3GYDA

Crystal structure of a cyclic nucleotide-binding domain (mfla_1926) from methylobacillus flagellatus kt at 1.79 a resolution
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
178
structure length
178
Chain Sequence
HHHENLYFQGMYPDLVHLGGADKYFEEILEIVNKIKLFGDFSNEEVRYLCSYMQCYAAPRDCQLLTEGDPGDYLLLILTGEVNVIKDIPNKGIQTIAKVGAGAIIGEMSMIDGMPRSASCVASLPTDFAVLSRDALYQLLANMPKLGNKVLIRLLQLLTARFRESYDRILPKTLGELI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cyclic nucleotide-binding domain
publication title Crystal structure of cyclic nucleotide-binding domain (YP_546034.1) from Methylobacillus flagellatus KT at 1.79 A resolution
rcsb
source organism Methylobacillus flagellatus kt
molecule tags Dna binding protein
total genus 52
structure length 178
sequence length 178
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3gydA00
3E5QA 2IXIA 1DGRA 2VQAA 3RNSA 4EV0A 3MYXA 4E2QA 1Q5OA 4A2UA 2PAKA 4JTOA 1UPIA 2B8MA 1O3SA 4MZUA 3LWCA 5J3UA 3LZZA 2Q1ZB 4FT8A 5FQ0B 1X7NA 2QDRA 4HVOA 4IEYA 2GC3A 1CAWB 4QGLA 1ZZ9A 3NW4A 1ZZ8A 4AVAA 1YFXA 1H1MA 4Q29A 2E9QA 2UYBA 5LEJA 2PTMA 2PHDA 3HIFA 3UKVA 5D1IA 1J1LA 4J1WA 4KU8A 1OD5A 3H7JA 1YFWA 3U10A 4DINB 4F8AA 4AVBA 1X82A 4YSFA 1O5LA 2PYTA 4HN1A 1OI6A 4WZCA 3OGJA 1ZRFA 2IXLA 1RGSA 3M3IA 5EFUA 1ZNPA 2BNNA 4LUMA 3DKWA 4PIZA 3HT1A 2GU9A 4PJYA 3FZ3A 1FI2A 1RUNA 2XKOA 2MPFA 3NJZA 4Q0VA 5FPXA 5BUVA 1OFNA 3MPBA 1EP0A 5JAXA 1XE7A 4KWKA 4E2GA 5J7MA 2BEOA 4NVPA 3KCCA 2MNGA 5BPXA 1QY4A 2ATFA 1I5ZA 4LLOA 1LR5A 4QM9A 4XFAA 5FLHA 4K8FA 2XLGA 1YLLA 1SFNA 4EWEA 2Q0AA 1L3JA 3I59A 1CAWA 3CO2A 4J1XA 3CJXA 3S7EA 4IETA 5JSRA 1FT9A 5E1RA 3SMHA 1ZX5A 2Z2SB 4JV4A 2ETEA 1DZTA 2I45A 5I8YA 5KBFA 2Q30A 2DCTA 1UD1A 2GC0A 3E5UA 4BH9A 1FXZA 4MX3A 3USSA 1VJ2A 4I01A 4RD7A 3FE5A 5J48A 1NZCA 4ZU5A 5C8WA 1H1IA 1SEFA 2PA7A 2K9ZA 4XFBA 3H50A 4QXKA 3RZZA 3IBMA 4MGIE 4LEJA 1JUHA 2QNKA 3E5XA 4Q0QA 3HQXA 2XL9A 4PIYA 1YHFA 3B02A 2UY8A 4OLLA 3H1MA 4E2SA 3NSTA 3BCWA 3SXWA 2UYAA 3NVCA 4META 4KU7A 1NE4A 4LULA 4MV2A 3S0MA 3SCHA 3KMHA 2BYVE 3PLQA 2EA7A 3LOIA 3S7IA 2UY9A 2HJIA 4IEWA 1PM7A 1XE8A 1ZRRA 3SHRA 5I0SA 2VECA 5FLJA 3TNPB 4XF9A 4QX5A 2XHKA 5BXXA 4KWLA 3RYKA 1XRUA 3C3VA 4AQ2A 2QJVA 1CAXA 4HBNA 2XKPA 3E97A 4IEXA 2B5HA 2FMYA 3WW4A 4XFCA 5I0TA 4I2OA 4QM8A 4LA2A 5LEKA 3LA2A 4ZU7A 1LKNA 3H3UA 4F7ZA 1IPKA 1O4TA 4WBBA 1CAVB 1CAUA 2CV6A 2PAEA 3E6CC 3H3ZA 1O3RA 1ZZ6A 4O9EA 3EQEA 1LB2A 3OD0A 2D93A 3IDBB 1VR3A 1LRHA 2IXKA 1TQ5A 4XF0A 2CGPA 1VP6A 3H1YA 4XFFA 2Q4SA 2C0ZA 3PVBB 3DN7A 4XEZA 4HSLA 5HI0A 3ACLA 1V70A 3M70A 3CEWA 3TNQA 4BYYA 2GC2A 3D82A 3LAGA 4D7TA 1RL3A 2PQQA 4I0AA 3BU7A 5AVPA 3I54A 3QOPA 4XFIA 2K0GA 4Z07A 4MUVA 5KHGA 3PNAA 2VPVA 1YUDA 2GZWA 4YYOA 2O1QA 2D5FA 3CLPA 3ZDSA 3I7DA 3EHKA 3MDPA 2OZJA 4WVZA 1U12A 4HMZA 1G6NA 5FQ0A 1J3QA 1Q43A 5E16A 2IXCA 3D0SA 1CGPA 3BB6A 2XLFA 4IEQA 3WW3A 3KGLA 3UKNA 4IEUA 3UKTA 3CF6E 1ZRDA 4X6RB 1CAVA 4AVCA 3FX3A 2O8QA 4KL1A 4I3PA 3DL3A 3LA7A 1ZVFA 4ORFA 3EJKA 3R6SA 2ET1A 4HZFA 1O7FA 3ES1A 4IEOA 5I93A 4Q0UA 2B9UA 5JR7B 1EYBA 4I09A 3ES4A 4HN0A 4QGMA 3KSCA 3JZVA 4ZU4A 4IESA 4L11A 4BIFA 4UBGA 2GAUA 2PHLA 2Y0OA 2HKXA 1X8MA 5KHKA 4YRDA 3E6DA 3OF1A 1OMIA 3L2HA 3D0JA 2D40A 1GQHA 2ZKLA 4TLFA 2KXLA 4O9GA 2CAUA 3QACA 2IC1A 4MGYE 4P9GA 1YWKA 1CX4A 3FHIB 3SCFA 2N7GA 3O14A 4H7LA 3BPZA 1J3PA 4LTAA 3H7YA 2WFPA 3KGZA 3ST7A 1QWRA 3E6BA 3GBFA 4HSJA 4IEPA 4MH0E 5KHJA 4FBFA 4LUKA 1PMIA 1UIKA 4EWAA 3G7DA 4R8HA 2XLAA 3IDCB 1QXRA 1UCXA 3IIAA 4Z82A 4FAGA 2GH2A 2V09A 2OPKA 4UXAA 5I0RA 4N9HA 3WW1A 5F1RA 4MGKE 1NYWA 2P17A 3H9AA 2IXHA 2BNMA 3WW2A 2H6CA 3RPQA 1O3QA 3RYPA 1J58A 3EO6A 5KHIA 4I0BA 3I59B 4D7SA 4AXOA 2QCSB 1QXJA 1DZRA 2ZCWA 3LA3A 2EAAA 4IERA 4ONUA 1WLTA 5BV6A 5EZWA 1O5UA 4N9IA 3ROUA 5FDBA 4HVRA 4QMAA 4XF4A 1RC6A 4BHPA 2BGCA 2XL7A 1X8EA 3N4MA 4OFGA 5JCTA 4XF3A 2MHFA 2EVXA 3RYRA 1UW8A 5I0UA 4EROA 1ZRCA 1J3RA 4XETA 4X6QB 4CYDA 1GQGA 4GULA 1ZZ7A 4YNIA 1ZZBA 2FQPA 4PIXA 2Z69A 1YFUA 4Q0SA 4JTNA 4QGNA 2H0VA 3H1WA 4JVAA 4I02A 5FCCA 3SCGA 5LRRA 1EPZA 2WC2A 4UBHA 1WA4A 2PFWA 4IEZA 5I8SA 3GYDA 3FWEA 2OYZA 3FJSA 1Y3TA 4HVQA 4MGZE 1EY2A 2BNOA 5LRSA 2QVSB 3NL1A 2OA2A 1RUOA 3OCPA 4Q0PA 5I91A 5CADA 3FFQA 1CAXB 2F4PA 5CVRA 5KHHA 4FAHA 4AQ6A 2OZ6A 5BY5A 5FPZA 4YARA 2PAMA 1O3TA 1YFYA 2ET7A 1ZREA 1ZZCA 3RDIA 1DGWA 1SQ4A 5T3NA 3IWZA 2D5HA 1CAUB 3H8UA 3HT2A 4B29A 5K8SA 3NKTA 2H6BA 3DV8A 2CAVA 5C6CA 4XFHA 1J59A 1UIJA 3U0ZA 1RTVA 1WGPA 3EBRA 4LA3A 2GC1A 4KWJA 4XFGA 5JSPA 1Y9QA 3U11A 1IPJA 5JSOA 1NXMA 1Q3EA 4EWDA 3OTFA 3BALA 4L2NA 5I8TA 4IEVA 4R52A 1HW5A 5CU1A 2IXJA 2XGXA 5FLIA 1I6XA 3ELNA 4XF1A 3VHRA 3MZHA 4HLTA 1NE6A 3CL1A 3ETQA
chains in the Genus database with same CATH superfamily
