2O1QA

Crystal structure of a putative acetylacetone dioxygenase (mpe_a3659) from methylibium petroleiphilum pm1 at 1.50 a resolution
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
144
structure length
144
Chain Sequence
MLKSKIKEEYVQMDQVDWKPFPAAFSTGGIRWKLLHVSPEMGSWTAIFDCPAGSSFAAHVHVGPGEYFLTKGKMDVRGGKAAGGDTAIAPGYGYESANARHDKTEFPVASEFYMSFLGPLTFVKPDGSPIAVIGWEDAQGAWAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords putative acetyl/propionyl-CoA carboxylase, alpha subunit
publication title Crystal structure of putative acetyl/propionyl-CoA carboxylase, alpha subunit (ZP_00243239.1) from Rubrivivax gelatinosus PM1 (Methylobium petroleophilum PM1) at 1.50 A resolution
rcsb
source organism Methylibium petroleiphilum
total genus 29
structure length 144
sequence length 144
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-11-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2o1qA01
4QM8A 1CAVA 4HLTA 4Q29A 2GH2A 4I0AA 3CO2A 3NKTA 4XFFA 2QVSB 1WA4A 1VJ2A 4P9GA 1UIJA 4FAGA 2EAAA 3E5UA 4Z07A 3EHKA 2BGCA 2MPFA 2KXLA 4FBFA 3H3ZA 4BH9A 2F4PA 4IEPA 4LUMA 4EROA 1QWRA 2QNKA 3ST7A 4BYYA 2QDRA 3USSA 1SFNA 1ZVFA 4I01A 4MX3A 4O9EA 4IEXA 2UY9A 4ZU4A 5I8SA 3LA7A 2OZ6A 3EJKA 4O9GA 3VHRA 4XF9A 1VP6A 5JSOA 4XF1A 1EY2A 4EWAA 5BUVA 3H50A 3OD0A 1YFWA 3H7JA 3TNPB 1RUOA 1ZNPA 2HJIA 1H1IA 3E97A 4YRDA 1RL3A 2PHDA 3WW1A 2BNOA 3CJXA 1OI6A 3DV8A 5KHHA 3PVBB 4IEVA 1CAUB 2IC1A 5FPZA 3BPZA 4PJYA 4KWLA 2PAKA 1O5LA 2XL9A 3SCHA 1J58A 1YFYA 4LA3A 3U10A 3H8UA 1QXRA 1J1LA 1DGWA 4XFIA 1SQ4A 4MH0E 3HQXA 3EBRA 3I7DA 2ATFA 1J3QA 2B5HA 2FMYA 5FPXA 1OFNA 1ZRCA 1NYWA 3FZ3A 4XEZA 4QGLA 2D93A 2OPKA 5J48A 5I91A 2Q30A 3JZVA 3QOPA 4FAHA 2DCTA 3M3IA 4E2GA 3IDBB 3KGLA 4MGZE 2IXLA 3GYDA 5C6CA 3GBFA 3FFQA 3LA2A 2GC2A 4QM9A 3PNAA 1GQHA 3LAGA 4IEQA 4UBGA 5BPXA 1U12A 4CYDA 2CV6A 4XFBA 3DN7A 4LA2A 3FWEA 1LR5A 4NVPA 2PA7A 1PM7A 1JUHA 1DZRA 4IERA 2GC3A 4YARA 4AVCA 1CAUA 4AXOA 2XLGA 4WBBA 1ZZ9A 5BXXA 1ZX5A 2CGPA 1CGPA 3H9AA 2D5HA 2IXIA 1LKNA 4KWJA 5F1RA 2H6CA 3WW4A 4IEUA 1VR3A 2UYAA 4HSJA 3B02A 4XF0A 5I93A 1Q43A 3SCGA 5FDBA 5LRRA 2C0ZA 1EYBA 4IEOA 1Y9QA 5LRSA 4LTAA 1ZZ6A 1OD5A 2VECA 3HT1A 5KHGA 3IDCB 1RC6A 2GZWA 1I5ZA 3OF1A 4HSLA 1X8MA 5CADA 5CVRA 3SHRA 3FJSA 2PFWA 4IETA 5C8WA 4IEWA 4IEZA 1TQ5A 3OTFA 4HVQA 4YYOA 3D82A 2O8QA 4QX5A 4YNIA 2PAMA 4HBNA 1O7FA 4MGIE 2IXJA 3ES4A 1DZTA 2BNNA 3IWZA 4LULA 3IBMA 4GULA 3KCCA 2V09A 4DINB 3ELNA 1X82A 5KHKA 1RGSA 1X7NA 1YUDA 4HMZA 4PIYA 1HW5A 2B9UA 4HVRA 1ZRRA 1DGRA 2GC1A 4OLLA 5I0UA 5KHJA 2OA2A 2UY8A 4N9IA 4E2SA 3NJZA 2I45A 2Q0AA 4XFAA 3KGZA 4AQ2A 4XFHA 4H7LA 1ZZCA 4JVAA 3BALA 1SEFA 4A2UA 2GAUA 5I8YA 3S7IA 1YFUA 5JSRA 5HI0A 5FLHA 3UKTA 2XKOA 3S7EA 1NZCA 1IPKA 1H1MA 4MUVA 2BEOA 1XRUA 4PIXA 2OYZA 2QCSB 5KBFA 1CAXB 1EP0A 2ET7A 3H7YA 5E1RA 2GC0A 2XHKA 4JTOA 2FQPA 4IEYA 1UD1A 2VPVA 2D40A 4XETA 3NL1A 2BNMA 4WZCA 4QGNA 3RZZA 3L2HA 3CLPA 1CAVB 3D0SA 2Z69A 4I3PA 1RTVA 4X6RB 3NVCA 3ETQA 5I8TA 4KU7A 5JCTA 3FHIB 4HN1A 1XE7A 3CEWA 4D7SA 1ZRFA 3DL3A 4K8FA 3MPBA 4D7TA 1CX4A 2EA7A 3CL1A 1FT9A 3UKNA 1UCXA 5K8SA 1CAWB 4LLOA 1EPZA 2UYBA 2ETEA 2CAUA 3ZDSA 1G6NA 3NW4A 2PHLA 3HT2A 4JTNA 3RDIA 5FLJA 2D5FA 2H6BA 4J1WA 1O5UA 3TNQA 2GU9A 3U0ZA 2E9QA 3E6BA 5E16A 3UKVA 2EVXA 2XKPA 1O3SA 3RYPA 3RYRA 5BV6A 3E5QA 1YHFA 2B8MA 3CF6E 4Q0VA 4I2OA 1YWKA 4HN0A 4ONUA 4EWDA 3RYKA 4Q0SA 4BIFA 4L2NA 2Y0OA 3I59B 3BB6A 4OFGA 1UIKA 1QXJA 3H1MA 5EFUA 2QJVA 3N4MA 4J1XA 1Q5OA 2K0GA 4QMAA 4AVBA 5FCCA 4HVOA 4YSFA 4Q0UA 2MHFA 2IXHA 4MV2A 1J3RA 4BHPA 3BU7A 4UBHA 2VQAA 3G7DA 4HZFA 1UPIA 1ZREA 1RUNA 2P17A 5D1IA 5I0SA 5JR7B 5JAXA 3FE5A 3SXWA 1XE8A 2PTMA 4ZU7A 1J3PA 2Q4SA 3WW2A 5FQ0B 3E6CC 1I6XA 3OCPA 4XFGA 3SMHA 2H0VA 1GQGA 4ORFA 1CAWA 5BY5A 4E2QA 3ACLA 1Q3EA 3RNSA 2XL7A 4QXKA 4I02A 4R52A 1Y3TA 3H3UA 3BCWA 4MGYE 1IPJA 4AVAA 3OGJA 4LUKA 1NE4A 1QY4A 2O1QA 2HKXA 1OMIA 3LOIA 2CAVA 4UXAA 4AQ6A 2PAEA 5T3NA 1FXZA 2ZCWA 4R8HA 4L11A 4EV0A 2N7GA 1ZRDA 1LB2A 1ZZ8A 1O3TA 3I59A 3QACA 5EZWA 1L3JA 3H1YA 3SCFA 2WC2A 1X8EA 4WVZA 2XLFA 4FT8A 1NE6A 4ZU5A 3E5XA 3M70A 3EQEA 3LWCA 4Q0PA 4MGKE 3R6SA 5LEJA 2BYVE 5AVPA 5J7MA 5JSPA 3EO6A 1PMIA 1ZZBA 5KHIA 5FQ0A 1FI2A 3WW3A 3HIFA 5FLIA 4META 3LA3A 1UW8A 1YLLA 1O3QA 1LRHA 1YFXA 4PIZA 2MNGA 3MDPA 3C3VA 3S0MA 3D0JA 1J59A 2PYTA 3FX3A 3I54A 2K9ZA 2IXKA 2Z2SB 3LZZA 4Q0QA 1ZZ7A 5J3UA 2IXCA 4I09A 1NXMA 5I0TA 4KU8A 4JV4A 2XGXA 4KL1A 3RPQA 2ZKLA 4XF3A 4RD7A 4EWEA 5CU1A 3KSCA 3NSTA 4N9HA 4LEJA 1O3RA 3MZHA 2PQQA 1V70A 4X6QB 4F7ZA 4QGMA 2Q1ZB 2ET1A 4B29A 4IESA 1CAXA 3IIAA 1WLTA 2XLAA 1O4TA 2WFPA 4XF4A 3DKWA 4I0BA 3H1WA 3U11A 4F8AA 5I0RA 5LEKA 3ES1A 4TLFA 2OZJA 3KMHA 4Z82A 3PLQA 4MZUA 1WGPA 3E6DA 3O14A 3ROUA 3MYXA 4XFCA 4KWKA
chains in the Genus database with same CATH superfamily
