1U5XA

Crystal structure of murine april at ph 5.0
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
137
structure length
130
Chain Sequence
KHSVLHLVPVNITSDVTEVMWQPVLRRGRGLEAQGDIVRVWDTGIYLLYSQVLFHDVTFTMGQVVSREGQGRRETLFRCIRSMPSDAYNSCYSAGVFHLHQGDIITVKIPRANAKLSLSPHGTFLGFVKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytokine, hormone/growth factor
molecule keywords Tumor necrosis factor ligand superfamily member 13
publication title The Crystal Structure of A Proliferation-inducing Ligand, APRIL.
pubmed doi rcsb
source organism Mus musculus
total genus 23
structure length 130
sequence length 137
ec nomenclature
pdb deposition date 2004-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00229 TNF TNF(Tumour Necrosis Factor) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1u5xA00
1O91A 2QE3A 4QQOA 1JH5A 3URFA 4D7YA 1IQAA 4E4DX 2OIIA 5TSWA 4GIQA 4KG8A 3B9IA 2JG8C 5BNQA 1DG6A 1U5ZA 5HBAA 1D0GA 2JG9B 4TSVA 3IT8A 3TWIA 5CIRA 4QPYA 3FC0A 1RJ8A 2WNVB 3ALQA 2X29A 4KGGA 4MXWA 4DOUA 1U5YA 1OQDA 4E4SA 5KC5A 1WCKA 2HEWF 3QD6A 4TWTA 1KD7A 4OUMA 2WNUA 4HT1T 2Q8OA 2JG8B 1PK6B 4QQ2A 5KWRA 1XU2A 4MXVA 2R32A 3V56A 1KXGA 2WNVA 4OUSA 4MSVA 2ZPXA 1OSGA 1I9RA 1JTZX 1A8MA 1DU3D 2Q1MA 4OULA 3B93A 2HEYF 2R30A 3K48A 2RE9A 1OQEA 5L36A 1TNFA 3QBQA 2TNFA 4QQHA 2WNUC 3MI8A 1PK6A 1U5XA 3WD5A 1D2QA 2HEVF 2RJKA 2JG9A 2RJLA 4J6GA 2WNVC 4QQLA 1ALYA 4MXWB 3L9JT 5L19A 3ME2A 2O0OA 2TUNA 2E7AA 3K51A 4DB5A 1TNRA 2Z5WA 4N90A 4G4FA 4F3JA 3TYJA 2WNUB 3B94A 3LKJA 2ZJCA 4G3YC 1XU1A 2R6QA 4EN0A 1PK6C 1S55A 1C28A 1RJ7A 2JG8A 2KA3A 4QQPA 1D4VB 2JG9C 2QDNA 4KGQA 4NN0A 1GR3A 5KC6A 1C3HA 3AB0A 4RSUA 2AZ5A
chains in the Genus database with same CATH superfamily
1O91A 1XYOA 2HWB2 1AXZA 2RS53 4LR4A 3PHMA 4QT6A 4E4HA 2WSUA 1IG0A 4Q0VA 3ZSEA 4XW3A 2MEV1 2XLAA 3DXUA 3SKVA 4EWAA 1W6PA 1MQTA 1VP6A 2GH2A 3JZVA 5TSWA 4ES8A 2X09A 3UYJA 1OKQA 1OFSA 4XBLA 4NROA 1QJY1 3Q8BA 1ZREA 5GLUA 4C0BA 3F2ZA 3ZFEC 2QQIA 4L99A 4NHYA 3BPSA 1HN1A 4Y1XA 1I1EA 1RVF1 1C8M2 3ZMOA 1DYOA 4M3CF 2FZ1A 3ZLIA 1FOD1 4B4PA 4CCDA 1YC61 4AG4A 3IDCB 4QM9A 1AZDA 1FT9A 4OI1A 4IEPA 2GN7A 4B7KA 4FBFA 1SZBA 4XBQA 2JX9A 5DG2A 4BQ1A 4CDWC 5CKNA 1IKPA 1KQRA 1O8PA 3WP6A 1Z7S1 3WQ1A 4I02A 4Y3OA 3GM8A 1GWLA 4ZZ5A 1W9TA 1L7LA 2VQ0A 3E1F1 4TTGA 1R091 2D6LX 2WN2A 3WW2A 3E5QA 3EXUA 2ZABA 2Y6FA 2XJQA 1F31A 5LY2A 2JG8B 1W9WA 3VBRB 1C1LA 4PQQA 4W4ZA 1WLCA 3RPQA 1RUF2 2YFUA 3DV8A 2J1SA 5BNNB 2Z69A 3KHBA 3C7EA 4NAOA 1LEMA 2VAUA 4UOJA 5FO8B 2XJVA 4FXGB 4JX0A 4KMQA 4DQAA 5HPOA 4N53C 4CEWA 1H1AA 1AR81 2Q1MA 4KQ7A 3UESA 2GH8A 2Y60A 1K5MA 3ZXJA 4YZ2A 5A3UA 1YUDA 1MS4A 2DDUA 4WM8C 3AMNA 1QJX3 4B8EA 3B7MA 5IWFA 1AYM2 1AL0G 1JYCA 3SH4A 4FP3A 1SLTA 5J98B 5EYXA 5F3EA 1QDOA 1WD4A 1XQNA 1ZM1A 2EF6A 5H9SA 2C24A 1XNKA 2B4KA 3IPVB 1MS3A 2MEV3 3GZUC 5DUVA 3O1PA 3U11A 5IFTA 4YW4A 4K9SA 3CNAA 5LK5A 1JYVA 4KBZA 2YC0A 4A6SA 2W52A 1IPKA 3WD5A 3MZHA 2HEVF 2OX0A 1GBGA 1NLRA 3IBMA 3OJBA 4MGTA 4LITA 4YG0A 3USSA 1ZA7A 3JD71 2XHKA 3RI8A 5DN2A 2V73A 2E31A 1L3JA 3J7NA 5FZMA 1FOD3 1ND3B 1AF9A 4LIUA 3ZN5A 2ZX1A 2O0OA 3MIBA 4QPIA 1CJPA 1GYKA 2WQ4A 2PN5A 2Y0IA 1Q43A 1AR73 2GNTA 3ATGA 1XSQA 4N43A 5FFOC 4CDQC 1HB3A 2X53S 4LBJA 4MOAA 2F4LA 4L92A 4LHLA 4ASLA 4XFIA 2R0HA 2HWE2 3LAGA 2VMIA 2NN8A 3RYRA 2WSVA 3BGAA 4TN7A 4GKYA 1UZWA 1VAKA 4OQ8A 3FFZA 1OLQA 5KXDA 1ZRDA 1I5PA 1BVVA 2ET7A 1CAVA 1R093 4FTSA 5GZEA 5C4WA 4JKKA 1O4YA 3CJXA 3VBHB 3AVRA 3IDBB 1LHWA 4NOTA 4HN0A 2D3RA 4XMAA 1T2XA 3OBZA 5FYTA 3TAYA 4E9KA 1LB2A 2DCTA 4QPGA 4CEYB 5FCCA 2ZGRA 3D3AA 4OHYA 4MADA 3URFA 3MLJA 2K0GA 1CAXA 4Y22B 1OVSA 4GA9A 4Q0PA 2QQMA 1SQ4A 2VTFA 3GZAA 2JEMA 3ZR5A 2ZMKA 4QHBA 4R9DA 5T52A 4AGGA 3OTFA 1LKNA 1W6NA 1ZNPA 3DGTA 1H2NA 5FZ1A 3UK9A 3VKOA 4C1WA 4FTEA 4O65A 2GU9A 3J26N 3H3UA 1U5ZA 1W2UA 5FKCA 3VBOB 5FPBA 2B8MA 3ABZA 1JS9A 4XZPA 1LGCA 1UAIA 1UW8A 4UW4A 3TWIA 2VMCA 1RYYA 3S57A 3PURA 4B4QA 4Q4Y1 2VVDA 4RGKA 2WS91 1PNGA 3LA2A 1NA1C 3OUIA 3I2DA 3O1TA 5GJ6A 1V6KA 1Y3TA 3K4ZA 2BUKA 5A7PA 5L7OC 4BOWA 2YYOA 4YGEA 2QFEA 1GZ9A 3O0VA 1KDMA 2RDNA 2W5FA 4OUMA 3AK0A 3WW4A 3QH6A 2CAVA 5JCTA 5ACA3 5BXXA 1N47A 2XBO1 1IS6A 3DL3A 4FPFA 3ZFEB 4LA3A 4PDWA 4IUGA 1LOCA 1WA6X 2ZX0A 3NNLA 2I2SA 1D2SA 2A3XA 2BBVA 1KGYA 2GMPA 5FY0A 3NJXA 1Z0HA 4AQTA 2EAAA 3KS7A 4HXCA 5FYCA 5C8WA 5F5CA 1NCRC 4LBOA 4XTPA 4DY5A 3C7OA 5FZCA 4A7ZA 4H2AA 2DU0A 4L2NA 3JB4C 4PT6A 1OA2A 1QJX2 2W95A 2P3KA 4QDRA 5DUUA 5FOBB 4QX8A 1XYPA 1DQ4A 2J7MA 5FJHA 3VHPA 1HRV1 1IGOA 2WBKA 3BIWE 4IEVA 4I3GA 3UETA 5CFDB 3KT7A 1EYBA 4IQPA 1KITA 3ZYFA 2D5HA 4URAA 2BPA2 1R1A3 3AP7A 3VBUC 1K5JA 2MEV2 4IV3B 3ZXDA 1PK6A 3ZPOA 4I0WB 5FZKA 3T1MA 1U5XA 1E5HA 3AZXA 3ACIA 4K8RB 5KXEA 1P8JA 3AKRA 2QNKA 3B02A 5J1XA 5IJRA 4CCJA 5JSOA 4YSFA 5HV4A 1OUSA 1QJY2 4JTNA 2V09A 4EROA 3OUJA 5GKAC 3IIAA 1W04A 4ZU7A 3CJIC 5L9BA 1DGLA 2WWSA 4LBQD 1RVF2 3RMXA 2ZMNA 4CCOA 4D69A 3POJA 4YWAA 1GUIA 4LKSA 4GWMA 4YVSC 1BJQA 1FOD2 2XWBB 3KLSA 4WM8B 5LK7B 1W2TA 2VZ3A 2DFCA 3THPA 3PUAA 1KFXL 1ULGA 4Q4Y3 2G9GA 4EZ4A 4YZ4A 2PXJA 3MUZ1 4G4FA 1KJLA 1TME1 4CU7A 2NQYA 1Z7S2 2DV9A 4JRAA 3A4UA 5F6LB 2W3JA 4H14A 2JG8A 3VKNA 1SPPB 3AL6A 