3E5QA

Unbound oxidised cprk
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
209
structure length
202
Chain Sequence
NFFPIEKLRNYTQMGLIRDFAKGSAVIMPGEEITSMIFLVEGKIKLDIIFEDGSEKLLYYAGGNSLIGKLYPTGNNIYATAMEPTRTCWFSEKSLRTVFRTDEDMIFEIFKNYLTKVAYYARQVPTIRILRLFYELCSSQGKRVGDTYEITMPLSQKSIGEITGVHHVTVSRVLACLKRENILDKKKNKIIVYNLGELKHLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cyclic nucleotide-binding protein
publication title Molecular basis of halorespiration control by CprK, a CRP-FNR type transcriptional regulator
pubmed doi rcsb
source organism Desulfitobacterium hafniense
molecule tags Transcription regulation
total genus 47
structure length 202
sequence length 209
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2008-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3e5qA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3e5qA01
5H20A 4ORFA 5FB2A 5I8TA 2H09A 4KFCA 1ZRDA 3TNPB 5ICCA 3ELNA 5K5OA 2HYFA 2IA2A 4NHJA 5JSPA 2VOOA 1TQ5A 3BPXA 4LULA 1UW8A 4EJTA 4A0XA 1AOYA 4RGUA 3MYXA 1UIJA 3F6VA 3E6MA 4XFBA 3CLOA 5F1RA 5FGMA 1KU9A 1NYWA 4DINB 2PA7A 4BAYA 3AAFA 4BHBA 5EZWA 3FHZA 4LMYA 2XLGA 5ILSA 4OIOF 1QXJA 3ACLA 5JR3A 5BPXA 4X6QB 1S29A 3GFJA 1J3RA 4UV8A 5FLJA 2HTSA 3V7RA 2ETEA 4HF2A 2XAHA 3F6OA 3EO6A 4PCQA 2OYZA 1OYWA 3IL2A 4XETA 2RDPA 2LSOA 2Q8KA 1LB2A 2GC2A 1OPCA 5T3NA 2EFNA 1FBSA 2PQ8A 6PAXA 5KHIA 5ILUA 4Q0QA 2XAFA 1RC6A 2FF4A 1UD1A 2VE8A 3JTGA 1IRGA 3TGNA 2A3SA 3E5UA 1ZVFA 3RKWA 3RYKA 5D5WB 3UKVA 3IHUA 3K9TA 4YFNF 2ELHA 2PFWA 2XVCA 3IKVA 1CAUB 4B8XA 4OU0A 3RKYA 1FZPB 3ZMZA 1YUDA 4WXCA 1E2XA 1BC8C 2D1VA 1XCBA 3HRTA 4ON0A 2IC1A 4R79A 1LDDA 4XRFA 2CG4A 1O5LA 3I59B 1SMYF 2PMHA 1SMTA 3G73A 3K69A 1YW8A 5DD4A 1IRFA 3WTYC 1IXCA 3CDHA 2QUFA 5AVPA 3IIAA 3MDPA 5LHGA 4I3PA 4RAZA 1XE7A 1CF7B 3WW3A 4RB3C 4F7ZA 3ST7A 2OQGA 3D0SA 3OD0A 4EMSA 4R8HA 4HW0A 2HOEA 3GLXA 2KXLA 4R1HA 3TO9A 1WSUA 3CO6C 1DGRA 2F4PA 2HKOA 2V6CA 4OMYA 1I1GA 4XFFA 5EFUA 2A5YB 4BQAA 4Q29A 1IF1A 4EROA 2ESNA 2KJBA 4UUVA 1QZZA 4F8AA 1R58A 3H7JA 5FDBA 1IAWA 4XF9A 2XLAA 2Y0MA 3WGIA 5CVUA 4IEXA 4I2OA 3VHRA 5LHHA 2LF8A 1IPKA 3CF6E 3E6BA 1QNTA 2UYBA 3JSPA 1YHFA 1IN7A 1W5SA 2BNMA 4YARA 4CO8A 2Z9OA 2VE9A 2M1BA 1WA4A 1CX4A 3CJXA 3Q9SA 2D45A 2DPDA 3WW1A 3MEXA 1MD0A 2OD5A 2P5KA 3CUQB 3DPTA 3W6KB 1T39A 3LWCA 2NNYA 1SEFA 3LQRA 1IUYA 4P96A 1FP1D 1WWXA 4AIJA 4BIFA 4KWLA 1CAXA 4AD9A 3WTVC 2FSWA 3RDIA 1YQAA 2ETHA 2Q1ZB 2A68F 1FNNA 3I71A 2P5VA 1GXQA 3S2WA 5HI0A 5E1XA 4EJWA 1I5ZA 5HLGA 1UIKA 1BOAA 1G4DA 4KU7A 1HQCA 4BXUA 3KGLA 5FD6A 3I0TA 4BNCA 4RGXA 4HSJA 4U88A 4WXHA 1RGSA 3IDBB 4IVNA 2H6BA 2VONA 3HT1A 4K2EA 4KWKA 1LDJA 3U2RA 5HDKA 2BYVE 2L01A 2FOKA 4IEOA 1XGMA 2MH2A 3BDDA 2YX7A 2DK5A 4L9TA 3FXQA 2EFPA 1TNSA 4LB5A 1O3TA 3T8TA 4IEYA 2AS5F 2VPVA 1TQPA 4I0BA 1LR5A 2C6YA 1B59A 4EJOA 2VXZA 3GFIA 3TO6A 4UBGA 2LKPA 3N4MA 3WU1B 4CXFA 2IXCA 2JSCA 4HQMA 3FMQA 4OIQF 1ZG5A 2GWRA 4XLNF 3J81K 2DU9A 3D0JA 1UCXA 1STZA 3MCZA 4OOIA 3ZMSA 3MPBA 3M8EA 5L3BA 1YFHA 2W85A 5KHJA 3L2CA 3J80Z 2CWEA 2OQRA 3ZMVA 2QLZA 1PP7U 3F8NA 5C6CA 4CDGA 5IT3A 2PYTA 5I0SA 3ZMTA 2FMLA 4MGRA 4KUMA 4FX0A 3O6BB 3ZN1A 4G7HF 2X4HA 1WRJA 1QGPA 3GWZA 3H1MA 3GX4X 5HDGA 2XASA 2D2WA 1ZN2A 2XAJA 4L5JA 3U9GA 1EH7A 4M6YA 1K78B 4GULA 3BP8A 2HQNA 2QM3A 1SD4A 1YLLA 3PFIA 4YIIA 1RNLA 5D4RA 2DFIA 4WWCA 4AVBA 3IC7A 1RL3A 2XRNA 3R61A 2D1HA 4KNYA 3H8UA 1LQ1A 4HDUA 5LRSA 2L4AA 5FPXA 5BV6A 5KVRA 5CADA 2DW4A 5E20A 1RI7A 4JTNA 1G3YA 2Z99A 4ZYDA 3EBRA 5BOXA 3SCGA 2OAZA 2H94A 1FSEA 3H1WA 4EQQA 3DEUA 3B73A 3M1EA 1KGSA 2IVMA 3I53A 3QP5A 1XB4A 4OIRF 3REOA 1K6OA 2P7CB 2UXXA 1JGSA 1S3JA 4GYIA 4BYYA 4NB5A 2XKPA 2EFOA 5L3EA 2QBYA 4YIFA 1D8KA 4A0YA 2YSRA 3B02A 4KU8A 1ON1A 4MGZE 1XSVA 2PMUA 4M71A 3SZTA 2HFHA 2HWVA 3QPTA 1EPZA 5J8FA 2XROA 1SFUA 2EB7A 1Z7UA 4M74A 1FWZA 3KFWX 4MGYE 3GFMA 2MH9A 3DP7A 2IA0A 1REPC 2XLFA 2W57A 3ZQ7A 3BB6A 3I58A 2PQQA 3IWFA 4MZUA 3F8CA 3MZHA 1ZG3A 1MJAA 4XFCA 2E9QA 3LWFA 3NRVA 5H6QA 3E6DA 3V8LA 2ZBKA 1EV7A 4IEUA 3HRUA 1TLHB 4LLGF 2IXJA 4Y13A 1NE4A 4P9GA 2QQAA 1I1SA 4I01A 2P4WA 4N9HA 4EM1A 2P8TA 2MPFA 3KMHA 1USTA 3ECOA 3FF5A 4LD5A 4EWEA 1H0MA 2B8MA 3FFQA 1AWCA 1SD7A 2ZFWA 2LNBA 1VP6A 5JHUA 2RNJA 5BXXA 2ZO4A 4WVZA 4J1XA 2P5LC 4BH9A 5I0TA 2IPQX 3WTTC 4PGHA 1ZG1A 3NSTA 4OFGA 1X82A 5JSOA 3KZZA 1WQ2A 3T8RA 1XDUA 3IDCB 4JV4A 5FQ0A 4KMFA 1IN8A 4XFGA 4HF0A 2GXBA 2CSOA 3JW4A 4RAYA 3OV8A 1RIOH 3M3IA 2BNOA 5DUKA 4I7HA 4ZYGA 2DAOA 1HW1A 5D1IA 1JHFA 3JZVA 1H1MA 1YS6A 1ZGJA 4KWJA 4K8FA 2QWWA 1J75A 5J6XA 2Q30A 2PJPA 4WX9A 4HLYA 1LEAA 2EVXA 4HLXA 1YTYA 2PFBA 5BQTA 1EH8A 1LVAA 5KK1A 2QZ8A 4A12A 4ZU4A 2YPRA 2NRAC 3PLQA 3ZPLA 4JVAA 3KP3A 1FX7A 2UWMA 4CYDA 2H0VA 5D8KB 3ZN0A 1GXPA 4G6QA 3IKTA 3ES4A 1ZRRA 2OZUA 3UKNA 5HLIA 2VBYA 5CJ9A 1KQ0A 1PUEE 1CAXB 4RS8A 4HA8A 3FXRA 3L7WA 3BWGA 1CGPA 5FFXA 3F22A 3I64A 4RB1A 2Z3YA 4MEXF 1NZCA 1FT9A 3LOIA 4YFKF 3ROUA 1V4RA 3BPZA 3HOSA 5LEKA 1W4MA 4MNUA 4OLLA 4WF2A 2G7UA 4LUKA 2E7WA 5J7MA 3KGZA 3O3KA 5CYVA 1ZYRF 2OZ6A 1R00A 2EA4A 3IBMA 2G7HA 5JI6A 3FWEA 2VECA 5JR7B 3U11A 3FZVA 1F5TA 2RQPA 2YR2A 1YFWA 1D8JA 3CO2A 1EYBA 2BEOA 4EVIA 4ZYEA 1P4XA 1QO0D 3W6JB 