3E5QA

Unbound oxidised cprk
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
209
structure length
202
Chain Sequence
NFFPIEKLRNYTQMGLIRDFAKGSAVIMPGEEITSMIFLVEGKIKLDIIFEDGSEKLLYYAGGNSLIGKLYPTGNNIYATAMEPTRTCWFSEKSLRTVFRTDEDMIFEIFKNYLTKVAYYARQVPTIRILRLFYELCSSQGKRVGDTYEITMPLSQKSIGEITGVHHVTVSRVLACLKRENILDKKKNKIIVYNLGELKHLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis of halorespiration control by CprK, a CRP-FNR type transcriptional regulator
pubmed doi rcsb
source organism Desulfitobacterium hafniense
molecule tags Transcription regulation
molecule keywords Cyclic nucleotide-binding protein
total genus 47
structure length 202
sequence length 209
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2008-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3e5qA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3e5qA01
2VECA 2FBHA 3KE2A 4HVRA 1I1GA 3BJOA 4L9VA 2EWNA 4ZH4F 1WSUA 1J3PA 4B8XA 3UKNA 2P5VA 4Z82A 3I59B 4MTDA 3HHGA 3KP7A 3CUQA 5FLXZ 1DP7P 5I8SA 2RGVA 2ESHA 5DYMA 3LQQA 1FSEA 4P96A 4OU0A 4M71A 4XSZF 5CVUA 4MUVA 1KQ0A 2RDPA 2ET1A 3QAHA 3O3KA 4JVAA 3FM3A 2KIMA 1IXCA 5LEKA 1K78A 3BALA 3MWMA 1B59A 4HX4A 4IEVA 2GQQA 2FMLA 2UZKA 4YFNF 2F4PA 2QQAA 3HHHA 1FY7A 4ESFA 1ZRCA 2UWMA 1IAWA 3V8KA 4DQ2A 3DFGA 1TQIA 3LOIA 3M8EA 2EJRA 1BIAA 3WTSC 3RKYA 5HI0A 1K6OA 1O3RA 3U11A 3CLOA 4BHBA 5FFZA 5L3BA 4BYYA 1SFXA 1U12A 3RYKA 4HN1A 1XE7A 5LGNA 4LJZF 2EFNA 3TO7A 3CTAA 3EO6A 5ED4A 1HW5A 3RPQA 2Q30A 6PAXA 3P9IA 3KLOA 4B09A 3F6VA 2A61A 5L3GA 4UVCA 2DQLA 3M8FA 3E5UA 1H9GA 4WXHA 4MV2A 4OMYA 4MEXF 3U10A 4KN7X 2FOKA 2FXAA 3W6KB 3WTVC 1SFUA 4I2OA 4JK1X 1FNNA 5FQ0A 4H0EA 4A5NA 1J7KA 4BAYA 2IXJA 4ZYGA 3J81K 4Q4ZF 1PM7A 1HQCA 5CVRA 2M8EA 1MDMA 3KFWX 2MBFA 1EY2A 1E17A 3OTFA 5I93A 2HYFA 2XKOA 3G3ZA 5E20A 1U5TB 5D4SA 2CFXA 1SFEA 1QPMA 2WFPA 4EVIA 4U0YA 2J5OA 4FX0A 4XFCA 2GZWA 1ZRDA 3KLNA 2PMHA 1K79A 4HV5A 3G7DA 1Z7UA 1RC6A 1KQ9A 1EP0A 2HGCA 4MTEA 4LLNA 3U0ZA 2IJLA 2VONA 1NZCA 1CF7B 3QU3A 2LKPA 2I45A 1Z1DA 2STTA 1JXSA 2A69F 4HBLA 1R58A 3FZVA 4I01A 2D5FA 1UPIA 1R1TA 4XFIA 4IEOA 4I09A 2XRNA 5TJJA 1XE8A 1EPZA 5AONA 2NNNA 3I58A 1ZN2A 1U8RA 4OMZA 1XGMA 1QZYA 1ONVA 1XSXA 4UV9A 5JHUA 2L3DA 3HRUA 4HDUA 2NRAC 2DCTA 3FHZA 1TNSA 4EWAA 2G7HA 3HT2A 4UHTA 3F23A 4M6YA 4LGWA 5E8GA 5TRDA 3UKTA 4LG0B 3M70A 1P2FA 3S0MA 1T0FA 5K8SA 2A5YB 3F3XA 2QUFA 3BZ6A 1OYYA 1LKNA 3ZPLA 3U2RA 2JRTA 2A3SA 4IJAA 3H1MA 4OIOF 3D0SA 1ODDA 2P6TA 1J9IA 2IVMA 2WTEA 2RQPA 3HOSA 2QZ8A 3REOA 1BM9A 1DZRA 3ISPA 2Q4SA 1WRJA 3H3UA 2Z99A 1A04A 2GWRA 1JE8A 1CAWB 3WTUC 1Y0UA 5K5OA 5DD8A 4AVBA 5DD4A 2HS5A 4MQ9F 2XL9A 5KHGA 2BYVE 4XF1A 3HQXA 2OQGA 1W7PB 1QO0D 3COAC 1FYKA 3L7WA 1DZTA 4I3PA 2ETHA 4LK1F 4R52A 3L09A 1HBXG 4JV4A 4L11A 1CAVB 1IN4A 4XFBA 1PDNC 1QNTA 3BU7A 1STZA 1G3SA 4IEQA 2MC3A 3KEQA 3L00A 3JW4A 2YU3A 3OOPA 3FFQA 1KU2A 4BXUA 1D5VA 2K27A 4OIQF 2IXCA 2YR2A 4HQEA 4L5JA 1BBYA 4UXAA 4R8HA 1HXDA 1Q43A 1ZARA 4YFXF 1RUNA 2QQBA 1T98A 2QNKA 3FJSA 1TQPA 2ESNA 1OYWA 5J8CA 1ZVFA 1LNWA 4U0WA 3SZTA 1ZGJA 3L2HA 3BJ6A 3CUOA 5BOXA 3CO6C 5JFRA 3JAMZ 2IA1A 4LK0F 4AD9A 1B6AA 2J5PA 3J7AO 4M9XA 5HLIA 1D8KA 5DCFA 4HMZA 2R3SA 2H6BA 1O3SA 1YWKA 3IC7A 1R1UA 3E6BA 5BUVA 2EV0A 3HTSB 4J1XA 3C3WA 3QPTA 1LR5A 2ZJ2A 4HOBA 3ZMDA 2ZNYA 3M9AA 3O2PE 2XASA 2RVCA 3PNAA 4QGMA 3KP5A 2L4MA 1SQ4A 2ELHA 5EZWA 2LF7A 2VBYA 3GFLA 4RB1A 2IXKA 1B9MA 1YTYA 2D40A 1ZZ9A 2UYAA 4NQWA 1IRGA 3VFZA 3WE2A 2CV6A 3V8LA 1ULYA 2E1NA 3WTWC 1RL3A 1ZZCA 3J81Z 3E6CC 1IW7F 3ECHA 1WA4A 3K9TA 4UVBA 3TNQA 1X8EA 2MH2A 2YX4A 5I8YA 3WU1B 2VN2A 4KMFA 4WZCA 4HAMA 4B29A 4QWQA 2IPQX 3R0AA 3KZZA 2HJIA 4P9FA 2E1CA 3ACLA 3FMSA 1IZ1A 2HTSA 2M45A 3DV8A 4PGHA 3FHIB 4L9NA 4Y17A 2CO5A 4AVPA 5CADA 2PN6A 2CQKA 1S6LA 2IA0A 1QY4A 4UBGA 1BOAA 1P92A 5BY5A 4FX4A 1YQAA 1ZRFA 5FGMA 1TBXA 1MD0A 2GC1A 2HWVA 3WG9A 3G73A 2ZO4A 2HR3A 1S3JA 3FF5A 1DPRA 3GBFA 3ELNA 4META 1QGPA 2WV0A 2VT3A 4NVPA 1HW2A 3MFKA 1ON2A 2JZYA 2NYXA 3Q9SA 4AIKA 2OA4A 2FNAA 3VODA 4YNIA 3IBMA 1JHFA 5J6XA 3M7GA 2IT0A 3H7JA 2PAMA 1NE4A 4D7SA 2VC1A 2WWYA 2QBYA 1F1ZA 1R5HA 4KWJA 2CYYA 3K1NA 1HKQA 1FT9A 4IHTA 2VOOA 3PVBB 2OYZA 1MJ9A 3FZ3A 5HS7A 2K0GA 2VE8A 4ZU4A 4RS8A 1H1MA 1ZG3A 2PBIA 2A6EF 5CU1A 2EV5A 4TV7A 1Q3EA 4L2NA 3I64A 4DINB 2VE9A 5LBQA 2V1UA 1IXSB 1YG2A 4U0VA 1VJ2A 3F8MA 5ICGA 3FX3A 3KP4A 4RGRA 1IXRC 1SMYF 3IWZA 4LLGF 1B1BA 5C8WA 1QWRA 4LUMA 2MLKA 4M6XA 5DV5A 1F5TA 3UKVA 1R00A 3C18A 2IC1A 1RZ4A 3T8RA 4KYWA 4Y15A 3QP6A 2Z33A 3IKTA 1X8MA 2GC2A 5DCMA 2Y0MA 4KWKA 5E1ZB 3M1EA 2ZBKA 1J3RA 4GYIA 5L3DA 2EFOA 2JTVA 1LJ9A 4HV6A 4N9HA 1FYLA 3O14A 2OPKA 1FSHA 1Q5OA 2QENA 4YIIA 5F1RA 5DUIA 4CICA 4HBNA 3NRVA 1U5TC 1VR3A 2JPBA 2QCSB 3ROUA 5D5WB 4M74A 4MQVA 1G6NA 1CAWA 1UCRA 1HSJA 3RTRA 4EJVA 1D8JA 1JHHA 3HOTA 5E1RA 1AOYA 2H0VA 4KDPA 1Y3TA 3MPBA 2GC3A 5I0RA 2OD5A 4MNUA 4KN4X 2DAOA 2B8MA 2ADUA 5KHHA 4R79A 4LEJA 1FBQA 4IEYA 3DL3A 3B02A 3BCWA 4CGZA 4Q0QA 2W25A 2L02A 4KNYA 5LEJA 2PEXA 4XF9A 3SHRA 1AWCA 3MQ0A 2RV8A 2FSWA 3ZQ7A 1ZX5A 3NSTA 1IPKA 1X7NA 1IUYA 4WWCA 4D7TA 3JAMK 1WQ2A 1QQIA 3RYPA 3WODF 4GCVA 5D5XB 4O3MA 2H27A 1WLTA 2ZXJA 4Y13A 3LA3A 1FOKA 4PIYA 2BV6A 