2WWSA 3CKHA 4HLTA 4OULA 2GH2A 4MO3M 1BBT1 5LA9A 1MS9A 1VBA2 1UIJA 4CUAA 4FAGA 1JYTA 2A1XA 4XHXA 3J7HA 5FKBA 1PZ7A 3W9AA 2VC9A 1PO11 4R9BA 3U1XA 4Z07A 5DXDA 1D4VB 2WO3A 1LNSA 2KXLA 5DABA 3K2OA 4FBFA 1UOJA 2E6VA 2ZBJA 1R1A3 3H3ZA 2FDGA 1WCQA 2TEPA 1SLIA 3N9QA 3A0KA 2RS13 4YGDA 2XWJB 2WZR2 1GYKA 2X29A 3USSA 1ASJ3 2BFUS 4QWNA 4NIGA 1GICA 5CFCB 4KMQA 2CWSA 1MEC2 2A75A 2UY9A 4B1LA 3LA7A 1Z7S2 3VL8A 5L9VA 4YGEA 1YQ8A 4XF1A 1EY2A 4WM7A 4N7IA 3ZSJA 4AHWA 1LULA 5JSOA 4AQTA 1SLBA 1AR91 3B01A 5G04L 3WNXA 5IFPA 4FXGB 1YFWA 2QTWB 1W8ZA 3DECA 4AHZA 2FZ2A 1EV12 2G4IA 5A3TA 2VZVA 4A44A 2BPA2 2JE8A 5FWEA 5DZFA 1W90A 3V65A 3KVAA 1VAVA 4FFFA 5K0UB 1YQCA 1DGRN 4BB3A 2WAOA 1KEXA 4CEWC 3BU0A 2A3YA 2RDQA 2NZ9A 3GBWA 2Y6KA 5LBCA 1S2KA 3EXUA 4IW3A 4XURA 4K40A 2JJ6A 3N9LA 3O0VA 4JAAA 2HWC3 2ARCA 2ZAHA 2W87A 1CAUB 4YGBA 4CPBD 1V9U1 3IDEA 4PJYA 2VR4A 4KWLA 5FPZA 4A45A 4DXTA 2QE3A 4M4PA 1J58A 1O4YA 5D8AC 1YFYA 2CYFA 2UU8A 5A6ZA 4GH4B 1JW6A 2HWB3 3CZUA 4LA3A 2XXZA 1K12A 1WMFA 4P02B 3A21A 1QXRA 5F3GA 5EIYB 2ZGRA 2AEZA 4HK9A 1AYM2 2B39A 3HQXA 4XUTA 3EBRA 4XIOA 1X9PA 1G9FA 4MGSA 4AVTA 5JZGC 1VMFA 3VKLA 2FDFA 2VMCA 4Y5TA 1DLLA 5M0TA 5C5UA 2J1VA 1TE1B 1WWYA 3RVHA 2JDNA 4G4FA 4B8EA 4FPHA 1RHI2 3BGAA 4YM1A 2WS93 1VBB3 4NWWA 5FK7A 5J48A 1OD3A 1W6QA 3RZGA 1YJKA 3QOPA 4CUBA 1WKYA 2WNVA 4CDUC 1N3PA 2DCTA 4FAHA 5CFDB 3IDBB 4LOSA 4YGCA 2W52A 5C6CA 1J1TA 2WABA 1DBNA 1WLWA 3CZJA 2XVKA 5EJ1B 5C9AA 1AXYA 4K7JA 2XONA 1BVP1 5FK8A 4QM9A 5FZMA 1AJKA 2RV9A 3LAGA 1BJQA 1F15A 1HXS3 2WRAA 2CV6A 1QJX2 1S2EA 1D0HA 2C5DA 4XFBA 5BYNA 1NUKA 4QQHA 4NVPA 2CNAA 2ZX4A 1MPXA 2GNTA 3OUHA 1JUHA 4RGAA 4GB31 1HB1A 1PO23 1DQ0A 3MF6A 4PF1A 4Q4X3 5DDJ1 4YARA 1CIYA 2QQNA 4LQRA 4AXOA 4P14A 2ZGOA 4P9LA 4WBBA 1UKGA 4NIAA 2BW8A 3VDDA 1RJ7A 3M4FA 3NAPB 1P8JA 2CDPA 4NMIA 5FP8A 2DYCA 2VY0A 4COZA 4P9XA 1QGLA 5J98B 3IDAA 1ZX5A 1H6YA 2W0XA 3U4XA 2Y64A 3HNMA 3H9AA 2IXIA 2Q1MA 3VZMA 5A3LA 4JRLA 1XYPA 3OOXA 3MGUA 2JDUA 4IEUA 5FYSA 2VZRA 5DAVA 3VZLA 4Y5SA 4E4ZA 3WNLA 5CFCC 1WA6X 3THTA 3AVRA 1F31A 4N7UA 1DCSA 3W21A 4LKDA 4HSJA 2CGNA 2VNRA 2JG8A 5I93A 2Q1FA 1I9RA 5KR7A 2ZTNA 3HD8B 5C8CA 1KS5A 3LCPA 4LBQA 3UETA 1IS4A 1E5RA 5FDBA 2C0ZA 2XWBB 1VALA 5TSWA 1EYBA 4JQRA 5GLWA 1DFQA 3RJRA 2X5IB 2WA3A 4CA9A 2GMEA 5K0UC 1ZZ6A 2NN8A 2VBDA 2NPIA 1DZQA 4K21A 1SLTA 1VBE1 2JB4A 2ZACA 4LIVA 1V6MA 4HPKB 5DUXA 2V72A 5FZ0A 2Y38A 5KHGA 3I3QA 4LT5A 3POEA 4QX0A 1X8MA 2CWMA 1RUH3 1RVF2 2J1RA 1K45A 2PFWA 5KC6A 3ZIWA 3ZSKA 2FDIA 1OHFA 4XVHA 1K3IA 2DURA 5DN2A 5IVEA 4GH4C 3AMHA 2RDSA 4NROA 2AREA 1H9PA 3B7MA 3LPGA 1PIV2 4CZSA 5I0DA 4W65A 2A7AA 2I07B 2VGDA 3LEKA 2PAMA 2RE9A 5FZIA 1KFUL 2R043 1GUIA 5FZFA 2YC0A 1VBA1 3UGHA 2ZPXA 3HR9A 1DF0A 5FZEA 2XDVA 1LGNA 5T55A 4X8NA 1BEV2 2J42A 3WG2A 3O1UA 4V1PA 1C8M2 1YCIA 1RUI3 4RHV1 1WBLA 4HT1T 1IS3A 4S2FA 3TN93 3AVSA 1DZTA 4LO7A 4LULA 3ZFEA 3H8XA 1LOFA 4P5HA 2VZUA 1UKRA 4GD4A 2GH8A 5T5PA 3KCCA 1A78A 2VBBA 5CKQA 2ZEZA 5LB6A 3WP3A 4AAXA 4AGGA 5KHKA 4XJWA 4AR2A 4IE7A 2BDRA 3MLKA 4UWDA 4DUVA 1CD3G 3ILFA 2ZGMA 1MEC1 2AENA 3AJYA 1ZRRA 4LPLA 3ZMOA 3ZYJB 2O8OA 4DZGA 1ZBA3 2WQZC 3FC0A 2Q0AA 4M3CB 4XFAA 4AQ2A 4R9AA 1Q8OA 3TYJA 4XFHA 4BQWA 1G7YA 3O1MA 3VBHA 5F5IA 2WN3A 3ZN6B 1NX9A 1Q8SA 1EV11 1QJY3 3BALA 1SEFA 4DY5A 3ZN4A 2JG9A 3DYPA 4FOVA 1MZ5A 3S30A 3WSOA 3VKNA 1OLQA 3NV4A 4FI9A 1AX2A 4L92A 5FP3A 3VZNA 4JDNA 4DEQA 1IPKA 1H1MA 4QAWA 4M01A 3NNGA 4MUVA 2BEOA 4MADA 2OYZA 3UGFA 2LALA 3PMEA 5KBFA 5G05L 3BOWA 1CAXB 1EP0A 2R7EB 2ARAA 1LHNA 3BPSA 3K75B 3UL2A 4FPJA 4R9CA 2HWD3 3H42B 4NHKA 4JRAA 2XHKA 4NAMA 4U36A 2WNEA 3LEGA 3ZYFA 4YZ3A 4WM8B 1S0BA 1O8SA 2FQPA 1UD1A 1W2UA 3POIA 2ZZQA 1CJPA 3PJYA 4XOGA 2E51A 3POSA 1LHOA 4YZ1A 4WZCA 5BNQA 1BYHA 1AYM1 2NQYA 1H4HA 4ES9A 4JZRA 3MUZ1 3PIJA 2WO1A 2W1SA 4I3PA 1AXZA 5E88A 5JI9A 3NV3A 2EIBA 3J7NA 1W0NA 2IFRA 4P9JA 4CCJA 5JCTA 2X5IC 1XSRA 2XJRA 4B1MA 5DPNA 1ZRFA 1FNYA 1RUF3 2OX0A 3I2HA 2ZA9A 1EAH3 3R4SA 2HWE2 4HXCA 2BQPA 1C5IA 3R4DB 4K8FA 5GLVA 3WP5A 4A3ZA 3O1TA 3W59A 1AUYA 5F2SA 1FT9A 5IVCA 1LB2A 1GWLA 4FPLA 4LLOA 1CR7A 1OPMA 2UYBA 5HCHA 5A1LA 2PHLA 3HT2A 1AR82 4BA6A 1D2QA 2GALA 4N43C 4QQ2A 4IE0A 5E16A 3RSJA 1MZ6A 2PHTA 3UKVA 4WM7B 5A3NA 3RYRA 3I2IA 1UF2C 2QQIA 4NR1A 2B8MA 2B42B 1ULDA 2XBO3 3I3DA 5IVJA 1H2KA 3QLQA 1RIRA 3GZEA 5F9TA 2NM1A 1BKZA 1MQTA 4RN5A 3Q8EA 1NOVA 4O65A 4L2NA 2Y0OA 3PDQA 5K9YA 5IAVA 1RUG3 3L2YA 4OFGA 2BVBA 5FWJA 2WUHA 2JKXA 3PIGA 4QMAA 1ENSA 4AVBA 4HVOA 1HQNA 2DU0A 1PGSA 1C1FA 1NY72 1VB4A 2DCZA 2AZ5A 2IXHA 2LW8A 2R062 3JB4C 4GIQA 4MV2A 4W4ZA 4ASLA 1CZVA 1EPWA 4L8QA 3FL7A 1D7PM 4DFSA 1ZREA 2B7YA 2RR12 3M3CA 3WDVA 5C3OA 4UFLA 4YW3A 4EJRA 1XYNA 3LOBA 1D4M2 5F32A 4HG6B 1OFSA 4XUNA 1PZ8A 1XE8A 2ILMA 3SXWA 4CP9A 3NNJA 4FPKA 4ZU7A 2FHRA 3AYDA 3MI8A 2YDEA 1JZ5A 3E6CC 3OCPA 5FZDA 4XFGA 1GNZA 5FO7B 1JOPA 4OHXA 4XC9A 1OOPB 1W2OA 1YNAA 5D21A 1PNGA 1Q3EA 2XL7A 4NN0A 4XDQA 2VTXJ 4CCLA 1LESA 2VVEA 1XNBA 1PK6B 3H3LA 3OY8B 4LHNA 4NRQA 4GKXA 4UW5A 3H3UA 4CCMA 5F7UA 5FP9A 3FBMA 3ZPYA 3OGJA 1RVF1 1G9DA 5JXHA 5IK7A 1VMHA 2JDHA 2O1QA 1LGBA 1N1TA 4JKKA 3I3BA 4WM8C 3J8F1 4OHZA 1O6UA 1OMIA 2R30A 4O61A 2CAVA 4UXAA 2FDKA 4AQ6A 4BQ1A 3FMGA 4Q8KA 1FXZA 5T50A 1UQXA 1PIV1 4L11A 3SEEA 4EV0A 4NUBA 4W6WA 4XQ4A 3VD9A 3G6JB 4OHVA 3TEZA 1H4GA 1ZZ8A 1NAEA 2GP3A 2ID4A 2JE9A 1WD3A 2EAKA 3I59A 4GWNA 3LB9A 4B7EA 2Q5TA 4U2AA 1W6MA 4OUMA 1XE0A 5FREA 4PBOA 4P08A 2D6OX 4LHKA 1C8M1 3ZIXA 1UU5A 4BXFA 3JD73 1PGW2 5FY7A 5CYYA 1CZSA 1NE6A 3GJAA 2OT7A 1XJAA 3SH3A 3VDDB 2BYVE 2ZAAA 1XXNA 1HLCA 5HXMA 3ZN5A 2QUOA 5J7MA 4BQXA 2ADDA 