 3IN9A 5JZGC 2P2KA 1U5ZA 5ERLA 2ZBJA 2G9ZA 3JBG2 5E8AA 3EJKA 3N7KA 3KMHA 1EPWA 1ULFA 1OVSA 2VUCA 5AFEA 4Y20B 1YLLA 1CAUB 1CR7A 2LW8A 1YC61 3VDCA 4EV0A 1D4M2 1W8NA 2BERA 3PJYA 2WNVA 1OPMA 4QPYA 4HBNA 3NAPC 4HMZA 3B69A 4QQLA 4RHV2 3VDBA 1UOBA 2JDHA 3K3OA 5CU1A 5DUXA 4ES9A 4Y26A 2WWSA 2RR12 4N43A 4BH9A 1JBCA 1PHMA 2CDPA 3NNGA 2FDHA 1AR93 4XCAA 3TEWA 4ET7A 5EHDA 2Z4FA 1RUI1 3IMNA 5CG8A 1WW6A 3NJZA 3T2OA 1IQDC 2F6BA 1E5HA 4AFBA 1UX6A 4UWDA 1AR62 2H6BA 2IXLA 1VBD3 2VH9A 5ACA1 4P9IA 4PF1A 2GZWA 3VKLA 4MG2A 3BGAA 1ZZ7A 4AVBA 3KF3A 4D8MA 2RMU2 2RS31 1VBB3 1XE8A 4N7UA 3ZR6A 2FZ1A 4CPBA 2P1BA 2XL9A 5C8CA 1GWLA 4GA9A 3OGVA 2W39A 3AKPA 1SFNA 3VZKA 3ZXFA 5DAVA 3M3CA 4XVHA 4XACA 2XJUA 1DGRN 2A70A 4Q0UA 3ZO0B 5GLWA 2D3SA 1A6CA 2XQRA 1BZWA 1XQNA 1NZCA 3VBSA 3W59A 2WAAA 2WINB 2VZOA 4DFSA 2CY6A 1W6MB 4XAEA 4AVSA 4CU6A 1FV2A 4R8HA 1AR82 3H7YA 5LEKA 4NPRA 4AG4A 3VBUC 2ZHLA 3K3NA 4E9KA 4AL9A 2EA7A 2VW2A 2VO5A 3OF1A 4Q2FA 4CU7A 1D0HA 3IDAA 4GH4B 5FYBA 2UURA 1D4M1 1UZWA 2WS92 3FBYA 1RYYA 2BP6A 2QNKA 4RHV1 3UKTA 1YYNA 3AKSA 1KD7A 4ARXA 2D6KA 5FPZA 2YMZA 2XLFA 3BN6A 2RR11 1YJLA 1SLCA 3O14A 1ND2C 5FZGA 5IYYA 4TSVA 5FZ7A 5JCTA 4QX0A 1UYYA 2HBUA 4QKDA 3LSDA 3AYDA 1LOCA 1J59A 4B4QA 1DYPA 1UY0A 1DGWA 2WNUA 4Q4W3 4CEYC 1UY1A 1W2TA 1U0AA 2DFBA 1X33A 1AR92 1UKRA 3WQBA 3D82A 1OOPC 4IE7A 1XNAA 3KLSA 4LO6B 2X5IB 3WT3A 4AGVA 3OUHA 2LROA 1HRV3 1GNZA 1VBD2 4QX5A 3BTXA 2W1QA 2W2IA 4NOTA 4PF5A 5FZBA 4A7ZA 5A32A 3PTYA 2MHFA 1WCUA 1QJY2 3ON7A 5L9RA 1ZM1A 3GBGA 3AFGA 4R4XA 3UL2A 3IZOA 3P3PA 2ARBA 3JQWA 4IEPA 4YW7A 1TNRA 1AR81 4YNIA 4CXYA 4YM3A 1G7YA 1VBA2 5KHIA 3BVCA 3HN3A 4UAPA 2QQIA 2Y60A 3N9PA 3VBHB 4WM8A 1UNBA 3OSDA 2EXJA 2WUHA 4OHZA 5CA6A 3W5NA 1YFWA 2VZUA 1X9PA 1C1FA 2WO1A 2GP5A 4D7YA 1G6NA 4F7ZA 1ZREA 1PVC3 1RC6A 2EIGA 2WS91 1YFXA 3M2MA 1OHFA 3AMPA 2P17A 2OUHA 5FOJB 1JXNA 2V5DA 3I7DA 4HG6B 1ACCA 4DXTA 1TZOA 3B9CA 5AFBA 1CGPA 3UYJA 4NHLA 4AXOA 4YM1A 3WUCA 2DCJA 5BNOA 1DGWX 5GLVA 4QDQA 4WBBA 1KQRA 1H4GA 1EV13 3LFMA 5FQ0B 3NV2A 2IXCA 1KDKA 2D44A 5C6CA 3JB4C 2R063 1VB4A 2OT7A 1AJOA 4QDSA 3PVNA 5FZCA 3U0ZA 3MFAA 5KXDA 1AR91 4ZHNA 2BU9A 2BOIA 3E6BA 4ZS2A 3SC7X 3U07A 4DO0A 5JOWA 1HV0A 2V73A 3LA3A 4GD4A 4NR1A 4PQQA 4KWLA 5JXGA 1HX6A 3RZLA 1SPPA 4Y33A 1VBD1 4UW5A 1F35A 4QPIB 3WW2A 2WR9A 3KV9A 1WMEA 3B01A 5FZDA 2OUJA 4L99A 1WKYA 3MI8A 2K2SA 2G9FA 4XJ8A 1VBB1 3T08A 1POQA 4PDWA 4AI0A 2YXSA 2NZ9A 5FY0A 1DZTA 1BK0A 4QX8A 1PGL2 2VMIA 4MGSA 5FYTA 4XF0A 3RYRA 1CX4A 3AYAA 3UGGA 5IVJA 2XKOA 4P9WA 4QGMA 4QXBA 1IS3A 3SMHA 4WV8A 2W87A 1UZVA 5IK7A 1W6PA 3VL8A 1H30A 4Q27A 3PJQA 4BLJA 5FYYA 5FZKA 4AVAA 2VBBA 3O0XA 1H1MA 2FMYA 1GNHA 1QGLA 1REEA 1I3HA 4LBLA 2C9AA 5J1XA 1CONA 1G9DA 3WG4A 3BB6A 3MZHA 4OZXA 2VMEA 4LORA 1PIV3 1QQP3 3CNAA 2L9LA 2J1TA 2DUPA 4JGYB 1X8EA 2XR4A 1CX1A 