3E5QA

Unbound oxidised cprk
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
209
structure length
202
Chain Sequence
NFFPIEKLRNYTQMGLIRDFAKGSAVIMPGEEITSMIFLVEGKIKLDIIFEDGSEKLLYYAGGNSLIGKLYPTGNNIYATAMEPTRTCWFSEKSLRTVFRTDEDMIFEIFKNYLTKVAYYARQVPTIRILRLFYELCSSQGKRVGDTYEITMPLSQKSIGEITGVHHVTVSRVLACLKRENILDKKKNKIIVYNLGELKHLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis of halorespiration control by CprK, a CRP-FNR type transcriptional regulator
pubmed doi rcsb
source organism Desulfitobacterium hafniense
molecule tags Transcription regulation
molecule keywords Cyclic nucleotide-binding protein
total genus 47
structure length 202
sequence length 209
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2008-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3e5qA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3e5qA01
4HN0A 2L02A 5BS6A 2HGCA 3LWCA 4FAGA 3K9TA 2P7VB 1LDKB 2GIVA 3LA3A 5TRDA 3GZ5A 4AXOA 3KGZA 2J5PA 2ESHA 5H6QA 3WW2A 1WSUA 3U11A 4U0VA 2O03A 4JQFA 2L54A 1UIJA 4HBNA 4G8XA 3JTGA 4KICA 4G94A 4HLTA 4FAHA 4WF2A 3JZVA 1FP1D 4XFFA 1O7LA 2IVMA 3QP6A 3HT2A 4ASNA 2FRHA 2FMYA 1DP7P 1HSTA 3BB6A 5FFZA 3P9KA 1MDMB 2BEOA 3NEUA 5CYVA 4QGNA 1GXQA 2ETHA 5FO5A 1AWCA 4KN7X 2OBPA 3FZ3A 4KUMA 2QQ9A 3JSOA 3NVCA 5HLHA 1R36A 5HS8A 2EFQA 3BU7A 2FOKA 2HQNA 3DXJF 2FBKA 2JSCA 2ZXJA 3JW4A 3N97A 1O4TA 4XETA 4B29A 3ZMZA 1XD7A 3I0TA 2MNGA 5FQ0A 3I5UA 3WE2A 5JSRA 4HF1A 3FHZA 2XHKA 3BWGA 1GVJA 1ZZCA 4AVBA 1Z9CA 4A0ZA 2WTEA 2DFIA 2W24A 1WA4A 1WGPA 1D5VA 4MGIE 4YFNF 5C8WA 1SD4A 3KCCA 4PGHA 1QNTA 3FJSA 1YIOA 1IN7A 1U6GA 4ZU7A 3HIFA 4BHBA 3K1NA 3M9AA 1ZLKA 2HTSA 2HYFA 1XSVA 1IN8A 2JRTA 4M73A 3ZP5A 2P6TA 4UHTA 3GVAA 2E1NA 1D8KA 2UZKA 1BI0A 2E9QA 3GBFA 3G3ZA 3PNAA 3REOA 4KIBA 3D0SA 5FLXK 2L01A 4X6RB 1IPJA 3HHHA 3GLXA 3CO2A 2PHLA 2Z33A 4HN1A 1J59A 3ZPLA 1XGOA 4F8AA 1S29A 5H20A 3H1WA 2UY8A 2D5HA 4QGMA 2NRAC 1P2FA 2XAHA 2WWYA 5E20A 4UBHA 4WZCA 1CAXA 5L3GA 4GO1A 1GXPA 2V09A 3JAMK 1JUHA 3GF2A 2QCSB 3OOPA 2LF8A 4H0EA 3WU1B 1ZX5A 4L5IA 3I59B 5LBQA 1FT9A 1STZA 1ULYA 1L3JA 3V4GA 1FBQA 2V1UA 4RAZA 4XFGA 1O7FA 5LGNA 2WC2A 2V6CA 2GA2A 2OA4A 5FLXZ 3D0JA 4IERA 5T3NA 2VT3A 2IXHA 4CDGA 3K2ZA 4A12A 3L7WA 2BV6A 2ATFA 2VE9A 4IEXA 2STTA 4QM9A 1ZRDA 3WGGA 2RGVA 2G7HA 2FQPA 3TNPB 4QWQA 1G3WA 3DV8A 1BC7C 1X7NA 2M87A 2FBIA 4AWXB 4IEOA 2XKOA 3KP3A 3L9FA 4EJOA 3CUQA 4Q5SF 5LHIA 5BQTA 3HT1A 2IP2A 5JSPA 4WWCA 3GX4X 2A61A 2NNYA 3GFIA 4Z82A 2CAUA 3DN7A 4R1HA 3MYXA 2IA1A 4RGRA 3RJPA 1QWRA 1YW7A 2V1XA 3BPZA 2CW0F 3EHKA 1NXMA 1QQIA 5E8IA 5EFUA 1FYKA 1EH7A 4YFXF 3CTAA 2FU4A 3GW2A 1XCBA 2M45A 1U5TB 5BPXA 2Z2SB 4L9JA 4PCQA 3ZMUA 2OZ6A 2ESNA 4XF0A 1FBSA 3KFWX 4CXFA 1FLIA 4I2OA 1KGSA 5D8KB 3ZQ7A 3T8TA 3WTVC 3JTHA 1YHFA 3SQNA 2Y0OA 1XN7A 1S6LA 3M70A 4WBBA 5LGTA 1RI7A 4HF2A 1ZZ8A 3WTTC 4PGGA 3E3VA 4EJVA 1IXRC 5E17F 2XAFA 2EV5A 4Z07A 4MGZE 5CJ9A 4UV9A 4KL1A 1LRHA 2QWWA 2W85A 4MQVA 2JTVA 2NNNA 2QYOA 5F1RA 1ODDA 5EEHA 4G9YA 3RKXA 5CLSA 5D8LB 1YFXA 5H6RA 3LAGA 4IRHA 5D5VB 2HEOA 2Q30A 1RL3A 2OPKA 1T39A 3HYIA 5JCTA 4L9NA 5ILUA 2F2EA 2UY9A 2PAMA 4CHUA 5BXXA 2IW5A 4HVRA 2ET7A 2OQGA 4J1WA 4D7TA 3K1MA 2DO7A 2ISYA 2KIMA 2ZBKA 3QRFF 3ROUA 1OMIA 1U5TC 3EO6A 3QU3A 3L2HA 1W7PA 3HRUA 2L3DA 2VOOA 4PIXA 1XMAA 1T2KA 2GC2A 1FP2A 3K69A 3F8FA 3WU0A 3KP6A 4KN4X 3NJZA 4LTAA 1K78B 2A69F 3PQJA 4ENJA 3C3VA 1IZ1A 4BQAA 1VP6A 4BIFA 3QPTA 4R8HA 2EA7A 3RPQA 2ZJ2A 2F5CA 4KIFA 5I8TA 4QXKA 4E2SA 3EYYA 4JTOA 2G9WA 3LOIA 1YFHA 2UYAA 3ACLA 4S04A 4GXOA 1JGSA 3LA7A 4GYIA 4A0YA 1OPCA 4GCVA 4LD5A 4FX4A 1FZPB 1USTA 3OGJA 1ZREA 3BDDA 2DQRA 2FSWA 2XLAA 5C6CA 1Q3EA 4P9UA 1ZVFA 4AVPA 4F7ZA 3SCGA 1R22A 4ENKA 4LEJA 4HX7A 2PFBA 1XSXA 4M74A 3BPXA 3FE5A 1W4MA 4XFBA 1R7JA 1K78A 1Q43A 2KIUA 1WLTA 4YSFA 5LLQA 3EBRA 2CWEA 1L3LA 1ZRCA 2V9VA 2FEZA 5I0TA 3MZYA 4GULA 4PDKA 3S7IA 4I98B 4UV8A 5CVIA 2N7GA 3IL2A 2XIGA 3MAJA 4OMYA 3CLPA 1O5UA 1B9NA 4LFUA 5LRSA 2PHDA 3IKVA 2WV0A 1KYWA 3V8JA 1IF1A 3BPVA 2DW4A 4AVAA 3WW3A 3IWZA 3GFLA 1NE6A 4IPAA 3TOAA 1W7PD 1IRFA 5I91A 4AVCA 4K8FA 3KP2A 3RTRA 3EJKA 3CL1A 1WKMA 1R1TA 2KXLA 4P5OA 5BY5A 2MPFA 4HVQA 2ACJA 2EFOA 1Q1HA 3NRVA 2CAVA 3AAFA 3WW4A 5HDNA 1RTVA 2QENA 2CGPA 4HAMA 4Q0PA 2EFWA 1W5SA 4N0BA 1UFMA 4WXCA 4PIYA 3IC7A 2O6GE 3CUQC 2IA2A 4XLPF 4I7HA 3ELNA 4LG0A 4QMAA 1DZTA 4AD9A 3NSTA 3H7YA 3CO6C 4A5MA 2YPRA 3CDHA 1LKNA 2D5FA 4KA4A 4LG0B 5DD4A 2D93A 5A2QZ 1KQ0A 2EB7A 3LQRA 2HQRA 2XL7A 2IXCA 2H09A 1P4WA 2F4PA 2E7XA 4QX5A 5D6EA 3RDIA 1XMKA 4M72A 1SQ4A 2DU9A 3J81Z 3OCPA 5CVRA 2F5FA 4HV6A 3HHGA 3WGIA 3R61A 2P8TA 4HMZA 1Z7UA 2VBXA 1XE8A 4D7SA 1NHAA 2RNJA 2VXZA 4R79A 2XROA 1BI2A 3FXRA 2TDXA 3QAHA 2ZNYA 4IRGA 5I8SA 5FB2A 2DPUA 4DQ2A 2PJPA 5D4SA 1XSDA 1CX4A 5TJJA 1CAWB 3HSRA 2Z5UA 2AS5F 5HLGA 1QXJA 5ILVA 2O8QA 2CFXA 1S7OA 2XAQA 4I01A 4G7HF 4N9HA 2C6YA 1IXSB 5KK1A 2Y48A 4M9ZA 2QLZA 5KHJA 3GO5A 1P6RA 4E2GA 4JVAA 2DT5A 1IUYA 1U78A 1CAVA 4XBFA 3FX3A 3ML6A 4AIKA 2B0LA 5IT3A 2UXNA 2LNBA 4HYEA 3FXUA 4ON0A 4MUVA 2EJRA 3TNQA 1XDUA 2KKOA 2E1CA 3SZPA 1Y0UA 5KHKA 3FMQA 4WXDA 3DEUA 1KA8A 1R1UA 3MEXA 4IF4A 1EP0A 4Q29A 4LLLA 1YLFA 1KU3A 3TDUC 3Q9SA 3COAC 5FDBA 