1U5XA

Crystal structure of murine april at ph 5.0
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
137
structure length
130
Chain Sequence
KHSVLHLVPVNITSDVTEVMWQPVLRRGRGLEAQGDIVRVWDTGIYLLYSQVLFHDVTFTMGQVVSREGQGRRETLFRCIRSMPSDAYNSCYSAGVFHLHQGDIITVKIPRANAKLSLSPHGTFLGFVKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tumor necrosis factor ligand superfamily member 13
publication title The Crystal Structure of A Proliferation-inducing Ligand, APRIL.
pubmed doi rcsb
source organism Mus musculus
molecule tags Cytokine, hormone/growth factor
total genus 23
structure length 130
sequence length 137
ec nomenclature
pdb deposition date 2004-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00229 TNF TNF(Tumour Necrosis Factor) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1u5xA00
1XU2A 2JG8A 5KC6A 2RJKA 3QD6A 2ZPXA 1ALYA 5KWRA 5CIRA 2R30A 2WNVA 1D0GA 3MI8A 2JG9A 2ZJCA 4QQPA 4D7YA 4MXWA 4EN0A 3B9IA 1PK6C 3B93A 4TSVA 3K51A 3IT8A 1KXGA 2OIIA 1WCKA 2JG8B 5L19A 1GR3A 1OQDA 1D2QA 4RSUA 4QPYA 2TNFA 4QQ2A 4NN0A 2JG9B 1U5XA 1U5ZA 2WNUA 1DU3D 3V56A 4KGQA 4KGGA 2TUNA 1PK6A 1TNFA 4OUSA 5TSWA 1S55A 3K48A 4E4SA 1A8MA 4QQOA 4KG8A 1JH5A 2KA3A 4F3JA 1JTZX 1KD7A 4TWTA 2HEYF 4MXVA 1D4VB 1I9RA 3AB0A 1DG6A 2WNUB 4E4DX 3ME2A 2X29A 3TWIA 1U5YA 2WNVB 4MXWB 2Z5WA 3L9JT 1RJ8A 3TYJA 5L36A 5HBAA 1IQAA 3QBQA 3ALQA 3URFA 4G3YC 2Q1MA 1C3HA 5KC5A 1TNRA 2O0OA 3LKJA 2AZ5A 4GIQA 1OQEA 4DOUA 2RJLA 1O91A 4OUMA 2R6QA 4OULA 4QQHA 1PK6B 2HEVF 4HT1T 2JG8C 2HEWF 4QQLA 2RE9A 2WNUC 3FC0A 4G4FA 1C28A 2WNVC 2JG9C 2QE3A 1RJ7A 2R32A 4J6GA 4DB5A 5BNQA 2Q8OA 3B94A 3WD5A 1XU1A 2E7AA 4N90A 1OSGA 2QDNA 4MSVA
chains in the Genus database with same CATH superfamily
2JXAA 5FUPA 4FOQA 4P9XA 5E8AA 3MIHA 1FAYA 4EN8B 4J1WA 2PHUA 1XJAA 4BLJA 4CVUA 1AR82 4CDUC 3V0BA 1CJDA 1LOFA 3KF3A 3LIHA 2ZEWA 2V4VA 1RIRA 1GWMA 2ATFA 3B93A 3M7AA 4TSVA 3WF4A 4MH0E 1W8UA 3SEPA 5C3SA 2ZGPA 3K51A 1HXS2 4LKSA 1FOD3 3RWKX 4C8DA 3RNSA 1NCQB 1I5PA 4AEDB 1HDKA 5I0SA 3K77A 2WDBA 3EXUA 4YGCA 5JR2A 3NNMA 5FPVA 3CHXA 1VLNA 3AMMA 3CDZB 2VMHA 3OEBA 3MPBA 4FI9A 4Q4W3 5F39A 3OY8A 5EFUA 3UK9A 3C2UA 1U5XA 3VLBB 2W52A 2O8OA 2RHPA 1VBC1 1U0AA 1LOBA 2DCTA 1T6GC 5A6XA 3JBG3 4OHXA 3OCPA 4OUSA 4MGSA 3C8XA 4P08A 2N7GA 3C7EA 3RYKA 1ST8A 3SISA 4KMQA 1QJEA 2VO5A 5EP9A 5HXVA 3TEXA 1CAUA 2D6KA 4JZRA 2ZGTA 2WFF2 1FMD3 1SDDB 1X8MA 2C6SA 4IEYA 4JGYA 4LTAA 4RR3B 3N35A 5JZGB 1W6PB 2J7MA 3WVJA 3NNFA 4R9BA 2X05A 3PHMA 4BK5A 1F8VA 1VBE3 2JB8A 1G8WA 1VRH2 2B45X 2P5BA 4DIQA 3K2OA 4E4DX 1C8M1 4GMP3 2PAKA 5ABJA 4PHZA 5FYZA 1QJU1 4UFMA 3LA2A 5AC91 4OHYA 3U4SA 4AFAA 4NHYA 5C8CA 2V5DA 3NV1A 3ZYIB 1RUD1 4MXWB 1L7LA 1GP6A 4B4PA 3FZ3A 4DPNA 4E4HA 3RQ0A 1F9KA 3WDVA 2W47A 5FMCA 5EJ1B 2FCVA 4COUA 4PBOA 2P3JA 4H7LA 4A45A 5J1XA 3V0AA 4HSJA 4JDMA 2VW0A 1BKZA 3WUCA 3EQEA 2IVJA 1E5RA 2D98A 4XF3A 5L7OB 3U10A 5KC5A 1R1A3 1LU1A 2O0OA 2RVAA 1DZQA 2RDQA 2PN5A 4S2FA 2JECA 5GZGA 1ND3A 2W91A 2VBBA 4CXWA 3PMSA 4CU8A 1UY0A 5FP8A 4GWJA 3NSTA 1GU3A 3POGA 5CEHA 2FDGA 4HPKB 3AP4A 5KXBA 2JIJA 1VAMA 3MFAA 2D6OX 2P2KA 1VP6A 4FFIA 2F4LA 4QQHA 5FYHA 1T2XA 3PURA 4ZZ5A 4RHV2 4QQLA 2J1UA 2RE9A 4GJYA 4JHTA 4ASLA 3THCA 4W8JA 4CCJA 1N1SA 1VBD1 4ZXEA 3O0VA 5CKNA 1JYCA 2Y0IA 5E16A 2MEV3 4FPGA 3W5NA 1SFNA 1OHFA 1DHKB 4TYSA 4JGZB 1O3SA 5CFDC 4QGMA 4BZ4A 4Q4V2 3VHNA 4N90A 2ZA9A 2ADEA 2VD7A 1OSGA 2WBKA 3OTFA 4ITCA 4GQ7A 5FYIA 4U2AA 1VB2A 3K4DA 1US2A 2ES3A 4N7UA 4Q4Y3 1TVGA 2HYXA 4AL9A 1V9U1 1UKGA 4X6RB 4BISA 5J37A 5KWRA 1VBB1 2E32A 3WHTA 1XNKA 3I59A 3N36A 1BZWA 3WW4A 4IEQA 2WNVA 3N7JA 1D0GA 1DGWX 1NE4A 3AXDA 2DVAA 2VMCA 1SG3A 2ARXA 2BDRA 1REEA 2PHLA 5ACA1 4DXSA 1R091 3ILNA 4DY5A 3MIDA 2UWAA 3FLPA 5C8WA 1OLME 4RQPA 1KDMA 4FP3A 2FDJA 1F4AA 5FZ6A 3VV1A 1ZM1A 2RR11 4CUBA 2VOVA 1NYWA 1XE0A 4CCMA 3KT1A 3LGRA 1B35C 3VZKA 1ZZ9A 2A3YA 3VBFC 1JW6A 3OGVA 2GC2A 3ZFEC 4QX2A 3TEWA 4FAGA 2Y6FA 2Q8EA 3ZSKA 5JPNB 4N53C 2WZPP 3WV6A 3WNOA 1AR73 5C4WA 3TN92 2TUNA 5CFDB 5A3WA 3IMMA 2B4KA 1S55A 2GN7A 3BGAA 3LDBA 4C90A 1RUJ1 4ATEA 4MGZE 4TWTA 2W39A 4P9WA 5GLZA 1NZCA 4CEYB 3GZTB 4AI3A 1ZYBA 4NHKA 4YVWA 1DP0A 1QXJA 4BIFA 4E27A 2I74A 1FNYA 1MVEA 2PA7A 4P9GA 4PDWC 3VBSC 4UXAA 4YZ2A 1HB3A 5FZ3A 5DG2A 1IKPA 1NCRC 2WZR2 1NKGA 1HRV2 2FMYA 1PZ8A 2VQAA 4LIVA 4NPMA 2BP6A 2RMU3 5IK5A 1KQRA 4XQWA 5DQ0A 4JTOA 1ZVFA 2Y6GA 1IQAA 1POV3 1PVC2 2BNNA 3NKTA 4CXXA 2XWJB 3VBFB 3BOWA 1ODMA 2CU5A 3CEWA 3ATGA 3HD8B 1OLQA 2DCKA 4XQ4A 4QT6A 2WIIB 2A5ZA 4JAAA 4R4ZA 1AR93 1RUH3 2R0HA 3KCXA 4H55A 2JE8A 2R49A 1UL9A 4XFHA 3T4HB 1PO12 1UU4A 2WYSA 3JXSA 5J09A 4AI1A 1W8HA 4AF9A 1K5MC 3JD71 4RD7A 1DYPA 1XSRA 4CCDA 5EQUA 3I2IA 3NNJA 3UNPA 5BNNA 1BBT1 1AR83 3INAA 3ZXGA 1NZIA 2WNUC 1UOGA 3WP3A 2YFZA 1S0IA 1NXMA 1W0OA 2QQLA 4TLGA 5DDJ2 1GICA 3VN4A 1KS5A 4Q8LA 4AHXA 5LEKA 4HVQA 3E97A 1HXS3 5I0RA 2DDUA 1WLDA 2JEMA 1AXYA 1NCRB 1ULFA 2VVEA 3LD8A 4UBHA 3ZPYA 5IVEA 1UX6A 4LORA 1NLSA 2IXLA 3O0XA 1KRIA 4CCCA 1HB1A 2DU0A 4NO4A 4S2GA 3HIFA 1TME1 3M70A 1O4YA 3RJRA 4CU7A 2B39A 3BIEA 2B7YA 2BOIA 3AYDA 2A3XA 3OGGA 1N47A 2ORZA 4XJAA 1UYYA 4E2SA 1JZ3A 3JQXA 2E33A 2D6PA 2XLGA 1DQ0A 2XGXA 3FFZA 5CG8A 