3GYDA

Crystal structure of a cyclic nucleotide-binding domain (mfla_1926) from methylobacillus flagellatus kt at 1.79 a resolution
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
178
structure length
178
Chain Sequence
HHHENLYFQGMYPDLVHLGGADKYFEEILEIVNKIKLFGDFSNEEVRYLCSYMQCYAAPRDCQLLTEGDPGDYLLLILTGEVNVIKDIPNKGIQTIAKVGAGAIIGEMSMIDGMPRSASCVASLPTDFAVLSRDALYQLLANMPKLGNKVLIRLLQLLTARFRESYDRILPKTLGELI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of cyclic nucleotide-binding domain (YP_546034.1) from Methylobacillus flagellatus KT at 1.79 A resolution
rcsb
source organism Methylobacillus flagellatus kt
molecule tags Dna binding protein
molecule keywords Cyclic nucleotide-binding domain
total genus 52
structure length 178
sequence length 178
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3gydA00
2VPVA 1X82A 5LRSA 3U11A 2QCSB 2H6BA 5C8WA 3D82A 4MGZE 2BEOA 1ZRDA 2IXHA 1YWKA 2BNMA 2O1QA 1XRUA 3L2HA 3GYDA 4YARA 1ZZBA 1ZZ6A 4HN0A 2DCTA 4I02A 2BNOA 1FXZA 1LR5A 1YFUA 3BCWA 3BU7A 1GQHA 3UKVA 2PFWA 3D0JA 1CAUB 4XFAA 3RZZA 3ST7A 2O8QA 1FT9A 1UPIA 3E6BA 4J1XA 5K8SA 5LEJA 4FT8A 5I8SA 3LA3A 2PAEA 4PIYA 3S7IA 2IXKA 3IBMA 4QM8A 4LEJA 5FLHA 3FX3A 2ETEA 4X6RB 5FLIA 5FCCA 3KGZA 3EBRA 5FLJA 2D5HA 1CX4A 3RDIA 2D40A 3BB6A 4ONUA 1HW5A 4QGNA 4XF0A 3BALA 5BPXA 4I01A 3WW3A 4HVRA 1O3TA 4H7LA 4UBGA 1NXMA 2XLGA 5E1RA 4UXAA 4BYYA 4XF3A 4LUMA 5BY5A 1YFWA 5JSOA 2V09A 5CVRA 3MPBA 1I5ZA 1O5LA 3H9AA 2QDRA 1FI2A 4XF4A 3RYPA 4WBBA 3CLPA 1LKNA 5T3NA 2Z69A 1ZZ9A 2WC2A 4XFCA 1X7NA 2B8MA 3H1YA 1CAXB 4IEOA 1QWRA 4FAHA 1QXJA 3FFQA 4DINB 5KHGA 4HSJA 1SEFA 5JSPA 2OZ6A 5CADA 4JVAA 4QX5A 1O7FA 1OMIA 3U10A 1ZZCA 1VJ2A 4EV0A 5E16A 3KCCA 4QGMA 4AVAA 4I0AA 4WVZA 4XEZA 4PIZA 4Q0PA 4A2UA 3DV8A 3H1WA 1LB2A 4IEQA 3U0ZA 1UW8A 1PM7A 4P9GA 2XHKA 4XFFA 2FMYA 3NVCA 2XGXA 5BXXA 4XETA 4QXKA 3H7JA 5I0RA 1U12A 3CO2A 3NKTA 4IESA 1Y9QA 2IXIA 4LLOA 5BV6A 1JUHA 2H6CA 4YSFA 3DL3A 4IEWA 2QJVA 3FHIB 3WW4A 1H1MA 1YFYA 1OI6A 3I59A 4MGYE 4OLLA 3EHKA 1O5UA 4GULA 4KL1A 2GC1A 3CL1A 1CAXA 1TQ5A 4ZU7A 2BYVE 4HMZA 1RC6A 1UIJA 4MGIE 5FQ0B 4X6QB 1ZX5A 4HBNA 5FPZA 2OPKA 3SXWA 1ZREA 3R6SA 1WLTA 2UY8A 2PYTA 3E97A 1J3QA 5I0SA 1H1IA 3S0MA 1WGPA 2GC0A 5JSRA 4Z82A 3IDBB 1OFNA 4B29A 1UCXA 2QVSB 1CAVB 4HLTA 3FJSA 1RUNA 4J1WA 1J58A 5KHHA 5I93A 1O4TA 3TNQA 2OZJA 2XKOA 4FAGA 3ACLA 4MUVA 3SCGA 2ATFA 2KXLA 3SCHA 5LRRA 4YRDA 2GU9A 2Z2SB 4Q0QA 4E2SA 3EJKA 3G7DA 2ET1A 1EPZA 2VQAA 4IEUA 3ZDSA 4XFHA 3LWCA 2VECA 4ORFA 2QNKA 1YFXA 3E5UA 2XLFA 3E6DA 5I8YA 4EWDA 1UIKA 4IERA 1Q43A 3FWEA 1SFNA 3H1MA 4IEYA 3I7DA 3ROUA 4OFGA 3C3VA 2XLAA 4NVPA 4JV4A 3MYXA 4QGLA 4XF9A 4LTAA 5KHJA 4HN1A 3CEWA 1RL3A 2GH2A 3H8UA 3OGJA 3SCFA 2XL7A 3NSTA 1ZZ8A 5JR7B 4L11A 4IEPA 4JTOA 3KSCA 1O3QA 2H0VA 2MPFA 4AQ2A 1QY4A 1WA4A 1EY2A 4MZUA 1GQGA 1RTVA 4Q0SA 2PHLA 2IC1A 2GZWA 2HJIA 4F8AA 2XKPA 1YUDA 5BUVA 4E2QA 1J3RA 4I2OA 1CAWB 4MH0E 2UY9A 3JZVA 1CAVA 3ETQA 3VHRA 5I0UA 2ZKLA 4JTNA 4L2NA 5J7MA 4XFIA 3UKTA 1CGPA 4K8FA 4ZU5A 4HVQA 1LRHA 2BNNA 2CV6A 2UYAA 1PMIA 1J3PA 1IPKA 4CYDA 4EWAA 2IXCA 4META 4PIXA 3SHRA 1J1LA 4LULA 4Z07A 4WZCA 3LZZA 4XF1A 1SQ4A 3WW2A 3OF1A 4EROA 1NE4A 3DN7A 2EVXA 5KHKA 3N4MA 3NW4A 5FQ0A 2XL9A 4XFGA 4BIFA 3MZHA 3EQEA 2Q0AA 2EA7A 3HT2A 4O9GA 5J48A 3QOPA 1I6XA 1CAUA 3E5QA 3IIAA 1NE6A 5CU1A 2I45A 1ZNPA 4HSLA 2GC3A 3PLQA 3RPQA 3IWZA 1L3JA 4D7SA 2F4PA 2UYBA 4ZU4A 3TNPB 5JAXA 1DZTA 4HVOA 1UD1A 4BHPA 1X8EA 5EFUA 2PAKA 2Q30A 3S7EA 1ZRCA 4LA3A 4FBFA 3ES1A 4KWLA 3E6CC 3KGLA 3DKWA 2D93A 1O3SA 1RUOA 5KHIA 1NYWA 3E5XA 2ZCWA 3EO6A 4XFBA 2BGCA 5D1IA 5LEKA 2PAMA 5JCTA 2HKXA 1ZVFA 3LOIA 3M70A 2OA2A 2N7GA 4KWKA 4R8HA 2B5HA 1X8MA 4RD7A 3GBFA 2PTMA 3RYRA 5HI0A 3LA7A 1O3RA 3HQXA 2MHFA 1YLLA 3UKNA 3HT1A 4N9IA 2CAUA 2K9ZA 5I91A 3MDPA 2B9UA 1DGRA 4LUKA 4LA2A 1V70A 1ZZ7A 1RGSA 2E9QA 2MNGA 4IETA 4O9EA 2PA7A 3USSA 1DGWA 3I54A 2Q1ZB 3D0SA 3PVBB 2EAAA 4Q29A 4R52A 5I0TA 4Q0VA 4IEVA 3RNSA 4AVBA 3ES4A 2WFPA 4F7ZA 3H3UA 2PHDA 3M3IA 3NL1A 2IXJA 3BPZA 1XE8A 3LAGA 4PJYA 1EYBA 1QXRA 2D5FA 2GAUA 4QMAA 3WW1A 5I8TA 1CAWA 3H3ZA 2Q4SA 5FDBA 3CJXA 4N9HA 4UBHA 4BH9A 1DZRA 2P17A 3CF6E 3ELNA 4Q0UA 4KU7A 2OYZA 4E2GA 1OD5A 5AVPA 3OCPA 4MV2A 3FZ3A 1Q5OA 1YHFA 4YYOA 1IPJA 1ZRRA 3H50A 4KWJA 5FPXA 3LA2A 1EP0A 2K0GA 3I59B 1Y3TA 3OTFA 4HZFA 1G6NA 3SMHA 1NZCA 3HIFA 3O14A 4TLFA 5EZWA 3RYKA 4MX3A 5J3UA 4MGKE 1Q3EA 2FQPA 2IXLA 1ZRFA 3FE5A 4IEXA 4I3PA 3OD0A 5F1RA 1J59A 3NJZA 3IDCB 3QACA 1VP6A 4D7TA 2CAVA 4QM9A 4AXOA 4AVCA 4EWEA 2PQQA 2ET7A 4KU8A 4I0BA 3B02A 4IEZA 2CGPA 1XE7A 4YNIA 5C6CA 3H7YA 2Y0OA 3PNAA 4AQ6A 2GC2A 2C0ZA 3KMHA 5KBFA 4I09A 1VR3A
chains in the Genus database with same CATH superfamily