2PHLA 1J59A 3I5UA 2XIGA 3L9FA 4IHSA 1IPJA 4D0PA 5K5RA 1PP8F 1UCRA 4L5IA 3PNAA 4HVQA 1PDNC 3CEWA 4O6JA 2ACJA 4X6RB 4HX7A 3KETA 1GQGA 2UY9A 2M5WA 1TQMA 3NQOA 5L3GA 2DPUA 3USSA 5JSRA 2V1UA 1U12A 1O5UA 1Z6RA 2VBXA 1KQ9A 1KA8A 2JT1A 1O3RA 4YNIA 3KLNA 3P9CA 1F1ZA 4FT8A 4B09A 2PLYA 3C3WA 4G7OF 3CO7C 1FBQA 1YG2A 2EA2A 3K2ZA 4I98B 4YRDA 4KT5C 3SXWA 4L0ZB 3E5QA 4CHUA 2UYAA 1Q1HA 3C7JA 5FD5A 5EEHA 3M7GA 2CO5A 3I54A 4LFUA 3KEOA 4ESFA 4Q4ZF 5ILVA 2MC3A 4O5VA 3MZYA 4KMUX 5LEJA 1R7JA 5K8SA 2ZMEA 4A6DA 5ED4A 1ZNPA 4QXKA 3R6SA 4OMZA 2KIUA 1T6SA 5D6FA 1HSJA 3HSRA 4YYOA 2K7LA 5HOOA 4IERA 2JTVA 2X0LA 2CV6A 2QCSB 4NVPA 1D5VA 2NAZA 3H1YA 4Q48A 3S7IA 1EY2A 2FU4A 4S05A 3LAJA 1NE6A 1C0WA 3P9KA 1L0OC 3CJNA 2IJLA 1TW2A 4ONUA 2HDCA 2HTJA 2O8XA 2HS5A 1S7AA 1YWKA 3H9AA 4PIYA 1YW7A 2Q2EA 4LGWA 1O3QA 3DFGA 4ZYHA 4KA4A 4CZZA 4YFXF 4XF1A 1LEBA 1GHCA 1SAXA 1FI2A 3I7DA 2QBYB 4GCVA 5I8YA 3WTXC 1OMIA 5KBFA 2NS0A 5BY5A 3RNSA 1H9TA 5FFZA 5JCTA 5J8CA 2RN7A 2XUBA 4UXAA 1P2FA 5CLSA 5E16A 5I0UA 1R5HA 1FC3A 2FA5A 1O4TA 1LRHA 1FBUA 2E7XA 1UHMA 3RYRA 5CVVA 3EHKA 2V1DA 4U0WA 1YFXA 4ASNA 3HQXA 4MX3A 3KE2A 2EFWA 4AIKA 4WXDA 4HDVA 5IT9K 4UV9A 4MGIE 1KQ8A 2FRHA 3P7NA 3V8JA 1TTYA 3IWZA 1XGSA 1P92A 4HV5A 3WTWC 1X8EA 1FLIA 1BIBA 2FMYA 1PMIA 2Q4SA 1WLTA 4I0AA 3BPVA 3C18A 5I91A 4P9FA 2EA7A 3PVBB 1R1TA 1P4WA 4E2SA 3TKYA 1I27A 2IXIA 3MWMA 2GA1A 3HIFA 4WBBA 5BUVA 1HBXG 2J5OA 3QRFF 1FY7A 2DCTA 2MNGA 3QAHA 2JPBA 4RGSA 3BJAA 5I8SA 1MZBA 3ISPA 3QP6A 2H6CA 3GYDA 2I45A 3H50A 2HYGD 2ESHA 2GU9A 4Q0SA 2A61A 2CW0F 2CQKA 1PM7A 4QWQA 4HN0A 1YFYA 4A5MA 4B29A 1ZZCA 3BCWA 3SXYA 2F2EA 2K27A 3KP4A 3TQNA 5HS8A 2IXLA 4ZZDA 3DL3A 1QXRA 5J48A 3SHRA 3U1DA 3GF2A 2BE5F 4IEZA 1P4AA 3QU6A 3K1NA 2XKOA 3TOBA 5C8WA 2V79A 3KP6A 1OD5A 4QGMA 4A5NA 2Y0OA 5FQ0B 3BJ6A 2IW5A 3NL1A 4MGKE 1W5TA 1XN7A 2W84A 1T98A 3EJKA 2C0ZA 4AIHA 4U7DA 1Z6TA 2A69F 3DKWA 4DNCA 3RTRA 3QACA 3FM3A 5D4SA 1Z1DA 4Z07A 2VN2A 3J81Z 5HVQC 1X7NA 4IEWA 3WTSC 5DCFA 4CICA 4QLCU 2CAVA 2BGCA 1BI3A 4IJAA 1O3SA 1K7AA 3EYYA 4HMZA 4UXNA 4H0EA 2QQBA 2PI0A 3NJZA 3PQKA 2RKHA 4AVCA 2VBZA 4PJYA 3LA2A 4IRIA 1U8RA 2DO7A 1W7PA 4M6XA 4XF0A 4M9XA 4HN1A 2L02A 5D5UB 4AVAA 4LB6B 1G3TA 5E1RA 5KHHA 3CLPA 2KIFA 1BC7C 4WZCA 1J58A 1U3EM 4UNOA 2OA4A 2QDRA 4XSXF 5BPDA 4OINF 5BPIA 3JTHA 5ICEA 2EV6A 1R1VA 4ENMA 4KYWA 4Q0VA 4KIBA 3HOTA 1LNWA 3V7SA 1ZX5A 4RGRA 4EM0B 1WKMA 2D5FA 4KIFA 2GAUA 1KYWA 2GQQA 2EV0A 4XLPF 2COMA 1IN6A 2PAKA 2JZYA 2R7FA 2KKOA 3OTFA 1ZGAA 5AONA 2ATFA 3WE2A 2O61A 4IPAA 3J7AO 1ZAOA 1L3LA 4LA2A 1R5GA 5KHKA 4UVAA 5JAXA 5J3UA 2OBPA 2V9VA 4EJVA 1Z91A 4HBNA 1R36A 4EGYA 1NHAA 3GUDA 2M87A 5ICGA 1EH6A 2VT3A 3NEUA 3R4KA 1YYVA 3RJPA 3BROA 1J1LA 5CVRA 3LQQA 1BBYA 1DUXC 2IRFG 4QM9A 4HV6A 1JUHA 2YX4A 1J2XA 2ET1A 3ELKA 5E17F 1OR7A 1B4AA 3HTSB 4ZU7A 3HT2A 4G9YA 2LDUA 3GBFA 4L2NA 2V1XA 1IZ1A 2J5PA 5DDGA 3V4GA 2Q0OA 4LJZF 4N0BA 4HLTA 3ECHA 3K1MA 2EJRA 1RZ4A 4P9UA 1UHWA 3ERED 1F4KA 1DDNA 1U6GA 1ZLJA 1LJ9A 3U10A 3EQLF 3F8FA 1DGWA 2WFPA 1XD7A 2OPKA 3KZYA 1TW3A 3WODF 4HVRA 2IP2A 2EK5A 1YIOA 3GO5A 4KN7X 5BS6A 1DZRA 4QX5A 1XSDA 3NVCA 3M70A 2PG4A 4LG0A 2ZMEB 3V7CA 1SFXA 2Y75A 4XBFA 1SD6A 2BBYA 1Z9CA 3QOPA 3OGJA 3E5XA 1TQIA 5I93A 2E1CA 1CAWA 1BN5A 5H6RA 4GXOA 1T2KA 3FJSA 2G9WA 3GYHX 1IN5A 2A07F 4QGLA 1IXRC 3FZ3A 1IW7F 1ZRFA 4FAHA 3Q9VA 3F8BA 2MBFA 1FYKA 3VODA 5HLHA 3F8MA 1O7LA 1QBJA 2GH2A 3WGHA 2QENA 1QY4A 3O2PE 4LTAA 4D7SA 2FEZA 5L3DA 2TDXA 3WGGA 3EETA 4G8XA 1Q5OA 3E97A 1UFMA 1HKSA 2FXAA 2P6TA 1BI1A 4I09A 4QM8A 1OKRA 2F5FA 1SQ4A 5HS7A 4ESBA 1J7KA 3WW2A 1D3YA 1Z05A 4IXAA 1QQIA 3K0LA 1R23A 1TBXA 2M8EA 4I02A 2ZNYA 1MKMA 1Q3EA 1WGPA 3CUQC 1MGTA 2GC3A 3DF8A 2UZKA 3NKTA 4GYGA 3ULQB 1U5TC 4FX4A 4PZJA 2DLLA 2JRTA 4KDPA 1G6NA 4XF3A 1H1IA 3HSEA 2D40A 4Z82A 4EV0A 4NQWA 1YW9A 2R7DA 5D5XB 1ZZ9A 1ZZ7A 5DCMB 4M73A 3ZP5A 4KN4X 1QPMA 1XGNA 2HEOA 1Y0UA 3SFZA 3C1DA 2MLGA 2GC0A 2DQLA 2VT2A 4U7BA 3SCFA 5K1YA 1YLFA 3GFLA 4J1WA 4META 2B0LA 4M9SA 4GO1A 2OZJA 1BJAA 2PBIA 2VOPA 4CGZA 1T38A 1B9MA 1MDMB 4KICA 1XCVA 4XFHA 3QU3A 1BIAA 1DPUA 1U78A 1R1UA 2MA3A 2PHDA 4OIPF 2Z2SB 2STTA 1J3QA 4MUVA 1W7PD 5CU1A 3T1BA 4WCGA 2HGCA 4ENKA 3F72A 4UVCA 2EWNA 3QPHA 3F21A 4PIZA 3WE3A 1CAVA 3FXUA 3H92A 4FAGA 1BI2A 2NYXA 3R0AA 2ADUA 4A6EA 5TRDA 2O6GE 3BU7A 2M45A 1OFNA 1XE8A 2KJCA 3PQJA 1FYMA 3HSFA 1VJ2A 5FCCA 4E70A 3TOAA 1I6XA 2LF7A 1G3WA 3HTUA 3BZ6A 3SHFA 1HSTA 2ZJ2A 1FSHA 2HKXA 3L09A 2QJVA 5E1WA 4A0ZA 4ENJA 1KU2A 2AXLA 3SQNA 3HYIA 4UBHA 4MTDA 2EFQA 4EGZA 1KU7A 4IEPA 3WG9A 1SFEA 2DTRA 4UHTA 3H3UA 4WK8F 4AQ6A 4M9ZA 5DD8A 4M72A 1O7FA 3ABUA 5HS9A 4R52A 4XFIA 5AIQA 3BOQA 3RKXA 5FLIA 4AVPA 3EUHA 2DK8A 2L3DA 3BJOA 3ML6A 5KHGA 5I0RA 2FQ3A 3BALA 3GZ5A 2W25A 3D82A 2F5CA 3LAPA 1FP2A 4HQEA 3CTAA 2Z69A 1HXDA 4LA3A 1W7PB 2WWYA 1JHHA 2XAQA 4L18B 1FPQA 1VTNC 3LA3A 4PDKA 3GVAA 4L0YB 4TV7A 5ERIA 2XL9A 3M8FA 5LGTA 3P9IA 3CUOA 2E1NA 5D6EA 1USSA 1ZZ8A 1UB9A 2PAEA 3HUGA 1E17A 2WC2A 1YS7A 4E2QA 3ES1A 3KP2A 2MD5A 3BY6A 2A6EF 4MQVA 4IRGA 3ETQA 5LGNA 2IXKA 1O57A 1T0FA 2H27A 2BV6A 1DZTA 1ZHFA 4S04A 2FNAA 3OCPA 2PEXA 1DP7P 4YSFA 5F64A 3JAMK 3G3ZA 4G94A 2GXGA 4LLNA 2D93A 2PN6A 4LLLA 3WU0A 3ZDSA 