1EV13 3ZDVA 3NAPC 4D7TA 1AYN1 1R092 1UN1A 3PL0A 4Q0SA 1RC6A 4FFGA 3DPRB 2VXJA 1WMXA 3KZ4C 5JR7B 3UGFA 3ZN4A 2XBO3 3VKMA 4AI3A 4A41A 2VCCA 1X36A 3N9OA 4CCCA 1UOBA 3PTRB 4YM3A 5SV5A 2XVKA 4AHWA 2AZ5A 1HB4A 2ZGSA 3LFMA 1EP0A 4Y1ZA 1NOVA 5FZEA 3M3EA 5JXGA 4ARXA 4HOOA 1S4CA 2BP6A 3KHCA 2ZGLA 3CKHA 1D4M1 2FDHA 1V6IA 4CDQB 2OW4A 5HXMA 4XPVA 4WZFA 1POV0 1AR82 1XPWA 2ERFA 5FUNA 2NP0A 1MZ5A 2RS31 2ZXQA 5A7QA 4BLJA 2AEZA 3BTAA 4A7KA 1UOJA 1ND2B 2VM9A 2X10A 2B5HA 2VECA 1ZBA3 1UZYA 4NHXA 1IS4A 1LENA 4N7UA 4K21A 4BXFA 3ACHA 3H1WA 4S2HA 3P3NA 5KXCA 3IT8A 3MLLA 5T5PA 2BQPA 4LO5B 5FZDA 2XPJA 3WOGA 1SBDA 2D6NA 4DUVA 1PO11 3FE5A 4LXLA 4XOGA 5K0UA 3AYDA 1XNAA 2VY0A 3SXWA 3VKLA 1N1VA 3ZXFA 3I54A 3JD72 2W94A 2UYAA 2P1BA 1RUC3 3I2KA 3THTA 2NM1A 2PAEA 4GALA 1PO23 5JI7A 3N4MA 1I3HA 4L11A 4XJAA 4EYUA 1GP5A 1RMU1 4Q8KA 5A6ZA 1REEA 4OZOA 4TXWA 3VZLA 2TBVA 3T08A 5T54A 3C2UA 1LNSA 5JZGB 1HDKA 4S2GA 2CYFA 1OVPA 3ZFFA 1IQDC 3VD4A 4Q4W3 1NG0A 4COWA 1G9FA 3RWKX 4PI0A 1OSGA 3NMBA 1IZ3A 4M3CB 3PUIA 3D4KA 5AVPA 4J25A 2VCMA 4GWNA 4OULA 3UNPA 2XL7A 5GALA 4LEJA 3E97A 3POEA 1LCLA 3EQEA 3RZZA 2DCZA 4XHBA 5LB6A 1NLSA 3FBYA 1V70A 1LOFC 4K8FA 3ZYJB 1D4M3 1BXHA 2R7EB 5B2GB 3MV01 5IAVA 3S30A 1GWMA 4OYUA 1QOOA 2AACA 2XH6A 2VZTA 3MEPA 4QB2A 4QX1A 4M4RA 3MDPA 4IERA 4GH4A 5G04L 1VBB3 4IEYA 1HW5A 2BJSA 3K3NA 2ORXA 2WO2A 4P14A 3KF5A 4HMZA 1JYNA 4CUAA 3NV3A 4YM2A 1G9BA 4Q4Y2 2WS92 2BNOA 2GNBA 1O7FA 3O0WA 3BB6A 5GZDA 3VBUB 3H8UA 4ONUA 1XBFA 2ZGKA 4ZS3A 1UX6A 3T1LA 1B35C 5A1FA 3ZFEA 3WR0A 1RJ7A 3GHMA 3LWCA 1BBT3 3WNLA 2JKXA 2VZOA 3A0NA 4HVQA 5T3NA 3M7AA 5AC91 1RMU3 3WCSA 2XBO2 4HETA 4OVEA 1MS1A 1UU6A 3AZWA 3CJIB 5KC6A 1MS0A 4XF1A 1PX3A 4DRRA 3H8XA 5EPAA 2ZOEB 4CDWA 3BVCA 2OS2A 2NZ9A 4CP2A 2ADEA 5DAXA 3VDDC 4BDVB 2QQPA 2Q0AA 4L8QA 1X8MA 1VBE1 1REFA 3A21A 2VUCA 4GIQA 4P9YA 4EV0A 1WCQA 3MUY1 3IDAA 4YG6A 4BQ3A 4CXXA 5E1RA 3RMYA 5GLTA 1EPWA 1UY4A 2VZQA 2CGOA 4LMFA 4V2WA 5FWJA 1BMV1 3NAPB 1HRV2 4SLIA 4CZSA 4D0QA 3O1RA 3OUHA 4JV4A 2XWJB 5J09A 2ZZQA 4EN6B 5CIRA 2WFF3 4LBQA 4XYXA 4KGGA 4R4ZA 1UXZA 4Z07A 4HPKB 3MW2A 3N9LA 4N53A 4BHPA 4XFGA 4XDQA 4FPJA 3INAA 5JPNB 4MG2A 3RGBA 4GB31 3A0KA 4WM8A 4Q26A 5FBJA 2PHDA 4MYEA 1VBC1 2W47A 1CWPA 4FO9A 4JGYB 2J1TA 4TWTA 2EIBA 5F3IA 3WNPA 3PVBB 2ZHKA 1XJAA 4DS0A 2VXRA 2IC1A 1WZXA 2UWAA 4P9GA 3PUSA 5FYMA 3HQUA 2E63A 3NKTA 3OGGA 1OLMA 4Q4X1 3U0ZA 2ZGPA 2OPWA 4Q2FA 4YVWC 2YU2A 1SPPA 2J42A 5IVYA 1RTVA 3WCRA 1XU2A 4BA6A 3OGSA 5D1IA 1NQJA 1OLRA 2Y6HA 2Y6JA 1TME2 3R0RA 3V56A 4LKFA 2KM2A 5JAXA 2UYBA 1C57A 3DCQA 3THDA 5FXZA 1RUJ1 2CTVA 1KJRA 2GN3A 2O14A 3OYWB 2BRTA 4RL7A 4UFIA 5FP4A 4BIFA 1ZZBA 3I2JA 4QKNA 2V4AA 1J3QA 4QX7A 1AYN2 3KD4A 5FZGA 3ZKYA 4LT5A 1GU3A 1IHMA 1OD3A 1LGBA 4XDOA 3P3PA 4BZ4A 5KHJA 3GJAA 4IV1B 4CDQA 2RE9A 4UFLA 1OQEA 3VDAA 4COZA 3OCPA 1TNFA 3C7FA 4CDUB 1YFXA 2VTXJ 3B3QE 4P9IA 5A7WB 1F8VA 1D4M2 5FPAA 3ZIXA 3OY8B 3RQ0A 2ZEWA 1W8UA 1PM4A 1HB2A 3WF0A 3ZSMA 3MIGA 4AVVA 2VMHA 3CEWA 2XJUA 1CN1A 4HVOA 3WSOA 2RS32 5K7PA 4Q4V1 1EUUA 3K3OA 5A33B 2VW1A 1SDDB 2A7AA 5LBBA 4JHZA 1OPMA 1N3QA 4ZU5A 2CGPA 2B9UA 3L9JT 4C0HA 2P3YA 1DCSA 2KR2A 2QVSB 4LKEA 1UYXA 4XIKA 4Q0QA 4WV8A 1IKQA 3N3HA 5KBFA 2OUJA 5FZBA 2G9FA 1QJEA 1TNRA 1ZRCA 1PO12 5IVFA 3VD3A 5C70A 4B3NA 3TEWA 4MH0E 1OLME 3NSTA 4JDMA 3B00A 5DZFA 1WBFA 1UY1A 4XIOA 4AAPA 4QX5A 1QHDA 3SNMA 3MBWA 1BQPA 4CCEA 2EXHA 1VRH1 1RMU2 1UMHA 4Q4X3 4BQWA 3WF2A 1AHSA 2UURA 5C5UA 3H8RA 1O3QA 1C3HA 1HQNA 2PAMA 2QCSB 3FLTA 4M3CA 4QQOA 1NA1A 1YLLA 3ZYIB 4AEDC 4AFAA 3DEMA 4ITCA 1STMA 5HCHA 1NX9A 3VGIA 4GD4A 5L7OA 5F2WA 3NV2A 4LOSA 1UKGA 3NJYA 4JQTA 3VBSC 1Y9MA 4NJ4A 2AYHA 5J7MA 1B35B 4KBBA 2P5BA 3IAQA 4AQ6A 2YROA 5FO7B 3S7IA 1N3OA 1YI7A 2NLRA 3CIHA 5DXDA 1ASJ1 1VR3A 2G1MA 3NL1A 1IS5A 4XF9A 1WW5A 4E27A 2WO3A 2OXBA 2IFWA 1LOAA 3ACGA 3OBAA 4FOWA 5JVVA 1NCRA 5IATA 2QQJA 2JKBA 5JLVA 5IK8A 3FHQA 3VBFC 4NVPA 2UU8A 4NR1A 3VDDB 2RMU1 2A6ZA 3FX3A 3QACA 3QD6A 4WM7C 2ATFA 1VALA 4XFAA 2WRAA 3O1VA 4NHKA 1LRHA 1JZ6A 2ARXA 1I6XA 3VBUA 4MX3A 1F5FA 3I3QA 4MGSA 1VRBA 3AJYA 1TMF1 2Q5TA 3O1MA 3KWVA 5EZWA 3ETQA 1RUE1 2Q1FA 4MZUA 4YFZA 3IMMA 1C8M3 4LA2A 4LHKA 4XBNA 5T5JA 4ES9A 4LORA 4LIVA 2EXKA 1LR5A 2DCKA 3K4DA 1UY3A 2MHFA 3WX5A 3CJIA 2IVIB 5IVVA 4L0PA 4Y1UA 4ZHNA 1RUI1 1UYZA 2WYFA 4YVSA 1VRH3 1ENRA 5AC92 1DFQA 5BUVA 4QPIB 2I07B 3ITQA 4XVHA 2PLV1 3OF1A 1PVC1 4QAWA 3N7LA 2IUWA 3HN3A 4JDNA 1ZBE1 5LA9A 3MLKA 2W1SA 3QBQA 2E9QA 3H1YA 2B39A 3AVSA 3I2FA 5A70A 3ZPYA 3KV6A 3QOPA 4GULA 4Z92B 1S0BA 1UD1A 2W92A 3HMYA 5DDJ1 1VBE2 3GCWA 3NAPA 4UAPA 2AC1A 5E8AA 1CAVB 4DXRA 3POWA 3RSJA 3FUQA 4P5YA 2RDSA 4UXAA 1RUF3 2VW2A 2XLGA 3ASIA 3VV1A 4WVWA 4B1MA 2WNVC 4CUBA 5C4WB 3JXSA 3T0BA 5C6CA 5LY1A 1R64A 1HRI1 2YGMA 3PJQA 4XJZA 1BMV2 4LE4A 3ZXGA 3I49A 2DTWA 5A7NA 4DEQA 1ASJ3 2DBNA 2LROA 4RA0A 3MV11 2Q8EA 3WY6A 4BJ0A 1CAXB 3SMHA 2EVXA 3MF9A 1TVGA 5FZLA 1JMUB 1UNBA 4SBVA 5C33A 4GB32 2TEPA 1YWKA 2DVGA 4Y4RA 3U10A 1PZ9A 1VBC2 4JTOA 3WINE 2D43A 2ZKNA 5FY4A 4Q1PA 2CU5A 5LRRA 4NIDA 2O8OA 1C5HA 2ZX3A 4FT8A 1N3PA 2PYTA 3RRDA 1YO8A 3OD4A 4O9GA 4Q5OA 5T50A 2BV4A 2XJSA 5A3LA 4URTA 3ZXEA 4Z2WA 1M4WA 4Q4X2 1FMD1 1Z78A 2ZAAA 