2DT5A 2W24A 4E2QA 2R7FA 4K8FA 3E5QA 1BJAA 5E18F 3SFZA 4ZYDA 2DO7A 1TLHB 1I5ZA 5HVQC 3EYYA 3S7EA 4HYEA 1R22A 2P17A 3L2CA 2VC0A 3CUQB 3ML6A 2K86A 2OZ6A 2E9QA 3DQVC 1USTA 1XD7A 4MGKE 1W7PA 4KMUX 3TDUC 3QRFF 5D1IA 4HSJA 4HVQA 3V4GA 2VBZA 1QZZA 4HX7A 3E5XA 2XAFA 3KEOA 3GLXA 4AVAA 1SD6A 1U6GA 2COMA 1XCVA 2MA3A 3IRRA 4ORFA 3ABUA 2YSRA 2D5HA 2FNPA 4XBFA 4WX9A 4PIZA 2AS5F 5IT3A 5ERIA 2FA5A 2HKOA 3ELKA 1XSVA 1Z05A 2KJCA 3OGJA 2KIUA 1IPJA 4GXOA 1BIBA 1J75A 3R61A 1R1VA 5CLSA 1YFYA 1YW9A 2DLLA 3TKYA 2V1DA 5HS9A 1U2WA 1EH7A 5FQ0B 2ISZA 1ZLJA 4IEZA 5HOOA 1YFHA 1Z6TA 4UV8A 3BY6A 4HZFA 3TDZC 5F64A 2PJPA 2W85A 5DEQA 1CGPA 4O9EA 4G7HF 4G8XA 5A2QK 1I27A 3GVAA 4OLLA 4LA2A 5I8TA 4Q29A 4M9ZA 1SMTA 4LMYA 4E70A 1FPQA 3K2ZA 1Z9CA 2VT2A 3EBRA 4IRHA 4PJYA 2STWA 1FBUA 4ZZLA 5J48A 4R1HA 4RGSA 5I0SA 2IP2A 5BPXA 2D1HA 3HTUA 5HDKA 2BBYA 3ZN0A 1WWXA 3ZMZA 2DTRA 3ZMUA 5A2QZ 1YYVA 1OKRA 3F22A 2O8QA 2Q8KA 1Q1HA 4HX8A 5BS6A 2D93A 3GWZA 2HYGD 1T39A 1XSDA 3TOAA 4EGYA 2K7LA 2XLAA 2UY9A 4FBFA 4RB2C 2GAUA 1F4KA 2ZKZA 2N7GA 1TQMA 5FCCA 2KIFA 3OV8A 3H1YA 1ZG5A 4MH0E 2VBXA 1RIOH 5JVTA 1YFWA 5JR7B 3LQRA 2OA2A 4I7HA 2RKHA 2P6SA 5CVIA 2F2EA 3IHUA 4WVZA 2Y48A 4XFGA 4XLPF 3RZZA 4EGZA 1O3QA 4ENMA 2Q0AA 3BDDA 1VP6A 3R60A 2IXLA 3BPXA 1RNLA 1XB4A 3BPVA 5D8LB 3IIAA 1XMKA 2HEOA 3ES1A 3SHFA 4ENKA 4Z07A 3JSOA 1ZHFA 3IKVA 4A0YA 5EFUA 3V7CA 3HSRA 3TO9A 1XN7A 3Q5FA 2LSOA 2P5LC 4BNCA 3D82A 4WCGA 4EWDA 4XFFA 5ILUA 3E6DA 3PLQA 2L01A 1SD7A 4BQAA 4G9YA 3MDPA 2Q0OA 4ASNA 4ESBA 4S04A 4PDKA 3EYIA 2FBKA 2Z9OA 2GA2A 2TDXA 5BPDA 1ZZ8A 1X3UA 3GZ5A 1FP1D 3ZMSA 5DDGA 5BQTA 5K5RA 3QP5A 4UXNA 4FAHA 4WBBA 3EHKA 2ZMEA 1XGNA 2QJVA 3HSFA 2GA1A 4LLOA 1ZGAA 3NQOA 1R23A 3HUGA 3I5UA 4KIFA 2HQRA 5E17F 5KHIA 4HDVA 4MZUA 4O9GA 3USSA 2KJBA 4PZJA 4HLYA 3LZZA 1DPUA 1W5SA 2UXNA 3WW2A 2ISYA 3HIFA 4GYGA 1UCXA 1YHFA 5FD6A 2Y0OA 3DKWA 1C0WA 4KL1A 1REPC 1KA8A 4MGIE 5DCMB 4IEPA 1CAVA 3NEUA 2OU2A 4HF0A 4P55A 1YFXA 1K78B 3EUHA 5ILVA 2OZJA 1RTVA 3BOQA 2F5EA 2FRHA 4RGUA 2BNNA 1E2XA 2HZTA 3PQKA 4ENJA 4Q0VA 5LGTA 1P6RA 3HRSA 4Q48A 1R5GA 3V7RA 1YW8A 1ZREA 3S2WA 5FD5A 3T8TA 4QM9A 4MHGA 3HRTA 1CX4A 4YYOA 1W5TA 3OF1A 4YG2F 1HW1A 1H0MA 1L3LA 2IXIA 3WTZA 5LGUA 3KMHA 1BI3A 2M5WA 2O61A 1D3YA 1NHAA 2B9UA 3FXUA 2GH2A 1R36A 4KUMA 3I0TA 4ONUA 3MZHA 3CO2A 3L9FA 4N0BA 1GXQA 1SD4A 2O1QA 2PFWA 4EJUA 3N4MA 2XHKA 3E97A 2QBYB 1W4MA 5CVJA 2IXHA 3GX4X 3BWGA 2BNMA 4U88A 2A6HF 2QM3A 3NW4A 3EDPA 4A5MA 3LSTA 1IN5A 3VEPA 3RJPA 3HRMA 3C1DA 3FE5A 3WTXC 1MDMB 5KHKA 2Z2SB 2ATFA 2HDCA 2XL7A 4HF2A 4EM0B 4I98B 4EJOA 3U9GA 4ENNA 2EFPA 4IHSA 2BNOA 2DQRA 2VPVA 1DGWA 2E7WA 4YSFA 3LAGA 2VBWA 4KFCA 4XF4A 1FI2A 4IETA 4RAZA 3JZVA 2CG4A 2X4HA 4GO1A 2DFIA 2L4AA 2ETEA 1HKSA 1LEAA 4RGXA 3WW3A 1ZYRF 3PQJA 2MNGA 3MAJA 2GU9A 2O03A 4M72A 1J58A 2PQQA 2M1BA 1G4DA 1DDNA 3WTTC 5ICCA 2L54A 2UYBA 1SEFA 4Q0PA 1G3WA 4KWLA 1FC3A 3T0YA 3KCCA 1X82A 3ZN1A 2OQRA 3QOPA 2EFQA 2VOPA 2FQPA 5KVRA 2XLFA 1ZH5A 1FWZA 3J80K 3NJZA 2XROA 1O7FA 3DN7A 1W7PD 4HLTA 5FPXA 2XV4S 4OINF 1J3QA 3H50A 5L3EA 5CVVA 2PHDA 4OIRF 3S7IA 1XGOA 4NHJA 2XGXA 2H6CA 2XAGA 1SD5A 1OR7A 5JSOA 4L5IA 1XGSA 1IN6A 2IRFG 3R4KA 3JTHA 1K7AA 1GHCA 4JTNA 2VXZA 5FDBA 3CL1A 3H3ZA 3I71A 3NL1A 5JCTA 2PFBA 2JPCA 3MEXA 1DUXC 4EMSA 3JTGA 4FHTA 3GXOA 3ABTA 1O57A 2ZKLA 2EV6A 1NXMA 4XF0A 1JGSA 1ZLKA 5FLHA 3KETA 3WGHA 2EAAA 3V8JA 3RKWA 2EA7A 2AXLA 3FXRA 2O6GE 1FP2A 1PMIA 3T5XA 3TOBA 2QVOA 1YLLA 1UHMA 3D0JA 3SXWA 3K0LA 2FQ3A 1LDDA 2K02A 1KU3A 1J1LA 4IERA 3VHRA 4HSLA 2UXXA 3KSCA 3SCHA 2QYOA 1WI9A 3GZ6A 5FLIA 4KIBA 2V79A 4XFAA 1Z6RA 4UBHA 3GFJA 3KGZA 3I53A 3F8CA 2H09A 5F6FA 4H7LA 5IT9Z 4LG0A 3SXYA 3P9CA 5D4RA 3QPHA 3EETA 5JR3A 3FWEA 3I54A 3IRQA 1TW2A 5FPZA 1I6XA 3GO5A 1UIJA 2XVCA 5H20A 1KYWA 3VOEA 5E1WA 3KGLA 1S7AA 5HLHA 2Y75A 5LRSA 3H1WA 5D6FA 5AIPA 4NB5A 5J7MA 3TGNA 3CF6E 3QACA 1KU9A 1S29A 4A6DA 4ZU5A 3LWFA 2DPDA 4MX3A 3CO7C 5BPIA 2X0LA 2C6YA 1P4WA 3CEWA 1SAXA 1ZG1A 5ICFA 2ZNZA 1MKMA 4L0YB 1O5LA 4E2SA 1UW8A 1ZZ6A 1GQHA 2DW4A 1KYZA 1USSA 4WF2A 1L3JA 5JI6A 2VODA 4KIGA 2C0ZA 4IEUA 2K4JA 3P9KA 2MD5A 1FLIA 3ZDSA 2DBBA 4P9UA 3CJNA 4KICA 4RAYA 3GEZA 5HS8A 1GXPA 2K9ZA 4LTAA 2YX7A 3DPTA 3DEUA 1XDUA 2Q2EA 4KU8A 1UIKA 1U5TA 5C6CA 4Q47A 1NYWA 1YUDA 5FB2A 2PAEA 2ZFWA 2W57A 4EM1A 1YS6A 3H92A 4EQQA 3U1DA 4HA8A 1ON1A 3IDCB 4X6QB 4FAGA 3AAFA 2FE3A 2O8XA 2XUBA 4JBAA 3MZYA 2DI3A 4ZYHA 3ETQA 1J5YA 2ET7A 1WKMA 4X6RB 3ST7A 4YFKF 2BE5F 2JT1A 3FMRA 3K1MA 3F8NA 3GYHX 5D5VB 3OCPA 2DPUA 2FU4A 3FM5A 2JSCA 3W6JB 2CSOA 4HF1A 4XEZA 2CGPA 2FBIA 2A68F 1BN5A 3GUDA 4ZZDA 3LFKA 1LQ1A 1LEBA 3DPLC 3K69A 4IPAA 2PTMA 2ZCWA 1O3TA 2CW0F 2CWEA 1CAXA 3GFMA 1JUHA 4ZYEA 2BGCA 4A6EA 1IN7A 4XFHA 1V70A 3E3VA 2RNJA 1CF7A 5LHGA 1IRFA 4WXCA 4Z2YA 1O7LA 4HLXA 3NKTA 2O3FA 3Q9VA 1IN8A 5JSPA 3BJAA 4G6DA 2F5CA 3GF2A 2Q1ZB 5K5QA 4EJTA 3ES4A 4XRFA 2LDUA 5BMZA 1CAUB 5HLGA 5KHJA 4UVAA 2IW5A 5FLXK 5E1XA 1U3EM 1GQGA 1V3FA 5HDNA 2DK5A 2VQAA 4UNOA 1OD5A 2LF8A 4PGGA 1YO5C 2DK8A 2Z5UA 1ZRRA 1KU7A 3R0JA 3SCGA 3LWCA 1LDJA 4MGZE 4A2UA 1PP8F 5LLQA 4FT8A 2YPRA 4AVCA 1OMIA 4EM2A 1RGSA 1EH6A 4KT5C 2GXGA 1KQ8A 5AVPA 2P4WA 5EEGA 1U78A 4S05A 4LA3A 5D6EA 4LB6B 