3E5QA 3IT8A 2AUYA 3C7OA 4Y1VA 2BPA2 2IXIA 2FDHA 4WV8A 5FZAA 1DGRA 1G8WA 1QF3A 3BIWE 4K40A 4N90A 4YM2A 3U75A 3J4UH 3L9JT 1PGW1 5FZDA 1EV11 3WQ0A 3VD4A 4JKMA 2OIIA 3O0VA 4JTOA 5LY1A 4ET7A 3VBUB 2A1XA 5LA2A 1V0AA 4AI0A 1NT0A 3LWCA 5FYYA 4U2AA 4R9CA 4XQWA 3K48A 5FQ0B 4B1LA 1X7NA 2Z4FA 4HVOA 1CZTA 3MIBA 1EV13 4RR3B 1H2KA 1SG3A 3K77A 4JHTA 2W52A 3WEZA 2VR4A 1ZZ8A 3ECQA 3AKTA 4LPLA 4NHLA 5BUVA 1VBB1 4L9BA 5A3UA 3BODA 3MEPA 3OUHA 3R4SA 2ZEYA 1D7PM 3M2MA 5KXBA 1UU4A 5LEJA 1WUVA 3UKVA 3ACIA 4WVMA 2ZXQA 1UY4A 4YVSB 2P6CA 2VBBA 1J1LA 1VBB3 1JW6A 1RHI3 1QQP2 2V4VA 2VQTA 4ISRA 1YCIA 4QKFA 3ZLIA 1S2KA 1NLRA 3OB8A 4AVBA 4A7YA 1X82A 1Z78A 1O5LA 3VBOA 1DG6A 5FZGA 2BOJA 3DYPA 1W9TA 2QQVA 5A7NA 4Y3OA 3T08A 4C91A 3FLRA 1C5IA 4L92A 3T0AA 4BQ5A 2JB4A 1ZNPA 1OOPB 1RUD3 2BNNA 3DKWA 2GDFA 3HT1A 2X10A 1AL21 1MVQA 3KV4A 1FI2A 1RUNA 1C3HA 4W6XA 2ADDA 3KV5A 2ZGLA 4AE2A 1VBA2 4D6QA 2ZPXA 5JAXA 4KWKA 4ITCA 1D0HA 1N47A 5FZFA 1W8TA 3KCCA 5L36A 2R061 5LY2A 3A23A 4LBQD 3ORJA 4XPVA 1XNTA 2RS31 2PHUA 3OBRA 4AEDC 3B3QE 5BPXA 2WNUC 3HPNA 4LLOA 5T5LA 3WP3A 3M3OA 3I2FA 5BNOC 2RJLA 3AKRA 3NJVA 4KI5M 5ABJA 1AL0G 5FLHA 2RG4A 2R063 2W9XA 1H9WA 3UV9A 2JD4A 2RS33 1NQDA 3GCWA 1REEA 1QJY1 2YBSA 3HWJA 5LW9A 2P4EA 1L3JA 1OQDA 1YRZA 2A6XA 3CO2A 4Z1VA 4NR1A 5FY1A 1O59A 1VE0A 2WO7A 2VQUA 3S7EA 1CZVA 1KS5A 1PVC2 1UY2A 4ZHNA 5JSRA 4AW7A 1UZ0A 5E1RA 3UJQA 1QJY3 5FPAA 5F2WA 3AMNA 4P5YA 5GZCA 3ZXFA 4XUPA 1QJZA 2Z2SB 4ZZ8A 3T4HB 2UU8A 3AC0A 4KGQA 5B4NA 5I8YA 1IKPA 3KF5A 5KBFA 4XHBA 5APAA 1IS3A 2VNOA 2GC0A 3THTA 5KXCA 4D8MA 4YW7A 4MG2A 2JDNA 2UWCA 2VTXJ 1G9DA 3AYCA 2VW0A 5KWRA 2QQNA 4I01A 4OVEA 3EB7A 1LULA 3UK9A 1H0BA 4QX1A 4QPIC 4XTMA 5C8WA 1AR91 1FOD1 1TMF2 2WAOA 5D8AB 2WZEA 3T2TA 1MZ5A 1D4VB 3H50A 4QDRA 3N3HA 4LHSA 4C0HA 5A7SA 2VXRA 5FIXA 4MGIE 4NPMA 1IQDC 2A75A 1SPPB 1A78A 2WWJA 5JI7A 3T3YA 1RUI2 3PUQA 4PIYA 5FPVA 2XOMA 1DQ1A 1AR93 1FOD3 1YHFA 2ARXA 2UY8A 2YGLA 2VC9A 3B02A 4ZONA 1DU3D 4K8RB 4EYUA 4RGAA 2VH9A 1WMXA 4GH4B 4XUQA 4META 4HPKB 1GOHA 5F6LB 2XQRA 5CBLA 3S0MA 4DRRA 2WN2A 3EMRA 2J22A 5CZKA 3KMHA 4M4RA 1MS3A 1DBNA 1PHMA 1PIV2 3RFRA 2B46X 2QQLA 2EA7A 4XXPA 5D21A 5C3QA 1UU5A 3TAYA 1LHVA 2PN5A 3T1LA 2I07B 4AAXA 2HJIA 1KITA 2Y64A 3UNPA 2G19A 1HDKA 2ZEXA 3APBA 1WZXA 4CTEA 5K0UC 2VECA 5FLJA 1OPMA 4QX5A 4N43A 1F31A 5IVEA 2HYKA 3OGSA 2PHWA 4Q4Y1 1SBFA 1K42A 1ZM1A 4CP0A 1WLWA 4AWDA 2QQOA 3AYEA 4IDZA 2Q5TA 4IEXA 2B5HA 2FMYA 1E5RA 3J8F2 3WW4A 1UYXA 1TVGA 4COWA 1RVF2 3FLTA 3VZNA 2QBXA 5C33A 2JXAA 1LKNA 4Q4Y3 1CPMA 1D4M2 3DPRA 5DZGA 2A70A 2ID4A 3RZMA 5A1FA 3GZUC 3H3UA 1HN1A 3KB5A 1IPKA 3ZMNA 5G05L 4XQDA 2BVBA 1CAVB 2A6YA 1O3RA 1LODA 4FPJA 2JG8C 3EQEA 5DG1A 1H8TC 4Y22A 2WBKA 2HWF1 3OPWA 5FZOA 1VR3A 1LRHA 4Y33A 4GWIA 2C9KA 2YU1A 2VZQA 4C1WA 4WM8B 1XPWA 2W46A 3WNKA 1LGNA 1JYIA 2F6BA 1V9U2 1KD7A 3RS6A 5FY7A 3UGFA 4EN6B 3SH4A 2DVBA 2C0ZA 2CGOA 4IV1C 2LRPA 5GLZA 1H2LA 3VBFB 1LGCA 3DUIA 3OY8A 3NNLA 3I2OA 5HXVA 2JDMA 2DDUA 3ZFGC 1D0GA 3LAGA 3SITA 4D7TA 1W2OA 1W2TA 2XH6A 3MPPG 1SLBA 1RUJ1 2E63A 3KT1A 2E31A 2W3JA 5JR2A 4R9AA 5DUVA 2K0GA 1PGW2 2HBTA 5KHGA 3PNAA 1NCQB 1U5IA 1GR3A 5FMOL 1Q8VA 2OUJA 2DVFA 1RUJ3 2F4LA 1J83A 2P5BA 3AZWA 4FFIA 4Q2FA 4YG3A 1ALYA 1HJFA 3VB9A 3ZYIB 4P00B 1Y9GA 3ZDSA 3I7DA 3MDPA 5DUXA 4Y1UA 2ARAA 1DCSA 3AP6A 1EPWA 4UF0B 5FY8A 1F9KA 1X9TA 1F2NA 2Y38A 4LO4B 3BB6A 2WZPP 2DCYA 1RHI2 4OUEA 2DYCA 1CWPA 4L8QA 2CYFA 2PHXA 3MBWA 3CNAA 1ZRDA 2JKBA 4X6RB 4IQPA 2EIEA 1CAVA 4IE5A 1GYKA 1M4WA 3FX3A 1KQRA 2ZX1A 4N53A 5HCBA 1JYWA 1NCRB 3GZEA 5A3OA 5FZKA 2GH8A 5J98B 4ATFA 3R6SA 1RUD2 4KGGA 3VD9A 3T0DA 4QXBA 5CFCC 3N9LA 3ES1A 1IHMA 4WM8A 5F2SA 5JZGB 2DV9A 4DOUA 5BNPB 4D0QA 2AEYA 4BLJA 3AZYA 4FVVA 1W6PB 3NV1A 1SLCA 4M3CF 4QU1A 3FUOA 1HV0A 4CE8A 3VBFA 4NHKA 4LIVA 1TE1B 4PI2A 4PLOA 1P8JA 4OHVA 4HN0A 4QGMA 3MV01 1O8PA 1RUC1 5FJKA 4A45A 1YC61 2PHLA 1T6GC 1BLZA 1RIRA 3JB8A 4E8DA 2RS32 5L7OA 5JIUA 1GBGA 3OG2A 1X8MA 4ARYA 1RUC3 1OKOA 1NCQA 3WF1A 1C28A 2BU9A 4QU2A 2EIDA 3OF1A 1UOBA 3H0OA 3VBUC 1MEC1 4D94A 1N3OA 2C24A 5DXDA 1OMIA 1QJY2 4QB6A 3L2HA 4BQ3A 3D0JA 4COUA 3WF2A 4TLFA 3AVRA 2J7MA 2X8KA 2Q8DA 1TNFA 4RQPB 1GOFA 1QNYA 1MEC3 2CAUA 4O9GA 1O8SA 3QACA 4MSVA 1OXCA 2LS6A 3V56A 5J37A 4A6OA 1HXS3 2XR4A 4MGYE 4P9GA 1YWKA 1CX4A 2A7AA 4JAAA 3WINE 3IZOA 4NRMA 3G6JB 4EN0A 3UL2A 2WFPA 2A6ZA 3ST7A 1QWRA 4BB3A 1UMIA 2WRAA 1F4HA 3OGGA 3UYJA 3R4UA 3T4VA 1VBC1 3ZSJA 1BZWA 1W8WA 1K5MC 4LKSA 4I30A 4Q4X1 1BEV1 4CCCA 5L9RA 5JZGA 3MICA 1AR92 1FOD2 2XMLA 5EYXA 2ES3A 4BWOA 5BNPA 4R8HA 2XLAA 1VBC3 1SZBA 4PCRA 4H7MA 3VKNA 2HLEA 2A3YA 1FYUA 1U5ZA 3AYAA 4NOTA 3JB4C 3EYPA 1BEV3 1OOPC 1ULFA 3IDEA 3KV9A 4KWUA 4Q4X3 5H9RA 4G4FA 4JGZC 3VBRA 1DQ0A 5FK7A 4CP9A 4P9IA 1OD3A 1PGL2 4MVTA 1O4ZA 4P02B 4UXAA 4N9HA 4Y5TA 3VZKA 3WW1A 1LTEA 2R30A 5FAXA 2WLQA 4CDXC 2QTWB 5IT6A 2ZGQA 4PDWA 2WNVB 2EIGA 2H6CA 5FPLA 1JTZX 2VU9A 2GSYA 4QPYA 4XACA 3EO6A 3JD71 4HANA 4QX2A 3I59B 4D7SA 2D7FA 4LHKA 4AXOA 1PZ9A 3F95A 1RUG1 5DUWA 2VZSA 4AHYA 3ZYJB 1H4GA 5FMOS 1LOBA 3LA3A 1AR63 5K4LA 3ZYRA 4ONUA 1C4RA 2VOKA 1WLTA 3DGTA 3MFAA 3GJBA 1O5UA 3JD73 4GJYA 3THCA 5BV6A 2ZABA 3WNNA 5FY9A 3ROUA 3T2OA 1RUG3 2YZ4A 3KVAA 2VZ1A 1JYCA 2AC1A 2GN3A 4HVRA 1RXFA 3AP4A 4AQTA 3MHZA 4FFGA 2JICA 3K4ZA 2XL7A 5FYMA 3VBHC 1XNBA 5HCHA 4GIQA 2JDYA 4Q4Y2 2NZ9A 4RGGA 4AGRA 3SQOA 1BQPA 2MHFA 2EVXA 2DTWA 2FCTA 3IDAA 5I0UA 2OXBA 5FR3A 3AL6A 5M0TA 2UURA 1ZRCA 3KD4A 4B7EA 3LF7A 5CB7A 4QDQA 1GQGA 1XBFA 5LBEA 3LKJA 1XE0A 1RB8G 1FMD1 2P34A 4XILA 4YVWA 1GP4A 4DEVA 3N35A 1UQXA 4IXLA 4PIXA 1GQPA 5D8AC 2VOWA 3IB3A 1W99A 1YFUA 3S6PA 3NNJA 1L7RA 4FP2A 2XJRA 3H1WA 