4HPKB 3ME2A 3BALA 3L2HA 4GALA 1W99A 4XFHA 1IG0A 2VZTA 3W9AA 1OUXA 2A3WA 3ZYJB 3HPNA 3TEZA 1R093 1OQEA 1E57A 1APNA 2VNRA 5FPAA 4COWA 5L7OA 3AMNA 2RM23 4I2OA 2ORZA 3IWZA 2P3IA 1LHUA 2LRPA 4P00B 4Y5SA 5EFUA 5T5JA 3SHRA 4MXWA 1JYXA 4YG6A 2IXJA 2WA4A 3I2IA 3AZYA 2XHNA 4MX3A 3ES1A 5D8AB 4C8DA 1K42A 2WSVA 1MQTB 5LATA 2FD8A 5C3OA 5FZOA 2VBDA 1AF9A 4COVA 4IEXA 1NQJA 2HEYF 2R062 1E5RA 1QHDA 3LDRA 4Q4W1 3TYJA 3WNXA 4W8JA 1H6YA 4HN1A 4RS5C 1VAMA 5FY1A 3RS6A 3WY6A 2VVEA 1KS4A 2W95A 4I0AA 3TOJA 4LT5A 4X6RB 4MSVA 4NHXA 4CP0A 1WW7A 4OULA 1PGL1 4AEMA 4G3YC 5JMOA 1GOGA 3VZLA 2K0GA 4OYUA 4D6SA 1HRV1 5I0RA 3K75B 3CJXA 5AVAA 2NLRA 3JD73 2EVXA 1X9TA 4B4PA 2GNDA 2R043 1DQ5A 5GZCA 1BVP1 2W92A 2IVIB 4META 4RFRB 2VJXA 3HAGA 3HT2A 4MGQA 3QBQA 1NA1C 4TYSA 1AXYA 2P37A 3DPRA 3TAYA 2C0ZA 3VKMA 4AOCA 1Q8QA 2HYXA 3JU9A 2VR4A 4LHKA 4E27A 2J1VA 1V6JA 2B4KA 2YFZA 1PMHX 2PAKA 2X09A 5FMBA 2A3YA 1US2A 4HKOA 1ZBA2 4QAWA 2WQ4A 2ZGSA 4Q0QA 4AYUA 1JODA 1PVC1 4XPVA 3H8RA 1O91A 4ZONA 1LHNA 3OYWA 2R0HA 1B35C 2PLV3 4XJWA 1MPXA 2OX0A 4NHYA 4JRLA 1P8JA 1QQP2 5FP9A 4XJAA 2WFF2 5KWRA 3RWKX 2BPA2 4N53B 4I01A 1EV11 3E1F1 5CB7A 2EAAA 5HCHA 1LGNA 5BNPA 1ENSA 2R061 4ZU4A 4DQAA 2RM22 2YGMA 3UJOA 1DBNA 2PHRA 5JIAA 1S0FA 4N43B 2OVUA 5CFDC 4KL1A 4O9EA 2PA7A 3Q8AA 4YZ2A 3ES4A 4LBKA 4MHRA 2JG9A 3PVEA 4HL0A 2Q1ZB 1FX5A 5A3TA 1W2OA 3A21A 1D4VB 2MEV2 3VBRA 3LZZA 5FP4A 3AC0A 1GUIA 2ZEWA 4OFGA 2VZVA 3R6SA 5CAZA 2RDNA 3FLTA 1F4AA 3MUZ1 4N8MA 2W94A 1J84A 5IATA 3W5MA 2YGLA 4Z82A 1LOEA 2XUEA 1X36A 1VBC2 2C4XA 1URXA 2ORXA 4NIGA 3CZJA 5K0UA 3WDYA 4CCKA 3B9IA 1RUG3 3JD72 4K1ZA 3ZN6B 1FI2A 1AYM3 1NLSA 4BQWA 3CO2A 2GMPA 4HVQA 1O3RA 1JZ5A 1HQLA 1LR5A 2R042 1LRHA 2VMGA 4L9BA 5E6HA 1HXS3 4EE2A 4OMDA 5DQ0A 5F1RA 4W6WA 2VNOA 3MLKA 4YVSC 4D3WA 4ZKTB 5C5UA 4ZS3A 1LHOA 2WN3A 5I8SA 1JW6A 1J1TA 1NXMA 4Y5TA 3AKTA 5CKQA 1G9BA 3ZPOA 3IB3A 5IVFA 4MH0E 4GH4C 5FZIA 1NX9A 1IG3A 2FCVA 1PIV1 1QQP1 4GKXA 4LKDA 5JOYA 4FTEA 3MDPA 4JDMA 2JDPA 4LBQD 5DN2A 3ETPA 4DEQA 3RMXA 2P4EA 2NQYA 1OVPA 3MIDA 5DAXA 4JGZB 3THTA 5JPNB 1E5SA 2ENRA 2JIJA 1AL23 1GMMA 4M01A 1R091 4KBBA 2WSUA 3M70A 4K20A 2RM21 3ACLA 3POEA 4CCJA 1ND3B 1RJ7A 4FP3A 3OOXA 5LBCA 2D5HA 3ZFFB 1EP0A 1WD4A 3C7GA 5A6YA 2R072 2Q1FA 5BNNB 3I3BA 4AE2A 4NN0A 3S7IA 4XBLA 1O4ZA 4IEYA 2O8QA 4BQYA 1CAXA 2CTVA 1Y9QA 5JSPA 5M0TA 4MGTA 5HCBA 1BYHA 2PHWA 4M4RA 5FYHA 2BFUL 1CJDA 1EAH3 2Q30A 2ID4A 1TG7A 1AVBA 2JECA 3OG2A 4NUBA 4CEWB 1W8WA 3U14A 4TZDA 1T6BX 2XB6C 5JZGB 5APAA 4DEVA 3U4XA 4XBNA 2A75A 4KI5M 3WHTA 1U5IA 4HN0A 3JD71 3G6JB 1QY4A 1W0OA 2PHDA 3KHBA 4IE5A 4IV3C 4PLNA 5A7NA 4FPCA 2R0FA 2R041 1F31A 3U10A 3V0BA 1OLQA 5FZEA 2Q8EA 1NYWA 4PI0A 2KM2A 1QKQA 2VGDA 3Q9OA 5T3NA 3WG2A 1HRI3 4LE3A 4ORFA 3HIFA 4LKSA 4QB2A 5FUPA 3RVHA 1UKGA 3ZIXA 1ZZ6A 2VD7A 2QQWA 1MVEA 