3GYDA

Crystal structure of a cyclic nucleotide-binding domain (mfla_1926) from methylobacillus flagellatus kt at 1.79 a resolution
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
178
structure length
178
Chain Sequence
HHHENLYFQGMYPDLVHLGGADKYFEEILEIVNKIKLFGDFSNEEVRYLCSYMQCYAAPRDCQLLTEGDPGDYLLLILTGEVNVIKDIPNKGIQTIAKVGAGAIIGEMSMIDGMPRSASCVASLPTDFAVLSRDALYQLLANMPKLGNKVLIRLLQLLTARFRESYDRILPKTLGELI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Cyclic nucleotide-binding domain
publication title Crystal structure of cyclic nucleotide-binding domain (YP_546034.1) from Methylobacillus flagellatus KT at 1.79 A resolution
rcsb
source organism Methylobacillus flagellatus kt
total genus 52
structure length 178
sequence length 178
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3gydA00
2PQQA 3I7DA 4CYDA 3TNPB 3PLQA 1YWKA 3FJSA 4BH9A 1ZZ8A 4KWJA 4Q0PA 5EFUA 4IEUA 1SEFA 1J3QA 1UD1A 4Q0SA 4IEXA 1H1IA 3ST7A 1O3SA 4IEPA 2B8MA 5JCTA 1ZRRA 5EZWA 2PFWA 4XF3A 2ET7A 2GH2A 2XKPA 4ONUA 2QVSB 2KXLA 4FT8A 2UYAA 4I02A 4OFGA 2XKOA 1Y9QA 2IXIA 3IWZA 4JTNA 4AVBA 2CGPA 1NE4A 5BXXA 3QOPA 3ES4A 1CAXB 5I91A 4XFIA 1ZX5A 2IXHA 3SCHA 2P17A 3H1YA 5CU1A 3MDPA 2OA2A 4YARA 5FPXA 5LRSA 1ZREA 4HVRA 4ZU7A 2O8QA 1YHFA 2N7GA 2EA7A 2H6BA 4LUKA 2BEOA 4L2NA 3L2HA 2MNGA 5FQ0B 1YLLA 3LZZA 5E1RA 2BYVE 3OTFA 3RYPA 4MH0E 3DN7A 4KU8A 4P9GA 3MPBA 1JUHA 3TNQA 1OMIA 2XHKA 3SCGA 1EYBA 1O5UA 4E2GA 4MUVA 2QNKA 5HI0A 5I93A 2OPKA 1J3PA 1RC6A 1YFYA 1J58A 1CAUB 4MGZE 2ET1A 4F8AA 2QCSB 1XE7A 1FXZA 3NL1A 4B29A 3OGJA 4IEVA 2WFPA 4EV0A 4HVQA 4N9HA 4ZU4A 4TLFA 4XFCA 2Q0AA 1FI2A 4LULA 1X82A 4ORFA 4WBBA 1ZRFA 4IESA 3LA2A 3CL1A 3UKNA 2ATFA 2PAMA 3NW4A 4XF4A 1ZZ9A 2DCTA 4FAGA 2E9QA 3D82A 3C3VA 1J1LA 5I8YA 4A2UA 4I3PA 4EWAA 3CLPA 3BPZA 3EBRA 4X6QB 2IXKA 4L11A 1TQ5A 1YFXA 2PAKA 3D0JA 3WW3A 3IIAA 3LAGA 1ZZBA 3EHKA 2XLGA 3UKVA 2CAUA 2ZCWA 2QDRA 2ETEA 4O9GA 1SQ4A 4N9IA 3H7YA 1YUDA 5JSRA 3PVBB 4R52A 4QGMA 1FT9A 2PHDA 4QXKA 2ZKLA 5FDBA 3OD0A 1NE6A 1YFWA 5FQ0A 1CGPA 1ZZ7A 4KL1A 4IEZA 3M3IA 2MHFA 4HN1A 5KHHA 4YNIA 4YSFA 4XF1A 3S7IA 2IXLA 4NVPA 2OYZA 5JR7B 1G6NA 2PHLA 4J1WA 3S7EA 5J48A 2B5HA 1O4TA 3HT2A 5I0UA 3FX3A 4D7SA 4XFAA 5BY5A 1XRUA 3EJKA 4Z82A 5FPZA 1X8MA 3IBMA 5LEJA 1EP0A 4UBHA 1CAUA 4IEOA 4WVZA 1NYWA 4MZUA 2CV6A 1O5LA 2XLFA 5K8SA 4LA3A 2EVXA 3H3UA 3HT1A 4JTOA 4PJYA 2EAAA 3IDCB 5CVRA 1DZRA 2IXJA 2XGXA 3B02A 4XF0A 2GC2A 1QXRA 2HJIA 4XFFA 4XFGA 3FE5A 5I8SA 2VPVA 1L3JA 2O1QA 4Q0VA 3U0ZA 4GULA 5I8TA 4HLTA 4Q0UA 4I09A 5C6CA 1RTVA 2D5FA 3BCWA 3RPQA 4I2OA 4Z07A 1EPZA 2Q30A 3U11A 3OF1A 4QMAA 4AQ6A 5FLHA 2F4PA 5KHJA 1PMIA 4AQ2A 1UIJA 4E2SA 1V70A 4AXOA 4LA2A 3FFQA 2Z2SB 4MGYE 4K8FA 3SHRA 3EO6A 1UIKA 3D0SA 3G7DA 5F1RA 5KHKA 4QX5A 3DKWA 4MV2A 3UKTA 3I59B 1NZCA 1I6XA 1ZNPA 4QM8A 3E97A 3CO2A 3NVCA 5AVPA 4LTAA 3E5UA 4AVAA 2I45A 1GQHA 4KWKA 2Q4SA 2C0ZA 3H50A 2XL7A 1CX4A 1CAWB 2BNNA 3OCPA 4HBNA 3WW1A 3N4MA 1YFUA 2HKXA 3NKTA 1WA4A 4QGLA 3LA3A 4BYYA 3SMHA 5I0SA 3DL3A 3WW4A 2GAUA 1IPJA 2H6CA 4EWEA 4I0BA 4QM9A 4IEQA 2IC1A 5KBFA 1VJ2A 4MGIE 1QY4A 1GQGA 3MYXA 3H7JA 4YRDA 2GC1A 2UY9A 3HIFA 2PA7A 4JV4A 1I5ZA 2K9ZA 4HZFA 4LUMA 3E6BA 3GBFA 3DV8A 3LOIA 2UY8A 4I01A 3RNSA 3H1MA 3ACLA 2XLAA 2XL9A 5CADA 1O3TA 1ZZCA 4MGKE 1Q3EA 4YYOA 3E5XA 4DINB 2BNMA 3BALA 5BV6A 4R8HA 1WGPA 4LLOA 1DGWA 3KCCA 4ZU5A 2V09A 1DZTA 1PM7A 2UYBA 3NSTA 2D5HA 4HSLA 4F7ZA 1LR5A 1O7FA 1RL3A 1RUOA 2WC2A 5JSOA 1OD5A 4XETA 2IXCA 2MPFA 1OFNA 3ZDSA 4PIYA 2CAVA 3LWCA 3EQEA 1LRHA 1XE8A 2BNOA 1O3QA 3H3ZA 5FCCA 5J7MA 1WLTA 5LEKA 2BGCA 3I59A 1CAVA 3M70A 4HVOA 4Q29A 1NXMA 3CJXA 1LKNA 2GU9A 3H1WA 4IETA 4UBGA 1CAWA 3LA7A 3SXWA 3IDBB 2FQPA 1J3RA 5BUVA 1QXJA 5J3UA 3U10A 1RUNA 1H1MA 2H0VA 4BHPA 4D7TA 4J1XA 3ELNA 1IPKA 3E6CC 3WW2A 4LEJA 1QWRA 1X8EA 3CF6E 1ZVFA 2Q1ZB 3O14A 2VECA 5FLIA 5FLJA 3E5QA 1DGRA 1O3RA 1LB2A 1UPIA 3BB6A 1EY2A 3PNAA 1U12A 3FHIB 3JZVA 1CAVB 3NJZA 3H8UA 4BIFA 3RYRA 4PIXA 2GC0A 2VQAA 2B9UA 3KGLA 4O9EA 3KMHA 4PIZA 4IERA 3FWEA 3I54A 1UW8A 1J59A 3QACA 4XEZA 4UXAA 5JAXA 5I0RA 4EROA 4Q0QA 3H9AA 1HW5A 3SCFA 4QGNA 5D1IA 3ETQA 3RDIA 2PAEA 4XFHA 4E2QA 1VR3A 4KU7A 2D93A 5KHGA 2GC3A 1VP6A 3HQXA 4XF9A 4XFBA 3ROUA 1RGSA 5E16A 2OZJA 3GYDA 3ES1A 1OI6A 5BPXA 3RYKA 3VHRA 4HSJA 3RZZA 2PYTA 1Q43A 2Y0OA 5I0TA 3R6SA 4OLLA 4EWDA 5KHIA 3E6DA 2PTMA 1UCXA 1Y3TA 4META 1ZRDA 2Z69A 5LRRA 1X7NA 4H7LA 4HMZA 2OZ6A 4FBFA 4AVCA 1SFNA 1Q5OA 4RD7A 3MZHA 4MX3A 5T3NA 1CAXA 2FMYA 4FAHA 2D40A 3KSCA 4KWLA 2GZWA 4I0AA 4X6RB 3BU7A 3CEWA 3USSA 3S0MA 4IEWA 4JVAA 3FZ3A 4HN0A 5C8WA 3KGZA 4WZCA 5JSPA 4IEYA 2K0GA 2QJVA 1ZZ6A 1ZRCA
chains in the Genus database with same CATH superfamily