5E8IA 2EFWA 5JSRA 3P7NA 3J80Z 4I0AA 5HDGA 3V7SA 3EQLF 3KP2A 1QXJA 5D5UB 3SQNA 2RC4A 5LRRA 2KRFA 1YFUA 4HVOA 3RDIA 1BC8C 3EJKA 1XDSA 3WW4A 2HTJA 1OFNA 3GFIA 2HFHA 4UUVA 3CJXA 1ZNPA 3ULQB 4BH9A 4QGLA 3DXJF 3D5LA 5DUKA 4CZZA 5L3CA 4LB5A 1TNTA 1J0RA 3TQNA 3LAJA 3HSEA 4I02A 1YIOA 1I1SA 1VTNC 2MHFA 2Z69A 5IT9K 5BV6A 1LVAA 4OOIA 4Q0UA 2CAVA 1YS7A 1HSTA 3FMQA 3CLPA 4P9GA 2XAHA 2V6CA 4ESJA 2LNBA 2P7VB 2A07F 4A0XA 2KKOA 2QDRA 4TLFA 4IRIA 3GW2A 4AQ2A 5KBFA 4A12A 3F21A 1UFMA 2D1VA 1MZBA 3HYIA 1EYBA 1OI6A 5LHIA 4AWXB 1EH8A 1B4AA 4XLNF 4IESA 3M3IA 4CDGA 3K1PA 3O6BB 4G7OF 3CUQC 1ZZBA 5CJ9A 4L18B 3I59A 1T38A 4GGGA 2HQNA 1R7JA 1EV7A 3JSPA 3WGGA 4J1WA 3ECOA 3WGIA 1T6SA 2XLGA 4HN0A 2UY8A 5L3FA 1MJAA 4ZU7A 1BI0A 1PUEE 1O4TA 4G94A 4HQMA 4XF3A 3R6SA 4LULA 5E16A 1P4XA 1LRHA 3N97A 3B73A 3TO6A 4F7ZA 4QGNA 5D8KB 5FLJA 4XETA 5ILSA 1QXRA 2PAKA 2PMUA 4WK8F 3EQEA 1UHWA 3I4PA 2B5HA 2MLGA 3HT1A 4E2GA 3KZYA 4JQFA 1GVJA 4AQ6A 2IA2A 4MGYE 1TQ5A 1FZPB 4LFUA 2D45A 1QBJA 5I0TA 1J59A 3SMHA 4OFGA 3ERED 2M30A 1FBSA 2B0LA 1L0OC 4AXOA 5I91A 4ON0A 1XCBA 1TW3A 4RB0A 3BPZA 2W84A 4BHCA 3MCZA 1P4AA 2NAZA 1FX7A 1MJBA 1BC7C 2GXBA 3WW1A 2XAJA 3E6MA 4IEWA 2ACJA 4RD7A 4M73A 4IXAA 2OBPA 1RUOA 1KGSA 3T1BA 2PHLA 1G3YA 2V9VA 2Z3YA 5H6QA 4EV0A 4EROA 3NVCA 4CHUA 3VB2A 4QXKA 5FFXA 4G6QA 3F8FA 2CAUA 3RYRA 4QX5A 3LA2A 2H94A 4N9IA 3GYDA 1BI2A 3C3VA 4EWEA 3H7YA 1O5UA 2E7XA 4D0PA 2EA4A 2MPFA 1Y9QA 4YRDA 3IL2A 4F8AA 2EA2A 5AIQA 5K1YA 4DNCA 3PFIA 4IEXA 2XIGA 2PLYA 4QM8A 2GC0A 4K2EA 4RB3C 1LB2A 3LAPA 4U7BA 2P7CB 3ZP5A 1S7OA 2XAQA 3FXQA 5ICEA 1SFNA 1CAXB 5JAXA 3RI4A 1UD1A 4IF4A 5J3UA 1T2KA 2P5KA 2OZUA 3SCFA 4Q5SF 5I0UA 1ZAOA 1NE6A 3H8UA 2WC2A 2XKPA 2M87A 1XMAA 2PYTA 4CYDA 3BROA 5FO5A 4P5OA 2G7UA 4IVNA 3RIRA 1WGPA 4I0BA 1OYIA 3OD0A 1LDKB 4IRGA 3IWFA 5CYVA 4AIHA 2GIVA 3F8BA 3C7JA 1CAUA 4WXDA 2EB7A 5KK1A 1Z91A 3IDBB 4PIXA 2NS0A 3DF8A 1IF1A 3ZMTA 2KXLA 4PCQA 3RPUA 4O6JA 3RKXA 2D2WA 2O0YA 4A0ZA 3WTYC 5EEHA 4MEYF 1FYMA 4L9JA 4G7ZF 2F5FA 2HOEA 4CXFA 4OIPF 3F6OA 2R7DA 1S8NA 5J8FA 1H9TA 2P8TA 2QLZA 1FXZA 1RI7A 4LD5A 4GULA 4QLCU 1J2XA 2HKXA 3TNPB 4JTOA 4KA4A 2DU9A 4MGRA 2F5DA 2PQ8A 4HW0A 3RNSA 3KP3A 4YARA 5H6RA 1MGTA 2PG4A 1ZZ7A 2QQ9A 2FEZA 1B9NA 3QU6A 5T3NA 1HKTA 5BXXA 1YLFA 2EVXA 1H1IA 1DGRA 2QVSB 3WE3A 3CDHA 2RN7A 4Q0SA 4EJWA 4LUKA 4ETSA 3LA7A 2OAZA 4KU7A 1OPCA 3H9AA 2G9WA 2FF4A 4L9TA 1TTYA 4LLLA 3DP7A 3BP8A 4O5VA 3I7DA 1UB9A 5LHHA 4QMAA 4AIJA 3F72A 1BI1A 2FMYA 1PP7U 2MH9A 3WU0A 3SZPA 2QWWA 2EK5A 4CO8A 1YW7A 2PI0A 4BHPA 4M9SA 2NNYA 1XRUA 2V09A 3KP6A 3ZMVA 3BB6A 2K4BA 4YIFA 3MYXA 2ZMEB 2V1XA 1V4RA 4XSXF 2PA7A 1F9NA 2BEOA 4U7DA 4BIFA 4L0ZB 1G3TA
chains in the Genus database with same CATH superfamily
2VECA 1OCCH 4CA0A 1L7QA 4GB33 4JGYB 1W36D 4L9VA 2W3JA 1ST8A 3A23A 2I8DA 4M4RA 1WSUA 4E9KA 4MTDA 4JC1A 3WINE 2I10A 5F5AA 3UL2A 1ENSA 2E6VA 3LQQA 3K3NA 5FYIA 3FXKA 2FDIA 3K6GA 1WMFA 4GWNA 1XYOA 5CVUA 1HDPA 3T0DA 3QAHA 3J8F1 3FM3A 2WA3A 5HODA 2VMHA 3U07A 2C5DA 5FZLA 1LULA 1C5HA 2WS91 3VBRC 1OFCX 2FMLA 3K77A 4LG3A 2UZKA 4YFNF 1XU2A 3AKPA 1IPSA 4C0BA 2QQAA 3HHHA 1QNYA 2X05A 1ZRCA 4WM7A 4A3CJ 4HK9A 4DQ2A 4V2VA 1ASJ3 3LOIA 2PXJA 1BIAA 1GNYA 5F5CA 3J7HA 4BPZA 2CQXA 4MFDA 1LEDA 3U11A 1LAJA 2OUJA 1SFXA 1OLMA 3BTIA 2WQ4A 3QD6A 4D8MA 1PGL2 2BERA 1XE7A 5LGNA 2RMU1 1WH5A 4K9SA 1H6YA 1V5FA 2QGUA 5E88A 4XOPA 3P9IA 4BXFA 4OHZA 1GZ9A 3JCIA 2A61A 3MZ8A 3J7AY 1SVLA 4P5YA 1K5MB 2RR11 1H9GA 4AE2A 2JN6A 2MGQA 1HQNA 2A71A 3U10A 4KN7X 1PMJX 2BQPA 3OS1A 2FXAA 3HG9A 3O7OA 3WHUA 1FJLA 2J1RA 4PLOA 1SFUA 3FLRA 1YQ6A 5KWRA 1MSFC 4BAYA 2IXJA 1UN1A 3LSMA 2VMGA 4ZYGA 1VQOI 3DEMA 2OC6A 1AL22 1MDMA 3AL0B 5CFCC 3KFWX 3HOVJ 4E4SA 2X5IC 1MACA 2Y9YA 2ZGTA 1RUG2 5FZ4A 3ZQHA 2CTVA 4FPHA 2ARAA 3DXTA 2CFXA 3PM1A 1HB2A 4XTMA 3PU3A 4ARXA 4I3GA 3H9JA 3F9KA 2PMHA 2KIQA 5IT6A 2XBO3 4MVTA 2R7XA 2EH3A 2Z5WA 1RVF2 3U0ZA 2VONA 1ETQA 2LY9A 4PBPA 3VBRB 2I45A 2P5BA 4OUEA 4F93B 2M4GA 1V0AA 1WLCA 1OPMA 4CCOA 3I3DA 4GMP3 1XE8A 5AONA 5F04A 1VRH1 1Z67A 1U8RA 4OMZA 4UW6A 5JHUA 3HRUA 2ZTNA 3X29B 3HL2A 2ORXA 1QHHD 2W1SA 2BFUS 5E8GA 2B9SA 1MBJA 5C8CA 3B69A 4UF0B 1G59A 3R05A 2GNTA 5K8SA 2A5YB 3F3XA 3BZ6A 1LKNA 2VBPA 3W5MA 4OIOF 3D0SA 2P6TA 3KZIC 1VBC1 2J1EA 4URTA 4CP9B 1RUJ3 2W52A 4CEWC 4QDQA 5C4XJ 2KDZA 3LSRA 3ZXJA 3ZQQA 2Z99A 2GWRA 3WQ1A 3OSFA 3WTUC 5FUIA 5LBBA 5A6QA 1U5YA 2MEV3 2XPJA 4AVBA 2XQXA 2HS5A 1PIV1 1QO0D 3COAC 2KRHA 4HANA 3L7WA 4BQ1A 2W00A 2HEWF 2ETHA 5DM7F 5DUWA 4ES9A 4L11A 4XFBA 3LEGA 3WDVA 1QNTA 2QKDA 2PLV1 4GAZA 1GWLA 1G3SA 2YYOA 1XMXA 1PM4A 4DOUA 4F52A 1F4HA 2RAEA 1T2XA 4GMP1 1I9RA 1ULEA 3HWJA 1GLHA 4CDXA 4E4DX 4HQEA 2JDMA 5FRMA 3WU2C 3ABZA 1BBYA 2LYCA 1MMDA 4I0WB 4CCNA 4XRSA 1HXDA 1ZARA 4C2UA 3S3OA 1O91A 4PQ9A 2X85A 2WB1N 1POV1 3BC8A 1S0GA 2QNKA 4KITB 3THCA 1KDKA 2ESNA 5FYYA 1DGWX 1D4VB 5SV5A 1BEV1 4U0WA 4OQ9A 2HOTA 1COV1 3CUOA 1AR83 2G1MA 4FE4A 4LK0F 4QKBA 1Q56A 3J7AO 4M9XA 5HLIA 5JVGF 5DCFA 2H0BA 1O3SA 3OBAA 1R1UA 1EAH3 2WAAA 1D4M2 1IV8A 2EALA 2ZNYA 1SVOA 1H2LA 5CAZA 3O2PE 1QOOA 3AG2H 3GZTB 1QOTA 2VCBA 4DUVA 4UT5A 3V0AA 1B9MA 4EN0A 2UYAA 3O1TA 3MV11 5KXBA 1JTZX 2ZC2A 2E1NA 1ZZCA 3J81Z 