4Q4V2

Crystal structure of coxsackievirus a24v
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
264
structure length
264
Chain Sequence
GYSDRVRQITLGNSTITTQEAANAVVAYGEWPSYLDDKEANPIDAPTEPDVSSNRFYTLDSVQWKSTSRGWWWKLPDALKDMGMFGQNMYYHYLGRSGYTVHVQCNASKFHQGALGVFAIPEYVMACNTEAKTSYVSYVNANPGEKGGVFDNAYNPSAEASEGRKFAALDYLLGCGVLAGNAFVYPHQIINLRTNNSATLVLPYVNSLAIDCMAKHNNWGLVILPLCKLDYAPNSSTEIPITVTIAPMFTEFNGLRNITVPATQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coxsackievirus capsid protein VP1
publication title A sialic Acid binding site in a human picornavirus.
pubmed doi rcsb
molecule tags Virus
total genus 61
structure length 264
sequence length 264
ec nomenclature
pdb deposition date 2014-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4q4v200
4Q4Y2 2WWSA 1D4M2 3ZFEC 1R091 2IZWA 1RUD1 2RS32 1QQP3 2HWC3 4PDWA 2MEV1 4GB32 1NY71 1H8TA 1PO22 1ZBA3 1GFF2 2X5IA 3DPRB 1RUC2 3ZFFA 4Q4V3 1TME1 1CJDA 1F8VA 1DDLA 1ND2A 3JB8A 4PDWB 1FOD3 2DF7A 4CEYB 1TMF2 3JBG3 2RMU3 3TN91 1RB8G 1FPN1 3VBFC 1H8TB 1VBE3 4CDQC 3S6PA 4QPGC 5ACA1 2X5IB 1COV3 3VBOB 3VDDA 4CEWA 1OPOA 4RFT0 4AEDC 1EAH1 1RUF2 1VBD2 1FMD2 5BNNA 1BBT1 2RM21 2R071 3J8F2 5CFCA 1AR63 4CDWB 1PGL2 2R041 1QJY2 1VB2A 4YVWA 1NCQB 5AC92 2BFUL 3VDDB 1RMU3 2RR11 3DPRC 1AYM3 1RUJ2 5BNNB 4RR3A 5BNOB 2FZ2A 4Q4Y1 4PDWC 4IV1A 4CEYC 5CFCB 1ASJ3 1HRI3 1K5MB 5L7OA 1H8TC 1AL21 1RVF2 4GH4A 2X5IC 4GB31 4SBVA 4RS5A 1AL0G 3VBRB 3VBOC 1AYN1 5C9AA 2XPJA 5BNPA 3JD72 2HWD3 1RUE2 1VRH2 4RHV3 1RUC1 5L7OB 2RS52 2HWB1 1ZBE3 1TMF1 2HWF3 4CDWC 1NY72 4RS5B 1NCQC 5K0UA 3VDDC 5C9AB 1RHI3 5BNPB 4Q4X3 5C4WB 1VB4A 1R082 5BNNC 5BNOC 4GMP3 5CFCC 1AR82 4N53B 1EV13 1FMD1 2WFF3 4LLFA 2RS13 1K5MC 5K0UB 1HRV3 1BEV2 1PGL1 1AUYA 1ND3B 2RS33 4JGYB 1MEC3 1QJY1 1MQTB 3VBRC 2WS93 1VBC3 1EAH2 2QQPA 5FMOL 1PO23 3ZFGA 1POV1 1RUJ1 2R072 1AR73 5L7OC 1C8M3 4RS5C 3VBUA 5C8CA 5C9AC 1RVF1 5JZGB 5BNPC 4CDXB 5C4WC 1RUH3 4Q4V1 1RUI3 3JD71 1RUE1 1V9U2 1VRH1 4JGZA 4N53C 3CJIB 4WM7A 1AL22 2RMU1 1VBA3 2RS51 5C8CB 1RUF3 5K0UC 1C8NA 1ND3C 4NWVA 4JGYC 2VQ0A 1MQTC 3J8F3 1AYN2 4IV3B 4RQPA 2HWE3 1R081 2XBO2 4WM7B 2GH8A 1NOVA 4FSJA 2HWB2 2WZR3 1QJX3 1PO13 1AR81 2R062 1AR61 1B35A 1AR93 1RUG3 4Y5Z0 1BEV1 2PLV1 4Q4W3 5JZGC 2ZZQA 3ZFFB 4CDXC 1IHMA 1ND2B 5J98B 1PVC2 5D8AA 3CJIC 1R093 5C8CC 1RUD3 4Y4YA 2GSYA 4GMP0 2MEV3 4CEWB 4IV3C 5DDJ1 1QJU1 4QPIA 1HXS1 5D8AB 1VBB1 2HWC2 1TME3 1V9U1 1R1A1 2HWF1 4YVWB 2BPA2 3ZXAC 1OOPA 1WCDJ 1ZBA2 3TN93 1FPN3 5FMOS 3VBSA 5ACA3 1X33A 3ZFFC 1PIV1 4RR3B 4Q4V2 4N43A 1ND2C 4IV1B 1BMV1 1NCRA 1FOD2 1EAH3 2RMU2 2XBO1 3HAGA 1OOPB 1VBE2 1NA1A 1BBT3 2RM23 4GH4B 2R061 2R073 5A33A 4CEWC 5CFDA 2R043 3NAPA 1Z7S3 3VBHA 1NCRB 2RR13 5LK7B 5D8AC 1HX6A 1NA1B 4WM8A 1AR62 4Q4Y3 1D4M3 1PVC1 4YVWC 5A33B 3M8LA 5CFDB 1RMU2 2PLV2 1AL23 3VBHB 1AYM2 4GB33 4RR3C 2ZAHA 4IV1C 4WM8B 1HRI2 3IDEA 1RUC3 1OOPC 1PGW1 1OHFA 1QQP1 2HWC1 1VBA1 4Z92B 4GH4C 1VAKA 2HWB3 1TMF3 5DDJ2 1ZBA1 4BCUA 4NWWA 4CDQA 3ZFGB 1QJU2 2HWD2 1NCRC 1HXS2 1VBB2 1ZBE2 1NA1C 1FOD1 1R1A2 2HWF2 3JBG1 1QJX1 1AR91 2BFUS 3VBUB 1VBE1 1VBD3 5CFDC 1FMD3 1CD3G 3VBHC 1COV1 1PIV2 4Q4X2 1QJY3 1BMV2 2ZTNA 5FOJB 5AC93 4WM8C 4JGZB 1EV12 5J96B 2WFF2 2RS12 1POV3 3DPRA 1HRV2 2BBVA 1RUJ3 1MEC2 4FTBA 4CEYA 4RQPB 2WS92 1RMU1 1VBC2 5ABJA 3ZFGC 1RVF3 1E57A 1AYM1 1AR72 3VBOA 1B35B 1ASJ1 1C8M2 1HRI1 4EJRA 3JD73 1RUE3 1VRH3 3VBUC 5ABJB 2RS53 2Y26A 1RUH2 4CDWA 2BUKA 1RUI2 1NCQA 2HWD1 1W39A 4RHV1 1QJZA 4JGZC 4WM7C 1PGW2 1QQP2 1VBA2 1R083 4YVSA 1ZBE1 5BNOA 1AR83 1NG0A 4RQPC 1K5MA 1RHI1 1Z7S1 2HWE2 4QPIB 4Q4X1 1BEV3 2PLV3 1X36A 4CDUA 4GMP1 3LOBA 4YVSB 3VBRA 2WZR2 1QJX2 3JBG2 1PO12 1B35C 1AR92 1EV11 1RUG2 2WFF1 2RS11 1D4M1 1HRV1 1F2NA 4Q4W2 3VBSB 5ABJC 1COV2 2RS31 1MEC1 3FBMA 2WS91 4N43B 4CDUB 1VBC1 5DDJ3 4FTEA 1PO21 2FZ1A 5GKAC 1SMVA 1QJU3 1R092 1AR71 5C4WA 1HXS3 1RUD2 1C8M1 1VBB3 2MEV2 3ZFEA 1V9U3 3NAPB 1R1A3 4N53A 1POV0 4QPIC 1RUH1 1ND3A 4JGYA 1AYN3 1MQTA 1PIV3 2TBVA 1RUI1 4YVSC 1TME2 1ASJ2 4FTSA 3ZFEB 5A32A 1RUF1 2WLPA 1VBD1 2XBO3 3TN92 1FPN2 3VBSC 5ACA2 3J8F1 2R063 4N43C 4CDUC 3VBFA 4RHV2 4QPGA 1M06G 5AC91 2HWE1 3JB4C 5JZGA 5A32B 4CDXA 1BBT2 2RM22 4AEDA 2WZR1 1PO11 1RUG1 2R042 3NAPC 1PVC3 1RHI2 1Z7S2 4Q4W1 3CJIA 1A6CA 3VBFB 4CDQB 4QPGB 2RR12 1HQNA 4IV3A 4AEDB
chains in the Genus database with same CATH superfamily
3K4DA 3GJAA 4QHZA 2IUWA 3KV9A 2OA2A 3ZFEC 5J09A 4UOJA 4OZOA 3MEPA 1DQ2A 4TLFA 2IZWA 2RS32 3SNMA 1H2NA 2B39A 3OUIA 3I3MA 3DGTA 4OYUA 2MEV1 2VZQA 5IWFA 2ORZA 4E8DA 2VZTA 3FZ3A 4XAEA 5C3QA 1GQPA 5EV7A 1PO22 2GMPA 5B2GB 4CPBD 2DUQA 1S0JA 4P14A 2ZS6B 4PIXA 4XIOA 4AVVA 1J59A 2JDNA 2CAVA 3AMHA 4Q26A 4Q4V3 1CJDA 2Y6GA 4OUSA 4W6YA 1WW6A 2Q1MA 4PDWB 4CEYB 2DF7A 4UAPA 3WHTA 4PLNA 4Q1RA 4QM8A 3TNPB 1NQJA 1CWPA 4NRMA 1H0BA 1LOAA 2WBKA 1WCUA 4XUNA 4L11A 1VBE3 4CDQC 1LB2A 4D3WA 3PVNA 2C9AA 3MZHA 1RIRA 4BZ4A 5A1FA 5I0DA 1COV3 5F5IA 3O1OA 4CEWA 1OXCA 2QQJA 1X7NA 5GZCA 1BHGA 3TEWA 1AVBA 2G9ZA 5LEJA 4WVZA 2CSGA 3VKNA 4BB3A 1F9KA 1UWWA 2B5HA 2RJ2A 2NQYA 3O1RA 1VALA 4BQ3A 2ZHMA 4FFGA 3N9MA 4RGAA 4XFGA 1SDDB 2R041 3LDBA 2JDUA 1JN2P 4WVWA 3NW4A 1XE7A 3MFCA 5FYMA 5I0SA 