1UPIA 4AQ2A 2XV4S 4HF1A 2KIMA 3I4PA 5BMZA 4HYEA 1U5TB 2RV8A 5FLXK 4KL1A 4O9GA 5DCMA 3HRMA 1QWRA 5K5QA 4BHPA 2ZKLA 4L9JA 5DEQA 2V09A 4HBLA 2HQRA 4HVOA 1G3SA 2QVOA 1Q43A 1XDSA 1IXSB 3VB2A 2B9UA 3TNQA 2CFXA 5E8GA 5A2QK 4O3MA 1XGOA 4XSZF 2CGPA 4N9IA 2Q0AA 3ZMDA 2WV0A 2F5EA 2W24A 2XAGA 3HRSA 2RC4A 2ZCWA 4QMAA 4AWXB 3JAMZ 2DQRA 1MDMA 1Y9QA 3GW2A 1B9NA 4IEQA 4JBAA 3WW4A 3T5XA 1ON2A 5E18F 5FLXZ 1B6AA 5IT9Z 4XFAA 4G7ZF 3RYPA 1Y3TA 2BNNA 3KSCA 4AXOA 4EWDA 3FX3A 3LFKA 3N97A 3E3VA 5FPZA 2ISYA 4L9VA 3J80K 2HJIA 3SMHA 3JSOA 3LAGA 4IHTA 2GA2A 3K1PA 5A2QZ 2GIVA 1ZZBA 4HSLA 5E8IA 2NNNA 1SFNA 1OI6A 2FBKA 1X8MA 4FHTA 1S7OA 3GEZA 1P6RA 2FBIA 4EJUA 1HKTA 1X3UA 2JPCA 4LG0B 1B1BA 4U0VA 1CAUA 2YU3A 4JK1X 4U0YA 2K4BA 3DXJF 2RVCA 4XF4A 4L11A 2EAAA 4E2GA 1YO5C 2Y48A 4HX8A 1CAWB 3KEQA 3VEPA 3H7YA 1LKNA 1S8NA 4LK0F 4IF4A 3C3VA 3S0MA 1RTVA 3RPQA 3R0JA 1A04A 1HW5A 3I59A 4DQ2A 5JFRA 4RD7A 4HOBA 1RUOA 2FBHA 3TO7A 2PTMA 4Q0UA 4HX4A 3HHHA 4IETA 2CYYA 3R60A 2CAUA 4JQFA 1ZLKA 3UKTA 3HHGA 2EV5A 2IT0A 4JTOA 4KIGA 1ONVA 4RB2C 1GVJA 5D5VB 2QQ9A 1CF7A 5D8LB 3FHIB 4O9EA 3LSTA 3LA7A 2R3SA 1ULYA 3VFZA 2O0YA 2VODA 1S6LA 1KYZA 1V70A 1XRUA 1JE8A 4HZFA 1R22A 4G6DA 2QNKA 1VR3A 2B5HA 2OA2A 4L9NA 4Y15A 3V8KA 3RPUA 4D7TA 4MHGA 4UVBA 5DYMA 3MFKA 2FE3A 4BHCA 3EDPA 5HDNA 3O14A 2ZKZA 4Q0PA 2OU2A 2K9ZA 3FE5A 3NW4A 1OYYA 3FMSA 1RUNA 2STWA 4MEYF 1YFUA 4ZH4F 3G7DA 4PGGA 2Z5UA 4ETSA 2ZXJA 2GC1A 2HR3A 1MJ9A 2M30A 3CUQA 2VQAA 3VOEA 5EEGA 2K4JA 2MLKA 1U5TA 2O03A 3MQ0A 3SCHA 1IN4A 1TNTA 2A6HF 1ZZ6A 3GXOA 2P17A 3ABTA 3H3ZA 4RB0A 5JVTA 2DI3A 4EM2A 3RZZA 1SD5A 3KCCA 3L00A 4ESJA 4XEZA 5FO5A 1OYIA 3Q5FA 3KP5A 5CVIA 1CAVB 3WTZA 3RI4A 2GZWA 5AIPA 2WTEA 4Y17A 1MJBA 2FNPA 2O8QA 2P7VB 2O1QA 3KLOA 2QVSB 4LK1F 3F3XA 3ZMUA 2IXHA 4P55A 2HZTA 1WI9A 2RGVA 2DBBA 3EYIA 4Z2YA 2KRFA 4A2UA 3U0ZA 4HAMA 3FMRA 3KP7A 2K86A 5LLQA 1ZARA 1HW2A 4FBFA 3TDZC 2N7GA 4ZU5A 2IA1A 4ENNA 2UY8A 2VC0A 5LBQA 1ZREA 4PIXA 2D5HA 3CL1A 4MV2A 4P5OA 5ICFA 2L4MA 1EP0A 1FOKA 4IESA 4EWAA 1LDKB 4IRHA 3F23A 5DUIA 1BM9A 3EQEA 1H9GA 4MTEA 1K79A 1U2WA 3L2HA 1QZYA 5E1ZB 1BI0A 1ODDA 3S7EA 3MAJA 3WTUC 1ZRCA 3RIRA 2VBWA 3M9AA 2PAMA 5FLHA 3D5LA 4QGNA 3FM5A 2DT5A 3DQVC 2UXNA 3DN7A 3OF1A 1GQHA 1J0RA 1ZH5A 1KU3A 5CVJA 2ZNZA 4H7LA 3LZZA 5LRRA 1XSXA 4LUMA 4IEVA 5LGUA 5L3FA 1J3PA 2L54A 3COAC 5DV5A 2K0GA 4GGGA 1HKQA 1K78A 4MH0E 3E6CC 2ET7A 1L3JA 1DPRA 2P6SA 5TJJA 3IRQA 2ISZA 5LHIA 3IRRA 2VC1A 1XMAA 2QYOA 1NXMA 3DV8A 4MQ9F 3GZ6A 3TDUC 3T0YA 3OOPA 1FYLA 1J5YA 4Q47A 1J9IA 2XGXA 4Q5SF 5F6FA 5L3CA 2O3FA 2Z33A 4LLOA 1JXSA 1V3FA 2XL7A 2K02A 1F9NA 2FQPA 2F5DA 1XMKA 1FXZA 3DPLC 4ZZLA 4TLFA 4LEJA 2XHKA 4YG2F 2MHFA 3SZPA
chains in the Genus database with same CATH superfamily
1KD7A 3V0AA 4CPBA 3HQRA 2H8WA 4ORFA 5I8TA 4M4PA 4XZUG 4KMQA 2H09A 4Q4X1 3K3OA 4EN6B 1JU4A 2JECA 4M3GA 5ICCA 5LASA 4P9WA 1XQNA 3LD8A 3BOPA 5FYHA 3Q9OA 1WJDA 4NHJA 5JSPA 1TQ5A 1JI8A 1UW8A 4EJTA 2IVIB 5FXXA 1AOYA 1RC9A 4PHZA 5FP9A 2CSGA 4AFDA 5EGOB 3BR2A 3WG2A 5FGMA 1KU9A 1NYWA 4DBQA 2X53S 4BAYA 1COV1 3LSJA 2FZ2A 4BHBA 1PK6A 4FETA 4LMYA 5B3SH 2R042 1IRXA 4XAEA 5BPXA 5HXVA 4NHXA 4BISA 3ZN4A 1F31A 3I2OA 1QXPA 1TC3C 4AUXA 2L7FP 5DM7F 4ASLA 3F6OA 3RPUD 2C9KA 3TWIA 3C7HA 5T3NA 3LDRA 1FBSA 3K2OA 4I6ZA 3OY8A 5KHIA 3TEZA 3VL8A 2JENA 2X1DA 4Q0QA 2VQLA 3RRDA 2CRGA 2XAFA 3QPLA 4W97A 3ZR6A 1JKOC 1C28A 4CEYC 1CJPA 3ZQGA 1ZVFA 1MVEA 3VHOA 2QA4I 4XUNA 1MS9A 5T5JA 3M3EA 2ELHA 3IKVA 4PCRA 2J1RA 3A22A 4Q4Y2 3CCLI 3T3YA 2XSDC 2ZGTA 3HRTA 3C7GA 4YELA 1JYIA 4XKCA 4XRFA 1O5LA 3I59B 1LE8B 5DUVA 1NLSA 1SMYF 4RS5B 1SMTA 2DVBA 2RS33 1TME2 3PIPF 1IRFA 3RWNA 3WTYC 3CDHA 4B4QA 3AM2A 3CCQI 5LHGA 3JCUC 4NWWA 4BB3A 2HEVF 4RB3C 3JRCA 3SEPA 2OQGA 3ASOH 2R5ZA 1FMD2 2VZQA 2DFCA 4PBOA 3GLXA 4P1WA 2LMDA 3KLSA 3TO9A 3R4UA 2D7FA 1R49A 1QJZA 2HKOA 2C5DA 5CFCC 3SDBA 1GQPA 1IF1A 4PDWA 4BQ5A 2ORZA 5C4JJ 4F8AA 1HXS3 5FDBA 1TMF2 5EXOA 3VHRA 3JR9A 1W99A 2OTJI 1IN7A 4LLFA 2Z9OA 2KRCA 1WA4A 2B7EA 3WW1A 1UN1A 1DQ0A 2LVSA 4YLZA 2BFUL 4N53A 2P5KA 1ZQ3P 3X29B 4QWNA 5CPRB 5JMOA 3LQRA 1SBFA 1W2OA 1FP1D 4KWLA 2ZHLA 1ZBE1 3HOWJ 4Q4X2 1IDZA 1BBT1 3S2WA 4JGZA 1YRNB 5HLGA 2ARBA 4KU7A 3VDDC 4IL6C 4BNCA 4CDQA 4DXSA 3FLPA 4YFWA 3AXEA 4LE4A 4IVNA 4IV1A 5A1LA 2WQ8A 3OYJA 2JD4A 5KC6A 5L19A 1COV2 2FHRA 3U2RA 2BYVE 1W9FA 4CRQA 3LL7A 2WL1A 2X48A 3C2BA 4L9TA 1UAAA 4LB5A 3T8TA 2AS5F 1IRZA 2VPVA 2R0FA 3PJYA 4N7UA 4AK3A 2WNVA 3CDIA 4BLIA 2C6YA 3TO6A 5FY4A 4XHXA 2R16A 4BBSJ 1JTZX 2VULA 3WU1B 5FJHA 2DVDA 3FMQA 1B72A 1SZBA 4OOIA 2NVUB 1MS3A 2O7OA 2GN7A 3M8EA 4LHNA 4FOVA 2HWC3 2DMUA 3J7LA 2CWEA 2RAEA 5C6CA 2QLZA 3F8NA 4CDGA 4KG8A 5I0SA 2E1MB 5C3SA 3H8OA 3O6BB 3ZN1A 4G7HF 2X4HA 1WRJA 3GWZA 3H1MA 5FYSA 2B4KA 5HDGA 4FOYA 3SITA 1PGW2 4L5JA 4D3WA 5KR7A 4BMBA 3PUSA 4DPNA 4N8MA 2PN5A 4BS9A 2ECCA 5IPAA 5T55A 2D5VA 1YLLA 4CH7A 5D4RA 4O61A 2DFIA 2JD9A 4AVBA 3IC7A 2Z79A 3M3YJ 3VBHC 2VJ5A 3C2GA 2RS13 1WJEA 4XKVA 5FV3A 4CDWA 5FPXA 5IK7A 1EV13 4LO6B 5BV6A 4B4CA 3GHNA 4HOOA 3L2QA 2BU9A 3JREA 5BOXA 2DFEA 2A6WA 1CR7A 1WCMJ 1Z3XA 1HLCA 2GNTA 3I53A 3VZKA 2YG0A 1OD3A 3QP5A 3NAPB 4N43B 4OIRF 1YJ9I 4IQJA 1RMU3 3REOA 4KI5M 5CAZA 