3ZIWA 3B3QE 3Q8AA 1XU1A 4BQ3A 3JQXA 4LIUA 1WW5A 2QQJA 2VH9A 4A7YA 4FTEA 1R083 1T6BX 1WCUA 5C8WA 3D82A 4CDQB 1FMD3 2HWE3 2MEV2 2O1QA 1XRUA 1OLME 3FBYA 1OPMA 2AZ5A 2W46A 4QX7A 4A42A 1TVGA 2DCTA 1F4AA 3ZXFA 4LIVA 4BK5A 4CCEA 2R30A 3CZUA 4NUBA 1FXZA 2FDIA 1S0FA 2JE9A 5FZCA 4EZHA 4Q4V1 1ASJ2 1W2AX 4JGYB 4B1LA 4DY3A 1ND3B 2P2KA 2VQ0A 1NCQC 3JXSA 4N90A 1GQHA 4JHTA 5A3UA 3UKVA 2JX9A 2WNUA 3ZYHA 1ND2B 2WT1A 4XFAA 4W50A 2FZ2A 3ST7A 1ALYA 1OT5A 5FYYA 2LRPA 1JTZX 3KT1A 3I4IA 4DOUA 5LEJA 5FYVA 4COZA 4BQ4A 1V6NA 1MZ6A 3DPRA 4YPJA 2R32A 4D6RA 1NQJA 1NKGA 1XNDA 3IBMA 3R05A 3VHOA 1BK1A 2OQ6A 3ZN6B 2X29A 5L9VA 4P02B 3ZYPA 1WW7A 1W6MA 5FXWA 3EBRA 1QGLA 4HOOA 3URFA 1GUIA 2D5HA 1CX4A 2JDPA 5ANQA 5F32A 4CDXB 4COYA 5CFCC 3LD8A 4I09A 4IV1A 3MICA 1VAKA 2PHXA 1L7LA 2RS32 4OZXA 4AHXA 1QJX2 4XF0A 2HYKA 5BPXA 4HVRA 3TB0A 3LSDA 5A3OA 4AEMA 4UBGA 4COUA 1NXMA 2ZGUA 1J1TA 1DU3D 3H42B 3N7MA 2QFEA 3P3PA 3PUIA 4LXLA 5BY5A 3WP4A 3ZVXA 1D4M2 4A44A 2R0HA 1PO22 4QPIA 5C8CC 2F6BA 1ENQA 1HX6A 1CD3G 2BFUL 4XZUG 2CHHA 4CCLA 4BQ5A 2OIIA 5JR2A 4WZFA 1JZ3A 4XJ9A 4L99A 4AI3A 3BTYA 3CLPA 1B35B 4IUGA 1OOPB 5CFDC 3RZMA 3I2JA 2DUOA 1MACA 1PNGA 1F5JA 1R093 1US3A 2R073 2B8MA 3H1YA 3OEAA 2OQ7A 4XFCA 5EHDA 4YGCA 3VD3A 4IEOA 2UWAA 1KS4A 2ZS6B 1QXJA 5K0UC 4Y3OA 2EIBA 4DPNA 1WUVA 2A70A 5B2GB 5C33A 3B00A 3LCPA 5JSPA 2ZEYA 1CWPA 1FMD2 2MEV3 5CADA 3NJVA 2DVFA 1O7FA 1UKGA 4OUSA 1QQP1 1OMIA 1QJY2 1UYYA 2WFF1 1LOAA 1ZZCA 4GH4B 2OKXA 3ZO0B 1VJ2A 3MLJA 4XVHA 1O6UA 3ZFEB 2VUAA 4D6QA 4Z2WA 1R1ZA 4B3NA 2ZGMA 1SBDA 5A7SA 5E16A 1GOGA 5C5UA 4UFJA 4XEZA 5FUIA 4PIZA 4A2UA 3L9JT 3MBWA 5KC5A 3H1WA 2ZMLA 3GJBA 4CDXA 2JKBA 4IE4A 1W6QB 2VVFA 3LPGA 4XJWA 3POEA 1FX5A 1K5MA 4UFHA 4BOWA 5GLUA 5J98B 4YGDA 3VBUB 2BW8A 5KR7A 2JICA 2XHKA 4LK6A 4QDQA 4B4PA 3O1UA 2XONA 5JXGA 4L97A 1PO11 2XGXA 5C3QA 2P3KA 2VQUA 2R6QA 1J83A 1VBE2 4QU1A 1GR3A 3CJIB 3CO2A 4K6BA 3W21A 4W6WA 1AL21 2DU1A 2H6CA 4YSFA 1VBD3 1V6LA 5FV3A 4NIAA 2VTXA 1DIWA 2VC9A 3J26N 3AZYA 2R1BA 1QJY1 3ZMNA 1D7PM 1U5ZA 2WA3A 2YY1A 4KQ7A 1JYXA 3WW4A 3HAGA 5DG1A 2VMGA 4MGYE 2R041 5FWEA 5AC93 1O5UA 3TYJA 2WIIB 4NHLA 3FL7A 3H3LA 3PVOA 3VBSA 5JIUA 2GC1A 3VBOA 1S55A 1UZZA 1RB8G 1RC6A 1UIJA 3K48A 5DUWA 4X6QB 5FQ0B 4EN7B 2NM1A 3N9OA 3MW2A 3THPA 1ZX5A 4MXWB 1MPXA 4K20A 2X8KA 3PMEA 5T5OA 3J7NA 1X9TA 5FP3A 1XYOA 3JB8A 3GXUA 1DF0A 3SXWA 2GNTA 1ZREA 1AXYA 2HWC3 4W65A 3C8XA 1WLTA 4LHLA 4QD2A 4XUQA 5FYMA 3T2OA 4QT6A 5DDJ1 3E97A 1X9PA 1TG7A 2WQ8A 1NLRA 1K5MB 3S0MA 4MADA 2W5FA 5FK8A 4D8MA 1OPOA 2D6MA 2NP0A 1W2NA 2WYSA 4Q8LA 3JB4C 4FFHA 1UX7A 3WNOA 5F39A 4L8QA 4P5HA 1CAVB 2TBVA 3TWIA 3UETA 1S0CA 3WY6A 5FWJA 4NROA 3AMMA 2YMZA 1LU1A 1MS1A 1VBC3 4YG0A 4Y1XA 2YHJA 2HH9A 3T1LA 1JI6A 3PUAA 3K46A 1W0OA 4PDWC 2JDZA 3DGTA 3SCGA 4UAPA 1OLRA 2HWF2 3POYA 1GP4A 3SCHA 4LBLA 4YRDA 5LRRA 4ZXEA 4Q0QA 4Y24A 5CFCB 3VBRB 2DVAA 4LO7A 1HRV1 1WLWA 4TWTA 2W47A 4HANA 5FXVA 2ZKNA 4C0HA 4NN0A 1YC61 1UX6A 2ZGNA 2JIGA 2CTVA 3J8F3 2VECA 4Q2FA 2E51A 3E5UA 2DTWA 2PLV2 3NNGA 1FYUA 1Q43A 3U07A 1SFNA 4XZPA 1OHFA 4GKYA 4AI2A 2JIJA 4CP9A 4CVUA 4OFGA 4YFWA 2ZGQA 3BODA 1U5IA 1V6OA 3C3VA 4X8NA 4BWOA 3AP4A 1QU0A 3MYXA 1ZBA2 1FAYA 3ON7A 4LTAA 1PVC1 3E1F1 3KD4A 3PMSA 4OZOA 1ZRIA 3OGJA 1IKQA 1OOPC 2VUJA 5CFDB 4A4AA 2BGPA 1H8TC 2FDKA 1LU2A 1UYZA 4AEDC 3RZJA 4HXCA 4L11A 1WLDA 4JCKA 2E53A 4YWAA 2QZ3A 1UY3A 4ZPIA 4RR3A 3I3DA 4FI9A 3O1OA 2IVJA 4LOTA 4AHZA 1W6MB 5BNNA 4MZUA 3GF6A 1LECA 4H14A 4QHBA 5J96B 4B1MA 2E63A 3AJYA 5FJKA 3DYOA 4F8AA 3HR9A 4RQPC 2D6KA 1UOGA 4NHKA 5DDJ3 3VHPA 5BUVA 1G8WA 1H6YA 4ASKA 5C9AC 3WNPA 4A7ZA 5KWRA 5A6YA 5GJ6A 2PQSA 2D3PA 2ZKLA 1WKYA 3M3QA 1G9CA 4JTNA 1URXA 5CKMA 3WINE 4M3CA 4WM8C 3AJZA 5CISA 4K8FA 1UXXX 4ZU5A 4BPZA 4D6SA 4OI0A 1LRHA 4CP1A 2BNNA 1KGYA 3MIEA 4WV8A 1J3PA 1GBGA 5FYIA 5FZKA 1BBT3 3VL8A 3OB8A 1H1AA 3M3OA 4XCAA 4PBOA 5LA1A 4META 4NPRA 4PIXA 1PVC3 4LULA 4MLOA 4FTBA 4LBKA 4WZCA 3LZZA 4LT5A 1FOD2 1OC1A 1TME1 4LKFA 1WCQA 4P9JA 4UFKA 4D3WA 1GV9A 3DYPA 3ZDVA 2VZ1A 4Y4RA 5E89A 4EROA 4NWWA 1GICA 4COVA 3RZKA 1O4YA 5E6HA 5FZFA 5A32A 1NG0A 1PK6A 4NOTA 3EMRA 3DXTA 2G9ZA 2KA3A 5IJRA 3DN7A 4ZZ5A 5FOBB 1UPSA 5TSWA 2RJ2A 2WRAA 2ILMA 1DGRN 5FUNA 3U14A 4N8MA 1GWKA 4DUXA 5DZFA 3MZHA 5FR3A 3NJXA 4TZDA 2BDRA 2E7TA 2Q0AA 2VXRA 3HT2A 3W59A 3D4KA 4CDWB 3QOPA 3A7QA 1CAUA 5ABJC 3N36A 4Q4Y3 2I45A 2UWCA 5ISLA 1HRI3 5FYTA 5LB6A 5FPLA 5F5AA 1CX1A 3T4VA 5FZ6A 1OURA 5EYXA 2J1TA 1VBB3 3M3CA 5GLVA 1XYPA 3ZXKA 1GZCA 3RWKX 4EN8B 1MQTB 3MIBA 2GSYA 1W2UA 4GKXA 4KGGA 4TYSA 3VBFA 2HWC2 1ZBA3 2GP5A 3TNPB 1N3PA 3FMGA 4Q4X3 2W1SA 4KG0A 2DU0A 1UD1A 4BHPA 4DUWA 2WAAA 1BVP1 1X8EA 2WS91 5A7PA 5EYYA 4QB6A 2C9AA 2E26A 2CGOA 3FN9A 5DUXA 5FZMA 4LO6B 3S7EA 4QX8A 1NAEA 2VY0A 3AYAA 4NPLA 4Y1UA 1HN0A 4BQXA 4YW6A 4H2AA 1SCRA 1WMEA 2V4AA 5IYYA 1DGLA 1BXHA 1REDA 2D6LX 4GJZA 4SLIA 3KGLA 1VAVA 2VQTA 3POIA 3DKWA 4I0WB 1SPPB 4EJRA 5GZGA 1WA6X 1C8M3 1J84A 4IE7A 3PUSA 4B4QA 4DZGA 5KHIA 4XHXA 1W6OA 1AR62 4XFBA 1ODMA 4PDWB 2XG3A 4C0BA 1BKZA 1DG6A 1QNYA 5JCTA 4LE4A 2HKXA 4EN9B 3AZVA 2CY6A 4WVMA 2WNVC 1X8MA 1WMDA 2BJSA 1IQAA 1UMIA 2RV9A 1ENRA 3GBFA 3GHMA 3M7AA 3VBHC 3PVNA 3VZMA 2D98A 3B93A 5HI0A 4LQRA 3I97A 1H2NA 2HWD3 2JE7A 3D3AA 4IV3B 3ZN5A 3KF5A 5EJ3A 1QJY3 3T2QA 3UKNA 2BBAA 3AMPA 4ZS2A 2D3SA 1DZQA 2DCJA 2P5BA 2RMU1 4X8PA 4CDXC 4N9IA 2YPJA 4YZ4A 1KS5A 5APAA 2XJRA 4MO3M 2G1MA 2XR4A 1HRI1 4UF0B 2Y0IA 2B9UA 1VALA 2FCVA 1DGRA 2ENRA 2G4IA 4QX2A 1DLCA 3AYCA 5JI7A 5K4LA 4IE6A 1PVXA 1RGSA 1S2KA 3CDZB 4P5YA 4URTA 3VKMA 5FMCA 4IETA 4O9EA 1GNHA 4MVTA 1MQTA 4YZ2A 1BVVA 2QQLA 4Q29A 2BQPA 3M3EA 2UU8A 5A3TA 1JYWA 2WLQA 4IEVA 4AHYA 2F4LA 