1RUD3

Rhinovirus 14 mutant n1105s complexed with antiviral compound win 52084
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
236
structure length
236
Chain Sequence
GLPTTTLPGSGQFLTTDDRQSPSALPNYEPTPRIHIPGKVHNLLEIIQVDTLIPMNNTHTKDEVNSYLIPLNANRQNEQVFGTNLFIGDGVFKTTLLGEIVQYYTHWSGSLRFSLMYTGPALSSAKLILAYTPPGARGPQDRREAMLGTHVVWDIGLQSTIVMTIPWTSGVQFRYTDPDTYTSAGFLSCWYQTSLILPPETTGQVYLLSFISACPDFKLRLMKDTQTISQTVALTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords RHINOVIRUS 14
publication title Structural studies on human rhinovirus 14 drug-resistant compensation mutants.
pubmed doi rcsb
source organism Human rhinovirus 14
total genus 37
structure length 236
sequence length 236
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1995-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1rud300
1AL23 2ZZQA 1NA1C 1R091 4GH4A 4Q4V3 5DDJ1 5C9AC 1RUC3 1PIV2 1RHI1 1PO21 5ABJA 1AYM1 2R071 1RVF3 1VBE1 4Z92B 4AEDB 3ZFEA 2HWD2 5L7OB 5C8CA 1RMU2 4IV3A 1AR71 4Q4W2 1W39A 1RUE1 1QJX3 2HWE2 3TN91 4CDUB 2R043 5BNPC 1V9U3 1PGL1 1BEV1 1VRH2 1ZBE3 1NA1B 2RMU1 2WS93 3VBSC 5C9AB 2HWD3 4WM7A 4Y5Z0 3CJIC 3J8F3 2Y26A 1HRI3 4GB31 2BBVA 1ASJ1 1Z7S2 1NCQC 1ZBA3 4JGZC 3JBG3 1QJU2 4N43C 2X5IC 1BBT3 4CDQC 1RUJ2 1VBD2 5BNPB 1VBC2 4JGYC 1POV3 1WCDJ 5L7OA 3ZFFB 2HWE1 4QPGC 2XBO3 1VB2A 2HWB1 2WWSA 3VBHA 1E57A 2HWF1 4Q4Y2 1EV11 4GH4C 5ACA1 1TME2 3CJIB 4CDUA 1OPOA 4QPIA 1QQP1 1R081 4Q4X3 1RUF3 4RHV2 2BFUS 5ABJC 2RS13 1NA1A 1AR62 2RS52 4JGZB 3ZFEC 1VB4A 1RUH2 1MEC1 1PO11 5C8CC 1EAH2 4IV3C 4N43B 2X5IB 4LLFA 4YVWC 1AYN2 4CDQB 2WZR3 4GMP0 1RUI1 4JGYB 5C4WA 2GSYA 1FMD3 2GH8A 2RS32 4QPGB 2WFF3 1AL0G 1R1A2 4GH4B 1RUJ1 3VBFB 1TMF1 2TBVA 5AC91 1AUYA 1R092 1VBA1 4WM7C 1FPN3 5BNPA 1A6CA 5DDJ2 4CDWA 5ABJB 3VBUA 3ZFFA 3HAGA 1RHI2 5CFCB 3ZFEB 1PO22 1AR83 1AYM2 5C8CB 2R072 5J98B 1VBE2 2XPJA 4YVWB 3JD73 1D4M1 4FTBA 1AR72 1RUE2 1HXS1 1COV3 1EAH1 3TN92 4JGZA 5A33B 3VBHC 1H8TA 1PGL2 1BEV2 2X5IA 4WM7B 2RMU2 1QJY1 4QPIC 1AR91 3NAPA 1RUD3 4Y4YA 4GB32 2IZWA 1ASJ2 1FOD3 5D8AB 3VBFA 5JZGC 1HRV1 3FBMA 4RR3A 3VBOB 4CDXC 4RQPA 2RR13 5C4WC 5CFCA 2RM21 5A32B 4BCUA 3VBHB 4CEWB 2BUKA 4YVWA 4QPIB 2HWB2 1VBB1 2HWC1 2MEV1 1ND2A 2HWF2 3LOBA 1EV12 2DF7A 5ACA2 1C8M1 4CDWC 1QQP2 1R082 1PIV3 4IV1A 1OOPC 3VBUC 3ZFFC 5A33A 1QJZA 1PVC1 1RUG1 5JZGB 2R061 2BPA2 1RMU3 2PLV1 1MEC2 1PO12 4Q4W3 4CDXB 1AL21 2ZAHA 2HWE3 4Q4V1 2BFUL 5C4WB 2FZ2A 1RUC1 1RUI2 5D8AA 4GMP3 1H8TC 1VRH3 1RVF1 3VBOA 3NAPC 1B35A 4CDWB 1TMF2 1CD3G 5K0UA 5AC92 1OOPB 1VBA2 3VBUB 4CEYA 5A32A 1MQTA 1QJX1 4CEWA 1SMVA 1Z7S3 1NG0A 4WM8A 2R041 3VBFC 1V9U1 1GFF2 4RR3C 1ZBE1 1QJU3 1IHMA 2WS91 4RQPC 1D4M2 1RUJ3 5CFCC 1VBD3 1VBC3 1HXS2 3J8F1 1HRI1 5JZGA 1TMF3 1H8TB 4PDWC 5FMOS 3ZFGA 5J96B 4Q4Y3 1ZBA1 1ND2C 3NAPB 4CDXA 5BNNA 1TME3 3JBG1 1QJY2 4YVSB 1AR92 4RHV3 4IV1C 1BBT1 1X33A 1DDLA 1AR63 2RS53 1RUH3 1HXS3 1POV1 1X36A 4RR3B 1EAH3 2XBO1 1HRV2 1OOPA 4RQPB 1AYN3 4N53A 4Q4X1 1RUF1 5D8AC 4PDWB 2RS33 4FTEA 2RM22 4SBVA 1PGW1 1OHFA 1K5MC 1R1A3 2RS11 1ND2B 5BNOB 1NY71 3VBOC 1B35C 1VBB2 1R093 2HWC2 2MEV2 4IV1B 5K0UC 1F8VA 4CEYC 3S6PA 5DDJ3 3M8LA 1MQTC 1C8M2 4CEWC 2WZR1 2QQPA 1F2NA 1ND3B 1RHI3 4WM8C 1PO23 1AYM3 1FMD1 1PVC2 2R073 1RUG2 5LK7B 4FTSA 1VBE3 1BMV1 2WFF1 2R062 4EJRA 2PLV2 4YVSA 1AR73 1NCRC 1RUE3 1AL22 4Q4V2 1FPN1 3TN93 1K5MB 5CFDA 1RUC2 3ZFGC 1BEV3 1AR81 1B35B 5BNNC 1VAKA 2RMU3 5K0UB 1RVF2 4CEYB 5FOJB 1MQTB 3JD71 4PDWA 4GB33 4WM8B 1COV1 1ASJ3 1QJX2 5BNOA 1NOVA 2R042 1V9U2 3JB8A 1NCRB 4N53C 1ZBE2 1CJDA 2WS92 1ND3A 1RUD1 4FSJA 3ZFGB 3J8F2 1HRI2 3DPRC 4RFT0 5BNNB 1FOD1 2HWB3 3VBRB 2HWF3 1EV13 1ZBA2 5ACA3 3JBG2 1QQP3 1R083 1HX6A 1K5MA 1HQNA 2RR11 1BBT2 5FMOL 4N53B 1MEC3 1PO13 4YVSC 2XBO2 1RUI3 3DPRB 4Q4X2 4RS5C 5CFDC 1PIV1 1RUF2 4NWWA 1PGW2 2ZTNA 2RS12 3VDDC 1NCRA 2HWD1 3ZXAC 1NY72 1RMU1 5AC93 1VBA3 4Q4W1 4AEDA 2WZR2 3VBSB 5BNOC 4GMP1 1FMD2 3VBRA 1VRH1 1BMV2 2WFF2 1NCQB 3IDEA 1D4M3 1ND3C 4RS5B 5CFDB 3JB4C 4NWVA 2VQ0A 1FPN2 2WLPA 5C9AA 1Z7S1 3VDDB 1RB8G 1M06G 1AR82 1QJY3 1QJU1 1AR93 3DPRA 3JD72 2FZ1A 1POV0 1VBD1 1VBC1 1COV2 1HRV3 4Q4Y1 1TME1 3VBSA 4RHV1 4IV3B 1RUD2 2RM23 3CJIA 1AR61 1NCQA 2RS51 1RUH1 1FOD2 1VBB3 2HWC3 2MEV3 4RS5A 4AEDC 5L7OC 1AYN1 1C8M3 4N43A 3VDDA 2RR12 4CDQA 1PVC3 4CDUC 1RUG3 2RS31 1C8NA 3VBRC 5GKAC 4JGYA 2R063 1R1A1 2PLV3 4QPGA
chains in the Genus database with same CATH superfamily
