4XABA

Crystal structure of evdo2 from micromonospora carbonacea var. aurantiaca
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
248
structure length
245
Chain Sequence
MEVVGTIDHRDREEFRSRGFAILPQVASESEVAWLRQAYDRLFVRRATPEDFYDIAGQRDRGPPLLPQIIKPEKYVPELLDSPHFARCRSIASAFLDMAEEELEFYGHAILKPPRYGAPTPWHQDEAYMDPRWRRRGLSIWTTLDEATVESGCLHYLPGGHRGPVLPHHHIDNDDRIRGLMTDDVDPTSAVACPLAPGGAVVHDFRTPHYAGPNLTDQPRRAYVLVFMSAPAEVADPEPRPWMDW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords EvdO2
publication title Oxidative cyclizations in orthosomycin biosynthesis expand the known chemistry of an oxygenase superfamily.
pubmed doi rcsb
source organism Micromonospora carbonacea
total genus 74
structure length 245
sequence length 248
ec nomenclature
pdb deposition date 2014-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05721 PhyH Phytanoyl-CoA dioxygenase (PhyH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.620 Mainly Beta Sandwich Jelly Rolls q2cbj1_9rhob like domain 4xabA00
3DKQA 4BQYA 4NHXA 4XCAA 5L9RA 4JZRA 5LBBA 5IAVA 4NHYA 3W20A 4XABA 3W21A 4MHRA 5LBCA 4NHMA 2OPWA 3HQRA 2G19A 4XC9A 3BVCA 4Y5SA 5IATA 3GZEA 5C5UA 2FCUA 4BQXA 4XACA 3NNLA 3HQUA 5EPAA 3KT1A 5HV0A 5LA9A 5HV4A 3KT4A 3NNJA 5ERLA 4NAOA 5DAWA 4UWDA 3PL0A 2RG4A 4NHLA 4XAAA 3NNMA 3ITQA 3GJBA 2RDNA 5DAQA 5LB6A 5LBEA 2G1MA 5IAXA 4NMIA 5EQUA 5LASA 4Q5OA 2Y34A 4ZPIA 5LATA 5M0TA 2FCVA 4ZONA 5L9VA 3OUHA 4KBZA 2HBTA 4BQWA 2A1XA 2JIGA 4J25A 4XCBA 3OUJA 4Y5TA 2FCTA 5DAXA 3EMRA 3OBZA 5DAPA 4MHUA 2Y33A 2RDRA 5C5TA 3NNFA 2RDSA 5LBFA 3MGUA 5EP9A 2JIJA 5L9BA 2HBUA 5A3UA 3OUIA 4NHKA 5DAVA 3GJAA 3KT7A 4IW3A 2V4AA 2RDQA
chains in the Genus database with same CATH superfamily
3B00A 1UOBA 2BTVC 3WW2A 3DKQA 1ZBA2 4AEDC 2RR11 4BQYA 3I3MA 4AQ2A 4ZXEA 5FZ6A 3WSOA 1GQHA 3AL6A 2EA7A 2EICA 2BPA2 1BZWA 5FO7B 1C5IA 3IZOA 5FCCA 2JKBA 3VBHA 3ZPYA 1PMIA 2O1QA 1W3XA 1D7PM 3S7IA 2UURA 2RJ2A 4J6GA 3UKNA 1HB1A 4OHVA 2J42A 3GHMA 3DUIA 3AX4A 4RHV1 2P1BA 3WV6A 3EXUA 1PM4A 4NHMA 5F6LB 4JGZA 5K9YA 3U4SA 1IG3A 2Z42A 1PO12 1TZOA 5FZCA 4N43C 3ZXKA 4CDWB 1FI2A 4CUCA 4YW5A 3VHPA 1RVF1 1N1VA 2WNEA 1M06G 1UXZA 1AR81 2E63A 1HN0A 1LHVA 3C8XA 2WFF1 1AYN2 2P17A 3B7MA 3NAPA 5T54A 5C3PA 4KWUA 1AXKA 1R1A3 3BPSA 4KI5M 1Q8OA 2XHNA 3T2TA 2B39A 3OPZA 3HT2A 4DS0A 2AR6A 1XC6A 4AVAA 4CPBD 1OH4A 1JZ2A 2FDJA 2WS93 5FR3A 3ZOIA 5FTTC 1SACA 4XIKA 1REEA 3WQ7A 4RGAA 1EY2A 4IV1A 1GYKA 1UOJA 1FMD2 1ZNPA 4NAOA 2YBPA 1DCSA 1R083 4RHV3 2EAKA 4FFFA 4MV2A 4ET7A 1CPMA 2VZPA 2WWJA 4HSLA 2H0VA 5FMCA 4F8AA 3RZKA 1A8DA 1H4HA 2Y6KA 5JMOA 1OI6A 2DUPA 2GC2A 3A4UA 4LA3A 1UD1A 1G7YA 1XSQA 2EIBA 1MS4A 3WG1A 2WJSA 1QHDA 1YI7A 4PF1A 3WUCA 2WFF3 1PO22 3VUOA 5SV8A 2B46X 4COWA 5BPXA 1QJZA 3O1MA 4P9JA 3K4AA 2ILMA 1ZBE3 2RS33 2GSYA 3GYDA 4R8HA 1OURA 3NJXA 4QHBA 1PVC1 5C8CB 3CO2A 1EUTA 3D6EA 3LZZA 1SCSA 4M0NA 2EXIA 4QPGB 1DGWX 4CCCA 3EJKA 4D0QA 1BEV1 3AKTA 2OZJA 1RHI1 1NXD1 1WD4A 2VBDA 4EWEA 2VH9A 3A23A 2GNMA 3H0OA 3VBUA 1TNFA 4QB6A 3I2HA 4GULA 4K8RB 2ZGSA 1GNHA 5IK8A 2BEOA 1Y9QA 4WVMA 5EHDA 4CP0A 1LOAA 4JKKA 4BXSV 5A6YA 1YUDA 3D8CA 1VJ2A 5LK5A 2IVIB 2BV4A 1GWKA 2ARBA 3SHRA 4E4HA 4ITCA 3C7GA 1B09A 4IESA 4XVHA 3UNPA 4OQ8A 5F3IA 4XJZA 3N9QA 4LBKA 2VY0A 2FQPA 2NYYA 2HWF2 4DRRA 2QQNA 1UIJA 2IFRA 4N53C 5FYUA 4A45A 3D0SA 2X5IB 1OQEA 3H7JA 3OD0A 2R063 2VE1A 2VNVA 2ARAA 2YC4A 5IVBA 2QZ3A 4FPCA 3RS6A 4QGMA 4UOJA 5KC5A 4A7KA 2RDQA 2DV9A 5C70A 2CGPA 2W47A 4URTA 4QX1A 4XILA 4OUEA 1VR3A 2WT0A 2Z2SB 2ZMNA 2ZHMA 4UBGA 5L9RA 5E6HA 1JOPA 3S0MA 4LHSA 3BPZA 2YUEA 1VBD1 2J7MA 1L7QA 2WZEA 1MZEA 3CIHA 2BW8A 4CZSA 4TZDA 3VKMA 3A0NA 3GZTB 1SBEA 1XNKA 3MF9A 5LEKA 1N3PA 3PJQA 1IG0A 1KJLA 3IDAA 3H7YA 3K3NA 2GP5A 2RS11 5H9PA 3TEZA 4GMP0 2VZRA 3LB9A 4WZCA 2BDRA 1XNCA 2ZACA 4DY3A 1I6XA 3KS7A 1DDLA 1CJPA 2WO1A 4B7KA 1G9BA 3ZVXA 5KXDA 1UU4A 1RXGA 5BXXA 5JR7B 3ASIA 1QJY3 4G3YC 5CA6A 2CAVA 2IXKA 2FCUA 4BQXA 2ZZQA 5GJ6A 5HV0A 2VQ0A 3DF0A 4OCTA 4SLIA 1F35A 4XF4A 2RM22 4K8FA 4P9XA 3USSA 1QF3A 4Z2WA 1FOD3 1IKPA 1ND3A 1SLAA 4LOTA 1E57A 1F4HA 2CYFA 4XJ8A 5FZLA 3MW4A 5HBAA 4W6WA 1X50A 1O3SA 1OOPC 4QX3A 3ACFA 3EBRA 3WDWA 1LJ7A 4RQPA 1O8SA 1PGW2 5ANNA 2QBXA 3G6JB 1UX6A 2JDUA 3HBZA 3KMHA 1WCQA 3V0BB 1W04A 2QCSB 1QNWA 4FFHA 1ZBA3 1AHSA 1PNGA 2DVDA 2C0ZA 3SNMA 5FYTA 4JDNA 3WY6A 1CPNA 1YQ6A 3ZFFA 4OYUA 3I4IA 2Y34A 5F8PA 1X9PA 3ACHA 2WZ8A 4LHLA 5FIXA 5KXBA 2EIGA 1BMV1 2VAUA 1CX4A 4JQTA 5D8AB 1MQTA 2A3YA 1F15A 3M3QA 2WAAA 4KBZA 5SV5A 2B42B 1DQ5A 3E6DA 3H1MA 3O0XA 1C4RA 3I3BA 2C6SA 2JB8A 3QD6A 3AC0A 4YW2A 5FXWA 2DFCA 3MFCA 5T5PA 2P37A 4P00B 1PO13 4AVVA 2DBNA 3LA7A 4XMIA 1ZRRA 2ZGPA 4QKDA 4ZY9A 4LBQA 4XTMA 2RE9A 3ZN6A 4YM3A 4UT5A 4GKXA 2VMHA 3M2MA 4RR3A 4YM0A 4FPKA 2P3YA 5K0UC 5I0RA 1BKZA 1AYN3 3LDKA 4ONUA 3VZJA 5FOJB 1IS4A 4HG6B 2BYVE 5C5TA 1QOOA 3WP5A 3NNFA 1D4VB 3DPRC 2A6VA 2ZGRA 3I2GA 1LEMA 4JGZB 1A34A 2ZKLA 4IEVA 2C24A 5K0UB 5FY4A 1QJU1 5FMOL 2OS2A 4UW6A 1G9CA 3IDEA 3J26N 3WW3A 3SMHA 3SLIA 5IVCA 1NYWA 2DFBA 1VPHA 5F3GA 1FMD3 3UL2A 3WDXA 1V00A 3RYPA 5J7MA 4TTGA 2YZ4A 3N9LA 5C71A 1UY2A 5A1AA 4Q1PA 5A32B 4MLOA 3CF6E 4AQTA 2OZ6A 1GSLA 3RZZA 4QX5A 5FPXA 4QDRA 2OVUA 4FPOB 2GZWA 1DBNA 2VXJA 3VDBA 1AYM2 2JG8C 2KXLA 4LBNA 4IV1B 1H8VA 4BXFA 1PO23 4CEYA 5A70A 1XYNA 2W52A 4M00A 4UYBA 2HWF1 2ZEWA 2DUQA 4WM8A 3VV1A 4DUWA 3WX5A 5JR2A 1RUD2 4AE2A 1KQRA 3SCGA 2BOJA 3OG2A 4Q8KA 2J1SA 4E4DX 5DZFA 4ZS3A 3ATGA 2QDRA 2FDIA 1Z78A 3GXUA 5BV6A 3ZXAC 3ZFEC 5IATA 5FPVA 1RINA 2Y6LA 1JUIA 3HT1A 4XXAA 4PLNA 5HXMA 1QXPA 4S2DA 3ECQA 1DQ2A 3GCXA 1NA1C 2MEV2 2VU9A 3EO6A 4M4PA 4L92A 2VVDA 1ASJ1 1X8MA 4CDQA 1RUG1 1U0AA 4PIXA 3I8TA 4ORFA 1HRV2 1IHMA 2VW2A 4QQHA 2WIIB 4CP9A 4MUVA 1LOGA 1WMXA 4A6SA 5CFCC 3IB3A 5H9RA 2XH6A 5A33B 2DCKA 2DCTA 4QX7A 2SBAA 4JGYB 2HWF3 4EN6B 2Q8OA 2OQ6A 3MIFA 3O12A 1VALA 2Q8DA 3ZFGA 1Q5OA 3J4UH 2XBO2 2HJIA 3VBSB 3ABZA 1R1ZA 2VZ3A 3FLPA 3K75B 1T6BX 1YLLA 3U07A 4NRPA 3WCRA 2VZUA 3AP5A 4FAHA 5C7GA 2XPJA 1FNZA 2JG9A 3Q8EA 3QH6A 3R4SA 5F32A 5BNNC 4KMQA 1ODNA 4WVZA 1O6UA 3AFGA 3VKOA 1W6NB 1W2OA 2DF7A 3Q9OA 4AL9A 1KDMA 3RZHA 1HRI1 2Q1FA 1Q56A 1EV11 2UWAA 2VOTA 1CONA 3KCXA 4RSUA 3RMXA 1UY4A 2ZAHA 1SCRA 4BWOA 4XQDA 2YPJA 3B3QE 3K48A 3O1PA 2C1FA 4DQAA 1I9RA 2W1SA 3ZDSA 3VZOA 1H30A 3QCWA 1GQGA 1FYUA 1NCRC 3OGVA 1C8M2 1DQ0A 1H0BA 1MVQA 2JENA 3T1MA 5CAZA 2GC3A 3PTYA 3RG0A 1LHNA 1X36A 4YM2A 1PK6B 2WO2A 5C3QA 1PGW1 2EIEA 3NMBA 4PI0A 1SQ4A 4MHUA 1G9DA 2H6BA 1GWMA 2ZGOA 4MADA 2DCJA 1B35C 4LXLA 5F5QA 4I30A 2ID4A 1M4WA 3GGLA 1ZZ6A 4CU9A 4MYEA 1QY4A 4AFDA 3ACLA 4I3GA 2NQYA 2PHDA 4CEWB 4DEVA 4MXWA 2WC2A 3KF5A 2OA2A 2ZX3A 3KT7A 1CWPA 1PGL2 2RM23 1H6YA 2YU2A 4C0HA 3NNGA 4J1XA 4YFWA 2JE7A 2XVKA 4XF1A 1RGSA 2OXBA 4LPLA 1FATA 4FVVA 1UU5A 4Q1RA 3N7KA 5F37A 5HXVA 3R6SA 5CISA 4EYUA 1NZCA 2D5FA 1D2QA 3GALA 2CWSA 4AHXA 3KV9A 4PBPA 2C5DA 2TBVA 3BTZA 1SPPA 1H8TB 3PUQA 4MGZE 4AFAA 5A1FA 4YVSB 4HN0A 3GBWA 1QOTA 2V09A 3FUOA 3OYWA 1EAH2 4OZXA 1FNYA 3CEWA 5E89A 3GDBA 4IEXA 3SEPA 1AJOA 3BVCA 3WXPA 3WNMA 3VBOA 2E26A 4XDOA 3NV3A 4BB3A 1UZVA 5J37A 2IXCA 2XLAA 1AX0A 5CEHA 1N3OA 4LKSA 3MIHA 5A3WA 5CKNA 1MEC1 1POV0 3VBFB 2L9LA 1PIV2 4Y3OA 1REDA 1JYVA 2OT7A 3WDVA 3LEKA 1H9WA 1YXWA 1BHGA 2EIDA 1V6NA 5LA9A 3K2OA 4H3WA 3ILNA 4U2AA 2VNOA 1AYM1 3VD9A 1S2EA 2JDNA 5FZHA 2R1BA 4XQWA 4WM7C 1SG3A 1HXS1 2J22A 2YFUA 4MX3A 3M3IA 5J48A 1WA4A 4BIOA 4HVQA 4HT1T 1YFXA 5I91A 3I59B 3O0WA 5JZGC 1V9U2 1DG6A 4FOYA 4RN5A 4Z82A 3BOWA 2GH2A 2CAUA 3BTAA 4UBHA 4NIIA 2YMZA 4AI2A 4NIDA 4NHLA 4NWWA 3WNOA 2R49A 4IV3B 5FZOB 1VBE2 5J98B 3U0ZA 2P3JA 3MBWA 4Q4X2 4RS5A 4D94A 1VBB2 2RDNA 1ENXA 2UWBA 4NOTA 5FLIA 1CAUA 4LHKA 1YFYA 1N1TA 4ASMB 3SKVA 3POSA 3TN91 4OUMA 3PJYA 3PIGA 3PUHA 3KSCA 5EQUA 2RV9A 1JYTA 1BLZA 3WHUA 1S0JA 3DKWA 4UF0A 2VMCA 4HANA 5EYXA 2PHWA 3H3LA 2DYCA 1WBFA 4CUAA 3FHQA 1DP0A 2VCBA 1DYPA 1TME2 2W9XA 4HVOA 4BQWA 2V4VA 2YGMA 3C7HA 5K7PA 2X8KA 3N7LA 4FT8A 2D7FA 4BQ5A 1RB8G 1LOBA 3H42B 2ZA9A 3L2YA 4XCBA 5GZEA 1RUD3 5GALA 2PHFA 1H2MA 2QQOA 3RYRA 1S55A 4Y22A 3SKJE 1XSRA 4QKBA 4AFBA 5KXEA 4A4AA 4AEDA 5C3OA 3FN9A 1CAXA 1SEFA 3ILRA 4CU7A 5F9TA 3NW4A 2WAOA 2JDYA 4JHTA 2W1QA 3ETPA 4XFIA 2MEV3 1DGWA 4IE7A 4Q4V2 2PLV2 4XFHA 3K77A 3RNSA 3KGZA 2DTYA 4O65A 1R1A2 1UIKA 1HRV3 4LITA 2OKXA 2D6NA 1D0HA 1BYHA 1V6LA 2YU1A 3MV11 1NAEA 1NE4A 2V4AA 5C9AC 4YGCA 5F39A 5GZCA 3LEIA 2P5BA 3BN6A 3MV01 4QQ2A 3TB0A 1H2NA 2UYAA 1AXZA 1H1IA 4N43A 1DQ4A 4BQ1A 3M3OA 1C8M1 4XETA 1NQDA 1AX2A 2EXHA 2KR2A 2XBO3 5IVJA 5CG8A 3FWEA 4AR2A 1W0OA 2W1WA 1PNFA 2PAEA 2WL1A 3ON7A 3OBAA 4Y1YA 3VBRC 1K5MC 4FXKB 3WOGA 5GLTA 2W91A 2WUHA 2WLQA 2JD4A 4KQ7A 1XNBA 5C33A 1V6OA 1AVBA 1WMDA 4FO9A 2G9FA 4RA0A 5KBFA 4N8MA 1CZVA 2Q0AA 5B2GB 3HNYM 5JSOA 5BNOA 3O1TA 1RUE1 3ZXFA 3DV8A 4YG6A 1LODA 2D6PA 5KWRA 4V2VA 2ENRA 1RUH1 2QUOA 3B69A 3KZ4C 5FBJA 5IWFA 1SHWB 