4UOJA 3E6CC 1MR5A 4CDWB 1IW7F 5M5YJ 1WA4A 3NV4A 5C3SA 4UVBA 2COBA 4JGZA 5ABJC 1Z78A 1YEWA 4XN0A 5I8YA 2VN2A 3ZIWA 1GDTA 2IPQX 5T5OA 4P02B 4II2A 4P9FA 1TWCJ 2HWD1 1CX1A 3FMSA 2M45A 1TZOA 3BTJA 3DV8A 3GCWA 4Y17A 2RS51 1GZWA 2PN6A 1W1WE 2CQKA 1OA3A 2JJ6A 5FZIA 1P92A 4QAWA 5BY5A 5I0DA 1WUVA 1WW4A 3QBQA 1YQAA 3MW4A 5FGMA 1ENRA 4NC6A 2GC1A 3WG9A 3OJBA 1VBD2 3V42A 1S3JA 2G9GA 1Y43B 1DPRA 2DCJA 2HXIA 3GBFA 3ELNA 2O5RA 2W1WA 3CZJA 3I2HA 1QMJA 2DFCA 2VT3A 4NVPA 2A3WA 4CDWC 1HW2A 4UB8C 5DG1A 1BR4A 2NYXA 3DBHB 3Q9SA 2NVTJ 1QJY2 2EXHA 5C4JJ 3A0NA 2JD4A 3M7GA 1YIJI 2ECCA 3CKHA 2PJRA 3FN9A 4CE8A 2WWYA 2E35A 4KWJA 1ZBA2 4H2AA 4MGTA 1HKQA 2VOOA 1HDKA 3EPZA 5IVBA 5HS7A 3B94A 3H0OA 1Z7S3 4ZU4A 2VNRA 1H1MA 1C5IA 2A6EF 3IKWA 2ECBA 5LBQA 3WDUA 1GKBA 3GNEA 4DO0A 3RZDJ 2X48A 4U0VA 1YG2A 1W8UA 1JOBA 4RGRA 1IXRC 2FZ2A 5AC93 1B1BA 1QWRA 4LUMA 3BQYA 1V55H 5DV5A 1GICA 1HB3A 2ZX1A 4GD4A 3UKVA 5T5JA 3N9PA 3O1UA 1UY1A 5C4WC 2XR4A 3FLTA 3QP6A 4RFT0 2DA2A 2GC2A 5DCMA 3POYA 3RFRA 4R9BA 2JTVA 1LJ9A 1FYLA 2OPKA 4QX8A 3POIA 4YIIA 4OAZA 5DUIA 4HBNA 2GP5A 2J1SA 1VR3A 1VBD3 2CQ7A 1W3XA 3NJXA 3ZN6B 4GZ9A 2DCZA 4MQVA 3K7AJ 1LGNA 4CXWA 3NWSA 2VOVA 5LA9A 4EJVA 1D8JA 3DKQA 1XNDA 2H0VA 1Y3TA 3OYLA 2KZVA 3DTIA 4BEHB 2XSJC 2ADUA 1CJDA 5KHHA 1XQNA 1E3HA 5DAVA 4GWJA 4GRIA 1X1DA 3I8TA 3T2QA 3ASIA 5LEJA 2PEXA 1BBT3 3CCUI 1BR2A 4QPWA 3K4KA 1ZX5A 3NSTA 2B7EA 1IPKA 1MVQA 1SFPA 2QZ3A 1F8VA 4WWCA 3ZYIB 2YC0A 1S5LC 1UOBA 5D5XB 2ZXJA 2D6PA 4Y13A 1O8PA 4QU2A 3RZLA 4LQRA 4E2QA 2AO9A 1ULCA 4K8FA 4YZ5A 2DO7A 2J1VA 2R042 5HVQC 2VKHA 4S2HA 4HYEA 3S7EA 4RS5A 2DT7B 3WNPA 2CGNA 1PK6B 2W47A 5BNOC 5GLTA 3PIGA 3CUQB 2E9QA 2OZ6A 2JG9B 3DQVC 4BQNA 1W99A 5DG2A 2X8KA 4KMUX 2X6OA 3ZR8X 3V4GA 4HX7A 5K9YA 3RPUD 1RR8C 1UJ8A 4P00B 3WG1A 2P6HA 4BBRJ 4EN8B 2YSRA 4L8QA 3KV5A 4XIKA 3DYPA 2PHTA 1Z05A 4CSWA 2RJLA 3JREA 1FNYA 1BIBA 2Y34A 2DOAA 5CKTA 3VPRA 3BT9A 3TKYA 2V1DA 1CQTA 1U2WA 3CJRB 4BDYA 3JR9A 3NAPB 3S15J 1ZLJA 2QE3A 4Y20A 4XJWA 1Z6TA 4HZFA 4Z6YA 3VZLA 4CZSA 1POV3 4B44A 3FKIJ 3OYFA 1BCXA 3BGAA 4O9EA 2X29A 4G7HF 2WNEA 2OV7A 2MABA 4LKDA 2FDHA 2C6SA 4QKFA 2XJRA 3GVAA 1IG3A 1FPN2 4BQ5A 1SMTA 4LMYA 3WP3A 3K2ZA 1QJX2 2GMPA 5B4XA 3S5AA 2VT2A 2STWA 1AR71 1NY71 3DBRB 2OKXA 5BPXA 2EQRA 1C57A 3HTUA 1KQRA 2BBYA 2LS6A 2DTRA 4NIGA 1R4NB 3ZMUA 5A2QZ 1PO23 4FSJA 2VW0A 2RS11 2JWPA 1Q1HA 4HX8A 4QSHA 1UL9A 1JYNA 3GWZA 2HYGD 3PL8A 2K7LA 4EGYA 1X4OA 2UY9A 2GAUA 1NLSA 3T0AA 3ZFFA 3AM2A 1TQMA 3K4BA 3H1YA 4MH0E 2VBXA 5JVTA 2HQAA 4OUMA 4I7HA 2P6SA 2F2EA 5F3CA 2R0QC 1C4RA 2AQFA 2VOTA 1AR62 4Q8KA 2VI6A 1VP6A 1W2OA 1XBFA 2N8GA 2EINH 1PX3A 3B5LB 2K40A 1AJKA 1B8IA 3SHFA 2CV0A 3PHMA 3ORJA 4FP2A 5FO8B 3V7CA 2CV1A 5JZGC 1MH4A 3SH3A 4BNCA 3AVRA 4WCGA 3I49A 3LSDA 5ILUA 4J00A 2DFBA 3H35A 3G2BA 3RMXA 4BQAA 1H1AA 5FWEA 1BBT1 2UWBA 3EYIA 2TBVA 2DA3A 4BXSV 2FBKA 3UYJA 5FOJB 3SEPA 4LBQA 3GZ5A 4AGRA 3WP5A 3IH4A 1WMXA 2E1MC 4AWDA 3MIHA 2ZEZA 3L2YA 4S2DA 4WBBA 1XGNA 1JOPA 1POGA 3PIOF 3I2OA 3NRUA 3HUGA 3I5UA 5E17F 4W50A 4MZUA 5AFBA 2HWE1 2NOGA 1DGLA 4HLYA 3ZQIA 3IB3A 2G4IA 5B2GB 4PHZA 4ZPIA 3WW2A 5JZGB 1RYYA 1SMVA 3I3EA 4K40A 1C0WA 4XNFA 1KA8A 5DCMB 4E7LA 4Q4W3 4IEPA 2ARCA 3NEUA 4HF0A 4P55A 4JRLA 1L7LA 3BR2A 5C3OA 5FKOA 3KIOA 2HZTA 3HEFA 3PQKA 4XN3A 1JKOC 2OUHA 4W6YA 2EIDA 4Q0VA 5LGTA 2XVLA 1UMQA 3HRSA 4A3BJ 3V7RA 1YW8A 3S2WA 2ZHMA 1NT0A 3HRTA 1CX4A 2XBO2 1WVRA 1WKYA 1YQ5A 4YYOA 3OF1A 5EG0A 2E7AA 2NMOA 1AYM1 2BZTA 3WTZA 2ELKA 4SBVA 4KUMA 3I0TA 4QIWN 3D1NI 4ONUA 3MZHA 4Y1XA 3L9FA 3SH4A 5JMCA 4WVWA 1MQTC 5T5PA 2JKXA 3GTOJ 4A3IJ 2W94A 4EJUA 3N4MA 4DBRA 1MNMC 4ET7A 3OGVA 2L0KA 3GX4X 4MFEA 4HEA2 2IGKA 4U88A 4XHXA 2A6HF 4IQPA 3NW4A 3PUQA 3EDPA 3RZOJ 4GDFA 3HRMA 3CMEI 3ZYPA 2LRDA 1EJ9A 3AJYA 4HF2A 1PO12 1X9TA 2BNOA 1GR3A 1NA1B 1DGWA 2E7WA 3SEQA 4XF4A 4OHVA 4RAZA 2CG4A 2WNVC 2DBIA 2YXSA 4JDMA 1HKSA 1LEAA 1BOBA 5FYUA 1ZYRF 3EXUA 2XOMA 3ZR6A 5JMOA 2GU9A 1GZWB 2O03A 5J1YA 2VKVA 4BU2A 1J58A 4AFDA 1DDNA 3WTTC 1MS8A 3VBUC 1X19A 5IP7J 1YI9A 2KLOA 1SEFA 5C44J 2IGMA 1FC3A 1AXZA 3T0YA 3CMAI 1OOPC 4AHXA 2Y9ZA 3VD4A 1ZH5A 4B8EA 2QSHX 3J80K 3ZXAC 3C2UA 4UW4A 3RZHA 3DN7A 4IV1A 1HX6A 1C8M3 4PSXA 1J3QA 1S9HA 3KLSA 2PHDA 5CVVA 3OYAA 4PF1A 2XGXA 3A22A 1CZSA 3WV6A 4JDOA 2WFF3 3AKSA 3JTHA 2VXZA 5CB7A 1PX4A 1YQ2A 2WNVB 1AR63 2WAQA 2JDNA 3ZMOA 1DUXC 1G9DA 2HDWA 1PGW1 3CNAA 3MGUA 3ABTA 5FP7A 4K8RB 2RDRA 4HSRA 2ZX3A 5F1JA 3B01A 5J40A 3H0GJ 2WWJA 3BN6A 1ONAA 1JGSA 3POEA 2EAAA 3WGHA 2ZXWH 3V8JA 3FXRA 2O6GE 4Y22B 1FP2A 1LPQA 2QQPA 3CC4I 2Y64A 2R1DA 3RVHA 2BFUL 3K0LA 1VQKI 2VG9A 3MPPG 2ZX4A 2BPA2 1K45A 2X9DA 4RYDA 5KC6A 2F4OB 4XFAA 2E34A 4UBHA 5LATA 3CC7I 1I6HJ 1MNDA 4H7LA 1O4XA 3QPHA 4CDQA 2VZRA 3I54A 4HRIA 5F6KA 5IK5A 5HV4A 3PUHA 3GO5A 1E57A 2H1LA 2XVCA 5H20A 1VQ5I 3KGLA 1ND3C 4D1QA 3H1WA 1ND2A 4N43A 3E1F1 2VH9A 3RJ2X 1GWMA 3QACA 1KU9A 4A6DA 4ZU5A 2CU7A 3DCQA 2O14A 1N3PA 5A3MA 2VTFA 2Z1DA 2RS13 2X0LA 1PUFB 1PO21 5FMCA 4Z2AA 1UW8A 1GQHA 2DW4A 1AR81 4FTBA 1WFXA 3GJAA 5JI6A 1Y56A 2DOFA 3WG3A 3B9IA 4KBZA 4KIGA 1A36A 2C0ZA 4IEUA 2K4JA 1HCRA 2ARBA 2P1BA 4L97A 3URFA 4P9UA 1RMU3 3BTZA 2VKDA 2YX7A 1W04A 1QRYA 3DPTA 3DEUA 