3WF0A 2ZZQA 4N7UA 1R091 5JPMB 4GWNA 1HIXA 2NMNA 5DDJ1 3OCPA 4KG8A 1WLCA 4AW7A 1AX0A 3M1HA 3OF1A 1PIV2 5I0UA 3VB9A 2ZGPA 1VMHA 1JHJA 3WINE 4DPNA 2R071 1EPWA 2X29A 4QD2A 4FXGB 3KHCA 2EIBA 1OLQA 2W91A 4AEDB 2P3KA 3LCPA 1QWRA 5L7OB 5KXCA 2FDGA 4FPCA 3FE5A 1NKGA 1POQA 4Q4W2 4DO0A 1RUE1 2JE7A 3NKGA 4CDUB 3GCXA 5LA1A 5IWFA 3FBYA 5T5PA 4MGYE 1HLCA 1KQRA 2XHKA 4PHZA 1V9U3 4OHZA 4CXYA 4M3CF 1LU2A 2NPIA 4C8DA 1NA1B 4M01A 2ZMLA 4AGGA 2PQSA 4P9WA 4LBQD 2F6BA 2OQ7A 2D6LX 2HWD3 4LTAA 1GNZA 2H0VA 3CJIC 4OULA 2Y0OA 4Y5Z0 2Y26A 5FQ0B 1IQDC 3NJXA 2X8KA 3TEYA 5A3OA 3VHRA 1ASJ1 1VIWB 3AYDA 3LEMA 1Z7S2 2W1SA 4FO9A 5FPZA 1FAYA 3IAPA 3MGUA 2JDKA 5F7UA 4Z2AA 3SEPA 5K4LA 1LR5A 5CISA 4W8JA 4JGZC 1OQ1A 4MGQA 4HN1A 3K3NA 2W5FA 4JDNA 1JOJA 2X5IC 2VCMA 2Z2SB 3NKTA 1GOGA 1XQNA 3KMHA 4WZCA 5LBCA 2VBBA 5FZEA 5I0TA 1XNBA 5BNPB 5C71A 5FO8B 1W8WA 2QKDA 1V0AA 3ZYJB 4BMEA 1UX7A 5L7OA 2EXHA 2Y6FA 3R05A 2HWE1 2NQYA 3VBHA 1H30A 2VY0A 2A6VA 1TEIA 1EV11 3KCCA 2JEMA 4CDUA 1OPOA 1UL9A 4N7IA 3DYMA 2Q8OA 5I8SA 1QQP1 2B7YA 4BISA 1OMIA 3M3EA 2VC9A 1J3PA 4RHV2 1JZ3A 3NQHA 2BNOA 2VR4A 2QCSB 3MIEA 3OPWA 3QBQA 4MSVA 1NA1A 3LDBA 4LO8A 5BNQA 4CSWA 1VB4A 1DZTA 3WDUA 4EN0A 1PO11 1EAH2 3BOWA 2QQOA 2FHRA 2W94A 3AVSA 4IV3C 3VZJA 2GU9A 2WNVB 5EYXA 1GWKA 5FQ0A 3ZXDA 4GMP0 3F95A 1LESA 1Y9MA 1O3RA 1PZ9A 4IESA 4A2UA 3MUY1 3A21A 3CDZB 3CZUA 3WG3A 3BTXA 3RZJA 3EBRA 4QPGB 3RDIA 3CKHA 2WFF3 5IUQA 4ASMB 1R1A2 1RUJ1 3AP4A 4GA9A 3O1RA 2BBAA 1QMJA 2VUCA 4Y5TA 2GC1A 4XFHA 3RZGA 1A78A 1AUYA 1W6PA 4FFHA 1FPN3 3IDCB 3H8OA 2O8OA 5BNPA 2QNKA 5A7WB 5ABJB 3DEMA 4NR1A 4DXRA 2FCVA 2VW2A 3QOPA 2Y6LA 3HAGA 3M3IA 4XUQA 3ZFEB 4E2GA 4BDVB 1OXCA 1PO22 3B00A 3K51A 4L97A 1AYM2 1NLRA 4AHWA 3WCSA 3MEPA 5J98B 1VBE2 2WA3A 5LK5A 3ACHA 2BEOA 5FWEA 3D0JA 5A1FA 5C3PA 2XKOA 1WZXA 1D4M1 5FJHA 3ROUA 1AR72 2CY6A 4IEZA 2ADDA 3IWZA 1H2LA 2PHTA 2X05A 3TN92 2ZGTA 4BLJA 4AQTA 1WCUA 2KM2A 1LHOA 1FATA 2KA3A 3KHBA 1EUTA 3ZXJA 4QX3A 1ZA7A 3MHZA 1Y3TA 1PGL2 4ZZ5A 5FYYA 1BEV2 2WNVA 5JWPA 3WLUA 1W28A 3PUHA 4N9HA 1CN1A 3WZ1A 1S55A 1FX5A 2IC1A 4P9XA 2DDUA 1JU4A 2LRPA 3AMMA 4GB32 4QGMA 4YW6A 1YFXA 5KHGA 3LKJA 2PHWA 2VO5A 3UJOA 4FOWA 4BQ3A 5D8AB 4RL7A 2ADEA 4BQXA 2B42B 1E5IA 3O7OA 2HEYF 3RMYA 3CHXA 5JZGC 1HRV1 3I2IA 3CMGA 1STMA 4AHYA 4RR3A 4XFFA 5CG8A 5A7WA 1R1ZA 2ZGLA 4TSVA 4PIXA 5FZHA 5JIUA 1GQPA 2GC2A 2VBPA 3ELNA 3HQRA 1ZRFA 3D3AA 1KD7A 1W3VA 1ULFA 2IVIB 2C1FA 2BUKA 4XETA 5TSWA 5LZ6A 1DBNA 1C4RA 2GP3A 3W5MA 4QB6A 4QPIB 2HWB2 4FFGA 4HVQA 3K77A 4QMAA 3QCWA 4PCRA 1ENRA 3HBZA 3SXWA 3LIGA 1KXGA 1J59A 4DUVA 1W05A 5ACA2 5HCAA 3LOBA 4GIQA 4CDWC 2DCJA 3U14A 4C91A 4AI2A 3I2KA 5FP4A 3VBUC 1QJZA 2K0GA 1YUDA 2W9XA 3PHMA 3PIGA 5C6CA 3H3UA 2Q4SA 1YRZA 4XDOA 3TWIA 2BPA2 2PLV1 4UXAA 2XDVA 1ALYA 1IS4A 1T6BX 4CDXB 1AL21 2ZAHA 1JYXA 2HWE3 2BFUL 4FOQA 4BIFA 5ANQA 1CGPA 4PBOA 1SLLA 2A7AA 1RUC1 1RUI2 2D98A 5D8AA 3RZKA 3QACA 4AOCA 1V00A 2RDSA 3WNPA 1H8TC 4CU7A 3PU8A 3VDCA 1RVF1 2FCUA 1DP0A 4A44A 1LHWA 3MUZ1 1OKOA 1K5JA 4IEVA 1CAXB 3RYKA 1CAVB 1VBA2 3WF1A 4YFZA 4LHLA 5AC92 2A3XA 2DUQA 1CX1A 2B9UA 2JG9B 1AXKA 1QJX1 2NZ9A 1WCQA 3UL2A 2EF6A 3J4UH 4YFWA 5FY7A 3O1VA 2GALA 3VBFC 1CIWA 5JIAA 1W9TA 1GFF2 1Q5OA 2DVAA 4AEKA 4BLIA 2NLRA 2Z79A 1QJU3 3BN6A 4FQ4A 5JXHA 5E6HA 1K12A 1O5UA 1U0AA 2WS91 4XCBA 5LY2A 3TEWA 3VKNA 3OSDA 2BNMA 1RUJ3 5CFCC 4CP1A 1VBC3 4I0BA 1Q8QA 5T5OA 5FZGA 2EIGA 2JDMA 2Z69A 1W3XA 2PHFA 4YG6A 5FZ8A 5F37A 1QXJA 1J3RA 1OI6A 1H4HA 2VW1A 5J96B 4Q4Y3 4CDXA 3NAPB 4IE7A 4CP9B 1TME3 4GZ9A 1JYNA 3JBG1 3ZMOA 1DGWA 1AR92 4OI2A 4PIZA 4IV1C 1CZVA 2I07B 4S2FA 1BBT1 4C1WA 2W3JA 3AC0A 1JYWA 1QXRA 1XE8A 2OPWA 4AXOA 1RXGA 3ZSLA 1IKQA 4BWOA 3ZVXA 1RUH3 1POV1 1GOHA 3AP5A 3P3PA 4RD7A 2ES3A 3OEAA 5FY9A 1I5ZA 3VHPA 3VD3A 4B29A 2XBO1 1W2NA 2Z4FA 1CAXA 4FFIA 3BUCA 1SFNA 4AVTA 1DZRA 1AJKA 1ENQA 2JG9A 3N9OA 3RG0A 3WR0A 4IW3A 4Q4X1 4JKMA 4XFIA 4U2AA 4Q5OA 4OI1A 4SBVA 3WQ7A 4HXCA 3SCFA 3WG4A 3O1PA 4QAWA 1DHKB 1ND2B 4QPWA 4CCCA 1GR3A 4GWIA 1UO9A 3HD8B 1M4WA 3MLJA 3LGRA 3BOPA 3AYAA 1HKDA 3ZYRA 3MO4A 4FAHA 5CBLA 3PURA 2VZPA 2VOVA 1MQTC 1C8M2 4XACA 2WZR1 2C4XA 3WHTA 1RHI3 3V56A 4JZRA 1RYYA 1PVC2 3ZXGA 2WAOA 2YUEA 1O8PA 3KCYA 4GAZA 5JVVA 3ZIXA 4C1XA 3WF3A 4CP9A 1SPPA 3DGTA 3R4UA 4ZZ8A 3F2ZA 1PVXA 1LENA 4AFMA 4HN0A 2BZDA 2D3PA 2TNFA 2XXZA 4Y1YA 1NCRC 3T2TA 5LBFA 1V6IA 5HXVA 4JKLA 2XJQA 2J1AA 4X6RB 3ZXFA 1V70A 1RITA 1ULDA 1XBFA 2VVDA 4HOOA 4XXAA 3ZYHA 4QXBA 4AQ6A 1K5MB 4BQ4A 3NJZA 1CWPA 4L11A 1XC6A 4K1YA 3ZFGC 3T0DA 3HT1A 4QX7A 4LK7A 1XNCA 1HJFA 5BXXA 4QHBA 4QB1A 1VAKA 2RMU3 5GLTA 3KV5A 5D21A 4CEYB 1W8HA 3BKZA 2FDFA 4CPBD 3IKWA 3JD71 2W08A 3N9PA 1GNYA 4YM0A 4WM8B 2E7QA 3LDRA 2VMEA 2G1MA 2BW8A 3WP5A 4W50A 1OLRA 2VW0A 5FUPA 1UOGA 4K3UA 1V9U2 2X10A 1SZBA 2ERFA 2HYKA 4I02A 1BVVA 5F5CA 2PHRA 1G7YA 3I8TA 3N36A 4RGGA 3PVNA 1NZIA 4XF3A 4YM1A 1RUD1 4AI1A 4AGVA 2VNVA 3R0RA 4DXZA 5IFPA 3GJAA 5SV8A 2YV8A 4FQZA 3KV6A 5BNNB 1H0BA 2D43A 3AZWA 3H3ZA 5A6QA 4INDA 1O3QA 3ST7A 2HWF3 2GH2A 2A6XA 2LALA 3ACGA 4E8DA 1R083 1GP4A 1HX6A 1LB2A 5GJ6A 1K5MA 5DUWA 1MS5A 1XSRA 3A7QA 2IVJA 1WA4A 5BUVA 1QH7A 3P1IA 4XUNA 5FMOL 5LBBA 3DUIA 5A1AA 2XL9A 4N8MA 1PGSA 5IVCA 4N53B 1MEC3 5FAXA 3N7LA 2A6ZA 4NIAA 4YG3A 2Z42A 1UD1A 4FFFA 4O61A 3EHKA 3H1YA 1OD3A 2VH9A 2ZHKA 1GBGA 5GZGA 3NNMA 1A8DA 1KJRA 1YEWA 3GM8A 4ZXKA 1PGW2 2YY1A 3NNLA 1SDDB 1CAWB 3KF3A 1Y9GA 3WNNA 3FZ3A 5D1IA 1DQ5A 4IEWA 5FJKA 2GNTA 3JCIA 1RMU1 3KLSA 2GP5A 3ORJA 4Q0VA 3WNLA 3RMXA 5B4NA 3HNYM 3WDVA 4QM8A 2UYAA 1REFA 1O4ZA 3WF2A 1CPMA 3GBFA 4EV0A 5K7PA 3U1XA 5FZ4A 4AVBA 3NO8A 3AL6A 5BPXA 1W8NA 2J1EA 1AZDA 3D8CA 5DAXA 3WQ0A 1MS0A 4GMP1 1VE0A 2QQUA 3IT8A 1BHGA 4JVAA 1BMV2 1NQJA 2WFF2 2ZGKA 3UT0A 3IDEA 3HJRA 5FY4A 3UKNA 3ZSKA 3NV1A 4HSJA 4LIVA 1PMHX 5FMBA 4FPOB 3WQ1A 3AFKA 1ND3C 4BQ5A 5A70A 5JXIA 3HR9A 3S7EA 1N3OA 5CFDB 5I8TA 3JB4C 4NWVA 1FPN2 5I0DA 4NJ4A 1J1LA 2DURA 4BZ4A 2E7TA 2IWGB 1U5IA 2R30A 3VDDB 2VAUA 