2NLRA 4AVBA 3ES4A 1HKDA 2AR6A 2WFPA 4NRQA 3WNXA 3VDDB 2WN2A 3H3UA 3AB0A 4EN6B 2A6WA 1BZWA 1QH7A 2W1UA 3NL1A 1UF2C 1Z78A 1S0EA 2A6VA 2VMEA 3LAGA 5D2AA 5DXDA 5FO7B 3W5MA 1EYBA 1K3IA 3ZYFA 3USUA 4Q4X2 2QQPA 4K7JA 1RUI3 1AXZA 4OQ8A 3HQUA 2Q8EA 3O12A 5FDBA 4YVSA 2ZGTA 4EYUA 5CG9A 4ARXA 3B9IA 4N9HA 2RS31 4FTSA 4JGYC 4BH9A 3CF6E 2X53S 1XNBA 2HWE1 4KU7A 4CDUA 1TNRA 3OJBA 4C91A 4XTMA 1C8NA 3W58A 4YYOA 1LHOA 1UYXA 1ZRRA 3H50A 4FPGA 4GD4A 5FKCA 1W9FA 5F2SA 1FATA 4HZFA 2LALA 2D6NA 4ATEA 3SMHA 1E57A 1VBA1 3HIFA 4RHV3 4TLFA 3TOJA 3B7MA 5FZOB 3VB9A 5B4XA 2J22A 1W6NA 5FOJB 5ACA2 1JHNA 2C24A 5CZKA 3I49A 3C7GA 1GP6A 4JKKA 4YW3A 3WG1A 1W0PA 1ULDA 2TEPA 3S5QA 4MG2A 3WQ1A 1VP6A 4K1YA 3CJIA 3WG4A 1WMFA 5KXDA 3V0AA 5F9TA 3ZOIA 5C7GA 5GLZA 4IQPA 2VNGA 4NRMA 1TZOA 2EIDA 2D3RA 1AYN2 3WZ1A 4YGBA 2L9LA 4M0NA 1NCQA 3APBA 1EPWA 1SFPA 5BNQA 1FOD1 2CGPA 1Y43B 2BV4A 5A6QA 2DURA 5ABJB 3N9PA 4YNIA 2BGOA 4QDSA 1LHWA 1LHVA 2ZX3A 1RUJ2 1E5IA 2X09A 2Y0OA 3MLLA 3WP3A 4A6OA 2PN5A 2VU9A 4BMBA 4BK4A 5K9YA 1TME2 1ULEA 3NV3A 4S2HA 5JSOA 2C9KA 2A3WA 2HWF3 5SV8A 1OSGA 1SFYA 4QB1A 3KT7A 4P08A 2WZ8A 5LRSA 2C1FA 2XOMA 3U11A 3BI3A 1QJEA 1ZRDA 4A6SA 3ALQA 1YWKA 2BNMA 4XYXA 4GB33 3AZXA 2XUMA 5CYYA 4AFAA 4YARA 3V64A 4H7MA 3KM5A 1E5RA 2KD7A 5FYCA 1VRH2 3ZFFC 1G9BA 1LR5A 1YFUA 1G9AA 4ISRA 5AC92 3PDQA 4OVEA 2WZR3 5C5TA 5IVVA 2PFWA 3HMYA 4IL7A 4LO4B 1JMUB 1UZWA 2FBEA 4NIDA 1W9SA 2HWD1 3HNMA 4IE0A 4KBBA 4IV3A 1NA1B 5LK5A 4D69A 2WS92 4J1XA 4ARYA 5CBLA 3OUJA 3S57A 2XBO1 1VB2A 3O1RA 1S2EA 3KLSA 1D2QA 3V56A 4C8DA 4PIYA 3DECA 4WVWA 2WNVB 2NQYA 5DAVA 3VBHB 1LENA 5FY9A 3UL2A 1KFXL 3CJIC 4Q1RA 4X6RB 4CUBA 3VBSB 1C8M1 5FLJA 2PMWB 5L19A 2RS11 5FZ8A 5HCHA 3RDIA 3T0BA 5BYNA 1RHI1 2D40A 2IFWA 3ZFGA 2AREA 2B9VA 4XCBA 5F37A 5JXIA 5EPAA 2PHTA 2Y6HA 3T09A 3KWVA 5DDJ2 3BIEA 2JWPA 2B39A 4QGNA 3B5LB 1MS4A 4I01A 1PGW2 4YZ5A 4H7LA 4N53A 4JKMA 1JOBA 1PO12 2QTWB 1RHI2 4IGPA 4QXCA 1JU4A 1GZTA 2VNVA 2R043 4XF3A 1H30A 3A22A 4HKLA 4DQAA 2XPJA 1YFWA 1F15A 5HBAA 2NZ9A 5JOZA 2WO2A 5FK7A 2HWB3 3H9AA 4OI4A 2ZAAA 1FI2A 2VULA 3O7OA 4PDWA 1RJ8A 4TLGA 2GN7A 5E8AA 3POWA 5A7OA 3KQRA 4CU9A 4CE8A 4CRQA 4XXAA 5FMDA 5IAVA 2WC2A 1MS8A 3AKRA 4W6YA 1PGL2 1QJU3 1X7NA 4DEVA 1VBD1 4AF9A 5L36A 2O14A 4UW5A 5BNOA 4XDOA 3N7KA 1YJLA 5KHGA 2AH2A 1LESA 3GZAA 1SEFA 3NQHA 2YC4A 4OYUA 2A3YA 3SH5A 1I9RA 4QX5A 4BXSV 1QJX3 2GMPA 1REFA 3N9LA 3KCXA 1SCSA 5FZ9A 1SLTA 2JE8A 3THDA 4CDUC 4FFGA 2ARAA 1PMHX 1RUI1 4AR2A 4DS0A 4O7XA 5JI9A 2Q1FA 3OSDA 2WZR2 3KCCA 3POGA 4RSUA 4BISA 1PK6B 5LA0A 3CHXA 4JGZC 4WVZA 2AEZA 3SLIA 4RN5A 4TXWA 4A3ZA 1UY0A 3LKJA 4AI8A 3U0ZA 4GZ9A 1PM7A 2PHRA 2RM23 2TUNA 4CCOA 3C7FA 1PM4A 2NYYA 5H9QA 4LPLA 1BBT1 3AL5A 1VBB2 5FY4A 4AGGA 1JHJA 2J42A 5IVFA 2DVDA 2B42B 3WP6A 1Q8QA 1WWYA 3NV2A 4QX1A 3TEYA 4GJYA 1D0HA 4P14A 3NKTA 3HN3A 1PO21 3NNJA 1W2TA 2A6ZA 1W8FA 2K46A 3IPVB 3MO4A 2GMMA 3W5NA 4CPBD 1R1A2 3M8LA 1QJU1 5JUVA 2VVDA 1PZ7A 1GOHA 4E4HA 3OG2A 3DL3A 4IEWA 2A6XA 1A34A 5FMOL 2EIGA 4B7EA 5H9SA 5FPAA 4AYUA 1L7QA 2QJVA 1H1MA 1OI6A 5LCWL 1CPNA 3NRUA 3EHKA 5FYUA 4FPLA 4BB3A 2W3JA 1DCSA 1RUE3 1QQP2 4DXRA 4OCTA 3HNYM 4HMZA 5IHRA 2FDGA 3ZR6A 2VGDA 4M3CB 2WSUA 1RHI3 2A75A 1HXS3 5HCFA 1SLAA 1SBFA 5LBBA 3WHTA 5A1LA 3WG2A 2OPKA 3BTAA 3OD4A 5FREA 3ZYBA 4H3WA 4NIGA 5FJHA 5IAXA 4Q26A 3K4ZA 2B4KA 3O0XA 1COV2 3T2TA 4RQPB 4PI0A 2PYTA 1OA3A 2E32A 3I2FA 2YB7A 1UWWA 2CDOA 3GZTB 1G9DA 1J3QA 1KDMA 1E5HA 1H1IA 4NHXA 3F2ZA 3MUZ1 1C5IA 1UU5A 2Q1MA 4Y33A 4DIQA 4QPGC 2JD9A 1QIQA 2FMDA 2JDUA 5JSRA 1VBA2 2FDFA 1ULGA 2VMIA 4C1WA 3VDCA 1OFNA 5ABJA 4DRVA 1UCXA 2XVLA 4LBQD 4UFIA 1RUNA 2WT2A 1UKRA 5I93A 3TNQA 1LOEA 3RFRA 2WZPP 3IB3A 4XJUA 2RM22 1CIYA 2A3XA 4E4SA 2VZQA 4CEWB 3HBKA 1KFUL 3I2KA 3KF3A 5F6LB 3ILFA 4DO0A 3LF7A 4RYDA 2VL4A 1X33A 2KXLA 3LPFA 4QKDA 1W6OB 1ZBE1 2HBTA 2P3YA 2RDRA 2Z2SB 4CP9B 1W3XA 1R081 3ZR5A 3PU8A 3ZDSA 4IEUA 2KR2A 1FMD1 2YU2A 3J7HA 4BA6A 3AP9A 3DF0A 2DUPA 4OI2A 2QNKA 3BGAA 4YW7A 5LATA 3WDVA 3O1VA 5SV5A 1W90A 3D8CA 3AFKA 3SKJE 4IV1C 4YW5A 3S5AA 4OMDA 4FXKB 4IEYA 2BRTA 1XU2A 3MIGA 5A3MA 4CA9A 1KXGA 5FO8B 2XLAA 3GHNA 3B01A 5DAQA 4CU6A 2VZ3A 1VBC2 1RL3A 3CEWA 5H9RA 4E8CA 5AFBA 5JPMB 1UMZA 1YI7A 2EXKA 3K77A 3LE0A 3SCFA 4XIKA 4PT6A 5FFOC 3RZGA 1UOJA 3AKSA 1CIWA 1WW6A 4GQ7A 3W20A 3RZLA 5IT6A 1RYYA 4FQZA 2VUDA 4Y5SA 1MQTC 3OBTA 1LODA 4IEPA 5A3PA 1LULA 3KSCA 3VHNA 4A45A 1MVQA 2H0VA 2WNUC 2MPFA 1A3KA 3PIJA 4NRPA 3RI9A 4AQ2A 4FVVA 3TEZA 1EY2A 5BNNC 2V4VA 3ZMOA 1GQGA 2ZABA 4CDWA 5AC91 2DUQA 2ZAHA 4HFSA 3A23A 2C26A 2VZSA 2GZWA 1HB4A 1AR92 3ACHA 3M1HA 1ST8A 4E2QA 2J1RA 1XYNA 3WDTA 4AEDA 4MH0E 2UY9A 2XJPA 3JZVA 1YNAA 4IE5A 2PHWA 4XUPA 2E31A 5FZ1A 5I0UA 1JYVA 3DEMA 1BMV1 2VBDA 1SHWB 1FPN1 4UW3A 5A32B 2QQUA 2VOVA 2BU9A 3PTRB 1PZ8A 3LIHA 4XFIA 4RQPA 1POV0 1MS5A 2I74A 1IOAA 3KQ4B 3AYEA 4HVQA 2IVIB 3U4XA 3ZXJA 1DDLA 2UYAA 2DTYA 5HPOA 4RS5B 3THTA 3FLRA 2DF7A 2R0FA 3N9QA 4CYDA 4EWAA 1RUC3 5FBJA 4CU8A 3FLTA 4QKBA 4YW4A 1YCIA 4K3UA 4OHZA 4LORA 5C4WC 4BQ1A 4K9SA 1RXGA 4QDRA 4N43C 1H2KA 1W3VA 3I3MA 3TEWA 3WW2A 3OF1A 2VD7A 2P4EA 3P3NA 5FZEA 3RWNA 2JDYA 4HONA 4RS5A 1VB4A 1LTEA 1UOBA 3GZEA 1NE4A 1LEMA 4G9SB 5DMYA 