1Z0HA 5IK4A 3EBRA 3NV3A 4XTMA 1ULOA 4WM7A 4QB6A 1S0JA 1HXS2 4XABA 2DBIA 4WM8B 2WC2A 4YPJA 5CKNA 3ZOIA 2DVAA 3FFQA 4FQZA 2PLV1 2EAKA 5A1AA 3KM5A 1C1LA 3I2FA 4LLFA 4NRPA 4XE9A 3T4HB 3JQXA 3FHQA 4OHVA 2E63A 2VZQA 2JDKA 3VD5A 3JXSA 1IKQA 3ZPYA 4FXGB 4AI1A 4KNCA 4AF9A 5BNOB 1TMF3 4AI2A 4GXLA 4H7MA 3RJRA 1X7NA 4JKMA 3PUIA 3ZVXA 4MZUA 4I3GA 3KQ4B 2W52A 2WQ8A 2VMFA 3VBUB 3PLQA 1KGYA 1US3A 1QNWA 3RFRA 2E32A 1W0NA 1JOJA 5FOBB 1EAH2 4NIDA 1SPPB 4KU8A 2JE7A 4HVOA 3WHUA 4BQ3A 2J1UA 1F4HA 5F2SA 2XWBB 1BMV1 1NCRA 2K46A 5FPXA 3K4ZA 1UPIA 4I3PA 3ZX7A 1H8TC 1GR3A 3IM0A 4AEKA 3NSTA 1RUG1 4BDVB 1JYWA 1AYM1 3AYEA 3ZN5A 1CPNA 1XNCA 1SDDB 1SCRA 2J7MA 4Q8LA 2PELA 1HXS1 2CL2A 2W1WA 2JD9A 5L9BA 3VBOA 4CUBA 4CEYB 1ZRRA 4JGYC 3TBDA 5DAWA 2F17A 2WZ8A 1HRI2 4V1PA 4IE6A 1GSLA 1YFUA 1DZQA 4CTEA 4UBGA 3I3DA 4PBOA 1KJRA 2W1SA 3A0KA 1A34A 2B5HA 5LA2A 1PGW1 5FAXA 4OQ9A 4OZOA 3T2QA 4RR3C 4TWTA 3BIEA 1LODA 2BW8A 5IK8A 3QACA 1AL21 1AYN3 1SLBA 1TQ5A 4XJUA 4Y1VA 3ZYFA 1JI6A 3N4MA 1LOGA 4LR4A 3ZYBA 1EUUA 5ABJA 5CADA 1OMIA 4RQPC 1UYZA 1MQTC 5L7OB 5FUNA 2VCBA 4FT8A 2YUEA 3IKWA 4W50A 3HOBA 5FK8A 4CP1A 2ZGNA 1DZRA 5FPLA 1ZRIA 4ZU7A 4TXWA 3E5QA 2QJVA 4Q29A 3VN4A 5GM0A 5H9SA 3WW3A 1TMF2 2VE1A 1BBT3 4BQ5A 5IAXA 3BU0A 1WMFA 1EAH1 2DCTA 2E53A 1LCLA 2YBPA 3GZEA 2C26A 2R1DA 4Y5Z0 1DGRA 3VHNA 2VUAA 5AVPA 1RXGA 1K5MA 4MGKE 1R64A 1CVNA 4MV2A 5I0UA 4E2QA 3H8OA 4LE4A 5FYIA 1MS0A 1N3QA 4UW3A 5FWEA 3HD8B 3PURA 3RG0A 2PN5A 4RGKA 1UYXA 5KR7A 2VECA 3NRUA 3MPPG 5JMCA 4S2FA 4CDUC 1G8WA 4D6QA 4AI3A 1XYPA 1RUE3 2ZEYA 5JI7A 3FMGA 4BZ4A 5L19A 1JZ8A 2VM9A 3FN9A 3ABZA 2UWAA 4J6GA 4M3CF 4QX1A 1VP6A 3N9NA 5FXXA 1DLLA 1HRI1 2VVDA 3AL5A 5HXVA 2DVFA 4BCUA 4BQ1A 1OD3A 3NNMA 5A1FA 3AXDA 4EN9B 2ZGPA 3SITA 4K40A 1GWMA 2ZGLA 3KV5A 3ORJA 1C4RA 4RGAA 5I91A 1MVQA 1WW4A 1ODNA 2PQSA 3ILNA 5FMOL 4B29A 1S55A 1RIRA 2R6QA 3OYWB 5F3EA 4D0QA 1YFYA 5DZEA 5T5PA 3OTFA 5F6KA 2ARCA 1XXNA 3AYCA 2WNVC 5KXEA 2JXAA 1XYNA 1AYN2 3H1WA 4WVMB 3O1VA 3K2OA 1TMF1 3I54A 1FT9A 4L8QA 4LA2A 4N43C 4AVTA 1LOBA 2KXLA 2VZSA 2DCKA 3HT1A 5FZ0A 3AP7A 4JQTA 3WNLA 2CGNA 5JOXA 1YIPA 4S2DA 1VAVA 1IOAA 4QHZA 2E7AA 3T0DA 1SEFA 4NO4A 3WG1A 1V0AA 1XPWA 3M3IA 3E5UA 3UGFA 4YW3A 1WBFA 4N90A 3AK0A 1BBT2 3VB9A 2GMEA 1H2MA 2BWCA 1J83A 4DOUA 3MLLA 1PX4A 4CCMA 2CV6A 1V6IA 5C9AA 2BBVA 1H9WA 5FBJA 5C8CC 3K77A 4A45A 2D5FA 1FV3A 4YLZA 5DAPA 1W6NA 2PHFA 5A3MA 5H9RA 4Q4X3 3VGIA 4BOWA 2DU0A 5B2GB 2G9GA 4YG3A 1NG0A 5K0UB 4DS0A 2CGPA 2JEMA 3OBTA 3EO6A 3VBSC 3VUOA 3BI3A 3W58A 4C0HA 1RUE2 3CJIA 4H14A 3FHIB 3DECA 3SQOA 2EICA 3BCWA 3FWEA 3U78A 2PHUA 4QX3A 4RS5B 3DXUA 2FMDA 4R9CA 1GOHA 2GMMA 2PHTA 4QB1A 5DUVA 1FOD3 5A7WA 5T52A 5ACA2 4JGZC 2Y6GA 3GCWA 3HQUA 3URFA 2RHPA 3H1YA 3POBA 1ND3C 2CAUA 1AYN1 4RGGA 5GALA 3IPVA 3M3QA 3CF6E 1H4HA 3C7OA 1VMJA 5FMDA 4YM2A 