1IGOA 1MPXA 2PQQA 1HXS2 1LNSA 3ZYPA 2YPJA 4Q4V1 4CYDA 2D3PA 2DU0A 4DQAA 1CZTA 4UFKA 3MI8A 4QX8A 1FMD1 2VW2A 3ZFFA 4KWJA 2BOJA 1F4AA 1S0EA 3PIJA 4K6BA 4B4RA 5FYSA 4Q0SA 1E5IA 1W90A 3AZXA 2VVEA 2VUDA 1Z0HA 3ST7A 4RQPA 3WDVA 1O3SA 4IEPA 1QJY2 1ZRRA 2WNVB 4XF3A 1UWWA 4ONUA 1ND2C 2VNVA 3CJIA 4YGCA 4BOWA 1XNBA 3MIBA 1IG3A 4NRQA 2VCAA 2AH2A 3VD9A 1E5HA 2RDSA 1LHNA 3AXDA 5C33A 3K2OA 4LOTA 1YJLA 3HQUA 5FAXA 5BXXA 4BPZA 4ASLA 3MLJA 2WT0A 4LKEA 3PU8A 3ZPYA 5FO8B 5C3SA 1CPMA 1F8VA 1R082 1ZX5A 2ZABA 1DQ2A 1IG0A 3R4UA 4JGZA 3SCHA 5LA0A 1XE0A 1UZVA 3ZKYA 2QQLA 2DVGA 1LOFA 4AEDA 1I5PA 2V73A 1CR7A 4Y22B 5CZKA 4A42A 5FYCA 2N7GA 4DO0A 5IFTA 2X29A 2QKDA 2H6BA 3LPGA 4LUKA 4WVWA 1FYUA 2BEOA 4Y4RA 4YZ4A 1WWYA 5FPBA 4JGYA 4HPKB 1AYM2 1X50A 4K20A 4CDUA 1NLSA 3C8XA 2Z79A 2I07B 4IW3A 2R32A 3Q8EA 1YLLA 1JOPA 3VBHC 2G1MA 5JUVA 4CP0A 3APBA 4ISQA 4QX2A 3TNQA 1JUHA 4KH9A 2WNUB 1QJU2 1B09A 4ATEA 5IVCA 2VNOA 4PT6A 3OG2A 3ZMOA 2WZEA 2GMMA 3GZAA 1RUE2 1UX6A 4YM3A 5EYXA 1TME1 1UPSA 1RC6A 3AFKA 4IV3C 4MGTA 5GLUA 1LCLA 1PVC1 1CD3G 4LHNA 1OLRA 2WIIB 4XJWA 1YFYA 5FK7A 3VZLA 4LBQD 2WYSA 2ET1A 4WM8B 1HRI2 1XE7A 2QCSB 4XCBA 2DCJA 3W58A 2HWE1 2CY6A 3PVEA 3WNPA 5C8CB 1N1TA 4QX1A 3USUA 2P6HA 2WFPA 5FOJB 1UY3A 4ZU4A 5CFDA 4TLFA 4BWOA 2ZHLA 3QH7A 4QPWA 1BKZA 5APAA 4C8DA 2VG9A 1X82A 1AJOA 1JU4A 4ZZ8A 2VNRA 3B5LB 4YWAA 4JRLA 3ZXEA 1HLCA 2YB7A 4N43A 4O65A 5ERLA 1HN1A 2DCTA 3B93A 4QPIB 5D2AA 1V00A 1TZOA 1SPPA 5BNNB 5JWPA 1JI6A 3IDEA 1ASJ2 2Y6JA 4E4ZA 1ENSA 3CLPA 3ZFEB 1RUC3 2WS91 1ZYBA 5LA2A 2RG4A 2RS51 4L11A 3MEPA 5FPUA 2DURA 2E51A 4E4SA 3NV4A 1YFXA 2BERA 2PAKA 1H8VA 4ZZ5A 1HRV3 2QZ2A 3K4DA 3N9MA 4M4RA 3VDDC 4AHYA 3SKVA 2JDPA 4JX0A 3EHKA 5J36A 1I1EA 1ST8A 1VIWB 2VMCA 2A70A 4GA9A 1UOJA 4NJ4A 5E8AA 4UFHA 1PHMA 3N9PA 2ETEA 1AYN1 4FPJA 1BLZA 1QNYA 3H7YA 3ZKUA 2ZGRA 5A6QA 5FZKA 5JSRA 3LDBA 3QLQA 4R52A 2QQIA 4SLIA 3GBGA 1D4M3 4CEYC 2ZAAA 2JKBA 4AI2A 4YG3A 3OD0A 1L7QA 1NE6A 2Z4FA 1AR61 3BTYA 3CKHA 2RS13 2W39A 1VLNA 2AGSA 2JDYA 3IPVA 5FJHA 5FQ0A 1H9PA 1ZZ7A 1KFUL 5FYTA 4HN1A 1RUF3 1T6GC 5CNAA 4XF1A 2WT2A 1R64A 2TEPA 2BUKA 3EXUA 4BE3A 1AR73 5KR7A 5FMDA 2CWSA 2PHLA 5JR7B 2VTXA 4GWIA 5J48A 1KFXL 3AMHA 4CP9A 3HT2A 3TEWA 2Y33A 5I0UA 5A7WA 1LEMA 4YW4A 2EXJA 4C1XA 4UW6A 3ZXAC 1L7RA 1F35A 3VBSC 2ORXA 4KMQA 5FPZA 1LGNA 5C4WA 4YFZA 3THTA 3UETA 5LEJA 3UGGA 5EQUA 5FY4A 4WVZA 4CXWA 1WA6X 4LBQA 1NA1B 3WUCA 2W94A 4I3GA 2V72A 3N9OA 4FP3A 2C1FA 4KG0A 5F9TA 3DPRB 5JOWA 4EE2A 1H2MA 1B35C 1QH6A 4D7YA 1NG0A 1G9FA 2JE9A 3NNJA 4Q4Y3 1NKGA 5CFCB 5K9YA 3HT1A 5T5LA 4C91A 4IDZA 4CU8A 1WW5A 5AC93 5GZGA 3SEPA 1OBNA 5L9RA 4JTOA 1RUI2 2EAAA 1MACA 4BQXA 1DBNA 3J7HA 3GCXA 1N3QA 3OOXA 3VBOB 4B4QA 2OIIA 2BBAA 1BVVA 1JN2P 1HQLA 5K0UB 2VH9A 3AZWA 3NV2A 1MVEA 1OA2A 2GC2A 4DUVA 2NLRA 4XFFA 5HBAA 2D6PA 2AC1A 4W4ZA 3RZJA 4HT1T 1A8DA 1D0HA 3LGRA 2DUQA 3OB8A 5BNQA 3VZOA 4BQ4A 1JU3A 1SDDB 5C6CA 1UKGA 3ZVXA 3H42B 3IAQA 5A33B 4QX7A 2ILMA 5FXZA 3CQOA 2D5FA 2UWCA 3WF0A 1UMZA 5KXEA 2HWC1 2WAOA 5IVYA 5FWJA 4I2OA 1RUH1 5GJ6A 2Q30A 3U11A 5FZ7A 3T0DA 4RHV1 4P9LA 1DGRN 3J26N 5EIYB 5JPNB 4AQ2A 4O61A 5F37A 2GALA 1DYOA 5LZ6A 2DVBA 1XYOA 1LEDA 4K21A 2JICA 3NAPA 4MGYE 5A7OA 3MBWA 3G7DA 5LY1A 3GNEA 4CDQC 1AX2A 1LOCA 4FFGA 4QX5A 1DLCA 1HJGA 3UKTA 1VMFA 4PQQA 1GP5A 3ILFA 2DU1A 1ZNPA 4JDMA 5E89A 4QM8A 1H8TC 3E97A 2W52A 3M3CA 2FBEA 2JDMA 4IV1A 3U78A 2W9XA 1OURA 1SG3A 2VCBA 4CDWC 2I45A 1XXNA 3HN1A 1MZ5A 2Q4SA 4OI1A 3RS6A 3C7HA 3H50A 3LSDA 2XL7A 4YVSB 4OCTA 2JG9B 1OOPC 2BNNA 3OCPA 2R072 3I3EA 4HBNA 3MV01 3N4MA 2BGOA 2DCYA 2HKXA 5DN2A 4Q8KA 4YG0A 3UGFA 2FMDA 1LECA 4BXSV 3LA3A 4L92A 4BYYA 4AFBA 3DL3A 1H1AA 2VUCA 1IPJA 2H6CA 5GLTA 4XCAA 3B00A 3RJ2X 3VD4A 4CCNA 3JB4C 3ZXGA 3OUJA 1X9TA 1VJ2A 1K12A 2DFCA 3PUSA 5LK7B 3AX4A 1JUIA 1NQDA 4XIKA 4YW6A 1CVNA 2CGOA 1JS9A 1GQGA 3MYXA 3PMSA 2WO1A 3NKGA 3H7JA 1YC61 2B7YA 2AEZA 3VKOA 2PA7A 1QOTA 4A3XA 1I5ZA 2YC4A 4BQ3A 3IZOA 2X5IB 3D5OA 5GZDA 3VLBB 4CUAA 5A7PA 3MICA 4RSUA 1WMXA 4AHXA 1H9WA 1PMJX 1SCRA 2G4IA 5F5AA 4I01A 1H4GA 3MHZA 3PJQA 1YJKA 2JDAA 5HV4A 1AXZA 4XYXA 1OHFA 3IB3A 3MLKA 2B39A 1VRH3 4Y26A 3UT0A 2XL9A 3OBTA 1PGL2 3J7MA 1AR93 3WHTA 4DINB 4Q4W3 1S0BA 4AW7A 5L7OC 3DECA 5BV6A 3O1SA 2W2IA 3RI9A 2K46A 3KCCA 4ZU5A 5FYUA 2ZGPA 1UY4A 1FPN3 2QQNA 2GP5A 4FPKA 1GZ9A 4M3CB 4KWUA 1TMF3 1QJEA 1RUC2 3F2ZA 3J8F3 5CG9A 4OQ8A 3N9NA 3VB9A 3V0AB 1O7FA 1RUD3 4COWA 3JB8A 4RA0A 1VBC1 3AK0A 2P37A 3RSJA 1OD5A 2XDVA 2XR4A 3DUIA 4XETA 2IXCA 4OI2A 2MPFA 3JQXA 4NIIA 3ZDSA 4FFIA 2EICA 2R043 1C8NA 2CAVA 2TUNA 4N90A 4Y3OA 2CGNA 2D7FA 3N7LA 4X8PA 1QH7A 1UU5A 1XE8A 3H3ZA 2E32A 1UF2C 1LU2A 1W8OA 4W65A 3S30A 2X10A 3A21A 3U37A 3AYDA 1VALA 5B4XA 1BMV1 2JXAA 1OC1A 1NY71 1SMVA 1WD3A 2Q8OA 1S1AA 1DU3D 3UJQA 2BFUS 4XE9A 4OHZA 3TN93 3OEBA 3ZXDA 3ZR6A 3TAYA 3CJXA 4RS5C 3AXEA 4ZY9A 2BOIA 4CU7A 4CCCA 4DNYA 2GU9A 2RS12 2X53S 3M8LA 1JW6A 1OKQA 3JBG3 1RUJ1 2R0FA 5FBZA 3NRUA 3ZSJA 2Y6GA 1RUF2 2DTYA 4COVA 1RMU2 3K4ZA 2AUYA 3KT7A 2YC0A 2C4XA 5CEHA 3J4UH 4IUGA 1AR72 1ZBA1 1OLQA 5A32B 2P3JA 2VOTA 1H1MA 5T52A 4PF5A 3MPPG 3ZFFC 2YUEA 1BBT2 1IS4A 4D7TA 1EV13 1SACA 4J1XA 4Z2AA 2D6KA 3ELNA 3B3QE 3M3QA 4O7XA 4NIHA 2BW8A 4QPGB 2XJSA 2B4KA 3THPA 1DP0A 4CUCA 2AENA 3OPZA 3G6JB 3AJZA 1LHUA 1LGBA 1X8EA 1MQTB 4ARYA 3RGBA 1H2LA 2VZOA 4GB33 1D2SA 2Q1ZB 1WW7A 5FLIA 2VNGA 2EF6A 1CJPA 3AP7A 3E5QA 5A1LA 1NCRA 3HJRA 1PZ8A 1O3RA 2QQKA 1H6XA 1NCQA 1LB2A 3BB6A 2JG8A 2VTXJ 4M01A 4AFAA 2ZHKA 1U12A 5L73A 2R063 4CCMA 1RUG1 3LF7A 5FZCA 3H8UA 1VBD3 3R4DB 1DYKA 1RHI2 4IE7A 4KGGA 4BIFA 3WQ7A 2GC0A 4C1WA 4ZPIA 2LTNA 3KGLA 2ZXQA 3PJYA 4O9EA 1QOOA 3I3BA 1LOFC 5BYNA 1JH5A 1UW8A 