1XSQA

Crystal structure of ureidoglycolate hydrolase from e.coli. northeast structural genomics consortium target et81.
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
160
structure length
154
Chain Sequence
MKLQVLPLSQEAFSAYGDVIETQQRDFFHIVERYHDLALVEILEQDCTLISINRAQPANLPLTIHELERHPLGTQAFIPMKGEVFVVVVALGDDKPDLSTLRAFITNGEQGVNYHRNVWHHPLFAWQRVTDFLTIDRGDNCDVESIPEQELCFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ureidoglycolate hydrolase
publication title Crystal structure of ureidoglycolate hydrolase from E.coli. Northeast Structural Genomics Consortium target ET81.
rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 27
structure length 154
sequence length 160
chains with identical sequence B
ec nomenclature ec 4.3.2.3: Ureidoglycolate lyase.
pdb deposition date 2004-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04115 Ureidogly_lyase Ureidoglycolate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.480 Mainly Beta Sandwich Jelly Rolls Ureidoglycolate hydrolase 1xsqA00
1XSQA 1YQCA 2BDRA 1XSRA
chains in the Genus database with same CATH superfamily
4JTNA 2Q8CA 1RUH2 2PHTA 1RMU2 3LFIA 1LEDA 5F5QA 2C9AA 4AGGA 3CIHA 3VGIA 2RDNA 3PJYA 4QHBA 4PDWB 4JKMA 2B7YA 1X7NA 1KDMA 1D4VB 1K45A 3OTFA 2WWSA 1UZWA 4N9IA 4AFDA 2WKKA 2YY1A 4BHPA 1MQTB 3VB9A 2BDRA 2J1RA 3RDIA 3AP6A 2UWAA 1J83A 4ZY9A 3A22A 1H2NA 2QZ2A 1W3XA 4AFCA 4AI1A 2DU1A 4CCNA 3B94A 2YBSA 3NKTA 1EP0A 4AYUA 1I1EA 2A70A 5J37A 1TNFA 4XMIA 4XF3A 5C8CC 5L9RA 5JPMB 1RHI1 2VCAA 4JHZA 4XJ8A 5FMBA 1JU3A 2H0BA 2JDMA 3D0SA 3M1HA 4IV1C 2XQRA 5D1IA 3ME2A 4PJYA 2FMYA 1CVNA 1MS4A 1MEC2 3KCXA 2CNAA 2RS52 5FZ3A 4BQWA 3PHMA 4L97A 1PM4A 4JZRA 2YUEA 3E5QA 1BVP1 2ZBJA 3OGRA 5LWBA 1OLME 2DURA 2FMDA 4GZ9A 3H3ZA 4HFSA 5I91A 1WCUA 2A6YA 3RI8A 1UWWA 3B5LB 5I8TA 1OA2A 1VLNA 1PVC3 4AF9A 1LNSA 5JXIA 3RMYA 3T0BA 3HEIA 1JOBA 4G9SB 3AYCA 1G9BA 1QEXA 3WP4A 4YG3A 4QX5A 1ULDA 4DUXA 2Y60A 5J48A 3OBRA 1FPN3 2BFUL 1O4TA 2ZMKA 4PI2A 4CDUA 1EV13 1IHMA 3MFAA 3FHQA 1AYN2 4PBPA 1QDOA 2XBO2 4HK9A 5DQ0A 1ZZ8A 2A73B 1Q56A 2WWJA 4NVPA 1C8M1 3WNMA 5FLIA 2PAMA 2JICA 4FSJA 2DDUA 2CYFA 2A6VA 3NJZA 4CDXC 2P3YA 4Q8LA 4CE8A 1FXZA 3KV6A 4A2UA 2R0HA 4JGZC 5EP9A 4RQPC 3IPVB 3SH4A 2VZTA 3OPWA 4IEVA 1AL22 4M3CB 1MS3A 2X09A 1DLLA 3DPRC 4AOCA 1JOPA 1GMMA 3AJYA 2PN5A 1DZTA 4NHLA 3BPZA 4Q1PA 1ZBE2 4RFT0 4YRDA 1CPNA 4JQRA 3SNMA 4B1LA 4Y4YA 5BNPA 4OHYA 3MEPA 1CAXB 1VBC3 2O1QA 3BTZA 2X10A 3T2OA 3WP3A 2YYOA 4B1MA 4COWA 3VBUA 2JDKA 4UT5A 1VBD3 2JX9A 2CU5A 4IEWA 1W8OA 4Q4V1 5IT6A 3GBFA 1ND3C 3O0WA 4L99A 3CNAA 1KJLA 1QXJA 1LECA 4GQ7A 4LORA 1RUJ2 1NG0A 1GLHA 5SV5A 1CR7A 2FCUA 3Q8CA 1JMUB 4QPWA 5K4LA 3SCHA 3ZN5A 3H8OA 1XXNA 4GJYA 2W47A 3ES1A 5FOJB 1GFF2 5E6HA 1IS4A 4PDWC 3IM0A 3NV2A 3ZYFA 3ZXAC 4QB6A 4CCMA 4J1WA 3H0OA 3CO2A 1CN1A 5FLHA 3RYRA 3EMRA 4A42A 5F9TA 3POGA 4P5HA 1MQTC 1N3OA 1UYYA 3V0AA 3ZPOA 5FUNA 1RUF2 2XJPA 3JQXA 3K4DA 4UW5A 5ISLA 4R8HA 4HOOA 5CIRA 1QJEA 1HKDA 1ULOA 1GR3A 1UY4A 3PNAA 4W6XA 1S1AA 2RDSA 2VZQA 3P3PA 3N7JA 3GCXA 3HMYA 1MZ5A 3M3OA 4I02A 4TLGA 5FYBA 4CEWA 1YQ6A 2D6OX 4C91A 2HWF3 4UW6A 2ZGOA 3RMXA 1TME1 5FPUA 4NIGA 4N7IA 2YZ4A 4HONA 3ON7A 3GHNA 3EBRA 5K7PA 1W2NA 4BXFA 2RMU2 2WS93 1H8TB 3IWZA 2E9QA 2VZ1A 4TLFA 4GMP1 5F1RA 4Y22A 1RUC1 1QKQA 1WMEA 5ERLA 1OPOA 4MGSA 1S0JA 5JWPA 2WFF3 2DTWA 4P9IA 4UF0B 3ACIA 5I0DA 5JCTA 4LJHA 4IGOA 1JYIA 3AL6A 4FPCA 5LW9A 4NOTA 2GAUA 1H9WA 1H0BA 1VAMA 5CKQA 2F4LA 4YW3A 3JQWA 1COV1 4LUMA 2FDHA 2YFUA 4BDVB 5AC91 4Z07A 2HWC1 1ACCA 2A6WA 3N4MA 2IVIB 3PUHA 5BYNA 5FK7A 5FY5A 3GZAA 2YDEA 1IS6A 1BBT3 4I2OA 1MPXA 3H1YA 4HSLA 4BYYA 4CDWA 1ZZ6A 2XONA 1OI6A 3ZFGB 2TUNA 1M06G 1LOBA 5JLVA 5KWRA 3BI3A 2R071 3KVBA 1EYBA 1SLIA 3ACHA 4DNYA 3T09A 2E51A 3LOIA 5EQUA 1W8FA 4O65A 3RQ0A 4Y20B 1U5IA 3MDPA 1K5MB 1OOPB 4P00B 5FXWA 1G9FA 4X8NA 2AUYA 1LODA 4YW4A 2RS13 3WG4A 5FQ0B 1W2OA 3FUQA 4XFBA 4LT5A 3JB4C 1RGSA 4IEZA 2CL2A 2GN3A 1RVF2 2VM9A 4CU8A 1NCRA 1IG0A 3CMGA 1EAH1 2VUAA 3IAQA 2UU8A 4Z82A 1PGL1 3BOPA 4CCCA 1QJU3 4IQPA 3ETQA 3O7OA 4MVTA 4WM8B 1B35B 1QJY1 1G9DA 5JZGB 4W6WA 1VBE1 2QNKA 5FZOB 5BNOB 1U0AA 5D8AA 3IDCB 3SQOA 4AL9A 4AQTA 5FYZA 3ZFEA 1ZNPA 4H55A 4B4RA 1DHKB 2PHUA 1GKBA 2ZGMA 1JZ3A 1RHI2 3RZMA 4C1XA 1GWKA 4P9WA 5LBEA 2WR9A 4PHZA 3AZYA 4RS5B 5T52A 5IK7A 3IDEA 4FT8A 3KS7A 4M00A 4RSUA 1W6PB 4FXGB 2JKBA 2JG8B 3I59B 4KQ7A 3D8CA 4EWDA 2YBPA 4GH4B 3C7GA 3M3EA 4E4ZA 3HT1A 1BXHA 5ACA1 1ZZBA 1VBB3 2W1QA 2LW8A 5DUVA 3B01A 5DDJ3 2NN8A 3J4UH 5BPXA 1DF0A 4WM7B 3VBFC 3ZMNA 2GC2A 1PO23 2OT7A 4D69A 1AXYA 2VMDA 2WQ8A 5L7OB 2VOVA 1IPSA 3KHBA 3ZMOA 2VOTA 1HQWA 4PQQA 1TVGA 3BOWA 4NIIA 3AMNA 3OGGA 3POSA 4DEQA 4XETA 2W5FA 4BH9A 4QM8A 1H8TC 2G9GA 3UJOA 3S0MA 3OBZA 1ULEA 1HRI2 1WA4A 2K9ZA 2RM21 4BPZA 3SCGA 3NAPB 1F8VA 3FMGA 1FATA 1H1IA 1C8M2 2HEYF 3KV9A 3MLLA 3N7KA 2WT2A 2DCYA 4NPRA 4AHZA 4ASKA 4PIZA 5KBFA 1OF4A 1H8VA 1O4YA 3I3DA 1ASJ1 3JD73 5FO7B 1IZ3A 3OGVA 2IFWA 5C3PA 4TTGA 3N9LA 4YZ5A 1LJ7A 2AGSA 4FOVA 1RUI3 1UZVA 5APAA 5KC6A 1NCQA 2B39A 5A70A 2GDFA 1JH5A 2GNMA 5GLZA 1ZRIA 3ZFGC 4JQTA 3G7DA 3LWCA 1R1A3 1DBNA 4CXYA 4JC1A 2TEPA 1W99A 4UFIA 3WDUA 2OQ6A 3CJIA 3ZKUA 4EWAA 4XIOA 1UL9A 3MBWA 1K5MC 2W94A 4LBQD 2VVEA 1WCSA 4LXLA 4Q4V2 5DUXA 5E16A 5C4WA 2CSGA 2P17A 2WZR3 1GWMA 2RR13 3PMEA 1BK0A 4LUKA 4P9JA 5FO8B 2VR4A 1AR63 4DY5A 3MIGA 3Q8EA 4LR4A 1X50A 4KNCA 5BXXA 3TN91 3MI8A 3AYEA 3FLPA 3PLQA 2WLPA 2GZWA 1S2EA 3WVJA 1TG7A 4B4PA 4LA2A 1AUYA 1DGWX 1ENRA 1GZ9A 1SMVA 1CONA 5F3CA 5FJHA 3I7DA 2HKXA 4ISQA 1B35C 3GCWA 2Y6LA 5JZGC 2P3KA 2PHDA 1BHGA 3ZOIA 5A3MA 3EB7A 4Q27A 1UKRA 4MADA 3ITQA 5FTTC 4NHYA 3RPQA 5BNOC 1TMF1 4GD4A 1URXA 3J8F1 3AKRA 2IFRA 3T08A 1CESA 3O14A 1C1FA 4W4ZA 2FDFA 3V56A 5FO9B 5FY9A 1JI6A 1JOJA 2ZX2A 3IN9A 2HJIA 3MIBA 1ZVFA 1OURA 4CCEA 1FMD1 1HDKA 1TME2 4RS5C 3WNNA 5FR3A 3MLJA 4JHTA 3POYA 4XFCA 5KHKA 3HBKA 5FZ6A 4UWDA 1QJX3 2PQSA 2UYBA 2XB6C 5FZKA 2XJRA 5FZ1A 2R6QA 5FDBA 2DVBA 1W28A 2D6LX 2XJUA 4GH4C 5L73A 1AX2A 4IEXA 4CXWA 5C5TA 1RUC2 5GLVA 3USSA 3E5UA 3VZOA 1RUE3 2Z42A 1V00A 1NY72 2XL9A 4P02B 2GP3A 4Y24A 5AFBA 4Q4W3 1UY1A 4QQPA 4HPKA 3X29B 2RDQA 5FZ9A 3LEKA 3GDBA 4AQ6A 3AFGA 4LBNA 5T50A 2R063 4E2QA 3LFMA 4XMAA 3TAYA 4JRLA 4HL0A 4GKYA 5CYYA 5AC92 3HOBA 1QQP3 1SFPA 4XABA 2QQVA 5CFDB 2VBDA 3A7QA 3IIAA 2VU9A 1UW8A 2PQQA 4H7MA 4AEDA 4DB5A 5IVBA 4Q4Y3 3DL3A 1W6MB 4RN5A 1QH7A 1R64A 4QPGB 4BA6A 2QQIA 4XF9A 1CZTA 3R0RA 4I09A 3NAPC 4XQDA 1JZ2A 4EN9B 2Z69A 3OUIA 1D4M1 4XJ9A 4AFBA 3I3MA 4QKNA 4XYXA 5FMOS 5HPOA 5DG1A 2ZCWA 3KQRA 2FHRA 4Y1YA 4XJWA 1YLLA 3K2OA 4R4ZA 2NP0A 5F5IA 4MLOA 1SEFA 4PIYA 3WCRA 1ZYBA 2WQZC 4QX2A 4XCBA 4AI9A 4E8DA 2ARCA 3BIEA 2BBVA 3WD5A 1TEIA 2CWMA 1LCLA 1SHWB 4LKDA 5KXCA 2VECA 3KM5A 1UY3A 3UKVA 1ENXA 1QNWA 4LNVA 2EVXA 1ZRFA 1GOHA 4FAHA 3KD4A 4QPYA 5FPBA 4TN7A 5GLWA 2XJQA 4H2AA 1UIKA 1BKZA 2W92A 1SDWA 4FQZA 4P5YA 4L92A 4GA9A 4QD2A 1AF9A 1W8UA 4L0PA 4AVTA 4NO4A 3NJVA 4XUOA 1SBEA 1V9U3 1KQRA 5J09A 1LHVA 3OD4A 3WDWA 5FAXA 5JSOA 3CLPA 4XAAA 4W50A 1OXCA 1W6QA 5CVRA 4ZS2A 3UV9A 1L7QA 4GALA 2P6HA 2ZEWA 3GJBA 3ABZA 5I0TA 4DRRA 2O8OA 4LITA 5GM0A 2WN3A 4HKOA 5FYHA 1SPPA 1J1LA 4ZXKA 1W9FA 2VQ0A 2Q8OA 5ACA2 1Z78A 3THCA 2KR2A 5LZ6A 3ELNA 1Y9GA 3I2OA 3AP7A 3OUHA 4FPKA 1ODMA 4EZ4A 4UAPA 5LRRA 4J1XA 1ULGA 3LSDA 1VRH2 2WYSA 4G3YC 4K21A 4M3CF 2OIIA 4MZUA 5DN2A 4CEYB 4H7LA 1ZM1A 2G9FA 1Y43B 1XYPA 5CBLA 5JSPA 2Q4SA 2VVFA 4BLIA 3CDZB 2XVGA 1CAWB 2E26A 1Y4WA 4URAA 1O59A 2C1FA 4XFAA 5L36A 4UXAA 5A3OA 1DZQA 1O8SA 1VBA1 4LA3A 5LEKA 3AMQA 4ATFA 4AE2A 3LDRA 1W6NA 3VBRA 4J6GA 4GIQA 2C4XA 3WP5A 3NQHA 1UXZA 3POIA 3PUQA 4OHVA 2QDNA 3AB0A 2Y34A 5IWFA 4EWEA 3WNKA 1CJPA 5IFPA 1YFXA 4W65A 4CU6A 2CV6A 4CVUA 5CFDC 5M0TA 3BPSA 1UMZA 1AYM3 3HNBM 3USUA 1C5IA 3W20A 2E31A 5KXDA 3LOBA 4IGPA 1J3PA 3LA7A 4JX0A 2GALA 4QPGC 3WNXA 1AYN1 3OJBA 1UD1A 2GSYA 4YVSA 3BN6A 3S5QA 1NZCA 3THTA 2W68A 5AFEA 4ZPIA 2PHWA 4I0WB 2QBXA 4XFHA 1UN1A 3VD5A 3W58A 1UOFA 3N35A 2W95A 3GF6A 4QX1A 3ZN6B 1MZ6A 2D3PA 1BK1A 1G9AA 4BQ2A 1WCDJ 4CP0A 1YI9A 5A6YA 3O1SA 4UFMA 2JDYA 1LENA 4KI5M 1E57A 4PT6A 1WWYA 3NNLA 2RJ2A 2Y33A 4ONUA 1D0GA 4LHSA 5FUPA 3DKQA 4HBNA 1W6OB 2BNNA 1LOFC 2D40A 2BOJA 1EUTA 5DAPA 4UYBA 1PGW2 3C3VA 1GQGA 3N9PA 1W2TA 3WR0A 1FV3A 2HWD1 5BNNA 4D6QA 4ITCA 1DQ2A 2ARBA 2X5IC 2HWF1 3VKMA 2JE8A 3VHPA 1ZRDA 2D44A 5FXXA 1REEA 1TMF2 4LEJA 4YGCA 5FZ7A 3POEA 5LA9A 2JIJA 5T54A 1GP6A 2V4VA 3EQEA 2HBUA 3HR9A 3J8F2 2EF6A 2C26A 2C9KA 