3BKZA 4XUTA 1NA1B 3OEAA 5FZAA 2CU5A 1O7FA 4LA3A 4BU2A 1GWKA 2ZX0A 4XFBA 3LA7A 1BBT1 1VR3A 2WNUC 2OYZA 4AEDA 3BTYA 2O0OA 2BGCA 5CZKA 4QKBA 2WZR3 2Y6FA 3POSA 2YV8A 3WEZA 4OQ8A 3ZKUA 5F5AA 3H1MA 1YXWA 2ZGKA 3WV6A 2FZ2A 1B35B 3J4UH 1IGOA 1XSQA 1UAIA 2XJSA 2YC4A 2ZABA 3IDBB 3KQRA 4K7JA 4W65A 3RZGA 4Y1ZA 1RB8G 4CE8A 4BQXA 1Z7S3 4PQ9A 1J58A 1PZ9A 4FTBA 4QU2A 2XLGA 3OJBA 4Q0VA 1S1AA 4M0HA 5FV3A 1GICA 1H0BA 4KU7A 2HWD3 2NMNA 4CU9A 4OI4A 1RUE1 3PMEA 1POV3 4MVTA 1SCSA 1KFUL 5FY4A 5KBFA 5A7QA 1CWPA 4OHXA 4AFCA 1NAEA 4FBFA 5KC5A 3PVOA 2HWE3 5FMOS 2EXIA 4DUWA 1HQNA 4I09A 4WM8C 4BQ4A 5CFDB 5LRRA 5JPMB 2C6SA 2ZTNA 3EYPA 1H6XA 5EV7A 3VLBB 1D2SA 3D3AA 1L7LA 2CSGA 1DIWA 1MZ6A 4QX2A 4O9GA 3S5AA 1FMD3 1LTEA 1FPN3 1PK6A 2W08A 2WIIB 2R7EB 3GZAA 2WN2A 3KV4A 2Y26A 4U2AA 4YFZA 5DG1A 2HBTA 4YZ4A 2TNFA 2ZX1A 4GWIA 2ZKLA 4XEZA 4D6RA 3WW1A 4Z8BA 1DDLA 1WLWA 2XOMA 1S0CA 4N9HA 2UWCA 5BNOC 5C3QA 3O5SA 1LNSA 1IZ3A 3TRSB 4EWDA 2CWMA 3GBWA 3B94A 5FP7A 3SLIA 2Y33A 2A6ZA 4HK8A 1DU3D 2QQJA 4LMFA 4JX0A 4GWMA 3WUDA 1YQ6A 3BPZA 4A7KA 4YVSB 4DPNA 2WJSA 4JRAA 3O1PA 3MO4A 3OY8A 3OCPA 3IT8A 3ZDVA 4AVVA 2WA3A 4FPYA 1AHSA 2OQ6A 1DYOA 1R083 4GWJA 5FO7B 4BQ2A 2ZEXA 4FQ4A 1XYOA 4QM9A 1H1IA 2JG8A 5JSOA 2D3PA 2WZR2 1OA2A 2Y8KA 3MICA 4CCEA 1PM4A 3POIA 3RYPA 2FDGA 5JOZA 1XNDA 4NE9A 4PDWC 1LGCA 1ZYBA 2G4IA 4XW3A 2HWC3 1PM7A 2OPWA 3J7LA 2BGPA 4OLLA 5FLJA 1Z7S2 2C1FA 5DDJ3 4BISA 1ULPA 2JIGA 1CAVB 3DEMA 1K5JA 3AP6A 4GKYA 3B93A 4OVEA 4Q4X1 4YVWA 5G05L 4CU8A 3O1RA 3A23A 2ZAAA 1UN1A 3UK9A 1C28A 2DDUA 5IVEA 1GZWB 5JI9A 4QU1A 3FE5A 2I45A 1XE7A 1LOAA 1RGSA 3A4UA 2A71A 5GKAC 2B45X 4LHLA 2UU8A 4Y4RA 4YFWA 1UIKA 4D94A 3FLRA 2HWE2 4R52A 3I2JA 1C57A 1FOD1 1Q8PA 4QQ2A 4XQDA 4LBQA 4XTPA 4PIZA 5FZLA 3ZMOA 3AP5A 3USUB 1GU3A 1UU6A 4QWNA 5C4WA 4IE0A 1W9TA 1VBB2 1FPN2 5FP3A 1LKNA 3R05A 5L73A 2JJ6A 4IV3B 1JU3A 3I2DA 5L7OC 5F5IA 2VXJA 2B8MA 2PHXA 2X53S 3ZIWA 4K8RB 4D69A 1SLIA 4QX7A 3MGUA 2PMWB 2JWPA 1LGBA 5FY8A 3RGBA 3W21A 2ZEZA 2ZS6B 5FKCA 5C7GA 3NV4A 4HLTA 4M3CB 5DUUA 4UT5A 4XHBA 2DCYA 2DTYA 4IEWA 2PXJA 2WZR1 5EYYA 4E2GA 1DHKB 3C3VA 1TVGA 4KGGA 5FZ1A 4XFIA 3U1XA 5EIYB 2P5BA 2OS2A 2D43A 1W2NA 1MZ5A 5KC6A 1IHMA 1WCQA 4UFHA 3NNJA 4OUEA 1H1AA 5FJKA 3H42B 1Z7S1 4O61A 4YSFA 4P14A 3MF9A 3KSCA 2ATFA 4NIIA 2VCAA 3GHMA 3ATGA 2HWD1 3T0AA 5T5LA 3Q8CA 2N7GA 1BK1A 2HWC2 2TUNA 2VNGA 2V09A 1POV1 2ZCWA 3GBFA 3HNMA 1RXFA 2WBKA 3DPRC 4J1WA 4LO4B 3WF1A 4BYYA 4AHZA 5A1LA 5HPOA 3WDXA 5J09A 1BQPA 3NQHA 3RI8A 4XDQA 3S57A 4ISQA 2HWE1 4ISRA 1ZRDA 1W6OA 4DB5A 3HMYA 5JIUA 4Q4W2 1TEIA 1OXCA 1PNFA 1W3XA 2D98A 2P6HA 5BYNA 1FMD1 3FZ3A 1FPN1 1N1TA 4JDOA 1AR73 4CCCA 2R30A 5K7PA 4BLIA 4EQVA 4P9LA 1YQ8A 1QJFA 4HXCA 1W39A 4V2VA 3ZXGA 1SQ4A 1HRV2 1O5LA 3NMBA 2CNAA 1Q8OA 5A33A 1FYUA 3WF0A 4K3UA 2WT0A 3Q8BA 1PMJX 1F5FA 4JDNA 