1FMD3 1DLLA 1VAVA 2VVDA 1MZ6A 4I02A 2ZHMA 4JVAA 5FCCA 2OS2A 3OBTA 3N7LA 1QOSA 4NHYA 5IW0A 3SCGA 4AEMA 1N1TA 1UKRA 3A22A 2XDVA 5FBZA 2P1BA 4BMBA 3U78A 2D3SA 4DXZA 4FXKB 4HVQA 1ENQA 1W8HA 1EY2A 2SLIA 3OGVA 4PLMA 2BNOA 1OQEA 5JOXA 4CXYA 3TYJA 3LOBA 3MLKA 1URXA 3AP9A 4Q1PA 1W0PA 4XBQA 1HB4A 5A7WA 1TNRA 4M3CB 4OYUA 2DFBA 4Q0PA 5ANQA 1HKDA 4B4QA 5CADA 1AR81 3FFQA 4HKLA 3BTAA 5GLUA 2WNUB 4AEDB 2C9AA 4C90A 1DYPA 4GB32 1ULGA 2CNAA 1WLCA 1WA6X 3LDRA 5BNOB 5CVRA 1K3IA 1UPSA 3JXSA 1YQ6A 2C26A 1BBT2 4RL7A 4FAHA 1AR83 5CG9A 4DRVA 2B4KA 4CDQA 5LBCA 2ET7A 5FP4A 2AYHA 3VDCA 1CX1A 4Q27A 3RDIA 4OUSA 2Z79A 1VMJA 1HB3A 5T3NA 5A32B 2PELA 5J36A 1Z7S1 3ITQA 3NKTA 2OKXA 3NRUA 1HRV1 4DZGA 2VNVA 3DV8A 4S2FA 1CJDA 4LQRA 2CAVA 1QMJA 4XFHA 5C9AA 5ISLA 5FZ1A 4FI9A 1RTVA 1WGPA 3EBRA 1Z7S3 3N7JA 3RMXA 1IS5A 2GC1A 1GOGA 1LJ7A 1AYN1 1AX1A 3O1RA 1HRV3 1Q3EA 1DQ5A 1ZA4A 1TZOA 1VIWB 2J1VA 2YBKA 2YBPA 3DXUA 2R6QA 3OTFA 2CGNA 4XBLA 2XUMA 4AI2A 5A70A 4QQ2A 2QQUA 4ASMB 3DF0A 4IEVA 1HW5A 2GNMA 5DAXA 1AYN3 2BJSA 5LBBA 2XGXA 1FATA 2RJ2A 3ZR5A 3POEA 1B35A 3VHRA 3CQOA 2VW2A 1NE6A 3CL1A 3ETQA 3H3LA 3IDBB 4UWDA 2HWE2 4S2HA 3GXUA 1BHGA 4M3CA 5D2AA 3RNSA 3PMEA 1SCSA 1UOFA 4O61A 5K7PA 1GZCA 1Q8OA 2ZHKA 2VMHA 4AEDA 1OFSA 1HRI1 4MGQA 1XC6A 1KDKA 1NLQA 2NQYA 3GGLA 4RSUA 5DAVA 2JE8A 1OVSA 3LZZA 2Q1ZB 4MGTA 3JBG2 4FT8A 4AK3A 5A6YA 1VB2A 3POIA 3QH6A 4QDSA 1OUSA 1CAWB 1YIPA 1HRI3 4ES9A 3GF6A 3UGHA 2FMDA 1MEC2 3WT3A 2L9LA 3NW4A 1CONA 1XSQA 4XDPA 4AVAA 2YXSA 4DUWA 1YFXA 1HXS2 2XJTA 3K2OA 4UYBA 1S2EA 5K0UB 1I1EA 3N9QA 3GZAA 1JZ6A 3S5AA 1RMU1 1Q8PA 2FDJA 2HBUA 2UYBA 3M8LA 3MI8A 1SCRA 5JMOA 2YV8A 3POYA 5LASA 3I97A 4RYDA 3LEKA 4J1WA 4KU8A 3H7JA 3V0BB 3M3QA 1RUF2 1RMU3 3HJRA 2VUCA 1QGLA 3ATGA 3FHQA 5IAXA 2PMWB 2PYTA 1C8M1 1V6LA 1OI6A 4WZCA 5F3EA 3UJOA 1N1YA 1RGSA 3VLBB 3AK0A 2WS91 1AX0A 5FYIA 1NQJA 1QEXA 4KG8A 4AHWA 1C8NA 3FZ3A 3KZ4C 1H8TB 1C8M3 4AOCA 2XKOA 2MPFA 3GHMA 1W6NB 1OFNA 3PJQA 1FAYA 3KM5A 1EP0A 4HK9A 4NN0A 5GJ6A 1R1ZA 1ND2C 1XE7A 3ILFA 3NAPC 4FPCA 4CDWC 3DECA 2BEOA 5CFDC 1A6CA 2FDIA 1W2NA 2WS93 2TBVA 2MNGA 1HQNA 5A6ZA 3D6EA 2DWRA 1VRH1 4HKWA 4YW4A 1QNWA 4GD4A 4AQSA 2ATFA 3WG1A 4IV1B 5BYNA 1LR5A 2J1TA 4BA6A 1AR62 2R072 3JD72 5DQ0A 1W0OA 3PURA 3ZFGB 5FPUA 1YEWA 2W94A 4LOTA 1SFNA 3CKHA 4EWEA 1VRH3 2IWGB 4V2VA 4OMDA 1NXD1 4BCUA 5FZ6A 1CAWA 2ZJCA 3CJXA 5FZ7A 1POQA 2J42A 3ZYPA 2Y34A 3CDZB 1DGRN 5K0UA 2R16A 2A5ZA 4ZY9A 1YQ5A 3MLLA 3ZIWA 4K1ZA 2ETEA 3ZN6B 1DZTA 2I45A 2VCAA 4I0WB 3V65A 1CJPA 4PBPA 5FZIA 1K12A 5C3RA 4BH9A 3FBMA 3V0BA 3VD5A 3CJIB 4IE6A 3WG3A 3RRDA 4H2AA 1NZCA 2R0FA 2DVAA 5H9QA 1PNFA 1SEFA 3CZJA 5C8CA 5DUUA 3THPA 4XFBA 4BK4A 5C4WC 3H8RA 4DMIA 3IBMA 4K7JA 3H8XA 2JG8A 1JUHA 3E5XA 3P3NA 4Q0QA 2Q8CA 3HQXA 2XL9A 1H8TA 1SHWB 5L73A 3ZYFA 3ZM8A 4AFBA 3I3QA 4OLLA 3H1MA 3W58A 4E2SA 3CBNA 2EICA 3BCWA 5CFCB 3ZO0B 3OEAA 1XSRA 3O0XA 4AFCA 4KU7A 4A41A 3V0AB 2BBAA 3ZFEC 2VBPA 2YC4A 3AB0A 3P3PA 4IV3C 5DAQA 3KF3A 3LFMA 2V73A 2JDKA 2WL1A 4CUAA 5F9TA 2Z5WA 3GBWA 3SH3A 1VBE1 2ZAHA 3LOIA 5FYBA 5T52A 1U5XA 3S7IA 5ACA2 3IPVB 5DABA 2YFUA 1H30A 3WDUA 1STMA 4JHZA 3GJAA 5C3OA 4HG6B 3SHRA 3IKWA 2BZDA 3T1MA 1SLAA 3AL5A 1VBE3 4V2WA 4XF9A 5E88A 3RYKA 5BXXA 4KWLA 4H55A 4LO7A 1GUIA 5JUVA 2W08A 1FPN2 4AQ2A 2LALA 4RN5A 1AR71 5B2GB 5H9SA 1WBLA 2QJVA 3NV3A 2XKPA 3ZYHA 3JQWA 1JZ5A 4M0HA 2HH9A 2QUOA 4XFCA 5I0TA 2VCBA 2ZHNA 2ORZA 3AP7A 1ULOA 2W1WA 3KQRA 5A6XA 2B9VA 1R091 1UO9A 1UZVA 2E7TA 1AR73 4S2GA 5IVJA 2W1UA 3NV2A 2Y6FA 4LKFA 3U37A 1ZA7A 1Z7S2 3POFA 4GZ9A 3T0BA 3QD6A 3I4IA 2RS51 1QOTA 1PM4A 2D43A 1LCLA 4UFJA 3E6CC 1CAUA 2CV6A 2WWSA 3A21A 4Q4V2 3NNGA 1R093 4O9EA 4JKLA 1LB2A 1XNCA 3W5NA 2QQJA 2CWSA 2JG9B 1R1A2 2D93A 2WT1A 3AMPA 5FP7A 2RS53 5A33B 4XF0A 1R081 2YU2A 1K5MB 4LNVA 2WNEA 1BMV1 1H6YA 3B94A 5CFCA 4NIHA 1JUIA 1ACCA 4FQZA 5FZMA 3V0AA 4LBMA 3DN7A 4EJRA 3WQ7A 3K51A 1W6MB 2FHRA 1WCUA 1WCDJ 3ACLA 5T5PA 1R083 3C8XA 3CEWA 1H4HA 1LHUA 1JH5A 1UNBA 1F15A 3FFZA 5F37A 2Y6KA 3D82A 1JZ8A 4JGZB 3ZXJA 4O7XA 2A73B 4P9XA 2XONA 3B5LB 3WY6A 4CDXB 4FTBA 1LHOA 2BTVC 1REDA 4KBBA 3BU7A 5AVPA 3I54A 3AX4A 4Z07A 3USUB 2WLPA 4YGEA 3RZHA 2XVKA 4XHXA 1AL23 2WR9A 4AI9A 2VPVA 3R05A 1JMUB 2Y6LA 3WF3A 5GM0A 3OOXA 3HVDA 4XYXA 1HQLA 4CUGA 5LCWL 2DUOA 1CZSA 2ERFA 3ZFFC 5JXHA 3LPGA 3VBUA 2D5FA 3MV11 1TG7A 2OZJA 3WCRA 4UFIA 1G6NA 5FQ0A 1J3QA 1Q43A 5E16A 4R4XA 3D0SA 4TZDA 2CU5A 1SBEA 4IEQA 4RR3A 1LOFA 3KGLA 1UOGA 5FZCA 3UKNA 2IUWA 2UWAA 5C7GA 1RMU2 3VN4A 4BJ0A 3VBHB 3LEIA 1ZBA1 2ZX2A 4YWAA 4XAEA 4I3PA 3DL3A 3KT4A 3PUAA 4E4SA 3VL8A 3SKVA 1V00A 3KCYA 4YVSA 1W3VA 3HNBM 3WQ1A 1ZBA3 2VCMA 4CCKA 1SBDA 4OMCA 1K45A 1O7FA 2VQ0A 2RHPA 4W65A 1TME2 1VPHA 2D44A 3ZXAC 5LK7B 1GICA 2B9UA 1BK0A 4EN7B 2G4IA 2HWB1 2EXHA 4D69A 1EYBA 1I9RA 2TNFA 1NX9A 3POBA 1MZEA 3ES4A 1AUYA 5FY4A 1OOPA 1C5HA 4XTPA 1F5JA 3JZVA 2ZGOA 1W3XA 4ZS3A 4P9WA 1S0CA 4ZU4A 1G9BA 1KRIA 5EJZB 4BIFA 4UBGA 4B8EA 2HWB3 1LEDA 4CDXA 2WABA 2BWCA 3ZXEA 1JU3A 3DCQA 2CTVA 2HKXA 3SNMA 3C7EA 5HCAA 4M00A 5BNNC 1Y43B 1GV9A 1H1AA 1DP0A 3LCPA 5KHKA 2RDSA 3KQ4B 1MACA 2B45X 2P3JA 5IK5A 5CG8A 5FZ3A 5H9PA 4YYOA 1NUKA 1JOJA 3LFIA 2XWBB 3R0RA 3I3MA 2RDNA 3N9OA 