3ZKYA 1BEV3 1YQ8A 2Y38A 1Q8VA 3O1PA 4GAZA 1J59A 1SFNA 1A8MA 2VCCA 5A1AA 5FYIA 1HN1A 2J1AA 5GZCA 5B4XA 3PTYA 1IOAA 1GZWA 4XJZA 1F35A 1UU6A 5J96B 3ZLIA 2P37A 4XUNA 4IV1B 1XNAA 5EWSA 2A7AA 2OZJA 3ZFFB 3VZKA 4YVWB 3G6JB 4CP1A 3ES4A 1H6YA 2DCTA 1JYVA 4JVAA 1BZWA 3QBQA 2AACA 1VIWB 3BU7A 4D3WA 4LO7A 1NQDA 2PHXA 1ZZ9A 4CEYC 3FUOA 4CU7A 4WVMB 4FP2A 1S0IA 2CGOA 2JE9A 2XLGA 1HV1A 3OCPA 5FY4A 1QXPA 3T4HB 3VD3A 1FV2A 4S2FA 1OUSA 5DAWA 2ZAHA 2ZA9A 3ILNA 2BQPA 3CU7A 1UPIA 2VCMA 3PU8A 5E89A 2VY0A 2RS11 3ST7A 2JDZA 1H2KA 4ARYA 3PUSA 5FPLA 4OMCA 1DQ5A 1ND2A 2VUDA 4LMFA 2OVUA 1D4M2 2MEV2 1V6MA 2DCZA 2JE7A 3GZUC 4IV3B 1W8TA 1FX5A 5T5PA 3SH5A 3SITA 4ZONA 3MF9A 1LGCA 4K6BA 2HWE3 2LRPA 1EPZA 3AJZA 4NMIA 1YUDA 3WQ7A 3C8XA 1H4GA 3FN9A 2P2KA 4CDXB 1D0HA 1VAKA 3S30A 3VBOB 5FOBB 5IATA 1QJU1 4MG2A 3GXUA 1O3RA 2PHLA 4JGZB 4J25A 3KCYA 1XNDA 4FAGA 1IKQA 1PIV1 1EPWA 2D6MA 4MO3M 3VD4A 4FQ4A 3R05A 4A3XA 4QT6A 3VKLA 3FHIB 4Q26A 5CFCB 2J42A 4XZUG 1QY4A 1RJ8A 1W04A 3WF0A 1EY2A 5EV7A 1W0OA 5FFOC 2CAUA 3QH7A 2EAAA 1UY2A 2A6ZA 3MV11 5EFUA 1US3A 5J36A 2BJSA 2OZ6A 5CZKA 4PF1A 4IE5A 4CDQC 4CP9B 5L19A 1IS5A 1IQDC 2ZX0A 3FL7A 2DVGA 2WZPP 2AC1A 3VDDB 1HN0A 5JIAA 4LO8A 4XUTA 2DTYA 3N7LA 1O5LA 1RVF1 2QQNA 4NIAA 2YV8A 3EXUA 3DPRA 5CNAA 3AKPA 4MYEA 1OLMA 4KBBA 1FOD1 4YZ4A 5AVAA 4JCKA 1KS5A 1S2KA 4JRAA 4Q0UA 3VBSC 3C2UA 2YU2A 4X6QB 2D6KA 3P5BA 4UBGA 4OQ9A 1DYKA 2VZRA 2R1BA 2V5YA 3WW3A 3VL9A 3ZSLA 4XBLA 1PX4A 2R49A 1FPN2 3PU3A 4LLOA 2VQAA 3GYDA 3LE0A 4GB33 2VGDA 4UBHA 4QAWA 1ND3A 1EV12 2L9LA 1O91A 3AYAA 3OGJA 4RHV1 5DXDA 1LU2A 1AL0G 3UYJA 2VD7A 3LD8A 4P08A 2ADEA 1N1TA 2G4IA 2DUPA 4QU1A 5FKCA 3IBMA 5FZ0A 4AWDA 2B9VA 4ZZ8A 2BU9A 5HXVA 4B4QA 3U37A 4PLOA 4HSJA 3HBZA 4Q8KA 4F8AA 1Z7S3 1OA3A 4BQXA 4PDWA 2VNVA 3ZFFC 4YVWC 4L11A 1OT5A 3OGSA 3WY6A 1VBA2 3I2FA 4IL7A 1GNHA 3V64A 4CTEA 1W3VA 2XLFA 5C3QA 4XQ4A 4K8FA 1YJLA 3B02A 4MXWA 4BCUA 4N43C 2ZEXA 2GNBA 4XDQA 2HH9A 5FLJA 5C71A 3MLKA 1V6KA 2XJSA 1R1A1 4HXCA 4CUGA 1VBC2 5HBAA 3QACA 2RJLA 3APBA 1NA1B 2EAKA 5IFTA 1A8DA 4CDUB 2JG9A 5A3PA 4CXXA 4OHXA 1YQ2A 3NNMA 4BZ4A 1DG6A 1NLSA 3LDKA 1LHOA 4AEJA 4OUSA 1UY0A 4XQWA 1HRI1 1DGLA 2ATFA 2XL7A 3GM8A 4INDA 4E9KA 1R083 2FDIA 1SDDB 1RUH3 4IV3C 4NROA 3TYJA 4CCJA 1LTEA 1XJAA 2PLV1 5T5OA 1Q8PA 1CX4A 1WBFA 1W8ZA 2LUWA 3VBOC 3SLIA 5A80A 1OH4A 5L9BA 1A34A 1XBFA 4RR3B 4AI3A 2G19A 2LROA 1PK6A 1POV0 3DECA 2E7AA 1LRHA 4UOJA 5LASA 5HCAA 1W39A 1VP6A 1YI7A 4H14A 5JI9A 4KG8A 2UURA 4P9GA 2E7TA 1NE4A 5FXZA 3H8RA 1XPWA 1F4HA 1MS5A 3N3HA 5CFCC 3SC7X 5K8SA 1UYPA 1S0FA 2WIIB 2CGNA 4LBQA 1XNKA 1DGRA 1NQJA 1Q8OA 3D0JA 2PMWB 4D0QA 1HXS3 4C0BA 5CU1A 1XNCA 4NHXA 1Y9MA 5FZLA 1SBFA 2HWD2 4JDMA 1HQNA 4LLFA 4YGBA 5FPVA 4OHZA 1AHSA 2HWF2 4MGTA 4XFGA 5J1XA 2DCJA 1PHMA 1MEC3 2C6SA 2HWB1 2RS53 4O61A 3GALA 3EYPA 1AVBA 2OPKA 1AJKA 2IZWA 1W06A 2PXJA 3O1UA 2AEZA 2WS92 3VDDC 2ZACA 3IPVA 4M3CA 1QWRA 4E8CA 1RUE1 3AP5A 4OI2A 2PFWA 5FKBA 3WHUA 3WXPA 4EROA 1GP5A 5IHRA 2ILMA 2WFF2 4Q4W1 3H1WA 2V5DA 4WBBA 5DUWA 2Y8KA 2GC3A 1CAXA 1E5IA 2VXRA 2W39A 5GLTA 4OMDA 4OUMA 3TWIA 4YFZA 5E88A 4RYDA 3I2DA 1W90A 2H6BA 1PMJX 3K46A 3R4UA 5LY2A 1N1SA 1V6IA 1BBT2 4IEUA 4Y3OA 3NVCA 2XBO3 4UW4A 2XH6A 3VBFB 1YIPA 5I8YA 1XOYA 4MGYE 5LBFA 4Q4X1 3R4SA 1YQCA 1OQEA 1LB2A 2XG3A 2FZ2A 3Q8BA 2BWAA 3O1MA 1T6GC 2AYHA 2YHJA 2W08A 2ZGPA 4FOQA 2BP6A 2XUEA 4A7YA 1V6LA 2RS12 1H2MA 4XURA 5JXGA 2WNUA 3J7NA 1AL23 4Y22B 5E1RA 4M3CE 4BXSV 2VUJA 1N1YA 3HWJA 4XFIA 5HV4A 3VHOA 4FTSA 1MACA 2YBKA 3FZ3A 4QX8A 4YM2A 3WDXA 3ZYPA 1ZBE3 1Q3EA 2EXJA 1NY71 1ULFA 1Q5OA 4DINB 2ARXA 3MIEA 1MS8A 4MGKE 1V70A 3POBA 2UY9A 3PIGA 1GSLA 1A3KA 4CYDA 1QJU2 1ZX5A 1JZ5A 3BCWA 4XTPA 1BMV2 1NA1C 4FFGA 1WMXA 2VW0A 4CDUC 3CEWA 1PIV2 3AKSA 5DAQA 4SBVA 5FZGA 4CDWB 5K0UB 3ZYRA 3KV4A 3C7HA 1KFUL 1RUJ3 1NLRA 3GHMA 1OMIA 1XC6A 1D2SA 2H6CA 3FX3A 5FZ4A 3WW2A 1H8TA 2Q1MA 5FYYA 5FIXA 4L9BA 1DQ1A 1JYCA 2VE1A 1DYOA 1AR93 1NX9A 2VZVA 1LGNA 3J9SA 3M3IA 4UF0A 4XDOA 2P3IA 4K8RB 4QX3A 4RR3C 2Y6HA 5LRSA 4ES8A 3NSTA 1ZBA3 1OPMA 5CAZA 2NYYA 2XOMA 1VBB2 3VDDA 3UGHA 1GQHA 2BBAA 2DUOA 2PHRA 4ZU4A 5DDJ2 5BNPC 3JZVA 4NAOA 4IXLA 1O8PA 2Y64A 5A3UA 5JUVA 4YGEA 5FZCA 1DZRA 1FOD2 4UFHA 4GULA 4KG0A 3RYPA 1FYUA 5A3NA 3ZFGA 3DF0A 5LA0A 1HJGA 4LKFA 1JODA 4K1ZA 1OD3A 2WRAA 5JOXA 4QB2A 1CAVA 3A0KA 4YW1A 5D8AB 4FTBA 4Y20A 4URTA 1OH3A 3VL8A 4HVQA 5EIYB 1OOPA 5G05L 2RMU3 3DCQA 3OBAA 4PQ9A 3RSJA 3C7FA 4RHV2 1HRV1 1UXXX 4K3UA 5FQ0A 2F4PA 4L8QA 1JU4A 3MV01 5A6XA 4LO4B 3ZXEA 4HKLA 4E27A 2QQKA 4NWVA 5JR7B 1JS9A 2D3SA 2NMNA 4E4DX 3H42B 1GV9A 2ZABA 3WG3A 1QU0A 1E5RA 1H6XA 5GZDA 1P8JA 1V6JA 3U4SA 1U12A 2Z4FA 3POJA 2GMEA 5DPNA 5F3GA 2B8MA 1AR71 2QQOA 4FO9A 4WM8A 2MHFA 3ZDVA 1AYM1 4XF0A 2P6CA 2R043 3KGZA 3ZM8A 4OHWA 2Y26A 1GNYA 1RXFA 4IE4A 1VRH1 4KWJA 4XBNA 2ZOEB 3MW2A 4XHXA 3UESA 5IVVA 4GJZA 5B4NA 1R1A2 2Y6GA 1UYXA 3BIWE 4ZZ5A 2K0GA 2EICA 4NHMA 2ZGUA 4M4RA 2WO1A 4WZCA 4BQYA 3JXSA 1X82A 4H3WA 3H3LA 4AEMA 1AXKA 1RUD3 1PM7A 2WO7A 5IVYA 4A6OA 5C9AB 2WZR2 1UX6A 1W6PA 4I0AA 3OSDA 2JG8A 4Y26A 4R4XA 2D6PA 2VZOA 5C8WA 1POV3 3ZXKA 1C3HA 2EIEA 5CKMA 2XVKA 2XJTA 2FBEA 2D5HA 2EALA 4DOUA 2PLV2 2SBAA 3QD6A 4YYOA 1HJFA 2A1XA 2C5DA 2V09A 4WM7A 1CAUB 1NAEA 3I2JA 1PGSA 4LOTA 2BUKA 1KEXA 2ENRA 5FYVA 1ST8A 2OUHA 3ILRA 5L7OA 1LAJA 3GGLA 1VMFA 4BM8A 2OS2A 3ZSEA 2RHPA 5A3WA 1YJKA 3FLRA 1QF3A 1PX3A 4CDWC 5K0UC 2NM1A 1CJDA 4XIKA 4XUPA 2QE3A 3Q8FA 1BLZA 3VUOA 3IAPA 4AQ2A 4OI0A 1RHI3 2KA3A 3CJIB 3NAPA 4X8PA 1JZ4A 1A78A 2ORZA 4BQ1A 2DYCA 4Z1VA 5HCHA 2VNOA 2FCTA 4D94A 3ZR5A 3FWEA 2WABA 2HWB2 4HMZA 3B9CA 4YZ1A 1NE6A 2XXZA 4ZXEA 1QJX2 2QQUA 4DO0A 4HT1T 1S2BA 2BYVE 3BGAA 3IKWA 3MUZ1 1HB3A 1UOGA 2QJVA 3IB3A 3N36A 3OBTA 1VRBA 2AR6A 4QKFA 2XWJB 3IIIA 4K7JA 3ZVXA 2JD4A 1G9CA 2Z2SB 1BYHA 4PLNA 1RUE2 3DUIA 3AMMA 3SEPA 5A32A 2JB8A 3NW4A 4JKLA 5LBBA 2ZGNA 4Q4W2 3JU9A 1DQ6A 2O14A 1J3RA 3N9OA 1PGW1 2R062 1O5UA 4YWAA 3TEWA 5C6CA 5C5UA 4YZ3A 5D8AC 3HD8B 4COYA 2VMFA 3ZFEC 4BQ5A 2JXAA 3LKJA 4Q4Y2 1YRZA 3PUAA 4Z2AA 2PA7A 1QMJA 5AVPA 5IAXA 2ZKNA 4FI9A 5IVJA 4L2NA 4Q4X2 3OOXA 1RITA 4QGMA 2JJ6A 1N47A 3K75B 3ZXLA 5CADA 2RJKA 1Q43A 3VBHB 1DQ4A 5JXJA 3RI9A 3FFQA 4CUAA 2AEYA 3POFA 4O9GA 1ZZCA 5EYYA 1RUG1 2ZTNA 1GU3A 2ID4A 2VJXA 2P34A 3HIFA 5A6QA 3OB8A 5I8SA 1XQNA 2IWGB 4LIVA 1G6NA 2JB4A 3MUY1 4P9LA 4UW3A 1WLDA 5F8PA 3I49A 1GOFA 1ALYA 2CWSA 3WDYA 1LULA 2WA3A 3VDBA 2OYZA 3VHNA 5FZEA 4LHNA 1F15A 1O4ZA 1IPJA 4MSVA 1S55A 2OX0A 2JEMA 2WL1A 1GZCA 2WNVB 4AI2A 3ATGA 4COVA 4E2GA 1GNZA 1YQ5A 1AJOA 4CCLA 4CPBD 1DDLA 4JGYB 1CPMA 3FFZA 3S7IA 5C9AC 3MICA 2LALA 4Z8BA 1UNBA 5JSRA 4AFAA 2PAEA 5H9SA 1XYOA 1ZA4A 2GC1A 1GBGA 2VNRA 3U0ZA 1V9U2 1CWPA 5KXBA 3ACFA 5EHDA 2MEV1 2XQXA 2O8QA 1JHJA 2V4AA 4XC9A 4MX3A 2J1VA 3SMHA 5T5LA 3OUJA 1E5SA 1RC6A 1C1LA 3D82A 3LF7A 1M4WA 1PNGA 4KH9A 1PO13 1ODNA 1LGBA 1YC61 1SFYA 3RZHA 5LEJA 4A3ZA 5CFDA 3V65A 3ZYIB 1JZ6A 5IAVA 1UIJA 4S2GA 2OQ7A 2W87A 4IDZA 5H9PA 3RRDA 2JWPA 4N53B 2VPVA 3NV1A 4QPGA 3NJXA 3HNMA 3DXTA 2Q8DA 3FE5A 3ZDSA 4AFMA 2YC4A 3CJIC 1GICA 4QQ2A 1R1ZA 2P3JA 4AGRA 3E6CC 5C4WC 2WZEA 2P1BA 3RZKA 5LK7B 2X5IB 3WG1A 4I0BA 2VTXJ 5KXEA 1O6UA 1HRV2 1QXRA 4GWNA 2ZGQA 3WF1A 4AVCA 1RUC3 1LEMA 4IUGA 5ABJA 1MVEA 3AC0A 3RZJA 3PVBB 3NV3A 3BTXA 4A7KA 2WSUA 5DZEA 1LOFA 1COV3 1PVC1 3NWKA 4QX7A 1MR5A 5AC93 5JDBA 1AR72 2EIBA 2HWC3 4QM9A 4JKKA 4QPIB 4DY3A 1UKGA 2YG0A 3RWKX 1AYM2 2AH2A 1DU3D 2WQ4A 1FPN1 2C24A 2CHHA 4LKEA 5J98B 4ASLA 4E4HA 3BU0A 1A6CA 2VNGA 3DYOA 1UF2C 5FYTA 2JECA 2ZHKA 1EV11 2XWBB 3FHAA 1UOJA 2R073 3VHRA 4X6RB 4NIHA 3ZXJA 3O1TA 3VBHC 1RTVA 1U5YA 2YC0A 4Q2FA 4C0HA 4CUCA 1B09A 1XSQA 4F83A 2B42B 2VMIA 4OQ8A 4HVOA 3LQCA 4WVZA 2A3WA 1AXZA 2GU9A 2E6VA 3W9AA 5I0RA 3CF6E 1F9KA 1KD7A 1LR5A 4AVVA 3A23A 5JOYA 4FPJA 2GC0A 2X05A 3B9IA 1OLRA 4FPHA 4FFFA 4R52A 4QDSA 2VMGA 3KGLA 2XHNA 4QGNA 2VZSA 1ULPA 2PHFA 4W6YA 4EN6B 5KHJA 1EAH3 4YM1A 3WSOA 4CRQA 2V73A 5FP3A 4JAAA 1OLQA 1L7LA 3KV5A 1HV0A 2ZHLA 2DF7A 2DBIA 2WFPA 3BTYA 4CEYA 4LO6B 1QJY3 2ES3A 2NZ9A 1CD3G 1HXS1 1T2XA 1VBC1 2WNVC 3E1F1 1VBE3 3N7MA 4LE4A 2FDGA 2D43A 1PMIA 5A7WB 1VBD1 4JGYC 4DS0A 1CAWA 2VULA 3DEMA 3F2ZA 2DVAA 1LOCA 4R9DA 3ZYGA 4BISA 3LCPA 1E5HA 3J7LA 2GN7A 4RGAA 2VVDA 3LZZA 4JV4A 1UX7A 1I5ZA 4OFGA 1V6OA 2XJVA 4V2WA 3UJQA 4TYSA 1MS1A 4MOAA 5F6KA 3ZR6A 4AVAA 5LA1A 4Y5Z0 1KITA 4LBKA 4NRPA 2DCKA 3E6BA 4CDQB 1KDKA 2KXLA 5ACA3 3OG2A 4Y1ZA 2LS6A 4IEOA 4Z92B 1SQ4A 3ASIA 1SLAA 4CCOA 2PELA 3PVNA 1XU1A 4LE3A 1W05A 