5HVQC 1CAVB 4OOIA 4GYGA 3IDBB 4AQ6A 4NQWA 4XSXF 1VTNC 2IC1A 4HQMA 3GZ6A 1TW3A 3EYIA 2K0GA 1Z05A 1UCRA 5HOOA 1DUXC 1E17A 3R0JA 1ZAOA 3I64A 4BHCA 3H1YA 3SFZA 4IEVA 4Q0UA 3KP7A 2RVCA 4KWLA 5EEGA 4EGYA 4I3PA 4HF0A 2PAKA 1HKQA 4XFIA 3TQNA 2OD5A 2HS5A 1ZRFA 2IXLA 4KYWA 2P4WA 3E6MA 2DBBA 1XGNA 2IJLA 3HOTA 3DL3A 2VOPA 2ELHA 4K2EA 5DCMA 5LEJA 2XAGA 2Z69A 3RIRA 3E6DA 1O3SA 3ETQA 3U1DA 3ES1A 4EM1A 3L00A 3VHRA 5K5OA 2ZFWA 4MEXF 4HV5A 2B5HA 2XRNA 1H1IA 1UW8A 4XRFA 2GC0A 1B4AA 3E5QA 2BE5F 1C0WA 1BN5A 5LHHA 3FFQA 2E7WA 4BAYA 4IEZA 2P5VA 2GWRA 1XE7A 4OIPF 3H7JA 2M30A 3TOBA 2UXXA 2OZJA 1F4KA 3NL1A 3CUQB 2YSRA 3RKYA 5E1XA 3QP5A 3IDCB 2EA4A 3LAJA 4KMFA 4ZYHA 4KNYA 4Z2YA 3I53A 4CZZA 1U5TA 4HSLA 2HYGD 2GZWA 4I02A 1HBXG 2YU3A 4BXUA 4I0BA 1HW5A 2W84A 4YIFA 1FSHA 1ZG5A 2XLFA 1IN4A 2CQKA 1KU9A 4ZZDA 2GAUA 4WXHA 1R5GA 1J5YA 1YFUA 3H8UA 2DI3A 1V3FA 2KRFA 1G4DA 3SHFA 3RI4A 4UVAA 4IRIA 3GYDA 1HKTA 4XF3A 1FYLA 4A0XA 4LJZF 1DGRA 3EQLF 2O3FA 5CADA 4MTDA 4KIGA 2YX7A 3F22A 5BOXA 3P9IA 3TDZC 1RZ4A 1X8EA 3GFJA 1J2XA 1I5ZA 2GH2A 1BM9A 3GWZA 5D4RA 1SMTA 1TBXA 1QY4A 5I0SA 3P9CA 3ERED 3FWEA 1G3YA 4OMZA 4ZYEA 3HTUA 4U0YA 3ECHA 1LNWA 4KT5C 3GUDA 2K02A 2OAZA 1D3YA 2FE3A 3RYKA 3BOQA 3OTFA 2W57A 1B59A 3WODF 3DF8A 4LA3A 1FI2A 3KP4A 4XFAA 3ABUA 2ZMEA 3PLQA 1RNLA 4EM0B 5DUKA 4DINB 3P7NA 5E1RA 2O8XA 4Q48A 2ZKLA 1YFYA 2COMA 4M9SA 3M1EA 3SHRA 2IXIA 2VN2A 1G3SA 2XKPA 4ETSA 4ZYGA 1EY2A 5HLIA 4IEPA 4ONUA 5BUVA 2IPQX 3FMSA 4YFKF 2Q4SA 1BOAA 3ZMSA 5LEKA 3M8EA 2H6BA 1UHMA 5F64A 4E70A 3L2CA 1B1BA 5I0RA 2PMUA 3TGNA 1KQ8A 2VODA 2A6HF 4HLYA 1IAWA 3HRTA 3ZMVA 4ZU5A 1FY7A 2P17A 1DZRA 4U0WA 2A3SA 4HA8A 2AXLA 5FLHA 1R5HA 5ICGA 3DKWA 3QACA 5ERIA 1MJ9A 3KLOA 3IBMA 1ZZ7A 3MDPA 1F9NA 1LEAA 4WCGA 5LHGA 3IRQA 4MQ9F 1ZYRF 4EMSA 4IETA 1JXSA 1XB4A 2O61A 5AONA 3KGLA 3RYPA 4O9GA 3WG9A 1IW7F 4XEZA 5E18F 2L4AA 3HRMA 3LZZA 3F3XA 1R1VA 1EH6A 1ZG1A 3MZHA 1K7AA 1BC8C 3JAMZ 2C0ZA 3F6VA 1GQGA 2IT0A 4UNOA 3RNSA 2KJCA 1JHFA 1EH8A 1MZBA 4OLLA 1PDNC 2BBYA 5FFXA 1BJAA 3MCZA 1I1GA 1JHHA 4LB6B 1H9GA 2X4HA 1SFNA 2FMLA 1TNTA 5BPIA 3JSPA 4RB1A 2QVSB 4IJAA 5J8CA 2P6SA 5DV5A 3T5XA 1FXZA 4CO8A 2UWMA 5L3CA 2CV6A 3WTUC 3KE2A 4EWAA 1H9TA 1Z6RA 4U7DA 5HS7A 5JSOA 3Q5FA 3UKVA 2XL9A 5E8GA 3ZN1A 3KEQA 4QGLA 1O3QA 4L18B 1WWXA 2GQQA 4Q0VA 2O1QA 3DFGA 4XSZF 3H50A 5HS9A 1P4AA 2EAAA 4G6DA 4G6QA 3VFZA 3N4MA 3S2WA 4HDVA 4PIZA 3BZ6A 2GA1A 3BALA 2D2WA 2EWNA 5FGMA 5LRRA 4Q47A 3WTXC 3SCFA 1HKSA 3OF1A 3LAPA 3FF5A 1BI1A 3CF6E 2R3SA 4LK0F 3MPBA 1SMYF 4B8XA 3U2RA 2BNOA 4HVOA 4CYDA 3J7AO 1B9MA 1T0FA 3BCWA 3GFMA 1KU7A 1TNSA 5DYMA 3ZMDA 2K4BA 1HXDA 2EA2A 5D6FA 1FOKA 2I45A 2MD5A 1SD5A 3FXQA 3K0LA 1OI6A 3CLOA 3O6BB 2DAOA 2ET1A 3O3KA 5KBFA 3W6JB 3NW4A 1FYMA 1KQ9A 4Q0SA 4HX4A 5EZWA 2OZUA 3ZN0A 1DPUA 4HSJA 4IEUA 5CVUA 4ZYDA 2RQPA 4MGYE 4YYOA 1TQIA 2EK5A 1QXRA 1KYZA 1T98A 4L9TA 1CGPA 3H1MA 4L0YB 1YYVA 2HTJA 3E97A 1NZCA 1UCXA 2BGCA 3EETA 3TKYA 5FQ0B 2Z99A 5D5UB 1NYWA 3UKNA 2Q1ZB 2V1DA 1X82A 2IXJA 4L2NA 1P4XA 1LDJA 2VC0A 4H7LA 3H3UA 1DPRA 4OIRF 1OYWA 4IEYA 4XF9A 1YW8A 2H27A 4IHTA 4XLNF 4HLXA 2PFWA 1QZZA 4U88A 3UKTA 2HOEA 2QBYB 4TV7A 1CF7B 1OKRA 3LQQA 1CAUA 3B73A 3FMRA 5BMZA 3VEPA 3V7CA 5I8YA 3NKTA 1QPMA 2F5DA 4L0ZB 1OD5A 2CO5A 2K7LA 4OINF 2HKXA 4KFCA 2VC1A 2KJBA 5DUIA 3LA2A 4AIJA 1YS6A 1MDMA 4IESA 2PYTA 2DK5A 2JPCA 3T0YA 5ICFA 1AOYA 3WTWC 1ZG3A 3NQOA 1J3PA 2HWVA 1LQ1A 5AIQA 3KSCA 2YX4A 4RD7A 4MTEA 4LUMA 1BBYA 1CF7A 3KLNA 3PFIA 4UUVA 3J81K 3HSEA 2LSOA 2GXBA 2PA7A 2MC3A 4ESBA 4LK1F 1RGSA 2BYVE 4RB2C 2WFPA 1YFWA 4ZH4F 2RC4A 2OA2A 3RKWA 2H6CA 3DPLC 2XV4S 1REPC 5E16A 2Z9OA 1B6AA 1ON2A 3F21A 1CAXB 2QZ8A 3FZVA 3B02A 4HOBA 3F6OA 2DLLA 3WTYC 4WX9A 2A5YB 5KHHA 3CUOA 3LFKA 3E6BA 1T6SA 4EROA 4EV0A 3WGHA 1TQMA 1XDSA 1LJ9A 1TQ5A 3EQEA 1LVAA 1TQPA 5FLIA 2R7DA 4UXAA 1QBJA 4BHPA 5FD5A 1CAUB 1ZARA 1FSEA 3ES4A 3OD0A 2PBIA 3C18A 2M8EA 4EGZA 2V79A 1W5TA 1G3TA 3SZTA 1FBUA 2K27A 4MEYF 4LB5A 1RC6A 3F8NA 5J6XA 4JBAA 2QUFA 3SCHA 4LMYA 4G7ZF 1DDNA 1IRGA 2PLYA 2MLKA 2PI0A 3HQXA 4P9GA 1I1SA 4JV4A 3T1BA 4IEQA 2PQQA 1WI9A 4Q0QA 3IKTA 1J58A 2QNKA 4L11A 1LB2A 1Q5OA 1RIOH 2FQ3A 2QJVA 1ZNPA 2PAEA 4RB0A 3LWFA 2EFNA 4EVIA 4FBFA 2ZO4A 3E6CC 2STWA 1D8JA 2FXAA 2EV0A 1YG2A 5JR3A 1YO5C 2Q8KA 4IHSA 4P55A 4XFCA 4ESJA 4OU0A 5DCFA 1QZYA 3GEZA 4HZFA 4META 2DPDA 4EQQA 3I58A 3F23A 1SD7A 5FPXA 5CVVA 3V7SA 3H92A 2Y75A 5ED4A 3IWFA 1IXCA 5F6FA 1FWZA 1LEBA 2DCTA 4NB5A 4UXNA 4BYYA 4ZU4A 2NAZA 4L9VA 2MBFA 2MH9A 1U3EM 3ZMTA 2HJIA 2VPVA 4RB3C 4BH9A 4I0AA 3HOSA 5BV6A 1U12A 5K8SA 4A5NA 2QM3A 1PP7U 3SXYA 3CEWA 2R7FA 1PM7A 3E5XA 4QLCU 3CJXA 3G73A 2VE8A 4PJYA 4Y17A 1R00A 3EDPA 5I93A 1QO0D 2D1HA 2K86A 1YTYA 3MWMA 5JI6A 3V8LA 3ECOA 2ZKZA 5L3EA 4NVPA 2VECA 1CAWA 2H0VA 3RYRA 3U9GA 5BPDA 3OV8A 3D82A 2D45A 2VBYA 3BP8A 4MX3A 5JAXA 1I6XA 1P92A 1S8NA 4AIHA 4EWDA 4HQEA 2HKOA 3C7JA 3CO7C 2K9ZA 1XCVA 1R23A 1QGPA 2XLGA 1KU2A 2OYZA 5D5XB 5L3BA 4Y15A 2VBZA 3ISPA 1HSJA 4O3MA 2JZYA 1RUNA 3BJAA 5K5QA 4XF4A 3SXWA 1SFUA 4M9XA 2HFHA 1ZZBA 2P5KA 2M1BA 4BNCA 5E1ZB 4KU7A 3G7DA 4HW0A 1BIBA 5HI0A 1O57A 2VONA 1YWKA 2G7UA 4S05A 5D1IA 5CU1A 3I71A 1HW2A 3IIAA 2NYXA 1H1MA 2HDCA 5IT9Z 