4XUOA 4CEYC 3VD3A 3FN9A 4GMP1 2BQPA 4FPLA 4CP1A 3WG4A 2PHTA 1AVBA 1N3PA 1DQ2A 4DY3A 1W0NA 4GMP3 5CKQA 4CA9A 4Z92B 4P9YA 1OVPA 3JU9A 4HONA 3SCFA 1JHNA 2Q8OA 4COYA 2N7GA 3SISA 3O14A 2J1AA 3BPZA 1J3PA 2X5IC 1C1FA 3KGZA 2GALA 3SEPA 4F83A 2ZGKA 5JLVA 1QJU2 5FYHA 3FMGA 1S0DA 5FMCA 4QKDA 2CSGA 1ZBE1 1W8NA 2VUAA 5KHJA 3AYDA 4LBLA 1OUXA 1UIKA 4EWAA 2JIGA 2AH2A 4JGYC 4OHXA 5A1LA 3WQBA 3K3NA 3G7DA 2FCVA 3Q8AA 1QJX1 3IDCB 1QXRA 1ZBE3 5LA9A 5D8AA 1JZ4A 3D8CA 3ZKUA 4P14A 2VZUA 2BERA 2RDQA 2GH2A 1NG0A 1QH7A 2RM21 1WCQA 5IWFA 2OPKA 3WF0A 1LOCA 1SPPA 1XXNA 2VXJA 2Q8EA 5I0RA 4WM7C 4OCTA 2F17A 1QJX3 4GA9A 4XURA 5EIYB 3OPZA 5F1RA 3H9AA 3WW2A 1AYM1 3I2KA 3RPQA 1MS0A 2YYOA 3RYPA 2RM23 2WN3A 1NA1C 5FTTC 2DU0A 5HV4A 4GH4A 4DXTA 1REFA 4HPKA 3EXUA 1CPNA 4R9DA 5IFTA 5DPNA 2HWF3 3LE0A 2JX9A 4IGPA 1AYM3 1VBE2 3AMHA 1S0IA 4QHZA 5EZWA 3GDBA 3IN9A 1WMDA 2E7AA 3TN91 3B93A 1XYOA 4KG0A 1OBNA 3DKQA 4ISQA 1W03A 2QZ3A 4QMAA 2K46A 4DY5A 3O7OA 1RC6A 2D6NA 1MS8A 2BGCA 1UY0A 1X8EA 4L97A 4TXWA 2HEYF 1EV12 2HWC1 1BXHA 3TN93 3FHAA 4BPZA 3RYRA 1ULDA 2QZ2A 1UAIA 4EROA 3AKPA 1KFXL 1PNGA 4XETA 4X6QB 5SV5A 2HWC3 4UW6A 1R092 3M3EA 3R4DB 3CJIC 2VE1A 1V6NA 4MO3M 4UFMA 2WDBA 4BLIA 4GULA 1VBB2 1T2XA 1Q8QA 1PK6C 1W6OB 2FQPA 3AMMA 1N1VA 2IFWA 3RVHA 3PHMA 4YFZA 5JPNB 1F8VA 1XQNA 2WQ8A 2R32A 4UAPA 4Q0SA 2FZ2A 1W06A 1IQAA 1JU4A 2O8OA 5DAWA 3HEIA 4YW3A 5LRRA 4UBHA 1ENXA 1WA4A 1SACA 2WQZC 3VKMA 1KS4A 1W8ZA 2CDOA 4BXFA 3ABZA 5I8SA 3GYDA 1IPSA 4GMP0 4BISA 3FC0A 4MGZE 4LBOA 1APNA 4CPBA 2VMCA 5LRSA 4PQ9A 4HETA 4LLFA 4OHYA 1UYZA 2GNTA 2CHHA 2WQ4A 4QAWA 1RUOA 1ND2B 1DYOA 2ZX4A 3AFKA 1DGWX 3NAPB 2XWJB 4CDWB 3U07A 5CFDB 5J96B 3RZGA 3MW3A 4URAA 1AL22 5I91A 4OHWA 5DG2A 5IHRA 3CU7A 1I3HA 3M3CA 5T54A 4LJHA 5F3CA 2VZPA 1CAXB 5A80A 2Y0IA 4OHZA 4Z2AA 5GZGA 2BDRA 2YMZA 3TWIA 2R062 1DLCA 4AAPA 1QKQA 3K4DA 3ILNA 3ZXGA 3ACFA 2W1QA 5F6KA 3PUIA 2OZ6A 5BY5A 1S55A 5FPZA 3POSA 4JRAA 1QXPA 4XDQA 4COVA 1OPOA 1ZZCA 5FOBB 2R041 2P3YA 2B7YA 5ERLA 3BOWA 1SQ4A 3ZVXA 3IWZA 4QHBA 1PO11 2D5HA 2Y33A 4LIUA 3H8UA 3HT2A 4QX0A 1LENA 4DPNA 4PF1A 2C6SA 4UF0A 2R043 4IL7A 3WDVA 2JJ6A 2BW8A 5FUPA 5FP9A 5C6CA 4Y1YA 3WF4A 1W6OA 4AFMA 1PO13 2NLRA 1OQ1A 4XFGA 2HWD1 4Z2WA 1QU0A 3U11A 1PGL1 3ZSKA 4EWDA 4AVVA 2PXJA 2P3KA 2VNRA 5DN2A 1OHFA 3LEGA 1OF4A 1GMMA 1NCRA 3AM2A 3GHNA 3BALA 3WDXA 2H0BA 3T30A 3NWKA 4L2NA 1PMHX 2W5FA 2WT2A 2JG9C 2Y6JA 5C4WB 3LSEA 2HWD3 3QCWA 3VKOA 4YM3A 3MIHA 5J09A 5FLIA 4FPGA 4XF1A 4ATEA 5JOZA 3MZHA 1LOAA 1UN1A 4HLTA 1VALA 1YYNA 5CEHA 1W6PA 1WW6A 1X33A 1ND2A 3HBKA 1SLLA 3SLIA 1B09A 1DHKB 4TLGA 2VMEA 3OYWB 1CD3G 1R64A 3MYXA 5FKCA 4E2QA 4XJAA 4Q4W1 4Y4RA 1JZ7A 2CDPA 4LITA 3ZFEB 3ZXKA 4IV3B 2PAKA 2JDPA 1UPIA 2B8MA 1O3SA 2VNGA 4NO4A 3WVJA 1UU6A 1SLTA 3MUY1 2WZR1 3B7MA 1ONAA 2W68A 2D6LX 2VMGA 4IEYA 2KA3A 2GC3A 4XJ8A 3HNYM 5HPOA 1EUTA 4A4AA 3Q8CA 3QLQA 2EAKA 4CCEA 3NJYA 1OLQA 2Y60A 3ZR6A 1HB2A 2QQPA 2WZR3 1UX7A 5LATA 2YPJA 1H1MA 4Q29A 2E9QA 4Y20B 1U5YA 2PTMA 1WD3A 2PHDA 3C7GA 1WCKA 1W2UA 5D1IA 3U14A 3WUDA 4RQPA 1BCXA 2CY6A 5IAVA 4LO8A 1EUUA 1YFWA 3U10A 1RUE1 2RDRA 3CZUA 4DINB 4F8AA 4TTGA 3VBSC 4YSFA 2NMOA 5F3GA 1UZWA 1ENRA 2ZMKA 3OGJA 1W05A 2IXLA 5L9VA 2XVLA 5FXXA 2XBO1 3LIHA 4U36A 5C4WA 4AI1A 4Q26A 5DDJ1 1RUE3 2BOIA 2G9GA 2WJSA 5DZEA 4N7IA 3RSJA 1XU2A 1XOYA 1K5JA 5FPXA 4Q0VA 1W8UA 3GBGA 3MUZ1 4UW4A 3ZYBA 4KBZA 5JXJA 2XBO3 2VGDA 3IM0A 5FJHA 5FPBA 4K20A 1HX6A 2RM22 1GZWB 5J7MA 5DDJ3 3C7HA 3D4KA 4LBJA 4N43C 3S57A 4N8MA 2DURA 3H42B 1UY1A 4LK7A 2XB6C 2HWF2 1QY4A 1I5ZA 4K21A 4DNYA 1QH6A 2HEVF 2J1EA 1AYM2 3KCXA 4INDA 4QM9A 4CDUC 3JCIA 4YFWA 2EXJA 3MIGA 1RINA 3JQXA 3RWNA 3WHUA 4DO0A 3W5MA 2WNVA 4K8FA 4M3CE 1YLLA 2WSUA 5JXIA 5A7PA 3J7MA 1UMHA 2Q0AA 3P1IA 3ASIA 3I59A 4LE4A 3DPRC 1Y4WA 4Y1XA 2J1RA 3I2GA 4XIKA 4IETA 3PTYA 1W8OA 4UOJA 2E26A 3BYWA 3VUOA 3OBZA 3TN92 1FT9A 2AZ5A 4AG4A 1W8FA 2PLV1 4NHMA 3I3DA 1RUJ2 2VZ3A 4IW3A 1OA3A 3ZFFB 4XVHA 4YGCA 1GFF2 4P9LA 2Q30A 4ARXA 1LGBA 4M01A 1UD1A 4OI0A 4NIIA 1DF0A 2YDEA 2WWUA 5F5QA 4HKOA 1FXZA 3E1F1 4H3WA 4A7KA 2PLV3 4MX3A 1SFPA 5FWEA 4NUBA 5FYUA 1VJ2A 4RD7A 4AYUA 3FE5A 3X29B 1PGSA 4P9JA 2D3RA 1FNYA 2Q1FA 4HFSA 1H1IA 4KNCA 1XNDA 5B4XA 4A6SA 2X05A 2I74A 2PQSA 4QXKA 1IG3A 1ZYBA 3ME2A 1ULCA 2VZOA 2QQMA 3WX5A 4CPBD 1YIFA 2ZKNA 1PO21 2QNKA 1S0GA 3I3EA 5HV0A 4G3YC 3J7LA 5JI9A 4QT6A 4YG6A 5A3NA 1PZ8A 5FFOC 4E4ZA 3NO8A 4MXWB 2V72A 3HAGA 3HN1A 4LKDA 4A44A 4ZXEA 2XG3A 1GZWA 3NSTA 1J84A 1CIYA 1LU2A 2UYAA 3NVCA 1PO23 2WO3A 4LBKA 3WP4A 1NE4A 3M4FA 4LULA 1WW4A 4MV2A 2VVEA 3SEEA 3PMSA 3PTRB 3SCHA 2BYVE 5F5IA 2XJQA 3TEWA 4XMIA 2GP5A 4LBQB 3UT0A 1VBD1 3RWKX 4B3NA 1QJEA 2BVVA 3HOBA 1AXZA 1V6KA 2DU1A 2E7QA 5AC91 4LKEA 4FTSA 4M4PA 1Y7BA 1ZRRA 3ZMOA 1NZIA 3LIGA 1QDOA 2X29A 1WMEA 1VBD3 5BNNB 5I0SA 2OT7A 1OC1A 1AXKA 1RUC2 3PVOA 2XHKA 1QQP1 4NRPA 1XRUA 4KMQA 1DFQA 5GZFA 1W90A 1Q56A 2RS11 4GAZA 4N53C 2WNUA 4ZS2A 5AC93 2ENRA 3ZYGA 3BTXA 2CWMA 5GLWA 5A7OA 1OSGA 3HQRA 3PDQA 5CKMA 4CEYB 4XZPA 5BNOA 5A6QA 2W95A 1QQP3 1WLDA 1UF2C 1ULEA 4QM8A 4BQ2A 4I2OA 2FDKA 2RS13 3O0WA 4LA2A 2JECA 2R042 3LA2A 5FZLA 4ZU7A 2ARCA 3P6BA 3KLSA 2DCJA 4AF9A 1WCSA 1PO12 3MLJA 3I8TA 1RUH1 