3JCIA 1MEC3 1W2AX 2HWD3 5IK4A 5LCWL 2RS32 5F7UA 5FP9A 1RXFA 2WFF3 2JE7A 3HD8B 1EAH1 1GR3A 5FIXA 3HPNA 3WNNA 1JYVA 5FYIA 2FDGA 3NNLA 3H9AA 2GN7A 4CDUC 5F3IA 3BYWA 5H9RA 5DABA 4WVVA 1X33A 4XDQA 4UOJA 2HH9A 2JIGA 1JBCA 2PAEA 4AOCA 5FZAA 4NHMA 3BTXA 1WD4A 3WSOA 4XF9A 4XFBA 5E16A 4E9KA 2YROA 4QQ2A 4IGPA 4CDXA 1V6LA 3AKRA 1WMEA 4CEYA 2CNAA 5T5PA 3POJA 4RYDA 2Y0IA 3RYKA 3VHRA 4CTEA 3RZZA 3VDCA 3URFA 1QQP1 5A3PA 2ZOEB 5DAVA 1CESA 2CDPA 2QZ3A 5IYYA 2PYTA 2VZTA 3I2DA 4M0NA 5A3UA 3HVDA 2ZJCA 1BCXA 2WRAA 4HONA 4RR3B 5LBEA 4EWDA 1YI7A 2VZPA 1PIV2 1D2QA 3ITQA 5FZHA 1VBA1 5E88A 1WW6A 2J1RA 1C8M3 2WNVA 5IFPA 3O1UA 1BEV1 5JMCA 2OT7A 5LRRA 2XJUA 1VBE1 4MHRA 5FK8A 4BQ2A 4HMZA 3VBSA 1QJX3 4NHXA 3SKJE 5A33A 3ZIXA 1ND3B 1T6BX 3AZYA 2OZ6A 4FBFA 3AL5A 1W2NA 3K75B 4N43C 1Q5OA 5FY7A 3E1F1 1H2KA 4MX3A 4AEKA 1ALYA 3O1TA 3WEZA 4HL0A 5A1FA 5A3LA 1B35A 1C1FA 1ENRA 4TLGA 4AI8A 4FAHA 2RJLA 4L97A 5A80A 2ZGSA 2WO2A 4KWLA 3B7MA 2GZWA 1Q8VA 4I0AA 4BJ0A 3CEWA 3IM0A 2WZR3 1KD7A 3ABZA 4IEWA 4JVAA 1JYCA 5JZGB 2QBXA 1H2NA 4DOUA 2RM22 3KGZA 5C8WA 2DBNA 4XDOA 1UZWA 1YQ5A 1S2BA 1GP4A 4IEYA 3A0KA 5EXOA 4FPYA 4WM7B 5FP8A 3RWNA 3O1VA 1HQWA 4XAAA 1PO13 4XIOA 5BNPB 1AF9A 4HPKA 1ZRCA 1Q56A 5JIAA 5ACA3 3TNPB 1G86A 5C3PA 1JHJA 3PLQA 1FX5A 1YWKA 3HNYM 5FPAA 2YMZA 3M4FA 4Y5TA 3ZN6A 2P3IA 4CXXA 3U4SA 3VBFC 4Q0PA 1YYNA 5D8AB 4IEUA 4CUGA 3WF4A 5EJ1B 2UWAA 4CVUA 2I74A 1UD1A 2WQ4A 2J1EA 1VRH2 2WNUA 3AB0A 2AACA 4H2AA 4IEXA 4QKBA 4LO7A 4LNVA 4PLNA 1AR92 2BWCA 1MZEA 2E31A 4HXCA 2WKKA 4MO3M 4A7YA 2B8MA 4ZS3A 4R4XA 2RR11 5EZWA 1L7LA 3ZSMA 1FOD3 2GH2A 2YDEA 4FOVA 2VGDA 1FPN2 4GXLA 1GBGA 2UYAA 5FV3A 4COUA 5ANNA 4I02A 3ZXLA 3ZFGC 1PVXA 1XQNA 3SQOA 1OA4A 4JKKA 3POBA 4OFGA 5F2WA 1RUD2 2IXIA 4A7ZA 3IWZA 4Q4V3 1W8ZA 5IVJA 1WCSA 3QOPA 3ES4A 5C8CA 5I91A 4K1YA 4DUWA 1C5HA 1FMD3 2ZTNA 2R042 2RJKA 5D21A 1UZYA 5EV7A 5FREA 2P17A 4NROA 1FNZA 5CU1A 1HV1A 4CSWA 4BDVB 2VMDA 3ZDVA 3CZUA 1HX6A 2O8QA 4ZU7A 5C4WC 1BQPA 4JQTA 5HV0A 2W46A 1AJKA 2C9KA 3JD73 2GDFA 3LIHA 2G9ZA 1G9BA 4QPIA 3TN92 5BNNA 3L2HA 1V9U1 4HFSA 4YW7A 5FY5A 3ZFEA 4I30A 1W9SA 3LZZA 2JB8A 2RDQA 1DLLA 2PHFA 2WUHA 4FOQA 4J6GA 3RYPA 4YGDA 2PLV1 4KU8A 4QB6A 2FDJA 3JBG2 1W8FA 4P9GA 1ULFA 3RZHA 4XMAA 1DIWA 1ZM1A 2XHKA 3L2YA 2JKXA 5HXMA 1JZ5A 4E2GA 1O5UA 2RJ2A 3RZMA 5I93A 1QOSA 3IMMA 1V0AA 5FUPA 4Y20B 2E26A 3BTZA 4LQRA 4A3ZA 2VW1A 1EV12 1AX0A 2WN2A 4W50A 1K5MA 3N9LA 1XNCA 5FPLA 5J37A 1XU2A 1LAJA 2C24A 2I2SA 1WLWA 1FXZA 2VCMA 1YQCA 3VBRB 5A3WA 3FBMA 2E7QA 2XXZA 2JDNA 1VMHA 5FZFA 5FJKA 4CCKA 5A1AA 4Y24A 2WO3A 4XFCA 3O12A 1SBFA 2Q0AA 4DXSA 2RDNA 4LULA 4Q27A 5FZMA 1HXS1 1ZRFA 3KVAA 3POWA 1LTEA 1W3XA 3I2FA 4PBPA 1CIWA 1ULGA 3NAPC 4OZOA 2R062 4IESA 5GKAC 2J1UA 3LA2A 4INDA 3UKNA 3AKPA 3D4KA 3T1LA 1NAEA 4GD4A 1TME3 3CHXA 4IV3B 4FAGA 2D6LX 2EXHA 1FV2A 4F83A 1O91A 3ALQA 3M3EA 1BHGA 1PVC3 3AL6A 4BM8A 5I8YA 2GNBA 5FZ8A 2YY1A 4AAXA 1IS3A 1GICA 2JEMA 1MEC2 2HWD2 3KV9A 2GMPA 4IV1C 4X6QB 4EWAA 1ULOA 3FHAA 2WFF2 4KBZA 2KD7A 1W2UA 1QJY1 2ORZA 1FATA 3OBAA 1DYPA 5F5CA 1OXCA 1TQ5A 2HWE3 2LS6A 3AYEA 4PI2A 5GM0A 1Q8QA 4EN0A 1ONAA 2RMU3 2DCKA 4DMIA 3A22A 3WW3A 3ZX7A 3GDBA 5CFCA 4PDWC 4AI0A 2XLGA 4NR1A 2EIEA 3AVRA 2ZHMA 1PX4A 3WDTA 3VBUC 2DTWA 4NAOA 4UF0A 2CAUA 2ZCWA 2XQRA 2QQOA 2WWSA 3BOWA 1SQ4A 1RXGA 4N9IA 2XVKA 3CZJA 5K0UA 4WVMB 3AFGA 3PVBB 1GNYA 3T3YA 4B4PA 2PHRA 1GUIA 2PHTA 2PHDA 4QXKA 3VL8A 1JYWA 3AP9A 2V4AA 3BPSA 1SHWB 5L9VA 2WS93 3QD6A 3VN4A 2WLQA 2RS53 1XJAA 2AREA 5FXXA 3OGSA 1AYM1 2J1TA 3KT1A 4AVTA 4KL1A 4IEZA 2JB4A 3M3IA 2XJQA 3NV3A 4NUBA 4P5HA 2R16A 3PDQA 4YNIA 1OH4A 2L9LA 5T54A 3S7IA 2WABA 1Y43B 3POFA 2Y6FA 4GH4A 5J96B 4XJZA 5EJZB 5FYZA 3N7KA 2B5HA 2LROA 4ATFA 1WKYA 3FX3A 4D7SA 1ZA4A 2X09A 1W6MB 2XPJA 5BY5A 2TNFA 2Y38A 4QKNA 3AKQA 1AYN3 1UXXX 3EJKA 3EMRA 3HMYA 3KV5A 4JKMA 4FI9A 1RUE1 4Y1VA 5GALA 1NQJA 4UBHA 4K40A 2JD9A 3WQ1A 3UESA 1CAUA 4CCEA 2AZ5A 3ETPA 4RL7A 2W1WA 1C4RA 1O5LA 1AR63 1TVGA 3ZYGA 2EVXA 1R092 1HRI1 4LKFA 4UW3A 4L8QA 4QX3A 1OVSA 2XUMA 3A0NA 3D3AA 3U07A 3VKLA 1PO12 5ABJB 3W5NA 4QHZA 5FZOB 2OQ6A 4LO5B 4OHXA 5FXVA 2XGXA 1UOFA 3OSDA 4BMBA 4LJHA 2H0BA 4GJZA 1UYZA 1UX7A 5FPVA 2HJIA 4DXTA 4XFGA 4IE4A 5J98B 5IVVA 1W04A 2V4VA 5C5UA 1W6OB 4UFJA 1L3JA 2O1QA 4IXLA 3OJBA 3HOBA 1V6MA 4HLTA 3OEAA 1YCIA 1W05A 3EB7A 5DAWA 1ASJ1 1RTVA 5EYYA 4CPBA 1YIFA 2ERFA 3BCWA 1FOD2 3ME2A 3O0WA 3OY8B 1UOGA 1GZWA 4LXLA 4Z07A 4ES9A 5C9AA 1OA3A 3V56A 4AQ6A 2ZGNA 5FLHA 3OGRA 4BB3A 2MEV3 1PMIA 3KQ4B 1E5SA 4XBLA 1LESA 1LOBA 4FFFA 4QHBA 4XXPA 4YGEA 3RG0A 4AXOA 3GF6A 4E2SA 2FZ2A 2X5IA 4QB1A 3FFQA 2Z2SB 4QWNA 2YPDA 4R9BA 3SHRA 1E5RA 4DXZA 2EXKA 1WBLA 3FLTA 2WNOA 1MVQA 3I4IA 4D0QA 5F1RA 5KHKA 4F3JA 4QQHA 2ARBA 3RMYA 2NZ9A 1NT0A 1I6XA 1KQRA 3AM2A 4RGAA 1EPWA 1G7YA 1FAYA 4AG4A 1MS3A 3CO2A 5AVPA 3JD72 2GMEA 1VBB3 3DYMA 1BK1A 1ODMA 4KWKA 5L36A 1W6PA 3O0VA 2HWC3 4D8MA 3RZGA 2W87A 1QDOA 1RUH3 2IZWA 1CX4A 1NCRC 4QAWA 1RYYA 4RHV3 4UFLA 3WW1A 1AL0G 1NCQC 4A6SA 5F3CA 1JZ2A 1JYXA 2JG8C 1E57A 2NPIA 3I2HA 2QQVA 3N35A 3NKTA 4N53A 3WHUA 2W92A 4LR4A 4LIVA 2FCVA 4AAPA 4NOTA 4URTA 4XHBA 4COZA 4A45A 4W8JA 3SH4A 2IC1A 3OUHA 5KBFA 2E63A 3AYCA 3GCWA 1XOYA 