3TOJA 3W5NA 3TEYA 3AMHA 4BLIA 3HAGA 3OYWA 3PIJA 4M0HA 4WVMB 1RUOA 5FWEA 2NPIA 3FLRA 1RUE3 2IWGB 4RFT0 4FTBA 1L7RA 1RUJ2 4PBPA 1GKBA 4UWDA 1W9FA 2VUAA 3AMQA 4D7YA 1Q8SA 1RUI3 2MPFA 2WYSA 2ZGNA 2YB7A 1AR61 2PQQA 3ROUA 4P02B 3RZHA 1MVQA 3PUHA 2AH2A 1WW4A 3AFKA 5A7WA 2HWE3 4CU9A 2PLV3 3UGGA 4DUWA 1KRIA 2BDRA 1H8TC 3AM2A 3OY8A 4K20A 5F37A 4XJUA 4XXAA 2HWD1 1J84A 3AJZA 3LPFA 3M3IA 1AJOA 5CISA 3QLQA 5HCFA 1XE7A 4TSVA 4U2AA 4QPYA 4XJWA 4LQRA 3FC0A 1AX2A 1X9TA 4TLGA 2Q30A 5DDJ3 3WHUA 3AYCA 5FXWA 4AEDB 1W8NA 2P3JA 5DAQA 4Q4V2 1WD3A 3RZJA 1UF2C 1J1TA 3OGRA 4QXKA 5GZCA 3IN9A 4BB3A 2VUJA 2FDKA 4O61A 1HRI3 3U4SA 2QDRA 3TNQA 5C9AC 2V4VA 2WO7A 3POYA 5A3TA 1SLBA 2PTMA 2FZ2A 3AZVA 1LOFA 3OGJA 3USUA 4AWDA 1J3PA 1PK6B 2WWJA 2AGSA 1XE0A 2JICA 3NV1A 1EY2A 3JQXA 3I59A 5GLZA 1WCSA 3T2OA 3E6BA 4LLOA 5DMYA 3D0JA 1WGPA 3BTXA 4JDOA 2P6CA 4FPHA 1UPIA 1W6MA 3C7GA 1VRH2 2WZ8A 1MVEA 2HEYF 4RFRB 3POFA 1BEV1 3AZZA 1Q5OA 3BCWA 4R9BA 1LULA 2YZ4A 4Y4YA 4CDXA 2D6KA 4XXPA 1RUG1 4P08A 2R071 5APAA 3UKNA 4JC1A 2WZPP 2ZHNA 4IE7A 1WCUA 3S7EA 2ZGMA 2J1UA 1B35A 1CZTA 5CVRA 2K46A 4QU2A 3VKFC 1YQ8A 3LSEA 3W20A 1XXNA 5JOYA 2VZUA 3ES1A 1AR63 4YLZA 2B45X 5FYSA 2A6VA 1CIWA 2BU9A 2QBXA 3SHRA 4J6GA 1W3VA 2FMYA 4LHNA 4NRQA 3WP3A 3ZSJA 4HVRA 4IEOA 3ZXLA 2SBAA 4AYUA 3DN7A 5L19A 1D7PM 1ASJ2 4LLFA 4GAZA 1W2NA 2TUNA 3VDDA 4ATEA 4DB5A 2BOIA 1W8HA 3F95A 1O4ZA 5F8PA 3TN91 5LBEA 4JQRA 4BQXA 3L2HA 2Y6KA 4F7ZA 1W03A 2RMU2 4GZ9A 2VQUA 1C28A 1PGL1 2YC4A 2W9XA 1IS3A 1LTEA 3NV4A 4KH9A 1I5ZA 3ZYHA 2E7QA 1LGNA 4QQPA 5BNPC 2ZHMA 5IK4A 1LJ7A 2JG9C 2Y8KA 1QJY3 1M06G 1TMF2 5ISLA 4BMEA 4AVSA 4MVTA 5F3GA 3VZNA 4CP1A 3PVOA 1RUE2 4PIXA 5K4LA 1RVF3 2QUOA 4FFFA 2GC2A 2IXLA 5JSPA 4HSLA 2EIEA 5K0UB 3OB8A 1JXNA 4XFFA 4AHYA 1DGRN 1JZ5A 2HWF1 4XJ8A 1RUI2 2GDFA 4LO7A 3KM5A 3WQ0A 3WLUA 2WA3A 2NYYA 3EJKA 4GMP1 4JVAA 3ZMNA 1H6YA 2IXIA 2PHWA 2RR11 5JIAA 2XMLA 3WDYA 2PLV2 1BEV3 2Q1ZB 1E5IA 1PVC2 1Z7S3 3DYOA 4ZPIA 4Y20A 4YVWA 2IXHA 5D8AC 2R16A 2XLFA 3GGLA 5BNQA 1ZBE2 4XCAA 1NLQA 2R073 5FBZA 1WMDA 2ZEXA 3ZFFB 4IETA 4K1ZA 1PZ7A 3E6DA 3EBRA 2VH9A 2Y38A 5DDJ2 3V65A 3R05A 3M70A 1ULDA 5KC5A 4H7LA 1WCKA 1RHI1 3ACLA 3WF1A 2BW8A 1HRI2 3PUQA 3WDWA 4CXYA 1W8ZA 4XC9A 3UJQA 1FAYA 5FMBA 2WAOA 1AR83 1HLCA 4BE3A 1H30A 3KV9A 2E53A 3OSDA 3HN1A 2D7FA 1Y4WA 2OUHA 3UT0A 4QQ2A 3ILFA 3W59A 4BISA 1OPOA 4IGQA 2A6XA 4AZZA 1WLDA 4AHXA 1QJZA 4BK4A 5DAPA 3O14A 3KCYA 4V2VA 3RJRA 1W8OA 4WVMA 1O3RA 4HKLA 4C91A 5I91A 4GH4B 2D6OX 2BWAA 1OA4A 2WJSA 3KB5A 3LPGA 3Q8CA 4YW2A 2C4XA 3DECA 3VN4A 1FMD2 4IGOA 2DUOA 2JE7A 3B93A 4E2QA 1SACA 4QDSA 3WV6A 3Q8FA 4IDZA 5C9AB 5A3PA 3JD73 3OBTA 2HJIA 2J1VA 5L36A 4CVUA 2B46X 3ES4A 2LM3A 3HEIA 2XVLA 5GLVA 4QX2A 2FDIA 2HWF3 3I8TA 3WW1A 1HJGA 1FV3A 1KEXA 1OT5A 2A6YA 2YV8A 4J1WA 3KQRA 1AR62 5GZGA 4FI9A 4XABA 1PNFA 2OVUA 2VTXA 1GFF2 2VZ1A 3IM0A 3MIFA 5FY5A 1JOBA 3G7DA 2IVJA 1MACA 3O0XA 1OH4A 2QQNA 3LQCA 3ZFGC 5FYZA 3DF0A 4COUA 5FR3A 1DIWA 2HWD2 1LHVA 1S0DA 3EMRA 4AEDA 3AYEA 4CDWB 1H1MA 1RUD1 2WT0A 2C6SA 3GDBA 5FDBA 2BEOA 4N90A 1QXRA 5JXJA 1BYHA 4B1LA 4Y1YA 3B9CA 3VBSA 3B94A 4D8MA 1RHI3 3TEXA 1MS5A 1JHNA 5FYBA 4EZHA 1EAH1 4L97A 3BTZA 1CZSA 4IEUA 4FXKB 5F5IA 4E8CA 4Y5Z0 4KGQA 3HVDA 3ZYRA 2WAAA 4LBQB 1K3IA 3AB0A 5IVEA 4CU6A 3MW4A 4N53B 1MEC1 3OG2A 2QE3A 2YBKA 4XFCA 3VBFA 2RHPA 4CP9B 1F5JA 1O3SA 5L73A 4PCRA 2OPKA 3VD7A 5FPUA 4RQPC 2IZWA 4XUNA 5ABJC 4WM7A 5JXHA 2E51A 2VNVA 5E89A 3BU7A 1ZYBA 4FPEA 1JN2P 2WS93 3ECQA 2Y6GA 4FCAA 3ZYBA 5EXOA 4GXLA 3H7JA 1WW6A 4AFBA 1BEV2 3B9IA 3CZUA 2F17A 2AREA 5FZ7A 3TEZA 1JODA 3N7JA 3I2IA 5FQ0B 4A42A 4CTEA 1XRUA 1RUG2 2CY6A 2R072 4LUMA 5F5QA 5LA1A 4ISQA 2FD8A 2ARAA 2JG9B 4W6XA 1G7YA 4JKMA 5DAVA 3V0BA 3WF3A 1U5YA 4AQ2A 1UMZA 4DPNA 5BV6A 2C1FA 5C3QA 5JR2A 4QHOA 1OI6A 5C8CC 1E5RA 4Y5SA 5FY7A 3S5QA 4IEXA 2P6HA 2ZGUA 2JECA 5GZFA 2W87A 2JDAA 3ZX7A 4CU8A 5EQUA 2DTYA 2HBTA 3VHNA 1RUD3 3ZSKA 4ASKA 3GZEA 3N9QA 3WUDA 4D6SA 4Z8BA 3SISA 1MS9A 1HRV3 4PLOA 5FREA 4BXSV 3TN92 3EO6A 3ZYGA 3S5AA 4P5HA 3M1HA 4GJYA 4A2UA 1EAH3 4AAXA 2WNVA 5FP7A 1PGL2 5FPXA 4MSVA 3FJSA 1T6BX 5HCBA 2J22A 3THCA 1DU3D 2VZRA 2R49A 2XQXA 3MFCA 3MHZA 2ZGQA 3FWEA 3MF6A 4AEJA 5F9TA 3PU8A 1JOPA 1N1SA 4OCTA 1DBNA 5A1AA 1PM7A 3W5MA 3FN9A 2F6BA 1ULCA 1V6MA 1MEC3 3D6EA 3C3VA 3M4FA 1CIYA 4XQWA 2ORZA 4BQ2A 5A6XA 5BNOC 1N1TA 2GSYA 2WNUC 2QKDA 2PHLA 3UV9A 4AQSA 2OT7A 2HWF2 4HFSA 4KWUA 4BK5A 3AL5A 5FZIA 2Q8DA 1CAWB 1AXYA 1K12A 4CCNA 5A3NA 1NUKA 1Q8VA 1D2QA 1QH7A 2E33A 1VBA1 2RR12 4XFBA 1TME3 4C1XA 4NIHA 5FLIA 2RJLA 4A45A 2LW8A 1YJLA 1E5SA 3AP5A 5L9RA 2FCTA 1QJU1 5FK7A 4AVTA 4ZZ8A 3U37A 1AYN3 5FPLA 4DXZA 1NA1B 4W8JA 1A6CA 2ZTNA 1MZFA 5FK8A 1HXS1 1XNCA 5EP9A 2JJ6A 5FYUA 3WNXA 3LCPA 2E7AA 5L7OB 3H3LA 4K3UA 2D40A 4F3JA 4K40A 5F7UA 4NUBA 1RHI2 3ELNA 1ENQA 2EXIA 5IHRA 3O12A 4DRVA 2KA3A 2VMFA 1H8TA 2DVBA 1XNBA 1S0GA 1QGLA 1D4VB 4S2FA 3N36A 5F2SA 3T2TA 3LFIA 2RS33 4IEZA 1VJ2A 1GR3A 4I09A 2JDYA 4XQDA 5FP3A 2Z2SB 4NPMA 1W6QA 1D0HA 1NCRB 5DZEA 3H0OA 1SCRA 2GC1A 1DQ0A 4EWEA 3WF4A 4A7YA 2VZPA 1YI9A 1SFNA 3JU9A 3MIDA 5C9AA 2W0XA 2XGXA 5FLHA 4CDXC 5FTTC 1PO13 3O1OA 3H3ZA 3IB3A 2V5YA 2BGPA 2LALA 4AF9A 1UYYA 3T4VA 