5FZ1A 2PMWB 3SQOA 5A33B 2VAUA 3KSCA 1HRI1 3UESA 4URAA 2PHDA 1BK1A 3M3CA 3OEAA 3B9IA 3P1IA 2G19A 1FV2A 1Q8VA 2WFF3 1BVP1 2YFUA 3IM0A 2ARBA 3PVEA 4I3GA 2CGNA 4D3WA 4IL7A 4BE3A 3MUZ1 4UWDA 2X10A 3POIA 4O9EA 5A7NA 3ZXFA 1NOVA 3MIFA 1VRH3 4PF5A 3OGRA 1OQDA 3H3UA 2R1DA 4HN0A 4A6OA 4Q5OA 3N9LA 2X5IC 4YW3A 2D3SA 4IDZA 1N1VA 1LCLA 1OVSA 4JVAA 5C5UA 4PI0A 1MZ5A 1UKRA 2BJSA 3GNEA 4KGQA 3NVCA 1STMA 2W1QA 4XTPA 4Y1YA 1IOAA 1OH4A 4AK3A 3WDWA 3WQ1A 5AFBA 1TE1B 5FWJA 1P8JA 3H8OA 1YQ2A 2GP3A 3N9MA 2RS12 4WBBA 2YUEA 2DVGA 4YW7A 2XONA 2ZHNA 2DCZA 1WD4A 2EXIA 3A21A 3HQXA 4OFGA 4OUEA 2OXBA 3T0AA 4A3ZA 4ZKTB 3VBHC 1D2SA 1UXXX 1X7NA 1AXZA 3THTA 1O8PA 3MICA 4RFRB 1D4VB 1GLHA 2B46X 1LB2A 3NJZA 3P5BA 2BOJA 2FDFA 4E9KA 4I30A 1W06A 2FDHA 1KFUL 3ZXLA 1JOJA 1LTEA 3KCCA 2VU9A 2RS52 3IPVB 4V2WA 3SMHA 2XDVA 4RHV3 2JWPA 3HEIA 2WQ8A 2WRAA 5A1AA 3WF1A 3WNNA 4K7JA 4MZUA 5HCHA 3BYWA 3ELNA 5LY2A 5FZCA 2W5FA 2VMFA 3PLQA 4P5HA 3ENRA 4XDQA 1AVBA 2VQUA 2C26A 4CZSA 4DXZA 3H9AA 2J1EA 4Y20A 5D8AA 1H6YA 5FY7A 1DIWA 2I07B 4COWA 2VG9A 3AFKA 1LOEA 1GNZA 4WM8C 3VBRB 4Q4V3 1OA4A 1X9PA 2Q30A 2YU2A 3DF0A 5FO8B 1RUC1 4YNIA 3V64A 1EV12 2V73A 3F95A 3KHBA 2ARAA 3U37A 1PZ9A 4CPBD 1QMJA 1IS3A 2FZ1A 2GP5A 4O61A 4ZU5A 1DQ5A 4BQ4A 1S0FA 3H3ZA 3BU7A 4ASMB 2DYCA 3VDDC 1MQTB 4DRRA 3O1MA 5FPBA 4BOWA 3BVCA 2DVDA 2JD4A 1SACA 2CDPA 4KG0A 2HEWF 4M3CF 3J7MA 1CZVA 3O1OA 2XBO2 1VRBA 1SBDA 1W90A 3AZYA 3NO8A 4QGLA 1HKDA 3ASIA 4LQRA 4XFIA 4YYOA 2VXRA 2ZACA 1YXWA 2XLFA 2EIDA 2C9AA 2VL4A 4LO5B 2Z79A 1LRHA 2Y6LA 3W58A 2K0GA 5IATA 2VUJA 3FHQA 3H1YA 3B3QE 4EN6B 2WSVA 3OOXA 4J1XA 1AYN2 4NWVA 5IHRA 4PDWA 2RS31 3VBSA 4GWMA 3I3QA 1UAIA 4LKEA 4FOVA 1DGWA 1WGPA 2VUAA 2ZGRA 5DAQA 3PMEA 4DZGA 1HQNA 1BVVA 2PFWA 4YZ5A 2JG8A 3WZ1A 3GF6A 1CPNA 3CLPA 2QBXA 3ES4A 4PF1A 3TN93 3B7MA 3D4KA 3E5QA 5CIRA 3RYRA 4KBBA 3HT1A 1IS5A 4S2DA 1GOHA 4XJ9A 5A70A 1POQA 2DF7A 5F6LB 2K9ZA 5T5OA 3MO4A 4DUWA 5GZEA 1YIPA 1N3PA 5A7WA 3W9AA 3OYWB 3HMYA 5J7MA 4IGPA 5D2AA 4JKKA 4JRLA 3UETA 3POWA 2OT7A 3QLQA 4AW7A 2EXJA 1H8TA 3WDYA 1MZ6A 4KWJA 4RS5C 5BNOB 5L9RA 2WZR3 1H9PA 1HRV3 2PLV1 2XJPA 4M0NA 2WNUA 1GOGA 2WNOA 2ADDA 3I2OA 3EB7A 3KV9A 3WNLA 2H0VA 4GH4A 5CKQA 4EV0A 4IEOA 2PHRA 5TSWA 2XWBB 1PVC3 1YQ5A 1C57A 3HBZA 2HWF1 1CGPA 4XAAA 4DQAA 4OI2A 5K0UB 3KMHA 1QQP1 2JX9A 5FPLA 1W9YA 2E53A 2HWB1 3PU3A 2BV4A 3U4XA 4MGKE 5FPAA 4MYEA 5LBEA 2IWGB 3AX4A 3POFA 4UOJA 4AI0A 1I9RA 3VKOA 3LWCA 4I3PA 2J42A 1SCSA 3SNMA 1TMF1 1I5ZA 3W5MA 3ZIXA 4EWDA 1PO13 1J1LA 1MS1A 2OW4A 2X29A 1FYUA 2GSYA 5LB6A 4ARXA 1C4RA 4HBNA 2A73B 1NG0A 2Z5WA 4DUVA 2NM1A 4Q26A 2BTVC 1RHI1 5DDJ3 4H14A 3M3OA 2BGOA 1IG0A 2GNBA 3QBQA 4IV1C 3WUDA 5BXXA 3ZYRA 3ZIWA 5DMYA 4WZFA 4NHLA 4L2NA 3MGUA 4FFGA 1SCRA 1XNCA 4QPIB 2QQVA 1FT9A 3WNMA 3C7GA 1BLZA 1QIQA 1RMU1 3I3EA 5DPNA 4AGVA 2W1UA 1QH7A 3PDQA 1PGL1 4YW5A 5JOZA 2DVBA 3FBMA 1CAVB 4DOUA 5LCWL 2AENA 5CFCC 1AYM2 1BEV2 5FZ4A 3N9NA 3ACFA 3GZEA 3KQRA 3E5XA 2D40A 5EXOA 4YFWA 3HBKA 3ZKYA 4V2VA 4ZS2A 2D44A 4HT1T 4D7TA 5DUVA 5JXJA 1Y9MA 5K7PA 4PLNA 3GHNA 5IVVA 3RZLA 3OD4A 5JLVA 1DLCA 4MUVA 1ASJ2 1NX9A 4KU7A 1LENA 4EZ4A 3J7LA 4I0AA 3HR9A 5CB7A 2VNGA 1HB4A 2UURA 1LOFC 3AL6A 4ZZ8A 1W8ZA 2EICA 5FQ0A 2W95A 4KL1A 3WCRA 3I2HA 4N43B 4FAHA 2R32A 1H2NA 5GZCA 1UY3A 3ORJA 4Y22A 1RINA 1HLCA 3ZFGA 4I0BA 2AGSA 4G9SB 1LAJA 3CO2A 3S0MA 4PBPA 3ZMOA 4IE5A 1H9WA 4DXRA 1OMIA 2GAUA 3AMQA 3JUUA 3VKLA 2ERFA 1NT0A 3FBYA 3POBA 1CESA 4QAWA 4FPYA 4IGOA 3LIGA 2A75A 4CDXA 5CA6A 4FPEA 3OBAA 3QH7A 4FOYA 4K1ZA 2JG9A 2RS13 2YBPA 3USUA 2PHXA 5BNPB 3CNAA 4CP1A 1COV1 3HWJA 1OOPB 2CY6A 4GB32 5FXVA 3DGTA 3WP6A 3ILRA 5ANQA 5JVVA 3JZVA 3K4AA 4XVHA 2QKDA 3PIJA 1DYKA 1ND2C 2NYYA 4JGYC 4UW3A 2GC3A 2JDYA 2R042 2RS53 4HN1A 4QU2A 1UOJA 5FCCA 4DRVA 4I01A 3S5AA 4ZU7A 5ABJC 1WMDA 1H6XA 2XPJA 2OUJA 4QPGC 1W2NA 1QJY2 1O5LA 4YFZA 2D6MA 2GDFA 3CJIA 1A8MA 4QQOA 2IXHA 4FFHA 2VQTA 4XF9A 4PIXA 1AR62 5T5JA 2O1QA 1ACCA 1ZREA 3M4FA 2AYHA 5D21A 4D6RA 2WAOA 4ZU4A 1WCUA 1EV13 4FQ4A 4C91A 2VMDA 2VCCA 5FKCA 4EYUA 1IQDC 4M00A 4YGDA 3AMPA 5L9VA 1IKQA 3ITQA 4BQ1A 2YROA 1SFPA 5T52A 1U12A 1AL21 2WAAA 2VZUA 1ND3C 4HL0A 3ES1A 5F3EA 5SV5A 5JAXA 1W04A 3SH4A 2MNGA 2Y8KA 5FJKA 1PIV2 3V65A 3L9JT 2ZX1A 3OPWA 2XBO3 3M3QA 1DQ1A 2VZQA 2YHJA 5ANNA 4IESA 1NLQA 5FYCA 4BIOA 5JSOA 4AGGA 5T50A 3WCSA 1YNAA 2BZDA 3ACLA 4OZOA 3RZGA 2VXJA 4GXLA 4R9CA 1RUI2 2J22A 5EHDA 1DQ2A 2DU1A 5FZ9A 1N3OA 2VUCA 1AYN3 2HWD2 3GGLA 5KR7A 2ZGKA 1VAKA 4I09A 4RGGA 1W8FA 3QOPA 5ISLA 5L7OA 1OC1A 4BYYA 4JCKA 2YG0A 5C8CB 1R082 2SBAA 4LO4B 3T4VA 2H0BA 3C7OA 1UPIA 4YRDA 3ZSJA 1CN1A 4GULA 1LNSA 3SHRA 3ZO0B 2BNOA 2RJ2A 1XYOA 1VBE1 4HOOA 4UI9L 3V0AB 1PGW2 1NA1B 1WZXA 4KBZA 1VB4A 4LK7A 3RS6A 4LBQA 5FP3A 3X29B 4IV3B 3FC0A 1UZZA 4AG4A 5JI7A 4K8FA 4CDWA 2WNVC 1JZ8A 2ZGSA 1UMZA 3H42B 4AAPA 1ND3B 1H4HA 5DZFA 2BBVA 3HQRA 4EWAA 2WS92 3HJRA 5EIYB 3MBWA 4N7IA 4CU9A 1F35A 4HVRA 1LHWA 4BM8A 4UFLA 4CUCA 4XC9A 4OCTA 1AX1A 2DBIA 3UYJA 3VDAA 2D6LX 4M3CA 4RQPC 2FDIA 1IG3A 4DNYA 1VBC2 2ET1A 1XU2A 3K4ZA 4IE6A 1GP4A 3KT4A 1B09A 5LZ6A 2DUQA 4YW2A 1X8EA 4GWNA 4IV1A 1HQWA 5EJZB 2NLRA 1NQJA 2E7TA 5E1RA 4B1LA 4XUTA 1DQ4A 2E31A 4FOWA 5C4WC 3AMHA 