4ZXKA 1Q8SA 3HMYA 4F7ZA 1KXGA 5A32A 1HJGA 1O4TA 4WBBA 4NHXA 5FZ0A 1SDDB 4RA0A 3H3ZA 3WOGA 1ZZ6A 3AXEA 3GCXA 3RZKA 2X5IB 4MGSA 2ORXA 3OD0A 3N9NA 3ACHA 4ZPIA 3PUHA 1RUH3 4XJWA 2IXKA 4TN7A 4MXWA 5L7OC 5EP9A 4YZ5A 3QBQA 2CGPA 1VP6A 3MGUA 1HLCA 1WD4A 4N7UA 4JGYB 1GZ9A 4GALA 2Q4SA 4QPIA 2YY1A 4XEZA 4CCLA 1VBC2 4HSLA 2V5YA 3UGGA 2RMU1 1IZ3A 3AP5A 1L7LA 4Q4X2 1GANA 1BEV2 1V6MA 1AJOA 2QE3A 4DXSA 3RMYA 5SV8A 3VZOA 5CISA 4FQ4A 5IJRA 4JDNA 3OSDA 4WM7B 1S0EA 2RMU3 2A3XA 1JXNA 2OPWA 2YUEA 4C0BA 4FSJA 5BNNA 4XDOA 4MUVA 1NA1B 1WBFA 5FZHA 4YZ4A 1GU3A 2AR6A 2LM3A 2O1QA 5AVAA 2VBDA 4XBNA 2WZR2 3POGA 2JKXA 4CEYA 4PBOA 3RG0A 2VJXA 4BU2A 4AZZA 4HMZA 1RUG2 1DYKA 3BI3A 3Q8FA 4FOQA 3C7FA 5CIRA 4Q8LA 2QQKA 1YJLA 3NV4A 5FXWA 2QQIA 1KGYA 1W2AX 2VL4A 3IAQA 4NAOA 1OH3A 4MADA 1D2SA 4YW6A 3VBRC 4LHNA 1W9FA 4WVVA 4OQ9A 3O1PA 1GZTA 3LA7A 5FO7B 4CXXA 1ZVFA 2ZGMA 1XNKA 4ORFA 1ZRIA 3EJKA 4PDWC 1RUE2 2XJSA 2AREA 5FXZA 4HZFA 4JC1A 1PIV1 2Y6HA 3OJBA 4EE2A 1HIXA 2ARBA 2VMFA 5JR7B 4JGYA 2XBO2 1PK6B 4XE9A 4L0PA 1JYVA 3VZLA 2EF6A 2YFZA 3B9CA 5DDJ2 4BZ4A 5IVYA 4CUCA 5GZEA 1H2NA 1FMD2 1PIV3 4Z8BA 4CEWC 4BIOA 5F8PA 2C5DA 3VD7A 5C71A 1UXXX 4L11A 1HV1A 4XXAA 4WM7A 3P5BA 1AJKA 1W6NA 2Y0OA 4NE9A 4AGVA 1S4CA 5FRAA 3MF6A 1C57A 3NKGA 2VULA 1BJQA 1JI6A 1COV1 4LO5B 2XJPA 4EN9B 5DMYA 3WNMA 1RVF1 1KJRA 4YRDA 4IV1A 1XJAA 4XABA 1U0AA 1E5IA 2BV4A 1D4M1 4H14A 4JDMA 4NMIA 3WDTA 4E9KA 5IK7A 1DDLA 2P3IA 1PX4A 2YROA 3ZFGA 4XJUA 3VKLA 1COV3 2WA4A 2D40A 2ZKLA 2FBEA 4YVWC 1RVF3 2ZMNA 4MHUA 2JIJA 1D4M3 4XQ4A 4DQAA 1N3QA 5CKNA 1AR82 1S2BA 3FHIB 5BNQA 2V4AA 1MPXA 3MIFA 4H7LA 4HT1T 3LGRA 4QQLA 2TUNA 4WVWA 5GLTA 4D6SA 3H7YA 5FYCA 1AHSA 2ZHLA 3ZN6A 4PF5A 2O0OA 4HSJA 4IEPA 4MH0E 2YG0A 4FBFA 3CJIA 3LEMA 2FDGA 2DF7A 2MEV1 5IK4A 1WMFA 3U4XA 1GWMA 3IIAA 1UCXA 3KV6A 1ODMA 1XNAA 4Z82A 5FZ8A 3J26N 1PO22 1HRV2 4XIOA 3O1TA 5EV7A 1JOBA 3RI8A 1S0JA 3ON7A 1UOJA 3IMNA 2MEV3 5FYSA 2RJKA 1GWKA 3KVBA 4QB1A 2IXHA 2BNMA 1AYN2 1YO8A 1IGOA 4PQQA 1O3QA 4GKYA 1J58A 4RGKA 5IATA 1JYNA 4CDQC 3MFCA 2VW1A 4I0BA 3ZOIA 1ND3C 2ZX3A 3AJYA 2QCSB 4FPHA 1GKBA 1QXJA 2WT0A 2ZA9A 2NPIA 1VBD2 2QDNA 5GALA 1RHI1 2ZCWA 4QB2A 2EAAA 3F2ZA 5AC92 4LBNA 3IAPA 4KH9A 3WCSA 3B00A 2XJUA 3IPVA 3O1MA 2EXIA 2E32A 3Q9OA 2JWPA 2VZTA 5C9AC 2DTYA 5LZ6A 1US2A 3FBYA 1E5HA 2OQ7A 3N4MA 1V6OA 2HYXA 2RS12 2ZEZA 2VUJA 1RUD1 1HRI2 2X53S 4DB5A 5JOYA 2P2KA 4CCJA 4A42A 3WDYA 1CESA 5LK5A 1UXZA 5JWPA 4FCAA 1GSLA 1UW8A 2W2IA 4W4ZA 3RJRA 4MLOA 5FXVA 2B39A 1OLMA 2VVFA 5JVVA 3ZIXA 1B35C 1MS4A 4QXCA 4LOSA 3VHNA 4BQWA 1SMVA 1RUH2 4YNIA 1OURA 1ZZBA 3CMGA 4I3GA 4NPRA 3TEZA 2LW8A 4K9SA 2I2SA 4UT5A 3ZXLA 1KJLA 4GWMA 1ASJ1 4MYEA 4QGNA 3RI9A 4LR4A 3VBSB 2NMNA 4HK8A 2R0HA 1EPZA 2WC2A 2BGPA 5LA1A 3K4AA 2EALA 2WZ8A 4CU7A 2PFWA 2JG9A 4IEZA 1GWLA 1ASJ3 3FJSA 5A33A 1XYPA 1DIWA 1K5MA 1C8M2 1RYYA 2K2SA 3W21A 2OA2A 2RMU2 4BDVB 1YXWA 2W47A 2WO2A 2UWBA 3WP6A 2E53A 2ZGUA 3OEBA 2WKKA 1W6MA 2WS92 3OCPA 5C70A 1JODA 1PMJX 4N43B 4CXWA 3AMQA 1H9PA 4AFDA 2ZAAA 1DQ6A 4JGZA 1JYXA 4LMFA 4AHZA 4A7ZA 2F4PA 3TB0A 3VGIA 5KHHA 4CDUB 5HBAA 4CP2A 4S2DA 1VRH2 2SBAA 1UZYA 3USUA 3Q8BA 4IGQA 1CVNA 2PAMA 4BMEA 4YARA 1G9AA 1IOAA 1O3TA 3DPRB 1C1LA 4J25A 1H6XA 3T09A 4EQVA 1UYYA 3AVSA 1OA4A 4OI4A 4CCOA 1G9FA 4E4DX 3OUIA 2JDAA 4E27A 5K8SA 2TEPA 5IK8A 3BTZA 5FKBA 4Y22B 2WSVA 2H6BA 3T2PA 5FZOB 3ZKYA 4DEQA 5FZ9A 1J59A 1UIJA 2WIIB 3AKQA 5FZEA 3U1XA 1V6IA 4LORA 5KC6A 3U0ZA 4B7KA 1NKGA 1UL9A 3HNMA 3KWVA 1GLHA 2GN7A 4KWJA 5FP8A 3RJ2X 3SH5A 3VBHA 1IPJA 4YZ1A 3PL0A 1NXMA 5EQUA 2VMIA 3O5SA 4JQTA 3VBSA 4IE4A 1F35A 3N36A 3V64A 3VDBA 1DZQA 3OY8B 2DFCA 3WP5A 3RQ0A 4R52A 5EWSA 5CU1A 5JPMB 2IXJA 2Y6GA 3N9MA 5FMBA 1I6XA 3ELNA 3SC7X 1NAEA 4CZSA 3WG2A 2VO5A 4E8CA 5FUIA 4V1PA 4Y5SA 4PT6A 2VQAA 4AEJA 4EV0A 2AEZA 3QH7A 1O91A 2LUWA 4AEKA 5EXOA 1Q5OA 5J1XA 3D3AA 4A2UA 2VM9A 1UZZA 2LTNA 4CDUA 3OPTA 3W9AA 4BM8A 2E51A 4MZUA 3TBDA 4YZ2A 5J3UA 2DCZA 3BTYA 4NIDA 4NWVA 3WHTA 1COV2 2C1FA 3OGRA 4QX8A 2NM1A 4QKBA 4AVTA 2QDRA 1W9SA 3FUQA 4FOVA 4QPGC 4QGLA 4PLNA 1ZZ9A 5IYYA 3ALQA 2VZRA 3AZVA 2D6OX 5A1AA 4LHLA 1ODNA 3VHOA 5C8CC 4C8DA 1LOGA 3U4SA 4J6GA 4JDOA 3WNXA 1LOEA 4QQOA 4N53B 4SBVA 3HIFA 3WNPA 4IGOA 4Y26A 2C4XA 3PIJA 3O1SA 3TEYA 4RS5C 2AGSA 4R4ZA 5K9YA 3ZXDA 1PZ7A 3J9SA 1OD5A 2R49A 2WO1A 4ASLA 4CU9A 2FD8A 2Y8KA 1AR72 3ACGA 3PU3A 5JMCA 4HN1A 4K3UA 4BE3A 1ZRFA 4FPKA 5F5AA 2KR2A 1MQTC 2A6VA 3ZN5A 3M3IA 4FTEA 1CQ9A 2QQWA 4OUMA 3MIEA 5EFUA 1JOPA 5FP3A 3A7QA 4FFFA 1S0FA 4LUMA 4PIZA 3VDDC 2RE9A 2GU9A 2MEV2 4PJYA 3CHXA 5FMDA 2DUQA 1KFUL 1LNSA 3NJZA 3WNOA 2V5DA 2EXKA 3MPBA 4GB31 3LDBA 1KDMA 2RS52 3Q8EA 4GWNA 4A3ZA 4JX0A 4E2GA 4NVPA 5L7OB 2GMEA 5ABJC 2ZOEB 1BBT1 2ZGTA 2IVIB 2YC2A 3VZJA 5FOJB 3PIGA 2ZX0A 4QXHA 2GNDA 5C3PA 4GB33 1R082 4XFAA 3ZPOA 1LHNA 4X8NA 4OZXA 1BMV2 2AACA 4P08A 2ZGRA 2XLGA 1A8MA 1BBT3 2D98A 2VTXA 3S30A 1S1AA 2PHFA 3NNFA 1Y9MA 4J1XA 1CR7A 4UFLA 2ZZJA 4X8PA 1A34A 4K6BA 4ASKA 4OI2A 2ZZQA 1X50A 4D3WA 1H2MA 3SMHA 1GP6A 2XJVA 1LHWA 1TEIA 1ZX5A 4URTA 4JV4A 1ENSA 2BFUL 4YLZA 2DCTA 2D6PA 4XC9A 4Y24A 3LPFA 1IG0A 3E5UA 4NAMA 1YJKA 5ANNA 4FPFA 3WSOA 3USSA 2DCKA 2WA3A 2W91A 3BN6A 2VG9A 5J48A 4ZU5A 3VBOC 