1URXA 3BI3A 3PIGA 1KDKA 1OBNA 3I3EA 2DUPA 1CONA 4LO6B 3WDTA 4JGZC 3QH7A 3RVHA 2VQTA 2DVFA 3AKPA 2A70A 3MW3A 1LU2A 2JDUA 1VIWB 4B29A 4C8DA 2W46A 3NVCA 3DKQA 3N35A 4AE2A 3IMNA 5LASA 1HX6A 4NRPA 1DDLA 1BCXA 1DHKB 1VBA3 4YVSB 1PGW1 5E88A 4NWWA 4FP2A 3ZM8A 5EHDA 1W90A 4EWDA 5ABJB 2ZKLA 4GKXA 1QJU3 1YEWA 1YQ2A 4MLOA 4V1PA 3WQBA 2PQSA 4PIZA 3H7YA 1W3XA 2D93A 1BVP1 1RUD2 4HT1T 4BCUA 5C5TA 3SH5A 4X6RB 4FSJA 2HYKA 5FAXA 3M3QA 2WA4A 4CRQA 1Q56A 1XYNA 1DP0A 4YZ5A 4KWLA 4OMCA 5DUXA 3RNSA 1MZ6A 1EAH2 1K45A 1BHGA 1H1IA 3H8OA 3KCCA 5CNAA 2P3IA 1JYIA 5ERLA 4ARYA 1WBLA 3LEKA 1OF3A 3NNMA 4OHVA 1IG3A 5FPZA 1F35A 4LO4B 2FHRA 5CKQA 4CP9A 3DXTA 1NE6A 5C8CB 4LKDA 1ULPA 3K48A 5IK7A 2OYZA 2PFWA 3OEAA 1R1ZA 1MEC2 3H9AA 5IYYA 1WMFA 2JXAA 2VULA 5FRAA 4DXTA 3PNAA 1C1FA 3RYKA 2D44A 2ZX4A 1F4HA 1Y9GA 5FYIA 3WP5A 3HJRA 5BNPA 5J36A 3BIEA 4WBBA 5FQ0A 1UWWA 2YMZA 1GICA 5A7OA 2VOXA 4YPJA 5IT6A 4EN7B 3J4UH 2VPVA 2JG9A 2HKXA 1OC1A 2WIIB 5LEKA 1DYPA 2WO1A 3LA7A 4FOVA 4XFHA 1TEIA 4YZ3A 2JDPA 2XR4A 4EN8B 1W8FA 3AMPA 3X29B 1GWKA 3VZMA 5AC93 1A34A 3MPPG 4LBMA 4P00B 1C5IA 4AEMA 1QH6A 2WZEA 4RD7A 5I8YA 4GQ7A 2WNUB 2YUEA 5FZAA 2ZJCA 4YM0A 3ETPA 4G3YC 2FDGA 1WKYA 4GWIA 1QQP1 1UY2A 4UW5A 4AEKA 5D8AA 2LTNA 1Y9QA 1VBE3 1XC6A 1ULFA 1ZZ6A 1HIXA 4LTAA 3FLPA 3H50A 1GZWA 2A3YA 2CAUA 2Y26A 4RR3C 4AFDA 4YARA 2XHNA 1DYKA 2W08A 4C90A 2B9VA 5KHHA 3PLQA 4YW3A 4D94A 3A7QA 5LATA 2VMEA 4CUGA 4WZCA 4E4DX 4YNIA 1R081 3UL2A 4D6QA 1W28A 4BH9A 2FCUA 4GB33 3LEGA 4LJHA 1CVNA 1VLNA 3N9NA 1VBC3 4NE9A 5GM0A 3USUB 4OUEA 3W9AA 4MO3M 3NRUA 1CAWA 1GSLA 5HBAA 1MR5A 3I59B 5LW9A 4HLTA 1UCXA 3E6CC 4IE6A 1OF4A 1RJ8A 1IPSA 3AZYA 5IUQA 1FXZA 2NMOA 4AL9A 1W6OB 1ODMA 5IK5A 1AR91 4AFCA 1VBA2 1W6MB 4KU8A 4LOTA 1QF3A 1LECA 5BYNA 2FMDA 1RUJ3 5FLJA 2RDRA 1QJU2 1YFWA 4K1YA 3J7MA 1F15A 5EYYA 4CDXB 4F8AA 5CB7A 1EUTA 3HNYM 4RGGA 4ZS2A 1GQHA 5FPVA 3WVJA 2K2SA 1HXS2 1YFUA 2ZGOA 4DY3A 2ARBA 3EHKA 3CF6E 1POV1 2WNOA 3KT4A 1J59A 4I0AA 4RHV1 1ENSA 3OGVA 4NPLA 2DWRA 3RS6A 4FAGA 2CGNA 1X9PA 5FZ0A 2ZBJA 2JDZA 2B7YA 1SCSA 2CV6A 2CWSA 2VZSA 3I2GA 3O5SA 4HG6B 2ZCWA 4ZXKA 4IW3A 2CDPA 3ZFGA 2VBDA 2RM21 5FUPA 2ES3A 1IPJA 4Q4V3 1PIV1 1F4AA 4NHMA 2C9KA 4YM1A 5LBFA 2FQPA 4AI9A 4R8HA 3GHNA 1DLLA 1XB9A 2DCYA 1ENXA 2P37A 4XUOA 3U75A 4OQ9A 1GQPA 1SDWA 5A3OA 5DABA 2O8QA 3LOBA 3J9SA 1VBD1 4N9IA 2W1QA 3I2OA 1HB1A 4YW7A 1RGSA 2BFUL 4B7EA 1C4RA 4HN1A 2WQ8A 3J7LA 4UF0A 3VHRA 1DQ6A 3TRSB 1W0NA 5FZOB 3SLIA 2W1UA 1UZ0A 2BGCA 2VZVA 5H9RA 3IWZA 4D7SA 1SFYA 3LEIA 4QPWA 2Y0OA 2YG0A 4RQPA 4XILA 4I0BA 5ABJA 1RITA 1DZQA 2WUHA 1SLAA 3H1MA 1VB4A 5EJ3A 3FBMA 1PGW2 2UY9A 3VLBB 4TZDA 5F3CA 1RUNA 3M3CA 2YGLA 1QIQA 3HPNA 5FV3A 1S55A 3VDCA 4AK3A 1GP6A 3K77A 3VBRC 4YVWB 4Y20B 5DPNA 3UGHA 3WNMA 1FNZA 1Q8OA 2WR9A 2D6PA 1UMIA 4JRLA 4DINB 4META 1CD3G 1DQ2A 4JAAA 5BNNC 1OMIA 5CYYA 4UFMA 1AXKA 2QDNA 4N8MA 5IVBA 2ZZJA 2EXJA 2DURA 2ETEA 2R041 1AX1A 3IAPA 2EICA 3BOPA 5HCAA 5JUVA 3A22A 2QQLA 2H6CA 2JB8A 1X82A 5G05L 4AVAA 3GXUA 4FPCA 4ZU4A 2GP3A 4ET7A 3L2YA 3K46A 5C8CA 4QKBA 5CG9A 2AUYA 2VG9A 2V5DA 4LULA 5F39A 5KR7A 2DCJA 1YCIA 2VW0A 4GWJA 3M3OA 3ORJA 1J3RA 3VZOA 2FDFA 1ODNA 2D97A 2OA2A 2PHRA 2RMU3 4KWKA 5C3OA 4DNYA 3HT2A 1W05A 2I45A 4HSJA 4FPLA 2XDVA 3HWJA 2G4IA 1REDA 2RS51 3JUUA 3GZTB 1D0GA 4XF3A 1YIFA 2GNMA 4AI2A 4NPRA 4YGBA 1EPZA 5GLWA 1RB8G 3ALQA 2X29A 3KVBA 4OI2A 4DOUA 1TMF3 1VBD3 2Y33A 3B69A 4UFKA 2DFBA 4QX3A 3ZR6A 2WFPA 3WG3A 1U0AA 1ND3C 4K6BA 3I2HA 1PZ8A 2P17A 1RUH1 3RJ2X 2EIGA 5J37A 4LNVA 3GJBA 1FPN1 1LEDA 1W06A 5IW0A 2D6MA 1KS4A 1TG7A 2Z42A 3RWNA 2IFRA 2YHJA 4BIOA 1DZRA 5BNOA 2WNUA 4PBOA 1GMMA 3GF6A 1WA4A 5EWSA 1PVC3 4UI9L 5HXVA 4ZY9A 2NMNA 1S0EA 4XF4A 3BUCA 2A73B 3Q8EA 1NT0A 1ZBE3 1JBCA 4QDQA 3I3MA 1OKOA 3K4AA 4OI4A 3VBHC 5I0DA 1QQP2 3KV5A 5A3WA 4BWOA 1TQ5A 1QDCA 1W8WA 1DF0A 1TZOA 2HBUA 5A80A 5FP8A 1SLIA 1NAEA 4UFHA 2DU1A 2BFUS 4KI5M 3RZLA 2A71A 2FCVA 1O5LA 2R043 3T3YA 5A6YA 3D82A 4TYSA 5FKBA 2QQVA 4KWJA 3ZXAC 5FUIA 3MICA 1G9DA 3VBSB 4QQHA 1GOFA 2WABA 2WC2A 5H9QA 2JDHA 2C26A 3DKWA 3NNFA 3MI8A 2LRPA 4ORFA 2IXCA 3O7OA 4XHXA 1O8SA 2ID4A 2XB6C 1R082 3VBOC 1QXJA 4MHRA 3NNJA 1NQDA 4D6RA 5F1RA 3VDBA 4NWVA 1ALYA 3IIIA 3T30A 3JQWA 4FOYA 5C3SA 4A3XA 1W6OA 4L9BA 3VHOA 3ZO0B 1O3TA 2OZ6A 3LDKA 3ME2A 3VBFB 1UZZA 3ZN6B 2H6BA 2UY8A 1J58A 1FMD3 2Q8CA 2H0BA 2ET1A 4Q29A 1RIRA 2Z5WA 4WM7B 5A32B 2R061 1AR92 1A8DA 4OHXA 4Y5TA 1RUH3 4CPBD 2YBSA 1FPN3 3OD0A 1UY0A 2W68A 2ZEYA 1IOAA 4JGZA 2O1QA 1FI2A 4JCKA 2CDOA 3SCGA 1AR71 5FXVA 4RHV2 4AI8A 1H4GA 3RYPA 3V0BB 4XQ4A 1NE4A 2HWD3 2W91A 4MGQA 2PHUA 1QY4A 1ULOA 3RI9A 4BQYA 3T4HB 2BBAA 2RM22 5CFDC 4HK9A 1GNHA 1ZZ7A 3NJZA 3T2PA 5A3MA 3WG1A 4WVZA 1NKGA 4BM8A 5FZ4A 4CCLA 4E4ZA 3DUIA 4P9JA 1PIV2 2DVDA 3FUOA 4IV3C 4LK7A 1T6GC 1S0CA 4LHSA 2WL1A 2XJRA 5HV0A 2XJPA 3VUOA 2EA7A 5SV8A 1S2BA 3FFQA 1X50A 5C3PA 3U78A 1VMHA 3PMEA 4DMIA 2WNVB 4DEVA 2PELA 3NW4A 1JW6A 4QD2A 1VBD2 2CL2A 5AFBA 5JDBA 3D0SA 1OQDA 1JZ8A 4M0NA 4N9HA 2XQRA 4E4SA 5FZOA 1JZ2A 1RL3A 1A3KA 1QKQA 4QB6A 5JOXA 1V6OA 1YQ6A 2PHXA 3AKQA 2BVVA 1ZRRA 2X5IC 1AVBA 1KD7A 4R9AA 5FOJB 1XSRA 5K9YA 5J3UA 2F4PA 4CCMA 1CX1A 5FZ6A 3WXPA 3KMHA 1V00A 2PHFA 