1XDUA 4KU8A 3N9LA 2GP3A 5C6CA 5IYYA 5FB2A 5CKNA 2ZEXA 3UJQA 4YVWC 2LROA 4QXCA 1RUH1 3AKTA 4D6SA 1HLVA 4RQPB 4X6QB 2V1NA 4FAGA 2VPRA 2FE3A 2VMCA 3DBLB 3LEMA 3HOYJ 2OUMA 4L9BA 2WT1A 4X6RB 3VBFA 3EYPA 3ST7A 2J42A 5L73A 2VQGA 1HRV2 3GTGJ 1JZ7A 1VI0A 5D5VB 3CQOA 3OCPA 2FU4A 1HB1A 3FM5A 2CSOA 2R5YB 2CGPA 1XPWA 1BN5A 5JOWA 4PT6A 2QEXI 4EN9B 5HNFA 3DCFA 4OZOA 1O3TA 2BUKA 3WDXA 1VE0A 2CWEA 1CAXA 2P0WA 4HT1T 4UAPA 1S0CA 1SG3A 1HA8A 1JUHA 1JKPC 1CIYA 3HQRA 4V19K 3X2QH 3LD8A 2RNJA 1HJFA 5B3SH 4LNVA 3PTYA 1AF9A 4CCEA 1VBE1 4BXXJ 1O7LA 3AK0A 2R92J 2Z79A 3ZSJA 4U87A 1FAYA 4WM8A 2O3FA 3Q9VA 2JDKA 1W9SA 5IK4A 3ES4A 4UFKA 5IK8A 2LDUA 3ZFGB 5HLGA 4NWWA 5KHJA 3MIBA 1PIV2 2XDVA 1LEMA 1GQGA 2QUOA 3I2FA 1YJNI 5CZKA 3TEDA 3MD2A 1Z0XA 5BNPA 1WLWA 1OD5A 4COUA 5FKCA 4DXTA 3KV4A 2V4AA 3SCGA 2EIEA 1LDJA 2MEV2 2XF6A 4A2UA 4M0NA 2J1AA 4LBNA 3VSLA 2KQRA 4FT8A 3AFGA 2AENA 2IFWA 1VMJA 2HWB2 1CESA 3KWVA 2GXGA 5FZOB 1FYUA 3WUDA 5AVPA 4S2FA 2E2HJ 2VJJA 3N05A 3ZCOA 5GALA 1U78A 1MIJA 2MYSA 4UFMA 5HDGA 3S14J 3JRHA 1AUYA 3KP2A 5D5UB 3VKFC 1W06A 4DUXA 2RC4A 1LODA 1BC8C 2OCCH 3FXMA 1XDSA 2JDPA 1TT0A 1OFNA 3MFCA 2JX9A 2WZPP 2MFZA 1JBCA 1HQLA 3VD7A 1AL21 1FATA 4BH9A 2VUMJ 4IZZA 3F0CA 5L3CA 4U2AA 1TNTA 5LD2C 2B39A 3OIOA 3VBHB 4J6GA 1K83J 3ZMNA 4JP0A 2MHFA 3UJOA 2Z69A 4I6ZA 5LBFA 3BKZA 5BV6A 2ICWG 1BVP1 4Q0UA 1HSTA 1ZBE1 2UWCA 2XAHA 4ESJA 4CEYC 1UYPA 3FLPA 4BACA 1BA5A 2L7FP 4YZ4A 3GW2A 5GKAC 2YBPA 2L7ZA 3F21A 4A12A 1MZBA 1ZK8A 4GJZA 4TWTA 2WO3A 4AWXB 1XNKA 3PVOA 4LK6A 5A3LA 4XLNF 1S0FA 4AAPA 1G8WA 1SLLA 4JQRA 5LBEA 1QVUA 2XG3A 1T38A 3ZQGA 4CEYB 1EV7A 2JDZA 2XGEA 1LE8B 2PMWB 4C3IJ 2QQJA 2HWF2 2XLGA 4HN0A 3WX5A 4LORA 1MJAA 1I5PA 4IHVA 4G94A 4HQMA 3U1KA 5E16A 4NC8A 3R6SA 5A3TA 3MI8A 3B73A 5FLJA 4WK8F 1APNA 3E7LA 3EQEA 3TN93 4ZY9A 5ANNA 2MC4A 3UGHA 2E1OA 1QXPA 1UHWA 4NR1A 3R0RA 4CCJA 1TMF3 4ZZ5A 4IDZA 2D45A 3TEWA 4YPJA 4Y5SA 4FPFA 1D5YA 2EILH 3KQRA 3W3CA 1FBSA 2B0LA 1ND3A 2E5NA 2K9LA 3JU9A 1GANA 3ZYGA 1WJFA 5K7HA 3IIIA 2LK2A 2R073 3HOXJ 3FXJA 1FX7A 1B72B 2IZWA 2Q1MA 1H8TA 3OGRA 1VMFA 3MKYB 1ZM1A 4LPLA 4XTPA 3LL7A 3TN91 3V0BA 3HOZJ 2ACJA 1ULFA 3T1BA 1TME2 2PHLA 1VZ0A 4DW6A 1AKHB 3NO8A 1QJY1 5FYTA 1GLNA 4NBQA 1GNHA 2NVQJ 5C5TA 4CHUA 3HNMA 2CAUA 3C3VA 1RPWA 4JZRA 2A70A 1U9OA 5E79C 1AVBA 5F37A 4D0PA 4M3DA 4IKFA 5GAEJ 1OSGA 3IL2A 1HJGA 2VUCA 4IEXA 3N9NA 4HK8A 1YNAA 4HPQA 3H5NA 3AP9A 4UI9L 1UY3A 4AHZA 4N53B 1PO11 1REDA 3LCPA 4U7BA 1AR91 4XHBA 3FXQA 5ICEA 5TSWA 4IF4A 3NQHA 1IGNA 1T2KA 4NAMA 4JHZA 3H8UA 2XKPA 4AK3A 4RMNA 1VAKA 2PYTA 2JJ7A 3HR9A 4P5OA 4I0BA 3C7HA 4F91B 4IRGA 4M3CB 2RS53 4D3WA 4XKVA 1T56A 4AI0A 2EB7A 4BE1A 1JHJA 5EQUA 1Z91A 2FMDA 3U1XA 1VNDA 1E3PA 2SLIA 3PSFA 2DXIA 1MS9A 1H30A 1P7IA 3NKGA 5FZFA 4XOTA 2CSGA 5EEHA 3WTYC 4A45A 4L9JA 2F5FA 5BNOA 2C1FA 5L7OA 4BQYA 2R7DA 5DDJ2 1S8NA 1IQDC 1H9TA 5J1XA 2QLZA 3KYDB 1K5JA 2VZQA 5TGTA 1DP3A 3ZYJB 3OYGA 4ITCA 1COV2 4IE7A 3WEZA 5H6RA 2R062 1ZZ7A 4K1YA 4UUSB 2YUSA 1LU1A 2WR9A 5BXXA 1YLFA 2L9NA 1H1IA 1WZ2A 5ACA1 3QQAA 2HU9A 1ODNA 4EJWA 4LUKA 4LO5B 1RUG1 2R6QA 4KU7A 3H9AA 2VUAA 1W5CC 2P4EA 3LDRA 1W39A 3BP8A 1OJLA 3T2OA 3PDQA 4O5VA 4TLGA 1UB9A 2K46A 5LHHA 3WHTA 4TSVA 3F72A 3KPHA 2QQWA 1BI1A 2MH9A 2EK5A 3BCBA 1CJPA 2YPJA 3ZYRA 1GOHA 4BHPA 2JWTA 3ZXKA 2DN0A 2NNYA 1R082 3GHNA 3BR5A 4ZS2A 1FOWA 4YIFA 1V4RA 2IFRA 2PA7A 3LFMA 1NQDA 4HVRA 3ACGA 1EPWA 2EWNA 2O9LA 2LOOA 3VBSA 3BR6A 2XSDC 1IG7A 3PO3J 1N3QA 1J3PA 5CYYA 1YRNB 4Z82A 1JJ8C 3WF4A 2R5ZB 5T52A 2P3JA 1XPXA 4C0HA 2E33A 2RGVA 2ESHA 4P96A 3IH3A 3RSJA 3IPVA 2X6XA 5EP9A 4MUVA 4A3XA 1GYKA 3GTMJ 3ZFEB 1KQ0A 1FMD3 2RDPA 3WG4A 2WWSA 2ZFUA 3BG3A 2KIMA 2VVFA 1IXCA 4LT5A 5LEKA 1K78A 3BALA 3MMYB 2ME6A 2JDYA 3MWMA 4HX4A 1AZDA 2GQQA 4CU8A 2F4PA 3MW3A 4OQ8A 3MW2A 2VPLA 2VMFA 3TW6A 1C3HA 2H8WA 3M8EA 2XHNA 3WTSC 2FD5A 4QB6A 5JLVA 3D5RC 4A7KA 5HI0A 1I3AA 4S2GA 2CFOA 1R1ZA 5EJZB 5L3BA 3IAS2 4BYYA 1QEXA 1H9PA 4RAGA 3CCSI 3OY9A 2ARXA 5GM0A 1RUE3 2MSYA 4QDRA 1ULGA 3EO6A 1HW5A 3Q8BA 4AQSA 2Q30A 1W6MA 1FOYA 4UVCA 5L3GA 2ZEWA 2M7AA 3M8FA 3E5UA 4WXHA 4DYRA 1GBGA 4MV2A 3BG9A 1S2KA 1DLLA 1UOFA 4CPBA 2FOKA 3JRBA 4MXWB 3WTVC 4PJJA 1A6QA 4I2OA 4JK1X 4A5NA 4H0EA 2DFHA 4IUGA 1W36C 4NHMA 1PM7A 1RMU1 2M8EA 4LBQD 3OTFA 2RQQA 3B3QE 4LBJA 4N7UA 1TG7A 2W7NA 1U5TB 3OY8A 1OC1A 1QPMA 4XPVA 2FOWA 4V2GA 2WFPA 2J5OA 1ETWA 3AYCA 4MSVA 3OSDA 1UMIA 2WLPA 5A3NA 1K79A 2F6BA 3VD5A 1WJ5A 2VBBA 4XYXA 3A1YA 5EEAA 2WUHA 1CIWA 1YYNA 5EJ3A 2XPUA 2A6XA 3ACFA 4MHRA 2KL4A 1CF7B 3M3YJ 5CEHA 3OUJA 2CL2A 4LE4A 3PFYA 1ASJ1 1ENXA 4QTRA 1UPIA 4IEOA 2V26A 4I09A 4DXSA 1EPZA 5FKKA 1XGMA 3AJZA 1QZYA 1V6LA 2L3DA 3ZN5A 2YS9A 5F9TA 1FMVA 2DCTA 3FHZA 2WZR3 4GQ7A 4EWAA 2QQKA 3JBG2 4CCKA 3PNYA 4AGGA 3F23A 5FRNA 1JT6A 4K20A 3UKTA 1P2FA 1G9AA 2KM2A 2K9NA 3J9SA 5IVYA 3ZPLA 3U2RA 4IJAA 2DVBA 3L9JT 1J9IA 2V9PA 4R4ZA 3M4FA 3FHNA 1RUF3 4IV3C 2ZJQF 3VGIA 2R041 3A01B 1UY0A 1MMNA 4WVMB 5KXCA 2F48A 2R7SA 2GOMA 2C26A 3VHPA 2JA2A 3ZXDA 1Y0UA 5DQ0A 2W1UA 4MQ9F 5LA2A 2XL9A 5KHGA 1N1YA 4XF1A 3HQXA 3FC0A 1W7PB 2R7RA 2XUEA 1DZTA 2GLOA 1I3HA 5CFDB 4BMBA 1R1A2 4LK1F 2VM9A 1CAVB 1IN4A 2XXZA 1PDNC 2RNGA 3CCVI 5GTIC 4TN7A 