5FP9A 2FZ1A 4EZHA 1OC1A 4N53C 4QXBA 4A41A 3V0BB 2Q5TA 1BVVA 5GZEA 2OA2A 3IDAA 1W8NA 1XE7A 4IESA 1XRUA 1YFUA 5BNNB 5IVFA 3RYKA 3VBSB 4EN7B 1WLTA 4TSVA 3SKJE 2TBVA 1IKPA 3OPTA 4HANA 2Z79A 2BV4A 3H3UA 4I3GA 3BVCA 1WCQA 4JTOA 3JB8A 5CB7A 4BQ3A 3QLQA 3I54A 2J7MA 2QQWA 3ZN6A 1AR83 2HEVF 2RM23 1I5PA 2GMPA 2YGMA 4O7XA 5A33A 4AZZA 3BUCA 3PVOA 2WS91 3NO8A 2QUOA 2Y6FA 1GWLA 3KF5A 4N7UA 3GBWA 2VBPA 3NKGA 4C8DA 1GZWB 4COZA 2D3RA 1TZOA 3OYWB 4C90A 3OY8B 3INAA 4YFWA 4CP2A 1XNBA 1X33A 3ZYBA 1ASJ3 1RUG2 2RDRA 4PIXA 2WFF1 4NN0A 1W6OA 3QH6A 4HG6B 1W0PA 5JOZA 2JIGA 4ZKTB 4K1YA 2WO3A 1RYYA 4WVVA 1SBDA 1Y7BA 2WBKA 3MW4A 4QPIC 3T2QA 3W5MA 3WNPA 3VZNA 5G04L 5FPAA 4LHKA 3RWNA 3K48A 3TNPB 3S57A 2WN2A 5JVVA 2BOIA 1BBT1 3QOPA 4IE0A 4N43B 5EPAA 3ZIWA 2BEOA 4UFLA 2VG9A 1VMHA 2I2SA 5FYMA 2VZPA 1W0NA 4AXOA 4JDNA 4NPMA 5HCFA 4QXKA 2JDHA 3UKNA 2XPJA 4NR1A 5DAXA 1LOAA 4OI4A 5C8CA 4NIDA 3HN1A 3OEBA 5FXVA 2D5FA 3ZYJB 4EN0A 2JDAA 3A0NA 3DKWA 3LEGA 4IV1A 5FY1A 4EV0A 1ND2B 3VD9A 1OVPA 1J58A 3TN93 2VQTA 2ZGLA 1ZZ7A 1SCSA 4QB1A 3VBRC 3WINE 2YGLA 1UOBA 4KL1A 4NPLA 4NAMA 1WW5A 3PVEA 4M01A 3K77A 3NL1A 3ACLA 5FV3A 4AI8A 1HIXA 4N8MA 4WVMA 1IG3A 2QKDA 3VV1A 2ADDA 2VOKA 5JIUA 1YNAA 1CIYA 2WNOA 4BQ4A 5I0SA 1BMV1 2VBBA 4XDPA 5GLUA 4UFKA 3GBGA 2H0VA 2VUCA 3HQXA 4FP3A 5F5AA 3J8F3 3VKFC 2VTFA 1SLLA 2CDPA 4GB32 4YVSC 4AG4A 3B93A 4QQLA 1UU5A 4QGLA 2Y6KA 3WHTA 1F31A 3RFRA 3I2KA 1YIFA 3JBG3 2AENA 1YWKA 1FMD3 2Y0IA 4RL7A 4XUQA 5JPNB 5CA6A 4TZDA 2GH2A 4FPGA 4IV3A 4IW3A 4NE9A 1WMFA 3OPZA 5BY5A 3KLSA 1MS0A 1SG3A 4KWUA 2VXJA 4CDXA 4AHYA 1UPSA 3UKTA 2R30A 4LQRA 1RXGA 3NRUA 5ANQA 4DXSA 4JGZA 2RS33 4RQPA 3M3QA 4DUWA 3ORJA 1VBB1 4ZU7A 3BODA 3RS6A 1YFWA 3H7YA 3NNFA 4XJUA 5DDJ1 2ORXA 3MIFA 3LA3A 5FUIA 3FJSA 1Q8QA 3FC0A 4HK8A 1JN2P 1O3QA 1PO21 2JDPA 5BNNC 1CX1A 1PVC2 3KMHA 4AAXA 1JUHA 3HJRA 4A7ZA 2VMEA 5J7MA 2W52A 5A3LA 4D7TA 2QQJA 2OPWA 2XMLA 5F5CA 4NRMA 3SEEA 2FDJA 2WAOA 3VKOA 1LKNA 3T30A 3EO6A 3O5SA 2W1WA 2WT1A 1LHWA 3RG0A 4AW7A 1ENQA 2RE9A 3I3BA 1D4M3 4U2AA 4XFFA 1KGYA 4QU2A 2R7EB 2RVAA 5IUQA 1O3SA 1POV1 4FFHA 1KJRA 1MZEA 3KHCA 3O1VA 3WLUA 1H4HA 1GYKA 3U4XA 2GNDA 4W8JA 5FREA 5FBJA 5JOWA 3O1OA 1KFXL 1H30A 4QKDA 3HVDA 1Q8SA 4BK5A 4ISRA 3JD71 1SZBA 4XJAA 2EIDA 3D5OA 4HZFA 4JDOA 3WV6A 3LPGA 4M0NA 4EQVA 2BVBA 2HLEA 1PZ9A 5FMCA 1F5JA 3NMBA 4MXWB 3L2YA 2W0XA 3ECQA 1MQTA 3TEYA 2YMZA 1J1TA 1RUI1 3AVSA 5E8AA 3ZX7A 1JYWA 3GNEA 1GP4A 1JXNA 1U5XA 1UQXA 4IEPA 4XHBA 1QIQA 1YO8A 4MGIE 5F6LB 1XE0A 1LOGA 3AX4A 3IMNA 4R9BA 1HXS2 1R093 3IT8A 2ZAAA 5FYUA 4DFSA 3Q9OA 2JG9B 3I3QA 1CQ9A 1VBD2 1YHFA 2BGPA 3M8LA 3WG2A 3R4DB 1ZRCA 3GZTB 5H9RA 3WW4A 1JZ8A 5F32A 1ND2C 5F3IA 3MIDA 2WZR1 3CQOA 4KU7A 2RR11 5FZHA 2VMHA 3DXUA 1AX1A 1AR61 1OKQA 5FZIA 2J22A 2ZS6B 4A4AA 5FP4A 2Q8EA 5CISA 1NYWA 1RMU3 3N9NA 4YLZA 2YC2A 1DCSA 1XNTA 4QXCA 4Y1XA 1VE0A 4MUVA 4A45A 5JMCA 2OW4A 3P3NA 2UYAA 2VL4A 1PK6B 4QMAA 3WF3A 1OHFA 4KGGA 2G9ZA 4ATEA 3WQ1A 5FZBA 5IVCA 4XAEA 1NA1A 3AMHA 3WUDA 4AGVA 1JBCA 4LBQB 5BNPB 3CKHA 3MZHA 4PLMA 2GMMA 1OA4A 2E53A 3THDA 1H2LA 4GWJA 3VBUB 1WCKA 3D6EA 4YZ2A 3URFA 5FYCA 2A75A 3PURA 2BFUS 3WQ0A 3IDBB 2EXKA 4NUBA 1VBA3 3E97A 1QJX1 2K46A 1H9PA 4DXZA 1JYXA 2C0ZA 4RR3A 3MPBA 4GWIA 5A7QA 1FNYA 3Q8AA 2B9UA 2XDVA 5FRAA 1KRIA 4FPFA 2DBNA 1VALA 3KT7A 4P14A 4LIUA 3LIHA 1W2AX 1DQ0A 5C3RA 1EUUA 2YPJA 2VZUA 4DEVA 3L9JT 5A1FA 4GXLA 5DZFA 1AZDA 2W9XA 3VZMA 2R061 1HB2A 3ZO0B 1VMJA 3V0AB 4B7EA 1SCRA 4AVSA 5CKNA 2WWUA 1QQP1 2SLIA 4C1WA 4Z2WA 4FBFA 1AYN3 3WDTA 1VB2A 1S0DA 3BALA 4Q4Y1 2F6BA 3T0AA 3SXWA 3I2GA 1WW4A 1OQDA 1W8WA 4CSWA 1C57A 1T6BX 3AM2A 3H8UA 4CEWB 4P9XA 5HCBA 5DG2A 2TNFA 4NHKA 4WZFA 2BZDA 5KHHA 3AMPA 1AR92 2NQYA 1W2UA 2RV9A 4RA0A 2WNUB 2QQPA 5IVEA 5HXMA 1YYNA 3NNGA 4LULA 1PO11 4OZOA 5GZGA 1QJFA 1ZBA2 1MS9A 1VPHA 3U14A 3UETA 3O0VA 3CZJA 5DABA 2QVSB 1OQ1A 3S7EA 3M7AA 1OVSA 4XACA 3ZSMA 1WW6A 2D98A 4F3JA 1ZREA 1OUXA 4SLIA 4CPBA 3VBFA 1GANA 2ZX1A 1GOGA 2HWD3 4RGGA 4XE9A 5EYXA 1HLCA 5CG8A 2JG9C 1RUNA 2BNOA 1JUIA 1HB1A 2FQPA 4AEKA 3WQBA 2Q0AA 3BTAA 4IERA 4LPLA 5JXHA 2ET1A 1NT0A 4P9YA 2D7FA 1C4RA 1JHNA 3HPNA 2ZMNA 1V9U1 1OKOA 4LHLA 4FTEA 1WZXA 2B5HA 3UT0A 5JI7A 1W9WA 1N3QA 1JYTA 1PK6C 3VD7A 3ZXGA 1WD3A 5FZMA 1S0CA 2V72A 1LHNA 3ILFA 4DPNA 1RUF3 1NCRB 3PL0A 3VDCA 2BWCA 2J1SA 5K0UA 2R042 1I3HA 2W2IA 1FNZA 2YB7A 3WT3A 5HI0A 1UCXA 1PO22 1NKGA 1NXD1 1H1MA 4IEQA 3AYDA 3VBUC 1V6NA 3HQUA 4GWMA 3A4UA 1XE8A 1CAVB 4QX0A 3B00A 1WLCA 1D2QA 4AHXA 4YSFA 5FK8A 3ZYHA 2RG4A 3K4AA 4K40A 1BCXA 2DV9A 4Y33A 4DXTA 4DZGA 1N1VA 3LEIA 2BGOA 1K5MA 3OF1A 3KQ4B 1RUD2 3ZFEB 5DAVA 5IK5A 1LESA 1PVXA 4QXHA 4YG0A 3LEMA 4Q29A 3S5AA 2BGCA 3UGFA 3I3EA 2ZX3A 4ZHNA 1D7PM 5TSWA 2HBTA 3DV8A 3ETPA 2VCBA 3JD72 2ZEZA 3MO4A 4GMP0 2LM3A 4IGQA 3TBDA 2WAAA 4LO5B 3UNPA 5LY1A 3KT4A 2K2SA 4ES9A 1PIV3 1B35A 4MHRA 2PTMA 5JZGA 5BV6A 5FZ8A 4HKWA 4OZXA 1RUI2 4QDRA 5FZOA 5BNOA 2VQUA 4KU8A 2A3YA 5FPZA 1CGPA 2CTVA 2UWBA 4CEWC 2EA7A 1XYNA 2HYKA 2I45A 1UU4A 2VOXA 3RZZA 4BLJA 2XUMA 1OSGA 4FVVA 3HT2A 5A7PA 1X9PA 4ZS3A 3D3AA 1QDCA 2CDOA 5D21A 4BWOA 2DVDA 2XKOA 2WNUC 4RS5A 5JR2A 2B46X 2WC2A 3M3CA 2VAUA 2RR12 3JCIA 5LATA 3PUIA 1J3QA 4LKSA 3LAGA 3I59A 1RVF3 1AR62 2ERFA 2HEWF 4GH4A 1G7YA 2QZ3A 1Y3TA 3M70A 2YFZA 5F2WA 1FOD3 1PNFA 4DMIA 2NLRA 3FLTA 2A71A 3UK9A 3CJXA 2B45X 5A3TA 1DGRN 2IXJA 3ZN4A 4BB3A 2DFCA 1NCQB 4D7YA 5JAXA 3ACGA 3LSEA 4RHV3 3ZSKA 1WMDA 4XF1A 4HN1A 2WSVA 4PF5A 4XF4A 4YGDA 1AR81 3HNYM 4Y5TA 5C9AA 1RB8G 3RZLA 5LK5A 5EJ1B 5DZGA 2JKXA 3J26N 2A6XA 3MIHA 1BEV1 2W46A 3K3OA 4KBZA 1REDA 2CY6A 3WNOA 1VJ2A 2VOWA 5KHIA 2EXHA 1LU1A 1WA6X 1SLBA 3WOGA 5C4WB 1XB9A 5EJ3A 2ZMLA 4DRVA 3KT1A 1PZ8A 1REFA 3TNQA 5F3EA 1QGLA 3DGTA 1CAUA 3WDVA 1POQA 2CGPA 2VW2A 3VKNA 3AP4A 2Y0OA 2EXIA 3I2IA 3WCSA 2UY8A 3POWA 1NCRC 5A32B 3WUCA 4XVHA 2WJSA 2ZGTA 5A7SA 5T5JA 5FY0A 4DIQA 4ET7A 5C33A 4YW2A 5IK8A 1RJ7A 1UZ0A 3MFCA 4LK6A 3WP6A 4B3NA 2OKXA 3U75A 4NRQA 3E6DA 1XU2A 1OOPC 4FCAA 1WUVA 4QQHA 4NJ4A 3AL5A 1QQP2 2BRTA 3LGRA 1UAIA 2ZHNA 3LIGA 4V1PA 1U5ZA 4B29A 3R6SA 4DQAA 1QOSA 4OUEA 5C3SA 1N3PA 1HRI3 3K3NA 3TB0A 1GZTA 3WNLA 4XEZA 2IXLA 1HB4A 2Y6JA 3F95A 3LA2A 1C8M3 1UZZA 5IK4A 2PLV3 3UGGA 3RVHA 4D6SA 1OBNA 3VN4A 1HQLA 3W59A 3WEZA 3OEAA 3RZGA 1CIWA 4EYUA 3EJKA 4I01A 2F17A 1W9TA 2HWE1 2BTVC 5GKAC 4WM8C 3NJYA 3ZPYA 1OF3A 3TRSB 2NMOA 1H1AA 1MVQA 2IXIA 1PO12 5IW0A 3H1MA 5FJKA 4IE6A 2ET7A 5A7OA 3RJRA 1F4AA 4EN8B 5H9QA 1BQPA 3K51A 5EJZB 4HPKB 2E33A 1WLWA 4BJ0A 4TXWA 3RGBA 4NWWA 4QWNA 4AHWA 1YCIA 2AREA 2FCVA 1NOVA 1F2NA 3JBG1 4FFIA 3B7MA 4HN0A 4OVEA 5FMOL 3VBHA 1X36A 4Q4V3 1QJZA 4AEDB 3MF6A 5T3NA 2HWB3 3O12A 2XKPA 2QQLA 5GALA 2ZHMA 3KVAA 4UFJA 1FAYA 2BW8A 3LPFA 3EHKA 2JG8C 3KZ4C 1YEWA 4XPVA 1IPKA 1V0AA 5LB6A 2E32A 4FPYA 4LTAA 3I8TA 2RS31 4CZSA 2WLQA 4WM7C 3H50A 1AX0A 2R16A 4COUA 2O0OA 3VDAA 5FPXA 5KHGA 3SH3A 5L7OC 1CZSA 1ULCA 4LBOA 4D8MA 4QKBA 5HV0A 2WUHA 4OYUA 4AK3A 1COV2 1W9SA 3HQRA 1NZIA 1VAVA 3I97A 4LBMA 4ASMB 3AXEA 4FPLA 1J84A 2HWC2 4OI1A 2WNVA 1NCQC 4IETA 4WV8A 4XZPA 4FPOB 1C5HA 1S4CA 4JGYA 2X29A 1WD4A 2D97A 4GB31 4GKXA 5FZAA 4KMQA 1WW7A 3U10A 3J7HA 4FOWA 1W6MA 1SLCA 2BVVA 2DU0A 4Q4X3 4Y4RA 5B2GB 1XSRA 4PBOA 4AQSA 2R072 1L7RA 4YM3A 1TME3 3AFKA 3AZWA 4MH0E 2P4EA 3T4VA 4PCRA 4YW7A 1W03A 1K42A 2IXCA 4Q1RA 2Q1FA 4Q0SA 2YXSA 3AZVA 5J3UA 3AZZA 4XXAA 4YG6A 5CEHA 4GMP3 1Z7S1 2D93A 3AVRA 3WW1A 1HW5A 2MNGA 3ZIXA 5FWJA 4BU2A 5ABJB 3N9QA 1S0EA 4K9SA 1CZVA 1W6QB 5ANNA 3C7EA 1WKYA 4Q0QA 1YFYA 1EAH2 3UL2A 5CG9A 2JENA 4N53A 1PGL2 2XVLA 1SPPB 4LBJA 3ROUA 5L9VA 3T2TA 5KR7A 4MV2A 5F7UA 1QJY2 5SV8A 2XR4A 3A21A 1QNYA 1JW6A 1NXMA 1BJQA 1R091 1IS3A 1ENSA 1TNRA 2P5BA 1VBE2 1DLCA 3HN3A 3KF3A 4QHOA 3PDQA 5FWEA 4E2SA 3AKQA 1UO9A 2CAVA 2JDUA 2X5IA 3QCWA 4HETA 4OLLA 3DN7A 3TEZA 1UZYA 4O9EA 3VLBB 4AAPA 5LBCA 4QQOA 2A3XA 4DUVA 5C3OA 1K3IA 1SACA 4PI0A 5DMYA 4WVWA 1JTZX 1R081 1O3TA 2YU1A 3L2HA 1RUH1 1OD5A 4ZU5A 4ARXA 1RMU1 3AK0A 1G8WA 1OFSA 4HLTA 3N9MA 2BERA 4E4SA 2ZGSA 2WNEA 3KWVA 4XCAA 2OXBA 5EZWA 1W9YA 1DIWA 3CZUA 1W6NB 2QDRA 4QPIA 2R32A 1US2A 5F39A 5LA2A 1I9RA 3VBRB 4B7KA 4CCKA 4ORFA 4IE7A 1DYPA 2BNMA 3MHZA 5FP8A 1S0GA 1QHDA 2FD8A 3KB5A 3ZXFA 5BUVA 2DWRA 2G1MA 2BPA2 3HAGA 4META 4R9AA 1IQAA 4BIFA 3ALQA 3CL1A 3VZJA 1DP0A 2PAKA 4I3PA 3USUB 4AEDC 4DXRA 3ZXDA 2ZX4A 1NLQA 1K12A 2OUJA 2A5ZA 3SISA 1HRV3 4Y5SA 3MPPG 2FDKA 3RJ2X 2WA4A 1MEC1 3MW3A 2RS51 1AR82 4YVSB 3SKVA 4F7ZA 2RM22 4N9HA 4YPJA 4YM0A 1RL3A 1NUKA 2ZXQA 