1VB2A 4Q26A 4QDQA 3KHCA 4FPHA 5FYBA 4PQ9A 4QKFA 4CRQA 2VMFA 3LA2A 3VDAA 3PMSA 3HNBM 1Z7S1 2DWRA 3FFZA 3NJVA 3PNAA 4OULA 5BY5A 3FE5A 5CFDB 1UY3A 3CDZB 4P9WA 3U14A 2Y6JA 1OH3A 1ZM1A 1W6QA 4D6RA 4L2NA 1EPWA 4NPRA 1JYWA 4X6QB 1UO9A 2AYHA 4D7TA 1Q8QA 3M7AA 2ARXA 2PHTA 1PHMA 4AG4A 3TYJA 4LO7A 3WP3A 4D8MA 2Y8KA 1JI6A 5FKCA 3M70A 2GC0A 4IGQA 2O14A 2ATFA 4XAAA 2MNGA 3CQOA 2ZEZA 2KD7A 4NJ4A 2DCYA 3B5LB 1DQ6A 2E7QA 1G8WA 1GZCA 1O4ZA 1RITA 2VUDA 5FAXA 3O1RA 1Y9MA 2LTNA 1LGCA 3NQHA 1OUXA 1DGRA 1R093 4YW4A 2HEYF 3BCWA 1RUOA 2VZQA 4AOCA 4XHXA 4K21A 1W6MA 5M0TA 2PHLA 5L9VA 2NMOA 1O4TA 3FJSA 3AKQA 4AEKA 4LOSA 4K6BA 4V1PA 1NLSA 1LOEA 4P02B 1CAWB 1QDOA 2A71A 2K2SA 2HBTA 4PIYA 1R64A 4YG0A 2VG9A 3OOXA 2VVFA 5BNPC 4N53A 2ZGKA 2JE9A 1KFXL 2VC9A 1ND2B 1UYZA 1CR7A 1VMFA 1J3QA 1XU1A 2VTFA 1EAH3 3INAA 4LIVA 1F31A 3LDRA 5JI7A 1MVEA 3UGFA 4Q27A 1LECA 5AVAA 4EN9B 5DAPA 5GZGA 5L36A 4AAXA 2WT1A 3WG3A 1RYYA 3S57A 3DYMA 4YM1A 1JYNA 2AGSA 2FHRA 5FK7A 3WR0A 4NRQA 2AREA 3VL9A 1BBT1 2HWD2 1PIV3 1ZZ8A 3M8LA 2EAAA 2A3XA 5L9BA 1HB2A 2XB6C 2YC2A 3TEXA 1XRUA 2YXSA 3N7MA 4D3WA 1I3HA 3JXSA 1BVP1 1HQWA 5I0SA 1D2SA 1NQJA 3SEEA 5C4WA 3IAPA 4UAPA 3ILFA 4AGRA 2PYTA 4FQ4A 1OSGA 3UGGA 4KWJA 4RGGA 2XJQA 1PX3A 4HVRA 5FZ0A 3KD4A 4HN1A 2XJRA 1V9U3 4LKEA 4Y4RA 1UWWA 4QHZA 4JZRA 1WZXA 3WEZA 2BBVA 3F95A 3MUZ1 3M3CA 5JXGA 1IQAA 2ZGQA 2OUJA 1LENA 5JOWA 2VZVA 4D6SA 3RYKA 3THDA 4AFMA 5JPNB 3SH4A 1VBE3 2ZX4A 4Q4X3 3ZR6A 1UYXA 1VBB3 4JDOA 2V73A 1V6IA 5APAA 3G7DA 2DVAA 1V6JA 2VULA 4R9DA 4PBOA 3I49A 2FDHA 4NIHA 2FBEA 4OMDA 5T5LA 4G9SB 1WCDJ 4C1WA 3O14A 1R1A1 3UKTA 3AP4A 5CB7A 2DVFA 1TME3 1HN1A 3WD5A 1UQXA 1VRBA 2I07B 4NWVA 1OPMA 2W95A 1E5SA 3RDIA 1NOVA 2WS91 2PXJA 4URAA 3WVJA 1NX9A 2TNFA 1W05A 2OX0A 1OOPA 2HEVF 5EPAA 5FZKA 4AGVA 2BOIA 4CDWC 2WKKA 3POEA 2LALA 3KT4A 5A3PA 3HPNA 3CJIA 1R081 4UW3A 5I0UA 2LUWA 1SLIA 5FZ4A 3NVCA 4Y1XA 4EE2A 2GU9A 1VE0A 4GZ9A 4MGYE 3AYCA 2ZS6B 4I09A 1OBNA 2MHFA 1K45A 2VMIA 4Q0SA 4I0AA 4UWDA 3WW1A 3V0AB 4GWIA 4N9IA 3VD3A 4Q4V3 2PLV3 3HMYA 4BE3A 2OIIA 2VBPA 2Y6GA 2VGDA 4RFT0 1MZ5A 2ZGTA 2A5ZA 4QQPA 3FUQA 2RJKA 2XQXA 1GP4A 2WZPP 3RI9A 4LR4A 4Y1VA 4Q0PA 2G9GA 2RS31 1ZBE1 4XOGA 1X33A 4XF0A 2ADEA 4Y1ZA 4HONA 3BODA 2W5FA 5H9QA 4AHYA 3BTYA 3KCYA 2N7GA 3BTXA 4BH9A 2TEPA 4YVWB 2B5HA 3VZMA 4UFHA 2D6LX 3CU7A 4GH4A 5FXZA 1JODA 3I3DA 1F5FA 1FX5A 1U5YA 4YGBA 3AXDA 5FMDA 2FCVA 3B93A 2XG3A 4M3CA 1HV1A 3TNPB 3VDDB 1W8ZA 1J58A 3ZXGA 5LEJA 1SFPA 4IEQA 4B29A 4B4RA 1J3RA 3DPRA 5CYYA 2ZHNA 2WNVB 4L8QA 3AJZA 3KWVA 4R4XA 4UFJA 5LA2A 3LCPA 4QWNA 3U1XA 1T6GC 3D4KA 1WW5A 5FZAA 3CHXA 5C8CC 2Y60A 1MS5A 2XKPA 3P3PA 3IM0A 5FZ7A 5D1IA 4CDUB 2E7TA 3WG4A 4YARA 4Z1VA 2CGOA 3JBG2 4BU2A 1W6PB 3OCPA 4QPGC 5DZGA 4F7ZA 3LOBA 4AWDA 3A7QA 4B1MA 4BMBA 4PDWB 5J1XA 5HCBA 1CAVB 2JX9A 3IIAA 3MW2A 4DUVA 1OVPA 5IK5A 5FFOC 2R061 4DXTA 5FKBA 4YFZA 3GCWA 5BNOB 3VDCA 4CDXB 2JG8A 1NY71 1UOFA 4V2WA 2QQIA 4KWLA 1FPN2 2W46A 1OLMA 4XW3A 4JDMA 5FMOS 1S0GA 3H8UA 2ZX2A 3PIJA 4I0WB 1H1MA 1POV3 4NHXA 2D6OX 2VMGA 1SLLA 3KV4A 4PHZA 3OEAA 4YZ5A 1MPXA 4A7YA 2X5IC 1MR5A 4GJZA 4TWTA 2JECA 2JE8A 1QJEA 2B45X 3ZFEA 3WINE 5DUVA 3CMGA 2CDPA 3FMGA 4IGPA 4MH0E 1NA1A 4IE5A 3THCA 2WA4A 4OHWA 3CL1A 3I2DA 4B4QA 5A1LA 3OF1A 4A41A 2K9ZA 1W0NA 1QH7A 1XJAA 3OPTA 1POQA 1N47A 4GALA 3T2QA 2WO7A 1ULCA 3TBDA 1QJY1 3B9IA 5CFCA 1TMF2 3ZMNA 4OHYA 3KQRA 1LCLA 1XE8A 4EV0A 1ZZBA 2VTXJ 2XDVA 4WZFA 4FP3A 1OD3A 5ACA2 3ZIWA 1LKNA 2ET7A 5JMCA 1W6MB 3TEYA 5L73A 4E27A 2DBIA 3VL8A 1FT9A 2ETEA 4XFFA 4Y1UA 4AEMA 5BNNA 2HYKA 1FOD1 1TE1B 2Y38A 2YROA 3J7NA 2DURA 4GB33 5ABJB 4TXWA 3DYPA 2HWD3 3NO8A 5J36A 3NKGA 1NLQA 4QXBA 3RQ0A 5IFTA 4DO0A 5J3UA 5LRSA 4LJHA 4XJUA 1UPIA 3NNMA 1O3TA 1UZWA 2BGPA 2EXJA 4A44A 1ZBA1 2PQSA 1W2NA 4Z92B 1YWKA 2WNUB 1HQLA 5FV3A 1NCRA 1S4CA 1VRH2 3D0JA 1HDKA 2E31A 1Y4WA 4NR1A 5FPLA 2E51A 2VECA 1AL22 2DU0A 2VNRA 2ZGNA 3JD72 3NRUA 4BLIA 3AMMA 1YCIA 3HIFA 1JZ8A 5GLVA 2IXIA 5CKMA 3RRDA 3OGRA 4R9AA 5C4WB 4CVUA 4DNYA 1JN2P 1NCQB 3DXUA 4GWNA 5KHHA 3C7EA 1I5PA 2DUOA 3WDTA 3I2JA 4B8EA 3BGAA 1PO11 2RS52 2WZR2 2D3RA 3GHNA 4CUGA 3E5UA 2ZHKA 5L7OA 2NM1A 1E5HA 1AYN1 2BUKA 4LO5B 4EWAA 4BM8A 4AI0A 2XL7A 3H1WA 4QXHA 4W6YA 5D8AC 1GWLA 1QKQA 2RHPA 4PCRA 4Y26A 1LHWA 2P6CA 4K1ZA 5F3CA 4HSJA 3H8RA 3LEGA 1RUJ2 2ZAAA 4KWKA 4K1YA 1J1TA 3SISA 4BK4A 2FDKA 1FMD1 4QPIB 1OUSA 2H6CA 4M3CE 3ZSLA 3DCQA 4YYOA 2FDFA 1SDWA 1GFF2 2VO5A 3WP4A 4JGZC 2ERFA 4AVTA 1IS3A 1VAKA 3VBHB 1VBA2 1D4M2 4S2GA 1K12A 1OFSA 5A3OA 4AHZA 2EF6A 5HPOA 3H8OA 1PO21 3O1VA 1O3RA 1W6OA 2WRAA 3CJIB 3DXTA 3JBG1 2X29A 2VCAA 2CWMA 3WLUA 2VOVA 4GWMA 4ZU4A 3ZYIB 4MHRA 5LBCA 3BIEA 1PZ8A 3MI8A 2X10A 2OPWA 3T4HB 1XE7A 1RUF2 4PI2A 2H0BA 1RMU3 3SH3A 1OA2A 2G19A 3POWA 3FHAA 3NAPB 4LK6A 4LULA 4HMZA 2W92A 2D93A 4CU8A 1MS8A 4WM7A 2VQTA 1OLME 4IV1C 3BOPA 2D6MA 3IKWA 5JZGA 3RJRA 1FXZA 4IEYA 5JCTA 4FQZA 2GMEA 4ZXKA 3V56A 3K46A 4GH4B 1LHUA 5KHGA 2WR9A 5JWPA 2Z79A 5F1RA 4FTEA 2DVBA 4QPWA 3NNJA 2UU8A 3JBG3 2LRPA 3AK0A 3WDYA 4LUMA 4XBNA 3AMNA 3PMEA 4QGLA 3WQBA 3EHKA 1BQPA 2FD8A 2A6ZA 4QAWA 4R9CA 1D0GA 3RPQA 2HH9A 3N4MA 4ES9A 4XDPA 3BU0A 1NG0A 1FPN3 2GNDA 1RUC2 4B4PA 1W3VA 2A73B 4JVAA 1YIFA 4Z8BA 4N7IA 2PAMA 4JGYC 2G1MA 2QJVA 4LUKA 5IAXA 4RGKA 1N1YA 1DLCA 1PM7A 1QQP2 5FWEA 4L99A 3VBSC 3ZYGA 3VBUB 1G6NA 3WT3A 1KJRA 3ZYPA 3H9AA 4CP2A 2BU9A 4W6XA 4AI9A 4WVMB 5FQ0A 2ZGLA 1KDKA 1GBGA 5T5JA 3RSJA 3WQ0A 2UY9A 4CCOA 1DLLA 1UZYA 1ULFA 2BWAA 2YG0A 4XPVA 4XUNA 4AVCA 5T50A 2QQJA 2WQ4A 2HWC2 1RUI2 3S5AA 3N9MA 1IZ3A 5A6ZA 1W8WA 2CY6A 3UJOA 1APNA 1GZTA 3GM8A 5C9AA 1TMF3 1XNAA 1XNTA 2Y26A 1XYPA 3PUSA 1YQ5A 5DZEA 1QU0A 4ARXA 5F2SA 1OT5A 3WZ1A 1JZ3A 4JKLA 1UY1A 1LGBA 3AYEA 3AZWA 2HBUA 3BUCA 5ACA3 2WYSA 1XB9A 1OLRA 2BRTA 2RM21 3MHZA 1K5MA 3AZZA 4H7LA 1W06A 3GZAA 2Y64A 2ADDA 4W4ZA 1PK6C 2YGLA 1ZRIA 4XZUG 3BB6A 5A7WA 1NUKA 4FFGA 4BQ2A 3UT0A 5IK4A 2X53S 3W59A 2WZR1 1S0IA 1COV2 4NVPA 3T2OA 1GNYA 1US3A 2W39A 2WSUA 2RMU2 1QEXA 3AMHA 1W9WA 3HN1A 2P4EA 3KGLA 5DMYA 3LGRA 1G9FA 2P3KA 2IUWA 5FP9A 4CEWC 1O4YA 2IWGB 3OSDA 3B02A 4LQRA 1N3QA 2OYZA 3VKNA 5KR7A 3LPGA 4IE0A 1WCKA 1CJDA 1W90A 3F2ZA 1VRH3 5FZEA 1OXCA 4QQLA 2IXJA 4XTPA 3T2PA 3U37A 1AL23 3CNAA 3JD73 3W5MA 5EV7A 3MUY1 4R52A 4IUGA 3K3OA 1DU3D 2DCZA 3PTRB 2P6HA 4HFSA 2FZ2A 3B94A 1DQ1A 3GZEA 3PVBB 5GLWA 5C3RA 1R092 4O9EA 2RS53 2WZR3 5JXJA 2JJ6A 2JICA 3T30A 1H8TC 2XQRA 4WVVA 4FTBA 2XJPA 1D4M1 4YVSC 3MLLA 4OUSA 1S1AA 1SFYA 2AZ5A 1FAYA 1SBFA 2GH8A 5IVYA 5ERLA 4GJYA 1JYIA 1DGRN 2VVEA 1KRIA 1ND3B 2VQAA 2NN8A 5DAWA 4ZU5A 2ZMKA 2YHJA 3KVAA 4FPGA 4Q4W3 1UMZA 2QVSB 3LEMA 4I2OA 1A3KA 1VP6A 3OGSA 1RUJ3 1YFWA 3VBFC 4AVBA 2VCCA 5JSPA 3MW3A 4ATEA 5KXCA 1CIWA 1QJX2 3NV4A 4RQPB 5L7OB 3RZLA 5F5AA 2QE3A 1AR93 4PT6A 4DXSA 2R0HA 1XU2A 1W8TA 1SBDA 1NZIA 3OEBA 4Y20A 5BNPA 3GF6A 3BKZA 4AI8A 1JZ4A 1UAIA 2K0GA 4IEWA 2E6VA 3ZFFB 2QQKA 4NMIA 5FYCA 1OMIA 1VBA3 1D4M3 3MICA 4R4ZA 1VAMA 5LATA 3T4VA 4IL7A 5FZ1A 2GALA 2B9UA 1MQTB 3LQCA 5FY5A 1W9FA 1QMJA 3Q8BA 2ZX0A 4HPKA 2Q30A 4IV3C 1HB3A 2EXKA 1HJGA 4OI2A 5A80A 1YFUA 2D97A 3VZLA 1HB4A 4QX8A 1RUD1 1VBC2 1OD5A 5FBZA 3LIGA 2B9VA 4HK9A 5KHJA 3P6BA 4LBQB 3EYPA 1RUF3 3IPVA 3URFA 3ZN6B 4CXYA 4FXGB 4RR3B 4OZOA 4G4FA 1O5LA 3N9OA 5C6CA 1X7NA 1W6OB 3USUA 3LFIA 2VQUA 4CXXA 1WWYA 4EWDA 4L11A 2BFUS 1WLDA 1AR62 3IIIA 1LU1A 3I2KA 3ACIA 2HYXA 4JX0A 2MEV1 3ZYBA 2HWE2 2ZJCA 1UYPA 1UKRA 5A3UA 2GN7A 1VB4A 4K40A 5FUNA 1HRV1 4NHKA 1QQP1 1AUYA 3D5OA 3OY8A 4KNCA 3RWKX 3ZSJA 5J09A 3HOBA 1W0PA 2VJXA 3UJQA 3KQ4B 3W5NA 1LB2A 1YC61 4GQ7A 4HOOA 3POGA 3IWZA 1H9PA 3BU7A 2XBO1 4AK3A 4MXVA 2OW4A 3SH5A 5IAVA 1QXJA 2JDZA 1NKGA 1RUI1 2BERA 2PHXA 4GKYA 2BVVA 4P9YA 4CEYB 4LBOA 1RUC3 4LBQD 1A78A 2G9ZA 4DIQA 2CSGA 1PGSA 1SLBA 4WM8B 2UWCA 2QNKA 3P3NA 1UKGA 4GMP3 1WBLA 5IW0A 3OB8A 5F5CA 1UY0A 5F2WA 3OBTA 2D44A 1ZRDA 4GAZA 2V72A 4CDWA 3MIBA 1JUHA 4AQSA 1QQP3 1MZ6A 3CKHA 3LAGA 3S30A 3ZXDA 3I2IA 5F5IA 3WDUA 2VD7A 4A7ZA 2WT2A 2VOXA 2PFWA 1GV9A 1ENQA 4ZU7A 1KEXA 1NE6A 4AW7A 1COV1 3T3YA 4XUOA 3AP9A 4CP1A 4CDQB 3RZMA 5ISLA 3KLSA 1EP0A 1BK1A 3D3AA 1L7RA 3NJYA 4CP9B 4EZHA 1LAJA 2HWC3 1LESA 1RUI3 1WKYA 4LBJA 4LT5A 5FPZA 1Y3TA 5FREA 3VHRA 3L2HA 5CG9A 1ZA7A 4KGQA 5A7PA 3DN7A 5FUIA 2R043 3ZFGB 2ET1A 1UW8A 2RR12 5DUUA 1SFNA 2ZTNA 4UW4A 1UZ0A 2VM9A 1XOYA 3PHMA 3LE0A 1Y43B 3PL0A 3AMPA 4JC1A 4YNIA 4D6QA 1PGL1 5J96B 2PA7A 2VUCA 2C4XA 2JG9B 3KV6A 4XUTA 1CQ9A 3IT8A 5FJHA 3ITQA 3N36A 4KH9A 3WQ1A 2F4LA 3ZPOA 4XBLA 5A7OA 4BYYA 4YZ4A 5CBLA 3R05A 5CFDC 4JTOA 2IFWA 1R091 4BQ3A 1COV3 4P14A 3MIGA 2JEMA 2WQ8A 2WA3A 4GA9A 5LBEA 2VW1A 2YFZA 3A22A 5C8CA 2D3SA 2RMU3 1CZTA 5FO9B 4ZPIA 1RVF2 2FMYA 5LW9A 1BXHA 1YEWA 1S0EA 3J7HA 4QPGA 3DECA 1GZWA 1JOBA 1J1LA 3I54A 5FZDA 3OUHA 2R30A 3H3UA 1OF4A 5FZ8A 3OPWA 3ELNA 4BLJA 4EJRA 3GBFA 3I2FA 3PUIA 5TSWA 5EIYB 5IVVA 2F4PA 2J1EA 2PELA 