1OFNA 2BNNA 3J80K 3KP5A 3DP7A 2DQLA 2OQRA 3U10A 2GC3A 2ZMEB 1JE8A 3T8RA 2XGXA 4GGGA 2EFPA 1V4RA 3C1DA 1F1ZA 3CJNA 2D1VA 1Y9QA 3R4KA 4JK1X 3WTSC 2Q0OA 4FX0A 4YRDA 2W25A 5KHGA 5FCCA 3O2PE 1X8MA 2CYYA 2PN6A 3USSA 2BNMA 2ISZA 1XGMA 2B9UA 3IHUA 2CSOA 2VBWA 4YNIA 3V8KA 2PEXA 3BROA 2FBHA 2PTMA 1FNNA 4O5VA 4MV2A 2XASA 2RN7A 4EJUA 2EV6A 3U0ZA 2O0YA 4HDUA 4MGKE 5K5RA 3W6KB 1SEFA 1VJ2A 3O14A 4ENNA 1VR3A 4MHGA 3L09A 5CVJA 4LLOA 3RZZA 3TO9A 4M71A 2K4JA 3QPHA 1UIKA 2NS0A 2JT1A 4D0PA 3FM5A 4EWEA 3I4PA 4OIOF 2QQAA 2QVOA 2KIFA 2CG4A 4OIQF 1J0RA 1YS7A 3I7DA 1MGTA 1Z1DA 1GHCA 3DPTA 4LGWA 1GQHA 2PMHA 2EVXA 5KHIA 1WRJA 1ZRRA 4LLNA 4I09A 5FD6A 5J3UA 2MA3A 2M5WA 4TLFA 3Q9VA 4Q4ZF 4JTNA 1MKMA 4YG2F 2QBYA 4UVCA 2GU9A 1O3TA 1O5LA 5HDGA 4CGZA 2IRFG 6PAXA 1XGSA 4IXAA 2LF7A 1ZGJA 4DNCA 5AIPA 4G7OF 1UPIA 3S7EA 3K1PA 4RAYA 3IRRA 2XVCA 5ILSA 1T38A 5E1WA 2RV8A 4RS8A 1BI3A 3MQ0A 5DCMB 1HQCA 1YQAA 5L3FA 2F5EA 5J8FA 3J80Z 4A6EA 1SAXA 4MGRA 4XFHA 3ULQB 1J3QA 4P96A 1U2WA 4ORFA 3F8MA 3I59A 3SMHA 2OU2A 4LA2A 2ETEA 1UHWA 2DK8A 4ZZLA 3D5LA 5HDKA 1SFXA 4ENMA 1PMIA 5FPZA 4IEWA 3ABTA 3FM3A 2L4MA 1LDDA 3F8BA 2UYBA 3WW1A 4RGSA 3R6SA 1J75A 1IPKA 2DTRA 4CICA 2FNAA 4QM8A 3HTSB 1YW9A 4UBGA 4RGXA 2RKHA 2ZNZA 5I0UA 2LKPA 3M7GA 4ESFA 3WTZA 2MHFA 3QU6A 3PVBB 1L0OC 2IXKA 2QQBA 3VOEA 1PUEE 4FT8A 5L3DA 4KWKA 1LR5A 1ZN2A 3M8FA 2IA0A 4IVNA 5FLJA 4N9IA 2D40A 2PQ8A 1V70A 2A6EF 3BY6A 5IT9K 3GXOA 5J7MA 4YIIA 2A68F 3EUHA 1OYIA 2Q2EA 2B8MA 4MNUA 3ELKA 1TW2A 4WVZA 5JFRA 5DD8A 5JHUA 5ICCA 3R60A 1A04A 2MH2A 2FF4A 1IN5A 1SFEA 1UD1A 1E2XA 2PG4A 4NHJA 2H94A 3KETA 2HR3A 3KMHA 4HX8A 1W7PB 2FA5A 3DQVC 4YARA 4FHTA 4RGUA 3V7RA 1UB9A 3M3IA 1G6NA 3BJOA 4KWJA 3PQKA 1ZZ6A 3I54A 3MFKA 2MLGA 3H9AA 1R58A 4KMUX 4O9EA 3S0MA 4L5JA 4J1XA 3BJ6A 1ZHFA 5DEQA 1HW1A 4EM2A 3F8CA 1K6OA 2A07F 4M6XA 2RDPA 3VODA 5ICEA 1ZZ9A 4R52A 1F5TA 1IN6A 2Z3YA 1K79A 4LLGF 5JVTA 1MD0A 3HRSA 1ON1A 5DDGA 1X3UA 4WK8F 2XAJA 2HZTA 1Z91A 1S3JA 1XRUA 1S7AA 1MJAA 2P5LC 3ZDSA 1H0MA 1I27A 4A2UA 2ZCWA 3C3WA 4O6JA 3ST7A 1USSA 2JPBA 4Y13A 2VQAA 3HSFA 1U8RA 2XUBA 4X6QB 3HUGA 2YR2A 1J1LA 2VT2A 4B09A 3R0AA 1BIAA 5KVRA 1FC3A 2QDRA 1YUDA 1EV7A 5AVPA 4AQ2A 5J48A 4E2QA 1ZLJA 1MJBA 3E5UA 1OR7A 1FPQA 4XF1A 4A6DA 5A2QK 1EPZA 2LDUA 4M6YA 3KZYA 4KU8A 5D5WB 1RUOA 4EJWA 1PP8F 4KDPA 4MZUA 2Q0AA 3VB2A 4LULA 1WQ2A 4UVBA 1J7KA 4LUKA 1ZH5A 1DGWA 5JR7B 1J9IA 2GXGA 1EYBA 2P7CB 2J5OA 1ZGAA 4U7BA 2X0LA 1Z6TA 3KZZA 1SD6A 4MH0E 3LSTA 1J3RA 2GC1A 3TO7A 5LGUA 3RPUA 3KEOA 4HBLA 1FX7A 1ONVA 3FHIB 4OFGA 1OYYA 4PZJA 3TO6A 3GYHX 3WE3A 2Y0MA 3QOPA 1TTYA 2ADUA 1NE4A 1Y3TA 1YLLA 1TLHB 2FNPA 4EJTA 3F72A 5K1YA 4P9FA 3H3ZA 1O3RA
chains in the Genus database with same CATH superfamily
3FISA 1HN0A 2A6VA 4Y1YA 4AW7A 3LWCA 4FAGA 3MD2A 2BW3B 1O4YA 4RYDA 1X4PA 5ACA3 2GIVA 1VQKI 5FZBA 5C4XJ 3ITQA 1RESA 2J5PA 5H6QA 1RRJA 1NT0A 3K4LA 1WSUA 1R093 4YM0A 2ZOEB 5BYNA 4G8XA 1JZ2A 3FHNA 1BL0A 4HLTA 4CCLA 1XQNA 4BQOA 1UOBA 3T4HB 2IVMA 3QP6A 3HT2A 1JUPA 4ASNA 4XACA 1Z7S3 5FMOL 2IFWA 4GKYA 4HPKA 1HSTA 1NCQC 4BACA 3BB6A 5FFZA 1Y6IA 4V2VA 2BEOA 5FPUA 4KN7X 1Q56A 4Z92B 2OBPA 1DBNA 2E32A 4KBBA 3FZ3A 2QQ9A 5HLHA 2EFQA 2FBKA 3N97A 3ECQA 1POQA 4YW4A 1XD7A 2ZMEC 3WE2A 4ATFA 2WNVB 1TNFA 5IWFA 1GVJA 4AVBA 4DYCA 3T2OA 2Y6JA 1E3OC 2WZ8A 5C8WA 3MUY1 1D4M2 1HJFA 4PGHA 1QNTA 3FJSA 3OYKA 1SPPB 2ZGMA 4BHBA 2HYFA 1IN8A 3N9LA 4IGOA 2JRTA 4M73A 3VBUC 3HBLA 4CCJA 1RUE3 4UHTA 3GVAA 2E1NA 5A7PA 4HG6B 1VIWB 3G3ZA 3POFA 3T2TA 4C1WA 1WVRA 2RAEA 2VKDA 2X1EA 2PJRB 5GTHC 4IE6A 3GLXA 5EGOB 4L97A 4GWJA 3TL4X 5K7HA 1KITA 4V2FA 4HN1A 4LBNA 1HCRA 1JOPA 4F8AA 5H20A 1QQP3 3H1WA 4YW2A 4TSVA 1PMHX 4QGMA 2NRAC 5IVEA 1Y9MA 1KEXA 1P2FA 2XAHA 4BQNA 2VZ3A 4UF0B 2WWYA 5E20A 3F9KA 4XTPA 4CUCA 1CAXA 2PMZA 1GXPA 3HD8B 3ZYIB 3AXEA 3AMHA 3OOPA 1ENRA 4YW3A 3CCEI 1WA6X 1MS8A 1G8XA 5C70A 3K4NA 3JCIA 4B1RA 1E57A 3BTCA 1STZA 1ULYA 1X1DA 1TMF3 1ASJ2 4RFT0 3KQ4B 4FPCA 2V1UA 4KG0A 1LU2A 1HDPA 4AL9A 1O7FA 2BY3A 2R041 5GAGJ 2V6CA 4ZDOA 3Q8EA 5IW0A 4XAAA 3TW6A 3D0JA 4IERA 4XYXA 2VT3A 5M5YJ 2IXHA 2CV0A 2BV6A 4E7JA 2FX0A 5CFDA 1VBC2 2KMUA 3I8TA 3QYBA 5FYHA 2FQPA 4QWQA 1OLRA 2VKEA 1HLVA 1G3WA 3DV8A 1BC7C 3I3DA 1YJLA 2VVEA 1VBB3 4A45A 3BTLA 3AC0A 1NCQB 4UT5A 4GFBA 4IEOA 4QB1A 3HUGB 4EJOA 2YU1A 1GZWB 2HPMA 4Q4W2 4WWCA 3GX4X 4E7LA 4XILA 1KJLA 2W91A 4X0GA 5JZGC 4FE7A 4NNJA 1H6XA 3GGLA 4RGRA 3RJPA 3AZVA 1QWRA 1YW7A 4B3NA 2BHZA 1G8WA 3ACFA 1GP5A 4NAOA 1FYKA 1EH7A 1WMFA 5GLTA 2BVLA 3DCFA 4DZGA 3AXDA 3JBG1 1BA5A 4PCQA 4XF0A 2K9QA 1P9QC 2VMDA 2R4GA 3KFWX 1LCLA 1U5XA 4FPYA 5D8KB 3NWKA 4J25A 1YHFA 1X33A 5FKLA 4RR3A 3SH5A 5L7OA 2FD8A 3BCAA 1TVGA 4ZJZA 3FUQA 4WBBA 5LGTA 2BP6A 5FKKA 3C7FA 2ZEWA 3V65A 1EUTA 1OKOA 5E17F 5CJ9A 4UV9A 1LRHA 1VB4A 2W85A 2VMGA 5F7UA 3PM1A 2DA4A 2JA2A 4OWRB 1ODDA 5A1AA 4WV8A 2MC4A 3UV9A 5GJ6A 5CLSA 1YFXA 4FXKB 2O9LA 2JXAA 5D5VB 1V9U2 5ACA2 2Q30A 2KIQA 1T39A 4K3UA 5ILUA 1PMJX 4HVRA 1U0AA 3GZAA 1REFA 3A4CA 5EP9A 2ISYA 3HNMA 3KZ4C 3AZXA 3RPUD 1T56A 3I2KA 3EYPA 5FPAA 3EO6A 4CPBA 1W7PA 3HRUA 2L3DA 1UMHA 1T2KA 1FP2A 4BE0A 3K69A 1UWWA 2VXRA 3KP6A 4KN4X 3PUHA 1AYM3 1K78B 1ENXA 3PQJA 1RMU3 3C3VA 