4CTEA 2VNGA 1PMIA 2JDPA 5DZEA 1DYKA 1FOD3 1JYWA 2D6PA 4EN7B 4QPIA 2C26A 3RQ0A 3VHOA 4META 3LA3A 5IFTA 1DGLA 2YFUA 1PVC2 4WM7C 2B9VA 1W8FA 1LRHA 1LOEA 1O3QA 1WLDA 3C3VA 2JG8B 5DMYA 3KS7A 4QX7A 3S0MA 5LA2A 2VUJA 3FX3A 4XJAA 4LBQB 2Z2SB 1ZZ7A 4CDXA 1R092 2SBAA 2FCTA 3O0WA 5A3MA 2Y0IA 4G9SB 4GMP0 2V73A 4KU8A 1C57A 1XBFA 2RS52 3MLJA 5C3QA 3JBG1 2RJLA 4M00A 2Z5WA 3WQBA 4P9YA 2ES3A 4RD7A 4DXRA 5H9QA 4EWEA 1X50A 5CU1A 1SDDB 2VCCA 3KSCA 3NSTA 1I1EA 5FV3A 5FZKA 4W8JA 1GV9A 2BGPA 4RS5A 5GLTA 3VDBA 3OBZA 4N9HA 1AYN3 4LEJA 1O3RA 5KXBA 2IUWA 4WVVA 5CG8A 1GP4A 1LJ7A 4QB2A 1LU2A 1V70A 4JKLA 3DXUA 5DAQA 5FP7A 3RWNA 3I2JA 2C6SA 3SLIA 3ZR5A 1H8VA 4QGMA 4URAA 2ET1A 1TNFA 2L9LA 1NA1C 2R16A 4DXSA 4HANA 4B29A 3K4DA 1IQDC 1OOPC 4IESA 1AJOA 2JICA 3IIAA 4QT6A 3WZ1A 3TB0A 2XLAA 2WFPA 3K3NA 3DKWA 4I0BA 1L7LA 3H1WA 3U11A 2HWE1 3P6BA 1PK6C 3K48A 2FCVA 2WINB 2P1BA 2WKKA 2CDOA 5FPVA 1MS0A 5F5AA 5GLZA 1OLME 4QPYA 3UNPA 2RDRA 4H14A 4HFSA 1DQ5A 5AFEA 5CA6A 4AHXA 4MXVA 4XFCA 4KWKA 2P3JA 5FFOC 3RZMA 3MV11 3L9JT 5JI7A 3VBRA 1AR81 4ZXEA 1JXNA 5FYBA 4I0AA 5DUVA 1QQP1 5JIUA 3CO2A 3LFIA 4XFFA 4AFBA 4QX8A 1WA4A 2FDHA 1AR92 2ZJCA 5CB7A 3PVEA 2YBPA 1XNDA 4FPEA 5F6LB 4ARXA 3GJBA 1W8TA 2WZR3 5JOWA 3LD8A 2ZKNA 1BXHA 2ZEWA 3WEZA 3NRUA 1AR63 5CBLA 2WFF2 5LA1A 2JG9B 1G86A 1Z7S3 4AI3A 5A3OA 3HJRA 3VLBB 1X9TA 2ZGTA 3B00A 3VDDC 3NMBA 4CU7A 1V9U2 1M4WA 3LQCA 4I01A 3ZSEA 2Y33A 4MX3A 4FFIA 2R061 2QQLA 2F6BA 3WF2A 3GZTB 3MF9A 3RJ2X 2OZ6A 1OXCA 3VHRA 2DFBA 2Y6JA 1LAJA 3PUSA 4EWAA 2HWF2 3VKOA 2RR11 2WWJA 3H50A 4LXLA 4BM8A 4A7YA 2WL1A 1KS4A 5A1AA 5L7OB 1ZNPA 2AGSA 4COVA 1E57A 1D4M1 3VBOA 2OS2A 3QH7A 4YRDA 3THPA 3THDA 2WT2A 3V64A 1PGL2 3MIHA 2XJTA 4YG0A 2JG8C 2LTNA 2DVDA 1Q8QA 3P3NA 4Z92B 4ASMB 1JH5A 2DBNA 5A7PA 1SFPA 3LPFA 1HJGA 2JIGA 4AEDA 2BV4A 5LCWL 4HK8A 3BPZA 1Y7BA 4Q4Y3 3WNOA 4EZ4A 4DRRA 2XL9A 2P2KA 3O1RA 5GM0A 3VDCA 4DQAA 4LO4B 5B2GB 4CCCA 1JZ3A 4UW6A 1AXKA 4PF5A 4AFDA 3TAYA 2VL4A 2A6XA 5ACA3 4LK7A 1H2NA 1RHI3 3NO8A 5EPAA 2YY1A 1US2A 3POWA 3PVOA 4MGTA 4OI0A 4OI1A 4CP0A 1HDKA 4QPGB 2DCYA 3PUHA 2G9FA 4RFT0 2Q8DA 1J3QA 3VD3A 1RUC2 2ORZA 3CJIB 3KT1A 3KV5A 5DDJ2 2WSUA 1ZRCA 1JTZX 3FZ3A 4FOYA 1W8OA 3O7OA 2D93A 3B93A 3JXSA 1MS4A 4KGQA 3ZYBA 1PGW1 4FCAA 5HCBA 3MIDA 3KZ4C 3K3OA 1U5YA 4OUSA 4XYXA 5JOXA 3BTYA 4I30A 3RRDA 1QJX3 1NLSA 4MGZE 3GYDA 1LOFC 2WDBA 4COYA 2IFWA 4JGZA 2J1EA 4H2AA 3FFQA 4BQ3A 4F3JA 1RYYA 2VOVA 3ASIA 3PNAA 4NAOA 5FYYA 3LDRA 5FYIA 4UBGA 3JQXA 3VUOA 1LENA 4CSWA 4CYDA 1LOAA 3KD4A 2EXIA 1KQRA 4Y22A 4OVEA 2GDFA 1JZ8A 2VH9A 2PA7A 3OJBA 1PM7A 4E4DX 3AP6A 4GA9A 1FATA 2C1FA 3IIIA 1WUVA 5JXGA 1HRV3 1UZ0A 3KT4A 4EE2A 2RMU3 1QJEA 4Y4RA 1GP6A 1ZZ9A 1H0BA 4GMP3 1W9YA 1VBE2 3WG3A 4OHYA 1R091 2WO7A 2JG9C 1T6BX 5BXXA 4ARYA 5C70A 3VBSA 2WBKA 3T0DA 2RS51 5HCFA 4A3XA 2ZGSA 3AYEA 2D5HA 3PU8A 4LHLA 1SBFA 5J1XA 2DUOA 2RM22 1PMJX 3KQRA 3N35A 4KWJA 3ZSLA 1JZ7A 4NPLA 2H6CA 2YG0A 5F39A 5F1RA 3TEYA 1F5JA 4HONA 1UN1A 1Q56A 4B7KA 2D98A 2HBTA 1OLMA 2VMHA 1GZCA 4Y24A 4QB6A 2NYYA 1MR5A 3T08A 2JEMA 2GN7A 5FIXA 5L7OC 4I0WB 5FZ9A 4QQOA 3C7FA 2VE1A 4LE3A 5A6YA 3IAPA 3TRSB 3ZFFA 3OBRA 1RXFA 1VRH3 2Z4FA 4PBPA 3AMMA 5GKAC 3WDXA 4EZHA 2VQ0A 2D6MA 5KWRA 2AUYA 4RHV2 4A6SA 2YPJA 4AEKA 1COV1 1W6MB 3ZR6A 3HT1A 3N7LA 3IDCB 4XIKA 3RZKA 1I5ZA 4HSLA 3ZDVA 5LWBA 3N9MA 5EJ3A 4TSVA 5CADA 1DLCA 2W1WA 5HV4A 5C8WA 1UOGA 2D6LX 2ZZJA 4IEWA 2BWCA 1TQ5A 4NWVA 4CCEA 2DFCA 2VCMA 2ZMLA 1BEV3 1DP0A 5FZ7A 3H8OA 2VZPA 1W04A 1TME2 2DVFA 2O8QA 3CU7A 5ABJA 1URXA 4QX5A 1IKQA 1WW4A 3OSDA 3PURA 4LBLA 4YNIA 3T3YA 2O0OA 2ADEA 4JHZA 5EV7A 5HBAA 1HIXA 1VIWB 5JUVA 4QPGC 1SBEA 3WP4A 1ZBE2 4QPIB 1SPPB 2Y6FA 3CJIC 1IS5A 3KCXA 1FMD2 3OB8A 1KDKA 1UY2A 1QF3A 3ZM8A 1YO8A 4DNYA 2BU9A 1H8TA 3IWZA 3IBMA 1IQAA 1QDOA 2WFF1 4JQTA 3GHNA 1GBGA 1W9WA 2V09A 4QX3A 2C9KA 4A6OA 4OZXA 3ELNA 5FMCA 1NCQC 1KRIA 1RGSA 4GWJA 3F2ZA 3WQ0A 3B9CA 4HMZA 1YXWA 3ILNA 3M8LA 1C3HA 3MHZA 2B9UA 1HRI3 5KHJA 2VJXA 5F3CA 1WW6A 1TMF2 2ZEXA 2OA2A 1VBD3 2QZ2A 3NJZA 3KGZA 1N1VA 4OI2A 4B3NA 2HWF1 5FMBA 4RS5B 4YFWA 2XJUA 5JXIA 1ZZCA 2XVLA 3ME2A 4XJ9A 4BK5A 3POJA 3OPZA 4IV1A 3NV1A 1PGL1 2W92A 4YW5A 3GF6A 1YFUA 3S7IA 3VBUA 3OYWA 4JKMA 1SBDA 1GANA 2F17A 3WDUA 3TOJA 3N9PA 2JKBA 4BOWA 4JX0A 2VVFA 3MW2A 4PIXA 3ZX7A 3GBGA 2QCSB 2E53A 1V6NA 4CCDA 2MEV2 5FXWA 3WDTA 1NCRA 5T5JA 1REEA 1FPN3 3AL6A 1ENQA 1RUD1 4JTOA 3WG4A 1UO9A 1XPWA 5FRAA 3M2MA 4I3GA 1UX7A 3M1HA 1O8PA 1RMU3 2D40A 4Q4V3 1ULCA 4JGYA 1UY0A 4YVSB 3VBRB 1ULFA 3T2QA 3MICA 3VKMA 4X6RB 3O1PA 4RA0A 1K5JA 4BMEA 4CPBA 3D6EA 3AK0A 1RUC1 3DYOA 4HN1A 5BNPA 4AWDA 1JN2P 1IGOA 4SLIA 3Q8FA 3AFKA 4LBQD 4Y33A 2ZHMA 5A3PA 2WNUA 5IK5A 2R072 3CL1A 3IZOA 1UCXA 4FXKB 4RQPA 2ARBA 5FZOB 5LBFA 1AL22 2HH9A 5A7SA 3ZYHA 1OQDA 1W8WA 1ZYBA 2DVBA 1EPZA 2VNVA 5IT6A 3I2KA 2CAUA 3K46A 2BOJA 4ASKA 4JTNA 2BBAA 3U4SA 4JHTA 3WF0A 2H6BA 4J1WA 4XXPA 2G1MA 3FLTA 4QU2A 2VMIA 1XOYA 3UESA 5IVBA 4OYUA 2E32A 2GU9A 1R083 5FZ6A 4AGRA 5FUIA 4FSJA 2PELA 1PX4A 4GXLA 4QDRA 2Q8EA 2RJ2A 2X8KA 1GNHA 3PMSA 1O3SA 4ATFA 4QHBA 1S0CA 4W6XA 3POGA 3HBZA 3KCYA 4AI0A 3QBQA 4KH9A 4NHLA 5AC91 4I2OA 1YWKA 4BIFA 3VBOB 3VBFA 2YYOA 2ORXA 2VZOA 3BB6A 3PL0A 1UIKA 2J1UA 