1U5XA

Crystal structure of murine april at ph 5.0
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
137
structure length
130
Chain Sequence
b'KHSVLHLVPVNITSDVTEVMWQPVLRRGRGLEAQGDIVRVWDTGIYLLYSQVLFHDVTFTMGQVVSREGQGRRETLFRCIRSMPSDAYNSCYSAGVFHLHQGDIITVKIPRANAKLSLSPHGTFLGFVKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tumor necrosis factor ligand superfamily member 13
publication title The Crystal Structure of A Proliferation-inducing Ligand, APRIL.
pubmed doi rcsb
source organism Mus musculus
molecule tags Cytokine, hormone/growth factor
total genus 23
structure length 130
sequence length 137
ec nomenclature
pdb deposition date 2004-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00229 TNF TNF(Tumour Necrosis Factor) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1u5xA00
1OQEA 1IQAA 4MXWB 2QE3A 1TNFA 2JG8C 2KA3A 4DB5A 2R6QA 4E4SA 1C3HA 2Q8OA 1C28A 1D0GA 2HEVF 4QQ2A 2RJKA 4MXWA 2TUNA 3B93A 4QQOA 5TSWA 1TNRA 2R32A 3URFA 4TSVA 1JH5A 2HEYF 3TWIA 4G3YC 1D4VB 1OSGA 4OULA 3K48A 2TNFA 1U5ZA 1XU2A 1KXGA 1RJ7A 4QPYA 2WNUB 2AZ5A 3MI8A 2RJLA 4HT1T 1U5XA 1O91A 3IT8A 4QQHA 4QQPA 5HBAA 3L9JT 5KC6A 1D2QA 2WNUA 3B94A 4OUMA 3FC0A 5KC5A 3QD6A 4DOUA 2O0OA 4D7YA 2WNVB 4KG8A 3AB0A 1OQDA 4KGQA 4E4DX 1WCKA 2JG9B 2WNUC 4MSVA 1PK6B 5L36A 1DU3D 5KWRA 4KGGA 5CIRA 1ALYA 1RJ8A 5BNQA 5L19A 4TWTA 2E7AA 3LKJA 4N90A 1A8MA 4J6GA 2ZJCA 1I9RA 2R30A 4QQLA 3WD5A 2HEWF 2JG9A 4NN0A 1JTZX 1PK6A 2Q1MA 2JG8B 4F3JA 1KD7A 2RE9A 4GIQA 1U5YA 2WNVC 4OUSA 3QBQA 4MXVA 2JG9C 1XU1A 3K51A 3ME2A 3TYJA 1GR3A 1PK6C 2OIIA 2Z5WA 3B9IA 1S55A 2QDNA 3V56A 3ALQA 2ZPXA 4G4FA 2JG8A 4RSUA 2X29A 1DG6A 2WNVA 4EN0A
chains in the Genus database with same CATH superfamily
4NIAA 2YU2A 3O0VA 2WBKA 1HDKA 2H6CA 5F5AA 1J83A 3JD71 3OY8B 2D3SA 2OS2A 4MGZE 2JG8C 1RMU3 1W2TA 4IXLA 5FYBA 4P14A 3JBG2 1SBEA 1FXZA 1HN1A 2ENRA 1EPZA 3JB8A 3PMSA 5EHDA 5FP8A 1T6BX 4FTEA 3OEBA 2EVXA 2NYYA 2FDIA 1WUVA 1C57A 1RC6A 1BBT1 1F35A 5J1XA 5C70A 3RYPA 1X9TA 1VRBA 4JKMA 4CPBD 1XSRA 1X8MA 5FYSA 5D8AC 2VMHA 4F7ZA 1GQHA 1OUSA 5T54A 1LU2A 2CGNA 1UPSA 4YVWC 1QDCA 2IXHA 3DUIA 1O8SA 3IMNA 1BXHA 2WAAA 4ZU5A 3TN91 3N9OA 2CHHA 1RUF1 5F3EA 1WCSA 2QKDA 4UT5A 3TOJA 1Q8SA 4PHZA 5K8SA 1X7NA 4IE0A 3WG1A 1UOFA 1VRH2 3LEIA 2C26A 4PDWB 3ZYGA 2VVEA 4EQVA 1QMJA 4GAZA 5C3OA 5CZKA 1AYM3 1W9TA 2WZR2 3RS6A 3ZR5A 4HT1T 4UF0B 2VW0A 1XXNA 4LITA 2OPKA 4E9KA 1VBC2 1IPSA 2Y6HA 4QPGC 2Y6KA 1LULA 1QXJA 1NLSA 4JHZA 4HL0A 5FY4A 2FD8A 2XLGA 4AEDC 3LIGA 5KC6A 3C2UA 4X8NA 4IEUA 2BUKA 2O1QA 3WY6A 4IUGA 2VOWA 2WSUA 3GGLA 2XJRA 4JCKA 4LUKA 4BIOA 1YJLA 5KHJA 3BVCA 4Z07A 2VOKA 2JX9A 5FUIA 2PHTA 2E53A 4DXRA 5IVVA 1R1ZA 3VZLA 1RUI1 1WW4A 1OMIA 4KGQA 4XF0A 2DCYA 2WS93 5FWEA 3T30A 4WVWA 3VHPA 4E4DX 3MW3A 1WLTA 3A7QA 2RS31 5C3QA 3OBZA 1ZVFA 4P9WA 1G9DA 4TTGA 5CIRA 1XQNA 1YQ2A 4Q4X2 5CADA 3KM5A 4EN6B 1AXZA 1GUIA 2VBPA 1QHDA 2CAUA 2RDNA 3U37A 5L9BA 1TG7A 4OZXA 3N35A 3AX4A 4PF5A 1GMMA 4RGAA 1NZCA 2JG9A 3OBTA 2OZJA 2W08A 1RL3A 3GBFA 4XPVA 2L9LA 4M01A 5FYVA 3TBDA 2N7GA 5FO9B 5E8AA 3GZUC 3O14A 5C7GA 1BEV3 5FPAA 3T0BA 3HJRA 5JVVA 4CSWA 4XDQA 4DUWA 5GZGA 2ORXA 4XC9A 3WW1A 4Y1XA 3UETA 1MQTC 1ZBE2 2A6XA 5B2GB 2DCZA 3IN9A 3KD4A 4JTOA 3WOGA 3VD3A 4CCMA 5L9VA 5J37A 2VVDA 5FJKA 4Q4V2 1DYKA 4I3GA 4R9BA 1W2NA 3C3VA 4CDUA 2ZMNA 1LAJA 2XJVA 2X05A 2PLV3 2QQOA 2R073 1YEWA 1KRIA 1V9U2 3WDTA 4HBNA 1DYOA 1O5UA 2RMU3 1OOPB 4QDRA 5KR7A 3MV11 4FPKA 1SG3A 4O61A 2DYCA 2X10A 3WDUA 1MQTA 3POIA 1LOGA 2A73B 2B39A 4HLTA 5A6YA 5IK8A 5HCBA 4COZA 3IDEA 5H9PA 3ZSJA 2C1FA 2RG4A 4QXKA 1J3RA 3AMQA 5HPOA 3J8F3 4GD4A 4GXLA 4AHYA 1VAMA 1KFUL 1ND2A 2P1BA 2R041 1PVXA 3NWKA 4MXWA 4ARXA 4WVMB 1E5SA 1LHVA 4FPYA 4Y24A 1R1A3 1H1AA 5ABJB 4WM8C 5A3OA 4NPLA 1HRI2 4HPKA 2YB7A 4ZKTB 4QHZA 1HN0A 1LHNA 3H1YA 1Q43A 3IDCB 3B9CA 3OPTA 4PI2A 4XFBA 3ZFGB 5FZLA 4A42A 1IPKA 1VBB1 2ARCA 1W8TA 2RM21 1U0AA 1GP5A 4WV8A 1D4VB 2OQ6A 2ZEWA 3PUHA 4FO9A 2Y6LA 2A6YA 1DGWA 2VUJA 4D3WA 1RUH3 1VBD1 1W9SA 3DKQA 3KLSA 1QOTA 2GNDA 3U10A 4W50A 4CXXA 1SFPA 3O1PA 3I59B 2XWBB 4JHTA 4QM9A 4R9CA 4XXPA 1RUC3 4JX0A 1HB3A 1H8VA 3NO8A 5L9RA 4H2AA 1SBFA 2VM9A 2CSGA 4BE3A 1OVSA 2LW8A 5G04L 3BTXA 2UYBA 4MZUA 1WW5A 1QJX2 3T09A 3ECQA 3HBKA 3LSDA 1V6IA 2PAKA 1W6PA 1RUJ2 5IJRA 2A5ZA 5F32A 3RZZA 2P6CA 4MGYE 4LBQB 4LO6B 3SQOA 4BQYA 4EZHA 3QLQA 1JYNA 3WW3A 1PX4A 4PLMA 2WFF1 5FLJA 3DXUA 2CGPA 1NA1C 2D3PA 4RGGA 3AB0A 1W2UA 4IGOA 1W0PA 1FPN2 5GLWA 1WGPA 2DCKA 3LDBA 5JR2A 4ZXEA 2OYZA 5LBBA 3POEA 4QX0A 1O8PA 1H6YA 2DU0A 5L36A 1PIV3 5CU1A 1OLME 4TWTA 4DQAA 1UYYA 2VCMA 4FPCA 4AEJA 4CCKA 2G4IA 3VD4A 3DECA 2BZDA 1WA4A 3LKJA 2QCSB 3NKTA 4Q0SA 4XDPA 3IZOA 1A8DA 4YW5A 4CU7A 3PIJA 1JI6A 1LNSA 4XTPA 3DPRA 1R64A 5CEHA 1KDKA 1RUOA 3AMHA 5GZCA 4AVTA 4BQ2A 2GC2A 4PLNA 2R0FA 2PHUA 3AP9A 4JGYB 4E8DA 3SXWA 3SH5A 1S0JA 3U78A 1YQ8A 3D82A 1CD3G 3KCCA 3LWCA 3CBNA 4YZ3A 4Z92B 3VB9A 1FYUA 4CYDA 4BWOA 2P3KA 3FUOA 2XVGA 2IVJA 2QQNA 4Q0UA 5BPXA 5JCTA 2IXIA 3K4ZA 3GJBA 3WHUA 2HYKA 4AI8A 2AH2A 4CEWA 1NUKA 3ZDVA 1OH4A 1FOD2 1YLLA 2VMIA 5F7UA 4DUXA 3NAPA 4XAAA 2CYFA 3POYA 5A32A 2W52A 1J1LA 4V2VA 2ZMKA 1XNKA 1ZYBA 3OGGA 1DQ0A 