5FWJA 3ORJA 1LU1A 1O91A 1PK6B 3PIGA 4K8RB 2XONA 4XQDA 3J26N 4XJAA 3RYPA 3K48A 1OH4A 2CNAA 2E7TA 3I97A 2FZ2A 4FAGA 3UKNA 4Q4Y1 4BQXA 1WA4A 1T2XA 3POIA 4M3CF 2KXLA 4Q27A 5DN2A 4LBQB 5FR3A 5L7OA 3VKLA 2EVXA 3MIFA 1UMZA 3IB3A 3O0XA 5FZOA 1YIPA 2X5IC 2ET1A 2XKOA 4SBVA 1PZ9A 2WT0A 3VBRB 5T5LA 3ROUA 3SMHA 3VBOC 3AZVA 5C70A 3L2YA 4C1XA 5BNPA 1WD4A 1ULEA 2IVIB 2J1TA 2A3YA 1XSRA 4AOCA 2WO3A 2BNMA 4GAZA 3JQXA 4XF3A 1FAYA 3HNYM 1V6LA 4LJHA 2PHFA 4MGKE 1PHMA 1TMF1 2HWF3 2JKXA 1UY0A 3MW3A 1N1YA 2OPKA 5TSWA 4CDWC 4RS5B 3TB0A 1Y9GA 4EZHA 4JKKA 2JG8C 3VDDC 5C9AB 1QDCA 3L2HA 1ULOA 2WNVB 1WCSA 2E26A 2DVDA 5C4WB 4UW5A 2OS2A 1R082 1UMHA 2TNFA 3KF3A 4HVOA 1LHOA 2DFCA 2QNKA 3DF0A 4GMP3 1OVSA 2GDFA 4XFCA 5BNNC 3BU0A 3NNLA 3HNBM 3HPNA 4P9GA 2D7FA 4GULA 4NR1A 5CFCC 2VL4A 4JX0A 3N9QA 1EV13 4N53B 1FMD1 3USUA 2R0HA 1HQLA 3T2TA 2GC3A 2OW4A 4UFKA 4AW7A 3AVSA 1HJGA 3LGRA 4Q0UA 3WP6A 3OPTA 2RS33 4NHXA 2PAKA 4QX7A 1AJOA 3EBRA 1W0PA 4MVTA 1VBC3 1SFYA 3ZXJA 5FMOL 1MACA 2MHFA 2YZ4A 1PO23 3WDUA 3KGZA 2JG9C 1J3RA 1XPWA 1RUJ1 3ZSEA 2BZDA 1UYZA 2R072 1ZZBA 1CQ9A 5DAQA 5J3UA 5JXGA 1D0GA 3W21A 4YWAA 3Q8EA 3N9NA 4DQAA 1PGSA 5FK8A 1IPKA 3ZLIA 4FBFA 4Y3OA 5EPAA 5DAPA 1W6QB 3KCCA 3VDAA 5K7PA 3UESA 3GZTB 3CZUA 4I30A 2XH6A 2ES3A 4Q4V1 5FY5A 3KGLA 4B1MA 1RUI3 3D8CA 1H2KA 3JD71 1BQPA 1VRH1 1W2AX 2EIEA 4DINB 5JMCA 3KT7A 3EQEA 4Z07A 4TZDA 3KT4A 1AL22 4META 5C3RA 5C8CB 3HOBA 5JXJA 2WL1A 3H1WA 4QQOA 1C8NA 4LBLA 3V65A 5KC6A 4FAHA 1YWKA 1IQAA 2W87A 5IK8A 4W6WA 1LNSA 2ZGUA 1WZXA 1MQTC 5FUIA 1AYN2 1YFXA 1QXPA 5JOWA 2Z2SB 4Y1YA 2F4LA 1DCSA 2PYTA 3AYCA 1UD1A 2BTVC 4IEVA 3D5OA 2X8KA 1V00A 5JOZA 4IGPA 1Z0HA 4GKYA 1I3HA 3PHMA 5C8WA 2G19A 4PHZA 3H7YA 1ZZ7A 4QB6A 2WUHA 3FFQA 5IVCA 1PO13 3S57A 1Q5OA 4KGQA 1LOEA 3K4ZA 4AWDA 4EN0A 4DRRA 5T50A 4AL9A 4COVA 1IKQA 2WIIB 1REFA 1UZYA 5JR2A 1JZ5A 1LECA 2HYKA 1UZZA 3AMPA 1BEV1 2PLV1 3IIIA 2XJPA 4INDA 5J7MA 5HPOA 2ZACA 4YW6A 4CDXC 1NQDA 3H8RA 4HVQA 3RZHA 1UOFA 4RYDA 1LOFA 1GWLA 3LIGA 2VMHA 3OEBA 2P17A 3DEMA 3ILRA 1Q8SA 4AAXA 3LEIA 5FY4A 2X05A 5CA6A 4UFHA 1RUD3 5DUUA 4CU7A 5DUVA 4KU8A 4GMP0 4CEWB 4IV3C 2E9QA 2DCKA 1X8EA 4E2QA 2VZOA 1GNZA 4A3ZA 4JC1A 3EB7A 3M3OA 2C5DA 4OHVA 1FATA 4UXAA 4QPIA 4HKWA 4QQLA 1HXS1 4ES8A 4AQSA 4UW3A 2XUMA 3B94A 2WNEA 4XEZA 4XUOA 3F95A 4ASLA 4D6SA 1VBB1 2JE8A 3OBRA 1W8OA 2ARBA 5BXXA 2DCZA 3KT1A 2HWF1 5J36A 1U5XA 4P02B 3ZXAC 3JU9A 4Q8LA 5K9YA 2XL7A 2GU9A 5F7UA 1OLQA 1LHWA 5FMOS 1UKRA 4FPLA 4D0QA 5ACA3 2O0OA 2AENA 1W9TA 2D5FA 2XDVA 1JZ8A 1ND2C 3SCHA 2ZX0A 3H9AA 5HCFA 3WQBA 1FOD2 5LA0A 1GOGA 1DG6A 4TYSA 3T3YA 3AX4A 4DNYA 1C1LA 5GZGA 2RMU2 2WAAA 2XBO1 2YC2A 2G1MA 1T6BX 3IMNA 4FFFA 2YPJA 1WBFA 4X8NA 3U0ZA 5FZOB 3ZXFA 4LHKA 1NX9A 2R073 2Q1FA 3A7QA 4M00A 3TRSB 3U4XA 3CF6E 5CFDA 3RS6A 4GALA 3NAPA 2YMZA 1GP5A 5JSRA 5EHDA 2J1SA 3AMNA 4XUPA 2A7AA 2IXLA 3HNMA 4Q2FA 5D8AC 3ZVXA 1G9DA 1W2OA 2D3SA 3CU7A 1HX6A 1NA1B 1QY4A 1XNKA 1ZYBA 4Y1XA 1GLHA 1D4M3 4AI1A 1WUVA 2EICA 2JKBA 2Z42A 3UETA 5A3OA 4IW3A 1AL23 3SH3A 3PURA 2XR4A 5CG8A 2XVKA 4GB33 3KCYA 4R52A 4YPJA 3FBYA 5CISA 4JDNA 3T0BA 2V4VA 3BCWA 1WW5A 3KQRA 1UOJA 2WKKA 4IV1C 4QXHA 1QJFA 2QQMA 1YQ6A 3USUB 3RRDA 1Y3TA 1CONA 4Q0VA 1RUC3 4XTMA 5FO7B 5BYNA 1OHFA 1QQP1 5E88A 5FIXA 2W2IA 1GZTA 3PTRB 2Z69A 2ET7A 4YGDA 1UOGA 1VAKA 3AYAA 5GJ6A 5FYUA 4BWOA 5F37A 4CCDA 4BCUA 4NWWA 1QJU2 2HWD2 4BISA 1QDOA 3AXEA 3KSCA 3AKRA 5BPXA 4UFMA 2SLIA 1JYVA 4LXLA 3BTAA 5HCBA 4CXWA 5KHJA 4XYXA 4H2AA 2RDRA 3B00A 3UGFA 4QGLA 1DU3D 1PM7A 1XYPA 1F5FA 1VBD3 3NQHA 4N7IA 5FRAA 1X9TA 5FZCA 2VUJA 5EXOA 2QQOA 1CD3G 2ZHNA 1G8WA 2ZGNA 3VBHC 2B42B 4FP3A 3WDWA 4CCLA 5KC5A 3LSDA 1UZ0A 1BK1A 1QJY3 1C1FA 1P8JA 1XXNA 2ORXA 2OZ6A 3OY8A 2CGPA 1CX1A 1GUIA 5DMYA 3X29B 4DO0A 4HT1T 3SC7X 4DRVA 2KM2A 2VOKA 4AFBA 1YLLA 2CU5A 5J96B 2EXJA 4IE7A 4KG8A 1POV3 3R6SA 5AFEA 5KXBA 4AAPA 1EUTA 2D40A 5EJ1B 2Y6KA 3SHRA 2BVBA 1K45A 2YXSA 5CYYA 3NV4A 5FXVA 4QKDA 3VHOA 1MS3A 1RMU1 4NRPA 4XCBA 2H0BA 3M3EA 1RVF3 5KWRA 3SCGA 5FP9A 3SCFA 2AC1A 3I54A 4FI9A 1JH5A 4QMAA 1AR72 4E4SA 1YYNA 1SHWB 4LBQD 4PCRA 1OQEA 4CP0A 4EWEA 1HRI1 2VR4A 3FLPA 4K40A 1DGRN 1RUE3 4MYEA 2EIDA 1VMHA 2VCAA 2YC0A 3AP6A 1OI6A 2WZEA 5ABJB 4C91A 2RS53 5KXDA 3WF2A 1VP6A 2L9LA 2W1SA 4ZZ8A 4M3CA 4A7KA 1FNZA 4OI4A 3THTA 1W39A 1WGPA 2TEPA 3WNMA 4JDOA 1A8MA 1PGW2 5A3WA 5B4XA 4TXWA 3NNJA 2YROA 4M3CE 3ACIA 3I2FA 4ZXEA 5H9SA 1EP0A 4CUAA 5IVBA 5BNOA 2R1DA 4YZ4A 2D6MA 3B93A 1HN1A 3AZWA 1AR83 4ZS3A 4LE3A 2OVUA 4V2VA 2VBPA 3M3IA 2BNOA 4UYBA 4EN9B 5FY1A 2ZAAA 1K5MA 1RHI1 3WQ0A 3RNSA 5HI0A 2HWE2 2PTMA 1TVGA 2DYCA 2VOWA 3C7FA 3GDBA 4Q4X1 4QPIB 5DG2A 1UY2A 2IFRA 4H14A 1WWYA 2DVFA 1W9WA 5LK5A 4YVSB 4AGGA 4DXTA 2P3YA 3BU7A 1XE0A 1DZRA 1RUG2 2ATFA 1HB4A 4K7JA 1W8FA 4OI2A 5GZFA 1D4M1 4W6XA 4A42A 3EMRA 5FKCA 2XJSA 4CA9A 4Q4W2 3RPQA 4D8MA 3VZMA 1F15A 1MEC1 1XC6A 3N9OA 3WXPA 2FDHA 3MW4A 2XL9A 4Y24A 1UN1A 4CDUB 2OUJA 4XF1A 4ET7A 5FYSA 1GP4A 4BLIA 4O61A 3T0AA 4YZ5A 2FZ1A 4WZCA 5BY5A 1QJU3 5EFUA 3ZIWA 3C7GA 3DKWA 4CE8A 2ZGKA 1N1VA 2MEV2 1VRBA 2VW0A 3HBZA 3NAPB 1OF3A 2W1WA 1XNAA 1YNAA 2E33A 3FHAA 3GYDA 1EPWA 1POV0 1V6NA 3I3QA 4KNCA 4LO8A 5FP8A 2Q8OA 1JYIA 3T4VA 