1ND3A 1VBE3 4XJUA 3CU7A 4QTRA 1UXXX 1WKYA 3QPTA 4R8HA 4XCAA 4Q4Y2 4QXKA 3HKZN 2OTLI 1C1FA 4JTOA 3CJRB 4QQ2A 1YFHA 4QQOA 1QMJA 3ACLA 1Q8OA 1HF0A 2Y0SA 2ILMA 2V5YA 4GYIA 4C1XA 3SEEA 4GCVA 2DDAA 2A5ZA 4GZ9A 1FZPB 5FO8B 2DQRA 1FMWA 5H9QA 3V42A 2RDQA 2E7QA 2YROA 3HKZA 1NG0A 2WWUA 4ITCA 1ODNA 1ZVFA 3OBRA 4AVPA 3T4VA 1HRV3 1UQXA 1DHKB 2OF7A 3CZ6A 3VHNA 3OR1C 2XWBB 1XSXA 1JKQC 3B69A 2GOXB 4XFBA 1R7JA 4E7HA 4BXXJ 3PSFA 2QQPA 4S2DA 1GU3A 4Y7NJ 5LLQA 3OBZA 1E0EA 1L3LA 3H35A 2V9VA 5FYSA 1PK6B 3M1HA 4GULA 3ZIWA 3DPRC 4I98B 2JDHA 2N7GA 1W99A 4I30A 3IL2A 4SBVA 1Y8QB 4OMYA 1I9RA 1O5UA 1UZZA 5FPLA 5LRSA 2WV0A 4A3LJ 5FLVA 4CUAA 1W0TA 1IF1A 3M2MA 5A33B 2PHTA 3GFLA 3AJZA 1NE6A 4JKLA 4K8FA 4PLNA 3KP2A 1WGXA 2ELJA 3OEBA 3RFRA 3BOPA 4GB31 3CL1A 1W2AX 1S0JA 1XNTA 2MPFA 3N36A 4P1WA 4JZRA 3AAFA 1JZ8A 1ONAA 3QCWA 5HDNA 1WUVA 3ZXEA 4M3CF 1DQ4A 2LOOA 2HPIA 2R071 4QXCA 4N0BA 1UFMA 1K4SA 4WXCA 1SFOJ 2ZAHA 3IC7A 5FZIA 1NOVA 4Y5SA 3O5SA 5F9TA 4XLPF 3N9OA 4PFPA 5KR7A 3K46A 2ZAAA 3H7YA 3W9AA 2BUKA 3THCA 2VO5A 1S0IA 3NAPA 2FJ1A 3DU5A 1ZTRA 5HCHA 3LQRA 2HQRA 2AEYA 2L9SA 1IPSA 2M4GA 1Z78A 2UWAA 2UUZA 3WG4A 4GWIA 1JYVA 1SQ4A 2VQUA 2DU9A 4OUSA 1A5JA 4HV6A 3VSLA 3ZR6A 2P8TA 4HMZA 2VBXA 2RNJA 3IMMA 3FXRA 5FR3A 2ZNYA 1IDYA 3HZJA 2DPUA 4A7YA 3ILNA 1CX4A 5TJJA 3AL5A 3HSRA 3VD9A 2Q8CA 3WG1A 1WH5A 5HLGA 2W48A 5ILVA 2O8QA 3DBRB 5IP9J 3QWLA 4RL7A 2NP0A 1S1AA 2ZGSA 2XAQA 2EXIA 4I01A 2DJNA 3M4FA 4ES8A 2CQ7A 4XRMA 5FZEA 2Y48A 1E5HA 3HVDA 2X6OA 2LREA 1MBKA 5FJ8J 2HYXA 2DT5A 5A3MA 4QT6A 2CMPA 1U78A 3BC8A 4XBFA 1R1A2 2B0LA 4DXSA 2OIIA 4V2WA 3ZYJB 3H0GJ 4BKXA 5C3SA 3MIFA 2EJRA 3QD6A 1PX3A 1O8PA 5IOYA 2E1CA 5IATA 4EZ4A 1JOJA 3BG5A 3MEXA 1EP0A 2WB1N 1PK6C 2WKKA 4XK4A 3Q9SA 3FIWA 4ZDPA 1G7YA 4WM8A 5FDBA 2HNHA 1W04A 4AQ6A 1XPWA 4OI0A 2IC1A 3S1NJ 1W03A 3DTIA 1Z05A 2G4IA 5HOOA 4LBJA 1YJ9I 3ZYHA 5IHRA 2DURA 4Q0UA 1LEMA 4MGTA 3TB0A 5EEGA 4GQ7A 2AEZA 2XVGA 4Y1XA 2VJ4A 5L7OB 3V0BA 1ZRFA 2IXLA 4FPLA 4AFAA 4A6SA 1AR82 2DBBA 1XGNA 2ELHA 4K2EA 3D8CA 1IS4A 3P3PA 4AOCA 1OOPA 4E4SA 1SCRA 3LSEA 1RPWA 5BNGA 4CP1A 4CU9A 3U1DA 4COWA 3OY8B 3VHRA 4HV5A 2B5HA 3BIEA 3VBSB 2RNGA 2PX9A 5D2AA 3FFQA 3VBOC 1TT5B 4FPGA 4JYKA 5LWBA 4MVTA 2UXXA 2R49A 2YSRA 1GSLA 1I50J 2V5DA 1BVVA 4KMFA 2CTVA 1MH3A 3DWLE 1WCUA 4S0HB 1U5TA 4XORA 1FV2A 1XU1A 3OS2A 1R081 4ISQA 2YU3A 4H7MA 3NNLA 2Y64A 3V0AB 4KMQA 1Y1WJ 4YIFA 1FSHA 4JGZA 1SAUA 4NC7A 1IN4A 2DMPA 2K46A 3MHZA 1TNRA 4CDUA 1R5GA 2CQQA 3H8UA 4Q4W1 5D21A 3SHFA 1OA4A 4W6WA 1B72A 4IRIA 2ZGUA 1HKTA 1FNYA 4P5HA 2DYSH 2FQ4A 1A6CA 4OMCA 4LJZF 1Y9GA 2V9PA 2VTXJ 2BQPA 3K7AJ 2E7AA 1XC6A 2DFFA 5CADA 4KIGA 2YX7A 1LHWA 5BOXA 3P9IA 4CEWC 3CJIC 3GFJA 3HXLA 2E34A 4NRQA 2WV1A 5A3UA 2R7RA 1EAH1 1VMJA 4LORA 1SMTA 1HRI3 1QY4A 3ERED 3FWEA 2WNOA 3SEPA 1ETVA 3JRGA 3I9V2 1QJY3 2W46A 1VBA3 4N53B 4JAAA 1LNWA 3GUDA 4OCTA 3WZ1A 1F35A 1G9DA 4NHXA 1BW6A 1X36A 2M8GX 4AWDA 3DF8A 4D8MA 4LA3A 3KP4A 4DUVA 3HOYJ 2ZMEA 2DA2A 1RNLA 2V9KA 4D5FA 5FZCA 4FQ4A 2WABA 4SLIA 2COMA 2ZJRF 4UFJA 4YW7A 4IV1B 3LKJA 1N1TA 3K70C 2EXHA 2XKPA 2KP6A 4G3YC 1WMXA 4II3A 4AHXA 4LNVA 4DBQA 1MS5A 4IEPA 4ONUA 5BUVA 3FMSA 3B9IA 2H6BA 4R9DA 4XLAA 4CCKA 4BMEA 3FLTA 3WNNA 3N3HA 2WFF2 2E36A 5I0RA 3TGNA 1QH6A 2PQSA 5E88A 2F48A 1ZR4A 4XC9A 1DZRA 3VHPA 4U0WA 2W47A 5FZLA 3WDTA 2WIIB 1J09A 2FZ1A 1UMQA 4AI3A 5ERIA 2ARXA 1FEXA 1MJ9A 2HXOA 1F9NA 1ZGWA 5LHGA 3DBLB 1RKWA 3DKXA 4EMSA 5AONA 1IW7F 4J01A 4XEZA 5E18F 1W28A 3MGUA 3VL9A 5M5XJ 4E8CA 3OYNA 3HRMA 4C0BA 1IUFA 1AF9A 4UWDA 3LOCA 2C0ZA 2KJCA 3VDCA 2I8DA 4QHOA 2Y6LA 4YW6A 1AR72 1H9GA 3OB8A 1R091 2BHYA 1RJ7A 1SFNA 1NA1B 5FZDA 2FMLA 2AC1A 4WVMA 1V6NA 5BPIA 1K5JA 2WT1A 4BBRJ 3WQ0A 2NN8A 2QVSB 4IJAA 1FXZA 4CO8A 1YIPA 4IHXA 5L3CA 1REDA 4OI1A 4N53A 4CXYA 1AL22 1HQLA 3EPZA 2ZKNA 2X6XA 1RIRA 4MHUA 2CU7A 3I2OA 4QGLA 2V4JC 4XVHA 2WY8Q 2ECBA 4Y20B 1IGNA 4L18B 2NVTJ 5A7OA 4BZ4A 2DU1A 1MSFC 3DFGA 2CUFA 2JDPA 2EH3A 5FY8A 4TWTA 3GTOJ 2EAAA 4XKVA 2R7VA 4COZA 1VQLI 5FXVA 1H6YA 2PXJA 1JYNA 4IE5A 4AGGA 3NV4A 4QHBA 5DUWA 1UYYA 3OF1A 1I1EA 5C8CA 5DM6F 3LSPA 5JIUA 2R3SA 2H1LA 2VQGA 4LK0F 4RSUA 3UYJA 3ZXKA 3VSKA 5C3EJ 2WY7Q 1JTZX 1MR5A 5HCFA 1PO21 1HA8A 4M0HA 1R1A3 1B9MA 1T0FA 4M3CB 3BCWA 3W21A 1TNSA 4RM2A 3R4SA 1FMD1 2EIJH 1Q1VA 4JX0A 4LBQA 2EA2A 2WZR3 4I6ZA 2K40A 1SD5A 1UZ0A 3ZFGC 3K0LA 2ET1A 1VRBA 3GTQJ 5KBFA 3HR9A 3W6JB 3NW4A 1YJNI 1FYMA 2ERFA 4KISA 1KQ9A 1TP4A 4W6XA 3NNMA 4I76A 2OZUA 4LE4A 4DYQA 1DCSA 1BMV1 4NUBA 2HLEA 1MSEC 1K4TA 2YBPA 5FROA 1OOPB 1E5RA 4A3KJ 2RQPA 4YYOA 4HK8A 4BXFA 1W8WA 1KYZA 2HOSA 1IS5A 1CGPA 4DB5A 3H1MA 1LHUA 1AYM2 3CF5F 1NZCA 2BGCA 2E1MB 3EETA 5FQ0B 3ASIA 2JKBA 3H9JA 2ZGNA 2ZGTA 3ONQA 3OYDA 1X82A 2IXJA 1AX2A 1QIQA 1GNZA 2CH0A 3WX5A 1LOCA 3HOBA 4H7LA 4BDYA 2ZX1A 3H3UA 4FFIA 2JJ6A 1GWMA 4OIRF 4C9YA 1AYN2 3WF1A 4XLNF 2PFWA 4JDNA 1XB9A 4U88A 2XMLA 5H9RA 5CG9A 2HOEA 4TV7A 3IP4B 1CF7B 2XF5A 3LQQA 5EIYB 5BMZA 3V7CA 5I8YA 1C3HA 4UFKA 5FY4A 4P5YA 1OD5A 1RUI2 1B35C 2JG8B 2CO5A 1W8NA 3DCQA 4GWNA 2VC1A 5IVJA 3RWKX 3CJTB 4AE2A 1MDMA 5L9RA 3IB3A 4BE2A 2JPCA 1ZG3A 5FY7A 3NQOA 1J3PA 4DOUA 3IAPA 4Q27A 4OAYA 4XZPA 2RDRA 3J81K 3K4BA 2PA7A 1RGSA 