3E5XA 2HWF3 4URTA 1BZWA 1R081 2X5IC 4IEVA 1CZSA 2VVFA 5ANQA 4CUBA 3G7DA 1AL22 2YC2A 4AVVA 3FBMA 2HBTA 1LOCA 2H0VA 1CR7A 1VLNA 5JI7A 1RUG1 2BW8A 3WVJA 3N9MA 3FUQA 3G6JB 5FLHA 4CE8A 5T5LA 4YGBA 4XBLA 2E31A 5FCCA 4QQ2A 5DG2A 2JD4A 3POFA 4O9GA 1UX6A 2P17A 3USUB 2YC0A 5FZ1A 1RXFA 1BCXA 1ASJ3 1XNBA 1ZZ6A 2DURA 1RMU2 2YGMA 3DXTA 3LSEA 1SLTA 4JGZC 3T3YA 3WF0A 2XUMA 4NPRA 3PVEA 3C7OA 3KSCA 3ZMNA 2E51A 1RUE3 4Y1VA 2ZOEB 4W6XA 1G86A 1V6KA 3HMYA 4OHXA 4UFLA 4XFIA 1HIXA 4H7MA 4IQPA 3GNEA 2ZGKA 3ZIXA 1V0AA 3POWA 3GZTB 4P9YA 4AI2A 1O91A 1RVF3 1QXPA 3Q8EA 1EAH3 3ZXEA 3RJ2X 4RHV1 1AUYA 4LLOA 5FWJA 4BQ3A 4FSJA 4M3CA 2NMOA 1WCQA 4RQPC 2GC1A 1PO13 4YW2A 4DXZA 4Y1YA 3VHNA 3IM0A 4L92A 5FUPA 4Q27A 1BHGA 1W2AX 4FT8A 5APAA 4BLIA 5BNPB 2ZACA 4PBOA 5L7OC 1YYNA 1OFSA 1ZZ9A 2A6ZA 1AR73 4PCRA 4L2NA 1AYM2 2HKXA 2VG9A 1DGRN 2DVAA 2RS51 3VZNA 4AVAA 5C6CA 4Y4YA 3RYKA 2XJQA 3S5AA 2FMYA 1IS5A 3AZXA 5AFBA 1JZ3A 3W5NA 4OQ8A 4N90A 4A7ZA 1QQP1 4CCNA 3MLKA 1LEMA 3ZFFA 1SLAA 4E4ZA 1US3A 2Y6JA 3VBHC 4QQLA 2RVAA 2FDKA 1ENSA 3B7MA 1MEC1 4CCJA 1PGW1 1Q8VA 5C8CC 1ZZ7A 2WS92 3T08A 1ZX5A 4QDQA 4EE2A 5ANNA 3ZO0B 1JHNA 1GWMA 1QDOA 3WW4A 3VBUB 2C9AA 3I3DA 4AI3A 4YRDA 5GZDA 3ORJA 4XVHA 3VBHA 2LUWA 4INDA 2Y33A 4TZDA 3HAGA 4FOQA 4Q1RA 3WNXA 5JIUA 3R0RA 4I0WB 1F5JA 3VZOA 3POJA 2HWB1 3BIWE 2A3WA 5JZGB 1H2NA 4A6OA 5A7WA 4AHXA 3WG3A 3KT4A 4LEJA 2VPVA 1S4CA 1ZBA3 2R061 1PZ8A 4FQZA 3ZVXA 1GBGA 1BEV2 2PAMA 5HXVA 2R1BA 3K4AA 2QUOA 4FPGA 2ZX1A 3PLQA 5D2AA 4WM7C 3FWEA 2GSYA 1LHUA 5BNNC 5J98B 3BB6A 2XHNA 4DY3A 2J1SA 4NAOA 3M4FA 4KWJA 4AR2A 2O14A 2VZOA 2B9UA 5FDBA 1HXS1 1W6OB 1O3TA 3IDAA 1HQWA 4Q4Y1 5FAXA 2PLV2 1RUF3 3AVRA 2NN8A 2R072 1MS5A 4HVRA 5IK4A 1XE0A 4XHBA 1XNDA 2RMU2 1C5HA 3OGVA 5IFPA 2BYVE 2XDVA 2ZGOA 4K9SA 5F1RA 4ZZ8A 3D8CA 4DNYA 2LS6A 5BNOA 3HEIA 5FPUA 2H6BA 2XMLA 4W4ZA 1C8M1 5LBFA 3TWIA 4NROA 4H7LA 5FPLA 3VKNA 2Y0OA 3HBZA 1LRHA 2O8OA 1XU2A 1GOFA 2ZXQA 3M3EA 3J8F2 4GJZA 4CP9A 5T50A 3O1RA 1YI9A 1URXA 4LK6A 4N43B 1MZFA 4LE3A 1PZ9A 2B9VA 1XC6A 2JECA 2CTVA 2ZGSA 4HONA 5LA0A 1R1A2 3WT3A 1O3QA 5FPXA 3ZYBA 4N53C 1S0GA 4PIYA 4I02A 4XACA 4V2WA 3NQHA 4KG0A 1TME1 4QQHA 2B46X 2JJ6A 3GCWA 4UOJA 1RUI3 4XYXA 2XONA 1PGL1 1RIRA 4LHKA 1RUH2 5EJ1B 2W1WA 3LOBA 2VUAA 1Q5OA 1XYPA 2UYAA 1W8WA 2YDEA 3JQWA 1HQNA 3VBRB 1CX4A 2VQTA 3LD8A 3VBOA 5JPMB 4DZGA 2TBVA 1P8JA 1RUC2 1WZXA 5FO7B 3ZMOA 5HCFA 1EV13 4BLJA 1QJY1 2D3RA 2IXCA 4FVVA 4P9GA 5A1AA 2OZ6A 3EJKA 2WO1A 2WZEA 2ZEYA 2K9ZA 1CAXB 4JC1A 1GWLA 1GZTA 3B3QE 4B7KA 5C3PA 1BMV1 4E2QA 1JU3A 4XFGA 1CAUA 3NNLA 4IV1C 4K1YA 4NR1A 5B4XA 2P3IA 3H8RA 4QPIA 2ZJCA 5FY0A 1JW6A 4LOSA 1EPWA 5A3LA 2ARBA 3T2QA 1IGOA 2WO7A 3OOXA 4RR3C 1QEXA 1Z7S1 5FKCA 4QXHA 5L73A 3ZPYA 3PMEA 2ARXA 3PJYA 5FBJA 4IEYA 4KBBA 3R4SA 4IV3B 4OUSA 4GZ9A 4E2GA 1PIV2 1FMD1 1IZ3A 2W87A 5I0DA 1KITA 4ZONA 4KU7A 4OI1A 5EPAA 3RMYA 3DN7A 4TLGA 4XJUA 2ET7A 5FJHA 1OHFA 5FZOA 5FXVA 5A3PA 3OUJA 5JXJA 3FLTA 2NPIA 1VMHA 2PFWA 2ZPXA 2VZ3A 4B8EA 4KNCA 3LPFA 4GA9A 4CUGA 2ZX2A 2GP3A 1W6QB 1FI2A 1I6XA 2EICA 4YWAA 3T2PA 2QE3A 2EIBA 4O65A 2R043 2AUYA 4XABA 1IQDC 2EALA 1SACA 4IE6A 1ODNA 2BRTA 5GLTA 5LA9A 4XE9A 2Q0AA 3CKHA 5LRRA 1JZ8A 4HKWA 2UY8A 1UY3A 1LGBA 1HV1A 4AOCA 2FZ1A 2I07B 2JD9A 1UU6A 1VBB3 2ORZA 4LKFA 4Q4W1 2RM23 3CZJA 3ACIA 1WLDA 3B00A 3KGLA 4UI9L 1UZVA 3KT1A 5DUUA 4B1LA 1X8EA 3N3HA 2VOTA 4YM2A 1UX7A 3QH6A 2WWSA 3I2OA 2R32A 2OKXA 4FOWA 1GLHA 1COV1 1TEIA 1AR91 2HWF2 5I8YA 5FXXA 1IS6A 1E5IA 2R7EB 2VO5A 3I2IA 1W0OA 2D40A 2W3JA 1UW8A 3JZVA 4Q2FA 3DV8A 2YPJA 5FYZA 2XVLA 3KV6A 5FK7A 1W8OA 4IETA 5CFCC 2ZX3A 2DCJA 2DBIA 2J1RA 3PL0A 3WP3A 3INAA 1JBCA 1GNYA 3AYDA 2VNOA 1XE7A 2WNUB 3N4MA 1NY72 1UO9A 2V73A 2AEZA 4NRPA 4UFKA 4XZPA 5IW0A 2RJLA 1UCXA 2V4AA 3AFKA 1KS5A 3GM8A 2A3XA 3W59A 4LXLA 1MZ6A 1WCUA 3C7HA 3WF3A 4CVUA 3VDAA 3ACHA 1ASJ2 4JDMA 4ZHNA 1POQA 3LGRA 2KXLA 1YC61 3LFMA 4PBPA 5HBAA 3F2ZA 2JDYA 4P5YA 5CFCA 1BKZA 3Q8FA 1AR61 1NYWA 1RUE2 2QTWB 4PDWA 3HNBM 1QOSA 3B94A 1GZWB 3NJZA 3L2YA 3APBA 2WT1A 5JLVA 1QIQA 2J42A 4PLOA 4E4HA 4BA6A 3O12A 3H3ZA 2BTVC 4G9SB 4K7JA 1AYN3 4Q0QA 5I0SA 3HQXA 2WZ8A 4M0HA 2J1TA 2D6NA 2CNAA 2XKOA 1RVF2 2ZMLA 1BK0A 1PK6B 4YVSC 1EAH2 1OI6A 3MLJA 4CP2A 1WW7A 5LEKA 1YQ5A 1QNYA 3GHNA 2VXRA 3NNGA 2E7TA 1PO12 3VDCA 4CCDA 1UU4A 1TMF1 1UYXA 3ETQA 3D6EA 2GNBA 3CNAA 1WD3A 4WVZA 4QX5A 3PTYA 3WD5A 4BQXA 2C24A 1AR72 4NN0A 1AHSA 4NHMA 4XUOA 1G7YA 4PF1A 3SCGA 4JDNA 5KXBA 1W05A 2QQJA 5DUWA 1OVPA 4XFCA 2XBO3 3CQOA 2JIGA 1W8NA 4YZ4A 2VQUA 3WNLA 1MZEA 5FIXA 4ZY9A 4XF9A 2Y38A 1LTEA 1VJ2A 1HJFA 2B7YA 1ODMA 1L3JA 4RD7A 4KI5M 5EFUA 3KVBA 5GLUA 5JOWA 1RHI1 3W5MA 2VL4A 2OW4A 4LBKA 4RN5A 1UYPA 2G9FA 3ILFA 2WO2A 3Q9OA 4N9IA 5F39A 4BK5A 1W28A 5HCHA 4EN0A 1LESA 1SCRA 2DBNA 4WVVA 3ACLA 3UJQA 4CDQB 2FDFA 2HWE1 2J1AA 3E5QA 4HFSA 1RTVA 1HW5A 4L97A 4M0NA 3VKLA 1L7LA 4DB5A 4XF4A 1RUNA 2G9ZA 4MX3A 1CAWB 1UMIA 2IXJA 2IXLA 2XOMA 3THDA 3U4SA 2UWCA 3CL1A 3HQUA 1CWPA 1JOJA 3BN6A 4JDOA 1I5ZA 1SDWA 1WKYA 5F3GA 5LY2A 2W1QA 3MFAA 4LOTA 2VCAA 4UYBA 1DCSA 1RUD3 3B93A 2VZSA 5TSWA 4BMEA 1ZBA2 4D69A 1IG0A 2BEOA 2YPDA 4AGRA 4D7SA 1GFF2 1F9KA 1OA3A 1YNAA 4M3CE 4QD2A 3WDXA 5DPNA 1IKQA 