3E5QA

Unbound oxidised cprk
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
209
structure length
202
Chain Sequence
NFFPIEKLRNYTQMGLIRDFAKGSAVIMPGEEITSMIFLVEGKIKLDIIFEDGSEKLLYYAGGNSLIGKLYPTGNNIYATAMEPTRTCWFSEKSLRTVFRTDEDMIFEIFKNYLTKVAYYARQVPTIRILRLFYELCSSQGKRVGDTYEITMPLSQKSIGEITGVHHVTVSRVLACLKRENILDKKKNKIIVYNLGELKHLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulation
molecule keywords Cyclic nucleotide-binding protein
publication title Molecular basis of halorespiration control by CprK, a CRP-FNR type transcriptional regulator
pubmed doi rcsb
source organism Desulfitobacterium hafniense
total genus 47
structure length 202
sequence length 209
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2008-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3e5qA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3e5qA01
4DQ2A 4PIYA 2GAUA 3QP6A 4U0VA 5FPZA 1ODDA 2P7CB 2F5EA 4UVCA 2UYBA 5FFZA 3S7EA 4YRDA 3ZQ7A 4IJAA 4HSJA 4KU7A 4JTNA 1W5SA 2K4JA 5CJ9A 2BV6A 2FBIA 4Y15A 4D0PA 4CYDA 1L3JA 1WKMA 4XFFA 5K1YA 4CGZA 3QACA 1U6GA 1HSTA 4FX0A 3GBFA 2PN6A 2M8EA 3ROUA 2RKHA 1XCVA 4YSFA 3E6MA 3CJXA 4G7ZF 3HSEA 4JVAA 2UXNA 3B73A 2J5OA 1R1VA 5CLSA 2KIMA 1SD6A 1EPZA 3J80Z 1QBJA 2GH2A 4IEOA 3RIRA 3LWFA 4R79A 3WTXC 4LG0A 2FBKA 4UXNA 1DP7P 3VFZA 1XD7A 4QM8A 2GC2A 2VBWA 3HT2A 2KIUA 3R6SA 1HKQA 1ZNPA 4RB3C 3TNQA 2Q0AA 3F8BA 1LDKB 2PMUA 1P6RA 2M87A 3BPVA 1XN7A 3HRSA 2IP2A 5I8SA 2UXXA 4GULA 1R58A 2OBPA 3Q5FA 3I59B 3BDDA 1ZLJA 5K5OA 1S29A 5DYMA 4RB1A 1I1SA 3LA3A 3R61A 5HOOA 2VPVA 3F8NA 3M8FA 2LNBA 3RYKA 4KWLA 2PJPA 5TJJA 4CXFA 3NJZA 4P9FA 2XUBA 1GQGA 4LK0F 4EV0A 2QWWA 1FXZA 1UHWA 4UVBA 2OZJA 2A07F 1OFNA 4XSXF 4EWDA 2VBXA 1YFYA 3O2PE 1FOKA 1FZPB 5L3FA 5I93A 2FMLA 3MEXA 3CEWA 1MJ9A 3E97A 3KP3A 4MV2A 1UFMA 1F9NA 4MQ9F 3E6CC 4G8XA 4I2OA 3I0TA 3KLOA 1WSUA 5I0UA 3WTTC 3T0YA 4UUVA 4LA2A 2BE5F 1SMTA 4NVPA 2JPCA 4ZYDA 1T98A 1BC8C 2IC1A 1UHMA 2ZKZA 4LB6B 4LLOA 4MX3A 2YX4A 3GF2A 5JSPA 3I71A 4P96A 4BYYA 4I3PA 4ENJA 3TO6A 1KQ9A 2PEXA 2OD5A 2UYAA 1LEBA 3OTFA 3H7YA 4ENNA 4MQVA 1O3SA 2H09A 1CAVB 1G3WA 1O57A 2M45A 5HDGA 4L5JA 5HLIA 5DCMB 5KHIA 4X6QB 1NE4A 4LLNA 3KZZA 3K2ZA 3F3XA 5A2QK 2KIFA 3GZ6A 3FXUA 1CAXA 3D0SA 4G9YA 4WBBA 1S6LA 5D8LB 2Y0OA 1OI6A 4Q4ZF 2O03A 5KHGA 3H50A 3E6DA 1FYLA 3E5QA 1C0WA 5F6FA 2Q0OA 4P5OA 2L01A 4EMSA 1T6SA 4G6DA 1FC3A 1CF7B 3QP5A 5F1RA 4OIQF 2WFPA 1E17A 2YR2A 5AVPA 2CQKA 4GCVA 3GFMA 2UY8A 3H8UA 3NKTA 5D6EA 3IHUA 1T0FA 3KP4A 5HS9A 4XLPF 4PGGA 2QUFA 2VECA 3IDCB 4BQAA 1BM9A 3CUQB 1F4KA 1KU9A 1K78B 1WGPA 4HX4A 2H6CA 5JR7B 4MTEA 5D5WB 1SMYF 2V9VA 2EAAA 3AAFA 4EJWA 1MJBA 4HF0A 2VC0A 4PDKA 4X6RB 1PUEE 3VEPA 2Q2EA 2PLYA 1WA4A 1V4RA 2ZO4A 3O14A 3H1YA 3FFQA 2QQBA 2XL7A 3ACLA 4OIRF 1HXDA 3HRMA 3GYDA 2L4AA 1SFUA 4U7BA 3BJAA 1IF1A 1V70A 2K9ZA 5J3UA 5E1RA 1XGSA 1J59A 3FHIB 2HWVA 1MKMA 4EJTA 1ZAOA 4OINF 1QPMA 4BHBA 3RKWA 4RB0A 4IESA 3E5XA 4XFAA 1FI2A 3BJ6A 2FMYA 4G94A 3V8JA 2IXCA 4P55A 1XMKA 1MJAA 2ZMEB 3V7RA 5JHUA 3RI4A 4EWAA 1W7PB 4L2NA 4NB5A 1IN7A 4HQEA 1FP2A 3H92A 1ZG5A 4NQWA 3GFIA 1V3FA 3BU7A 1TW2A 1LDJA 2F4PA 3KETA 3OGJA 2H0VA 4KWKA 2PQ8A 1E2XA 1P4XA 1HKTA 3HTSB 2ZNYA 1J0RA 3MZHA 2MLGA 4HDVA 3LAGA 2B5HA 1QQIA 2P6TA 4Q0QA 3SMHA 2A3SA 3WE2A 4CO8A 4AQ6A 2C6YA 2QYOA 3MZYA 3ZP5A 1SQ4A 3JSPA 5I0TA 3K0LA 4XF4A 3C7JA 5BQTA 1DGWA 5E1WA 4HVOA 2PFWA 2IRFG 2MH9A 3JAMZ 5LEKA 1XGOA 3HHGA 4ESJA 2XAHA 4Q47A 3ABUA 2COMA 2ACJA 3SHFA 2DPUA 2Y75A 5E8IA 3GO5A 3CLOA 1OKRA 4KIFA 5ICFA 3WTSC 4OU0A 4QX5A 4A6DA 5IT3A 1YS6A 3ULQB 4HSLA 3U11A 2MA3A 2Q1ZB 3TDZC 3LQRA 5AIPA 1QO0D 3JAMK 1ZX5A 4B29A 4OIOF 4IEQA 3F72A 2B8MA 2Q30A 3V7CA 1DGRA 4KICA 3D5LA 3L7WA 3RDIA 2Z3YA 5C6CA 3G3ZA 5EZWA 4I7HA 1TQIA 2HKXA 3TQNA 1BIAA 1Z7UA 6PAXA 3WG9A 1XB4A 4UV9A 5DUKA 1W5TA 4YNIA 2PAEA 5L3BA 1BI3A 3IWFA 1OD5A 4EJUA 1UIJA 4IRIA 2EK5A 3I53A 4G7HF 5D4RA 4CICA 1NE6A 4R8HA 1O4TA 4PIXA 2P5VA 3K1NA 1TQPA 4O6JA 4Y17A 2VT3A 3ZMSA 3ES1A 3MCZA 2JZYA 1L3LA 4MEXF 2HTJA 2KJCA 1FBUA 5E17F 3NSTA 1I6XA 3DV8A 3N97A 5J6XA 5TRDA 1OYIA 4G7OF 4XF3A 1OYYA 1IPKA 4XRFA 1T2KA 4FAGA 3CO2A 4HDUA 4GO1A 3KEOA 1I5ZA 2D45A 4KIBA 4Q29A 1OMIA 2OPKA 1KU3A 3RNSA 3SCGA 3ZN1A 5D5VB 3PLQA 1IXRC 4B09A 1H1IA 3BWGA 1WWXA 1Y9QA 1R5HA 4MUVA 3D0JA 2IVMA 4IPAA 5DCMA 4RAYA 3WE3A 1RUOA 1ZZ9A 4YARA 2JSCA 2IXIA 4FAHA 4LD5A 1H0MA 1B1BA 1U3EM 3NW4A 4H7LA 1WRJA 1GXPA 4XBFA 1F5TA 4ZU7A 1R23A 2DLLA 4IXAA 1KYWA 3SZTA 2DQRA 5JFRA 4UHTA 3ZMUA 1B4AA 1YQAA 2J5PA 4L9NA 4BIFA 3CLPA 1WLTA 2XV4S 5FFXA 4A12A 2LF7A 1PM7A 4LLLA 3EUHA 1S3JA 1CF7A 5LBQA 3WW4A 4LJZF 3FM5A 4KN4X 3WTZA 5LRRA 4IHTA 2DAOA 1BBYA 1D3YA 3DFGA 1O3RA 5DD4A 4FX4A 5H6QA 3LAJA 2MHFA 4Q0PA 4IHSA 1HW5A 1ZHFA 2Y48A 1U78A 3COAC 3CUQA 1K78A 3GX4X 3WGHA 2W25A 3QU6A 4ENKA 4HAMA 4O9EA 4F7ZA 2E7XA 1MD0A 2X0LA 3VHRA 3RPUA 2MPFA 2Z69A 3BY6A 2DI3A 4LUKA 4JV4A 3C1DA 5J7MA 4L9VA 2CO5A 2XKPA 1RI7A 1FY7A 1IRGA 2Y0MA 1FT9A 5JSOA 4IEVA 1B59A 3C3VA 5I91A 3RYPA 3KCCA 3P9CA 2PI0A 1ZRDA 3DEUA 3HOTA 5FCCA 1J3QA 5HDNA 5I0SA 2V79A 5LGTA 1EY2A 5CVRA 3H9AA 4OLLA 2GXBA 3M70A 2FOKA 3MPBA 3CO7C 4EGYA 2ZMEA 3TDUC 3IRRA 5LHGA 2BBYA 3S7IA 4XF0A 2JRTA 