1FV3A 2CHHA 1WKYA 2G9FA 2C9KA 3CJXA 3E5UA 5FBJA 3WQBA 1O3SA 3FUOA 1KDKA 1MS4A 4LIUA 1QJY3 1KS5A 1JN2P 2VUDA 1O6UA 2JECA 3ZN4A 5JAXA 1JZ7A 5A3LA 5IATA 1BK1A 4QQ2A 4R52A 5I0SA 4IERA 1W2UA 2Q0AA 4HLTA 1BKZA 1Q8SA 1VBD1 2XWBB 3POJA 2PFWA 2RG4A 4FOVA 5A3UA 3DXTA 1ONAA 3DYOA 2W1UA 4DY3A 3OGVA 3K3OA 4HETA 5FBZA 4P9LA 4IEXA 1CZSA 3TB0A 2JJ6A 3O0VA 3SISA 3AKRA 3CU7A 5CIRA 2VZOA 2Y34A 2DCZA 1K42A 4WVVA 5CA6A 2O0OA 2R49A 4IV3B 2J1TA 2RM23 3ZXLA 1O7FA 3CJIA 3MBWA 3SHRA 3TYJA 4BQWA 1JYIA 2RS51 3POIA 2W46A 4XIKA 5BYNA 1Q3EA 3HQXA 1QXPA 2BERA 2DCYA 2MEV3 2HWC3 5IVFA 2ZOEB 3WDXA 3WDWA 1W6NA 4LBQA 1U5YA 4BJ0A 4M3CE 2CV6A 1QEXA 5GLZA 1AYN1 4ITCA 1WMFA 3KT4A 1UY1A 1LOEA 1RINA 3BYWA 2EAAA 4V1PA 2XJVA 1OD5A 2Y6GA 4W65A 3TOJA 3VDDA 1RUG3 3C7GA 5J3UA 2R063 1H2MA 1PX4A 3OGSA 5FZIA 2Y6HA 4R9BA 3AJZA 3RWNA 5FXZA 4KGGA 2CDPA 1XB9A 4LA3A 4D7TA 4C0HA 5KC6A 2A3YA 2XR4A 4Q4V3 2JDUA 5K9YA 3THCA 2XB6C 4AVSA 4JKKA 3DECA 5LCWL 4QB2A 2B45X 4QU2A 2WJSA 1YFUA 5F5AA 1XYPA 3ILNA 5FPAA 3WW3A 3MFAA 2ARBA 1UXZA 5JCTA 1WLWA 4LPLA 4NIGA 5GLVA 2YU2A 4YARA 4AGRA 3MIDA 1BQPA 4LK6A 1MVQA 1DZQA 4IV3A 1GWLA 1WMEA 4L0PA 5DZFA 1F5JA 4L99A 1CR7A 2R16A 3OGGA 4QWNA 4GQ7A 3WF4A 2HWE2 3EQEA 3I7DA 1GQGA 5EXOA 3AXEA 3SEEA 3KVBA 5A7NA 4IEUA 5FXVA 1L7RA 3U4SA 1MZ6A 3JQXA 3WD5A 5A6YA 2J42A 4XF1A 5DXDA 4C90A 5A7PA 4L8QA 3FMGA 2AEZA 4A3XA 1YFYA 3KB5A 1UOBA 4NROA 3CF6E 5M0TA 2I74A 1I3HA 2SBAA 4QQPA 3SITA 3UNPA 1ST8A 1ULEA 1LHUA 2IXLA 3VL8A 3EO6A 4Z1VA 5C9AB 3J8F3 4OUSA 3O1TA 3NRUA 1HRI3 5FKBA 5FREA 4YZ5A 1JUHA 2Q5TA 3N7JA 3AYEA 3I97A 1JYCA 2WWUA 2UWCA 1CAUA 4LITA 2D6KA 2PHXA 2QQIA 3Q9OA 4UF0B 4XEZA 3WP3A 3MPPG 1QJU2 4MUVA 5FP8A 1WW6A 4N43C 5DG2A 2ET1A 5L9VA 4YZ2A 4A7KA 3DL3A 3ILRA 1YI7A 4K8FA 1W6QB 3BIWE 1RUJ2 4QHOA 3ZPOA 3KV4A 2BGCA 1WCSA 1VBC2 3FLTA 2RE9A 3O0WA 1DIWA 1VLNA 1E5HA 1OH3A 1WCDJ 2IFWA 3C3VA 1JOPA 2AREA 1D2SA 5LB6A 3PVOA 3OBAA 2P17A 3IPVB 4Q4Y2 2VMHA 4GH4C 4NE9A 4D69A 2Q1ZB 4FCAA 1EUUA 1TME2 1MS8A 4ES9A 3N4MA 3FHAA 3ZM8A 1RUF3 3ALQA 1XYNA 1SACA 1JW6A 3BU7A 2YU1A 1JS9A 2BFUS 3SQOA 4JDOA 1P8JA 1OA4A 1V6KA 2XLFA 3ZYPA 5FRAA 3T30A 1IG0A 1MZEA 4K9SA 4YG0A 4HKOA 1RUH2 4Z2WA 1OQEA 5C8CC 4LOTA 4QDQA 5CYYA 4LLFA 4CDQB 5EJ3A 5A3NA 1JYVA 2BV4A 1LOFA 1W99A 4JGYB 2VMFA 4YW5A 4JC1A 1FMD3 3U75A 4XF4A 1CJPA 2B9VA 1J83A 5KR7A 4ATEA 3SKVA 1UYYA 1AVBA 5EIYB 2YHJA 2DCKA 2L9LA 5FOBB 2VZTA 2XKPA 2WO3A 2EAKA 3VBFB 3ZKUA 2ETEA 2XUEA 4WM7C 1W6QA 1E5SA 5FP9A 4S2DA 1RXFA 4CDWA 4BMBA 3I3QA 4LLOA 2SLIA 4Y33A 4JQRA 1W6MB 5FZOB 3VBUA 1RHI2 3Q8CA 5CFCB 5IK7A 1GMMA 5G04L 1AR83 3KWVA 3POWA 1QDOA 4JHTA 4Z07A 3WW2A 1LOAA 2YROA 4P9GA 4YVWB 4OHYA 2KR2A 1YLLA 4PF1A 5FZOA 4FTBA 2EALA 3SH5A 4GJYA 3RYPA 2DVFA 2ZEXA 4OUMA 1ODMA 3R4DB 3O1SA 5LASA 3VZMA 5A33B 2ZBJA 1H8TA 4CU8A 4XILA 3C7HA 5DG1A 3RGBA 3ES1A 3CO2A 2WQ4A 2OVUA 2RMU2 4FPGA 1LAJA 4Q8LA 4K40A 2PQQA 3RZLA 3NJYA 3SH3A 5EFUA 3MF6A 5L73A 3BI3A 1KFUL 2WINB 1UYPA 3HPNA 4IE5A 4K6BA 1FOD3 4A45A 1ZVFA 1NXMA 2VU9A 5HCFA 3VBFA 1PMIA 4Y5SA 2DVGA 1PM7A 1WW7A 2FDJA 2VVEA 4MYEA 4F7ZA 5JUVA 4QM9A 1IPKA 2WYSA 3W21A 4QDSA 3ZLIA 1F5FA 1SLIA 1V6OA 1W6MA 2WSVA 2R0FA 1F15A 2RVAA 3H1WA 4MVTA 4YW1A 5C4WC 5CFCA 1I1EA 2D3RA 3AZYA 3T2PA 3VBHB 2P3JA 2QZ2A 4XTPA 2D44A 4N9IA 5KHIA 4YVWA 4Q27A 1Q43A 3OGJA 1VBB1 2UY8A 2QZ3A 3MZHA 2JXAA 4XBLA 2HWF2 1VAMA 3D6EA 5KHHA 1BYHA 3N3HA 1R082 4IV1A 4MADA 1OOPC 3ZFFC 5A33A 2VNRA 4Y22A 4TLGA 1AX1A 3AL5A 4P5HA 1YC61 4DFSA 4URAA 3MLLA 1UY4A 4J1WA 1UKGA 2DU0A 1YYNA 1GZTA 1MEC2 1WA6X 2WKKA 4NHLA 2YC0A 4P02B 1QHDA 3LOIA 1W9FA 5KC5A 4A4AA 3RZHA 3ETQA 2ZX1A 3D82A 2VCCA 4YGCA 4D6SA 4P9YA 4PF5A 4LEJA 5FZMA 3RYRA 2JIJA 1KRIA 4LE3A 2A6YA 2HEWF 5DUVA 2XHNA 2BVBA 5LRSA 4BQ2A 1VRH3 3ACLA 2XJSA 2J1UA 2ZX2A 4NHYA 5FY1A 4BB3A 3RZMA 2VXJA 1W6PB 5DN2A 4XAEA 1NX9A 4AHXA 1TMF2 5FYTA 1MZFA 2WYFA 3VHNA 2QFEA 2AACA 4HVOA 1MQTA 1LKNA 2W0XA 1FT9A 4NOTA 5J7MA 5K8SA 2R041 3MIHA 5DUUA 2V4VA 5IYYA 1VAVA 3BTAA 3L2YA 1DQ1A 4KU7A 1YO8A 5JOZA 2MNGA 1CVNA 1ZBE1 1XRUA 1URXA 2EXJA 3NSTA 4UFHA 4XPVA 1XNKA 3VKOA 4ATFA 4AFDA 5JLVA 4R8HA 4RQPC 4H55A 1HXS2 1WWYA 3ASIA 4M3CB 3ON7A 4QQOA 3KV9A 4Y26A 4BYYA 1LU1A 1W0OA 3AM2A 4PDWC 2ZGSA 2OZ6A 4M00A 4EN9B 4FBFA 5FMOS 2Q1MA 3ZFGA 2CTVA 1EY2A 4YW7A 4LBNA 1ZM1A 1ZBA1 5GZEA 3N9NA 4CUAA 4LA2A 4YW3A 3ZOIA 2A5ZA 1QJY2 2X53S 1AJOA 1F31A 3RRDA 4H7LA 1H2NA 1UU6A 5FLIA 5C3RA 4IXLA 4UW4A 3FL7A 3IMNA 4B4RA 1F4AA 4UI9L 1X33A 1QDCA 2JB4A 2H6CA 2VQUA 3KGLA 2D6OX 1LOCA 3PUAA 4FI9A 1AR63 3ZN6A 1DDLA 1SCRA 3OOXA 5EHDA 5B4XA 2QBXA 5BY5A 1YHFA 5I8YA 1FV2A 1X36A 1UNBA 2I45A 2NM1A 3PLQA 4P14A 4RR3B 2JE9A 4WVMB 3VKFC 1EYBA 4ZHNA 4Q0UA 2XQXA 1O3TA 3K4DA 2D6NA 3VKLA 1V6MA 2ENRA 2H0BA 2ZZJA 4QXHA 2WIIB 2RS33 4FTEA 2ZKNA 2RM22 3N7MA 4XQDA 2W92A 3AVRA 4CE8A 5DZEA 4IE0A 3DKQA 5C5UA 2RS11 3K48A 1NY71 2QQKA 4HBNA 2GN3A 4RFRB 1B35C 3W58A 2MEV2 1R093 2HWC2 1DGLA 1QNWA 2E53A 4XF0A 3VZLA 1HDKA 1S0BA 5K0UC 3THTA 5DDJ3 3AX4A 4M3CA 4Q29A 4JHZA 4CEWC 3MV01 1OLME 2BOJA 2F17A 2QQPA 1F2NA 2P6HA 1ND3B 1Z78A 3S0MA 4HSLA 4PI0A 4ZS3A 4XQWA 3C2UA 2R073 3NWKA 4B4QA 1RUG2 5EQUA 4FTSA 2WN3A 4YGBA 2HKXA 1O4TA 2R062 5C3OA 3DN7A 2CGNA 4EJRA 