3DLAA 2A3WA 2BYVE 1DGLA 2D6PA 2WFPA 2IGKA 2WL1A 1OLTA 4O65A 3ZQQA 1R4NB 5K7FA 1MS4A 3VKNA 3RKWA 3DECA 1GOFA 1LOFA 4FCYA 3F21A 1ZBE2 4LLFA 1CAXB 1DQ2A 2NYYA 3NNJA 3S57A 2F4OB 4WX9A 5KHHA 3MV01 4BY7J 4EROA 2ZBJA 4K1YA 1HDKA 1TQMA 1XDSA 1BK0A 3EQEA 1LVAA 3ZQLA 2R7DA 4UXAA 2JIGA 3P1IA 4BHPA 1CAUB 4Q1RA 3OYLA 3OD0A 3RSNA 3WOGA 4M3GA 1FBUA 2EZHA 4NE9A 1RC6A 2B45X 3IZOA 1CJDA 1SC7A 5AVAA 3SCHA 2V7FA 3DXTA 5KCMA 1DDNA 5J1RA 1MMSA 2ZHLA 1IRGA 2PI0A 4P9GA 5FPVA 2DOEA 1WJ5A 2XG3A 1RUF1 5FTTC 5G04L 5D8AA 2VPRA 1W36C 4AYUA 1Z67A 4B7KA 1IG3A 3NJYA 4L11A 2W1SA 1VBB2 1DYPA 1RIOH 2QJVA 2LR8A 1ZNPA 4Q4V2 2OT7A 2P3KA 2V1NA 4BMBA 1OT5A 1VBC3 4N90A 2TEPA 4MXWA 3OGRA 2QUOA 4XABA 1DQ1A 5EJ1B 1YG2A 1US3A 2CNAA 5KHDA 1RYYA 2Q8KA 4P55A 4XUPA 4XFCA 5EJCA 4I99C 2VQ0A 3ASNH 3U37A 3N7KA 3OY8A 1SD7A 4NO4A 5FPXA 2LBFB 2HWD3 1TME1 5JDBA 2R93J 1JYWA 3OSDA 3IWFA 1S0CA 1FWZA 1XSRA 1BCXA 4ZU4A 4LE3A 3VL8A 2VMFA 2MH9A 1U3EM 2VUJA 2HJIA 3C7OA 3K3NA 1FAYA 1ULDA 1YRNB 3AZZA 3WQ7A 1G59A 4RB3C 4A5NA 1WLCA 3MKLA 3SXYA 2YB7A 2VNRA 1MBEA 1PM7A 5JIAA 3TEWA 4PJYA 4P9YA 3E0JB 4QDRA 2XF7A 3ECOA 1U5IA 5L3EA 2EXJA 4A7KA 3UESA 3U9GA 3OBTA 3X2QH 5EG0B 2W00A 4A69C 4MX3A 2VG9A 5JAXA 4R9BA 3WUDA 1P92A 4AIHA 1W8FA 4HQEA 1UMZA 3C7JA 2CDPA 2K9ZA 1XCVA 9ANTA 3S3OA 2OYZA 2I5UA 2DN0A 5D5XB 4LR4A 1HSJA 3POYA 2B9VA 1CZTA 3BJAA 2R0QC 3TN92 5JPMB 3BTZA 1SFUA 4XXAA 4GMP0 1LHVA 2Y0SN 3RSJA 1RUH1 2M1BA 2ZB9A 5E1ZB 2JRMA 1WJDA 3WV6A 2VQCA 4Y5Z0 1GV5A 1B8IA 5D1IA 1ULFA 1OFNA 2HEYF 3KP5A 1FV3A 3DP7A 2YV8A 5CFCB 4P9XA 1MQTB 1PZ7A 2XGXA 1V4RA 4V2GA 3AL0C 2XONA 2Q0OA 2VOTA 4XJAA 1X8MA 2CYYA 4MGSA 3JBG2 4QB2A 1NH3A 1AXKA 4IL7A 3AKTA 3JRBA 3LPFA 1V6JA 2P3JA 4LKSA 5EEAA 1QA6A 2BNMA 1YE9A 4NIHA 5KXCA 3A23A 3IHUA 4CU8A 3HWJA 3V8KA 4MO7A 4COYA 3SC7X 2FBHA 2JA7J 4K20A 3CCQI 4ET7A 4ISRA 2PTMA 5LBFA 4O5VA 3K2AA 2X6YA 2XASA 4EJUA 1VFCA 5EG0A 4UW3A 3W6KB 2E2JJ 1GOHA 4XW3A 2AHQA 4LBQB 3G1OA 4FXGB 3CDLA 3A4UA 4MHGA 2GLOA 4QXBA 3RZZA 3TO9A 2Q8DA 1M06G 2JB8A 2L7FP 3DPUA 2R7XA 2WAOA 5HXMA 2NS0A 2CUZA 2XAUA 5GZGA 1ETKA 1LFPA 4OHZA 3B7MA 2VH9A 3FM5A 1R9TJ 5BNOA 3DEWA 3I4PA 3J26N 1QJX2 4OIOF 1PUFB 2QQAA 2KIFA 1COV2 4YZ2A 4OIQF 3I7DA 1KGYA 2E5ZA 3GZNB 2PMHA 1YI2I 2LTNA 3A22A 3ON7A 5J3UA 4Q4ZF 1CVNA 3POBA 1SVOA 2QBYA 3JUUA 4UVCA 5ANQA 1O3TA 5T5JA 1U8BA 2V4AA 1ZGJA 4DNCA 1UN1A 2JG8A 5KC5A 4IHYA 4UFMA 1D1CA 1UJ8A 1KD7A 4XZUG 5ILSA 5B66C 3BKZA 2J1RA 1JT0A 1HQCA 5L3FA 4HOOA 3ZXDA 4CPBD 3RZMA 1SAXA 5HLTA 4JDOA 4XFHA 3ULQB 4P96A 1W9SA 3I59A 3ZYBA 1GQPA 4LA2A 5HDKA 4M3CA 2BOLA 4BQWA 4ENMA 1PMIA 2E1OA 2X53S 4PI2A 5FPZA 1VI0A 2QFEA 2KM2A 4P9IA 4AUXA 3RZDJ 1HB3A 3R6SA 4WZFA 1NLQA 2DTRA 1K5MC 4CICA 4QM8A 5DPNA 3DUIA 3HTSB 5JLVA 1QOTA 3AYAA 5I0UA 2LKPA 1MEC3 4NROA 1OCPA 2TUNA 3PVBB 1L0OC 2RJ2A 2HYKA 1N47A 4BM8A 2NVXJ 1AL23 1TWCJ 2W95A 2NQYA 4KWKA 1B72B 1QQP2 5CEHA 4N9IA 1WJAA 2A6EF 5CPRB 3GXOA 4X6AJ 4YIIA 3ZYRA 4CDUC 3ASOH 3IH3A 5LCWL 5DZFA 4LO8A 3VHOA 4AI2A 4WVZA 3S5QA 2HVRA 5ICCA 1MIJA 4DGWB 1JZ5A 3VZNA 2MH2A 2FF4A 4D9JA 1E2XA 5FY9A 1AU7A 2XJTA 3KMHA 4JP0A 1W7PB 5G05L 1C28A 1O59A 1AKHA 4Q8KA 1UB9A 4KWJA 1LE8A 2VZUA 5IYBJ 1VQPI 1KONA 3S0MA 5FKOA 2AO9A 4J1XA 3VD4A 1G86A 4X1EA 3I3QA 3M8LA 4EM2A 3WNLA 4KH9A 3FXKA 1RUI1 1ZZ9A 4R52A 1IN6A 2Z3YA 5A32B 2TCTA 3VDXA 2LROA 2WQ4A 1ON1A 4XBQA 3V0AA 3L2WA 1ULCA 2LFBA 4PJJA 2XAJA 2CW7A 1Z91A 3BR3A 4IE4A 5BNPB 1H0MA 2R7UA 3GZUC 1DGWX 4O6JA 3LDBA 1SZBA 4GB33 5E3LA 2X5IA 2F4IA 4CU7A 3AP4A 1V6IA 3M07A 1U8RA 5KVRA 1HRI1 3T30A 1EV7A 3R4DB 1BZWA 1W0UA 3S5AA 3PO3J 1UY1A 3P5JA 1FPN2 4S2HA 3E5UA 1LKXA 1QU0A 4A6DA 1YQ2A 5A6ZA 4M6YA 4B48A 3JD73 4KDPA 2GMEA 1BJQA 3POIA 3CJIA 2DJIA 3W2WA 4S2FA 4Y5TA 1POGA 2VB6A 1J9IA 3HDDA 1PX4A 2DODA 2X0LA 4FO9A 5LK5A 3KHBA 1J3RA 5LK7B 2GC1A 4RM3A 3RZHA 1Z3XA 3FHIB 1HLCA 1OYYA 1ENSA 3GYHX 4Q5OA 2Y38A 2CQNA 1W8ZA 2Y0MA 5DG1A 4BQ4A 3MZ8A 2ADUA 2O8OA 3SITA 1NE4A 2CDOA 4HKWA 3OL4A 1ZRIA 5K1YA 4P9FA 3H3ZA 4FOQA 4HN0A 3BZCA 1DU0A 4KI5M 5HV0A 4UUTA 4FOYA 3K9TA 2P7VB 4CXXA 1EF4A 1OQEA 1OVPA 3JB4C 1AJOA 5TRDA 1JI8A 4AXOA 1IV8A 3BLYA 2ESHA 3WW2A 2YPDA 4G9SB 4A93J 1HV0A 2O03A 3WHUA 4JQFA 4EJRA 4HBNA 3JTGA 4KICA 4G94A 1PVXA 4XQDA 1Y4WA 2JSPA 3JZVA 3ABMH 4AK3A 4YM3A 4IOCF 4QX3A 2VTFA 3ZO0B 3KM5A 2IVJA 4CCEA 3LPGA 2FRHA 2X1DA 1JT6A 2OQ6A 1GP6A 3ZR5A 3P9KA 3KYLA 1UPSA 1JBCA 4QGNA 2ETHA 2R7OA 1WCQA 3BUCA 1ASJ3 2VD7A 3N9QA 5HODA 3I3BA 1MEC2 1C57A 4QPOA 1UX7A 3JSOA 2VZSA 4PCRA 5T5OA 2FOKA 1AR71 3DXJF 2JSCA 1O4TA 5E6HA 3B93A 5FQ0A 3I5UA 4LOCA 4DW6A 2HWC1 1Q8SA 2D6KA 4AEDC 2VNOA 3LEMA 1VBB1 3UGGA 1IS6A 3BG9A 1AR91 2DFIA 2RHPA 2EIGA 4KT6A 5JLWA 3D1NI 2IUWA 4NIGA 5FYZA 2K3FA 1YIOA 2DMQA 3T0BA 1LFBA 3K1NA 1N1YA 4QDSA 2UV1A 4HSRA 2KISA 3BR0A 3I2IA 1D8KA 2UZKA 2WAEA 1GMMA 3AFGA 2G19A 4KIBA 1F8VA 5DUUA 2L01A 2A6XA 4X6RB 1IPJA 2YBSA 3CO2A 1I6HJ 3GNEA 4PUSA 1GNYA 2HWE3 3HOUJ 3ZSKA 3QH6A 1J59A 4JQRA 1AJKA 1S0BA 1S29A 3K4MA 4MGQA 2UY8A 2W1OA 2IBDA 1W0OA 2D5HA 4EN9B 5HCAA 2VVFA 2X05A 2EZIA 2M4KA 2W39A 4UBHA 2WZR1 1XNKA 2D3SA 4XUNA 5BNOC 5DM7F 1JUHA 5IVCA 3RGBA 2LF8A 2ENRA 2RJLA 1ZX5A 3NJXA 1R083 5DAXA 2IS2A 1L3JA 2HXIA 3MF6A 4BPZA 4A3CJ 3H1CA 