1KA8A 3WU0A 1R1UA 4IEYA 1W7PA 1X82A 3Q9VA 3DL3A 4XFBA 1YWKA 5T3NA 4PJYA 2OA2A 1B9NA 4TV7A 4HVRA 1YW8A 4HQMA 3GFLA 4AQ2A 4HX8A 4LLGF 2EFNA 2K7LA 4AVBA 3SCFA 4YFKF 4XFIA 1ZYRF 1IN4A 2XVCA 1D8KA 2FQ3A 4WXCA 1X8EA 2O0YA 1TNSA 5J8CA 2QCSB 1USTA 2XROA 3MAJA 2FA5A 1Z6TA 2EV6A 2ZFWA 4LEJA 4M9XA 5FDBA 4RGRA 1KQ8A 2O3FA 5LRSA 2V1UA 1PMIA 1RL3A 4M6XA 4EVIA 4EJVA 2O8XA 1ZG1A 3J7AO 1MGTA 3U9GA 3S2WA 5EFUA 2GA2A 1NHAA 2MNGA 2K27A 4JK1X 3T1BA 3WW3A 3C18A 4GXOA 2XGXA 3JZVA 3V4GA 1XGMA 2OAZA 5AIQA 1DDNA 4Z07A 1Z05A 3M9AA 3FX3A 5KHKA 3WGGA 2KKOA 5ICCA 3MDPA 2PMHA 3FXRA 2ADUA 2RDPA 3MWMA 2IA0A 2YX7A 3KFWX 2O61A 3OCPA 1G6NA 2YPRA 4HLYA 3EO6A 3U0ZA 2BGCA 3L2CA 5BV6A 3WGIA 1RZ4A 1HSJA 3QRFF 3KE2A 1JGSA 5FD6A 1U5TB 1O7FA 4Y13A 1YO5C 2PQQA 2VOOA 4WCGA 5AONA 1OYWA 4TLFA 4HF1A 2MLKA 3S0MA 2XLAA 2L4MA 3QU3A 2OQGA 4WZCA 5FGMA 3K1MA 3K1PA 2PA7A 2QLZA 2WC2A 1O3QA 4AXOA 3GXOA 2IPQX 4MZUA 3EQEA 2PHLA 4HV6A 3F23A 2L3DA 3TOBA 4E70A 1FBSA 5FB2A 1ZZBA 3VOEA 1UB9A 2K0GA 3KLNA 2IT0A 2O1QA 1XSDA 2FNPA 1Q5OA 3ZDSA 1XSVA 3PQJA 4ENMA 1QWRA 2NNNA 5E16A 2CG4A 2FXAA 4CZZA 1RC6A 2GQQA 4I01A 1T38A 4A5MA 3HTUA 1TLHB 5L3DA 4AD9A 4QXKA 4WVZA 4A0XA 5JI6A 4ZYEA 2DO7A 4J1XA 4KT5C 5A2QZ 4B8XA 1BC7C 1P4AA 2XHKA 2DCTA 4HBLA 2R7FA 3RTRA 3LSTA 3B02A 4N0BA 5KK1A 2Z33A 4AVAA 4OIPF 2GXGA 5ERIA 3FXQA 2EV5A 1I27A 3WTVC 3SFZA 3IC7A 4HZFA 1DZTA 4PGHA 3FJSA 3L9FA 3PNAA 2P5KA 4YIFA 1ON2A 1VP6A 3K69A 2CGPA 4A0YA 3OD0A 4L11A 1GQHA 2ZXJA 1IRFA 5H6RA 2XASA 2PFBA 3V8LA 3ZMZA 2FE3A 2EFOA 3M7GA 3WTWC 4EROA 3CJNA 3F6VA 2R3SA 4KN7X 1OPCA 4L18B 4XETA 5CVVA 2PG4A 2F2EA 2HS5A 4GGGA 1ZZCA 3O6BB 1FWZA 2AXLA 4O9GA 2RC4A 4HMZA 2VQAA 5D6FA 3DXJF 2STTA 3H3ZA 2ETHA 2HKOA 3GUDA 3T8TA 5BOXA 1UD1A 4LTAA 2ET7A 1U2WA 3FZ3A 1ZRRA 1X3UA 3E5UA 2IXHA 3QAHA 2OA4A 1SFNA 3QPTA 4E2QA 2CW0F 2QNKA 4RGUA 4ZU4A 5LGUA 2H6BA 3EJKA 4YFXF 2EA4A 4BAYA 2QM3A 2RVCA 1JUHA 3EHKA 4BH9A 2BNMA 4HLTA 3GLXA 1Z6RA 4HN1A 1K79A 2V1XA 2A6HF 3UKNA 2VE8A 1L0OC 4LMYA 3HUGA 2OZ6A 4LUMA 3SCHA 4EWEA 2CFXA 2ZNZA 3ELKA 2VC1A 2FEZA 1EH7A 4L0ZB 4RD7A 3F6OA 3KP7A 1LVAA 3BJOA 1IAWA 1RTVA 1ZZ8A 2EWNA 1IPJA 3LWCA 2GIVA 2QVOA 4IRHA 3TGNA 3DPLC 4BXUA 3NL1A 3SXWA 4KMFA 2VODA 2P7VB 2XLFA 3DPTA 1YFHA 3QOPA 1YLFA 4R52A 5H20A 2W84A 1TNTA 3KGLA 5BY5A 4IETA 1R36A 4DNCA 3O3KA 5DUIA 3HRUA 2JPBA 2MD5A 4UBGA 5ICGA 3BPXA 1SFXA 3TO7A 5J8FA 1UPIA 4H0EA 4Q0SA 1DUXC 2FSWA 2D40A 2ATFA 5KHHA 1WI9A 4XF1A 5FO5A 3FZVA 1W4MA 4EJOA 4J1WA 2EA2A 4XSZF 4IRGA 5JR3A 5E8GA 4Q5SF 4A6EA 1G3TA 1LKNA 1U5TA 5JAXA 1Q43A 1CGPA 5KHJA 3BOQA 3Q9SA 3GVAA 3L2HA 4RAZA 3NEUA 1BI1A 2IXLA 4I0AA 4ZYHA 4JQFA 1JE8A 4Q0VA 3HYIA 1LJ9A 5E1XA 3ZPLA 4IVNA 2NS0A 3OV8A 2NYXA 3BB6A 2EV0A 2H94A 2UZKA 3MFKA 1Y3TA 2DK5A 2V1DA 4U7DA 4ONUA 5FLJA 3H3UA 5KVRA 5J48A 3P9IA 4EGZA 2EFWA 4IEWA 5D1IA 2P17A 4KA4A 2BNNA 5HLGA 3RYRA 3RZZA 2H27A 3ZN0A 4I98B 1EH6A 4ETSA 4M74A 2HEOA 4I0BA 3SXYA 1HW1A 4OMZA 1BI2A 1S7OA 3OOPA 4ZU5A 4ZH4F 1BJAA 1MDMB 3SHRA 1LEAA 3JTHA 1ZG3A 3JW4A 3GWZA 5FLIA 5HDKA 5EEGA 2WWYA 4RB2C 2NNYA 4L9TA 4EM0B 1HKSA 2CAVA 5ILVA 4FBFA 1K7AA 2O8QA 1KU2A 4AWXB 2PBIA 2IA2A 2M1BA 2W85A 2DW4A 3C3WA 2D1HA 2ZCWA 3IIAA 4HYEA 1ONVA 4CDGA 2BNOA 3DF8A 2UY9A 2IXJA 1KYZA 4EQQA 1J75A 2G7HA 1J2XA 2DU9A 1YIOA 5FPXA 2STWA 1EP0A 4UBHA 3GEZA 4META 1Q1HA 5DCFA 2DQLA 2ESNA 1O5UA 1FPQA 1ZGJA 4YFNF 4E2GA 2FF4A 1HBXG 2A61A 2Z99A 1DZRA 5CYVA 3HQXA 4K8FA 4QMAA 2M30A 3R0AA 3EETA 4F8AA 1S8NA 2F5CA 2Z9OA 4S05A 1IN6A 1XDSA 1D8JA 1Y0UA 2Q4SA 2PYTA 1GXQA 2VE9A 3BALA 2F5DA 3RPQA 2HOEA 3CL1A 2UWMA 1AWCA 3ES4A 4U0WA 4LFUA 5E20A 1FNNA 4LGWA 3MYXA 3D82A 4L9JA 3K9TA 4KNYA 1NZCA 4KYWA 2D5FA 4AIHA 2A6EF 3WU1B 3FHZA 3M1EA 1TBXA 5DD8A 5BPDA 1XCBA 3ECOA 4U0YA 3LFKA 1W7PD 2FNAA 2RN7A 4UNOA 3WTUC 5DEQA 2FBHA 3PVBB 3M3IA 3J81Z 2VXZA 3TKYA 1ZARA 5E1ZB 4M9SA 2D93A 5C8WA 3VB2A 4A2UA 1U8RA 5E18F 1VR3A 4ORFA 4UXAA 1XRUA 1B9MA 3GW2A 3HSFA 3KP6A 1CAUB 4HN0A 3HHHA 3T5XA 1FSEA 1EV7A 3KZYA 2ETEA 5D8KB 1MZBA 3J81K 1DPRA 2GZWA 1IXCA 2ELHA 3EQLF 5K5RA 3JTGA 5IT9K 1ULYA 4WXHA 1RNLA 2BEOA 3LOIA 3SQNA 2P5LC 2EA7A 4AIKA 5L3EA 2LDUA 4O3MA 2GC1A 3EDPA 1P4WA 4MGRA 1O7LA 4KDPA 1CAWA 3SZPA 4Q0UA 3IWZA 5DV5A 1DPUA 3WTYC 2D1VA 2Q8KA 1J58A 4PZJA 5FQ0B 2B9UA 3ERED 3ML6A 4AIJA 2FQPA 3HIFA 4FHTA 2HFHA 3WW2A 3ZMTA 3UKTA 4D7SA 2EFPA 3EYIA 1Z91A 4ESFA 4XLNF 1G3SA 2ISZA 1P92A 3F8MA 3H7JA 2Z5UA 4P9GA 3R60A 2HJIA 3ZMVA 5BPIA 2D2WA 2BYVE 5CVUA 1OR7A 4EM1A 5JVTA 4QLCU 2DPDA 3P9KA 1B6AA 1IXSB 5CVIA 1R5GA 3V8KA 1J3PA 2PAKA 1GVJA 1XGNA 4LA3A 2OQRA 3KP2A 2O6GE 2LKPA 2Z2SB 3NVCA 1LQ1A 3J80K 4KUMA 4YG2F 2K4BA 2VONA 4PCQA 4UV8A 5CVJA 4HVQA 3F22A 1REPC 1HQCA 1FSHA 1USSA 2KJBA 1D5VA 1UW8A 3I7DA 3LA7A 4BHPA 4HF2A 1MDMA 4PIZA 4XEZA 1NYWA 2QVSB 3REOA 1LNWA 3P7NA 4ON0A 2A5YB 3ELNA 4ASNA 5HS8A 3CTAA 1VTNC 2K86A 3L00A 1XSXA 2V09A 2E9QA 1J9IA 4QGMA 2HQRA 3TO9A 4E2SA 3CDHA 5LEJA 2WTEA 2YU3A 3H1WA 3I54A 4WXDA 4DINB 1XDUA 2QBYB 2RGVA 1GHCA 1JHHA 2P4WA 3M8EA 2KXLA 3I4PA 5JSRA 2VBYA 2XAJA 2A69F 2ZBKA 1RGSA 1ZZ7A 4XF9A 2FU4A 2AS5F 3KEQA 2DTRA 4P9UA 4IF4A 4U88A 1SD5A 4HX7A 2HQNA 2NRAC 5ED4A 4RS8A 4BHCA 1IUYA 3BZ6A 4XFCA 2XIGA 1YHFA 2MH2A 3IKVA 4QGLA 4GYGA 