5FY8A 1BEV2 2R0FA 4YW5A 1KXGA 4Y1VA 3AZXA 5T55A 2DUQA 3RNSA 3MYXA 4FXKB 4QHZA 3LB9A 3JUUA 5FP7A 2E63A 2R1DA 1ASJ2 3KCCA 2IUWA 3I4IA 3KSCA 4Y1UA 2ZZJA 4YNIA 3S6PA 3BKZA 1X8EA 5C7GA 1AR73 2ZJCA 2GP5A 5FYSA 1SLTA 3WF2A 1DGWA 4Q0VA 2VZ3A 2ZPXA 4M0HA 4Q5OA 1O7FA 1Z0HA 4M4PA 4XBQA 5A7WA 5A6ZA 4XOGA 4MXVA 4Q0PA 2WT0A 1VRH3 2GH8A 2UWCA 3U11A 3MGUA 1YXWA 1VR3A 1PZ7A 2XBO1 3H8XA 1ZRRA 5LCWL 4XXPA 2JDNA 4EJRA 1LHUA 4D7SA 3T3YA 3ZSJA 1JYNA 4IEYA 1KS4A 3P1IA 1G86A 3E5XA 1TQ5A 4OCTA 3PTRB 4V2VA 2IXHA 2I07B 2MPFA 5EXOA 5A33B 3AXDA 1HX6A 5A7NA 4A6SA 1S0BA 2KD7A 4CDQA 3TN92 1AL21 3TOJA 4CA9A 4YARA 5ABJC 1GUIA 4A44A 1I6XA 4BOWA 3W5NA 2W91A 2N7GA 5GJ6A 1ZBE1 4XTMA 5BNQA 1OFNA 1X9TA 3V0BA 2HWE2 2ZKLA 1JZ7A 3U78A 2NPIA 2XLAA 4RFRB 4QDQA 3PMSA 2E7QA 4LOSA 3VBSA 2QQMA 3GZEA 5A1LA 3FBYA 3B3QE 3D4KA 4R9CA 4TWTA 5IJRA 3WZ1A 4AR2A 4EE2A 2VMCA 4LK7A 1STMA 2I74A 3I2HA 3T1LA 1RUJ1 4D6RA 1TE1B 5KC5A 4BK4A 1DFQA 3JBG2 4MGZE 1FT9A 5C8CB 2VW1A 5FZFA 1FMD2 4YW6A 3T1MA 4U36A 3OYWA 1APNA 3OY8A 1AR91 1RIRA 2X53S 4G4FA 5FBZA 4BIOA 4KWKA 2PYTA 3DYMA 1LOEA 3WX5A 4LBLA 4CUBA 2IXKA 2XGXA 5JMOA 3ZFFA 4RD7A 4YVWA 4BMBA 1L3JA 3LDBA 3U07A 4BMEA 3NV4A 2J1EA 4MGQA 1ZBA1 2RS32 2LTNA 1RUF1 3CBNA 5I0UA 2XHKA 1UMHA 2WO2A 2B4KA 4AVBA 4XW3A 2YROA 2IC1A 1QOOA 1Y9QA 3GJAA 2ZEYA 2W1UA 4HVRA 4N43A 3THPA 1GQPA 3T2PA 4FPEA 4K20A 1FI2A 5FCCA 1F5FA 1QH6A 3O0XA 1C8NA 2QTWB 4N90A 5F37A 3ENRA 1TMF3 2DFBA 1K5JA 1QOTA 1UYZA 2ZGKA 3IZOA 3OD0A 4MHUA 3AKTA 4RGKA 4KWLA 2GNTA 2RMU1 2ZZQA 1ONAA 5F2SA 2Q30A 2IVJA 2VC9A 4FOYA 4I30A 3SHRA 2VTXA 2X8KA 2VH9A 2WYFA 3H9AA 1RUG3 3K4ZA 2W1SA 5D2AA 3J7MA 1WBLA 1UMIA 3T0DA 3VZLA 3BYWA 2ARAA 3C7OA 3CHXA 2J1UA 3P6BA 3IMMA 2DVFA 5FMDA 2Q1ZB 2D6NA 2QCSB 2WZ8A 3BB6A 4UI9L 4BE3A 2VO5A 5I93A 5K9YA 1Z7S2 3VBOA 2ZGRA 4B8EA 4RQPB 2ETEA 5FZDA 2JD9A 4OULA 4S2HA 3DPRB 1VB4A 3SCFA 2KM2A 3AP9A 4AI0A 3B69A 2WINB 2J1TA 3U1XA 2R041 4CU9A 3FBMA 2EIGA 3WF4A 3DYPA 1IGOA 1RINA 4KGQA 3W21A 3TEXA 5CFCA 1RUOA 3M2MA 2Z5WA 5GZFA 3PJQA 1MZFA 2W3JA 1R092 4CCDA 2AZ5A 2YPDA 1PMHX 2QFEA 5IYYA 5DUUA 1ND3B 4S2DA 3PIJA 1RUD1 3H7JA 1W8HA 4CP9A 1ZA7A 5C70A 1X8MA 2HYXA 2MEV3 4XILA 3M4FA 5FY7A 2WDBA 3NNJA 3O1RA 1WGPA 1C28A 1R082
chains in the Genus database with same CATH topology
1XSQA 1YQCA 2BDRA 1XSRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XSQ A;  1YQC A;  2BDR A;  1XSR A; 
#chains in the Genus database with same CATH topology
 4JTN A;  2Q8C A;  1RUH 2;  2PHT A;  1RMU 2;  3LFI A;  1LED A;  5F5Q A;  2C9A A;  4AGG A;  3CIH A;  3VGI A;  2RDN A;  3PJY A;  4QHB A;  4PDW B;  4JKM A;  2B7Y A;  1X7N A;  1KDM A;  1D4V B;  1K45 A;  3OTF A;  2WWS A;  1UZW A;  4N9I A;  4AFD A;  2WKK A;  2YY1 A;  4BHP A;  1MQT B;  3VB9 A;  2BDR A;  2J1R A;  3RDI A;  3AP6 A;  2UWA A;  1J83 A;  4ZY9 A;  3A22 A;  1H2N A;  2QZ2 A;  1W3X A;  4AFC A;  4AI1 A;  2DU1 A;  4CCN A;  3B94 A;  2YBS A;  3NKT A;  1EP0 A;  4AYU A;  1I1E A;  2A70 A;  5J37 A;  1TNF A;  4XMI A;  4XF3 A;  5C8C C;  5L9R A;  5JPM B;  1RHI 1;  2VCA A;  4JHZ A;  4XJ8 A;  5FMB A;  1JU3 A;  2H0B A;  2JDM A;  3D0S A;  3M1H A;  4IV1 C;  2XQR A;  5D1I A;  3ME2 A;  4PJY A;  2FMY A;  1CVN A;  1MS4 A;  1MEC 2;  3KCX A;  2CNA A;  2RS5 2;  5FZ3 A;  4BQW A;  3PHM A;  4L97 A;  1PM4 A;  4JZR A;  2YUE A;  3E5Q A;  1BVP 1;  2ZBJ A;  3OGR A;  5LWB A;  1OLM E;  2DUR A;  2FMD A;  4GZ9 A;  3H3Z A;  4HFS A;  5I91 A;  1WCU A;  2A6Y A;  3RI8 A;  1UWW A;  3B5L B;  5I8T A;  1OA2 A;  1VLN A;  1PVC 3;  4AF9 A;  1LNS A;  5JXI A;  3RMY A;  3T0B A;  3HEI A;  1JOB A;  4G9S B;  3AYC A;  1G9B A;  1QEX A;  3WP4 A;  4YG3 A;  4QX5 A;  1ULD A;  4DUX A;  2Y60 A;  5J48 A;  3OBR A;  1FPN 3;  2BFU L;  1O4T A;  2ZMK A;  4PI2 A;  4CDU A;  1EV1 3;  1IHM A;  3MFA A;  3FHQ A;  1AYN 2;  4PBP A;  1QDO A;  2XBO 2;  4HK9 A;  5DQ0 A;  1ZZ8 A;  2A73 B;  1Q56 A;  2WWJ A;  4NVP A;  1C8M 1;  3WNM A;  5FLI A;  2PAM A;  2JIC A;  4FSJ A;  2DDU A;  2CYF A;  2A6V A;  3NJZ A;  4CDX C;  2P3Y A;  4Q8L A;  4CE8 A;  1FXZ A;  3KV6 A;  4A2U A;  2R0H A;  4JGZ C;  5EP9 A;  4RQP C;  3IPV B;  3SH4 A;  2VZT A;  3OPW A;  4IEV A;  1AL2 2;  4M3C B;  1MS3 A;  2X09 A;  1DLL A;  3DPR C;  4AOC A;  1JOP A;  1GMM A;  3AJY A;  2PN5 A;  1DZT A;  4NHL A;  3BPZ A;  4Q1P A;  1ZBE 2;  4RFT 0;  4YRD A;  1CPN A;  4JQR A;  3SNM A;  4B1L A;  4Y4Y A;  5BNP A;  4OHY A;  3MEP A;  1CAX B;  1VBC 3;  2O1Q A;  3BTZ A;  2X10 A;  3T2O A;  3WP3 A;  2YYO A;  4B1M A;  4COW A;  3VBU A;  2JDK A;  4UT5 A;  1VBD 3;  2JX9 A;  2CU5 A;  4IEW A;  1W8O A;  4Q4V 1;  5IT6 A;  3GBF A;  1ND3 C;  3O0W A;  4L99 A;  3CNA A;  1KJL A;  1QXJ A;  1LEC A;  4GQ7 A;  4LOR A;  1RUJ 2;  1NG0 A;  1GLH A;  5SV5 A;  1CR7 A;  2FCU A;  3Q8C A;  1JMU B;  4QPW A;  5K4L A;  3SCH A;  3ZN5 A;  3H8O A;  1XXN A;  4GJY A;  2W47 A;  3ES1 A;  5FOJ B;  1GFF 2;  5E6H A;  1IS4 A;  4PDW C;  3IM0 A;  3NV2 A;  3ZYF A;  3ZXA C;  4QB6 A;  4CCM A;  4J1W A;  3H0O A;  3CO2 A;  1CN1 A;  5FLH A;  3RYR A;  3EMR A;  4A42 A;  5F9T A;  3POG A;  4P5H A;  1MQT C;  1N3O A;  1UYY A;  3V0A A;  3ZPO A;  5FUN A;  1RUF 2;  2XJP A;  3JQX A;  3K4D A;  4UW5 A;  5ISL A;  4R8H A;  4HOO A;  5CIR A;  1QJE A;  1HKD A;  1ULO A;  1GR3 A;  1UY4 A;  3PNA A;  4W6X A;  1S1A A;  2RDS A;  2VZQ A;  3P3P A;  3N7J A;  3GCX A;  3HMY A;  1MZ5 A;  3M3O A;  4I02 A;  4TLG A;  5FYB A;  4CEW A;  1YQ6 A;  2D6O X;  4C91 A;  2HWF 3;  4UW6 A;  2ZGO A;  3RMX A;  1TME 1;  5FPU A;  4NIG A;  4N7I A;  2YZ4 A;  4HON A;  3ON7 A;  3GHN A;  3EBR A;  5K7P A;  1W2N A;  4BXF A;  2RMU 2;  2WS9 3;  1H8T B;  3IWZ A;  2E9Q A;  2VZ1 A;  4TLF A;  4GMP 1;  5F1R A;  4Y22 A;  1RUC 1;  1QKQ A;  1WME A;  5ERL A;  1OPO A;  4MGS A;  1S0J A;  5JWP A;  2WFF 3;  2DTW A;  4P9I A;  4UF0 B;  3ACI A;  5I0D A;  5JCT A;  4LJH A;  4IGO A;  1JYI A;  3AL6 A;  4FPC A;  5LW9 A;  4NOT A;  2GAU A;  1H9W A;  1H0B A;  1VAM A;  5CKQ A;  2F4L A;  4YW3 A;  3JQW A;  1COV 1;  4LUM A;  2FDH A;  2YFU A;  4BDV B;  5AC9 1;  4Z07 A;  2HWC 1;  1ACC A;  2A6W A;  3N4M A;  2IVI B;  3PUH A;  5BYN A;  5FK7 A;  5FY5 A;  3GZA A;  2YDE A;  1IS6 A;  1BBT 3;  4I2O A;  1MPX A;  3H1Y A;  4HSL A;  4BYY A;  4CDW A;  1ZZ6 A;  2XON A;  1OI6 A;  3ZFG B;  2TUN A;  1M06 G;  1LOB A;  5JLV A;  5KWR A;  3BI3 A;  2R07 1;  3KVB A;  1EYB A;  1SLI A;  3ACH A;  4DNY A;  3T09 A;  2E51 A;  3LOI A;  5EQU A;  1W8F A;  4O65 A;  3RQ0 A;  4Y20 B;  1U5I A;  3MDP A;  1K5M B;  1OOP B;  4P00 B;  5FXW A;  1G9F A;  4X8N A;  2AUY A;  1LOD A;  4YW4 A;  2RS1 3;  3WG4 A;  5FQ0 B;  1W2O A;  3FUQ A;  4XFB A;  4LT5 A;  3JB4 C;  1RGS A;  4IEZ A;  2CL2 A;  2GN3 A;  1RVF 2;  2VM9 A;  4CU8 A;  1NCR A;  1IG0 A;  3CMG A;  1EAH 1;  2VUA A;  3IAQ A;  2UU8 A;  4Z82 A;  1PGL 1;  3BOP A;  4CCC A;  1QJU 3;  4IQP A;  3ETQ A;  3O7O A;  4MVT A;  4WM8 B;  1B35 B;  1QJY 1;  1G9D A;  5JZG B;  4W6W A;  1VBE 1;  2QNK A;  5FZO B;  5BNO B;  1U0A A;  5D8A A;  3IDC B;  3SQO A;  4AL9 A;  4AQT A;  5FYZ A;  3ZFE A;  1ZNP A;  4H55 A;  4B4R A;  1DHK B;  2PHU A;  1GKB A;  2ZGM A;  1JZ3 A;  1RHI 2;  3RZM A;  4C1X A;  1GWK A;  4P9W A;  5LBE A;  2WR9 A;  4PHZ A;  3AZY A;  4RS5 B;  5T52 A;  5IK7 A;  3IDE A;  4FT8 A;  3KS7 A;  4M00 A;  4RSU A;  1W6P B;  4FXG B;  2JKB A;  2JG8 B;  3I59 B;  4KQ7 A;  3D8C A;  4EWD A;  2YBP A;  4GH4 B;  3C7G A;  3M3E A;  4E4Z A;  3HT1 A;  1BXH A;  5ACA 1;  1ZZB A;  1VBB 3;  2W1Q A;  2LW8 A;  5DUV A;  3B01 A;  5DDJ 3;  2NN8 A;  3J4U H;  5BPX A;  1DF0 A;  4WM7 B;  3VBF C;  3ZMN A;  2GC2 A;  1PO2 3;  2OT7 A;  4D69 A;  1AXY A;  2VMD A;  2WQ8 A;  5L7O B;  2VOV A;  1IPS A;  3KHB A;  3ZMO A;  2VOT A;  1HQW A;  4PQQ A;  1TVG A;  3BOW A;  4NII A;  3AMN A;  3OGG A;  3POS A;  4DEQ A;  4XET A;  2W5F A;  4BH9 A;  4QM8 A;  1H8T C;  2G9G A;  3UJO A;  3S0M A;  3OBZ A;  1ULE A;  1HRI 2;  1WA4 A;  2K9Z A;  2RM2 1;  4BPZ A;  3SCG A;  3NAP B;  1F8V A;  3FMG A;  1FAT A;  1H1I A;  1C8M 2;  2HEY F;  3KV9 A;  3MLL A;  3N7K A;  2WT2 A;  2DCY A;  4NPR A;  4AHZ A;  4ASK A;  4PIZ A;  5KBF A;  1OF4 A;  1H8V A;  1O4Y A;  3I3D A;  1ASJ 1;  3JD7 3;  5FO7 B;  1IZ3 A;  3OGV A;  2IFW A;  5C3P A;  4TTG A;  3N9L A;  4YZ5 A;  1LJ7 A;  2AGS A;  4FOV A;  1RUI 3;  1UZV A;  5APA A;  5KC6 A;  1NCQ A;  2B39 A;  5A70 A;  2GDF A;  1JH5 A;  2GNM A;  5GLZ A;  1ZRI A;  3ZFG C;  4JQT A;  3G7D A;  3LWC A;  1R1A 3;  1DBN A;  4CXY A;  4JC1 A;  2TEP A;  1W99 A;  