4HKOA 4W6YA 3J8F1 2R063 2J1RA 4INDA 1JHJA 1WW7A 3IZOA 1W0PA 3DPRC 3FMGA 1RUG3 4Y33A 3CL1A 3SEPA 2IXKA 2VCBA 4IGPA 4OUSA 1LOGA 2JIJA 1E57A 2ZPXA 4XAEA 2LUWA 4MUVA 3WNNA 1CPNA 2YFZA 1G8WA 3BOWA 3U4XA 1FYUA 1OD5A 4QGNA 3AXEA 5ACA1 1C8NA 2Y34A 5FXXA 2R042 5CFCC 3DYMA 1NZCA 2E7TA 1SG3A 4MHUA 1GQGA 5EJ1B 5FIXA 2XL9A 5H9PA 3T09A 4R52A 1ND2C 4MV2A 3PU3A 3POSA 1H8TB 4KNCA 3ST7A 3P5BA 1LHUA 1BK0A 3CBNA 2QJVA 4YG3A 3TN93 3ZSLA 4ATFA 2LS6A 1OXCA 5FZ9A 5CKMA 5EFUA 3WW3A 4MXWB 4RR3A 4CSWA 2P34A 3E5UA 4EE2A 3I4IA 1W6QB 1DGWX 5D21A 3IKWA 2RS52 4QKFA 1R1A1 3BKZA 3KQ4B 3OEBA 3U1XA 4XURA 3FHIB 4XUQA 3H42B 1Q8QA 1PHMA 3T0AA 2GALA 1GNYA 4F83A 4BYYA 3BPZA 1S0IA 4NRMA 1F9KA 1S1AA 1S2KA 4QB1A 1RUH2 1UOGA 2X05A 4XUTA 1DZTA 3GBFA 3KGZA 4PJYA 1FPN2 1US3A 2E32A 3RZKA 1N1YA 5FZFA 2ENRA 3NJVA 5T55A 1UPSA 4FAHA 2A1XA 4QX0A 3PTYA 3S0MA 5F32A 1CAUB 3SKJE 2D5FA 2VNGA 2YU1A 3J7HA 2RR13 3MPBA 4GMP3 3SC7X 3MGUA 5KHKA 1Q3EA 3LOIA 3J8F3 4M00A 5D2AA 3R6SA 1G86A 1BKZA 2VBPA 4DFSA 2ZEZA 3M8LA 1V6LA 2QQUA 5FY8A 2Z4FA 4XACA 4XF0A 5FYVA 4QXHA 1W39A 1K42A 1V6JA 1EV11 2CWMA 4YRDA 1MZEA 5FP9A 1SBFA 4LE3A 1GOHA 1UU5A 3OPTA 2PAKA 2ZMLA 3W21A 1NXMA 3ZKUA 4MGYE 2BNNA 1CR7A 1AUYA 2HLEA 4U36A 3V0AA 5CU1A 2E26A 3SQOA 4XAAA 4Y24A 4OLLA 2GC0A 2AENA 4PI2A 5LWBA 3OPWA 1VB2A 4NIGA 4DIQA 1WWYA 2JIGA 3LA3A 5BPXA 4HZFA 4QXBA 5I0SA 5T5OA 3SCHA 4P9WA 2UWBA 3AP4A 3ZN6A 5JXIA 5LZ6A 3HIFA 4AVBA 5L9VA 4XTMA 5FZHA 1XNTA 4RS5C 4FPKA 3WP4A 5C7GA 1ZBA1 5DUWA 4QWNA 2BYVE 3LD8A 3PVEA 1ZZCA 5A32A 2BERA 4CPBA 4XZUG 1UYPA 4DO0A 5CAZA 2GP5A 1SLLA 3HD8B 5JZGC 2E6VA 5EV7A 1QOTA 1JOJA 5DQ0A 2G19A 1HQWA 4QGLA 4E8DA 5CBLA 1FATA 1PGSA 1ZZ8A 3NO8A 4A3ZA 2R062 5BNPB 5KWRA 4PHZA 2P4EA 5J48A 2VVEA 1KXGA 4XCBA 1SEFA 2I74A 4XMIA 4ZONA 2D3PA 2QZ3A 5I0RA 2W39A 1RUC1 1JTZX 1YNAA 2XKOA 1A8MA 1PO21 1W9SA 4I30A 5FY9A 1JZ4A 1AR72 1GP4A 3DYPA 2R30A 4I01A 4QU1A 5B4NA 2P2KA 2X5IB 4W65A 1YQ5A 3N7KA 4Q27A 2WT1A 1WMEA 1VMJA 2VOWA 4Q4W1 3NQHA 2R1BA 3AKTA 1G9CA 4WVVA 2VNOA 3VBRA 4A6OA 4BPZA 4M01A 5D8AB 5CEHA 5JMOA 2WT2A 3KGLA 1GZTA 4LK6A 3LGRA 5BNNA 5JWPA 2C9AA 1OOPC 1SBEA 1Y43B 2KD7A 3MIEA 1CQ9A 1GZWB 3KF3A 4AGRA 1DLCA 1COV1 1VAMA 3AMMA 3GCXA 3G6JB 2VJXA 3WUCA 1QJFA 1W2AX 4A4AA 3C8XA 3D5OA 3RZGA 1OA3A 3MIHA 1KS5A 5CFCB 4JGYC 4DZGA 3NKGA 3AP6A 1UQXA 4X8NA 2WINB 1JU3A 1UZVA 3CQOA 3N7MA 5T5LA 2VUDA 3IPVA 2A75A 4XDPA 1O6UA 2IXJA 1NZIA 2GMEA 2DYCA 5BY5A 1VBB1 3OBRA 4AW7A 2VL4A 3UJOA 5LA2A 1J1LA 1OQ1A 4B4RA 4AOCA 4NN0A 1NCQC 2RVAA 3GALA 5EIYB 3WEZA 2VNRA 3J8F2 4FFIA 4H55A 2GC3A 4ASMB 2WDBA 1LHNA 1ND3A 2JD9A 4PLMA 1S2EA 2RG4A 4LPLA 1SMVA 1YJKA 4HONA 2A3WA 1ST8A 4IV1C 3W58A 4LBNA 4ZXEA 3I3DA 4XE9A 2FBEA 1BBT1 1TE1B 3LIGA 3M2MA 4GJZA 2D3SA 3LB9A 4KG8A 4IE0A 3WQ7A 4CDUC 2VMDA 1S0FA 5ACA2 3WG4A 1LODA 3WDXA 4HANA 1YXWA 4NIIA 1O59A 1PMIA 2YBPA 4P9XA 4Z82A 5AVAA 4IEWA 3VBHA 1BZWA 1VE0A 5IVCA 1F2NA 4MXWA 4CEYA 3ZFGB 1FX5A 4Q1RA 4BQ5A 1YRZA 5FZ3A 1CZVA 5JSRA 1CPMA 2UWCA 1H2KA 1ZVFA 3JCIA 4FVVA 4CXWA 3VD5A 1HN0A 4Y22A 1QU0A 4UBGA 2WKKA 1COV3 1X8EA 2VOKA 3BYWA 2A5ZA 3AYAA 2ZA9A 4JZRA 1MQTC 4O9EA 2BTVC 2V72A 1G9AA 4JHTA 1GLHA 1R1A2 2QQOA 3POGA 1O4TA 4MGZE 3TNPB 2RV9A 4OFGA 1MPXA 2WFF1 2WNEA 4XEZA 2Q8OA 5JOWA 2QTWB 1BK1A 4W6WA 3GBWA 1JYTA 2VVFA 2WWUA 3I3BA 5FMDA 4UBHA 3VBOA 5A7SA 2BZDA 1CAUA 4OHZA 5FY1A 3Q9OA 1AJKA 1HV1A 4AGVA 2OQ6A 5LBCA 4NAMA 1I9RA 4UF0B 3CMGA 3PJYA 2JDKA 4RN5A 2DUQA 4QM8A 5FJKA 3PDQA 1MS8A 2OQ7A 1JUHA 4RS5B 5E6HA 3SITA 2CNAA 1YIPA 3AXDA 2AR6A 2R0FA 4RQPB 1JYWA 1XOYA 3ENRA 1GOGA 1LOBA 4G9SB 4UYBA 4YYOA 3U07A 2CHHA 1YQCA 3ACFA 1YFYA 2BVBA 1HXS3 1LOEA 4TLFA 3ZDSA 1EV12 4CCKA 3KSCA 1YYNA 1SHWB 2AEYA 4KL1A 3EYPA 1UXXX 3CLPA 5JOZA 3K2OA 2RJKA 1LESA 4LUKA 4PF1A 5I93A 1UKRA 1ULEA 3LE0A 3VB9A 4QKDA 1LAJA 2VMGA 4CEWC 3E5XA 4NHLA 3VZKA 1K5MC 2J1AA 3FL7A 1AL21 3HOBA 5B4XA 3MO4A 2ZACA 2JENA 3ZIWA 5CFDA 1JUIA 4XJ9A 5CADA 1XE8A 3KVAA 4IE5A 4M4PA 4XETA 1PX4A 3LKJA 3UKVA 2Q4SA 1RXGA 2YPDA 4IV3A 2R6QA 3AP9A 1ZBA2 4EN0A 1WCDJ 3CO2A 2BNMA 4EN9B 5A6QA 1JZ7A 4FQ4A 3JBG1 3EB7A 3ON7A 5E16A 2YDEA 2PA7A 1OOPB 3TBDA 4EQVA 3T0DA 4LBLA 2D98A 1W0OA 5FMOL 3RZMA 1VPHA 2XONA 2BWCA 1A78A 4Q8LA 5LEJA 2VE1A 5ANQA 3VD9A 4NO4A 3HNBM 4QPIC 2J1EA 3SH3A 1ACCA 3SEEA 1PMHX 4BQ4A 4UW6A 1RUC2 2GAUA 2RS11 2X5IA 4N43C 5I8SA 3VZJA 1PO22 1H8VA 2OIIA 4H7MA 1APNA 2XXZA 3JB8A 5FYHA 5A1LA 2GNDA 5BNOB 2VO5A 2HYXA 2VR4A 3KT1A 1S0JA 5I0UA 3HT1A 4FFHA 4A44A 4NIAA 2KXLA 4D3WA 1QNWA 1QOSA 3CZJA 1V0AA 2L9LA 2WZR1 3DPRA 3C7HA 4Q4W2 5FZ8A 4PLNA 1H4HA 4O7XA 5C4WC 1NCQB 2HWC1 2PHTA 1NY71 2CSGA 1CJDA 2QZ2A 2VC9A 4N7IA 4QPGC 1LU1A 2C5DA 1W9YA 2SLIA 2VCAA 1ONAA 3R4UA 4MGIE 4R9CA 4UT5A 3ILRA 1AX0A 4CE8A 1V6NA 5CFCA 5JMCA 1COV2 4KG0A 1CX4A 1V9U1 1CGPA 5LCWL 4EJRA 1O5UA 1DGWA 1U5IA 1AL23 3LDBA 2JB4A 3WDVA 3WDUA 1US2A 1ND2A 4JKLA 1QXPA 2ZS6B 5JPMB 2WQZC 1VAVA 4K7JA 1GZCA 1GNZA 4R4XA 4OZXA 4QXCA 3RDIA 5K8SA 1SFPA 4QHZA 3I7DA 3P6BA 3FZ3A 4YW1A 5LRSA 2HWB1 1Y7BA 1WLWA 3HBKA 4QGMA 4UFJA 1VBB2 2RDQA 3RG0A 3JBG3 2DVAA 3BN6A 1JU4A 1W8TA 3Q8AA 2YY1A 1LHOA 1UIJA 4FPYA 1RINA 4IE4A 3WHTA 1OURA 4AFMA 4AI0A 4Y26A 5KHGA 1XNDA 2XOMA 2JE8A 4FPOB 5KXBA 