1E57A 3POSA 3I2DA 1Q43A 4ATFA 1V6NA 2ZZQA 3K75B 1KXGA 5JR7B 1C8M2 4M3CE 1GKBA 4P5YA 5GZFA 3O12A 2WQ4A 5H9PA 4BU2A 5AC92 1A3KA 2PAEA 3THPA 3D0JA 1C1FA 1D2QA 3ZLIA 2OQ7A 3T1MA 5JMOA 1RUD2 1W8OA 1ZZBA 4Q27A 4Y4RA 4YVWC 4CUGA 1EY2A 1SHWB 1GQHA 5J36A 1YO8A 2P6CA 2Y64A 1UY4A 2E51A 4XUOA 1APNA 3I8TA 4CYDA 2QTWB 3IAPA 1PGSA 2XH6A 3NAPB 1L7RA 4XF0A 1ONAA 3KD4A 4HFSA 5BYNA 4NIDA 4KWKA 1OA3A 4J25A 2A1XA 4MGYE 5IT6A 4IQPA 3H8UA 2VE1A 3OBZA 3BUCA 1UIJA 1YC61 5GJ6A 3S57A 1AYM3 1BEV3 5T55A 5FOBB 5C3RA 2HWE2 4BJ0A 5HPOA 1Q8SA 3Q8BA 4LHSA 1RUOA 2WWJA 1AX2A 3PJQA 2DCJA 2EA7A 1OKOA 3SKJE 1W2AX 1W6NA 3AP9A 4NROA 3U75A 5FR3A 1VBD2 3ZSMA 1ULOA 1ASJ3 2VQ0A 3D0SA 4YG6A 2R071 1W05A 1GOFA 2DBNA 4QHZA 5BNNC 1PMJX 4HKOA 1S2BA 4ONUA 3BOPA 5DAWA 4PIYA 4YVWB 1UMIA 1AR71 1O8SA 2YC2A 3KB5A 1D4M1 3VHRA 4FTEA 4K9SA 4EN9B 4NIGA 1IPSA 4DFSA 4FO9A 1GYKA 1ZA4A 4HSLA 1ND2A 4OHWA 1V9U2 1OUSA 2C9KA 1JZ6A 5E6HA 5JPMB 3MW2A 4YVSA 4D6QA 1VBB2 4V1PA 1RITA 4CDUB 1ENXA 2A70A 5FJHA 1YJLA 4QPGA 1GZTA 4NRQA 2ZCWA 3HNBM 2J1SA 3B02A 4AR2A 1HN1A 5ACA2 5F9TA 1R092 4L99A 1HN0A 3T3YA 2IXIA 5DUXA 3IBMA 1K45A 3AYAA 2JDPA 1SLLA 4IE7A 3VBOA 3VD7A 3A22A 2AC1A 4PQ9A 1RUNA 1RVF1 4GB33 4L0PA 1YFXA 5CAZA 2NN8A 2RR12 4NE9A 2TEPA 5A1LA 3C7HA 1PMHX 3B94A 2AEYA 1RXFA 1PX4A 4FVVA 4NR1A 1FPN1 2UY9A 5IVFA 2R043 2GZWA 1UX7A 3U0ZA 2YC4A 1W8TA 5CU1A 3OUJA 5CBLA 3MUY1 4M01A 2R7EB 4QX7A 4XTMA 1MS0A 1OXCA 1C5HA 1QJY3 3DPRA 4XMAA 5GZDA 3ZFFA 2X09A 4AQ2A 3PUSA 1YI7A 4WVMA 1FX5A 4EN0A 2YGLA 1WBLA 4Q1RA 2Y26A 3AYCA 4AFBA 1AR63 2QVSB 3NMBA 1N1TA 3WR0A 2QQUA 1XNBA 4QHOA 2BERA 3A0NA 1US3A 1YIFA 3SC7X 2CSGA 5DUUA 1WCKA 1HXS1 4LMFA 1ZNPA 1OLMA 3FLTA 1Y9GA 3FWEA 4A7ZA 4QXHA 2ZMNA 2YYOA 1PIV3 5IK4A 4IEVA 2NZ9A 1JBCA 1DU3D 4PQQA 3RZMA 2GN3A 3RFRA 3T0BA 2VTFA 3O7OA 1PK6A 1OPOA 1E5HA 4LOTA 2Y6HA 3M3EA 5HXMA 1HIXA 4PJYA 2XQRA 4E4ZA 3DYPA 3HOBA 1RUI3 1DGRA 3AL5A 1GANA 1MEC2 3GM8A 2VMGA 3FUOA 3RI9A 2HWD3 2RDRA 3FUQA 4MXVA 5FK7A 5D8AC 5KHHA 5HV0A 2WFF1 4CEWA 1R083 4NIHA 3GDBA 3JD72 2ZABA 1SBEA 5M0TA 1VMFA 4A42A 4Z8BA 1W3VA 1ZRCA 3PNAA 3ME2A 5J96B 1LHUA 2GH2A 3GZAA 4WVWA 1HB2A 4NUBA 2DUPA 1UMHA 1HX6A 3CBNA 3H8XA 2LW8A 3LEIA 3AC0A 1QJX1 1M06G 3CZUA 1GV9A 5F2SA 4AFMA 1JN2P 4AYUA 3SH5A 3S30A 3URFA 1OH3A 4XFGA 1RUF1 4C0HA 3J8F1 1UXZA 4KWUA 1AJOA 2EALA 1O5UA 4XCAA 4RFT0 2WS93 4AEMA 2OZJA 1TME2 1MZFA 2XHKA 4CE8A 1YRZA 1TQ5A 2XMLA 2VM9A 1EUUA 3U07A 3H8RA 1E5IA 4IE0A 1IZ3A 4B4RA 2FCTA 2Y33A 1W99A 1VBC3 2VCBA 4LO8A 4TZDA 1NCQA 4AEDA 4A44A 1QNYA 3WQBA 1ODNA 2QQPA 1FATA 1OT5A 1HRI2 1DGRN 1MPXA 3LFMA 4H2AA 2XR4A 4BWOA 2VCMA 2YDEA 4K20A 2JG8C 2VH9A 3KLSA 4FT8A 4L92A 4OZXA 2Q1ZB 3RWNA 3IIAA 1F5FA 5C3QA 4GA9A 2G1MA 2XQXA 3LEGA 5FYSA 3NV2A 4RHV1 4M0HA 2UWCA 4BH9A 3UGFA 2JIGA 1AJKA 1B35B 2ZGLA 2Q4SA 2ZKLA 5KXEA 5KXDA 1Q56A 1C8M3 1RB8G 3ZFEB 1IHMA 2FHRA 2LROA 2P6HA 2IFWA 2RM21 4JQRA 3JQWA 4QXCA 4FBFA 5AC93 1JYIA 1CZSA 3U78A 2C1FA 1XYNA 4N53B 1CR7A 4RR3A 1RUD3 3ACGA 4EJRA 2BWAA 5JZGA 2BVBA 5L73A 4EE2A 2FMDA 5KHJA 4MHUA 2B5HA 3UJQA 3DKQA 4Y26A 3AM2A 5FYTA 1H8TC 2QFEA 5GLUA 3ZXEA 4CP2A 1BQPA 3AZWA 2XUMA 4LE4A 1C1LA 3GZUC 4MXWA 1E5SA 2WYFA 4LLFA 5CG9A 4GH4C 1EP0A 1Y7BA 4DINB 4PDWB 3ZSLA 3VBSB 2WL1A 3KF5A 2JKBA 1DLLA 3BKZA 3LA7A 1RC6A 3B69A 1UPSA 5LA0A 5LW9A 1OD5A 2JG8B 2R061 4UF0B 3RMYA 5FZAA 1H8VA 4JRAA 2PAMA 5FXZA 2HWE3 3T08A 3VB9A 2PYTA 2WQZC 3LPGA 4IW3A 2DFBA 1K42A 1C8NA 4Q4X2 3LDKA 1LEDA 1QNWA 3R4SA 2Y38A 3H7YA 2WKKA 3WG1A 4GWIA 4HPKA 1VBD3 4HETA 3V56A 3A0KA 4FP2A 4UFKA 3POJA 4KGGA 4QU1A 2GMMA 1Q3EA 4GALA 5CZKA 5A7WB 4COYA 2GALA 4FPOB 2BW8A 4QWNA 2HH9A 2GMPA 1X82A 4A6SA 5J48A 2VNRA 1WMEA 4GJZA 1F31A 4FXKB 4O65A 1SFYA 2R0FA 4F3JA 1JOPA 2IC1A 5IAVA 1RUC2 3OJBA 2CGOA 4LNVA 4D6SA 2WSUA 4CXYA 1F4HA 4FPHA 1K5MB 1MACA 1PX3A 2AEZA 1ZA7A 4CP9B 1V9U3 5F3IA 5FY8A 5A6ZA 4QX3A 5FY5A 1AF9A 1G6NA 1VBB3 3CU7A 4JGZA 1PMIA 2WNUB 4HK8A 4JX0A 1UZWA 3GJBA 5JSRA 2EIEA 1NLRA 1QXPA 2VZOA 1Q8PA 2HWC2 1M4WA 3P3NA 3LOBA 5ACA3 2Q5TA 1R093 4U36A 4IE4A 2LRPA 1RUE1 4IGQA 1UO9A 3AKQA 3S7EA 1G9FA 5A7SA 5A3PA 4IERA 2BPA2 2WABA 4G3YC 5LASA 4UBGA 2Q1MA 2RR13 1OURA 2RS32 3ZPOA 2JE7A 1WW7A 3ABZA 3HVDA 3OD0A 4NIAA 5KBFA 4JKMA 3VHPA 2BQPA 1CIWA 2ARCA 1Q5OA 5FZMA 5B4NA 1H0BA 1H30A 1OFNA 1D0HA 5FMOL 4QX8A 4XBQA 3OBRA 1OVPA 1H2MA 4BMBA 2P3YA 5FIXA 2NQYA 4OMCA 2QQWA 4YG3A 4L8QA 2V5YA 3LB9A 1CAXB 4DY3A 2KM2A 3ZFGC 3VDBA 1H1AA 1VALA 3FL7A 2HEVF 5BPXA 3W20A 4RA0A 4UW5A 5HCAA 5EWSA 4LR4A 4QDSA 2WA4A 3N9OA 2UU8A 3HNMA 1RTVA 1WWYA 4KQ7A 1DCSA 4CDXC 1TG7A 1DYOA 2BFUS 1LGBA 2A71A 2YBSA 1ZRIA 2X5IB 2JG9C 3M8LA 1MS5A 1UU6A 2MPFA 1YWKA 3EBRA 2DV9A 3FMGA 3MPPG 1EAH2 4XE9A 4LO6B 5FZIA 5C71A 2FCUA 4NPRA 5IVCA 2VY0A 3JU9A 1GFF2 3LQCA 2PLV2 3D82A 3TBDA 4CEYA 5K8SA 4XF1A 1KDKA 2HYKA 4QXKA 1LESA 1MS8A 5FZOB 3WP5A 5LY1A 4SBVA 3VZOA 2IUWA 1YFWA 1H1IA 4QB1A 2IXCA 3NL1A 3VBHB 4O9GA 5FMDA 4YM3A 2R30A 2HWB2 3Q8FA 4BQ3A 5C7GA 1GZ9A 4FPFA 3MI8A 1DFQA 4NWWA 5FQ0B 1MEC3 2EIBA 3KGZA 1YFYA 2FBEA 1VIWB 3O1PA 2HKXA 3RYPA 1OPMA 1O7FA 3AVRA 4QDQA 1FV3A 4AI9A 4AVVA 4B29A 5BY5A 1TMF2 2JKXA 4YW6A 3CJIC 5FZGA 3I3DA 3K3NA 4YLZA 3IT8A 2G4IA 1CPMA 2NMOA 3H1WA 3R4UA 