4QB6A 2UXXA 4NB5A 2XKPA 5L3EA 4XOPA 1BW5A 1D8KA 4LQRA 3B02A 1ON1A 4MGZE 4RA0A 5ACA3 3S2HJ 1N1YA 1IS5A 3SZTA 1ULCA 5BNOB 5CBLA 1EPZA 1G9DA 4HNTA 1ZBE2 2XUEA 4YVSB 4YM1A 4CA9A 2WIIB 2BXYA 1W8UA 2X1EA 4MGYE 1OA3A 4EN7B 4QX0A 1QRYA 3W5NA 2CU5A 3IWFA 2BGPA 4CCMA 4PFPA 3LDKA 2W46A 4LHSA 3N9QA 1EV7A 2R0QC 5EZGA 1NLRA 4YZ4A 4CUCA 2CQQA 4Y13A 4QQ2A 3OSDA 1GUUA 1AL21 4WVVA 1PO22 4P9GA 5C33A 2QQAA 1GZ9A 4BJ0A 4I01A 5BNGA 2P4WA 1MSEC 3URFA 2R92J 4QPWA 2LREA 4BXFA 3KMHA 4PBPA 4ATEA 3ECOA 3FF5A 4LD5A 2WJSA 1G9AA 5FY1A 1R4NB 2WS92 4AFCA 3OS1A 1G9FA 3WEZA 5IJRA 1AWCA 1RUD3 2QSHX 5CG9A 1VP6A 3OPZA 1DQ2A 1OUXA 1OLMA 3OUJA 2WT1A 3DXTA 3J7MA 4P02B 4CEYA 4PGHA 1POGA 4AFBA 1X82A 1WLWA 3KZZA 1WQ2A 2UWBA 3GGLA 1XDUA 4DZGA 4QPYA 3FBIB 1ZBA2 5T5LA 3BZKA 1OT5A 2LK2A 3H5NA 2GXBA 4B3NA 2LY9A 4CXWA 2CUFA 3NJYA 2BNOA 5EWSA 3WDVA 4I7HA 3TEDA 2CH0A 4ZYGA 2QZ3A 2IAIA 4DQAA 5LFAA 2VUJA 5FZ8A 1VLNA 1BR4A 2QWWA 3D5SC 2Q30A 4QX8A 4IV3A 4BY7J 4UF0A 1YTYA 1EH8A 4PK4A 5F6LB 5KK1A 1UY2A 4ZU4A 2A6VA 3MKWB 2ZJQF 1WGXA 2NRAC 4II3A 3PLQA 3KP3A 2K9MA 5BNQA 1FX7A 3FXOA 5CFCA 2WZEA 2ZSIB 3ZN0A 1GXPA 2XWBB 2JG9B 4G6QA 3IKTA 2OZUA 2L9RA 3NQHA 1PUEE 3I2KA 4HA8A 5LZ6A 3VUOA 3H5AA 3OBAA 4BEHA 1JUMA 5FFXA 3I64A 2Z3YA 1FT9A 1URXA 4YFKF 3A02A 1V6OA 3BPZA 3HOSA 2VKHA 2ZA9A 1UO9A 5LEKA 2XGEA 4TWTA 4DRRA 4MNUA 4L99A 4M3CA 4OLLA 3AVRA 1HQLA 2CV0A 3GTLJ 2BUKA 5CYVA 1ZYRF 2JG8C 2RDQA 2G7HA 3J7AY 5FK8A 1F5TA 4QKFA 4XQWA 2YR2A 4XE9A 1OR7C 1CQTA 1QO0D 2RS31 2WYFA 3OYBA 5K5RA 3ASIA 4XORA 1VBB3 5EJZB 3P3NA 3PNAA 1KS5A 4UB8C 2R1BA 3VDDA 3E1F1 1XJAA 2ACJA 1Q8QA 1VBC1 2J1EA 4DB5A 2V73A 5DDJ3 5L3GA 2VOVA 4F91B 1Z6RA 2A1XA 5GKAC 1AL22 3SJMA 1YOVB 1W0PA 4LO5B 1WH5A 1GDTA 1HXS1 2IS2A 1BMV1 3GTJJ 3OB8A 5FR3A 3AYAA 3UGGA 5GADJ 3VD4A 2X85A 3ZFGC 3AL0B 1YG2A 2EA2A 2DMTA 3K2ZA 1IHMA 4KT5C 4I3GA 2GMEA 3P3PA 1V00A 1FOWA 2JJ6A 1SANA 5EEHA 3I54A 4LFUA 3AP7A 3KEOA 4BJ6C 5ILVA 2J7MA 3HOBA 3HGYA 1JHNA 2HWB3 4E7KA 1HSJA 5HCHA 4R4ZA 4B7EA 2JTVA 4Y4YA 2X0LA 1W06A 4XVHA 5GALA 1UL9A 2E35A 2VOTA 3H1YA 1EY2A 4S05A 3N9MA 5A7SA 4BE3A 2ENRA 3CJNA 2IJLA 4D7YA 2HDCA 2QQPA 3OEBA 4RDUA 2O8XA 2HS5A 3THTA 5F5AA 3S16J 1W05A 2EILH 2Q2EA 2ZB9A 4ZYHA 1GBGA 1A6QA 4KA4A 4CZZA 2EAKA 3ATGA 3IH2A 3VBHA 3HOUJ 1SAXA 5I8YA 3TP3A 1OMIA 3E7LA 5KBFA 3K4MA 3CCVI 2ZSHB 5FFZA 5JCTA 1D1BA 4XQDA 3R4SA 2XUBA 1DFQA 2BY1A 4IE6A 1UYYA 3ORJA 1R5HA 1O4TA 4LITA 2Y30A 4XN3A 4GJYA 2RDSA 3W58A 3I2DA 5CVVA 2VMFA 2V1DA 4LKSA 1YFXA 2TNFA 3IPVB 5JIAA 1FMWA 2EFWA 5IYCJ 4LK6A 1VF9A 3ZSKA 5IT9K 2Y38A 1QNYA 2ZAHA 3N36A 4IOAF 4E6KG 5LK7B 1KQ8A 2FRHA 3P7NA 2LY2A 3V8JA 5IP9J 1PMIA 2HNHA 4XPVA 3C18A 4P9FA 3UYJA 5F5CA 2GM4A 2WFF3 1E3PA 4E2SA 3AMPA 2BZDA 1QKQA 5E88A 3HIFA 2RS32 5BUVA 2R7WA 3POWA 1FY7A 4LBQD 2MNGA 1ZM1A 3BJAA 1FATA 3VBSC 2Y33A 3QP6A 1NT0A 3KCXA 2BW3B 1VBC2 2GU9A 4Q0SA 4U87A 2CW0F 5EIYB 4M3BA 2W08A 5FKLA 3L9JT 4QWQA 4A3GJ 2KP6A 1BK0A 5CYYA 3K46A 5GPAA 1EV11 2Y31A 5H9RA 3LCPA 3BCWA 3MW3A 2IXLA 4OI0A 4AI3A 1F43A 3PURA 1HXS2 1HC8A 1BMV2 1P4AA 4AI2A 3O7OA 5C8WA 3KP6A 1JZ5A 2Y0OA 4DYCA 5FQ0B 1DGLA 1RMU1 5F3CA 4MGKE 1K3IA 1LUJB 4AIHA 1Z6TA 4II2A 4NRPA 3DKWA 3VD9A 3SKVA 2MD0A 1BZWA 4JX0A 1IQAA 1Z1DA 4Z07A 5ACA1 3LFMA 5HVQC 2E2JJ 4H4KC 3WTSC 4K40A 3ZIXA 4JX5A 4BQQA 2CAVA 4XUTA 1BI3A 4EATA 3HQUA 3T2OA 1N78A 1MH3A 2OT7A 4XNFA 2QQBA 3Q8AA 4QD2A 3PQKA 4QHBA 5FZDA 2W4SA 2L0KA 4PI0A 1Y6IA 3KF3A 2LM3A 3RQ4A 4QKDA 2J22A 2DBNA 5T5PA 3FBYA 4HPKB 4XF0A 4M9XA 2OQ6A 3O12A 2JRMA 1CX1A 1PMJX 2AHQA 1Z3YA 2IS1A 3VD5A 2ZX1A 1RITA 1UG0A 5A32B 4WZCA 2OA4A 2QDRA 4XSXF 4XXAA 2RJ2A 4QX3A 5FZ4A 3GHMA 1R091 2VQCA 4RFRB 3WHTA 2Q8DA 4EM0B 4E8DA 1A34A 2GAUA 5FO8B 2W1UA 5EYXA 4A7ZA 1JZ3A 4XLPF 5HV0A 1DLLA 4TZDA 4ZY9A 3V42A 2R7FA 3U14A 4BQNA 3GBWA 3RGBA 2NLRA 4LA2A 5CIRA 3C8XA 4WVMA 4EJVA 1Z91A 5FPBA 4HBNA 3ZVXA 4EGYA 1LOFA 3ZFFC 1NCQC 4CU9A 3VKMA 2VT3A 4AW7A 3BQZA 3FKJA 3GTQJ 5T52A 3BROA 2WNUC 4UY8I 5FPUA 3AFKA 3POYA 1DUXC 5FKMA 2Y6KA 3TN93 4EJRA 4F3QA 4HV6A 1ULPA 2VCCA 1AZDA 1HX6A 1JUHA 1QQP3 5C4WC 3ELKA 1OR7A 1B4AA 1AYM1 4QKNA 3VSKA 4G9YA 2LDUA 1SLTA 1IZ1A 1R4MB 4ZYAA 4FQGA 3CF5F 5DDGA 3VYRB 3V4GA 4OMDA 2Q0OA 1EJ9A 1VBA3 1GMMA 2RS12 5FP7A 1U6GA 5JI9A 3MIFA 4AEKA 1EV12 2OPKA 1TW3A 3WODF 1X2MA 4Q4W1 1NQJA 4M00A 3DLLF 3ACFA 4AAPA 1XSDA 3NVCA 3HWJA 2ZMEB 1Z9CA 4C2UA 1AKHB 4OI1A 3ZFGA 5IATA 1RMU2 1CAWA 4FASD 1BN5A 3J7ZI 4AWDA 4PLOA 5C44J 3T1MA 1IN5A 1NK2P 2E26A 1NOVA 1YQ8A 2FD5A 3IH3A 1U5YA 3Q9VA 1WI3A 5ACA2 3VODA 4GWNA 3F8MA 1GV5A 3EUKL 1O7LA 1QBJA 3WGHA 1XG1A 3ZR8X 4D9JA 4LTAA 2XHNA 5L3DA 2FUG2 2IFWA 3KVAA 1R1ZA 4QT6A 1X50A 3HOXJ 2P3YA 3P6BA 3G2BA 2C24A 1Q5OA 1HKSA 2P6TA 1BI1A 2O9LA 3J8F3 2F5FA 2VUAA 3SYTA 4FTEA 1RKTA 1VBB1 3POJA 3WW2A 4IXAA 1QQIA 1TZOA 1TBXA 2ZNYA 3T08A 1ODNA 1W0NA 2VE1A 1R081 1BVVA 1ASJ3 3HDDA 3ENRA 1FPN3 5DDJ1 4FX4A 4PZJA 1H1IA 4Z82A 3O8HA 1NH3A 1YW9A 2R7DA 2W82A 1WMFA 1ZZ9A 2H8RA 1ZZ7A 1JYCA 5BNNB 3AX4A 4CVUA 1R092 3I3DA 5DCMB 4YIRX 4D8MA 3LOBA 4KN4X 5A3OA 1XS9A 2XUMA 1XGNA 4LT5A 1EAH3 2HEOA 2DTZA 2VNRA 4XKWA 1RUD2 5HODA 4UWDA 4X8PA 2JICA 2LALA 4META 2NMNA 2OZJA 4XJ8A 1XE0A 1WPKA 4A3EJ 5JDBA 2EZKA 4S0HB 5H2FC 