3KV5A 1OQ1A 2D98A 3NJZA 4K9SA 1EAH1 4O61A 1EUUA 4Q2FA 4UFLA 4DY5A 1TNRA 3VLBB 3BALA 4IE4A 2JD9A 4LBLA 2Y6FA 3OBZA 3ZN5A 4CCMA 4Q0VA 3SC7X 1TQ5A 4F83A 3HEIA 3RGBA 5FZ3A 1X9TA 1YYNA 4JRLA 4HKWA 1PIV1 1HQNA 1JOJA 2A75A 4YGEA 4PQQA 5LBFA 4BIFA 4COZA 1FV2A 2VZSA 3N7JA 4D7SA 5JOYA 3WF1A 1N1SA 4B3NA 4MXWB 1ND2C 1MS0A 4XXPA 5FJKA 2A6WA 3H50A 4N7UA 5I0DA 4YSFA 5LZ6A 4RD7A 5DPNA 3QACA 1V9U1 5D2AA 4E4ZA 3FLRA 1CESA 3LFMA 1JW6A 1YHFA 4X6RB 2CTVA 3BI3A 1VBC1 1OFNA 5I0TA 4Q29A 4LHNA 4ASLA 2BWCA 1E5RA 1UOGA 2IZWA 5FP3A 2XHKA 2WFPA 4X8PA 1QJX3 2WN3A 2AEYA 1VBE1 1S2KA 3IAQA 4AI1A 5FUPA 5FMBA 4Q4X1 4FSJA 1LULA 1VBB1 3WF4A 4GB32 5DN2A 3W20A 1BEV2 4QHOA 3VGIA 1RHI2 1SPPB 3W21A 1J83A 2QDNA 4BOWA 4Y4YA 5FRAA 1O8PA 4JV4A 1SDDB 2HWE1 5FLJA 3ZKUA 1Y9GA 3OYWB 5JVVA 1JHJA 1ODMA 2IC1A 1ACCA 5JXHA 5EXOA 3PVNA 4H14A 2ZMLA 2ZEYA 3DL3A 3DYOA 5CZKA 3VBOB 1TME1 3DEMA 5AFBA 3WW4A 1GOGA 2BGOA 1YQ8A 5JOXA 3I97A 4C1XA 5DDJ3 1MS3A 1OHFA 3HAGA 1VBC3 3MZHA 2A6YA 1V6KA 2VCMA 3E5XA 3POYA 4IEUA 2XOMA 4IEZA 3ZYFA 4Q8LA 4U36A 3FFQA 4QMAA 3NWKA 3LSDA 3THPA 4CCLA 5JOZA 4YGDA 2GNBA 2NLRA 2P3IA 5T5OA 3SQOA 4KG8A 5A7SA 1KS5A 4LA2A 4E8CA 1AR63 3BYWA 3AZXA 5FK8A 3HJRA 4MGTA 3RMYA 2HWE3 2PLV1 4Q4V1 4COYA 4Y33A 3ZMOA 4AYUA 5GKAC 2Q8EA 1REFA 3IMNA 1EYBA 3FHIB 1VBD2 2QFEA 2UYBA 1LTEA 4RS5B 1QWRA 1WUVA 4XAEA 4DB5A 4XQ4A 1US2A 2G4IA 4PF5A 4XJ9A 4ZS2A 3UETA 1CAUB 1Q43A 3GJBA 4NUBA 5AFEA 4BK5A 5FZBA 5K8SA 3V0BA 1ZRFA 2K46A 1LU2A 4E2GA 1UF2C 1QNYA 4UF0B 4WBBA 2RS12 5FP7A 5LASA 4CUBA 4QM9A 4HETA 3OY8B 3QBQA 2XLGA 4XUQA 1GP6A 3MO4A 5B4XA 2B8MA 5E16A 2XMLA 5D8AA 3O7OA 4A2UA 3AM2A 1ZA4A 5FDBA 5KHKA 1BVVA 3POFA 3LIHA 4A3XA 4DRVA 5FWJA 1UMHA 3V65A 2VMEA 5FLHA 1PZ7A 1WMFA 1WW7A 3WCSA 5IFPA 4YVWC 4CU6A 4DZGA 2JDAA 4NRMA 4RFRB 4Y22B 3H8XA 2QQPA 4S2FA 3HD8B 1P8JA 2YY1A 4IEPA 4AEDB 5IHRA 4QXCA 1DZTA 1CAXB 4QQOA 2JDMA 4P9GA 3OD4A 4H55A 1IGOA 2DVGA 3VDDC 5I8YA 4LNVA 4D69A 1RMU2 2ZZJA 4Q4Y2 4OI0A 4K7JA 3TAYA 2WNVC 3OGJA 4EROA 5K0UA 5A3NA 4TYSA 1JZ5A 2XWBB 5JDBA 1U12A 2W94A 4P9LA 1WLWA 1QOSA 4IW3A 4S2HA 4XIOA 1JXNA 4CDUC 1XBFA 1YIPA 2Z69A 3C7OA 5GZDA 4ZHNA 1POV1 2E33A 1UCXA 2Z4FA 4N43B 4R9BA 3WNXA 1ZYBA 2RR13 4IQPA 4PDWC 5A32A 2JXAA 2WNOA 1JU4A 5LA0A 4O7XA 5G04L 3LDBA 2WO3A 2QZ2A 3ZYRA 5BNOC 4WVWA 3ZXEA 2D40A 4TN7A 4CDXC 1BMV2 4MGSA 4XABA 3MFAA 2LROA 1JZ7A 3V64A 1KD7A 4FPEA 4ISQA 1BK0A 3EQEA 4TLGA 4CCDA 3JUUA 1IS6A 1RVF3 3PVOA 3LWCA 3AP6A 4NPLA 5T3NA 1AR83 4YRDA 2Z5WA 4ATFA 3T0DA 2VUAA 4I0BA 3TRSB 4FPYA 4XFAA 2ZBJA 5G05L 5FZFA 1WW4A 1OF3A 4C90A 3PDQA 4N9HA 2I2SA 5E8AA 4C8DA 5A6QA 3APBA 4XMAA 4LKDA 5F3EA 1LGNA 3HQUA 4E8DA 1QJU2 4COUA 2HLEA 3Q8CA 4JKMA 1GZWB 3AFKA 3CBNA 1BJQA 4GB31 1W6QB 2KM2A 2HWD1 5A33A 3JQWA 2NZ9A 3MEPA 2GNTA 4JGYA 3GBGA 2BGCA 2JB4A 4ASKA 3KM5A 1SZBA 1F9KA 1S2BA 4OFGA 2VZOA 1Q3EA 3ZR5A 4IERA 3RFRA 3VBSA 2RG4A 2E53A 3UESA 3MIEA 3C7FA 3P1IA 4XZPA 1JTZX 1TVGA 3T0AA 4FP2A 1J3PA 3ZYJB 2WINB 1ZRCA 1MS9A 3WHTA 1UL9A 2WWSA 4XF9A 5ABJC 2HKXA 4QU2A 3RZJA 1LOFC 5I8SA 2WN2A 3HN3A 1W6NA 5FY9A 3U78A 2X09A 1PVC3 3OTFA 5HCAA 1IQDC 1C5HA 2W3JA 4ZONA 2ZGMA 3HWJA 4GXLA 3VB9A 1XXNA 1BEV3 1RHI3 4N53B 2WDBA 1HKDA 3WNNA 1JU3A 5JAXA 1VLNA 3KCCA 2WNUC 3M1HA 4Q0UA 4BMEA 4QX0A 1T2XA 2AEZA 2WWUA 4LIUA 4TSVA 4Y5TA 5FZIA 3RWNA 4W8JA 1ASJ2 2X05A 5EJ3A 5JUVA 4KL1A 1RUG2 4UI9L 5BUVA 4FTSA 4XFBA 4CXWA 1PK6A 4META 2QTWB 1HIXA 2Y33A 3VHNA 2W1UA 3ES1A 5C4WC 1NCQC 5CKQA 2WABA 2JKXA 2E9QA 1MACA 2D43A 2XJVA 1NLRA 1Q8PA 4CE8A 4CCKA 1C1FA 3AJYA 2Q1ZB 3VHOA 1O59A 1F5JA 1UN1A 3ACGA 3GZUC 3NL1A 5BYNA 4AHWA 4XDQA 2Q8CA 1RUNA 4CEWA 4YWAA 3IBMA 2VMDA 4BQ4A 2P2KA 1HLCA 3K51A 1B35A 1SMVA 5BNQA 4QT6A 3A0KA 4C91A 2F17A 3ZN4A 1J59A 2HWB2 1RIRA 1W8OA 2XJSA 4B1LA 4UFMA 1J84A 1PMJX 3ZIXA 1AF9A 2Q5TA 3LF7A 5A7NA 3TNQA 1PZ9A 4MO3M 4NHYA 1STMA 3KF3A 1AL0G 1HRI2 3T1LA 3NKTA 1EV12 3THTA 1VBD3 4AAPA 4DXRA 3VD4A 5LK7B 1HW5A 4RYDA 3AZYA 4QPIC 1CVNA 4Q4W2 4DFSA 4GIQA 4DOUA 3E6CC 1ULDA 2BNNA 1W8UA 3AKSA 2XVLA 2XVGA 3I3EA 1RMU1 1H8TA 2UY8A 4Q4Y1 3R4DB 1ST8A 1RJ8A 1X82A 3ETQA 5FXXA 2RS13 4YVSA 1O91A 4XC9A 1AR92 1PVXA 3VBHC 5E88A 3ZLIA 4EQVA 4LMFA 2PHRA 4NPMA 3TEWA 3UGHA 2VPVA 3CJIC 3N35A 4E4SA 1IOAA 2ZXQA 4XJWA 5LCWL 5T52A 2C9AA 2CL2A 1A6CA 1V70A 2YYOA 1S0FA 1YI9A 3MYXA 5DABA 1OOPB 4HBNA 4JQRA 4XACA 3S5QA 3VBFA 3LPFA 4IGOA 4OHZA 3U75A 4E2SA 1RC6A 4JCKA 1XNDA 5HV4A 1WCUA 2QQVA 3FL7A 4MGKE 3RJ2X 4MG2A 2GN3A 3NAPC 1OA3A 3Q8FA 2BQPA 2J1UA 4H7MA 2C9KA 3QH7A 2R072 2XR4A 2OQ7A 5I93A 3I59A 4OHXA 4Q4Y3 1F4AA 5F7UA 1V0AA 2CU5A 5FYHA 3VZNA 3HBKA 4PIZA 2E7AA 5JIAA 1FPN1 4GH4C 2V5DA 4QDSA 2R16A 1S0CA 5GLUA 3O1UA 4NN0A 2VBBA 3L9JT 2Q4SA 4CSWA 1SLTA 1WLCA 5FZOA 3N9PA 1ZZCA 4IV3A 1ZZ9A 4K20A 2XGXA 2LM3A 5DUXA 3O1OA 5FYMA 4CCEA 1GP5A 1WLTA 4EN0A 5DAQA 1QIQA 3FX3A 4CYDA 1LOCA 4FAGA 4TLFA 2C26A 2VOWA 4ZZ8A 4UFKA 5AC92 1Y7BA 1XYOA 4I3PA 4M3CB 1NT0A 3CZJA 3DPRB 4LBMA 4ES8A 1IKQA 3R4UA 2FZ1A 1WA6X 2YB7A 5CVRA 1AR72 1YJKA 3IN9A 1V6MA 5FPAA 4Z07A 1GOHA 1U5IA 2IXHA 5KHIA 2O8QA 1MEC2 1WMEA 1ZVFA 2VUJA 4PLMA 1F2NA 3NSTA 2XLFA 3MDPA 1K3IA 3JB4C 4IETA 4DEQA 1CGPA 1U5XA 1TMF1 3ZM8A 3PU8A 4P5HA 3W58A 4BCUA 1W9YA 3VBUC 4BHPA 1HXS2 5FY8A 4X8NA 2PMWB 5ACA1 5EP9A 2JIJA 1GNZA 3S7EA 3OUIA 2WSVA 2JG8B 3ZFFC 3UKVA 1QJU3 2WLPA 3TWIA 2WQZC 1JZ6A 3RVHA 3JB8A 2O8OA 2R6QA 5GZFA 5GM0A 3EB7A 1DFQA 5IYYA 2QQLA 3X29B 4QKNA 2GDFA 4A6OA 4QPYA 1W9TA 4ZZ5A 3PUAA 1GMMA 2J1VA 5LBBA 3H1YA 1UX7A 3TN92 5FY7A 1KGYA 2XJUA 1UU6A 2RVAA 3ES4A 3AB0A 4UFIA 3TOJA 4QB2A 1VIWB 3ZFEB 5EZWA 1W8FA 3AXEA 2AH2A 5EFUA 2D5HA 3VZKA 5CADA 2R042 2ZHLA 3C2UA 3E6BA 2VNGA 3ZXLA 2KA3A 3GNEA 4BJ0A 1VRH1 5LWBA 2XXZA 4M3CF 4B7EA 5A3LA 1NA1B 2ZABA 1AL21 2NPIA 3JD71 2GP3A 3VD7A 3PVEA 5FZMA 4C0BA 3VBRA 1AZDA 4KU8A 2SLIA 2XONA 4OI4A 5CFCB 2YC0A 4BZ4A 1O5UA 4LE4A 3O1SA 4JRAA 4Y5SA 2ARCA 5DUWA 2RS51 5IUQA 2HWB1 3SCHA 5HCHA 1S0DA 2CGNA 3WNLA 1CD3G 5C5UA 4FOQA 3UYJA 5HI0A 4JTNA 4DPNA 2JDHA 2AENA 3KB5A 2QKDA 1JBCA 1XQNA 1RTVA 1URXA 1CN1A 2ZX1A 2CHHA 3KT1A 3OBRA 3POBA 4XBQA 5K4LA 1ASJ3 2VL4A 1RUG3 3FC0A 4YLZA 5BNNB 4KG0A 3MPBA 1RJ7A 5CFDA 4Q4W1 5T55A 4Y5Z0 4CCNA 1Q8VA 2ZEXA 4KBBA 3AYDA 2VXRA 4XJAA 1RUJ1 1OKOA 3JZVA 2D3PA 3AL5A 2RJLA 4PLOA 3KVBA 1ULEA 3MIDA 4YW3A 3QLQA 4E2QA 3AYAA 5IVEA 1AR91 4YW7A 4LO8A 3AVRA 2XWJB 4Y24A 4INDA 5FZ9A 1A8MA 1E5IA 1LNSA 1W8NA 4JHZA 1KXGA 1NCRB 3A21A 2HWB3 4NROA 1ND3C 1H6XA 2LW8A 3VBRB 1VBA1 4HL0A 1DYKA 5A3MA 2R32A 4XUPA 2W08A 3LD8A 4MZUA 1RUE2 1HRI3 5HCFA 3SCFA 1EV13 1HJFA 1YO8A 3B01A 5L7OC 4IXLA 3AKRA 2ZOEB 1EPZA 1B35B 1XPWA 1C8NA 4RQPC 4CPBA 3O5SA 1JYXA 1CAWA 1HX6A 1RUH2 2PN5A 3FLTA 3KHBA 3LKJA 3ZSMA 4XFGA 5B4NA 4DMIA 2A6XA 2VR4A 2Y0OA 1RUF1 2R071 3AMQA 2NMNA 3ME2A 2GC1A 3MF6A 4EN8B 1O3QA 1DGLA 4YZ2A 1ND2A 3WNKA 2BNMA 4ISRA 1H2KA 1W9SA 3VN4A 3E5QA 4LO4B 3C3VA 1Z7S2 2I45A 4FCAA 3AZVA 3EMRA 3VD5A 4LKFA 1RL3A 3IMMA 2JDKA 3HQXA 3D82A 1AX1A 1G9AA 1MQTC 2RDRA 4ARYA 4OVEA 2J1AA 4AFCA 3E1F1 4FPLA 2RDSA 3OJBA 5C8WA 3I2OA 3MGUA 4UXAA 1WGPA 1LR5A 5IT6A 5JLVA 3ZSKA 2CNAA 5AC91 4L9BA 2W68A 3IDCB 3SITA 4YZ3A 4RR3C 5FOBB 4P5YA 1ULOA 4AQ6A 2ES3A 2DU1A 4XURA 4AEJA 5DDJ2 1PMHX 1AR71 2ORZA 2V5YA 3ENRA 1GQPA 2R073 1C57A 1DZQA 3FBMA 4XEZA 1Z0HA 3RI8A 3N3HA 5FZGA 4FPFA 3Q8AA 1QGLA 3T08A 2B4KA 3B9CA 2ZCWA 4QX2A 1UPSA 1RUC1 1VMJA 3POJA 1VAVA 5FYIA 4M0HA 5EJZB 2PAKA 3ZDVA 5FYVA 1JS9A 3ALQA 4GMP1 4YW1A 1DHKB 2P34A 4OMCA 5DG1A 1DF0A 1QDCA 3HQRA 4MOAA 1GR3A 1IPKA 3J7LA 3PLQA 5AC93 1GZ9A 3WNPA 1U5ZA 4WM7B 1I1EA 5JZGB 4CEYC 2GMPA 5ANQA 4CCJA 1ZZ7A 2I74A 1AR73 4NAMA 5DG2A 4WM8C 1UXXX 3PU3A 1BBT2 4LLOA 5FP4A 1MEC3 3NNLA 2HWC1 1RXFA 3J8F2 2BBAA 4IDZA 5A7QA 3LOIA 2IXLA 5FXVA 2IVJA 4MGQA 4N90A 5LRRA 5IVFA 2BZDA 4P08A 3UV9A 2CDOA 1OQDA 4W65A 1AYM3 2R041 1LHOA 2R1DA 4L97A 4RL7A 5A6XA 5DQ0A 1UMIA 3ZO0B 1HXS3 2TUNA 2HEWF 2ZKNA 3E97A 3JCIA 5LY2A 4XF3A 4Z2AA 5FO8B 3V0AA 3AVSA 2PHUA 2ZGUA 4QU1A 4CDQC 2VTXA 4DUXA 3OGGA 2A7AA 3AKPA 1O7FA 1YQCA 1FV3A 4AXOA 1SLCA 2R7EB 1TG7A 4FI9A 5H9SA 3IDBB 2EALA 2BP6A 1ONAA 3PURA 3ZXJA 1VMHA 4NE9A 1WD3A 2RMU1 3ZFGC 4YVWA 3TN93 4Q5OA 1W39A 1C28A 2YPDA 1DYOA 1LRHA 4LTAA 5C3SA 2FDGA 1G86A 4NO4A 3I7DA 4AGGA 5A3TA 4A3ZA 3VDDA 1I5ZA 2JG9C 3WF3A 5FQ0B 1TEIA 1X8EA 2BNOA 4P9IA 1GUIA 5KC6A 1ALYA 2A1XA 1AXYA 1IPJA 4BISA 2JIGA 1C1LA 4J25A 2WYFA 2WNVA 1ENRA 4D7YA 2WS92 3OUJA 4LK7A 4HLTA 5FYSA 3SXWA 3ZSEA 3QOPA 3RZGA 2VZ1A 3HNMA 3ORJA 2XKOA 4AF9A 2NP0A 5JXIA 1W03A 5C9AB 4CDUA 2EVXA 3ST7A 1R082 4RHV2 1W6PA 1YRZA 2LS6A 2MPFA 2YDEA 4FOVA 4H2AA 4MSVA 3R0RA 2AACA 4PDWA 3ZX7A 1L3JA 1CAVA 1S0BA 1WCSA 2J1RA 4XHBA 4YZ1A 2DTWA 3BIWE 1C3HA 1PX4A 1AR82 1K5MB 2Q1MA 1OC1A 5FY0A 1UZZA 4NIAA 1QXRA 4BA6A 2YBSA 4CDXA 4K3UA 2WFF2 2XL9A 5EYYA 4OLLA 5A7WB 5JI9A 5JSRA 3CJXA 1OLQA 3I3QA 1K5JA 2QQUA 3U11A 4E9KA 4SBVA 5F6KA 1HV0A 5IJRA 2RS32 1ZBE2 2QQMA 3T09A 4XCAA 