4XBQA 1KFUL 5DZGA 4QDQA 1OLRA 1RTVA 2TBVA 3ZYRA 4I3PA 1YQ8A 2ADDA 4E9KA 3V0AB 2WABA 1OF4A 1HB2A 4XIKA 3RI9A 2WLPA 1U5YA 1VBD1 2ZGRA 1OPMA 1FYUA 5F6LB 3SEEA 2CWMA 1ODNA 2WR9A 3J8F1 2R063 1N1SA 4ITCA 4N43C 1HJFA 4FPJA 1OH3A 4AI9A 4E2SA 3CIHA 1LEMA 2XKPA 2YU1A 3JB4C 3F2ZA 5FFOC 5JZGA 2K0GA 5A32B 1VMJA 5FO9B 2WZR1 5KXEA 4R9AA 3FUOA 3MIEA 1DGWA 4FOWA 2R042 1V0AA 4Q0QA 4YG3A 3VD4A 4BIFA 3VBFB 1Z7S2 2WSVA 3FE5A 3ST7A 4CVUA 5F9TA 1OD5A 4XE9A 3S5AA 3UT0A 3IDAA 2YFZA 1BJQA 4NHMA 3W20A 4AEDB 1IGOA 2VW2A 4Q4Y2 4XW3A 1NUKA 1YC61 2WWSA 1I5PA 1DGRA 3WG2A 3KVBA 3WDYA 4W8JA 1R091 3HT2A 3VUOA 3PVBB 2ZJCA 3RYKA 4R8HA 2QKDA 4L8QA 2HWC3 4PDWA 2RE9A 2QCSB 3GZAA 4LKEA 4ASKA 4N7UA 4BQ2A 1RL3A 2H6CA 3RMXA 4XUTA 1ZBA3 3WD5A 3ILFA 2VTXJ 2WO1A 2AR6A 2VUAA 1ZZ9A 4IL7A 5E16A 4XF4A 4XJWA 4A4AA 1TE1B 2HYXA 3KHBA 1DDLA 4CU6A 3E97A 2FDIA 2JDKA 3O5SA 1TMF2 2VTXA 1LCLA 4KG0A 1CZVA 5JAXA 1PMHX 2ILMA 4L0PA 3D6EA 4XAAA 1H8TB 2EAAA 5D2AA 3S6PA 1CZSA 4QPGC 4DZGA 1O4TA 4ISRA 3HQXA 2DCTA 4EWDA 5GM0A 1EY2A 2VY0A 4MGYE 4AHYA 1PK6A 1XNCA 4GA9A 3VZKA 3AM2A 2VNRA 3AP5A 4ZONA 5DUXA 1AXKA 2Q8DA 1HIXA 2ZBJA 5IVEA 2XLGA 1FMD2 4UW4A 3ZSLA 3RZGA 2PHWA 2WFPA 2OYZA 3WNXA 1EUUA 1QMJA 1AR63 1D0HA 4Z82A 2R49A 4MXWA 1LOGA 1VB2A 3BN6A 4LBQA 1D4VB 4YVWA 4A3XA 5AC92 4UWDA 1UZVA 3S0MA 2RR11 4MLOA 4ORFA 1LJ7A 4K9SA 3DPRC 3OUHA 2JDMA 1AYM3 1GKBA 1RUJ2 2VVFA 4F83A 5FZMA 5BNOB 3N9LA 2VMDA 4JQTA 4CCCA 5A3NA 2C0ZA 1SCRA 2UWAA 3H3LA 4YW4A 2Q8CA 2X09A 4AZZA 3VZNA 3LZZA 4NIDA 2PFWA 3G6JB 3BGAA 1K5MB 1LR5A 5CZKA 2ERFA 1QH7A 2J1RA 3S7IA 2VZUA 4B7KA 5I91A 3CO2A 2VZRA 4GH4A 1XNTA 2WNUB 1BKZA 1EPZA 1FV3A 1AL0G 2YV8A 4GWIA 4RS5A 4HL0A 5C9AA 4Q5OA 4LPLA 4MO3M 4AVSA 3RVHA 2WNVA 2ZZJA 3ITQA 1VRH2 3JD72 3MF9A 5BUVA 4AEKA 5T54A 1UXZA 2HWB1 1ZBE3 3DYOA 4GZ9A 4ZPIA 3WDTA 1Q8PA 3UV9A 1NY72 1OD3A 2ZMKA 4HKOA 3ZPYA 1U5IA 1NCQC 2ZXQA 3MICA 1UX6A 4IESA 4FFIA 4TN7A 4CCNA 4CCOA 2QQKA 5FLJA 1VB4A 2PELA 3RSJA 3VKMA 5JIAA 2XQRA 5A70A 1DFQA 3RYRA 1O3QA 4A45A 1WKYA 2WFF3 2F6BA 2RS13 5LWBA 5K0UB 1HRV3 5FY9A 1KJLA 1BEV2 1WW7A 5FJKA 2NLRA 1PGL1 4XFIA 2DTWA 3LEMA 1ZNPA 1J3PA 5FUNA 1X50A 3UKVA 5M0TA 4OQ8A 5JI7A 1OLME 1ZA7A 2WS93 3Q8AA 4P5YA 3M3QA 4YFWA 5JXHA 1EAH2 2VNGA 3W59A 5KR7A 3U78A 1HV1A 3ZFGA 1WW4A 3DCQA 2I45A 1STMA 5LW9A 3WLUA 5FXZA 4DOUA 4IEUA 2J22A 2V73A 5L7OC 1US2A 2QQUA 2ZKLA 2XJTA 1C8M3 1VJ2A 2XJUA 3POGA 2IFWA 2A6VA 3U10A 3VBUA 1ZM1A 3LD8A 4YNIA 3MIDA 5F3GA 5LRRA 2VQTA 4R9BA 1JOJA 5SV5A 3D0SA 5JZGB 3P1IA 5BNPC 4OZXA 4AVBA 1RUH3 2AUYA 2OQ6A 3ZDSA 4WBBA 3G7DA 4LNVA 2F4PA 3DECA 4OMDA 4BA6A 3DXTA 2WA4A 4NN0A 2FDKA 2B7YA 3H8OA 1VBA3 4YFZA 4QXCA 3B69A 5FJHA 1XNDA 2JWPA 4IETA 4NO4A 1F8VA 1ND3C 1ENQA 2FMYA 4JGYC 2A70A 4CU8A 4LR4A 2XVGA 1BK0A 1DYOA 1DP0A 5C71A 3B3QE 3MIGA 2Q8EA 5FCCA 3U14A 3WZ1A 1TNRA 3SISA 2ZGSA 2VCBA 3MDPA 1TG7A 1J1LA 1DZQA 2XBO2 3MI8A 2GH8A 3WOGA 4BJ0A 4DS0A 2V72A 4DUWA 4LO5B 1QJX3 2JB8A 2IVJA 3GALA 4N9IA 1AR61 1B35A 3WCRA 2QQIA 3JUUA 3J9SA 3PTYA 5I0RA 4QU1A 1XJAA 1LHVA 2P1BA 3HJRA 4HSLA 1US3A 4KL1A 3LDKA 2ZZQA 3UL2A 5FPLA 4BK5A 5C6CA 4IXLA 4ZU4A 2YPDA 4BU2A 1BVP1 4FOYA 4LKDA 5HV0A 5KHGA 2ZEYA 2JECA 5J98B 4YZ3A 3R4SA 3CL1A 1JU3A 4CRQA 2FQPA 3CJIC 1KJRA 5IK4A 2NN8A 3UJQA 3O1PA 4ZZ5A 4JTNA 2BERA 3AZYA 3N7LA 4PIZA 4ZU5A 5FWEA 4B7EA 1UW8A 3MGUA 4HOOA 1CN1A 4DFSA 1JU4A 2PHUA 2ZPXA 1CAXB 4BDVB 5DDJ1 5SV8A 1XBFA 1JYTA 4HN0A 2DBNA 2EF6A 1ENXA 1IG3A 1ZRRA 4JKLA 4I2OA 3CHXA 2ZEZA 1VLNA 3I2GA 1YO8A 2WO2A 3VLBB 1TME3 3PVEA 5KHHA 1V9U1 3B01A 2ZGMA 5K8SA 4MXWB 2DTYA 4FPKA 4JZRA 4YVWB 1S4CA 4AXOA 1WCDJ 2Y6LA 2GH2A 1O7FA 4LHSA 3WF1A 3TN93 1FPN3 4ES9A 1K3IA 3GHNA 2VBDA 1X33A 1NXMA 4XQ4A 3ZFFC 2VNOA 4NIGA 4EQVA 3NRUA 1UY3A 4FXGB 1FV2A 3NMBA 5FP7A 3HEIA 3EYPA 1BMV1 3M3CA 5CU1A 1W8TA 4IEOA 1EAH3 2HKXA 2MPFA 2O1QA 3HAGA 1OOPB 5FZDA 3WY6A 2QUOA 4BPZA 1NA1A 1BBT3 1OKQA 1UAIA 2RM23 3BB6A 1UU4A 3I3EA 4GH4B 3HR9A 3BALA 1QOTA 4FQ4A 4BIOA 4R9CA 1XU2A 2GMEA 3PUIA 5A1LA 5L9BA 4ARYA 5FV3A 4HSJA 3W5MA 3LOIA 4S2GA 1NCRB 1SPPA 2P37A 2ZA9A 2B9UA 3I7DA 1H6YA 2FDJA 1JXNA 3RWKX 5LK7B 5A3PA 1W3XA 3ZR6A 1W04A 2VMEA 3ZXGA 2NYYA 4Z8BA 4DY5A 2ZX3A 1O8SA 2EALA 3KCXA 1HDKA 1KXGA 1PVC1 1VR3A 2D44A 2R32A 3CJXA 3M8LA 1MZ6A 4L92A 3AC0A 4MX3A 4B4PA 5A33B 1RMU2 5JSOA 3W9AA 4HMZA 5F5QA 2W68A 1WLDA 4QDSA 3FL7A 3FJSA 3ZXDA 4RR3C 3QLQA 2ZAHA 5EJZB 1Q43A 1N3QA 2UY9A 2YU2A 1JZ2A 1OUXA 4WM8B 5L9VA 4NOTA 1UU6A 3EO6A 1HRI2 2FMDA 2P6HA 5A7NA 2H6BA 4YW1A 3WHUA 5DABA 1ZVFA 2Y38A 1ODMA 3IM0A 4AVCA 1VBA1 3AFKA 5E8AA 4B3NA 2Q30A 1NLRA 1NT0A 2CWSA 3I3DA 5KBFA 4XC9A 3IAPA 4AQ2A 2A3XA 4IGOA 5F2SA 5FY7A 2VNVA 4CDQA 3ZFGB 1DQ5A 5IYYA 3AYDA 3P5BA 3UGHA 3PJQA 1R1A2 1LGCA 1QJX1 1H4GA 3VBUB 4QKFA 3ACHA 1VBE1 5CFDC 4JRLA 1PNFA 5L36A 3MBWA 3PU8A 1L3JA 1COV1 1PIV2 4Q4X2 1MS1A 3N7KA 3VHRA 1LHNA 1YQ5A 2Y60A 4P9IA 4YSFA 5ANQA 2NPIA 4MHUA 2HBTA 5C5TA 4ZHNA 2VQUA 5CKNA 3SKJE 2XJQA 1LU2A 4OUEA 3ZN6A 3NVCA 1UNBA 5FZ4A 4AF9A 3N9PA 1MEC2 2RDSA 2W08A 1XQNA 5LA1A 1QWRA 5FYHA 5EJ3A 2FCVA 5ABJA 5FBJA 1HN0A 1WMDA 4EN6B 3WUDA 5F2WA 3ZKYA 1LGNA 2AEYA 5IK7A 5DZFA 1C28A 3FMGA 3NV1A 1Q8QA 5ANNA 3VBOA 4XZPA 5CVRA 1B35B 3PNAA 1CIWA 2ZX2A 