3SKVA 3MIGA 5EFUA 2QJVA 3N4MA 4XUPA 1YC61 1AX0A 4OUEA 1VBC2 3D5OA 3CIHA 4YSFA 4FOQA 3VV1A 3AKRA 3WDYA 2H0BA 5A32A 2RM21 3AYAA 4EN9B 2VQAA 3NNFA 4NJ4A 3G7DA 4HZFA 3TBDA 4D0QA 2TNFA 1NXD1 5EJZB 4WZFA 3J8F2 2ZGUA 2P17A 5I0SA 3ZOIA 1F4AA 2Q8OA 5JR7B 5JAXA 1OLRA 3DF0A 3U37A 1W0OA 4PLOA 1DIWA 2JD4A 1O59A 5FZ3A 2P37A 4RS5C 4PI2A 5T5LA 2Q4SA 4HKLA 4R4ZA 5FQ0B 1OURA 1ND3B 2ERFA 3DPRA 5J09A 5FYTA 3HN3A 1CESA 1CAWA 4P9IA 1GKBA 1LECA 4CCOA 1IPSA 1UYXA 4QX1A 3FLPA 5LBEA 4UOJA 4A7KA 4J25A 4CCNA 5LY2A 3VD4A 4Q26A 4QXKA 2VUDA 4R52A 4QQLA 3T4HB 1UYYA 3U07A 4P9WA 2PMWB 5CFDC 1G8WA 1IPJA 2Y26A 1R1A2 3AJZA 3GCXA 1QY4A 3UK9A 2J22A 2JE7A 3BKZA 1YQ2A 2WAAA 1JU4A 4XACA 5F3EA 4XMIA 5JMOA 1K42A 1ASJ2 2W47A 5T3NA 1TME1 2ZCWA 4R8HA 2W68A 2CGOA 4YVSC 3VBRC 4CU9A 1Q8VA 1ZRDA 4K3UA 4G3YC 1YQ5A 2IWGB 2ZX3A 4UW3A 1C28A 1ULEA 2VQUA 4PQ9A 5LZ6A 3TEWA 1W2AX 2E31A 5F8PA 4XW3A 1ZBE1 4Y22B 2PHXA 1BMV1 2EIGA 2VTFA 3I8TA 4Q4W1 3D3AA 1FMD1 3N7MA 2WT0A 2W46A 1RUJ1 2X09A 4FT8A 1HB4A 4ZU5A 4CCKA 4D69A 3E5XA 3R4UA 2RDNA 1QOSA 3NAPC 3WNMA 2D6KA 3M70A 2A71A 5FPUA 3LWCA 4Q0PA 3JBG2 4EYUA 4B4PA 2WN2A 3V0BA 4LBOA 3AMQA 2R32A 1JZ6A 4CEYA 4TWTA 3VBSB 5JSPA 1PVC3 2Y60A 5GLUA 2YZ4A 2XUEA 2R0HA 1RUE3 1JS9A 5FZLA 2JXAA 1TMF1 3RI8A 3LDBA 5FY8A 3T0BA 3S5QA 2AACA 4ZS3A 5HXVA 2JDYA 1LTEA 2AYHA 5BNOA 4PIZA 2MNGA 5KXCA 2OUJA 3WUDA 4LK6A 2VZQA 3TWIA 3D0JA 3IPVA 4PI0A 4CDWA 5JLVA 1WMXA 2BOIA 2K9ZA 2IXKA 4WVWA 3LZZA 2RS33 3GHMA 5DAWA 2IXCA 5FZBA 3U75A 3VBOC 5FO9B 5H9RA 2PLV3 3ZXGA 3ACHA 3P1IA 3KF5A 3BN6A 3E1F1 3WR0A 5E89A 2XGXA 1HV1A 5FPBA 3I97A 4YW7A 4Y1VA 3RPQA 5LY1A 1TNRA 2WS92 1VBB2 1S0GA 2MEV1 1BBT3 2J1TA 1FV3A 4LIUA 4NIHA 1OA4A 3V56A 3ZPOA 4L97A 5A7WA 4GZ9A 1YEWA 2YXSA 3MW4A 3LKJA 4V2WA 1PO13 3LDKA 4TYSA 1GP5A 4GQ7A 2XHNA 1SMVA 3MZHA 4MG2A 1QQP2 4S2HA 1W6PA 1SFYA 1QJU1 2P6CA 4F7ZA 1REFA 1V6OA 1QNYA 1PNFA 2B4KA 5A80A 4NHYA 1QMJA 3BI3A 2Q1ZB 3OGVA 5ERLA 1ND3C 1NT0A 4XAAA 1UY3A 5ANNA 1NLRA 1POV1 2XG3A 5FXXA 1SZBA 1PO22 3AFGA 2YMZA 3DKQA 4Q4X2 4F8AA 3WP6A 3RZLA 3ES1A 4UAPA 1I5PA 2FCUA 1XU2A 3C8XA 4E4HA 2OZJA 1H8TB 2R071 3SQOA 3WCSA 3PLQA 4MZUA 4BCUA 1AR93 3ROUA 3T4VA 1AL21 3J9SA 4KWUA 3MYXA 1ND2A 2W91A 3GXUA 5FUPA 3THCA 4AVVA 4W6YA 2OW4A 1NKGA 1GLHA 1CAVA 1GZ9A 2BGOA 4Q29A 3ILRA 3LIGA 2VD7A 4MOAA 3NKTA 5DG2A 5FBJA 1VJ2A 3VGIA 4CEWA 2WYFA 4YZ2A 3KT7A 2EAAA 1YIPA 3E5UA 4D6SA 2XQXA 4QD2A 1QDCA 2LS6A 2EALA 1HX6A 4CXYA 1V9U3 1ULPA 3EHKA 2DWRA 1A8DA 3W5MA 4XQWA 2DV9A 3WVJA 4K20A 2PHRA 3VBUB 1QWRA 3AMNA 3AZZA 3OYWB 2BBVA 5IUQA 2QDRA 4NHMA 2JB8A 3VDAA 4ZZ8A 1SFNA 1VBC1 5DUUA 1OPOA 3SEPA 1N1YA 4Y20A 5JZGA 4IEXA 3VBSC 1W6QB 4MXWA 4ZU4A 3AP5A 4XBNA 1NCRB 2TUNA 2WNVB 3EJKA 4OI4A 4XF9A 1VP6A 1RUH2 1YYNA 4WV8A 1KJRA 4HETA 5IW0A 2RHPA 5BUVA 2R0FA 3OD0A 2QBXA 3C7OA 1UNBA 5C9AB 3WG1A 3H7JA 1RUOA 3Q8BA 2DF7A 2HJIA 1H1IA 3E97A 1E5SA 4Q5OA 1UWWA 3N9NA 4JGYB 2YB7A 2Y6HA 5FY5A 1OF4A 4CDUA 5FBZA 1RL3A 3NNLA 2R042 2XB6C 3KV9A 3WW1A 4BDVB 1DU3D 3RMXA 2YU1A 3GNEA 1CPNA 3CJXA 1OI6A 3DV8A 4LLFA 3FUQA 5FYCA 1T6GC 3PVBB 4L0PA 3VZOA 1J84A 1RUI2 2A6VA 4IEVA 5B4XA 5IAXA 1UZWA 3IN9A 4XJUA 2VXJA 3KF3A 4BZ4A 3TN92 1O5LA 1VLNA 3NJVA 4INDA 4EN0A 1R1A1 2GSYA 4CU8A 1KJLA 1AR72 3U10A 1N3QA 1RUC3 4RQPB 2RS11 3H8UA 4GB33 5FY9A 4OQ8A 1J1LA 5DDJ3 1JBCA 4XFIA 1GR3A 1SQ4A 4MH0E 5EXOA 4AK3A 5JDBA 1ASJ1 3I7DA 1UPSA 5A1FA 2ATFA 1UU6A 2B46X 2AC1A 1SCSA 2UWCA 2NLRA 4IUGA 2DTYA 4K6BA 1H1AA 1NQJA 1DYOA 1ZBA2 5A7NA 3ENRA 5FPXA 1RINA 1OFNA 1UMZA 1NYWA 5H9SA 3RWKX 5SV8A 4GWMA 2P3YA 3MO4A 2Z79A 5FYVA 1QJY2 2HLEA 5C8CB 1GNYA 2KD7A 5FZHA 3BIEA 4AG4A 3OUIA 4IE4A 5I91A 2Q30A 2DBIA 2YV8A 3VBFB 3M3IA 4IQPA 4YVWA 3AYCA 3KGLA 4LKEA 5F2WA 1OF3A 4UYBA 1H8TC 2IXLA 1ACCA 3RZHA 1YIFA 3PTYA 4QXCA 4BE3A 2YBSA 4P5YA 3GBFA 4N90A 1OKQA 3P5BA 4HOOA 1V0AA 1GQHA 4BK4A 5ANQA 5BPXA 1B09A 2HWC1 2HWD2 3MFAA 5K0UA 3GZAA 1W05A 2NMNA 3FWEA 4EQVA 1LR5A 5FMOL 4UT5A 1VBE3 2HWB1 5GZFA 2E33A 4PLMA 3HEIA 1DZRA 1BCXA 4H7MA 4IERA 4LBNA 1EUUA 3WY6A 2V5DA 3C2UA 3ZXKA 4AVCA 4S2DA 3FFZA 5FPAA 1CAUA 2WZPP 4AFMA 1VRBA 2OVUA 4AEMA 4M3CE 3BTZA 3B69A 1A8MA 3OPTA 2EXJA 1COV2 2BVVA 3DPRB 3WX5A 4LBKA 1W3XA 2GMMA 2ZXQA 1S0IA 4FTEA 1MVQA 3VBUC 4XUQA 1RUF2 4LKFA 2VZSA 1OQ1A 3OBAA 2FDJA 1LKNA 4MYEA 1EAH2 1XU1A 1FNZA 1VBB1 2DUQA 2WS91 3WW4A 3ZFEB 3C7HA 2WR9A 1VBA3 2D44A 4GALA 1R1ZA 5GZDA 3AZYA 1SACA 1NCRC 4YWAA 2WNVC 2UYAA 1CN1A 2VCBA 1C1LA 4GJZA 4RHV3 1UZZA 3B02A 4XF0A 5C9AC 1Q43A 1SLLA 1JU3A 5CZKA 5LRRA 3W5NA 4JGYC 4RYDA 3UV9A 5JMCA 3HAGA 1CJDA 4CP2A 1HXS1 1Y9QA 5JXJA 2W3JA 5LRSA 4LTAA 1QXPA 2CU5A 1ONAA 4Y5Z0 3AKSA 2EICA 3JQWA 1F8VA 1JHJA 3VBHB 4AYUA 4A7ZA 3ZYPA 1MEC3 1PO21 1W2TA 2GZWA 1Y9MA 4Q4X1 4W50A 5DZGA 5EYYA 3OF1A 5L36A 4BQ4A 1NZIA 5CVRA 3SHRA 3FJSA 5GZEA 1IG0A 1UXZA 2SLIA 4QHZA 5JR2A 1U5IA 4IEZA 3RI9A 4BIOA 2Q8CA 4HVQA 1EV13 3V0BB 4RQPC 3D82A 4DUWA 5DQ0A 2R1BA 4QKNA 5FOJB 4CEYB 4ZKTB 4LITA 2VOWA 2VXRA 5CEHA 4MSVA 4URTA 3T2TA 1HN1A 3KHCA 4DXZA 2XUMA 1ST8A 4D7YA 3DXTA 4F83A 4UFHA 4XUOA 4LKSA 3PUAA 4QPWA 1DGWX 2CHHA 3BVCA 5FY0A 5J96B 2IXJA 1Y43B 4LOTA 4C1WA 5BNOB 5C3RA 2BNNA 2ZGLA 2WQ8A 4AAPA 5C8CC 4FPGA 5FXZA 4XHBA 4BQ2A 2QKDA 3PVNA 1GZTA 1HN0A 