4UFI A;  3WDU A;  2OQ6 A;  3CJI A;  3ZKU A;  4EWA A;  4XIO A;  1UL9 A;  3MBW A;  1K5M C;  2W94 A;  4LBQ D;  2VVE A;  1WCS A;  4LXL A;  4Q4V 2;  5DUX A;  5E16 A;  5C4W A;  2CSG A;  2P17 A;  2WZR 3;  1GWM A;  2RR1 3;  3PME A;  1BK0 A;  4LUK A;  4P9J A;  5FO8 B;  2VR4 A;  1AR6 3;  4DY5 A;  3MIG A;  3Q8E A;  4LR4 A;  1X50 A;  4KNC A;  5BXX A;  3TN9 1;  3MI8 A;  3AYE A;  3FLP A;  3PLQ A;  2WLP A;  2GZW A;  1S2E A;  3WVJ A;  1TG7 A;  4B4P A;  4LA2 A;  1AUY A;  1DGW X;  1ENR A;  1GZ9 A;  1SMV A;  1CON A;  5F3C A;  5FJH A;  3I7D A;  2HKX A;  4ISQ A;  1B35 C;  3GCW A;  2Y6L A;  5JZG C;  2P3K A;  2PHD A;  1BHG A;  3ZOI A;  5A3M A;  3EB7 A;  4Q27 A;  1UKR A;  4MAD A;  3ITQ A;  5FTT C;  4NHY A;  3RPQ A;  5BNO C;  1TMF 1;  4GD4 A;  1URX A;  3J8F 1;  3AKR A;  2IFR A;  3T08 A;  1CES A;  3O14 A;  1C1F A;  4W4Z A;  2FDF A;  3V56 A;  5FO9 B;  5FY9 A;  1JI6 A;  1JOJ A;  2ZX2 A;  3IN9 A;  2HJI A;  3MIB A;  1ZVF A;  1OUR A;  4CCE A;  1FMD 1;  1HDK A;  1TME 2;  4RS5 C;  3WNN A;  5FR3 A;  3MLJ A;  4JHT A;  3POY A;  4XFC A;  5KHK A;  3HBK A;  5FZ6 A;  4UWD A;  1QJX 3;  2PQS A;  2UYB A;  2XB6 C;  5FZK A;  2XJR A;  5FZ1 A;  2R6Q A;  5FDB A;  2DVB A;  1W28 A;  2D6L X;  2XJU A;  4GH4 C;  5L73 A;  1AX2 A;  4IEX A;  4CXW A;  5C5T A;  1RUC 2;  5GLV A;  3USS A;  3E5U A;  3VZO A;  1RUE 3;  2Z42 A;  1V00 A;  1NY7 2;  2XL9 A;  4P02 B;  2GP3 A;  4Y24 A;  5AFB A;  4Q4W 3;  1UY1 A;  4QQP A;  4HPK A;  3X29 B;  2RDQ A;  5FZ9 A;  3LEK A;  3GDB A;  4AQ6 A;  3AFG A;  4LBN A;  5T50 A;  2R06 3;  4E2Q A;  3LFM A;  4XMA A;  3TAY A;  4JRL A;  4HL0 A;  4GKY A;  5CYY A;  5AC9 2;  3HOB A;  1QQP 3;  1SFP A;  4XAB A;  2QQV A;  5CFD B;  2VBD A;  3A7Q A;  3IIA A;  2VU9 A;  1UW8 A;  2PQQ A;  4H7M A;  4AED A;  4DB5 A;  5IVB A;  4Q4Y 3;  3DL3 A;  1W6M B;  4RN5 A;  1QH7 A;  1R64 A;  4QPG B;  4BA6 A;  2QQI A;  4XF9 A;  1CZT A;  3R0R A;  4I09 A;  3NAP C;  4XQD A;  1JZ2 A;  4EN9 B;  2Z69 A;  3OUI A;  1D4M 1;  4XJ9 A;  4AFB A;  3I3M A;  4QKN A;  4XYX A;  5FMO S;  5HPO A;  5DG1 A;  2ZCW A;  3KQR A;  2FHR A;  4Y1Y A;  4XJW A;  1YLL A;  3K2O A;  4R4Z A;  2NP0 A;  5F5I A;  4MLO A;  1SEF A;  4PIY A;  3WCR A;  1ZYB A;  2WQZ C;  4QX2 A;  4XCB A;  4AI9 A;  4E8D A;  2ARC A;  3BIE A;  2BBV A;  3WD5 A;  1TEI A;  2CWM A;  1LCL A;  1SHW B;  4LKD A;  5KXC A;  2VEC A;  3KM5 A;  1UY3 A;  3UKV A;  1ENX A;  1QNW A;  4LNV A;  2EVX A;  1ZRF A;  1GOH A;  4FAH A;  3KD4 A;  4QPY A;  5FPB A;  4TN7 A;  5GLW A;  2XJQ A;  4H2A A;  1UIK A;  1BKZ A;  2W92 A;  1SDW A;  4FQZ A;  4P5Y A;  4L92 A;  4GA9 A;  4QD2 A;  1AF9 A;  1W8U A;  4L0P A;  4AVT A;  4NO4 A;  3NJV A;  4XUO A;  1SBE A;  1V9U 3;  1KQR A;  5J09 A;  1LHV A;  3OD4 A;  3WDW A;  5FAX A;  5JSO A;  3CLP A;  4XAA A;  4W50 A;  1OXC A;  1W6Q A;  5CVR A;  4ZS2 A;  3UV9 A;  1L7Q A;  4GAL A;  2P6H A;  2ZEW A;  3GJB A;  3ABZ A;  5I0T A;  4DRR A;  2O8O A;  4LIT A;  5GM0 A;  2WN3 A;  4HKO A;  5FYH A;  1SPP A;  1J1L A;  4ZXK A;  1W9F A;  2VQ0 A;  2Q8O A;  5ACA 2;  1Z78 A;  3THC A;  2KR2 A;  5LZ6 A;  3ELN A;  1Y9G A;  3I2O A;  3AP7 A;  3OUH A;  4FPK A;  1ODM A;  4EZ4 A;  4UAP A;  5LRR A;  4J1X A;  1ULG A;  3LSD A;  1VRH 2;  2WYS A;  4G3Y C;  4K21 A;  4M3C F;  2OII A;  4MZU A;  5DN2 A;  4CEY B;  4H7L A;  1ZM1 A;  2G9F A;  1Y43 B;  1XYP A;  5CBL A;  5JSP A;  2Q4S A;  2VVF A;  4BLI A;  3CDZ B;  2XVG A;  1CAW B;  2E26 A;  1Y4W A;  4URA A;  1O59 A;  2C1F A;  4XFA A;  5L36 A;  4UXA A;  5A3O A;  1DZQ A;  1O8S A;  1VBA 1;  4LA3 A;  5LEK A;  3AMQ A;  4ATF A;  4AE2 A;  3LDR A;  1W6N A;  3VBR A;  4J6G A;  4GIQ A;  2C4X A;  3WP5 A;  3NQH A;  1UXZ A;  3POI A;  3PUQ A;  4OHV A;  2QDN A;  3AB0 A;  2Y34 A;  5IWF A;  4EWE A;  3WNK A;  1CJP A;  5IFP A;  1YFX A;  4W65 A;  4CU6 A;  2CV6 A;  4CVU A;  5CFD C;  5M0T A;  3BPS A;  1UMZ A;  1AYM 3;  3HNB M;  3USU A;  1C5I A;  3W20 A;  2E31 A;  5KXD A;  3LOB A;  4IGP A;  1J3P A;  3LA7 A;  4JX0 A;  2GAL A;  4QPG C;  3WNX A;  1AYN 1;  3OJB A;  1UD1 A;  2GSY A;  4YVS A;  3BN6 A;  3S5Q A;  1NZC A;  3THT A;  2W68 A;  5AFE A;  4ZPI A;  2PHW A;  4I0W B;  2QBX A;  4XFH A;  1UN1 A;  3VD5 A;  3W58 A;  1UOF A;  3N35 A;  2W95 A;  3GF6 A;  4QX1 A;  3ZN6 B;  1MZ6 A;  2D3P A;  1BK1 A;  1G9A A;  4BQ2 A;  1WCD J;  4CP0 A;  1YI9 A;  5A6Y A;  3O1S A;  4UFM A;  2JDY A;  1LEN A;  4KI5 M;  1E57 A;  4PT6 A;  1WWY A;  3NNL A;  2RJ2 A;  2Y33 A;  4ONU A;  1D0G A;  4LHS A;  5FUP A;  3DKQ A;  4HBN A;  1W6O B;  2BNN A;  1LOF C;  2D40 A;  2BOJ A;  1EUT A;  5DAP A;  4UYB A;  1PGW 2;  3C3V A;  1GQG A;  3N9P A;  1W2T A;  3WR0 A;  1FV3 A;  2HWD 1;  5BNN A;  4D6Q A;  4ITC A;  1DQ2 A;  2ARB A;  2X5I C;  2HWF 1;  3VKM A;  2JE8 A;  3VHP A;  1ZRD A;  2D44 A;  5FXX A;  1REE A;  1TMF 2;  4LEJ A;  4YGC A;  5FZ7 A;  3POE A;  5LA9 A;  2JIJ A;  5T54 A;  1GP6 A;  2V4V A;  3EQE A;  2HBU A;  3HR9 A;  3J8F 2;  2EF6 A;  2C26 A;  2C9K A;  3ZKY A;  1BEV 3;  1YQ8 A;  2Y38 A;  1Q8V A;  3O1P A;  4GAZ A;  1J59 A;  1SFN A;  1A8M A;  2VCC A;  5A1A A;  5FYI A;  1HN1 A;  2J1A A;  5GZC A;  5B4X A;  3PTY A;  1IOA A;  1GZW A;  4XJZ A;  1F35 A;  1UU6 A;  5J96 B;  3ZLI A;  2P37 A;  4XUN A;  4IV1 B;  1XNA A;  5EWS A;  2A7A A;  2OZJ A;  3ZFF B;  3VZK A;  4YVW B;  3G6J B;  4CP1 A;  3ES4 A;  1H6Y A;  2DCT A;  1JYV A;  4JVA A;  1BZW A;  3QBQ A;  2AAC A;  1VIW B;  3BU7 A;  4D3W A;  4LO7 A;  1NQD A;  2PHX A;  1ZZ9 A;  4CEY C;  3FUO A;  4CU7 A;  4WVM B;  4FP2 A;  1S0I A;  2CGO A;  2JE9 A;  2XLG A;  1HV1 A;  3OCP A;  5FY4 A;  1QXP A;  3T4H B;  3VD3 A;  1FV2 A;  4S2F A;  1OUS A;  5DAW A;  2ZAH A;  2ZA9 A;  3ILN A;  2BQP A;  3CU7 A;  1UPI A;  2VCM A;  3PU8 A;  5E89 A;  2VY0 A;  2RS1 1;  3ST7 A;  2JDZ A;  1H2K A;  4ARY A;  3PUS A;  5FPL A;  4OMC A;  1DQ5 A;  1ND2 A;  2VUD A;  4LMF A;  2OVU A;  1D4M 2;  2MEV 2;  1V6M A;  2DCZ A;  2JE7 A;  3GZU C;  4IV3 B;  1W8T A;  1FX5 A;  5T5P A;  3SH5 A;  3SIT A;  4ZON A;  3MF9 A;  1LGC A;  4K6B A;  2HWE 3;  2LRP A;  1EPZ A;  3AJZ A;  4NMI A;  1YUD A;  3WQ7 A;  3C8X A;  1H4G A;  3FN9 A;  2P2K A;  4CDX B;  1D0H A;  1VAK A;  3S30 A;  3VBO B;  5FOB B;  5IAT A;  1QJU 1;  4MG2 A;  3GXU A;  1O3R A;  2PHL A;  4JGZ B;  4J25 A;  3KCY A;  1XND A;  4FAG A;  1IKQ A;  1PIV 1;  1EPW A;  2D6M A;  4MO3 M;  3VD4 A;  4FQ4 A;  3R05 A;  4A3X A;  4QT6 A;  3VKL A;  3FHI B;  4Q26 A;  5CFC B;  2J42 A;  4XZU G;  1QY4 A;  1RJ8 A;  1W04 A;  3WF0 A;  1EY2 A;  5EV7 A;  1W0O A;  5FFO C;  2CAU A;  3QH7 A;  2EAA A;  1UY2 A;  2A6Z A;  3MV1 1;  5EFU A;  1US3 A;  5J36 A;  2BJS A;  2OZ6 A;  5CZK A;  4PF1 A;  4IE5 A;  4CDQ C;  4CP9 B;  5L19 A;  1IS5 A;  1IQD C;  2ZX0 A;  3FL7 A;  2DVG A;  2WZP P;  2AC1 A;  3VDD B;  1HN0 A;  5JIA A;  4LO8 A;  4XUT A;  2DTY A;  3N7L A;  1O5L A;  1RVF 1;  2QQN A;  4NIA A;  2YV8 A;  3EXU A;  3DPR A;  5CNA A;  3AKP A;  4MYE A;  1OLM A;  4KBB A;  1FOD 1;  4YZ4 A;  5AVA A;  4JCK A;  1KS5 A;  1S2K A;  4JRA A;  4Q0U A;  3VBS C;  3C2U A;  2YU2 A;  4X6Q B;  2D6K A;  3P5B A;  4UBG A;  4OQ9 A;  1DYK A;  2VZR A;  2R1B A;  2V5Y A;  3WW3 A;  3VL9 A;  3ZSL A;  4XBL A;  1PX4 A;  2R49 A;  1FPN 2;  3PU3 A;  4LLO A;  2VQA A;  3GYD A;  3LE0 A;  4GB3 3;  2VGD A;  4UBH A;  4QAW A;  1ND3 A;  1EV1 2;  2L9L A;  1O91 A;  3AYA A;  3OGJ A;  4RHV 1;  5DXD A;  1LU2 A;  1AL0 G;  3UYJ A;  2VD7 A;  3LD8 A;  4P08 A;  2ADE A;  1N1T A;  2G4I A;  2DUP A;  4QU1 A;  5FKC A;  3IBM A;  5FZ0 A;  4AWD A;  2B9V A;  4ZZ8 A;  2BU9 A;  5HXV A;  4B4Q A;  3U37 A;  4PLO A;  4HSJ A;  3HBZ A;  4Q8K A;  4F8A A;  1Z7S 3;  1OA3 A;  4BQX A;  4PDW A;  2VNV A;  3ZFF C;  4YVW C;  4L11 A;  1OT5 A;  3OGS A;  3WY6 A;  1VBA 2;  3I2F A;  4IL7 A;  1GNH A;  3V64 A;  4CTE A;  1W3V A;  2XLF A;  5C3Q A;  4XQ4 A;  4K8F A;  1YJL A;  3B02 A;  4MXW A;  4BCU A;  4N43 C;  2ZEX A;  2GNB A;  4XDQ A;  2HH9 A;  5FLJ A;  5C71 A;  3MLK A;  1V6K A;  2XJS A;  1R1A 1;  4HXC A;  4CUG A;  1VBC 2;  5HBA A;  3QAC A;  2RJL A;  3APB A;  1NA1 B;  2EAK A;  5IFT A;  1A8D A;  4CDU B;  2JG9 A;  5A3P A;  4CXX A;  4OHX A;  1YQ2 A;  3NNM A;  4BZ4 A;  1DG6 A;  1NLS A;  3LDK A;  1LHO A;  4AEJ A;  4OUS A;  1UY0 A;  4XQW A;  1HRI 1;  1DGL A;  2ATF A;  2XL7 A;  3GM8 A;  4IND A;  4E9K A;  1R08 3;  2FDI A;  1SDD B;  1RUH 3;  4IV3 C;  4NRO A;  3TYJ A;  4CCJ A;  1LTE A;  1XJA A;  2PLV 1;  5T5O A;  1Q8P A;  1CX4 A;  1WBF A;  1W8Z A;  2LUW A;  3VBO C;  3SLI