3LFMA 3WP5A 3RWNA 3THCA 4AFDA 2DUOA 3SQOA 5A3MA 2CAUA 3DXUA 4TTGA 4YM3A 3TAYA 5DUWA 4YM1A 4CDWA 5A6YA 5FPUA 4LORA 3QH7A 3UNPA 4LLOA 4QHBA 4HK8A 4JGZC 3OCPA 2V4AA 1ULGA 4WM7C 3T1MA 1ZRFA 5HXVA 4IEQA 4GWNA 1R083 1UIKA 1YEWA 4Y33A 1CPNA 4YVSA 5HV4A 1MS5A 3BKZA 3FHQA 3N3HA 4QD2A 4ATFA 5KHKA 1OURA 5A7QA 3AKTA 1NG0A 4XXAA 3ASIA 4RQPC 3MUZ1 3POEA 1PX4A 2QQNA 1S0BA 1VAVA 4MSVA 1REEA 3NJXA 3LPGA 5KXCA 4QX1A 1W6MB 2DU1A 4P9WA 5FPZA 5JOYA 4OI0A 2JXAA 2LW8A 1DZTA 4FPOB 4V2WA 4CDUA 1NZCA 1V6IA 4GMP1 4FQZA 4YLZA 1Y4WA 4GQ7A 4XZUG 2WZR2 3JBG2 3WQ7A 4I09A 3WX5A 2EIBA 1AR92 1EV11 1GZCA 1UYYA 2J1EA 4QX3A 2WN3A 3KV5A 1JZ3A 1NE4A 2JG9A 3EXUA 1RJ7A 4BXFA 5H9RA 4KH9A 3CBNA 4QQPA 2RS31 5C3PA 2BOJA 4XUQA 4ARXA 2NP0A 1NE6A 4LHNA 1L7QA 1LRHA 2DVBA 2HJIA 1FT9A 1VBC1 3NJYA 5GZEA 1E5SA 2W39A 4U2AA 2E51A 3ZYJB 1PO21 1CR7A 2XXZA 2MNGA 4CXYA 2DUPA 1S0EA 3QOPA 5A7OA 4HFSA 2WZ8A 2VZSA 2YYOA 2DU0A 2VMCA 4RGGA 1YCIA 2E7AA 1R092 1AJKA 2KD7A 3HT1A 5DAWA 2VJXA 2BGPA 3V0AA 3ETPA 4Q0PA 4KBBA 4F3JA 2DDUA 2VBBA 1IPJA 4GWMA 3E6BA 1UU5A 1R1A3 4CEYA 1YFWA 1O3TA 2PHDA 1SPPB 4W65A 5EWSA 5J37A 1RUNA 2GZWA 4QPYA 3ENRA 3P3PA 1YFYA 1A34A 2BBAA 1AYN3 1MQTA 1PIV3 4YGCA 5H9QA 1RUI1 4E27A 1S0DA 2XUEA 1ASJ2 4KU7A 4P9XA 5A80A 3ZYFA 4BM8A 4LT5A 3T2QA 1ONAA 3OGVA 3ZFEB 3OBZA 3MYXA 5F3IA 5A32A 5AFBA 3J7NA 4P00B 2YBSA 3VBSC 3HD8B 3LEKA 4XPVA 1H2LA 2QQWA 3WVJA 4Y1UA 3VBFA 2OQ7A 4RHV2 4B8EA 2IXJA 5FO8B 1PZ7A 4RGKA 5FY0A 4AI0A 1W9FA 4COZA 1V70A 1F35A 2LUWA 2WQ8A 4CDXA 1H8VA 2Y33A 4AEDA 1S2BA 2BU9A 1AHSA 1PO11 3PUQA 2LRPA 1HV0A 3LPFA 3AP7A 4YZ2A 3E1F1 4IQPA 2JDPA 3MF6A 4BK4A 2DVAA 3ABZA 4CDQB 5F1RA 3PVOA 1A6CA 2KR2A 3OYWA 1OVPA 2RR12 3HQUA 3BUCA 4BE3A 1IPSA 3OGGA 3M2MA 3IT8A 2VUDA 3O14A 3WNKA 3E5XA 4H3WA 4IV3A 1GICA 1Q56A 3B02A 4OHXA 1QXRA 2GC0A 2XB6C 4K8FA 3GGLA 5FBZA 3USSA 4QPWA 1RUD1 3OGJA 5FZGA 3MUY1 2WRAA 2UWBA 3WW2A 3LQCA 4CUBA 4JHZA 3SEPA 4E2GA 3DL3A 2WT1A 1H8TA 3IDBB 5FPBA 1UCXA 1GFF2 1V6OA 1NLSA 2HEYF 4JHTA 1OFNA 4LUKA 3ZIXA 5D1IA 3ZN6B 2X10A 4XJ9A 2ZX4A 1CX4A 1ND2A 2D6LX 1FOD3 2W52A 3JB8A 3PL0A 4NJ4A 1D2QA 1PNGA 3JBG3 4CYDA 1JBCA 2XVLA 2RMU3 3ES1A 3ZXEA 1RB8G 3BIEA 3WCSA 5ACA1 3HVDA 5JI9A 2RJKA 2IXIA 4M4RA 2X5IB 3ALQA 3WNNA 3VBOB 4OHWA 3H0OA 4I02A 4RFT0 3U75A 2VU9A 1W6NA 3VL8A 4LBMA 4KQ7A 2UYBA 1RUF2 2W0XA 1KDMA 3E5UA 1AX0A 5F6KA 4FXKB 5JXIA 3CNAA 1DQ1A 2R071 5IK5A 1UYXA 4Y22A 4CDWB 2D6PA 3ZDVA 1PGL2 2Q0AA 5FUPA 3AKQA 4LTAA 3ME2A 5LBCA 2BFUL 2JG8B 2QDNA 3OUJA 3VDDB 4F7ZA 5C5UA 2W47A 4WV8A 1UL9A 4YW2A 5FZ3A 2W1UA 3CDZB 2WNUA 5FZKA 3I2DA 4EE2A 1DGWX 1DLCA 2C9KA 3DYMA 3BTZA 1KEXA 4IE0A 3ZXKA 5BNNB 3U11A 5JIUA 2ADEA 3I2IA 4NMIA 4IV1A 4PDWC 5CKMA 3ZMNA 4CEYC 5CBLA 1ASJ3 5CFCB 1GANA 2ARXA 3T2PA 5FDBA 1SACA 1YI9A 2GN3A 3OJBA 5C8CA 1AL21 4YGBA 3OSDA 2WC2A 1F4HA 4GB31 2J1AA 4I0WB 4GD4A 4LBOA 2GNTA 1AYN1 2FBEA 4NRQA 4LULA 4K20A 2DVGA 3RZLA 1V6KA 1SLCA 5F5CA 4DMIA 3VD9A 2BQPA 2HWD3 3FC0A 4RHV3 2GNMA 1M4WA 1RUC1 3I8TA 2JG9B 4IEYA 4AQ6A 4IDZA 3HWJA 1CIYA 4MADA 3M7AA 5GZDA 1IKPA 2QQVA 4XJ8A 3OOXA 2VO5A 3O1SA 4QX0A 3ETQA 4OCTA 2OZJA 3IIAA 3C7OA 2OXBA 1QH6A 5FAXA 4FO9A 1C4RA 1CAUB 3KQ4B 3QH6A 2EXKA 5K0UA 1PK6C 4PF5A 3WNOA 4MGQA 4F8AA 2VGDA 3ON7A 2C26A 5FZBA 3O1TA 4S2HA 5FQ0A 2QBXA 3NO8A 4KI5M 1R64A 4B1LA 4IERA 2A75A 1W28A 3BI3A 3SKVA 1HLCA 1MZ5A 3WNLA 1H6XA 1W2TA 1GSLA 1VPHA 3POBA 4LLFA 4DPNA 3H1YA 1XU1A 5JSPA 1J83A 1G86A 4J1XA 1AUYA 2Y8KA 2IXCA 3O1VA 1J84A 1QJY1 1MQTB 2Q5TA 3OTFA 3CEWA 1GQGA 1IS5A 4Y1ZA 5FYBA 3VBRC 2A6XA 2YFUA 4OUMA 4NHLA 1W6OA 3N7JA 4AEJA 2F17A 4HLTA 1W9YA 4QGNA 5I8YA 1POV1 2VOTA 1FI2A 2QDRA 1HB3A 4AYUA 1JHNA 3A4UA 3AJYA 3KMHA 1KRIA 3RG0A 2VC9A 1AR73 2BEOA 3KF5A 5I8SA 1NAEA 5A7WA 3CLPA 1BVVA 4QX2A 1LAJA 3OBAA 2W1QA 3POFA 4N90A 4XXPA 3ZKUA 4RS5C 4LIUA 5C9AC 1H9WA 1RVF1 2D93A 2HLEA 2WYFA 3UYJA 1S1AA 4DUVA 2WNVC 2PHLA 4CDXB 3AP4A 5C4WC 2B45X 2JEMA 4NPLA 2Y0IA 1GYKA 4ISQA 5FZ0A 2HEWF 4M0NA 1H1IA 3O0VA 5FZ9A 3WINE 4AI3A 1RUE1 1V9U2 3FLTA 2R7EB 4ZXKA 2JIGA 2R30A 4N53C 5CKQA 1L7LA 1QKQA 3OYWB 1YQ2A 1F31A 2RMU1 4UFLA 2RS51 3FX3A 1RUF3 4N8MA 1PM4A 5FXXA 5IW0A 5T5PA 5JCTA 2D6OX 3PMEA 3T09A 4NWVA 2VQ0A 2C4XA 3H42B 5JPMB 5LY1A 4IV3B 1DYKA 2JB4A 3C7EA 3POYA 5IAXA 4KWKA 3H3ZA 3TEXA 3KWVA 4MGZE 1UF2C 2HWE3 1KGYA 1I9RA 2HBUA 5LB6A 1G9BA 2XJRA 3KD4A 4YG0A 3LEGA 4RD7A 4WM7B 3POSA 1NOVA 4XABA 3SH5A 4DIQA 2P5BA 4G4FA 3LAGA 4FPYA 1AR81 5G04L 1YFUA 1RUG3 2KA3A 2GALA 3BTYA 3R4UA 3ZO0B 3AVRA 1OQDA 2DFBA 3RGBA 2AREA 4Q4W3 1G7YA 1SBEA 3ATGA 4HK9A 5FZLA 3OF1A 1CAXA 5JMOA 1IHMA 5JWPA 4J25A 1W99A 3T2OA 1JYXA 3AKSA 2LROA 1E5HA 1ND2B 5FLHA 4UBGA 1U0AA 1K5JA 3BOPA 3MLLA 1PVC2 5GALA 3TEYA 5GLZA 2BWCA 2VH9A 2CDOA 5C8CC 2XLFA 3I49A 4W4ZA 2WINB 4KGGA 2JDAA 2VQAA 1RXGA 4Y4YA 2MEV3 3AXDA 1E5IA 3ZYHA 1HB1A 3EJKA 1RJ8A 4O9GA 4JKMA 1W6NB 4LHLA 4OULA 1JYCA 4CZSA 1W3VA 1H4HA 1QJU1 3LCPA 2CGNA 4PT6A 5DAXA 4D7YA 1CESA 5D8AB 5GLTA 4JV4A 4LA2A 3A0NA 1MS0A 4RN5A 1MVQA 2WWUA 4XETA 4Y22B 1TNFA 5JPNB 3LA2A 4XJUA 5AVPA 3VZLA 3A21A 3PUAA 4FP2A 1ZZ8A 1SLTA 1OOPA 1LENA 5FYZA 1V6JA 2RVAA 3GJBA 2QVSB 5I0TA 4CTEA 3OPWA 3CMGA 2PXJA 5GLWA 4Q4V2 2A3WA 3APBA 5FZFA 4N43A 5T3NA 