1H8TB 1GYKA 4PBOA 1XC6A 2W3JA 2W1UA 4CDWB 4RN5A 5FP3A 1WLCA 5CB7A 2OUHA 2ZEYA 2UY9A 1APNA 2Q8DA 3IMNA 4SBVA 4FPOB 4E8DA 1ZBE3 3ACGA 3KHCA 3VBFA 5AFBA 3CU7A 1QKQA 2BTVC 4P14A 3ZPOA 1WCQA 1D0GA 3GBFA 3MF9A 5FZGA 1RUI1 2JJ6A 1MS0A 2HYKA 2HWF2 4Y5Z0 2K2SA 1JYTA 2XBO2 4DB5A 5B4NA 5J1XA 5K4LA 4AFCA 2OVUA 3T2PA 4CDXC 5IT6A 1Q3EA 1UYXA 4YYOA 4AEJA 1UY2A 5A32A 3BALA 4OQ9A 5A3NA 4R8HA 5IHRA 1WGPA 3Q8AA 1DGWA 1R1A3 5HXVA 2CHHA 3ZFGA 4QT6A 4ZS2A 1PM7A 4XUPA 1SBEA 3BOPA 4CCOA 4EJRA 4P9YA 2W91A 2BPA2 2OUJA 3NSTA 4HSLA 2D43A 1JZ3A 1V6IA 3WD5A 2Y8KA 2WC2A 4HG6B 2HWE2 2WNVC 1W6NA 2RMU2 3VD7A 1OFNA 2IUWA 5DZGA 4AE2A 1V6JA 4Q5OA 2XONA 2VOKA 3B01A 3EQEA 3THCA 4MADA 2D6MA 5FZ9A 4Q4X1 1W6QB 4KBBA 3SEEA 5J7MA 3IKWA 2BGCA 4XZUG 1GFF2 3I59A 5FY1A 4FOWA 5L7OB 1NX9A 3DEMA 3MW2A 4QD2A 4HVOA 5DG1A 4Q29A 4GKXA 1F15A 5BNOA 4U2AA 1F5JA 3VDBA 2CTVA 4KI5M 4MXWA 3V0BB 1PX3A 4IETA 3N36A 5TSWA 4D6SA 2P1BA 1OUSA 1CAWA 2VD7A 4X8NA 1VBC3 5H9QA 4CCLA 4R9DA 4FCAA 3VV1A 2VMFA 2R071 3MW4A 3IDBB 4LBMA 4K1ZA 4TN7A 1J3RA 3WP4A 1QXJA 2DVDA 3U10A 3WLUA 3RVHA 2VBPA 1G9DA 2A1XA 4CE8A 3WF2A 3U4XA 4PLMA 4D69A 2WNUC 1RINA 1GWMA 3CNAA 1AYN2 2VMGA 1H6YA 3IT8A 4XAEA 4BK4A 2KM2A 4W6XA 4LEJA 5A7NA 4Q8LA 5T5JA 1QWRA 5IJRA 3POEA 4RS5B 3C7EA 1ULCA 4HKWA 5C7GA 2A5ZA 3LPFA 4H3WA 3O14A 3RI8A 1XSRA 2VECA 2W1QA 3I97A 4IL7A 3EYPA 5FLJA 4B7EA 5FO9B 2DVAA 1GLHA 2FCTA 2D44A 4WM8C 4M00A 4LO8A 4MXVA 4RR3A 1SFPA 2D6NA 4MOAA 1YIPA 3JZVA 2XVGA 1CPNA 5LY2A 4AGRA 5C8CC 3ZFFB 4NAMA 3NJZA 1ZBA3 2P2KA 1LOAA 1U5XA 2UWBA 1LU1A 1POQA 2B9UA 3WG1A 3JUUA 1UY1A 2YFUA 3KMHA 1POV0 4PIZA 3FWEA 5FZEA 5JXJA 1H4HA 3I54A 1PGL1 1SLTA 2QQWA 5JOXA 4MG2A 2F6BA 4TXWA 4RQPB 4XEZA 5FKCA 4Y5SA 2DCZA 1DZQA 1H0BA 1IZ3A 4AVSA 4UXAA 4QPIC 3ZIWA 2X05A 5I0RA 4V2VA 4Q0QA 2C5DA 3CJIB 4PDWA 4XPVA 2ZMNA 2CU5A 1BK0A 1KGYA 5BNNC 1C5IA 3LDKA 3BN6A 2FDFA 4QU1A 2FZ1A 3ZYFA 5C70A 2B45X 1RUC1 4LE4A 3ZFEC 5IVFA 1ENQA 1OQ1A 3MIGA 2WO7A 3ETQA 4M0HA 3RDIA 3VBUA 4CRQA 5JZGA 1JODA 2GSYA 4BXFA 5ANQA 2D93A 3BTAA 5KHGA 2MEV2 1REDA 1VP6A 2YYOA 3HQXA 3ROUA 1TG7A 1S4CA 3RMXA 4YW5A 5DMYA 4PHZA 1X36A 4RGGA 2UU8A 4XUQA 4JGZB 1OI6A 5FZDA 5BPXA 2SBAA 3S57A 2Z42A 4B1LA 2FCUA 4AEDB 3CDZB 2A3YA 2JDZA 1K5MC 4LBOA 4JHZA 3WF3A 3FUQA 3ZXKA 1EAH3 2P34A 4JGYB 5I0TA 3RWKX 3L9JT 3THDA 4DY3A 4AHZA 4ITCA 4OLLA 4XURA 3PUHA 3HBKA 1N3PA 1VBB2 2NMNA 5FYYA 5FYMA 3DF0A 2J7MA 1HDKA 3U1XA 2PTMA 1UCXA 1D4VB 2WBKA 3AMQA 3WINE 1RUH2 2O0OA 4RHV2 3ACHA 1X7NA 1D7PM 3I2JA 5A7SA 2VXRA 3GM8A 3V65A 3VZJA 5JDBA 1RUF1 2Y26A 1WMFA 1RMU1 3KF3A 5L9BA 2D6OX 2OX0A 4AVCA 4URAA 5IK8A 4RD7A 5DUVA 4AF9A 3MZHA 1DGWX 5JPMB 4ZHNA 3UL2A 1BBT1 2XQXA 3KSCA 1OSGA 1Y9MA 4NHYA 3MGUA 2ZAHA 5IVBA 1S0DA 4X6RB 3LFIA 4HKOA 3USSA 1W0NA 4DRVA 5EHDA 3S0MA 1OD3A 3FZ3A 3VHNA 3TBDA 3IIIA 2ID4A 4WZCA 1HRV2 4UI9L 1W8NA 3GHNA 1F31A 3USUB 4CU9A 3TWIA 5CFDB 1BEV3 1ZBE2 2VZ3A 2F17A 5FUIA 1HQNA 2G9GA 2YC2A 4NPMA 3BUCA 3ZSLA 5CFCC 1YNAA 1DGLA 1VBE3 3FJSA 4LBJA 4YG6A 1PM4A 3MIDA 4EN8B 2EIBA 1QJFA 5LASA 3M2MA 5C3RA 1J3QA 1DG6A 1RHI1 4NPLA 4GZ9A 1W2OA 2DUOA 3BGAA 2JDHA 1D4M2 1H1IA 5K0UC 3I8TA 2WA3A 1WCKA 2YU1A 1AHSA 5JCTA 5M0TA 4FXKB 2RS31 2W95A 1R1A2 2ET7A 3B69A 3ON7A 5FP7A 4EN7B 2QVSB 3VD3A 3LKJA 5F3EA 1Z7S1 2BU9A 5FYHA 2WSUA 4OUMA 3W21A 4JRAA 3FFZA 2NM1A 3FHQA 2XKOA 1Y9QA 1HKDA 1C28A 4Y1ZA 3T4HB 4AVBA 4GH4C 3T1MA 1NE4A 2G9FA 3O1OA 3GZTB 5CKQA 1CAXB 3OGGA 3WV6A 3MIFA 2VR4A 4XFIA 2JWPA 5IK5A 2DYCA 3ZOIA 3UV9A 5A7QA 3W20A 3H1YA 4CEWA 2ZEZA 1OQDA 3MDPA 2OA2A 4A41A 3H8XA 1U5YA 1SFYA 2HWB1 3LEMA 2ZGUA 1C3HA 2W68A 3UJOA 2EA7A 5HCFA 4XQWA 2GNDA 2XJPA 4Q4Y2 4AI1A 2ZGLA 4HK8A 5AC92 5T50A 2P4EA 1NZIA 2XJTA 1POV1 3PUIA 3WP3A 1I9RA 1AZDA 5FQ0B 4RFT0 4XOGA 5E1RA 2HLEA 4FPCA 1PIV1 5JR2A 4XQDA 1CWPA 3DN7A 2PMWB 4P00B 5F8PA 2P6CA 4GQ7A 4YVSC 4Y4YA 2JG9C 3SCGA 1ENXA 1EYBA 5FZIA 1K42A 5HI0A 1LOGA 2OPKA 3KB5A 2A7AA 4PCRA 3PTRB 1W8HA 4NO4A 3QH6A 4FPFA 4RGKA 5CBLA 4MSVA 2PELA 4FTSA 1TNRA 3P3NA 3ZYHA 5DAQA 4LBQB 4MGZE 3ZYBA 1PK6B 4ARXA 4XILA 5CKNA 5FZ6A 3OGJA 5GLZA 5A6ZA 1V9U3 5DZEA 4ZXKA 3MIHA 2RM21 4CP1A 5C9AC 3DXUA 4EV0A 3O1PA 2ARXA 2HBUA 3O0XA 2XWJB 4MVTA 4XUNA 1RVF1 4OUSA 1MS5A 2VBDA 2VU9A 2X8KA 2PLV3 3WY6A 5FYBA 2KR2A 3PUAA 1FI2A 4WBBA 4M3CE 2BP6A 2X5IC 3W5MA 2J1VA 3GHMA 4LE3A 2XMLA 4QQOA 1HB1A 2Y60A 4YLZA 1ZBA2 3AKTA 1K3IA 4HK9A 1CX1A 4XF4A 1WCDJ 1ZZ9A 1CIYA 5DDJ3 2VOVA 1HV0A 2A6WA 1VRH1 4I3PA 1S2EA 4WZFA 1NUKA 2DFBA 1JXNA 3HQRA 4XQ4A 1CN1A 3BPZA 3C2UA 3EBRA 3RQ0A 4DUXA 1RB8G 1UXZA 3HNMA 1V6OA 5KXBA 3O1MA 1W39A 3UYJA 1LODA 2W5FA 2LM3A 4GJYA 3M1HA 5F39A 4AEMA 5FMCA 1J84A 3J7LA 4MLOA 2XUEA 3IAPA 1ZZBA 3HWJA 1COV1 1HXS3 5F32A 3WG3A 4N53C 2V5DA 4D6QA 4HANA 1KRIA 1TNFA 2ZX2A 4XW3A 1AR81 5ABJA 1XNTA 1KJLA 3I2KA 3OBZA 5FZOA 2QDRA 2R041 2BV4A 5ISLA 1GNZA 4OI4A 5FY0A 1YUDA 3AYAA 4Y22A 4NMIA 4QGMA 3HN3A 4MHUA 1AXYA 1REEA 1W6OA 5EJ3A 2ZKLA 5FDBA 4IQPA 1YFWA 4S2HA 4XBQA 2QQUA 1QJY3 3S6PA 2GNMA 4CU6A 1DQ0A 3AZVA 1XB9A 2A71A 4NRPA 1OKOA 2VO5A 3NMBA 2W1SA 4OMDA 5JXHA 2MHFA 4YVWB 3B9IA 1YQ2A 1BYHA 3FBYA 2Q8EA 1S0IA 1UQXA 4YZ3A 2A6XA 3OY8A 4NVPA 4XZPA 5DUXA 1S55A 1G6NA 5FMOL 2OYZA 4J1WA 2CL2A 3JBG1 