2WC2A 4AHYA 3AP9A 5A3WA 1U5YA 4AQSA 2GA2A 2OA4A 5FLXZ 3O1VA 4U87A 5T3NA 5GLUA 4CDGA 3K2ZA 3L7WA 2YFUA 3H9GA 4D94A 4QM9A 1ZRDA 3IDAA 3WGGA 4TXWA 1S9HA 3VYTB 4LT5A 3KV4A 4TTGA 1RUG1 1X7NA 2M87A 3ZDVA 3T1LA 2RMU3 3QH7A 1IV6A 3DF0A 2O5RA 1X1BA 3VZJA 2ZC2A 3T3YA 3KD4A 3HT1A 3U07A 5JSPA 3AZWA 1AYM1 1GZTA 1CIYA 1QDOA 3J4UH 3W58A 5JOZA 4PSWA 2A61A 2DA7A 4YG3A 3GFIA 3DN7A 3IUOA 4A3FJ 4LHLA 2IA1A 4W8JA 4FI9A 2V1XA 1NCRB 2Y0IA 2CW0F 4RAFA 4YG6A 1QQIA 4M01A 4YM1A 5EFUA 1HC8A 2JDNA 2JX9A 2FU4A 2WT2A 2XJRA 4IO9F 2M45A 1U5TB 4L9JA 5LZ6A 3ZMUA 2OZ6A 2BJSA 4P08A 3N35A 4CXFA 1SLBA 3ZYFA 1Z0XA 3H8OA 1KGSA 3BU0A 3ZQ7A 2VUCA 3HNYM 1EA3A 3WTVC 3NAUA 1HDDC 1AX1A 2WZR2 5GLWA 3M70A 5FZ6A 4RQPB 3BTAA 4F52A 4BGDA 5FZHA 1KDMA 1IXRC 3G4SI 2GXAA 2LRPA 4OHWA 2EV5A 4RHV1 4Z07A 2VE1A 2VBPA 5FUPA 2JDMA 4MQVA 2JTVA 1QJY2 3OYJA 5EEHA 4G9YA 3KS7A 4N43C 5K0UB 2HWF1 5JOWA 3LAGA 2RREA 1RL3A 2OPKA 3HYIA 5IPAA 4XUOA 4L9NA 2YZ4A 4ZS3A 4CHUA 2RR12 1WJBA 2ET7A 2OQGA 4J1WA 2DO7A 3QRFF 4GMP3 1VRH3 3ROUA 5FKBA 3KVAA 5JZGA 1UYZA 5FMCA 1QJX1 4P9JA 3DTEA 1XMAA 3ZLIA 2H1KA 3PIOF 1UU5A 3F8FA 3HG9A 3IH2A 4R4ZA 1OLQA 3S14J 3W5MA 4INDA 2VQTA 3H5NA 2LVSA 3RPQA 2ZJ2A 2F5CA 5F3EA 1PZ9A 3L2RA 3H5AA 1IKPA 3EYYA 4OAZA 2DCKA 4WM7A 4ZTFA 5F6LB 4W50A 3LEGA 4S04A 2VU9A 2ECCA 1WJEA 4E7KA 2QQJA 3J8F1 1BEV2 5JI7A 5KXEA 2DXIA 4GD4A 4FX4A 2ZGLA 1USTA 3W20A 2XLAA 3HBKA 4Z8BA 1Q3EA 1K12A 4U36A 3SCGA 3AL0B 3MVPA 4Q2FA 4RDUA 4ENKA 2PFBA 4M74A 4RR3B 3FE5A 1W4MA 5CAZA 2D7FA 4XLFA 1ZQ3P 3WQBA 3V56A 1K78A 3HJRA 1F43A 2IFRA 3TEXA 4BQ5A 1UY3A 3N9MA 2CWEA 2OW4A 2R0FA 3MZYA 4NDLA 2WWJA 3S7IA 4UV8A 4XDQA 1A31A 3AG4H 1RUH2 3CJIB 2ZXHA 1RXGA 3GALA 2UWBA 3T0AA 4XDPA 3BPVA 4AVAA 3IWZA 4OHVA 2K9NA 4IPAA 1LOFC 4B4CA 2F6CA 1IRFA 5I91A 3A0NA 2VMHA 1DF0A 3VN4A 1Y7BA 4P5OA 5A3PA 3GBWA 3NRVA 1MQTA 3V0BB 1H2KA 2AUYA 3O1MA 3VBFC 1W2UA 1L7RA 1RTVA 4COVA 2EFWA 5C44J 4PDWA 1OVSA 1W6MA 3VBRC 1WMDA 4LBOA 2E26A 2IA2A 2Y9ZA 3ELNA 4LG0A 3NSTA 5GM0A 2R063 2K9LA 3CO6C 4A5MA 1HRI2 3CDHA 3OGSA 1LKNA 1OUXA 2Y6HA 5K9YA 4YEJA 4CDXA 4IGPA 4JRAA 3FBIB 2EB7A 4N43A 3KYCB 2F4PA 2E7XA 2HBTA 2IVIB 2YYOA 3A02A 5D6EA 1XYNA 4AC0A 1XJAA 2E19A 3OYMA 1H89C 4HXCA 3OCPA 5CVRA 3R61A 3MBWA 3CCUI 1JYCA 4D7SA 1NHAA 1UG2A 2IGOA 1BI2A 3QAHA 4P00B 1X19A 2MW8A 1OD3A 4IRGA 4HRIA 4E9KA 5I8SA 4DQ2A 1RUE1 1CAWB 4BS9A 3AYEA 1ENQA 2CFXA 1FMVA 4AGVA 1VMHA 3J7ZI 3ZXSA 1IXSB 2QLZA 2LK2A 1C8M1 4EN7B 2J1AA 3J7MA 1P6RA 4ANJA 4E2GA 5ABJC 4JVAA 3BQZA 5FO7B 5LD2C 2QQNA 5FO9B 4OI2A 2E31A 5IT3A 3Q8BA 4HYEA 1OHFA 4IV3C 5IP6A 4CA9A 2ZGQA 4MUVA 3TNQA 1XDUA 3OPTA 4QKNA 5KHKA 1YCIA 2VR4A 4WXDA 3DEUA 1R1UA 4IF4A 4Q29A 4LLLA 1GWLA 3CKHA 2PLV2 2XJVA 3AZYA 2DYRH 4DZJA 2W4SA 4K7JA 1NQJA 2KPMA 1CAVB 4OOIA 1JKPC 1VTNC 2EIDA 3SZGA 1D4M3 3GZ6A 1TW3A 1NK3P 3EYIA 2PHFA 3PIGA 3ZR8X 1XMXA 1DUXC 1E17A 5APAA 3R0JA 3I64A 4RA0A 2CV2A 2WBMA 3KP7A 2ZX3A 3NARA 1UU4A 4XIDA 3RJ2X 4IQPA 4HF0A 2PAKA 3UGHA 1JMUB 4KYWA 1K42A 1YOVB 1YQ6A 2BVVA 4YGEA 3HOTA 2VOPA 4JC1A 3FDYA 1M1EB 1LGCA 3HOWJ 4PDWC 2F6BA 1WW7A 4PQ9A 3TBIA 3SFIA 5DCMA 5LEJA 3ZXFA 1MBHA 3WHBA 2LP0A 3WG7H 1O3SA 1ULPA 1TME3 3OOXA 4XLEA 1IHMA 1JHNA 3ES1A 1CN1A 3IMNA 1AL21 2ZFWA 4MEXF 2K9MA 2XRNA 1H1IA 2D5VA 2BE5F 1BN5A 4B8EA 5LHHA 3J7NA 2E7WA 4BAYA 4IEZA 1JZ7A 5GLVA 2GWRA 3VDBA 1GR3A 2P81A 4W65A 3JRHA 2M30A 2VCCA 5FZAA 3LB9A 2OZJA 2CJJA 2PELA 1WPKA 4S2GA 3RKYA 1MBFA 2WLPA 4FPFA 5FKCA 3LAJA 4NR1A 1RHI1 3GTPJ 4ZYHA 4KNYA 2RS52 1US2A 1JOBA 4AM3A 4I02A 3ZXGA 2XJSA 1HBXG 4M3BA 3PHMA 1IDZA 2GSYA 2W84A 1A8MA 1I5PA 2XLFA 1KU9A 1TEIA 3KEYA 3VWBA 2GAUA 4WXHA 4XR6A 1QJZA 3LDRA 3FKJA 2DI3A 1V3FA 2KRFA 1A6QA 5F8PA 3GYDA 4GKXA 1WD4A 1FYLA 3V64A 4A0XA 3S93A 5CYYA 4BLJA 2XUEA 4NRMA 4LMFA 2XBO2 3TDZC 1RZ4A 1X8EA 1MNDA 1J2XA 1I5ZA 3AYDA 2GIZA 4QKBA 4CCOA 4ZPIA 2HDWA 4DIQA 2DMNA 1XYOA 1WHUA 4OMZA 1OR7C 4ZYEA 4XJZA 2BBVA 4G6TB 3CDIA 4AYBN 3U78A 1AR61 5FKMA 4CRQA 3FLPA 4B1LA 2Z5WA 1VRH2 3OTFA 3I3LA 1W2OA 3WODF 4L92A 1PVC2 3LL7A 4AVSA 1YI9A 5DAVA 3PLQA 4EM0B 5DUKA 3CJQB 1JH5A 4GJZA 2ZKLA 4M9SA 2OUHA 2BXZA 3M1EA 3SHRA 2NVUB 1PGL1 5EF6A 3O8HA 3DTKA 4ETSA 4IV3B 2VIXA 4YFKF 4PDWB 3ZMSA 1RUG2 1B35B 3IM0A 4A44A 3L2CA 1B1BA 1V6KA 2VODA 2A6HF 4HLYA 2P17A 1OCTC 5DDJ1 3BR5A 3FXLA 2R072 3KV5A 3DKWA 4UOJA 1IS3A 1Y39A 4O7XA 2RM22 3WHTA 1DGRM 2AYHA 1QRYA 1PO12 2BOIA 3IRQA 1T0FC 1ZYRF 4MQ9F 2DDBA 1JJ6C 4TN7A 4O9GA 1ERDA 1PO23 2VZPA 4CYCB 2B46X 4CP9B 2XJQA 2O0OA 5A7WA 1PIV3 5LW9A 4AI9A 1H4HA 3LZZA 3F3XA 1R1VA 2ZGRA 2RS12 1EH6A 1D0YA 3KX2A 3CC2I 3K48A 3N7LA 1JHFA 2C4XA 1EH8A 1MBJA 1V9U1 5HNHA 4QU1A 3S1QJ 1PDNC 2BVMA 5FFXA 1BJAA 1JHHA 1GFF2 4LPLA 3SDBA 2OVUA 3M4OJ 3JSPA 3VPRA 3WF4A 3I49A 4RB1A 2X6WA 1QEXA 1BW5A 2C9KA 5DV5A 1XYPA 3T5XA 1GV2A 5FK8A 2UWMA 2D97A 1VNDA 1ULOA 4XHXA 2P6HA 3OS0A 5HS7A 2AREA 5JSOA 4ASMB 5FMDA 1O3QA 2W7NA 3VBHA 5EDNA 1XE0A 1XG1A 4IZZA 2BVBA 5A7WB 1YJWI 2O1QA 4XSZF 1CX1A 3H50A 4MHRA 1SVMA 2WNUC 4XIOA 1YIJI 2BY2A 4D0QA 3S2WA 2IS4A 4PIZA 5DDJ3 4UUSA 3HBZA 2GA1A 5FXZA 5F5IA 2CFOA 5FGMA 2RS33 5LRRA 2NZ9A 1XNCA 4BU2A 1WCMJ 3ZFFA 3WNMA 1JKRC 3FF5A 2HWB3 2QDNA 3CF6E 1OKQA 4HNUA 5F0FA 2G9FA 2V6EA 2G9ZA 