2PMWB 1WLTA 3HQXA 3OPZA 2XUMA 1W6PB 3QCWA 2JDMA 4IESA 2W1WA 4RGAA 5IVJA 1MQTB 2OZJA 1H0BA 4KU7A 3VL9A 1C8M1 1HV0A 3U14A 1W2OA 2ZAHA 5LA0A 3HQRA 4OMDA 3MYXA 2W2IA 4Z2AA 4COVA 1VMFA 4PDWC 2RS13 1BBT2 3LSDA 2BOJA 1OFNA 4JGZB 3AFGA 4AR2A 2XVGA 3WNOA 3NWKA 4HL0A 4QQLA 3TB0A 1FNYA 5FMCA 1QQP3 4AXOA 2ARCA 4HK8A 1ZA4A 2XUEA 4HKWA 5KHIA 2JDNA 3O1UA 4AHZA 1U12A 2WZR3 3AKSA 1H2MA 2HWC3 1H9WA 3PMSA 5FO9B 3WZ1A 5F6KA 3I97A 5FMOS 4GMP0 3WNKA 1HJFA 3LDRA 4UW3A 1DQ1A 1GANA 3BALA 3D8CA 3ZVXA 1RUF1 2N7GA 5CG8A 1ZX5A 4CA9A 3KCXA 1PK6C 3LIHA 4H3WA 1WUVA 2GZWA 2RJ2A 1V9U3 5CZKA 3UKTA 2VBBA 2JD4A 3POIA 4AVCA 1PMJX 1R083 4MGKE 3R4DB 4I2OA 1H9PA 1SLCA 1POQA 2WFF2 2VGDA 3IDEA 3PVNA 4IXLA 3RFRA 2WLQA 1YHFA 3POBA 5ANNA 1AYM1 1H6XA 2XJTA 1L7QA 3HBZA 2WN3A 4CEWB 4ZKTB 4Y1VA 2ZHLA 3BODA 1HKDA 5AFEA 1K5MB 3AX4A 4W50A 2HWB3 1JH5A 1NXD1 3CDZB 3SCFA 2G9ZA 4FPGA 3NNGA 4RS5A 4BU2A 1HQLA 2Y6LA 4CUCA 2YXSA 4HBNA 4YZ1A 1IQAA 1Q8PA 2VU9A 2XG3A 1PVXA 3GBGA 2VOTA 3FHAA 1AR93 5JI9A 5JZGA 5M0TA 5FYYA 4CP0A 5CA6A 1QWRA 2JG8C 2K9ZA 4X8PA 2ILMA 2YPJA 4YGCA 1DG6A 2FDJA 3T2QA 3K75B 4DXSA 1RXFA 2QQWA 2VD7A 1OUXA 2EIDA 4YW6A 3WT3A 2X8KA 4AI1A 4Z1VA 1POV3 4J1XA 4E2GA 4M3CE 4CYDA 4RHV3 2EAKA 2ZGTA 1B09A 3O1SA 3KV4A 5IAXA 4PF5A 1J83A 4LO8A 1FV2A 4YFWA 2HWE1 1UO9A 2DF7A 3N9MA 3GNEA 2HEWF 4YW5A 4XUPA 2GMMA 1ZZ9A 4N43B 3LF7A 4LBKA 1BLZA 2RM23 2Z79A 3BU0A 1JYXA 3VL8A 3B5LB 2VOVA 1AL22 4Q0UA 3ZXKA 3BTYA 3V64A 3AC0A 1UOFA 3R4SA 3LZZA 3LEMA 3MFAA 1H2LA 4PIYA 1PIV3 4RYDA 4ISRA 1DGRA 1QMJA 3HR9A 4MXVA 1ZRIA 4E2SA 3N9PA 4DUXA 4IL7A 1NYWA 3OOXA 3A23A 2R32A 5F5AA 5IFPA 3ZYPA 1JZ3A 1CESA 1OOPA 2H0VA 1OHFA 1G6NA 2EALA 4HPKA 3JBG2 2Y64A 4RR3B 2R1DA 4QPGB 3S6PA 5C71A 1UL9A 3B01A 3P1IA 4OHWA 5K0UC 2JE9A 4OI0A 4X6QB 5JIUA 1DQ5A 4JGYA 1AYM3 1GV9A 5J96B 3GYDA 2YC2A 1W6NB 2TNFA 5EJZB 5HI0A 3CHXA 1UU4A 2RS12 4S2DA 5C3RA 5I8TA 5DAWA 1KFUL 2A6WA 3ZFFC 3ZOIA 2ZX2A 1ZRFA 1QNYA 1NCQA 2MNGA 4QMAA 4BMBA 4COYA 3CU7A 4CEYC 2DBIA 4FOQA 2WZR2 5I0TA 3HNMA 2HWC2 5DZGA 1NY72 2WLPA 2B42B 4IV1A 2OKXA 4P9LA 3K51A 1OH3A 4IEQA 4PQ9A 1JI6A 4CDUA 2C0ZA 3WG2A 3TYJA 2XKPA 1W99A 1XU1A 3APBA 4PDWB 1X7NA 2VQAA 2HH9A 1V9U2 4YGDA 4NMIA 3V0AB 1QEXA 3ILNA 5A33A 2ADDA 2QQKA 5DG1A 1QJX1 1X33A 4FQZA 4I3PA 1UX7A 2BGOA 1UIKA 4GH4C 4RSUA 2JWPA
chains in the Genus database with same CATH topology
1O91A 1XYOA 2HWB2 1AXZA 2RS53 4LR4A 3PHMA 4QT6A 2WSUA 4Q0VA 3ZSEA 4XW3A 2MEV1 2XLAA 4EWAA 1W6PA 1MQTA 1VP6A 2GH2A 3JZVA 5TSWA 4ES8A 1OKQA 1OFSA 4XBLA 1QJY1 1ZREA 5GLUA 4C0BA 3ZFEC 4L99A 1I1EA 4Y1XA 1RVF1 1C8M2 3ZMOA 4B4PA 4M3CF 2FZ1A 1FOD1 4AG4A 3IDCB 4QM9A 1AZDA 1FT9A 4OI1A 4IEPA 2GN7A 4B7KA 4FBFA 4XBQA 2JX9A 5DG2A 4BQ1A 4CDWC 1IKPA 1KQRA 3WP6A 1Z7S1 3WQ1A 4I02A 2VQ0A 1R091 2D6LX 3WW2A 3E5QA 3EXUA 2ZABA 2XJQA 1F31A 2JG8B 3VBRB 1C1LA 1WLCA 3RPQA 1RUF2 3DV8A 5BNNB 2Z69A 1LEMA 5FO8B 2XJVA 4FXGB 4DQAA 4N53C 4CEWA 1H1AA 1AR81 2Q1MA 4KQ7A 2GH8A 4YZ2A 1K5MA 3ZXJA 1YUDA 1MS4A 4WM8C 3AMNA 1QJX3 4B8EA 3B7MA 3SH4A 1AYM2 1AL0G 1JYCA 4FP3A 1SLTA 5J98B 5EYXA 1QDOA 1WD4A 1XQNA 1ZM1A 2EF6A 5H9SA 1XNKA 3IPVB 1MS3A 2MEV3 3GZUC 5DUVA 3U11A 4YW4A 4K9SA 3CNAA 5LK5A 2YC0A 2W52A 1IPKA 3WD5A 3MZHA 2HEVF 3IBMA 1GBGA 1NLRA 3OJBA 4YG0A 3USSA 3JD71 2XHKA 3RI8A 2V73A 1L3JA 1FOD3 1ND3B 1AF9A 3ZN5A 2ZX1A 2O0OA 3MIBA 4QPIA 1CJPA 1GYKA 2WQ4A 2PN5A 2Y0IA 1Q43A 1AR73 2GNTA 3ATGA 4N43A 5FFOC 4CDQC 2X53S 4LBJA 4L92A 4LHLA 4ASLA 4XFIA 2R0HA 2HWE2 3LAGA 2VMIA 2NN8A 3RYRA 2WSVA 4GKYA 1VAKA 3FFZA 1OLQA 5KXDA 1ZRDA 1BVVA 2ET7A 1CAVA 1R093 4FTSA 5GZEA 5C4WA 1O4YA 3CJXA 3VBHB 3IDBB 1LHWA 4NOTA 4HN0A 2D3RA 4XMAA 1LB2A 3TAYA 4E9KA 2DCTA 4QPGA 4CEYB 5FCCA 2ZGRA 4OHYA 3URFA 3MLJA 2K0GA 1CAXA 4Y22B 4GA9A 4Q0PA 1SQ4A 3GZAA 2JEMA 2ZMKA 4QHBA 4R9DA 5T52A 4AGGA 3OTFA 1LKNA 1W6NA 1ZNPA 3DGTA 1H2NA 4C1WA 3UK9A 3VKOA 4FTEA 2GU9A 3J26N 3H3UA 1U5ZA 1W2UA 3VBOB 2B8MA 4XZPA 1LGCA 1UAIA 1UW8A 4UW4A 3TWIA 4B4QA 4Q4Y1 2VVDA 2WS91 1PNGA 3LA2A 1NA1C 3I2DA 5GJ6A 1V6KA 1Y3TA 2BUKA 5L7OC 4BOWA 2YYOA 4YGEA 2QFEA 1GZ9A 3O0VA 1KDMA 4OUMA 3AK0A 3WW4A 3QH6A 2CAVA 5JCTA 5ACA3 5BXXA 1N47A 2XBO1 1IS6A 3DL3A 4FPFA 3ZFEB 4LA3A 4PDWA 1LOCA 2ZX0A 2I2SA 1D2SA 2A3XA 2BBVA 2GMPA 1Z0HA 4AQTA 2EAAA 3KS7A 5C8WA 1NCRC 4LBOA 4XTPA 4DY5A 4A7ZA 2DU0A 4L2NA 3JB4C 1OA2A 1QJX2 2P3KA 5DUUA 5FOBB 1XYPA 1DQ4A 3VHPA 1HRV1 1IGOA 3BIWE 4IEVA 4I3GA 5CFDB 3KT7A 1EYBA 4IQPA 1KITA 2BPA2 2D5HA 1R1A3 3AP7A 3VBUC 2MEV2 4IV3B 3ZXDA 1PK6A 4I0WB 3T1MA 1U5XA 3AZXA 5KXEA 3AKRA 2QNKA 3B02A 5JSOA 4YSFA 1QJY2 4JTNA 2V09A 4EROA 5GKAC 3IIAA 4ZU7A 3CJIC 4D69A 1DGLA 2WWSA 4LBQD 1RVF2 3RMXA 2ZMNA 4GWMA 4YVSC 1BJQA 1FOD2 2XWBB 3KLSA 4WM8B 5LK7B 2DFCA 3THPA 4Q4Y3 1KFXL 1ULGA 2G9GA 4YZ4A 4G4FA 1KJLA 1TME1 2NQYA 1Z7S2 2DV9A 4JRAA 3A4UA 5F6LB 3VKNA 4H14A 2JG8A 4AHWA 1EV13 3NAPC 4D7TA 1AYN1 1R092 1UN1A 4Q0SA 1RC6A 3DPRB 3KZ4C 5JR7B 3ZN4A 2XBO3 3VKMA 4AI3A 1X36A 4YM3A 5SV5A 2XVKA 2AZ5A 2ZGSA 1EP0A 4Y1ZA 1NOVA 3M3EA 2ZGLA 1D4M1 1V6IA 4CDQB 2OW4A 4XPVA 4WZFA 1POV0 1AR82 2ERFA 2NP0A 1MZ5A 2RS31 4BLJA 4A7KA 3BTAA 1ND2B 2B5HA 2VECA 1ZBA3 1UZYA 1IS4A 1LENA 4N7UA 4K21A 3H1WA 4S2HA 3P3NA 5KXCA 3IT8A 3MLLA 5T5PA 2BQPA 