1W8HA 4YG3A 3LA3A 5LY1A 1QJX1 1GU3A 5FPBA 1C8M3 1GOFA 4MGIE 3K4ZA 4NIGA 4L0PA 4HZFA 3U10A 1JH5A 3DGTA 1BCXA 1UNBA 1GLHA 4XYXA 3MLKA 4PJYA 1W2UA 2W0XA 4HKLA 4QD2A 5CNAA 4FBFA 2D6KA 4CA9A 5JIUA 1DZRA 1QJFA 4DXZA 1KITA 1YNAA 2BVBA 3ROUA 3LSEA 2X5IA 4LO6B 3WUDA 2AC1A 4FFIA 5EWSA 3ZKYA 1IS5A 2GMMA 1W99A 2A70A 1CZSA 2YV8A 3P5BA 4FPJA 4LORA 1RUE3 3N9NA 4WV8A 3WF2A 4DINB 5FP8A 5L19A 1F8VA 1W2TA 5FYZA 4JAAA 2GAUA 5DDJ1 1RUH3 1ULGA 4BDVB 4M01A 1K42A 4LLFA 2QQWA 3HR9A 3S6PA 5E1RA 5FY1A 1PVC2 2BJSA 2B7YA 3WG2A 1KS4A 2JDPA 2R062 2XUMA 2DDUA 1AJKA 4M4RA 1GICA 1H2LA 3AP7A 1Z7S3 4HKOA 3K4DA 1NY72 2FMDA 3JU9A 4O9GA 1AR61 1Q8SA 3H3ZA 4GWJA 4QGNA 4YPJA 4OI1A 1XE0A 3VBOC 3WP6A 3ZYHA 3J9SA 4QM8A 5CIRA 2OUHA 5ABJA 4Q0QA 1ZREA 1LOFA 3M3EA 4LEJA 2JWPA 1OVSA 3FBYA 4XFCA 5FPUA 1L7LA 2PTMA 3JQXA 4AZZA 2BFUL 1H1AA 4IEOA 5JPMB 5LA1A 4Y20B 4MVTA 5BNPB 5FYYA 4QB1A 3MPPG 1YJLA 1UYYA 3CLPA 4XE9A 4LE3A 4AI3A 5CU1A 3VKFC 2CV6A 2Y6HA 1MZFA 2W2IA 2WNUA 1OKQA 2R0FA 1NXMA 5LB6A 4OQ9A 1DIWA 3W9AA 4BPZA 2Y0IA 1ULPA 3J8F1 4QXKA 1QH6A 2WBKA 2ZPXA 4KU7A 4YW6A 3MLJA 2A3WA 1JHNA 1GANA 3M4FA 4HPKB 3UK9A 1QJY2 4I01A 5AVPA 1JYCA 1NCQA 4RS5C 4F3JA 2VZTA 5I8TA 5EJ1B 4AVSA 4HK8A 2VW0A 4I02A 1IPSA 4W50A 3IPVB 4GD4A 3NV1A 1CX1A 2AUYA 4EZ4A 1KFUL 3CZUA 2FCTA 2OPKA 5DAXA 3NV2A 3VKLA 4CTEA 3USUB 5DXDA 3WF0A 3HVDA 4J1WA 4COVA 3T0BA 2YBKA 1W2AX 1OPOA 3O0VA 2O0OA 2PQQA 4FOWA 5D21A 1W28A 3POIA 5GLZA 4KGGA 4A42A 1FOD2 1LEDA 1GKBA 4EN7B 1H4GA 2W87A 3U4XA 4UW5A 2XUEA 3J7MA 1CIYA 1BBT3 3FZ3A 1WW6A 1MS1A 1YQ2A 2E32A 1ZX5A 3J8F3 2J1TA 4IE6A 5DAVA 1JMUB 4ZKTB 3GJAA 1OA4A 4HXCA 2VOKA 5IK7A 1ENSA 4QPIA 2XJTA 2ORXA 2F6BA
chains in the Genus database with same CATH topology
3DKQA 4BQYA 4NHXA 4XCAA 5L9RA 4JZRA 5LBBA 5IAVA 4NHYA 3W20A 4XABA 3W21A 4MHRA 5LBCA 4NHMA 2OPWA 3HQRA 2G19A 4XC9A 3BVCA 4Y5SA 5IATA 3GZEA 5C5UA 2FCUA 4BQXA 4XACA 3NNLA 3HQUA 5EPAA 3KT1A 5HV0A 5LA9A 5HV4A 3KT4A 3NNJA 5ERLA 4NAOA 5DAWA 4UWDA 3PL0A 2RG4A 4NHLA 4XAAA 3NNMA 3ITQA 3GJBA 2RDNA 5DAQA 5LB6A 5LBEA 2G1MA 5IAXA 4NMIA 5EQUA 5LASA 4Q5OA 2Y34A 4ZPIA 5LATA 5M0TA 2FCVA 4ZONA 5L9VA 3OUHA 4KBZA 2HBTA 4BQWA 2A1XA 2JIGA 4J25A 4XCBA 3OUJA 4Y5TA 2FCTA 5DAXA 3EMRA 3OBZA 5DAPA 4MHUA 2Y33A 2RDRA 5C5TA 3NNFA 2RDSA 5LBFA 3MGUA 5EP9A 2JIJA 5L9BA 2HBUA 5A3UA 3OUIA 4NHKA 5DAVA 3GJAA 3KT7A 4IW3A 2V4AA 2RDQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DKQ A;  4BQY A;  4NHX A;  4XCA A;  5L9R A;  4JZR A;  5LBB A;  5IAV A;  4NHY A;  3W20 A;  4XAB A;  3W21 A;  4MHR A;  5LBC A;  4NHM A;  2OPW A;  3HQR A;  2G19 A;  4XC9 A;  3BVC A;  4Y5S A;  5IAT A;  3GZE A;  5C5U A;  2FCU A;  4BQX A;  4XAC A;  3NNL A;  3HQU A;  5EPA A;  3KT1 A;  5HV0 A;  5LA9 A;  5HV4 A;  3KT4 A;  3NNJ A;  5ERL A;  4NAO A;  5DAW A;  4UWD A;  3PL0 A;  2RG4 A;  4NHL A;  4XAA A;  3NNM A;  3ITQ A;  3GJB A;  2RDN A;  5DAQ A;  5LB6 A;  5LBE A;  2G1M A;  5IAX A;  4NMI A;  5EQU A;  5LAS A;  4Q5O A;  2Y34 A;  4ZPI A;  5LAT A;  5M0T A;  2FCV A;  4ZON A;  5L9V A;  3OUH A;  4KBZ A;  2HBT A;  4BQW A;  2A1X A;  2JIG A;  4J25 A;  4XCB A;  3OUJ A;  4Y5T A;  2FCT A;  5DAX A;  3EMR A;  3OBZ A;  5DAP A;  4MHU A;  2Y33 A;  2RDR A;  5C5T A;  3NNF A;  2RDS A;  5LBF A;  3MGU A;  5EP9 A;  2JIJ A;  5L9B A;  2HBU A;  5A3U A;  3OUI A;  4NHK A;  5DAV A;  3GJA A;  3KT7 A;  4IW3 A;  2V4A A;  2RDQ A; 
#chains in the Genus database with same CATH topology
 3B00 A;  1UOB A;  2BTV C;  3WW2 A;  3DKQ A;  1ZBA 2;  4AED C;  2RR1 1;  4BQY A;  3I3M A;  4AQ2 A;  4ZXE A;  5FZ6 A;  3WSO A;  1GQH A;  3AL6 A;  2EA7 A;  2EIC A;  2BPA 2;  1BZW A;  5FO7 B;  1C5I A;  3IZO A;  5FCC A;  2JKB A;  3VBH A;  3ZPY A;  1PMI A;  2O1Q A;  1W3X A;  1D7P M;  3S7I A;  2UUR A;  2RJ2 A;  4J6G A;  3UKN A;  1HB1 A;  4OHV A;  2J42 A;  3GHM A;  3DUI A;  3AX4 A;  4RHV 1;  2P1B A;  3WV6 A;  3EXU A;  1PM4 A;  4NHM A;  5F6L B;  4JGZ A;  5K9Y A;  3U4S A;  1IG3 A;  2Z42 A;  1PO1 2;  1TZO A;  5FZC A;  4N43 C;  3ZXK A;  4CDW B;  1FI2 A;  4CUC A;  4YW5 A;  3VHP A;  1RVF 1;  1N1V A;  2WNE A;  1M06 G;  1UXZ A;  1AR8 1;  2E63 A;  1HN0 A;  1LHV A;  3C8X A;  2WFF 1;  1AYN 2;  2P17 A;  3B7M A;  3NAP A;  5T54 A;  5C3P A;  4KWU A;  1AXK A;  1R1A 3;  3BPS A;  4KI5 M;  1Q8O A;  2XHN A;  3T2T A;  2B39 A;  3OPZ A;  3HT2 A;  4DS0 A;  2AR6 A;  1XC6 A;  4AVA A;  4CPB D;  1OH4 A;  1JZ2 A;  2FDJ A;  2WS9 3;  5FR3 A;  3ZOI A;  5FTT C;  1SAC A;  4XIK A;  1REE A;  3WQ7 A;  4RGA A;  1EY2 A;  4IV1 A;  1GYK A;  1UOJ A;  1FMD 2;  1ZNP A;  4NAO A;  2YBP A;  1DCS A;  1R08 3;  4RHV 3;  2EAK A;  4FFF A;  4MV2 A;  4ET7 A;  1CPM A;  2VZP A;  2WWJ A;  4HSL A;  2H0V A;  5FMC A;  4F8A A;  3RZK A;  1A8D A;  1H4H A;  2Y6K A;  5JMO A;  1OI6 A;  2DUP A;  2GC2 A;  3A4U A;  4LA3 A;  1UD1 A;  1G7Y A;  1XSQ A;  2EIB A;  1MS4 A;  3WG1 A;  2WJS A;  1QHD A;  1YI7 A;  4PF1 A;  3WUC A;  2WFF 3;  1PO2 2;  3VUO A;  5SV8 A;  2B46 X;  4COW A;  5BPX A;  1QJZ A;  3O1M A;  4P9J A;  3K4A A;  2ILM A;  1ZBE 3;  2RS3 3;  2GSY A;  3GYD A;  4R8H A;  1OUR A;  3NJX A;  4QHB A;  1PVC 1;  5C8C B;  3CO2 A;  1EUT A;  3D6E A;  3LZZ A;  1SCS A;  4M0N A;  2EXI A;  4QPG B;  1DGW X;  4CCC A;  3EJK A;  4D0Q A;  1BEV 1;  3AKT A;  2OZJ A;  1RHI 1;  1NXD 1;  1WD4 A;  2VBD A;  4EWE A;  2VH9 A;  3A23 A;  2GNM A;  3H0O A;  3VBU A;  1TNF A;  4QB6 A;  3I2H A;  4GUL A;  4K8R B;  2ZGS A;  1GNH A;  5IK8 A;  2BEO A;  1Y9Q A;  4WVM A;  5EHD A;  4CP0 A;  1LOA A;  4JKK A;  4BXS V;  5A6Y A;  1YUD A;  3D8C A;  1VJ2 A;  5LK5 A;  2IVI B;  2BV4 A;  1GWK A;  2ARB A;  3SHR A;  4E4H A;  4ITC A;  3C7G A;  1B09 A;  4IES A;  4XVH A;  3UNP A;  4OQ8 A;  5F3I A;  4XJZ A;  3N9Q A;  4LBK A;  2VY0 A;  2FQP A;  2NYY A;  2HWF 2;  4DRR A;  2QQN A;  1UIJ A;  2IFR A;  4N53 C;  5FYU A;  4A45 A;  3D0S A;  2X5I B;  1OQE A;  3H7J A;  3OD0 A;  2R06 3;  2VE1 A;  2VNV A;  2ARA A;  2YC4 A;  5IVB A;  2QZ3 A;  4FPC A;  3RS6 A;  4QGM A;  4UOJ A;  5KC5 A;  4A7K A;  2RDQ A;  2DV9 A;  5C70 A;  2CGP A;  2W47 A;  4URT A;  4QX1 A;  4XIL A;  4OUE A;  1VR3 A;  2WT0 A;  2Z2S B;  2ZMN A;  2ZHM A;  4UBG A;  5L9R A;  5E6H A;  1JOP A;  3S0M A;  4LHS A;  3BPZ A;  2YUE A;  1VBD 1;  2J7M A;  1L7Q A;  2WZE A;  1MZE A;  3CIH A;  2BW8 A;  4CZS A;  4TZD A;  3VKM A;  3A0N A;  3GZT B;  1SBE A;  1XNK A;  3MF9 A;  5LEK A;  1N3P A;  3PJQ A;  1IG0 A;  1KJL A;  3IDA A;  3H7Y A;  3K3N A;  2GP5 A;  2RS1 1;  5H9P A;  3TEZ A;  4GMP 0;  2VZR A;  3LB9 A;  4WZC A;  2BDR A;  1XNC A;  2ZAC A;  4DY3 A;  1I6X A;  3KS7 A;  1DDL A;  1CJP A;  2WO1 A;  4B7K A;  1G9B A;  3ZVX A;  5KXD A;  1UU4 A;  1RXG A;  5BXX A;  5JR7 B;  3ASI A;  1QJY 3;  4G3Y C;  5CA6 A;  2CAV A;  2IXK A;  2FCU A;  4BQX A;  2ZZQ A;  5GJ6 A;  5HV0 A;  2VQ0 A;  3DF0 A;  4OCT A;  4SLI A;  1F35 A;  4XF4 A;  2RM2 2;  4K8F A;  4P9X A;  3USS A;  1QF3 A;  4Z2W A;  1FOD 3;  1IKP A;  1ND3 A;  1SLA A;  4LOT A;  1E57 A;  1F4H A;  2CYF A;  4XJ8 A;  5FZL A;  3MW4 A;  5HBA A;  4W6W A;  1X50 A;  1O3S A;  1OOP C;  4QX3 A;  3ACF A;  3EBR A;  3WDW A;  1LJ7 A;  4RQP A;  1O8S A;  1PGW 2;  5ANN A;  2QBX A;  3G6J B;  1UX6 A;  2JDU A;  3HBZ A;  3KMH A;  1WCQ A;  3V0B B;  1W04 A;  2QCS B;  1QNW A;  4FFH A;  1ZBA 3;  1AHS A;  1PNG A;  2DVD A;  2C0Z A;  3SNM A;  5FYT A;  4JDN A;  3WY6 A;  1CPN A;  1YQ6 A;  3ZFF A;  4OYU A;  3I4I A;  2Y34 A;  5F8P A;  1X9P A;  3ACH A;  2WZ8 A;  4LHL A;  5FIX A;  5KXB A;  2EIG A;  1BMV 1;  2VAU A;  1CX4 A;  4JQT A;  5D8A B;  1MQT A;  2A3Y A;  1F15 A;  3M3Q A;  2WAA A;  4KBZ A;  5SV5 A;  2B42 B;  1DQ5 A;  3E6D A;  3H1M A;  3O0X A;  1C4R A;  3I3B A;  2C6S A;  2JB8 A;  3QD6 A;  3AC0 A;  4YW2 A;  5FXW A;  2DFC A;  3MFC A;  5T5P A;  2P37 A;  4P00 B;  1PO1 3;  4AVV A;  2DBN A;  3LA7 A;  4XMI A;  1ZRR A;  2ZGP A;  4QKD A;  4ZY9 A;  4LBQ A;  4XTM A;  2RE9 A;  3ZN6 A;  4YM3 A;  4UT5 A;  4GKX A;  2VMH A;  3M2M A;  4RR3 A;  4YM0 A;  4FPK A;  2P3Y A;  5K0U C;  5I0R A;  1BKZ A;  1AYN 3;  3LDK A;  4ONU A;  3VZJ A;  5FOJ B;  1IS4 A;  4HG6 B;  2BYV E;  5C5T A;  1QOO A;  3WP5 A;  3NNF A;  1D4V B;  3DPR C;  2A6V A;  2ZGR A;  3I2G A;  1LEM A;  4JGZ B;  1A34 A;  2ZKL A;  4IEV A;  2C24 A;  5K0U B;  5FY4 A;  1QJU 1;  5FMO L;  2OS2 A;  4UW6 A;  1G9C A;  3IDE A;  3J26 N;  3WW3 A;  3SMH A;  3SLI A;  5IVC A;  1NYW A;  2DFB A;  1VPH A;  5F3G A;  1FMD 3;  3UL2 A;  3WDX A;  1V00 A;  3RYP A;  5J7M A;  4TTG A;  2YZ4 A;  3N9L A;  5C71 A;  1UY2 A;  5A1A A;  4Q1P A;  5A32 B;  4MLO A;  3CF6 E;  4AQT A;  2OZ6 A;  1GSL A;  3RZZ A;  4QX5 A;  5FPX A;  4QDR A;  2OVU A;  4FPO B;  2GZW A;  1DBN A;  2VXJ A;  3VDB A;  1AYM 2;  2JG8 C;  2KXL A;  4LBN A;  4IV1 B;  1H8V A;  4BXF A;  1PO2 3;  4CEY A;  5A70 A;  1XYN A;  2W52 A;  4M00 A;  4UYB A;  2HWF 1;  2ZEW A;  2DUQ A;  4WM8 A;  3VV1 A;  