1PNFA

Pngase f complex with di-n-acetylchitobiose
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
314
structure length
314
Chain Sequence
APADNTVNIKTFDKVKNAFGDGLSQSAEGTFTFPADVTTVKTIKMFIKNECPNKTCDEWDRYANVYVKNKTTGEWYEIGRFITPYWVGTEKLPRGLEIDVTDFKSLLSGNTELKIYTETWLAKGREYSVDFDIVYGTPDYKYSAVVPVIQYNKSSIDGVPYGKAHTLGLKKNIQLPTNTEKAYLRTTISGWGHAKPYDAGSRGCAEWCFRTHTIAINNANTFQHQLGALGCSANPINNQSPGNWAPDRAGWCPGMAVPTRIDVLNNSLTGSTFSYEYKFQSWTNNGTNGDAFYAISSFVIAKSNTPISAPVVTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords PEPTIDE-N(4)-(N-ACETYL-BETA-D-GLUCOSAMINYL)ASPARAGINE AMIDAS
publication title Active site and oligosaccharide recognition residues of peptide-N4-(N-acetyl-beta-D-glucosaminyl)asparagine amidase F.
pubmed doi rcsb
total genus 85
structure length 314
sequence length 314
ec nomenclature ec 3.5.1.52: Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase.
pdb deposition date 1995-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09112 N-glycanase_N Peptide-N-glycosidase F, N terminal
A PF09113 N-glycanase_C Peptide-N-glycosidase F, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.230 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1pnfA02
2.60.120.230 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1pnfA01
3MIBA 3MLLA 3MIEA 4QHBA 3MIGA 1OPMA 1PHMA 1YIPA 4E4ZA 3PMSA 4R4XA 3MIDA 1PNFA 1YI9A 4R4ZA 3PHMA 3MIHA 3MLJA 1PNGA 3MLKA 1YJKA 1SDWA 1PGSA 1YJLA 3KS7A 3MIFA 3MICA
chains in the Genus database with same CATH superfamily
2W2IA 1LOEA 1WUVA 1O4YA 1DBNA 2XVLA 3LDRA 4FFGA 4RHV1 1W06A 1TMF1 5J37A 1PHMA 1DGRN 2ZAAA 3BIEA 4L97A 4GWNA 4HVOA 1O8SA 1ZVFA 2E32A 4NWVA 2TEPA 1QOSA 4FPLA 2BFUS 2B4KA 1NE4A 2RS53 2W1UA 4GIQA 3ZFFC 1UW8A 2OXBA 1XYNA 4CDUA 3K75B 4XJUA 1QEXA 1SLLA 3CHXA 3FLTA 2VVFA 3WT3A 3IMNA 4IL7A 3SH3A 1XBFA 1CIYA 2Y34A 3LCPA 4CUCA 1ULCA 4QXHA 4TN7A 5I0DA 2JDMA 4BIFA 4DXZA 1L3JA 1UOJA 4AVAA 5FFOC 5KHIA 3BGAA 1R092 2CHHA 