1AOYA 2C0ZA 2FRHA 1IW7F 1YS7A 1LRHA 3BROA 3E3VA 1IN5A 3CF6E 3KGZA 3NQOA 2G7UA 2EVXA 4HBNA 3BPZA 1QZYA 4MNUA 5ICEA 4AVPA 1ZREA 2EFQA 2HYFA 5BXXA 1NXMA 3QPHA 1CX4A 2PAMA 4IEUA 2EJRA 3WODF 4JTOA 2QZ8A 5HI0A 1X8MA 2D5HA 2EB7A 3FF5A 5I8TA 4M71A 2KRFA 4LULA 2QQ9A 3HOSA 1YFUA 4IEPA 4XFHA 1QY4A 3PFIA 4HA8A 2PHDA 4RGXA 1YFXA 2YSRA 4IERA 3KP5A 2L54A 1JHFA 3I64A 4KU8A 5DDGA 1PDNC 2XLGA 4D7TA 5ILSA 3L09A 5HVQC 4LK1F 5FLHA 3U10A 4Q48A 1ZH5A 1CAUA 4OMYA 5CU1A 3PQKA 3ECHA 2QQAA 3E6BA 3T8RA 3DKWA 1IZ1A 1BN5A 2QDRA 1YW9A 3GYHX 2P6SA 5LHHA 5BUVA 3G7DA 2MBFA 2R7DA 1R22A 5D5XB 2P8TA 1R7JA 1ZGAA 4QGNA 1X7NA 4ZYGA 4KL1A 3USSA 2OU2A 3LZZA 1JXSA 4MHGA 4G6QA 1XE8A 1FLIA 4K2EA 1WQ2A 2GWRA 4ZZDA 3GZ5A 1P2FA 3IRQA 2XAQA 1H1MA 1SEFA 4Z82A 3RJPA 5FQ0A 1FYMA 2VN2A 4ZZLA 1UCXA 1Z1DA 4HLXA 5KBFA 2RQPA 4A0ZA 1CAWB 3IDBB 3H1MA 2W57A 3V7SA 5BPXA 1YYVA 3F8CA 1R1TA 2N7GA 3DN7A 1H9GA 3F8FA 3ZMDA 1VJ2A 2HTSA 1O3TA 3ETQA 2IA1A 4LB5A 4HOBA 1R00A 1K6OA 2L02A 2VBZA 1XMAA 2IXKA 3BCWA 1U5TC 1ZLKA 2XL9A 1S7AA 2HDCA 3HSRA 2LF8A 2RV8A 2IJLA 1FBQA 2HGCA 3F21A 2VT2A 4XFGA 5ILUA 4KFCA 1QZZA 1TW3A 1H9TA 1BI0A 4MEYF 3I59A 2MC3A 4LG0B 2ZJ2A 2GC3A 2QJVA 1LR5A 3ISPA 2F5FA 1UCRA 2W24A 3NRVA 1Q3EA 3CO6C 2E7WA 4MH0E 4L5IA 3BP8A 4O5VA 5BMZA 2WV0A 4WX9A 4BNCA 2DT5A 5L3GA 4Z2YA 3GFJA 2QENA 3HRTA 1YUDA 3FM3A 2JT1A 4M72A 2XKOA 3R4KA 1UIKA 3FMQA 1ZVFA 2QBYA 3DQVC 2A68F 2PTMA 4QWQA 4M6YA 2V6CA 4ESBA 4IEXA 1G3YA 1G4DA 5FD5A 3I5UA 2E1NA 1TTYA 5K8SA 2X4HA 5D5UB 5I0RA 3HT1A 4HV5A 1KU7A 2IW5A 2CV6A 2XRNA 3DP7A 1KGSA 2GU9A 1BIBA 3LQQA 4M9ZA 1HW2A 2OYZA 5EEHA 3VODA 3U1DA 4NHJA 2VOPA 2CWEA 4RGSA 3W6KB 1EH8A 3MQ0A 3OF1A 4I09A 3R0JA 1SFEA 2G9WA 1O5LA 1I1GA 2B0LA 1J7KA 3I58A 1QXRA 4IEZA 2GA1A 3KMHA 3TOAA 1PP8F 5CADA 1PP7U 1CAVA 1Z9CA 1RIOH 1QGPA 1QXJA 2NAZA 3WW1A 5LGNA 1SAXA 4MGKE 1J5YA 2OZUA 5I8YA 4WF2A 4KIGA 2TDXA 3EYYA 1YTYA 2DBBA 4M73A 4I02A 1RUNA 1QNTA 1A04A 3IL2A 3FMRA 5LLQA 3FWEA 2HR3A 3LA2A 3G73A 2CAUA 4YIIA 1FP1D 4OFGA 2K02A 3CUQC 5JCTA 2XAFA 1YFWA 5FLXZ 1ZRCA 1ZRFA 4EM2A 1TQ5A 3TNPB 3FMSA 4N9IA 2JTVA 5HLHA 2ESHA 5K5QA 5L3CA 1EYBA 2GC0A 1STZA 1LB2A 1CAXB 3EBRA 3JSOA 4MGIE 3CUOA 4MTDA 4MGYE 1KQ0A 4WWCA 4QM9A 1YW7A 1T39A 1F1ZA 2HYGD 3ST7A 1SD7A 2XAGA 3N4MA 4R1HA 5FLXK 4N9HA 1LDDA 3RKYA 1BOAA 4OOIA 4GYIA 1U12A 5BS6A 1J1LA 1ZN2A 2CSOA 3IKTA 1FX7A 2M5WA 4YYOA 4A5NA 3W6JB 2HZTA 1J3RA 3IBMA 1TQMA 5IT9Z 2I45A 1YG2A 2E1CA 3FE5A 4JBAA 4AVCA 4KMUX 2CYYA 2LSOA 4UVAA 4FT8A 1FYKA 1ZZ6A 1XE7A 2ZKLA 1IN8A 4HW0A 2DFIA 4WK8F 1YLLA 2RNJA 4CHUA 5D4SA 4MGZE 3ABTA 5F64A 3U2RA 4S04A 5HS7A 3LAPA 2ISYA 2DK8A 5LHIA 3RKXA 1SD4A 4L0YB 3KSCA 3UKVA 1ON1A 4KWJA 2ET1A
chains in the Genus database with same CATH superfamily
3OIQA 1COV1 4PIYA 2HXOA 1I1EA 2W46A 3WF1A 1ZTRA 1TP4A 3GCMA 3RZHA 2RM21 2DTWA 3S7EA 4YRDA 4IJAA 4HSJA 4JTNA 2R7WA 4WV8A 3LIGA 1W5SA 3UL2A 5CJ9A 2ZX0A 3W2AA 2BV6A 2BOIA 1IG3A 4LIVA 4QSHA 2UWAA 2JK3A 5K1YA 1U6GA 4ZDLA 4Y1UA 5H9RA 4HNTA 3OL3A 3ROUA 1PIV1 2RKHA 1XCVA 5FZHA 4AHXA 3MICA 4FSJA 3JD72 3HSEA 1TWGJ 1OQDA 2DBNA 2UXNA 2WT2A 3W59A 2FJ1A 3HOVJ 4MHRA 3VBUA 1N1TA 1EPZA 2WQZC 1JYNA 2IVIB 3IMMA 2DMNA 1VAMA 4OCTA 3AZYA 3ZFGB 1DP7P 1MEC2 2KIUA 2N8GA 3R6SA 2V1NA 1HKQA 1ZNPA 2IVJA 3M1CA 5L73A 2HWE2 5FY1A 3F8BA 3MIEA 4ITCA 3VBSC 3SDBA 1ETVA 3HRSA 1NY71 1R58A 3AZVA 2WSUA 5EV7A 5K5OA 5A33A 2HDDA 5DYMA 4RB1A 3LA3A 3KD4A 4FOVA 5TJJA 4CEWC 5A6YA 4FOYA 3S5AA 2VOWA 3PNYA 3EPZA 4LK0F 5J3LA 4FPLA 4Y20A 4UVBA 2J1SA 3O2PE 5KAFC 1FZPB 1C8M3 3V0AB 3CEWA 3ZFFA 2QSFX 3E97A 4XLAA 3KP3A 4MV2A 4QPIA 3WF3A 3E6CC 4BK5A 4G8XA 3POFA 4MOAA 4ABZA 2Z16A 3KLOA 1WSUA 3FFZA 2WN2A 1RUH2 4CXWA 4BQ3A 1SVMA 1ULDA 5CZKA 1TMF1 2L7KA 5J47A 1VQ6I 2KZGA 4DIQA 3LEMA 2IC1A 4JRLA 3R0RA 2R5YA 5JSPA 5ISLA 4P96A 1DDLA 2YZ4A 2PEXA 2UYAA 2VD7A 3OTFA 3M3CA 4PSXA 5JVGF 4ZXEA 5A3OA 2DCEA 4MQVA 4BIOA 3P1IA 4IX7A 1PUFA 2H09A 5LZ6A 2E60A 1O57A 3WHCA 3ZOBA 4LO4B 4F92B 3CJQB 5HDGA 1YIPA 1WHUA 5DCMB 1R64A 5DPNA 3OSGA 4YELA 1NE4A 4YGDA 3KZZA 3F3XA 5B3SH 2RDSA 3J9SA 4G9YA 3ZR5A 1S6LA 3NNMA 4Q4ZF 3CC7I 4NHLA 4E4SA 4LBQB 1UYYA 2KA3A 4M3FA 5GTHC 2L01A 4EMSA 2OUHA 3PMSA 3MV01 1V6IA 3BI3A 3AKZA 1FC3A 3LQCA 1MNEA 2X85A 3LL7A 1VQ4I 2IS2A 3GNEA 4IQPA 1QXPA 5K7ZA 5AVPA 4OHVA 4GCVA 3IDEA 2UY8A 3IHUA 4TZDA 3OSFA 4KITB 3CJIA 2VQCA 1OCRH 4F3JA 2L9VA 2M34A 1BM9A 1WGPA 3SZGA 2VXJA 4HX4A 1SMYF 3AAFA 1RITA 5BNNB 3ZSEA 2MSYA 1XNKA 1XX5A 3VEPA 4QPGB 2Q2EA 1WA4A 3A0NA 1V4RA 4WM7C 2QQBA 5DTDA 1D4M1 2NPIA 1CD3G 3AKTA 1W0TA 3I55I 5J3UA 4YLZA 4MFEA 5E1RA 1J59A 2YMZA 1GZCA 1YI2I 1ZAOA 3CD6I 1TWHJ 2WV1A 4RB0A 2R062 4XFAA 4LT5A 3BJ6A 3LCPA 3NQHA 4M4RA 1RVF2 2ZMEB 1YJWI 3V7RA 2JICA 3RI4A 1YJNI 5CFDB 1VRH3 2ZJRF 2L2OA 1UYXA 3E0JB 4RAGA 4NQWA 1TW2A 3S14J 3O1MA 2NLRA 3KETA 3OGJA 2CQNA 1E2XA 5FZCA 2MLGA 4XZUG 1QJU3 2B5HA 2P6TA 2CYFA 2A3SA 3PVOA 3WE2A 4AQ6A 2IGMA 1V5GA 2QYOA 1HRI2 5J09A 2VB6A 1V6NA 2VUAA 3ZP5A 3N7KA 4XF4A 1DGWA 2BFUL 1VBA3 4D6SA 2IRFG 4Q1PA 3JAMZ 5GM0A 5LEKA 2E63A 3HHGA 4ESJA 2A05A 3VBOA 5FXWA 4EZHA 2DPUA 2ID6A 2Y75A 2XJTA 1VBC2 3Q8FA 5AC92 3VDDB 2KL4A 4KIFA 3WTSC 4QX5A 5CG9A 4P9IA 3PURA 3ULQB 2COBA 3LQRA 5AIPA 1AA7A 