4FPFA 2WSVA 3HN1A 5KHKA 3ZYGA 4BDVB 4M3CF 3AK0A 4CEYC 1L7RA 3RGBA 3N4MA 5FQ0A 5IK7A 4YVWB 1SLBA 2XL9A 1HRV3 2ZJCA 2D6OX 2Y6JA 3ILNA 4DXSA 1UZ0A 5FP9A 3WQ7A 1IS5A 1W8NA 3ME2A 3OEBA 4XAEA 5FMBA 2LUWA 2X10A 2MEV1 2EA7A 3H8OA 4LK7A 1I6XA 1D4VB 3E5QA 3IIAA 1NQDA 3WX5A 1US2A 1JZ7A 2FDHA 1NLQA 1F35A 3PLQA 1OKOA 3WDYA 3VDDC 3T3YA 1GLHA 2RMU3 2YBPA 3KT4A 1GWMA 2JB4A 2GDFA 2BTVC 2YC0A 3IWZA 4GWJA 3M4FA 4NIIA 3BOWA 2R061 1COV3 4E4DX 1HRV2 1IG3A 2VMDA 4PQQA 2GALA 1A8DA 1N3OA 4TSVA 3QH6A 5F5QA 1JYNA 1GZWB 5EQUA 4COWA 4ET7A 4PLOA 5CB7A 3GM8A 2E33A 4IW3A 2QE3A 1RUC1 1C3HA 1KJRA 3BTZA 4GIQA 1MS0A 2J1EA 2PAKA 1LGBA 1OD3A 2Z4FA 4R9DA 1U5XA 3ZFFB 4LA3A 4XURA 1UU4A 2YPDA 1LOBA 1RUH2 3LIGA 1O3SA 5T5PA 1MEC3 2X05A 1RUOA 4CCMA 5C3SA 2EXJA 3E5XA 2ZCWA 3EO6A 1JZ6A 2BGCA 1D4M3 3ZFFA 4Q4W1 5FZ7A 3AVSA 4FP2A 5E88A 1CR7A 2W1WA 3LFIA 3LOIA 3M70A 4R8HA 4KWKA 5IVBA 3R4DB 2YBKA 4BLJA 1AXKA 1UN1A 4XMIA 5CNAA 3WF1A 3HQXA 5FTTC 3WNNA 1GMMA 3ZM8A 4CU7A 3VBSC 4AAPA 5A7QA 5C3OA 3ZXEA 2GN3A 2RR11 5A70A 3CNAA 4HKOA 5JLVA 3IMNA 2R49A 4IV1B 5KXEA 3FC0A 2CAUA 1TEIA 3ACIA 3ABZA 2VW0A 2K9ZA 4UW4A 5GLWA 1M4WA 3TN91 1AL23 1DQ6A 4YZ3A 4F3JA 1LGCA 4LUKA 3J7MA 1AHSA 1SMVA 4XUTA 3WF2A 4AL9A 2RHPA 4LBQB 3LOBA 5G04L 1H4GA 1YI9A 2YU1A 4NHYA 4QPIB 5FY7A 4AK3A 1DGWA 2RJLA 4R52A 1LNSA 3HEIA 4DRRA 4Q0VA 5L9RA 1F5FA 2WNOA 1S0IA 1UY1A 5CKNA 2OUHA 5KXBA 3Q8BA 1BEV2 2R042 3U37A 3DCQA 5A6XA 2WNUB 3M3IA 3S30A 3BPZA 1V0AA 1RIRA 4PJYA 4Y20A 2HYXA 5FZIA 3K51A 2FCTA 1CQ9A 1RVF2 2D5FA 4QMAA 2R1DA 2CDPA 2P34A 3H0OA 2Q4SA 3H8RA 2Z42A 1W8OA 2IFRA 2QQVA 1XPWA 3Q8CA 2RS53 4UBHA 3WNMA 4NIHA 2HEWF 1DZRA 1U5YA 3IN9A 5DAPA 2VOXA 2CU5A 3AP7A 3DPRB 4MXVA 5CFDA 4CCNA 3IIIA 2OYZA 4E2GA 5IFTA 3N9NA 4MV2A 4Q4Y2 2ZMKA 3ZFGB 1A78A 1CJPA 2AYHA 1F4HA 1PIV3 1ND2C 1OQ1A 2QUOA 5FAXA 4GWIA 3GALA 4GMP3 3LDBA 1V9U2 2YGLA 3POFA 4JGZB 4XBNA 5FPXA 3I59B 4S2GA 1ZBE2 2HBUA 2Y26A 5FIXA 1SLIA 2UWBA 3AZWA 4BE3A 5AFEA 1W8TA 1TE1B 2CSGA 4JGYA 1DQ0A 4D94A 4BCUA 3DKQA 1C57A 3ZSJA 2IXLA 4L0PA 3FE5A 4I3PA 3UT0A 4RR3B 1W8UA 3OD0A 1E5SA 1FNYA 2YGMA 3NAPA 4I3GA 4NAOA 5F1RA 1AX1A 1H2LA 2OVUA 4UI9L 4D7TA 5C3RA 3VDAA 1RUJ3 2B46X 3POJA 2BVVA 5T5LA 4AVCA 1W04A 2WA4A 4Y5Z0 4QPYA 2O8OA 1JZ4A 4IEZA 2G9FA 1W9YA 4BU2A 4J6GA 1N1YA 3MV11 4LBNA 3O1SA 3J9SA 2RS12 2XQRA 1XE7A 1CZTA 2GMEA 4JRAA 4CUCA 3GBWA 4IXLA 1LOFA 2GH8A 2WKKA 1YQ2A 4XIOA 4BQ2A 4N53B 4YGEA 4TN7A 3ZXDA 5D21A 2X5IA 2WO7A 3KMHA 3WLUA 4R4ZA 5KBFA 5T54A 2Y60A 2ZZJA 5GKAC 2WWSA 3PU3A 4GMP1 1YQ8A 1X82A 4UFLA 1AZDA 4HETA 4XTPA 4AVTA 4BLIA 4QQOA 1BYHA 2QCSB 2H6BA 3IAQA 3UJOA 5IATA 4MGZE 1EV11 3ECQA 5BNOB 1I3HA 2BEOA 4NWVA 1K5JA 2IXHA 4EE2A 5F5CA 5FPUA 3L2HA 3KZ4C 4FOYA 3ZXAC 4GWNA 1ZZ6A 3VBHA 2Q5TA 2ADDA 4DNYA 1UMHA 4KNCA 5FP8A 1UNBA 2YZ4A 4Z92B 1HB2A 1RUD3 1JXNA 4CDUB 4JGZA 3UGHA 1DFQA 3PTYA 2LW8A 4GH4A 4Q5OA 1N1VA 5L7OB 3BCWA 3ZYRA 3BU7A 2BOJA 5ACA1 1R64A 1UXZA 1V00A 2QZ2A 2VTXJ 5DAWA 3AYDA 3OYWB 1CAUB 1AX0A 4Y1VA 5JDBA 3T0AA 1Z7S3 5H9PA 5JWPA 3ZSEA 3T4HB 3RZZA 4FSJA 1A6CA 1S0GA 3LSEA 1FT9A 1UPIA 2VNRA 4QQLA 1Q8VA 1F9KA 3ETPA 4FT8A 3R4SA 5K8SA 1CN1A 3LA3A 2PAEA 3S7IA 2IXKA 3U78A 3OYWA 4LEJA 1SLCA 1UZVA 4ES9A 1QJX1 5J36A 3FX3A 3PHMA 4WM7C 5FCCA 4RFRB 3A21A 3WXPA 1WCDJ 1XNKA 2QKDA 4CEWA 2CGNA 2D43A 1EAH3 2GNBA 4MGTA 2VZVA 1K12A 3BB6A 4NJ4A 4XXPA 4GMP0 4EZ4A 4ONUA 4CCKA 4LLFA 1O8PA 3PUHA 4NR1A 3BALA 3WW3A 1D2SA 2XJVA 1ZM1A 1KQRA 1CVNA 1NLSA 2A6YA 2RG4A 4JC1A 5FRAA 2XLGA 4BYYA 1LJ7A 5E1RA 1AR81 1C1LA 4AQSA 4LUMA 5EXOA 2BWCA 4LO8A 5T52A 1ASJ1 2V09A 5CVRA 3DYMA 1I5ZA 1NUKA 1O5LA 2QQMA 4PI2A 2QDRA 1AR83 4WBBA 4CDQA 1LKNA 4Y1YA 2Z69A 4YM1A 4G3YC 3WNKA 4DXZA 3PURA 4Z8BA 4WVMB 3V65A 3TN92 4PQ9A 3ZLIA 1IS6A 2V72A 4LR4A 4C1XA 4CXWA 4YVSC 4DINB 4ZKTB 1VMFA 5FKBA 1RUG2 4HSJA 2RS13 3VV1A 2OZ6A 4FPCA 1ULOA 3WF0A 4CDQC 4JVAA 2XXZA 5T50A 3VDBA 2B45X 5BNNB 3KHCA 2PXJA 5FXXA 2VW2A 2VZPA 4QX0A 4O65A 3QBQA 3MIHA 2FHRA 3AX4A 4QPGB 3EYPA 2AGSA 2DVBA 3WUDA 5BNPA 1S4CA 2EIEA 3ZFGC 3ZIXA 1MZEA 1OA2A 2JEMA 1T6GC 1JH5A 2R063 4ZS3A 4P9WA 1JU3A 1ONAA 3OBZA 2EXIA 2ZHMA 1AR63 1Z0HA 2VOTA 3VUOA 4B4RA 3AXEA 3DV8A 4P9YA 3LDRA 3FUOA 1AYM3 4NAMA 2NPIA 3SEEA 2C4XA 2YYOA 4QKFA 1UQXA 1QF3A 2BVBA 3F95A 4HPKB 4WM7A 2ZEZA 3VBOC 3VD4A 3CIHA 2FMYA 3NVCA 5IW0A 3OUIA 3LEKA 2ZPXA 4ES8A 1POQA 1DYPA 2JG9A 2VCAA 4XETA 2VO5A 2CL2A 5C4WB 3N7LA 2J1SA 5I0RA 1N1TA 1QOSA 4IESA 1W8HA 2D6PA 4LLOA 4BM8A 4DB5A 1QDCA 3HNBM 1HIXA 2YC2A 2W1QA 2RM21 1AR91 5HXVA 2JXAA 2OS2A 2ZGKA 2CWMA 1GU3A 2ZZQA 3HVDA 5FZ0A 4CUGA 3K2OA 5FYZA 3MFCA 1IHMA 1VIWB 4FPKA 4YVWC 5A7NA 5IK8A 2XUEA 4MXWA 1QJFA 4M01A 4YM3A 1LAJA 3GZUC 4NMIA 1Q8PA 4R9BA 4AI0A 1H8TB 1BHGA 2ID4A 4KGQA 5LBEA 4KL1A 4XBLA 4I30A 1CAXA 3VD5A 1JOPA 4AAXA 3V0BA 1TQ5A 1WLCA 4FPYA 4ZU7A 5HCBA 5LZ6A 4MGIE 1YRZA 3KV6A 4ASLA 2GP3A 5FPZA 3UGGA 3O0VA 2W39A 5JVVA 1AF9A 1WD4A 2ZBJA 4SBVA 1X36A 5DG2A 1FPN3 1QH6A 2PLV1 4L9BA 1LOFC 5CKQA 5IVCA 3H8XA 1PZ9A 1RUF1 3SH4A 3POBA 5FY5A 3IDAA 3WDXA 2W2IA 1QDOA 3OGSA 1IS3A 3U4SA 4YZ1A 4RHV1 1K42A 3K4AA 2GC0A 4BIOA 3AMQA 3AXDA 4O61A 2FZ1A 1LEDA 5DN2A 2JDHA 3IDBB 4B29A 2QVSB 5EV7A 1TNFA 4J1WA 2YV8A 5IFPA 5FXZA 4FOVA 5FYBA 