3WHCA 3ON7A 2DBNA 2MC3A 1O4YA 5JWPA 3JW4A 2YU3A 3OOPA 1KU2A 4QPYA 1D5VA 1IDYA 2E51A 4L5JA 2UV1A 2E71A 4UXAA 4R9CA 3K70C 3ASOH 1HQWA 1Q43A 1MS1A 3UNPA 3G1LA 3VHNA 4YFXF 1RUNA 3S3NA 3FJSA 5FZMA 2GXAA 1MEC3 3CCEI 5J8CA 4FPCA 1LNWA 1SC7A 4BL0B 3L2HA 4ZYAA 5HV0A 3CO6C 1BEV2 1JHNA 3JAMZ 3KEYA 2ZAHA 3ESWB 3RZMA 1XSQA 1NCRA 5CFDC 3ZRGA 3PUSA 4XCAA 3TAYA 2ZGNA 3C3WA 1UZCA 2XB5A 3OG2A 5GZGA 2KA3A 1OVSA 4HOBA 1FPN1 2ZGMA 3PJRA 3PMEA 1IRXA 3ZMDA 2WFF2 3FBYA 4HNTA 3KS7A 2XASA 3KP5A 4QPIB 3CMMA 5KAIC 2NS7A 3W5NA 2DCEA 4RB1A 1YTYA 4NQWA 3B93A 5FPBA 3KHCA 1MS5A 2IVIB 2DMUA 1IRGA 3VFZA 3J26N 3J7LA 2J1TA 4D6QA 4XAAA 4LKSA 1QIQA 1ULYA 3WTWC 1RL3A 2B9VA 1FMD2 1P9QC 2OW4A 4BZ4A 4NWVA 3K9TA 2OTJI 1FV2A 4KMFA 1CQ9A 4HAMA 4WZCA 4AVVA 3KZZA 2VE1A 2G9ZA 2HJIA 2E1CA 2QQVA 3ABKH 2AEYA 1IZ1A 1KITA 5EYYA 5GTHC 4PGHA 3WF1A 1X1AA 1Z3XA 2WO2A 2CO5A 4AVPA 1S6LA 1QY4A 1BOAA 2M7BA 3AX4A 5FIXA 4JX6A 2NOJB 2ZO4A 2HR3A 3OPWA 3FF5A 3OB8A 3WNKA 1TVGA 2ZBJA 1QGPA 4XXPA 2WV0A 1H8TC 4CPBD 3MFKA 1GSLA 1KJRA 1ON2A 4AIKA 2OA4A 5J6XA 4RAFA 1I3QJ 4D7SA 2VC1A 2QBYA 4QDSA 1WWYA 3K1NA 3S6PA 1JW6A 4BMEA 3BR3A 1ENQA 4XLEA 2YG0A 2VE8A 5JOZA 1ZG3A 4ZKTB 3UGGA 2EV5A 1Q3EA 4L2NA 2CW7A 3I64A 2ZPXA 4DINB 2DV9A 3GGLA 4A93J 2RDQA 5DDJ3 4BA6A 4LITA 4NRMA 5ICGA 3FX3A 3S2HJ 1OF3A 4YW6A 3HPHA 4LLGF 4N4OB 4Q4X1 5C8WA 4GFBA 3ME2A 3L2UA 1WD3A 4M6XA 4KG0A 2E53A 2ENRA 5B1AH 1F5TA 1JMUB 2JDAA 2VIXA 4JRAA 4PBOA 2D3RA 3M3EA 4D7NA 1UU6A 4ZDOA 2ID6A 5A7PA 3VKLA 1X8MA 3OIPA 5IY5H 1ZYBA 3AZZA 1WZXA 1WA6X 3H8OA 2JRMA 2ZBKA 2V9KA 2LKXA 1J3RA 5IATA 5GZCA 3AG3H 4GYIA 2PLV2 4N9HA 3O14A 3LSHA 2QENA 2RR12 5F1RA 2D6LX 3W2VA 1U5TC 3ROUA 2WADA 3ZOBA 3O1OA 1G6NA 4DIQA 1NH3A 2W48A 5HNHA 1XU1A 1J83A 4R9AA 5GLWA 5J4YA 4Y3OA 4ZZ8A 4A42A 1HSJA 3CC2I 4Q4Y2 2XAUA 1W2NA 2JDUA 2VBDA 3OYIA 5I0RA 4KN4X 1B09A 2DAOA 4YLZA 3IAPA 3S8PA 1YJ9I 1DIWA 4PF5A 3LSIA 5IVVA 4OHYA 1S0BA 3BCWA 5J1UA 4Q0QA 2L02A 4KNYA 4HPKA 2GDFA 3M8LA 4XF9A 3SHRA 1AWCA 5CBLA 4LBLA 2WABA 4YVSC 3ZGKA 1IJWC 4CYCB 1QQIA 5C70A 4CUAA 4YVWA 4GCVA 3TEXA 4C30A 1XYNA 4C3HJ 2JG9C 4FFFA 2BV6A 2WJSA 2R7FA 2EIBA 2HWD2 3S32A 5J98B 3AC0A 3LEIA 3L2CA 1VLNA 3ML6A 2EF6A 1MZ6A 3OYCA 4PI0A 3M8JA 3TDUC 1LENA 5D1IA 4HVQA 4AHWA 3OUHA 4QB1A 2XAFA 2ZGRA 4AVAA 2WN2A 3RI9A 2VU9A 3SKJE 2X09A 1QJFA 4M3CE 2D5HA 3ZSMA 1GP4A 2DDBA 5IFPA 5F8PA 1FOD2 1XSVA 4OHWA 1JTXA 3FL7A 2JEMA 2BBVA 1GU3A 5CFCA 1T95A 2JB8A 4OUSA 5CLSA 3RWNA 1YW9A 2DLLA 5HS9A 3EUAA 4KQ7A 3MIFA 1MQTB 3FMGA 1WI3A 4IEZA 1YFHA 5FAXA 1NA1C 4UV8A 3AP6A 4HPKB 3BY6A 2YHJA 2CWMA 3LSPA 5ANQA 2XBO1 2RG4A 5DAQA 2Y0IA 2R7OA 4OLLA 2AXTC 3A4CA 3K10A 5KCMA 3LEKA 4Q8LA 1QQP3 1Z9CA 2HYXA 2DUQA 4IRHA 4PJYA 1FBUA 2Y6JA 4R1HA 5J36A 4RGSA 1NKGA 5I0SA 2IP2A 2D1HA 5K7FA 3ZXLA 3ZN0A 1WWXA 1WMDA 1HB4A 2ADDA 1OLTA 1YYVA 4A3LJ 4UFLA 3F22A 2VVEA 4Q4X2 1SLCA 4F92B 3DU6A 1UU5A 1VFCA 3TOAA 1F4KA 4YG0A 3VBUB 3TEYA 4IGQA 2KIFA 3OV8A 2OA2A 3ETPA 3HPNA 3WDYA 1QJY3 1W8TA 4GMP0 1AX0A 2KZGA 3KYCB 4OHXA 4WVZA 5FLMJ 2HZDA 4XLPF 3WP4A 1TE1B 1O3QA 1MMGA 3BDDA 3BUCA 2IXLA 2PMZA 4QX3A 1W6NA 5L9VA 5D8LB 5IVFA 1J84A 4LO8A 4ENKA 1YJKA 2KR2A 1ETKA 3CCLI 4UFIA 4A3FJ 3VZKA 2ZX2A 5DAPA 3GDBA 3HSRA 1XN7A 3Q5FA 2B7YA 1Z7LA 2P5LC 4XFFA 2E1MB 4AEDC 1U5IA 4DPNA 4Q4Y3 2D6MA 1UZ0A 1SD7A 1HV0A 1SDDB 1VBB1 3Q0VA 4PDKA 2DA6A 3LIHA 5D8AA 1A6IA 2Z9OA 2TDXA 1ZZ8A 1E5SA 1R64A 3I56I 1W8FA 2ZXHA 1FP1D 2B63J 4P08A 5DDGA 5K5RA 3JRFA 3QP5A 4A3EJ 3BTXA 4QX7A 2ZGOA 5A7WA 2LFBA 3JBG1 1J1TA 4EYUA 1SHWB 1DQ6A 2XPWA 1D1BA 4FASD 2BGPA 3IDAA 2VL4A 4A6OA 3FKJA 1LOAA 3C8XA 5KHIA 3TEZA 1XC5A 4AYBA 1SLBA 3AZVA 2E5ZA 4O9GA 4GXLA 1KFXL 2P2KA 3LZZA 1W5SA 2UXNA 2ISYA 1UKRA 1HRI1 2ERFA 5KR7A 5FZEA 4K1ZA 2QBXA 1YFXA 2WZ8A 3WF3A 3WNXA 3SDBA 5ILVA 5AVAA 4RGUA 1H8VA 2V72A 2DMTA 2A5WA 4PJLA 4RLFA 3CCQI 4ENJA 3SITA 4E27A 4FETA 3BLYA 4Q48A 3WNMA 4PJNA 4MHGA 4DJAA 1FTTA 5IAVA 1G7YA 4BK5A 1JZ2A 3HMYA 1QJU2 4YG2F 1HW1A 3PSIA 1WD4A 5FZ1A 3PIPF 5LGUA 2CHHA 3OEBA 1BI3A 3KVBA 2O61A 3GZAA 1NHAA 3SH5A 1RRJA 2R7VA 2OVUA 1HDDC 4Q27A 3CO2A 4N0BA 4FCAA 4Q4Y1 3VDDB 4IXLA 1GXQA 1SD4A 1X1BA 5GJ6A 4NJ4A 4JAAA 1W4MA 3GTQJ 4Q4W2 2IXHA 1RB8G 1A3KA 4HG2A 2PLV3 4CDUA 2Y2ZA 4RDUA 3THTA 3KT1A 4A5MA 5A32A 4B3NA 3LSTA 1IN5A 4B43A 4BQ4A 3HGGA 1MVEA 2ATFA 4RS5C 3JBG3 2W82A 4I98B 4EJOA 3U9GA 4ENNA 2EFPA 5FMOS 1X58A 5FYCA 4M01A 2VPVA 3JQXA 3LAGA 4KFCA 3HBZA 1FI2A 3KV6A 1RUI3 2MG4A 1Y1VJ 4GO1A 4C1WA 2L4AA 1UMZA 3BYWA 1SLIA 1K5MC 1BJZA 3PQJA 2MNGA 1R6RA 3UT0A 4N90A 5F0HA 1VRH2 4HNUA 2M1BA 1G4DA 5B1BH 4RR3B 5ICCA 3AYEA 3ZVXA 2L54A 1G3WA 3ZQLA 4QPIC 4AEDA 3KCCA 1TZLA 1LGCA 1UMHA 2VOPA 2FQPA 2VOXA 1FWZA 1IG0A 4YEJA 5GAHJ 4HLTA 1SPPB 2IUWA 3H50A 3S5QA 4NPMA 1XNBA 1XGOA 3TP3A 2BW3A 2ZOEB 1LOCA 1EV13 3BOWA 1RUE2 3R4KA 1FNZA 4IGPA 3I2KA 3CL1A 3DF0A 2H8RA 1H8TB 3H3ZA 1B72A 1W6QA 3NL1A 4P14A 5IVEA 1GWKA 2JPCA 1MZEA 1DQUA 4XRMA 3N7JA 4FQZA 3GXOA 3OYMA 3LGRA 1WH7A 2VZTA 4YVSA 1FIAA 1NXMA 1W8OA 4XF0A 3TL4X 2QTWB 2ILMA 5DAWA 3FBMA 3RKWA 1OF4A 2AXLA 2R0FA 3GZEA 3VBHC 3TP0A 2AH2A 5F39A 5H9SA 2FCUA 2WDBA 3WNLA 1UHMA 2A7AA 3D0JA 2VNOA 3CLQA 5D21A 1LDDA 2FQ3A 2K02A 1KU3A 2R7TA 3MBWA 1A6CA 4HSLA 