3I3DA 4FPGA 3S7EA 3ECQA 4FO9A 5FZ3A 1OVPA 3K51A 1QMJA 4Q4W2 3O7OA 4XFAA 1G9AA 4XJAA 5H9SA 5FOBB 1O59A 1MS1A 1XNKA 2BQPA 1X8MA 3I49A 3KD4A 4N8MA 1TMF2 4NHKA 4JC1A 3J8F2 5DQ0A 4WM8A 3KZ4C 5JMOA 1F4HA 1GOFA 3DCQA 3QBQA 4LA3A 5DUUA 4U36A 3P1IA 4BQYA 4NIGA 4QPGC 4L0PA 1AYM3 4Y1YA 1NXD1 3I2OA 1MQTC 2YBKA 4PJYA 1RJ8A 3IDCB 1UN1A 2A3XA 3KF5A 3FL7A 2VAUA 2ZX0A 4IE6A 4AK3A 1O8SA 3B02A 1WUVA 5E6HA 1NOVA 4XF0A 2DVFA 2CSGA 1QXRA 4A44A 3OBRA 3B94A 4MGSA 2R061 4DFSA 3GBWA 2QQPA 2YBPA 1AL21 2VUAA 1ND2B 3U0ZA 1RUE3 2AEYA 1DHKB 2Q1MA 5DAXA 4FXGB 4I09A 3PIGA 5F2SA 5FRAA 3PL0A 5BNOC 2VM9A 1TE1B 4AYUA 4H14A 5CAZA 2HWD1 1BJQA 3RPQA 1HRI3 5FZ4A 1GWKA 2WFF1 4ET7A 2GNTA 3OF1A 4ZXEA 1YQ6A 5F5QA 2B46X 4JQRA 5DUWA 1UU6A 3WNMA 1JZ7A 3PU3A 4YW1A 1PO21 1V70A 3VZKA 3HEIA 4BQ5A 4K9SA 4D6RA 3EO6A 1UIKA 1HIXA 3AZZA 2SLIA 5KC5A 4UFMA 1WZXA 1A3KA 1NLQA 4R9AA 5HCBA 1NZCA 1CZSA 3OPTA 3MO4A 4GWNA 4OZXA 5A3MA 4GMP0 5JI7A 4GB32 5GZFA 1WMDA 1SLLA 2YBSA 4LTAA 3E5UA 1ASJ3 3N7MA 4R9CA 3VBHB 4FQ4A 5JI9A 1GQHA 3WP6A 1US2A 3AVSA 5JLVA 1XNDA 2A73B 3NQHA 2PXJA 3ENRA 1W9TA 2AR6A 1HB3A 3AC0A 1GOGA 4RR3C 4XMIA 3ZSEA 1VBD2 3POIA 3R05A 4QGLA 2LUWA 2WNEA 3NNGA 1VB2A 1UZZA 1W3VA 2VBBA 4JDOA 3WW4A 4DZGA 5I0SA 3T30A 4TTGA 3ACIA 4EWEA 3LSEA 5LBCA 4QM9A 4UW4A 4CPBD 3WZ1A 1ND3C 3POGA 1LHOA 5GLVA 1U5IA 5GZEA 2ZZJA 3ACFA 1NA1A 2R0HA 2VZUA 4ES8A 3DPRA 2ES3A 2GC1A 2VW0A 5FZ0A 4MGQA 1PNFA 4JV4A 2WT1A 3CIHA 3HBZA 4QU2A 3ZSKA 2HEVF 4HZFA 1R091 1PGW2 1SZBA 4LUMA 1NCQB 4NE9A 5C3OA 4LK7A 5JZGC 1XBFA 3DV8A 3VBOA 3HR9A 3ZYJB 2VQ0A 1GSLA 1R081 4WM7C 1PO11 3FN9A 4MYEA 4E8CA 1EUUA 3RNSA 3H1MA 2Q8CA 2WWJA 2A6VA 1KS4A 2XLAA 1Z78A 1O3TA 1JTZX 3S5QA 4AFMA 1KXGA 1MZFA 1GNHA 3JXSA 4Q1PA 2BNMA 1S0FA 1N1SA 2VY0A 3WF1A 4AQTA 5D8AC 2B42B 4PQ9A 1W2TA 1XYPA 5DDJ2 2E33A 1ZA7A 2XB6C 4QPYA 3VDDB 4EN9B 3VDAA 4YW2A 4A7KA 1C8M2 4Q26A 3M3OA 1W06A 2D5HA 1IOAA 4F7ZA 1ACCA 1LR5A 1RL3A 1RUOA 1FOD1 3W59A 3ATGA 1QJU1 1QJX2 1SCSA 2RE9A 4M4PA 2P3YA 4PIYA 1RUI3 3AMPA 3ZYIB 2GP3A 3LWCA 4R4ZA 1W99A 4GAZA 1LRHA 2BNOA 4CDXB 1W9FA 1REFA 5FCCA 3VKNA 1WLTA 4CEYB 3WQ0A 4FP2A 4A6OA 3S5AA 2YU2A 5SV5A 4BIOA 4EZHA 5IAXA 2WZR2 2D3SA 2ZZQA 3M70A 4YGBA 5CIRA 2HBTA 1NXMA 3MLLA 1F9KA 3VKFC 4AHWA 1LKNA 3VGIA 1OUXA 3WDWA 1U5ZA 3JD71 3LEGA 4LT5A 5ACA2 4YVSA 1KJRA 2JG9A 2VMIA 4ASMB 4EYUA 1DQ1A 1JYIA 2J22A 3PTYA 3LA7A 3SXWA 5KXCA 2ZEWA 2FQPA 3KHBA 1Q8SA 5DZFA 3OYWB 3VBSB 5BUVA 1DCSA 4OUEA 3NJVA 3ZN4A 4AQSA 2O14A 3IDAA 4BHPA 3KCYA 2ARAA 4Q4X3 5H9PA 2JDKA 3GZUC 3P5BA 3WCSA 2WJSA 2WN3A 1B35B 2YGMA 4CCJA 2XG3A 3FC0A 5FUNA 2R1BA 2WL1A 4E4DX 5A3OA 4AGGA 3CF6E 3BI3A 3H3LA 1ZVFA 5FZLA 4Y1UA 1DGRA 1W8TA 4GMP1 4Q4V2 5SV8A 5AFEA 1N1YA 1N1VA 2ZACA 1SLIA 3VBRC 1XSQA 1EY2A 1FMD2 3PNAA 2DUPA 2R073 4D3WA 3X29B 3ZN6B 1UY0A 1XNAA 2JDUA 4FVVA 4GIQA 1CAVB 2G19A 5F3GA 2Y6HA 4WV8A 3SISA 3RYRA 4PIXA 2HWF1 1O4ZA 5IW0A 3VHPA 2XBO1 4CEWC 5F6KA 1I3HA 3NJYA 2Y34A 3T08A 2FHRA 1AXKA 4DS0A 4FFHA 2VVFA 3QACA 2WQ8A 2E6VA 1IKQA 3NJXA 3PHMA 4I0WB 5HCHA 2FDIA 2FD8A 4YM1A 4M3CA 2VOWA 4AL9A 3WNLA 2YGLA 4XUTA 3NO8A 1C1LA 4LIUA 3V0AA 4LHLA 1IPSA 2JD4A 1GP6A 1HN0A 1XYNA 3SCFA 3MV11 3A7QA 3MFCA 4CDQB 5IVEA 4XFHA 4E2QA 2VQTA 4JZRA 3VZNA 1DFQA 2GC3A 5FFOC 5C71A 2RMU1 3OPWA 1RGSA 3N9QA 4JAAA 5LA9A 1NLRA 1PZ9A 2OZJA 2WINB 1SLAA 3GYDA 3ES1A 3WNXA 1OQEA 2ENRA 3P6BA 4KG8A 4QXCA 4P9JA 4H55A 4TZDA 2JENA 4QXBA 3UNPA 2WZPP 3TEXA 4YZ2A 1VAMA 2W47A 2ZGKA 4NHLA 4XVHA 4LKSA 2C6SA 2QE3A 1GOHA 4BLJA 4UT5A 1OOPB 4Z2WA 1STMA 5LATA 1N3OA 1Q43A 5A3TA 3I3QA 2VZQA 1UYPA 3NNMA 3O5SA 4YZ5A 4FTBA 2QFEA 2HEWF 2ADEA 3E6DA 2R30A 3N3HA 1YXWA 4OMCA 3KM5A 4TWTA 1Y3TA 1US3A 5LBFA 2D97A 1VPHA 4XDPA 2DWRA 2JECA 1WCUA 3DYPA 1BZWA 1K5JA 1TME2 3Q8FA 1SFNA 1W03A 1PNGA 2YV8A 1PVC2 5FTTC 1CAXA 1UZ0A 2ZMKA 1KS5A 4BISA 1ULDA 2EXIA 4QPGA 5T55A 1K5MB 4LO4B 1QGLA 1A78A 1EUTA 1MQTA 2A6YA 2JIJA 2BBVA 3C7GA 1WLDA 1O8PA 1QEXA 5G04L 2ZPXA 3VHOA 1FNYA 1PZ7A 2NQYA 2BWAA 4N7IA 2QJVA 1U0AA 1ZZ6A 3LEIA 3MIEA 3I7DA 4B7KA 3MUY1 1W0OA 3MF6A 2IFRA 5CKMA 3ASIA 5FMBA 4BH9A 5CA6A 1ZZ8A 5EFUA 3TOJA 3J9SA 1Q8PA 1SEFA 1RMU3 3F95A 3OD4A 2ZEXA 4QDQA 1W28A 5ABJC 2BJSA 5DXDA 1DQ4A 2WA4A 2Q1FA 1BBT3 2LALA 2OXBA 3PMEA 3DGTA 1IS5A 3KV4A 3RZKA 2WS92 3LOBA 5FBJA 1F2NA 2RS52 4L9BA 2EAKA 2PFWA 2XKPA 4FT8A 2KXLA 3WUDA 4BMEA 4CCDA 2W08A 5KWRA 3T4VA 1CONA 4LKDA 1PK6A 2C9AA 3U75A 5IWFA 2DV9A 1T2XA 4Z8BA 1K45A 3NWKA 2R1DA 2B9VA 4JTNA 3VL9A 2P3KA 2CGPA 1G8WA 2E7AA 2ZGTA 3DXTA 4FPHA 1QF3A 4DXRA 4QXHA 3K77A 2MEV1 4BCUA 2CWMA 4P02B 2VQUA 2IXHA 4UF0B 2VZSA 1RHI3 2ZHNA 4YARA 1KITA 4HKLA 5FPXA 3RRDA 1S0JA 5LRSA 1ZREA 4HVRA 3LEKA 1YHFA 1VAKA 1ODNA 1AR62 4YW3A 2YXSA 2RV9A 4L2NA 2RS33 4QQLA 1RUJ3 2F4LA 2ZGMA 4P9XA 1OPMA 2MNGA 1YI9A 1LOEA 1XU1A 4W6WA 1Z7S3 1OLME 5A6YA 4P9IA 2Q5TA 1VBB1 2BYVE 3WNKA 3OTFA 3I3MA 4MH0E 4XJUA 4GH4B 1J83A 3N7JA 1IKPA 4QDSA 3MPBA 4XABA 1A6CA 2DBIA 2OW4A 1OMIA 1ND3A 4MUVA 2QNKA 4IE5A 1J3PA 3AMMA 2PHXA 2WZ8A 2YG0A 4QDRA 4Q4X2 1TEIA 2XHNA 2WAAA 2HWB3 2QTWB 5FXWA 3LE0A 4LPLA 3GJBA 1SBDA 4CP2A 1J58A 1QHDA 5DAPA 1CAUB 3BKZA 5FZ1A 4F8AA 1UMIA 3NL1A 2WLPA 1FV3A 4YM2A 1JOJA 4OHVA 4LITA 4B29A 1POV3 3AKSA 4XUOA 