4NAMA 1OLME 1VPHA 2L9LA 4HSTA 1CQ9A 5C5UA 5DYMA 1IGOA 3ZMDA 5ABJA 5JXGA 3ESWB 3HQUA 1HXDA 2DFEA 1SDWA 1QHGA 3HGGA 2I45A 2MD5A 4YVWB 2BGOA 3FXQA 2EZLA 3K4DA 3O6BB 2DAOA 3C7EA 5SV8A 4LBQD 1GUIA 2VBDA 5EPAA 5IFTA 4Q0SA 4HX4A 2VMEA 4UFIA 1DPUA 1V6OA 4BBSJ 4NQWB 1Z7LA 2D6NA 3JQWA 3RQ0A 4DUWA 4L9TA 1OXCA 4L0YB 1YYVA 2HTJA 3E97A 2M0CA 4Q4X2 2JUCA 1A3KA 3IH4A 2Z99A 3GXUA 1NYWA 3UKNA 3O8GA 4ZYAA 3EUKL 1RUI3 1BKZA 1X3WB 1P4XA 3U4XA 4DYRA 3EB7A 2WJSA 4CXWA 4WM8B 4OHYA 2VC0A 2JEMA 4YZ5A 1JUMA 3LSMA 1YQCA 1OYWA 1YW8A 3NAPC 5DAQA 2JD4A 4BQYA 3UKTA 2ARCA 2QZ2A 4DXRA 1RUG3 1JJ8C 3IIIA 2F5DA 4RQPC 4C30A 4FP3A 2IXSA 2ID6A 3CIHA 3L2UA 1MMNA 3C2HA 3A03A 5ICFA 1Z21A 1X3ZB 1RVF2 1LOBA 2HWVA 1OA2A 2DBNA 5FZ3A 4RD7A 4MTEA 4LUMA 3W5NA 1CF7A 3N9NA 4UUVA 3WQ1A 1TWFJ 1ODMA 4Y26A 5FYBA 4LK1F 3WF2A 2L9NA 4RB2C 4XM3A 1YFWA 2RC4A 4XURA 4JHTA 1PM4A 2H6CA 3DPLC 2Z9OA 2WO3A 1NCRC 1W6NA 3I2JA 2BGPA 2WR9A 2QZ8A 1W9WA 3B02A 3CUOA 2WSUA 2R6QA 1T6SA 3WGHA 4M00A 3S8PA 1W9YA 5FD5A 3ES4A 5FYUA 3WHCA 4E6KG 3C18A 2E1MC 1GBGA 4BJTA 3M3OA 2EZKA 1HB4A 2CSGA 2C26A 2QUFA 5A70A 4FPKA 3FXJA 3HQXA 1I1SA 2R5ZA 5F5AA 3IDEA 3T1BA 4Z1VA 4IEQA 2VTXA 3O12A 4X8NA 1WI9A 4B47A 4LK6A 1Z7S2 2W08A 3NJVA 2FBEA 2FQ3A 1JYIA 2RDNA 2P37A 4P9WA 3TP0A 2ORXA 3E7LA 4RB0A 2QSGX 5A80A 1UZCA 1V5EA 4K8RB 2EFNA 2BWAA 1JYXA 5B4XA 1CR7A 2K3PA 2GN7A 2STWA 1D8JA 2DT7B 2FXAA 5GZCA 2ZHNA 5JR3A 4WM7C 1OFSA 2HOTA 5A1LA 2J22A 2W1QA 3S1RJ 4OU0A 1QZYA 2YFZA 4Y22A 2DPDA 4FE4A 1Z7S1 3I58A 4BJ5C 3BGAA 3V7SA 2KR2A 3QYFA 1ETYA 1KDKA 1HQWA 1W3XA 2JA5J 3DKQA 4AZZA 5I0DA 5JUVA 4PLOA 3VZLA 3O1UA 4RS5C 2DCTA 2M0MA 1T6GC 4BYYA 3D5OA 4L9VA 2JVGA 3SLIA 3ABLH 3ZMTA 3BTYA 5F39A 1OQ1A 4JX4A 2B7EA 4FVVA 4C3HJ 2ZXQA 4R9CA 5BV6A 2UU8A 5AFEA 1FOD2 1PP7U 4M3EA 1WW5A 1OSGA 2WAQA 3ILRA 1AR93 1SACA 5F3IA 3G73A 2VE8A 4Y17A 4CDQB 2AH2A 4AQTA 1QO0D 2D1HA 4OZOA 3RZKA 3MWMA 2A73B 1RUJ2 1YRNA 2CRGA 4XQFA 3BVCA 1PGW2 3RYRA 1SCSA 2VW2A 5BPDA 4EEFG 2V4VA 1N77A 2HWE2 2QCOA 2TNFA 1S8NA 2XGEA 3UL2A 2HVQA 2HKOA 4AIDA 2XLGA 1R23A 2XXZA 4FFGA 4YVSB 2EIBA 3P6BA 1T08B 3NAPB 1KFUL 2W0XA 5EJZB 3ILFA 2P5BA 3MW3A 4C0HA 1RUNA 5FXXA 1KS5A 4XF4A 4LBLA 1OA3A 4V1PA 1BBT2 4KU7A 2PN5A 3G7DA 4HW0A 5HI0A 2VONA 1ENHA 2G7UA 1GUUA 5CU1A 4MFDA 2CS3A 3IIAA 2NYXA 4K40A 1H1MA 2BNNA 4RAGA 3U10A 1JE8A 1W06A 2DCYA 5BNNC 4EE2A 1OBNA 3TWIA 2XBO3 3LDKA 3VBRA 1KZHA 1Y9QA 3K3OA 5HV4A 5CKMA 3R4KA 2R073 1E3HA 4YRDA 4AI8A 2PLV3 4RS5B 5KHGA 4DXZA 3O2PE 4DMIA 5A33A 3VBFA 1LULA 3USSA 2VCBA 3CD6I 4GXLA 1URXA 2QBXA 3WDYA 1XGMA 2WN2A 1ST8A 3MKWB 2CSOA 2VBWA 1YX3A 4YNIA 3POSA 2PEXA 5JXIA 3BROA 3MEPA 5E3NA 2GN3A 3M3QA 1FNNA 3KQRA 2RN7A 3ALQA 2VL4A 3U0ZA 2O0YA 2JA8J 4MGKE 2OC6A 5A3NA 4XN3A 5K5RA 2KL4A 4CUGA 4PLMA 3VGIA 3PVNA 3N9PA 1FNZA 2L5QA 1PO22 4UB6C 3CDZB 4Q4X1 4UY8I 2CQXA 4RMNA 2K4JA 2I07B 3HQRA 1GKBA 4YWAA 3A01A 2K2SA 4Z2AA 4EWEA 4CCDA 5IVYA 2XJUA 4BE3A 2MYSA 1DP0A 2CG4A 2QA4I 3LOBA 1J0RA 4Y24A 1MGTA 1Z1DA 3DPTA 3S6PA 3SYTA 2W68A 1MZFA 1D4VB 1ZRRA 3ZPYA 4LLNA 2M5WA 1UY4A 2OV7A 4JTNA 3I4MJ 3DYMA 3GCMA 5C3PA 3A01B 3S15J 3WY6A 1O5LA 4AU7A 2IRFG 4ITVA 2FDGA 1PUFA 5AIPA 4AGRA 4G7OF 4XMAA 5DUVA 3VYUB 4RAYA 3WLUA 1X1CA 3VBUA 3B94A 5BNNB 3GCXA 4XLCA 1H88C 5J8FA 4KGQA 5CFCC 4A6EA 3OOUA 1XNDA 4MGRA 3PNYA 4ORFA 3F8MA 2OU2A 5F0CA 1RUD3 2ETEA 3OYIA 4ZZLA 4FPEA 4XJ9A 3A0KA 3WF3A 3J7YJ 4HL0A 4BQ1A 4Y33A 5J1XA 4IEWA 3ABTA 1IG0A 3K4JA 1BBT3 2MGQA 3F8BA 1FTZA 1OC1A 2JWTA 4IE7A 5DZGA 3WW1A 4BXSV 3IT8A 3Q0WA 2X8KA 1LEDA 3K2OA 4NHKA 3DEMA 2ZNZA 2CGOA 1ZK8A 4ESFA 4XNFA 1JN2P 5CQEA 1RMU1 4QPIA 4YZ3A 3LFUA 1ZBA1 4XN0A 1PUEE 5IVFA 5L3DA 4BQXA 1XC5A 2ZJQF 5EHDA 3WDWA 3OYAA 1UL9A 4UW4A 4BOWA 5F37A 2N8GA 3EUHA 5FZFA 2Q2EA 2B8MA 3ELKA 1TW2A 4YW5A 1FOWA 1A04A 4QPWA 3HN1A 3ZCOA 2LRDA 3PUIA 1UD1A 2HR3A 3O0XA 4HX8A 4C2UA 3NKGA 5FREA 3V7RA 4IV1A 2H8RA 1G6NA 4XQWA 2L2OA 3PQKA 2XH6A 1PGL2 3I54A 3MFKA 3VBOA 2MLGA 1RUF2 5IY5H 1R58A 1JUIA 4UFLA 1S2KA 2D44A 3BR1A 5JHFA 3WNKA 1SEUA 4M6XA 3VODA 5ICEA 1KRIA 2R30A 2VXJA 1RUD1 2YGMA 4G4FA 5FZMA 3WDUA 1LOEA 5T5PA 5DQ0A 5C33A 2WN3A 4FTHA 5DDGA 1R64A 1NLSA 3AVSA 2EILH 3GTGJ 4XHBA 1BBT1 3ETPA 1S3JA 4B3XA 1S7AA 3KWVA 4E7ZA 3C3WA 3PL0A 3TN91 3T08A 3G1MA 1R4MB 2XRLA 2XUBA 5EQUA 3S30A 2YR2A 3R0AA 4HKLA 2QDRA 1T8IA 1HX6A 1VAKA 5J48A 1BR2A 1VQ4I 2B42B 2EICA 1ZLJA 2ZSHB 5TGTA 1OPMA 2X09A 1FPQA 1ZYBA 4XF1A 1LENA 5A2QK 1RUOA 1PP8F 4Y1UA 2X1CA 5F2SA 3AFHA 2YU9J 1DG6A 4YGBA 4UVBA 4IQ4A 1NTCA 3D3AA 4XDOA 3MI8A 3QOEA 3AL6A 5JR7B 3ZFEA 2GXGA 1EYBA 2HWC3 1JGGA 4ARYA 1ZGAA 3PUSA 5GTIC 5FP8A 3IAS2 1POV1 3WEZA 3INAA 3HOVJ 3ACGA 2CL2A 3HL2A 2EIEA 2L9RA 5LGUA 4HBLA 1ONVA 5EV7A 1N1SA 4HETA 3OSGA 1TWHJ 3TO6A 4M4RA 4IUGA 3WE3A 3QOPA 1TLHB 1WCSA 3F72A 4DFSA 1SLIA 1O3RA 1W6PA 1UO9A 2L02A 2H0BA 3FC0A 4E7SA 5BS6A 3PMEA 1WMEA 3I2FA 1LDKB 2DFCA 4DJAA 5FUIA 3PMSA 4A3ZA 2WWSA 4U0VA 1C8M3 1UIJA 5F0HA 4FAHA 4LO5B 2IS6A 4XFFA 1O7LA 2Q8OA 4C2MJ 3G2BA 1RUH3 4CUBA 3MF9A 1QH7A 2K9SA 2GP3A 3HC7A 1D0HA 3Q8FA 3CNAA 1ETWA 2LKXA 2FHRA 4XXPA 3CBNA 5CYVA 3ZMNA 5FOBB 1F9KA 3GHMA 4CTEA 5B4NA 4J6GA 4GIQA 5A7NA 3OYBA 1R36A 1XBFA 3BU7A 3HPGA 2ZXJA 5LB6A 1JUSA 4Y3OA 