4IV1B 5LBFA 1NCRA 4K3UA 4CP9A 5E1RA 5FYYA 3J7LA 2K9ZA 1AX2A 1VBE2 4GIQA 2E53A 2WZPP 4ZKTB 5LBEA 1MS4A 2R061 1JI6A 2JICA 1OQ1A 3GM8A 3FFZA 4CP1A 5A33A 2FCUA 4CEWC 2R043 3C8XA 4EROA 2JJ6A 3HN3A 1QNYA 1Z7S3 3E6CC 5FMBA 3KV6A 1W8HA 1RUOA 3H3UA 2Y0OA 2ZHLA 1BZWA 3NL1A 2GN7A 1E5RA 4WM8A 2VE1A 4CP2A 1GNYA 1ZRCA 2A1XA 1JOBA 3VN4A 4Q4Y3 5A6XA 4PBOA 3LWCA 1SLLA 2WYSA 2UURA 1QNWA 4QHOA 2PLV2 1ZREA 4OMCA 4QXBA 3VBHB 2B8MA 3OGRA 4LITA 5FQ0B 5F39A 1OA2A 4CSWA 1OSGA 2C6SA 2ID4A 4KWJA 3UKTA 3AL5A 5CNAA 1YQCA 3ZMOA 2PQSA 4E8CA 1W03A 4JRAA 4TLGA 4AFMA 1W6PB 2Y6HA 2YGMA 2UWCA 4OHZA 1W8ZA 2G9FA 1VE0A 3IDEA 3WQ1A 3U4SA 1PGW1 1AX1A 1GV9A 3T1LA 2HWC1 3D0JA 1UO9A 4UI9L 4A44A 1O6UA 2YB7A 2BOIA 4M01A 1W2UA 2XHKA 1TMF3 2WSUA 4XFBA 1ZBA1 3N35A 1W6OB 3AZZA 3AMQA 4Q8KA 5DAVA 2VW1A 4ZS2A 2D6NA 1JHJA 1HXS2 2YC4A 4KWUA 4C8DA 1Y43B 4Y4RA 1VBB2 1W2NA 2DCYA 3IAQA 5A7WB 4BQ5A 2O8QA 2QZ2A 1NA1C 3Q8CA 3WSOA 2HWF2 1XYOA 1QEXA 4ZU7A 2D3PA 2CYFA 3NJVA 1MVEA 1FMD3 2QJVA 5T5JA 4GJZA 3B9IA 3WEZA 4AHZA 2SBAA 1CGPA 1W0NA 2YBPA 1JS9A 1C5IA 2EAKA 5JUVA 4UW6A 2WN2A 1GOHA 3THDA 2ZTNA 5JLVA 2J1VA 4J6GA 5AC93 3IPVB 4XURA 3GCWA 3O0WA 5JVVA 1EV12 2ZMLA 2VZ3A 1YI7A 4CCEA 5L19A 1XRUA 3DPRA 1LHUA 2ENRA 2UY8A 4PQ9A 1RUJ3 5AVAA 4MGSA 3JCIA 1QF3A 1UY4A 1CAWA 4C0HA 1FX5A 2BVVA 4KBZA 4WVMA 4YG6A 2W92A 4FTBA 5E6HA 3NSTA 2A6WA 4PIYA 4FCAA 1SFNA 1EYBA 1VBC2 4MG2A 4UBHA 4PF1A 2QQLA 3OEAA 1W8NA 4MXVA 1ULDA 4MH0E 1E57A 3H7JA 3KM5A 1AYM1 1UQXA 3R05A 1XNBA 1Q8OA 3LA7A 3BVCA 2IWGB 3VV1A 2D3RA 1IS3A 1JUHA 4BOWA 1UKGA 3ACLA 2BRTA 3PU3A 3JD73 4URTA 4EJRA 1VRH3 2VXRA 3W5NA 3A0KA 1GP6A 4B29A 3DKQA 2CHHA 4QB2A 2GP5A 4AI2A 3VB9A 3FWEA 3VDBA 2Y26A 2E63A 3MFAA 5FYVA 4GWJA 2P3IA 5LATA 1X8MA 5H9PA 4MOAA 4H7LA 4EZ4A 5DPNA 5EZWA 1RUI2 1C3HA 1NCQA 1DBNA 2DV9A 4FT8A 3SLIA 3WNPA 1W6MA 2GNDA 1QJZA 1RYYA 3V56A 3WW1A 1AF9A 2JD4A 2E32A 2ZGTA 1QQP2 2JD9A 3RFRA 4LO4B 3S5QA 1N3OA 1QJEA 1ZBE1 2Z4FA 2P2KA 3UGGA 1WMXA 2K46A 3T4HB 4R4ZA 4P08A 5I8TA 3ZYGA 4NIIA 1HQWA 2G4IA 1GWMA 1Z7S1 2WNOA 2Z79A 1ENRA 1GNHA 3MIBA 1BEV3 2PLV3 4FPHA 4UT5A 5CIRA 2VM9A 3WV6A 4D69A 3LOBA 1PO12 4LKSA 1XSQA 5F8PA 2WFF1 2RS11 2OX0A 1SDWA 2P3KA 1RGSA 3K51A 4H55A 1X82A 3E6DA 1HRV1 2BWAA 3FN9A 4PLMA 3CZJA 4QB1A 5ABJC 4L9BA 2HEVF 3JZVA 2WS91 3ELNA 4N43B 3MLKA 2ZGOA 1LOFC 4CP9B 3OBTA 1TQ5A 3R0RA 1ULPA 3S7EA 2PAEA 1HXS3 2O8OA 1RUD2 3MIHA 5DZEA 1C8M1 1VBB3 3I3BA 4HZFA 4ATEA 3ZFEA 4NPMA 3N7MA 3POWA 3VDCA 5L9RA 1SBFA 5HXMA 4W50A 3ILNA 4AHWA 4QPIC 1WLTA 1RUH1 1X9PA 1ND3A 2GC1A 3H1MA 5IAVA 4JGYA 5APAA 3I4IA 4XMIA 5IFPA 2C1FA 1W05A 2VXJA 4YVSC 4Y20B 2UU8A 5CEHA 2B9VA 3LF7A 3OG2A 1O59A 1WBLA 3I59A 2HH9A 4HG6B 4LUMA 3U07A 3GBFA 1S2KA 3MV01 4XOGA 4S2DA 1G9CA 1WA6X 3D3AA 4JDMA 4LEJA 1JYWA 2XBO3 4XDPA 1NYWA 5IVYA 3RZZA 1ZZ6A 3CQOA 4HANA 5ACA2 3P6BA 1SLAA 2YGLA 4HKLA 4KMQA 1J3QA 5T5OA 5LCWL 2OT7A 4D7TA 4CDUC 2Q1ZB 4M4PA 2P3JA 1J58A 1M06G 2VMGA 3AB0A 5AC91 3MO4A 2WLQA 3BTXA 3BOWA 1VMFA 2ZOEB 1ENSA 4EN7B 3V64A 4ASMB 4OI1A 4XILA 4LO6B 2EIGA 3FUQA 4P9JA 4B4RA 4AEMA 1CPMA 2YY1A 5LEKA 1TEIA 1WCQA 3NAPC 4OFGA 2AGSA 2D98A 1RHI2 3CJIA 2NM1A 2ZKNA 4QPGB 2GAUA 1Z78A 3VD3A 4L99A 1G9AA 4E4ZA 2WO7A 5IVJA 2ZGPA 2B4KA 1HQNA 2ZGLA 3RZKA 1N1TA 1O4YA 2RJLA 1YRZA 4FPGA 2QFEA 4UF0A 5A3TA 3ZN4A 5E89A 3WG4A 1OMIA 1D4M2 3FHIB 3GBWA 1YXWA 1KS5A 3O12A 4R9DA 5C33A 1LOBA 1ULFA 4XACA 1QQP3 4DUXA 3DV8A 3OB8A 5GLVA 2J1UA 4A7YA 5C3SA 1A78A 3GNEA 3Q8FA 4GB32 4XBNA 4YRDA 4AFAA 4D7SA 1NY71 4L2NA 1YJKA 2XWBB 5BV6A 3J4UH 4Y5TA 1FXZA 2X5IA 4IEXA 4Q0SA 4PQQA 3PMSA 3DPRB 4XHXA 4YYOA 1RUC2 3ZFFA 5HCHA 1PX3A 1BXHA 1CAWB 1SG3A 1TME1 2PHRA 2VG9A 4QXKA 4IUGA 4QU2A 4X8PA 4WVMB 3ZPOA 1QIQA 5BNQA 2NMNA 4BQ4A 3JQWA 1GBGA 3TN91 1FPN1 4Q1PA 3VBFC 2VVDA 1OBNA 3M70A 1URXA 1WD3A 4Y5SA 3Q8BA 4NAMA 4XQWA 3ZSKA 1JODA 4XFHA 3AJZA 3QD6A 1DLLA 1GQHA 3DUIA 4QT6A 4COWA 3VDDA 2JG8A 3RQ0A 1OPOA 3H8XA 4AEDC 5A7SA 2VOXA 1EAH1 2LM3A 1FNYA 2ZGQA 1JZ6A 2VECA 1ZRIA 5FZIA 1QOOA 3O1UA 1VBD2 3OD4A 3NV2A 4YW7A 2BW8A 1BBT1 2RM21 4CPBA 2GNBA 5BNNA 3C7HA 4DXSA 1SCSA 3J8F2 1MZFA 5CFCA 3BPZA 5I0UA 4AFCA 2NZ9A 4MV2A 1QJY2 4MHRA 1YUDA 1ALYA 1SQ4A 1GZ9A 2TUNA 1NCQB 1UIJA 4YZ1A 5IFTA 4XFFA 1O3SA 1RMU3 4E4HA 4COUA 1T6GC 4JQRA 2WJSA 4O9EA 3I2KA 4N9HA 4WZFA 2JIJA 3C2UA 2BYVE 5FZAA 3HN1A 4YM2A 4RR3A 4EV0A 5LASA 3ZSJA 5I93A 4AK3A 3N4MA 1O3RA 1DHKB 3BODA 4YW5A 1HRI3 2PAMA 4O65A 3THPA 4YM0A 1NKGA 1H8TC 1ACCA 3V0BA 1GZWA 1REDA 2G9GA 3D82A 1RVF2 2ETEA 4XF0A 3BPSA 4DY3A 4QWNA 1D7PM 3AYEA 3RDIA 5J48A 2VMFA 4Q29A 4XDQA 1H30A 3LKJA 2GMMA 3NV3A 1CAUA 4CU9A 2W95A 5IUQA 1B09A 4NIHA 2XPJA 1Y9QA 1RUE2 4FOVA 1C5HA 1IQDC 4GJYA 4RL7A 1QGLA 5EQUA 1XB9A 4BMBA 2ZX1A 4HETA 5CB7A 2CGOA 2D6KA 5L7OB 2RS52 4RA0A 1GOFA 3KZ4C 5DQ0A 5FLIA 1BYHA 5JOXA 4FPFA 3OGSA 3KLSA 3D4KA 2DWRA 3NKTA 5IATA 4OQ9A 2FDGA 3ZX7A 1RHI3 4I0AA 4YGEA 5BNPB 2CL2A 4Q4X3 1OC1A 4IEPA 4JCKA 3TOJA 1Q3EA 1Q8VA 1GU3A 5BNOC 2R6QA 3TNQA 4OHYA 1AR82 1DIWA 3GCXA 4A6OA 3J7HA 3PIJA 4XMAA 1OA4A 3Q9OA 4NUBA 2RHPA 5G05L 4P9YA 4JAAA 1DF0A 1K5MC 2ARAA 5A7PA 3ZYIB 3K77A 2ARCA 2VCMA 5LZ6A 4COYA 1ND3B 2XMLA 1CAVA 1MEC3 4JGYB 2WNUC 2ZMNA 1UY1A 3IN9A 5LY2A 3M4FA 