4FP2A 5HI0A 4AXOA 2PXJA 3U1XA 3FHIB 5CG8A 2PYTA 1J84A 3I3MA 1X33A 5IYYA 1U5ZA 2NZ9A 4U2AA 4WVMA 2HH9A 3BODA 4QX3A 5ABJA 3H50A 2AZ5A 2D93A 4MHRA 5IVCA 2QFEA 3RFRA 1RUF2 4XQ4A 3BU0A 1VBA1 1R093 1XNTA 3ZFGA 5LK7B 1K5MC 1UZYA 2QQVA 2DVBA 3FN9A 5C9AB 4LIUA 3KT7A 3T0AA 2PTMA 2VTXJ 5FPZA 3W58A 5KXCA 3M8LA 4AEKA 2QQKA 4EWDA 1RITA 1AF9A 2RS53 3WW2A 1WD4A 1NQJA 5IVBA 5K0UB 3WUDA 3I59A 3KGZA 2QJVA 4UBGA 2DVGA 1H4HA 3O5SA 3WQBA 1G9CA 4UFJA 5H9QA 3AKQA 5LK5A 4D6QA 1K5MA 3N9LA 1QQP3 3WNPA 4YW1A 4AFMA 4AL9A 4BB3A 2FBEA 4OVEA 1ZZBA 5DUVA 5EWSA 1QJU1 5LBCA 1T6GC 4Y3OA 4I2OA 1A78A 1D4M3 4M4RA 2JDKA 2VNVA 1NXD1 4LBQA 1RUI2 4XFHA 5FPVA 5C3SA 4AFAA 3SKJE 1X9PA 4COYA 1UQXA 3RZKA 1A8MA 1QH7A 4W6YA 3ZXFA 4LKSA 3GBWA 2QZ2A 1OF3A 2F4LA 4ZS3A 2R30A 1HJGA 1KJLA 2MHFA 3UV9A 3RZGA 2KM2A 1G9BA 2C6SA 2D5FA 4GMP3 5F2SA 1BLZA 3PIGA 1JYTA 3FHAA 2J7MA 2GAUA 3I4IA 4JKKA 3BCWA 1JTZX 3QACA 4XF3A 1EV12 1UY0A 1CAVB 4CDXC 3U75A 5T55A 2W9XA 3A0NA 5FZMA 3CU7A 2WWJA 5I0UA 3BUCA 4OUEA 4XHXA 2AR6A 3VDBA 2NP0A 3NV2A 2JG9C 2IUWA 1JOPA 3ZX7A 4XURA 1DQ2A 2VUDA 1HQLA 2R063 3ATGA 3MEPA 4PIXA 1WA6X 1PO23 3OB8A 1JZ5A 1XRUA 5T5OA 1JXNA 5JXHA 1YQCA 4Q29A 1H2MA 2XLFA 4FPJA 4CDXA 4AVSA 2WUHA 3USSA 2R16A 3LA3A 3ZKUA 3OJBA 3UNPA 5LA2A 1VRH1 2WINB 3I97A 2J1EA 1SLBA 3AMNA 5LRSA 2VOVA 3ZXKA 1NCQB 1HXS3 1W2OA 2PHFA 1OQ1A 3AZYA 3E1F1 3FE5A 4ITCA 4MGQA 3ZXJA 4YZ2A 5DAPA 4Q4Y3 2WZR1 3M3IA 1DHKB 3ZR6A 4CDUC 5AC91 3RZHA 2BGCA 4P00B 1IS4A 3BU7A 1DGWX 4P08A 2ARAA 2UWBA 3B01A 4GWIA 3M3CA 2UY9A 2WT2A 1C28A 2VW1A 1IPJA 3AKRA 4LJHA 3WSOA 4RS5B 1S2EA 3I49A 5SV5A 2VXJA 2P3JA 1UMHA 3VBSB 2RJKA 2WR9A 4CCCA 5FO8B 3HOBA 2JKBA 2WAOA 1TNRA 1J3QA 5EJ3A 1LODA 3I7DA 3SH3A 5SV8A 3THPA 2XQXA 4N7IA 1TVGA 2JB4A 1CQ9A 2R042 3E6BA 4Z2WA 1ND2C 4DRVA 3VV1A 2ZX0A 5HV0A 3CMGA 1OSGA 3BGAA 3V65A 1PMHX 1F4AA 1CZVA 2WQ8A 4DXTA 4Q4X1 4UFHA 5FP9A 4JV4A 1VBB2 2RM22 1GOGA 3USUA 5DUXA 5FRAA 5D1IA 2QQLA 3UKNA 2P2KA 5BXXA 1HB1A 2WL1A 4B29A 1S2BA 1ENXA 4ASKA 3Q8AA 5CFDB 1ZZCA 4P9IA 1PVC3 2PQSA 3AYCA 4AHWA 1UIKA 4MH0E 3O1SA 5KHIA 4QB2A 5EIYB 3AKSA 2DVDA 2QQMA 5E88A 1B35B 2V09A 1APNA 2J1UA 3ZXLA 2FDHA 5HXMA 2RDQA 1YIPA 3N7KA 4ASMB 2NLRA 4XETA 4XJ9A 1IG3A 4QM8A 4GH4B 4DOUA 3RJRA 5BNPC 4AYUA 2CU5A 1HRV1 2AGSA 4H55A 2I74A 5FZ7A 1I3HA 4CUAA 2D5HA 3EBRA 1W3VA 3TNPB 2VU9A 1FNYA 4IE4A 4I0BA 2Z79A 1W6NB 3H3UA 3AP6A 1LOAA 4UFMA 4D0QA 1Z7S3 5BNQA 5JWPA 1O7FA 4K6BA 5DG1A 2E7AA 4URAA 5BNPA 4IGQA 5C33A 4OHZA 3PVNA 3ZN6B 4GMP0 1FMD3 4Y22B 1H30A 1O4TA 4UW6A 1F15A 2B42B 4EROA 1UY4A 2E9QA 4UW5A 1AYN2 1LGNA 5F5IA 2MNGA 2QQUA 1H1IA 2W0XA 3S5QA 1QNWA 2WDBA 2JG8B 1H1MA 2R1DA 3PTRB 1GQGA 3WNKA 2JDAA 2FCTA 2WNVC 3DPRC 3LA7A 3ZM8A 4MXVA 4XW3A 3RNSA 3CJXA 1T2XA 1HRI1 3K51A 4YW3A 3RSJA 3WNMA 1GR3A 1S0FA 4LUMA 1PMIA 4AQTA 4D6RA 2W95A 5DAXA 2ZGMA 4AI9A 3K2OA 4HANA 4IDZA 3ZPOA 1O5LA 2AEYA 2XR4A 3FJSA 3POBA 4RSUA 3AXEA 5D8AB 2OUJA 4P02B 4YLZA 2WNVA 3WQ7A 4NAMA 2JENA 3ZIWA 1OQEA 4YVWB 2XBO2 3RGBA 4Y1ZA 2ADDA 3VBUA 3AVSA 3OGJA 4Q4W3 3TEWA 3WCRA 4CEWC 1DGRA 5IVJA 4HSJA 5D21A 3VD7A 4FFIA 3T4VA 3KCXA 4COUA 1UF2C 2KA3A 2Y8KA 4TN7A 3UGGA 3SISA 3NAPC 4RFRB 4HK8A 4BM8A 1DQ5A 1COV3 1GANA 4K1ZA 2YFZA 4HVQA 5CA6A 4I30A 5JZGA 2P5BA 4OHYA 1OKOA 4MYEA 1GNZA 5DAVA 1QU0A 1XPWA 5FP3A 4A45A 2A7AA 4HSLA 4ET7A 5ACA3 4QPGB 4NOTA 2XL7A 1OPMA 1G6NA 2QQWA 3K3NA 4XCAA 5C3RA 4AEDB 1ULEA 2TEPA 4TXWA 3GJAA 4ZPIA 3ST7A 4QT6A 4DY5A 3MIBA 3UYJA 1H2LA 5FZAA 2VD7A 4OULA 1JZ7A 4AI1A 2XWJB 4KL1A 4IW3A 4P9LA 1W6OA 3FBYA 4Y5Z0 1CPNA 1J59A 4QGNA 2O8QA 2HWD1 1LR5A 4BXFA 4Y26A 3UT0A 4XQWA 1UAIA 3AJZA 3LF7A 1O3SA 1O4YA 1WWYA 1CESA 1RUD2 1UY1A 2W39A 3IPVB 2W94A 5FK8A 1GNHA 1GP4A 2AYHA 2WA4A 3M70A 3PUSA 5FYYA 3IIAA 5DN2A 3ZSEA 4AI0A 4AVCA 4IERA 4XJ8A 5GJ6A 1MS9A 3KZ4C 4C0BA 5JOZA 4AGGA 4LIVA 2VOXA 4DUVA 2W91A 4N43A 2ZHKA 1LOBA 1REFA 3H0OA 3LA2A 2PAEA 5KHKA 3ES4A 4MADA 1QJZA 1US2A 2QDRA 3VBRC 2BU9A 3M1HA 4IGPA 5FBZA 2VZQA 4UBHA 4GKYA 1XNCA 4X6RB 1R092 1FOD1 3TEYA 5AFEA 3KS7A 3WR0A 4QKNA 2AENA 4M00A 4YYOA 4W65A 3VHOA 1ALYA 1RJ8A 2EAAA 3QOPA 5C4WB 4Q0PA 2QQIA 2WNOA 3PUIA 3S7IA 1EUTA 2P3YA 1LOEA 2RS52 2XUEA 3VBRA 3OBRA 3I8TA 2X53S 4EN8B 2ZCWA 2FCUA 1PMJX 2D6OX 1AL21 2ZEXA 4QGLA 1C1LA 1O6UA 3RDIA 3WHTA 5FOJB 3BTYA 3OG2A 4TYSA 5FXWA 1QQP2 1BJQA 2Y34A 3C8XA 4YW4A 5FYTA 4YPJA 2Q1MA 5KXEA 1UKRA 1UKGA 1CAXA 3VHRA 3VL9A 5A7QA 4ZS2A 3HNMA 3PUQA 2E6VA 3ZFFC 4EN9B 5FY1A 5E89A 3AL5A 3VDDB 1D4M2 4AW7A 2KR2A 4R4XA 4Z2AA 1MZ5A 5EYXA 1AX1A 1CPMA 3WXPA 2HWC3 4C1XA 2Z5WA 2E7QA 3KHBA 3MW2A 2HWE3 1LJ7A 4XFFA 2W46A 2XXZA 3CLPA 4G4FA 1YQ6A 4LHSA 4WM8B 3ZYFA 1UOGA 4Y5TA 1O4ZA 1N3PA 4AF9A 4XUQA 3HT1A 3MICA 1K5JA 2A71A 5C71A 4ES9A 1EYBA 1DGLA 1KQRA 2RS13 4CDWB 3AXDA 4FFHA 2FDJA 3SLIA 2DTWA 2SBAA 2F17A 4A41A 4NMIA 1JHJA 2R062 3H8XA 1ND3C 1G9FA 3AP7A 3WNOA 4AE2A 1PO22 1C1FA 3LE0A 3H42B 2YFUA 2YC4A 1W6QA 4HOOA 3DYMA 4NPMA 5A6QA 4UAPA 1E5RA 2OA2A 1XE8A 5T5JA 2BWCA 2XL9A 3JD73 1GKBA 4HG6B 3IAPA 5J36A 3DEMA 1DBNA 5A7SA 4A3XA 5IHRA 4KWKA 3ITQA 4NHLA 5FZIA 2VTFA 3NV4A 1OA4A 1HXS2 1IS3A 1JU4A 3P3NA 2FZ2A 4XBNA 3MV01 5FYUA 1L7QA 3CF6E 3R4DB 1AYM1 2Q1FA 1ND3A 1N1TA 2CL2A 4YGDA 1FATA 1XYOA 