4DUW A;  3WX5 A;  5JR2 A;  1RUD 2;  4AE2 A;  1KQR A;  3SCG A;  2BOJ A;  3OG2 A;  4Q8K A;  2J1S A;  4E4D X;  5DZF A;  4ZS3 A;  3ATG A;  2QDR A;  2FDI A;  1Z78 A;  3GXU A;  5BV6 A;  3ZXA C;  3ZFE C;  5IAT A;  5FPV A;  1RIN A;  2Y6L A;  1JUI A;  3HT1 A;  4XXA A;  4PLN A;  5HXM A;  1QXP A;  4S2D A;  3ECQ A;  1DQ2 A;  3GCX A;  1NA1 C;  2MEV 2;  2VU9 A;  3EO6 A;  4M4P A;  4L92 A;  2VVD A;  1ASJ 1;  1X8M A;  4CDQ A;  1RUG 1;  1U0A A;  4PIX A;  3I8T A;  4ORF A;  1HRV 2;  1IHM A;  2VW2 A;  4QQH A;  2WII B;  4CP9 A;  4MUV A;  1LOG A;  1WMX A;  4A6S A;  5CFC C;  3IB3 A;  5H9R A;  2XH6 A;  5A33 B;  2DCK A;  2DCT A;  4QX7 A;  2SBA A;  4JGY B;  2HWF 3;  4EN6 B;  2Q8O A;  2OQ6 A;  3MIF A;  3O12 A;  1VAL A;  2Q8D A;  3ZFG A;  1Q5O A;  3J4U H;  2XBO 2;  2HJI A;  3VBS B;  3ABZ A;  1R1Z A;  2VZ3 A;  3FLP A;  3K75 B;  1T6B X;  1YLL A;  3U07 A;  4NRP A;  3WCR A;  2VZU A;  3AP5 A;  4FAH A;  5C7G A;  2XPJ A;  1FNZ A;  2JG9 A;  3Q8E A;  3QH6 A;  3R4S A;  5F32 A;  5BNN C;  4KMQ A;  1ODN A;  4WVZ A;  1O6U A;  3AFG A;  3VKO A;  1W6N B;  1W2O A;  2DF7 A;  3Q9O A;  4AL9 A;  1KDM A;  3RZH A;  1HRI 1;  2Q1F A;  1Q56 A;  1EV1 1;  2UWA A;  2VOT A;  1CON A;  3KCX A;  4RSU A;  3RMX A;  1UY4 A;  2ZAH A;  1SCR A;  4BWO A;  4XQD A;  2YPJ A;  3B3Q E;  3K48 A;  3O1P A;  2C1F A;  4DQA A;  1I9R A;  2W1S A;  3ZDS A;  3VZO A;  1H30 A;  3QCW A;  1GQG A;  1FYU A;  1NCR C;  3OGV A;  1C8M 2;  1DQ0 A;  1H0B A;  1MVQ A;  2JEN A;  3T1M A;  5CAZ A;  2GC3 A;  3PTY A;  3RG0 A;  1LHN A;  1X36 A;  4YM2 A;  1PK6 B;  2WO2 A;  5C3Q A;  1PGW 1;  2EIE A;  3NMB A;  4PI0 A;  1SQ4 A;  4MHU A;  1G9D A;  2H6B A;  1GWM A;  2ZGO A;  4MAD A;  2DCJ A;  1B35 C;  4LXL A;  5F5Q A;  4I30 A;  2ID4 A;  1M4W A;  3GGL A;  1ZZ6 A;  4CU9 A;  4MYE A;  1QY4 A;  4AFD A;  3ACL A;  4I3G A;  2NQY A;  2PHD A;  4CEW B;  4DEV A;  4MXW A;  2WC2 A;  3KF5 A;  2OA2 A;  2ZX3 A;  3KT7 A;  1CWP A;  1PGL 2;  2RM2 3;  1H6Y A;  2YU2 A;  4C0H A;  3NNG A;  4J1X A;  4YFW A;  2JE7 A;  2XVK A;  4XF1 A;  1RGS A;  2OXB A;  4LPL A;  1FAT A;  4FVV A;  1UU5 A;  4Q1R A;  3N7K A;  5F37 A;  5HXV A;  3R6S A;  5CIS A;  4EYU A;  1NZC A;  2D5F A;  1D2Q A;  3GAL A;  2CWS A;  4AHX A;  3KV9 A;  4PBP A;  2C5D A;  2TBV A;  3BTZ A;  1SPP A;  1H8T B;  3PUQ A;  4MGZ E;  4AFA A;  5A1F A;  4YVS B;  4HN0 A;  3GBW A;  1QOT A;  2V09 A;  3FUO A;  3OYW A;  1EAH 2;  4OZX A;  1FNY A;  3CEW A;  5E89 A;  3GDB A;  4IEX A;  3SEP A;  1AJO A;  3BVC A;  3WXP A;  3WNM A;  3VBO A;  2E26 A;  4XDO A;  3NV3 A;  4BB3 A;  1UZV A;  5J37 A;  2IXC A;  2XLA A;  1AX0 A;  5CEH A;  1N3O A;  4LKS A;  3MIH A;  5A3W A;  5CKN A;  1MEC 1;  1POV 0;  3VBF B;  2L9L A;  1PIV 2;  4Y3O A;  1RED A;  1JYV A;  2OT7 A;  3WDV A;  3LEK A;  1H9W A;  1YXW A;  1BHG A;  2EID A;  1V6N A;  5LA9 A;  3K2O A;  4H3W A;  3ILN A;  4U2A A;  2VNO A;  1AYM 1;  3VD9 A;  1S2E A;  2JDN A;  5FZH A;  2R1B A;  4XQW A;  4WM7 C;  1SG3 A;  1HXS 1;  2J22 A;  2YFU A;  4MX3 A;  3M3I A;  5J48 A;  1WA4 A;  4BIO A;  4HVQ A;  4HT1 T;  1YFX A;  5I91 A;  3I59 B;  3O0W A;  5JZG C;  1V9U 2;  1DG6 A;  4FOY A;  4RN5 A;  4Z82 A;  3BOW A;  2GH2 A;  2CAU A;  3BTA A;  4UBH A;  4NII A;  2YMZ A;  4AI2 A;  4NID A;  4NHL A;  4NWW A;  3WNO A;  2R49 A;  4IV3 B;  5FZO B;  1VBE 2;  5J98 B;  3U0Z A;  2P3J A;  3MBW A;  4Q4X 2;  4RS5 A;  4D94 A;  1VBB 2;  2RDN A;  1ENX A;  2UWB A;  4NOT A;  5FLI A;  1CAU A;  4LHK A;  1YFY A;  1N1T A;  4ASM B;  3SKV A;  3POS A;  3TN9 1;  4OUM A;  3PJY A;  3PIG A;  3PUH A;  3KSC A;  5EQU A;  2RV9 A;  1JYT A;  1BLZ A;  3WHU A;  1S0J A;  3DKW A;  4UF0 A;  2VMC A;  4HAN A;  5EYX A;  2PHW A;  3H3L A;  2DYC A;  1WBF A;  4CUA A;  3FHQ A;  1DP0 A;  2VCB A;  1DYP A;  1TME 2;  2W9X A;  4HVO A;  4BQW A;  2V4V A;  2YGM A;  3C7H A;  5K7P A;  2X8K A;  3N7L A;  4FT8 A;  2D7F A;  4BQ5 A;  1RB8 G;  1LOB A;  3H42 B;  2ZA9 A;  3L2Y A;  4XCB A;  5GZE A;  1RUD 3;  5GAL A;  2PHF A;  1H2M A;  2QQO A;  3RYR A;  1S55 A;  4Y22 A;  3SKJ E;  1XSR A;  4QKB A;  4AFB A;  5KXE A;  4A4A A;  4AED A;  5C3O A;  3FN9 A;  1CAX A;  1SEF A;  3ILR A;  4CU7 A;  5F9T A;  3NW4 A;  2WAO A;  2JDY A;  4JHT A;  2W1Q A;  3ETP A;  4XFI A;  2MEV 3;  1DGW A;  4IE7 A;  4Q4V 2;  2PLV 2;  4XFH A;  3K77 A;  3RNS A;  3KGZ A;  2DTY A;  4O65 A;  1R1A 2;  1UIK A;  1HRV 3;  4LIT A;  2OKX A;  2D6N A;  1D0H A;  1BYH A;  1V6L A;  2YU1 A;  3MV1 1;  1NAE A;  1NE4 A;  2V4A A;  5C9A C;  4YGC A;  5F39 A;  5GZC A;  3LEI A;  2P5B A;  3BN6 A;  3MV0 1;  4QQ2 A;  3TB0 A;  1H2N A;  2UYA A;  1AXZ A;  1H1I A;  4N43 A;  1DQ4 A;  4BQ1 A;  3M3O A;  1C8M 1;  4XET A;  1NQD A;  1AX2 A;  2EXH A;  2KR2 A;  2XBO 3;  5IVJ A;  5CG8 A;  3FWE A;  4AR2 A;  1W0O A;  2W1W A;  1PNF A;  2PAE A;  2WL1 A;  3ON7 A;  3OBA A;  4Y1Y A;  3VBR C;  1K5M C;  4FXK B;  3WOG A;  5GLT A;  2W91 A;  2WUH A;  2WLQ A;  2JD4 A;  4KQ7 A;  1XNB A;  5C33 A;  1V6O A;  1AVB A;  1WMD A;  4FO9 A;  2G9F A;  4RA0 A;  5KBF A;  4N8M A;  1CZV A;  2Q0A A;  5B2G B;  3HNY M;  5JSO A;  5BNO A;  3O1T A;  1RUE 1;  3ZXF A;  3DV8 A;  4YG6 A;  1LOD A;  2D6P A;  5KWR A;  4V2V A;  2ENR A;  1RUH 1;  2QUO A;  3B69 A;  3KZ4 C;  5FBJ A;  5IWF A;  1SHW B;  1VB2 A;  4Q26 A;  4QDQ A;  3KHC A;  4FPH A;  5FYB A;  4PQ9 A;  4QKF A;  4CRQ A;  2VMF A;  3LA2 A;  3VDA A;  3PMS A;  3HNB M;  1Z7S 1;  2DWR A;  3FFZ A;  3NJV A;  3PNA A;  4OUL A;  5BY5 A;  3FE5 A;  5CFD B;  1UY3 A;  3CDZ B;  4P9W A;  3U14 A;  2Y6J A;  1OH3 A;  1ZM1 A;  1W6Q A;  4D6R A;  4L2N A;  1EPW A;  4NPR A;  1JYW A;  4X6Q B;  1UO9 A;  2AYH A;  4D7T A;  1Q8Q A;  3M7A A;  2ARX A;  2PHT A;  1PHM A;  4AG4 A;  3TYJ A;  4LO7 A;  3WP3 A;  4D8M A;  2Y8K A;  1JI6 A;  5FKC A;  3M70 A;  2GC0 A;  4IGQ A;  2O14 A;  2ATF A;  4XAA A;  2MNG A;  3CQO A;  2ZEZ A;  2KD7 A;  4NJ4 A;  2DCY A;  3B5L B;  1DQ6 A;  2E7Q A;  1G8W A;  1GZC A;  1O4Z A;  1RIT A;  2VUD A;  5FAX A;  3O1R A;  1Y9M A;  2LTN A;  1LGC A;  3NQH A;  1OUX A;  1DGR A;  1R09 3;  4YW4 A;  2HEY F;  3BCW A;  1RUO A;  2VZQ A;  4AOC A;  4XHX A;  4K21 A;  1W6M A;  5M0T A;  2PHL A;  5L9V A;  2NMO A;  1O4T A;  3FJS A;  3AKQ A;  4AEK A;  4LOS A;  4K6B A;  4V1P A;  1NLS A;  1LOE A;  4P02 B;  1CAW B;  1QDO A;  2A71 A;  2K2S A;  2HBT A;  4PIY A;  1R64 A;  4YG0 A;  2VG9 A;  3OOX A;  2VVF A;  5BNP C;  4N53 A;  2ZGK A;  2JE9 A;  1KFX L;  2VC9 A;  1ND2 B;  1UYZ A;  1CR7 A;  1VMF A;  1J3Q A;  1XU1 A;  2VTF A;  1EAH 3;  3INA A;  4LIV A;  1F31 A;  3LDR A;  5JI7 A;  1MVE A;  3UGF A;  4Q27 A;  1LEC A;  5AVA A;  4EN9 B;  5DAP A;  5GZG A;  5L36 A;  4AAX A;  2WT1 A;  3WG3 A;  1RYY A;  3S57 A;  3DYM A;  4YM1 A;  1JYN A;  2AGS A;  2FHR A;  5FK7 A;  3WR0 A;  4NRQ A;  2ARE A;  3VL9 A;  1BBT 1;  2HWD 2;  1PIV 3;  1ZZ8 A;  3M8L A;  2EAA A;  2A3X A;  5L9B A;  1HB2 A;  2XB6 C;  2YC2 A;  3TEX A;  1XRU A;  2YXS A;  3N7M A;  4D3W A;  1I3H A;  3JXS A;  1BVP 1;  1HQW A;  5I0S A;  1D2S A;  1NQJ A;  3SEE A;  5C4W A;  3IAP A;  4UAP A;  3ILF A;  4AGR A;  2PYT A;  4FQ4 A;  1OSG A;  3UGG A;  4KWJ A;  4RGG A;  2XJQ A;  1PX3 A;  4HVR A;  5FZ0 A;  3KD4 A;  4HN1 A;  2XJR A;  1V9U 3;  4LKE A;  4Y4R A;  1UWW A;  4QHZ A;  4JZR A;  1WZX A;  3WEZ A;  2BBV A;  3F95 A;  3MUZ 1;  3M3C A;  5JXG A;  1IQA A;  2ZGQ A;  2OUJ A;  1LEN A;  5JOW A;  2VZV A;  4D6S A;  3RYK A;  3THD A;  4AFM A;  5JPN B;  3SH4 A;  1VBE 3;  2ZX4 A;  4Q4X 3;  3ZR6 A;  1UYX A;  1VBB 3;  4JDO A;  2V73 A;  1V6I A;  5APA A;  3G7D A;  2DVA A;  1V6J A;  2VUL A;  4R9D A;  4PBO A;  3I49 A;  2FDH A;  4NIH A;  2FBE A;  4OMD A;  5T5L A;  4G9S B;  1WCD J;  4C1W A;  3O14 A;  1R1A 1;  3UKT A;  3AP4 A;  5CB7 A;  2DVF A;  1TME 3;  1HN1 A;  3WD5 A;  1UQX A;  1VRB A;  2I07 B;  4NWV A;  1OPM A;  2W95 A;  1E5S A;  3RDI A;  1NOV A;  2WS9 1;  2PXJ A;  4URA A;  3WVJ A;  1NX9 A;  2TNF A;  1W05 A;  2OX0 A;  1OOP A;  2HEV F;  5EPA A;  5FZK A;  4AGV A;  2BOI A;  4CDW C;  2WKK A;  3POE A;  2LAL A;  3KT4 A;  5A3P A;  3HPN A;  3CJI A;  1R08 1;  4UW3 A;  5I0U A;  2LUW A;  1SLI A;  5FZ4 A;  3NVC A;  4Y1X A;  4EE2 A;  2GU9 A;  1VE0 A;  4GZ9 A;  4MGY E;  3AYC A;  2ZS6 B;  4I09 A;  1OBN A;  2MHF A;  1K45 A;  2VMI A;  4Q0S A;  4I0A A;  4UWD A;  3WW1 A;  3V0A B;  4GWI A;  4N9I A;  3VD3 A;  4Q4V 3;  2PLV 3;  3HMY A;  4BE3 A;  2OII A;  2VBP A;  2Y6G A;  2VGD A;  4RFT 0;  1MZ5 A;  2ZGT A;  2A5Z A;  4QQP A;  3FUQ A;  2RJK A;  2XQX A;  1GP4 A;  2WZP P;  3RI9 A;  4LR4 A;  4Y1V A;  4Q0P A;  2G9G A;  2RS3 1;  1ZBE 1;  4XOG A;  1X33 A;  4XF0 A;  2ADE A;  4Y1Z A;  4HON A;  3BOD A;  2W5F A;  5H9Q A;  4AHY A;  3BTY A;  3KCY A;  2N7G A;  3BTX A;  4BH9 A;  2TEP A;  4YVW B;  2B5H A;  3VZM A;  4UFH A;  2D6L X;  3CU7 A;  4GH4 A;  5FXZ A;  1JOD A;  3I3D A;  1F5F A;  1FX5 A;  1U5Y A;  4YGB A;  