4LO5B 2XPJA 3WOGA 1SBDA 2D6NA 1PO11 3FE5A 4XOGA 5K0UA 3AYDA 2VY0A 3SXWA 3VKLA 1N1VA 3ZXFA 3I54A 3JD72 2UYAA 3THTA 1RUC3 2NM1A 2PAEA 4GALA 1PO23 5JI7A 3N4MA 1I3HA 4L11A 4XJAA 1RMU1 4Q8KA 1REEA 3VZLA 2TBVA 5T54A 3C2UA 1HDKA 4S2GA 2CYFA 3ZFFA 4Q4W3 1NG0A 4COWA 1G9FA 1OSGA 1IZ3A 4M3CB 3D4KA 5AVPA 4GWNA 4OULA 2XL7A 5GALA 4LEJA 3E97A 1LCLA 3EQEA 3RZZA 2DCZA 4XHBA 1NLSA 3FBYA 1V70A 1LOFC 4K8FA 3ZYJB 1D4M3 1BXHA 5B2GB 3S30A 1QOOA 2XH6A 3MEPA 3MDPA 4IERA 4GH4A 1VBB3 4IEYA 1HW5A 4P14A 4HMZA 3NV3A 4YM2A 1G9BA 4Q4Y2 2WS92 2BNOA 2GNBA 1O7FA 3O0WA 3BB6A 5GZDA 3VBUB 3H8UA 4ONUA 2ZGKA 3T1LA 5JZGB 1UX6A 1B35C 3ZFEA 3WR0A 1RJ7A 3GHMA 3LWCA 1BBT3 3A0NA 4HVQA 5T3NA 3M7AA 5AC91 1RMU3 3WCSA 2XBO2 4HETA 4OVEA 1MS1A 1UU6A 3AZWA 3CJIB 5KC6A 1MS0A 4XF1A 4DRRA 2ZOEB 4CDWA 2NZ9A 4CP2A 3VDDC 2QQPA 2Q0AA 4L8QA 1X8MA 1VBE1 1REFA 4GIQA 4P9YA 4EV0A 4YG6A 5E1RA 3RMYA 5GLTA 1EPWA 2CGOA 1BMV1 3NAPB 1HRV2 4SLIA 4CZSA 4JV4A 2XWJB 5J09A 2ZZQA 4EN6B 5CIRA 2WFF3 4LBQA 4XYXA 4KGGA 4R4ZA 4Z07A 4HPKB 3MW2A 4N53A 4BHPA 4XFGA 4XDQA 4FPJA 3INAA 5JPNB 4GB31 3A0KA 4WM8A 4Q26A 2PHDA 4MYEA 1VBC1 4FO9A 4JGYB 4TWTA 3PVBB 2ZHKA 4DS0A 2VXRA 2IC1A 2UWAA 4P9GA 2E63A 3NKTA 3OGGA 4Q4X1 3U0ZA 2ZGPA 4Q2FA 4YVWC 3WCRA 1RTVA 4BA6A 1XU2A 5D1IA 1NQJA 1OLRA 5JAXA 1TME2 3R0RA 3V56A 2KM2A 2UYBA 1C57A 1RUJ1 2CTVA 1KJRA 2GN3A 3OYWB 4RL7A 4BIFA 1ZZBA 1J3QA 1AYN2 3KD4A 4LT5A 1IHMA 1LGBA 3P3PA 4BZ4A 5KHJA 4IV1B 4CDQA 2RE9A 4COZA 1OQEA 3OCPA 1TNFA 4CDUB 1YFXA 3B3QE 4P9IA 1F8VA 1D4M2 3ZIXA 3OY8B 3RQ0A 3ZSMA 3MIGA 4AVVA 2VMHA 3CEWA 2XJUA 1CN1A 4HVOA 2RS32 5K7PA 4Q4V1 5A33B 2VW1A 2A7AA 1OPMA 1N3QA 4ZU5A 2CGPA 2B9UA 3L9JT 4C0HA 2QVSB 4XIKA 4Q0QA 4WV8A 1IKQA 3N3HA 5KBFA 2OUJA 2G9FA 1TNRA 1ZRCA 1PO12 4B3NA 4MH0E 3NSTA 4JDMA 3B00A 5DZFA 1WBFA 4XIOA 4QX5A 1QHDA 3SNMA 1BQPA 2EXHA 1VRH1 1RMU2 4Q4X3 1O3QA 2UURA 1AHSA 1C3HA 1HQNA 2PAMA 2QCSB 3FLTA 4M3CA 4QQOA 1NA1A 1YLLA 3ZYIB 4AEDC 4AFAA 4ITCA 3VGIA 5L7OA 3NV2A 1UKGA 3VBSC 2AYHA 5J7MA 1B35B 4KBBA 4AQ6A 2YROA 5FO7B 3S7IA 1N3OA 1YI7A 2NLRA 5DXDA 1ASJ1 1VR3A 3NL1A 1IS5A 4XF9A 1WW5A 4E27A 5JVVA 2IFWA 1LOAA 4FOWA 1NCRA 2JKBA 5JLVA 5IK8A 3VBFC 4NVPA 2UU8A 4NR1A 3VDDB 2RMU1 2A6ZA 3FX3A 3QACA 3QD6A 4WM7C 2ATFA 1VALA 4XFAA 4NHKA 1LRHA 2ARXA 1I6XA 3VBUA 4MX3A 1F5FA 3AJYA 1TMF1 2Q5TA 5EZWA 3ETQA 1RUE1 4MZUA 4YFZA 5BV6A 4LA2A 1C8M3 4LHKA 4XBNA 5T5JA 4ES9A 2EXKA 1LR5A 2DCKA 2MHFA 3WX5A 3CJIA 4Y1UA 1RUI1 4YVSA 1VRH3 1ENRA 5AC92 1DFQA 5BUVA 4QPIB 2I07B 2PLV1 3OF1A 1PVC1 3N7LA 4JDNA 1ZBE1 3MLKA 3QBQA 2E9QA 3H1YA 2B39A 3ZPYA 3QOPA 4GULA 4Z92B 1S0BA 1UD1A 3HMYA 5DDJ1 1VBE2 3NAPA 5E8AA 1CAVB 3POWA 3RSJA 3FUQA 4UXAA 1RUF3 2XLGA 2VW2A 3ASIA 3VV1A 4WVWA 5C4WB 2WNVC 5C6CA 1BMV2 1HRI1 2YGMA 3PJQA 4XJZA 4LE4A 3ZXGA 2DTWA 1ASJ3 4RA0A 3WY6A 1CAXB 3SMHA 2EVXA 3MF9A 4SBVA 5C33A 4GB32 2TEPA 1YWKA 2DVGA 3U10A 1PZ9A 1VBC2 4JTOA 3WINE 2D43A 2ZKNA 4Q1PA 5LRRA 2O8OA 1C5HA 2ZX3A 4FT8A 1N3PA 2PYTA 3RRDA 1YO8A 3OD4A 4O9GA 5T50A 5A3LA 2XJSA 4URTA 3ZXEA 4Z2WA 1M4WA 4Q4X2 1FMD1 1Z78A 2ZAAA 3TOJA 3AMHA 4BLIA 3HAGA 3OYWA 4M0HA 4WVMB 1RUOA 2NPIA 3FLRA 1RUE3 2IWGB 4RFT0 4FTBA 1RUJ2 4PBPA 1GKBA 2VUAA 3AMQA 4D7YA 1Q8SA 1RUI3 2MPFA 2ZGNA 3ROUA 1AR61 2PQQA 1MVQA 2AH2A 1WW4A 3AFKA 2HWE3 2PLV3 1KRIA 1H8TC 3AM2A 3OY8A 4K20A 4XJUA 4XXAA 2HWD1 3M3IA 3AJZA 1AJOA 3QLQA 5HCFA 1XE7A 4TSVA 4U2AA 4QPYA 4XJWA 3FC0A 1AX2A 2Q30A 5DDJ3 3WHUA 3AYCA 4AEDB 2P3JA 4Q4V2 1WD3A 1UF2C 1J1TA 4QXKA 5GZCA 3IN9A 2VUJA 1HRI3 2QDRA 3TNQA 5C9AC 3POYA 1SLBA 2PTMA 2FZ2A 3AZVA 1LOFA 3OGJA 3USUA 4AWDA 1J3PA 1PK6B 2AGSA 2JICA 3NV1A 1EY2A 3JQXA 3I59A 5GLZA 1WCSA 3E6BA 4LLOA 3D0JA 1WGPA 4JDOA 4FPHA 1UPIA 1W6MA 1VRH2 1MVEA 2HEYF 1BEV1 3AZZA 1Q5OA 3BCWA 4R9BA 1LULA 2YZ4A 4Y4YA 4CDXA 2D6KA 4XXPA 1RUG1 3UKNA 2R071 4JC1A 2WZPP 2ZHNA 3S7EA 2ZGMA 1B35A 5CVRA 4QU2A 3VKFC 3LSEA 1XXNA 5JOYA 3ES1A 1AR63 4YLZA 2B45X 2A6VA 1CIWA 3SHRA 4J6GA 2FMYA 4LHNA 3WP3A 3ZSJA 4HVRA 4IEOA 3ZXLA 2SBAA 4AYUA 3DN7A 5L19A 1ASJ2 4LLFA 2TUNA 3VDDA 4ATEA 4DB5A 1O4ZA 3TN91 4JQRA 3L2HA 4F7ZA 2RMU2 1C28A 1PGL1 3NV4A 1IS3A 1LTEA 5BNPC 4KH9A 1I5ZA 2E7QA 1LGNA 4QQPA 2ZHMA 5IK4A 1LJ7A 2JG9C 1QJY3 1M06G 1TMF2 4BMEA 4AVSA 4MVTA 3VZNA 4CP1A 3PVOA 1RUE2 4PIXA 1RVF3 2QUOA 2GC2A 2IXLA 5JSPA 4HSLA 5K0UB 1JXNA 4XFFA 4AHYA 1DGRN 2HWF1 4XJ8A 1RUI2 2GDFA 4LO7A 3KM5A 3WQ0A 3WLUA 2WA3A 2NYYA 3EJKA 4GMP1 4JVAA 3ZMNA 2RR11 2IXIA 2PHWA 5JIAA 3WDYA 2PLV2 1BEV3 2Q1ZB 1PVC2 1Z7S3 4YVWA 4Y20A 2IXHA 5D8AC 2R16A 2XLFA 5BNQA 1ZBE2 2R073 5FBZA 1WMDA 3ZFFB 4IETA 4K1ZA 1PZ7A 3E6DA 3EBRA 2VH9A 2Y38A 5DDJ2 3V65A 3R05A 3M70A 1ULDA 5KC5A 4H7LA 1WCKA 1RHI1 3ACLA 2BW8A 1HRI2 3WDWA 3UJQA 1FAYA 1AR83 1HLCA 4BE3A 1H30A 2E53A 3HN1A 2D7FA 2OUHA 3W59A 4QQ2A 3ILFA 1OPOA 2A6XA 1WLDA 4AHXA 1QJZA 3O14A 3KCYA 3RJRA 4WVMA 1O3RA 4HKLA 4C91A 5I91A 4GH4B 2D6OX 2BWAA 1OA4A 2WJSA 3KB5A 4YW2A 3VN4A 1FMD2 4E2QA 2DUOA 2JE7A 3B93A 1SACA 3WV6A 5C9AB 3JD73 3OBTA 2HJIA 5L36A 2B46X 3ES4A 2LM3A 2XVLA 5GLVA 2HWF3 3I8TA 3WW1A 2A6YA 1FV3A 2YV8A 4J1WA 3KQRA 1AR62 5GZGA 1PNFA 2OVUA 1GFF2 3IM0A 3MIFA 3G7DA 3O0XA 1MACA 3ZFGC 4COUA 3DF0A 1DIWA 2HWD2 1LHVA 1S0DA 4AEDA 3AYEA 4CDWB 1H1MA 1RUD1 