2UXXA 4W4ZA 2QYOA 2VZPA 2XUMA 2V79A 5AFEA 4D69A 3GFJA 2LBFA 4ABZA 5F3GA 3KGZA 3F8CA 3VYSB 1NUKA 4AM3A 3JUUA 5F5QA 1LOBA 2YY1A 5JR3A 3ILFA 4D6RA 3FWEA 1CD3G 2VJ4A 2CYFA 1OR7C 5KHDA 5HLTA 2ZA9A 1S7AA 5HLHA 5FYZA 2HWB1 5D6FA 3AKRA 1VBC3 4PDWB 1MS0A 1F2NA 4JOMA 1B35A 5J7MA 3DYOA 1S29A 2ME0A 3PJQA 3A0BC 2QQLA 4MX3A 3CO7C 2W91A 1ZA4A 4C8DA 2C6YA 2K9SA 1ZG1A 1CN1A 2ZNZA 1CZVA 1MKMA 3POGA 1ZZ6A 2WAOA 1WCQA 1USSA 1NAEA 1HXS2 1NK3P 4GKXA 1XX5A 4WF2A 1L3JA 1HRI2 3W58A 1SFOJ 3P9KA 2DT6A 3PIJA 3VD3A 3ZDSA 2IGOA 3TYJA 1EKEA 2OJED 4XBLA 5LZ6A 3CJNA 3BR0A 1LCLA 4KICA 1RR7A 3GEZA 4BLIA 1A35A 2VULA 2K85A 4E7IA 2A6TA 4QHBA 4YM3A 1HRV3 1U5TA 3WNNA 5H9RA 4QXHA 1IS3A 1Y39A 1YUDA 3M1HA 2RS32 2ZFWA 3K48A 4YW4A 1YS6A 3H92A 3U1DA 3ZSKA 1ON1A 1YIFA 3K4CA 3AAFA 2W4SA 2O8XA 2XUBA 1DDLA 4ZYHA 2ET7A 1WKMA 2QSGX 1OQDA 4DXZA 2VQUA 3GCMA 1GZTA 4JKKA 1LOFA 2ORZA 4BOWA 2XWBB 3F8NA 4XQDA 1UZWA 1D4M1 2BZDA 2FBIA 2A68F 3I2DA 3GUDA 3TOJA 2RM22 2QQNA 4LIUA 3J7ZI 3R4UA 2ZCWA 3R4SA 4QHOA 4B1MA 1MZ5A 2ZGUA 3HJRA 1B35B 2HOAA 3Q0UA 1IRFA 4E7SA 4WXCA 2Z42A 3HXLA 4Z2YA 1UU4A 2CJJA 3RKQA 4B3XA 3GJBA 5FLVA 2L5QA 2F5CA 1AYN3 3GF2A 3PNTA 4X0GA 2KD7A 1P8JA 3S57A 1YJLA 4UVAA 1OOPB 2B42B 5T54A 2XJPA 2IW5A 2IWGB 3GLLA 5FLXK 4GH4B 1N1TA 2W39A 4QPGC 1Y4WA 2OIIA 3RJRA 5FJHA 2IS4A 2P3KA 2DK5A 4UY8I 2VQAA 2CDPA 4PGGA 4IOAF 1YO5C 2VTXA 2Z5UA 3RZJA 1ZRRA 1KU7A 3R0JA 2LD5A 3C2GA 1JZ8A 3LWCA 4ASLA 3I3LA 3WVJA 2HOSA 3VZMA 4DUWA 5FZCA 4AL9A 3OBTA 1ENHA 3KYLA 4D5FA 1EH6A 3VBSB 2M9HA 5E89A 1TME3 2P4WA 4NC7A 4QKDA 3BVCA 5D6EA 4XJ9A 1H2MA 3DPRC 4LXLA 2JKBA 2WS92 1HF0A 2SBAA 1QXJA 3HPGA 3SQNA 5LRRA 2KRFA 4HVOA 5IP9J 3VL9A 2VGDA 4FOYA 2QZ2A 3HBLA 3RQIA 1RMU2 5C71A 4QGLA 3HGYA 5HCBA 5DUKA 4YG3A 2JA8J 2D6KA 1RESA 2LUWA 4AI9A 3TQNA 3LAJA 4MOAA 2I07B 1LVAA 4OOIA 3NNGA 1Z7S1 4N8MA 2F4MB 5FZGA 4G4FA 3CLPA 3PURA 4P9GA 1ZA7A 1VQPI 2FBEA 4UUSA 1U5XA 4FTSA 4AEKA 1E5RA 2P7VB 4D7YA 3L2WA 4YGBA 2F4LA 2HPIA 5IW0A 5GADJ 1XOYA 1OUSA 2GN7A 5A6XA 2VXRA 1G2HA 1BVVA 3KCXA 1OQYA 3HYIA 1EYBA 5LHIA 3EUKL 1EH8A 4XCBA 3BG5A 5IP6A 1FPN3 4CVUA 4IOCF 5BNOB 3K1PA 1ZZBA 4N43B 1ZBA1 4SLIA 4NROA 4L18B 2JENA 2HQNA 3GHMA 2R7WA 1R7JA 1HOMA 3JSPA 2VW1A 3ECOA 3LSGA 4BJ5C 1UG0A 1T6SA 3ZXEA 2UY8A 1S0IA 4CDUB 2WQZC 2W95A 3MVPA 4FTEA 1KFUL 4CDQB 3OYEA 3CQZJ 1DFQA 2V6EA 1TME1 4Q4V2 1O4TA 4PUSA 1UXXX 1W6OA 4LULA 3CJIA 1IRZA 1LRHA 5G04L 1S1AA 4H4KC 4GKYA 4NO4A 1A8MA 2WFF1 3CMYA 5K4LA 2PAKA 3OYNA 1OHFA 4FPOB 5LK5A 2Z16A 2VKEA 3G4SI 5FYVA 3KF5A 5CPRB 3I4PA 1JKQC 2MLGA 1KGYA 2LW8A 2ELJA 2X1CA 1PMHX 2R063 4LFUA 1JTYA 2CMPA 2GMEA 4QQOA 3P5BA 2J1UA 4LHLA 1E0EA 4OFGA 2M30A 5T50A 5M5XJ 2FDJA 4N53A 2R1BA 3VYTB 1ACCA 2VZVA 4X8NA 1XCBA 4RB0A 2D3SA 1DQ4A 3IAQA 3AG1H 4BHCA 4KI5M 4A4AA 4MYEA 1MJBA 2GXBA 5C3RA 4MO3M 1EF4A 4F55A 1IOAA 3E6MA 1UX7A 4TYSA 1NG6A 2ZGLA 2YUEA 3RG0A 4IXAA 2OBPA 4H14A 3B00A 4EV0A 3NVCA 3BIEA 4RM2A 4HFSA 1R49A 4QXKA 3T09A 5FFXA 2P6CA 3F8FA 3IH2A 3RYRA 4A3GJ 1D2SA 4EWEA 4CXYA 1Q8QA 4YFWA 1N47A 3DPRA 3DEWA 4MG2A 2M4KA 1SLAA 4XUTA 2KPMA 1Y9QA 3VL8A 4YRDA 3B6AA 1O8SA 4F8AA 5AIQA 2IBDA 3U78A 4DNCA 3PFIA 2VJIA 4ZTJA 3OD4A 3ABLH 1R1A1 4BBSJ 5D8AB 1Y6IA 2VQ0A 4LKFA 3CCYA 3H5AA 1SFNA 3I4NJ 3BQZA 3O8GA 1UD1A 4GA9A 3FHQA 3GTPJ 5J3UA 4C2TA 1WW7A 5I0UA 2X10A 4LR4A 3BI3A 5A1FA 4D0QA 2M87A 5BNPC 1XMAA 1JUMA 1V9U1 1ZGWA 1V54H 1JYXA 4IVNA 3RIRA 3ZPOA 2BY3A 4V1PA 1OYIA 1LDKB 2RS31 1I50J 3H3LA 3KQ4B 3FUQA 3L2VA 3S1QJ 5DAXA 3UETA 1W0TA 4BE2A 4RBOA 2NVYJ 1PVEA 3O0VA 1X9PA 1MBEA 3RPUA 4AI3A 2WBMA 3RKXA 1OCOH 5JIUA 4CEYA 4XQFA 4E6KG 2NQYA 4G7ZF 4L5EA 3JXSA 1ZBE2 4OIPF 2X5IB 1VF9A 2P8TA 4QLCU 5J37A 1J2XA 2HKXA 2VZUA 4KA4A 2E7QA 2IEKA 2AYHA 3K4DA 2ZXIA 2WLQA 3KP3A 2BGOA 4K3UA 4H55A 2PG4A 5FPLA 1QJX1 3SLIA 3MO4A 1AYN1 1DGRA 4G9SB 2XH6A 4CDXC 1WHUA 1S72I 2HWC2 3WE3A 1T33A 1DZQA 4Q0SA 3K4JA 5DZGA 3LA7A 2HWC1 4P1WA 5JZGA 5K0UA 2G9WA 4ISQA 4L9TA 1QF3A 3WG7H 4LLLA 4EZ4A 3NWTA 2WKKA 3DP7A 3VSKA 4XDOA 3WCRA 4AIJA 1Q8OA 4E8CA 3WU0A 2DURA 5FKNA 1AX2A 2YDEA 2RS12 4YW1A 1HIXA 3AYDA 2HXOA 1XRUA 2V09A 5GPAA 4IEJA 2I5UA 1T6GC 3ZMVA 2K4BA 1W8ZA 2R7QA 5GZDA 1E5IA 3C7FA 4XSXF 1VQ7I 2BEOA 4U7DA 1G3TA 2FBHA 3KE2A 4ZONA 1JZ5A 3UGFA 5A1AA 4IE0A 1F35A 2Q8DA 2RV9A 1VBE2 4LBQB 3VDBA 3MIGA 1UZVA 4NRPA 3RSNA 4AZZA 1SCRA 2P5VA 5JXGA 3I59B 3HHGA 3KP7A 1S0JA 2E31A 2OXBA 5FLXZ 1DP7P 2E63A 5I8SA 5EJCA 4I76A 3G6JB 3RZKA 1FSEA 4OU0A 3AMHA 4R9DA 2ZJCA 4M71A 2VTXJ 4CP2A 1IZ3A 3H9GA 1X1PA 4WV8A 1B8IB 1TNFA 3O3KA 4GJYA 3CP2A 2A3YA 1LOGA 4ZHNA 2HVQA 4Q1RA 5EHDA 1N75A 4BQ2A 3HOUJ 1JN2P 1W9TA 4LOTA 5FP9A 3PUIA 3PJYA 2G9FA 4ZDPA 2A73B 4W6XA 2A6YA 1FY7A 4ESFA 4N7IA 4F3QA 2DUOA 4MGQA 1IAWA 2LBFB 1WCSA 3CDLA 3RKYA 1XXNA 4MLOA 3UR3C 1O3RA 2CDOA 4DZGA 3CLOA 2I74A 1V5EA 2EIKH 5FFZA 1R092 2IS6A 1U12A 3H5RA 5FRAA 5EPAA 1ACIA 4Y5TA 4P9XA 1VBA3 3C7EA 4HN1A 2C9KA 4XLHA 3CTAA 3W59A 4BY1J 3RPQA 4MO7A 6PAXA 3VBOB 4HKLA 1D0YA 3F6VA 4XORA 4XLAA 3T1MA 4LBOA 4FQGA 3ATGA 4OMYA 1H0BA 1S2EA 4NIAA 1RITA 2FDFA 5F6LB 3AP7A 3VBFB 4TZDA 1R71A 2YGLA 2WNOA 1JT0A 1RC9A 4FQ4A 4LMFA 5DDJ1 2R7UA 1MBGA 2FUG2 1RUC1 2HBUA 1V00A 1EY2A 1KS5A 5I93A 1DYOA 2XKOA 5E20A 