1UIJA 1GV9A 5KXCA 1H8TB 1OI6A 2QQNA 3ALQA 2P34A 3FJSA 1EUTA 3WQ1A 4Y1UA 5FPBA 1W9FA 5BNPC 1Q8VA 3KGLA 4XF9A 4YW1A 5GLUA 5IVYA 2VQTA 4M00A 4MGZE 5C3PA 4Q4V3 1C5HA 5B4XA 5J7MA 2ZOEB 4CDQA 5LEJA 3MIBA 4P02B 3ZDSA 1UMZA 3OUIA 1GKBA 2MNGA 4L92A 4NJ4A 1KEXA 1PNGA 4CCOA 1R081 5CNAA 1VBE3 1NE4A 1S0EA 2AEYA 1PVC2 2RVAA 3AZVA 1O3QA 1JZ2A 2JG9C 1COV3 3UJQA 1OF3A 3ACHA 3I97A 3RZZA 2KA3A 3GGLA 4RR3B 1OSGA 1CZVA 3I2HA 4NAMA 5IJRA 3V0AA 1QJU3 2YZ4A 3VBRC 2RS53 1TE1B 3T2TA 3DF0A 2JKBA 1O5UA 1HLCA 2PAEA 3ETQA 2HWC1 4WVWA 4YM0A 5IT6A 3V56A 4RQPB 3WP5A 5JLVA 5K0UC 1NOVA 1DQ6A 1EV12 2XHKA 1YO8A 5DDJ1 2Y34A 5BY5A 4XILA 2XPJA 3MF6A 1W6NB 4B7EA 4DRRA 3UESA 1YWKA 4XUQA 2B9VA 4YGDA 4DRVA 2ZXQA 4GQ7A 3E6CC 4NRQA
chains in the Genus database with same CATH topology
3TNQA 3CJIB 2AH2A 2UY8A 2PTMA 4LHNA 5FFOC 1OD5A 4Y1YA 2D7FA 3APBA 3EQEA 2XG3A 2NYYA 2SBAA 2WQZC 4R9AA 5FLIA 4W6YA 1JUHA 4BMBA 4CDUB 2K9ZA 3H3UA 2GH8A 2GALA 4YGBA 5CVRA 5E88A 3ZYPA 2P3JA 4AVCA 5SV5A 1HKDA 1CQ9A 1OQDA 1DFQA 4QQOA 4LEJA 2VW1A 1VJ2A 4OI2A 3FC0A 1RUF3 1PIV2 3CLPA 1OA3A 3WD5A 3B02A 2GNBA 1LHVA 1ONAA 5J37A 3CEWA 5BUVA 1COV2 1R092 4JAAA 1QF3A 1BJQA 2WNVB 2DVGA 1ZZCA 3FUOA 1J3PA 3N7MA 4AHXA 3VZOA 1WA4A 3HR9A 4EROA 5EXOA 3IIAA 4YW5A 2E6VA 1UU5A 4OUSA 3BOWA 1GYKA 2FQPA 4WM7C 4AGGA 4LBOA 3POWA 4AGRA 2XJPA 3V64A 2AUYA 1AR71 2VW0A 2IC1A 4YW2A 1LOFA 5FCCA 3LOBA 1PK6B 2WNEA 5CFCA 4XFFA 1O4TA 5C8CB 3VBFA 2ETEA 5K9YA 1QJX3 4I0BA 3G7DA 2A6XA 3WQ7A 3ZFGA 4INDA 2Q8OA 2GC0A 3LSEA 1O4YA 2Z42A 1BXHA 2A6VA 3VBSB 4IEVA 1LENA 4Q4V1 4IQPA 1RVF3 3EHKA 3K51A 1MEC3 4UW4A 4WVVA 1QDOA 1O3SA 2YROA 3RQ0A 2XBO3 1GZ9A 3EXUA 3WG3A 1VBE1 4IEUA 4AHYA 3ZYRA 5FLHA 1COV1 2B7YA 2PLV2 4FOYA 4Q26A 2DYCA 2B46X 1QJU1 3FBMA 2RS51 1RUF2 4XQWA 2EF6A 2A7AA 4NWWA 2JG8B 4XIOA 4CP2A 2HWB3 1NCRC 1XU1A 3FFZA 2YHJA 1RMU3 1J1LA 1BEV3 4KWJA 3J9SA 3VHRA 4N7IA 2QVSB 1RINA 5J48A 1ASJ3 5H9QA 2BTVC 3VBOC 4YVWB 2WNUB 2NN8A 4DY5A 4E4ZA 2A6YA 4C90A 2LALA 1L3JA 3FUQA 1NXD1 4L11A 3AMQA 5FBZA 4BMEA 3UV9A 4GWNA 4IL7A 2HKXA 2E7QA 3WCRA 4COYA 1QJZA 2QQPA 2Z2SB 3WR0A 3HQXA 5A32B 4CDWA 5LK5A 1R1A3 4OI1A 4Q4Y3 1EPZA 5ABJC 1DYKA 4Y20A 1CAUA 4G4FA 3R4SA 1RUG2 1M4WA 1AYM2 1QJX2 1NY72 3S30A 4QM8A 2VG9A 5I93A 1ZVFA 2IXIA 5EZWA 1V70A 3KT1A 5DZFA 4FOQA 3TNPB 2XVKA 5E16A 2UYBA 1RVF2 1K5MC 1RUF1 1MEC2 5T55A 1GFF2 4NWVA 1PGW2 5DXDA 2XBO2 4LO7A 4H7LA 1AL22 4QGNA 4QPGA 2B42B 4LTAA 4Z2WA 4XJ9A 1MZEA 2H6CA 3MPBA 3WX5A 4L2NA 4PIYA 1LULA 5HCFA 2R1BA 1QH6A 2O1QA 1CESA 1RMU2 1BEV2 5FO9B 3QOPA 4XZPA 3RNSA 3ZFEA 5CIRA 1GZCA 1WCKA 1LHWA 1W6MA 5DG2A 2WZPP 3WDTA 1KJLA 1AUYA 1YNAA 1RUJ3 1Y3TA 4PDWB 3HWJA 5GLZA 3LCPA 1QJX1 3MEPA 1NY71 4Q0PA 4GB33 3SH4A 1RJ8A 1KRIA 1W6PB 4IV1A 2WKKA 5T50A 2RJLA 1H9PA 1RVF1 4QQPA 1MEC1 4ES8A 1ULDA 3I4IA 1V6MA 4QXKA 3VDDA 3I8TA 