2XH6A 3LFMA 2HBUA 3OEAA 4GULA 1WD4A 4NE9A 3RFRA 1X82A 3VBFC 2WWUA 1DHKB 1AYM3 5T5OA 1UMIA 3O12A 1X7NA 4XPVA 1RUD2 1YUDA 4IDZA 2WSVA 3AM2A 2XJSA 4AGVA 3VZKA 4PIYA 4E8CA 5HPOA 1CWPA 3WV6A 1DGRA 3DGTA 3URFA 1JYIA 4NHXA 4N9IA 1W6NA 1RUH1 2OPWA 1UOFA 5A7WB 2WIIB 4GJYA 4H7LA 4CXWA 3ZMNA 3OEBA 1VPHA 3WHTA 4FO9A 1W2NA 2YBKA 3BOPA 2JDKA 4XMAA 1GQPA 1W6PB 2E7TA 5A6QA 2GAUA 3OGSA 3U14A 1U0AA 4NPMA 2R041 3ZSMA 1LCLA 1RB8G 2D3SA 5FOBB 3I3MA 3B94A 3DPRC 2ARXA 3AZVA 4N43A 1XRUA 2IVJA 5FXVA 3S5AA 4IE5A 2DVGA 1RUI1 2ET7A 3JD72 1Z78A 1MQTB 4Y26A 3JCIA 4LE4A 4QKDA 3TN91 2P3IA 3ZFEC 1WCUA 2D3PA 1MVEA 5A33A 4IEYA 5E8AA 1W8NA 1AR71 1KITA 3K51A 1DQ2A 1CX1A 4M4RA 4XETA 3NL1A 1ND2B 5IK8A 3RZZA 1ODNA 3M7AA 5FZ4A 2P34A 1G9BA 1VE0A 5FR3A 3CLPA 1CAVB 4RGGA 4FPFA 4COUA 1FOD2 5I8TA 3WCRA 1ZBA1 2IVIB 3N9OA 5AC92 3AZWA 1SDWA 1QNWA 2OQ7A 3N7JA 3ZKUA 4D7SA 4CP9B 1F9KA 2CSGA 2TBVA 1JODA 3LSEA 3MFCA 4M0NA 4C0HA 3VBHC 3MPBA 4H3WA 3VZJA 1QJY1 4XJZA 2J1AA 1JZ2A 4AVSA 1F35A 2BZDA 1XSQA 3UKNA 4DRVA 3EYPA 2VZ3A 4M3CA 2ZHLA 5K8SA 1TZOA 1GWKA 2YROA 4FQ4A 4HKOA 2ETEA 5CIRA 3ZDSA 1G6NA 2GP5A 5FP4A 3RDIA 4UF0A 5FLJA 2D5FA 3ZN6A 5FY1A 4FFHA 4KQ7A 4PDWA 1O5UA 2BERA 3FN9A 3TNQA 1TG7A 4AI9A 3CHXA 3E6BA 2HWD1 3IT8A 1CQ9A 4LBJA 4OCTA 1NQDA 2AH2A 4PT6A 2EVXA 1UMHA 2DCKA 3RYPA 2ENRA 3CF6E 1W0PA 2A5ZA 4AL9A 1VAKA 4HN0A 4ONUA 1CIWA 1GU3A 4Q0SA 1DYPA 4XJ8A 1RVF3 2QQWA 2YGMA 4CDUB 4IV3A 5BNOC 4M0HA 3I59B 5IATA 4BU2A 2JDMA 1HKDA 3N36A 3J8F3 4DO0A 3IMNA 2ZX0A 1Q5OA 2G9ZA 4UFJA 1PM4A 5F5QA 1OH3A 1OC1A 5FCCA 1HQLA 2UWAA 1PIV3 1RUF1 2MHFA 3J4UH 5C4WA 4H55A 4BHPA 4QDSA 2BTVC 1H30A 1EAH1 1K5MA 1V6KA 4FP2A 2BRTA 1ZA7A 3PTRB 4FPYA 4RL7A 2EF6A 2ZGKA 1A6CA 3KQ4B 3IAQA 4M3CF 4QXBA 3H8RA 1RUNA 5D1IA 1OQEA 3POYA 1C8M3 1HQWA 3IMMA 5JPMB 3AMPA 4KG8A 2DCJA 1J3PA 2QDNA 1L7QA 2PHFA 3WW2A 1UXXX 2AR6A 3HMYA 2RVAA 1H6XA 1I6XA 1X33A 2H0VA 1UU4A 4B4QA 1S4CA 4AI2A 1BMV2 1AF9A 5IWFA 3I2GA 1AL0G 4Q4W2 5BY5A 3HWJA 4E2QA 1BK1A 3ACLA 3RNSA 1U5XA 2QFEA 1RUJ2 4FPCA 3UYJA 1KXGA 3FHAA 3P3PA 1RXGA 2VMDA 2XBO1 4BJ0A 1AR62 3BCWA 4MGYE 4OMDA 3AXEA 1MQTC 3OG2A 4ATEA 2GNMA 3GALA 3OD4A 4AVAA 1NE4A 4CDXB 3BUCA 3SH5A 4BWOA 3T1LA 4N53A 1RUG1 4YVWB 1IHMA 2XQRA 4AQSA 3CNAA 1HB2A 2W9XA 3QD6A 5DAXA 3USUA 3X29B 1ND2C 5DG1A 3H0OA 2G9GA 1QH6A 2ZGNA 1A34A 4BLIA 4LJHA 3QACA 1UL9A 3WXPA 5EZWA 3JBG3 1L3JA 5A70A 1WCKA 4DMIA 3H1YA 2O14A 3SCFA 4D6RA 1UAIA 2WC2A 2W95A 2VVDA 4WVZA 2XLFA 1ZA4A 5FZ8A 5FMOS 4OZOA 4AI8A 3MPPG 2FBEA 3EQEA 3R6SA 4MGKE 5LEJA 1LHUA 2JDAA 4JDMA 3RZJA 5A3WA 1D0GA 3EO6A 3SH4A 1DQ4A 4LMFA 1ZZBA 5L9BA 2DU1A 4ISQA 1OSGA 5FZ1A 3WW3A 4NIDA 4Q4Y2 1S0FA 3MUY1 1PMHX 1CVNA 3HIFA 4FVVA 1NA1A 5GALA 3AC0A 5L9RA 3ZXLA 4YM3A 1QJZA 1OOPA 3FLRA 1FAYA 1UW8A 2WZ8A 1YLLA 4UFKA 4PHZA 5FYHA 4JC1A 4AOCA 1QJU2 1IG3A 2HWE3 1W9FA 1WCDJ 4XBQA 1PK6A 5ACA2 3OY8A 3SISA 1BVVA 3GDBA 4YZ4A 3IKWA 1J59A 4IGOA 2VUAA 5J3UA 4CDQA 4Q0QA 2VW1A 3LEIA 4I09A 2VMFA 2E7AA 3ECQA 4KNCA 1C5HA 2D97A 2KR2A 5FJHA 3ALQA 2VQTA 2A73B 4EN6B 1AR83 1Q8PA 1DG6A 2A70A 4JV4A 3CQOA 4KL1A 4JDOA 1QQP3 4UI9L 4XF3A 3MIBA 3JD71 1B35A 4PLNA 2D6NA 3VHPA 1R64A 2Y6LA 3AKPA 3QCWA 3HOBA 3IB3A 3NJYA 4E8DA 3KLSA 2R49A 3JUUA 3MIEA 1CONA 1W99A 4XTPA 1REDA 2KM2A 3M3EA 4RR3A 4Z2AA 3J7MA 1BLZA 1MACA 3A7QA 4X6QB 4BQYA 5CKNA 2QQOA 4ZY9A 3BTAA 1KGYA 1FOD1 4FP3A 3A0NA 1SHWB 4BPZA 2OQ6A 5KXDA 3AXDA 4QPIC 1PVXA 3WT3A 2R063 2WJSA 3BTXA 5L19A 4LBMA 1E5HA 4IE6A 5I0RA 5LEKA 4X8PA 1E5IA 1HRV2 1U5ZA 2RMU2 3EB7A 2RR13 1WGPA 3KV4A 3ZXFA 3E6DA 4TLGA 4YG3A 1APNA 3INAA 4CDXC 5C3SA 1W28A 1D4M3 3NJXA 4K1ZA 4YVWC 4AHYA 3S57A 4QM8A 2EIDA 4Y1XA 5DAPA 4AEDB 1YI9A 2VULA 3VKFC 2LUWA 5IVYA 3UJOA 1HJFA 3TEXA 5JPNB 3R05A 3SITA 2QVSB 4P9GA 5CG9A 2VMEA 4NOTA 1XNAA 3I3EA 3ZFGA 4DOUA 5C71A 1JYXA 3ITQA 3I2DA 4NRPA 5IK4A 1W6NB 2GNBA 1OA3A 3JB8A 1H9WA 3WLUA 1UZYA 1AYN1 2BUKA 5BNNA 4R4XA 2ZGQA 1GFF2 1OVPA 2BGCA 2MPFA 2OIIA 1M06G 1N47A 3HNYM 1W3VA 4BH9A 5JOYA 2E7QA 2F4PA 1VRH2 4K9SA 4IEPA 4LUMA 5APAA 2QNKA 4LNVA 3ST7A 4EROA 5T54A 1OUXA 4BYYA 3KM5A 1JHNA 2WA4A 4E9KA 1W39A 4NIIA 1XNKA 1STMA 1ZVFA 5LK7B 3O1OA 4N43B 2EIEA 4O9EA 5FY4A 4IGPA 5I8SA 3ZVXA 3ZXAC 2YHJA 1HB3A 4O9GA 1GMMA 1JYNA 5FZAA 3B3QE 2BJSA 2OXBA 2RS12 2W2IA 3NV2A 3MIFA 5A7OA 1W9SA 3U78A 4C0BA 4CU6A 3HN1A 3LE0A 5A33B 2XJVA 4JGZB 4O7XA 3DYMA 3TNPB 3AP7A 1GOGA 2W08A 2ZMNA 5LK5A 1LOGA 3A4UA 4LHSA 1H2LA 2ZMKA 4IGQA 4CUCA 1T2XA 4OMCA 1S55A 3OUJA 4BQ5A 3I49A 4RGKA 5FZGA 2PHDA 3NQHA 2R6QA 2XJQA 3ZYGA 4XE9A 2BNOA 1AR73 1GZWA 1XB9A 1D2SA 3BODA 2XVGA 5KHHA 1OUSA 2WZR1 1W8UA 4C8DA 1I3HA 1O91A 4C90A 2OKXA 2IC1A 3T2OA 1AHSA 2PAKA 4AF9A 4AE2A 1S2BA 3ZYIB 1AR61 3SCHA 3PU3A 1Z7S1 2Y6GA 5FYUA 1UOBA 3ZXJA 5JIAA 5T52A 4DY3A 2E63A 1DGWA 3ORJA 1OH4A 5LASA 3KVBA 2HWC2 2VCAA 3JU9A 1S0DA 2PXJA 4XILA 1OT5A 1LOCA 2WO2A 4UF0B 2XMLA 4PDWB 1LEMA 1CPMA 2GN3A 1WZXA 1HRI2 2W1QA 3KV6A 1R093 3T0AA 2B5HA 1S0JA 2HWB2 2QQKA 1VBD2 2WQ4A 2C4XA 2PQSA 2FMYA 3KWVA 3O5SA 4QU1A 2W94A 4Y1YA 1Y9GA 2J7MA 2RS53 5A6XA 2P5BA 4MHRA 4XEZA 3AX4A 4QGLA 4ISRA 5C5TA 5LA0A 2OPKA 3I2OA 3ZFFB 2WNOA 3JZVA 4UFMA 1GOFA 1NG0A 1WW7A 2F4LA 3OGRA 4Q8LA 4E2GA 2VZTA 4IV3B 3AKTA 3MLLA 1KD7A 2ZGPA 1G9AA 