1MS8A 1W9YA 1DQ6A 1JHNA 4WM7A 1QIQA 2OKXA 3KWVA 1S0CA 4IEVA 2IFWA 1RUG3 4HVQA 4N9HA 1HRV1 5F6LB 1PIV3 3A4UA 4JDNA 4YFWA 4L99A 4Y1XA 4V1PA 3DKQA 3HAGA 1UOBA 4YZ1A 1ZBE1 4ORFA 1QJZA 1VAVA 2NYYA 3ORJA 5D8AA 4YVWA 4IGOA 1R1ZA 3WDYA 1GWLA 3CL1A 1GMMA 2ATFA 3Q9OA 4XJ9A 2PAMA 4Q2FA 3NW4A 2E9QA 3D82A 3K3NA 4NWWA 4UW5A 3C3VA 2NP0A 1J1LA 2BFUL 4LLFA 1W8WA 3SLIA 2Z5WA 3TYJA 4A2UA 4CDUB 2NN8A 4ZONA 1D4M1 4K7JA 1CQ9A 3J7NA 3WR0A 2HWC2 2IXKA 2RS11 3TRSB 3WVJA 2JE8A 1R1A1 3KQRA 1IQAA 1GZWB 5LWBA 2JX9A 4GWJA 5C9AB 2RM23 4QKFA 4FPEA 1M06G 2ZX3A 4KGQA 3O1RA 3D0JA 1V6NA 1MZ6A 1RVF3 3IIAA 3LAGA 1LJ7A 3NV1A 1AR71 3Q8BA 5FR3A 3POYA 4AGVA 5CISA 3WG4A 3UKVA 3FMGA 4OHYA 1GV9A 1QQP3 1LHWA 2BGPA 1UO9A 2OS2A 4O9GA 5T5OA 3BODA 2QQJA 4XTPA 5DPNA 1W9WA 2QQMA 1GZCA 3LQCA 4PF1A 1FT9A 4UFIA 1VBA3 2HYXA 1NA1C 3JU9A 3JQWA 4G3YC 5LBBA 4GWMA 1ND2A 1W8UA 3DPRC 3T2QA 2C26A 4Q4Y1 2DDUA 1UKRA 1W6PB 3RFRA 5AC91 3KS7A 1CGPA 3ZM8A 4JHTA 3SNMA 5JOZA 3WNOA 2VZRA 1RITA 5KHHA 3ZLIA 4YSFA 4COYA 1UMHA 4N43B 2IXLA 4XHXA 4FPLA 3VBOC 2ZX1A 3D8CA 4N53B 1WW4A 1COV3 1SPPB 3ZXJA 1O4TA 2HEYF 1UL9A 4E27A 4EZ4A 1AR83 3AJYA 4B8EA 1XRUA 4Y20A 4Z82A 5GZCA 2PN5A 2XOMA 2VTFA 3LFMA 4K3UA 3IBMA 4ZKTB 1EP0A 3WCRA 2WSVA 2VMEA 4Q1RA 4IEOA 3AP5A 2KA3A 4GALA 1GU3A 1NYWA 4MZUA 2VC9A 2WR9A 2CV6A 3VBRA 2IVJA 2WQZC 2XLFA 5K8SA 5LK5A 3H3UA 2XJVA 4IE0A 3GZEA 4XBNA 3H0OA 5FP4A 5IUQA 3WG2A 3VBFB 3WOGA 4N7UA 4LBKA 1AX1A 1SLCA 3I2GA 3VBHA 4FTEA 1URXA 2ADDA 2UURA 5CVRA 1OH3A 4AFDA 1DZRA 5BNPC 3DYOA 3W9AA 2IXJA 1GKBA 1XPWA 1X9PA 2YZ4A 3OUIA 4LOSA 4QHOA 1DDLA 2PQSA 1GQPA 3VKMA 4LHKA 4Z92B 2ZGOA 2GH8A 1MS9A 1UYYA 2RR13 2VXJA 3FE5A 2VMHA 4IV3A 2VPVA 3MUZ1 3MFAA 2EIGA 5EP9A 4Q0VA 5I8SA 2PHWA 3A23A 5FWEA 4OULA 4GULA 5I8TA 3IPVB 4DEQA 3ZFGB 1ZRIA 4Q0UA 4UAPA 4DIQA 4QQPA 4BZ4A 1UU4A 1VBC2 4RQPC 1EPZA 3U14A 4DRRA 1ULEA 2IVIB 4QMAA 1RIRA 3TEZA 4CP9B 2F4PA 3LD8A 1W6NB 3M7AA 5A7WB 4BQ1A 5KHJA 1A34A 1UIJA 2IWGB 2O8OA 2VULA 2WWUA 3CJIC 3FUOA 3BIWE 3KV6A 3KLSA 4LA2A 4NWVA 4LHSA 4S2GA 4AWDA 5LW9A 2VE1A 4K8FA 5JIUA 5C4WB 3D0SA 5FYVA 1S2KA 3V64A 3ILRA 1IS6A 1MS4A 1BMV2 1NY72 1ULPA 4OI0A 3DKWA 4MV2A 3I59B 5DG2A 1AL23 1S0GA 3LIGA 4WVMA 3HNBM 4LO6B 3WT3A 2BVVA 4Y33A 5FKBA 3T0BA 2OPWA 3NVCA 3ZYRA 1Y4WA 2RHPA 4JGZC 3PUQA 3RJRA 2A6ZA 4IGQA 4AVAA 5BNOB 4MXWB 3ZMNA 1VMJA 3AP4A 2XWBB 4AEDC 1LGCA 2C0ZA 1SLBA 2J1AA 5JOYA 1RUJ2 4RFRB 5J09A 1CAWB 2PHUA 3VDDA 1Z7S2 1YFUA 2XVLA 3SH5A 2P5BA 4JGYC 4C0BA 4EN6B 2RVAA 4FOYA 4S2FA 1PO23 3WDXA 1WA4A 1O6UA 1QXPA 3SMHA 3ZN5A 4V2WA 1LULA 5HPOA 1KDKA 2GAUA 1W6MA 4XXAA 3TB0A 3B9CA 4I0BA 1AR91 4IEQA 4CZSA 3WP5A 4MGIE 4Q4W1 2Y64A 1VB4A 1QY4A 5GLWA 1HB4A 4TYSA 3D6EA 2HWB2 1A8MA 1KEXA 1FPN1 4OHWA 5KC6A 5FY9A 4FSJA 4TSVA 4YRDA 2DF7A 3KCXA 1TMF1 2E53A 3J8F1 3UGHA 5L19A 1AVBA 3HIFA 5A70A 3WDUA 4QX0A 2QUOA 3T2OA 4B1MA 3H8OA 4G4FA 1RUD1 2K9ZA 1DF0A 2VJXA 4BK5A 3NAPB 2NMOA 3T09A 1BXHA 3E6BA 4NPRA 1LHVA 1RUG2 3LOIA 3BU0A 2UY8A 2V5YA 3SH3A 4UWDA 1YRZA 1C57A 3ACLA 5AVAA 5CFDC 5CADA 5F5IA 1JZ4A 1ZZCA 4IV1B 3ZO0B 4JKLA 2QDNA 4MGKE 2A3WA 2VL4A 3OYWA 3E5XA 2BDRA 2OQ7A 4DY5A 2BVBA 4XC9A 4DPNA 1LENA 2J42A 1EAH2 2EIDA 2VVDA 4LLOA 4P5YA 3TN91 2V09A 1DZTA 2E7TA 4NIDA 4B3NA 4PDWB 2UYBA 1UNBA 4LK6A 2WDBA 3ILNA 4OVEA 3LB9A 1R093 4YM0A 5JSOA 3C7OA 3VBUB 3SITA 4J25A 3C7FA 3VZMA 2YHJA 3R4SA 1J1TA 1RVF2 2W0XA 4P9WA 1R083 2ZA9A 4W6YA 4P08A 5KXDA 1O3QA 4KQ7A 3QCWA 4OYUA 4S2DA 1EV11 1QQP2 2VUJA 1DQ5A 1VE0A 5LEKA 3PVOA 2R6QA 1CJDA 1CAVA 2AYHA 3K4AA 3UK9A 4AI9A 4XACA 4PI0A 5CYYA 4NIAA 1IQDC 1VRBA 2EALA 2ZMLA 3NNFA 5EWSA 3SC7X 4CUBA 5C3QA 4GB31 1VBA2 3H1WA 4QB2A 3LDRA 3KT4A 4UBGA 1BEV2 1QNWA 2GN3A 4D94A 5I0DA 4PLOA 1VBE2 2VOXA 3BIEA 1QJU3 1AUYA 5C5TA 1OT5A 5IAVA 4HETA 4H7MA 1V6KA 4QKDA 2CYFA 5J3UA 1O4YA 3TEYA 1VBD1 1IHMA 1JOBA 4CDQA 1RUNA 1COV2 2H0VA 3FLPA 3PVNA 3T0AA 3WX5A 3ZXFA 3RZLA 4ASKA 1OLMA 1AR82 5JXGA 3FLRA 5CG8A 3BVCA 3VD5A 1IPKA 1MEC1 3E6CC 1OF4A 1H8TA 1OPOA 3LCPA 3WW2A 4LBLA 4YPJA 4BQWA 4CDWA 3R0RA 4E4HA 4CA9A 5LA1A 4ISRA 1WBFA 2RDRA 3POSA 1KDMA 1OOPA 2R49A 1OF3A 1PK6C 4C90A 3K3OA 1UPIA 5IATA 1PGW1 3T2TA 3I2IA 3FHIB 5FMOS 2WYFA 3H8RA 2ZBJA 3AP6A 3VUOA 2VQAA 2Y6LA 5FZBA 4K8RB 5G05L 4NN0A 5A6XA 3P3PA 4IERA 4EQVA 1UAIA 3WQBA 1J59A 2RR12 4DEVA 4GKYA 1JZ6A 4BA6A 1QDCA 1P8JA 4LBNA 4AI3A 5JAXA 5DDJ1 1RJ7A 4BLIA 5FO7B 4NRMA 4EROA 2A75A 1W0PA 4BU2A 1JYNA 3GXUA 2LW8A 2Y6KA 5B2GB 4GMP3 1C8M1 5JXIA 2ZX4A 4QGNA 5D1IA 4AVVA 5EPAA 3WXPA 2D98A 1VR3A 4KU7A 4FQZA 1QJX1 3GALA 4A4AA 1N47A 5HCAA 5K7PA 2VZVA 2BRTA 3GJAA 1W6QA 2HWF3 4XTMA 4CEWB 2XH6A 2LRPA 2XBO3 1GANA 1OFSA 2ZKNA 2ZS6B 3OGVA 5JVVA 2VZ1A 4HSJA 5L7OA 1CZVA 1Q8OA 4M3CF 1HJFA 1AL22 1BVP1 1QU0A 2VCCA 1JMUB 1G9CA 1NCRB 2WZR1 4LMFA 3CBNA 4AR2A 4CXYA 1V9U2 2Y0OA 1YQ8A 3R6SA 3V0BA 4JCKA 1HB2A 4UYBA 1Y9GA 1PMHX 2JG8B 4XJ8A 3PURA 2FDKA 5KHIA 3AMNA 4LORA 1JZ8A 4HOOA 2PLV2 4AZZA 5IK7A 2D3RA 4META 1SDWA 2TBVA 5ACA1 1ZRDA 2Z69A 4H7LA 1M4WA 2XJRA 2R7EB 4Z1VA 1PO22 1H30A 5LB6A 2YFZA 3IN9A 1GZTA 3INAA 4YVWC 2FDHA 3KVBA 5FY8A 5T3NA 2FMYA 1MR5A 1Y7BA 2BZDA 3CMGA 2J1SA 4KNCA 2D40A 2CDOA 3GGLA 3Q8CA 3BU7A 1YO8A 4RS5A 3ZR5A 3MW3A 4HN0A 4G9SB 5BNPA 5JSPA 1YEWA 1F5FA 2K0GA 3K48A 2ARCA 3K46A 1PGSA 1HW5A 4C0HA 2ZGQA