4U36A 3M3EA 2XBO1 1WUVA 4C1XA 4CDQB 1FNYA 1MS8A 1RUH3 5AC93 4P9XA 2A3XA 2TEPA 2HWF3 2W68A 4CDXA 4P9YA 2BYVE 2SLIA 3LKJA 3VZNA 3KD4A 4DXZA 2X5IA 3V0AB 4CYDA 5C9AC 3CL1A 2NPIA 4EWEA 2HWB1 2CWSA 2FBEA 4ZU5A 4B3NA 1LEMA 1REDA 4AQ6A 4MXWB 2AR6A 2DCZA 2A5ZA 2GC1A 3AMHA 3B00A 4H55A 1UCXA 1RUD3 1RMU1 4GMP3 2OA2A 3S6PA 1YUDA 1BEV1 2GNTA 1S0IA 3KS7A 4IETA 4HKLA 4WZFA 4COUA 2QE3A 1W0PA 1ASJ1 4YYOA 1NLRA 3CJIC 2D40A 4ITCA 5GLTA 3ZXJA 2E9QA 3VBHA 1FAYA 1QNYA 3VKOA 1VAKA 1MS4A 4OHWA 4ASMB 3L9JT 1MS5A 2Z5WA 4Q1PA 1J3QA 1R1A1 3KCCA 4Q4Y1 1PO13 1RUJ2 3GZTB 3SCFA 4EN6B 1IS5A 2D97A 3DPRB 2CGOA 4GB32 3MIFA 4QMAA 5LK7B 4HZFA 4L97A 3ZXEA 4AEDC 2YPJA 3RI9A 2D93A 2UYAA 4RSUA 3D4KA 4AW7A 4BIFA 4ZXKA 4I0WB 5L36A 4AK3A 3ZMNA 4QPIA 4OUMA 3LB9A 1YI7A 4XFCA 1RUH2 3AP4A 1QU0A 5AC92 5K8SA 2GH2A 1CIWA 4AQ2A 2HWF2 1QOOA 2ZGMA 3J8F3 3RWNA 2DUQA 5BNPB 1BKZA 1OA4A 2VOWA 5A3LA 5JDBA 3H0OA 3TN93 1U12A 3SNMA 1RUD2 1NE6A 3PHMA 1CN1A 1FATA 4F3JA 1AJKA 1AZDA 1MZFA 3M7AA 4XJZA 3R4UA 2VVFA 3DN7A 4YRDA 3NKTA 4NHKA 1PK6C 2JG9B 2H0VA 3IDEA 4LULA 3D0JA 2RE9A 3VBRB 3ZXLA 1RUJ1 4M0NA 4HPKA 3JBG3 1YJKA 4IEOA 1DGLA 3QH6A 5H9PA 4FPLA 1MS3A 4GB31 1QXPA 3LWCA 4B7KA 4UXAA 1QOTA 1RUOA 1BMV1 3HBZA 2VUJA 1YRZA 1U5YA 2XL7A 4JQRA 4AWDA 1TNFA 1REFA 1OPOA 1WLDA 3ZXKA 5D8AA 3D6EA 1DQ4A 4ONUA 2GN7A 1C3HA 4RL7A 2P3KA 4E4DX 3RJ2X 1AR63 2QZ2A 1RUH1 2QFEA 1CJPA 2EXKA 5AC91 5J36A 2DF7A 1UZZA 2JG8C 3AZZA 5C8WA 2HWF1 4Q1RA 2IXHA 2ZPXA 2Y38A 3RSJA 5BPXA 2RMU3 4LO8A 2PHLA 4P9GA 3WP6A 2GC3A 3FLPA 2XUMA 1JTZX 1V9U3 2ZX4A 3QLQA 4FSJA 1V6LA 2QCSB 5D1IA 4D7SA 5DZGA 1MS9A 3AMMA 1PVXA 2I07B 1YI9A 1RUD1 4GMP1 3MIHA 1W2UA 2H0BA 4I30A 4YVWC 3QCWA 3LGRA 1SLAA 1CAXB 2EXHA 5GZFA 3SISA 2AYHA 1O3TA 1WLCA 4FXKB 3AJYA 2WLPA 1NCQA 3TN92 4SBVA 4XIKA 3WVJA 2AGSA 1V6OA 2XH6A 4HSJA 4I02A 5C4WC 1WCDJ 5HBAA 4IESA 1LU2A 1F9KA 2GSYA 3LOIA 4QHBA 1QMJA 5EJ3A 1PO11 3V0BB 2D6PA 5I0TA 4CDWB 4LBMA 1ZZ9A 2DVDA 4N53A 1MR5A 4Q4X2 3BODA 1UL9A 1VLNA 1OKQA 1QXRA 1N47A 3E97A 4XBQA 3N35A 1A8MA 3DKWA 4WM7B 1F5JA 1S0GA 4UBHA 4YARA 1FOD2 3VHOA 3ZSJA 3ELNA 3ILFA 5JSRA 2HYKA 3CU7A 4XOGA 1OLRA 3E5XA 1ALYA 3AP9A 2XLAA 3UKNA 5TSWA 1AXZA 2Q0AA 2VPVA 1OFSA 4RFT0 1A78A 1QJY3 3J8F1 2QZ3A 3AB0A 3N3HA 1JN2P 4QPGB 1V9U2 4GMP0 2WLQA 3ZN6A 1UW8A 4FPOB 4EN0A 3JZVA 3ZSLA 4AQSA 3TN91 4K1YA 3VHPA 1VBA3 2JD4A 4EN8B 5F6LB 4YGEA 2ZJCA 2Y0IA 5CBLA 5GZGA 4S2GA 5KHHA 3ZN4A 3ZFEB 3GF6A 1SLLA 3GALA 3ENRA 3JBG1 1N1SA 1WLTA 4XF4A 2VXRA 1NCRB 3AZWA 4JGZA 4YZ5A 1B09A 4YGCA 2HWD2 1GBGA 3KGZA 2DTWA 3INAA 5KXBA 1ND3A 4FAHA 1OQ1A 2W0XA 1W6QA 3ZFFA 4B4RA 4URTA 3MLJA 5BNNA 1PO23 4R9DA 4IV1B 2WL1A 1HIXA 3VBOB 4CDQC 1AXKA 4C1WA 1CD3G 1TME3 3H9AA 3I59A 1FMD2 1AR61 3VDDB 1D2QA 1DG6A 2YYOA 5JVVA 3ST7A 1Y43B 4FTSA 1ZA4A 4CEWA 1S2BA 3NV1A 1N3OA 5FDBA 1RUNA 5JZGA 