1OCZH 4B4CA 5D4SA 3LDBA 1D0HA 3U4SA 3ZKYA 3WDWA 3NAUA 1LNSA 1PO13 2ZMNA 4EVIA 4U0YA 2P34A 3CJIB 2GZWA 1ZRDA 1UYXA 3KLNA 2R061 2CU5A 2V73A 1D2QA 1GZCA 1QJU3 3ILRA 1A5JA 4LE3A 1KQ9A 5FXXA 2CNAA 2W5FA 4MTEA 3O5SA 4XURA 1DQ1A 5AC92 1W0PA 1Z1DA 1JXSA 1GP6A 2A69F 2WIIB 4KG8A 3FZVA 2D5FA 3BU0A 1R1TA 1RKTA 3J4UH 4BGDA 3NV2A 2A6ZA 2NNNA 1C8M1 3BCAA 2H1KA 3I58A 1KONA 3D3AA 1XSXA 3B7MA 2AACA 2NRAC 1OLME 2QFEA 2G7HA 3PVEA 4AYUA 4ZDLA 4QQHA 4UHTA 2VASA 1SBFA 3O1SA 5TRDA 2JE9A 3S0MA 2YC2A 3KCYA 5CISA 4PLNA 3VDDA 2JRTA 3GTJJ 2BJSA 3H1MA 1ODDA 2JD9A 1BQPA 1POQA 1TT5B 2WTEA 4X8PA 4WZFA 2QQ8A 4QQLA 3SC7X 4PSWA 5BNQA 4QPOA 4Y22A 3D5SC 3DTKA 3REOA 5BYNA 1DZRA 4DFSA 3ISPA 2BBAA 4COWA 1V6JA 1RUC3 2ES3A 3M3OA 1F15A 5D2AA 4DB5A 4B1LA 5K5OA 5DD8A 3AXDA 5FZKA 1BJQA 2BYVE 5JXJA 2OQGA 2VQTA 2VMIA 2XJTA 3OPZA 5FY7A 2FCTA 3L09A 4LBKA 4JV4A 3ZQCA 1JZ3A 1ULDA 5FPAA 3BU7A 3I2GA 3FBNB 1STZA 1US3A 1MBKA 2WO7A 3VLBB 3KEQA 4FFGA 3K4AA 3KZ4C 2R30A 4INDA 2K27A 4OIQF 2IXCA 2QKLB 2Y33A 1EUTA 4M3FA 4GH4A 4QXBA 1TWHJ 3JCUC 4DQAA 1FOXA 1W9WA 2QQBA 4V2FA 1IGOA 1TQPA 9ANTA 4EQVA 4RM3A 2R071 4AEMA 1TP4A 2Y60A 3SZTA 1DP0A 3BJ6A 1ZBA3 4LHSA 5FYHA 5DM6F 5BOXA 1S55A 4AD9A 1B6AA 3MUY1 1D8KA 2M8GX 4Z92B 5E3LA 1D0XA 3VYRB 4HMZA 4YW3A 2BRTA 4HKOA 5J1RA 2H6BA 4ZXKA 1YWKA 3IC7A 3E6BA 3WCSA 1AR82 2K2SA 4J1XA 4IE5A 1XYPA 3JD73 3WF2A 4FP3A 1OA4A 1X36A 4TTGA 2OPTA 4GB31 1PO22 4K7JA 1Y0NA 3WUCA 3FXLA 1RHI3 5JPNB 2RVCA 3PNAA 3ZLIA 4Q5OA 1UOGA 5A3PA 4JKMA 5EZWA 2EZKA 2LF7A 3ZOIA 3GFLA 1QKQA 3AL6A 2DWRA 2IXKA 2A1XA 4IHWA 5FREA 3ZO0B 4DYQA 2DCKA 1RXFA 1ZELA 3TB0A 2VXJA 4I30A 5DUUA 1H4HA 1GOGA 3PMSA 1YOVB 3FXOA 2CV6A 3V8LA 4Y4YA 3AFKA 3ECHA 1A34A 3A0KA 2UU8A 3TNQA 3FFZA 3SQOA 1X8EA 3MLKA 3LNQA 3WU1B 4B29A 2WV1A 1LHWA 4CH7A 4QWQA 5IWFA 1SVMA 4NIHA 2DU0A 3R0AA 3ACLA 4JGZB 1P7JA 2GNMA 1T6BX 4WM8C 3CJTB 5LK7B 1NLRA 3FHIB 4CDWA 4UW3A 5CADA 4GIQA 2XJUA 2IA0A 3WQ7A 3ZXSA 1DF0A 4FX4A 4EEFG 1LOEA 5FK8A 2W2IA 1S0EA 1WJCA 2AC1A 3ACIA 3WY6A 5F0FA 4FPLA 2RM21 3S3MA 3VKOA 1RUF2 1V6NA 2BWAA 1QZEA 4PDWA 1EA3A 4JYKA 3NV1A 5K7PA 4X1EA 2JZYA 5FP4A 1WJAA 3K4ZA 2FNAA 5IVCA 4YNIA 2NLRA 1EAH1 1JHFA 1EV12 1HLCA 3CDZB 3H7JA 2IT0A 4CCDA 4M6VA 2E26A 3CBNA 3LPGA 2HWE3 3POJA 1F1ZA 3N7LA 1R5HA 4FVVA 5FO9B 1C8M2 1FT9A 1V5GA 4IHTA 4FPGA 4KBBA 2OYZA 1JYIA 5JXIA 1MJ9A 1RUD1 4M3BA 4AEJA 3ZX7A 3FZ3A 3K51A 4I99C 3THDA 5CKQA 2CS3A 4RS8A 2BXYA 4EN7B 1JI6A 4TV7A 2MEV1 1IO2A 3HZJA 1W8NA 1QJX3 2RVAA 2O0OA 2XGDA 2JICA 1DGWY 4CEWB 4RGGA 2V1UA 3VZJA 3F8MA 3KP4A 2Y6KA 3IWZA 1A8DA 3FBIB 4YVSB 1DQ5A 2MLKA 5FZ8A 4AIDA 1S2BA 3K75B 4G3YC 5EF6A 3JQWA 3NARA 2IC1A 3BTAA 2BY2A 1GVDA 1C28A 4EATA 3T8RA 4KYWA 1RVF1 4CYCA 4XR6A 4HG6B 3Q3SA 2LTPA 2HH9A 3IKTA 3HOBA 5FO7B 1MS3A 1X4PA 3RS6A 1SBDA 2Y0MA 4O65A 3M1EA 4HSTA 2EFOA 2WAQN 1RUE1 2VO5A 4OMDA 2BW3B 5IYDJ 1RUH3 2Y6LA 3K3OA 2PELA 2R4GA 1A31A 4CICA 2LRPA 5CIRA 1U8BA 3NRVA 3S1MJ 3ECQA 1UX6A 2HDDA 3VZOA 1N78A 1VRH3 5EXOA 5D5WB 4FXGB 1ETXA 1KRIA 1UZZA 1K4TA 2EIMH 2HWF1 3D8CA 2D5VA 1RUH2 3AB0A 3UKGA 3IZOA 5ISLA 3RTRA 1YRZA 1JHHA 2Q5TA 5E1RA 4KDPA 1I1EA 3MPBA 2GC3A 2WQ8A 1F31A 2WA0A 2OD5A 2WY7Q 4MNUA 4OWRB 2WSUA 4LEJA 1UYYA 1FBQA 4IEYA 2A5ZA 3DL3A 3VB9A 4CGZA 3ZM8A 1VBD1 2Y6GA 2CUZA 4YZ1A 4Y20B 5C8CB 2DDUA 2E32A 2RV8A 2FSWA 3ZQ7A 5T55A 1X7NA 4URAA 4D7TA 3JAMK 1DG6A 2B45X 2VUDA 1DU0A 3WODF 4XZUG 3HN1A 4O3MA 2H27A 1R081 2O8KA 4UW5A 3RMYA 2VC9A 3GBGA 1BBT2 3N7KA 4CDQC 1YO8A 3LFIA 3GTKJ 4PQQA 3E5QA 1AX1A 5E18F 3SFZA 3IPVB 1TLHB 1I5ZA 3WHBA 4XMAA 1PHMA 3RI8A 1R22A 2P17A 2VC0A 1PGSA 3JD72 1UAIA 4GH4C 3VBOC 2HWE2 2K86A 4NNJA 1USTA 1VQ9I 1AR93 2JG9A 4EE2A 2XJSA 4HSJA 3LSKA 2VBZA 1FMD1 2JUCA 3J8F3 3W6VA 3Q8AA 4K6BA 5A3OA 3H8XA 5E3NA 1GNZA 4RS5B 3KEOA 1SD6A 1JKRC 2OQ6A 1U6GA 2CGOA 2MA3A 4UFHA 4ORFA 2DFEA 3ABUA 2FNPA 1UQXA 4PI2A 3ERMA 1SFYA 2AS5F 3I97A 2W87A 5ERIA 2YU9J 3IUOA 4B48A 5FKBA 3OGJA 2NYYA 1IPJA 3R61A 1QQP2 4K21A 2VR4A 1EH7A 5GAGJ 3I9V2 3C2HA 4II3A 2VOKA 1RHI2 3HM5A 5HOOA 1URXA 1YHQI 3HNYM 5F64A 3OS0A 3D4KA 1JJ6C 5EZGA 2PJPA 3EUHC 1XC6A 4A3DJ 3MN2A 1YE9A 4IQJA 4G8XA 4ZC3A 1I27A 2ZEYA 2D43A 4M9ZA 3I3QA 2VB6A 1FPQA 4E70A 1OQEA 2IAIA 4L0PA 3OSGA 5J48A 2W9XA 5A7WB 3BTCA 3JRCA 3VBFC 1CR7A 5F3EA 5HDKA 4RA2A 3ZMZA 4OVEA 3R4DB 4QX1A 1OKRA 2O8QA 2Q8KA 4JGYC 3WQBA 1QDOA 2EIGA 4XOGA 4FBFA 2I2SA 5K7ZA 2ZKZA 4WM7C 5CA6A 1JU4A 2N7GA 3A2KA 1ZG5A 3NV3A 3LQRA 2RKHA 1G8XA 4F83A 4XFGA 1IDZA 4NHKA 3S30A 4EGZA 2DYRH 3ONQA 2Q0AA 3R60A 1X3ZB 3T0BA 2PHUA 3BPVA 1RNLA 1XB4A 3QWLA 4FTHA 4R4XA 4YM2A 3Q8EA 1XMKA 1E5HA 3ES1A 4Z07A 4PFOA 1W6NB 1ZHFA 4BQOA 4BJ6C 4A0YA 3THPA 1RUF1 1WJBA 2LSOA 4D9JA 2D3PA 3LIGA 1NX9A 3MDPA 5GZEA 4NRQA 1M1EB 3VBUA 4ESBA 4S04A 2EAKA 5FZBA 1D1AA 1SDWA 1EAH2 4ITVA 2GA2A 4CZCA 4A7ZA 1X3UA 3ZMSA 5BQTA 2D6NA 1ZBE3 5JVVA 3VBOA 4UXNA 4ASKA 1OA2A 2Q8OA 4P9IA 1SACA 3EHKA 2ZMEA 3POBA 4JX5A 3HSFA 1V6IA 3L1PA 1ZGAA 1R23A 2HQRA 2OCEA 5IK7A 5DTDA 2PX9A 4HDVA 2UWAA 2KJBA 1Y8QB 2YPDA 1DPUA 1UCXA 1YHFA 5FD6A 2Y0OA 1TL8A 3VDDC 1MQTA 1REPC 4MGIE 3T2TA 2DYCA 2ADEA 1CAVA 1COV3 5LA0A 3GMEA 5EJ1B 3CMGA 2RMU2 3EUHA 1AJOA 2OZJA 1RTVA 3BOQA 2F5EA 1OD3A 3QPSA 4JKLA 2QQUA