3LQCA 3K75B 1VRBA 2MA3A 2Z2SB 2STTA 4MUVA 3ZLIA 1BLZA 4X1EA 4ENKA 2EWNA 2CL2A 4JHTA 3F21A 2G9FA 1N1VA 1CAVA 2FDFA 1YC61 3FXUA 4FAGA 2FX0A 2ADUA 1W8FA 2DWRA 3M4FA 4IE5A 1K12A 4XQ4A 4RYDA 1W0OA 1RB8G 3QODA 2KJCA 3PQJA 2YC0A 4E70A 1RVF3 4YGBA 5DM6F 5EEAA 3RZHA 4PLMA 1TWGJ 5KHDA 2XF7A 1JZ8A 2QJVA 4QPGB 1NK3P 3VBSA 1PX3A 2ZGKA 2K5CA 4EGZA 3KF5A 5EDNA 2OXBA 2DTRA 4UHTA 3H3UA 1FTTA 2FDKA 5FBJA 5FXWA 2GNMA 5DD8A 5K0UB 3W3CA 4M72A 2RQQA 1U8BA 3OGSA 3FK6A 1GWKA 1DQUA 3RKXA 3BCBA 4AVPA 4RGGA 5A7NA 5L9RA 4QDRA 3GZ5A 4JAAA 1VBE3 4QQPA 3WV6A 4XLEA 2F5CA 5FWEA 4XCAA 5HBAA 1D1AA 3K4ZA 3CTAA 5EG0B 3KT1A 4LA3A 1W7PB 3DUIA 2WWYA 1FPQA 2C6SA 1X1BA 3LA3A 4L0YB 1C5HA 5DZFA 4JHZA 5ERIA 5C3EJ 3M8FA 4NHMA 1PVEA 3CUOA 1IV6A 1K5MC 2PAEA 2E19A 3SNMA 5CFDC 1E17A 2ZXWH 4E2QA 3O1PA 4FSJA 3BY6A 4MQVA 3VN4A 1W04A 4BIOA 1VBB2 3LGRA 2Y6LA 1I1EA 2BV6A 1B35C 3KZIC 4S04A 3JCIA 2E60A 4CA0A 3BTLA 4YRVA 1Q8SA 2CS3A 3G3ZA 2QQNA 4LLLA 2OS2A 5DDJ2 5CB7A 4A42A 4A3FJ 2XV4S 4A3CJ 1OCTC 4HF1A 1YIFA 2HH9A 4M0HA 4GH4C 1K4TA 1N1TA 3HRMA 1QWRA 1Z0HA 5K5QA 3BG9A 1TWHJ 5DQ0A 4C2MJ 2HQRA 4M6VA 1IXSB 3VB2A 3TNQA 5E8GA 1XGOA 2CQNA 5GZEA 5FP8A 1M1EB 2Q0AA 3CDZB 3ZMDA 3A21A 2K9QA 3H9QA 1D2QA 3HRSA 1REEA 4PJMA 1IG7A 4CDXB 2DQRA 4LKEA 2FZ1A 4XFAA 1Y3TA 3PUIA 3ZFFA 4YW6A 3D4KA 3LEKA 1NCQA 1LKXA 3E3VA 2HWB2 4LR4A 2ZX0A 4DNYA 2ZGUA 2V6EA 3AP4A 1KFUL 1OBNA 4L9VA 2WNUA 4IHTA 4BE2A 4NOTA 2GIVA 4BQXA 3DPRB 1ZZBA 1XNTA 2NQYA 1RUG3 2VVDA 2NNNA 1SFNA 1OI6A 5C4WA 4MFEA 5IK8A 4OYUA 3ZXLA 3GEZA 1P6RA 4U0VA 1JH5A 3DXJF 4XF4A 4IE7A 2VKVA 3ZN5A 3S17J 2DVFA 1ETXA 1AR73 1DHKB 3VEPA 3KYLA 3CJRB 3C3VA 3RPQA 3RI8A 5F1JA 4DQ2A 4RD7A 2X6OA 2FBHA 2W47A 3NKGA 4Y3OA 1VQ5I 1AR83 4FQ4A 1N3OA 2JB8A 1HA8A 3HHGA 4B4PA 4LNVA 1UOFA 1ONVA 1R71A 5FMOL 5LD2C 3LSTA 4OUSA 5LA9A 1IKQA 2R3SA 3BTZA 2O0YA 4P9XA 4FISA 3PMSA 4G3YC 3WDWA 1XRUA 1JE8A 5EJ1B 3JRHA 2FCVA 1AXZA 4G6DA 3K51A 1NA1C 4FFFA 1OCCH 4SBVA 1SCSA 2I74A 4Y15A 4JGYB 2J1VA 2J1AA 5FYBA 2OW4A 1MBEA 3MIGA 3PL8A 1S9HA 2ZMLA 4DUXA 1F4AA 2CMPA 1AU7A 1FYUA 5CA6A 1POV3 1QQP1 2PLV3 4GQ7A 2AR6A 2GXAA 1WFXA 2PMWB 4BHCA 4NQWB 2VKEA 3ZQCA 3R4DB 4Q0PA 3NJVA 5FYUA 4B47A 1C5IA 1TT5B 3UESA 3NW4A 4CP9B 3OEAA 4QX7A 2DJIA 1RUNA 4B3AA 4K20A 2WKKA 4DYQA 1VBA1 2Z5UA 4D5FA 2GC1A 2W2IA 5EPAA 3OYWB 3I9V2 2R1DA 2VQAA 4OI4A 2ZXHA 3VOEA 4XLCA 4FP3A 1ZA4A 2L5QA 1IN4A 2A6HF 1O4XA 3ZYJB 4MIMA 2VQUA 3H3ZA 3UETA 2WINB 2DI3A 1RETA 3RZZA 1RESA 1SD5A 5TSWA 2ORXA 3Q5FA 2JMWA 3RI4A 5IVBA 3CU7A 1MJBA 4Z1VA 2O8QA 1AA7A 1HJFA 5F2WA 1W90A 2VM9A 2XONA 2EXJA 3GTOJ 2IXHA 4P55A 1A8DA 4J00A 2GN3A 2DBBA 5FMBA 1UX7A 3EYIA 3DF0A 4A2UA 4ASMB 1BVP1 3FMRA 2L9VA 1HW2A 1U9OA 3MIBA 4UFKA 5JVVA 1S72I 3M1HA 2VC0A 3FUQA 2YBPA 4YZ3A 1V6JA 4UUTA 4AHWA 4HT1T 3N9PA 1EP0A 2W1QA 1T8IA 5L9BA 4IESA 4QU2A 5LATA 4FPFA 3F23A 1H9GA 1K79A 4Y22B 5E1ZB 4A44A 3MAJA 3RIRA 5FLHA 2KR2A 2NN8A 2TBVA 3NV3A 2PELA 1GQHA 1Y39A 4AOCA 4Q4V3 1QVUA 4KQ7A 3NMBA 1WCDJ 2WWUA 4NJ4A 1XSXA 1YJWI 1O4YA 1EAH1 5F6KA 1VAMA 1J3PA 2W3JA 3VKFC 3VBUA 1OCRH 3PJQA 1YQ5A 2VZTA 2ET7A 3QYEA 2P6SA 1S4CA 1U5XA 3M3CA 1KRIA 3TEXA 3IRRA 2QYOA 3DV8A 3RWKX 3TDUC 5FJKA 1FYLA 3ZOIA 3DYMA 4IHWA 3S57A 5F6FA 1WKYA 3WNLA 2FQ4A 1RHI3 2RR13 2AEZA 2Z33A 5EJ3A 2DJNA 2CFOA 3DPLC 4ZZLA 3LSRA 1S0CA 3TN92 1UMQA 2XHKA 3GJBA 2CDPA 1JJ6C 4XDOA 1K5MA 1QQP2 3LSEA 5CFDA 5FB2A 1RVF1 5KAFC 2DBIA 1PHMA 3TNPB 4LG3A 2OPWA 3K4JA 2VOOA 3BPXA 4LULA 1VBA2 1B35A 1O4ZA 4MO7A 3MYXA 1UIJA 1V0AA 3HD8B 2O5RA 5E3LA 4JQTA 1TZLA 3CMAI 5DTDA 5F1RA 3LMMA 4ABZA 2EIMH 4XKBA 2C9AA 2PA7A 4DINB 1W6NB 3PFYA 2WQ4A 3S3OA 1LFBA 4GH4A 1DP0A 3CMEI 2QZ2A 2XLGA 5ILSA 4XJAA 1XC5A 2HU9A 4QDQA 1S29A 2QTWB 3J4UH 3GFJA 4Q8KA 1H8TC 2WDBA 1W8TA 4XBNA 1LGCA 4F3JA 2MC4A 1VBE1 2OYZA 1OYWA 4F92B 2B9VA 4TTGA 2LSOA 1LB2A 2GC2A 4L0PA 3T2PA 2PQ8A 9ANTA 4XIDA 1OF3A 4UOJA 1FOD1 3ABZA 4LE3A 2FF4A 3M7AA 1W6OB 3PM1A 3O0XA 5IP7J 2A3SA 5GLZA 1QA6A 3RYKA 1REFA 2MABA 5D5WB 2GLOA 2P0WA 1H4GA 4DOZA 3HG9A 5HLTA 2VZSA 4LBOA 4B8XA 3X2QH 3APBA 1O8SA 1FZPB 2E1MC 4WXCA 1E2XA 1BC8C 2D1VA 1XCBA 3M2MA 2DT7B 1CZVA 3ZM8A 4ON0A 2W95A 3ZFEC 3OS0A 2IC1A 3ZXKA 3BTCA 3GJAA 2K40A 1Z7S3 4QXHA 1RUF3 3K69A 3I2FA 4IDZA 4C3JJ 3H1CA 1IXCA 2QUFA 2WZR3 2WV1A 1ASJ2 1FPN2 2QKLB 4RAZA 5AC91 4N7IA 3USUA 3WW3A 4F7ZA 1XU2A 4R8HA 1JKRC 5A6QA 2HOEA 2KXLA 2RMU3 3IKWA 2V6CA 4OMYA 5EFUA 4J25A 1EAH2 3IAM2 3AL5A 3WP6A 3OJBA 1OOPB 4N43C 1IAWA 3ZQQA 5A7WB 2DOAA 2LRDA 5CVUA 3ZCOA 1IDYA 3OOXA 1C4RA 2XWJB 3A4UA 4E27A 1QNTA 5FK7A 4NPRA 5EYRA 4YARA 4CO8A 2DURA 1GSLA 1HDPA 1HRI3 2DPDA 3MEXA 1NA1A 1MD0A 3RZMA 1RPWA 2RS53 3HJRA 2WLQA 3DPTA 3TAYA 1T39A 1TEIA 4KG0A 4IGOA 1AXYA 2NNYA 3OYAA 4YVSC 1W36C 5GLUA 2W1WA 4NIIA 1RUG1 2R5YA 3D5OA 3CJIB 1RVF2 1V54H 3K4KA 4AD9A 2ETHA 2Q1ZB 4Y5Z0 2DA4A 2P5VA 2KM2A 4EJWA 1I5ZA 4AGRA 1UIKA 1G4DA 1HQCA 4BXUA 2YU1A 2CJJA 1C1LA 3I0TA 3IMMA 5HXMA 1AR71 2Y6HA 4U88A 1RGSA 3IDBB 3HT1A 3U4SA 2HBUA 2FOKA 4OHVA 4XILA 4AGGA 1ENXA 3BDDA 1PO13 2DK5A 2UWCA 3FXQA 1VAKA 3JBG3 1TNSA 4YEJA 1VE0A 1QHHD 4WV8A 4I0BA 1LOEA 4JX4A 1VBE2 2VXZA 4MSVA 3HPGA 2AACA 3JRDA 1JU3A 4YW3A 2JA2A 3ZR5A 2DN0A 2LKPA 3N4MA 4X0GA 3I56I 4CXFA 5KXBA 