A;  5A80 A;  1OH4 A;  5L9B A;  1A34 A;  1XBF A;  4RR3 B;  4AI3 A;  2G19 A;  2LRO A;  1PK6 A;  1POV 0;  3DEC A;  2E7A A;  1LRH A;  4UOJ A;  5LAS A;  5HCA A;  1W39 A;  1VP6 A;  1YI7 A;  4H14 A;  5JI9 A;  4KG8 A;  2UUR A;  4P9G A;  2E7T A;  1NE4 A;  5FXZ A;  3H8R A;  1XPW A;  1F4H A;  1MS5 A;  3N3H A;  5CFC C;  3SC7 X;  5K8S A;  1UYP A;  1S0F A;  2WII B;  2CGN A;  4LBQ A;  1XNK A;  1DGR A;  1NQJ A;  1Q8O A;  3D0J A;  2PMW B;  4D0Q A;  1HXS 3;  4C0B A;  5CU1 A;  1XNC A;  4NHX A;  1Y9M A;  5FZL A;  1SBF A;  2HWD 2;  4JDM A;  1HQN A;  4LLF A;  4YGB A;  5FPV A;  4OHZ A;  1AHS A;  2HWF 2;  4MGT A;  4XFG A;  5J1X A;  2DCJ A;  1PHM A;  1MEC 3;  2C6S A;  2HWB 1;  2RS5 3;  4O61 A;  3GAL A;  3EYP A;  1AVB A;  2OPK A;  1AJK A;  2IZW A;  1W06 A;  2PXJ A;  3O1U A;  2AEZ A;  2WS9 2;  3VDD C;  2ZAC A;  3IPV A;  4M3C A;  1QWR A;  4E8C A;  1RUE 1;  3AP5 A;  4OI2 A;  2PFW A;  5FKB A;  3WHU A;  3WXP A;  4ERO A;  1GP5 A;  5IHR A;  2ILM A;  2WFF 2;  4Q4W 1;  3H1W A;  2V5D A;  4WBB A;  5DUW A;  2Y8K A;  2GC3 A;  1CAX A;  1E5I A;  2VXR A;  2W39 A;  5GLT A;  4OMD A;  4OUM A;  3TWI A;  4YFZ A;  5E88 A;  4RYD A;  3I2D A;  1W90 A;  2H6B A;  1PMJ X;  3K46 A;  3R4U A;  5LY2 A;  1N1S A;  1V6I A;  1BBT 2;  4IEU A;  4Y3O A;  3NVC A;  2XBO 3;  4UW4 A;  2XH6 A;  3VBF B;  1YIP A;  5I8Y A;  1XOY A;  4MGY E;  5LBF A;  4Q4X 1;  3R4S A;  1YQC A;  1OQE A;  1LB2 A;  2XG3 A;  2FZ2 A;  3Q8B A;  2BWA A;  3O1M A;  1T6G C;  2AYH A;  2YHJ A;  2W08 A;  2ZGP A;  4FOQ A;  2BP6 A;  2XUE A;  4A7Y A;  1V6L A;  2RS1 2;  1H2M A;  4XUR A;  5JXG A;  2WNU A;  3J7N A;  1AL2 3;  4Y22 B;  5E1R A;  4M3C E;  4BXS V;  2VUJ A;  1N1Y A;  3HWJ A;  4XFI A;  5HV4 A;  3VHO A;  4FTS A;  1MAC A;  2YBK A;  3FZ3 A;  4QX8 A;  4YM2 A;  3WDX A;  3ZYP A;  1ZBE 3;  1Q3E A;  2EXJ A;  1NY7 1;  1ULF A;  1Q5O A;  4DIN B;  2ARX A;  3MIE A;  1MS8 A;  4MGK E;  1V70 A;  3POB A;  2UY9 A;  3PIG A;  1GSL A;  1A3K A;  4CYD A;  1QJU 2;  1ZX5 A;  1JZ5 A;  3BCW A;  4XTP A;  1BMV 2;  1NA1 C;  4FFG A;  1WMX A;  2VW0 A;  4CDU C;  3CEW A;  1PIV 2;  3AKS A;  5DAQ A;  4SBV A;  5FZG A;  4CDW B;  5K0U B;  3ZYR A;  3KV4 A;  3C7H A;  1KFU L;  1RUJ 3;  1NLR A;  3GHM A;  1OMI A;  1XC6 A;  1D2S A;  2H6C A;  3FX3 A;  5FZ4 A;  3WW2 A;  1H8T A;  2Q1M A;  5FYY A;  5FIX A;  4L9B A;  1DQ1 A;  1JYC A;  2VE1 A;  1DYO A;  1AR9 3;  1NX9 A;  2VZV A;  1LGN A;  3J9S A;  3M3I A;  4UF0 A;  4XDO A;  2P3I A;  4K8R B;  4QX3 A;  4RR3 C;  2Y6H A;  5LRS A;  4ES8 A;  3NST A;  1ZBA 3;  1OPM A;  5CAZ A;  2NYY A;  2XOM A;  1VBB 2;  3VDD A;  3UGH A;  1GQH A;  2BBA A;  2DUO A;  2PHR A;  4ZU4 A;  5DDJ 2;  5BNP C;  3JZV A;  4NAO A;  4IXL A;  1O8P A;  2Y64 A;  5A3U A;  5JUV A;  4YGE A;  5FZC A;  1DZR A;  1FOD 2;  4UFH A;  4GUL A;  4KG0 A;  3RYP A;  1FYU A;  5A3N A;  3ZFG A;  3DF0 A;  5LA0 A;  1HJG A;  4LKF A;  1JOD A;  4K1Z A;  1OD3 A;  2WRA A;  5JOX A;  4QB2 A;  1CAV A;  3A0K A;  4YW1 A;  5D8A B;  4FTB A;  4Y20 A;  4URT A;  1OH3 A;  3VL8 A;  4HVQ A;  5EIY B;  1OOP A;  5G05 L;  2RMU 3;  3DCQ A;  3OBA A;  4PQ9 A;  3RSJ A;  3C7F A;  4RHV 2;  1HRV 1;  1UXX X;  4K3U A;  5FQ0 A;  2F4P A;  4L8Q A;  1JU4 A;  3MV0 1;  5A6X A;  4LO4 B;  3ZXE A;  4HKL A;  4E27 A;  2QQK A;  4NWV A;  5JR7 B;  1JS9 A;  2D3S A;  2NMN A;  4E4D X;  3H42 B;  1GV9 A;  2ZAB A;  3WG3 A;  1QU0 A;  1E5R A;  1H6X A;  5GZD A;  1P8J A;  1V6J A;  3U4S A;  1U12 A;  2Z4F A;  3POJ A;  2GME A;  5DPN A;  5F3G A;  2B8M A;  1AR7 1;  2QQO A;  4FO9 A;  4WM8 A;  2MHF A;  3ZDV A;  1AYM 1;  4XF0 A;  2P6C A;  2R04 3;  3KGZ A;  3ZM8 A;  4OHW A;  2Y26 A;  1GNY A;  1RXF A;  4IE4 A;  1VRH 1;  4KWJ A;  4XBN A;  2ZOE B;  3MW2 A;  4XHX A;  3UES A;  5IVV A;  4GJZ A;  5B4N A;  1R1A 2;  2Y6G A;  1UYX A;  3BIW E;  4ZZ5 A;  2K0G A;  2EIC A;  4NHM A;  2ZGU A;  4M4R A;  2WO1 A;  4WZC A;  4BQY A;  3JXS A;  1X82 A;  4H3W A;  3H3L A;  4AEM A;  1AXK A;  1RUD 3;  1PM7 A;  2WO7 A;  5IVY A;  4A6O A;  5C9A B;  2WZR 2;  1UX6 A;  1W6P A;  4I0A A;  3OSD A;  2JG8 A;  4Y26 A;  4R4X A;  2D6P A;  2VZO A;  5C8W A;  1POV 3;  3ZXK A;  1C3H A;  2EIE A;  5CKM A;  2XVK A;  2XJT A;  2FBE A;  2D5H A;  2EAL A;  4DOU A;  2PLV 2;  2SBA A;  3QD6 A;  4YYO A;  1HJF A;  2A1X A;  2C5D A;  2V09 A;  4WM7 A;  1CAU B;  1NAE A;  3I2J A;  1PGS A;  4LOT A;  2BUK A;  1KEX A;  2ENR A;  5FYV A;  1ST8 A;  2OUH A;  3ILR A;  5L7O A;  1LAJ A;  3GGL A;  1VMF A;  4BM8 A;  2OS2 A;  3ZSE A;  2RHP A;  5A3W A;  1YJK A;  3FLR A;  1QF3 A;  1PX3 A;  4CDW C;  5K0U C;  2NM1 A;  1CJD A;  4XIK A;  4XUP A;  2QE3 A;  3Q8F A;  1BLZ A;  3VUO A;  3IAP A;  4AQ2 A;  4OI0 A;  1RHI 3;  2KA3 A;  3CJI B;  3NAP A;  4X8P A;  1JZ4 A;  1A78 A;  2ORZ A;  4BQ1 A;  2DYC A;  4Z1V A;  5HCH A;  2VNO A;  2FCT A;  4D94 A;  3ZR5 A;  3FWE A;  2WAB A;  2HWB 2;  4HMZ A;  3B9C A;  4YZ1 A;  1NE6 A;  2XXZ A;  4ZXE A;  1QJX 2;  2QQU A;  4DO0 A;  4HT1 T;  1S2B A;  2BYV E;  3BGA A;  3IKW A;  3MUZ 1;  1HB3 A;  1UOG A;  2QJV A;  3IB3 A;  3N36 A;  3OBT A;  1VRB A;  2AR6 A;  4QKF A;  2XWJ B;  3III A;  4K7J A;  3ZVX A;  2JD4 A;  1G9C A;  2Z2S B;  1BYH A;  4PLN A;  1RUE 2;  3DUI A;  3AMM A;  3SEP A;  5A32 A;  2JB8 A;  3NW4 A;  4JKL A;  5LBB A;  2ZGN A;  4Q4W 2;  3JU9 A;  1DQ6 A;  2O14 A;  1J3R A;  3N9O A;  1PGW 1;  2R06 2;  1O5U A;  4YWA A;  3TEW A;  5C6C A;  5C5U A;  4YZ3 A;  5D8A C;  3HD8 B;  4COY A;  2VMF A;  3ZFE C;  4BQ5 A;  2JXA A;  3LKJ A;  4Q4Y 2;  1YRZ A;  3PUA A;  4Z2A A;  2PA7 A;  1QMJ A;  5AVP A;  5IAX A;  2ZKN A;  4FI9 A;  5IVJ A;  4L2N A;  4Q4X 2;  3OOX A;  1RIT A;  4QGM A;  2JJ6 A;  1N47 A;  3K75 B;  3ZXL A;  5CAD A;  2RJK A;  1Q43 A;  3VBH B;  1DQ4 A;  5JXJ A;  3RI9 A;  3FFQ A;  4CUA A;  2AEY A;  3POF A;  4O9G A;  1ZZC A;  5EYY A;  1RUG 1;  2ZTN A;  1GU3 A;  2ID4 A;  2VJX A;  2P34 A;  3HIF A;  5A6Q A;  3OB8 A;  5I8S A;  1XQN A;  2IWG B;  4LIV A;  1G6N A;  2JB4 A;  3MUY 1;  4P9L A;  4UW3 A;  1WLD A;  5F8P A;  3I49 A;  1GOF A;  1ALY A;  2CWS A;  3WDY A;  1LUL A;  2WA3 A;  3VDB A;  2OYZ A;  3VHN A;  5FZE A;  4LHN A;  1F15 A;  1O4Z A;  1IPJ A;  4MSV A;  1S55 A;  2OX0 A;  2JEM A;  2WL1 A;  1GZC A;  2WNV B;  4AI2 A;  3ATG A;  4COV A;  4E2G A;  1GNZ A;  1YQ5 A;  1AJO A;  4CCL A;  4CPB D;  1DDL A;  4JGY B;  1CPM A;  3FFZ A;  3S7I A;  5C9A C;  3MIC A;  2LAL A;  4Z8B A;  1UNB A;  5JSR A;  4AFA A;  2PAE A;  5H9S A;  1XYO A;  1ZA4 A;  2GC1 A;  1GBG A;  2VNR A;  3U0Z A;  1V9U 2;  1CWP A;  5KXB A;  3ACF A;  5EHD A;  2MEV 1;  2XQX A;  2O8Q A;  1JHJ A;  2V4A A;  4XC9 A;  4MX3 A;  2J1V A;  3SMH A;  5T5L A;  3OUJ A;  1E5S A;  1RC6 A;  1C1L A;  3D82 A;  3LF7 A;  1M4W A;  1PNG A;  4KH9 A;  1PO1 3;  1ODN A;  1LGB A;  1YC6 1;  1SFY A;  3RZH A;  5LEJ A;  4A3Z A;  5CFD A;  3V65 A;  3ZYI B;  1JZ6 A;  5IAV A;  1UIJ A;  4S2G A;  2OQ7 A;  2W87 A;  4IDZ A;  5H9P A;  3RRD A;  2JWP A;  4N53 B;  2VPV A;  3NV1 A;  4QPG A;  3NJX A;  3HNM A;  3DXT A;  2Q8D A;  3FE5 A;  3ZDS A;  4AFM A;  2YC4 A;  3CJI C;  1GIC A;  4QQ2 A;  1R1Z A;  2P3J A;  4AGR A;  3E6C C;  5C4W C;  2WZE A;  2P1B A;  3RZK A;  5LK7 B;  2X5I B;  3WG1 A;  4I0B A;  2VTX J;  5KXE A;  1O6U A;  1HRV 2;  1QXR A;  4GWN A;  2ZGQ A;  3WF1 A;  4AVC A;  1RUC 3;  1LEM A;  4IUG A;  5ABJ A;  1MVE A;  3AC0 A;  3RZJ A;  3PVB B;  3NV3 A;  3BTX A;  4A7K A;  2WSU A;  5DZE A;  1LOF A;  1COV 3;  1PVC 1;  3NWK A;  4QX7 A;  1MR5 A;  5AC9 3;  5JDB A;  1AR7 2;  2EIB A;  2HWC 3;  4QM9 A;  4JKK A;  4QPI B;  4DY3 A;  1UKG A;  2YG0 A;  3RWK X;  1AYM 2;  2AH2 A;  1DU3 D;  2WQ4 A;  1FPN 1;  2C24 A;  2CHH A;  4LKE A;  5J98 B;  4ASL A;  4E4H A;  3BU0 A;  1A6C A;  2VNG A;  3DYO A;  1UF2 C;  5FYT A;  2JEC A;  2ZHK A;  1EV1 1;  2XWB B;  3FHA A;  1UOJ A;  2R07 3;  3VHR A;  4X6R B;  4NIH A;  3ZXJ A;  3O1T A;  3VBH C;  1RTV A;  1U5Y A;  2YC0 A;  4Q2F A;  4C0H A;  4CUC A;  1B09 A;  1XSQ A;  4F83 A;  2B42 B;  2VMI A;  4OQ8 A;  4HVO A;  3LQC A;  4WVZ A;  2A3W A;  1AXZ A;  2GU9 A;  2E6V A;  3W9A A;  5I0R A;  3CF6 E;  1F9K A;  1KD7 A;  1LR5 A;  4AVV A;  3A23 A;  5JOY A;  4FPJ A;  2GC0 A;  2X05 A;  3B9I A;  1OLR A;  4FPH A;  4FFF A;  4R52 A;  4QDS A;  2VMG A;  3KGL A;  2XHN A;  4QGN A;  2VZS A;  1ULP A;  2PHF A;  4W6Y A;  4EN6 B;  5KHJ A;  1EAH 3;  4YM1 A;  3WSO A;  4CRQ A;  2V73 A;  5FP3 A;  4JAA A;  1OLQ A;  1L7L A;  3KV5 A;  1HV0 A;  2ZHL A;  2DF7 A;  2DBI A;  2WFP A;  3BTY A;  