4XJ8A 1IS5A 3U10A 1NYWA 5IFTA 1RUE3 1Q8OA 4LKFA 4Q4V2 5C8WA 5FYCA 3ZX7A 4MGSA 3T2QA 1DG6A 3WP4A 4OYUA 4Q26A 5H9RA 1SCSA 1CIYA 3ATGA 2JENA 2JG8B 2ORZA 4WVMA 4XUTA 4ZKTB 2WBKA 5SV5A 4AK3A 4Q1RA 5F3GA 2O8QA 3ZXKA 3DYPA 3I49A 2HH9A 3EMRA 4OQ9A 3WUCA 4AAPA 3AMPA 2VNOA 1NT0A 1LRHA 3VD7A 5EJ1B 2WO1A 4NRPA 1COV1 1ASJ3 2RHPA 1OPMA 4HVRA 3KSCA 5L36A 1HB3A 1NOVA 1DF0A 4KWKA 4EZHA 3MI8A 2W68A 4HFSA 1ZA4A 2CGOA 2E51A 2JDZA 3IDAA 4K8RB 3B9IA 3J7NA 1Y7BA 5IK8A 4QQHA 3LZZA 2Y0IA 1A8MA 5D2AA 1ND3A 4UT5A 3W59A 1DYOA 3NMBA 3IM0A 5FXWA 3J8F2 3FFQA 1HRI2 1JMUB 3IN9A 5FZKA 2VZVA 5JOXA 3CNAA 4E4DX 2D3SA 1EV13 4NHMA 5CKQA 3NJVA 4EWEA 1YJKA 1QQP3 3VZOA 3V65A 2BDRA 3P6BA 1UW8A 3KM5A 2G9GA 2JG8A 2OUHA 2RR11 4ZU7A 1JODA 1MR5A 5A7QA 1UZ0A 1LEMA 1OC1A 1WLDA 4DRRA 2VMGA 3E1F1 4GD4A 3TAYA 2VM9A 2VMIA 3S30A 4FP2A 3WCRA 4CXWA 4MG2A 1UF2C 1PO13 5FY5A 2Y64A 3NNJA 4YVSC 2Q8CA 5JOYA 3CIHA 3PMEA 2XONA 5T5JA 1G9DA 2YZ4A 2VBDA 5FYHA 1UYXA 4ES8A 4KMQA 2R0HA 3DPRB 4XW3A 5FLHA 1PIV1 1RUF2 2HJIA 4NWWA 2ZEWA 4AAXA 5IT6A 2JKXA 2ZA9A 4L9BA 4XHXA 1VMFA 1BCXA 3T3YA 1UIKA 3VN4A 3WNOA 3GBWA 5FWJA 1OFNA 4KWJA 5FO7B 4EROA 2ZGQA 5DAPA 3HVDA 3ZXAC 4BQYA 3VDBA 4Y1VA 4I2OA 1UN1A 4WZFA 2BYVE 4Q4W1 1QOOA 1S0CA 5CB7A 3LFIA 4XOGA 5CADA 4D94A 5BNOC 1ZZ8A 1XPWA 1SPPB 4HKWA 4ZPIA 2VZRA 4KBZA 1FMD2 2E9QA 4LUKA 5F5QA 2V4AA 2VMDA 1O91A 2YG0A 1DGRA 3NL1A 4ISQA 4X8NA 1W06A 5JR7B 4F3JA 1GU3A 1US3A 2D5FA 4XXPA 1YQ2A 1BZWA 1D4M3 2Y38A 4QKDA 3LD8A 4RS5B 2DBNA 4Q2FA 4X6QB 3EYPA 2VQ0A 1G86A 1K45A 1YQ6A 2K9ZA 2NYYA 2PA7A 3CLPA 3OYWA 4OVEA 2H6BA 4FPEA 1Z7S1 2D93A 5FMCA 5FUIA 2GNDA 2VVFA 1M06G 1PK6C 1AR82 1Q56A 3H9AA 1O8SA 1US2A 2WRAA 5L19A 4RA0A 1GOFA 1C1FA 5IVJA 4UW3A 4P00B 2WNUC 3ABZA 1IOAA 3DPRA 2R1DA 2RJ2A 2GC3A 4JDMA 2V5DA 5FFOC 5GZCA 4ZU5A 2GZWA 1APNA 4YGDA 5G05L 1IS3A 3RZZA 3VHOA 5GZFA 3LFMA 1OF3A 1WW4A 1SBDA 2ZX0A 3H3LA 1XE7A 4NHKA 4HK8A 1CESA 1HRV3 5EZWA 3AYCA 3ILFA 4JTNA 4DXTA 5FZFA 4H14A 4MXWA 1GQHA 1X50A 2P3YA 4LHSA 4LBJA 4MH0E 3I3EA 3H8RA 4CCJA 1LECA 2E6VA 4RHV1 2WT1A 3T2OA 2QUOA 2GC0A 1ZRRA 5FZCA 3HN3A 1I5PA 1J84A 1GYKA 4H7MA 3RI8A 1FOD2 5EYYA 2Q1FA 3K4ZA 3I2DA 1IGOA 2UWBA 4RS5A 3K4AA 5IW0A 4AEDC 4JRAA 5HV4A 5L7OC 2R6QA 3T08A 3LPFA 5DMYA 2Y33A 4N43A 2IXCA 5JMOA 4AHZA 1G9CA 1UWWA 2RJLA 5T5LA 4CDUC 4HKLA 5I0RA 4LXLA 1HV0A 1HQWA 1LULA 3H1MA 4JCKA 4XDQA 2FDIA 1QH6A 3MF9A 1R1A1 5A3MA 3PUSA 2PLV3 4O65A 4XMIA 2FMYA 4FPLA 3J9SA 4GALA 3M3CA 3OY8A 1AL23 4G9SB 5FXXA 1NA1C 2J1RA 1S0EA 4GH4A 4DIQA 1W90A 4UAPA 1JYTA 2WNEA 5EP9A 1S1AA 2VTXJ 2XJTA 2QDRA 1PZ8A 3AKPA 1SBFA 1RUC3 3QH6A 4MGZE 4J25A 1RIRA 4LBKA 2YPDA 2ZXQA 1PO21 2ZJCA 1OVPA 1AYM1 2D6MA 3B5LB 1W0PA 3O12A 1RVF3 1VBE1 4K20A 4AI3A 4Z92B 1N3PA 2HWD2 1YIFA 5C8CA 4CCOA 1XNDA 2IXIA 5FUNA 1CZTA 1AR71 1W39A 2JD9A 1LGCA 1QJX3 3JQWA 3TN91 3DXUA 2ZHMA 4CCNA 5FYMA 2JWPA 3LPGA 4PIYA 5BNPC 2TUNA 3CEWA 1AX2A 1PGL1 4Q0QA 2MPFA 1BEV1 1VRH2 3RVHA 1WGPA 2BVVA 5FZ9A 1HV1A 2PYTA 4JQTA 4LO5B 2WS93 3MLKA 1QY4A 3AZVA 3HWJA 4NUBA 3U07A 3H8UA 2BNNA 4WM7A 2VQAA 2YGMA 1R64A 4LQRA 3KT1A 4GB31 4M4RA 2W1QA 4Y1XA 2OA2A 3M4FA 3LB9A 2PHDA 2ZGRA 1NCQC 2JDAA 5F2WA 1C3HA 1YQ5A 2ZGUA 3LA2A 1REEA 4LHNA 3VGIA 2ZACA 3I3MA 3JBG3 4AF9A 3IAQA 5T3NA 2D40A 2CL2A 3VLBB 2WNVC 3J26N 3E5QA 4FT8A 2ZMKA 1BBT3 4TLFA 1ZRIA 1RC6A 3WDTA 3NNGA 2KD7A 1FXZA 4D0QA 5FR3A 1POV3 4GXLA 4ZU4A 2VTXA 3ZFFB 1W9WA 4FPFA 4QPGC 2XBO3 2HWB1 2WWSA 4UFKA 2B8MA 1E57A 1XXNA 4BHPA 2XMLA 4FXKB 5ACA1 3ENRA 3CJIB 1H2KA 1AXYA 4Y20B 5FZ6A 2R32A 3FFZA 5FV3A 4Q4X3 5H9SA 4LBLA 4CCDA 5IK4A 4BPZA 1H9PA 4MV2A 3TNPB 1DYKA 2ZCWA 4DRVA 4XE9A 2DCTA 2C26A 1D0GA 3K46A 5ABJC 1PNGA 1S2EA 4Q0SA 5CKMA 3KF5A 4HPKB 1W6NB 4LBQB 1AR62 3C7EA 4JGZB 2DBIA 5EWSA 2OX0A 3ZFEC 4AWDA 3WHUA 3M2MA 4MX3A 3Q8BA 2CGPA 1PX3A 1S0GA 2CAUA 2DWRA 3AZXA 1UY3A 2VUAA 4GULA 5DAVA 2X5IB 2YYOA 5AFBA 4NIDA 4CTEA 4XHBA 4KQ7A 1DU3D 5ANNA 3ACIA 1AHSA 2WZR3 3ZIWA 3G7DA 5FYIA 1RUI1 2O14A 2OS2A 5JI7A 1NAEA 5C4WA 5HCBA 1W8OA 2XLAA 2E63A 2GH8A 2RS32 2VZ3A 1GNHA 3AZZA 1CX4A 3I54A 3BIEA 1N1SA 4L92A 3ZSEA 3T0AA 2XL7A 3KT7A 3OPZA 3H7YA 2ZAAA 1B09A 1UMIA 5AC91 1R092 5IVEA 1VBA1 2R7EB 3ZR6A 1JUIA 1TNFA 3ZSMA 5DDJ2 4MGKE 4OZOA 3BTZA 1OLMA 3ZFFA 4TYSA 4JAAA 4A3ZA 3IDBB 5FY0A 2R072 3POSA 2XGXA 4Y20A 2XPJA 1ZZ7A 1TQ5A 1YFWA 3JD73 4XQ4A 4DEQA 5BV6A 1JI6A 1RUE2 2B4KA 5IJRA 3PVEA 3RS6A 2Y6KA 4HPKA 3I59A 2VD7A 1KEXA 2WAAA 4JGZA 4KL1A 5FZ3A 1HN1A 4YSFA 1W6OA 1SEFA 5T52A 4CP0A 2PAMA 3MDPA 2WO2A 2X5IA 3PTYA 3BPSA 1DGWX 5HI0A 4QPIC 3DKWA 4MXVA 1AR91 3PUQA 1RUD3 1FI2A 4PQQA 4Y4YA 4E2SA 1H8VA 4OCTA 3SNMA 3I2HA 2IZWA 3HQUA 3ME2A 1ASJ2 1CAUB 2IXHA 2WZ8A 4HG6B 2GMMA 1ODNA 2P37A 2YC2A 3H7JA 5F6KA 3UJQA 4TWTA 3MICA 1GWMA 2G19A 4NAMA 3AMQA 2JDPA 3FBMA 1REDA 4QGLA 2BOIA 5C70A 4BE3A 4IGQA 4QXCA 3HN1A 4CDXC 5FLJA 5DPNA 4RQPA 5CKNA 3NNFA 5A32B 4EYUA 2GNMA 5F3CA 2FD8A 2V09A 1PNFA 4RGAA 4CEWB 2UY9A 4HANA 1ULGA 2Y6JA 1S4CA 1OQDA 2HLEA 1SBEA 2QTWB 4I30A 3HNMA 3V64A 2BTVC 3R4SA 3WEZA 1EV12 3UV9A 4CUBA 4E4SA 2ZX3A 2DVBA 1C8M1 3TEXA 5FO9B 1QQP2 2A75A 2QQNA 2UYBA 2D97A 4LO7A 3U0ZA 1O5LA 2JG9C 2Y8KA 4UBHA 1PVC1 2VXRA 2ILMA 1UPSA 3AMHA 4KG0A 5JZGB 3GYDA 3FLRA 