1I3QJ 2LTNA 2HBTA 4FE4A 2DU9A 1L7QA 1Y1WJ 1UCXA 2OQ7A 3MCZA 1RUE3 1ZK8A 3MPBA 1WZXA 5L3BA 4A6OA 2AUYA 1MMSA 3L2CA 3J80Z 3ZYBA 4CDUC 1PP7U 5F04A 1RUH1 3GLLA 1LE8A 3VD7A 2FMLA 3JXSA 5LY2A 1GYKA 1W36D 3GX4X 2ZACA 3HNMA 3CD6I 2XAJA 5JPMB 1JYXA 5IOZA 1MMDA 2D3SA 3BP8A 4JDOA 3OSFA 3IAPA 4RGAA 4CZSA 4LOSA 4LBKA 4RAGA 1RL3A 2XRNA 1DQ6A 4KBBA 1UMIA 2HWD3 2D1HA 3DCFA 3PVEA 5KVRA 2XPWA 5CADA 3TRSB 2PJRA 3VBRB 2DW4A 3QLQA 3LIHA 5IWFA 4ZYDA 1XPXA 5FZOB 2OAZA 4OHYA 3H1WA 5DG2A 4EQQA 3OL3A 2VPLA 1CIYA 3PUBA 1U0JA 3M1EA 1KGSA 1HDKA 2WRAA 3AP9A 2QF7A 1K6OA 2P7CB 4OUEA 1N77A 3QYFA 2AQFA 2ZKNA 5GLVA 4GYIA 4PUSA 3KT4A 2EFOA 1PIV3 1XNAA 4YIFA 4AC0A 4A0YA 4AGVA 2ZXQA 3I3LA 5JXJA 4X6AJ 2HFHA 2HWVA 2W68A 4W4ZA 3WDXA 2FCUA 3VBOB 1RUG2 1SFUA 3KHCA 3A0KA 4M74A 1LVKA 1FWZA 3KFWX 3GFMA 2MH9A 3DP7A 1REPC 1JOPA 3BB6A 3ZQ7A 3FKIJ 2PQQA 2X29A 3JRBA 4LIUA 4MZUA 3J7YJ 3S2DJ 2JE9A 3FUOA 2E9QA 3DPUA 3S15J 3E6DA 1H2KA 4CSWA 1AR72 3OY8B 3WP5A 4IEUA 3HRUA 2DCYA 3W59A 4AHYA 1NE4A 4ZDOA 3FHQA 5AVAA 3B6AA 2VNOA 2JA6J 2JDMA 2O8KA 4EM1A 1AR82 2P8TA 1MACA 3KV6A 1N3PA 5JOZA 1GZTA 4EWEA 2B8MA 1H8TA 4E7SA 3CJTB 4DZJA 3FFQA 5IK5A 3FISA 2ARCA 3VL9A 5KWRA 3OYCA 1LENA 2TCTA 1NG0A 1MMGA 5A6YA 1D4M1 2ZO4A 2DODA 1I5PA 4A3JJ 1X3WB 5ANQA 1RHI1 2RR11 3BLYA 2HQAA 4QX2A 4L8QA 3T8RA 3WDYA 3MPPG 3T2TA 3VZMA 3WDUA 3IDCB 2VTXA 4KH9A 4C0HA 1MMNA 2R5ZB 1IN8A 4XFGA 4HF0A 2JDPA 4A7YA 3JW4A 2ZGPA 2LY1A 4FPEA 4XIKA 4RAYA 1H9WA 3OV8A 1HRV1 1LULA 1HDDC 5DUKA 3ZFEA 4GFBA 2WR9A 3HXLA 3IMNA 4AYUA 2DAOA 1HW1A 2OV7A 3WLUA 4Z92B 3JZVA 4PDWB 5A1AA 1H1MA 1DU3D 5J6XA 2RJKA 3PSIA 2PJPA 4Y1XA 4WX9A 1LEAA 2G0EA 1H6XA 2DCJA 4PQQA 5BQTA 3PVOA 4K8RB 2DT6A 3FXKA 1G86A 4HSRA 1K61A 1YEWA 1RIRA 2KISA 3T2QA 2YC4A 2NPIA 4JVAA 2V7FA 4CYDA 1VQPI 5D8KB 2YFUA 1ZRRA 1ETKA 2Z4FA 2RNGA 3PNYA 2CQXA 3GZAA 3DCQA 1KQ0A 3FXRA 3L7WA 4FP2A 3BWGA 5HPOA 1BYHA 4RA2A 1RKWA 5EP9A 4MEXF 1NZCA 5IHRA 3CZ6A 5A7QA 4UT5A 2JUGA 2JDAA 1VQLI 1MQTC 1YX5A 5EQUA 3FL7A 5FXVA 5A6ZA 4WF2A 3AZVA 4YG0A 3WUDA 1SBDA 1W3XA 2XF6A 4CDQB 1WCUA 2OZ6A 1R00A 2EA4A 3IBMA 2VECA 5JR7B 5GLTA 2VXJA 2G1MA 1YFWA 3PUAA 1EYBA 1R6RA 1Z7S1 1RUF1 1P4XA 1XSQA 3W6JB 1T6GC 2PHLA 1J59A 2HWF3 2BDRA 2F5VA 2IGMA 2WZR1 4IXLA 4PQ9A 1UCRA 4HVQA 1PDNC 3CEWA 2WNVB 3WF3A 4O6JA 4X6RB 4HX7A 3KETA 3H35A 2M5WA 4XJ9A 3BG5A 2LKXA 2RMU1 2DPUA 2ZEWA 3LSGA 4TXWA 2DUPA 5JOWA 2XH6A 1GT0C 3N9OA 3ZMNA 2DMPA 4PSWA 1B72B 1O3RA 3P9CA 4XW3A 1BQPA 1F1ZA 4B09A 4C30A 3ZO0B 2BWCA 1BHGA 2PLYA 1MZFA 4XTMA 1TG7A 4FPOB 4YZ1A 3VYTB 2YU9J 3W6VA 4YRDA 2R071 5J1UA 1OFSA 3AG2H 2UYAA 1Q1HA 3J26N 3C7JA 1D4M2 2GOMA 2OC6A 1HRI1 1S0DA 5HCFA 3ZYPA 4WM8C 1RHI2 2RR12 5DAVA 2P4EA 1Y43B 4O5VA 3ERMA 4KMUX 5LEJA 1R7JA 1T56A 5K8SA 4A6DA 5ED4A 3R6SA 4BE0A 4CZCA 4YYOA 5D6FA 3AZXA 2K7LA 4K6BA 5HOOA 1YRZA 4CDUA 3OSGA 3K70D 2QCSB 4CDWB 4NVPA 2NAZA 4Q48A 1NE6A 3RJ2X 1ETWA 1C0WA 3P9KA 4CYCB 1W2NA 4ZS3A 5IT6A 3CC2I 1BJQA 4ONUA 2CUZA 2XGCA 2VVFA 1MBFA 5J09A 5A3PA 4JRAA 1XTAA 2JA5J 3DFGA 2BJSA 4JQRA 1WW4A 4AQSA 4RHV1 2AH2A 4YFXF 3POIA 1I3HA 1PO11 4GCVA 5HNFA 3J7NA 3JBG1 3W2WA 2XJQA 2RN7A 3WVJA 4UXAA 4RFT0 5T50A 5C8CB 1DLCA 1UHMA 3EHKA 4U0WA 3AKQA 5FRMA 3JD71 4MX3A 3K3NA 3KE2A 4WXDA 2YHJA 1JW6A 4HDVA 1F8VA 1GWLA 1FX5A 4E7LA 2R49A 2E7QA 3JQXA 3JB8A 1TWCJ 3T0BA 3IWZA 1P92A 4HV5A 3WTWC 1M4WA 1Y9GA 1AX0A 3VBFC 3RJRA 1RR7A 4ZJZA 3VPRA 2Q4SA 4I0AA 3BPVA 4DYRA 3PMEA 2VPRA 2EZLA 1R1TA 4A4AA 1PGL2 5LA0A 2VZRA 1Z7S2 1RUF2 2GA1A 3MFAA 4GD4A 5F3GA 5FZAA 1HBXG 2ADDA 4OHWA 2WZR2 4A3MJ 1UKGA 2VBPA 3B9CA 1HN1A 4W6WA 3QAHA 1ODMA 1MZBA 3ISPA 3GYDA 4AYBA 2QQMA 4XK4A 2HWD1 2A61A 1CWPA 2CQKA 2IXSA 2G9GA 4RL7A 2GNDA 2RMU2 4FTSA 4A5MA 1LHNA 1ZZCA 3SXYA 3KP4A 2RVAA 3OYDA 4ZZDA 2ZMEC 4CEWB 4IHXA 4HONA 1ZBE3 5CG8A 3SHRA 2BV4A 2WSUA 3EUHC 1EA3A 4Q8LA 3QU6A 1KJRA 1GLNA 1BBT3 3O1MA 4FCAA 4A5NA 1QJY3 5FZ1A 3NL1A 3QH7A 1VRH3 1XN7A 2R072 5FYVA 1T98A 3EJKA 2KD7A 2ZX3A 5FZMA 1PIV1 1HRI2 4DNCA 3RTRA 3QACA 4M3DA 2LUWA 3GDBA 2WO2A 2HYXA 2RS52 1SPPB 3J81Z 5D21A 3A03A 2N8GA 5FZCA 5DCFA 4CICA 5LK5A 2V4VA 2CUEA 3NARA 4IV3B 4HK8A 1O3SA 4UF0B 5F0CA 3EYYA 5EYYA 3ZXFA 5FTTC 2PI0A 3WF2A 3C2HA 4UW4A 4M3FA 2DA2A 4PJYA 3FHNA 3MO4A 2C1FA 5A3LA 3DXUA 2OJED 3S1RJ 1E5HA 1OH4A 3QBQA 2TEPA 1FOXA 5FPAA 1K45A 4D1QA 2R7RA 2R30A 1F5JA 3LEIA 1G3TA 5KHHA 1X19A 1BC7C 2HYKA 1LPQA 4IHVA 3K4LA 4AYBN 3HOZJ 1KQRA 4BEHB 3I49A 1VMFA 5ICEA 2QQWA 1BW6A 4Q0VA 1PO12 1D4VB 1LNWA 3V7SA 2ZAAA 3JBG2 4A41A 4AI9A 1V55H 2D6KA 2Y64A 4NC8A 2PAKA 1YE9A 2ZGQA 2KIQA 1X4PA 2WBMA 1ZGAA 2O61A 1X1CA 4NROA 3IPVA 3RQIA 5KHKA 1QHDA 5JAXA 3PNTA 1FV2A 3JD72 2VO5A 3RMYA 2VCBA 4QHOA 3GUDA 1K4SA 5F3IA 2AREA 3CMGA 3AL6A 1MZEA 3J7HA 3ILFA 4NHLA 3AYCA 1UXXX 3R4KA 1MQTA 2M7AA 2JIJA 1LFUP 3RJPA 1GZWA 2E2IJ 5FPLA 1J1LA 5FY5A 1BBYA 2R32A 2DYRH 4K9SA 2R7EB 2ET1A 5E17F 2R063 2AQEA 5DUXA 3HTSB 4FXGB 5F9TA 3PTRB 5FJ8J 1SFYA 4QPGC 1UZCA 3VLBB 2W1OA 3VB9A 2PQSA 3T30A 3UGFA 1D5YA 4BXSV 5GZGA 2J5PA 1D7PM 2BW3A 4XBQA 4IKFA 4HLTA 4HPQA 2YGLA 4IX7A 1GNZA 2EJRA 4R9AA 4P9UA 3ERED 1DDNA 1Z7LA 2HWD2 5K0UC 2JQ7A 5FPVA 4XRSG 4OHXA 3B7MA 4FOWA 2WFPA 3F8FA 1DGWA 2EIDA 2WNOA 1NCRB 1TWFJ 2IP2A 