3RI8A 3UESA 4RHV2 3MUY1 5DZGA 5JIAA 5JOWA 4RS5C 5T55A 2OZJA 4UW6A 2XKOA 2JDMA 4ITCA 4QPGA 2Y6GA 4FAGA 4MUVA 2D97A 3ZYIB 3ZX7A 2JB8A 1YJKA 3Q8FA 1VBD2 3ZYJB 1BMV2 4N43B 4FQ4A 4Y20B 2ATFA 1T2XA 4EQVA 3MW3A 5C8CA 1VAMA 3EJKA 2ORXA 3BOPA 2NMOA 3X29B 2VQAA 2P6CA 1YEWA 3HPNA 1ZA4A 4XFHA 1OVSA 3CMGA 2H0BA 3TRSB 2ZGLA 3LWCA 5KC6A 4ORFA 4A41A 1YFXA 2VCBA 3AKTA 5JXJA 5A6ZA 4KBZA 1PVC2 1UOFA 3E6DA 3SC7X 1XNTA 3KS7A 1UIKA 2EALA 3A0KA 3IMMA 5BNPB 2YXSA 1S0BA 1RUI2 3NO8A 3PJQA 3I7DA 1Q56A 1PIV2 4FPOB 4OMCA 2WZR1 2ZX2A 5F5IA 2PLV3 3I2DA 3JQWA 1KEXA 4XF9A 1IG0A 4YW1A 4HN1A 5HXMA 5KHJA 4N7IA 2GH2A 3C7HA 4IGOA 3H8UA 1ZBE3 3MI8A 1UL9A 2RVAA 1PMJX 2WWUA 4R9CA 5FZAA 4FOWA 2XL7A 1LCLA 3TN93 2WO1A 5C9AA 4GALA 2WABA 1HV0A 3WP5A 1B09A 4JZRA 5JR7B 3N3HA 2ERFA 3AC0A 2WNVA 3KHBA 3S6PA 3AL6A 3I8TA 1HQWA 3WVJA 3ZFEA 4AEKA 3B94A 1NX9A 3NV1A 1CJDA 3ACGA 5FPBA 3K3NA 4E27A 2O0OA 5CAZA 1QY4A 1RMU1 2WWJA 2HWF1 1OH4A 2G19A 2WINB 4OHWA 1RTVA 1OF4A 2HJIA 2XKPA 1YUDA 1RUF3 2ZX4A 4AGRA 2W0XA 1D4M1 1C28A 3WD5A 1K5MC 1DQ5A 5I0DA 3ETQA 3VHRA 3N9MA 1POV1 2WYFA 5JMOA 1OOPA 4AZZA 5JZGB 3IT8A 4JQTA 3ZSMA 5KXCA 2ZEWA 1QJZA 3GCXA 4XUOA 3AP6A 2Y8KA 2A5ZA 5FYSA 2EICA 4P9XA 2Q8OA 2VOWA 2CV6A 4K1ZA 3JBG3 2XMLA 1PMIA 4ZXKA 1QEXA 1RUG1 3N35A 4XQDA 3HJRA 3OPTA 2Z79A 2WAOA 3VKFC 3VBFC 2IXCA 5A1FA 3O0WA 1GWLA 1RUE1 5LY1A 1OQEA 4Z07A 1AYM1 2XDVA 4BXFA 3P1IA 5FZOA 5DUUA 1COV1 2ARXA 5FZ3A 3MFAA 5J09A 1QKQA 3TAYA 3MF6A 1VBA3 5GZCA 4CSWA 1PX4A 1HLCA 2PELA 3SITA 4JDMA 5L7OA 5GALA 4GB32 3NW4A 4Q4Y1 3AFGA 3DUIA 1QMJA 3CU7A 4XFGA 5FP7A 1VRH1 3BVCA 3VKNA 1AJOA 5GZFA 1DGWX 1JW6A 3ZXLA 1Z7S2 4QPIC 4HKWA 2XQXA 3WNLA 4YM2A 3V0AB 2WLPA 5IK5A 4XQWA 3FBMA 4GAZA 2YBSA 1NE6A 3VZJA 5JMCA 1AR71 5EWSA 1ZNPA 4HSLA 4LKEA 2JJ6A 2VZUA 3T0DA 1WMXA 4N53C 2LM3A 4XW3A 5F2WA 2I07B 4AE2A 1U0AA 1VBE1 2J1AA 1JUIA 1W6NB 1DBNA 2F17A 4FFFA 4LMFA 1ODNA 4ZU4A 4D7SA 1QOOA 3ZKYA 2RR13 1YXWA 1SG3A 2Q8CA 3VDDA 1FPN2 5CFCA 5JAXA 1DZTA 1PGL1 2W95A 3PVEA 1S0DA 2OXBA 3KV5A 2ORZA 1NY72 4QQPA 4KI5M 5EFUA 4TTGA 1S1AA 1OH3A 4MGSA 3JCIA 4RGKA 1AUYA 2Q30A 4P00B 2WUHA 1Q8SA 3RJ2X 2BZDA 2WFF3 5C9AB 2ES3A 5L7OC 2ADEA 4KWLA 3HBZA 4XE9A 4AFMA 1XQNA 3E6CC 4BMEA 4FP3A 1H8VA 2D93A 4AI9A 1EUUA 4UFMA 4FFIA 4F83A 4FPJA 3CKHA 3ZN4A 4E8DA 1UYPA 2C5DA 2ZTNA 3JBG2 3KV9A 2ZHKA 4J25A 5D1IA 3ZXGA 5B4NA 2ZGOA 1STMA 2A73B 2JG9C 5C4WA 1KJLA 1PGW1 1ZVFA 1W6QA 2N7GA 2FCUA 2OA2A 3KVBA 4D7YA 3VKLA 1UO9A 2B5HA 3NNFA 4K8RB 4WM8A 3GCWA 1B35A 1V6JA 2HWB1 2ARCA 2PTMA 1R1A3 4PLMA 1HDKA 1EV12 3LA7A 1O3RA 2Y6LA 1SBEA 3EXUA 3RMYA 3WUCA 3QLQA 4C90A 1YLLA 1FNZA 5ERLA 5LA2A 4NE9A 4OHYA 1VBE3 1OVPA 1XXNA 5ACA3 3HT1A 5A80A 3OY8B 5EIYB 5IVEA 1AR73 2KM2A 5I91A 2LROA 1WW4A 3AP5A 4QB2A 5HCAA 2VCCA 4LBOA 2LS6A 1ZZ7A 3N7JA 2E9QA 3WQBA 1QJU2 2FDJA 4LO5B 4XJAA 4XUNA 2ZACA 4JAAA 2PA7A 4DY5A 1EV13 1BCXA 2WNEA 3D0SA 3PVBB 5I0TA 5IWFA 3WQ0A 1CESA 3BPSA 4OULA 2ZEXA 4XAAA 4AEJA 5C70A 5IK4A 2VXJA 4FO9A 3RNSA 5FP4A 5LW9A 2BPA2 4F7ZA 3MHZA 1REEA 2RDSA 2VVEA 2JDAA 1AR61 2WL1A 5BNOC 5A7WA 4HT1T 1QXRA 3NNMA 2Y33A 4ASMB 3ZSKA 5I8TA 1RUH1 4M00A 4QQHA 1AYN1 3JD71 2ZHLA 3CJXA 4JQRA 3PUQA 2R16A 3RMXA 2VOKA 5FZ4A 4JRLA 1CONA 4W6XA 2WT0A 3KVAA 5LA9A 1YQ6A 1ENSA 2XVGA 3AMHA 4LHKA 4Q0UA 3WOGA 4AOCA 1RXFA 3OCPA 4GXLA 5AVPA 3NKGA 1HV1A 3FZ3A 1JBCA 1Q5OA 1RUJ1 4Y4YA 2W52A 1YHFA 2VAUA 3IDEA 4NO4A 3VKOA 2YFZA 2W92A 1NA1C 4KWJA 1POV3 2WQ4A 1WBLA 3LEMA 4R4XA 5EJZB 1Y3TA 1DQ4A 3O1PA 2HWE2 1GKBA 1G6NA 4ISQA 3O14A 3VBFB 2YFUA 2ZGRA 2W9XA 5EZWA 3GDBA 4MX3A 3K3OA 5J3UA 4K40A 2VE1A 3CQOA 3I3EA 2TNFA 1Q3EA 1V6MA 1W06A 3PIGA 4LHNA 4MGKE 4AFCA 2ZXQA 4IEXA 3SH3A 3I2OA 2OPWA 3BYWA 1ASJ3 4AFBA 2LTNA 5CA6A 1J59A 1AJKA 4HK8A 3HOBA 1AX2A 5AVAA 1NT0A 1RMU3 2CAVA 4QM9A 5L73A 1A8MA 1PIV1 4IV3C 4QXBA 4RFT0 3VZKA 3HWJA 3ITQA 2DFBA 2XWJB 2JECA 3AKPA 4JDOA 4LITA 3POSA 4PCRA 3WG3A 2C6SA 2ARBA 2B7YA 1EAH1 1MEC2 2XJQA 3QCWA 4Y22A 4URAA 1OLMA 4UT5A 2ZX1A 2VMFA 2WQZC 4QQ2A 4CZSA 1AYN3 1GNYA 4RGGA 5DQ0A 2GNDA 3THCA 3H7YA 1RMU2 3PNAA 1XOYA 3MGUA 4YLZA 4AQ6A 2GC2A 3VL9A 4P9LA 2JENA 2WJSA 4JDNA 2BP6A 4YVSB 4OQ9A 1VR3A 5CIRA 2VPVA 1KD7A 2AEYA 2EF6A 4OUMA 4Q1PA 1G86A 4LHSA 5FY1A 2SLIA 4WVVA 3I3BA 4P9IA 4ZONA 5GZEA 1G7YA 2BFUS 4LNVA 3GBGA 1SDDB 4RGAA 3O1MA 1H9WA 2DBNA 3GYDA 1ZZBA 3VBRA 4HN0A 4EN0A 4I02A 4AW7A 1CZVA 4AI1A 3LFMA 4MYEA 3I2HA 4Q8KA 2BNOA 1WCSA 4YVWA 2RS33 1UY4A 3C7OA 1MS9A 1YYNA 1QHDA 3T30A 3UV9A 3WR0A 4G4FA 3I3QA 2QQWA 1QNWA 1DQ2A 3D0JA 4AG4A 4BQYA 1XSRA 2A7AA 5FZHA 4NPMA 4AFDA 3KV4A 4YG6A 2O8QA 1MZFA 3HD8B 4XACA 5M0TA 3E6BA 1V6IA 4B8EA 3VBOB 5I8SA 1Y9MA 3MF9A 3ENRA 3I2IA 3IKWA 3NAPB 3USUB 4QM8A 4V1PA 1IZ3A 5FLHA 5A1AA 4UOJA 3R4UA 2ZGSA 4K21A 4E9KA 3V0BB 1BK0A 1TMF2 2ETEA 2VMHA 5FLIA 5LK7B 5HV4A 3KGZA 1AVBA 1WD3A 2X5IC 1UU6A 2RS52 2VNOA 1OF3A 4N7UA 3AM2A 1JYTA 2JG8C 1OBNA 1BLZA 1NCRA 1HJFA 1LOGA 4FCAA 1PGSA 3SEPA 1HW5A 3P5BA 3R0RA 1LHNA 4Z2AA 1O3TA 1ND2A 2VZOA 4DXTA 1C8M2 1MR5A 1FV3A 3PJYA 4ZY9A 4UXAA 3T1MA 2Q8DA 5BNPC 2WZEA 2BERA 5DUVA 1F31A 2CYFA 1JOJA 4AGVA 1JYCA 3MPBA 2DVGA 5K0UA 4LE3A 5EP9A 5LASA 1XNCA 3RQ0A 2YROA 4XF4A 2RMU2 2JDNA 4V2VA 1VE0A 3RYPA 2SBAA 5T3NA 1IS4A 