1VBA3 1H0BA 1PNGA 2VMCA 3Q8BA 2YBKA 4NO4A 4META 3K48A 1SHWB 1BBT3 5FQ0B 1NA1B 2Q8EA 4XEZA 1K12A 2NMNA 3KCYA 3SC7X 1RB8G 4LK7A 4FQ4A 1ZRDA 2VZPA 3FX3A 3H3LA 3ASIA 5K9YA 4AFBA 3ZN5A 4CZSA 5BNOC 3FLRA 2AC1A 1S1AA 3MHZA 3IDBB 1OLRA 1CZTA 1NQDA 1LEDA 3TN93 3NJXA 4QHBA 3IT8A 1LHWA 2IWGB 3OF1A 2WS91 5BUVA 2CWMA 3D0JA 3QH7A 4BYYA 3TEXA 5T3NA 2D6PA 2R49A 4AFCA 1CX1A 4E2SA 1CGPA 1ULDA 4GB31 4ZU7A 1QJU3 1UL9A 2WNUA 4LORA 4Z82A 1DFQA 4GQ7A 4MOAA 2ZX4A 3H9AA 3ZN4A 5IK7A 4XF1A 3BYWA 5I8TA 4YG0A 1OQDA 3WDVA 2Q4SA 5F9TA 3N7LA 3WDWA 4A44A 1S2KA 1POV1 4BISA 5IK5A 1PVC2 1Y4WA 2YZ4A 1GP6A 3DKWA 3VBOC 2OXBA 4IEPA 2E63A 1GZWA 3V0AB 1BEV1 4A2UA 5E1RA 1UPIA 3X29B 2E33A 1KGYA 1E5HA 4DXSA 4IE7A 1W8UA 5LASA 2RS33 4QXCA 5FMBA 1H8TB 4YGEA 1PK6A 2X5IB 4OLLA 3OUHA 3LAGA 1XOYA 4QPIC 2GH8A 5GALA 4A7YA 3MIFA 1CIWA 3MYXA 5EZWA 2PLV1 3S6PA 1Z7S2 3QBQA 4CU9A 1OBNA 2B8MA 4HXCA 3WCSA 1SFNA 1PM4A 3C7GA 3RI9A 5A33B 3JXSA 4HN0A 3D0SA 1QXRA 4B4QA 5DABA 1TE1B 1JN2P 1FMD2 2QDNA 1NLRA 2Y26A 3KWVA 3MDPA 2CDOA 5LW9A 5AC93 3EHKA 5CNAA 1SFYA 1JUHA 2JDMA 2YXSA 3WZ1A 3M7AA 4DS0A 1NT0A 3J8F1 1ULPA 1SMVA 1W6MB 4JGZB 1WMFA 5FREA 2D6KA 2EXHA 5A3WA 4AFDA 4CDQC 4JAAA 4HETA 1N47A 1F2NA 4K40A 4Q1PA 4S2HA 1AR81 2JICA 3GXUA 1R1A1 4MHUA 2WKKA 2IFRA 5FZ8A 2R0HA 3IMMA 2I2SA 3KQ4B 2WA3A 4IEWA 4FFGA 4DMIA 1QF3A 3KVAA 4A7KA 4LO8A 4XJAA 5EXOA 4NRMA 4QXBA 1LECA 3NSTA 4FPHA 2P34A 4GJYA 4CDQA 1H9WA 2WQ4A 3RVHA 2TUNA 4O7XA 2K0GA 1S0EA 1BVP1 3EXUA 3U11A 1H9PA 3EQEA 4OZOA 4CEYB 4Q4W2 3B69A 3IKWA 3C7FA 4D8MA 4QWNA 4RQPB 5DDJ1 1RUC1 3LPGA 5KHGA 3RPQA 2DFBA 1CAWA 1PX3A 2QZ3A 5F6KA 1NE6A 1Z78A 3VKOA 4AAXA 3DCQA 2OQ7A 3CEWA 3O0XA 4G3YC 5L7OB 5K4LA 3H7YA 4F8AA 4GALA 2TNFA 3O1UA 1COV2 1F31A 2ZBJA 2Q1ZB 1KXGA 1VALA 4IE5A 1DQ6A 1LHOA 3ZSMA 1E57A 3SHRA 3O1MA 1WBLA 2YBSA 4R9AA 5J09A 2VCBA 2XJUA 3A0KA 4FOYA 4BU2A 1K45A 1QH6A 4JKLA 3ZYPA 2C4XA 2WN3A 4NHYA 3THTA 2WC2A 4J25A 5ACA2 1SPPA 5ISLA 3ZXAC 5T52A 2OVUA 2ZABA 4LBQD 2FHRA 5ERLA 3HT2A 3AKTA 4A6SA 1HRV3 2JIJA 4QQPA 4FAGA 1WLCA 2GZWA 5LWBA 3H8OA 1VBD3 3OY8A 2AREA 4QDSA 1OT5A 3HWJA 5GZFA 4A4AA 2IZWA 5A1LA 3L9JT 4OI0A 4SLIA 2VR4A 5FKBA 5BYNA 1DP0A 1PIV1 1DZRA 3ZKYA 1PHMA 5C8CB 2YG0A 3E5UA 3M2MA 3C7EA 4WBBA 1BYHA 2WYSA 5FZEA 1WBFA 2ADEA 2JE9A 2RDSA 4ATFA 4D7YA 3BPSA 3TYJA 4AWDA 3D3AA 1CN1A 2GNTA 3P3PA 5C9AA 4HMZA 3FMGA 4WZFA 1Q3EA 2W1SA 4PDWC 4UFIA 3TAYA 1ZA7A 2WT0A 1FT9A 4NIIA 1YXWA 3EO6A 1KDMA 1SEFA 4O9EA 1ULGA 5K0UA 5A3TA 4FXGB 3FLPA 3MIEA 2WFF3 4XOGA 4ONUA 5I93A 4RGKA 4BOWA 3MIHA 3WQ0A 2VGDA 4NWWA 2ES3A 4BZ4A 1DF0A 2EIGA 1XYNA 2HEWF 3L2HA 4AK3A 2D6MA 5FTTC 1ULOA 4YM3A 2VZUA 1Z0HA 3HQRA 2RE9A 1ZM1A 2LRPA 4WM7B 5BNNB 2HJIA 1DLLA 4PJYA 4ISRA 4HKLA 4UF0A 1KFXL 4ZU4A 1VAVA 1VIWB 1EUUA 2ET1A 3ON7A 1NKGA 1ULFA 4OMDA 3RZMA 5FFOC 2BJSA 3ENRA 3NV1A 3NW4A 2HWF1 5FY5A 4DINB 4OQ9A 5DZGA 2BNNA 3V0BB 4BJ0A 2ZKNA 3ALQA 3VD9A 2V5DA 2UURA 1FV2A 3H1WA 1CAVA 1LGCA 2AACA 3P1IA 3NNJA 1V6LA 2Z2SB 1JMUB 2ZGRA 2NQYA 3WV6A 3H7JA 1FX5A 1GOHA 2YBPA 1NY71 3T2OA 3U07A 1RYYA 1TNFA 5FZCA 3R6SA 5JAXA 4QX1A 2VUCA 3MO4A 2ZGLA 5FYMA 4ASLA 2A1XA 2R6QA 3WP5A 4IL7A 2HWC2 1MPXA 3LIHA 4QPWA 4FOVA 4JQTA 4CCLA 4EWAA 3U4XA 1AZDA 1AX0A 3I2FA 3HD8B 2HWE2 1D0GA 4RS5C 3SEEA 2XG3A 4V1PA 1W03A 2WN2A 4FI9A 1RUE1 3J7HA 2HEVF 4L11A 4N53B 2YY1A 1NCQA 1R083 2YMZA 2WQZC 4OYUA 4CA9A 5GLVA 2HWD3 2RS12 3LEGA 2PHLA 2BDRA 1SZBA 2GC3A 3FHQA 1RUG3 4K21A 2HEYF 3S30A 4BQ5A 3FFZA 1DYPA 2CAVA 2RR11 2PN5A 1OOPC 2VQAA 4RS5A 3WP4A 5BY5A 4MG2A 1EAH1 4EN7B 1HKDA 5FMOL 3VBSA 3N9NA 4Y20B 2YROA 1AXKA 4M3CF 2JWPA 1Y9MA 4XMAA 2XJPA 2GP5A 4NVPA 4P9JA 4SBVA 3JD72 5FZDA 3KV4A 5HCAA 5H9SA 1W8HA 2V5YA 3OYWB 2A6VA 1AR71 4FPFA 1ZRFA 3KV9A 4IV1B 4Q0VA 1OOPA 1OPOA 3DYOA 3ZYRA 5ABJC 4YFWA 4YM1A 1A6CA 1VBA2 5CKQA 3BTZA 2I45A 3W21A 1B35C 2YYOA 2JDNA 4RR3B 3ZFGC 1BBT2 3DGTA 4UWDA 1D2QA 2ZGUA 1V70A 4H3WA 4C90A 5KC5A 1I5PA 4BH9A 5A3UA 2O0OA 3N7JA 1VBE1 3MGUA 4OFGA 2ZGNA 3SITA 2KD7A 4MLOA 4WZCA 2HYXA 4OMCA 5CFDA 4RHV3 3T1LA 1WCKA 1G8WA 4J1XA 3TN92 4MSVA 4RL7A 3AZZA 2HBUA 3JB4C 3LDKA 3D5OA 1B35A 4LTAA 5L19A 4BK4A 1HLCA 2IC1A 4AQSA 1UXXX 2VZVA 2VNRA 4GH4A 1AJKA 1MS0A 1QJU2 4J6GA 5LY1A 1UY2A 3GZAA 3JCIA 1MR5A 3OEAA 4GWNA 2GN7A 3AFGA 3E6DA 5F2WA 4AQ2A 4IEXA 3ES1A 3UGHA 2EIDA 3WEZA 4R52A 2QQPA 3RYRA 1J1TA 2VH9A 1ZA4A 5CISA 1W6NA 1ST8A 1WMEA 4JRLA 4BHPA 4GIQA 3A23A 5EP9A 4PI0A 4XJWA 2MEV1 3HPNA 2JKXA 5IWFA 4KH9A 2YU1A 3H1MA 1ZBA1 1BQPA 1O59A 4XFAA 3ZN6A 5A7OA 3KMHA 4Y22A 2VE1A 1XSQA 3ME2A 2ZAHA 1W3XA 1MEC3 2MPFA 1CONA 2OT7A 1W06A 1EP0A 2W68A 3PNAA 2A75A 4JRAA 3JU9A 3UGFA 2XKPA 4QMAA 3AYAA 3AMPA 2JG8A 4LO5B 5JPNB 2RS32 4CXWA 2JDPA 4MGSA 1OFNA 2FQPA 3ZXGA 3U0ZA 4I0AA 3SCHA 3JBG1 2XJSA 4Y1UA 1YWKA 4FP3A 4CU8A 4QKDA 4A3ZA 3MW4A 4C8DA 4GKXA 2Y6GA 1O3RA 4JGYC 5G05L 5J96B 5CFCB 1DIWA 3ILRA 5LEJA 2VY0A 4N9HA 1MVEA 5A7NA 3ZFEB 2DWRA 1OC1A 5GZEA 2W1UA 3ZDSA 1RINA 2ZZJA 2HWB3 4BQWA 5GKAC 4W6WA 2HLEA 5JXIA 5D8AA 3TRSB 4CP0A 5AC92 4OI4A 2ZHNA 4YVWA 4YW7A 4C0HA 2DUPA 3VBFB 2ZA9A 4FPLA 3VN4A 1FV3A 1NCRB 3O1OA 4JGYA 4TSVA 3OUIA 1NOVA 5CKNA 1F8VA 3N9QA 4W8JA 5F6LB 1JH5A 2VC9A 4NHXA 3CJIB 4LBJA 4U36A 4K8RB 4NE9A 3AP4A 