2AENA 1WWYA 2PA7A 2ZEWA 2K9ZA 5JIAA 3POWA 5FUNA 2HWE1 1US3A 1QOOA 3A0KA 3VBRB 5F5CA 3ZPYA 1XYNA 3RZZA 4CP9B 4FPYA 2IVJA 4LEJA 1W9WA 4CU8A 2KM2A 1HN0A 1RXGA 4EZ4A 4G9SB 3VL9A 2WFF1 4IE7A 4PDWB 1ASJ2 1ZBA2 2D6KA 2HWE3 5FZBA 3SXWA 1SDWA 4YW5A 5A3TA 2OUHA 3M7AA 5FWJA 3WXPA 2BP6A 3JBG1 4Q1RA 1FX5A 2NP0A 3BUCA 4LO6B 2WFF3 5CA6A 4FO9A 3VHPA 4KQ7A 4W8JA 4COZA 1W39A 2JDZA 3DYMA 3PLQA 1DGLA 4AI8A 3WLUA 2RR11 1HXS1 4CEWB 2QFEA 3WV6A 5KR7A 4NRQA 4BXSV 3JBG3 3I49A 1VLNA 2UY9A 4IEWA 5KXEA 2HWB2 5LA0A 5EHDA 4RR3C 4O65A 1PM7A 2FZ1A 1LOFC 1XE8A 2JDUA 2FCUA 3BPSA 1CN1A 3NAPA 4CDWA 3TEXA 5CFDA 5FK8A 2GP3A 4YGDA 5FYZA 3URFA 2RR13 3TNPB 4LK6A 5IVVA 3LDKA 4OZOA 5E89A 3C3VA 1RUF1 1RJ8A 5HI0A 1H8VA 2A3WA 3S5QA 2P37A 3SKJE 3NMBA 1CAXA 4YVSC 4B4RA 4HBNA 3E97A 5LWBA 4NIAA 1NY71 4WZFA 1BVVA 1LESA 4RHV1 3ZSLA 4Q4W3 2OX0A 2G9FA 1RUF3 4YVWB 5FO8B 4GQ7A 5LEKA 4NIGA 4QQHA 3W59A 4BQ4A 3I2HA 2DBIA 5AFEA 4IE0A 4NJ4A 3B01A 4RHV3 3HR9A 2PAEA 3T2QA 1G9CA 4NPLA 1N1SA 1ST8A 4MOAA 2ZMLA 3O1OA 2X09A 2J1SA 5IUQA 2HEWF 4P5HA 4ZKTB 1TQ5A 4QWNA 4SLIA 5IVCA 1AR61 2R071 2VCCA 2NN8A 3AXDA 4XMAA 3B69A 4Y4YA 3KS7A 2CL2A 5IVFA 3H1YA 2JEMA 2VY0A 5F39A 3PVNA 4MXVA 4XFFA 5A7WB 3PVBB 3MF9A 2GMPA 1ZBE2 3MO4A 1I5PA 4AI3A 1X9PA 4L99A 4XOGA 4CVUA 1IS6A 4AFAA 5AFBA 1V70A 1XB9A 4PI0A 3M70A 2R073 4TWTA 3TNQA 4BYYA 1WW5A 2XXZA 1JZ2A 1OLRA 2VOTA 2GC2A 4CEWA 4D7YA 1RL3A 5KC5A 5CYYA 2ILMA 2PQQA 4I0AA 1QJX2 2ZACA 2ZGPA 3BOPA 1BVP1 5T5OA 1A8DA 2GNBA 3C2UA 3J7HA 3N7MA 3QOPA 4FXGB 4XFIA 3ZSEA 4CUBA 4HOOA 3OUJA 3OYWA 4M0NA 4CDQB 3ZN4A 4JZRA 1ND3B 1YUDA 2GZWA 2J1UA 3LSDA 3ZFEA 3AJZA 4IV3A 5HCFA 3VDAA 1QDCA 2BFUS 1MR5A 5FBJA 1QJFA 3CLPA 3K46A 2D6MA 4PHZA 3EHKA 3ETPA 1GP5A 4WVZA 1NLSA 1U12A 3GM8A 4QPIB 2BGOA 1JBCA 5A7QA 2IXCA 1HQWA 2RVAA 1CGPA 2XLFA 5C9AB 5E8AA 2VD7A 3WW3A 2BRTA 4BOWA 2JE9A 4IEUA 2NYYA 3L2YA 4JCKA 3CF6E 5FZ4A 4JRLA 3UKTA 2YPDA 3DYOA 3ZDVA 1M06G 4LT5A 5G04L 1EAH1 4CCMA 4ES8A 4AVCA 2O8QA 4KL1A 4Y20A 4YG0A 2XVGA 3CIHA 5DAPA 3KT7A 2IFRA 3TRSB 3WD5A 3WNLA 3BVCA 2HWC2 1RJ7A 4NROA 4YM0A 4W6YA 2ET1A 1EAH3 2DVGA 1HB1A 1D2QA 3I2JA 4IEOA 1B35B 4GH4C 3GZTB 2BUKA 3AZZA 4Q0UA 4TSVA 5FYVA 1VAMA 2LROA 2WYSA 5GKAC 5A3LA 5ACA1 2DVDA 4EN8B 4BQYA 3BIEA 4I09A 2YB7A 1AF9A 4XJ9A 2W1SA 4YM1A 2EIBA 3POJA 1JYTA 4D6RA 3M1HA 3KSCA 2D3PA 5ACA3 3O12A 2JE7A 2OQ6A 5I0DA 4IESA 1SFYA 4EZHA 2GAUA 1FPN1 5F32A 4OQ8A 1SLIA 2BBVA 3K75B 2IZWA 4QKNA 1UMZA 3AFGA 1A3KA 2RV9A 1LU1A 4GKXA 3IIIA 5FV3A 5IVBA 1VMFA 2YHJA 4QD2A 1ND3A 1F4AA 1FPN3 1UY3A 3E6DA 3ILRA 4XCAA 2WAAA 4RFRB 5EYYA 4XUNA 5A3MA 1VRBA 1UWWA 3AKSA 2OVUA 3GNEA 5HXMA 2E33A 1GQHA 3I2DA 3IMMA 4B4PA 4CU6A 4Q4V1 1AXYA 2KXLA 3AZXA 1LAJA 4AHXA 1BKZA 1YQCA 4AVSA 2IC1A 4DS0A 3O1VA 4LXLA 3VKFC 1R1A1 5GZDA 1QIQA 3JUUA 1OF3A 1YQ8A 4CSWA 3B9IA 4UFHA 4XW3A 3RZLA 1W9YA 2VOVA 1QHDA 3A0NA 4LTAA 4Q4V3 4TYSA 5E6HA 3ZFFA 3E6BA 2VZVA 3GBFA 4OI1A 1FV2A 5JDBA 1R1A3 4B1MA 2XPJA 1JS9A 3UETA 1FNZA 4GXLA 3I3BA 1PMIA 3KHBA 4LUKA 4WM8C 2QKDA 5JOWA 4XJZA 3NJXA 2R1DA 1L7QA 2P6HA 2ZTNA 3H8OA 2OW4A 2XUEA 3VBFC 4E4HA 4FAGA 1UX6A 3FL7A 1VBA1 1BYHA 2E6VA 1POV1 2V09A 4UI9L 4DUVA 2KD7A 1J1TA 1ULPA 2WFF2 2DUPA 5A3PA 4JQRA 4Q8KA 2Y26A 1G7YA 4QPWA 1OH4A 2A71A 2WUHA 4MGKE 5KXDA 1NYWA 2HWD2 2P17A 5GLVA 4YW2A 1VBA3 1GNHA 1LEMA 1X36A 2R1BA 3INAA 4K1YA 2GMMA 3N7KA 1POV3 1S0BA 5KHIA 1XU1A 2W0XA 1WKYA 3D5OA 1NCQC 1V6JA 4YPJA 2WINB 5LB6A 1RITA 5C5TA 3BKZA 2BWAA 1WW7A 1DZRA 2RR12 4GJZA 2W39A 1OKQA 1MS5A 2ADEA 4IERA 4LBQA 4W6WA 1PVC1 4DFSA 2VTFA 2ZS6B 4Y5Z0 3LB9A 4DUXA 4N9IA 3VZMA 3ZSMA 1G86A 1W6QB 5FDBA 1W04A 4Q5OA 4YW1A 3WR0A 1JN2P 4XF4A 4BHPA 4BK5A 4F3JA 4QHOA 4FOWA 1DQ4A 1OT5A 4Q4W2 3WDWA 3DXTA 1PVC3 3PUSA 5JXGA 4OFGA 1YI9A 1KEXA 4Y1ZA 2O14A 4FOYA 1T6BX 4W50A 1NOVA 1LECA 1IS4A 4QPGB 4XF3A 5JCTA 5F3IA 1NCRC 1YQ2A 4QX3A 1NY72 1TME1 5C8CB 2WNOA 5A3WA 3NQHA 1J3RA 3WUCA 4RHV2 1MS9A 4CYDA 4YGBA 1TMF1 2R7EB 2DBNA 4IUGA 2JG8B 3MIDA 4C1XA 3O1UA 5JZGC 4AGGA 1O4YA 4DXRA 5BNPC 1TME3 1ZZ7A 2D97A 4RS5B 5DZFA 1E5SA 1MZFA 1RUI1 5I93A 2Z69A 4DIQA 1TMF3 4HXCA 5T5JA 3ZX7A 2B42B 4FPEA 4JTNA 5FREA 2H0VA 3WZ1A 3OD4A 5C3SA 3LQCA 4XAAA 2Z42A 4BQ1A 3TOJA 1VB4A 2X5IA 3THDA 1MQTB 1RUI3 2YC0A 3HBZA 4QQPA 4QX7A 2XHNA 3UESA 1YI7A 3FWEA 2OYZA 1Y3TA 3DEMA 3VDDB 3J7NA 1AZDA 2ZGNA 4ZZ5A 2QVSB 3NL1A 5CNAA 5FYTA 1VMHA 2YGMA 1UKGA 3W20A 5EJ3A 1VAKA 1CIWA 1JHJA 3MW2A 4MHRA 4CRQA 2VAUA 4RFT0 5T50A 5ABJB 3KHCA 1Z0HA 2XQXA 4XCBA 2Q1MA 4FPOB 1F5FA 5FY0A 4A3XA 2W92A 1MS1A 4UFKA 3RGBA 1W6QA 2W87A 4RQPC 5EJ1B 4UW5A 4JKKA 5IFPA 1PX3A 2G1MA 3PVEA 5T55A 1QJU1 1GNYA 3PU8A 1E57A 4AQ6A 2JD9A 4AR2A 3J8F1 1NA1A 3HD8B 2VMDA 1BK1A 2G9ZA 2JDHA 5L9BA 1YFYA 3RZJA 1GNZA 4QPGA 1ZREA 2A6WA 4FFHA 3BGAA 3LD8A 2JENA 3HN3A 1DGWA 5FO9B 2VUDA 2ZGSA 1QJU3 4CCDA 3PJYA 3NNMA 1CAUB 2JB8A 3J8F3 1POV0 3VV1A 4UW3A 4B29A 1W28A 4HL0A 1FV3A 3ENRA 3GALA 4FP3A 4WVMB 1PVXA 1MVEA 3OBAA 5EPAA 4OULA 4RS5A 4CCNA 1JZ3A 2WYFA 1EAH2 2PLV2 3I2IA 4LA3A 5FY5A 2ZBJA 5JSPA 1Y9QA 3A4UA 4XZUG 4BQXA 3N9PA 5TSWA 5LBFA 1YNAA 3FLPA 5F7UA 5JSOA 5L19A 3BU0A 2FDFA 4GWJA 4NWWA 1OLME 3VBOB 3K3OA 1IKQA 2PHRA 1V9U1 5I8TA 3MW4A 1MQTA 4YZ3A 4R9BA 2WNVC 1UYPA 5C5UA 5CAZA 2VOXA 3VDDA 3HQUA 4XUTA 1O6UA 4AL9A 1OA2A 1AX2A 4LE3A 1V9U3 1PK6A