4I01A 4CPBA 1NUKA 4H7LA 4OZOA 5FZ6A 2R0HA 3BPSA 2FCVA 3OBRA 5E88A 4CUBA 5LY1A 1AXZA 5J96B 1OD3A 4B1LA 1GOHA 3P5BA 1NXD1 3E97A 3A0KA 5D8AA 2GNMA 4FSJA 3ZSJA 3PNAA 2BGPA 2WWSA 1YC61 3LA3A 1YQCA 3WP6A 4BMBA 5JMOA 4GMP0 4Y24A 1QOOA 3LIHA 3OYWB 3ZFFB 2VBPA 1GICA 3PURA 1U5IA 1AR93 1WLCA 3O12A 5F3EA 3APBA 5ACA2 2XHNA 4R9BA 1QHDA 2E53A 2ADEA 3MLKA 3W58A 4ZXEA 1JYNA 4IQPA 1CVNA 3ACFA 3PVOA 2WS93 4CSWA 2VW1A 3N7JA 2C6SA 1J83A 2QBXA 4KWLA 1FI2A 1RUI1 4I3PA 4E2SA 1REFA 1WMFA 1GYKA 2AR6A 2QKDA 3AVSA 4I0WB 1SQ4A 2C5DA 4IEQA 4NJ4A 4CPBD 3VZKA 2EALA 1SLBA 1AX2A 5A6YA 2LTNA 4FPOB 2JE8A 5A7SA 3RZGA 4C0HA 1ZRFA 5FY0A 3ZFEA 4AFAA 3IBMA 4EN6B 1OBNA 2YFZA 1HV1A 4CDQA 5FREA 5M0TA 4HKWA 2DWRA 4BLJA 4IV3C 2H0BA 2J1RA 4QAWA 1AL22 2BUKA 2GH2A 1PO12 2XMLA 4Q4W1 3NQHA 2VNRA 3POBA 2BPA2 1HX6A 3VBFC 2FDGA 4IEOA 4WM7A 2GP3A 2VMEA 1IGOA 4GA9A 4KU8A 2V5DA 4BE3A 4CCKA 5T5JA 4KQ7A 4OLLA 1RMU1 1SCSA 1DF0A 2PHUA 1L7QA 1OPOA 1GZTA 2YU1A 1QH6A 2OUHA 1OQEA 4XJ8A 4KWKA 2D40A 2P37A 4PIZA 1JI6A 4KH9A 3H9AA 1CQ9A 1UWWA 1WZXA 4QKNA 5E16A 4AQ6A 4CCMA 5FWJA 1RVF1 4LBNA 5HV4A 3I3BA 1YNAA 1RUG2 4D8MA 3HD8B 2HWD3 2VJXA 1VBC3 5F3GA 4K7JA 5LA2A 4IV3B 3D6EA 1LEDA 3WG1A 3J7HA 1EUUA 5I8SA 2D98A 3PHMA 2Z2SB 3R05A 3OBTA 2XJUA 2YC0A 3VBFB 3VD3A 2W91A 3USSA 3WW3A 2N7GA 1VBA1 2VMGA 4OHXA 3CEWA 1NQDA 1W8FA 2ZGRA 3LZZA 5FYCA 2YXSA 1XSQA 3WDTA 4AG4A 1O4TA 5GZCA 3KWVA 3W9AA 4X8PA 1U5YA 3SISA 3CL1A 3JU9A 2WLPA 4PQ9A 4JKMA 2FDHA 1OVSA 2WWUA 1ZZCA 3KV4A 5LRSA 3O1OA 1BXHA 1SCRA 2PLV1 4XFFA 4B8EA 3WNOA 2ZTNA 1ULDA 3RMYA 1N1YA 2NPIA 4CP0A 2LW8A 3D0JA 3NJZA 3I3EA 5J36A 1K5JA 2C9AA 1QGLA 1YI9A 4AFMA 5I93A 1MS5A 1UO9A 3WF2A 2WUHA 2BBAA 3H1WA 2UYAA 4Q1PA 3V0AB 4MUVA 4Q4X2 1XNTA 2G9GA 1AYM2 1HRI3 2XLGA 4G9SB 5FP4A 3WVJA 1M06G 2J1EA 1RUC3 2HWC3 2XJVA 2YPDA 3NV4A 1FPN2 4LIVA 1VBB1 4QX2A 4DIQA 2YHJA 1C8M1 2E63A 3BODA 4PCRA 2YV8A 3AKTA 5BV6A 3PU8A 4RGAA 4FTSA 4HSLA 2G9ZA 4KMQA 1PGW1 1PIV2 3R6SA 1EP0A 1ZBE3 4LUMA 2WFF2 1UY3A 