2Y0IA 4HN1A 5E16A 1V6MA 4YZ5A 3GYDA 1D0HA 4MUVA 4QPYA 1NZIA 3OTFA 5FY7A 4HZFA 4AZZA 4QPGA 1JUIA 1VPHA 2VZRA 1U12A 3AZVA 3MI8A 4Y4RA 2JDUA 1VBC1 4GB33 4YVSB 2Q30A 5JR7B 5IUQA 5JOYA 4AEDA 2DUQA 2Y60A 1MS1A 4BMBA 1OKQA 1X50A 1C8M3 3MFCA 1KEXA 2ZEZA 4NUBA 1EV11 2QVSB 5A1FA 3AM2A 1POV3 4FXKB 3FC0A 4PT6A 3A4UA 4Q8LA 3IPVA 1CJDA 1BK1A 5FV3A 3ETPA 4CRQA 3IWZA 4CTEA 4Z1VA 3CIHA 2GMPA 3OCPA 1TME3 4NWVA 1JZ6A 2BWAA 3HR9A 2JB8A 2CV6A 1VP6A 2GMEA 3I3EA 1HRV2 3VZMA 5A6XA 1DU3D 4KGGA 1H2KA 2EXIA 1VBD2 5C4WC 1S0DA 3R4UA 4DPNA 5IAXA 3HN3A 3ZYJB 4BQ1A 4EJRA 1WLWA 3VZKA 5J7MA 2BERA 1CVNA 2BFUL 3MUY1 3WUCA 1NX9A 3VD5A 3CZUA 3PU3A 5FXZA 1QJY3 3T0DA 1NLQA 2IVIB 4JQRA 1OA2A 4PQ9A 1YCIA 2GN3A 4RYDA 4D7TA 2D98A 1JODA 4DEVA 4F3JA 4YFZA 1UWWA 5C4WA 3RWKX 1ZBE1 2A6WA 4QX8A 3VDDC 3ABZA 3WQ1A 3NVCA 1ENRA 3MIDA 3RRDA 4Q4V1 3T4HB 5E6HA 2X8KA 3OPWA 5FY9A 2F6BA 3ZYHA 4C91A 4E27A 2OIIA 2WFF2 2BNMA 1LOFC 1BVVA 3MPPG 4GWMA 1AR83 1V9U1 2WIIB 2XQRA 5JMOA 4AAPA 3ZYIB 3I2KA 3IAQA 4Z8BA 2RHPA 2LROA 3KHCA 4LULA 4NRQA 4GWJA 3RZLA 4YNIA 4KWUA 2XB6C 5IATA 2F4PA 1J58A 3LDRA 3VDDA 2ATFA 2B5HA 1UIJA 2BGPA 1IQAA 2CDPA 1DQ1A 4CDWC 4ORFA 1S0IA 4XUTA 4L8QA 3J7MA 1X82A 2XLAA 2EXJA 1LOFA 5JUVA 4FBFA 1IKPA 3LFIA 3KF3A 4WM8A 3AC0A 2Q8OA 2DCTA 5DDJ3 3VBUC 1QJEA 1V6OA 2XPJA 2LTNA 5EV7A 1K5MB 1JZ2A 2OUHA 2WJSA 4UW3A 5EQUA 5A3MA 4LO7A 4KWLA 5FYIA 2ZHMA 4CDWA 5I0RA 2BNOA 1W04A 5FP4A 5JZGC 1VMFA 3JQXA 3U14A 4QKBA 1AXYA 2WZPP 3RWNA 4JVAA 4BIFA 5A3NA 3ACFA 2ZTNA 1GQPA 1REDA 2VMFA 3UJOA 1REEA 1OLQA 3P6BA 4ARYA 1LU1A 2G1MA 2OPWA 2WSVA 3K3OA 1SLIA 2D97A 2P4EA 1ACCA 3I3BA 3PVOA 4Y33A 1YFYA 2VMGA 3VGIA 4B4RA 5JSOA 1GWKA 1QJX1 3IIIA 1IOAA 3GALA 4FPEA 1MVQA 3POSA 1AR93 4RFT0 4LPLA 1RUJ1 1R082 2VULA 2CY6A 4K3UA 1U5XA 2HWD2 4YZ1A 5C5TA 1JYVA 1AYN1 2ID4A 2JDZA 4CPBA 1RUG2 2XVKA 5FQ0A 1NA1A 4L9BA 2C0ZA 1POV0 3HIFA 4MV2A 1H4GA 1SDDB 3B02A 2GH2A 4TLFA 1HB4A 1S0BA 3WF2A 1FPN1 4OUMA 4QAWA 3WNNA 5JMCA 4LT5A 1ZNPA 1UZ0A 2Z4FA 3RI8A 3FL7A 4CDXB 5C8WA 5FPBA 4LA3A 1V6JA 1K42A 5DZFA 5F37A 1C4RA 3BOWA 3N9PA 4N43C 2JG9B 1GZ9A 5FMDA 5CVRA 2RV9A 1AR63 2D6LX 4R4ZA 1FAYA 5IFTA 5AVAA 2BVVA 2LM3A 5CAZA 1OUXA 4NIHA 2XBO1 1JYCA 1OURA 3I3QA 3GBGA 1WMXA 3AJYA 3RZJA 4EWEA 2DVFA 1H8TC 3O7OA 2ZGPA 2EIEA 4Y5SA 4BCUA 4AG4A 3MBWA 3R05A 4RHV2 4CDUB 4FCAA 2VMEA 5FZ4A 1PNFA 3AL6A 4KMQA 3V0AA 5FUNA 4B3NA 3PUAA 1TMF3 1ZREA 4CCOA 1GZCA 5JIAA 1HV0A 3RMXA 3NKGA 2V4VA 1Q8OA 1MQTB 3K77A 5I91A 3F95A 1H8TA 4LLFA 3GDBA 1C5IA 4DIQA 5KXDA 2YGLA 2X5IA 4CCEA 4I01A 3A22A 2JEMA 4B1MA 2PELA 2Y6FA 5CG9A 1YI7A 5JOXA 5FZKA 2XHKA 1ND2B 4R8HA 4DO0A 3AK0A 4MXWB 4X8PA 2JE7A 2UWAA 4C1WA 2WABA 3AYEA 1L7RA 1RUD1 2X09A 4QU1A 5DAWA 5A33A 1ONAA 4HPKB 2VTXA 1HX6A 1VMJA 5FLIA 1Y3TA 1KJRA 1RHI3 2JDHA 4IV3C 3WP6A 1GV9A 1MEC2 1SLCA 2DUOA 1AL0G 4FTBA 4QGMA 1PGW2 1U5IA 3TNQA 3O1TA 4OHVA 4M4PA 1XB9A 1W6MA 4JGZA 2RR13 1ULCA 2A70A 5FZ9A 5I0TA 1RMU1 4CP1A 5JXGA 4B7EA 2Q8DA 4YM0A 5FZHA 1CIYA 3LQCA 4CEYC 1PM7A 3SKVA 4LMFA 2Z69A 1GICA 2FDGA 2PHXA 2K2SA 3J9SA 1R091 4IV3A 1W90A 4OI2A 4YW6A 3WG4A 3IB3A 2G9GA 2VJXA 1OXCA 3AMMA 2VBBA 3SH4A 3MF9A 3NJYA 1W6PB 2HWB2 1YO8A 4EYUA 3O1VA 3J7LA 1J3PA 1KS4A 5F5CA 1A34A 3WX5A 1ENQA 3RG0A 1MACA 4CEYA 3JUUA 3BALA 3CHXA 1Y9GA 3HVDA 2QBXA 1MS8A 4RQPA 2PA7A 3OGRA 3UL2A 1N1YA 4CXYA 2BBVA 2BOIA 1FNZA 3DYPA 5FZBA 1VBE3 4AEMA 3CDZB 2OX0A 5L7OA 2C9KA 1WCDJ 2EF6A 1SCSA 3D4KA 3OD0A 2VBDA 4NJ4A 4CUCA 3S57A 1M06G 3AZWA 5CKMA 1K3IA 1Y43B 5FMOS 1D4M1 1JYWA 3HN1A 1XJAA 4Q4Y2 5KHHA 5DMYA 2WNVB 3DPRB 3O0WA 4GB32 3VKFC 3NL1A 5DAQA 3WF4A 2WO3A 2B4KA 1C8M2 1M4WA 2WNUC 4GMP1 1I1EA 4PIZA 2GMMA 2DU1A 4OCTA 3ROUA 4LBLA 3B5LB 4X6QB 5C8CA 4JZRA 2DTYA 4IEQA 4PQQA 3K46A 4LBNA 3NRUA 2QNKA 4NIGA 1PZ7A 1NXMA 1VB4A 2MEV3 2UU8A 4ATEA 5JDBA 4HVOA 4XTMA 5FZ0A 1JS9A 4R9DA 1YIFA 5FZ3A 4K20A 1OH3A 1PO21 2BQPA 2D43A 3NJVA 4LHLA 4AGVA 4CEWB 1TME2 1UOBA 1OD5A 3NAPB 3POGA 2Y64A 2BOJA 1LKNA 1LCLA 1U5YA 3T1MA 3T2TA 4LQRA 5A32B 4COVA 1JYXA 4FFFA 3VUOA 1PGL2 1NE4A 3W9AA 1DZQA 3MUZ1 1Q8QA 4LBMA 3JBG3 1VAKA 5FYHA 1B09A 3J7NA 1PK6C 2J22A 1DZTA 1S0CA 4LE4A 1S55A 4XUNA 4ZZ5A 2B45X 4XUPA 3FZ3A 4N7UA 4MGKE 1QJY2 1VE0A 4D94A 1ZRCA 3OGSA 2X29A 3EMRA 4WM7A 5F5QA 5BNNA 1RGSA 5BV6A 2ZS6B 5HV4A 5CYYA 1Y7BA 1YHFA 3MF6A 1BMV2 3V64A 1W8ZA 2ZGTA 2BBAA 3BOPA 2GNMA 4FTSA 3BI3A 5JI9A 3ZXDA 1W9FA 1DQ4A 1YUDA 1V00A 4XIOA 1QKQA 2GC0A 5AVPA 4D6SA 4B4PA 4EZ4A 3V0BA 2BPA2 1NAEA 4HK9A 2W5FA 4QU2A 5FMCA 2R071 4IEOA 3BKZA 1AR82 2EXKA 5EJZB 3LZZA 1VR3A 2GALA 1F4HA 2RMU1 3GHMA 1VRH3 3PDQA 3UESA 3MIGA 4S2DA 5J48A 5M0TA 1RXGA 2WZR3 3LB9A 2CWSA 3URFA 2PHDA 2EAKA 2YHJA 3SMHA 4BQ4A 4NHKA 1VBC3 3WDYA 2PMWB 4EV0A 4LBOA 1AX2A 1V6NA 3UKTA 5LZ6A 4N8MA 3ZLIA 5IT6A 1UU5A 3SEPA 4AHZA 1PVC1 2ETEA 2SLIA 4M3CB 3OBAA 4N53A 4LNVA 5DDJ2 1D7PM 1QY4A 2ILMA 1RJ7A 5A6ZA 2VZTA 1LB2A 3N36A 1QGLA 3VZJA 5FZFA 4I09A 3P5BA 4XDOA 3OD4A 1MS3A 1UMZA 5B4NA 2C5DA 4IEZA 2ZZQA 4XBQA 4YSFA 3ZOIA 2VNGA 3LOIA 1RUH1 4MGTA 5JSRA 2JE8A 4P5HA 3QCWA 4Q26A 3I2DA 2BGOA 4Q4X3 4IESA 4Y20A 3UK9A 3KF5A 4XXAA 4HKOA 5T5PA 5LCWL 3HNYM 3I2JA 1AJOA 2J1VA 3ZFFB 1G9AA 2PHRA 5GM0A 5A7PA 1D2SA 1N3QA 3N7MA 1AR92 1HB2A 