4LBJA 3JD73 1I3HA 4B1MA 4ZONA 2Z42A 4AVAA 1JU3A 1GR3A 1OD3A 3GHMA 4OLLA 1J3PA 2VMEA 1S4CA 4LUMA 2GU9A 5DABA 3WHUA 4MX3A 2HBTA 4JDOA 1RHI2 2TNFA 3USUB 2JG9B 2D5HA 4W6YA 5FZEA 4WM8B 2VNOA 1WUVA 2B9UA 4AEJA 3MFCA 2OVUA 3VD4A 3ST7A 1JU4A 3ZN6A 3WQ0A 5FZHA 3SCFA 1PGL2 2WWSA 1RUG1 4CDQB 1TME3 4P9LA 1PO21 3ZR6A 5FREA 5F37A 2HEYF 5FO7B 2W94A 3VDDB 4D69A 2KR2A 3LAGA 3LDRA 1EPWA 3AB0A 4XMIA 3KCYA 3VZJA 4B7EA 2YY1A 3DEMA 3P3PA 1YJKA 1Y3TA 4B7KA 2P37A 3IIIA 3ZYJB 1W2UA 4E8DA 1HRI3 2E63A 1GNHA 1DZRA 3IZOA 4QX0A 4XJUA 1NAEA 2BNMA 2VJXA 3ZR5A 2XVKA 1W6QB 1IS6A 2RS51 2BBAA 1JXNA 4UAPA 3N7MA 4R8HA 2YPJA 1GP5A 1KJLA 5C3OA 1ULDA 4BA6A 5GKAC 5A33A 3N4MA 2W68A 4ZXKA 4MO3M 1A34A 4XACA 1LULA 3LF7A 3TEYA 1X33A 1ZBE1 2ZHLA 4CDWC 2HLEA 2ZGNA 2F17A 1O3TA 4LBMA 3B01A 4LE3A 1POV0 3WY6A 1V6IA 5C70A 1ZX5A 2B42B 5I0TA 3KWVA 5A3OA 4Y1XA 4JC1A 3T30A 1X9TA 1EV11 4ZPIA 2AR6A 5C33A 2CWMA 1KGYA 4OI0A 1YFUA 4XAEA 3WXPA 1W6MB 3GALA 3UT0A 2O8QA 2QQJA 4TLFA 1XQNA 1WLCA 2P3IA 3GBGA 1REDA 1F5JA 2QQNA 4QB6A 3ZYGA 5FZBA 2VPVA 4K40A 3BN6A 2OZ6A 3GCXA 5CKMA 5FP7A 2ZEXA 4G4FA 2XL9A 4HK9A 1QU0A 5E88A 2XBO1 1ZRRA 2QE3A 4RS5B 4ET7A 3LOIA 4CDQA 3FN9A 4R52A 1YQ8A 4XQDA 1KJRA 1GZWA 3VZNA 1ZZ6A 1XC6A 2NMNA 4XIKA 3WD5A 3VUOA 3UGHA 3WF2A 4XZUG 5LWBA 2ILMA 1DBNA 1V6KA 4Q4X3 1AYN1 1JYVA 4OQ8A 2WLQA 5EPAA 1SPPA 2RJKA 1VBA1 3WNPA 3FHIB 1X50A 3DXUA 3IPVA 2EXKA 1A6CA 4AZZA 5IFPA 2VTXJ 1Z7S2 2ZJCA 4OMDA 3AP6A 4QM8A 4AE2A 4NPLA 4WV8A 1OF4A 1RUC3 3G7DA 3ECQA 3MLJA 2EF6A 3I3BA 5D1IA 3PU8A 5IVYA 3THDA 4F7ZA 4Q29A 3LE0A 3MV11 5LA9A 1AL22 2VVDA 5F2WA 5FKBA 5L19A 3ROUA 3KVAA 3VBRA 4LBKA 4YZ1A 2HWC3 4IEZA 2QZ2A 4IV1B 4A2UA 5A3LA 1I6XA 4CSWA 3LEKA 1WW6A 1ZBA1 5LRSA 1CAWA 1DQ6A 5IJRA 3RZKA 1W9WA 5CISA 3LSDA 4IEPA 1MQTA 5IFTA 3FHAA 4AGRA 1IPJA 4PT6A 1VMHA 3LCPA 1QOOA 2WC2A 4KNCA 5FZ8A 1QDOA 4PLMA 3PUIA 3VBUC 3WDXA 5FBJA 3ZXKA 4Z2AA 2RS33 2KA3A 2ZX3A 4JKLA 5A3TA 4F8AA 5CFCB 3O1TA 3S5QA 5A32B 1ULCA 2EXHA 1QEXA 4DUXA 3BCWA 4R9DA 3VKMA 2J1RA 5DUWA 3SEEA 2CGPA 3AKTA 1Y9QA 3ZXAC 2VC9A 2QQIA 5DN2A 4Z1VA 3I4IA 3C3VA 2CV6A 3PVBB 1JS9A 3ZN5A 2VECA 3I97A 5FUIA 3OBTA 5KHIA 2XVLA 2VOKA 5F5CA 4YVSC 3WINE 3V0BB 3S7IA 2I45A 1QY4A 2OKXA 1QDCA 4L9BA 3USSA 1GMMA 3SXWA 1Q8OA 1QF3A 3LSEA 4XABA 5CVRA 4CUAA 3BPZA 5JXGA 4B8EA 1CWPA 3MIGA 2JDKA 1O3QA 1O3RA 5FO9B 3RGBA 2VZVA 3POEA 3AVSA 4A41A 2XKOA 3BALA 1C3HA 5FYUA 1EAH3 2RG4A 5A7PA 3VBOC 3ZXJA 2UYBA 4GKYA 4PCRA 2PLV3 3IAQA 4R9AA 1CZTA 2NPIA 1N1YA 2RJLA 3SCHA 3MF9A 3OY8B 1BYHA 2DVFA 4OUMA 1UZVA 2Z4FA 5EYYA 2G9FA 2TBVA 4AVTA 1FOD1 1GNYA 4LKDA 4NAMA 4EWEA 4JQTA 2P4EA 1CX4A 2XB6C 5EV7A 1H1MA 2JENA 3VDCA 4XOGA 4FPCA 4LA3A 3WSOA 5I93A 5JCTA 3EYPA 2HWB3 3GBWA 5FP9A 5C3PA 1J59A 1ZRFA 5F5IA 1H2LA 1WCQA 4XYXA 1UN1A 2A6WA 3VL9A 1YLLA 1CAUB 1KEXA 4Q4W1 1W6OA 1JHJA 2PQQA 1LHOA 3TB0A 3AYEA 5FZLA 3PTRB 3DPRC 5G04L 4JGYB 1ND2B 1W0PA 1SZBA 2WZ8A 3GJAA 3ZFFC 1TMF3 3AJYA 3VD9A 1W9FA 2A6YA 2DURA 3LEMA 2CWSA 3JBG1 3MIEA 5K0UA 1J58A 4YG0A 2L9LA 4P14A 4M4RA 2QQOA 5HV4A 4HVOA 5ABJB 1KITA 4QPGB 3MW4A 1BCXA 2F6BA 2K2SA 1FMD1 2QDNA 5FWEA 5B2GB 4MSVA 3AFGA 5F6KA 1RHI3 2XXZA 4CCOA 5FOJB 2VZ3A 4ASKA 2VMIA 5I8SA 2ZPXA 3KGLA 3VKFC 3AJZA 3TRSB 3AP5A 4GMP1 4P00B 4S2HA 4COVA 4QQPA 1HQLA 3I49A 3BODA 2PXJA 3VHOA 4F83A 1H4GA 3H0OA 2C4XA 1PK6C 3E6BA 5F8PA 3DYMA 4TXWA 1NY71 3M2MA 3WW1A 4XUPA 2ZTNA 3VL8A 1J83A 1CVNA 5KHGA 1IS4A 5BV6A 2OIIA 4QPIA 3WF0A 5JWPA 3BI3A 3KQ4B 2BRTA 1R1A1 4QDRA 1F15A 4CEWC 5IYYA 1CAVA 1PNFA 3ZFFB 4A4AA 2R072 2D3PA 5I0DA 3DECA 3KHCA 4W6XA 1DZTA 4UFIA 5DZEA 4BCUA 3WG4A 2CDOA 1D4M2 3UJOA 4URTA 1XB9A 4YGEA 2ZHMA 3K48A 5T5PA 1R64A 3Q8EA 1QJY1 4XFBA 2GNTA 1JTZX 2ENRA 2WINB 1GUIA 1ZZCA 1XSQA 1CONA 4INDA 3TNPB 1O4ZA 4NAOA 5FP4A 4WZCA 2XKPA 1FI2A 2I2SA 1QJU2 4H7MA 5HI0A 4N43A 1OQ1A 4Y1VA 4B4QA 4XXPA 2MEV1 3OGJA 3RI8A 3Q9OA 3I59B 2DWRA 4AHZA 4I02A 1SLIA 2WNVB 3IB3A 3TOJA 2H6BA 1NCQC 4SLIA 5AVPA 3T09A 4AEDC 3J9SA 4BQ5A 3RRDA 2UY8A 1RVF2 2JDNA 2WT1A 4K8RB 4Q4Y1 5DAXA 5GALA 3ALQA 1UYXA 2D5FA 3CF6E 5DAPA 5FY4A 4RQPB 1JHNA 3ZYBA 4CEWB 5A3UA 4OI4A 5BNPA 1FPN2 1PZ7A 4LK6A 2W0XA 1V6JA 3KVBA 3NV3A 5FK8A 1V6OA 4A3XA 4Z2WA 1WA6X 1OOPA 2CAVA 4GIQA 1I1EA 2XVGA 2Q0AA 2GMEA 1A8DA 4N8MA 3R0RA 5IAXA 1IGOA 3W21A 3R05A 3LZZA 4RR3C 1R081 5C4WB 4YZ3A 4OVEA 5FTTC 1W28A 5JZGC 2QCSB 1J3RA 3RG0A 4Y24A 4CCLA 1BMV1 3ZX7A 1Z7S3 4Y5TA 3VBUA 4AHWA 4CPBA 1XRUA 4MG2A 3MDPA 4PLOA 4DXTA 1PGW1 1YQ6A 1H2KA 2QZ3A 4LITA 5GLWA 1GZCA 5JIAA 1DDLA 1REFA 3KM5A 5A6YA 4XBNA 3ZYFA 4CA9A 2ZMKA 3BTXA 1QOTA 4W50A 1LECA 1AL23 3OUHA 4J6GA 5FMBA 4DB5A 4QM9A 1YEWA 3TAYA 2W2IA 4YW1A 1CX1A 2FD8A 5F3GA 3DN7A 4Q0PA 4LHNA 1JMUB 2WS91 1VE0A 5FYBA 3DV8A 3IDCB 5FZKA 1W2TA 4QQ2A 5LA1A 1BXHA 5L7OC 1Y43B 1UYPA 3PVNA 5K9YA 3ZVXA 1UYZA 5T5LA 3QD6A 4BQXA 2ETEA 3N7KA 4RYDA 2WLPA 4DMIA 5I8YA 3FLRA 2ZGUA 4XDPA 5T54A 5F5AA 5C9AA 2IVIB 4D7YA 2BYVE 1LGNA 5H9QA 2B9VA 3VKNA 4XETA 4NMIA 1G9CA 3LFIA 5HCBA 3S6PA 2RMU1 4Y33A 3KS7A 1JYXA 3W59A 2D7FA 2PTMA 1SEFA 4IEWA 2YC0A 3D8CA 1POV1 4LJHA 5E89A 2FZ2A 4OHVA 4WVZA 5JDBA 1PM7A 2CNAA 5JXHA 2BVVA 3Q8AA 2ZGOA 5FMOS 3R6SA 2WN3A 4NIIA 4CCNA 5BNNB 4MHRA 1QJX2 4FFFA 4NN0A 