1FV2A 5L7OA 3LA2A 2GC2A 4D8MA 1UX6A 2UURA 2WT1A 4IEQA 5C4WB 5LBBA 1U12A 4AEDC 1QJFA 1FPN2 1K5MB 2YU2A 1US3A 2RJKA 4Q4Y1 4ZONA 2WYSA 3WNKA 3DN7A 2HEYF 4LA2A 3ZKYA 1QHDA 4L9BA 1COV3 5EYXA 5F3IA 4D94A 2LRPA 4GKYA 4YM0A 1MS3A 2V4AA 4XAEA 3WQ7A 1W03A 5F37A 1RMU2 3BYWA 4Q4V2 4D3WA 3LEMA 2GC3A 4GWIA 2VW0A 2CL2A 4GAZA 5JVVA 5ACA1 3A23A 5ABJB 1HXS2 1OVSA 5J36A 3LSDA 1G9CA 1RHI1 2XLGA 3D4KA 1W06A 3DCQA 2GMPA 1QEXA 3Q9OA 4XXAA 3C7EA 2CGPA 2A3WA 1RJ8A 1CGPA 3WF1A 4DUXA 1WMDA 4HL0A 4C1XA 1KDMA 1IOAA 1GOHA 2VTXA 2QQVA 3W58A 1ZRIA 3KB5A 1VR3A 1W6OA 4QPGA 4XCBA 3POBA 2LM3A 2VZ1A 4HKWA 1QJX1 3CJIA 4A4AA 1J83A 2YGLA 2HEVF 4N53B 4BXSV 5IVVA 1WBFA 4JGZC 2HYXA 4L99A 3USUB 3SCGA 3I2FA 2WFF3 3K4AA 5C33A 5EQUA 1V6JA 4IEOA 1R082 3AL5A 5EP9A 3VL9A 4WVMA 1NCQA 2HYKA 2A6WA 3WHUA 4DEVA 1OD5A 3ZYRA 3OPWA 5A3UA 5B4NA 1XNCA 2VECA 3F95A 3MW3A 4XCAA 4YM2A 2FMDA 5D8AA 1F4HA 4Q1RA 1RC6A 5GJ6A 4IV1B 4Z8BA 4Y4YA 4ZHNA 4Y1ZA 1BK0A 3HPNA 1HRV1 5GZGA 5IHRA 3HQUA 2VMGA 2RMU1 3WUCA 2HWF3 4IETA 4FFGA 4GMP1 4MVTA 1OKOA 3N7KA 2I2SA 3SKJE 3WD5A 1UZVA 4CVUA 3OTFA 4OQ9A 2A6YA 4YYOA 4KI5M 4XZUG 4CUGA 4QQPA 2NP0A 3ZXEA 3ABZA 2VOXA 4IXLA 1C8NA 4Q27A 3ZLIA 5C7GA 5J37A 1WW5A 4PDWC 2HEWF 4HBNA 1NA1B 1ALYA 2ZHKA 4AFAA 2K2SA 1O7FA 4K1YA 2QQJA 4MGIE 1FYUA 4CE8A 5FTTC 3ES4A 4XDOA 1RUD3 5FUNA 1UYZA 4YW4A 1QOTA 1LEDA 2ZEYA 4TXWA 3HQRA 4OHWA 3ZFFC 4KGGA 4ZS2A 3RGBA 1VRH1 4CDQB 4DINB 2YFZA 1MS1A 5BNPB 1MZFA 2KA3A 1XC6A 1LHVA 4IV3C 5IYYA 2NMOA 2FZ1A 4Y1UA 3N3HA 2WNUB 1ULGA 2XR4A 3CBNA 2WLPA 2X53S 2RG4A 4IL7A 2XOMA 1HW5A 4HVRA 4OLLA 5I0UA 2GC1A 5C4WC 2YUEA 1ZM1A 2UY8A 3WINE 1B35B 4E2SA 2I45A 2VOTA 3V0AB 1K5MC 1F2NA 3MV01 5FKCA 4YW2A 1S1AA 4EN8B 4CRQA 4UFIA 3RG0A 4AFCA 1POV0 1ULOA 4COWA 3WNNA 4JVAA 1BEV1 4XQDA 1DQ6A 4RR3B 4ET7A 1FX5A 5FPLA 4PCRA 4A2UA 4BMBA 1YQ6A 2BFUL 5ABJC 5I8YA 5JSRA 1IKPA 1BHGA 5FLHA 5HI0A 2P4EA 2XKOA 3S7EA 3UKTA 1NZCA 1ODMA 5CKMA 3LF7A 4YZ5A 1AX1A 4QDQA 5CFCA 1QH7A 3VD5A 3O1VA 2YPDA 4MHUA 2P6HA 2IZWA 3RMYA 5K7PA 1HV0A 3H7YA 5E1RA 4AW7A 4XZPA 2GC0A 2LROA 2VBPA 3T2PA 1AVBA 5CNAA 3ACFA 4QB1A 4A41A 4A42A 3PUQA 3UJQA 2K46A 2VPVA 4Z2WA 1SPPA 4QX2A 3GCWA 3CDZB 5AC93 5IJRA 2BNMA 1OA2A 2JX9A 3AKQA 4QGNA 3T1MA 3V0AA 4FQZA 4N53C 2VUCA 5A32B 3B5LB 3L2HA 2V5YA 2BP6A 1RUE2 2Z69A 1RTVA 3D0SA 5LATA 3WNPA 2PN5A 1HRI1 3NVCA 5JWPA 5LW9A 3ETQA 4KU7A 2GNDA 1VBD1 3FHIB 2JD9A 3ZFGB 1XE7A 5H9PA 2DDUA 3CEWA 5F5CA 3VN4A 5IVFA 2R1DA 3ATGA 4RFRB 4ZXKA 3B9IA 1C4RA 3DL3A 3AB0A 2RM23 4R9DA 1V00A 4D7TA 5BNNB 1CX4A 2EA7A 2FD8A 2P3KA 1SCRA 3K77A 4GH4A 4IV1C 4Y3OA 2ZX2A 3VB9A 2RS32 4E27A 1VB2A 1CAWB 3FUOA 3HBKA 2PLV2 4TN7A 1NLQA 1V6IA 1BQPA 3W20A 2B45X 5A7QA 5GZCA 3A22A 2QQMA 4YW6A 4FTBA 2DTWA 3NW4A 5K4LA 4LO6B 4YLZA 2J1SA 1QIQA 1BBT2 2JDZA 3SNMA 2W39A 2V4VA 2E9QA 1FPN1 3U0ZA 2ZHNA 4RSUA 2A6ZA 2XKPA 5FO8B 4QXHA 4D6QA 5BV6A 3E5QA 2JWPA 1PO12 4UW4A 1XYOA 1YHFA 5FYZA 3KHBA 2ZOEB 1RMU1 2D7FA 4Q2FA 4Q0VA 4Q4V1 4EWDA 3J7LA 3T09A 2VU9A 5CFDA 4XDPA 3RYKA 3T30A 1SG3A 4E4SA 2QQPA 4ITCA 3CMGA 4YW1A 3VD7A 3ON7A 4KG0A 1SLCA 1EUTA 1VMJA 2BWAA 5KC5A 2VG9A 3QH6A 1QXJA 3AZXA 2QZ3A 3H1MA 4BISA 4J1XA 3WQ1A 2K0GA 4CDQC 2XBO2 5BNPC 1TME3 4Q0UA 2E26A 1GZWB 3DEMA 1J3RA 1DDLA 3Q8CA 4YFZA 2XPJA 4YVSA 4DS0A 3VHNA 1XQNA 2WNUC 3BU7A 3IM0A 1Z0HA 3LIHA 3PUIA 1MS5A 1RUG2 3APBA 4N8MA 4UBHA 5CAZA 1W8HA 1JOJA 1UPIA 4LORA 2VM9A 1ZBE3 1POQA 1B35C 4BLJA 3FHQA 3FE5A 4PQQA 4Q4W3 1MZEA 1ENXA 1FMD3 5F6KA 4FPOB 1LU1A 1WMEA 2PTMA 1QOOA 1RUJ3 2XJPA 5FJKA 2VAUA 4DPNA 3NAPA 5C3PA 1MS8A 3SMHA 4RR3C 4V2VA 1GQGA 3MBWA 1R081 1JMUB 2X10A 5FZOA 4ORFA 2Y8KA 1PX3A 4C91A 3OBTA 4I02A 1CZTA 3NKGA 1Y3TA 5HV0A 1JYCA 2Z42A 4ZZ5A 1UY1A 2DUPA 3IPVB 1BZWA 4P00B 1NY71 4CDWB 5KXEA 1TMF3 1KFXL 4B4RA 1UY4A 4LUKA 3EMRA 5D2AA 2ZABA 3GM8A 1YRZA 1Y4WA 4MGQA 2EXHA 3O0XA 2HKXA 3LOIA 1SLAA 1H2MA 4XABA 5JOZA 2PAEA 3Q8AA 1TEIA 2DVAA 2VW2A 4YPJA 2X5IA 2N7GA 1TVGA 2ZX1A 3PJQA 4LO5B 5FYMA 4QKBA 1YI7A 1OBNA 5FAXA 1O3TA 1YJLA 4J6GA 1ENRA 4Z1VA 3MEPA 4HPKA 2YC2A 3GGLA 3M3QA 3C7GA 1L7RA 3ZFGC 3HVDA 2MEV3 1X8EA 1S0EA 4S2GA 2JIJA 1GWMA 5BNNC 4CP1A 2C9AA 2VOKA 1XNTA 1A3KA 1PHMA 3ETPA 1UYPA 3R0RA 5AVPA 1QKQA 4K8RB 4QKFA 4FTSA 1WLCA 1QJU3 3NNMA 5KHIA 5FQ0A 1AZDA 2Y34A 3UGGA 2PHUA 1FI2A 3ZO0B 1JYVA 4NO4A 2EXKA 1JUIA 1O4ZA 1ND3A 2W5FA 3DUIA 2ZS6B 2QQUA 5FLIA 1N1SA 1W6OB 1JOBA 4SBVA 4ES8A 1POV3 4DB5A 4TTGA 2JECA 4GB32 4NRMA 3ACGA 3GZUC 1LODA 1YFXA 3MDPA 3WF3A 2D43A 2VNOA 3UT0A 3O1SA 3WDWA 2R073 2PYTA 3I54A 5CISA 2WLQA 4CEWB 5SV5A 4LR4A 3AP4A 1AL23 5DUWA 1NXMA 5I0TA 4MLOA 3HNBM 3OGGA 3D8CA 4WVMB 2W1UA 1W9TA 4XBLA 1JI6A 1NCQB 2G19A 3WF4A 1GSLA 2ZKLA 1N3OA 2UWBA 4YG6A 1IZ3A 3FBYA 5D8AB 3RS6A 1LHWA 4KBZA 2C24A 2OUHA 3LGRA 4NPRA 5EWSA 3POFA 3K4ZA 4DIQA 3I4IA 4KBBA 5EHDA 3J26N 2D3RA 4LO8A 5E6HA 2JENA 2VO5A 5FMDA 2PQQA 5ISLA 2CY6A 3ZXDA 4Y20B 2YC4A 1IS6A 4CEYC 5JZGB 1PVC1 1LOBA 1X36A 4MXWB 2I74A 1QU0A 1V6LA 3AP9A 2WZEA 4CXXA 1RUE1 2CTVA 3WOGA 5L73A 5AFBA 1AYN2 1VBC3 2A3XA 3M3OA 2AEYA 3NWKA 2X05A 4AI1A 3S6PA 1F5FA 4TZDA 4XTMA 5HCAA 1CAXA 1WLTA 4XF4A 1LGCA 1O4TA 1VAMA 3PHMA 4ZPIA 3ACIA 4TLFA 2PHWA 5AVAA 5FZCA 4QHOA 3KMHA 4WM8A 1JZ4A 4Z82A 4CDWC 4AZZA 1RITA 3O14A 2RS31 4JCKA 1DQ1A 4AEJA 1WCSA 3SC7X 1PZ9A 2PLV1 4Q1PA 3BIWE 4FOWA