2R5ZA 3OL4A 3ZXDA 4B29A 2LG4A 1DGRA 3D5LA 3RDIA 2Z3YA 5EZWA 2HKXA 2ZTNA 1Z7UA 4FPCA 4MYEA 4W1UA 1IRXA 3O1TA 3OBTA 1YCIA 3U4SA 4UV9A 5KXCA 3GTQJ 4YNIA 4KMQA 2PQSA 1MSEC 3ZN5A 1BI3A 5DM7F 1UIJA 5FO7B 5FMDA 2DMQA 5D4RA 4R8HA 1O4TA 5L7OA 2VOKA 4W6WA 1DZQA 3K1NA 1TQPA 4BY7J 1HF0A 4Y17A 2JA6J 3I4MJ 3MCZA 2JRMA 1L3LA 5F2WA 4EYUA 1MVQA 5E17F 2B9VA 3N97A 3FLTA 3M4FA 3AYAA 3PHMA 1OYYA 1HDKA 4CEWB 3CO2A 1KXGA 2VBDA 3KEOA 2YBSA 4FOQA 1ZBE1 5H9QA 1QDOA 2BERA 4Q29A 1OMIA 1W2AX 3RNSA 1RUC2 1MMSA 1E5IA 5D5VB 1H6YA 1W8OA 2VQ0A 4AU7A 1UX7A 3H35A 1Z7S1 2ZZJA 4C90A 1H1IA 3CP2A 3LDRA 1LHUA 4YM0A 2OC6A 1RMU3 1V6KA 4RAYA 3S17J 3WE3A 1RUOA 4RHV3 4YARA 2JSCA 4ARXA 2OJED 3P3PA 4NJ4A 3NW4A 1U3EM 1GXPA 1UXZA 5B1AH 1R23A 4IXAA 1PYVA 3AYCA 5DZFA 3ZMUA 4L9NA 2QSHX 5DXDA 3N9QA 2JUGA 3L2YA 2XV4S 1W05A 5FFXA 4A12A 1PM7A 4LLLA 3BUCA 1YQ6A 1VRBA 4XDQA 1CF7A 4O61A 1OC1A 3IUOA 2ECCA 2DMUA 3WW4A 3QPSA 3FM5A 1AX1A 2RM23 3KYLA 3DFGA 5L9BA 3LAJA 3BR6A 1OISA 1HW5A 1ZHFA 3WGHA 5IYDJ 4DOZA 3WHTA 1F31A 1MBKA 2E7XA 1PIV3 1UMIA 3ILNA 2EICA 5DDJ3 1C57A 1PX3A 2DI3A 4JP0A 4AYUA 2WB1A 4L9VA 5F8PA 3MW3A 1FY7A 5FZKA 2RS11 5HCHA 1U5ZA 2Y6KA 3CCYA 4H4KC 4M3CA 4OI1A 1BBT1 5FIXA 2B39A 4M0HA 2JN6A 3FKIJ 5M5WJ 4M4PA 2DURA 5C9AB 3HOTA 3BR3A 1EY2A 5GZCA 2IS4A 3MPBA 4EGYA 5J96B 1RUE3 2BBYA 3A03A 3S7IA 3DXTA 3VBFB 3WU0A 4IEYA 4WM8B 1PVC2 1W7PA 4FQGA 4E7HA 4CUGA 2PHTA 3TAYA 1R49A 3WNOA 2VZRA 3OSDA 5T54A 4C8DA 2EFNA 2K7LA 3WF4A 3Q3SA 4AVBA 1IS5A 5LY2A 5K0UA 4JQRA 2LC2A 4WM7B 1D8KA 1H2KA 1X8EA 2O0YA 5J8CA 4IHVA 2QCSB 3MAJA 2FA5A 3WZ1A 1OR7C 2QQWA 1KQ8A 3CZ6A 3T2QA 4EJVA 1RUI1 3BCBA 4XURA 2E35A 2O8XA 3AG2H 1ZG1A 3J7AO 2D6LX 2XPUA 3ZCOA 2VNGA 1QHDA 5EFUA 1NHAA 1IS6A 1W6NA 3NWTA 2PMZN 4RA2A 4URAA 4JK1X 5JIUA 4GXOA 2ZX1A 5FYHA 4AI0A 2OAZA 5AIQA 4LHLA 4AZZA 3M9AA 3O1PA 5KHKA 3WGGA 2KKOA 3MDPA 2PMHA 2KISA 1US2A 5CPRB 3N7JA 4A3XA 3PUSA 2YX7A 3OCPA 5HV0A 1OH4A 3EO6A 2WZEA 5BV6A 1UU5A 5LBFA 1JGSA 3WG4A 3RS6A 1YO5C 1PZ7A 4WCGA 5AONA 1OYWA 4HF1A 3GCWA 1YIJI 2PHWA 3QU3A 2OQGA 4WZCA 4D6RA 3K1PA 3MFCA 3J8F1 1TL8A 2W9XA 4OYUA 2VVFA 2YB7A 2KP6A 3EQEA 3S2HJ 4LK6A 3F23A 2L3DA 5FMBA 4E70A 1FBSA 2E7QA 3K4AA 1ZZBA 3CMAI 4UI9L 4AFAA 1IDZA 4C3IJ 2NQYA 1V0AA 4WVMA 3ZYFA 5B4NA 1XSDA 3ZDSA 5G05L 4ENMA 5FYCA 2XHNA 2WAEA 1JYTA 1RC6A 4I01A 3S8PA 2F17A 3HGYA 2ZGSA 1GUIA 5EJ3A 4Y22A 1QH6A 4KT5C 2IGKA 5E89A 4B8XA 4Y3OA 1BC7C 2XHKA 2VMIA 5HV4A 3RWKX 2J1RA 3K48A 4AVAA 1EAH2 2GXGA 2HYKA 4JRAA 4RS5B 5A6QA 4DS0A 1I27A 2JD9A 1NCRB 4LHKA 1QJX1 4BBSJ 4PGHA 3USUA 2VI6A 2NVYJ 2P5KA 1YNAA 5FROA 2WA3A 1ON2A 1DF0A 1IV6A 2LBFA 5ACA1 4C30A 4URTA 3WTWC 1E3OC 2GNDA 5H2FC 4L18B 1H2LA 4BMBA 2XQRA 3ZSLA 1TME2 1T0FC 3W58A 3A2KA 4AVZA 1Z0HA 2F2EA 3GZEA 1ZZCA 4H2AA 2X1DA 1WLWA 4HMZA 1ETKA 3DXJF 1ND3B 3MZ8A 5BOXA 3T8TA 3FZ3A 4GKYA 3G6JB 3X2QH 1MS1A 3OY8B 3HN3A 1SFNA 2ZHLA 3HOXJ 4E2QA 2CFOA 1QHHD 2HWF2 4RGUA 3HEFA 2H6BA 3DEMA 4GWIA 1QDCA 1AYM3 4BAYA 3GTOJ 4CH7A 3H5NA 2W1QA 2BNMA 3AVRA 2YC4A 4BQNA 5C3PA 5TGTA 1GICA 3OGVA 4Z2AA 3F0CA 1FOD2 1Z3XA 1VBB2 4BDVB 2ZNZA 2DT7B 3ELKA 5FYYA 1EH7A 1W8HA 4L0ZB 4RD7A 2KZVA 2QQUA 2ZS6B 4JYKA 3KP7A 1IAWA 4KISA 1QPIA 1RTVA 1SBDA 1R71A 1OXCA 5D2AA 1ZZ8A 4LXLA 4BQWA 2E36A 3TGNA 4YWAA 1UZYA 4A3ZA 4KMFA 3VZJA 2VODA 4AEDB 1RC9A 4R52A 2XG3A 1YOVB 3HOWJ 1R36A 4JGYA 3O3KA 5DUIA 2JPBA 2MD5A 4UBGA 5ICGA 4YW6A 3BPXA 1B8IB 3CP8A 4LBOA 4QHOA 1UPIA 4Q0SA 1DUXC 2D40A 2ATFA 5K7PA 1ONAA 2QCOA 4XUNA 3VHPA 4DOUA 5FJHA 4XMYA 2UWCA 2YDEA 4IE4A 3FZVA 1LOGA 2ZEYA 1W4MA 4J1WA 1Z3YA 2EA2A 1H89C 1LGCA 4IRGA 5JR3A 1G7YA 5A1LA 2ZGTA 4PF1A 4A6EA 1LKNA 4OI2A 3I3BA 3I3QA 1PHMA 1E3HA 1LHOA 3WNNA 5DMYA 1CWPA 3HKZA 1DP0A 4Y33A 5BNOC 2IXLA 4ZYHA 2DJIA 1JE8A 3EUKL 2XOMA 2Q1MA 3KZIC 3ZPLA 3AKSA 3O7OA 5JPNB 5CKQA 4LOCA 2NYXA 2EV0A 2H94A 1H88C 2JWPA 2P6CA 1A31A 5GPCA 4RQPA 4NPMA 5FPVA 4AI9A 2WNVB 3H3UA 4DGWB 4E8CA 2K40A 5J48A 1ZA7A 3BT9A 4FO9A 1WPKA 2HWD2 4RBOA 3MKLA 2BNNA 4DXRA 1AR82 2LH9A 3CDLA 3RZZA 5BNPC 3SXYA 4A3FJ 1HW1A 1E3PA 4OMZA 5F3EA 1S7OA 3GZTB 2ZSIB 3J7AY 4ZH4F 2P6HA 1JT0A 1MDMB 3SHRA 1BR4A 2KQRA 3JTHA 3GWZA 5FLIA 3FXMA 1A34A 3JRDA 5EEGA 3FHAA 4RB2C 4RSUA 4NPRA 4L9TA 1HB3A 1RUG3 4EM0B 2CAVA 5ILVA 4FBFA 2O8QA 2RS13 1RRJA 2VTXJ 4AWXB 2IA2A 2M1BA 3APBA 4GALA 1XMXA 1UY4A 3S1RJ 1Z21A 3C3WA 3IIAA 4NWWA 4HYEA 1LCLA 4B4RA 3BTZA 5EXOA 4UFMA 4AE2A 1GP4A 2R7ZJ 2IFRA 2WAQA 1VQNI 2IXJA 1R1A3 1J75A 1J2XA 4N53C 5FMOL 1DYOA 1YIOA 5FPXA 3J7ZI 2STWA 2XMLA 1A6IA 1FYUA 2W3JA 1RUF3 4CEYB 3LMMA 1O5UA 4XOTA 5F1JA 1ZGJA 3V0BB 1T6BX 4E2GA 4IV3A 1LULA 2AACA 4XTPA 3ZFEC 2DV9A 4QMAA 2DTYA 1S8NA 4DYCA 1HRV2 4JQTA 4PDWC 3AK0A 1Y0UA 2BTVC 1C28A 3OD4A 2L9RA 2Q4SA 3DKYA 1ETXA 3ZIXA 2VE9A 2DXIA 1GOHA 2TNFA 2P0WA 3N7LA 4LKFA 1FNNA 4LGWA 4NROA 1J09A 2XB6C 2WZ8A 1JHJA 2MGQA 2VU9A 4OMDA 1NZCA 2ME6A 1XCBA 3ECOA 1QQP2 3LFKA 2FNAA 4B1MA 5GTIC 1KFUL 1ZARA 3H0GJ 3HNMA 2D93A 4NC8A 5C8WA 3FHQA 5E18F 1MQTC 1XRUA 1IHMA 3GW2A 3HSFA 5TISC 1DU6A 1I39A 4EN6B 5A3TA 3HUGB 3T5XA 2IEKA 3O8HA 3THTA 2O9LA 1SLLA 3JTGA 1GZTA 4HOOA 5CKNA 4WXHA 1T08B 5SV5A 1K4SA 2BEOA 4B47A 5IOYA 4Z1VA 4DQAA 3WHBA 3IAM2 4AOCA 4O3MA 2GC1A 4Q8KA 1P4WA 