chains in the Genus database with same CATH topology
1IGOA 2PQQA 1HXS2 3ZYPA 2YPJA 4Q4V1 4CYDA 2D3PA 2DU0A 4DQAA 3MI8A 1FMD1 2VW2A 3ZFFA 4KWJA 1S0EA 4K6BA 4B4RA 4Q0SA 3AZXA 2VVEA 1Z0HA 3ST7A 4RQPA 3WDVA 1O3SA 4IEPA 1QJY2 1ZRRA 2WNVB 4XF3A 4ONUA 1ND2C 3CJIA 4YGCA 4BOWA 1XNBA 3MIBA 2AH2A 3AXDA 1LHNA 5C33A 1YJLA 5FAXA 5BXXA 4BPZA 4ASLA 3MLJA 2WT0A 3ZPYA 5FO8B 1CPMA 1F8VA 1R082 1ZX5A 2ZABA 1DQ2A 3R4UA 4JGZA 3SCHA 2DVGA 1LOFA 4AEDA 2V73A 1CR7A 4Y22B 2N7GA 2X29A 2QKDA 2H6BA 4LUKA 4WVWA 1FYUA 2BEOA 4YZ4A 4JGYA 4HPKB 1AYM2 1X50A 4K20A 4CDUA 1NLSA 2Z79A 2I07B 2R32A 1YLLA 3VBHC 4CP0A 3APBA 4ISQA 3TNQA 1JUHA 4KH9A 2WNUB 1QJU2 1B09A 4ATEA 2VNOA 3ZMOA 2GMMA 3GZAA 1RUE2 1UX6A 4YM3A 5EYXA 1TME1 1UPSA 1RC6A 3AFKA 4IV3C 5GLUA 1LCLA 1PVC1 1CD3G 4LHNA 1OLRA 2WIIB 4XJWA 1YFYA 3VZLA 4LBQD 2ET1A 4WM8B 1HRI2 1XE7A 2QCSB 2DCJA 3W58A 2HWE1 2CY6A 3PVEA 5C8CB 1N1TA 3USUA 2WFPA 5FOJB 4ZU4A 5CFDA 4TLFA 4BWOA 2ZHLA 3QH7A 1BKZA 2VG9A 1X82A 1AJOA 2VNRA 3B5LB 3ZXEA 4JRLA 1HLCA 4N43A 2DCTA 3B93A 4QPIB 1V00A 5BNNB 5JWPA 3IDEA 1ASJ2 4E4ZA 1ENSA 3CLPA 3ZFEB 1RUC3 2WS91 1ZYBA 2RS51 4L11A 3MEPA 2DURA 2E51A 4E4SA 3NV4A 1YFXA 2PAKA 1H8VA 1HRV3 2QZ2A 3VDDC 4AHYA 3EHKA 5J36A 1I1EA 1VIWB 2A70A 4GA9A 5E8AA 1PHMA 2ETEA 1AYN1 4FPJA 1QNYA 3H7YA 2ZGRA 5JSRA 3QLQA 4R52A 4SLIA 3GBGA 1D4M3 4CEYC 2ZAAA 2JKBA 4AI2A 4YG3A 3OD0A 1NE6A 1AR61 2RS13 2W39A 1VLNA 2AGSA 3IPVA 5FQ0A 1H9PA 1ZZ7A 1KFUL 4HN1A 1RUF3 1T6GC 5CNAA 4XF1A 2WT2A 2TEPA 3EXUA 2BUKA 4BE3A 1AR73 5JR7B 2CWSA 2PHLA 5J48A 1KFXL 3AMHA 3HT2A 5I0UA 1LEMA 4YW4A 2EXJA 4C1XA 4UW6A 3ZXAC 3VBSC 5FPZA 1LGNA 5C4WA 4YFZA 3THTA 5LEJA 4WVZA 4LBQA 1NA1B 4I3GA 5JOWA 4FP3A 2C1FA 4KG0A 5F9TA 3DPRB 1H2MA 1B35C 1QH6A 4D7YA 1NG0A 1G9FA 2JE9A 5CFCB 4Q4Y3 5K9YA 3HT1A 5T5LA 4C91A 5AC93 5GZGA 1WW5A 4JTOA 1RUI2 2EAAA 1MACA 1DBNA 3VBOB 1N3QA 4B4QA 2OIIA 1BVVA 1JN2P 1HQLA 5K0UB 2VH9A 3AZWA 3NV2A 1MVEA 1OA2A 2GC2A 2NLRA 4XFFA 5HBAA 2D6PA 4HT1T 1A8DA 1D0HA 3LGRA 2DUQA 5BNQA 3VZOA 5C6CA 1UKGA 3ZVXA 5A33B 2ILMA 2D5FA 2UWCA 1UMZA 5KXEA 2HWC1 4I2OA 1RUH1 5GJ6A 2Q30A 3U11A 4RHV1 4P9LA 1DGRN 3J26N 5JPNB 4AQ2A 2GALA 2DVBA 1XYOA 1LEDA 4K21A 2JICA 3NAPA 4MGYE 3G7DA 3GNEA 4CDQC 1AX2A 1LOCA 4QX5A 3UKTA 3ILFA 2DU1A 1ZNPA 4JDMA 5E89A 4QM8A 1H8TC 3E97A 2W52A 3M3CA 2FBEA 4IV1A 4CDWC 2I45A 1XXNA 3HN1A 1MZ5A 2Q4SA 4OI1A 3RS6A 3H50A 3LSDA 2XL7A 4YVSB 2JG9B 1OOPC 2BNNA 3OCPA 2R072 4HBNA 3N4MA 2DCYA 2HKXA 4Q8KA 4YG0A 2FMDA 1LECA 3LA3A 4L92A 4BYYA 4AFBA 3DL3A 1H1AA 5GLTA 1IPJA 2H6CA 3B00A 3RJ2X 3JB4C 3ZXGA 1VJ2A 2DFCA 5LK7B 3AX4A 1JUIA 1NQDA 4XIKA 1CVNA 2CGOA 1GQGA 3MYXA 3PMSA 3NKGA 3H7JA 2B7YA 3VKOA 2PA7A 1QOTA 4A3XA 1I5ZA 2X5IB 3D5OA 5GZDA 3VLBB 3MICA 4RSUA 1H9WA 2G4IA 1SCRA 4I01A 1H4GA 3PJQA 1YJKA 1AXZA 4XYXA 1OHFA 3MLKA 2B39A 1VRH3 4Y26A 2XL9A 3OBTA 1PGL2 3WHTA 1AR93 4DINB 4Q4W3 1S0BA 4AW7A 5L7OC 5BV6A 3RI9A 3KCCA 4ZU5A 2ZGPA 1FPN3 4FPKA 1GZ9A 4M3CB 1TMF3 1RUC2 3J8F3 5CG9A 3V0AB 1O7FA 1RUD3 4COWA 3JB8A 4RA0A 1VBC1 3AK0A 2P37A 3RSJA 1OD5A 3DUIA 4XETA 2IXCA 4OI2A 2MPFA 3JQXA 3ZDSA 2R043 1C8NA 2CAVA 2TUNA 4N90A 2CGNA 2D7FA 3N7LA 4X8PA 1QH7A 1UU5A 1XE8A 3H3ZA 3S30A 1UF2C 1LU2A 4W65A 3AYDA 1VALA 1BMV1 2JXAA 1NY71 1SMVA 1WD3A 2Q8OA 1S1AA 1DU3D 3UJQA 2BFUS 4XE9A 4OHZA 3TN93 3ZXDA 3TAYA 3CJXA 4RS5C 3AXEA 4DNYA 2GU9A 2RS12 2X53S 3M8LA 1JW6A 1OKQA 3JBG3 1RUJ1 2R0FA 5FBZA 3ZSJA 1RUF2 2DTYA 4COVA 1RMU2 2AUYA 3KT7A 2YC0A 3J4UH 5T52A 1AR72 1ZBA1 1OLQA 5A32B 2P3JA 3ZFFC 1H1MA 4PF5A 3MPPG 2YUEA 1BBT2 1IS4A 4D7TA 1EV13 1SACA 4J1XA 2D6KA 3ELNA 3B3QE 3M3QA 2BW8A 4QPGB 2XJSA 3THPA 2AENA 3OPZA 3G6JB 3AJZA 1LHUA 1LGBA 1X8EA 1MQTB 1H2LA 4GB33 1D2SA 2Q1ZB 1WW7A 5FLIA 2VNGA 2EF6A 1CJPA 3AP7A 3E5QA 1NCRA 1O3RA 1PZ8A 1NCQA 1LB2A 3BB6A 2JG8A 4M01A 4AFAA 2ZHKA 1U12A 5L73A 2R063 1RUG1 3H8UA 1VBD3 3R4DB 1DYKA 1RHI2 4KGGA 4BIFA 3WQ7A 2GC0A 4C1WA 2LTNA 3KGLA 3PJYA 4O9EA 1QOOA 1LOFC 5BYNA 1JH5A 1UW8A 3JCIA 1MEC3 2HWD3 5IK4A 2RS32 2WFF3 2JE7A 3HD8B 1EAH1 1GR3A 3H9AA 2GN7A 4CDUC 5H9RA 4WVVA 1X33A 4XDQA 1JBCA 2PAEA 4NHMA 1WD4A 4XF9A 4XFBA 5E16A 4E9KA 2YROA 4QQ2A 4CDXA 1V6LA 3AKRA 1WMEA 4CEYA 2CNAA 5T5PA 2Y0IA 3RYKA 3VHRA 4CTEA 3RZZA 3URFA 1QQP1 2ZOEB 1CESA 2QZ3A 2PYTA 3I2DA 4M0NA 2ZJCA 1BCXA 4RR3B 4EWDA 1YI7A 1PIV2 1D2QA 1VBA1 5E88A 1WW6A 1C8M3 2WNVA 1BEV1 5JMCA 5LRRA 2XJUA 1VBE1 4HMZA 3VBSA 1QJX3 3ZIXA 1ND3B 3AZYA 2OZ6A 4FBFA 4N43C 1Q5OA 1H2KA 4MX3A 4AEKA 1ALYA 4HL0A 5A3LA 1B35A 1C1FA 1ENRA 4AI8A 4FAHA 2RJLA 4L97A 2ZGSA 4KWLA 3B7MA 2GZWA 1Q8VA 4I0AA 3CEWA 3IM0A 2WZR3 1KD7A 4IEWA 4JVAA 1JYCA 5JZGB 1H2NA 4DOUA 2RM22 3KGZA 5C8WA 4IEYA 5EXOA 1S2BA 3A0KA 3RWNA 4FPYA 4WM7B 1HQWA 1PO13 4XIOA 1AF9A 4HPKA 1ZRCA 1Q56A 5JIAA 5ACA3 3TNPB 1G86A 3PLQA 1FX5A 1YWKA 2YMZA 3M4FA 3ZN6A 2P3IA 3VBFC 4Q0PA 1YYNA 5D8AB 4IEUA 2UWAA 2I74A 1UD1A 2WQ4A 1VRH2 2WNUA 3AB0A 4IEXA 4LNVA 4LO7A 4PLNA 1AR92 2BWCA 1MZEA 2WKKA 4A7YA 2B8MA 4R4XA 2RR11 5EZWA 3ZSMA 1FOD3 2GH2A 2YDEA 4FOVA 2VGDA 1FPN2 4GXLA 1GBGA 2UYAA 4COUA 4I02A 3ZXLA 3ZFGC 1PVXA 1XQNA 1OA4A 4OFGA 1RUD2 2IXIA 4A7ZA 3IWZA 4Q4V3 1WCSA 3QOPA 3ES4A 