4JGZC 2PHTA 3N3HA 1XNAA 2Z69A 1RUF2 1AR91 1PNGA 1RUH1 2JE9A 3J8F2 1UZ0A 1RUJ2 1UY1A 2W1WA 5EYXA 2VOTA 3WQ7A 4N9HA 5J3UA 1QKQA 1NA1A 1YQCA 4QPWA 1G9AA 3NJXA 5A6QA 4KWLA 1JH5A 1XE8A 2P1BA 1VR3A 2VZSA 1AR81 4IV3A 3HQUA 4BK4A 3RDIA 1UW8A 2W3JA 2VCAA 4TTGA 5FLHA 2ORXA 5CYYA 3OB8A 5LBCA 2JDUA 4XJZA 1LHVA 3ZN4A 2LALA 4ES9A 3WDTA 1UU5A 3OGSA 2IXKA 1PM4A 2HWE1 2VZRA 4D7SA 3HN1A 1MR5A 3TYJA 1S0EA 4D94A 4BXFA 3DYOA 1ULPA 3AK0A 2VUDA 3OG2A 1MS9A 4FPJA 4LBNA 2RM22 5FUNA 2FQPA 1UOFA 2A6ZA 2WO3A 4E2GA 1FNZA 4GKXA 2OPWA 3GCWA 1Z0HA 1JUHA 1W0NA 3PL0A 4Q0QA 4WM7A 3E6DA 2AZ5A 4W6WA 1XE7A 4IETA 3ZKUA 3O1SA 2AUYA 2ZHKA 3RZHA 2RDSA 3SLIA 4MV2A 4QKBA 2LTNA 1J3QA 1UOBA 3N9QA 4QX1A 1BBT2 2JD9A 2ZS6B 4CEYC 1QGLA 2D43A 2YB7A 1VRH1 2ZEZA 3RZJA 3PUQA 4Q1PA 2WA3A 1URXA 4I0WB 2X8KA 2C5DA 1CJPA 1BHGA 2BU9A 2D3RA 3EO6A 4W65A 3O0WA 4P02B 3NAPA 3OF1A 1QJZA 3UKNA 1PVXA 2A7AA 3IDEA 2R062 2HJIA 3POYA 4AVBA 1W03A 1MS4A 4OYUA 4UFHA 2Q8OA 4LBOA 3NV4A 1VPHA 2W46A 1S0CA 4LT5A 3N9PA 1SQ4A 1RL3A 1WKYA 2A3WA 2R073 3RPQA 1YI9A 5T3NA 5I91A 3BTYA 2Q8DA 1WW5A 3WG3A 3KT7A 1D4M3 3VD3A 1AHSA 4HG6B 3MLKA 2XJRA 4Y20B 4XHXA 5D8AB 2LS6A 1XYPA 2GH8A 3CKHA 4Q0SA 3NWKA 4XUNA 2DUOA 4RL7A 4XEZA 1L7QA 2R1BA 3IWZA 5AVAA 4BQ2A 1PHMA 4QXBA 4AQSA 1UF2C 3WG2A 1QJU3 2ZAHA 4LHLA 1BJQA 1L3JA 2VW2A 4JHZA 4BQWA 3Q8CA 1BK0A 4AVCA 4UFJA 1AX0A 1AUYA 4KH9A 1W6PA 5FZDA 1JZ5A 2YU1A 1RUE2 1VJ2A 4Q4V1 4OQ9A 4P9YA 2J1AA 4LOSA 1JZ7A 4MLOA 5IK7A 3BTAA 4CDUA 4JTNA 1YUDA 5LA2A 1UQXA 1QXRA 3C7FA 1J1TA 2ZOEB 1RVF3 2QJVA 3NKGA 4LO7A 5H9SA 3MW3A 1HJGA 3A4UA 3MV01 2IXJA 3GBFA 4E4SA 3ZYHA 1WLWA 2ZX4A 4B3NA 3EHKA 2HBUA 3KV4A 1LEMA 2QNKA 4LKFA 4RN5A 4YPJA 1FPN3 1KD7A 2DFCA 3G6JB 4Y1ZA 3O1VA 1MEC1 2EAKA 1EPZA 2XL7A 2VZ1A 2A6VA 4Y4YA 1DGLA 2Y0OA 3AMNA 1S0BA 1CIYA 2BWCA 3IN9A 1LU2A 3OPTA 3UKTA 1U5YA 3AKPA 3JCIA 1Z78A 4HXCA 4XCBA 3ZN6B 5LATA 4AQ6A 2IFRA 3PVOA 4LXLA 4ZS3A 3BU0A 2FDKA 2BEOA 5A80A 5FRAA 3VZLA 1OLRA 1MZEA 3TN91 4BDVB 1JYTA 4Z92B 3T2TA 1VMJA 4XBLA 3MYXA 4MGQA 4MGTA 4LLOA 3AXEA 1H8TB 2C0ZA 1Y4WA 2YGMA 1W2OA 1T6BX 4P9IA 4CDQC 5JUVA 4EN7B 3ZMNA 4LBQD 5BUVA 4DEVA 4UT5A 4HZFA 4OULA 4YM0A 1VAVA 4GH4B 5LK7B 5FYMA 1HV0A 3T0DA 3HN3A 4XHBA 4XIOA 1WBFA 5FY9A 5FY0A 4D0QA 1NE6A 5FPZA 3M3IA 3DXTA 1SBFA 1YYNA 2WZR1 3H1MA 1HRV1 4FPKA 3WW3A 1OUXA 1C28A 1S0DA 4R4XA 4GMP0 3I2GA 3J26N 2PELA 1GBGA 1SDWA 1G86A 2E7QA 4YZ4A 2D97A 1PVC1 3ZM8A 1ZRDA 2E9QA 4ISRA 4QX5A 2Y34A 4Y5SA 1XOYA 3T1LA 1W39A 1S2KA 1AL0G 5L9BA 4Y1UA 4XPVA 2NP0A 1QJX3 1UCXA 3FX3A 4GAZA 4X8PA 3HNYM 2WN2A 3ZXDA 2XOMA 1QHDA 3VBRC 3WX5A 1RUF3 5A1FA 3J8F3 3BTZA 1RUJ3 1PO11 3D3AA 2WO1A 1RUG2 3MIBA 4AXOA 1PO22 5FPUA 5I0UA 1ZZ7A 1GZWB 1LR5A 4NRMA 1MQTC 5FAXA 2Y60A 5CFDA 5IK8A 2JICA 4QMAA 5IWFA 1N3QA 5FZ7A 4ES8A 2VNVA 5DDJ1 4K21A 2GNMA 4XZPA 2C24A 1SPPB 2CL2A 3WNXA 3ZDVA 1OI6A 3WDUA 1WCDJ 2ZBJA 3NNGA 3I2KA 3AZXA 3DL3A 1AXKA 1U5ZA 1LOGA 4L11A 5JOWA 4Q4X1 5A3NA 2HWF2 1LKNA 1SLAA 3MEPA 4MGIE 1V0AA 1QQP2 2VBPA 5APAA 1NUKA 2BUKA 2RM23 2XG3A 1ZBE2 2W1SA 3H7JA 2V4AA 2XJSA 2CHHA 2P3KA 4KG8A 5JIUA 5F7UA 3ACHA 2Y6KA 1F2NA 3GYDA 3ETPA 3CMGA 4K3UA 2W87A 4Y22B 4CRQA 1JZ4A 1OF3A 3H50A 3ZFGB 4AFCA 2RDNA 3EMRA 1B35A 4NRPA 4KI5M 5F5QA 4AWDA 3VBFA 2OQ6A 1CAWB 4XDOA 3SH3A 1K12A 1DG6A 5DG1A 3WNKA 1UD1A 2BGCA 2QQKA 3ZFEA 3A23A 1BBT3 1GSLA 2X53S 4MVTA 4N53A 3T2QA 3TWIA 1W8NA 5SV8A 4CDXB 3ZSEA 3KZ4C 1LOAA 3NW4A 2WO2A 5GLTA 4LEJA 1K5JA 3T2OA 5IUQA 5KXCA 2HWC1 2WJSA 2QDRA 1WW4A 2G9ZA 2WT0A 3DUIA 3EJKA 3L2YA 3P6BA 4XFFA 5BNOC 5HBAA 4I2OA 3NNLA 4PI2A 5FLJA 1JYWA 2R063 1WD3A 4BXSV 2P34A 4BB3A 1RMU2 4AOCA 1YHFA 2EVXA 3E1F1 3O14A 5C6CA 4BLIA 2RS11 3U11A 4AFDA 3LKJA 4KU8A 4EZHA 3E6CC 4Z07A 3VD5A 2AREA 2VOWA 5K0UC 2VGDA 1VBA2 1NCRA 1OKQA 4LULA 1WCSA 1KS4A 1ENQA 2PHFA 4UF0A 4YARA 3ZOIA 3B9CA 2D6NA 4QGNA 2QQMA 4X8NA 1G7YA 4XFCA 2XJUA 5CADA 2Q1FA 2PHWA 3CJIB 2WWUA 3PTYA 4P9JA 1LODA 4Y5Z0 3F2ZA 4E2QA 1A78A 5HCFA 4AQTA 3QH6A 5FFOC 4BPZA 4IXLA 1LOCA 2XJTA 4DS0A 1S0GA 4AHYA 3WP4A 4HKWA 4OI1A 1RJ7A 5IVBA 5H9RA 5AFEA 2SLIA 5A7OA 3J7HA 1ZBA2 1EAH1 3APBA 2JDMA 5JSPA 4C1WA 1K5MA 1DF0A 2WO7A 1RUE3 1WMXA 4XILA 4CP9A 4QPIC 4AEKA 2BGPA 4K6BA 4QB2A 2G9GA 1W6OB 2GC1A 1S1AA 1ALYA 1HV1A 1KFXL 2Z2SB 1IPKA 3H3LA 3J4UH 4XURA 1HJFA 1W9TA 4CCEA 3I2JA 3O1UA 3WW2A 4N9IA 1COV2 1TZOA 4QKFA 2XUEA 3SKVA 5GLVA 2J1TA 5LEJA 1U5IA 2CAUA 3ILFA 4UW6A 4X6QB 1K3IA 5A7QA 3UV9A 1C5IA 3CJXA 2W9XA 2VTXA 3MLLA 5FV3A 5A3MA 1YCIA 3IDAA 1O4TA 5ERLA 1QWRA 4RSUA 2VZTA 5FLIA 2ZZJA 2GC0A 5F32A 2KXLA 1NQDA 5LK5A 4N43C 3PUHA 4XJ8A 2XJQA 4LBQB 1UNBA 3L2HA 4JDNA 1CAXA 5LBFA 3ZDSA 5FXXA 2J1VA 1ENSA 3K3OA 4Q0UA 4YM2A 1TNFA 1JODA 4GD4A 4BHPA 4CDWB 2YPDA 3NQHA 3OSDA 5I8TA 3UGGA 3I54A 4HANA 1RGSA 4YGBA 1OBNA 5B4XA 2WR9A 5JI9A 2VVFA 3CZJA 4DO0A 4ORFA 4K1YA 2ZEYA 4CU6A 3LA3A 1MVQA 2E6VA 4M3CB 2X5IA 3PIGA 3HAGA 4E8CA 1FOD2 4XF4A 4AI8A 5BNPC 1CD3G 2ZXQA 4A7KA 1SLCA 5IVJA 4YW4A 1RYYA 2LM3A 5DXDA 4UYBA 4AI2A 1OOPC 5J98B 3I3MA 3SITA 4FQZA 2WUHA 4LA2A 2KD7A 5JOYA 4YWAA 4M4PA 4Q4W2 2ZKNA 1EYBA 2LUWA 4C1XA 5FZOA 4CCKA 1RJ8A 4QKDA 1HW5A 1LGCA 1R1ZA 2Y6JA 2YXSA 4GZ9A 4QKNA 1ENRA 3VBHA 2B8MA 3JBG2 4LIUA 5CNAA 5FPXA 3MZHA 