3VZJA 2WQ4A 2RV9A 3I59B 2QQPA 3L9JT 3WG3A 4AI8A 2R0FA 2OUHA 4I01A 1UOBA 4UFIA 5EYXA 4LOSA 2JDZA 5F3EA 2BNNA 1IOAA 1O5LA 4QGMA 5LA2A 4NHYA 4QKNA 1MS9A 1NXD1 4CXXA 4MGIE 4DXRA 2RDQA 3ZOIA 4AR2A 2AYHA 5FKBA 2E7QA 4IGQA 5DG1A 1IG0A 1ZZCA 4QX5A 5IVFA 3HBKA 4AE2A 1C57A 2BJSA 2Q4SA 2VPVA 3DN7A 4Y26A 2IC1A 4AVAA 2PA7A 5FZHA 2VUCA 3KB5A 2R1BA 1KS4A 1L7RA 4DB5A 1LESA 2PMWB 3FLRA 1F4AA 3WR0A 1NZIA 4JGZA 4XTPA 1MS8A 2A71A 2PHTA 3CJIB 3HIFA 4WM7A 4S2FA 5FY8A 3VKOA 5K0UC 4FFHA 1H1MA 4IEWA 2CDPA 1Y9MA 2FHRA 3ES4A 1UYPA 1WMFA 2E31A 3QACA 3QBQA 4IE4A 3K3OA 3M1HA 3J8F3 1ST8A 2YDEA 4HBNA 4LBJA 4OLLA 2ZABA 4LK6A 4RQPA 4URAA 1Y7BA 4UF0B 1W90A 2BGCA 3BYWA 1S0CA 4QQHA 1IZ3A 4D94A 1LEDA 4NROA 4X6QB 1R081 3ACGA 2V5DA 4PLOA 3TWIA 1F5JA 2P34A 2HWB2 2JX9A 1QXJA 4ZY9A 4FSJA 1OKOA 1JTZX 2WZR3 1GMMA 2BP6A 2GC2A 2O14A 2R062 3QCWA 4LIVA 1AR93 3ACFA 4BH9A 4Y5Z0 1O5UA 5EYYA 1WLWA 1ZA4A 3WF4A 4P5HA 3WW3A 5B4NA 4G9SB 5JZGC 1DQ0A 1RITA 1SLIA 1G6NA 3ZFFB 2IXHA 3LA3A 3B9CA 3WUCA 1I6XA 1IS6A 3GHMA 3WDXA 4D6RA 4BQ1A 3LE0A 1YHFA 3MHZA 2QTWB 4V1PA 4O7XA 4RFRB 4CCMA 4JTOA 2CY6A 5D8AA 3GF6A 3AL6A 1R093 3VHPA 1UX7A 4DXZA 3PLQA 2CTVA 2GSYA 4HN1A 4L97A 3VD7A 3EHKA 4LOTA 5A3UA 2LTNA 2VMIA 4EWAA 2JE9A 2ZEWA 1U12A 3BIWE 3UK9A 4HONA 3WW4A 4MZUA 1S55A 2DURA 4K1ZA 3T30A 4GKXA 4HPKA 3ZYBA 1S2EA 4CUCA 4Z1VA 4DEQA 2J7MA 2LS6A 3VZOA 2HWC2 1A3KA 3TEZA 5DXDA 1R1A1 5KHIA 1SEFA 3NNGA 4BYYA 2OIIA 2BPA2 2XGXA 1ZBA2 1O8PA 2LALA 2YUEA 1AXYA 3AK0A 2X53S 2V09A 3WF0A 5FP4A 3VBSA 4LQRA 3AP9A 1PIV1 4R4XA 4JVAA 4RR3B 3VGIA 3PJYA 4M0HA 2VZVA 4BXSV 1CJPA 3ZM8A 1DQ4A 1GR3A 2BGOA 5EIYB 1K42A 3MLJA 4LBKA 5F32A 2UYAA 4MUVA 5A1AA 1AXZA 1RC6A 3KV4A 4PBPA 4AHXA 1GZWB 3V0BB 5FXWA 1RINA 4A41A 2NMOA 4U36A 1SFPA 2XJVA 4XBLA 2W9XA 1W8WA 4I0BA 3ZXLA 1IS4A 1HKDA 3LSEA 4LA3A 4CCKA 2C24A 1XYNA 3I2OA 3K3NA 2BV4A 1XOYA 4LMFA 3VBHA 1YJLA 2VULA 4AG4A 2RR13 4RSUA 5FYTA 3IDCB 1O4ZA 3NJZA 2PHXA 1VAMA 1XE8A 1KQRA 3N36A 2A5ZA 5C7GA 1SBDA 3WDVA 4K6BA 2JE7A 1W6PA 1AR62 2P6CA 2VTFA 4YVWC 4K1YA 5CFDB 3GXUA 2WT2A 1UXXX 1OT5A 4FPEA 3LIHA 1W9SA 2DCJA 3O7OA 3GZEA 5D21A 3TYJA 5A6QA 1PMIA 2EXIA 3CKHA 3WP3A 1AYM2 2IXKA 2D43A 2QZ3A 1QU0A 3RI8A 4XF9A 4P9LA 2XQXA 3U1XA 4AGVA 1LULA 2W3JA 3VHNA 5IVVA 1W8UA 2BDRA 5LRSA 4KWLA 5K4LA 3IMMA 2PN5A 3P3NA 3IZOA 1MZEA 1OOPC 1H2MA 3LDRA 2XOMA 5F5AA 5CADA 4Z92B 4GH4C 1H1AA 3K2OA 1CAVB 2H0VA 1VIWB 3IWZA 5FMDA 2HWB3 2N7GA 2AZ5A 2VVEA 5DDJ2 1W0OA 4PJYA 4G3YC 3H50A 4NAOA 4LBNA 1OFSA 1DGLA 4A6SA 5FZ6A 2D97A 2WQZC 4BLJA 1NCRC 2R16A 1I1EA 3IBMA 1N47A 4FPCA 4QAWA 4UFJA 3GZUC 1DYPA 2ZHKA 3DYPA 2A6ZA 3VKFC 4AQTA 5A3LA 2Y64A 3IPVA 1ZBE2 4LK7A 1FOD1 5FTTC 5F3CA 4YW3A 1PMJX 3JBG1 5T55A 3RJ2X 3RZMA 1AR91 2BFUS 4NPRA 5LBBA 4WVVA 4LKFA 3HMYA 2B46X 4K21A 1KITA 1APNA 1JW6A 2XHNA 1MR5A 1CVNA 1KDKA 4A2UA 2ZCWA 5FOJB 1BMV2 3A22A 4WM8C 4JGZB 1LTEA 3WF3A 5FYCA 2OKXA 2WFF2 4QX8A 2RS12 5IJRA 2VZPA 3K4AA 1HRV2 1NLQA 2Y6FA 2W46A 3OPZA 1CZTA 3POJA 5A6ZA 5HCAA 2BBVA 3H8UA 5ERLA 4XCAA 2QE3A 2OPWA 2VOVA 2XWJB 4IE5A 2WS92 4RQPB 1PZ8A 2FCTA 3JXSA 4XHBA 3OY8B 4BQYA 1SZBA 4FOQA 3ZFGC 3I2HA 1OUSA 3KVAA 3WP4A 2I2SA 3PUSA 2WDBA 1LOCA 3ECQA 1ASJ1 1C8M2 1W06A 2JDHA 1WLCA 4LE4A 3VBUC 3E5QA 3W58A 2JENA 3IKWA 4XJZA 3C3VA 4J1WA 1JZ7A 4DEVA 2J42A 2E6VA 1JUIA 1TZOA 2P4EA 5FK7A 1RUH2 5J1XA 2BUKA 2X29A 4C90A 1QOSA 1YIFA 3AKPA 5FPXA 1LODA 2HWD1 4RHV1 2XG3A 2I07B 4BHPA 5ISLA 4C0BA 1VBA2 2Y34A 5C3OA 3PDQA 4BMEA 1G9FA 4XDOA 5FZ1A 3SH4A 3SXWA 5CG9A 5T52A 4BQWA 3ZYPA 4IE6A 1KFXL 3K75B 4GXLA 1N3PA 1OA3A 4M3CB 1U5ZA 1AZDA 1UPIA 1PVXA 4H7MA 3SITA 5FP3A 1GWKA 1QHDA 1I5ZA 4FVVA 4HPKB 1X36A 4YARA 3MPPG 2WWJA 3INAA 3KHCA 5EP9A 2K2SA 3VBRA 1D2SA 2CV6A 4TWTA 1QJX2 2W91A 4CCJA 1B35C 2W94A 2EA7A 3RMYA 4A7ZA 1BLZA 4SLIA 3VD5A 2W5FA 3TBDA 1F2NA 3VBSB 2YHJA 1COV2 4AGRA 1LGBA 2AH2A 3B7MA 2VZ1A 2VCCA 5FREA 2AEZA 3FBMA 3MPBA 2WAOA 4NVPA 5CAZA 5JDBA 3HQRA 3ZSMA 2YBKA 3A23A 1S0GA 1KD7A 4NHKA 5DDJ3 4PI2A 3U37A 4AVTA 4FTEA 3LB9A 5FZEA 5GKAC 5IHRA 1SMVA 2GP3A 5LA9A 1JZ4A 5JR7B 1POQA 1AR71 4QM9A 5C4WA 3ZR5A 5FOBB 4NE9A 2RDNA 4Y20A 3ZN5A 4QDRA 2RG4A 2Y6JA 3K46A 4Z2WA 4TSVA 2FD8A 4MGTA 1V9U3 4EN8B 2Z5WA 1WCKA 4N53A 4Y1VA 1K12A 4HVRA 1S0FA 4PI0A 4B4QA 5IT6A 3I2JA 5GLUA 5FPAA 2D5HA 3PUHA 5FPVA 2EXHA 3AMMA 4XVHA 3S30A 1ULCA 1TME2 4FTSA 4ONUA 3GBGA 5FZ7A 1UMIA 4XFAA 3RJRA 2JDYA 3NWKA 4EYUA 1UPSA 1RUF1 2XLAA 4C1WA 3TN92 1WMEA 4E4DX 1OLMA 1FPN2 1JMUB 1DQ6A 2AACA 2YG0A 4HXCA 4OVEA 5FMCA 3VL9A 4CUGA 4D6QA 5HBAA 3RZJA 1A8DA 3WT3A 4NIAA 1HW5A 3O1MA 1MPXA 5FZ8A 3NNFA 3KS7A 4QPGA 1ZX5A 2HWE1 1BCXA 1SLBA 2VAUA 3B5LB 1S0IA 3J7MA 4LO7A 4IEZA 1W6QA 3T08A 3NNMA 3URFA 3WG1A 2PQQA 2WA3A 4X6RB 3MW2A 1BBT2 2RM22 2ZEXA 2A73B 1JYNA 1V6MA 4QKBA 1RUG1 3LFIA 2V5YA 3NKGA 1PVC3 2DBIA 3AZXA 3MV11 3UJOA 4Q4W1 4Z2AA 1JOPA 1RXFA 3T0DA 3OD0A 1H9PA 2VD7A 3AFGA 5FYIA 1R1ZA 4I3GA 1UZWA 1LKNA 5L73A 1ZRDA 2FDFA 2A6YA 2I74A 4QQ2A 1J1TA 3R4DB
chains in the Genus database with same CATH topology