3AXD A;  5FMD A;  2FCV A;  3B93 A;  2XG3 A;  4M3C A;  1HV1 A;  3TNP B;  3VDD B;  1W8Z A;  1J58 A;  3ZXG A;  5LEJ A;  1SFP A;  4IEQ A;  4B29 A;  4B4R A;  1J3R A;  3DPR A;  5CYY A;  2ZHN A;  2WNV B;  4L8Q A;  3AJZ A;  3KWV A;  4R4X A;  4UFJ A;  5LA2 A;  3LCP A;  4QWN A;  3U1X A;  1T6G C;  3D4K A;  1WW5 A;  5FZA A;  3CHX A;  5C8C C;  2Y60 A;  1MS5 A;  2XKP A;  3P3P A;  3IM0 A;  5FZ7 A;  5D1I A;  4CDU B;  2E7T A;  3WG4 A;  4YAR A;  4Z1V A;  2CGO A;  3JBG 2;  4BU2 A;  1W6P B;  3OCP A;  4QPG C;  5DZG A;  4F7Z A;  3LOB A;  4AWD A;  3A7Q A;  4B1M A;  4BMB A;  4PDW B;  5J1X A;  5HCB A;  1CAV B;  2JX9 A;  3IIA A;  3MW2 A;  4DUV A;  1OVP A;  5IK5 A;  5FFO C;  2R06 1;  4DXT A;  5FKB A;  4YFZ A;  3GCW A;  5BNO B;  3VDC A;  4CDX B;  2JG8 A;  1NY7 1;  1UOF A;  4V2W A;  2QQI A;  4KWL A;  1FPN 2;  2W46 A;  1OLM A;  4XW3 A;  4JDM A;  5FMO S;  1S0G A;  3H8U A;  2ZX2 A;  3PIJ A;  4I0W B;  1H1M A;  1POV 3;  4NHX A;  2D6O X;  2VMG A;  1SLL A;  3KV4 A;  4PHZ A;  3OEA A;  4YZ5 A;  1MPX A;  4A7Y A;  2X5I C;  1MR5 A;  4GJZ A;  4TWT A;  2JEC A;  2JE8 A;  1QJE A;  2B45 X;  3ZFE A;  3WIN E;  5DUV A;  3CMG A;  2CDP A;  3FMG A;  4IGP A;  4MH0 E;  1NA1 A;  4IE5 A;  3THC A;  2WA4 A;  4OHW A;  3CL1 A;  3I2D A;  4B4Q A;  5A1L A;  3OF1 A;  4A41 A;  2K9Z A;  1W0N A;  1QH7 A;  1XJA A;  3OPT A;  1POQ A;  1N47 A;  4GAL A;  3T2Q A;  2WO7 A;  1ULC A;  3TBD A;  1QJY 1;  3B9I A;  5CFC A;  1TMF 2;  3ZMN A;  4OHY A;  3KQR A;  1LCL A;  1XE8 A;  4EV0 A;  1ZZB A;  2VTX J;  2XDV A;  4WZF A;  4FP3 A;  1OD3 A;  5ACA 2;  3ZIW A;  1LKN A;  2ET7 A;  5JMC A;  1W6M B;  3TEY A;  5L73 A;  4E27 A;  2DBI A;  3VL8 A;  1FT9 A;  2ETE A;  4XFF A;  4Y1U A;  4AEM A;  5BNN A;  2HYK A;  1FOD 1;  1TE1 B;  2Y38 A;  2YRO A;  3J7N A;  2DUR A;  4GB3 3;  5ABJ B;  4TXW A;  3DYP A;  2HWD 3;  3NO8 A;  5J36 A;  3NKG A;  1NLQ A;  4QXB A;  3RQ0 A;  5IFT A;  4DO0 A;  5J3U A;  5LRS A;  4LJH A;  4XJU A;  1UPI A;  3NNM A;  1O3T A;  1UZW A;  2BGP A;  2EXJ A;  4A44 A;  1ZBA 1;  2PQS A;  1W2N A;  4Z92 B;  1YWK A;  2WNU B;  1HQL A;  5FV3 A;  1NCR A;  1S4C A;  1VRH 2;  3D0J A;  1HDK A;  2E31 A;  1Y4W A;  4NR1 A;  5FPL A;  2E51 A;  2VEC A;  1AL2 2;  2DU0 A;  2VNR A;  2ZGN A;  3JD7 2;  3NRU A;  4BLI A;  3AMM A;  1YCI A;  3HIF A;  1JZ8 A;  5GLV A;  2IXI A;  5CKM A;  3RRD A;  3OGR A;  4R9A A;  5C4W B;  4CVU A;  4DNY A;  1JN2 P;  1NCQ B;  3DXU A;  4GWN A;  5KHH A;  3C7E A;  1I5P A;  2DUO A;  3WDT A;  3I2J A;  4B8E A;  3BGA A;  1PO1 1;  2RS5 2;  2WZR 2;  2D3R A;  3GHN A;  4CUG A;  3E5U A;  2ZHK A;  5L7O A;  2NM1 A;  1E5H A;  1AYN 1;  2BUK A;  4LO5 B;  4EWA A;  4BM8 A;  4AI0 A;  2XL7 A;  3H1W A;  4QXH A;  4W6Y A;  5D8A C;  1GWL A;  1QKQ A;  2RHP A;  4PCR A;  4Y26 A;  1LHW A;  2P6C A;  4K1Z A;  5F3C A;  4HSJ A;  3H8R A;  3LEG A;  1RUJ 2;  2ZAA A;  4KWK A;  4K1Y A;  1J1T A;  3SIS A;  4BK4 A;  2FDK A;  1FMD 1;  4QPI B;  1OUS A;  2H6C A;  4M3C E;  3ZSL A;  3DCQ A;  4YYO A;  2FDF A;  1SDW A;  1GFF 2;  2VO5 A;  3WP4 A;  4JGZ C;  2ERF A;  4AVT A;  1IS3 A;  1VAK A;  3VBH B;  1VBA 2;  1D4M 2;  4S2G A;  1K12 A;  1OFS A;  5A3O A;  4AHZ A;  2EF6 A;  5HPO A;  3H8O A;  1PO2 1;  3O1V A;  1O3R A;  1W6O A;  2WRA A;  3CJI B;  3DXT A;  3JBG 1;  2X29 A;  2VCA A;  2CWM A;  3WLU A;  2VOV A;  4GWM A;  4ZU4 A;  3ZYI B;  4MHR A;  5LBC A;  3BIE A;  1PZ8 A;  3MI8 A;  2X10 A;  2OPW A;  3T4H B;  1XE7 A;  1RUF 2;  4PI2 A;  2H0B A;  1RMU 3;  3SH3 A;  1OA2 A;  2G19 A;  3POW A;  3FHA A;  3NAP B;  4LK6 A;  4LUL A;  4HMZ A;  2W92 A;  2D93 A;  4CU8 A;  1MS8 A;  4WM7 A;  2VQT A;  1OLM E;  4IV1 C;  3BOP A;  2D6M A;  3IKW A;  5JZG A;  3RJR A;  1FXZ A;  4IEY A;  5JCT A;  4FQZ A;  2GME A;  4ZXK A;  3V56 A;  3K46 A;  4GH4 B;  1LHU A;  5KHG A;  2WR9 A;  5JWP A;  2Z79 A;  5F1R A;  4FTE A;  2DVB A;  4QPW A;  3NNJ A;  2UU8 A;  3JBG 3;  2LRP A;  3AK0 A;  3WDY A;  4LUM A;  4XBN A;  3AMN A;  3PME A;  4QGL A;  3WQB A;  3EHK A;  1BQP A;  2FD8 A;  2A6Z A;  4QAW A;  4R9C A;  1D0G A;  3RPQ A;  2HH9 A;  3N4M A;  4ES9 A;  4XDP A;  3BU0 A;  1NG0 A;  1FPN 3;  2GND A;  1RUC 2;  4B4P A;  1W3V A;  2A73 B;  4JVA A;  1YIF A;  4Z8B A;  4N7I A;  2PAM A;  4JGY C;  2G1M A;  2QJV A;  4LUK A;  5IAX A;  4RGK A;  1N1Y A;  1DLC A;  1PM7 A;  1QQP 2;  5FWE A;  4L99 A;  3VBS C;  3ZYG A;  3VBU B;  1G6N A;  3WT3 A;  1KJR A;  3ZYP A;  3H9A A;  4CP2 A;  2BU9 A;  4W6X A;  4AI9 A;  4WVM B;  5FQ0 A;  2ZGL A;  1KDK A;  1GBG A;  5T5J A;  3RSJ A;  3WQ0 A;  2UY9 A;  4CCO A;  1DLL A;  1UZY A;  1ULF A;  2BWA A;  2YG0 A;  4XPV A;  4XUN A;  4AVC A;  5T50 A;  2QQJ A;  2WQ4 A;  2HWC 2;  1RUI 2;  3S5A A;  3N9M A;  1IZ3 A;  5A6Z A;  1W8W A;  2CY6 A;  3UJO A;  1APN A;  1GZT A;  3GM8 A;  5C9A A;  1TMF 3;  1XNA A;  1XNT A;  2Y26 A;  1XYP A;  3PUS A;  1YQ5 A;  5DZE A;  1QU0 A;  4ARX A;  5F2S A;  1OT5 A;  3WZ1 A;  1JZ3 A;  4JKL A;  1UY1 A;  1LGB A;  3AYE A;  3AZW A;  2HBU A;  3BUC A;  5ACA 3;  2WYS A;  1XB9 A;  1OLR A;  2BRT A;  2RM2 1;  3MHZ A;  1K5M A;  3AZZ A;  4H7L A;  1W06 A;  3GZA A;  2Y64 A;  2ADD A;  4W4Z A;  1PK6 C;  2YGL A;  1ZRI A;  4XZU G;  3BB6 A;  5A7W A;  1NUK A;  4FFG A;  4BQ2 A;  3UT0 A;  5IK4 A;  2X53 S;  3W59 A;  2WZR 1;  1S0I A;  1COV 2;  4NVP A;  3T2O A;  1GNY A;  1US3 A;  2W39 A;  2WSU A;  2RMU 2;  1QEX A;  3AMH A;  1W9W A;  3HN1 A;  2P4E A;  3KGL A;  5DMY A;  3LGR A;  1G9F A;  2P3K A;  2IUW A;  5FP9 A;  4CEW C;  1O4Y A;  2IWG B;  3OSD A;  3B02 A;  4LQR A;  1N3Q A;  2OYZ A;  3VKN A;  5KR7 A;  3LPG A;  4IE0 A;  1WCK A;  1CJD A;  1W90 A;  3F2Z A;  1VRH 3;  5FZE A;  1OXC A;  4QQL A;  2IXJ A;  4XTP A;  3T2P A;  3U37 A;  1AL2 3;  3CNA A;  3JD7 3;  3W5M A;  5EV7 A;  3MUY 1;  4R52 A;  4IUG A;  3K3O A;  1DU3 D;  2DCZ A;  3PTR B;  2P6H A;  4HFS A;  2FZ2 A;  3B94 A;  1DQ1 A;  3GZE A;  3PVB B;  5GLW A;  5C3R A;  1R09 2;  4O9E A;  2RS5 3;  2WZR 3;  5JXJ A;  2JJ6 A;  2JIC A;  3T30 A;  1H8T C;  2XQR A;  4WVV A;  4FTB A;  2XJP A;  1D4M 1;  4YVS C;  3MLL A;  4OUS A;  1S1A A;  1SFY A;  2AZ5 A;  1FAY A;  1SBF A;  2GH8 A;  5IVY A;  5ERL A;  4GJY A;  1JYI A;  1DGR N;  2VVE A;  1KRI A;  1ND3 B;  2VQA A;  2NN8 A;  5DAW A;  4ZU5 A;  2ZMK A;  2YHJ A;  3KVA A;  4FPG A;  4Q4W 3;  1UMZ A;  2QVS B;  3LEM A;  4I2O A;  1A3K A;  1VP6 A;  3OGS A;  1RUJ 3;  1YFW A;  3VBF C;  4AVB A;  2VCC A;  5JSP A;  3MW3 A;  4ATE A;  5KXC A;  1CIW A;  1QJX 2;  3NV4 A;  4RQP B;  5L7O B;  3RZL A;  5F5A A;  2QE3 A;  1AR9 3;  4PT6 A;  4DXS A;  2R0H A;  1XU2 A;  1W8T A;  1SBD A;  1NZI A;  3OEB A;  4Y20 A;  5BNP A;  3GF6 A;  3BKZ A;  4AI8 A;  1JZ4 A;  1UAI A;  2K0G A;  4IEW A;  2E6V A;  3ZFF B;  2QQK A;  4NMI A;  5FYC A;  1OMI A;  1VBA 3;  1D4M 3;  3MIC A;  4R4Z A;  1VAM A;  5LAT A;  3T4V A;  4IL7 A;  5FZ1 A;  2GAL A;  2B9U A;  1MQT B;  3LQC A;  5FY5 A;  1W9F A;  1QMJ A;  3Q8B A;  2ZX0 A;  4HPK A;  2Q30 A;  4IV3 C;  1HB3 A;  2EXK A;  1HJG A;  4OI2 A;  5A80 A;  1YFU A;  2D97 A;  3VZL A;  1HB4 A;  4QX8 A;  1RUD 1;  1VBC 2;  1OD5 A;  5FBZ A;  3LIG A;  2B9V A;  4HK9 A;  5KHJ A;  3P6B A;  4LBQ B;  3EYP A;  1RUF 3;  3IPV A;  3URF A;  3ZN6 B;  4CXY A;  4FXG B;  4RR3 B;  4OZO A;  4G4F A;  1O5L A;  3N9O A;  5C6C A;  1X7N A;  1W6O B;  3USU A;  3LFI A;  2VQU A;  4CXX A;  1WWY A;  4EWD A;  4L11 A;  2BFU S;  1WLD A;  1AR6 2;  3III A;  1LU1 A;  3I2K A;  3ACI A;  2HYX A;  4JX0 A;  2MEV 1;  3ZYB A;  2HWE 2;  2ZJC A;  1UYP A;  1UKR A;  5A3U A;  2GN7 A;  1VB4 A;  4K40 A;  5FUN A;  1HRV 1;  4NHK A;  1QQP 1;  1AUY A;  3D5O A;  3OY8 A;  4KNC A;  3RWK X;  3ZSJ A;  5J09 A;  3HOB A;  1W0P A;  2VJX A;  3UJQ A;  3KQ4 B;  3W5N A;  1LB2 A;  1YC6 1;  4GQ7 A;  4HOO A;  3POG A;  3IWZ A;  1H9P A;  3BU7 A;  2XBO 1;  4AK3 A;  4MXV A;  2OW4 A;  3SH5 A;  5IAV A;  1QXJ A;  2JDZ A;  1NKG A;  1RUI 1;  2BER A;  2PHX A;  4GKY A;  2BVV A;  4P9Y A;  4CEY B;  4LBO A;  1RUC 3;  4LBQ D;  1A78 A;  2G9Z A;  4DIQ A;  2CSG A;  1PGS A;  1SLB A;  4WM8 B;  2UWC A;  2QNK A;  3P3N A;  1UKG A;  4GMP 3;  1WBL A;  5IW0 A;  3OB8 A;  5F5C A;  1UY0 A;  5F2W A;  3OBT A;  2D44 A;  1ZRD A;  4GAZ A;  2V72 A;  4CDW A;  3MIB A;  1JUH A;  4AQS A;  1QQP 3;  1MZ6 A;  3CKH A;  3LAG A;  3S30 A;  3ZXD A;  3I2I A;  5F5I A;  3WDU A;  2VD7 A;  4A7Z A;  2WT2 A;  2VOX A;  2PFW A;  1GV9 A;  1ENQ A;  4ZU7 A;  1KEX A;  1NE6 A;  4AW7 A;  1COV 1;  3T3Y A;  4XUO A;  3AP9 A;  4CP1 A;  4CDQ B;  3RZM A;  5ISL A;  3KLS A;  1EP0 A;  1BK1 A;  3D3A A;  1L7R A;  3NJY A;  4CP9 B;  4EZH A;  1LAJ A;  2HWC 3;  1LES A;  1RUI 3;  1WKY A;  4LBJ A;  4LT5 A;  5FPZ A;  1Y3T A;  5FRE A;  3VHR A;  3L2H A;  5CG9 A;  1ZA7 A;  4KGQ A;  5A7P A;  3DN7 A;  5FUI A;  2R04 3;  3ZFG B;  2ET1 A;  1UW8 A;  2RR1 2;  5DUU A;  1SFN A;  2ZTN A;  4UW4 A;  1UZ0 A;  2VM9 A;  1XOY