4CEY A;  4LO6 B;  1QJY 3;  2ES3 A;  2NZ9 A;  1CD3 G;  1HXS 1;  1T2X A;  1VBC 1;  2WNV C;  3E1F 1;  1VBE 3;  3N7M A;  4LE4 A;  2FDG A;  2D43 A;  1PMI A;  5A7W B;  1VBD 1;  4JGY C;  4DS0 A;  1CAW A;  2VUL A;  3DEM A;  3F2Z A;  2DVA A;  1LOC A;  4R9D A;  3ZYG A;  4BIS A;  3LCP A;  1E5H A;  3J7L A;  2GN7 A;  4RGA A;  2VVD A;  3LZZ A;  4JV4 A;  1UX7 A;  1I5Z A;  4OFG A;  1V6O A;  2XJV A;  4V2W A;  3UJQ A;  4TYS A;  1MS1 A;  4MOA A;  5F6K A;  3ZR6 A;  4AVA A;  5LA1 A;  4Y5Z 0;  1KIT A;  4LBK A;  4NRP A;  2DCK A;  3E6B A;  4CDQ B;  1KDK A;  2KXL A;  5ACA 3;  3OG2 A;  4Y1Z A;  2LS6 A;  4IEO A;  4Z92 B;  1SQ4 A;  3ASI A;  1SLA A;  4CCO A;  2PEL A;  3PVN A;  1XU1 A;  4LE3 A;  1W05 A;  5FP9 A;  2FZ1 A;  4EZH A;  1OC1 A;  4N53 C;  4QXB A;  4A41 A;  3V0B B;  2Q5T A;  1BVV A;  5GZE A;  2OA2 A;  3IDA A;  1W8N A;  1XE7 A;  4IES A;  1XRU A;  1YFU A;  5BNN B;  5IVF A;  3RYK A;  3VBS B;  4EN7 B;  1WLT A;  4TSV A;  3SKJ E;  2TBV A;  1IKP A;  3OPT A;  4HAN A;  2Z79 A;  2BV4 A;  3H3U A;  4I3G A;  3BVC A;  1WCQ A;  4JTO A;  3JB8 A;  5CB7 A;  4BQ3 A;  3QLQ A;  3I54 A;  2J7M A;  2QQW A;  3ZN6 A;  1AR8 3;  2HEV F;  2RM2 3;  1I5P A;  2GMP A;  2YGM A;  4O7X A;  5A33 A;  4AZZ A;  3BUC A;  3PVO A;  2WS9 1;  3NO8 A;  2QUO A;  2Y6F A;  1GWL A;  3KF5 A;  4N7U A;  3GBW A;  2VBP A;  3NKG A;  4C8D A;  1GZW B;  4COZ A;  2D3R A;  1TZO A;  3OYW B;  4C90 A;  3OY8 B;  3INA A;  4YFW A;  4CP2 A;  1XNB A;  1X33 A;  3ZYB A;  1ASJ 3;  1RUG 2;  2RDR A;  4PIX A;  2WFF 1;  4NN0 A;  1W6O A;  3QH6 A;  4HG6 B;  1W0P A;  5JOZ A;  2JIG A;  4ZKT B;  4K1Y A;  2WO3 A;  1RYY A;  4WVV A;  1SBD A;  1Y7B A;  2WBK A;  3MW4 A;  4QPI C;  3T2Q A;  3W5M A;  3WNP A;  3VZN A;  5G04 L;  5FPA A;  4LHK A;  3RWN A;  3K48 A;  3TNP B;  3S57 A;  2WN2 A;  5JVV A;  2BOI A;  1BBT 1;  3QOP A;  4IE0 A;  4N43 B;  5EPA A;  3ZIW A;  2BEO A;  4UFL A;  2VG9 A;  1VMH A;  2I2S A;  5FYM A;  2VZP A;  1W0N A;  4AXO A;  4JDN A;  4NPM A;  5HCF A;  4QXK A;  2JDH A;  3UKN A;  2XPJ A;  4NR1 A;  5DAX A;  1LOA A;  4OI4 A;  5C8C A;  4NID A;  3HN1 A;  3OEB A;  5FXV A;  2D5F A;  3ZYJ B;  4EN0 A;  2JDA A;  3A0N A;  3DKW A;  3LEG A;  4IV1 A;  5FY1 A;  4EV0 A;  1ND2 B;  3VD9 A;  1OVP A;  1J58 A;  3TN9 3;  2VQT A;  2ZGL A;  1ZZ7 A;  1SCS A;  4QB1 A;  3VBR C;  3WIN E;  2YGL A;  1UOB A;  4KL1 A;  4NPL A;  4NAM A;  1WW5 A;  3PVE A;  4M01 A;  3K77 A;  3NL1 A;  3ACL A;  5FV3 A;  4AI8 A;  1HIX A;  4N8M A;  4WVM A;  1IG3 A;  2QKD A;  3VV1 A;  2ADD A;  2VOK A;  5JIU A;  1YNA A;  1CIY A;  2WNO A;  4BQ4 A;  5I0S A;  1BMV 1;  2VBB A;  4XDP A;  5GLU A;  4UFK A;  3GBG A;  2H0V A;  2VUC A;  3HQX A;  4FP3 A;  5F5A A;  3J8F 3;  3VKF C;  2VTF A;  1SLL A;  2CDP A;  4GB3 2;  4YVS C;  4AG4 A;  3B93 A;  4QQL A;  1UU5 A;  4QGL A;  2Y6K A;  3WHT A;  1F31 A;  3RFR A;  3I2K A;  1YIF A;  3JBG 3;  2AEN A;  1YWK A;  1FMD 3;  2Y0I A;  4RL7 A;  4XUQ A;  5JPN B;  5CA6 A;  4TZD A;  2GH2 A;  4FPG A;  4IV3 A;  4IW3 A;  4NE9 A;  1WMF A;  3OPZ A;  5BY5 A;  3KLS A;  1MS0 A;  1SG3 A;  4KWU A;  2VXJ A;  4CDX A;  4AHY A;  1UPS A;  3UKT A;  2R30 A;  4LQR A;  1RXG A;  3NRU A;  5ANQ A;  4DXS A;  4JGZ A;  2RS3 3;  4RQP A;  3M3Q A;  4DUW A;  3ORJ A;  1VBB 1;  4ZU7 A;  3BOD A;  3RS6 A;  1YFW A;  3H7Y A;  3NNF A;  4XJU A;  5DDJ 1;  2ORX A;  3MIF A;  3LA3 A;  5FUI A;  3FJS A;  1Q8Q A;  3FC0 A;  4HK8 A;  1JN2 P;  1O3Q A;  1PO2 1;  2JDP A;  5BNN C;  1CX1 A;  1PVC 2;  3KMH A;  4AAX A;  1JUH A;  3HJR A;  4A7Z A;  2VME A;  5J7M A;  2W52 A;  5A3L A;  4D7T A;  2QQJ A;  2OPW A;  2XML A;  5F5C A;  4NRM A;  3SEE A;  2FDJ A;  2WAO A;  3VKO A;  1LKN A;  3T30 A;  3EO6 A;  3O5S A;  2W1W A;  2WT1 A;  1LHW A;  3RG0 A;  4AW7 A;  1ENQ A;  2RE9 A;  3I3B A;  1D4M 3;  4U2A A;  4XFF A;  1KGY A;  4QU2 A;  2R7E B;  2RVA A;  5IUQ A;  1O3S A;  1POV 1;  4FFH A;  1KJR A;  1MZE A;  3KHC A;  3O1V A;  3WLU A;  1H4H A;  1GYK A;  3U4X A;  2GND A;  4W8J A;  5FRE A;  5FBJ A;  5JOW A;  3O1O A;  1KFX L;  1H30 A;  4QKD A;  3HVD A;  1Q8S A;  4BK5 A;  4ISR A;  3JD7 1;  1SZB A;  4XJA A;  2EID A;  3D5O A;  4HZF A;  4JDO A;  3WV6 A;  3LPG A;  4M0N A;  4EQV A;  2BVB A;  2HLE A;  1PZ9 A;  5FMC A;  1F5J A;  3NMB A;  4MXW B;  3L2Y A;  2W0X A;  3ECQ A;  1MQT A;  3TEY A;  2YMZ A;  1J1T A;  1RUI 1;  3AVS A;  5E8A A;  3ZX7 A;  1JYW A;  3GNE A;  1GP4 A;  1JXN A;  1U5X A;  1UQX A;  4IEP A;  4XHB A;  1QIQ A;  1YO8 A;  4MGI E;  5F6L B;  1XE0 A;  1LOG A;  3AX4 A;  3IMN A;  4R9B A;  1HXS 2;  1R09 3;  3IT8 A;  2ZAA A;  5FYU A;  4DFS A;  3Q9O A;  2JG9 B;  3I3Q A;  1CQ9 A;  1VBD 2;  1YHF A;  2BGP A;  3M8L A;  3WG2 A;  3R4D B;  1ZRC A;  3GZT B;  5H9R A;  3WW4 A;  1JZ8 A;  5F32 A;  1ND2 C;  5F3I A;  3MID A;  2WZR 1;  3CQO A;  4KU7 A;  2RR1 1;  5FZH A;  2VMH A;  3DXU A;  1AX1 A;  1AR6 1;  1OKQ A;  5FZI A;  2J22 A;  2ZS6 B;  4A4A A;  5FP4 A;  2Q8E A;  5CIS A;  1NYW A;  1RMU 3;  3N9N A;  4YLZ A;  2YC2 A;  1DCS A;  1XNT A;  4QXC A;  4Y1X A;  1VE0 A;  4MUV A;  4A45 A;  5JMC A;  2OW4 A;  3P3N A;  2UYA A;  2VL4 A;  1PK6 B;  4QMA A;  3WF3 A;  1OHF A;  4KGG A;  2G9Z A;  4ATE A;  3WQ1 A;  5FZB A;  5IVC A;  4XAE A;  1NA1 A;  3AMH A;  3WUD A;  4AGV A;  1JBC A;  4LBQ B;  5BNP B;  3CKH A;  3MZH A;  4PLM A;  2GMM A;  1OA4 A;  2E53 A;  3THD A;  1H2L A;  4GWJ A;  3VBU B;  1WCK A;  3D6E A;  4YZ2 A;  3URF A;  5FYC A;  2A75 A;  3PUR A;  2BFU S;  3WQ0 A;  3IDB B;  2EXK A;  4NUB A;  1VBA 3;  3E97 A;  1QJX 1;  2K46 A;  1H9P A;  4DXZ A;  1JYX A;  2C0Z A;  4RR3 A;  3MPB A;  4GWI A;  5A7Q A;  1FNY A;  3Q8A A;  2B9U A;  2XDV A;  5FRA A;  1KRI A;  4FPF A;  2DBN A;  1VAL A;  3KT7 A;  4P14 A;  4LIU A;  3LIH A;  1W2A X;  1DQ0 A;  5C3R A;  1EUU A;  2YPJ A;  2VZU A;  4DEV A;  3L9J T;  5A1F A;  4GXL A;  5DZF A;  1AZD A;  2W9X A;  3VZM A;  2R06 1;  1HB2 A;  3ZO0 B;  1VMJ A;  3V0A B;  4B7E A;  1SCR A;  4AVS A;  5CKN A;  2WWU A;  1QQP 1;  2SLI A;  4C1W A;  4Z2W A;  4FBF A;  1AYN 3;  3WDT A;  1VB2 A;  1S0D A;  3BAL A;  4Q4Y 1;  2F6B A;  3T0A A;  3SXW A;  3I2G A;  1WW4 A;  1OQD A;  1W8W A;  4CSW A;  1C57 A;  1T6B X;  3AM2 A;  3H8U A;  4CEW B;  4P9X A;  5HCB A;  5DG2 A;  2TNF A;  4NHK A;  4WZF A;  2BZD A;  5KHH A;  3AMP A;  1AR9 2;  2NQY A;  1W2U A;  2RV9 A;  4RA0 A;  2WNU B;  2QQP A;  5IVE A;  5HXM A;  1YYN A;  3NNG A;  4LUL A;  1PO1 1;  4OZO A;  5GZG A;  1QJF A;  1ZBA 2;  1MS9 A;  1VPH A;  3U14 A;  3UET A;  3O0V A;  3CZJ A;  5DAB A;  2QVS B;  1OQ1 A;  3S7E A;  3M7A A;  1OVS A;  4XAC A;  3ZSM A;  1WW6 A;  2D98 A;  4F3J A;  1ZRE A;  1OUX A;  4SLI A;  4CPB A;  3VBF A;  1GAN A;  2ZX1 A;  1GOG A;  2HWD 3;  4RGG A;  4XE9 A;  5EYX A;  1HLC A;  5CG8 A;  2JG9 C;  1RUN A;  2BNO A;  1JUI A;  1HB1 A;  2FQP A;  4AEK A;  3WQB A;  2Q0A A;  3BTA A;  4IER A;  4LPL A;  5JXH A;  2ET1 A;  1NT0 A;  4P9Y A;  2D7F A;  1C4R A;  1JHN A;  3HPN A;  2ZMN A;  1V9U 1;  1OKO A;  4LHL A;  4FTE A;  1WZX A;  2B5H A;  3UT0 A;  5JI7 A;  1W9W A;  1N3Q A;  1JYT A;  1PK6 C;  3VD7 A;  3ZXG A;  1WD3 A;  5FZM A;  1S0C A;  2V72 A;  1LHN A;  3ILF A;  4DPN A;  1RUF 3;  1NCR B;  3PL0 A;  3VDC A;  2BWC A;  2J1S A;  5K0U A;  2R04 2;  1I3H A;  2W2I A;  1FNZ A;  2YB7 A;  3WT3 A;  5HI0 A;  1UCX A;  1PO2 2;  1NKG A;  1NXD 1;  1H1M A;  4IEQ A;  3AYD A;  3VBU C;  1V6N A;  3HQU A;  4GWM A;  3A4U A;  1XE8 A;  1CAV B;  4QX0 A;  3B00 A;  1WLC A;  1D2Q A;  4AHX A;  4YSF A;  5FK8 A;  3ZYH A;  2RG4 A;  3K4A A;  4K40 A;  1BCX A;  2DV9 A;  4Y33 A;  4DXT A;  4DZG A;  1N1V A;  3LEI A;  2BGO A;  1K5M A;  3OF1 A;  3KQ4 B;  1RUD 2;  3ZFE B;  5DAV A;  5IK5 A;  1LES A;  1PVX A;  4QXH A;  4YG0 A;  3LEM A;  4Q29 A;  3S5A A;  2BGC A;  3UGF A;  3I3E A;  2ZX3 A;  4ZHN A;  1D7P M;  5TSW A;  2HBT A;  3DV8 A;  3ETP A;  2VCB A;  3JD7 2;  2ZEZ A;  3MO4 A;  4GMP 0;  2LM3 A;  4IGQ A;  3TBD A;  2WAA A;  4LO5 B;  3UNP A;  5LY1 A;  3KT4 A;  2K2S A;  4ES9 A;  1PIV 3;  1B35 A;  4MHR A;  2PTM A;  5JZG A;  5BV6 A;  5FZ8 A;  4HKW A;  4OZX A;  1RUI 2;  4QDR A;  5FZO A;  5BNO A;  2VQU A;  4KU8 A;  2A3Y A;  5FPZ A;  1CGP A;  2CTV A;  2UWB A;  4CEW C;  2EA7 A;  1XYN A;  2HYK A;  2I45 A;  1UU4 A;  2VOX A;  3RZZ A;  4BLJ A;  2XUM A;  1OSG A;  4FVV A;  3HT2 A;  5A7P A;  1X9P A;  4ZS3 A;  3D3A A;  1QDC A;  2CDO A;  5D21 A;  4BWO A;  2DVD A;  2XKO A;  2WNU C;  4RS5 A;  5JR2 A;  2B46 X;  2WC2 A;  3M3C A;  2VAU A;  2RR1 2;  3JCI