2IWGB 4MH0E 2W0XA 4B4RA 3NAPC 4JTOA 2D6OX 5FK7A 1C57A 1S1AA 1KRIA 1E5RA 3J8F2 3FJSA 1QH7A 3M7AA 2JDYA 2R041 1ND3C 3I97A 3M3EA 2P5BA 4P9IA 3WQ0A 4NIHA 1K5MC 1GLHA 2DVBA 3ZDSA 4BQ1A 2W95A 1G9CA 5A32B 3URFA 2J7MA 4AL9A 1DHKB 5KHKA 5HXMA 5IYYA 2WO3A 4XFAA 2ZMNA 5C3SA 3WP4A 2R061 5HCHA 4AHYA 1SZBA 4DUVA 1MEC3 4P08A 3AYCA 1A8MA 3MPBA 4Y4YA 2WA3A 5FMOL 3DN7A 4FTBA 1E5SA 4QX1A 2RS33 3Q8EA 1AJOA 2J1VA 3M4FA 3ILRA 2JDKA 3NAPB 1GBGA 4LE4A 3V64A 1F8VA 4F83A 4R9AA 3IDAA 1QQP3 1ND3B 1QOTA 1VBE1 3INAA 4IE5A 4TYSA 3WDYA 2FD8A 1FV2A 1K5MB 2FCTA 4YGBA 5BNOC 1K12A 3THCA 4Y1VA 3AZXA 4Q4V2 4YGCA 2FDIA 2XWBB 1CAUB 2VUDA 3N9MA 1POV1 4PDWA 4RFRB 1RIRA 5FZIA 1L7RA 4ASKA 4CCDA 4QB1A 1EAH1 1GQPA 1N3PA 2AYHA 3LKJA 4N43C 1FAYA 4LBQB 1PZ8A 1VRH2 2G9FA 4YW4A 5H9PA 4QU1A 4DY5A 4J25A 4GJZA 2Y8KA 5JI9A 3EHKA 4CU9A 4JQRA 4LIUA 2ARAA 4QXKA 4XDPA 5IVJA 4M0NA 2DUOA 2YBSA 2DCKA 3LSDA 4Q4Y3 5BNOB 4ORFA 3VBOC 3WG4A 1H9WA 1LAJA 1W0NA 2DV9A 1OA2A 3ZSLA 2BOIA 4FT8A 3KB5A 1FOD3 1V6NA 5EJ3A 5FAXA 4I02A 5JI7A 4PQQA 1JZ2A 1NCQA 2E31A 1W2UA 3AL6A 4HPKB 5AVAA 5C4WC 5HV0A 3OY8A 2DCZA 4N43B 1LB2A 2RR11 1Y9GA 2G19A 2WT0A 3KQ4B 1W2AX 1BBT3 1GSLA 2PHLA 3OGJA 2ZGNA 2ERFA 3RDIA 2DYCA 3J8F3 4E2QA 5CADA 1UY1A 5CFDC 1JYWA 4LT5A 1Z7S3 5EHDA 3AMMA 5DAWA 4BQYA 5A1LA 1ZZ9A 2DTWA 2VZVA 3LEGA 5G05L 2VOWA 4A7KA 4HN1A 3TBDA 1MS8A 4RR3C 3IN9A 4YW6A 5L19A 4YW3A 3ST7A 3WSOA 3OD4A 4FFFA 5T5OA 2E51A 3IWZA 2VVDA 4ET7A 4XFCA 3WZ1A 1REDA 1DZTA 4F7ZA 3RZHA 4IXLA 5DUVA 4CZSA 3MBWA 3OEBA 1W9SA 4PLNA 3VL8A 3RQ0A 5FYMA 1H2KA 1LEMA 2DTYA 4UW6A 2VQUA 5FYIA 3VKMA 5C5TA 2XWJB 2ZA9A 4QPIC 4NR1A 5CFDB 4FP3A 4W50A 5FYTA 1TEIA 5F1RA 1J3RA 4JDOA 5T5PA 4OHYA 1WLWA 2IXLA 3I2DA 4XF1A 3CJIC 1LGBA 1IS4A 3PJYA 4QDQA 2K0GA 3MICA 4RR3B 3R0RA 5GJ6A 5J1XA 1DU3D 5DUUA 1WMEA 1FNZA 1C8NA 2R071 3ETPA 4JCKA 1ZNPA 4XFBA 1LOBA 2QQNA 3JBG2 3WX5A 5JXGA 3DECA 2P4EA 4ATFA 1UNBA 4FO9A 1BVVA 2C24A 2YGMA 3S6PA 5IHRA 2F4LA 1W04A 1Y7BA 2OKXA 3VDAA 4DEQA 