3OYWA 2VW2A 4IV1A 1UN1A 5KBFA 1XNAA 1JOBA 5IVYA 1W9WA 3ZSLA 4ISQA 3BTAA 5FP7A 5EYYA 2NM1A 4L99A 1TQ5A 2WYFA 4KBZA 1ZRRA 5I8SA 5KWRA 3GZEA 4RR3A 1CJPA 1W39A 3ZSKA 3A21A 5IVFA 5K7PA 1W8FA 5C9AC 1ZBE3 4J1WA 1JZ4A 3WF1A 1X36A 4MO3M 1I9RA 4Q4V3 3I54A 3VBHB 4AVBA 3TEZA 2BV4A 3MPBA 5A70A 5K0UC 4DEQA 3AKPA 2H0BA 5CBLA 2Q5TA 4KU8A 1QWRA 1V9U3 2YUEA 4Q8KA 3PJQA 4QKFA 1VB2A 2DDUA 5GLZA 4LKEA 5A7WB 2WRAA 3MLLA 1ND3B 1AR62 4BPZA 4BDVB 2Z42A 4K8FA 4S2GA 1OLMA 3Q8CA 4XCBA 2BFUS 3I2HA 4FAHA 3LEKA 4GULA 1NG0A 1XBFA 2ZHLA 2Q8CA 1QOOA 1UYZA 4FPOB 4LKDA 4XILA 2D44A 3V56A 3TB0A 1UNBA 2XJTA 2E32A 2GDFA 3NV3A 2WFPA 1DG6A 3ACGA 5F3CA 2PQQA 2WLQA 1DLCA 2WWUA 4QB1A 3VL8A 1HRI3 1YFUA 2VECA 1LENA 5ACA1 1TMF2 1EY2A 5LATA 2BP6A 2WLPA 4YG6A 1IHMA 3ZFEC 5F3IA 3ELNA 3NNFA 4YG3A 1YFXA 1N1SA 5FYCA 1N3OA 4E4SA 2DFCA 3NNMA 1C3HA 5BNOB 2VQ0A 4L0PA 3VKMA 1AVBA 3PVBB 1H6XA 1SBDA 2VCCA 4XZUG 4CP9B 3VBFC 2DF7A 1NCRC 2IFWA 2E26A 2XH6A 3FFQA 4QQOA 4KQ7A 2D7FA 4ZXKA 2P37A 4LA2A 3ZFEA 5FZGA 5IAVA 1Q56A 4S2FA 1QJX3 5F8PA 4Q5OA 3CJIC 1DDLA 3AP5A 1RUJ3 1Y9QA 2DV9A 4P9XA 5LA1A 1F5FA 1NCQC 1RHI2 3DF0A 3SNMA 3S0MA 2W2IA 4QX2A 4AQ6A 2RDRA 2V72A 1YJKA 3VBFA 4LO4B 5FOBB 4QX7A 1NCRA 1ZRIA 2VAUA 3OPZA 1WW6A 1UZWA 3M3OA 2RR12 1ASJ1 4DRRA 3WG2A 4ES8A 1GYKA 2VZ1A 1FPN3 2ERFA 2W92A 3PHMA 4H14A 1N1VA 3VBOB 3VBSC 4XMIA 5FZ6A 3CJIA 3LEMA 4OHWA 3GCXA 3I2GA 5JSPA 3E97A 4XJZA 1SQ4A 4RA0A 2YV8A 3MZHA 1WMDA 5LB6A 2IXKA 1TZOA 1UXZA 5H9RA 1QJFA 4UXAA 3BPZA 2ZGQA 3ILNA 4YVSA 4DFSA 4E8CA 3QD6A 1CAUB 5LBEA 1W0NA 3WINE 5CB7A 1RVF1 2LALA 4QPIB 5DXDA 1GSLA 1ZZ8A 4MGIE 2EA7A 3EYPA 4F83A 2FMDA 4KG8A 2CGOA 2XGXA 5FY8A 4QHOA 1OF4A 3PURA 1PO11 1UZZA 3BIEA 1VBE2 1W99A 2RJ2A 1MS4A 4LHNA 3GF6A 3K4DA 2PHWA 4XQDA 3J4UH 2ZAAA 1W9YA 3RQ0A 3WLUA 1UD1A 5DZEA 5CFDC 1GU3A 5FR3A 1UOJA 5IVEA 1A3KA 4LR4A 5FZOB 5A80A 3H8UA 1FOD3 2HWC1 3LCPA 3KB5A 2P6HA 2JXAA 3KQRA 3VLBB 4YGCA 4GH4C 1SLLA 1KD7A 3E6CC 1PGSA 3NMBA 4UW4A 2VMDA 4BXSV 5C5UA 1OD3A 2WNEA 1YRZA 3DL3A 4MVTA 3THCA 5J3UA 1STMA 3S7EA 4YARA 4I3PA 4CU6A 3K75B 1XU1A 3IBMA 3J26N 2FCVA 1AL23 2GU9A 2RS11 4JTNA 5DQ0A 2A3YA 2BVBA 3EB7A 4XIKA 4XAEA 3UKVA 3W20A 3CO2A 2ZKLA 3B9IA 2MEV2 1Q8PA 2G19A 3PU8A 4COWA 1JYIA 3OSDA 4QB6A 4NIDA 1YFWA 3KV5A 3M3QA 2W47A 2K46A 1SPPB 1C8NA 3SCFA
chains in the Genus database with same CATH topology
3O0VA 1HDKA 2H6CA 3JD71 3OY8B 2D3SA 4MGZE 2JG8C 1RMU3 4IXLA 4P14A 3JBG2 1SBEA 1FXZA 2ENRA 1EPZA 3JB8A 3PMSA 4FTEA 2EVXA 2NYYA 1WUVA 1C57A 1RC6A 1BBT1 3RYPA 1X8MA 5D8AC 2VMHA 4F7ZA 1GQHA 5T54A 1LU2A 2CGNA 1UPSA 4YVWC 1QDCA 2IXHA 3DUIA 3IMNA 4ZU5A 1BXHA 3TN91 1RUF1 1WCSA 2QKDA 3TOJA 1Q8SA 5K8SA 1X7NA 3WG1A 1VRH2 3ZYGA 4PDWB 2VVEA 1QMJA 3RS6A 1AYM3 2WZR2 4HT1T 2VW0A 1XXNA 2OPKA 4E9KA 1VBC2 4QPGC 1LULA 1QXJA 1NLSA 4HL0A 2XLGA 4AEDC 5KC6A 3C2UA 4X8NA 4IEUA 2BUKA 2O1QA 3WY6A 2VOWA 2WSUA 2XJRA 4JCKA 4LUKA 4BIOA 1YJLA 4Z07A 2VOKA 2JX9A 2PHTA 2E53A 1R1ZA 3VZLA 1RUI1 1WW4A 1OMIA 4KGQA 4XF0A 2DCYA 2WS93 3VHPA 4E4DX 4WVWA 3MW3A 1WLTA 2RS31 1ZVFA 4P9WA 1G9DA 5CIRA 1XQNA 4Q4X2 5CADA 3KM5A 4EN6B 1AXZA 1QHDA 2CAUA 4OZXA 3N35A 3AX4A 4PF5A 4RGAA 1NZCA 2JG9A 3OBTA 2OZJA 2W08A 1RL3A 3GBFA 4XPVA 4M01A 3TBDA 2N7GA 5FO9B 5E8AA 3GZUC 3O14A 1BEV3 5JVVA 4XDQA 5GZGA 3WW1A 4Y1XA 1MQTC 1ZBE2 2A6XA 5B2GB 2DCZA 3IN9A 3KD4A 4JTOA 3WOGA 5J37A 2VVDA 4Q4V2 1DYKA 4I3GA 4R9BA 3C3VA 4CDUA 2ZMNA 2XJVA 2PLV3 2R073 1KRIA 1V9U2 3WDTA 4HBNA 1O5UA 2RMU3 1OOPB 4FPKA 2DYCA 3WDUA 1MQTA 1LOGA 2A73B 2B39A 4HLTA 5IK8A 5HCBA 4COZA 3IDEA 5H9PA 3ZSJA 2C1FA 4QXKA 1J3RA 3AMQA 3J8F3 4GXLA 4AHYA 1VAMA 1KFUL 1ND2A 2R041 1PVXA 3NWKA 4MXWA 4WVMB 1LHVA 4FPYA 4Y24A 1R1A3 1H1AA 5ABJB 4WM8C 1HRI2 4HPKA 4ZKTB 1LHNA 3H1YA 1Q43A 3IDCB 3B9CA 4XFBA 3ZFGB 1IPKA 1VBB1 4WV8A 2RM21 1U0AA 1D4VB 4FO9A 2A6YA 1DGWA 2VUJA 4D3WA 1RUH3 1VBD1 3KLSA 1QOTA 2GNDA 3U10A 3I59B 2XWBB 4QM9A 4R9CA 4XXPA 1RUC3 1H8VA 3NO8A 1SBFA 4BE3A 2UYBA 4MZUA 1WW5A 1QJX2 3ECQA 3LSDA 1V6IA 2PAKA 1W6PA 1RUJ2 2A5ZA 3RZZA 4MGYE 4LBQB 4LO6B 3QLQA 3WW3A 4PLMA 2WFF1 5FLJA 2CGPA 1NA1C 2D3PA 4RGGA 3AB0A 1W2UA 1W0PA 1FPN2 5GLWA 1WGPA 2DCKA 2OYZA 2DU0A 5L36A 1PIV3 5CU1A 4TWTA 4DQAA 4FPCA 4AEJA 2G4IA 3LKJA 3NKTA 1WA4A 4Q0SA 2QCSB 4YW5A 4YZ2A 1A8DA 4XTPA 3DPRA 1KDKA 1RUOA 3AMHA 5GZCA 4AVTA 2GC2A 4PLNA 2R0FA 2PHUA 3AP9A 4JGYB 3SXWA 3SH5A 1S0JA 3D82A 1CD3G 3KCCA 3LWCA 4YZ3A 4Z92B 1FYUA 4CYDA 4BWOA 2P3KA 3FUOA 2XVGA 4Q0UA 5BPXA 5JCTA 2IXIA 2HYKA 4AI8A 2AH2A 4CEWA 1FOD2 1YLLA 2VMIA 3NAPA 2CYFA 3POYA 5A32A 2W52A 1J1LA 2ZMKA 1XNKA 1ZYBA 3OGGA 1DQ0A 3E5XA 2HWF3 4URTA 1BZWA 1R081 2X5IC 4IEVA 2VVFA 3G7DA 1AL22 4AVVA 3FBMA 1LOCA 2H0VA 1CR7A 1VLNA 5JI7A 1RUG1 2BW8A 3WVJA 3FUQA 3G6JB 5FLHA 5T5LA 4YGBA 4XBLA 5FCCA 4QQ2A 5DG2A 2JD4A 4O9GA 1UX6A 2P17A 3USUB 2YC0A 1BCXA 1ASJ3 1XNBA 1ZZ6A 2DURA 1RMU2 2YGMA 4JGZC 3LSEA 1SLTA 2XUMA 4NPRA 3PVEA 3KSCA 3ZMNA 2E51A 1RUE3 4Y1VA 2ZOEB 4W6XA 1G86A 1V6KA 3HMYA 4OHXA 4XFIA 1HIXA 4H7MA 4IQPA 3GNEA 2ZGKA 3ZIXA 3POWA 3GZTB 4P9YA 4AI2A 1O91A 1RVF3 1QXPA 1EAH3 3ZXEA 3RJ2X 4RHV1 1AUYA 4LLOA 4FSJA 4M3CA 2NMOA 4RQPC 2GC1A 1PO13 4YW2A 4DXZA 4Y1YA 3VHNA 3IM0A 4L92A 4Q27A 4FT8A 4BLIA 5L7OC 5BNPB 