chains in the Genus database with same CATH topology
3E5QA 3IT8A 2AUYA 4Y1VA 2BPA2 2IXIA 4WV8A 1DGRA 1G8WA 1QF3A 3BIWE 4K40A 4N90A 4YM2A 3J4UH 3L9JT 1PGW1 1EV11 3WQ0A 2OIIA 3O0VA 4JTOA 3VBUB 4AI0A 3LWCA 4U2AA 4R9CA 4XQWA 3K48A 5FQ0B 1X7NA 4HVOA 3MIBA 1EV13 4RR3B 1H2KA 2W52A 5BUVA 1ZZ8A 3ECQA 3AKTA 4NHLA 1VBB1 4L9BA 3BODA 3MEPA 3R4SA 3M2MA 5KXBA 1UU4A 5LEJA 1WUVA 3UKVA 4WVMA 4YVSB 1J1LA 1VBB3 1JW6A 1RHI3 1QQP2 4ISRA 1YCIA 1S2KA 1NLRA 4AVBA 4A7YA 1X82A 1Z78A 1O5LA 3VBOA 1DG6A 4C91A 3FLRA 1C5IA 4L92A 1ZNPA 1OOPB 1RUD3 2BNNA 3DKWA 2GDFA 3HT1A 1AL21 1MVQA 1FI2A 1RUNA 1C3HA 4W6XA 2ZGLA 4AE2A 1VBA2 2ZPXA 5JAXA 4KWKA 4ITCA 1D0HA 1N47A 5L36A 3KCCA 2R061 4LBQD 4XPVA 2RS31 2PHUA 3OBRA 4AEDC 3B3QE 5BPXA 2WNUC 4LLOA 5T5LA 3WP3A 3M3OA 5BNOC 2RJLA 3AKRA 1AL0G 5FLHA 2R063 1H9WA 3UV9A 2RS33 2JD4A 1NQDA 1REEA 1QJY1 3HWJA 1L3JA 1OQDA 1YRZA 2A6XA 3CO2A 4Z1VA 4NR1A 3S7EA 1KS5A 1PVC2 5JSRA 4AW7A 5E1RA 3UJQA 1QJY3 3AMNA 5GZCA 3ZXFA 1QJZA 2Z2SB 2UU8A 4KGQA 5I8YA 5KBFA 1IKPA 4XHBA 1IS3A 2VNOA 2GC0A 3THTA 5KXCA 2UWCA 1G9DA 3AYCA 2VW0A 5KWRA 4I01A 4OVEA 1LULA 3UK9A 1H0BA 4XTMA 4QPIC 5C8WA 1AR91 1FOD1 1TMF2 5D8AB 3T2TA 2FZ2A 4C0HA 1MZ5A 1D4VB 3H50A 3N3HA 2VXRA 4MGIE 2A75A 1A78A 5JI7A 1RUI2 4PIYA 1DQ1A 1AR93 1FOD3 1YHFA 2ARXA 2UY8A 2YGLA 3B02A 1DU3D 4RGAA 2VH9A 4GH4B 4META 4HPKB 5F6LB 5CBLA 3S0MA 4DRRA 3KMHA 1MS3A 1DBNA 1PHMA 1PIV2 2B46X 2EA7A 4XXPA 1UU5A 3TAYA 1LHVA 2PN5A 3T1LA 2I07B 2HJIA 1KITA 1HDKA 3APBA 4CTEA 5K0UC 2VECA 5FLJA 1OPMA 4QX5A 4N43A 1F31A 2HYKA 2PHWA 4Q4Y1 1SBFA 1ZM1A 4CP0A 1WLWA 4AWDA 3AYEA 2Q5TA 4IEXA 2B5HA 2FMYA 3J8F2 3WW4A 4COWA 1RVF2 3FLTA 3VZNA 5C33A 2JXAA 1LKNA 4Q4Y3 1CPMA 1D4M2 3DPRA 5DZGA 2A70A 3GZUC 3H3UA 3KB5A 1IPKA 3ZMNA 4XQDA 2BVBA 1CAVB 2A6YA 1O3RA 1LODA 4FPJA 2JG8C 3EQEA 5DG1A 1H8TC 4Y22A 2HWF1 1VR3A 1LRHA 4C1WA 4WM8B 1LGNA 1JYIA 2F6BA 1V9U2 1KD7A 3RS6A 4EN6B 3SH4A 2DVBA 2C0ZA 2CGOA 4IV1C 5GLZA 1H2LA 3VBFB 1LGCA 3DUIA 3OY8A 5HXVA 3ZFGC 1D0GA 3LAGA 3SITA 4D7TA 2XH6A 3MPPG 1SLBA 1RUJ1 2E63A 3KT1A 4R9AA 5DUVA 2K0GA 1PGW2 5KHGA 3PNAA 1NCQB 1U5IA 1GR3A 5FMOL 1Q8VA 2OUJA 2DVFA 1RUJ3 4YYOA 3AZWA 4Q2FA 4YG3A 3ZYIB 1ALYA 3ZDSA 3I7DA 3MDPA 5DUXA 4Y1UA 3AP6A 1EPWA 1F9KA 1F2NA 2Y38A 4LO4B 3BB6A 2WZPP 2DCYA 1RHI2 2DYCA 4L8QA 2CYFA 2PHXA 3CNAA 1ZRDA 2JKBA 4X6RB 4IQPA 1CAVA 1GYKA 1M4WA 3FX3A 1KQRA 2ZX1A 4N53A 5HCBA 1NCRB 2GH8A 5J98B 4ATFA 3R6SA 1RUD2 4KGGA 5CFCC 3ES1A 1IHMA 4WM8A 5JZGB 2DV9A 4DOUA 5BNPB 4BLJA 3AZYA 4FVVA 1W6PB 3NV1A 1SLCA 4M3CF 3FUOA 1HV0A 3VBFA 4NHKA 1TE1B 4PLOA 4OHVA 4HN0A 4QGMA 1RUC1 2PHLA 1T6GC 1RIRA 3JB8A 2RS32 5L7OA 5JIUA 1GBGA 1X8MA 1RUC3 1NCQA 1C28A 4QU2A 3OF1A 3H0OA 3VBUC 1MEC1 4D94A 1N3OA 5DXDA 1OMIA 1QJY2 3L2HA 3D0JA 4COUA 4TLFA 2X8KA 1TNFA 4RQPB 1QNYA 1MEC3 2CAUA 4O9GA 3QACA 4MSVA 5J37A 3V56A 1HXS3 4MGYE 4P9GA 1YWKA 1CX4A 2A7AA 4JAAA 3WINE 3G6JB 4EN0A 3UL2A 2WFPA 2A6ZA 3ST7A 1QWRA 3OGGA 3ZSJA 3R4UA 1VBC1 1BZWA 1K5MC 4I30A 4Q4X1 1BEV1 5JZGA 3MICA 1AR92 1FOD2 5EYXA 4BWOA 2ES3A 5BNPA 4R8HA 2XLAA 1VBC3 4PCRA 4H7MA 3VKNA 2A3YA 1FYUA 1U5ZA 3AYAA 4NOTA 3JB4C 4Q4X3 1BEV3 1OOPC 1ULFA 3IDEA 5H9RA 3VBRA 4G4FA 4JGZC 1DQ0A 4P9IA 1PGL2 4MVTA 1O4ZA 4UXAA 3VZKA 4N9HA 3WW1A 4CDXC 1LTEA 2R30A 5FAXA 2WLQA 5IT6A 2ZGQA 4PDWA 2WNVB 2EIGA 2H6CA 1JTZX 2VU9A 2GSYA 4QPYA 3EO6A 3JD71 4HANA 3I59B 4D7SA 2D7FA 4LHKA 4AXOA 1PZ9A 1RUG1 5DUWA 4AHYA 3ZYJB 1H4GA 5FMOS 1LOBA 3LA3A 1AR63 3ZYRA 4ONUA 1C4RA 2VOKA 1WLTA 3DGTA 3MFAA 5BV6A 1O5UA 3JD73 2ZABA 3ROUA 1RUG3 2YZ4A 4HVRA 1JYCA 2GN3A 3AP4A 4AQTA 2JICA 2XL7A 3VBHC 1XNBA 4GIQA 4Q4Y2 4AGRA 2NZ9A 4RGGA 1BQPA 2MHFA 2EVXA 2DTWA 5I0UA 1ZRCA 2UURA 3KD4A 4B7EA 5CB7A 1GQGA 3LKJA 1RB8G 1FMD1 2P34A 4XILA 4YVWA 3N35A 4IXLA 4PIXA 5D8AC 2VOWA 1YFUA 3S6PA 4FP2A 2XJRA 3H1WA 1FMD3 1DLLA 1VAVA 2VVDA 1MZ6A 4I02A 2ZHMA 4JVAA 5FCCA 3SCGA 3OBTA 3N7LA 1QOSA 4AEMA 1N1TA 1UKRA 5FBZA 4BMBA 2D3SA 4DXZA 4FXKB 4HVQA 1ENQA 1EY2A 2SLIA 4PLMA 3LOBA 2BNOA 1OQEA 5JOXA 3TYJA 3MLKA 1URXA 3AP9A 4Q1PA 1W0PA 4XBQA 1TNRA 4M3CB 2DFBA 4Q0PA 1HKDA 4B4QA 5CADA 1AR81 3FFQA 4HKLA 3BTAA 5GLUA 2WNUB 4AEDB 2C9AA 4C90A 1DYPA 4GB32 1ULGA 2CNAA 1WLCA 5BNOB 5CVRA 1UPSA 1BBT2 4RL7A 4FAHA 1AR83 5CG9A 4DRVA 4CDQA 2ET7A 2AYHA 4Q27A 3RDIA 4OUSA 2Z79A 5T3NA 5A32B 2PELA 5J36A 1Z7S1 3NKTA 1HRV1 4DZGA 4S2FA 3DV8A 1CJDA 2CAVA 1QMJA 4XFHA 5C9AA 1RTVA 1WGPA 3EBRA 1Z7S3 3N7JA 3RMXA 1IS5A 2GC1A 1LJ7A 1AYN1 1AX1A 1HRV3 1Q3EA 1DQ5A 1ZA4A 1VIWB 4QPIB 3OTFA 4XBLA 2R6QA 4AI2A 2CGNA 2XUMA 4QQ2A 4ASMB 3DF0A 4IEVA 1HW5A 2GNMA 1AYN3 2XGXA 1FATA 1B35A 3VHRA 2VW2A 1NE6A 3CL1A 3ETQA 3IDBB 2HWE2 4S2HA 4M3CA 3RNSA 3PMEA 1SCSA 5K7PA 1GZCA 1Q8OA 2ZHKA 2VMHA 4AEDA 1OFSA 1HRI1 1KDKA 2NQYA 4RSUA 3LZZA 2Q1ZB 3JBG2 4FT8A 4AK3A 1VB2A 3QH6A 1CAWB 1YIPA 1HRI3 4ES9A 3GF6A 3WT3A 2FMDA 1MEC2 3NW4A 1CONA 4AVAA 2YXSA 1YFXA 1HXS2 2XJTA 1I1EA 5K0UB 3GZAA 1RMU1 1Q8PA 3M8LA 3MI8A 2UYBA 1SCRA 2YV8A 3POYA 4J1WA 4KU8A 3H7JA 3V0BB 3M3QA 1RUF2 1RMU3 1QGLA 3ATGA 2PYTA 1C8M1 1V6LA 1OI6A 4WZCA 3UJOA 1N1YA 1RGSA 3VLBB 3AK0A 2WS91 1AX0A 1NQJA 4KG8A 4AHWA 1C8NA 3FZ3A 3KZ4C 