2WT0A 5FDBA 2BEOA 4N90A 1QXRA 1BYHA 4Y1YA 3B9CA 3VBSA 3B94A 1RHI3 1MS5A 1JHNA 1EAH1 4L97A 4IEUA 4FXKB 4Y5Z0 4KGQA 3ZYRA 4LBQB 3AB0A 3MW4A 4N53B 1MEC1 2QE3A 4XFCA 3VBFA 2RHPA 1O3SA 1F5JA 5L73A 4PCRA 2OPKA 4RQPC 2IZWA 5ABJC 4WM7A 2E51A 5E89A 3BU7A 1ZYBA 4FPEA 1JN2P 2WS93 3ECQA 4FCAA 5EXOA 4GXLA 3H7JA 1WW6A 4AFBA 1BEV2 3B9IA 2AREA 3N7JA 5FQ0B 4CTEA 1XRUA 1RUG2 2CY6A 2R072 4LUMA 5F5QA 4ISQA 2JG9B 4W6XA 1G7YA 3V0BA 1U5YA 4AQ2A 1UMZA 4DPNA 2C1FA 1OI6A 5C8CC 4IEXA 2ZGUA 2JECA 5GZFA 3ZX7A 2DTYA 3VHNA 1RUD3 3ZSKA 3WUDA 4Z8BA 3SISA 1MS9A 1HRV3 4PLOA 5FREA 3TN92 3EO6A 3ZYGA 4P5HA 3M1HA 4A2UA 1EAH3 2WNVA 1PGL2 5FPXA 4MSVA 3FJSA 5HCBA 1DU3D 2R49A 3MFCA 2ZGQA 3FWEA 3MF6A 4AEJA 5F9TA 1N1SA 1DBNA 1PM7A 2F6BA 1ULCA 1V6MA 1MEC3 3D6EA 3C3VA 3M4FA 4XQWA 5BNOC 1N1TA 2GSYA 2WNUC 2QKDA 2PHLA 3UV9A 4AQSA 2HWF2 4HFSA 1CAWB 1AXYA 1Q8VA 1D2QA 1QH7A 4XFBA 1VBA1 2RR12 4C1XA 1TME3 5FLIA 2RJLA 1YJLA 3AP5A 1QJU1 4AVTA 1AYN3 4DXZA 1NA1B 1A6CA 2ZTNA 1MZFA 1HXS1 1XNCA 2JJ6A 3WNXA 3LCPA 2E7AA 5L7OB 4K3UA 2D40A 4F3JA 4K40A 1RHI2 3ELNA 1ENQA 2EXIA 3O12A 4DRVA 2KA3A 1H8TA 2DVBA 1XNBA 1S0GA 1QGLA 1D4VB 4S2FA 3N36A 3T2TA 2RS33 4IEZA 1VJ2A 1GR3A 4I09A 4XQDA 2Z2SB 1W6QA 1D0HA 1NCRB 5DZEA 3H0OA 1SCRA 2GC1A 1DQ0A 4EWEA 4A7YA 1YI9A 1SFNA 3JU9A 3MIDA 5C9AA 2W0XA 2XGXA 5FLHA 4CDXC 5FTTC 1PO13 3H3ZA 2V5YA 2LALA 4AF9A 1URXA 1KDKA 2DUPA 1CONA 4LO6B 3WDTA 4JGZC 3QH7A 2DVFA 3AKPA 2A70A 3MW3A 1LU2A 1VIWB 4B29A 3NVCA 4AE2A 3N35A 3IMNA 1HX6A 1DDLA 1BCXA 1DHKB 1VBA3 4YVSB 1PGW1 5E88A 4NWWA 4FP2A 4EWDA 5ABJB 2ZKLA 4GKXA 1QJU3 4MLOA 4V1PA 4PIZA 3H7YA 2D93A 1BVP1 1RUD2 4HT1T 4BCUA 3SH5A 4X6RB 4FSJA 2HYKA 5FAXA 3M3QA 2WA4A 4CRQA 1Q56A 1XYNA 4YZ5A 4KWLA 5DUXA 3RNSA 1MZ6A 1EAH2 1H1IA 3KCCA 5CNAA 2P3IA 1JYIA 1WBLA 4OHVA 4LO4B 2FHRA 5C8CB 1NE6A 3K48A 5IK7A 2OYZA 2PFWA 1R1ZA 1MEC2 3H9AA 1WMFA 2JXAA 2VULA 5FRAA 3PNAA 1C1FA 3RYKA 2D44A 2ZX4A 3WP5A 5BNPA 5J36A 4WBBA 5FQ0A 2YMZA 1GICA 5IT6A 2VOXA 4EN7B 3J4UH 2VPVA 2JG9A 2HKXA 2WIIB 5LEKA 1DYPA 3LA7A 4FOVA 4XFHA 1TEIA 4YZ3A 4EN8B 3AMPA 3X29B 3VZMA 5AC93 3MPPG 4LBMA 1C5IA 4AEMA 1QH6A 4RD7A 5I8YA 4GQ7A 2WNUB 2YUEA 2ZJCA 4YM0A 4G3YC 1QQP1 4UW5A 4AEKA 5D8AA 2LTNA 1Y9QA 1VBE3 1ULFA 1ZZ6A 1HIXA 4LTAA 3FLPA 3H50A 1GZWA 2A3YA 2CAUA 2Y26A 4RR3C 4AFDA 4YARA 1DYKA 2W08A 4C90A 5KHHA 3PLQA 4YW3A 4D94A 4WZCA 4E4DX 4YNIA 1R081 3UL2A 4BH9A 4GB33 1CVNA 1VLNA 5GM0A 1VBC3 3USUB 3W9AA 1CAWA 1GSLA 5HBAA 1MR5A 3I59B 4HLTA 1UCXA 3E6CC 1RJ8A 3AZYA 5IUQA 1FXZA 2NMOA 1W6OB 5IK5A 1AR91 4AFCA 1VBA2 1W6MB 4KU8A 1QF3A 1LECA 5BYNA 2FMDA 1RUJ3 5FLJA 1QJU2 1YFWA 4K1YA 4F8AA 5EYYA 4CDXB 5CB7A 4RGGA 1GQHA 3WVJA 2K2SA 1HXS2 1YFUA 2ZGOA 4DY3A 2ARBA 3EHKA 3CF6E 1POV1 3KT4A 1J59A 4I0AA 4RHV1 1ENSA 4FAGA 2DWRA 3RS6A 2CGNA 2ZBJA 2JDZA 2B7YA 1SCSA 2CV6A 2CWSA 3O5SA 2ZCWA 4ZXKA 3ZFGA 2RM21 2ES3A 1IPJA 4Q4V3 1PIV1 4NHMA 4YM1A 2FQPA 4R8HA 3GHNA 1DLLA 2DCYA 1ENXA 2P37A 1SDWA 3LOBA 2O8QA 3J9SA 1VBD1 4N9IA 1RGSA 2BFUL 4B7EA 1C4RA 4HN1A 3VHRA 1DQ6A 3TRSB 3SLIA 2BGCA 5H9RA 3IWZA 4D7SA 1SFYA 2Y0OA 4RQPA 4XILA 4I0BA 5ABJA 1RITA 1DZQA 1SLAA 3H1MA 1VB4A 5EJ3A 3FBMA 1PGW2 2UY9A 3VLBB 4TZDA 1RUNA 3M3CA 2YGLA 1S55A 4AK3A 3VBRC 4YVWB 4Y20B 1FNZA 1Q8OA 4JRLA 2D6PA 4DINB 4META 1CD3G 1DQ2A 4JAAA 5BNNC 1OMIA 1AXKA 2QDNA 2ZZJA 2EXJA 2DURA 2ETEA 2R041 1AX1A 3BOPA 5HCAA 2H6CA 1X82A 4AVAA 4FPCA 4ZU4A 3L2YA 5C8CA 5CG9A 2AUYA 2VG9A 4LULA 2DCJA 1YCIA 2VW0A 3M3OA 1J3RA 3VZOA 2D97A 2OA2A 2PHRA 2RMU3 4KWKA 4DNYA 3HT2A 2I45A 4HSJA 4FPLA 3HWJA 2G4IA 1REDA 2RS51 3JUUA 3GZTB 1D0GA 4XF3A 1YIFA 2GNMA 4AI2A 4NPRA 4YGBA 1EPZA 5GLWA 1RB8G 3ALQA 2X29A 4OI2A 4DOUA 1TMF3 1VBD3 3B69A 2DFBA 2WFPA 3WG3A 1U0AA 1ND3C 4K6BA 3RJ2X 1PZ8A 2P17A 1RUH1 2EIGA 5J37A 4LNVA 1FPN1 1LEDA 2D6MA 1KS4A 2Z42A 3RWNA 2IFRA 2YHJA 4BIOA 1DZRA 5BNOA 2WNUA 4PBOA 3GF6A 1WA4A 5EWSA 1PVC3 5HXVA 2NMNA 1S0EA 4XF4A 2A73B 1ZBE3 1JBCA 4OI4A 3VBHC 1QQP2 4BWOA 1TQ5A 1QDCA 1DF0A 1SLIA 2DU1A 2BFUS 2A71A 1O5LA 2R043 3D82A 4TYSA 4KWJA 3ZXAC 3MICA 1G9DA 3VBSB 4QQHA 2WC2A 5H9QA 4ORFA 3DKWA 3MI8A 2IXCA 3O7OA 4XHXA 2XB6C 1R082 3VBOC 1QXJA 1NQDA 5F1RA 4NWVA 1ALYA 3JQWA 4FOYA 4A3XA 1W6OA 4L9BA 3VHOA 3ZO0B 1O3TA 2OZ6A 3ZN6B 3ME2A 3VBFB 1UZZA 2H6BA 2UY8A 1J58A 1FMD3 2H0BA 2ET1A 4Q29A 1RIRA 2Z5WA 4WM7B 5A32B 2R061 1AR92 1A8DA 4OHXA 1RUH3 1FPN3 3OD0A 2W68A 1IOAA 4JGZA 2O1QA 1FI2A 4JCKA 3SCGA 1AR71 4RHV2 4AI8A 1H4GA 3RYPA 3V0BB 4XQ4A 1NE4A 2HWD3 2PHUA 1QY4A 3RI9A 2RM22 5CFDC 4HK9A 1GNHA 1ZZ7A 3NJZA 5A3MA 3WG1A 4WVZA 4BM8A 4E4ZA 3DUIA 4P9JA 1PIV2 2DVDA 3FUOA 4IV3C 1T6GC 1S0CA 2WL1A 2XJRA 2XJPA 3VUOA 2EA7A 5SV8A 1S2BA 3FFQA 1X50A 3PMEA 4DMIA 2WNVB 2PELA 3NW4A 1JW6A 4QD2A 1VBD2 2CL2A 5AFBA 5JDBA 3D0SA 1OQDA 4M0NA 4N9HA 4E4SA 1RL3A 1A3KA 1QKQA 5JOXA 1V6OA 2PHXA 3AKQA 2BVVA 1ZRRA 2X5IC 1AVBA 1KD7A 4R9AA 5FOJB 5K9YA 5J3UA 2F4PA 3WXPA 3KMHA 1V00A 2PHFA 4HKOA 4W6YA 3J8F1 2R063 4INDA 1WW7A 1W0PA 3DPRC 3FMGA 1RUG3 3CL1A 2IXKA 4OUSA 1LOGA 1E57A 2ZPXA 2LUWA 4MUVA 1CPNA 1G8WA 3BOWA 3U4XA 1FYUA 1OD5A 4QGNA 3AXEA 5ACA1 1C8NA 2R042 5CFCC 1NZCA 2E7TA 1GQGA 5H9PA 2XL9A 4R52A 1ND2C 4MV2A 3POSA 1H8TB 4KNCA 3ST7A 1LHUA 4YG3A 2QJVA 3TN93 3ZSLA