2ZACA 4PBOA 1YYNA 1OFSA 1ZZ9A 2A6ZA 1AR73 4PCRA 4L2NA 1AYM2 2HKXA 2VG9A 1DGRN 2DVAA 2RS51 3VZNA 4AVAA 5C6CA 4Y4YA 3RYKA 2XJQA 2FMYA 1IS5A 3AZXA 5AFBA 4N90A 4A7ZA 1QQP1 3MLKA 1LEMA 3ZFFA 1SLAA 4E4ZA 3VBHC 4QQLA 1ENSA 3B7MA 1MEC1 1PGW1 1Q8VA 5C8CC 1ZZ7A 2WS92 1ZX5A 3ZO0B 1JHNA 1QDOA 3WW4A 3VBUB 2C9AA 4AI3A 4YRDA 5GZDA 3VBHA 2LUWA 4INDA 4TZDA 3HAGA 4FOQA 4Q1RA 3WNXA 5JIUA 3R0RA 4I0WB 1F5JA 3VZOA 2HWB1 3BIWE 2A3WA 5JZGB 1H2NA 4AHXA 3WG3A 3KT4A 4LEJA 2VPVA 1ZBA3 2R061 1PZ8A 4FQZA 3ZVXA 1GBGA 1BEV2 2PAMA 5HXVA 2R1BA 2QUOA 4FPGA 2ZX1A 3PLQA 4WM7C 3FWEA 2GSYA 1LHUA 5BNNC 5J98B 3BB6A 4DY3A 3M4FA 4KWJA 2B9UA 5FDBA 1HXS1 1W6OB 1O3TA 1HQWA 4Q4Y1 5FAXA 2PLV2 1RUF3 2NN8A 2R072 1MS5A 4HVRA 5IK4A 4XHBA 1XNDA 2RMU2 1C5HA 2BYVE 2ZGOA 4K9SA 5F1RA 3D8CA 4DNYA 5BNOA 2H6BA 3TWIA 1C8M1 4H7LA 3VKNA 2Y0OA 3HBZA 1LRHA 2O8OA 1XU2A 3M3EA 3J8F2 5T50A 1YI9A 1URXA 4N43B 1MZFA 4LE3A 1PZ9A 2JECA 2CTVA 2ZGSA 1R1A2 3WT3A 1O3QA 5FPXA 4N53C 1S0GA 4PIYA 4I02A 4QQHA 4KG0A 1TME1 2B46X 2JJ6A 4XYXA 1RUI3 1PGL1 1RIRA 4LHKA 1RUH2 3LOBA 2VUAA 1Q5OA 1XYPA 2UYAA 2YDEA 3JQWA 1HQNA 3VBRB 1CX4A 3VBOA 5JPMB 4DZGA 2TBVA 1RUC2 5FO7B 3ZMOA 5HCFA 1EV13 4BLJA 1QJY1 2D3RA 2IXCA 4FVVA 4P9GA 2OZ6A 3EJKA 2K9ZA 1CAXB 4JC1A 3B3QE 4B7KA 1BMV1 4E2QA 4XFGA 1CAUA 4K1YA 4IV1C 4NR1A 2P3IA 4QPIA 2ZJCA 1JW6A 1EPWA 5A3LA 2ARBA 1IGOA 4RR3C 3ZPYA 1Z7S1 5L73A 3PMEA 2ARXA 3PJYA 4IEYA 4KBBA 3R4SA 4IV3B 4OUSA 4E2GA 1PIV2 1FMD1 1IZ3A 1KITA 4KU7A 4OI1A 3TYJA 3RMYA 3DN7A 4XJUA 2ET7A 1OHFA 3FLTA 2NPIA 2PFWA 2ZPXA 4B8EA 4KNCA 4GA9A 2ZX2A 1W6QB 1FI2A 1I6XA 2QE3A 2R043 2AUYA 2EALA 1SACA 5GLTA 4XE9A 2Q0AA 5LRRA 4HKWA 2UY8A 1LGBA 1HV1A 2FZ1A 2I07B 4Q4W1 1UU6A 1VBB3 2RM23 3B00A 1WLDA 3KGLA 3KT1A 5DUUA 1X8EA 3N3HA 4YM2A 3QH6A 2WWSA 2R32A 4FOWA 1GLHA 1COV1 1TEIA 1AR91 2HWF2 5I8YA 1IS6A 1W0OA 2D40A 1UW8A 3JZVA 4Q2FA 3DV8A 2YPJA 2XVLA 5CFCC 4IETA 2ZX3A 2DCJA 3WP3A 3INAA 1JBCA 3AYDA 2VNOA 1XE7A 2WNUB 3N4MA 1NY72 2V73A 3UJQA 4XZPA 2RJLA 1UCXA 3AFKA 1KS5A 2A3XA 1MZ6A 1ASJ2 4JDMA 3LGRA 2KXLA 5HBAA 4PBPA 5CFCA 1BKZA 1AR61 1NYWA 1RUE2 4PDWA 1QOSA 3B94A 1GZWB 3NJZA 3L2YA 3APBA 2WT1A 5JLVA 4PLOA 4BA6A 3O12A 3H3ZA 2BTVC 4G9SB 4K7JA 1AYN3 4Q0QA 5I0SA 3HQXA 4M0HA 2D6NA 2CNAA 2XKOA 1RVF2 2ZMLA 4YVSC 1PK6B 5FTTC 1EAH2 1OI6A 3MLJA 4CP2A 1WW7A 5LEKA 1QNYA 3GHNA 2VXRA 2E7TA 1PO12 1UU4A 1TMF1 3ETQA 3D6EA 2GNBA 3CNAA 1WD3A 4WVZA 4QX5A 3PTYA 3WD5A 1AR72 4NN0A 1AHSA 4NHMA 1G7YA 3SCGA 4JDNA 5KXBA 5DUWA 4XFCA 2XBO3 4YZ4A 1MZEA 4XF9A 2Y38A 1LTEA 1VJ2A 2B7YA 1L3JA 4RD7A 5EFUA 5GLUA 5JOWA 1RHI1 2OW4A 4LBKA 2G9FA 3ILFA 3Q9OA 4N9IA 4EN0A 1LESA 1SCRA 4WVVA 4CDQB 3ACLA 2HWE1 4HFSA 3E5QA 4L97A 1RTVA 1HW5A 4M0NA 3VKLA 4DB5A 4XF4A 1RUNA 4MX3A 1CAWB 2IXJA 2IXLA 2UWCA 3CL1A 1JOJA 4JDOA 1I5ZA 1SDWA 3MFAA 1RUD3 3B93A 5TSWA 4BMEA 1ZBA2 4D69A 4AGRA 2BEOA 4D7SA 1GFF2 1F9KA 1OA3A 1YNAA 4M3CE 4QD2A 3WDXA 1IKQA 4FP2A 5HI0A 4AXOA 5CG8A 3FHIB 2PYTA 1X33A 1U5ZA 2NZ9A 4U2AA 4WVMA 3BODA 5ABJA 3H50A 2AZ5A 2D93A 2QFEA 1RUF2 4XQ4A 1VBA1 1R093 3ZFGA 5LK7B 1K5MC 1UZYA 2DVBA 5C9AB 3KT7A 3W58A 2PTMA 5FPZA 5KXCA 3M8LA 4AEKA 4EWDA 1RITA 1AF9A 2RS53 3WW2A 1WD4A 1NQJA 5K0UB 3WUDA 3I59A 3KGZA 2QJVA 4UBGA 2DVGA 1H4HA 3O5SA 1G9CA 5H9QA 3AKQA 5LK5A 1K5MA 1QQP3 4YW1A 4AFMA 2FBEA 4OVEA 1ZZBA 5DUVA 5EWSA 1QJU1 1T6GC 4I2OA 1A78A 1D4M3 4LBQA 1NXD1 1RUI2 4XFHA 4AFAA 4COYA 1A8MA 1QH7A 4W6YA 3ZXFA 3GBWA 2QZ2A 2R30A 1KJLA 2MHFA 3UV9A 2KM2A 1G9BA 2D5FA 4GMP3 2GAUA 3I4IA 4XF3A 3BCWA 1JTZX 3QACA 1EV12 1CAVB 4CDXC 5T55A 3A0NA 3CU7A 5I0UA 4XHXA 2AR6A 2NP0A 3NV2A 2JG9C 3ZX7A 1DQ2A 1HQLA 2R063 3ATGA 3MEPA 4PIXA 1PO23 1XRUA 5T5OA 1JXNA 4Q29A 1H2MA 2XLFA 4FPJA 4CDXA 4AVSA 3USSA 2R16A 3LA3A 3OJBA 1VRH1 2WINB 1SLBA 3AMNA 5LRSA 2VOVA 3ZXKA 1NCQB 1HXS3 3AZYA 2PHFA 1OQ1A 4ITCA 3FE5A 3ZXJA 4CDUC 4Q4Y3 2WZR1 3M3IA 1DHKB 5AC91 2BGCA 1IS4A 3BU7A 1DGWX 2UWBA 3B01A 3M3CA 2UY9A 2WT2A 1C28A 2VW1A 1IPJA 3AKRA 4RS5B 5SV5A 2P3JA 3VBSB 2RJKA 5FO8B 2JKBA 1TNRA 1J3QA 5EJ3A 1LODA 3I7DA 3SH3A 5SV8A 3THPA 4N7IA 2R042 4Z2WA 1CQ9A 3E6BA 1ND2C 4DRVA 3VV1A 2ZX0A 1OSGA 3V65A 4Q4X1 4JV4A 1VBB2 2RM22 3USUA 5DUXA 5FRAA 5D1IA 3UKNA 2P2KA 5BXXA 2WL1A 4B29A 1S2BA 1ENXA 5CFDB 1ZZCA 4P9IA 1PVC3 3AYCA 1UIKA 4MH0E 5KHIA 3AKSA 2DVDA 5E88A 3ZXLA 1B35B 2V09A 1APNA 1YIPA 3N7KA 4ASMB 2NLRA 4XETA 4XJ9A 5BNPC 4QM8A 4GH4B 4DOUA 3RJRA 4AYUA 1HRV1 2AGSA 4H55A 2I74A 1I3HA 2D5HA 3EBRA 3TNPB 2VU9A 1FNYA 4I0BA 2Z79A 1W6NB 3H3UA 3AP6A 1LOAA 1Z7S3 5BNQA 5JWPA 1O7FA 4K6BA 5DG1A 2E7AA 5BNPA 5C33A 4OHZA 3PVNA 3ZN6B 4GMP0 1FMD3 4Y22B 1H30A 1O4TA 4UW6A 2B42B 4EROA 2E9QA 4UW5A 1AYN2 1LGNA 2MNGA 2W0XA 1H1IA 1QNWA 2JG8B 1H1MA 2R1DA 1GQGA 2WNVC 3DPRC 3LA7A 4MXVA 4XW3A 3RNSA 3CJXA 1HRI1 3K51A 4YW3A 3RSJA 1GR3A 1S0FA 4LUMA 1PMIA 4AQTA 2ZGMA 4HANA 1O5LA 4RSUA 3FJSA 3AXEA 5D8AB 2OUJA 4YLZA 3WQ7A 2WNVA 3ZIWA 2JENA 1OQEA 4YVWB 2XBO2 4Y1ZA 3VBUA 3OGJA 4Q4W3 3WCRA 4CEWC 1DGRA 4HSJA 4COUA 3KCXA 1UF2C 2KA3A 3SISA 3NAPC 4HK8A 4BM8A 1DQ5A 1COV3 1GANA 4K1ZA 4HVQA 5CA6A 4I30A 5JZGA 4OHYA 4MYEA 1GNZA 1QU0A 2A7AA 4HSLA 5ACA3 4QPGB 4NOTA 2XL7A 1OPMA 1G6NA 4AEDB 1ULEA 2TEPA 3ST7A 4QT6A 4DY5A 3MIBA 1H2LA 4OULA 