1MH4A 3MBWA 3QWLA 4KNCA 1H8VA 4BQYA 3SZPA 4BWOA 4Q0UA 3VBUC 3ZM8A 1N75A 1J58A 3PIGA 4PZJA 2H8RA 5FQ0B 2R043 1LOAA 3LSIA 3ERED 5EGOA 4M3BA 1NZIA 2FQPA 4FHTA 3ZMTA 4YG0A 1C5IA 3UKTA 3VZNA 4E7SA 5ERLA 3BG5A 5A3UA 1JZ2A 4NIGA 1VE0A 3H7JA 2W08A 1W03A 1FIPA 3I2HA 4JGZA 1UWWA 2D2WA 3A21A 1JODA 5T50A 2PJRA 3LNQA 3OYHA 4JZRA 2K9SA 4RR3A 1X3ZB 1PGSA 4XZPA 2DN0A 3T0DA 3AJYA 3A22A 2J42A 5F3GA 2CUJA 1R5GA 3L2WA 4L99A 3OYCA 4XIKA 2XR4A 5ANNA 5F7UA 4P5HA 2PAKA 1P7IA 3IH2A 4D9JA 3ZFFC 2LKPA 2L7FP 3TL4X 4QPIC 2BXZA 1LQ1A 1NKGA 4MLOA 2JE9A 2DMPA 1WLDA 5C4WA 1EV11 2GP5A 2P1BA 2YUEA 3MLLA 4HVQA 5FKKA 5ACA3 2TCTA 1FSHA 3HPNA 1SHWB 4FFFA 1TWCJ 3I7DA 3BZKA 5IYCJ 3UETA 2XF6A 1RKWA 2QVSB 4HKLA 2QGUA 4ON0A 2A5YB 2XBO1 5HS8A 3CTAA 3FXOA 5GJ6A 1VTNC 1R091 2JECA 3ETPA 4Q1RA 3L00A 4II3A 5FKOA 2E9QA 1J9IA 4QGMA 1ZKGA 5BNOB 1UMZA 2WTEA 1U8BA 3TEDA 1MMGA 2QBYB 4CZCA 1ENRA 1AL21 4B8EA 2KXLA 5JSRA 1XNBA 2VBYA 2RMU3 2ZBKA 2VGDA 4JAAA 3BG6A 1JYVA 3KEQA 2EILH 1O59A 1MMNA 1WJAA 2VMGA 1BVP1 4Y1ZA 4C9YA 1RHI1 5ED4A 1IKPA 4RS8A 5BNPB 1JMUB 2FX0A 2CQQA 2P37A 1AOYA 3V65A 2CH0A 2FRHA 4Z92B 2F6BA 4YVSA 1LRHA 3BROA 1ORKA 3E3VA 1AVBA 3FUOA 5JZGA 3RZKA 3KGZA 2ICWG 3L2UA 3ZSKA 3W5NA 4X6AJ 2Y9ZA 4LORA 5J1UA 1YC61 2HOSA 1F2NA 1JOPA 5HI0A 1NQJA 1X8MA 2CTVA 2R1DA 2D5HA 3R05A 2QDNA 4M71A 4LULA 2WYFA 2R7QA 2HEWF 4BA6A 1YFUA 2KLOA 1AYN2 2MEV1 3KT4A 2GM4A 3GTJJ 4XFHA 4M00A 4S2HA 4NC6A 2JG9A 4N53B 4H14A 4RFRB 4HA8A 4BLJA 2W1OA 2YSRA 3M3QA 1H8AC 2VPRA 4QQ2A 3H5RA 4R4ZA 3I64A 1C3HA 4V1PA 4DRRA 3FDYA 5FLHA 2HQ5A 3TWIA 3U10A 4CYCA 2VMEA 1CAUA 4F3QA 3PQKA 2WN3A 5K7HA 4MGTA 2QQAA 3PJRA 2QQNA 3PUAA 4PDWB 4JKMA 2QQ8A 1RESA 1NUKA 1HB4A 2BWCA 3PSFA 1UPSA 1PZ8A 4QT6A 3BG7A 1YW9A 4KI5M 3GYHX 4YVWA 2P6SA 2F48A 3DTIA 3OUIA 2MBFA 1W6OB 1R22A 2A3XA 1AR62 1QEXA 1W39A 1ZGAA 4QGNA 3ZQGA 3USSA 4BOWA 4K8RB 4MHGA 4G6QA 2NMOA 3MF9A 2GWRA 4SLIA 4BM8A 3WT3A 4B3XA 2XAQA 2A3YA 3UR3C 1SEFA 2A75A 1XYPA 2VN2A 4XXAA 1MQTB 4Q4W3 4AC0A 2RQPA 3QYBA 2VVDA 3FLPA 4ATEA 2WL1A 3JCIA 2W00A 3VBOC 5GLTA 5BPXA 3F8CA 2N7GA 5IHRA 5LA9A 2RJLA 2YFZA 5GPAA 4QHZA 3ABLH 5HXMA 4BJ0A 3TRSB 3JD73 2L02A 3BCWA 3SQOA 1ZLKA 1QHGA 3QODA 3RZLA 2RV8A 1CPMA 3VBUB 4BE0A 3PVNA 4KFCA 1TW3A 3U07A 1VBD1 2NOJB 2HWE3 2ARXA 4XHXA 5KHDA 2ZJ2A 5A7PA 1BK1A 2F5FA 3T2PA 3NRVA 1LOBA 4MH0E 5IYYA 1UYPA 3FHNA 3BP8A 5F5IA 2WV0A 3WDVA 2JDYA 3OYGA 1BW5A 3W5MA 2GLOA 2W2IA 4IE0A 1MS3A 3A0HC 3AM2A 1W0NA 3DYMA 1FEXA 5A33B 1VFCA 1YUDA 3FM3A 3OR1C 5FKNA 2JG8A 5FP8A 2RR11 4CUCA 1ZR4A 1X33A 2A1XA 1C8M2 3T0BA 2Y2ZA 3VSKA 2ZHMA 4RMNA 2V6CA 5JLWA 1SC7A 2VULA 3ZFFB 3HT1A 2K9NA 2OQ7A 2R16A 1KRIA 3DP7A 1BOBA 1HW2A 2R0HA 1WH7A 3BTJA 1IZ3A 3D1NI 3JB8A 3K77A 3JQWA 2VJ4A 2R6QA 3CCRI 2Y9YA 5C4JJ 4YZ4A 3MQ0A 3OF1A 1IOAA 1WMXA 1WD3A 2DCKA 2GA1A 1DFQA 4QDQA 4NMIA 3K4LA 3ZXFA 2SBAA 2C1FA 5LGNA 2OZUA 2TDXA 1OLTA 2VCBA 2DBBA 4PLOA 4L8QA 2FHRA 2X5IA 1PM4A 3FMRA 1BL0A 2HR3A 4HK9A 5FRAA 1PUFB 2OUJA 4LBQA 1YFWA 5FLXZ 2XB0X 3TNPB 2QQPA 3FMSA 4N9IA 2ESHA 5K5QA 1EYBA 3FKJA 1W9YA 3CUOA 5IP9J 2WJSA 3CCLI 1MZFA 2F6CA 1KQ0A 4WWCA 1T39A 2XWJB 2HYGD 1WCSA 3N4MA 4R1HA 5EEAA 1XNCA 3OJBA 4EQVA 5CG8A 4YFZA 2NS8A 1LDDA 4N9HA 4RLFA 4Q4Y1 1S2BA 2VL8A 2CQXA 2BY1A 2M7AA 2FD8A 5BS6A 1FATA 1ZN2A 3HEIA 2CSOA 3OEAA 1Q8OA 1WCMJ 5BNNA 2A6YA 3W6JB 2HZTA 2CWSA 5EZHA 4IOCF 3DYPA 1A6CA 5IT9Z 4KG0A 1RXFA 4COUA 3KYDB 3CJIB 4RM3A 3RG0A 2DDAA 2W82A 1LAJA 2OKXA 4AVCA 3OYLA 2CYYA 5DUWA 3AP9A 1BCXA 3C2BA 3G1LA 3NWSA 2GMEA 4HW0A 4CHUA 5D4SA 1KDMA 4Q2FA 1BHGA 2DCJA 2Q2EB 1BMV2 5K0UC 5FOBB 4P9JA 5FZDA 5JPMB 3LAPA 5LHIA 2C9KA 2WS91 1H1AA 1SD4A 1GP6A 1N1VA 1EV13 1CZTA 2P3IA 2ENRA 1ULGA 1ON1A 1D0YA 2ET1A 2YROA 5JUVA 3E1SA 2A5ZA 1H8TA 3ITQA 5C3RA 1VRH2 5FPZA 1ODDA 3U21A 4ZTJA 4LITA 2P7CB 2A6WA 2F5EA 2WQ4A 2UYBA 3ZQ7A 1X50A 4IQ4A 2HYJA 1VB4A 2K4JA 1C5HA 3ME2A 2YHJA 3WDUA 2NMNA 4Y15A 4D0PA 1WKMA 5C3QA 3DTKA 1QJU2 1GDTA 4NQWB 2VM9A 3GBFA 4FQZA 5JXIA 3AL0C 4YSFA 3J7MA 3WG7H 4G7ZF 4JVAA 1K5JA 3B73A 1R1VA 5CLSA 3GZNB 4GDFA 4LPLA 2KIMA 2EBIA 2LR8A 3J80Z 4I30A 1OCZH 3RIRA 3VDDA 4XTMA 3SEZA 4LG0A 1JU3A 2BW8A 3WEZA 1G9FA 2VBWA 5E3LA 4XUQA 1RHI3 2X48A 3ZO0B 3TNQA 4RB3C 2FCVA 4LK7A 2Y0SN 2Q0AA 3JB4C 4XKCA 3ZXEA 1MZ5A 3B6AA 3VBOB 4QX8A 1XN7A 5I8SA 1QJZA 1ZBA1 2VZPA 3Q5FA 1G86A 1YQCA 3BDDA 2VPVA 3A0BC 3RYKA 4IV1A 2EXKA 1E5SA 4KWLA 5HBAA 2PJPA 1W2OA 1GQGA 1UY2A 3KT7A 3CKHA 1FXZA 4FISA 2A07F 2DFCA 4XSXF 4IOAF 2VBXA 1ASJ3 1YFYA 3LSHA 2R0QC 5I93A 4XCBA 1MJ9A 1T6GC 3J7HA 4UUSA 3S2DJ 1F9NA 3HNBM 5LBBA 1ULFA 4I2OA 5L7OB 3WTTC 3T0YA 3OG2A 4Q4X1 4UUVA 1P9QC 4LA2A 1R083 3OYMA 3NNFA 1DHKB 1W6PA 1LOFA 3MIFA 1DQ0A 5A7OA 1UHMA 3LSMA 5A7WA 4LLOA 4NHYA 4PCRA 3GF2A 5FREA 4QTRA 2WFF3 1S9HA 4NAMA 4ENJA 3H7YA 3TEWA 4YM2A 2Q8CA 1RMU2 2QSGX 1NK2P 3WDWA 4RHV2 3WQ1A 4P02B 1LFUP 5AVAA 2M45A 2EIJH 3T2TA 3DU5A 1BR2A 2JVGA 1TNRA 3POBA 5KHIA 1OA2A 4LLNA 2BUKA 3K2ZA 4XLFA 3GZ6A 3D0SA 1NK3P 5D8LB 1JHNA 1XB9A 3W2VA 2R93J 3GF6A 4LKSA 1FYLA 1UO9A 1COV2 2HLEA 3Q8CA 2RS51 3O1VA 4D6QA 2RM22 1T6SA 3GTGJ 1OLQA 4N43A 1CF7B 4OIQF 2WFPA 3BG9A 1WFXA 2CQKA 1Y4WA 3GFMA 3HOBA 1ULEA 1LGBA 3KP4A 2Z5WA 2A3WA 4XLPF 3OR2C 1PIV2 2QUFA 