2UWBA 1V70A 2GNDA 4FXGB 2OUHA 1UIKA 2IZWA 4QD2A 2O14A 1GQPA 2WT2A 4TN7A 2XLAA 3NRUA 2F4PA 4A7YA 4CP0A 1AZDA 3IMNA 1FMD2 4BMEA 3RVHA 1Q8QA 3IKWA 3OUIA 3BIWE 3WOGA 1ZZ8A 5FZ0A 1J84A 1OQEA 2R16A 5JMCA 1ULEA 1O91A 1WLTA 3RJ2X 2EIGA 4Y3OA 1VBE2 3D6EA 3K46A 1MS3A 2ID4A 2R6QA 3JB8A 2V09A 3FJSA 2Q8CA 3AKRA 4UW4A 4FCAA 4Q0VA 1ULGA 4NOTA 5F1RA 3DKWA 4IEUA 3BPSA 3NJVA 4XFAA 5FYVA 3QACA 5IW0A 1RUG3 4HONA 1PO23 5G05L 3D5OA 1G9DA 1NY72 2PQSA 2JDAA 1JZ2A 2W92A 4WM8A 1TEIA 1LJ7A 5C9AC 4IEXA 2H6CA 3HT2A 3E5UA 2ZGMA 2JJ6A 1O59A 3ETQA 3UKVA 1S0JA 4D8MA 5KHKA 5FXWA 1R1A2 5GM0A 3PJYA 1XU1A 2E7AA 2QUOA 3OYWA 4NJ4A 3VDDA 1W3XA 4ISQA 3ZYPA 5DZGA 2W08A 2XHNA 1W6NB 2ET7A 3MHZA 3RMXA 5FBZA 3VBUB 5KC6A 2HWF3 1AYM1 1BEV1 2OS2A 3CQOA 1NXD1 2WFPA 3NJYA 1QQP3 5BNOA 1SLTA 2AACA 2BFUL 1GWLA 4C0BA 2DTYA 2JB4A 3FFQA 4NVPA 3T2PA 4BQYA 3AP7A 4DEQA 1XNTA 1ZBE3 5LRRA 1W6QA 2EAAA 2E26A 4L97A 1Z7S1 2V72A 3I7DA 4LBLA 4XUQA 1CQ9A 5FY1A 1ASJ1 1NA1C 3B00A 2MEV2 4XW3A 4ZY9A 3ACIA 1GWKA 4YVSB 3FE5A 1W8WA 3UL2A 4AAXA 4IV3C 5FYYA 1V6MA 4ZHNA 3OPZA 1JI6A 4FTBA 1FXZA 5K4LA 2ZAAA 3LPFA 4QPYA 2VBDA 2AH2A 4YM1A 5C9AB 2OYZA 4FPLA 4LPLA 4O7XA 4Q4Y2 1SLBA 3I2FA 2ZMLA 3RZZA 3VZMA 1WMFA 4RGAA 3VGIA 4JV4A 3VBOB 4FTSA 1W9SA 1XPWA 1W6MA 4MOAA 1XBFA 3O5SA 3WEZA 1UWWA 1RMU3 3IDBB 1GQGA 5LBBA 5FDBA 3KV6A 4HKLA 5DAVA 3M1HA 4EROA 1D7PM 4XJWA 2YMZA 4ARYA 5F3CA 4RS5A 2OPKA 2YV8A 1VBA3 2RV9A 3QCWA 5FZFA 4GB31 4WM7C 4YSFA 1QJFA 1BMV2 5EJ3A 1SMVA 3GXUA 3A7QA 4AVSA 2VULA 3DPRB 3O1RA 2XJVA 4XXAA 1V6LA 4EQVA 2WZEA 2ZX2A 4WVMB 3AKSA 2R041 4META 1AR72 5L36A 4FSJA 3AZZA 3WLUA 3WT3A 1OFSA 2OX0A 4HMZA 4Q2FA 3HPNA 2K46A 2DTWA 3NAPC 1JOBA 4NHMA 1QOSA 1EUTA 1TNRA 1RXGA 2D93A 3AZVA 4NHXA 3U14A 4H3WA 4Z82A 1ZBA3 3BB6A 3DCQA 2OA2A 3J7NA 4PIZA 4WVVA 1AR61 3ON7A 3CIHA 3TEZA 4LUKA 4MADA 4COZA 4HLTA 4CTEA 2CTVA 4IUGA 4LHKA 2MHFA 1LHNA 2VR4A 1OA2A 1G9BA 1X36A 5C5TA 1QH6A 5C8CC 1V00A 1PK6B 3CL1A 4W4ZA 2YZ4A 4RGKA 4Q8KA 4OHZA 1XXNA 2ZX0A 3MF6A 2P17A 1COV3 3U1XA 1XNDA 2RMU2 2JDZA 2WNEA 2ZGQA 3KV5A 1UY2A 1UZYA 2JDHA 2CYFA 1PIV1 1S2EA 5EZWA 3RSJA 4WM7B 1O6UA 3TNQA 5JXIA 3PUAA 2A6XA 2DCYA 1JUIA 2VOXA 5JOXA 1JYNA 5CFCA 1WA4A 5BNQA 2YBKA 2VW1A 4QHBA 1RUI1 3R4DB 2UYAA 5A32A 3SCGA 3N7LA 3B5LB 3JB4C 3WF3A 2VZPA 2HWD1 1AR92 1RUH2
chains in the Genus database with same CATH topology
2JXAA 4FOQA 4P9XA 5E8AA 3MIHA 1FAYA 4EN8B 4J1WA 2PHUA 4BLJA 1AR82 4CDUC 3V0BA 1CJDA 1LOFA 1RIRA 2ATFA 3B93A 3M7AA 4TSVA 4MH0E 2ZGPA 3K51A 1HXS2 1FOD3 3RNSA 1NCQB 4AEDB 1HDKA 5I0SA 3EXUA 4YGCA 1VLNA 3AMMA 2VMHA 3MPBA 4Q4W3 3UK9A 3VLBB 3OY8A 5EFUA 3C2UA 1U5XA 2W52A 2O8OA 2RHPA 1VBC1 1U0AA 1LOBA 2DCTA 1T6GC 3JBG3 4OHXA 3OCPA 4OUSA 2N7GA 3RYKA 3SISA 3WQ7A 5HXVA 1CAUA 2D6KA 2ZGTA 2WFF2 1FMD3 1X8MA 4IEYA 4RR3B 4JGYA 4LTAA 3N35A 5JZGB 1W6PB 3WVJA 4R9BA 3PHMA 1F8VA 1VBE3 1G8WA 1VRH2 2B45X 4E4DX 1C8M1 4GMP3 2PAKA 5ABJA 4OHYA 1QJU1 3LA2A 5AC91 4AFAA 5C8CA 3NV1A 3ZYIB 1RUD1 4MXWB 4B4PA 3FZ3A 4DPNA 3RQ0A 1F9KA 3WDVA 4COUA 4PBOA 2P3JA 4H7LA 3V0AA 4HSJA 4JDMA 2VW0A 1BKZA 3WUCA 3EQEA 2D98A 4XF3A 5L7OB 3U10A 5KC5A 1R1A3 1LU1A 2O0OA 1DZQA 2PN5A 4S2FA 2JECA 5GZGA 1ND3A 3PMSA 3NSTA 4HPKB 3AP4A 5KXBA 1VAMA 3MFAA 2D6OX 2P2KA 1VP6A 4QQHA 4RHV2 4QQLA 2RE9A 4ASLA 1N1SA 1VBD1 3O0VA 1JYCA 2Y0IA 5E16A 2MEV3 4FPGA 1SFNA 1OHFA 1DHKB 4TYSA 4JGZB 1O3SA 5CFDC 4QGMA 4BZ4A 4Q4V2 3VHNA 4N90A 2ZA9A 3OTFA 1OSGA 4ITCA 4GQ7A 4U2AA 1VB2A 2ES3A 4N7UA 4Q4Y3 1V9U1 1UKGA 4X6RB 5J37A 5KWRA 1VBB1 3WHTA 1XNKA 3I59A 3N36A 1BZWA 3WW4A 4IEQA 2WNVA 3N7JA 1D0GA 1DGWX 1NE4A 3AXDA 2DVAA 2ARXA 1REEA 2PHLA 5ACA1 1R091 3ILNA 4DY5A 3MIDA 2UWAA 3FLPA 5C8WA 4RQPA 1KDMA 4FP3A 3VV1A 1ZM1A 2RR11 2VOVA 1NYWA 3KT1A 3LGRA 1B35C 3VZKA 1ZZ9A 2A3YA 3VBFC 1JW6A 2GC2A 3ZFEC 4FAGA 3ZSKA 5JPNB 4N53C 2WZPP 3WV6A 1AR73 5C4WA 3TN92 2TUNA 5CFDB 1S55A 2GN7A 4C90A 1RUJ1 4ATEA 4MGZE 4TWTA 2W39A 4P9WA 5GLZA 1NZCA 4CEYB 3GZTB 4AI3A 1ZYBA 4NHKA 4YVWA 1QXJA 4BIFA 4E27A 2I74A 1FNYA 1MVEA 2PA7A 4P9GA 4PDWC 3VBSC 4UXAA 4YZ2A 5DG2A 1IKPA 1NCRC 2WZR2 1HRV2 2FMYA 1PZ8A 2VQAA 2RMU3 5IK5A 1KQRA 4XQWA 4JTOA 1ZVFA 1IQAA 1POV3 1PVC2 2BNNA 3NKTA 2XWJB 3VBFB 3BOWA 3CEWA 3ATGA 3HD8B 1OLQA 2DCKA 4XQ4A 4QT6A 2WIIB 2A5ZA 4JAAA 4R4ZA 2R0HA 1AR93 1RUH3 3KCXA 4H55A 4XFHA 2R49A 1UL9A 1PO12 1UU4A 5J09A 4AI1A 4AF9A 1K5MC 3JD71 4RD7A 1DYPA 5BNNA 1BBT1 1AR83 3INAA 3ZXGA 2WNUC 3WP3A 1S0IA 1NXMA 1W0OA 5DDJ2 1GICA 3VN4A 1KS5A 4Q8LA 4AHXA 5LEKA 4HVQA 3E97A 1HXS3 5I0RA 1WLDA 2JEMA 1AXYA 1NCRB 1ULFA 2VVEA 4UBHA 3ZPYA 1UX6A 1NLSA 2IXLA 3O0XA 1KRIA 2DU0A 4NO4A 4S2GA 3HIFA 1TME1 3M70A 1O4YA 3RJRA 2B39A 2B7YA 3OGGA 3AYDA 2A3XA 1N47A 4XJAA 4E2SA 3JQXA 2D6PA 2XLGA 1DQ0A 2XGXA 3FFZA 5CG8A 5A33B 3KSCA 1HRI1 2PHDA 1BK1A 3M3CA 3B9IA 1FV2A 1Q8VA 2WFF3 1BVP1 3IM0A 2ARBA 3PVEA 4I3GA 2CGNA 4D3WA 4IL7A 4BE3A 4O9EA 3ZXFA 1NOVA 3MIFA 1VRH3 4PF5A 1OQDA 3H3UA 2R1DA 4HN0A 2X5IC 4YW3A 2D3SA 1N1VA 1LCLA 4JVAA 1MZ5A 1UKRA 3GNEA 4KGQA 3NVCA 4XTPA 4Y1YA 1IOAA 4AK3A 3WDWA 3WQ1A 5AFBA 1TE1B 2RS12 4WBBA 2YUEA 2DVGA 4CDQB 2ZHNA 3HQXA 2DCZA 1WD4A 2EXIA 4OFGA 4ZKTB 3VBHC 1D2SA 1X7NA 1AXZA 3THTA 3MICA 1D4VB 1GLHA 2B46X 1LB2A 3NJZA 4E9KA 