3ZPOA 4W4ZA 1ZZ9A 2HWD2 5L9BA 2HWB2 3MLKA 1CPMA 1ULPA 2BWAA 4Q4V2 1CAXB 1IKPA 2WDBA 1HB1A 1QWRA 4FAHA 1AR93 3FFQA 4QU2A 1AL0G 5F6KA 3RG0A 4CCJA 3ATGA 3OGVA 4A7KA 1HB3A 4XJ8A 1X50A 1I1EA 3WT3A 1EUTA 1NA1A 1NZIA 5G05L 3U10A 5A3NA 1HQNA 1DHKB 1FV2A 2DFCA 3VN4A 1YQCA 3GGLA 4LBQA 1WZXA 5FMOS 4EV0A 5DABA 5JPNB 3JD73 2AUYA 1PHMA 3VBUA 3ZSLA 4U36A 4XQ4A 1OQDA 3NWKA 3TBDA 1OFSA 3K4DA 2D44A 4M4PA 4QGMA 5JZGC 2VZTA 1OXCA 4I0AA 4Q4X1 4XJZA 1VBB1 1RUC2 4AVAA 4Q0PA 1IQDC 4M4RA 1LB2A 1ENXA 4IEQA 1RUF2 4CEYB 2JDKA 1UW8A 2QBXA 4M0HA 4CEWC 3TEXA 4QKNA 3AVRA 4KH9A 4MGQA 4OUEA 4P9GA 4XFFA 4YG3A 5DZEA 1NCRB 5FZLA 3NMBA 1RUG3 2A1XA 1MVEA 3JD72 5BXXA 3T2PA 4QXKA 5DPNA 4KWUA 3H7JA 5DAXA 1U12A 4HL0A 4XBQA 1C5HA 4BJ0A 1Y9QA 3KCYA 2IXIA 5BV6A 1JUHA 3ASIA 2HEYF 1WCKA 4Y22B 1GSLA 4QHOA 2OX0A 2J7MA 1CZSA 1W03A 1ZYBA 3MIFA 4XC9A 3RVHA 5F8PA 1JZ2A 1XJAA 1HN1A 2RE9A 4GA9A 4LBMA 3CZJA 4BQWA 1W99A 3FHIB 4KG8A 1R1A1 1Y9GA 1YFYA 2AACA 2GNMA 1GZ9A 2RDQA 3JU9A 3I59A 4Y5TA 2NN8A 4OLLA 4GULA 3CL1A 4Q4W3 2BBVA 1O59A 3MEPA 1S2BA 2BYVE 2P3IA 3WCSA 1B35C 3ORJA 3BKZA 2DBIA 1YIFA 2W08A 3VZOA 3FUQA 4HBNA 1RUE2 4JHZA 5D8AA 4CP2A 4DEQA 5JZGA 2NMNA 4UYBA 3BIWE 3MPPG 3VZNA 5A33B 2XHNA 5JOYA 2OT7A 1SDWA 5FZBA 5IUQA 3R6SA 1HXS2 1OA4A 2J1VA 2UY8A 3K75B 1JS9A 2PHUA 2WBKA 4RL7A 5I0SA 3J8F2 1APNA 1DQ1A 2DCZA 1W8ZA 5D8AB 1ND3C 4QPWA 1NCQB 1WGPA 2UURA 2VG9A 1H9PA 1N3QA 5ANNA 3VZLA 4XABA 2XBO3 2JKXA 2VBBA 4Z82A 1AR82 4ZZ8A 2YUEA 2G9GA 3NV4A 4NHMA 2Y38A 3D5OA 4CPBA 3UJQA 3UK9A 2P37A 3FJSA 4HLTA 2WN3A 1J58A 1ACCA 5KHHA 1PK6C 1O4TA 4MOAA 1V6KA 4H55A 1AL22 3AMNA 2QQOA 3OBRA 3ACLA 3NAPC 3IPVA 2VMCA 1HQLA 3U75A 4UWDA 2ZHNA 3ILRA 4MSVA 1RUD1 5GLTA 1UZYA 1PX3A 1ULCA 1XSQA 4JKLA 2GU9A 1IGOA 1H4HA 4E2SA 1VRH3 1BEV1 2JG8B 3G7DA 4AVVA 4GWMA 2ET1A 1EPZA 2V5YA 1K45A 4S2FA 1O8SA 2E7QA 1VLNA 1F2NA 5GM0A 1NY71 5J37A 2E7AA 5I8YA 1O91A 2XLFA 1M06G 3GNEA 4EWDA 4Y26A 1RVF3 1XBFA 3OGGA 4IERA 3FWEA 1ULFA 3H1MA 2I2SA 4PBPA 3ROUA 5FPVA 1AYM2 4XMAA 4W8JA 4PLNA 4UF0A 4CEYA 4YW2A 4NVPA 4JV4A 4QGLA 2V5DA 1BEV3 1FOD3 1XE0A 3WSOA 1OUSA 3UYJA 1OLQA 4CTEA 4YFZA 1GFF2 3JBG1 3NSTA 3ZN6A 2XVKA 1ZZ8A 4GB31 5F3EA 1VBC1 3UGFA 4JTOA 1VMJA 4FPEA 5K7PA 4FOQA 1O3QA 5EJ1B 1H6XA 4LKDA 2VJXA 4DFSA 1OKQA 1WA4A 5A7WB 2Y64A 4AHWA 1W39A 1H8TA 1V9U1 4GH4C 1W8WA 1AR72 2PHLA 2IC1A 4Q0SA 1JODA 3G6JB 1NXD1 3ZFEC 2J1UA 1W9TA 1J3RA 2AC1A 4I2OA 3FLPA 1CAWB 1XC6A 5F3CA 1JZ8A 4E4ZA 2IUWA 1CAVA 1P8JA 3OPWA 2QQNA 1W6PA 4D0QA 3OUHA 3BTXA 2XBO2 4LKSA 2HWC1 2RJKA 4L2NA 5F7UA 3VD9A 5J7MA 3J4UH 1IPSA 5LWBA 2W94A 1PO23 3UKTA 1CGPA 3LEGA 3U1XA 2EAKA 3BUCA 3D6EA 2R7EB 3VBUC 3WF3A 2W87A 5J1XA 2RS51 1H2MA 2JG9B 2PHFA 1IPKA 1VRBA 2Y6KA 3OBAA 1GOFA 5F3IA 2WS93 3JUUA 4U2AA 1RUH3 1J1LA 2Y34A 3SHRA 4INDA 4XDPA 1KRIA 1N47A 4FXGB 3C7EA 5FO9B 4XF1A 4S2DA 1SQ4A 1ZBA1 5JOXA 1W9WA 5FZDA 4M3CE 4ZHNA 4XPVA 1XB9A 4KMQA 2EVXA 3RRDA 4MHUA 1BBT2 1MZ5A 2OUJA 1W28A 4CUAA 3WF4A 1GQPA 3PL0A 1UY2A 1SZBA 2RDNA 3MW4A 4BIFA 1PO13 4LOSA 3EQEA 5C3PA 4IDZA 4PHZA 5FBZA 4O9GA 3WV6A 4Q4W2 3OY8A 1NOVA 1QXPA 4B7KA 4DUVA 5J48A 1W0NA 5CU1A 2GC3A 3LQCA 3MV01 5T5JA 2VR4A 3RPQA 4AEDB 2EXHA 3RZHA 1C1FA 1L3JA 1N1SA 1VPHA 2F4PA 1TMF3 1DYOA 2UYBA 2VCMA 3J7LA 5IVJA 2JG8A 2YDEA 4PF5A 2IWGB 2DV9A 2HEVF 4HVOA 2IZWA 3KB5A 1KITA 3Q8EA 5A3WA 1Q8OA 1D0GA 2CWSA 2E6VA 3O5SA 4MHRA 5D8AC 3RS6A 3WCRA 5CG8A 2D7FA 3DPRC 1RITA 3VLBB 2R062 1VMHA 3B9CA 4AVSA 3M2MA 1EAH2 1MEC1 3LB9A 3VGIA 1ZRCA 1GP5A 1QQP3 2Z5WA 1YQ5A 3WDUA 4FBFA 2VTFA 3A4UA 3ES1A 4BZ4A 3FHQA 5IVYA 1MS3A 4OHXA 1GZWA 2DYCA 1HXS1 2DCYA 2DCKA 2VUCA 2FD8A 1R091 2AENA 2R071 3RSJA 1NYWA 4HK9A 3IAPA 1YO8A 5LEKA 2PAMA 4N43A 5FUPA 3LGRA 3WEZA 2RR12 2XWBB 5FZGA 3HQRA 4RR3C 3I2GA 1GNZA 1RINA 4OHVA 4RD7A 1V9U3 4XILA 5GZDA 5A33A 3SKVA 1WBFA 3LEIA 3VBRC 3WHUA 3RYRA 2DDUA 2VBPA 3INAA 1G9FA 3T08A 3ACFA 1Z7S1 3VD7A 2MHFA 2X5IB 1W2OA 3IM0A 2ZMNA 4R9AA 5LBFA 4Q27A 2XH6A 2QQKA 3OGRA 5HV0A 4OI1A 1QOTA 4QX3A 3C2UA 3MDPA 1DYKA 2ZA9A 1YIPA 3SISA 4LA2A 1V70A 4QWNA 4AWDA 1JN2P 1R082 3OPZA 2MNGA 4YM0A 3B69A 4IGQA 4CXXA 3AZZA 3USSA 5C8CB 1S0JA 2JD4A 2Q1ZB 3I54A 2EAAA 4CDWC 1UAIA 2BUKA 3P6BA 5A3LA 2VZRA 1SACA 2WFF2 2ZGPA 1RVF1 4V2WA 1BQPA 3FHAA 1H0BA 2WR9A 2QQIA 4LJHA 1I5PA 1R092 2R072 2PHDA 2W68A 2XJSA 2BOIA 2IXJA 4PF1A 5JXHA 1XE8A 3J8F1 2V73A 1GANA 2XJTA 5FY8A 4CXYA 5K0UB 1TMF1 3GJAA 4Y1ZA 4ATFA 2GAUA 3BN6A 5LY2A 3CBNA 3WW1A 1CAWA 3H3ZA 1ZA7A 1DP0A 2P6HA 3RJRA 3SNMA 3WDWA 4CP0A 1SLLA 4Q4V3 2WO3A 1JYIA 1O4ZA 1F8VA 2P17A 1Y4WA 3L2YA 2CNAA 3ELNA 4FPHA 3W9AA 1OUXA 1LHUA 1OD5A 1SPPA 2YG0A 3MIDA 3O1TA 4WM8B 3LDKA 3EB7A 1ND3A 2DWRA 1IPJA 2XB6C 2ZOEB 3ZKUA 2QDNA 1RUD2 4DMIA 2VW1A 1XNAA 1EP0A 2K0GA 3LA2A 3OTFA 3QH7A 3ZPYA 1LOCA 1HJGA 4QAWA 2K2SA 1NZCA 4QXHA 1C4RA 1JZ5A 3RYKA 3Q9OA 4WM7B 1HRI2 1NCRC 1TME3 1PNFA 2FQPA 2P1BA 5FY0A 1ZRFA 5F3GA 3BU0A 3NJZA 3IDCB 3FFZA 2Y6FA 4L92A 3QACA 3AKQA 2OW4A 4QHZA 5FYHA 5CEHA 4RA0A 4AXOA 3DXUA 3NJYA 3SQOA 3OOXA 2HLEA 4EWEA 2PQQA 2ET7A 2A71A 4KU8A 3NNLA 4A3XA 1LGNA 2W91A 4I0BA 3B02A 4XOGA 1BJQA 1W05A 4Z1VA 1RJ7A 1W6PB 4HG6B 4CCCA 4LBJA 5C71A 4XHBA 4JX0A 4XDQA 3UNPA 1DLLA 5C6CA 3QD6A 2P3JA 2ZX0A 2XJUA 1KDKA 4AQTA 3IZOA 1GYKA 4CCDA 4HPKA 2C0ZA 1Y7BA 3A0NA 2VM9A 5LBCA