4FPKA 2RMU1 1YHFA 2XJVA 2DUOA 3ILRA 4BM8A 3JUUA 2ZGQA 4CDXB 1V6NA 1V9U1 5BXXA 5ABJB 2IFWA 3NWKA 2XVLA 1UZYA 4DINB 1PZ7A 3NAPA 2PAMA 1F2NA 3O12A 1UF2C 2X8KA 4HANA 4JTNA 3B5LB 3M3OA 1YIFA 2ARXA 3ROUA 1FNZA 1CPMA 1R082 1K5MB 2XJTA 4FP2A 4FPGA 5J98B 1LESA 3AKQA 4P9JA 3NL1A 1UU4A 1CAWA 2DWRA 5JAXA 4XMIA 1C8M3 1G9FA 1IPJA 1U5XA 5DDJ2 1JHNA 3AJZA 4JCKA 3WP3A 3AFKA 3WDWA 3DGTA 4BPZA 1Q8SA 4KG8A 2LUWA 1SACA 3WW4A 4N9IA 3WDVA 1SDWA 2PFWA 1PO22 1SMVA 1YCIA 2HEVF 3VBUA 1BCXA 1XNBA 2BNMA 1ULCA 3NW4A 5SV8A 1TME2 4KQ7A 3RMYA 2JDZA 3NKGA 4HKWA 1QH7A 5JWPA 3ZXAC 2ZHKA 2JX9A 1R1ZA 4MLOA 1QJY1 1FXZA 1SLTA 3IDCB 4QD2A 4JC1A 2CAVA 2ET7A 1ND2A 1Q56A 1IPKA 3THPA 4A7YA 1VBA1 3LA2A 4XQ4A 5C33A 2IXKA 2Q4SA 2OPKA 3OGJA 1RUC3 1ZBA3 4CEYA 3ZSMA 4EN7B 3KCYA 2B39A 5BNQA 1LOFC 2UWBA 1OOPA 3OD0A 4HK9A 1NQDA 5CFCC 5LRSA 4OHYA 4A3XA 5C9AB 3ZSEA 3VBFC 3KT7A 2DV9A 4R9BA 1POV0 2WFF3 3ZFGC 4PJYA 1C8M2 3WCSA 3R0RA 3T1MA 2BWAA 2WFPA 4MGIE 2DU1A 3KCXA 4AFMA 1T6GC 1XU2A 4HETA 1PO21 2OW4A 1G9CA 3AM2A 3P3NA 1AX1A 4WZCA 1I9RA 3OGGA 1Q3EA 4AFDA 3MW3A 1TME1 3WDUA 2WT2A 4Y24A 4BIOA 2RJKA 4QGLA 3WLUA 3BTAA 1UD1A 1AR72 4HT1T 1ENRA 4LLOA 5FTTC 4QT6A 3SH5A 4JVAA 2MEV3 2E51A 3AKRA 2B9UA 3DL3A 1KDMA 4YW4A 1JH5A 1VALA 3IPVB 4F83A 1M06G 2UY9A 3BIWE 3DV8A 4Y1XA 3O0VA 4FAGA 3SCHA 1H2NA 4MXVA 1S2KA 1VBC3 1RL3A 1N3PA 2ZZQA 3MYXA 4X8PA 1V00A 4K6BA 4Q4V2 3K48A 2Z69A 4AEDB 3VZMA 4LBNA 3PMSA 2ZAHA 3S7EA 4Y4YA 1VBE2 2YDEA 5DUWA 1ZZ8A 1QDCA 2XWJB 1NCQB 1QXJA 3GNEA 1RUC2 1QJU2 2RS52 2Y0OA 1C8M1 3A0NA 3ECQA 4SLIA 5HI0A 4CDWC 4HVRA 4NHMA 2D6MA 1I1EA 3ZSKA 2F4PA 2HJIA 2Q5TA 2D3RA 2R073 1RTVA 2ZHMA 2NM1A 4WVMA 3VKFC 3LAGA 4PLMA 1A8DA 2BQPA 1ENXA 3ZYIB 3O0WA 4DY3A 1Q5OA 4B8EA 1GANA 2QDNA 4XF3A 1S0BA 4E4SA 1PMIA 2QDRA 4EWAA 4YG0A 1KS5A 3KT4A 4QPGC 4C0BA 1Q43A 4QQHA 2WT1A 1AX0A 1I5ZA 2IWGB 3GHNA 3MFCA 3N7JA 4Y22A 2JE9A 4Z1VA 1HW5A 2ZMLA 5F5QA 1F8VA 3T1LA 1LEDA 1ZBE3 3OY8B 3B7MA 3X29B 1VIWB 3GYDA 1HQWA 4KGQA 2OIIA 1RUC1 3ZFEC 2ZX2A 1ZBA1 4WVZA 3MW4A 2ZMNA 5EYXA 1KITA 1LJ7A 4RS5A 4ATEA 4COZA 2ZKNA 2RS13 5BV6A 4AEJA 1AL0G 2VY0A 1OFNA 1HV1A 3E6DA 2WFF1 4LBJA 1N1VA 1MS1A 1RHI3 4KG0A 4AFAA 4IV1C 1QWRA 1VRH3 4IEQA 4AI8A 2AREA 4G9SB 1H8VA 1NA1A 3UKVA 3KB5A 1IKPA 1SBDA 4HFSA 3HN1A 4FPHA 2ZZJA 1W6QB 4A2UA 4W6XA 2XJQA 3VDDC 1HDKA 4FVVA 5E89A 1SFYA 4LBQB 2BVVA 1IQAA 4X8NA 1MACA 1X8MA 2A73B 3I59B 4RA0A 5C4WB 4NVPA 4CDXC 1B35A 1GLHA 2BUKA 3QD6A 4FOVA 3AXEA 2MEV1 2X5IC 2ZA9A 4XF1A 1WCSA 4KWKA 2GNMA 1WW5A 3MIGA 1DQ2A 1WGPA 3WQ0A 1C5IA 4YZ1A 3WXPA 1VBC1 3ZXDA 2VOKA 1SBFA 4CZSA 2OZJA 5FREA 1J3RA 3NAPB 3ZYGA 4C91A 3VBHC 2X29A 5CFDA 3J26N 2I2SA 1ZZBA 1IS6A 1ZBE2 3U11A 3WOGA 3S0MA 4JV4A 2ES3A 4AHWA 1EY2A 2VU9A 5GZEA 3RYKA 1CAWB 2RS12 4FO9A 2ERFA 2HWB2 2AENA 3B3QE 5GJ6A 2R071 2YC0A 4FCAA 4Z92B 1X50A 1RHI2 