4I30A 1KFUL 3ZXLA 1JOJA 1LTEA 3KCCA 2VU9A 2RS52 3IPVB 3SMHA 4RHV3 4K7JA 4MZUA 3ELNA 3PLQA 4P5HA 3ENRA 4XDQA 1AVBA 4CZSA 4DXZA 3H9AA 4Y20A 5D8AA 1DIWA 2I07B 4COWA 2VG9A 3AFKA 1LOEA 1GNZA 4WM8C 3VBRB 4Q4V3 1OA4A 2Q30A 3DF0A 5FO8B 1RUC1 4YNIA 3V64A 1EV12 2V73A 1PZ9A 1QMJA 1IS3A 2FZ1A 4ZU5A 1DQ5A 1S0FA 3H3ZA 3BU7A 4ASMB 2DYCA 3VDDC 1MQTB 4BOWA 2DVDA 2JD4A 1SACA 4KG0A 2HEWF 4M3CF 2XBO2 3AZYA 1SBDA 4QGLA 3NO8A 1HKDA 3ASIA 4XFIA 4YYOA 2VXRA 2ZACA 1YXWA 2XLFA 2C9AA 4LO5B 2Z79A 1LRHA 3W58A 2K0GA 2VUJA 3H1YA 3B3QE 4EN6B 2WSVA 4J1XA 1AYN2 4NWVA 4PDWA 2RS31 3VBSA 4GWMA 1UAIA 4FOVA 1DGWA 1WGPA 2VUAA 2ZGRA 3PMEA 4DZGA 1HQNA 1BVVA 2PFWA 4YZ5A 2JG8A 3WZ1A 3GF6A 1CPNA 3CLPA 3ES4A 3TN93 3B7MA 3D4KA 3E5QA 5CIRA 3RYRA 4KBBA 3HT1A 1IS5A 4S2DA 4XJ9A 2DF7A 5F6LB 2K9ZA 5T5OA 5GZEA 1YIPA 1N3PA 3W9AA 3OYWB 3HMYA 5J7MA 4JRLA 3POWA 3QLQA 4AW7A 2EXJA 1H8TA 3WDYA 1MZ6A 4KWJA 4RS5C 5BNOB 2WZR3 1H9PA 1HRV3 2PLV1 2XJPA 4M0NA 2WNUA 2H0VA 4GH4A 4EV0A 4IEOA 2PHRA 5TSWA 2XWBB 1PVC3 1C57A 3HBZA 2HWF1 1CGPA 4DQAA 4OI2A 5K0UB 3KMHA 1QQP1 2JX9A 2E53A 2HWB1 3U4XA 4MGKE 4MYEA 2IWGB 3AX4A 4AI0A 1I9RA 3VKOA 3LWCA 4I3PA 1SCSA 3SNMA 1TMF1 1I5ZA 3ZIXA 4EWDA 1PO13 1J1LA 1MS1A 2OW4A 2X29A 1FYUA 2GSYA 1C4RA 4HBNA 2A73B 1NG0A 2Z5WA 2NM1A 4Q26A 2BTVC 1RHI1 5DDJ3 4H14A 3M3OA 2GNBA 3QBQA 4IV1C 3WUDA 5BXXA 3ZYRA 3ZIWA 4WZFA 4NHLA 4L2NA 3MGUA 1SCRA 1XNCA 4QPIB 1FT9A 1RMU1 4AGVA 1QH7A 1PGL1 4YW5A 5JOZA 2DVBA 3FBMA 1CAVB 4DOUA 2AENA 5CFCC 1AYM2 1BEV2 3KQRA 3E5XA 2D40A 5EXOA 4YFWA 2D44A 4HT1T 4D7TA 5DUVA 5K7PA 4PLNA 3GHNA 3OD4A 5JLVA 4MUVA 1ASJ2 4KU7A 1LENA 4I0AA 3HR9A 5CB7A 2VNGA 2UURA 1LOFC 5FQ0A 4KL1A 3WCRA 4FAHA 4N43B 2R32A 1H2NA 5GZCA 4Y22A 1RINA 1HLCA 3ZFGA 4I0BA 2AGSA 4G9SB 3CO2A 3S0MA 4PBPA 3ZMOA 1H9WA 1OMIA 2GAUA 3AMQA 3JUUA 3VKLA 2ERFA 3FBYA 1CESA 4FPYA 4CDXA 2A75A 5CA6A 4FPEA 3QH7A 4FOYA 4K1ZA 2JG9A 2RS13 3USUA 2PHXA 5BNPB 3CNAA 4CP1A 1COV1 3HWJA 1OOPB 2CY6A 4GB32 3DGTA 3WP6A 3ILRA 5JVVA 3JZVA 2QKDA 1DYKA 1ND2C 2NYYA 4JGYC 4UW3A 2GC3A 2RS53 2R042 4HN1A 4QU2A 5FCCA 4DRVA 4I01A 5ABJC 1WMDA 2XPJA 2OUJA 4QPGC 1QJY2 1O5LA 4YFZA 2D6MA 2GDFA 3CJIA 1A8MA 4QQOA 2IXHA 4XF9A 4PIXA 1AR62 5T5JA 2O1QA 1ZREA 3M4FA 2AYHA 4ZU4A 4FQ4A 1EV13 4C91A 4YGDA 4M00A 3AMPA 1IKQA 4BQ1A 2YROA 5T52A 1U12A 1AL21 5SV5A 4HL0A 1ND3C 5JAXA 3ES1A 3SH4A 2MNGA 1PIV2 3V65A 3L9JT 2ZX1A 2XBO3 3M3QA 1DQ1A 2YHJA 4BIOA 4IESA 5JSOA 4AGGA 5T50A 3WCSA 1YNAA 3ACLA 4GXLA 4R9CA 1RUI2 1DQ2A 2DU1A 1N3OA 1AYN3 2HWD2 2ZGKA 1VAKA 4I09A 4RGGA 3QOPA 4BYYA 4JCKA 5C8CB 1R082 2SBAA 4LO4B 2H0BA 1UPIA 4YRDA 3ZSJA 1CN1A 4GULA 3SHRA 3ZO0B 2BNOA 1XYOA 1VBE1 3V0AB 1PGW2 1NA1B 1VB4A 3RS6A 4LBQA 3X29B 4IV3B 3FC0A 1UZZA 4AG4A 5JI7A 4K8FA 4CDWA 2WNVC 2ZGSA 1UMZA 1ND3B 1H4HA 5DZFA 2BBVA 4EWAA 2WS92 4N7IA 4HVRA 1LHWA 4BM8A 1AX1A 2D6LX 4M3CA 4RQPC 4DNYA 1VBC2 2ET1A 1XU2A 3KT4A 1B09A 2DUQA 4YW2A 1X8EA 4GWNA 4IV1A 1HQWA 2NLRA 1NQJA 2E7TA 5E1RA 1DQ4A 4FOWA 5C4WC 3AMHA 1E57A 3POSA 3I2DA 1Q43A 4ATFA 1V6NA 2ZZQA 1KXGA 5JR7B 1C8M2 4M3CE 1GKBA 5GZFA 3O12A 2WQ4A 5H9PA 5AC92 1A3KA 2PAEA 3THPA 3D0JA 1C1FA 1D2QA 3T1MA 1RUD2 1ZZBA 4Q27A 4YVWC 1EY2A 1GQHA 5J36A 1YO8A 2E51A 1APNA 3I8TA 1PGSA 2XH6A 3NAPB 4XF0A 1ONAA 3KD4A 4HFSA 5BYNA 4KWKA 1OA3A 4MGYE 5IT6A 4IQPA 3H8UA 1UIJA 5GJ6A 1AYM3 1BEV3 5T55A 5FOBB 2HWE2 1Q8SA 1RUOA 1AX2A 3PJQA 2DCJA 2EA7A 1W6NA 3AP9A 1VBD2 3ZSMA 2VQ0A 1ASJ3 3D0SA 4YG6A 2R071 5BNNC 4HKOA 1S2BA 4ONUA 3BOPA 4PIYA 4YVWB 3VHRA 1AR71 4FTEA 3KB5A 1D4M1 4K9SA 4EN9B 4DFSA 4FO9A 1GYKA 1ZA4A 4HSLA 1ND2A 4OHWA 1V9U2 5JPMB 3MW2A 4YVSA 1VBB2 4V1PA 1RITA 4CDUB 1ENXA 2A70A 1YJLA 4QPGA 2ZCWA 3B02A 5ACA2 5F9TA 1R092 4L99A 2IXIA 5DUXA 3IBMA 3AYAA 3VBOA 1SLLA 4PQ9A 1RUNA 1RVF1 4GB33 5CAZA 1YFXA 2NN8A 2RR12 2TEPA 3B94A 4FVVA 4NR1A 1FPN1 2UY9A 2R043 2GZWA 3U0ZA 5CU1A 5CBLA 4M01A 4XTMA 1MS0A 1QJY3 1C5HA 3DPRA 4XMAA 5GZDA 3ZFFA 4AQ2A 1YI7A 4WVMA 1FX5A 4EN0A 2YGLA 1WBLA 4Q1RA 2Y26A 3AYCA 4AFBA 1AR63 2QVSB 1N1TA 3WR0A 1XNBA 3A0NA 1YIFA 5DUUA 1WCKA 1HXS1 1ZNPA 3FLTA 3FWEA 4A7ZA 2ZMNA 2YYOA 1PIV3 5IK4A 4IEVA 2NZ9A 1JBCA 1DU3D 2GN3A 3O7OA 1PK6A 1OPOA 3M3EA 1HIXA 4PJYA 4E4ZA 1RUI3 1DGRA 1GANA 1MEC2 2VMGA 3FUOA 3RI9A 2HWD3 3FUQA 4MXVA 5D8AC 5KHHA 2WFF1 4CEWA 1R083 3JD72 2ZABA 1SBEA 4Z8BA 1ZRCA 3PNAA 3ME2A 5J96B 1LHUA 2GH2A 3GZAA 4WVWA 2DUPA 1HX6A 1QJX1 1M06G 1GV9A 4AFMA 1JN2P 4AYUA 3SH5A 3S30A 3URFA 4XFGA 1RUF1 4C0HA 3J8F1 1AJOA 2EALA 1O5UA 4RFT0 2WS93 4AEMA 2OZJA 1TME2 1MZFA 2XHKA 1YRZA 1TQ5A 3U07A 1IZ3A 4B4RA 1VBC3 4LO8A 4TZDA 1NCQA 4AEDA 1QNYA 2QQPA 1FATA 1HRI2 1DGRN 4BWOA 2YDEA 4K20A 2JG8C 2VH9A 3KLSA 4FT8A 4L92A 4OZXA 2Q1ZB 3RWNA 3IIAA 1F5FA 4GA9A 3NV2A 4RHV1 4M0HA 2UWCA 4BH9A 1AJKA 1B35B 2ZGLA 2Q4SA 2ZKLA 5KXEA 5KXDA 1Q56A 1C8M3 1RB8G 3ZFEB 1IHMA 2FHRA 4JQRA 2IFWA 2RM21 4FBFA 3JQWA 5AC93 1JYIA 2C1FA 1XYNA 4N53B 1CR7A 4RR3A 1RUD3 4EJRA 2BWAA 5JZGA 2BVBA 5L73A 2FMDA 5KHJA 2B5HA 3UJQA 4Y26A 3AM2A 5GLUA 1H8TC 2QFEA 4CP2A 3ZXEA 1BQPA 3AZWA 2XUMA 4LE4A 1C1LA 3GZUC 4MXWA 4LLFA 5CG9A 4GH4C 1EP0A 1Y7BA 4DINB 4PDWB 3ZSLA 3VBSB 2WL1A 2JKBA 1DLLA 3LA7A 1RC6A 3B69A 1UPSA 1OD5A 2JG8B 2R061 3RMYA 5L7OA 1H8VA 4JRAA 2PAMA 