chains in the Genus database with same CATH topology
3ZIWA 3B3QE 1XU1A 3JQXA 1WW5A 2VH9A 4A7YA 4FTEA 1R083 5C8WA 3D82A 4CDQB 1FMD3 2HWE3 2MEV2 2O1QA 1XRUA 3FBYA 1OPMA 2AZ5A 2DCTA 3ZXFA 2R30A 1FXZA 1S0FA 2JE9A 4Q4V1 1ASJ2 4JGYB 4DY3A 1ND3B 2P2KA 2VQ0A 1NCQC 4N90A 1GQHA 3UKVA 2JX9A 2WNUA 1ND2B 2WT1A 4XFAA 2FZ2A 3ST7A 1ALYA 1JTZX 3KT1A 3I4IA 4DOUA 5LEJA 4COZA 1V6NA 1MZ6A 3DPRA 2R32A 1NQJA 1XNDA 3IBMA 3R05A 3VHOA 1BK1A 3ZN6B 2X29A 3ZYPA 1WW7A 1W6MA 3EBRA 1QGLA 3URFA 2D5HA 1CX4A 5CFCC 4CDXB 4COYA 4IV1A 3MICA 1VAKA 2PHXA 4AHXA 2RS32 4OZXA 1QJX2 4XF0A 2HYKA 5BPXA 4HVRA 3TB0A 3LSDA 4AEMA 4UBGA 4COUA 1NXMA 2ZGUA 1J1TA 1DU3D 3N7MA 2QFEA 3P3PA 5BY5A 3WP4A 3ZVXA 1D4M2 2R0HA 1PO22 4QPIA 5C8CC 2F6BA 1ENQA 1HX6A 1CD3G 2BFUL 2OIIA 4WZFA 4XJ9A 4L99A 4AI3A 3CLPA 1B35B 1OOPB 5CFDC 2DUOA 1MACA 1PNGA 1F5JA 1R093 2R073 4XFCA 2B8MA 3H1YA 4YGCA 4IEOA 2UWAA 1KS4A 2ZS6B 1QXJA 5K0UC 4DPNA 1WUVA 2A70A 5B2GB 5C33A 3B00A 3LCPA 5JSPA 1FMD2 2MEV3 5CADA 2DVFA 1O7FA 1UKGA 4OUSA 1QQP1 1OMIA 1QJY2 2WFF1 1LOAA 1ZZCA 4GH4B 3ZO0B 1VJ2A 3MLJA 3ZFEB 2VUAA 4Z2WA 1R1ZA 4B3NA 2ZGMA 1SBDA 5E16A 4XEZA 4PIZA 4A2UA 3L9JT 5KC5A 3H1WA 2ZMLA 4CDXA 2JKBA 1W6QB 2VVFA 4XJWA 1FX5A 1K5MA 5GLUA 5J98B 4YGDA 3VBUB 2BW8A 2JICA 2XHKA 4B4PA 4L97A 1PO11 2XGXA 2P3KA 2R6QA 1VBE2 1GR3A 3CJIB 3CO2A 4K6BA 4W6WA 1AL21 2DU1A 2H6CA 4YSFA 1VBD3 1V6LA 1DIWA 3J26N 3AZYA 2R1BA 1QJY1 3ZMNA 1U5ZA 2WA3A 2YY1A 4KQ7A 3WW4A 3HAGA 5DG1A 2VMGA 4MGYE 2R041 5AC93 1O5UA 3TYJA 2WIIB 4NHLA 3PVOA 3VBSA 5JIUA 2GC1A 3VBOA 1S55A 1UZZA 1RB8G 1RC6A 1UIJA 3K48A 5DUWA 4X6QB 5FQ0B 4EN7B 2NM1A 3THPA 3MW2A 1ZX5A 4MXWB 4K20A 2X8KA 3PMEA 5T5OA 1XYOA 3JB8A 1DF0A 3SXWA 2GNTA 1ZREA 1AXYA 2HWC3 4W65A 1WLTA 4LHLA 4QD2A 4QT6A 5DDJ1 3E97A 1NLRA 1K5MB 3S0MA 1OPOA 2D6MA 2NP0A 4Q8LA 3JB4C 4L8QA 4P5HA 1CAVB 2TBVA 3TWIA 1S0CA 3WY6A 3AMMA 2YMZA 1LU1A 1MS1A 1VBC3 4YG0A 4Y1XA 2YHJA 3T1LA 1W0OA 4PDWC 2JDZA 3DGTA 3SCGA 1OLRA 2HWF2 3POYA 3SCHA 4LBLA 4YRDA 5LRRA 4Q0QA 4Y24A 5CFCB 3VBRB 2DVAA 4LO7A 1HRV1 1WLWA 4TWTA 4HANA 4C0HA 2ZKNA 4NN0A 4Q2FA 1UX6A 2ZGNA 3J8F3 2CTVA 2VECA 2E51A 3E5UA 2DTWA 2PLV2 1FYUA 1Q43A 3U07A 1SFNA 4XZPA 1OHFA 4GKYA 4AI2A 4OFGA 4YFWA 2ZGQA 3BODA 1U5IA 1V6OA 3C3VA 4X8NA 4BWOA 3AP4A 1QU0A 3MYXA 1ZBA2 1FAYA 4LTAA 1PVC1 3KD4A 3PMSA 3OGJA 1IKQA 1OOPC 2VUJA 5CFDB 1H8TC 1LU2A 4AEDC 4L11A 1WLDA 4JCKA 2E53A 2QZ3A 4RR3A 4AHZA 1W6MB 5BNNA 4MZUA 3GF6A 1LECA 4H14A 4QHBA 5J96B 2E63A 3AJYA 4F8AA 3HR9A 4RQPC 2D6KA 4NHKA 5DDJ3 3VHPA 5BUVA 1G8WA 5C9AC 4A7ZA 5KWRA 5GJ6A 2D3PA 2ZKLA 3M3QA 1G9CA 4JTNA 1URXA 3WINE 4M3CA 4WM8C 3AJZA 4K8FA 4ZU5A 4BPZA 4OI0A 1LRHA 4CP1A 2BNNA 4WV8A 3MIEA 1J3PA 1GBGA 1BBT3 3VL8A 1H1AA 3M3OA 4PBOA 4META 4NPRA 4PIXA 1PVC3 4LULA 4MLOA 4FTBA 4LBKA 4WZCA 3LZZA 4LT5A 1FOD2 1TME1 4P9JA 4D3WA 1GV9A 5E89A 4EROA 4NWWA 1GICA 4COVA 1O4YA 5A32A 1NG0A 1PK6A 4NOTA 5FOBB 2KA3A 3DN7A 1UPSA 5TSWA 2ILMA 1DGRN 5DZFA 3MZHA 4TZDA 2E7TA 2Q0AA 2VXRA 3HT2A 3W59A 3D4KA 4CDWB 3QOPA 1CAUA 5ABJC 3N36A 4Q4Y3 2I45A 2UWCA 1HRI3 5EYXA 1VBB3 3M3CA 3ZXKA 5GLVA 1XYPA 1GZCA 4EN8B 1MQTB 3MIBA 2GSYA 1W2UA 4GKXA 4KGGA 4TYSA 3VBFA 2HWC2 1ZBA3 3TNPB 1N3PA 3FMGA 4Q4X3 4KG0A 2DU0A 1UD1A 4BHPA 1BVP1 1X8EA 2WS91 5EYYA 2C9AA 5DUXA 2CGOA 4LO6B 3S7EA 2VY0A 3AYAA 4Y1UA 1SCRA 1WMEA 1DGLA 1BXHA 1REDA 2D6LX 4SLIA 3KGLA 1VAVA 5GZGA 3DKWA 4I0WB 4EJRA 1C8M3 4B4QA 4DZGA 5KHIA 4XHXA 1W6OA 1AR62 4XFBA 4PDWB 2XG3A 4C0BA 1BKZA 1DG6A 1QNYA 5JCTA 4LE4A 2HKXA 4EN9B 3AZVA 2CY6A 4WVMA 2WNVC 1X8MA 1WMDA 1IQAA 3GHMA 3GBFA 1ENRA 3M7AA 3VBHC 3VZMA 3PVNA 2D98A 3B93A 5HI0A 1H2NA 2HWD3 2JE7A 4IV3B 3ZN5A 5EJ3A 1QJY3 3UKNA 3AMPA 4CDXC 2D3SA 1DZQA 2DCJA 2RMU1 4X8PA 4N9IA 2YPJA 4YZ4A 1KS5A 2XJRA 1HRI1 4CEYB 2Y0IA 2B9UA 1VALA 4BOWA 1DGRA 2ENRA 2G4IA 3AYCA 5JI7A 1PVXA 1RGSA 1S2KA 4URTA 3VKMA 4IETA 4O9EA 1GNHA 4MVTA 1MQTA 4YZ2A 1BVVA 4Q29A 2BQPA 3M3EA 2UU8A 2WLQA 4IEVA 4AHYA 2NLRA 4AVBA 3ES4A 1HKDA 2AR6A 2WFPA 3WNXA 3VDDB 3H3UA 4EN6B 3AB0A 2A6WA 1BZWA 1QH7A 3NL1A 1UF2C 1Z78A 1S0EA 2A6VA 3LAGA 5DXDA 5FO7B 1EYBA 3USUA 4Q4X2 2QQPA 4K7JA 1RUI3 1AXZA 5FDBA 3O12A 4YVSA 2ZGTA 5CG9A 3B9IA 4N9HA 2RS31 4FTSA 4JGYC 4BH9A 3CF6E 2X53S 1XNBA 2HWE1 4KU7A 4CDUA 1TNRA 3OJBA 4C91A 4XTMA 1C8NA 3W58A 4YYOA 1LHOA 1ZRRA 3H50A 4FPGA 1FATA 4HZFA 2LALA 2D6NA 4ATEA 3SMHA 1E57A 1VBA1 3HIFA 4RHV3 4TLFA 3TOJA 3B7MA 1W6NA 5FOJB 5ACA2 1JHNA 4YW3A 3WG1A 1W0PA 1ULDA 2TEPA 3WQ1A 1VP6A 4K1YA 3CJIA 3WG4A 1WMFA 5KXDA 3V0AA 5F9TA 5GLZA 4IQPA 2VNGA 2D3RA 1AYN2 3WZ1A 4YGBA 4M0NA 1NCQA 3APBA 1EPWA 5BNQA 1FOD1 2CGPA 1Y43B 2DURA 5ABJB 4YNIA 1LHWA 1LHVA 2ZX3A 1RUJ2 3MLLA 2Y0OA 3WP3A 2PN5A 2VU9A 4BMBA 5K9YA 1TME2 1ULEA 3NV3A 4S2HA 5JSOA 2A3WA 2HWF3 5SV8A 1OSGA 1SFYA 3KT7A 5LRSA 2C1FA 3U11A 1ZRDA 3ALQA 1YWKA 2BNMA 4XYXA 4GB33 3AZXA 2XUMA 4YARA 4AFAA 3V64A 4H7MA 3KM5A 1VRH2 3ZFFC 1G9BA 1LR5A 1YFUA 1G9AA 4ISRA 5AC92 4OVEA 2WZR3 2PFWA 3HMYA 4IL7A 4LO4B 2FBEA 2HWD1 4KBBA 4IV3A 1NA1B 5LK5A 4D69A 2WS92 4J1XA 5CBLA 2XBO1 1VB2A 3KLSA 1D2QA 3V56A 4PIYA 4WVWA 2WNVB 2NQYA 3VBHB 1LENA 3UL2A 1KFXL 3CJIC 4Q1RA 4X6RB 3VBSB 