1ASJ2 1W6OB 1ULEA 1VRH2 4R4ZA 3NVCA 2FHRA 2GDFA 3PNAA 4YVSA 4Q8KA 1BVVA 2PYTA 2VQAA 2ZGOA 4K8FA 1ULGA 2EALA 4GH4A 5J96B 3V65A 4FPEA 4QPIC 3D0SA 4XFAA 4MUVA 2VULA 5A33B 2IFRA 1H2KA 3MIEA 1R1A2 2BNOA 4Q4Y2 3WP4A 4GULA 4RD7A 1IS4A 3GZUC 5HCAA 1QOSA 3SCGA 1X82A 4PBPA 2A6WA 4XXAA 2DURA 1CAVA 3M4FA 1ND2B 1ZBE1 2R16A 5EWSA 1PZ8A 3M8LA 4DZGA 3VL9A 1GZWA 3VV1A 4ATFA 2NP0A 4S2HA 1DQ1A 4H3WA 2RS11 1ENQA 4J1XA 4XFGA 1GQHA 3N7LA 3IBMA 4IERA 3USUA 4IXLA 1OOPB 3KZ4C 5I0SA 3D5OA 3C2UA 4XHXA 2QUOA 4IV3A 5F9TA 1ZRCA 1JYIA 1GQGA 1RHI1 4FPFA 4PIXA 3O7OA 1VRH1 5FRAA 1WD3A 2V5YA 2CYFA 2VQ0A 1SBEA 3H50A 5D8AC 1G9AA 3RRDA 4GIQA 1PGSA 2BFUS 1JUIA 4M3CA 1EYBA 2BNNA 3BU7A 3L2YA 1LB2A 2ZGTA 4FPJA 1D0GA 5T5OA 4JTOA 4DNYA 3VZJA 2D6NA 3RPQA 4ASLA 4X6QB 4IEZA 5CG9A 2ZHNA 3JCIA 5J3UA 2PQQA 2ZX3A 5FQ0A 4FOWA 3SXWA 1RITA 1AX2A 2DFCA 2HEWF 3NO8A 4CRQA 1BMV2 2ZGRA 2JICA 2DVBA 1G86A 2JENA 3AX4A 1ZRFA 2VOVA 4K9SA 4E2SA 4AQTA 2AZ5A 4XXPA 1NCQC 3MW2A 1RUI3 3OPZA 1I6XA 2XVGA 1KFXL 5ACA3 5IUQA 4LUMA 3VKNA 2Q1MA 5I8TA 3QH7A 4OI0A 2RS33 2ET1A 3H7JA 3BOPA 4F8AA 3SH3A 2ZMKA 4BA6A 4P5HA 2ZACA 3OD4A 4YZ3A 3POYA 4N53C 4KH9A 5KHGA 1H8TA 5E1RA 4BE3A 4Q0SA 4M3CE 3WINE 2BVBA 3PVBB 3N36A 2IZWA 1LECA 5KHKA 4JGYA 4MYEA 2R32A 2GN3A 1LU1A 4LUKA 5CFCB 1XNKA 2D6OX 1WBLA 4RR3A 5T54A 3RDIA 3VBFB 5IK5A 1D4M3 3H3ZA 2D6LX 2I74A 4RHV3 1N1YA 5KHJA 1ZX5A 1PO12 2GAUA 3ZFGB 3D8CA 5GZDA 2RR13 2ZGUA 4RQPA 4LO5B 1MQTA 3ASIA 3TWIA 2E7TA 2MPFA 2YY1A 1KXGA 1ZNPA 4Y22B 1V6KA 3H8UA 2TBVA 3WZ1A 2XKPA 2XGXA 4XYXA 1WMDA 2ILMA 1JYCA 2Z79A 4BHPA 5FO8B 4LNVA 1A3KA 2OZ6A 4DMIA 4UW6A 2GC2A 2VMHA 1RUI2 1UPSA 3R4DB 2NMOA 4Z07A 2QKDA 1Z78A 3OBRA 1C8NA 4XMAA 4HSLA 1H2LA 4PLOA 2XJRA 3M1HA 4BWOA 2R49A 2BEOA 3DUIA 3J8F2 2RS32 1DQ0A 2VOXA 3TB0A 1DF0A 2GU9A 1VB2A 4CDUA 3ZFFC 2LM3A 3JB8A 4PCRA 5BNNC 5I8YA 3FX3A 4D7TA 3AZXA 4MGYE 1AR83 2O8OA 5JR7B 4TLFA 1XRUA 2C5DA 4K21A 4EJRA 2LTNA 2WS93 1S0DA 4XETA 4CEWC 1Y7BA 3USSA 3IN9A 5JZGC 2P2KA 1U5ZA 2ZBJA 3JBG2 5E8AA 3EJKA 3N7KA 3KMHA 1EPWA 1ULFA 5AFEA 4Y20B 1YLLA 1CAUB 1CR7A 4EV0A 1D4M2 3PJYA 4QPYA 2WNVA 1OPMA 4QQLA 4HBNA 3NAPC 4HMZA 3B69A 4RHV2 5CU1A 5DUXA 4ES9A 4Y26A 2WWSA 2RR12 4N43A 4BH9A 1JBCA 1PHMA 1AR93 1RUI1 3IMNA 5CG8A 1WW6A 3NJZA 4AFBA 2F6BA 1AR62 1UX6A 2H6BA 2IXLA 1VBD3 2VH9A 5ACA1 4P9IA 2GZWA 3VKLA 1ZZ7A 4AVBA 2RMU2 2RS31 1VBB3 1XE8A 4N7UA 2FZ1A 2XL9A 5C8CA 4GA9A 3ZXFA 2W39A 3AKPA 1SFNA 3VZKA 3M3CA 2XJUA 1DGRN 2A70A 4Q0UA 3ZO0B 5GLWA 2D3SA 1A6CA 1BZWA 1XQNA 1NZCA 3VBSA 3W59A 2WINB 4DFSA 2CY6A 1W6MB 4AVSA 1FV2A 4R8HA 1AR82 3H7YA 5LEKA 4NPRA 4AG4A 3VBUC 2ZHLA 4E9KA 2EA7A 2VW2A 4Q2FA 3OF1A 1D0HA 4GH4B 2UURA 1D4M1 2WS92 3FBYA 2QNKA 4RHV1 3UKTA 1YYNA 3AKSA 1KD7A 2D6KA 5FPZA 2YMZA 2XLFA 2RR11 1YJLA 1SLCA 3O14A 1ND2C 4TSVA 5JCTA 3LSDA 3AYDA 1LOCA 1J59A 4B4QA