2OA2A 3ZFEC 5J09A 3MEPA 1DQ2A 4TLFA 2IZWA 2RS32 3SNMA 1H2NA 2B39A 3DGTA 2MEV1 3FZ3A 5EV7A 5B2GB 1PO22 2GMPA 2DUQA 1S0JA 4P14A 2ZS6B 4PIXA 4XIOA 4AVVA 1J59A 2CAVA 3AMHA 4Q26A 4Q4V3 1CJDA 4OUSA 4W6YA 1WW6A 2Q1MA 4PDWB 4CEYB 2DF7A 3WHTA 4PLNA 4Q1RA 4QM8A 3TNPB 1NQJA 1H0BA 1LOAA 1LB2A 4L11A 1VBE3 4CDQC 4D3WA 3PVNA 2C9AA 3MZHA 1RIRA 4BZ4A 1COV3 4CEWA 1X7NA 5GZCA 1AVBA 5LEJA 4WVZA 3VKNA 1F9KA 2B5HA 2NQYA 1VALA 2ZHMA 4RGAA 4XFGA 2R041 4WVWA 1JN2P 3NW4A 1XE7A 3MFCA 5I0SA 1LU1A 1O91A 1PK6B 4XQDA 3J26N 4XJAA 3RYPA 3K48A 2CNAA 2E7TA 2FZ2A 4FAGA 3UKNA 4Q4Y1 1WA4A 4M3CF 2KXLA 4Q27A 4LBQB 5L7OA 3VKLA 2EVXA 3MIFA 1UMZA 3O0XA 1YIPA 2X5IC 2ET1A 2XKOA 4SBVA 1PZ9A 2WT0A 3VBRB 5T5LA 3ROUA 3SMHA 3VBOC 3AZVA 3L2YA 4C1XA 5BNPA 1WD4A 1ULEA 2A3YA 2BNMA 3JQXA 4XF3A 1FAYA 1V6LA 4MGKE 2PHFA 1PHMA 1TMF1 2HWF3 3MW3A 5TSWA 4CDWC 1N1YA 2OPKA 4RS5B 3TB0A 3VDDC 2JG8C 5C9AB 1QDCA 3L2HA 2WNVB 1WCSA 5C4WB 2DVDA 4UW5A 1R082 4HVOA 2TNFA 4XFCA 1LHOA 2DFCA 2QNKA 3DF0A 4GMP3 2GDFA 5BNNC 4P9GA 2D7FA 4GULA 4NR1A 5CFCC 4N53B 1EV13 3USUA 1FMD1 2R0HA 1HQLA 3T2TA 2GC3A 2OW4A 4AW7A 3WP6A 3LGRA 4Q0UA 2RS33 2PAKA 1AJOA 3EBRA 1W0PA 4MVTA 1VBC3 1SFYA 3ZXJA 5FMOL 1MACA 2MHFA 2YZ4A 1PO23 3WDUA 3KGZA 2JG9C 1J3RA 1RUJ1 3ZSEA 2R072 1ZZBA 1CQ9A 5J3UA 1D0GA 4DQAA 1PGSA 1IPKA 4FBFA 1W6QB 3KCCA 5K7PA 3GZTB 4I30A 2XH6A 2ES3A 4Q4V1 3KGLA 1RUI3 3D8CA 1H2KA 3JD71 1BQPA 1VRH1 4DINB 5JMCA 3KT7A 3EQEA 4Z07A 4TZDA 3KT4A 1AL22 4META 5C8CB 2WL1A 3H1WA 4QQOA 1C8NA 4LBLA 3V65A 5KC6A 4FAHA 1YWKA 1IQAA 5IK8A 4W6WA 2ZGUA 1MQTC 5JOWA 1AYN2 1YFXA 1QXPA 2Z2SB 4Y1YA 3AYCA 2PYTA 4IEVA 1UD1A 2BTVC 3D5OA 2X8KA 1V00A 5JOZA 1Z0HA 4GKYA 1I3HA 3PHMA 5C8WA 3H7YA 1ZZ7A 3FFQA 1PO13 1Q5OA 4KGQA 1LOEA 4AWDA 4EN0A 4DRRA 5T50A 4COVA 1IKQA 2WIIB 1REFA 1UZYA 1LECA 2HYKA 1UZZA 3AMPA 1BEV1 2PLV1 5J7MA 2XJPA 4INDA 2ZACA 4CDXC 1NQDA 4HVQA 1LOFA 2VMHA 2P17A 3ILRA 1Q8SA 1RUD3 5DUUA 5DUVA 4KU8A 4GMP0 4CEWB 4IV3C 2E9QA 2DCKA 1X8EA 4E2QA 1GNZA 4JC1A 3M3OA 2C5DA 4OHVA 1FATA 4UXAA 4QPIA 4HKWA 4QQLA 1HXS1 4ES8A 4AQSA 4UW3A 2XUMA 3B94A 2WNEA 4XEZA 4ASLA 1VBB1 3OBRA 2ARBA 5BXXA 2DCZA 3KT1A 2HWF1 5J36A 1U5XA 3ZXAC 3JU9A 4Q8LA 5K9YA 2XL7A 2GU9A 1OLQA 1LHWA 5FMOS 1UKRA 4FPLA 5ACA3 2O0OA 2AENA 2D5FA 1ND2C 3SCHA 2ZX0A 3H9AA 5HCFA 1FOD2 1DG6A 4TYSA 5GZGA 3AX4A 4DNYA 1C1LA 2RMU2 2XBO1 3IMNA 4PBOA 4X8NA 3U0ZA 2YPJA 1WBFA 3ZXFA 4LHKA 2R073 4M00A 3TRSB 3U4XA 3CF6E 5CFDA 3RS6A 4GALA 3NAPA 2YMZA 5JSRA 3AMNA 2A7AA 2IXLA 4Q2FA 5D8AC 3ZVXA 1G9DA 2D3SA 3CU7A 1HX6A 1NA1B 1QY4A 1XNKA 1ZYBA 4Y1XA 1GLHA 1D4M3 4AI1A 1WUVA 2JKBA 2Z42A 1AL23 3SH3A 5CG8A 2XVKA 4GB33 3KCYA 4R52A 3FBYA 4JDNA 3BCWA 1WW5A 3KQRA 2WKKA 4IV1C 3USUB 3RRDA 1Y3TA 1CONA 4Q0VA 1RUC3 4XTMA 5FO7B 5BYNA 1OHFA 1QQP1 5E88A 2Z69A 2ET7A 4YGDA 3AYAA 1VAKA 5GJ6A 4BWOA 4BCUA 4NWWA 1QJU2 2HWD2 1QDOA 3AXEA 3KSCA 3AKRA 5BPXA 2SLIA 3BTAA 5HCBA 5KHJA 4XYXA 3B00A 4QGLA 1DU3D 1PM7A 1XYPA 1F5FA 1VBD3 4N7IA 5FRAA 2VUJA 5EXOA 1CD3G 2ZHNA 1G8WA 2ZGNA 3VBHC 2B42B 4FP3A 3WDWA 5KC5A 3LSDA 1BK1A 1QJY3 1C1FA 1XXNA 2OZ6A 3OY8A 2CGPA 3X29B 4HT1T 4DRVA 2KM2A 2VOKA 4AFBA 1YLLA 5J96B 2EXJA 4KG8A 5AFEA 1POV3 3R6SA 5KXBA 2D40A 3SHRA 2BVBA 2YXSA 3NV4A 3VHOA 1MS3A 1RMU1 2H0BA 3M3EA 1RVF3 5KWRA 3SCGA 3SCFA 3I54A 4QMAA 1JH5A 1AR72 4E4SA 1YYNA 4CP0A 4LBQD 4PCRA 1OQEA 4EWEA 1HRI1 3FLPA 4K40A 1DGRN 1RUE3 4MYEA 2YC0A 3AP6A 5KXDA 1OI6A 5ABJB 4C91A 2RS53 1VP6A 4M3CA 4A7KA 1FNZA 4OI4A 3THTA 1W39A 1WGPA 2TEPA 4JDOA 1A8MA 1PGW2 2YROA 4M3CE 5H9SA 1EP0A 5BNOA 2R1DA 4YZ4A 2D6MA 3B93A 3AZWA 1AR83 4LE3A 2OVUA 3M3IA 2BNOA 4EN9B 2ZAAA 1K5MA 1RHI1 3WQ0A 3RNSA 5HI0A 2PTMA 2HWE2 2DYCA 2VOWA 4Q4X1 4QPIB 5DG2A 2IFRA 4H14A 2DVFA 5LK5A 4AGGA 4YVSB 3BU7A 1DZRA 1RUG2 2ATFA 4K7JA 4OI2A 5GZFA 1D4M1 4W6XA 2XJSA 4Q4W2 3RPQA 3VZMA 1MEC1 3WXPA 3MW4A 2XL9A 4Y24A 1UN1A 4CDUB 2OUJA 4XF1A 4BLIA 4YZ5A 2FZ1A 4WZCA 5BY5A 1QJU3 5EFUA 3ZIWA 3DKWA 2ZGKA 1N1VA 2MEV2 2VW0A 3HBZA 3NAPB 1YNAA 3GYDA 1EPWA 1POV0 1V6NA 4KNCA 4LO8A 2Q8OA 1JYIA 4XBQA 1KFUL 5DZGA 1OLRA 1RTVA 2TBVA 3ZYRA 4I3PA 4E9KA 3V0AB 4XIKA 3RI9A 2WLPA 1U5YA 1VBD1 2ZGRA 1OPMA 1FYUA 5F6LB 2CWMA 3J8F1 2R063 1N1SA 4ITCA 4N43C 4FPJA 4E2SA 1LEMA 2XKPA 3JB4C 5FFOC 5JZGA 2K0GA 5A32B 5FO9B 2WZR1 5KXEA 4R9AA 3FUOA 3MIEA 1DGWA 4FOWA 2R042 4Q0QA 4YG3A 4BIFA 3VBFB 1Z7S2 2WSVA 3FE5A 3ST7A 5F9TA 1OD5A 4XE9A 1BJQA 4NHMA 4AEDB 1IGOA 2VW2A 4Q4Y2 4XW3A 2WWSA 1DGRA 3WG2A 3WDYA 1R091 3HT2A 3VUOA 3PVBB 2ZJCA 3RYKA 4R8HA 2QKDA 4L8QA 2HWC3 4PDWA 2RE9A 2QCSB 3GZAA 4N7UA 1RL3A 2H6CA 3RMXA 1ZBA3 3WD5A 3ILFA 2AR6A 2VUAA 1ZZ9A 4IL7A 5E16A 4XF4A 4XJWA 1TE1B 1DDLA 3E97A 3O5SA 1TMF2 1LCLA 4KG0A 5JAXA 2ILMA 3D6EA 1H8TB 2EAAA 4DZGA 3S6PA 4QPGC 1O4TA 4ISRA 3HQXA 2DCTA 4EWDA 5GM0A 1EY2A 2VY0A 4MGYE 4AHYA 1PK6A 1XNCA 4GA9A 3VZKA 3AM2A 2VNRA 3AP5A 5DUXA 1AXKA 1HIXA 2ZBJA 2XLGA 1FMD2 4UW4A 3ZSLA 2PHWA 2WFPA 2OYZA 3WNXA 1QMJA 1AR63 1D0HA 4Z82A 2R49A 4MXWA 1LOGA 1VB2A 4YVWA 4LBQA 1D4VB 4A3XA 5AC92 3S0MA 2RR11 4MLOA 4ORFA 1LJ7A 4K9SA 3DPRC 1AYM3 1GKBA 1RUJ2 2VVFA 4F83A 5BNOB 2C0ZA 1SCRA 2UWAA 4YW4A 3VZNA 3LZZA 2PFWA 3G6JB 1K5MB 1LR5A 3S7IA 2ERFA 1QH7A 4B7KA 5I91A 3CO2A 4GH4A 2WNUB 1BKZA 1EPZA 1FV3A 1AL0G 2YV8A 4RS5A 4HL0A 5C9AA 4AVSA 2WNVA 2ZZJA 3JD72 1VRH2 5BUVA 3MF9A 4AEKA 5T54A 2HWB1 1ZBE3 3WDTA 1Q8PA 3UV9A 1NY72 2ZMKA 4HKOA 3ZPYA 1U5IA 1NCQC 