3OB8A 1I6XA 1RMU3 4A7ZA 4XC9A 1PO12 4E8CA 4RYDA 5JSPA 4NO4A 2C6SA 4XFCA 4A6SA 5J37A 1NE6A 2FZ2A 4UW5A 4DEVA 5FP3A 4HMZA 3AKSA 4KBBA 2GN7A 4E9KA 4OI4A 4GMP3 3UGHA 3OUIA 2XJPA 2ZEZA 1YWKA 4GWMA 4FPKA 1SHWB 2OIIA 2J1VA 2EVXA 3NAPC 1B35A 1W2AX 4CDWB 3OPTA 4IGOA 1W8UA 5K0UA 1NLQA 2NN8A 3MV11 3LSDA 3VBUB 5A32A 4QX0A 4XJAA 2Q8DA 4CEWA 1SMVA 2EIDA 1GP5A 1NG0A 1U5ZA 1X9TA 4W6WA 4XBQA 3NW4A 5F5IA 3T1MA 4IEQA 4B7EA 1C5HA 3INAA 5GLUA 1V9U1 2CU5A 4CRQA 4Y3OA 1G9AA 3EXUA 3MW2A 2ZPXA 4RN5A 1IHMA 3G6JB 2ZEYA 4DB5A 2VCBA 2WC2A 4CXXA 2OYZA 3SLIA 1D4M2 2A3WA 2XLGA 4COYA 4DUWA 1VBD3 2P2KA 2W39A 3POFA 1JZ2A 5JZGA 1H8TB 4R9DA 2B5HA 2AZ5A 2P4EA 2VMCA 2ZGNA 3B93A 1ND2C 5JI9A 4KH9A 3OUJA 2K2SA 3KZ4C 5CNAA 3ZXEA 4CCEA 5HV0A 4YVSB 3DCQA 3ZR5A 5KHKA 2AGSA 1DGRN 2EXKA 2FDHA 1BK0A 4M0HA 4LOSA 1SLTA 3WV6A 4COVA 4NRQA 2OPKA 4ORFA 2RS53 1L7LA 1D0HA 3PUIA 4AEJA 4QKBA 1H6XA 2I2SA 2P34A 1NQDA 4YRDA 3GHNA 1HRV2 2C9AA 3SH4A 3O1OA 2XWJB 5CAZA 4YWAA 1AYN3 5IVVA 5APAA 1J3QA 1OFSA 2XH6A 3DF0A 5KXEA 4XJ9A 3BTYA 3GJBA 3GZTB 5T54A 1LCLA 3B01A 5IAXA 3M7AA 1PGW1 1OHFA 1K5MC 2CAVA 4J1XA 2UU8A 4R9AA 5BNOB 1WW5A 4LMFA 5FYUA 1S0FA 4XJWA 4JV4A 1UMZA 4PJYA 2DTWA 1MS1A 3KQRA 3VBOC 4K21A 4NRMA 4Z8BA 3RI9A 4IV1B 4MLOA 1F8VA 4CEYC 2XJUA 2J1SA 1OKQA 3ITQA 3LWCA 4H3WA 1ENXA 2ZX4A 1QOSA 4ONUA 5EV7A 4Y22B 5AVPA 3USSA 2NMOA 1VPHA 3W9AA 3D5OA 4PLNA 2HYXA 4XZUG 1UZZA 2TEPA 3MW4A 2VOKA 4WM8C 5FDBA 4QQLA 4EZ4A 1TG7A 5A3WA 2JX9A 3KGZA 4XFBA 1BMV1 3BU0A 2V5YA 2WFF1 3T4VA 2IUWA 1HB4A 3OJBA 4K1ZA 3ZKYA 1W8ZA 2PLV2 1XOYA 3PJQA 4YVSA 4XAAA 2GMPA 2HBUA 1PK6B 3T1LA 1AL22 2XVKA 4BH9A 1FPN1 4YZ3A 2FDKA 1SQ4A 1QGLA 2WNUB 2YBKA 1AXZA 2VZUA 3PL0A 1RUC2 3TEZA 1W8TA 5A1LA 4MZUA 4HK9A 5IAVA 2E26A 4EN7B 2VQTA 1IS6A 5BNNC 1K3IA 1F9KA 1RVF2 4YYOA 3D4KA 4NAOA 1MQTB 5A6XA 3APBA 3I2GA 4DNYA 2WO7A 2E7AA 4E2QA 3SCGA 1ULCA 1ZX5A 3OG2A 3UESA 1QJX2 4AVAA 5FCCA 4CVUA 1UU5A 4AL9A 5BNOA 1DQ0A 1ACCA 5F8PA 1ULPA 2WQ8A 3E97A 3HIFA 2VG9A 4DS0A 3BGAA 3ZN5A 2ARCA 4ASKA 4N53C 1NCRB 2BGPA 1CJDA 1QOTA 5LY1A 1IPJA 3B9CA 3C7OA 2WS92 2D7FA 2BGOA 5C3QA 1RJ7A 1BJQA 1GSLA 3EJKA 1LGNA 3S57A 1W03A 3LAGA 3ZFGB 1BLZA 2GNBA 4AI0A 5LEJA 3N7KA 3OD4A 1UCXA 1RJ8A 1NUKA 1Y43B 3I2JA 3LEGA 4PLOA 1ZZ9A 5E1RA 1PK6A 4Q0PA 3GCWA 5LRRA 1VALA 3LEKA 1FYUA 1Q8PA 2E33A 3JUUA 2WLQA 3JBG2 3P5BA 4B1MA 3UKVA 5J36A 3THPA 3ZN6B 2WNUA 1G6NA 4LUMA 4NPLA 3RNSA 3N9MA 1BBT2 4COZA 4ARYA 1H6YA 1PZ7A 1LHVA 2Q30A 3WG1A 1SLAA 2LM3A 2OUJA 1UY0A 2JD4A 1WLTA 2XBO2 4CUGA 1QIQA 4XMAA 5IVBA 1G9BA 1GV9A 5CEHA 2WA4A 1GZWA 3OTFA 2E31A 4Q4X2 1IG3A 5CFDC 4FPYA 2QQVA 1UYZA 5DABA 4DUXA 4R9CA 1TZOA 4Z82A 1SLCA 3VDDC 1NCRA 3BALA 4WBBA 3UYJA 1ENSA 3GNEA 4B1LA 3N9LA 5CG9A 3RPQA 1H9WA 3ZYIB 4AEDA 1DYPA 1S0JA 4S2GA 4NVPA 3FC0A 4P5YA 3WT3A 3WNKA 2WZR2 2G4IA 4UWDA 3HBKA 2LROA 1X8MA 2A1XA 3POEA 1XJAA 2F4LA 3VD9A 4BK5A 5FPLA 4DY5A 2W47A 4ASLA 4IUGA 1NCQB 2Q8EA 3FUQA 4FAGA 5DZGA 4LKEA 4EN8B 1T2XA 5FMDA 3S5QA 4A42A 5FY8A 5FZ7A 3WW4A 5JOWA 3WUDA 1LOGA 3SC7X 2WLPA 4MHRA 2PXJA 4PQ9A 4CPBA 1F4HA 2K46A 3O0XA 3S7IA 5DQ0A 3GHMA 3GALA 3ZYGA 3E5XA 3LA3A 1RB8G 4YNIA 4CU9A 2VTFA 2WT0A 1WD4A 5FYVA 4HZFA 4AI8A 1SFYA 2LUWA 4G4FA 2YFUA 2A73B 1S0DA 1QJU1 1W2TA 3AKQA 3JD72 3PDQA 3RFRA 1DLCA 3ACFA 5LBEA 1VBC1 1X9PA 3B02A 1IZ3A 2R1BA 1V6NA 2AR6A 2ZHLA 2BQPA 4AI9A 1OH4A 2Y60A 2LW8A 2JDNA 3WY6A 4I0WB 5IK5A 1T6GC 2JICA 5LA9A 3K2OA 4Q4Y1 1VJ2A 4CYDA 2B46X 4X8PA 5L9BA 1TME1 2BWAA 4AFAA 4YGEA 1WBLA 3O1UA 3OUHA 1Y4WA 1TNRA 1RUD2 2EICA 4XDPA 3W20A 1SG3A 1FNYA 2DUPA 4LKDA 1C1LA 1ZNPA 1NCQA 1GZCA 3CQOA 1RUH1 2OKXA 3WX5A 4YZ1A 1VBB3 1UIJA 5C5TA 4CU6A 1OBNA 4UFJA 1N1TA 1XU1A 2W52A 2XOMA 3VZNA 2AENA 4IETA 4B7KA 4LT5A 5I91A 1QF3A 5GM0A 2ARXA 1HB1A 3Q8FA 1N1VA 2WZPP 4PLMA 2WT2A 1C8NA 2WZEA 3VBRC 4LO6B 5GKAC 3UETA 3ECQA 3VD5A 5A3PA 1IQAA 1UAIA 2QVSB 2ORXA 4DMIA 4BQ1A 4QPGA 2WQZC 4EWAA 4XJZA 4GKYA 2B39A 2WFPA 5FPBA 4EE2A 4A6OA 2E32A 2ZGMA 4EQVA 5FZBA 1UY2A 3CZJA 5C9AC 2GAUA 5DAWA 3FWEA 1RHI1 3WDYA 3D0SA 4IEPA 5ABJA 2WL1A 1LOFC 3V0AB 1C5IA 3NV3A 2VUJA 1PM4A 3IB3A 3ZFEA 3U4XA 1RMU2 1VP6A 1YNAA 3M70A 4PBPA 4UFLA 1DFQA 2XG3A 3CBNA 3AK0A 3H42B 4W4ZA 3T09A 4FPJA 3WP6A 4META 3T4HB 1UZVA 4U36A 3N35A 3Q8AA 2R043 3AP7A 2XVGA 2WNOA 3ZDSA 1S2BA 4EWDA 4OI0A 1A34A 4Q8KA 1ZBE3 3U37A 2RMU1 1VR3A 1I9RA 1X7NA 5LEKA 3VBSC 3C8XA 1VRBA 4I3GA 4KWLA 3OYWB 3SCHA 3A0KA 4I01A 2BBVA 5DAQA 5GALA 5FZ1A 3V0BB 1G9FA 1HQLA 3POBA 2VNGA 2WWJA 3AP9A 3VL9A 1L3JA 1OVSA 5DUXA 3I4IA 5C33A 3S5AA 1ZBA3 1KS4A 3A23A 2WUHA 2PAEA 2VL4A 3N9QA 3OGRA 3KD4A 4V2WA 2MHFA 4OMDA 5HBAA 1JZ5A 4CDQC 3MIGA 2JB8A 4AZZA 1VBD2 4ZY9A 1UPIA 4JGYC 3V0AA 4MGTA 5FTTC 3LIHA 4MXWB 4ARXA 1OUXA 4CA9A 1JU3A 1ZZCA 3UGGA 1N1YA 4AEMA 1VB2A 4BU2A 3OEBA 4D6RA 2BJSA 3PNAA 3U11A 2HWF1 3AJYA 3POGA 1O4YA 5FZ0A 4QPIA 5GZDA 5JPNB 3U78A 1R081 4COUA 4MGIE 4XFAA 1LODA 1S2KA 4BA6A 1GUIA 4BOWA 2RS13 3W5NA 3POYA 5KXBA 1PHMA 3GZAA 5LWBA 2RS52 3PU3A 1G8WA 4NN0A 3J7LA 2W2IA 2F4PA 2IXKA 1MEC1 3KQ4B 5F3EA 3J7MA 4N43B 3M3QA 2A6WA 2BU9A 2OXBA 5JSRA 3MW3A 1D7PM 2ET7A 4YVWC 1AYN2 1YJLA 1LNSA 1FNZA 3V0BA 1GICA 4AFCA 2HEVF 5KWRA 2GSYA 3TBDA 3NV2A 4XYXA 4RGKA 5IVYA 