2I8DA 1F4KA 2EXHA 2H6CA 2HVRA 2ZXQA 4MTEA 1IDYA 2EAAA 1EPWA 4F55A 2VC0A 1PK6A 2IUWA 1JZ3A 4HSTA 4CTEA 3O14A 2VZQA 1W0PA 4HFSA 2HXIA 4BEHA 2BGOA 5GLVA 3VYRB 1AF9A 4DZGA 4GJZA 4M3CB 1XYNA 1IF1A 2K9ZA 5F5CA 5F0HA 3T4HB 2HWVA 3LE0A 1NY72 4EJTA 4OINF 3LOBA 4B7EA 1RUE2 1OLME 2EIMH 3RKWA 3FK6A 3V8JA 2IXCA 3KF5A 4JGYC 1MJAA 5JHUA 4EWAA 1W7PB 4NB5A 1IN7A 4HQEA 1RPWA 1UMQA 1ZG5A 3H9QA 2VUJA 2VOVA 3BU7A 2RR13 4FPOB 1LDJA 2ZACA 2H0VA 3DYOA 4KWKA 1P4XA 4LE3A 3KZ4C 2VKEA 4B1LA 2BVLA 2XUMA 1T95A 3DLLF 4IDZA 4XJWA 3MZYA 1Q56A 3POYA 4TYSA 3VKNA 5JOXA 1UZCA 3K0LA 3TW7A 3C7JA 5BQTA 2YBPA 3KV6A 3TB0A 1F36A 5LW9A 2PFWA 4D7MA 4F83A 4XMAA 3CMGA 2D97A 1XGOA 2HWB3 1G59A 4DXSA 2XAHA 2COMA 2LTPA 3GO5A 4NAOA 1MBGA 5JDBA 2VY0A 3CF5F 4RQPC 4AGRA 3VDAA 1LUJB 5H9PA 2Q1ZB 3UGFA 3TDZC 3PIJA 3DCQA 1ZX5A 4LR4A 4JC1A 2RS33 1SLCA 4P9YA 3PJYA 1HXS1 3FXKA 2JA7J 1O8PA 2V5DA 3G3ZA 1BIAA 5FZ9A 5HODA 6PAXA 2ZOEB 1QNYA 3WF2A 5FYSA 1W5TA 4XKWA 2PAEA 3IWFA 3C2UA 4AIDA 1OD5A 1KJRA 4SBVA 1KITA 1EJ9A 2X1CA 1JTYA 1XXNA 4CICA 4PIXA 1REEA 4BE2A 5B1BH 1V55H 2XJRA 1X1BA 4O6JA 4WVWA 2KPMA 5LK7B 2CHHA 3RMYA 1W2UA 2RV9A 3WG1A 1FBUA 2ZC2A 2PN5A 1I6XA 3NSTA 3DV8A 5T5OA 1H0BA 2VMDA 4WVMB 4FAGA 3GHMA 1MEC1 1S72I 4YW3A 3ZYIB 2DDUA 5LA2A 2D45A 1DG6A 4Y26A 1YE9A 3ZXAC 4YW4A 3ZN1A 2EZLA 5IK7A 3J4UH 1SFKA 4B09A 2WO3A 4Z8BA 4RS5A 3BWGA 1R5HA 4Y22B 2ZX3A 4IV3C 4MUVA 4IPAA 2AC1A 4P08A 1X4OA 3B01A 2BWAA 4C3HJ 1WRJA 1U0AA 2FDIA 4YGCA 4NWVA 2O8OA 1AU7A 2Y60A 5JFRA 2IS1A 1B4AA 1YQAA 2J5PA 2ME0A 3CLPA 2F4MB 2IGOA 1WLTA 5FZ4A 3LFUA 3OOXA 1MBEA 3QQAA 1I3QJ 1R5ID 1S55A 1S3JA 5HXVA 3USUB 2DA4A 3MW2A 1W8WA 2RE9A 5C70A 1ND3A 3ZYBA 2EIDA 3ZKUA 2NVXJ 5K9YA 1N3OA 3BR5A 5DD4A 2I07B 3ZN6A 3AG1H 3JBG3 2YXSA 1ENSA 3S1MJ 1VQ5I 4R9DA 2XGDA 2AQFA 2OT7A 3COAC 1GU3A 5J37A 2C24A 4K1ZA 3QU6A 1XC5A 4DY3A 1VB2A 5FYZA 4O9EA 4LNVA 2X0LA 3VHRA 4N7UA 4ASMB 3BTXA 4LUKA 4FASD 3LPFA 4JV4A 5J7MA 2DTZA 2P81A 2CO5A 1RI7A 1AYM2 2ZGNA 4K20A 2V4AA 1FT9A 1B59A 1BEV3 3RYPA 4OAZA 1HC8A 3KCCA 5F5AA 2PI0A 4DJAA 2ZKNA 4S2GA 5GLWA 4XLHA 5FCCA 5I0SA 5HDNA 5LGTA 4XJAA 5CVRA 3OYIA 4OLLA 4KBZA 1VMHA 3WDXA 3CO7C 4CCEA 3VWBA 5LHGA 5LA0A 4XF0A 2JRTA 1KA8A 4RFT0 1F5JA 4LO6B 1TT5B 3Q9VA 3SNMA 5IK8A 1FNZA 1YWKA 5T3NA 4PJYA 5A32A 3BLYA 4XR6A 4IE6A 1EUUA 3GFLA 1NLQA 4II2A 3C7GA 2P3YA 3OEBA 4AEDA 1O4YA 3SCFA 4AYBA 2XVCA 2HBUA 2WSVA 1W8TA 1N77A 5FYBA 4ZDOA 4JGZC 2VXRA 1Z6TA 2YU1A 2B46X 5FUNA 1B8IA 2EV6A 2XJUA 1S0BA 4LEJA 3E1F1 1YI7A 1MIJA 3ZR6A 2V1UA 4M6XA 5CQEA 2XGEA 1VQPI 1SLBA 1OLRA 3OYFA 1WW6A 1GV9A 1BZWA 4GD4A 3T1BA 3WW3A 2EIBA 1V6LA 1FTTA 1N47A 2WAOA 2QQKA 3R4SA 5C4WC 1IUFA 3V4GA 3MKZA 2YY1A 2Q8OA 3D5RC 5FZMA 3FX3A 5ICCA 2ADUA 2HNHA 3I3LA 1MW7A 4FCAA 2R061 1G6NA 4GKXA 2B42B 1DQUA 1RVF1 3G2BA 3QRFF 4UT5A 4FFIA 5A80A 2JXAA 5FRMA 4I76A 2PQQA 5IVVA 3S0MA 2HEYF 3P3NA 1JN2P 3K1MA 4B4QA 2E19A 3KVBA 2WC2A 2VR4A 1JZ6A 3S30A 2PHLA 4HV6A 1LFBA 5FKMA 1G8XA 3TOBA 5FB2A 3WNXA 3VOEA 1UB9A 2WAAA 3S6PA 2CU7A 1RUD3 3N36A 2IT0A 1A78A 4ANJA 5F08A 5DG2A 1XSVA 3PQJA 2BY0A 2OPWA 2A73B 3HQRA 1RR8C 1QWRA 2EAKA 5IW0A 2NNNA 5E16A 4XICA 2GQQA 1T38A 4AGVA 1OFSA 2M7BA 4RGAA 4B4CA 5HNHA 2JDZA 3POSA 1NG0A 1RUG2 1LGNA 1VBC1 2ZEWA 5AC91 4K1YA 1WZ2A 4A0XA 1CPNA 5JZGC 3LIHA 3CC2I 2HPIA 4ZYEA 1IGOA 4UW5A 2RS12 5A2QZ 4XLCA 3NARA 1P4AA 2DCTA 3RTRA 1BBT2 1GLNA 3LSTA 4IZZA 2HWC1 5DUVA 3CMYA 3OY9A 2W87A 4D3WA 3CHXA 2DA1A 2WWUA 4DW6A 2QE3A 2EV5A 5JMOA 1R1A2 1W8UA 1ALYA 1DZTA 3TN93 1RUJ1 3MLJA 4E7IA 3PNAA 4DXZA 1SACA 4UW6A 5B5EC 1VP6A 1UZVA 1VBE3 3OD0A 1RUF2 3UNPA 2QF7A 1H9WA 5A3MA 3V8LA 2D3RA 3ZMZA 2JE8A 2EFOA 2FDJA 4EROA 2MG4A 2R3SA 1OPCA 2WBMA 2ZMKA 1HRV3 2PG4A 1PJRA 3A0KA 2HS5A 4O9GA 2L9SA 2RC4A 2VQAA 1EA3A 5D6FA 3SEQA 4LTAA 1NCQA 3RZMA 1U2WA 1ZRRA 1X3UA 2IXHA 1W0OA 3G4SI 2ZEZA 3QAHA 2CW0F 5IVEA 2QNKA 5LGUA 4GWNA 1RUI2 1MBJA 2VKVA 2CUZA 4YFXF 2EA4A 4HANA 2VUMJ 3VUOA 5FKCA 2XUEA 2XJVA 3Q9OA 3VD3A 4IEJA 4C0HA 1N25A 5LY1A 3EHKA 4JKKA 4HLTA 3M8JA 4XQWA 1K79A 2V1XA 1KDKA 3VSLA 3PO3J 4LMYA 3HUGA 1WD4A 3OPZA 2OZ6A 2ZGQA 4CDWB 4Q4V3 3VYUB 2CFXA 3NNLA 2C9AA 3F6OA 3HWJA 4YPJA 3B3QE 1XOYA 3PMEA 1SAUA 3LWCA 2DDBA 2GIVA 1KGYA 3AL5A 3BG3A 3DPLC 5FMOS 4OHXA 2X6WA 4BXUA 1A35A 3NL1A 2ZGMA 5E3MA 1UXXX 4LMFA 2DUPA 1H4HA 3I3DA 4FPEA 3NAPA 3GTLJ 2P7VB 4R9CA 1NG7A 2OS2A 1MS9A 5FZGA 2RREA 3DPTA 4GAZA 1YFHA 1OVSA 1J83A 2W84A 1TNTA 3KGLA 4CP9A 1IQDC 4GXLA 4YG6A 2JSPA 5GAEJ 3MO4A 4DNCA 2VC9A 3HRUA 2R042 2XWBB 4C2TA 1LFPA 4BZ4A 3A4UA 1O8SA 5AFBA 5A1FA 2XXZA 5KCMA 4H0EA 4A93J 5KHHA 3K10A 4BXSV 1X1DA 1YX3A 5EGOB 5B4XA 1PGL2 1PVEA 1GFF2 1M1EB 5GZGA 2WLPA 1N3QA 4EJOA 3D8CA 3K70C 5E8GA 2FDFA 1PO23 2VZVA 3M3OA 4I3GA 3AFGA 5FXVA 3ZMNA 5IPAA 4JGZB 3AXDA 3IPVA 1GLHA 2WQ8A 1PVC1 1U5TA 2XVGA 5F32A 5JAXA 5E3NA 1H9PA 4RR3B 3BTLA 2DU0A 3BOQA 3BZCA 5FY7A 4I0AA 2I74A 1BK0A 5J98B 4Q0VA 3PUFA 4IVNA 1XSQA 5CAZA 1WGXA 2UZKA 1OKOA 3MFKA 4C0BA 2HOTA 5C44J 4DNYA 3H8XA 1V6JA 4U7DA 3K4JA 5ACA2 2NOGA 4EGZA 2W48A 3SFIA 2EFWA 4XDPA 2GSYA 5C4WB 2VJXA 2P17A 3I2JA 5HLGA 3ZXJA 3FC0A 1G9CA 3PNVA 4I0BA 4I99C 3OOPA 2QQVA 4ZU5A 3K3OA 5FJKA 3CCEI 3WV6A 4MADA 1A6QA 4QQHA 2DA3A 1CN1A 