chains in the Genus database with same CATH topology
2WWSA 4HLTA 4OULA 2GH2A 1BBT1 1MS9A 1VBA2 1UIJA 4FAGA 4XHXA 3W9AA 1PZ7A 1PO11 4R9BA 4Z07A 5DXDA 1D4VB 2KXLA 4FBFA 2E6VA 2ZBJA 1R1A3 3H3ZA 2TEPA 1SLIA 3A0KA 2RS13 4YGDA 2XWJB 2WZR2 1GYKA 2X29A 3USSA 1ASJ3 2BFUS 1GICA 5CFCB 2CWSA 1MEC2 2A75A 2UY9A 3LA7A 1Z7S2 3VL8A 4YGEA 3ZSJA 4XF1A 1EY2A 4WM7A 4N7IA 5JSOA 4AHWA 1LULA 4AQTA 1SLBA 1AR91 3B01A 3WNXA 4FXGB 1YFWA 4AHZA 2FZ2A 1EV12 2G4IA 2BPA2 3V65A 5DZFA 1VAVA 5K0UB 1DGRN 4CEWC 2A3YA 2NZ9A 3GBWA 1S2KA 3EXUA 4K40A 2JJ6A 4JAAA 3O0VA 4YGBA 2HWC3 5HCFA 2ZAHA 1CAUB 1V9U1 3IDEA 4PJYA 5FPZA 4KWLA 2QE3A 1J58A 1O4YA 5D8AC 1YFYA 2CYFA 2UU8A 4GH4B 1JW6A 2HWB3 4LA3A 1WMFA 1QXRA 2ZGRA 4HK9A 1AYM2 2B39A 3HQXA 3EBRA 4XIOA 1G9FA 4AVTA 5JZGC 3VKLA 1DLLA 1TE1B 4G4FA 4B8EA 4FPHA 1RHI2 4YM1A 2WS93 1VBB3 4NWWA 5J48A 1W6QA 1YJKA 3QOPA 5CFDB 2WNVA 4CDUC 1N3PA 2DCTA 4FAHA 3IDBB 4YGCA 2W52A 5C6CA 1J1TA 1DBNA 1WLWA 2XVKA 5C9AA 1AXYA 4K7JA 1BVP1 4QM9A 1AJKA 3LAGA 1BJQA 1HXS3 2CV6A 1QJX2 1D0HA 2C5DA 4XFBA 5BYNA 4QQHA 4NVPA 2CNAA 2ZX4A 2GNTA 1JUHA 4RGAA 4GB31 1PO23 1DQ0A 3MF6A 4Q4X3 5DDJ1 4YARA 4AXOA 4P14A 2ZGOA 4P9LA 4WBBA 1UKGA 2BW8A 3VDDA 1RJ7A 3M4FA 3NAPB 2DYCA 2VY0A 4COZA 4P9XA 1QGLA 5J98B 1ZX5A 3U4XA 2W0XA 3H9AA 2IXIA 2Q1MA 3VZMA 5A3LA 4JRLA 1XYPA 3VZLA 3MGUA 4IEUA 4E4ZA 5CFCC 3THTA 4N7UA 1F31A 4HSJA 2CGNA 2VNRA 2JG8A 5I93A 1I9RA 2ZTNA 3HD8B 5C8CA 1KS5A 3LCPA 4LBQA 1IS4A 5FDBA 2C0ZA 2XWBB 1VALA 5TSWA 1EYBA 4JQRA 5GLWA 1DFQA 3RJRA 2X5IB 2WA3A 2GMEA 5K0UC 1ZZ6A 2NN8A 2NPIA 1DZQA 4K21A 1SLTA 1VBE1 2ZACA 1V6MA 4HPKB 5DUXA 2Y38A 5KHGA 4LT5A 1X8MA 2CWMA 1RUH3 1RVF2 2PFWA 5KC6A 3ZIWA 3ZSKA 1OHFA 2DURA 4GH4C 3AMHA 2AREA 1H9PA 3B7MA 1PIV2 4CZSA 4W65A 2A7AA 2I07B 2VGDA 2PAMA 2RE9A 1KFUL 2R043 2YC0A 1VBA1 2ZPXA 3HR9A 1DF0A 5T55A 1LGNA 4X8NA 1BEV2 3WG2A 4V1PA 1C8M2 1YCIA 1RUI3 4RHV1 1WBLA 4HT1T 1IS3A 4S2FA 3TN93 4LO7A 1DZTA 4LULA 3ZFEA 1LOFA 4P5HA 1UKRA 2GH8A 5T5PA 3KCCA 1A78A 3WP3A 4AGGA 5KHKA 4XJWA 3MLKA 1CD3G 3ILFA 2ZGMA 1MEC1 2AENA 3AJYA 1ZRRA 3ZYJB 3ZMOA 2O8OA 4DZGA 1ZBA3 2WQZC 3FC0A 2Q0AA 4M3CB 4XFAA 4AQ2A 4R9AA 1Q8OA 3TYJA 4XFHA 1G7YA 3VBHA 3ZN6B 1Q8SA 1EV11 1QJY3 3BALA 1SEFA 4DY5A 3ZN4A 2JG9A 4FOVA 1MZ5A 3S30A 3VKNA 1OLQA 3NV4A 1AX2A 4L92A 3VZNA 4JDNA 1IPKA 1H1MA 4M01A 4MUVA 2BEOA 2OYZA 2LALA 3PMEA 5KBFA 3BOWA 1CAXB 1EP0A 3UL2A 1LHNA 4FPJA 4R9CA 2HWD3 4NHKA 4JRAA 2XHKA 4U36A 2WNEA 4YZ3A 4WM8B 1S0BA 2FQPA 1UD1A 1W2UA 2ZZQA 1CJPA 3PJYA 4XOGA 2E51A 3POSA 1LHOA 4YZ1A 4WZCA 5BNQA 1BYHA 1AYM1 2NQYA 1H4HA 4ES9A 4I3PA 1AXZA 5E88A 5JI9A 3NV3A 5JCTA 2IFRA 4P9JA 2X5IC 2XJRA 1ZRFA 1FNYA 1RUF3 2ZA9A 1EAH3 3R4SA 2HWE2 4K8FA 2BQPA 1C5IA 3R4DB 5GLVA 3WP5A 3W59A 1AUYA 1FT9A 4FPLA 4LLOA 1CR7A 1OPMA 2UYBA 2PHLA 3HT2A 1AR82 4BA6A 1D2QA 2GALA 4N43C 4QQ2A 5E16A 3RSJA 1MZ6A 2PHTA 3UKVA 4WM7B 3RYRA 1UF2C 4NR1A 2B8MA 2B42B 1ULDA 2XBO3 1H2KA 3QLQA 1RIRA 5F9TA 2NM1A 1BKZA 1MQTA 1NOVA 4L2NA 2Y0OA 5K9YA 1RUG3 3L2YA 4OFGA 2BVBA 4QMAA 1ENSA 4AVBA 4HVOA 1HQNA 2DU0A 1PGSA 1C1FA 1NY72 1VB4A 2DCZA 2AZ5A 2IXHA 2R062 3JB4C 4GIQA 4MV2A 4ASLA 1EPWA 4L8QA 4DFSA 1ZREA 2B7YA 2RR12 3M3CA 3WDVA 4YW3A 4EJRA 1XYNA 3LOBA 1D4M2 3SXWA 1OFSA 1PZ8A 1XE8A 2ILMA 4ZU7A 4FPKA 2FHRA 3AYDA 3MI8A 2YDEA 3E6CC 3OCPA 4XFGA 1GNZA 5FO7B 4OHXA 1OOPB 1YNAA 1PNGA 1Q3EA 2XL7A 4NN0A 4XDQA 1LESA 2VVEA 1XNBA 1PK6B 4LHNA 3OY8B 4UW5A 4GKXA 3H3UA 3FBMA 3ZPYA 3OGJA 1RVF1 1G9DA 5IK7A 2O1QA 1LGBA 1N1TA 4WM8C 3J8F1 4OHZA 1OMIA 2R30A 2CAVA 4UXAA 4AQ6A 4BQ1A 3FMGA 4Q8KA 1FXZA 5T50A 4EV0A 1PIV1 4L11A 4W6WA 4XQ4A 3G6JB 4OHVA 1LB2A 1H4GA 1ZZ8A 2JE9A 1WD3A 2EAKA 3I59A 4GWNA 3LB9A 4B7EA 2Q5TA 4U2AA 1W6MA 4OUMA 5FREA 4PBOA 2D6OX 4LHKA 1C8M1 3ZIXA 1UU5A 3JD73 1PGW2 1NE6A 3SH3A 3VDDB 2BYVE 2ZAAA 1XXNA 1HLCA 3ZN5A 2QUOA 5J7MA 4CTEA 2VNGA 1PMIA 5DZEA 1DYKA 1FOD3 2D6PA 4EN7B 4QPIA 3RQ0A 3VHOA 4META 3LA3A 1DGLA 1PVC2 4WM7C 1O3QA 1LRHA 1LOEA 1WLDA 3C3VA 2JG8B 3S0MA 3KS7A 2VUJA 3FX3A 4XJAA 4LBQB 2Z2SB 1ZZ7A 4CDXA 1R092 2SBAA 3O0WA 5A3MA 2Y0IA 4G9SB 4GMP0 2V73A 4KU8A 1C57A 2RS52 3MLJA 3JBG1 2RJLA 4M00A 2Z5WA 4P9YA 2ES3A 4RD7A 5H9QA 4EWEA 1X50A 5CU1A 3KSCA 3NSTA 1I1EA 1GV9A 4RS5A 5GLTA 4N9HA 1AYN3 4LEJA 1O3RA 5KXBA 4WVVA 5CG8A 1LJ7A 1LU2A 1V70A 3SLIA 3RWNA 1H8VA 4QGMA 2ET1A 1TNFA 1NA1C 2R16A 4HANA 4B29A 4IESA 1OOPC 1AJOA 2JICA 3IIAA 4QT6A 3WZ1A 3TB0A 2XLAA 2WFPA 3DKWA 4I0BA 3H1WA 3U11A 2HWE1 1PK6C 3K48A 2WINB 2WKKA 1MS0A 5GLZA 4QPYA 4H14A 4HFSA 5AFEA 1DQ5A 5CA6A 4AHXA 4MXVA 4XFCA 4KWKA 2P3JA 5FFOC 5JI7A 3L9JT 3VBRA 1AR81 1JXNA 4I0AA 5DUVA 1QQP1 5JIUA 3CO2A 4XFFA 4AFBA 1WA4A 1AR92 2ZJCA 5CB7A 3PVEA 4FPEA 1XNDA 5F6LB 2WZR3 5JOWA 2ZKNA 1BXHA 1AR63 5CBLA 2WFF2 2JG9B 1G86A 1Z7S3 4AI3A 3VLBB 2ZGTA 3B00A 3VDDC 1V9U2 1M4WA 4I01A 3ZSEA 4MX3A 2R061 2F6BA 3GZTB 3MF9A 3RJ2X 2OZ6A 3VHRA 2DFBA 4EWAA 2HWF2 3VKOA 2RR11 3H50A 4BM8A 4A7YA 2WL1A 1KS4A 5L7OB 1ZNPA 2AGSA 4COVA 1E57A 1D4M1 3VBOA 3QH7A 3THPA 4YRDA 3V64A 1PGL2 2WT2A 3MIHA 2XJTA 4YG0A 2JG8C 2LTNA 2DVDA 1Q8QA 3P3NA 4Z92B 4ASMB 1JH5A 4AEDA 4HK8A 3BPZA 1Y7BA 4Q4Y3 4DRRA 2XL9A 2P2KA 5GM0A 4DQAA 