5C8CA 5I91A 4K1YA 1C5HA 1FMD3 2ZTNA 2R042 2RJKA 1UZYA 5EV7A 5FREA 2P17A 5CU1A 1FNZA 1HV1A 4ZU7A 1HX6A 2O8QA 5C4WC 1BQPA 1AJKA 3JD73 2GDFA 1G9BA 4QPIA 3TN92 5BNNA 3L2HA 1V9U1 4HFSA 3ZFEA 4I30A 3LZZA 4J6GA 4FOQA 1DLLA 2PHFA 3RYPA 4YGDA 2PLV1 4KU8A 3JBG2 4P9GA 1ULFA 4XMAA 1DIWA 1ZM1A 2XHKA 3L2YA 4E2GA 1O5UA 5I93A 1QOSA 4Y20B 2VW1A 1EV12 1AX0A 1K5MA 1XNCA 5J37A 1XU2A 2I2SA 1WLWA 1FXZA 3VBRB 3FBMA 2E7QA 4Y24A 4XFCA 3O12A 1SBFA 2Q0AA 4LULA 4Q27A 1HXS1 1ZRFA 3POWA 1LTEA 4PBPA 1CIWA 1ULGA 3NAPC 5GKAC 2R062 4IESA 3LA2A 4INDA 3UKNA 3AKPA 3D4KA 3T1LA 1TME3 4FAGA 4IV3B 4F83A 2D6LX 2EXHA 1FV2A 1O91A 3ALQA 3M3EA 4BM8A 1PVC3 5I8YA 2GNBA 2YY1A 1IS3A 1GICA 2JEMA 1MEC2 2HWD2 4IV1C 2GMPA 4X6QB 4EWAA 2WFF2 1W2UA 1QJY1 1FATA 1DYPA 1TQ5A 2HWE3 3AYEA 5GM0A 1Q8QA 4EN0A 1ONAA 2RMU3 2DCKA 4DMIA 3WW3A 3ZX7A 5CFCA 4PDWC 4AI0A 2XLGA 4NR1A 2ZHMA 3WDTA 3VBUC 2DTWA 2CAUA 2ZCWA 3BOWA 2WWSA 1SQ4A 4N9IA 2XVKA 5K0UA 4WVMB 3AFGA 3PVBB 4B4PA 2PHRA 2PHTA 2PHDA 4QXKA 3VL8A 3AP9A 2WS93 3QD6A 3VN4A 2WLQA 2RS53 2AREA 1AYM1 4AVTA 3KT1A 4KL1A 4IEZA 3M3IA 5A33A 2XJQA 3NV3A 4P5HA 2R16A 4YNIA 5T54A 3S7IA 4GH4A 1Y43B 5J96B 4XJZA 3N7KA 2B5HA 4ATFA 3FX3A 4D7SA 1ZA4A 1W6MB 2XPJA 5BY5A 2TNFA 2Y38A 3AKQA 1AYN3 3EJKA 3HMYA 1RUE1 4Y1VA 5GALA 1NQJA 4UBHA 4K40A 1CAUA 2AZ5A 4RL7A 1C4RA 1O5LA 1AR63 3ZYGA 2EVXA 1R092 1HRI1 4UW3A 4L8QA 2XUMA 3A0NA 3U07A 3VKLA 1PO12 5ABJB 4LO5B 4OHXA 2XGXA 4BMBA 2H0BA 2HJIA 4XFGA 5J98B 1W6OB 1L3JA 2O1QA 4IXLA 3OJBA 1V6MA 4HLTA 1YCIA 1ASJ1 1RTVA 5EYYA 1YIFA 2ERFA 3BCWA 1FOD2 3ME2A 3O0WA 3OY8B 4Z07A 1GZWA 4ES9A 5C9AA 1OA3A 3V56A 4AQ6A 2ZGNA 5FLHA 2MEV3 1PMIA 4XBLA 1LESA 1LOBA 4QHBA 4AXOA 4XXPA 4YGEA 3RG0A 4E2SA 3GF6A 2FZ2A 2X5IA 3FFQA 2Z2SB 4R9BA 3SHRA 4DXZA 2EXKA 1WBLA 3FLTA 5F1RA 1MVQA 3I4IA 5KHKA 4F3JA 4QQHA 2ARBA 3RMYA 2NZ9A 1I6XA 1KQRA 3AM2A 4RGAA 1EPWA 1G7YA 1FAYA 4AG4A 1MS3A 3CO2A 5AVPA 3JD72 2GMEA 1VBB3 1BK1A 4KWKA 5L36A 1W6PA 3O0VA 2HWC3 1QDOA 1RUH3 2IZWA 1CX4A 1NCRC 4RHV3 3WW1A 1AL0G 1NCQC 2JG8C 1E57A 2NPIA 3N35A 3NKTA 4N53A 3WHUA 4LR4A 4NOTA 4URTA 4XHBA 4COZA 3SH4A 2IC1A 5KBFA 2E63A 3AYCA 1H8TB 1GYKA 4PBOA 4CDWB 5CB7A 1WLCA 2OUHA 2UY9A 1APNA 3IMNA 4SBVA 4FPOB 1ZBE3 3VBFA 5AFBA 3CU7A 1QKQA 2BTVC 4P14A 1D0GA 3GBFA 3MF9A 1RUI1 2JJ6A 1MS0A 2HYKA 2HWF2 4Y5Z0 2K2SA 2XBO2 4DB5A 4AFCA 2OVUA 4CDXC 5IT6A 1Q3EA 4YYOA 4AEJA 5A32A 3BALA 4R8HA 1WGPA 1DGWA 1R1A3 5HXVA 3ZFGA 4QT6A 1PM7A 1SBEA 3BOPA 4EJRA 4P9YA 2BPA2 2OUJA 3NSTA 4HSLA 2D43A 1V6IA 3WD5A 2WC2A 2HWE2 2WNVC 1W6NA 2RMU2 1OFNA 5DZGA 4AE2A 1V6JA 2VOKA 3B01A 3EQEA 2D6MA 4Q4X1 1W6QB 4KBBA 5J7MA 3IKWA 2BGCA 1GFF2 3I59A 4FOWA 5L7OB 3MW2A 4QD2A 5DG1A 4HVOA 4Q29A 4GKXA 5BNOA 4U2AA 1F5JA 2CTVA 4MXWA 3V0BB 4IETA 3N36A 5TSWA 1CAWA 4X8NA 1VBC3 5H9QA 4R9DA 4FCAA 3VV1A 2R071 3MW4A 3IDBB 4LBMA 4K1ZA 3WP4A 1J3RA 1QXJA 2DVDA 3U10A 3WLUA 1G9DA 3U4XA 4PLMA 4D69A 2WNUC 1RINA 3CNAA 1AYN2 2VMGA 3IT8A 2KM2A 4W6XA 4LEJA 5T5JA 4Q8LA 1QWRA 4RS5B 1ULCA 4HKWA 2A5ZA 4H3WA 5BNPB 3O14A 3RI8A 2VECA 4IL7A 5FLJA 5FO9B 4B7EA 2DVAA 1GLHA 2D44A 4WM8C 4M00A 4LO8A 4MXVA 4RR3A 2D6NA 1YIPA 3JZVA 2XVGA 1CPNA 4AGRA 5C8CC 3ZFFB 3NJZA 1ZBA3 2P2KA 1LOAA 1U5XA 2UWBA 1LU1A 2B9UA 3WG1A 3JUUA 3KMHA 1POV0 4PIZA 3FWEA 1PGL1 1H4HA 3I54A 1SLTA 5JOXA 2F6BA 4RQPB 4XEZA 2DCZA 1DZQA 1H0BA 1IZ3A 4AVSA 4UXAA 4QPIC 3ZIWA 5I0RA 4Q0QA 2C5DA 3CJIB 4PDWA 4XPVA 2ZMNA 5BNNC 1C5IA 2FZ1A 2B45X 1RUC1 4LE4A 3ZFEC 1ENQA 1OQ1A 3MIGA 4M0HA 3ETQA 3RDIA 3VBUA 4CRQA 5JZGA 2GSYA 2D93A 3BTAA 5KHGA 2MEV2 1REDA 1VP6A 2YYOA 3HQXA 3ROUA 3RMXA 4YW5A 1X36A 4RGGA 2UU8A 4JGZB 1OI6A 5BPXA 2SBAA 2Z42A 4AEDB 2A3YA 2JDZA 1K5MC 4LBOA 3FUQA 3ZXKA 1EAH3 2P34A 4JGYB 5I0TA 4DY3A 3L9JT 4AHZA 4ITCA 4OLLA 1N3PA 1VBB2 2NMNA 3DF0A 1HDKA 3WINE 2PTMA 1UCXA 1D4VB 3AMQA 1RUH2 2O0OA 4RHV2 1X7NA 2VXRA 3V65A 3VZJA 5JDBA 1RUF1 2Y26A 1WMFA 1RMU1 4AVCA 2D6OX 5IK8A 4RD7A 5DUVA 4AF9A 3MZHA 1DGWX 5JPMB 3UL2A 1BBT1 3KSCA 1OSGA 3MGUA 2ZAHA 1S0DA 4X6RB 4HKOA 3USSA 4DRVA 3S0MA 3VHNA 3FZ3A 3TBDA 4WZCA 1HRV2 3GHNA 1F31A 3USUB 3TWIA 5CFDB 1BEV3 1ZBE2 1HQNA 2G9GA 3ZSLA 5CFCC 1YNAA 1DGLA 1VBE3 3FJSA 4LBJA 4YG6A 3MIDA 4EN8B 3M2MA 1J3QA 1DG6A 1RHI1 2DUOA 1D4M2 1H1IA 5K0UC 3I8TA 2WA3A 1WCKA 1AHSA 5JCTA 4FXKB 2RS31 1R1A2 2ET7A 3B69A 4EN7B 2QVSB 3LKJA 1Z7S1 2WSUA 4OUMA 4JRAA 3FFZA 2NM1A 2XKOA 1Y9QA 1HKDA 1C28A 4Y1ZA 4AVBA 4GH4C 3T1MA 1NE4A 2G9FA 3GZTB 1CAXB 3OGGA 3WV6A 3MIFA 4XFIA 5IK5A 2DYCA 3UV9A 3H1YA 4CEWA 1OQDA 3MDPA 2OA2A 1U5YA 1SFYA 2HWB1 2ZGUA 1C3HA 2W68A 3UJOA 2EA7A 5HCFA 4XQWA 2GNDA 2XJPA 4Q4Y2 4AI1A 2ZGLA 4HK8A 5AC92 5T50A 2XJTA 1POV1 3WP3A 1I9RA 1AZDA 5FQ0B 4RFT0 4XOGA 5E1RA 4FPCA 1PIV1 4XQDA 3DN7A 4GQ7A 4YVSC 4Y4YA 2JG9C 3SCGA 1ENXA 1EYBA 5HI0A 1LOGA 2OPKA 3KB5A 2A7AA 4PCRA 4NO4A 3QH6A 4FPFA 5CBLA 4MSVA 2PELA 4FTSA 1TNRA 3P3NA 4LBQB 4MGZE 1PK6B 4XILA 3OGJA 5GLZA 1V9U3 5DZEA 4ZXKA 3MIHA 2RM21 4CP1A 5C9AC 4EV0A 2ARXA 3O0XA 2XWJB 4MVTA 1RVF1 4OUSA 1MS5A 2VU9A 2X8KA 2PLV3 3WY6A 1FI2A 4WBBA 4M3CE 2X5IC 3GHMA 4LE3A 4QQOA 4YLZA 1ZBA2 3AKTA 4HK9A 4XF4A 1WCDJ 1ZZ9A 5DDJ3 2VOVA 1HV0A 2A6WA 1VRH1 4I3PA 4WZFA 2DFBA 1JXNA 4XQ4A 1CN1A 3BPZA 3C2UA 3EBRA 3RQ0A 1RB8G 1V6OA