1VALA 1DZRA 4R9DA 4QX5A 1S7EA 1JZ6A 3OR2C 2KZVA 3V7CA 1SFXA 2ID4A 5DS9A 5I93A 3A0BC 5H6RA 3ONQA 2VG9A 3MLLA 2ZPXA 3GYHX 4LBMA 2RDNA 2A07F 4QGLA 3WQ7A 2VGDA 1PIV2 1SC7A 1IXRC 4EN0A 1ZRFA 4WM8A 3DEMA 1AL23 5D2AA 3VDBA 3BG7A 4KT6A 4P9LA 5C3RA 2GH2A 3SZGA 4H14A 3O2PE 2FEZA 1OKQA 2TDXA 4BY1J 5IFPA 5J36A 1HQNA 3EETA 4G8XA 3VBHB 3E97A 2HWF1 3ZXGA 2KFDA 3HBZA 1WH7A 1ETYA 5JOXA 4W6XA 1OKRA 2VZVA 5HS7A 1LOGA 4HPKA 4BM8A 3DBHB 2FD8A 4S2GA 1OPOA 1R23A 1E3OC 3RI9A 2ARXA 1MBHA 3CUQC 1MGTA 2GC3A 3DF8A 4GYGA 3ULQB 2L9LA 1YIPA 3TMOA 1G6NA 3HSEA 5DZGA 4XZPA 1PZ7A 1CN1A 3PL0A 4OZXA 2AGSA 4SLIA 1FOYA 5A3WA 5JMCA 5GLWA 1VNDA 4UW6A 5FUPA 2R7XA 5CNAA 3OYHA 2VCMA 1OUSA 2X8KA 3SDGA 4CDXC 4UI9L 4BU2A 5K1YA 4BL0B 2B0LA 4M9SA 1W6QA 1B09A 5M3FJ 1QU0A 1BJAA 2HI3A 3QPSA 3PSFA 1H4HA 2V5YA 5F5IA 1MDMB 4KICA 3AMHA 1XCVA 4XFHA 1BIAA 1MNDA 3HM5A 2FDJA 4OIPF 1LOAA 4LHLA 2QUOA 1W7PD 5CU1A 3T1BA 4WCGA 5D8AB 1OCPA 1YX3A 2VTXJ 2HGCA 1G8WA 4XLFA 1ZKGA 5IP6A 3H92A 2ZGRA 1BI2A 1LGNA 3PIGA 2O6GE 3VBFA 5IW0A 3BU7A 2M45A 2VC9A 2B9SA 1W5CC 1W2TA 3WXPA 1OFNA 1XE8A 2YZ4A 4CCDA 1RUC3 1VJ2A 5FCCA 3TOAA 1I6XA 3WNNA 2CWSA 3AJYA 3HTUA 3CLQA 3WSOA 3SHFA 3MKZA 2Y9ZA 1FSHA 1IQDC 1XYOA 4K1ZA 5E1WA 2BY0A 4ENJA 3HYIA 2IZWA 4GJZA 2EFQA 1KU7A 4O65A 2OX0A 4R9CA 4GB33 3JRAA 4BACA 4QX1A 1UZYA 4WK8F 5L36A 4M9ZA 3IP4B 3ABUA 4R52A 1GP4A 4O7XA 3OYKA 3MV01 3BOQA 3LFUA 1D0HA 4AFAA 3ZSEA 4C9YA 5FLIA 3EUHA 2DU0A 2HPMA 5K7ZA 1CPMA 3BJOA 3ML6A 3CCSI 2DU1A 2G4IA 5GZDA 5I0RA 3N7KA 4MHUA 3Q8FA 2W25A 4INDA 4E4SA 2XVGA 5JR2A 4H3WA 2DYCA 1FP2A 1F5FA 3ZX7A 1VBC3 3AG4H 1HXDA 4JGYC 3QH6A 4XM3A 2XAQA 4E7JA 4OCTA 4PDKA 4BQYA 2XL9A 3VWBA 3P9IA 5D6EA 4B4RA 1Q56A 1ZZ8A 1UB9A 1APLC 2JB4A 2DXIA 2NZ9A 2VOXA 1YS7A 1V6IA 2HWF2 3CZJA 4IRGA 2WA4A 1W6PB 3M8JA 3KWVA 2A75A 3GMEA 1DZTA 3MEPA 1ZHFA 2A05A 3OCPA 5F64A 3VYSB 2GXGA 2EXHA 5LY1A 3PHMA 4IL7A 3ZDSA 3AMQA 3P5BA 1A3KA 4WVMB 4QPIC 1U5TB 4KL1A 1W8ZA 4O9GA 5DCMA 3U75A 3VV1A 2ZKLA 4LHKA 5DEQA 3ZGKA 1MSFC 2QVOA 2QQJA 1XDSA 1WW7A 2CQ7A 2B9UA 3MICA 2B45X 2CFXA 1QJY1 3ASNH 5A2QK 2WQZC 2CGPA 1VQ8I 1VRH1 2WV0A 4IUGA 2F5EA 2XAGA 2A5ZA 3EB7A 4BJ5C 5IAVA 2LP0A 1SLLA 2XPJA 1O6UA 3ZYIB 1Y9QA 3DBLB 2XGDA 4IEQA 3WW4A 1OCZH 2MGQA 2EIBA 2YU2A 1GZCA 4EWDA 3FX3A 1DQ1A 2V1NA 1VQ7I 1X4OA 5FPZA 1HB3A 4DEVA 3L2YA 5G05L 1OH3A 3S5QA 2HJIA 5A2QZ 1DZQA 2E36A 3WP3A 1A35A 1DCSA 4MXWB 1C8M3 3WNMA 2VQ0A 1AYN3 4QU1A 3BVCA 3ABKH 3HB9A 2DDAA 2E6VA 3WG4A 4QPGA 2JPCA 1H1AA 1WUVA 4FQZA 1CAUA 3I8TA 2E1OA 2K4BA 2W0XA 3ZFGB 4PLNA 1YO5C 4HX8A 1CAWB 3KEQA 2WAQA 4XMIA 1LKNA 5K0UA 1S8NA 4BQWA 3HKZA 1QJX1 2M4GA 4IF4A 3S0MA 3Q8BA 5JFRA 2K2SA 5F3EA 3TO7A 4HX4A 4BGDA 2W00A 2A70A 1ZLKA 3UKTA 5F7UA 3PVNA 2EV5A 4KISA 4KIGA 2OIIA 4RB2C 4AIDA 5M0TA 1CF7A 4IZZA 2W39A 5KCMA 4NN0A 2MSYA 2CNAA 5EG0A 1ULYA 3VFZA 3SC7X 4FPGA 2R0HA 4Q5OA 1OQYA 3SEEA 2QNKA 4P9JA 4YM0A 3M8LA 3BT9A 3IDAA 1OKOA 5A3NA 1ORKA 2RJLA 3RPUA 5FZ9A 4MHGA 5C4XJ 1KXGA 4CP2A 1RYYA 4BQ1A 1MNEA 2VJXA 5DYMA 3MFKA 1UKRA 3EDPA 2R061 3PNVA 4XC9A 3AFGA 4MLOA 4XJZA 2OU2A 2KDOA 2QQ8A 2Q8OA 1OYYA 3LE0A 2H1KA 2GMMA 4ZH4F 5IVYA 4GKXA 4BDZA 3FBMA 4PSXA 4AEDB 4PGGA 2ZJCA 2ZXJA 4W65A 3CUQA 4W1UA 3CQZJ 2KRHA 1Y0NA 2K4JA 2MLKA 4NAMA 3OPWA 4W6YA 3UV9A 4RMNA 2VD7A 2WUHA 4DXTA 3SCHA 4AL9A 2WAQN 1WHUA 3GXOA 2RDRA 1JHJA 2P17A 3DYPA 5M3MJ 3ABTA 5JVTA 3HKZN 5EHDA 5C3QA 4XUOA 2LW8A 3L00A 4LBLA 3W20A 1BBT2 1CAVB 2I10A 2GZWA 5AIPA 2WTEA 3BCAA 1QJY2 2FNPA 1JYTA 3KV9A 2P7VB 2XMLA 4LPLA 2O1QA 4CDXA 1JOJA 3ZKUA 1VRH2 2PX9A 5DMYA 2CV2A 4CCLA 1WI9A 2ZFUA 4XMAA 1A5JA 1P7IA 1KS4A 4YVWB 5C3PA 2A3YA 2KRFA 3AJZA 2NXNB 3U0ZA 2BPA2 2KT0A 3WCRA 2K86A 2P2KA 5A7OA 3ME2A 5LLQA 1R093 3VBSB 4FBFA 1UU4A 4ENNA 2VZOA 1MH4A 3PUQA 3LEMA 5ICFA 2HEWF 4HXCA 4CUBA 2ELJA 1FMVA 2M34A 2WBKA 3TW7A 2WAOA 1G7YA 2LFBA 4IRHA 1BM9A 4P14A 4MTEA 3AP5A 3S30A 4HL0A 2HYJA 3SLIA 4AF9A 1QEXA 1QZYA 1BI0A 1ODDA 2F4OB 4ZDPA 3WTUC 1ZRCA 2WSVA 3D5LA 1GICA 3FM5A 1QDOA 2DT5A 1RUI3 3DQVC 3PIOF 2UXNA 1YQ6A 3DN7A 3OF1A 2VXRA 3HEFA 1ZH5A 2AENA 2JDUA 2WAAA 4NPLA 3G1MA 3AZWA 2ZNZA 4H7LA 3CCUI 5LRRA 1QJX2 4OULA 2ID3A 1SLAA 5T54A 5JWPA 1VQNI 2VUDA 3ABMH 2CU7A 2VMGA 2EXIA 2L54A 3COAC 2A3WA 2XDVA 3JRIA 1HKQA 1K78A 3FXJA 1Z0XA 1L3JA 1AYM3 2LBFB 2X51A 2R7SA 3LSPA 5TJJA 3A2KA 5LA1A 3IRQA 5FKBA 2EINH 2ISZA 3BR5A 2VC1A 4MQ9F 4OZOA 3T0YA 5A3MA 3OOPA 4Q47A 2XGXA 1VIWB 4JGYA 5GP9A 3K4CA 2O3FA 1JXSA 5DAXA 2HEYF 2F5DA 1FXZA 4CXYA 4Q4W3 2GP3A 1SMVA 2W7NA 2ZABA 3SZPA 1LHOA 2P3JA 2IWGB 1RUC1 5H20A 3EUAA 1W6MB 2R062 5GAEJ 1YJNI 4BQ2A 1YJLA 1ZRDA 2E2HJ 5K5OA 1GOGA 2HYFA 1LOBA 2ADEA 2XB6C 1KGYA 2IA2A 5BNPC 3OYWA 2P5BA 1V9U1 1T08B 1W3VA 3U1XA 5CISA 3F6VA 3UNGC 1WCKA 4GB31 3BGAA 2DV9A 5L7OC 2F4IA 4Y1UA 3WG7H 3KQ4B 4OAZA 2VB6A 3AAFA 5EZWA 1N47A 4QPIA 1QXJA 4QQHA 5B4XA 5ISLA 2GH8A 3ACLA 2QQOA 3ZFFB 2DTWA 5JR3A 1LEDA 1NCQB 4X6QB 1Y9MA 1UY0A 5FLJA 5JLWA 3V7RA 3MKYB 4HF2A 1ENHA 1AJOA 3H0GJ 4D6QA 1AX2A 3EO6A 4PCQA 1OPCA 2EFNA 4ZC3A 6PAXA 1R083 1HB1A 1VZ0A 3S1QJ 1JODA 1UD1A 5C4WB 3FFZA 3JTGA 1IRGA 3TGNA 2ZHKA 5J47A 1YO8A 3K9TA 4ZONA 4YFNF 1JBCA 3B00A 4TN7A 3BG3A 3K6GA 3RKYA 5FZEA 3WY6A 1BXHA 1YUDA 5BYNA 2UUZA 