1H8TB 1C8M3 2XKOA 2MPFA 3GHMA 1W6NB 1OFNA 3PJQA 1FAYA 3KM5A 1EP0A 4HK9A 4NN0A 5GJ6A 1R1ZA 1ND2C 1XE7A 3ILFA 3NAPC 4FPCA 4CDWC 5CFDC 2BEOA 1A6CA 2WS93 2TBVA 2MNGA 1HQNA 3D6EA 2DWRA 1VRH1 4HKWA 4YW4A 1QNWA 4AQSA 2ATFA 3WG1A 4IV1B 5BYNA 1LR5A 4BA6A 1AR62 2R072 3JD72 1W0OA 3ZFGB 4EWEA 1SFNA 1VRH3 2IWGB 1NXD1 4BCUA 1CAWA 2ZJCA 3CJXA 3ZYPA 1DGRN 5K0UA 2R16A 2A5ZA 3MLLA 3ZIWA 4K1ZA 2ETEA 3ZN6B 1DZTA 2I45A 4I0WB 3V65A 1CJPA 4PBPA 4BH9A 3FBMA 3V0BA 3CJIB 3WG3A 3RRDA 1NZCA 2R0FA 2DVAA 5H9QA 1PNFA 1SEFA 5C8CA 5DUUA 3THPA 4XFBA 5C4WC 4DMIA 3IBMA 4K7JA 2JG8A 1JUHA 3E5XA 3P3NA 4Q0QA 3HQXA 2XL9A 1H8TA 5L73A 4AFBA 4OLLA 3H1MA 3W58A 4E2SA 5CFCB 3BCWA 3ZO0B 3O0XA 4AFCA 4KU7A 3V0AB 3ZFEC 4IV3C 3AB0A 3P3PA 2V73A 2WL1A 5F9TA 2Z5WA 3GBWA 3SH3A 1VBE1 2ZAHA 3LOIA 5T52A 3S7IA 1U5XA 5ACA2 3IPVB 1H30A 3WDUA 3SHRA 3IKWA 3T1MA 1SLAA 1VBE3 5ABJA 4XF9A 5E88A 3RYKA 5BXXA 4KWLA 4H55A 4LO7A 2W08A 1FPN2 4AQ2A 2LALA 1AR71 5B2GB 5H9SA 1WBLA 2QJVA 3NV3A 2XKPA 3JQWA 4M0HA 2QUOA 4XFCA 5I0TA 2ZHNA 3AP7A 3KQRA 1R091 2E7TA 4S2GA 1AR73 3NV2A 1Z7S2 3QD6A 3I4IA 2RS51 1QOTA 2D43A 1LCLA 3E6CC 1CAUA 2CV6A 2WWSA 4Q4V2 1R093 4O9EA 1LB2A 1XNCA 2CWSA 2JG9B 1R1A2 2D93A 2WT1A 3AMPA 2RS53 5A33B 4XF0A 1R081 1K5MB 4LNVA 2WNEA 1BMV1 5CFCA 3B94A 1JUIA 4FQZA 3V0AA 4LBMA 3DN7A 4EJRA 3WQ7A 3K51A 1W6MB 2FHRA 1WCDJ 3ACLA 5T5PA 1R083 3CEWA 1H4HA 1LHUA 1JH5A 3FFZA 3D82A 4JGZB 3ZXJA 2A73B 4P9XA 3B5LB 3WY6A 4CDXB 4FTBA 1LHOA 2BTVC 1REDA 4KBBA 3BU7A 5AVPA 3I54A 3AX4A 4Z07A 3USUB 2WLPA 4YGEA 2XVKA 4XHXA 1AL23 2VPVA 3R05A 5GM0A 4XYXA 1HQLA 2DUOA 3ZFFC 2ERFA 3VBUA 2D5FA 2OZJA 3WCRA 1G6NA 5FQ0A 1J3QA 1Q43A 5E16A 4R4XA 3D0SA 4TZDA 4RR3A 1SBEA 4IEQA 1LOFA 3KGLA 3UKNA 2UWAA 1RMU2 3VN4A 3VBHB 1ZBA1 2ZX2A 4I3PA 3DL3A 3KT4A 4E4SA 3VL8A 1V00A 3KCYA 4YVSA 3WQ1A 1ZBA3 1SBDA 2VQ0A 1O7FA 2RHPA 4W65A 1TME2 5LK7B 2D44A 3ZXAC 1GICA 2B9UA 4EN7B 2G4IA 2HWB1 2EXHA 4D69A 1EYBA 1I9RA 2TNFA 1MZEA 3ES4A 1AUYA 1OOPA 1C5HA 4XTPA 1F5JA 3JZVA 2ZGOA 4P9WA 1S0CA 4ZU4A 1G9BA 1KRIA 4BIFA 4UBGA 4B8EA 2HWB3 1LEDA 4CDXA 2BWCA 3ZXEA 2CTVA 2HKXA 3SNMA 5HCAA 4M00A 5BNNC 1Y43B 1GV9A 1H1AA 3LCPA 5KHKA 1MACA 2B45X 2P3JA 5IK5A 5CG8A 5H9PA 1JOJA 2XWBB 3R0RA 4CEYC 4GMP1 2BQPA 4FPLA 4CP1A 3WG4A 2PHTA 1AVBA 1N3PA 1DQ2A 4DY3A 4GMP3 4Z92B 4P9YA 3JU9A 3SCFA 1JHNA 2Q8OA 4COYA 2N7GA 3SISA 3O14A 3BPZA 1J3PA 2X5IC 1C1FA 3KGZA 2GALA 4F83A 5JLVA 2ZGKA 1QJU2 3FMGA 1S0DA 1ZBE1 2VUAA 5KHJA 3AYDA 4LBLA 1UIKA 4EWAA 2AH2A 4JGYC 4OHXA 3G7DA 1QJX1 3IDCB 1QXRA 1ZBE3 5D8AA 3D8CA 4P14A 2GH2A 1NG0A 1QH7A 2RM21 2OPKA 1LOCA 1XXNA 5I0RA 4WM7C 1QJX3 4GA9A 5F1RA 3OPZA 3H9AA 3WW2A 1AYM1 3RPQA 1MS0A 2YYOA 3RYPA 2RM23 1NA1C 5FTTC 2DU0A 4GH4A 1REFA 4HPKA 3EXUA 1CPNA 4R9DA 2HWF3 2JX9A 1AYM3 1VBE2 3AMHA 1S0IA 5EZWA 3IN9A 1WMDA 2E7AA 3TN91 3B93A 1XYOA 4KG0A 4ISQA 2QZ3A 4QMAA 4DY5A 3O7OA 1RC6A 2D6NA 1MS8A 2BGCA 4L97A 1X8EA 2HEYF 1EV12 2HWC1 1BXHA 3TN93 4BPZA 3RYRA 1ULDA 2QZ2A 1UAIA 4EROA 3AKPA 1KFXL 1PNGA 4XETA 4X6QB 5SV5A 2HWC3 4UW6A 1R092 3M3EA 3R4DB 3CJIC 1V6NA 4BLIA 4GULA 1VBB2 1Q8QA 1PK6C 1W6OB 2FQPA 3AMMA 1N1VA 2IFWA 4YFZA 3PHMA 5JPNB 1F8VA 1XQNA 2R32A 4Q0SA 1IQAA 2O8OA 4YW3A 5LRRA 4UBHA 1ENXA 1WA4A 1SACA 2WQZC 3VKMA 1KS4A 5I8SA 3GYDA 4GMP0 3FC0A 4MGZE 4LBOA 1APNA 5LRSA 4PQ9A 4HETA 4LLFA 4OHYA 2GNTA 2WQ4A 1RUOA 1ND2B 3AFKA 2ZX4A 3NAPB 1DGWX 4CDWB 2XWJB 5CFDB 3U07A 5J96B 3MW3A 1AL22 5I91A 4OHWA 5DG2A 3CU7A 1I3HA 3M3CA 5T54A 1CAXB 4OHZA 2Y0IA 5GZGA 2YMZA 3TWIA 2R062 1QKQA 3ZXGA 3ILNA 5F6KA 2OZ6A 5BY5A 1S55A 5FPZA 3POSA 4JRAA 1QXPA 4XDQA 4COVA 1OPOA 1ZZCA 5FOBB 2R041 2B7YA 3BOWA 1SQ4A 3ZVXA 3IWZA 4QHBA 1PO11 2D5HA 3H8UA 3HT2A 1LENA 4DPNA 2R043 4IL7A 3WDVA 2JJ6A 2BW8A 5C6CA 4Y1YA 4AFMA 1W6OA 1PO13 2NLRA 1OQ1A 4XFGA 2HWD1 4Z2WA 1QU0A 3U11A 3ZSKA 4EWDA 4AVVA 2P3KA 2VNRA 1OHFA 3AM2A 1NCRA 3GHNA 3BALA 3WDXA 2H0BA 3NWKA 4L2NA 2WT2A 2JG9C 5C4WB 3LSEA 2HWD3 3QCWA 3VKOA 4YM3A 3MIHA 5J09A 5FLIA 4FPGA 4XF1A 4ATEA 5JOZA 3MZHA 1LOAA 1UN1A 4HLTA 1VALA 1YYNA 1W6PA 1WW6A 1X33A 1ND2A 3SLIA 1SLLA 1B09A 1DHKB 3OYWB 1CD3G 3MYXA 4E2QA 4XJAA 4Q4W1 3ZFEB 3ZXKA 4IV3B 2PAKA 1UPIA 2B8MA 1O3SA 2VNGA 4NO4A 3WVJA 1UU6A 1SLTA 2WZR1 3B7MA 1ONAA 2W68A 2D6LX 2VMGA 4IEYA 2KA3A 2GC3A 4XJ8A 3QLQA 2EAKA 1OLQA 2QQPA 2WZR3 2YPJA 1H1MA 4Q29A 2E9QA 4Y20B 1U5YA 2PTMA 1WD3A 2PHDA 1WCKA 1W2UA 5D1IA 3WUDA 4RQPA 1BCXA 2CY6A 4LO8A 1YFWA 3U10A 1RUE1 4DINB 4F8AA 3VBSC 4YSFA 2NMOA 1ENRA 2ZMKA 3OGJA 2IXLA 2XVLA 2XBO1 4U36A 4AI1A 5C4WA 4Q26A 5DDJ1 1RUE3 2G9GA 2WJSA 5DZEA 4N7IA 3RSJA 1XU2A 5FPXA 4Q0VA 3GBGA 4UW4A 2XBO3 2VGDA 3IM0A 5J7MA 4K20A 1HX6A 2RM22 1GZWB 5DDJ3 3D4KA 4LBJA 4N43C 2DURA 2XB6C 2HWF2 1QY4A 1I5ZA 4K21A 4DNYA 1QH6A 2HEVF 3KCXA 1AYM2 4INDA 4QM9A 4CDUC 3JCIA 4YFWA 2EXJA 3MIGA 1RINA 3JQXA 3RWNA 3WHUA 2WNVA 4K8FA 4M3CE 1YLLA 2WSUA 2Q0AA 3ASIA 3I59A 4LE4A 3DPRC 4Y1XA 4XIKA 4IETA 3PTYA 3VUOA 3TN92 1FT9A 2AZ5A 4AG4A 2PLV1 4NHMA 1RUJ2 1OA3A 3ZFFB 4YGCA 1GFF2 4P9LA 2Q30A 1LGBA 4M01A 1UD1A 4OI0A 1DF0A 2YDEA 5F5QA 4A7KA 4HKOA 1FXZA 4H3WA 2PLV3 4MX3A 4AYUA 1VJ2A 4RD7A 3FE5A 3X29B 1PGSA 4P9JA 2D3RA 1FNYA 4HFSA 1H1IA 4KNCA 1XNDA 2I74A 4QXKA 1ZYBA 3ME2A 1ULCA 3WX5A