2C6SA 3WNMA 1VQ9I 5FY8A 3LDKA 1JKPC 2RMU2 4M01A 2G9GA 2AEYA 2W85A 2DU1A 2R7RA 3S57A 1ONVA 2R7SA 2BNOA 1DU0A 3PUHA 2G7HA 4AQTA 1CIYA 2DU9A 3Q0WA 3I8TA 1EP0A 2ZGKA 5EIYB 1W36C 2ADDA 3ABZA 4YVSB 2DQLA 2ESNA 1FPQA 5EQUA 4CCNA 2Z99A 3HQXA 4K8FA 3PL0A 1VF9A 2BW3A 4DRVA 3RSNA 3EETA 4UWDA 4A3IJ 2F5CA 4FPFA 1I5PA 2E5ZA 2O5RA 3WCRA 1D8JA 5BNNC 5JXJA 3BYWA 4BQ1A 5GZEA 1GXQA 4QPGC 3BALA 3RPQA 3OPWA 1H2MA 3WP6A 2UWMA 1AWCA 4U0WA 1AYN3 4LFUA 5E20A 1RR7A 3FUQA 4JDMA 4CP2A 4BKXA 3DKQA 4KNYA 1Y0NA 2D5FA 4JCKA 3AP4A 4AIHA 3M1EA 1TBXA 5FZLA 5DD8A 5BPDA 2JG9B 5EWSA 1IV8A 1ZA4A 3WTUC 3RSJA 2ADEA 2ZPXA 1DGRN 3MIDA 3PVBB 2VXZA 1JT6A 1EAH1 5E1ZB 3KV4A 1POV3 1WCUA 1U8RA 4UXAA 4YW7A 1Y9GA 4CYCB 3S16J 1CAUB 2XSJC 4M3CE 3P6BA 3FIWA 1H8TC 5FOJB 4HN0A 3HHHA 3GTPJ 1GWKA 1F4AA 4AGGA 4F93B 1WW5A 3J81K 3UNGC 2GZWA 3EQLF 4IUGA 5IT9K 4YVWB 1AR93 4XONA 1L7LA 4E4DX 1TME1 1BQPA 2P5LC 1QGLA 3MI8A 2GN3A 2LKXA 1KEXA 2LYCA 3RRDA 3QH6A 1O7LA 3WP4A 4KDPA 3ZVXA 3IWZA 4UY8I 4OHZA 4R9BA 5DV5A 2W92A 3O8GA 3WTYC 4Q4W2 3VDDC 4V2WA 3ZX7A 2HWF1 3ML6A 4YW2A 1JUPA 4AIJA 4GRIA 1T33A 3TEYA 5GALA 2HFHA 2CMPA 2V26A 2VQGA 1VQLI 3FBMA 4D7SA 1E5HA 4G9SB 2ZABA 1JU4A 2GP3A 4XLNF 1QA6A 3H5AA 2ISZA 3F8MA 3VN4A 3MW4A 3UESA 5E8AA 4FETA 3TEXA 3VBHB 3WDTA 1V6MA 3MV11 3WU2C 3H9GA 1XJAA 5CVUA 4IV1C 4ATFA 2FQ4A 1FOD1 4QLCU 4MXVA 2HBTA 1VBB1 2KDZA 3HZJA 4EZ4A 1YXWA 2FOWA 5CVIA 2XF7A 4QU1A 5FZOA 4LA3A 2OQRA 3KP2A 2O0OA 3J80K 2RG4A 3CCUI 1SVLA 3KQRA 1RUJ3 4BS9A 3H0DA 4J01A 4PCQA 4BMEA 3KV9A 5CVJA 1GYKA 1W3VA 2GH8A 1AL0G 1UG2A 3WUDA 1OUSA 1D5VA 1UW8A 3LA7A 4ZC3A 1AR73 4FPJA 2YU2A 2WB1N 2PHXA 4U36A 2WUHA 4CDQA 1XSXA 2JG8B 4E2SA 4FVVA 1GP5A 2X05A 2OPTA 4B3AA 4D7NA 3I4PA 1ULOA 2A69F 1RGSA 1ZZ7A 2FU4A 2W68A 1DLCA 5L9RA 3DF0A 1NTCA 4P9UA 2V5YA 5FK8A 5LA1A 1SCSA 3DEEA 5FWJA 4C3JJ 1JTXA 4BLIA 4QXBA 2ZJPF 4ARYA 1RKTA 1ZGWA 5FXXA 4QGLA 4UUTA 4GYGA 2LVSA 4FPKA 5FLMJ 2VKHA 1ITYA 2CQ7A 1YS7A 2JKXA 3A01A 3ZQFA 2E5NA 5C3OA 5CA6A 4Y24A 1IN5A 3CCVI 3O1OA 3CF6E 2QQLA 4COZA 3BPZA 1QZYA 4AVPA 2LRPA 4XAAA 4LQRA 1K5MA 2HWD1 2EFQA 5F3CA 3POGA 3VZOA 5BXXA 1NXMA 4YG3A 3RFRA 1AR81 4OVEA 2EJRA 3LSKA 2X5IB 1ZELA 2XPWA 4JTOA 4BJ6C 1HV1A 4CPBA 5C33A 1W6QB 1UY1A 3N9PA 3ZLIA 1HLVA 2KRFA 4OHYA 1JZ4A 2FD5A 4AHZA 1V9U1 3K4NA 4IEPA 1UL9A 2XDVA 1QY4A 5C9AC 2BU9A 3HQUA 4RGXA 1W8FA 4HPKA 2H1LA 1JHFA 1LE8B 1U9OA 2ELKA 3VBFC 4KU8A 5LD2C 1PDNC 4WM8C 5EF6A 4D7TA 2VVEA 4V2VA 1V5FA 1TT0A 4LK1F 4FXKB 2A6ZA 4C2MJ 3JRFA 1ZH5A 1VAVA 4OMYA 5CU1A 4OQ9A 4HT1T 4MGSA 2XB5A 2ID3A 3T8RA 5J1XA 2D6NA 3DKWA 3AZZA 3T4VA 2QDRA 5GZFA 1N1SA 2ZMNA 3G7DA 2GXAA 1NA1A 4M3EA 4DBQA 3T2OA 3B9CA 4AI2A 4L97A 1ULPA 2P8TA 1R7JA 3HAGA 2LLKA 1POQA 1X7NA 2F4OB 1TZLA 2OU2A 1OH3A 1FLIA 4K2EA 1CZVA 4FQ4A 5GLUA 1EV12 4ZZDA 3GZ5A 1P2FA 3IRQA 1H1MA 2WNOA 3OYDA 2PLV3 2K5CA 4C1XA 3SH5A 4Z6YA 2GALA 4ZZLA 2G4IA 5A3PA 3QD6A 3T0AA 1A8MA 2Z79A 5G04L 3WLUA 4NC7A 3KIOA 4A44A 1JOJA 1H8TB 2M9HA 1R1TA 1OBNA 3DN7A 1H9GA 3I2KA 3F8FA 3ZMDA 1QQP1 3C8XA 1VJ2A 1O3TA 2B45X 4LB5A 3T09A 4HOBA 1I3HA 2WNUB 1HX6A 1D0XA 1FPN3 2YU9J 2VBZA 1XMAA 2IXKA 3S5QA 4RM2A 4PQ9A 4Q27A 1JUIA 4GMP3 2WZR3 5E88A 3RMXA 5A3NA 2IJLA 2HGCA 4KG8A 1WJDA 3ASOH 5KNLA 4B3NA 1QZZA 1RHI2 1SG3A 4N8MA 4EN0A 1BI0A 3QPLA 1W2TA 4MEYF 2VH9A 4LG0B 1MNDA 4GFBA 1LHVA 1LNSA 3I4NJ 2VW1A 2P4EA 2E7WA 4L5IA 4O5VA 5BMZA 3DKXA 4E4HA 2DT5A 3BTAA 4AAPA 5L3GA 3MUZ1 2ZGPA 2VCCA 5FP9A 3B6CA 2NS7A 4IV1B 3ABMH 2BBAA 1E57A 1ASJ2 3L2QA 1RJ7A 5FZBA 3CJRB 3C2GA 1QVUA 2PTMA 1ZK8A 1Y6IA 2QZ3A 2DOFA 5FD5A 1LECA 5D5UB 4RS5C 1U5XA 1ENHA 4HV5A 4UUSB 2IW5A 2CV6A 3Q8AA 1NCRC 4BGDA 4DXTA 1KGSA 2EINH 1A5JA 2CW8A 3KHCA 5EEHA 3I97A 1R082 4RA0A 3U1DA 3AMNA 5JOZA 4UOJA 3BPSA 3B93A 4L5EA 3THCA 3ERMA 3W6KB 1EH8A 3FBYA 1SFEA 4IEZA 2R0FA 2WFF2 3QYEA 1W6PB 4ES9A 1PP7U 1Z9CA 1RIOH 1OVPA 1QXJA 2NAZA 5A7WB 3VKOA 4Y1XA 1O6UA 4ZXKA 1QNWA 1CESA 4M73A 1MBHA 1ND3C 3WOGA 4CDXA 3BR0A 3V42A 1S0DA 1RUNA 2YBKA 1XQNA 1QNTA 1E5RA 4A7ZA 3AZXA 3VD9A 3IL2A 2Y0SA 1WVRA 3FWEA 3LA2A 3IDAA 2CAUA 1BR1A 4YIIA 1FP1D 4OFGA 5JCTA 3BU0A 4BQXA 1WMEA 2RAEA 1W04A 3BN6A 3VB9A 1ZRFA 4W4ZA 3M2MA 4LE4A 4BXFA 1ETYA 2JTVA 5HLHA 1V6OA 2Y33A 5D8AA 1COV3 1LB2A 3JSOA 4S2DA 3LSGA 4MFDA 4MGYE 5E3OA 2HYXA 2GDFA 4A7KA 1VPHA 4W8JA 5M5YJ 2QBXA 1ZYBA 2ZAAA 5IVBA 4N43B 3ZPOA 1U12A 2OCCH 3AMHA 2MW8A 3M3EA 3RZGA 2M5WA 2LY1A 3HKZN 2BXYA 5DUXA 1J3RA 4DY5A 4P5YA 2WYSA 4CU7A 2RHPA 3HBKA 2X6YA 4FT8A 1FYKA 3G6EI 2VUDA 5F0FA 2RNJA 4XPVA 4UFLA 1FOWA 1PK6B 1XC6A 4MGZE 4AEDC 2I5UA 1MZEA 3ABTA 1LPQA 5F64A 4CSWA 4CP1A 1TZOA 1WMDA 2JUCA 2YS9A 4BEHB 3H42B 5F6LB 3CDZB 1LU2A 3CCQI 1AXYA 2UURA 3DXUA 5ABJA 4DQ2A 5T5PA 2E26A 3AVSA 2MD0A 3QP6A 4U0VA 4XC9A 5JXHA 2XC7A 1REFA 1XNTA 3LEIA 2RR12 3KV5A 2LM3A 2EIKH 3LGRA 3ZXKA 2FBIA 4W97A 4CYDA 5C8CA 4XFFA 3QACA 4YZ3A 1HSTA 4FX0A 3VKFC 4PI2A 2JB4A 3JXSA 5FPLA 3O5SA 1Q1VA 2L7MP 1D0HA 3E6MA 3CJXA 2A5WA 3VL9A 2NVUB 2J5OA 2VZ1A 3PJQA 5F3IA 1SD6A 2DVFA 2YGLA 3UT0A 1QBJA 4IEOA 4CXXA 3WTXC 4H55A 1TMF3 4UXNA 2HWB2 1AHSA 5FK7A 2WNVC 2NVTJ 5FKBA 5F0CA 2W1WA 1AR61 1LDKB 2M87A 2VW2A 2IP2A 2OBPA 2E32A 3POEA 3I59B 5SV8A 2MFZA 1S29A 3R61A 2LY9A 3F8NA 