2OQ6A 3P3NA 5FYSA 3VZKA 1MPXA 3OY8B 4FVVA 1AL0G 1AF9A 2XJRA 4GH4B 3PTRB 4XF9A 1GKBA 1WMDA 1JHNA 3H50A 4YW2A 1TMF1 2TBVA 1PMJX 1GP6A 2PELA 3Q8EA 1SDWA 1A6CA 2GDFA 2CSGA 2ID4A 4E4HA 2GMEA 3GXUA 2QJVA 5ERLA 1CAVA 2CYFA 3ETPA 3LQCA 2WDBA 4AYUA 4TTGA 1ZREA 1DLLA 4B4PA 3IBMA 3H0OA 5C8CB 1OA2A 1UOJA 4YPJA 4TN7A 3X29B 3A22A 1CPNA 4QKNA 1HXS1 1COV3 4LHKA 4NPRA 1EAH1 3RQ0A 1W2OA 2ZGOA 4QDRA 4KNCA 3BODA 2DFBA 2DVDA 1MZ5A 2QE3A 2YBPA 2PAKA 3VBHC 2YGLA 3K75B 1HJGA 4IGPA 1RL3A 4I09A 4KWUA 4CCLA 5T50A 3PMSA 3OBRA 1YCIA 4WM7B 1WD3A 2VPVA 1QJY1 2JE8A 3B94A 1UOFA 3NAPA 1UX6A 3HNBM 4XBNA 4LE4A 2JKBA 3FN9A 2D6PA 3L9JT 3AP6A 4YW4A 5FIXA 4AVVA 1EP0A 3O5SA 5EJZB 2VZQA 2LS6A 1TVGA 4BM8A 1JZ6A 2AH2A 5FPVA 4DINB 3EB7A 4FOYA 3ZPYA 3IMMA 2RDRA 2VE1A 3LDKA 4AE2A 4XIOA 3VV1A 4QHZA 4CP2A 2ZS6B 3VBOB 4XJUA 1RUOA 2RR13 1UZYA 5J48A 1OSGA 2OZJA 3RJ2X 2RM21 5LW9A 4BCUA 1OURA 2BWCA 4P08A 3B7MA 2VZSA 4PI2A 3I2OA 1UU4A 1W0NA 2A70A 3FHIB 4M0NA 4OMCA 4XABA 1CQ9A 2HWC1 2IXJA 1VMJA 1ND2A 1ZZBA 2DFCA 2MEV1 2V73A 4Y1ZA 5JXGA 2DF7A 2PMWB 2VGDA 5E8AA 1UZWA 2DYCA 1UMHA 1PIV3 3QD6A 1A3KA 5JDBA 4Y24A 4QX8A 5F2SA 4KGQA 1RUG1 2WN2A 3ZSJA 1DQ2A 2R061 5E88A 3O1MA 2VCAA 2O1QA 2Z5WA 4XTMA 4XVHA 1ZYBA 4Q4W3 4GWJA 4DXSA 1YI9A 4N90A 4Q4V1 1XU2A 5C4WB 4D7YA 1OUSA 4NMIA 5L9RA 1J1TA 2AC1A 3J7HA 4F83A 5LATA 3WXPA 2YDEA 2QQMA 1QNYA 3MFCA 4I0AA 4D8MA 2CWSA 4O7XA 5FZLA 1BVP1 4I3PA 3VBOA 5FYBA 5HXMA 3PVBB 5CVRA 3OBTA 4K7JA 4MHUA 4CUCA 1CD3G 1XNTA 1OOPB 2OT7A 4CEYA 1H1MA 4MO3M 1Z7S3 5KHJA 4WM8A 4DZGA 5B2GB 1CONA 4XFGA 4XURA 2WABA 3WOGA 1YIPA 1YQ8A 4FP3A 4QX5A 4RR3C 2RDNA 3R6SA 3I3BA 4AVCA 4NIIA 2V72A 3UKTA 4LJHA 3MYXA 5T55A 1D2QA 4F8AA 2FQPA 3I59B 1XSQA 2KXLA 1W8FA 1W6OB 3BCWA 3J8F1 1HRI1 1QJEA 4P9JA 1TMF3 4OQ8A 4J6GA 3L2HA 4O9GA 4QPYA 4JRLA 1JBCA 3LE0A 4JX0A 4E27A 5I93A 2VULA 5AFEA 3QH7A 1NZCA 4AFBA 5BNNA 1H1AA 1ULOA 1HW5A 3GGLA 3JXSA 4CZSA 2YFZA 1LGBA 4RHV3 3USUB 1RUNA 4YLZA 3LA7A 4IEOA 4E4ZA 4IL7A 4AG4A 4DQAA 4QX1A 5F9TA 3KCXA 1HXS3 1NLSA 1EAH3 4URTA 4LR4A 2ZKLA 5JR2A 1OOPA 4RQPB 4N53A 4W6XA 4YM2A 5F32A 3HMYA 5GLWA 4CCKA 1RUF1 5D8AC 4PDWB 2W87A 3HT2A 3VKMA 5C7GA 2XQRA 4ZXEA 3AMNA 4LULA 1R1A3 1WMXA 2DTYA 2JG8C 1W9SA 5J1XA 2QDNA 2PHLA 2J22A 1SFPA 1CAWA 1VBB2 1V6JA 2W1WA 3MIFA 4W6YA 1UKRA 5EPAA 4LNVA 2IFRA 3S6PA 3M8LA 4AR2A 2CDOA 1U5XA 1S0IA 2ZABA 4G3YC 4JTOA 1RGSA 1MVEA 4QT6A 3RJRA 1LTEA 1PO23 4TZDA 2P6CA 3RSJA 1AYM3 1FMD1 2J7MA 3IIAA 3WNMA 5KXDA 3HEIA 5LK7B 1VBE3 4XUPA 5H9QA 3ES4A 1W9YA 3H8XA 1KFXL 3WSOA 2AUYA 3A0NA 1C57A 2QQLA 5FZAA 3USUA 1AR73 1L7QA 3OBZA 3GZEA 4OZXA 3TN93 5FZDA 1GANA 4R4XA 4B8EA 2VOXA 1XNAA 5H9PA 2UURA 2JIGA 5A6ZA 5CFDA 3WG2A 2D5HA 2YB7A 4TXWA 2HBTA 4UFMA 1BEV3 1LJ7A 1GZ9A 4WV8A 1JZ8A 1AR81 1B35B 4XZPA 4A7YA 1XYOA 1JTZX 1LEDA 2DUOA 5K0UB 5E89A 1N47A 1H4GA 1WCKA 5JSOA 5FOJB 1JXNA 2N7GA 4PDWA 4ISRA 4OLLA 3FHQA 4GB33 1WBFA 2AYHA 2FCTA 1MACA 2WR9A 1TE1B 3AFGA 5A7SA 3B3QE 3HOBA 2CWMA 1O59A 1IKPA 3ZDVA 3FLPA 2C0ZA 2DV9A 5FP7A 2QQJA 2R042 3C7FA 2LTNA 2P1BA 5HPOA 5FK7A 1V6LA 3JB8A 5F39A 1ZBE2 3IZOA 1JZ4A 3CL1A 4A41A 1UXXX 2CNAA 5CZKA 1N3QA 4HL0A 5LA0A 2BP6A 1U12A 3TNQA 5JMCA 2DU1A 1RTVA 5IHRA 4FSJA 4WVWA 5A7OA 3DPRC 4RFT0 3NV4A 4YZ4A 4IEYA 4H2AA 1QJFA 1FOD1 5E16A 1KITA 2HWB3 5A3TA 4WVZA 2VZ1A 3LEIA 3VBRB 1ZBA2 4LBOA 5ACA3 1HN0A 3THDA 1SLBA 3FJSA 3NVCA 3WVJA 4D7SA 3LSEA 2EIEA 4QKFA 1KJLA 1HQNA 3UGFA 2JDHA 3O14A 4FPHA 5ISLA 1ZRDA 1W04A 1DQ6A 1UQXA 2OW4A 3I2FA 4UBGA 1QKQA 3E6DA 3T0BA 4EN6B 4M4PA 5J09A 4COWA 4SLIA 2W95A 1BXHA 2A71A 4ET7A 4BK4A 2P3IA 3PJYA 4D6QA 3VUOA 1DQ4A 4NIHA 4LKSA 2EA7A 2FBEA 3KVAA 1RUI3 1NE4A 3OD0A 4RS5C 4BXSV 2P5BA 3M3OA 3MPBA 2NP0A 4ZS2A 4XUOA 2ZTNA 1KDMA 2RS12 2HWD1 3FX3A 3ZMNA 1C28A 2PHUA 1NY72 4R4ZA 4QX2A 4O9EA 4OHVA 3GBGA 5AC93 1JH5A 1HB2A 1VBA3 4QXKA 2VECA 3A4UA 3MIBA 4NHXA 3VBSB 5CU1A 4UOJA 4GKXA 3AB0A 3ZYBA 2C5DA 4BIOA 2PN5A 3GF6A 4LBMA 2C24A 3WNXA 3VBRA 4OHWA 2UWAA 1VRH1 1YQCA 4D3WA 4QGNA 4OFGA 3GZUC 2YXSA 3E6BA 2YPJA 2FMDA 3E6CC 1X82A 4IQPA 2VOTA 5JXJA 3JZVA 1EPZA 1MS9A 1OA3A 2JDYA 5C3SA 5C9AA 5FYZA 2ZMNA 4Y4RA 3JU9A 2PTMA 2QQWA 4L2NA 1XE0A 4XCAA 4IDZA 4AQSA 4LORA 3TRSB 5FPXA 3BVCA 4C0BA 4LO4B 3KS7A 2ATFA 1D4VB 4Q1PA 4BXFA 1E5RA 4IE4A 1AR93 2YBSA 4NPMA 1OT5A 4KI5M 4P9IA 4UF0A 5F6LB 2FZ1A 4OHXA 4ZONA 5A80A 5KBFA 3VDAA 1POV0 3QLQA 5F1RA 2XUMA 1COV2 1Y9QA 4UFIA 1DCSA 1Z0HA 4RSUA 4PT6A 2ZHNA 5LA2A 2RDQA 4B3NA 4UYBA 5F3IA 1OF4A 3B69A 3ZYFA 2G9ZA 5FK8A 4S2HA 3I3DA 4V2VA 4DOUA 1WUVA 2WSUA 2ARAA 2YC4A 4GJZA 2AEYA 2RJKA 3IPVA 3RWKX 2X09A 3VBSA 1GLHA 1ZZ6A 2EXIA 3BPZA 4HONA 2RV9A 2VJXA 3GDBA 5AVAA 2YMZA 1Q8VA 4OUEA 3AXDA 1AR61 4CCMA 4AQ2A 2XVLA 1LHNA 3DV8A 1JOBA 1H1IA 4Y1UA 3UK9A 2VOWA 3SMHA 1NXD1 1C8M3 5HCHA 1YXWA 3ZO0B 1IPSA 4MOAA 1F35A 5FKCA 4YM3A 1MS3A 1ZRCA 2BRTA 3AKTA 4IE6A 4KU8A 1LOBA 2RR12 1PVC3 3LF7A 3PIJA 2RS31 1QU0A 4HT1T 3IIIA 4CDQA 5FPUA 1X8EA 4JGYA 3VD4A 1KGYA 3URFA 4UW6A 3SKJE 3BB6A 3WW1A 1J58A 1GZWB 4QU1A
chains in the Genus database with same CATH topology