4AI1A 2XWJB 4KL1A 4P9LA 1W6OA 3FBYA 4Y5Z0 1CPNA 1J59A 4QGNA 2O8QA 2HWD1 1LR5A 4Y26A 4XQWA 1UAIA 3AJZA 1O3SA 1O4YA 1CESA 1RUD2 2W39A 3IPVB 1GNHA 2AYHA 2WA4A 3M70A 3IIAA 3ZSEA 4AI0A 4AVCA 4IERA 4XJ8A 5GJ6A 1MS9A 3KZ4C 4C0BA 5JOZA 4AGGA 2VOXA 4N43A 2ZHKA 1LOBA 1REFA 3H0OA 3LA2A 2PAEA 5KHKA 3ES4A 1QJZA 2QDRA 3VBRC 3M1HA 5FBZA 4UBHA 4GKYA 1XNCA 4X6RB 1R092 1FOD1 5AFEA 3KS7A 3WR0A 2AENA 4M00A 4YYOA 4W65A 3VHOA 1ALYA 1RJ8A 2EAAA 3QOPA 5C4WB 4Q0PA 3S7IA 1LOEA 2RS52 3VBRA 3OBRA 3I8TA 2X53S 4EN8B 2ZCWA 2D6OX 1AL21 4QGLA 3RDIA 1C1LA 3WHTA 5FOJB 4TYSA 1QQP2 1BJQA 4YW4A 2Q1MA 5KXEA 1UKRA 1UKGA 1CAXA 3VHRA 3VL9A 3ZFFC 4BCUA 2E6VA 4EN9B 5E89A 3VDDB 1D4M2 4AW7A 4R4XA 1MZ5A 5EYXA 1AX1A 1CPMA 3WXPA 2HWC3 4C1XA 2Z5WA 2E7QA 3MW2A 2HWE3 1LJ7A 4XFFA 3CLPA 4G4FA 4WM8B 4AHWA 1O4ZA 1N3PA 4AF9A 3HT1A 3MICA 2A71A 4ES9A 1EYBA 1DGLA 1KQRA 2RS13 4CDWB 3AXDA 3SLIA 2DTWA 2SBAA 2R062 1ND3C 1G9FA 3AP7A 4AE2A 1PO22 1C1FA 1W6QA 2OA2A 1XE8A 5T5JA 2BWCA 2XL9A 3JD73 1GKBA 5J36A 1DBNA 4A3XA 4KWKA 4NHLA 3NV4A 1OA4A 1HXS2 1IS3A 3P3NA 2FZ2A 4XBNA 3R4DB 3CF6E 1AYM1 1ND3A 1N1TA 2CL2A 4YGDA 1FATA 1XYOA 1VBA3 1H0BA 1PNGA 4NO4A 4META 3K48A 1BBT3 5FQ0B 1NA1B 4XEZA 2NMNA 1RB8G 3KCYA 4FQ4A 1ZRDA 3FX3A 3ASIA 5K9YA 4AFBA 3ZN5A 4CZSA 5BNOC 3FLRA 1S1AA 3IDBB 1OLRA 1NQDA 1LEDA 3TN93 4QHBA 3IT8A 1LHWA 2IWGB 3OF1A 2WS91 5BUVA 2CWMA 3D0JA 3QH7A 4BYYA 5T3NA 2D6PA 2R49A 4AFCA 4E2SA 1CGPA 1ULDA 4GB31 4ZU7A 1QJU3 1UL9A 2WNUA 4Z82A 1DFQA 4GQ7A 2ZX4A 3H9AA 3ZN4A 5IK7A 4XF1A 5I8TA 4YG0A 1OQDA 3WDVA 2Q4SA 5F9TA 3N7LA 3WDWA 1S2KA 1POV1 5IK5A 1PVC2 2YZ4A 3DKWA 3VBOC 4IEPA 2E63A 1GZWA 3V0AB 1BEV1 4A2UA 5E1RA 1UPIA 3X29B 2RS33 1H8TB 4YGEA 1PK6A 2X5IB 4OLLA 3LAGA 4QPIC 2GH8A 5GALA 4A7YA 3MIFA 1CIWA 3MYXA 5EZWA 2PLV1 3S6PA 1Z7S2 3QBQA 2B8MA 3WCSA 1SFNA 3RI9A 5A33B 4HN0A 3D0SA 1QXRA 4B4QA 1TE1B 1JN2P 1FMD2 2QDNA 1NLRA 2Y26A 3MDPA 5AC93 3EHKA 5CNAA 1SFYA 1JUHA 2YXSA 3WZ1A 3M7AA 4DS0A 3J8F1 1SMVA 1W6MB 4JGZB 1WMFA 5FREA 2D6KA 2EXHA 4AFDA 4CDQC 4JAAA 4HETA 1N47A 1F2NA 4K40A 4Q1PA 4S2HA 1AR81 2JICA 1R1A1 2WKKA 2IFRA 2R0HA 2I2SA 2WA3A 4IEWA 4DMIA 1QF3A 4A7KA 4LO8A 4XJAA 5EXOA 1LECA 3NSTA 4FPHA 2P34A 4CDQA 1H9WA 2WQ4A 2TUNA 2K0GA 1S0EA 1BVP1 3EXUA 3U11A 1H9PA 3EQEA 4CEYB 4Q4W2 3B69A 3IKWA 5KHGA 4RQPB 5DDJ1 1RUC1 3RPQA 2DFBA 1CAWA 2QZ3A 3VKOA 5F6KA 1NE6A 1Z78A 3CEWA 3O0XA 4G3YC 5L7OB 3H7YA 4F8AA 4GALA 2TNFA 1COV2 1F31A 2ZBJA 2Q1ZB 1KXGA 1VALA 3ZSMA 1DQ6A 1LHOA 1E57A 3SHRA 1WBLA 4R9AA 5J09A 2XJUA 3A0KA 4FOYA 1QH6A 3ZYPA 5ACA2 3THTA 2WC2A 3ZXAC 5T52A 2OVUA 2ZABA 4LBQD 2FHRA 3HT2A 3AKTA 1HRV3 4QQPA 4FAGA 1WLCA 2GZWA 1VBD3 3OY8A 2AREA 3HWJA 5GZFA 2IZWA 3L9JT 4OI0A 4SLIA 5BYNA 1PIV1 1DZRA 1PHMA 5C8CB 3E5UA 3M2MA 4WBBA 1BYHA 1WBFA 2JE9A 4ATFA 4D7YA 4AWDA 1CN1A 2GNTA 3P3PA 5C9AA 4HMZA 3FMGA 4WZFA 1Q3EA 4PDWC 3TAYA 2WT0A 1FT9A 1YXWA 3EO6A 1KDMA 1SEFA 4O9EA 1ULGA 5K0UA 4FXGB 3FLPA 3MIEA 2WFF3 4XOGA 4ONUA 5I93A 4BOWA 3MIHA 3WQ0A 2VGDA 4NWWA 2ES3A 4BZ4A 1DF0A 2EIGA 1XYNA 2HEWF 3L2HA 4AK3A 2D6MA 4YM3A 1Z0HA 2RE9A 1ZM1A 4WM7B 5BNNB 2HJIA 1DLLA 4PJYA 4ISRA 4HKLA 1KFXL 4ZU4A 1VAVA 1VIWB 2ET1A 1ULFA 5FFOC 3ENRA 3NV1A 3NW4A 2HWF1 4DINB 5DZGA 2BNNA 3V0BB 2ZKNA 3ALQA 2UURA 1FV2A 3H1WA 1CAVA 1LGCA 1V6LA 2Z2SB 2ZGRA 2NQYA 3WV6A 3H7JA 1FX5A 1NY71 3U07A 1TNFA 3R6SA 5JAXA 2ZGLA 4ASLA 2R6QA 3WP5A 4IL7A 2HWC2 4FOVA 4EWAA 3U4XA 1AZDA 1AX0A 3HD8B 2HWE2 1D0GA 4RS5C 2XG3A 4V1PA 1RUE1 4L11A 2HEVF 4N53B 2YY1A 1NCQA 1R083 2YMZA 2WQZC 5GLVA 2HWD3 2RS12 2PHLA 2GC3A 1RUG3 4K21A 2HEYF 3S30A 3FFZA 1DYPA 2CAVA 2RR11 2PN5A 1OOPC 2VQAA 4RS5A 3WP4A 5BY5A 1EAH1 4EN7B 1HKDA 5FMOL 3VBSA 4Y20B 2YROA 1AXKA 4M3CF 4XMAA 2XJPA 4NVPA 4P9JA 4SBVA 3JD72 5HCAA 5H9SA 2V5YA 3OYWB 2A6VA 1AR71 4FPFA 1ZRFA 4IV1B 4Q0VA 1OOPA 1OPOA 3ZYRA 5ABJC 4YFWA 4YM1A 1A6CA 1VBA2 2I45A 1B35C 2YYOA 4RR3B 3ZFGC 1BBT2 3DGTA 1D2QA 2ZGUA 1V70A 4H3WA 4C90A 5KC5A 4BH9A 2O0OA 3N7JA 1VBE1 3MGUA 4OFGA 2ZGNA 3SITA 4MLOA 4WZCA 5CFDA 4RHV3 3T1LA 1WCKA 1G8WA 4J1XA 3TN92 4MSVA 4RL7A 3AZZA 3JB4C 3D5OA 1B35A 4LTAA 5L19A 1HLCA 2IC1A 4AQSA 2VNRA 4GH4A 1AJKA 1MS0A 1QJU2 4J6GA 3GZAA 3JCIA 1MR5A 4GWNA 2GN7A 3AFGA 3E6DA 4AQ2A 4IEXA 3ES1A 4R52A 2QQPA 3RYRA 1J1TA 2VH9A 1ZA4A 1W6NA 1WMEA 4JRLA 4BHPA 4GIQA 4XJWA 2MEV1 4KH9A 3H1MA 1ZBA1 1BQPA 4XFAA 3ZN6A 3KMHA 4Y22A 3ME2A 2ZAHA 1MEC3 2MPFA 1CONA 4JRAA 1EP0A 2W68A 3PNAA 2A75A 3JU9A 2XKPA 4QMAA 3AYAA 3AMPA 2JG8A 4LO5B 5JPNB 2RS32 1OFNA 2FQPA 3ZXGA 3U0ZA 4I0AA 3SCHA 3JBG1 2XJSA 4Y1UA 1YWKA 4FP3A 3MW4A 4GKXA 1O3RA 4JGYC 5J96B 5CFCB 1DIWA 3ILRA 5LEJA 2VY0A 4N9HA 1MVEA 3ZFEB 2DWRA 5GZEA 3ZDSA 1RINA 2ZZJA 2HWB3 5GKAC 4W6WA 5D8AA 3TRSB 4CP0A 5AC92 4OI4A 2ZHNA 4YVWA 4C0HA 2DUPA 3VBFB 2ZA9A 4FPLA 3VN4A 1FV3A 1NCRB 4JGYA 4TSVA 1NOVA 1F8VA 5F6LB 1JH5A 3CJIB 4LBJA 4U36A 3AP4A 2Y0IA 4HN1A 5E16A 1V6MA 4YZ5A 3GYDA 1D0HA 4MUVA 4QPYA 3OTFA 4HZFA 4QPGA 1JUIA 1U12A 3AZVA 3MI8A 4YVSB 5JOYA 1VBC1 4GB33 5JR7B 2Q30A 5IUQA 4AEDA 2DUQA 4BMBA 1MS1A 1OKQA 1X50A 1C8M3 3MFCA 1EV11 2QVSB 3AM2A 1POV3 4FXKB 3FC0A 3A4UA 4Q8LA 3IPVA 1CJDA 1BK1A 4CRQA 3IWZA 4CTEA 4Z1VA 2GMPA 3OCPA 1TME3 4NWVA 2BWAA 3HR9A 2CV6A 1VP6A 2GMEA 1HRV2 3VZMA <