2HWE3 2PYTA 2WQZC 2DFBA 1C8NA 4Q4X2 1LEDA 1QNWA 3R4SA 2Y38A 3H7YA 2WKKA 3WG1A 4HPKA 1VBD3 4HETA 3V56A 3A0KA 4FP2A 4COYA 4KGGA 2GMMA 1Q3EA 4GALA 2GALA 4FPOB 2BW8A 1X82A 2GMPA 5J48A 2VNRA 1WMEA 1F31A 4FXKB 1SFYA 2R0FA 4F3JA 2IC1A 1RUC2 3OJBA 2CGOA 4LNVA 2WSUA 4FPHA 1K5MB 1MACA 1V9U3 1AF9A 1G6NA 1VBB3 3CU7A 4JGZA 1PMIA 2WNUB 4HK8A 5JSRA 1NLRA 1QXPA 1Q8PA 2HWC2 1M4WA 3P3NA 3LOBA 5ACA3 2Q5TA 1R093 4U36A 1RUE1 3AKQA 3S7EA 1G9FA 4IERA 2BPA2 4G3YC 4UBGA 2Q1MA 2RR13 2RS32 2JE7A 1WW7A 3OD0A 5KBFA 3VHPA 1CIWA 2BQPA 1Q5OA 1H0BA 1H30A 1OFNA 1D0HA 5FMOL 4XBQA 3OBRA 1H2MA 4BMBA 2NQYA 4YG3A 4L8QA 2V5YA 3LB9A 1CAXB 4DY3A 2KM2A 3ZFGC 1H1AA 1VALA 2HEVF 5BPXA 4RA0A 4UW5A 5HCAA 5EWSA 4LR4A 2WA4A 2UU8A 1RTVA 4KQ7A 4CDXC 2BFUS 1LGBA 2A71A 2X5IB 2JG9C 3M8LA 1MS5A 1UU6A 2MPFA 1YWKA 3EBRA 2DV9A 3FMGA 3MPPG 1EAH2 4XE9A 4LO6B 4NPRA 2VY0A 3JU9A 1GFF2 3TBDA 2PLV2 3D82A 4CEYA 5K8SA 4XF1A 1KDKA 2HYKA 4QXKA 1LESA 1MS8A 3WP5A 4SBVA 3VZOA 1YFWA 1H1IA 2IXCA 3NL1A 3VBHB 4O9GA 4YM3A 2R30A 2HWB2 1GZ9A 4FPFA 3MI8A 1DFQA 4NWWA 5FQ0B 1MEC3 3KGZA 1YFYA 2FBEA 1VIWB 2HKXA 3RYPA 1OPMA 1O7FA 5BY5A 1FV3A 4AVVA 4B29A 1TMF2 3CJIC 4YLZA 3IT8A 2G4IA 1CPMA 2NMOA 3H1WA 3R4UA 4LBJA 3JD73 1I3HA 2Z42A 4AVAA 1GR3A 3GHMA 4OLLA 1J3PA 4LUMA 3WHUA 2GU9A 4MX3A 4JDOA 1RHI2 2TNFA 3USUB 2JG9B 2D5HA 4W6YA 4WM8B 2VNOA 1WUVA 2B9UA 4AEJA 3MFCA 2OVUA 3ST7A 3ZN6A 3WQ0A 3SCFA 1PGL2 2WWSA 1RUG1 1TME3 4P9LA 1PO21 5FREA 2HEYF 5FO7B 3VDDB 4D69A 3LAGA 1EPWA 3AB0A 4XMIA 3KCYA 3VZJA 4B7EA 2YY1A 3P3PA 1YJKA 1Y3TA 4B7KA 2P37A 3ZYJB 1W2UA 1HRI3 2E63A 1GNHA 1DZRA 4XJUA 2BNMA 2XVKA 1W6QB 1IS6A 2RS51 1JXNA 3N7MA 4R8HA 2YPJA 1KJLA 1ULDA 4BA6A 5GKAC 5A33A 3N4MA 2W68A 4ZXKA 1LULA 1X33A 1ZBE1 2ZHLA 4CDWC 2ZGNA 1O3TA 4LBMA 3B01A 4LE3A 1POV0 3WY6A 1V6IA 1ZX5A 2B42B 5I0TA 4Y1XA 4JC1A 1EV11 2AR6A 5C33A 2CWMA 4OI0A 1YFUA 3WXPA 1W6MB 3GALA 2O8QA 4TLFA 1XQNA 1WLCA 2P3IA 3GBGA 1REDA 1F5JA 3ZYGA 4CRQA 2VPVA 4K40A 2OZ6A 4G4FA 2XL9A 4HK9A 1QU0A 5E88A 2XBO1 1ZRRA 2QE3A 4RS5B 3LOIA 4CDQA 4R52A 4XQDA 1KJRA 1GZWA 3VZNA 1ZZ6A 4XIKA 2NMNA 3WD5A 3VUOA 2ILMA 1DBNA 1V6KA 4Q4X3 1AYN1 2WLQA 2RJKA 1VBA1 3FHIB 1X50A 3IPVA 2EXKA 1A6CA 1Z7S2 2ZJCA 3AP6A 4QM8A 4AE2A 4WV8A 1RUC3 3G7DA 3MLJA 3ECQA 5D1IA 2EF6A 4F7ZA 4Q29A 1AL22 2VVDA 5L19A 3ROUA 3VBRA 4LBKA 4YZ1A 2HWC3 4IEZA 2QZ2A 4IV1B 4A2UA 5A3LA 1I6XA 1WW6A 1ZBA1 5LRSA 1CAWA 1DQ6A 3LSDA 4IEPA 1MQTA 4AGRA 1IPJA 3LCPA 1QOOA 2WC2A 4KNCA 1QDOA 4PLMA 3VBUC 3WDXA 3ZXKA 5CFCB 2RS33 2KA3A 2ZX3A 4F8AA 5A32B 1ULCA 2EXHA 3BCWA 4R9DA 3VKMA 5DUWA 2CGPA 3AKTA 1Y9QA 3ZXAC 4Z1VA 3I4IA 3C3VA 2CV6A 3PVBB 3ZN5A 2VECA 3OBTA 5KHIA 2XVLA 2VOKA 4YVSC 3WINE 3V0BB 3S7IA 1QY4A 2I45A 1QDCA 4L9BA 3USSA 3SXWA 1Q8OA 1QF3A 3LSEA 5CVRA 3BPZA 4B8EA 3MIGA 1O3QA 1O3RA 5FO9B 2XKOA 3BALA 1C3HA 1EAH3 3VBOC 3ZXJA 2UYBA 4GKYA 4PCRA 2PLV3 4R9AA 2NPIA 3SCHA 1N1YA 2RJLA 3MF9A 3OY8B 1BYHA 2DVFA 4OUMA 5EYYA 2G9FA 2TBVA 4AVTA 1FOD1 4EWEA 1CX4A 2XB6C 5EV7A 1H1MA 2JENA 4XOGA 4FPCA 4LA3A 5I93A 5JCTA 2HWB3 3GBWA 1J59A 1ZRFA 1H2LA 4XYXA 1UN1A 2A6WA 3VL9A 1YLLA 1CAUB 4Q4W1 1W6OA 2PQQA 3TB0A 1LHOA 3AYEA 3DPRC 4JGYB 1ND2B 1W0PA 3ZFFC 1TMF3 3AJYA 2A6YA 2DURA 2CWSA 3JBG1 3MIEA 5K0UA 1J58A 4YG0A 4P14A 4HVOA 5ABJB 1KITA 4QPGB 3MW4A 2K2SA 1BCXA 2F6BA 1FMD1 2QDNA 5B2GB 4MSVA 3AFGA 5F6KA 1RHI3 5FOJB 2VMIA 5I8SA 2ZPXA 3KGLA 3VKFC 3AJZA 3TRSB 3AP5A 4GMP1 4S2HA 4COVA 4QQPA 1HQLA 3BODA 3VHOA 4F83A 1H4GA 3H0OA 1PK6C 3E6BA 1NY71 3M2MA 3WW1A 2ZTNA 3VL8A 1CVNA 5KHGA 1IS4A 5BV6A 2OIIA 4QPIA 5JWPA 1R1A1 4CEWC 1CAVA 1PNFA 3ZFFB 2R072 2D3PA 4W6XA 1DZTA 5DZEA 4BCUA 3WG4A 1D4M2 3UJOA 4URTA 4YGEA 2ZHMA 3K48A 5T5PA 1QJY1 4XFBA 2GNTA 2WINB 1JTZX 2ENRA 1ZZCA 3TNPB 1CONA 4INDA 1O4ZA 4WZCA 2XKPA 1FI2A 2I2SA 1QJU2 4H7MA 5HI0A 4N43A 1OQ1A 4Y1VA 4B4QA 4XXPA 2MEV1 3OGJA 3RI8A 3Q9OA 3I59B 2DWRA 4AHZA 4I02A 1SLIA 2WNVB 3TOJA 2H6BA 1NCQC 4SLIA 5AVPA 4AEDC 3J9SA 3RRDA 2UY8A 1RVF2 2WT1A 4Q4Y1 5GALA 3ALQA 3CF6E 2D5FA 4RQPB 1JHNA 4CEWB 4OI4A 5BNPA 1FPN2 1PZ7A 2W0XA 1V6JA 3NV3A 4A3XA 4Z2WA 1V6OA 1OOPA 2CAVA 4GIQA 1I1EA 2XVGA 2Q0AA 2GMEA 1A8DA 3R0RA 1IGOA 3R05A 3LZZA 4RR3C 1R081 5C4WB 4YZ3A 4OVEA 5FTTC 5JZGC 2QCSB 1J3RA 3RG0A 4Y24A 1BMV1 3ZX7A 1Z7S3 3VBUA 4AHWA 1XRUA 3MDPA 4PLOA 1PGW1 5JIAA 1H2KA 2QZ3A 1DDLA 5GLWA 1GZCA 1REFA 3KM5A 4XBNA 2ZMKA 1QOTA 4DB5A 1LECA 1AL23 4J6GA 4QM9A 3TAYA 4YW1A 3DN7A 4Q0PA 4LHNA 2WS91 3DV8A 3IDCB 4QQ2A 1BXHA 5L7OC 1Y43B 3PVNA 5K9YA 3ZVXA 5T5LA 3QD6A 2ETEA 3N7KA 2WLPA 4DMIA 5I8YA 3FLRA 2ZGUA 5T54A 5C9AA 4D7YA 2BYVE 1LGNA 5H9QA 3VKNA 4XETA 1G9CA 5HCBA 3S6PA 2RMU1 3KS7A 3W59A 2D7FA 2PTMA 1SEFA 4IEWA 2YC0A 3D8CA 1POV1 5E89A 2FZ2A 4OHVA 4WVZA 5JDBA 1PM7A 2CNAA 2BVVA 2ZGOA 5FMOS 3R6SA 5BNNB 1QJX2 4NN0A 4JGZC 2PHTA 3N3HA 2Z69A 1RUF2 1AR91 1PNGA 1RUH1 2JE9A 3J8F2 1RUJ2 5EYXA 4N9HA 5J3UA 1QKQA 1NA1A 1G9AA 4KWLA 1JH5A 1XE8A 1VR3A 1AR81 4IV3A 3RDIA 1UW8A 5FLHA 4XJZA 1LHVA 3ZN4A 2LALA 4ES9A 3WDTA 1UU5A 2IXKA 2HWE1 4D7SA 3HN1A 1MR5A 3TYJA 1S0EA 4D94A 3AK0A 1MS9A 4FPJA 4LBNA 2RM22 2FQPA 2A6ZA 4E2GA 1FNZA 4GKXA 1Z0HA 1JUHA 4Q0QA 4WM7A 3E6DA 2AZ5A 4W6WA 1XE7A 4IETA 2AUYA 2ZHKA 3SLIA 4MV2A 2LTNA 1J3QA 1BBT2 2ZS6