2ZZQA 4N7UA 1R091 5JPMB 4GWNA 1HIXA 2NMNA 5DDJ1 3OCPA 4KG8A 1WLCA 4AW7A 1AX0A 3M1HA 3OF1A 1PIV2 5I0UA 2ZGPA 3WINE 4DPNA 2R071 1EPWA 2X29A 4QD2A 4FXGB 1OLQA 4AEDB 2P3KA 3LCPA 1QWRA 5L7OB 5KXCA 4FPCA 3FE5A 4Q4W2 1RUE1 2JE7A 3NKGA 4CDUB 3FBYA 5T5PA 4MGYE 1HLCA 1KQRA 2XHKA 1V9U3 4OHZA 4M3CF 1LU2A 2NPIA 1NA1B 4M01A 2ZMLA 4AGGA 4P9WA 4LBQD 2F6BA 2D6LX 2HWD3 4LTAA 1GNZA 2H0VA 3CJIC 4OULA 2Y0OA 4Y5Z0 2Y26A 5FQ0B 2X8KA 3VHRA 1ASJ1 1VIWB 3AYDA 1Z7S2 5FPZA 4FO9A 1FAYA 3MGUA 1LR5A 4JGZC 1OQ1A 4HN1A 4JDNA 1JOJA 2X5IC 2Z2SB 3NKTA 1XQNA 3KMHA 4WZCA 5I0TA 1XNBA 5BNPB 5FO8B 2QKDA 3ZYJB 4BMEA 5L7OA 2EXHA 3R05A 2HWE1 2NQYA 3VBHA 1H30A 2VY0A 2A6VA 1TEIA 1EV11 3KCCA 2JEMA 4CDUA 1OPOA 1UL9A 4N7IA 2Q8OA 5I8SA 1QQP1 2B7YA 1OMIA 3M3EA 1J3PA 4RHV2 2BNOA 3MIEA 2QCSB 4MSVA 3QBQA 1NA1A 4LO8A 5BNQA 1VB4A 1DZTA 3WDUA 4EN0A 1PO11 1EAH2 3BOWA 2FHRA 4IV3C 3VZJA 2GU9A 2WNVB 5EYXA 5FQ0A 3ZXDA 4GMP0 1LESA 1O3RA 1PZ9A 4IESA 4A2UA 3WG3A 3EBRA 4QPGB 3RDIA 5IUQA 2WFF3 4ASMB 1R1A2 1RUJ1 3AP4A 4GA9A 1QMJA 2GC1A 4XFHA 1A78A 1AUYA 1W6PA 1FPN3 3IDCB 2O8OA 5BNPA 2QNKA 5ABJB 4NR1A 2VW2A 3QOPA 3HAGA 3M3IA 3ZFEB 4E2GA 3K51A 1PO22 3B00A 4L97A 1AYM2 1NLRA 4AHWA 3WCSA 3MEPA 5J98B 1VBE2 2WA3A 5LK5A 2BEOA 3D0JA 2XKOA 1D4M1 3ROUA 1AR72 2CY6A 4IEZA 3IWZA 1H2LA 2PHTA 3TN92 2ZGTA 4BLJA 4AQTA 2KM2A 1LHOA 1FATA 2KA3A 3ZXJA 1PGL2 1Y3TA 1BEV2 2WNVA 5JWPA 3WLUA 4N9HA 1CN1A 3WZ1A 1S55A 1FX5A 2IC1A 4P9XA 3AMMA 4GB32 4QGMA 5KHGA 1YFXA 3LKJA 2PHWA 3UJOA 4FOWA 5D8AB 4RL7A 2B42B 3O7OA 2HEYF 3RMYA 5JZGC 1HRV1 4RR3A 4XFFA 5CG8A 1R1ZA 2ZGLA 4TSVA 4PIXA 5JIUA 2GC2A 3ELNA 1ZRFA 1KD7A 1ULFA 2C1FA 2BUKA 4XETA 5TSWA 1DBNA 1C4RA 4QPIB 2HWB2 4HVQA 4QMAA 3QCWA 4PCRA 1ENRA 3HBZA 3SXWA 1J59A 1KXGA 3LOBA 5ACA2 5HCAA 4GIQA 4CDWC 2DCJA 4C91A 4AI2A 3VBUC 1QJZA 2K0GA 1YUDA 3PHMA 5C6CA 3H3UA 2Q4SA 1YRZA 3TWIA 2BPA2 2PLV1 4UXAA 1ALYA 1IS4A 4CDXB 1AL21 2ZAHA 2HWE3 2BFUL 4FOQA 4BIFA 1CGPA 4PBOA 1SLLA 2A7AA 1RUC1 1RUI2 2D98A 5D8AA 3QACA 1V00A 1H8TC 1RVF1 1LHWA 4IEVA 1CAXB 3RYKA 1CAVB 1VBA2 4YFZA 5AC92 4LHLA 2A3XA 2DUQA 2B9UA 2JG9B 1AXKA 1QJX1 2NZ9A 3UL2A 2EF6A 3J4UH 4YFWA 2GALA 3VBFC 1CIWA 5JIAA 1GFF2 1Q5OA 2DVAA 4AEKA 4BLIA 2NLRA 2Z79A 1QJU3 4FQ4A 1O5UA 1U0AA 2WS91 3VKNA 2BNMA 1RUJ3 5CFCC 4CP1A 1VBC3 4I0BA 1Q8QA 5T5OA 2EIGA 4YG6A 2Z69A 2PHFA 1QXJA 1J3RA 1OI6A 1H4HA 2VW1A 5J96B 4Q4Y3 4CDXA 3NAPB 1TME3 3JBG1 3ZMOA 1DGWA 1AR92 4OI2A 4PIZA 4IV1C 2I07B 4S2FA 1BBT1 4C1WA 1QXRA 1XE8A 4AXOA 3ZSLA 1IKQA 4BWOA 3ZVXA 1RUH3 1POV1 3P3PA 3AP5A 4RD7A 3VHPA 2ES3A 4B29A 1I5ZA 2XBO1 1CAXA 1SFNA 4AVTA 1DZRA 1AJKA 1ENQA 2JG9A 3RG0A 3WR0A 4Q4X1 4XFIA 4U2AA 4OI1A 4SBVA 3WQ7A 3SCFA 3WG4A 1DHKB 1ND2B 1GR3A 3HD8B 1M4WA 3MLJA 3LGRA 3BOPA 3AYAA 1HKDA 3ZYRA 4FAHA 5CBLA 2VOVA 1MQTC 1C8M2 2WZR1 3WHTA 1RHI3 3V56A 1PVC2 3ZXGA 4C1XA 2YUEA 3KCYA 5JVVA 3ZIXA 3DGTA 3R4UA 1PVXA 1LENA 4AFMA 4HN0A 2TNFA 2D3PA 4Y1YA 1NCRC 3T2TA 1V6IA 5HXVA 2XJQA 4X6RB 3ZXFA 1V70A 1RITA 1ULDA 2VVDA 4AQ6A 4XXAA 1K5MB 3NJZA 4L11A 4K1YA 3ZFGC 3HT1A 1XNCA 5BXXA 4QHBA 1VAKA 2RMU3 5GLTA 4CEYB 3IKWA 3JD71 2W08A 4YM0A 4WM8B 2E7QA 2BW8A 3WP5A 1OLRA 2VW0A 4K3UA 1V9U2 2HYKA 2ERFA 4I02A 1BVVA 2PHRA 1G7YA 3I8TA 3N36A 4RGGA 3PVNA 4XF3A 4YM1A 1RUD1 4AI1A 4AGVA 3R0RA 4DXZA 5SV8A 2YV8A 4FQZA 5BNNB 1H0BA 2D43A 3AZWA 3H3ZA 4INDA 1O3QA 3ST7A 2HWF3 2GH2A 2A6XA 2LALA 1R083 1HX6A 5GJ6A 1K5MA 5DUWA 1MS5A 1WA4A 5BUVA 1QH7A 5FMOL 3DUIA 2XL9A 1PGSA 4N53B 1MEC3 5FAXA 3N7LA 2A6ZA 4YG3A 2Z42A 1UD1A 3EHKA 3H1YA 2VH9A 2ZHKA 1GBGA 5GZGA 1A8DA 1KJRA 4ZXKA 1PGW2 2YY1A 1CAWB 3FZ3A 5D1IA 1DQ5A 4IEWA 2GNTA 3JCIA 1RMU1 3KLSA 4Q0VA 3RMXA 3WDVA 4QM8A 2UYAA 1REFA 1O4ZA 1CPMA 3GBFA 4EV0A 5K7PA 4AVBA 3NO8A 5BPXA 3D8CA 1AZDA 3WQ0A 1MS0A 4GMP1 3IT8A 4JVAA 1BMV2 1NQJA 2WFF2 2ZGKA 3ZSKA 3IDEA 3UKNA 3NV1A 4HSJA 4FPOB 3WQ1A 3AFKA 1ND3C 3HR9A 3S7EA 1N3OA 5CFDB 5I8TA 3JB4C 4NWVA 1FPN2 1J1LA 2DURA 4BZ4A 2E7TA 2IWGB 1U5IA 2R30A 3VDDB 1FV3A 2G9FA 3CJXA 3E5UA 1O3SA 3FUOA 1KDKA 1MS4A 1QJY3 1KS5A 1JN2P 2JECA 3ZN4A 5JAXA 5A3LA 1BK1A 4QQ2A 4R52A 5I0SA 4IERA 1W2UA 2Q0AA 4HLTA 1BKZA 1Q8SA 1VBD1 2XWBB 4FOVA 2PFWA 1ONAA 4DY3A 4HETA 5FBZA 4P9LA 4IEXA 3TB0A 2JJ6A 3O0VA 3SISA 3AKRA 3CU7A 5CIRA 2DCZA 4WVVA 5CA6A 2O0OA 2R49A 4IV3B 2RM23 3ZXLA 1JYIA 1O7FA 3CJIA 3SHRA 3TYJA 2RS51 4XIKA 5BYNA 1Q3EA 3HQXA 1QXPA 2DCYA 2MEV3 2HWC3 2ZOEB 3WDXA 3WDWA 1W6NA 4LBQA 1U5YA 4M3CE 2CV6A 5GLZA 1AYN1 4ITCA 1WMFA 3KT4A 1LOEA 1RINA 2EAAA 4V1PA 2XJVA 1OD5A 4W65A 3TOJA 3VDDA 1RUG3 5J3UA 2R063 1H2MA 4R9BA 3AJZA 3RWNA 4KGGA 4LA3A 4D7TA 4C0HA 5KC6A 2A3YA 4Q4V3 5K9YA 2XB6C 4AVSA 4QU2A 2B45X 2WJSA 1YFUA 1XYPA 3ILNA 3WW3A 3MFAA 2ARBA 5JCTA 1WLWA 5GLVA 4YARA 4AGRA 3MIDA 1BQPA 1MVQA 1DZQA 4IV3A 1WMEA 5DZFA 1F5JA 4L99A 1CR7A 2R16A 3OGGA 4GQ7A 2HWE2 3EQEA 3I7DA 1GQGA 5EXOA 3AXEA 4IEUA 1MZ6A 3JQXA 3WD5A 4XF1A 5DXDA 4C90A 4L8QA 3FMGA 4A3XA 1YFYA 3KB5A 3CF6E 2I74A 1I3HA 2SBAA 4QQPA 3SITA 1ULEA 1LHUA 2IXLA 3VL8A 3EO6A 4Z1VA 5C9AB 3J8F3 4OUSA 1HRI3 5FREA 4YZ5A 1JUHA 2Q5TA 3N7JA 3AYEA 1JYCA 2UWCA 1CAUA 2D6KA 2PHXA 3Q9OA 4XEZA 3WP3A 3MPPG 1QJU2 4MUVA 1WW6A 4N43C 5DG2A 2ET1A 4YZ2A 4A7KA 3DL3A 3ILRA 1YI7A 4K8FA 1W6QB 3BIWE 1RUJ2 2BGCA 1WCSA 1VBC2 3FLTA 2RE9A 3O0WA 1DIWA 1VLNA 3C3VA 1WCDJ 2IFWA 2AREA 1D2SA 3PVOA 2P17A 3IPVB 4Q4Y2 2VMHA 4GH4C 4D69A 