1C8M1 5FLJA 5L19A 2RS11 3RDIA 5BYNA 1RHI1 2D40A 2IFWA 3ZFGA 2AREA 2PHTA 5DDJ2 2B39A 4QGNA 3B5LB 1MS4A 4I01A 1PGW2 4YZ5A 4H7LA 4N53A 1PO12 1RHI2 4XF3A 2R043 2XPJA 1H30A 4HKLA 4DQAA 1YFWA 5HBAA 2NZ9A 5JOZA 2HWB3 3H9AA 4OI4A 2ZAAA 1FI2A 2VULA 3O7OA 4PDWA 1RJ8A 2GN7A 5E8AA 3POWA 3KQRA 4CRQA 4XXAA 2WC2A 1MS8A 3AKRA 4W6YA 1PGL2 1QJU3 1X7NA 5L36A 1VBD1 4AF9A 4UW5A 5BNOA 3N7KA 1YJLA 5KHGA 2AH2A 1LESA 3GZAA 1SEFA 2A3YA 3SH5A 1I9RA 4QX5A 1QJX3 2GMPA 1REFA 3KCXA 1SCSA 1SLTA 4CDUC 1RUI1 4DS0A 5JI9A 2WZR2 3KCCA 4RSUA 1PK6B 4JGZC 4WVZA 3SLIA 4AI8A 3LKJA 3U0ZA 1PM7A 2PHRA 2RM23 2TUNA 2NYYA 5H9QA 1BBT1 4AGGA 1VBB2 2DVDA 2B42B 3WP6A 1Q8QA 3NV2A 1D0HA 4P14A 3NKTA 1PO21 2A6ZA 3IPVB 2GMMA 1R1A2 3M8LA 1QJU1 2VVDA 1PZ7A 3DL3A 4IEWA 2A6XA 5FMOL 2EIGA 4B7EA 5H9SA 4AYUA 2QJVA 1H1MA 1OI6A 1CPNA 3EHKA 4FPLA 1RUE3 1QQP2 4HMZA 2VGDA 4M3CB 2WSUA 1RHI3 2A75A 1HXS3 5HCFA 1SLAA 1SBFA 3WHTA 3WG2A 2OPKA 3BTAA 3OD4A 5FREA 4H3WA 4Q26A 3O0XA 1COV2 3T2TA 4RQPB 2PYTA 1OA3A 3GZTB 1G9DA 1J3QA 1KDMA 1H1IA 1C5IA 1UU5A 2Q1MA 4QPGC 2FMDA 5JSRA 1VBA2 1ULGA 2VMIA 4C1WA 5ABJA 1OFNA 4DRVA 1UCXA 2XVLA 4LBQD 1RUNA 2WT2A 1UKRA 5I93A 3TNQA 1LOEA 2WZPP 4XJUA 2RM22 2A3XA 4E4SA 4CEWB 1KFUL 5F6LB 3ILFA 1X33A 2KXLA 1W6OB 1ZBE1 2Z2SB 1R081 3ZDSA 4IEUA 1FMD1 4BA6A 3AP9A 3DF0A 2DUPA 4OI2A 2QNKA 3WDVA 5SV5A 3D8CA 3AFKA 4IV1C 4YW5A 4FXKB 4IEYA 1XU2A 3MIGA 5A3MA 1KXGA 5FO8B 2XLAA 3GHNA 3B01A 1VBC2 1RL3A 3CEWA 5H9RA 5AFBA 5JPMB 1UMZA 1YI7A 2EXKA 3SCFA 4XIKA 5FFOC 3AKSA 1CIWA 1WW6A 4GQ7A 5IT6A 4FQZA 1MQTC 3OBTA 1LODA 4IEPA 1LULA 3KSCA 3VHNA 1MVQA 2H0VA 2WNUC 2MPFA 1A3KA 3RI9A 4AQ2A 4FVVA 1EY2A 5BNNC 3ZMOA 1GQGA 2ZABA 4CDWA 5AC91 2DUQA 2ZAHA 4HFSA 2GZWA 1AR92 3M1HA 4E2QA 1XYNA 3WDTA 4AEDA 4MH0E 2UY9A 2XJPA 3JZVA 1YNAA 2PHWA 5I0UA 1BMV1 1FPN1 4UW3A 5A32B 2VOVA 1PZ8A 4XFIA 4RQPA 1POV0 1MS5A 2I74A 1IOAA 3AYEA 4HVQA 3U4XA 3ZXJA 1DDLA 2UYAA 2DTYA 4RS5B 3THTA 3FLRA 2DF7A 2R0FA 4CYDA 4EWAA 1RUC3 3FLTA 4YW4A 1YCIA 4K3UA 4OHZA 5C4WC 4BQ1A 4K9SA 4N43C 1H2KA 3WW2A 3OF1A 3P3NA 3RWNA 4RS5A 1VB4A 1LTEA 1NE4A 1LEMA 4G9SB 4FPFA 2WSVA 3HN1A 5KHKA 3ZYGA 4M3CF 3AK0A 4CEYC 3N4MA 5FQ0A 5IK7A 4YVWB 1SLBA 2XL9A 1HRV3 2ZJCA 2D6OX 3ILNA 3WQ7A 1IS5A 3ME2A 2LUWA 2MEV1 2EA7A 1I6XA 1D4VB 3E5QA 3IIAA 1NQDA 3WX5A 3PLQA 3WDYA 3VDDC 1GLHA 2RMU3 3KT4A 2GDFA 2BTVC 2YC0A 3IWZA 3M4FA 3BOWA 2R061 1COV3 4E4DX 1HRV2 2GALA 1A8DA 1N3OA 4TSVA 3QH6A 5F5QA 1GZWB 4COWA 4PLOA 5CB7A 2QE3A 1RUC1 1C3HA 1KJRA 4GIQA 1MS0A 2PAKA 1LGBA 4R9DA 1U5XA 3ZFFB 4LA3A 1UU4A 1LOBA 1RUH2 1O3SA 5T5PA 1MEC3 1RUOA 2EXJA 3E5XA 2ZCWA 3EO6A 2BGCA 1D4M3 3ZFFA 4Q4W1 4FP2A 5E88A 1CR7A 3LOIA 3M70A 4R8HA 4KWKA 3R4DB 4BLJA 1AXKA 1UN1A 4XMIA 5CNAA 3HQXA 5FTTC 3VBSC 3ZXEA 2GN3A 2RR11 3CNAA 4HKOA 5JLVA 3IMNA 2R49A 4IV1B 5KXEA 3FC0A 2CAUA 1TEIA 2VW0A 2K9ZA 4UW4A 5GLWA 1M4WA 3TN91 1AL23 1DQ6A 4YZ3A 4F3JA 1LGCA 4LUKA 1AHSA 1SMVA 2RHPA 4LBQB 3LOBA 4AK3A 1H4GA 1YI9A 4QPIB 1DGWA 2RJLA 4R52A 4DRRA 4Q0VA 1F5FA 1S0IA 5KXBA 2OUHA 1BEV2 2R042 2WNUB 3M3IA 3S30A 3BPZA 1RIRA 4PJYA 4Y20A 3K51A 1CQ9A 1RVF2 2D5FA 4QMAA 2R1DA 2P34A 3H0OA 2Q4SA 2Z42A 2IFRA 2RS53 4UBHA 2HEWF 1DZRA 1U5YA 3IN9A 2VOXA 3AP7A 3DPRB 4MXVA 5CFDA 2OYZA 4E2GA 4MV2A 4Q4Y2 2ZMKA 3ZFGB 1A78A 2QUOA 1CJPA 1PIV3 2AYHA 1ND2C 1OQ1A 5FAXA 3GALA 4GMP3 1V9U2 2YGLA 4JGZB 5FPXA 4XBNA 3I59B 4S2GA 1ZBE2 2Y26A 1SLIA 2UWBA 3AZWA 4BE3A 5AFEA 1TE1B 4JGYA 1DQ0A 4D94A 4BCUA 1C57A 3ZSJA 2IXLA 3FE5A 4I3PA 4RR3B 3OD0A 2YGMA 1FNYA 3NAPA 4I3GA 5F1RA 1AX1A 1H2LA 2OVUA 4D7TA 1RUJ3 2B46X 2BVVA 5T5LA 4AVCA 2WA4A 4Y5Z0 4QPYA 2O8OA 4IEZA 2G9FA 4J6GA 1N1YA 4LBNA 3J9SA 2RS12 1XE7A 2GMEA 4JRAA 3GBWA 4IXLA 1LOFA 2GH8A 2WKKA 4XIOA 4N53B 4YGEA 3ZXDA 2X5IA 3KMHA 3WLUA 4R4ZA 5KBFA 5T54A 2ZZJA 5GKAC 2WWSA 4GMP1 1X82A 1AZDA 4HETA 4XTPA 4AVTA 4QQOA 1BYHA 2QCSB 2H6BA 3UJOA 4MGZE 1EV11 3ECQA 5BNOB 1I3HA 2BEOA 4NWVA 2IXHA 3L2HA 3KZ4C 4FOYA 3ZXAC 4GWNA 1ZZ6A 3VBHA 2Q5TA 4DNYA 4KNCA 2YZ4A 4Z92B 1RUD3 1JXNA 4CDUB 4JGZA 1DFQA 3PTYA 4GH4A 5L7OB 1N1VA 3BCWA 3ZYRA 3BU7A 5ACA1 1V00A 2QZ2A 3AYDA 3OYWB 1CAUB 1AX0A 4Y1VA 5JDBA 1Z7S3 5H9PA 5JWPA 3ZSEA 3RZZA 4FSJA 1A6CA 1S0GA 3LSEA 1FT9A 1UPIA 2VNRA 4QQLA 1Q8VA 1F9KA 4FT8A 5K8SA 3R4SA 1CN1A 3LA3A 2PAEA 3S7IA 2IXKA 3OYWA 4LEJA 1SLCA 4ES9A 1QJX1 5J36A 3FX3A 3PHMA 4WM7C 5FCCA 3WXPA 1WCDJ 1XNKA 2QKDA 4CEWA 2CGNA 2D43A 1EAH3 2GNBA 3BB6A 4XXPA 4GMP0 4ONUA 4LLFA 4NR1A 3BALA 3WW3A 1D2SA 2XJVA 1ZM1A 1KQRA 1CVNA 1NLSA 2A6YA 4JC1A 5FRAA 2XLGA 4BYYA 1LJ7A 5E1RA 1AR81 1C1LA 4AQSA 4LUMA 5EXOA 2BWCA 4LO8A 5T52A 1ASJ1 2V09A 5CVRA 1I5ZA 1O5LA 2QDRA 1AR83 4WBBA 4CDQA 1LKNA 4Y1YA 2Z69A 4YM1A 4G3YC 4DXZA 4Z8BA 4WVMB 3V65A 3TN92 4PQ9A 1IS6A 4LR4A 4C1XA 4DINB 4YVSC 4ZKTB 1RUG2 4HSJA 2RS13 3VV1A 2OZ6A 4FPCA 4CDQC 4JVAA 5T50A 2B45X 5BNNB 2VW2A 3QBQA 3MIHA 2FHRA 3AX4A 4QPGB 2AGSA 2DVBA 3WUDA 5BNPA 3ZFGC 3ZIXA 1MZEA 1OA2A 2JEMA 1T6GC 1JH5A 2R063 4P9WA 1ONAA 2EXIA 2ZHMA 1AR63 1Z0HA 3VUOA 4B4RA 3AXEA 3DV8A 4P9YA 3FUOA 1AYM3 2NPIA 2YYOA 4HPKB 1QF3A 2BVBA 3VBOC 4WM7A 2FMYA 3NVCA 2ZPXA 4ES8A 1DYPA 2JG9A 4XETA 2CL2A 5C4WB 3N7LA 5I0RA 1N1TA 1QOSA 4IESA 2D6PA 4LLOA 4BM8A 4DB5A 1QDCA 1HIXA 2RM21 1AR91