A;  5LAT A;  3PUI A;  1J3Q A;  4LKS A;  3LAG A;  3I59 A;  1RVF 3;  1AR6 2;  2ERF A;  2HEW F;  4GH4 A;  1G7Y A;  2QZ3 A;  1Y3T A;  3M70 A;  2YFZ A;  5F2W A;  1FOD 3;  1PNF A;  4DMI A;  2NLR A;  3FLT A;  2A71 A;  3UK9 A;  3CJX A;  2B45 X;  5A3T A;  1DGR N;  2IXJ A;  3ZN4 A;  4BB3 A;  2DFC A;  1NCQ B;  4D7Y A;  5JAX A;  3ACG A;  3LSE A;  4RHV 3;  3ZSK A;  1WMD A;  4XF1 A;  4HN1 A;  2WSV A;  4PF5 A;  4XF4 A;  4YGD A;  1AR8 1;  3HNY M;  4Y5T A;  5C9A A;  1RB8 G;  3RZL A;  5LK5 A;  5EJ1 B;  5DZG A;  2JKX A;  3J26 N;  2A6X A;  3MIH A;  1BEV 1;  2W46 A;  3K3O A;  4KBZ A;  1RED A;  2CY6 A;  3WNO A;  1VJ2 A;  2VOW A;  5KHI A;  2EXH A;  1LU1 A;  1WA6 X;  1SLB A;  3WOG A;  5C4W B;  1XB9 A;  5EJ3 A;  2ZML A;  4DRV A;  3KT1 A;  1PZ8 A;  1REF A;  3TNQ A;  5F3E A;  1QGL A;  3DGT A;  1CAU A;  3WDV A;  1POQ A;  2CGP A;  2VW2 A;  3VKN A;  3AP4 A;  2Y0O A;  2EXI A;  3I2I A;  3WCS A;  2UY8 A;  3POW A;  1NCR C;  5A32 B;  3WUC A;  4XVH A;  2WJS A;  2ZGT A;  5A7S A;  5T5J A;  5FY0 A;  4DIQ A;  4ET7 A;  5C33 A;  4YW2 A;  5IK8 A;  1RJ7 A;  1UZ0 A;  3MFC A;  4LK6 A;  3WP6 A;  4B3N A;  2OKX A;  3U75 A;  4NRQ A;  3E6D A;  1XU2 A;  1OOP C;  4FCA A;  1WUV A;  4QQH A;  4NJ4 A;  3AL5 A;  1QQP 2;  2BRT A;  3LGR A;  1UAI A;  2ZHN A;  3LIG A;  4V1P A;  1U5Z A;  4B29 A;  3R6S A;  4DQA A;  1QOS A;  4OUE A;  5C3S A;  1N3P A;  1HRI 3;  3K3N A;  3TB0 A;  1GZT A;  3WNL A;  4XEZ A;  2IXL A;  1HB4 A;  2Y6J A;  3F95 A;  3LA2 A;  1C8M 3;  1UZZ A;  5IK4 A;  2PLV 3;  3UGG A;  3RVH A;  4D6S A;  1OBN A;  3VN4 A;  1HQL A;  3W59 A;  3WEZ A;  3OEA A;  3RZG A;  1CIW A;  4EYU A;  3EJK A;  4I01 A;  2F17 A;  1W9T A;  2HWE 1;  2BTV C;  5GKA C;  4WM8 C;  3NJY A;  3ZPY A;  1OF3 A;  3TRS B;  2NMO A;  1H1A A;  1MVQ A;  2IXI A;  1PO1 2;  5IW0 A;  3H1M A;  5FJK A;  4IE6 A;  2ET7 A;  5A7O A;  3RJR A;  1F4A A;  4EN8 B;  5H9Q A;  1BQP A;  3K51 A;  5EJZ B;  4HPK B;  2E33 A;  1WLW A;  4BJ0 A;  4TXW A;  3RGB A;  4NWW A;  4QWN A;  4AHW A;  1YCI A;  2ARE A;  2FCV A;  1NOV A;  1F2N A;  3JBG 1;  4FFI A;  3B7M A;  4HN0 A;  4OVE A;  5FMO L;  3VBH A;  1X36 A;  4Q4V 3;  1QJZ A;  4AED B;  3MF6 A;  5T3N A;  2HWB 3;  3O12 A;  2XKP A;  2QQL A;  5GAL A;  2ZHM A;  3KVA A;  4UFJ A;  1FAY A;  2BW8 A;  3LPF A;  3EHK A;  2JG8 C;  3KZ4 C;  1YEW A;  4XPV A;  1IPK A;  1V0A A;  5LB6 A;  2E32 A;  4FPY A;  4LTA A;  3I8T A;  2RS3 1;  4CZS A;  2WLQ A;  4WM7 C;  3H50 A;  1AX0 A;  2R16 A;  4COU A;  2O0O A;  3VDA A;  5FPX A;  5KHG A;  3SH3 A;  5L7O C;  1CZS A;  1ULC A;  4LBO A;  4D8M A;  4QKB A;  5HV0 A;  2WUH A;  4OYU A;  4AK3 A;  1COV 2;  1W9S A;  3HQR A;  1NZI A;  1VAV A;  3I97 A;  4LBM A;  4ASM B;  3AXE A;  4FPL A;  1J84 A;  2HWC 2;  4OI1 A;  2WNV A;  1NCQ C;  4IET A;  4WV8 A;  4XZP A;  4FPO B;  1C5H A;  1S4C A;  4JGY A;  2X29 A;  1WD4 A;  2D97 A;  4GB3 1;  4GKX A;  5FZA A;  4KMQ A;  1WW7 A;  3U10 A;  3J7H A;  4FOW A;  1W6M A;  1SLC A;  2BVV A;  2DU0 A;  4Q4X 3;  4Y4R A;  5B2G B;  1XSR A;  4PBO A;  4AQS A;  2R07 2;  1L7R A;  4YM3 A;  1TME 3;  3AFK A;  3AZW A;  4MH0 E;  2P4E A;  3T4V A;  4PCR A;  4YW7 A;  1W03 A;  1K42 A;  2IXC A;  4Q1R A;  2Q1F A;  4Q0S A;  2YXS A;  3AZV A;  5J3U A;  3AZZ A;  4XXA A;  4YG6 A;  5CEH A;  4GMP 3;  1Z7S 1;  2D93 A;  3AVR A;  3WW1 A;  1HW5 A;  2MNG A;  3ZIX A;  5FWJ A;  4BU2 A;  5ABJ B;  3N9Q A;  1S0E A;  4K9S A;  1CZV A;  1W6Q B;  5ANN A;  3C7E A;  1WKY A;  4Q0Q A;  1YFY A;  1EAH 2;  3UL2 A;  5CG9 A;  2JEN A;  4N53 A;  1PGL 2;  2XVL A;  1SPP B;  4LBJ A;  3ROU A;  5L9V A;  3T2T A;  5KR7 A;  4MV2 A;  5F7U A;  1QJY 2;  5SV8 A;  2XR4 A;  3A21 A;  1QNY A;  1JW6 A;  1NXM A;  1BJQ A;  1R09 1;  1IS3 A;  1ENS A;  1TNR A;  2P5B A;  1VBE 2;  1DLC A;  3HN3 A;  3KF3 A;  4QHO A;  3PDQ A;  5FWE A;  4E2S A;  3AKQ A;  1UO9 A;  2CAV A;  2JDU A;  2X5I A;  3QCW A;  4HET A;  4OLL A;  3DN7 A;  3TEZ A;  1UZY A;  4O9E A;  3VLB B;  4AAP A;  5LBC A;  4QQO A;  2A3X A;  4DUV A;  5C3O A;  1K3I A;  1SAC A;  4PI0 A;  5DMY A;  4WVW A;  1JTZ X;  1R08 1;  1O3T A;  2YU1 A;  3L2H A;  1RUH 1;  1OD5 A;  4ZU5 A;  4ARX A;  1RMU 1;  3AK0 A;  1G8W A;  1OFS A;  4HLT A;  3N9M A;  2BER A;  4E4S A;  2ZGS A;  2WNE A;  3KWV A;  4XCA A;  2OXB A;  5EZW A;  1W9Y A;  1DIW A;  3CZU A;  1W6N B;  2QDR A;  4QPI A;  2R32 A;  1US2 A;  5F39 A;  5LA2 A;  1I9R A;  3VBR B;  4B7K A;  4CCK A;  4ORF A;  4IE7 A;  1DYP A;  2BNM A;  3MHZ A;  5FP8 A;  1S0G A;  1QHD A;  2FD8 A;  3KB5 A;  3ZXF A;  5BUV A;  2DWR A;  2G1M A;  2BPA 2;  3HAG A;  4MET A;  4R9A A;  1IQA A;  4BIF A;  3ALQ A;  3CL1 A;  3VZJ A;  1DP0 A;  2PAK A;  4I3P A;  3USU B;  4AED C;  4DXR A;  3ZXD A;  2ZX4 A;  1NLQ A;  1K12 A;  2OUJ A;  2A5Z A;  3SIS A;  1HRV 3;  4Y5S A;  3MPP G;  2FDK A;  3RJ2 X;  2WA4 A;  1MEC 1;  3MW3 A;  2RS5 1;  1AR8 2;  4YVS B;  3SKV A;  4F7Z A;  2RM2 2;  4N9H A;  4YPJ A;  4YM0 A;  1RL3 A;  1NUK A;  2ZXQ A;  5FY8 A;  1BEV 2;  2R0F A;  4YW5 A;  1KXG A;  4Y1V A;  3AZX A;  5T55 A;  2DUQ A;  3RNS A;  3MYX A;  4FXK B;  4QHZ A;  3LB9 A;  3JUU A;  5FP7 A;  2E63 A;  2R1D A;  1ASJ 2;  3KCC A;  2IUW A;  3I4I A;  3KSC A;  4Y1U A;  2ZZJ A;  4YNI A;  3S6P A;  3BKZ A;  1X8E A;  5C7G A;  1AR7 3;  2ZJC A;  2GP5 A;  5FYS A;  1SLT A;  3WF2 A;  1DGW A;  4Q0V A;  2VZ3 A;  2ZPX A;  4M0H A;  4Q5O A;  1O7F A;  1Z0H A;  4M4P A;  4XBQ A;  5A7W A;  5A6Z A;  4XOG A;  4MXV A;  4Q0P A;  2WT0 A;  1VRH 3;  2GH8 A;  2UWC A;  3U11 A;  3MGU A;  1YXW A;  1VR3 A;  1PZ7 A;  2XBO 1;  3H8X A;  1ZRR A;  5LCW L;  4XXP A;  2JDN A;  4EJR A;  1LHU A;  4D7S A;  3T3Y A;  3ZSJ A;  1JYN A;  4IEY A;  1KS4 A;  3P1I A;  1G86 A;  3E5X A;  1TQ5 A;  4OCT A;  3PTR B;  4V2V A;  2IXH A;  2I07 B;  2MPF A;  5EXO A;  5A33 B;  3AXD A;  1HX6 A;  5A7N A;  4A6S A;  1S0B A;  2KD7 A;  4CDQ A;  3TN9 2;  1AL2 1;  3TOJ A;  4CA9 A;  4YAR A;  5ABJ C;  1GUI A;  4A44 A;  1I6X A;  4BOW A;  3W5N A;  2W91 A;  2N7G A;  5GJ6 A;  1ZBE 1;  4XTM A;  5BNQ A;  1OFN A;  1X9T A;  3V0B A;  2HWE 2;  2ZKL A;  1JZ7 A;  3U78 A;  2NPI A;  2XLA A;  4RFR B;  4QDQ A;  3PMS A;  2E7Q A;  4LOS A;  3VBS A;  2QQM A;  3GZE A;  5A1L A;  3FBY A;  3B3Q E;  3D4K A;  4R9C A;  4TWT A;  5IJR A;  3WZ1 A;  4AR2 A;  4EE2 A;  2VMC A;  4LK7 A;  1STM A;  2I74 A;  3I2H A;  3T1L A;  1RUJ 1;  4D6R A;  1TE1 B;  5KC5 A;  4BK4 A;  1DFQ A;  3JBG 2;  4MGZ E;  1FT9 A;  5C8C B;  2VW1 A;  5FZF A;  1FMD 2;  4YW6 A;  3T1M A;  4U36 A;  3OYW A;  1APN A;  3OY8 A;  1AR9 1;  1RIR A;  2X53 S;  4G4F A;  5FBZ A;  4BIO A;  4KWK A;  2PYT A;  3DYM A;  1LOE A;  3WX5 A;  4LBL A;  4CUB A;  2IXK A;  2XGX A;  5JMO A;  3ZFF A;  4RD7 A;  4YVW A;  4BMB A;  1L3J A;  3LDB A;  3U07 A;  4BME A;  3NV4 A;  2J1E A;  4MGQ A;  1ZBA 1;  2RS3 2;  2LTN A;  1RUF 1;  3CBN A;  5I0U A;  2XHK A;  1UMH A;  2WO2 A;  2B4K A;  4AVB A;  4XW3 A;  2YRO A;  2IC1 A;  1QOO A;  1Y9Q A;  3GJA A;  2ZEY A;  2W1U A;  4HVR A;  4N43 A;  3THP A;  1GQP A;  3T2P A;  4FPE A;  4K20 A;  1FI2 A;  5FCC A;  1F5F A;  1QH6 A;  3O0X A;  1C8N A;  2QTW B;  4N90 A;  5F37 A;  3ENR A;  1TMF 3;  2DFB A;  1K5J A;  1QOT A;  1UYZ A;  2ZGK A;  3IZO A;  3OD0 A;  4MHU A;  3AKT A;  4RGK A;  4KWL A;  2GNT A;  2RMU 1;  2ZZQ A;  1ONA A;  5F2S A;  2Q30 A;  2IVJ A;  2VC9 A;  4FOY A;  4I30 A;  3SHR A;  2VTX A;  2X8K A;  2VH9 A;  2WYF A;  3H9A A;  1RUG 3;  3K4Z A;  2W1S A;  5D2A A;  3J7M A;  1WBL A;  1UMI A;  3T0D A;  3VZL A;  3BYW A;  2ARA A;  3C7O A;  3CHX A;  2J1U A;  3P6B A;  3IMM A;  2DVF A;  5FMD A;  2Q1Z B;  2D6N A;  2QCS B;  2WZ8 A;  3BB6 A;  4UI9 L;  4BE3 A;  2VO5 A;  5I93 A;  5K9Y A;  1Z7S 2;  3VBO A;  2ZGR A;  4B8E A;  4RQP B;  2ETE A;  5FZD A;  2JD9 A;  4OUL A;  4S2H A;  3DPR B;  1VB4 A;  3SCF A;  2KM2 A;  3AP9 A;  4AI0 A;  3B69 A;  2WIN B;  2J1T A;  3U1X A;  2R04 1;  4CU9 A;  3FBM A;  2EIG A;  3WF4 A;  3DYP A;  1IGO A;  1RIN A;  4KGQ A;  3W21 A;  3TEX A;  5CFC A;  1RUO A;  3M2M A;  2Z5W A;  5GZF A;  3PJQ A;  1MZF A;  2W3J A;  1R09 2;  4CCD A;  2AZ5 A;  2YPD A;  1PMH X;  2QFE A;  5IYY A;  5DUU A;  1ND3 B;  4S2D A;  3PIJ A;  1RUD 1;  3H7J A;  1W8H A;  4CP9 A;  1ZA7 A;  5C70 A;  1X8M A;  2HYX A;  2MEV 3;  4XIL A;  3M4F A;  5FY7 A;  2WDB A;  3NNJ A;  3O1R A;  1WGP A;  1C28 A;  1R08 2; 
#chains in the Genus database with same CATH homology
 1XSQ A;  1YQC A;  2BDR A;  1XSR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...