4B29A 3QODA 2YUSA 4C3JJ 3PU8A 3KT1A 1WLWA 5JSRA 3OUHA 1W90A 3FHZA 3BWGA 1JHJA 1ZZCA 1YRZA 4A0ZA 1E3PA 1WA4A 4YVWC 1WGPA 2LLKA 5CA6A 1YYNA 3M7AA 1UY2A 4MGIE 5IAXA 3KCCA 3ATGA 4COUA 1FX5A 1HQNA 2M34A 2AGSA 3WP4A 2B7YA 4ZU7A 3HIFA 3WNOA 5CG8A 4F3JA 4ZDLA 1NG7A 3ZP5A 2P6TA 3ZPOA 1CQTA 4B3AA 2XSJC 2XF6A 3REOA 3BN6A 3O1TA 1CESA 3D0SA 5FLXK 2GMPA 4OZXA 3VZOA 3ZVXA 1Q8QA 3K4AA 3OYFA 3WU2C 2VOXA 3SEQA 1LOGA 4OQ9A 1YQ5A 3WCRA 5GAEJ 4D3WA 2DUQA 3NRUA 5L3GA 3AYCA 3GJAA 2V09A 4DS0A 3JAMK 1BXHA 1C8M2 3GF2A 3MKZA 1C8NA 2JE7A 3WU1B 1W36D 3VZKA 2QKMB 5LBQA 5HCBA 3H3VK 1W6OA 1FT9A 3I2HA 1MH4A 2JMWA 4N7IA 3KF5A 1FBQA 4RAZA 1MZ5A 2OCCH 4ES9A 5LGNA 5J96B 2SLIA 1W1WE 2E2HJ 1RB8G 4AFDA 4A12A 4Q4W3 2BWCA 5DUXA 4OUMA 2STTA 5FZ0A 2G7HA 3J7LA 2DA1A 1RUC1 2ZABA 2VM9A 5A32A 2ME0A 3VBHB 5T54A 2XKOA 1Y0NA 3KP3A 1GYKA 4EQVA 3PUAA 3CUQA 5LHIA 5BQTA 4II2A 1W6QA 4RQPA 3I2DA 3LNQA 3B9CA 4Z82A 2CAUA 2O7OA 4R1HA 3MYXA 5DDJ2 1AR63 1K83J 1LE8B 2AZ5A 4QPGB 1SBEA 3VV1A 4FISA 3UNPA 1MEC1 2BDRA 5E8IA 4YFXF 2BXYA 2E35A 4AG4A 3KYDB 4ZZ5A 3GW2A 5BPXA 5EXOA 1FBSA 3BODA 2F4MB 1J1TA 5F1JA 4HG2A 3DEEA 3ZN6A 1FLIA 5JI9A 1S2EA 5CFDB 5K7PA 2HWF2 3T8TA 2A6YA 3SQNA 4B44A 2HWB2 1S6LA 4CDUB 2VZRA 1RI7A 4HF2A 1ZZ8A 4Q1PA 4XQ4A 4PGGA 3E3VA 4EJVA 2XAFA 3FXOA 1AYN3 4MGZE 3CCLI 5FYCA 4TLGA 1I3QJ 5F1RA 2IGNA 3OBAA 1OCRH 1GWKA 1IC8A 1O4ZA 1GANA 3ACIA 2MABA 4E4DX 1GZ9A 4QSHA 4E27A 1QGLA 5D8LB 1VBD3 3CMGA 3RZJA 4IRHA 2HEOA 4LHNA 5JCTA 2M3AA 2J1UA 2RS13 2ZACA 3FK6A 4YFZA 2G0EA 4NBQA 4AFMA 4NHLA 1NK2P 2Y69H 3T1MA 3BQYA 2ZBKA 3HPHA 3POGA 3OYWB 2KDZA 4NOTA 1OMIA 1U5TC 3QU3A 3L2HA 1H1AA 2VOOA 3GMEA 2DTWA 2GC2A 5IAVA 3T09A 2DVBA 1H2NA 1ZR2A 3WU0A 3NJZA 1V6MA 4CP9A 3N7JA 2E2IJ 5JVGF 5IJRA 2M7AA 2P1BA 5FYYA 2KQRA 2YPJA 3CZUA 4PF5A 3GTLJ 2BW8A 2XVLA 1VP6A 4BIFA 5CB7A 2AQEA 5JMCA 4NPMA 4KIFA 4JHZA 1AL0G 2VZ1A 4GALA 3VBHC 2G9WA 3LOIA 2UYAA 3BR2A 4GXOA 1JZ3A 1JGSA 1OH3A 5J1UA 1DYOA 3IN9A 2BW3A 2FDIA 4CZSA 2EALA 1DYKA 2XWJB 1ZREA 5BNPA 2MEV2 2FSWA 1RVF1 5C6CA 1UHSA 1LUJB 1N3QA 1YQ8A 3VYRB 4XTMA 4NHYA 4L9BA 5C8CB 3ZQCA 1R22A 3UETA 2GMMA 4LEJA 1TZLA 2DBIA 4M6VA 2YDEA 1L7QA 5A6XA 3HEIA 4YSFA 3J8F2 3EBRA 4YM2A 3C7HA 4ZXEA 3L1PA 2OX0A 4BLIA 4PDKA 5DAWA 5CVIA 2A6ZA 3I3MA 1VZ0A 1PVC1 1QU3A 3VDDB 1R1A1 3CLPA 1B9NA 4LFUA 3OIQA 3IKVA 1HJGA 2WT0A 1KYWA 2DW4A 3MLKA 3POWA 1PJRA 3WW3A 1YJKA 2WB1A 4KITB 3TOAA 1W7PD 2WADA 2ZA9A 5FY5A 2VBBA 2LMDA 5FZ4A 4AVCA 2OXBA 3EJKA 3L2QA 3PO2J 2KXLA 1VQ7I 2JK3A 1N3PA 5BY5A 3WG3A 3ZQHA 2XJPA 1Q1HA 2EFOA 2NS7A 4LIUA 2EPFA 1DU3D 1XNAA 2CAVA 4CDXC 3FBYA 3WW4A 2QENA 2CGPA 1OF4A 1W5SA 1QNWA 2FCVA 4A7ZA 1ACIA 1MVEA 1ULEA 1WD3A 1VQ6I 3JXSA 3PJYA 2HEWF 2W1UA 4I7HA 1DZTA 1BOBA 1OFCX 1S0DA 3CCSI 2A71A 2ZX4A 2D5FA 4KA4A 4LG0B 2FUG2 5DD4A 2D93A 2PLV1 1EJ9A 1AR73 4CP2A 4AEJA 2VW1A 2IXCA 1P4WA 4QX5A 1OCCH 1MS1A 2HYJA 4IEJA 3RDIA 4WVVA 2DFHA 1AHSA 3OWTA 1T33A 4BCUA 1AXYA 2L7KA 5C71A 4FCAA 3MPPG 3JR9A 1NG6A 1PK6A 1UELB 3TBDA 4B4RA 2LH9A 3WGIA 2Z42A 1COV3 3Q9OA 1Z7UA 1XE8A 4HONA 2PMZN 2TDXA 5F27A 3K4KA 1XSDA 2E7TA 4FPJA 1FOD3 5EYXA 2AXTC 1QXJA 3A1YA 1XOYA 1S7OA 2JUGA 1MMDA 5DTDA 2WRAA 1Y56A 3LSGA 5KK1A 5J3LA 5M0TA 3GO5A 3Q0UA 2VNVA 1IRZA 1J83A 1GP4A 2K85A 1MVQA 1CAVA 3FX3A 2Q2EB 3ML6A 2LNBA 4OULA 5JWPA 1YNAA 4B7EA 3C2GA 2GNDA 3DGTA 2KKOA 4DQAA 2R062 1Y0UA 1QJFA 2WZPP 1NUKA 2WBKA 1KA8A 1V55H 1TT0A 5EWSA 1N25A 2CUEA 4HT1T 1YLFA 5FYTA 3WT3A 2P2KA 4HPKB 4FETA 3TDUC 2QQVA 3TP3A 3A0HC 3COAC 5HVQC 2R043 3PNTA 2DTYA 3IDBB 4NQWA 2W2IA 4XSXF 2Z16A 2JDUA 4N43B 4HQMA 1SMVA 1UCRA 1X9PA 4BHCA 1VBC1 3SFZA 1FPN1 4FPHA 4DRRA 2FMDA 4EGYA 2DF7A 1UMIA 1AR92 1QNYA 2OD5A 1AX0A 3OEAA 2P4WA 1GT0C 1AKHB 4UF0A 4BQ3A 3E6MA 2MSYA 4HKOA 4RLFA 3MICA 3OYWA 3ZRGA 3ZN6B 4UI9L 1S0EA 3WSOA 3TYJA 2XAGA 1Y8RB 3E6DA 5FRNA 4XOPA 1AR81 3ETQA 3AMQA 3O1PA 4EM1A 1GNHA 1NQDA 4JGYA 4F55A 3CQOA 4QWNA 4M3DA 4RGKA 3H36A 4I0WB 1C1LA 1UW8A 5EJ3A 5F5QA 3E5QA 1R1ZA 4CP0A 1C0WA 2Y60A 3JB8A 5SV5A 3LMMA 2IS1A 1XE7A 4KBZA 3W2VA 1XX5A 3H7JA 4K6BA 3M1CA 5GP9A 1F4KA 1J84A 5FYVA 5E3OA 3CUQB 1A8DA 2RM21 5E1XA 3IDCB 2EA4A 3JRIA 4Z2YA 4CZZA 1F36A 4HSLA 4QX1A 2HYGD 2GZWA 1UAIA 2HWC2 1TMF1 4AFCA 4BXUA 1UZWA 4X8PA 3FL7A 1RC9A 3L2YA 2EINH 3EXUA 3CMEI 1ZG5A 5FMOS 2WNUA 4ZZDA 1HB1A 3OR2C 3QQAA 1J5YA 1YFUA 3RI4A 4UVAA 1BEV1 2VI6A 4XF3A 1O8SA 1QDCA 5LBBA 4GH4B 1A36A 4JDMA 2QGUA 2EIMH 2YS9A 2R1DA 1PIV1 1VQ9I 3HEFA 3AMMA 1UX6A 4MTDA 4L99A 1LGBA 1S55A 3F22A 4FOWA 1FPN3 4E4ZA 2R5YB 1W6QB 1VE0A 2NVYJ 5E8AA 3ZSEA 1BK1A 2VVDA 1BM9A 3GWZA 3EMRA 2A7AA 5FBJA 1TBXA 1S2BA 4UW6A 5I0SA 3P9CA 5DABA 4U0YA 4QQPA 4KT5C 4DZPA 5C4WC 5FZOA 2K02A 3A2KA 3OG2A 2OAZA 4PK4A 2FE3A 5J1YA 1GZWA 3RYKA 2AR6A 3OYEA 2D6OX 1EPWA 4PBPA 1FI2A 3AMNA 1POV0 4Q4Y1 3ZKYA 3P7NA 5E1RA 2O8XA 4Q48A 5M3MJ 5CKQA 1VB2A 5J4YA 4CEWA 1G3SA 3Q8AA 3JD71 4JCKA 1EY2A 5HLIA 3BTJA 1VMFA 4RN5A 3MLJA 2DV9A 2Q4SA 1BOAA 2WO2A 4N8MA 1LESA 2PMUA 1KQ8A 4GRIA 1HIXA 1IAWA 2XGCA 2A3SA 4HA8A 4YVSA 5IUQA 2AXLA 2ZHKA 1MACA 1POV3 4A3BJ 3ZSJA 1HRV1 1R5HA 5GKAC 3QACA 2XUMA 2RS32 1DDLA 3IBMA 1ZZ7A 1F31A 3NV3A 1LEAA 1K5MB 4IETA 1JXSA 3NQHA 3KGLA 2O61A 2A3XA 3RYPA 3U21A 3SISA 1BEV3