A;  3PHM A;  3LE0 A;  1Y43 B;  3PL0 A;  3AMP A;  4JC1 A;  4YNI A;  4D6Q A;  1PGL 1;  5J96 B;  2PA7 A;  2VUC A;  2C4X A;  2JG9 B;  3KV6 A;  4XUT A;  1CQ9 A;  3IT8 A;  5FJH A;  3ITQ A;  3N36 A;  4KH9 A;  3WQ1 A;  2F4L A;  3ZPO A;  4XBL A;  5A7O A;  4BYY A;  4YZ4 A;  5CBL A;  3R05 A;  5CFD C;  4JTO A;  2IFW A;  1R09 1;  4BQ3 A;  1COV 3;  4P14 A;  3MIG A;  2JEM A;  2WQ8 A;  2WA3 A;  4GA9 A;  5LBE A;  2VW1 A;  2YFZ A;  3A22 A;  5C8C A;  2D3S A;  2RMU 3;  1CZT A;  5FO9 B;  4ZPI A;  1RVF 2;  2FMY A;  5LW9 A;  1BXH A;  1YEW A;  1S0E A;  3J7H A;  4QPG A;  3DEC A;  1GZW A;  1JOB A;  1J1L A;  3I54 A;  5FZD A;  3OUH A;  2R30 A;  3H3U A;  1OF4 A;  5FZ8 A;  3OPW A;  3ELN A;  4BLJ A;  4EJR A;  3GBF A;  3I2F A;  3PUI A;  5TSW A;  5EIY B;  5IVV A;  2F4P A;  2J1E A;  2PEL A;  3KV5 A;  1OQ1 A;  2D98 A;  3NJZ A;  4K9S A;  1EAH 1;  4O61 A;  1EUU A;  4Q2F A;  4UFL A;  4DY5 A;  1TNR A;  3VLB B;  3BAL A;  4IE4 A;  2JD9 A;  4LBL A;  2Y6F A;  3OBZ A;  3ZN5 A;  4CCM A;  4Q0V A;  3SC7 X;  1TQ5 A;  4F83 A;  3HEI A;  3RGB A;  5FZ3 A;  1X9T A;  1YYN A;  4JRL A;  4HKW A;  1PIV 1;  1HQN A;  1JOJ A;  2A75 A;  4YGE A;  4PQQ A;  5LBF A;  4BIF A;  4COZ A;  1FV2 A;  2VZS A;  3N7J A;  4D7S A;  5JOY A;  3WF1 A;  1N1S A;  4B3N A;  4MXW B;  1ND2 C;  1MS0 A;  4XXP A;  5FJK A;  2A6W A;  3H50 A;  4N7U A;  5I0D A;  4YSF A;  5LZ6 A;  4RD7 A;  5DPN A;  3QAC A;  1V9U 1;  5D2A A;  4E4Z A;  3FLR A;  1CES A;  3LFM A;  1JW6 A;  1YHF A;  4X6R B;  2CTV A;  3BI3 A;  1VBC 1;  1OFN A;  5I0T A;  4Q29 A;  4LHN A;  4ASL A;  2BWC A;  1E5R A;  1UOG A;  2IZW A;  5FP3 A;  2XHK A;  2WFP A;  4X8P A;  1QJX 3;  2WN3 A;  2AEY A;  1VBE 1;  1S2K A;  3IAQ A;  4AI1 A;  5FUP A;  5FMB A;  4Q4X 1;  4FSJ A;  1LUL A;  1VBB 1;  3WF4 A;  4GB3 2;  5DN2 A;  3W20 A;  1BEV 2;  4QHO A;  3VGI A;  1RHI 2;  1SPP B;  3W21 A;  1J83 A;  2QDN A;  4BOW A;  4Y4Y A;  5FRA A;  1O8P A;  4JV4 A;  1SDD B;  2HWE 1;  5FLJ A;  3ZKU A;  1Y9G A;  3OYW B;  5JVV A;  1JHJ A;  1ODM A;  2IC1 A;  1ACC A;  5JXH A;  5EXO A;  3PVN A;  4H14 A;  2ZML A;  2ZEY A;  3DL3 A;  3DYO A;  5CZK A;  3VBO B;  1TME 1;  3DEM A;  5AFB A;  3WW4 A;  1GOG A;  2BGO A;  1YQ8 A;  5JOX A;  3I97 A;  4C1X A;  5DDJ 3;  1MS3 A;  1OHF A;  3HAG A;  1VBC 3;  3MZH A;  2A6Y A;  1V6K A;  2VCM A;  3E5X A;  3POY A;  4IEU A;  2XOM A;  4IEZ A;  3ZYF A;  4Q8L A;  4U36 A;  3FFQ A;  4QMA A;  3NWK A;  3LSD A;  3THP A;  4CCL A;  5JOZ A;  4YGD A;  2GNB A;  2NLR A;  2P3I A;  5T5O A;  3SQO A;  4KG8 A;  5A7S A;  1KS5 A;  4LA2 A;  4E8C A;  1AR6 3;  3BYW A;  3AZX A;  5FK8 A;  3HJR A;  4MGT A;  3RMY A;  2HWE 3;  2PLV 1;  4Q4V 1;  4COY A;  4Y33 A;  3ZMO A;  4AYU A;  5GKA C;  2Q8E A;  1REF A;  3IMN A;  1EYB A;  3FHI B;  1VBD 2;  2QFE A;  2UYB A;  1LTE A;  4RS5 B;  1QWR A;  1WUV A;  4XAE A;  4DB5 A;  4XQ4 A;  1US2 A;  2G4I A;  4PF5 A;  4XJ9 A;  4ZS2 A;  3UET A;  1CAU B;  1Q43 A;  3GJB A;  4NUB A;  5AFE A;  4BK5 A;  5FZB A;  5K8S A;  3V0B A;  1ZRF A;  2K46 A;  1LU2 A;  4E2G A;  1UF2 C;  1QNY A;  4UF0 B;  4WBB A;  2RS1 2;  5FP7 A;  5LAS A;  4CUB A;  4QM9 A;  4HET A;  3OY8 B;  3QBQ A;  2XLG A;  4XUQ A;  1GP6 A;  3MO4 A;  5B4X A;  2B8M A;  5E16 A;  2XML A;  5D8A A;  3O7O A;  4A2U A;  3AM2 A;  1ZA4 A;  5FDB A;  5KHK A;  1BVV A;  3POF A;  3LIH A;  4A3X A;  4DRV A;  5FWJ A;  1UMH A;  3V65 A;  2VME A;  5FLH A;  1PZ7 A;  1WMF A;  1WW7 A;  3WCS A;  5IFP A;  4YVW C;  4CU6 A;  4DZG A;  2JDA A;  4NRM A;  4RFR B;  4Y22 B;  3H8X A;  2QQP A;  4S2F A;  3HD8 B;  1P8J A;  2YY1 A;  4IEP A;  4AED B;  5IHR A;  4QXC A;  1DZT A;  1CAX B;  4QQO A;  2JDM A;  4P9G A;  3OD4 A;  4H55 A;  1IGO A;  2DVG A;  3VDD C;  5I8Y A;  4LNV A;  4D69 A;  1RMU 2;  2ZZJ A;  4Q4Y 2;  4OI0 A;  4K7J A;  3TAY A;  2WNV C;  3OGJ A;  4ERO A;  5K0U A;  5A3N A;  4TYS A;  1JZ5 A;  2XWB B;  5JDB A;  1U12 A;  2W94 A;  4P9L A;  1WLW A;  1QOS A;  4IW3 A;  4S2H A;  4XIO A;  1JXN A;  4CDU C;  1XBF A;  1YIP A;  2Z69 A;  3C7O A;  5GZD A;  4ZHN A;  1POV 1;  2E33 A;  1UCX A;  2Z4F A;  4N43 B;  4R9B A;  3WNX A;  1ZYB A;  2RR1 3;  4IQP A;  4PDW C;  5A32 A;  2JXA A;  2WNO A;  1JU4 A;  5LA0 A;  4O7X A;  5G04 L;  3LDB A;  2WO3 A;  2QZ2 A;  3ZYR A;  5BNO C;  4WVW A;  3ZXE A;  2D40 A;  4TN7 A;  4CDX C;  1BMV 2;  4MGS A;  4XAB A;  3MFA A;  2LRO A;  1JZ7 A;  3V64 A;  1KD7 A;  4FPE A;  4ISQ A;  1BK0 A;  3EQE A;  4TLG A;  4CCD A;  3JUU A;  1IS6 A;  1RVF 3;  3PVO A;  3LWC A;  3AP6 A;  4NPL A;  5T3N A;  1AR8 3;  4YRD A;  2Z5W A;  4ATF A;  3T0D A;  2VUA A;  4I0B A;  3TRS B;  4FPY A;  4XFA A;  2ZBJ A;  5G05 L;  5FZF A;  1WW4 A;  1OF3 A;  4C90 A;  3PDQ A;  4N9H A;  2I2S A;  5E8A A;  4C8D A;  5A6Q A;  3APB A;  4XMA A;  4LKD A;  5F3E A;  1LGN A;  3HQU A;  4E8D A;  1QJU 2;  4COU A;  2HLE A;  3Q8C A;  4JKM A;  1GZW B;  3AFK A;  3CBN A;  1BJQ A;  4GB3 1;  1W6Q B;  2KM2 A;  2HWD 1;  5A33 A;  3JQW A;  2NZ9 A;  3MEP A;  2GNT A;  4JGY A;  3GBG A;  2BGC A;  2JB4 A;  4ASK A;  3KM5 A;  1SZB A;  1F9K A;  1S2B A;  4OFG A;  2VZO A;  1Q3E A;  3ZR5 A;  4IER A;  3RFR A;  3VBS A;  2RG4 A;  2E53 A;  3UES A;  3MIE A;  3C7F A;  3P1I A;  4XZP A;  1JTZ X;  1TVG A;  3T0A A;  4FP2 A;  1J3P A;  3ZYJ B;  2WIN B;  1ZRC A;  1MS9 A;  3WHT A;  1UL9 A;  2WWS A;  4XF9 A;  5ABJ C;  2HKX A;  4QU2 A;  3RZJ A;  1LOF C;  5I8S A;  2WN2 A;  3HN3 A;  1W6N A;  5FY9 A;  3U78 A;  2X09 A;  1PVC 3;  3OTF A;  5HCA A;  1IQD C;  1C5H A;  2W3J A;  4ZON A;  2ZGM A;  3HWJ A;  4GXL A;  3VB9 A;  1XXN A;  1BEV 3;  1RHI 3;  4N53 B;  2WDB A;  1HKD A;  3WNN A;  1JU3 A;  5JAX A;  1VLN A;  3KCC A;  2WNU C;  3M1H A;  4Q0U A;  4BME A;  4QX0 A;  1T2X A;  2AEZ A;  2WWU A;  4LIU A;  4TSV A;  4Y5T A;  5FZI A;  3RWN A;  4W8J A;  1ASJ 2;  2X05 A;  5EJ3 A;  5JUV A;  4KL1 A;  1RUG 2;  4UI9 L;  5BUV A;  4FTS A;  4XFB A;  4CXW A;  1PK6 A;  4MET A;  2QTW B;  1HIX A;  2Y33 A;  3VHN A;  2W1U A;  3ES1 A;  5C4W C;  1NCQ C;  5CKQ A;  2WAB A;  2JKX A;  2E9Q A;  1MAC A;  2D43 A;  2XJV A;  1NLR A;  1Q8P A;  4CE8 A;  4CCK A;  1C1F A;  3AJY A;  2Q1Z B;  3VHO A;  1O59 A;  1F5J A;  1UN1 A;  3ACG A;  3GZU C;  3NL1 A;  5BYN A;  4AHW A;  4XDQ A;  2Q8C A;  1RUN A;  4CEW A;  4YWA A;  3IBM A;  2VMD A;  4BQ4 A;  2P2K A;  1HLC A;  3K51 A;  1B35 A;  1SMV A;  5BNQ A;  4QT6 A;  3A0K A;  4C91 A;  2F17 A;  3ZN4 A;  1J59 A;  2HWB 2;  1RIR A;  1W8O A;  2XJS A;  4B1L A;  4UFM A;  1J84 A;  1PMJ X;  3ZIX A;  1AF9 A;  2Q5T A;  3LF7 A;  5A7N A;  3TNQ A;  1PZ9 A;  4MO3 M;  4NHY A;  1STM A;  3KF3 A;  1AL0 G;  1HRI 2;  3T1L A;  3NKT A;  1EV1 2;  3THT A;  1VBD 3;  4AAP A;  4DXR A;  3VD4 A;  5LK7 B;  1HW5 A;  4RYD A;  3AZY A;  4QPI C;  1CVN A;  4Q4W 2;  4DFS A;  4GIQ A;  4DOU A;  3E6C C;  1ULD A;  2BNN A;  1W8U A;  3AKS A;  2XVL A;  2XVG A;  3I3E A;  1RMU 1;  1H8T A;  2UY8 A;  4Q4Y 1;  3R4D B;  1ST8 A;  1RJ8 A;  1X82 A;  3ETQ A;  5FXX A;  2RS1 3;  4YVS A;  1O91 A;  4XC9 A;  1AR9 2;  1PVX A;  3VBH C;  5E88 A;  3ZLI A;  4EQV A;  4LMF A;  2PHR A;  4NPM A;  3TEW A;  3UGH A;  2VPV A;  3CJI C;  3N35 A;  4E4S A;  1IOA A;  2ZXQ A;  4XJW A;  5LCW L;  5T52 A;  2C9A A;  2CL2 A;  1A6C A;  1V70 A;  2YYO A;  1S0F A;  1YI9 A;  3MYX A;  5DAB A;  1OOP B;  4HBN A;  4JQR A;  4XAC A;  3S5Q A;  3VBF A;  3LPF A;  4IGO A;  4OHZ A;  3U75 A;  4E2S A;  1RC6 A;  4JCK A;  1XND A;  5HV4 A;  1WCU A;  2QQV A;  3FL7 A;  4MGK E;  3RJ2 X;  4MG2 A;  2GN3 A;  3NAP C;  1OA3 A;  3Q8F A;  2BQP A;  2J1U A;  4H7M A;  2C9K A;  3QH7 A;  2R07 2;  2XR4 A;  2OQ7 A;  5I93 A;  3I59 A;  4OHX A;  4Q4Y 3;  1F4A A;  5F7U A;  1V0A A;  2CU5 A;  5FYH A;  3VZN A;  3HBK A;  4PIZ A;  2E7A A;  5JIA A;  1FPN 1;  4GH4 C;  2V5D A;  4QDS A;  2R16 A;  1S0C A;  5GLU A;  3O1U A;  4NN0 A;  2VBB A;  3L9J T;  2Q4S A;  4CSW A;  1SLT A;  1WLC A;  5FZO A;  3N9P A;  1ZZC A;  4IV3 A;  1ZZ9 A;  4K20 A;  2XGX A;  2LM3 A;  5DUX A;  3O1O A;  5FYM A;  4CCE A;  1GP5 A;  1WLT A;  4EN0 A;  5DAQ A;  1QIQ A;  3FX3 A;  4CYD A;  1LOC A;  4FAG A;  4TLF A;  2C26 A;  2VOW A;  4ZZ8 A;  4UFK A;  5AC9 2;  1Y7B A;  1XYO A;  4I3P A;  4M3C B;  1NT0 A;  3CZJ A;  3DPR B;  4LBM A;  4ES8 A;  1IKQ A;  3R4U A;  2FZ1 A;  1WA6 X;  2YB7 A;  5CVR A;  1AR7 2;  1YJK A;  3IN9 A;  1V6M A;  5FPA A;  4Z07 A;  1GOH A;  1U5I A;  2IXH A;  5KHI A;  2O8Q A;  1MEC 2;  1WME A;  1ZVF A;  2VUJ A;  4PLM A;  1F2N A;  3NST A;  2XLF A;  3MDP A;  1K3I A;  3JB4 C;  4IET A;  4DEQ A;  1CGP A;  1U5X A;  1TMF 1;  3ZM8 A;  3PU8 A;  4P5H A;  3W58 A;  4BCU A;  1W9Y A;  3VBU C;  4BHP A;  1HXS 2;  5FY8 A;  4X8N A;  2PMW B;  5ACA 1;  5EP9 A;  2JIJ A;  1GNZ A;  3S7E A;  3OUI A;  2WSV A;  2JG8 B;  3ZFF C;  3UKV A;  1QJU 3;  2WLP A;  3TWI A;  2WQZ C;  1JZ6 A;  3RVH A;  3JB8 A;  2O8O A;  2R6Q A;  5GZF A;  5GM0 A;  3EB7 