2RS32 2LNBA 1JJ6C 1UN1A 2E1MB 1OQ1A 4CXFA 3NJZA 3VV1A 3N35A 3KWVA 4LO7A 3PO2J 4EV0A 4FFGA 3OIPA 5C3EJ 2QWWA 1D1CA 5IT6A 1UHWA 2OZJA 3GDBA 2ZJQF 4EWDA 4XQDA 3ZQIA 5CNAA 2TEPA 2HPMA 5A6XA 4FCYA 2FMLA 1XU2A 4UAPA 2VZOA 3KX2A 2OTJI 1YJLA 3SJMA 3N9OA 4MQ9F 1V9U3 4GWJA 1LENA 3FISA 5FWEA 4ES8A 2KDOA 2A71A 5LK5A 5DAPA 4XUOA 1Z7LA 2X51A 4HK8A 2K9QA 4BXXJ 2JQ7A 2JPCA 4ZYDA 1T98A 4QKDA 4DB5A 3ZXSA 1BC8C 4CEYC 3FBIB 2L9LA 1VMFA 4MX3A 2YX4A 1B72A 1EF4A 3NJVA 1LHWA 1NG6A 3NO8A 4I3PA 2Y69H 2OD5A 1LEBA 3T3YA 3CESA 3L2RA 2BPA2 1WJFA 5DAVA 1O3SA 2C4XA 4FXGB 4KBBA 3ACIA 1CAVB 5KXBA 1D4M3 5JI9A 3DLAA 5JLXA 1US3A 4N90A 4A42A 4CVUA 4AEJA 2DA6A 4A6OA 3NJYA 1NCQC 5A2QK 3SC7X 2KIFA 3T1MA 3FXUA 1UYZA 2WS92 3JQXA 3IMNA 2O03A 3H8RA 1CJDA 1C8M1 5KHGA 2UV1A 1K12A 3E6DA 2AGSA 3QLQA 2IAIA 3E5QA 4ZTFA 3O1SA 4JX6A 4XUTA 3LSEA 2MABA 3ACHA 2D7FA 1K42A 4LO5B 3JBG2 4A3GJ 1E17A 2YR2A 3BR1A 4QPQA 2BOLA 3H8UA 4BU2A 2VL4A 1T0FA 2KFDA 3ZN6B 1W8NA 4PGGA 2Y6LA 4PJ0C 2QQIA 2CV0A 4DUVA 1KU9A 5JR7B 2WT0A 5D5WB 1MJBA 3K3NA 5CKMA 4G6TB 4HF0A 1BJQA 4PDKA 2IXSA 1PUEE 3LOCA 1XPWA 4OAYA 3AKRA 1BEV2 1OLMA 2XL7A 3K4ZA 2OF7A 3K75B 3KS7A 1HXDA 1YQ2A 1OQYA 3GYDA 4QIWN 3PDQA 1SFUA 3ZR8X 1GSLA 4A3EJ 2RDQA 3BJAA 3FHIB 3NAPC 3H1CA 1QPMA 2FCUA 4BHBA 1VAKA 5A3WA 4IESA 4ZYAA 3E5XA 2OW4A 1JXNA 4X8NA 4P55A 1XMKA 4M0NA 2YGMA 2ZFUA 2OCEA 2X6OA 1S0FA 4L2NA 1FP2A 3H92A 2E2IJ 1W3XA 1V3FA 1TWFJ 1DGLA 5A32B 2DVAA 2F4PA 2PQ8A 3HTSB 2VASA 2ZNYA 3S93A 2P3KA 2DFHA 3SMHA 5GAGJ 1UZ0A 2QQMA 3CLQA 4CO8A 2MYSA 2C6YA 4XK4A 5EDNA 2BZTA 1SQ4A 3BTIA 3NMBA 5LATA 2DOEA 1BLZA 1QJY1 4XAEA 2ID4A 2MH9A 3H8OA 4PJMA 4PJJA 1Y43B 4NRMA 4Q47A 2IFWA 4K9SA 1ZBE3 3TMOA 3RQ0A 4ZHNA 5E8IA 5CB7A 1BVVA 3AMQA 1BMV1 5ICFA 3F9KA 2KMUA 1YS6A 5IT3A 1G8WA 1HQLA 1Z7S3 4PHZA 4HSLA 2QKDA 3U11A 2MA3A 4AVVA 1R4MB 1G9BA 4J6GA 4OIOF 3HGGA 2B8MA 2DOAA 3V7CA 5DM6F 2GNBA 4KICA 5H9SA 3L7WA 2V4VA 3C7HA 3OBRA 4I7HA 1TQIA 1VRH1 3MEPA 1S5LC 5DUKA 2RJKA 1HDPA 3HPHA 5L3BA 4AW7A 1MBFA 4IRIA 4DPNA 3I53A 4W6YA 1YQ8A 1QJU1 1IC8A 4G7HF 1GNHA 2RS52 1XBFA 5F27A 3U1KA 5HCFA 3ZMSA 2BHZA 1RUD2 1LESA 2JZYA 3B00A 1KS4A 2ORZA 1VBA1 2VQTA 2GOXB 5TRDA 3VYTB 5F04A 5FZ6A 1IPKA 4XRFA 1T2KA 1JKOC 2CL2A 2ZGOA 4GO1A 4UFHA 1S4CA 1I5ZA 2CGOA 2VE1A 3BQYA 4F52A 2JJ7A 1KU3A 2DODA 3J26N 4FTHA 1IXRC 2W91A 3WD5A 1Y9QA 3ZYRA 3D0JA 2IVMA 1BBT3 4PF5A 3CCSI 1ZZ9A 1UJ8A 2IXIA 2W4SA 2WT1A 3RQ4A 2DVGA 1XU1A 1H0MA 1YYNA 4JX4A 3ZYPA 4XBFA 3TN92 2DLLA 3SZTA 2DQRA 5FPUA 2KHMA 1UAAA 1L7QA 3BQZA 4BIFA 2FDKA 1IQAA 4Y4YA 3HC7A 2RDRA 2OX0A 4PFPA 1VBE2 4QQLA 2X6XA 2XPVA 1OOPA 1UOBA 3H0OA 5IVFA 3WNLA 3AMMA 4E27A 4LJZF 2HH9A 4KN4X 5LRRA 4IHTA 2WA0A 3WP5A 1OF4A 4UF0A 5C4XJ 4FI9A 5IJRA 4Q0PA 1FMD1 1YEWA 4YFWA 4XQFA 4BJ5C 1UX6A 2Y48A 5EP9A 1WCKA 1U78A 2Z4FA 1NX9A 3CUQA 1K78A 3GX4X 1JYCA 4ENKA 1PGW2 3MKWB 4HAMA 1MD0A 4J00A 1J1TA 3RPUA 1D2QA 1NCQB 5FZ3A 4W50A 3RZJA 3H3VK 3C1DA 5I0DA 1RUI3 5TSWA 4YRVA 1AKHA 5J1YA 2Y0MA 4DEQA 5JSOA 3C3VA 1JI8A 5I91A 1RMU1 3MHZA 4HETA 4CDWA 4RHV1 5L36A 3P9CA 4P14A 2EF6A 4Y4RA 3DEUA 1J3QA 1XNAA 2V79A 4ZJZA 2GXBA 3VBRB 1MS0A 3M70A 4Q4V2 3ZSJA 5JOWA 4XN0A 3ILFA 5GAHJ 3IRRA 2E71A 2ZHKA 1R1UA 5DAWA 3IN9A 2XJQA 4XL9A 5EPAA 3A1YA 2E51A 1W8ZA 4XFBA 1HXS2 1PNGA 4FOWA 2D6MA 2K46A 4QKNA 1WJ5A 3SKVA 3GBGA 4TV7A 4HVRA 5LB6A 5C71A 5IY5H 4HQMA 1JI6A 2ZXIA 4HX8A 1ENQA 2M4GA 4I6ZA 5F37A 4YFKF 3FXJA 2CSGA 2FZ1A 4LBKA 3VZLA 1IN4A 1SCRA 2FQ3A 2AQEA 4QWNA 2YV8A 3J8F3 3JUUA 3DBRB 3I2FA 3AZWA 1USTA 4CCLA 2R32A 4XBLA 3NKGA 4A69C 5FDBA 4RGRA 2UU8A 1XSRA 1W6MA 3NAPB 4XJUA 2V6EA 5DDJ1 3OGGA 3AP5A 4AI3A 2O3FA 5LRSA 1RL3A 1PMIA 4MHUA 4XOGA 4EVIA 2K9MA 5DZEA 3WG2A 4CP9B 1MGTA 3FK7A 1WBFA 4QHBA 1U9NA 2MNGA 1GBGA 4EN7B 1LJ7A 4LIUA 1SLIA 4KGGA 2E31A 4HG6B 3C18A 2XGXA 1PO22 3IH3A 1RUE1 2M4KA 3PVEA 2RDPA 1GOFA 2GNMA 3IKWA 3HPGA 1OCCH 3TEZA 3U0ZA 1H4GA 3L2CA 3CIHA 3WGIA 1RZ4A 1HSJA 3U37A 1UOGA 3IPVB 5DZGA 1APLC 2QKLB 5CIRA 4CU8A 1U5TB 1O7FA 1QJX3 4CDQC 2VOOA 2LRDA 1AXZA 2MLKA 4ZONA 1MVEA 2X29A 4CCOA 4YW5A 3D5OA 4BPZA 2PA7A 3MFAA 1XE0A 3L2VA 3RVHA 3ON7A 4NRQA 3GXOA 5JWPA 2IPQX 2LK2A 2K0GA 3UJOA 5F5QA 3KLNA 2FNPA 1W06A 1GZWA 5CEHA 1KQRA 5E6HA 2CG4A 4C91A 4CZZA 3ESWB 2HOAA 4A5MA 2WWSA 3HTUA 5IVYA 1DLLA 4AD9A 4WVZA 5JI6A 1F9KA 2E33A 3OYAA 4IKFA 2DO7A 4J1XA 3K2AA 2J1AA 2GBYA 1HIXA 5IUQA 3JRIA 1K5MC 4HBLA 2R7FA 3RJRA 1MS4A 5KK1A 3Q0VA 2WKKA 4OIPF 5ANQA 5M3MJ 1YI9A 3E7LA 5ERIA 3FXQA 2XONA 2DA5A 3NV2A 1XS9A 2BDRA 5T55A 5J4VA 4D5FA 1GUUA 3L9FA 2B4KA 3HJEA 4E7LA 4YIFA 4ASLA 4LBNA 2CGPA 4L11A 2Y6FA 3WQ7A 1IRFA 5H6RA 3KCYA 2PFBA 1TNFA 2RQQA 2DT6A 2OIIA 2Y26A 2ARCA 2X9DA 4KN7X 3GCXA 2J1TA 4M3DA 3CJIC 4NR1A 4GGGA 3O6BB 1FWZA 3D5SC 1DQ4A 2BW3B 1S0EA 3RZOJ 3CZUA 4XMIA 3H3ZA 3RI9A 3E5UA 4OUMA 1HDDC 4OWRB 4Q8LA 4YM3A 1HA8A 2XVLA 3HG9A 4A3BJ 1C8NA 5FLVA 1AHDP 1NA1C 1QJY3 3EJKA 4D8MA 1C4RA 4AWDA 5CFCA 3DCFA 2QM3A 1JUHA 2DUOA 4AF9A 2QA4I 3GLXA 3CC4I 1AX2A 1Z6RA 2A6HF 3UKNA 1ND2B 4LUMA 3SCHA 4BB3A 3SISA 3DU6A 1WZXA 3OWTA 2XH6A 4PJNA 3GXUA 4B4PA 3NV3A 2VC1A 1S0IA 2FEZA 2J22A 1W0UA 3DTEA 1QF3A 4CDUA 1Y1WJ 1S2EA 1IPJA 1F35A 2J1UA 1AR92 5BNQA 1JS9A 5J40A 3SXWA 1W2NA 4L9BA