2OCCH 4RN5A 1HN0A 4OVEA 2A71A 4R79A 1LDDA 1V6NA 3GXUA 3V56A 3KS7A 4PFOA 4YWAA 3LKJA 5IYBJ 4C1XA 5DD4A 3CKHA 3UK9A 5AVPA 3IIAA 3MDPA 2QKMB 4XACA 2HVSA 1XE7A 2VU9A 2PHRA 3VKNA 3D0SA 4BCUA 5E6HA 2JXAA 1MS4A 3OD0A 4EMSA 1JKQC 3ZSMA 5DXDA 3VBRC 4R1HA 2K3PA 3CO6C 1DGRA 2F4PA 1SVOA 1O91A 2YYOA 5ANNA 2XB5A 5B1AH 1I1GA 1APNA 4XFFA 2A5YB 4Q29A 3HBLA 4NDLA 2JSPA 2ESNA 2KJBA 1QZZA 3WINE 5I0DA 3I2IA 4XF9A 2XLAA 4B48A 4IEXA 4I2OA 1KJLA 3TBDA 5LHHA 1IPKA 3CF6E 3E6BA 4HNVA 1JZ4A 1LFPA 3OGRA 5G04L 2R7TA 1XU1A 3FHAA 5CKQA 3JSPA 3MGUA 1YHFA 2BNMA 4Y20A 1XNDA 1LODA 1E3HA 2A6ZA 4LO8A 3Q9SA 2D45A 1W9YA 3ZPOA 4RAFA 3KHBA 1DGRM 3F9KA 3VBOC 3R0RA 3THDA 3Q3SA 2YB7A 1UAIA 5FY8A 3LNQA 3POFA 5SV8A 4P96A 3I55I 1C8M1 1LU1A 4AIJA 4BIFA 1CAXA 1AYN1 1RUC2 1G2HA 2E5NA 1G9CA 1YQAA 3SQOA 1AJKA 2XR4A 1FNNA 3W2VA 4UFIA 1VMJA 2XVKA 1BOAA 4D5CA 2WB1A 4F55A 4Q1PA 1G9BA 5FD6A 3K4NA 5FLVA 4RGXA 4B43A 4HSJA 1W6NA 2H6BA 2VONA 2XG3A 4GB32 5FP4A 5AFEA 4KWKA 1WMDA 3MIEA 4IEOA 1XGMA 1DGRN 1AR63 1BJZA 3PUHA 2MH2A 4BPZA 3L2UA 2D44A 4Y1YA 1O3TA 4IEYA 1TVGA 3CDLA 2A7AA 1TQPA 1LR5A 3GFIA 4CPBD 1W6OA 4JCKA 4DO0A 3BPSA 2XQXA 3C7FA 2JA7J 2IXCA 1PYVA 2F17A 1HIXA 4HQMA 4OIQF 4OUMA 2X5IC 1QZEA 1ZG5A 3I97A 1S2KA 2D6NA 4R4XA 2JWTA 1YFHA 2KMUA 4BXXJ 3AKTA 2KPMA 4ES8A 4UW3A 2DFHA 1VQ6I 2PYTA 3ZMTA 3SH3A 4XURA 5FLMJ 4KUMA 4FX0A 3L2VA 2GIZA 2NVQJ 2WYSA 1ZN2A 3BQYA 4GZ9A 4QAWA 3VBUB 4M6YA 4N90A 3R05A 1TL8A 1Z78A 1V6LA 2QBXA 2HQNA 5FZ0A 2QM3A 2Y8KA 2WB1N 2M0CA 3PFIA 4YIIA 3AKPA 4QPOA 5IY5H 2MFZA 2DA3A 4I0WB 2K46A 5LBEA 4A3ZA 5C9AC 4KNYA 1LQ1A 4HDUA 5LRSA 2YY1A 3IM0A 5IYYA 2DYSH 4DUVA 1LAJA 3BODA 3AKSA 1G8XA 4EN9B 4XTPA 5E20A 1RI7A 1WMXA 5CQEA 4ARYA 2Z99A 3WR0A 3FIWA 3SCGA 4BBRJ 5A7WA 2VZ3A 1ULGA 2H94A 1H6YA 3DEUA 2XJRA 3B73A 1OQEA 1OLRA 1Y8RB 4RR3C 2IVMA 1UZZA 3A4CA 3UKGA 4A3IJ 5F27A 3G6EI 5CFDB 1XB4A 1GFF2 3OUHA 4BJTA 3K10A 4JC1A 4CTEA 3BR6A 5B2GB 1JGSA 1S3JA 4BYYA 4NC6A 2QBYA 1S2BA 4KU8A 2W92A 4COYA 2K9SA 4P9IA 5F0FA 2VUMJ 4FPCA 3S8PA 2KLOA 2VI6A 2XROA 3PIJA 1W9WA 1ETVA 3BTAA 1C8M2 2EB7A 1AYN2 1Z7UA 1ETOA 1H2LA 2WNVC 4C8DA 2FDIA 2W57A 3I58A 5BNPA 2JIGA 2YPJA 3F8CA 3MZHA 1RUI1 1ZG3A 1MJAA 4XFCA 3LWFA 4AI0A 4ZDLA 2CDOA 2ZBKA 3VZLA 2VQGA 4Y52J 2XOMA 2SLIA 5L7OA 1ULFA 2JG8A 1US2A 3CZUA 4LIVA 1I1SA 4D0QA 4COZA 1BK1A 2MPFA 1USTA 5F8PA 4B1MA 2XSJC 1BA5A 4EZ4A 1ENRA 1OLQA 1XBFA 2SBAA 1PVXA 2LNBA 3CP8A 1RXFA 1WLDA 3QCWA 2ZGNA 5JHUA 2RNJA 5BXXA 4NNJA 1NKGA 5L73A 1IS6A 4WVZA 4MO3M 4BZ4A 3ABLH 4H2AA 4J1XA 1VQMI 1G59A 3DEEA 4BH9A 2IPQX 4Z6YA 3WTTC 2WNEA 3V64A 4BDYA 3WNPA 3VKLA 5JSOA 2GDFA 3MUZ1 2VQTA 4JOMA 4UUSB 2X9DA 3USUB 4JV4A 2BVVA 1OURA 1MZ5A 2D6OX 3M3IA 1EUTA 4C2TA 4V19K 2V26A 4C0BA 4Y33A 1CJDA 1WBFA 5FFOC 1TMF1 2DCEA 3DU5A 1ZGJA 1HOMA 2UWAA 4HLYA 3S14J 3WCSA 4HLXA 5IUQA 3D6EA 5A7PA 3NNGA 1LVAA 1QDCA 2QQUA 5A3TA 2IFRA 2DMNA 4XAAA 4E7ZA 4XUQA 3VBRA 1XYNA 4QB2A 3ZPLA 1STMA 4BDVB 5FZOA 1UMHA 1W03A 3I4NJ 4XOGA 1JN2P 1NA1B 4LBQA 2H0VA 1ACCA 4MFDA 5C8CC 4CU7A 2VZPA 1QJFA 2W5FA 1AR91 1WJAA 1YXWA 4L97A 2R5YB 4AVVA 4RS8A 1YHQI 4CCCA 1J1TA 1CGPA 1CZTA 3F22A 4RB1A 1XOYA 3LOIA 4IO9F 1CZSA 1MS0A 1V4RA 3ZYRA 1RR8C 4RQPC 1W4MA 2WADA 5LBFA 2B7YA 2G7UA 4LUKA 3ZXAC 5J7MA 2BVBA 3VBOA 2HWE1 5B4NA 2CWMA 3H5RA 3OYIA 4F83A 3CBNA 2VH9A 1D8JA 2WAEA 1RJ7A 2BEOA 1C8NA 1SBEA 1UU5A 1PMHX 4EVIA 3UJOA 4Y24A 1U9NA 4NO4A 3I5UA 2XIGA 3L9FA 3FBNB 3MLJA 4D0PA 5TISC 4L5IA 3RMXA 1OHFA 4M01A 1RUI2 2D97A 2DCZA 2UY9A 3N3HA 4Y5SA 3NQOA 4CEWC 2V1UA 1B8IB 2VBXA 4LJHA 2VMIA 2FCTA 2DDBA 2NS7A 1E5IA 2JT1A 4DXRA 4YNIA 1F35A 3KLNA 2PMZA 1BCXA 1AYM2 5FZLA 1UWWA 2ZJRF 5IVEA 3CO7C 4EZHA 3NAUA 4I98B 3LPGA 5LW9A 1X33A 3F95A 1PGW1 3M7GA 5E89A 2Q8CA 2W48A 4HKWA 2I2SA 4Q4ZF 3NNLA 2NOJB 1HKDA 4QDSA 4IV3C 2MC3A 2QQKA 2X5IA 4XXPA 4WVWA 5IYDJ 1KITA 4Q4W2 1ZNPA 4QXKA 4DOUA 4XUPA 2KIUA 3HSRA 4IERA 5FKNA 1DYOA 1UZVA 4QQLA 1F15A 2CV6A 2WA0A 3WG1A 2ZOEB 1D5VA 2FU4A 3LAJA 5A1FA 1IV8A 2PJRB 3WHCA 4ZXKA 4Z2WA 1ND2C 4C90A 1L0OC 1ENSA 4GAZA 2DA6A 4BOWA 4YGEA 1S2EA 1FOD3 3BU0A 4XDPA 1UY1A 1U5ZA 4QQOA 1S7AA 4YM2A 1JT6A 2VBBA 3H9AA 3B94A 1TNRA 3BZCA 4BQ4A 1BEV3 4A3LJ 4COWA 1F2NA 2Y26A 4PIYA 3O8GA 3VD3A 4MOAA 4LGWA 1VQKI 1FIPA 5FY0A 2LR8A 3T1LA 1PNGA 4XF1A 1QNWA 4WM7C 4DMIA 5C9AA 1AR61 1LEBA 1FI2A 3EMRA 3I7DA 4C3IJ 4ASKA 2NS0A 4XN0A 3RNSA 1UG2A 1UYXA 1S55A 1JZ2A 3CCRI 2PMZN 1RINA 4LO4B 4XMYA 3OWTA 4D7MA 2DDUA 1P2FA 2Y34A 5CLSA 4OMCA 5DABA 5E16A 5I0UA 3HN1A 5GM0A 4RR3A 1R082 1AR92 3RYRA 3NV2A 5F32A 1WZ2A 3C7OA 4ASNA 3HQXA 5AC93 1RXGA 4GMP1 4AR2A 1LHWA 3O1VA 2Q1FA 4HEA2 4UW5A 5E79C 2RHPA 2AC1A 1TTYA 1X8EA 1FNZA 2VMHA 1BIBA 2FMYA 2EH3A 4E7IA 2HWE2 3WQ1A 4MG2A 1OLTA 3WDTA 1PO21 4N4OB 3QOEA 3BTJA 1D2SA 2EA7A 4CCOA 3PVBB 4YZ5A 3TKYA 1I27A 2NVTJ 3GZUC 4Y4RA 1LGBA 2WS91 2J5OA 3QRFF 3HC7A 2DCTA 1FIAA 1A31A 4WZFA 3QYBA 3PDQA 2D6LX 2Q8EA 3VDAA 1ZTRA 1H8TB 3VZNA 4DEQA 2H6CA 2YUSA 3VHPA 2QQVA 4D6SA 2HYGD 3PUFA 3S32A 3C2UA 1NCRC 3AMNA 2KZGA 1FV3A 1DU0A 5GJ6A 3ACGA 4HN0A 1YFYA 5JPNB 4B29A 2F2EA 5HS8A 3HOVJ 2EXKA 3W9AA 1UY3A 2A6YA 2V9KA 4D94A 1ZBA1 3MI8A 3NV1A 2BE5F 1Y1VJ 5FO9B 3TOBA 2V79A 3TOJA 1OF4A 4D6RA 1DGWX 4NRMA 3BJ6A