A;  1DFQ A;  5IYY A;  2QQL A;  3X29 B;  4QKN A;  2GDF A;  4A6O A;  4QPY A;  1W9T A;  4ZZ5 A;  3PUA A;  1GMM A;  2J1V A;  5LBB A;  3H1Y A;  1UX7 A;  3TN9 2;  5FY7 A;  1KGY A;  2XJU A;  1UU6 A;  2RVA A;  3ES4 A;  3AB0 A;  4UFI A;  3TOJ A;  4QB2 A;  1VIW B;  3ZFE B;  5EZW A;  1W8F A;  3AXE A;  2AH2 A;  5EFU A;  2D5H A;  3VZK A;  5CAD A;  2R04 2;  2ZHL A;  3C2U A;  3E6B A;  2VNG A;  3ZXL A;  2KA3 A;  3GNE A;  4BJ0 A;  1VRH 1;  5LWB A;  2XXZ A;  4M3C F;  4B7E A;  5A3L A;  1NA1 B;  2ZAB A;  1AL2 1;  2NPI A;  3JD7 1;  2GP3 A;  3VD7 A;  3PVE A;  5FZM A;  4C0B A;  3VBR A;  1AZD A;  4KU8 A;  2SLI A;  2XON A;  4OI4 A;  5CFC B;  2YC0 A;  4BZ4 A;  1O5U A;  4LE4 A;  3O1S A;  4JRA A;  4Y5S A;  2ARC A;  5DUW A;  2RS5 1;  5IUQ A;  2HWB 1;  3SCH A;  5HCH A;  1S0D A;  2CGN A;  3WNL A;  1CD3 G;  5C5U A;  4FOQ A;  3UYJ A;  5HI0 A;  4JTN A;  4DPN A;  2JDH A;  2AEN A;  3KB5 A;  2QKD A;  1JBC A;  1XQN A;  1RTV A;  1URX A;  1CN1 A;  2ZX1 A;  2CHH A;  3KT1 A;  3OBR A;  3POB A;  4XBQ A;  5K4L A;  1ASJ 3;  2VL4 A;  1RUG 3;  3FC0 A;  4YLZ A;  5BNN B;  4KG0 A;  3MPB A;  1RJ7 A;  5CFD A;  4Q4W 1;  5T55 A;  4Y5Z 0;  4CCN A;  1Q8V A;  2ZEX A;  4KBB A;  3AYD A;  2VXR A;  4XJA A;  1RUJ 1;  1OKO A;  3JZV A;  2D3P A;  3AL5 A;  2RJL A;  4PLO A;  3KVB A;  1ULE A;  3MID A;  4YW3 A;  3QLQ A;  4E2Q A;  3AYA A;  5IVE A;  1AR9 1;  4YW7 A;  4LO8 A;  3AVR A;  2XWJ B;  4Y24 A;  4IND A;  5FZ9 A;  1A8M A;  1E5I A;  1LNS A;  1W8N A;  4JHZ A;  1KXG A;  1NCR B;  3A21 A;  2HWB 3;  4NRO A;  1ND3 C;  1H6X A;  2LW8 A;  3VBR B;  1VBA 1;  4HL0 A;  1DYK A;  5A3M A;  2R32 A;  4XUP A;  2W08 A;  3LD8 A;  4MZU A;  1RUE 2;  1HRI 3;  5HCF A;  3SCF A;  1EV1 3;  1HJF A;  1YO8 A;  3B01 A;  5L7O C;  4IXL A;  3AKR A;  2ZOE B;  1EPZ A;  1B35 B;  1XPW A;  1C8N A;  4RQP C;  4CPB A;  3O5S A;  1JYX A;  1CAW A;  1HX6 A;  1RUH 2;  2PN5 A;  3FLT A;  3KHB A;  3LKJ A;  3ZSM A;  4XFG A;  5B4N A;  4DMI A;  2A6X A;  2VR4 A;  2Y0O A;  1RUF 1;  2R07 1;  3AMQ A;  2NMN A;  3ME2 A;  2GC1 A;  3MF6 A;  4EN8 B;  1O3Q A;  1DGL A;  4YZ2 A;  1ND2 A;  3WNK A;  2BNM A;  4ISR A;  1H2K A;  1W9S A;  3VN4 A;  3E5Q A;  4LO4 B;  3C3V A;  1Z7S 2;  2I45 A;  4FCA A;  3AZV A;  3EMR A;  3VD5 A;  4LKF A;  1RL3 A;  3IMM A;  2JDK A;  3HQX A;  3D82 A;  1AX1 A;  1G9A A;  1MQT C;  2RDR A;  4ARY A;  4OVE A;  2J1A A;  4AFC A;  3E1F 1;  4FPL A;  2RDS A;  3OJB A;  5C8W A;  3I2O A;  3MGU A;  4UXA A;  1WGP A;  1LR5 A;  5IT6 A;  5JLV A;  3ZSK A;  2CNA A;  5AC9 1;  4L9B A;  2W68 A;  3IDC B;  3SIT A;  4YZ3 A;  4RR3 C;  5FOB B;  4P5Y A;  1ULO A;  4AQ6 A;  2ES3 A;  2DU1 A;  4XUR A;  4AEJ A;  5DDJ 2;  1PMH X;  1AR7 1;  2ORZ A;  2V5Y A;  3ENR A;  1GQP A;  2R07 3;  1C57 A;  1DZQ A;  3FBM A;  4XEZ A;  1Z0H A;  3RI8 A;  3N3H A;  5FZG A;  4FPF A;  3Q8A A;  1QGL A;  3T08 A;  2B4K A;  3B9C A;  2ZCW A;  4QX2 A;  1UPS A;  1RUC 1;  1VMJ A;  3POJ A;  1VAV A;  5FYI A;  4M0H A;  5EJZ B;  2PAK A;  3ZDV A;  5FYV A;  1JS9 A;  3ALQ A;  4GMP 1;  4YW1 A;  1DHK B;  2P34 A;  4OMC A;  5DG1 A;  1DF0 A;  1QDC A;  3HQR A;  4MOA A;  1GR3 A;  1IPK A;  3J7L A;  3PLQ A;  5AC9 3;  1GZ9 A;  3WNP A;  1U5Z A;  4WM7 B;  1I1E A;  5JZG B;  4CEY C;  2GMP A;  5ANQ A;  4CCJ A;  1ZZ7 A;  2I74 A;  1AR7 3;  4NAM A;  5DG2 A;  4WM8 C;  1UXX X;  3PU3 A;  1BBT 2;  4LLO A;  5FP4 A;  1MEC 3;  3NNL A;  2HWC 1;  1RXF A;  3J8F 2;  2BBA A;  4IDZ A;  5A7Q A;  3LOI A;  2IXL A;  5FXV A;  2IVJ A;  4MGQ A;  4N90 A;  5LRR A;  5IVF A;  2BZD A;  4P08 A;  3UV9 A;  2CDO A;  1OQD A;  4W65 A;  1AYM 3;  2R04 1;  1LHO A;  2R1D A;  4L97 A;  4RL7 A;  5A6X A;  5DQ0 A;  1UMI A;  3ZO0 B;  1HXS 3;  2TUN A;  2HEW F;  2ZKN A;  3E97 A;  3JCI A;  5LY2 A;  4XF3 A;  4Z2A A;  5FO8 B;  3V0A A;  3AVS A;  2PHU A;  2ZGU A;  4QU1 A;  4CDQ C;  2VTX A;  4DUX A;  3OGG A;  2A7A A;  3AKP A;  1O7F A;  1YQC A;  1FV3 A;  4AXO A;  1SLC A;  2R7E B;  1TG7 A;  4FI9 A;  5H9S A;  3IDB B;  2EAL A;  2BP6 A;  1ONA A;  3PUR A;  3ZXJ A;  1VMH A;  4NE9 A;  1WD3 A;  2RMU 1;  3ZFG C;  4YVW A;  3TN9 3;  4Q5O A;  1W39 A;  1C28 A;  2YPD A;  1DYO A;  1LRH A;  4LTA A;  5C3S A;  2FDG A;  1G86 A;  4NO4 A;  3I7D A;  4AGG A;  5A3T A;  4A3Z A;  3VDD A;  1I5Z A;  2JG9 C;  3WF3 A;  5FQ0 B;  1TEI A;  1X8E A;  2BNO A;  4P9I A;  1GUI A;  5KC6 A;  1ALY A;  2A1X A;  1AXY A;  1IPJ A;  4BIS A;  2JIG A;  1C1L A;  4J25 A;  2WYF A;  2WNV A;  1ENR A;  4D7Y A;  2WS9 2;  3OUJ A;  4LK7 A;  4HLT A;  5FYS A;  3SXW A;  3ZSE A;  3QOP A;  3RZG A;  2VZ1 A;  3HNM A;  3ORJ A;  2XKO A;  4AF9 A;  2NP0 A;  5JXI A;  1W03 A;  5C9A B;  4CDU A;  2EVX A;  3ST7 A;  1R08 2;  4RHV 2;  1W6P A;  1YRZ A;  2LS6 A;  2MPF A;  2YDE A;  4FOV A;  4H2A A;  4MSV A;  3R0R A;  2AAC A;  4PDW A;  3ZX7 A;  1L3J A;  1CAV A;  1S0B A;  1WCS A;  2J1R A;  4XHB A;  4YZ1 A;  2DTW A;  3BIW E;  1C3H A;  1PX4 A;  1AR8 2;  1K5M B;  2Q1M A;  1OC1 A;  5FY0 A;  1UZZ A;  4NIA A;  1QXR A;  4BA6 A;  2YBS A;  4CDX A;  4K3U A;  2WFF 2;  2XL9 A;  5EYY A;  4OLL A;  5A7W B;  5JI9 A;  5JSR A;  3CJX A;  1OLQ A;  3I3Q A;  1K5J A;  2QQU A;  3U11 A;  4E9K A;  4SBV A;  5F6K A;  1HV0 A;  5IJR A;  2RS3 2;  1ZBE 2;  2QQM A;  3T09 A;  4XCA A;  1W8H A;  4YG3 A;  3LA3 A;  5LY1 A;  1QJX 1;  1GU3 A;  5FPB A;  1C8M 3;  1GOF A;  4MGI E;  3K4Z A;  4NIG A;  4L0P A;  4HZF A;  3U10 A;  1JH5 A;  3DGT A;  1BCX A;  1UNB A;  1GLH A;  4XYX A;  3MLK A;  4PJY A;  1W2U A;  2W0X A;  4HKL A;  4QD2 A;  5CNA A;  4FBF A;  2D6K A;  4CA9 A;  5JIU A;  1DZR A;  1QJF A;  4DXZ A;  1KIT A;  1YNA A;  2BVB A;  3ROU A;  3LSE A;  2X5I A;  4LO6 B;  3WUD A;  2AC1 A;  4FFI A;  5EWS A;  3ZKY A;  1IS5 A;  2GMM A;  1W99 A;  2A70 A;  1CZS A;  2YV8 A;  3P5B A;  4FPJ A;  4LOR A;  1RUE 3;  3N9N A;  4WV8 A;  3WF2 A;  4DIN B;  5FP8 A;  5L19 A;  1F8V A;  1W2T A;  5FYZ A;  4JAA A;  2GAU A;  5DDJ 1;  1RUH 3;  1ULG A;  4BDV B;  4M01 A;  1K42 A;  4LLF A;  2QQW A;  3HR9 A;  3S6P A;  5E1R A;  5FY1 A;  1PVC 2;  2BJS A;  2B7Y A;  3WG2 A;  1KS4 A;  2JDP A;  2R06 2;  2XUM A;  2DDU A;  1AJK A;  4M4R A;  1GIC A;  1H2L A;  3AP7 A;  1Z7S 3;  4HKO A;  3K4D A;  1NY7 2;  2FMD A;  3JU9 A;  4O9G A;  1AR6 1;  1Q8S A;  3H3Z A;  4GWJ A;  4QGN A;  4YPJ A;  4OI1 A;  1XE0 A;  3VBO C;  3WP6 A;  3ZYH A;  3J9S A;  4QM8 A;  5CIR A;  2OUH A;  5ABJ A;  4Q0Q A;  1ZRE A;  1LOF A;  3M3E A;  4LEJ A;  2JWP A;  1OVS A;  3FBY A;  4XFC A;  5FPU A;  1L7L A;  2PTM A;  3JQX A;  4AZZ A;  2BFU L;  1H1A A;  4IEO A;  5JPM B;  5LA1 A;  4Y20 B;  4MVT A;  5BNP B;  5FYY A;  4QB1 A;  3MPP G;  1YJL A;  1UYY A;  3CLP A;  4XE9 A;  4LE3 A;  4AI3 A;  5CU1 A;  3VKF C;  2CV6 A;  2Y6H A;  1MZF A;  2W2I A;  2WNU A;  1OKQ A;  2R0F A;  1NXM A;  5LB6 A;  4OQ9 A;  1DIW A;  3W9A A;  4BPZ A;  2Y0I A;  1ULP A;  3J8F 1;  4QXK A;  1QH6 A;  2WBK A;  2ZPX A;  4KU7 A;  4YW6 A;  3MLJ A;  2A3W A;  1JHN A;  1GAN A;  3M4F A;  4HPK B;  3UK9 A;  1QJY 2;  4I01 A;  5AVP A;  1JYC A;  1NCQ A;  4RS5 C;  4F3J A;  2VZT A;  5I8T A;  5EJ1 B;  4AVS A;  4HK8 A;  2VW0 A;  4I02 A;  1IPS A;  4W50 A;  3IPV B;  4GD4 A;  3NV1 A;  1CX1 A;  2AUY A;  4EZ4 A;  1KFU L;  3CZU A;  2FCT A;  2OPK A;  5DAX A;  3NV2 A;  3VKL A;  4CTE A;  3USU B;  5DXD A;  3WF0 A;  3HVD A;  4J1W A;  4COV A;  3T0B A;  2YBK A;  1W2A X;  1OPO A;  3O0V A;  2O0O A;  2PQQ A;  4FOW A;  5D21 A;  1W28 A;  3POI A;  5GLZ A;  4KGG A;  4A42 A;  1FOD 2;  1LED A;  1GKB A;  4EN7 B;  1H4G A;  2W87 A;  3U4X A;  4UW5 A;  2XUE A;  3J7M A;  1CIY A;  1BBT 3;  3FZ3 A;  1WW6 A;  1MS1 A;  1YQ2 A;  2E32 A;  1ZX5 A;  3J8F 3;  2J1T A;  4IE6 A;  5DAV A;  1JMU B;  4ZKT B;  3GJA A;  1OA4 A;  4HXC A;  2VOK A;  5IK7 A;  1ENS A;  4QPI A;  2XJT A;  2ORX A;  2F6B A; 
#chains in the Genus database with same CATH homology
 3DKQ A;  4BQY A;  4NHX A;  4XCA A;  5L9R A;  4JZR A;  5LBB A;  5IAV A;  4NHY A;  3W20 A;  4XAB A;  3W21 A;  4MHR A;  5LBC A;  4NHM A;  2OPW A;  3HQR A;  2G19 A;  4XC9 A;  3BVC A;  4Y5S A;  5IAT A;  3GZE A;  5C5U A;  2FCU A;  4BQX A;  4XAC A;  3NNL A;  3HQU A;  5EPA A;  3KT1 A;  5HV0 A;  5LA9 A;  5HV4 A;  3KT4 A;  3NNJ A;  5ERL A;  4NAO A;  5DAW A;  4UWD A;  3PL0 A;  2RG4 A;  4NHL A;  4XAA A;  3NNM A;  3ITQ A;  3GJB A;  2RDN A;  5DAQ A;  5LB6 A;  5LBE A;  2G1M A;  5IAX A;  4NMI A;  5EQU A;  5LAS A;  4Q5O A;  2Y34 A;  4ZPI A;  5LAT A;  5M0T A;  2FCV A;  4ZON A;  5L9V A;  3OUH A;  4KBZ A;  2HBT A;  4BQW A;  2A1X A;  2JIG A;  4J25 A;  4XCB A;  3OUJ A;  4Y5T A;  2FCT A;  5DAX A;  3EMR A;  3OBZ A;  5DAP A;  4MHU A;  2Y33 A;  2RDR A;  5C5T A;  3NNF A;  2RDS A;  5LBF A;  3MGU A;  5EP9 A;  2JIJ A;  5L9B A;  2HBU A;  5A3U A;  3OUI A;  4NHK A;  5DAV A;  3GJA A;  3KT7 A;  4IW3 A;  2V4A A;  2RDQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...