3MICA 1UX6A 4IESA 5FLJA 1VB4A 2PELA 3RSJA 3VKMA 5JIAA 1DFQA 3RYRA 1O3QA 2WFF3 2F6BA 2RS13 5K0UB 1HRV3 1KJLA 1BEV2 1WW7A 1PGL1 2NLRA 4XFIA 2DTWA 1ZNPA 1J3PA 3UKVA 1X50A 5JI7A 2WS93 4YFWA 3M3QA 1EAH2 2VNGA 3W59A 1HV1A 3ZFGA 1WW4A 2I45A 3WLUA 4DOUA 4IEUA 2V73A 5L7OC 2ZKLA 2XJTA 1C8M3 1VJ2A 2XJUA 2IFWA 2A6VA 3U10A 3VBUA 1ZM1A 4YNIA 5SV5A 3MIDA 5C8CA 5LRRA 4R9BA 1JOJA 3D0SA 5JZGB 5BNPC 4OZXA 4AVBA 1RUH3 2AUYA 3ZDSA 4WBBA 3G7DA 4LNVA 2F4PA 4BA6A 2WA4A 4NN0A 2B7YA 1VBA3 4YFZA 3B69A 1XNDA 4IETA 4NO4A 1ND3C 1ENQA 2FMYA 4JGYC 2A70A 4LR4A 2XVGA 3B3QE 3MIGA 5FCCA 3WZ1A 1TNRA 3SISA 2ZGSA 3MDPA 2XBO2 1J1LA 1DZQA 3MI8A 3WOGA 2GH8A 4DS0A 4LO5B 1QJX3 3GALA 4N9IA 1AR61 1B35A 3WCRA 3JUUA 3J9SA 3PTYA 5I0RA 1LHVA 4HSLA 4KL1A 2ZZQA 3UL2A 5C6CA 4IXLA 4ZU4A 1BVP1 4FOYA 5KHGA 2JECA 5J98B 4YZ3A 3R4SA 3CL1A 4CRQA 2FQPA 3CJIC 1KJRA 5IK4A 2NN8A 3UJQA 4JTNA 3AZYA 3N7LA 4PIZA 4ZU5A 4B7EA 1UW8A 3MGUA 1CN1A 4DFSA 2PHUA 2ZPXA 1CAXB 5DDJ1 5SV8A 4HN0A 2EF6A 1ENXA 1ZRRA 4I2OA 1VLNA 1YO8A 3VLBB 1TME3 3PVEA 5KHHA 1V9U1 3B01A 2ZGMA 5K8SA 4MXWB 2DTYA 4FPKA 4YVWB 4AXOA 1WCDJ 2GH2A 1O7FA 3TN93 1FPN3 4ES9A 3GHNA 1X33A 1NXMA 4XQ4A 3ZFFC 2VNOA 4FXGB 1FV2A 1BMV1 3M3CA 5CU1A 4IEOA 1EAH3 2HKXA 2MPFA 2O1QA 3HAGA 1OOPB 3WY6A 2QUOA 4BPZA 1NA1A 1BBT3 1OKQA 1UAIA 2RM23 3BB6A 1UU4A 4GH4B 3HR9A 3BALA 1QOTA 4FQ4A 4BIOA 4R9CA 1XU2A 2GMEA 4HSJA 3LOIA 4S2GA 1NCRB 2P37A 2ZA9A 3I7DA 2B9UA 5LK7B 1JXNA 3ZXGA 2NYYA 4Z8BA 4DY5A 2ZX3A 2EALA 3KCXA 1HDKA 1KXGA 1PVC1 1VR3A 2D44A 2R32A 3CJXA 3M8LA 1MZ6A 4L92A 4B4PA 4MX3A 5A33B 1RMU2 5JSOA 3W9AA 4HMZA 5F5QA 2W68A 1WLDA 3FJSA 3ZXDA 4RR3C 3QLQA 2ZAHA 1Q43A 1N3QA 2UY9A 4WM8B 4NOTA 1UU6A 3EO6A 1HRI2 2FMDA 2H6BA 4YW1A 3WHUA 4AVCA 1ZVFA 2Y38A 3IM0A 1VBA1 3AFKA 5E8AA 4B3NA 2Q30A 1NLRA 2CWSA 5KBFA 4AQ2A 2A3XA 4CDQA 3ZFGB 1DQ5A 3AYDA 3PJQA 1R1A2 1LGCA 1QJX1 1H4GA 3VBUB 1VBE1 5CFDC 4JRLA 1PNFA 5L36A 1L3JA 1COV1 1PIV2 4Q4X2 1MS1A 3N7KA 3VHRA 1LHNA 4P9IA 4YSFA 2NPIA 3ZN6A 2XJQA 1LU2A 3NVCA 4AF9A 1MEC2 2W08A 1XQNA 1QWRA 5EJ3A 5ABJA 1WMDA 4EN6B 3WUDA 1LGNA 5IK7A 5DZFA 1C28A 3FMGA 3NV1A 1Q8QA 3VBOA 4XZPA 5CVRA 1B35B 3PNAA 1CIWA 2ZX2A 3WP5A 3RWNA 4AFDA 2DUOA 5A3MA 2CAUA 3TAYA 4YM1A 4CDWA 3QH7A 4LLOA 4QHBA 4HK8A 4JGZC 3OCPA 3T1MA 1ULGA 4WM7C 1ZRFA 5HXVA 4IEQA 4GWNA 1R083 1UIKA 4YVSA 1CPNA 1MS5A 3N3HA 4QD2A 4ATFA 5KHKA 3AKTA 1NG0A 4XXAA 3ASIA 4RQPC 1S0BA 1VAVA 4MSVA 1REEA 5KXCA 1W6MB 2DU1A 4P9WA 5FPZA 5JOYA 4OI0A 2JXAA 4FPOB 1DZTA 4CDUA 1NZCA 1V6IA 4GMP1 4FQZA 4YLZA 4GQ7A 2WZR2 3JBG2 3WQ7A 4I09A 3WX5A 1AR92 1EV11 1GZCA 1NE4A 2JG9A 3EXUA 1RJ7A 5H9RA 4KH9A 4QQPA 2RS31 2NP0A 1NE6A 4LHNA 1LRHA 2DVBA 2HJIA 1FT9A 1VBC1 5GZEA 2W39A 3ZYJB 4U2AA 2E51A 1PO21 1CR7A 2MNGA 2DUPA 1S0EA 3QOPA 4HFSA 5DUWA 2YYOA 2DU0A 4RGGA 1YCIA 2E7AA 1R092 1AJKA 3HT1A 3V0AA 4Q0PA 4KBBA 4F3JA 1IPJA 4GWMA 3E6BA 1UU5A 1R1A3 1YFWA 1O3TA 2PHDA 4W65A 5EWSA 5J37A 1RUNA 2GZWA 4QPYA 3ENRA 3P3PA 1YFYA 1AYN3 1MQTA 1PIV3 4YGCA 5H9QA 4E27A 1RUI1 1S0DA 1ASJ2 4KU7A 4P9XA 4BM8A 4LT5A 1ONAA 3ZFEB 5A32A 3MYXA 5AFBA 3VBSC 3HD8B 4XPVA 1H2LA 3WVJA 4Y1UA 3VBFA 4RHV2 4B8EA 2IXJA 5FO8B 1PZ7A 4AI0A 4COZA 1V70A 2LUWA 4CDXA 1H8VA 4AEDA 1S2BA 1AHSA 1PO11 1HV0A 3AP7A 4YZ2A 4IQPA 3MF6A 2DVAA 4CDQB 5F1RA 3PVOA 1A6CA 3OYWA 2RR12 4BE3A 3OGGA 3M2MA 3IT8A 3O14A 3E5XA 4H3WA 4IV3A 1GICA 1Q56A 3B02A 4OHXA 1QXRA 2GC0A 2XB6C 4K8FA 5FBZA 3USSA 1RUD1 3OGJA 2UWBA 3WW2A 4E2GA 3DL3A 2WT1A 1H8TA 3IDBB 1UCXA 1GFF2 1V6OA 1NLSA 2HEYF 1OFNA 4LUKA 3ZIXA 5D1IA 3ZN6B 4XJ9A 2ZX4A 1CX4A 1ND2A 2D6LX 1FOD3 2W52A 3JB8A 1D2QA 1PNGA 3JBG3 4CYDA 1JBCA 2XVLA 2RMU3 3ES1A 3ZXEA 1RB8G 3WCSA 5ACA1 5JI9A 2RJKA 2IXIA 2X5IB 3ALQA 3VBOB 4OHWA 3H0OA 4I02A 4RFT0 2VU9A 1W6NA 3VL8A 4LBMA 4KQ7A 2UYBA 1RUF2 2W0XA 1KDMA 3E5UA 1AX0A 5F6KA 4FXKB 3CNAA 1DQ1A 2R071 5IK5A 4Y22A 4CDWB 2D6PA 1PGL2 2Q0AA 3AKQA 4LTAA 3ME2A 2BFUL 2JG8B 2QDNA 3VDDB 4F7ZA 4WV8A 1UL9A 4YW2A 2WNUA 3I2DA 1DGWX 3ZXKA 5BNNB 3U11A 5JIUA 3ZMNA 4PDWC 4IV1A 4CEYC 5CFCB 5CBLA 1ASJ3 1GANA 2ARXA 5FDBA 1SACA 1YI9A 2GN3A 3OJBA 1AL21 4YGBA 2WC2A 4GB31 4I0WB 4LBOA 2GNTA 1AYN1 2FBEA 4LULA 4K20A 2DVGA 1V6KA 1SLCA 4DMIA 2BQPA 2HWD3 3FC0A 4RHV3 2GNMA 1M4WA 1RUC1 3I8TA 2JG9B 4IEYA 4AQ6A 3HWJA 3M7AA 5GZDA 1IKPA 4XJ8A 3ETQA 2OZJA 3IIAA 1QH6A 5FAXA 4FO9A 1C4RA 1CAUB 3QH6A 5K0UA 2EXKA 1PK6C 4PF5A 4F8AA 2VGDA 4S2HA 5FQ0A 3NO8A 4IERA 2A75A 1HLCA 1MZ5A 4LLFA 1GSLA 4DPNA 3H1YA 1XU1A 5JSPA 1G86A 4J1XA 1AUYA 2IXCA 1QJY1 1MQTB 2Q5TA 3OTFA 3CEWA 1GQGA 1IS5A 4Y1ZA 3VBRC 2A6XA 4OUMA 4NHLA 1W6OA 3N7JA 4AEJA 4HLTA 4QGNA 5I8YA 1POV1 1FI2A 2QDRA 4AYUA 1JHNA 3A4UA 3AJYA 3KMHA 1KRIA 3RG0A 1AR73 2BEOA 5I8SA 3CLPA 1BVVA 4XXPA 4N90A 4RS5C 5C9AC 1H9WA 1RVF1 2D93A 1S1AA 2WNVC 2PHLA 4CDXB 3AP4A 5C4WC 2B45X 2JEMA 2Y0IA 1GYKA 4ISQA 2HEWF 4M0NA 1H1IA 3O0VA 3WINE 4AI3A 1RUE1 1V9U2 3FLTA 2R30A 4N53C 1QKQA 3OYWB 2RMU1 1F31A 2RS51 3FX3A 1RUF3 5T5PA 5JCTA 2D6OX 3PMEA 4NWVA 2VQ0A 5JPMB 4IV3B 1DYKA 3POYA 4KWKA 3H3ZA 4MGZE 1UF2C 2HWE3 1I9RA 1G9BA 2XJRA 3KD4A 4YG0A 4RD7A 4WM7B 3POSA 1NOVA 3SH5A 4G4FA 3LAGA 4FPYA 1AR81 1YFUA 1RUG3 2KA3A 2GALA 3R4UA 3ZO0B 1OQDA 2DFBA 2AREA 4Q4W3 1G7YA 1SBEA 3ATGA