2Q1ZB 4FCAA 1TME2 1MS8A 4ES9A 3N4MA 1RUF3 3ALQA 1XYNA 1SACA 1JW6A 3BU7A 2BFUS 4JDOA 1OA4A 1V6KA 2XLFA 3ZYPA 5FRAA 1MZEA 4K9SA 4YG0A 4HKOA 1RUH2 4Z2WA 1OQEA 5C8CC 4LLFA 4CDQB 5EJ3A 1LOFA 4JGYB 4YW5A 4JC1A 1FMD3 4XF4A 1CJPA 4ATEA 1AVBA 2YHJA 2DCKA 5FOBB 2XKPA 3VBFB 2EAKA 2ETEA 4WM7C 1W6QA 4S2DA 4CDWA 4BMBA 4LLOA 2SLIA 4JQRA 1W6MB 3VBUA 1RHI2 5CFCB 5IK7A 1AR83 3POWA 1QDOA 4Z07A 3WW2A 1LOAA 2YROA 4P9GA 4YVWB 4OHYA 1YLLA 4FTBA 2EALA 3SH5A 3RYPA 2DVFA 4OUMA 3R4DB 3VZMA 5A33B 2ZBJA 1H8TA 4XILA 5DG1A 3ES1A 3CO2A 2WQ4A 2OVUA 2RMU2 4FPGA 4Q8LA 4K40A 2PQQA 3SH3A 5EFUA 3MF6A 5L73A 1KFUL 2WINB 4K6BA 1FOD3 1ZVFA 1NXMA 2VU9A 5HCFA 3VBFA 1PMIA 2DVGA 1PM7A 1WW7A 2VVEA 4F7ZA 4MYEA 4QM9A 1IPKA 1F5FA 1SLIA 1V6OA 1W6MA 2WSVA 2R0FA 4MVTA 3H1WA 4YW1A 5C4WC 5CFCA 1I1EA 2D3RA 3AZYA 3VBHB 2P3JA 2QZ2A 4XTPA 2D44A 4N9IA 5KHIA 4YVWA 4Q27A 1Q43A 3OGJA 1VBB1 2UY8A 2QZ3A 3MZHA 2JXAA 4XBLA 2HWF2 1VAMA 3D6EA 5KHHA 1BYHA 3N3HA 1R082 4IV1A 1OOPC 3ZFFC 5A33A 2VNRA 4Y22A 1AX1A 4P5HA 4DFSA 3MLLA 4J1WA 1UKGA 2DU0A 1YYNA 1MEC2 4NHLA 2WKKA 2YC0A 1QHDA 3LOIA 5KC5A 3ETQA 2ZX1A 3D82A 4YGCA 4P9YA 4PF5A 4LEJA 3RYRA 1KRIA 4LE3A 2A6YA 2HEWF 5DUVA 5LRSA 2BVBA 1VRH3 3ACLA 2XJSA 2ZX2A 1W6PB 4AHXA 1TMF2 1MZFA 3VHNA 2QFEA 4HVOA 1MQTA 1LKNA 2W0XA 1FT9A 4NOTA 5J7MA 5K8SA 2R041 3MIHA 5DUUA 1VAVA 3BTAA 3L2YA 1DQ1A 4KU7A 1YO8A 5JOZA 2MNGA 1CVNA 1ZBE1 1XRUA 1URXA 2EXJA 3NSTA 4XPVA 3VKOA 1XNKA 4ATFA 5JLVA 4AFDA 4R8HA 4RQPC 4H55A 1HXS2 3ASIA 4M3CB 4QQOA 4BYYA 4Y26A 1LU1A 1W0OA 3AM2A 4PDWC 2ZGSA 2OZ6A 4M00A 4EN9B 4FBFA 5FMOS 2Q1MA 3ZFGA 2CTVA 1EY2A 4LBNA 1ZM1A 1ZBA1 5GZEA 4LA2A 4YW3A 2A5ZA 1QJY2 2X53S 1AJOA 1F31A 3RRDA 4H7LA 1H2NA 1UU6A 5FLIA 4IXLA 4UW4A 3IMNA 4B4RA 1X33A 1QDCA 3KGLA 2H6CA 3ZN6A 2D6OX 1LOCA 1DDLA 1AR63 1SCRA 5BY5A 1YHFA 5I8YA 1FV2A 1X36A 4P14A 2I45A 2NM1A 3PLQA 4RR3B 4WVMB 2JE9A 3VKFC 1EYBA 4Q0UA 1O3TA 2D6NA 3VKLA 1V6MA 2ENRA 2H0BA 2ZZJA 2WIIB 2RS33 4FTEA 2ZKNA 2RM22 3N7MA 4XQDA 5DZEA 2RS11 3K48A 1NY71 4HBNA 2GN3A 3W58A 1B35C 2MEV2 1R093 2HWC2 1DGLA 1QNWA 2E53A 4XF0A 3VZLA 1HDKA 1S0BA 5K0UC 3THTA 5DDJ3 3AX4A 4M3CA 4Q29A 4CEWC 2QQPA 1F2NA 1ND3B 1Z78A 3S0MA 4HSLA 4XQWA 3C2UA 2R073 3NWKA 4B4QA 1RUG2 4FTSA 4YGBA 2HKXA 1O4TA 2R062 3DN7A 2CGNA 4EJRA 4XJ8A 1IS5A 3U10A 1NYWA 1RUE3 1Q8OA 4Q4V2 5C8WA 3ZX7A 1DG6A 3WP4A 4Q26A 5H9RA 1SCSA 3ATGA 2JENA 2JG8B 4WVMA 4ZKTB 5SV5A 4AK3A 4Q1RA 2O8QA 3ZXKA 3WUCA 3AMPA 2VNOA 1LRHA 1COV1 1ASJ3 2RHPA 1OPMA 4HVRA 3KSCA 5L36A 1NOVA 1DF0A 4KWKA 3MI8A 2W68A 4HFSA 1ZA4A 2CGOA 2E51A 2JDZA 3B9IA 1Y7BA 5IK8A 4QQHA 3LZZA 2Y0IA 1A8MA 1ND3A 3W59A 3IM0A 3J8F2 3FFQA 1HRI2 3IN9A 5JOXA 3CNAA 4E4DX 2D3SA 1EV13 4NHMA 4EWEA 1YJKA 1QQP3 3VZOA 3V65A 1UW8A 3KM5A 2G9GA 2JG8A 2OUHA 2RR11 4ZU7A 1MR5A 1LEMA 1WLDA 4DRRA 2VMGA 3TAYA 2VMIA 4FP2A 3WCRA 1UF2C 1PO13 4YVSC 5JOYA 3PMEA 5T5JA 1G9DA 2YZ4A 4ES8A 2R0HA 3DPRB 4XW3A 5FLHA 1PIV1 1RUF2 2HJIA 4NWWA 5IT6A 2ZA9A 4L9BA 4XHXA 1BCXA 1UIKA 3VN4A 3GBWA 1OFNA 4KWJA 5FO7B 4EROA 2ZGQA 3ZXAC 4Y1VA 4I2OA 1UN1A 4WZFA 2BYVE 4Q4W1 1QOOA 1S0CA 5CB7A 4XOGA 5CADA 4D94A 5BNOC 1ZZ8A 4HKWA 1LB2A 5F5QA 1FMD2 2E9QA 4LUKA 3NL1A 4ISQA 1O91A 4X8NA 1DGRA 5JR7B 4F3JA 2D5FA 4XXPA 1BZWA 1D4M3 2Y38A 4RS5B 4Q2FA 4X6QB 2VQ0A 1G86A 2K9ZA 2NYYA 3CLPA 2PA7A 3OYWA 4OVEA 2H6BA 4FPEA 1Z7S1 2D93A 2GNDA 2VVFA 1M06G 1PK6C 1AR82 1Q56A 3H9AA 5L19A 4RA0A 1C1FA 4UW3A 2WNUC 3DPRA 1IOAA 2R1DA 2GC3A 4JDMA 5FFOC 5GZCA 4ZU5A 2GZWA 1APNA 4YGDA 1IS3A 3RZZA 3VHOA 5GZFA 1WW4A 1SBDA 2ZX0A 1XE7A 4NHKA 4HK8A 1CESA 1HRV3 5EZWA 3AYCA 3ILFA 4JTNA 4H14A 4MXWA 1GQHA 1X50A 4LBJA 4MH0E 1LECA 2E6VA 4RHV1 2WT1A 2QUOA 2GC0A 1ZRRA 1GYKA 4H7MA 3RI8A 1FOD2 5EYYA 3I2DA 1IGOA 2UWBA 4RS5A 4AEDC 4JRAA 5L7OC 2R6QA 4N43A 2IXCA 4AHZA 1G9CA 2RJLA 5T5LA 4CDUC 4HKLA 5I0RA 4XDQA 1HV0A 1HQWA 1LULA 3H1MA 4JCKA 1QH6A 3MF9A 1R1A1 5A3MA 2PLV3 4XMIA 2FMYA 4FPLA 3J9SA 4GALA 3M3CA 3OY8A 1AL23 4G9SB 1NA1C 1S0EA 4GH4A 2WNEA 1S1AA 2XJTA 2QDRA 1PZ8A 3AKPA 1SBFA 1RUC3 3QH6A 4MGZE 1RIRA 4LBKA 1PO21 2ZJCA 1AYM1 2D6MA 3B5LB 1W0PA 3O12A 1RVF3 1VBE1 4K20A 4AI3A 4Z92B 1N3PA 2HWD2 1YIFA 5C8CA 1XNDA 2IXIA 1AR71 1W39A 1LGCA 1QJX3 3JQWA 3TN91 2ZHMA 4PIYA 5BNPC 2TUNA 3CEWA 1AX2A 1PGL1 4Q0QA 2MPFA 1BEV1 1VRH2 1WGPA 2BVVA 1HV1A 2PYTA 4LO5B 2WS93 3MLKA 1QY4A 3AZVA 3HWJA 3U07A 3H8UA 2BNNA 4WM7A 2VQAA 2YGMA 4Y1XA 3KT1A 4GB31 2OA2A 3M4FA 3LB9A 2PHDA 2ZGRA 1NCQC 1C3HA 2ZGUA 3LA2A 1REEA 4LHNA 3VGIA 2ZACA 3JBG3 4AF9A 5T3NA 2D40A 2CL2A 3VLBB 2WNVC 3J26N 3E5QA 4FT8A 2ZMKA 1BBT3 4TLFA 1RC6A 3WDTA 1FXZA 1POV3 4GXLA 4ZU4A 3ZFFB 4FPFA 4QPGC 2XBO3 2HWB1 2WWSA 2B8MA 1E57A 1XXNA 4BHPA 4FXKB 5ACA1 3ENRA 3CJIB 1H2KA 1AXYA 4Y20B 2R32A 3FFZA 5H9SA 4Q4X3 4LBLA 5IK4A 4BPZA 1H9PA 4MV2A 3TNPB 1DYKA 2ZCWA 4DRVA 4XE9A 2DCTA 1D0GA 5ABJC 1PNGA 4Q0SA 4HPKB 1W6NB 4LBQB 1AR62 4JGZB 5EWSA 3ZFEC 4AWDA 3WHUA 3M2MA 4MX3A 2CGPA 1S0GA 2CAUA 2DWRA 4GULA 3AZXA 2VUAA 5AFBA 2X5IB 2YYOA 4CTEA 4XHBA 4KQ7A 1DU3D 1AHSA 2WZR3 3ZIWA 3G7DA 1RUI1 5JI7A 5C4WA 5HCBA 2XLAA 2E63A 2GH8A 2RS32 3AZZA 1GNHA 3I54A 1CX4A 1N1SA 4L92A 3ZSEA 2XL7A 3KT7A 3OPZA 3H7YA 2ZAAA 1B09A 5AC91 1R092 1VBA1 1JUIA 1TNFA 3ZSMA 5DDJ2 4MGKE 3ZFFA