5B2GB 4LO4B 4UW6A 1AXKA 4PF5A 4AFDA 3TAYA 2A6XA 5ACA3 1H2NA 1RHI3 3NO8A 4OI0A 2YY1A 3POWA 3PVOA 4OI1A 4CP0A 1HDKA 4QPGB 2DCYA 4RFT0 2G9FA 1J3QA 1RUC2 3CJIB 3KT1A 5DDJ2 2WSUA 1ZRCA 1JTZX 3FZ3A 4FOYA 3O7OA 2D93A 3B93A 4KGQA 1MS4A 1PGW1 4FCAA 5HCBA 3MIDA 3KZ4C 4OUSA 1U5YA 5JOXA 4XYXA 4I30A 3RRDA 1QJX3 1NLSA 4MGZE 3GYDA 1LOFC 4COYA 2IFWA 4JGZA 3FFQA 4F3JA 2VOVA 3ASIA 3PNAA 4UBGA 3JQXA 3VUOA 1LENA 4CYDA 1LOAA 3KD4A 2EXIA 1KQRA 4Y22A 4OVEA 2GDFA 2VH9A 2PA7A 3OJBA 1PM7A 4E4DX 3AP6A 4GA9A 1FATA 2C1FA 1WUVA 1HRV3 3KT4A 2RMU3 1ZZ9A 1H0BA 4GMP3 1VBE2 3WG3A 4OHYA 1R091 5BXXA 2JG9C 3VBSA 2RS51 4A3XA 2ZGSA 3AYEA 2D5HA 4LHLA 1SBFA 2DUOA 2RM22 3KQRA 3N35A 4KWJA 3ZSLA 5F1RA 2H6CA 1F5JA 1UN1A 1Q56A 4B7KA 2D98A 2VMHA 1GZCA 4Y24A 2NYYA 1MR5A 2JEMA 2GN7A 5L7OC 4I0WB 4QQOA 4LE3A 3TRSB 3ZFFA 3OBRA 1VRH3 4PBPA 3AMMA 5GKAC 3WDXA 2VQ0A 2D6MA 5KWRA 2AUYA 4RHV2 2YPJA 4AEKA 1COV1 1W6MB 3HT1A 3N7LA 3IDCB 4XIKA 1I5ZA 4HSLA 5CADA 5EJ3A 4TSVA 5C8WA 4IEWA 2D6LX 2ZZJA 2BWCA 1TQ5A 4NWVA 2DFCA 2ZMLA 1BEV3 2O8QA 1TME2 2DVFA 3CU7A 5ABJA 1URXA 4QX5A 1IKQA 1WW4A 4LBLA 4YNIA 2O0OA 5EV7A 5HBAA 1HIXA 1VIWB 4QPGC 1SBEA 3WP4A 1ZBE2 4QPIB 3CJIC 1IS5A 3KCXA 1FMD2 1KDKA 1QF3A 1YO8A 4DNYA 1H8TA 3IWZA 3IBMA 1IQAA 1QDOA 2WFF1 3GHNA 1GBGA 2V09A 4OZXA 3ELNA 1NCQC 1KRIA 1RGSA 3WQ0A 3B9CA 4HMZA 1YXWA 3ILNA 3M8LA 1C3HA 2B9UA 1HRI3 5KHJA 1WW6A 1TMF2 2OA2A 1VBD3 2QZ2A 3NJZA 3KGZA 1N1VA 4OI2A 4B3NA 2HWF1 4RS5B 4YFWA 2XJUA 1ZZCA 2XVLA 3ME2A 4XJ9A 3OPZA 4IV1A 3NV1A 1PGL1 4YW5A 3GF6A 1YFUA 3S7IA 3VBUA 3OYWA 1SBDA 1GANA 3WDUA 3TOJA 2JKBA 4BOWA 2VVFA 3MW2A 4PIXA 3ZX7A 3GBGA 2QCSB 2E53A 1V6NA 2MEV2 3WDTA 1NCRA 5T5JA 1REEA 1FPN3 1ENQA 1RUD1 4JTOA 3WG4A 5FRAA 3M2MA 4I3GA 3M1HA 1RMU3 2D40A 4Q4V3 1ULCA 4JGYA 4YVSB 3VBRB 1ULFA 3MICA 3VKMA 4X6RB 4RA0A 4BMEA 3D6EA 3AK0A 1RUC1 4HN1A 5BNPA 4AWDA 1JN2P 1IGOA 4SLIA 3AFKA 4LBQD 2ZHMA 2WNUA 5IK5A 2R072 3CL1A 1UCXA 4FXKB 4RQPA 2ARBA 3V0AA 1AL22 1OQDA 1ZYBA 2DVBA 1EPZA 5IT6A 2CAUA 4JTNA 2H6BA 4J1WA 4XXPA 3FLTA 4QU2A 2VMIA 2GU9A 1R083 4AGRA 4FSJA 2PELA 4GXLA 2X8KA 1GNHA 3PMSA 1O3SA 4ATFA 4QHBA 1S0CA 4W6XA 3HBZA 3KCYA 4AI0A 3QBQA 4KH9A 4NHLA 5AC91 4I2OA 1YWKA 4BIFA 3VBOB 3VBFA 2YYOA 3BB6A 1UIKA 3MIGA 5EFUA 2QJVA 3N4MA 1AX0A 1VBC2 3D5OA 4YSFA 4FOQA 3VV1A 3AKRA 3WDYA 2H0BA 5A32A 2RM21 3AYAA 4EN9B 2VQAA 3TBDA 3G7DA 4HZFA 2TNFA 1NXD1 4WZFA 3J8F2 2ZGUA 2P17A 5I0SA 2Q8OA 5JR7B 5JAXA 1OLRA 3DF0A 1W0OA 4PLOA 1DIWA 2JD4A 2P37A 4RS5C 5T5LA 2Q4SA 4HKLA 4R4ZA 5FQ0B 1ND3B 2ERFA 3DPRA 5J09A 1CESA 1CAWA 4P9IA 1GKBA 1LECA 3FLPA 4A7KA 4Q26A 4QXKA 4R52A 4QQLA 3U07A 4P9WA 5CFDC 1G8WA 1IPJA 2Y26A 1R1A2 3AJZA 1QY4A 3UK9A 2JE7A 4XMIA 1ASJ2 5T3NA 1TME1 2ZCWA 4R8HA 2W68A 2CGOA 4YVSC 3VBRC 1ZRDA 1Q8VA 4K3UA 4G3YC 2ZX3A 2IWGB 4UW3A 1C28A 1ULEA 4PQ9A 4XW3A 1ZBE1 4Y22B 2PHXA 1BMV1 2EIGA 3I8TA 4Q4W1 1FMD1 3N7MA 2WT0A 4FT8A 1RUJ1 4D69A 4ZU5A 3E5XA 3R4UA 1QOSA 3NAPC 2D6KA 3M70A 2A71A 3LWCA 4Q0PA 3JBG2 4B4PA 3V0BA 4LBOA 3AMQA 2R32A 4CEYA 4TWTA 3VBSB 5JSPA 1PVC3 5GLUA 2YZ4A 2R0HA 1RUE3 2JXAA 1TMF1 3RI8A 5HXVA 1LTEA 2AYHA 5BNOA 4PIZA 2MNGA 2OUJA 3WUDA 3TWIA 3D0JA 3IPVA 4CDWA 5JLVA 2K9ZA 2IXKA 4WVWA 3LZZA 2RS33 3GHMA 3VBOC 2IXCA 5FO9B 5H9RA 2PLV3 3ZXGA 3WR0A 5E89A 2XGXA 1HV1A 4Y1VA 3RPQA 1TNRA 2WS92 1VBB2 1S0GA 2MEV1 1BBT3 1FV3A 1OA4A 3V56A 4L97A 2YXSA 3MW4A 3LKJA 1PO13 4TYSA 4GQ7A 3MZHA 1SMVA 1QQP2 4S2HA 1W6PA 1SFYA 1QJU1 4F7ZA 1REFA 1V6OA 1QNYA 1PNFA 1QMJA 2Q1ZB 1ND3C 1NLRA 1POV1 2XG3A 1PO22 3AFGA 2YMZA 4Q4X2 4F8AA 3WP6A 3ES1A 1XU2A 2OZJA 1H8TB 2R071 3WCSA 3PLQA 4MZUA 4BCUA 1AR93 3ROUA 1AL21 3J9SA 3MYXA 1ND2A 4AVVA 4W6YA 2OW4A 1GLHA 1CAVA 1GZ9A 4Q29A 3ILRA 3NKTA 5DG2A 1VJ2A 3VGIA 4CEWA 4YZ2A 3KT7A 2EAAA 1YIPA 3E5UA 4QD2A 1QDCA 2EALA 1HX6A 1V9U3 3EHKA 2DWRA 1A8DA 4XQWA 2DV9A 3WVJA 4K20A 2PHRA 3VBUB 1QWRA 3AMNA 3AZZA 3OYWB 2BBVA 5IUQA 2QDRA 4NHMA 1SFNA 1VBC1 5DUUA 1OPOA 1N1YA 4Y20A 5JZGA 4IEXA 3VBSC 1W6QB 4MXWA 4ZU4A 3AP5A 4XBNA 1NCRB 2TUNA 2WNVB 3EJKA 4OI4A 4XF9A 1VP6A 1RUH2 1YYNA 4WV8A 1KJRA 4HETA 2RHPA 5BUVA 2R0FA 3OD0A 5C9AB 3WG1A 3H7JA 1RUOA 2DF7A 2HJIA 1H1IA 3E97A 4JGYB 4CDUA 5FBZA 1RL3A 2R042 2XB6C 3WW1A 1DU3D 3RMXA 3GNEA 1CPNA 3CJXA 1OI6A 3DV8A 4LLFA 3FUQA 3VZOA 1T6GC 3PVBB 1RUI2 2A6VA 4IEVA 3IN9A 4XJUA 4BZ4A 3TN92 1O5LA 1VLNA 4INDA 4EN0A 1R1A1 2GSYA 1KJLA 1AR72 3U10A 1N3QA 1RUC3 4RQPB 2RS11 3H8UA 4GB33 1J1LA 5DDJ3 1JBCA 4XFIA 1GR3A 1SQ4A 4MH0E 5EXOA 4AK3A 5JDBA 1ASJ1 3I7DA 1UPSA 2ATFA 1UU6A 2B46X 2UWCA 1SCSA 2NLRA 2DTYA 4K6BA 1H1AA 1NQJA 1ZBA2 3ENRA 5FPXA 1RINA 1OFNA 1UMZA 1NYWA 5H9SA 5SV8A 4GWMA 2Z79A 1QJY2 5C8CB 4AG4A 5I91A 2Q30A 2YV8A 3VBFB 3M3IA 4IQPA 4YVWA 3AYCA 3KGLA 1H8TC 2IXLA 1YIFA 3PTYA 4BE3A 3GBFA 4N90A 1OKQA 1GQHA 5BPXA 1B09A 2HWC1 2HWD2 3MFAA 5K0UA 3GZAA 2NMNA 3FWEA 1LR5A 5FMOL 1VBE3 2HWB1 5GZFA 4PLMA 1DZRA 1BCXA 4H7MA 4IERA 4LBNA 3WY6A 3C2UA 3ZXKA 4AVCA 4S2DA 3FFZA 1CAUA 2WZPP 4AFMA 2OVUA 4AEMA 4M3CE 3B69A 1A8MA 2EXJA 1COV2 2BVVA 3DPRB 3WX5A 4LBKA 2GMMA 4FTEA 1S0IA 1MVQA 3VBUC 1RUF2 1OQ1A 1LKNA 4MYEA 1EAH2 1XU1A 1FNZA 1VBB1 2DUQA 2WS91 3WW4A 3ZFEB 1VBA3 2D44A 4GALA 1R1ZA 5GZDA 3AZYA 1SACA 1NCRC 2WNVC 2UYAA 1CN1A 1C1LA 4RHV3 1UZZA