3O7OA 3OYWA 3KM5A 4RSUA 4UFLA 3ZFFA 4C91A 5CKNA 1REEA 3PUQA 2BNOA 4FPEA 4IGQA 3WNPA 4RHV2 4LHKA 1TMF2 3VDBA 3EO6A 3CJIB 1W99A 2XBO1 3B94A 3GZTB 3GZAA 4Y4RA 5FMDA 2I45A 3ZN4A 4L2NA 5L9RA 1WW4A 2GMEA 2OZ6A 1UYPA 3RYKA 1QJFA 5FP3A 4RQPC 5CKQA 3OPWA 4WVVA 5GLVA 3NL1A 4AI3A 1G8WA 2OX0A 5GLWA 2A73B 4CU8A 3THPA 1PMIA 5IWFA 4FOWA 4AXOA 3FUOA 5DDJ1 3A23A 1UY4A 1JW6A 2JICA 2VH9A 2A3YA 4BMEA 1X36A 1VBD1 2CGNA 1XNKA 5C3OA 1LHUA 3MIHA 4PIYA 2VZSA 5KWRA 1CGPA 1KD7A 4E4DX 3GZEA 3ZYRA 1GNYA 4D6RA 5DZEA 5L7OC 2EICA 1PM7A 4D94A 3VD5A 2ARBA 3ATGA 5HCBA 4RQPB 4MHRA 1MPXA 1SPPB 4M01A 3WLUA 3UNPA 1HXS3 1W8ZA 4XTPA 4PIXA 1GQHA 5C6CA 3RJRA 1HB4A 2K46A 5CAZA 1C1FA 3CKHA 1PNFA 2VVEA 1RUI2 1IPJA 2GAUA 2IVJA 2ZABA 3OJBA 4IV3A 1A34A 2GDFA 3ILNA 4LUKA 3RFRA 2YGLA 3RSJA 3E1F1 4AVVA 3PVNA 3VBFA 4CUGA 4D7YA 5GKAC 2VE1A 4LKEA 3T0DA 4QB2A 5JDBA 5L7OB 3GM8A 3HNBM 4WVZA 3ACIA 2VCBA 2JG8B 1UZ0A 5FP9A 1IS6A 3LPFA 4C8DA 1EUTA 1POQA 4K20A 3A21A 3PUIA 4Q4W2 4X6QB 5EYXA 3SH5A 3THTA 4CCEA 1JU4A 3D82A 3U1XA 2PHDA 4SBVA 3VBSC 4ZU7A 2GC1A 1TNFA 2P3JA 5C8CC 4Q26A 1SFYA 4QKFA 4N90A 2RMU1 1NCRA 2BGOA 2VZUA 3DXTA 4FFHA 4QWNA 3I4IA 3I8TA 1O5LA 4ZS2A 4NIGA 5JIUA 2W52A 3WUDA 1RUNA 2C26A 3K48A 3CLPA 3POIA 2ZOEB 4AI1A 4OHWA 2ZX2A 3L2HA 3V0AA 3O1RA 2WYSA 3NNLA 3I3QA 3E5UA 3O1VA 1RVF2 1DGRA 1IKQA 2XONA 3I59B 2Y6GA 3ZIXA 3EMRA 4YLZA 4DNYA 1NLQA 3O14A 3B69A 1LTEA 1ZX5A 1PO21 1H6YA 1STMA 2RM21 5LY2A 1WCKA 5FY1A 4XAEA 2R49A 3F2ZA 3IAQA 3VBSB 3ZXAC 4A3XA 1Q56A 3JD71 4TLFA 4FXKB 5C8CB 3AYDA 5FXWA 1VBA2 1RJ7A 3U78A 3LPGA 5CKMA 4LKSA 3UJQA 2FMYA 4YZ2A 3BTZA 4XC9A 3M3CA 4TWTA 3T2PA 5JCTA 1RUF1 5JIAA 3I3MA 5DQ0A 4IEYA 4XF9A 2Z5WA 3NNFA 3NV1A 2NMNA 5ERLA 4Q0PA 1YFXA 1GOGA 3L2YA 4I0AA 1ASJ1 4PI0A 5A32A 3HMYA 2PLV2 2CYFA 1IG0A 5A7NA 4JGZB 4Q2FA 4URAA 2Q8DA 2PELA 3ZXEA 2XUEA 4QHBA 1LULA 1OLMA 3B00A 4BLIA 3P3PA 5JLVA 4XDOA 2HEYF 1YO8A 1HRV3 3E6DA 1MVQA 2WAAA 3M70A 1Y9MA 4IE4A 3OSDA 4XJAA 1D0HA 3KT7A 3QCWA 1BEV3 2XVGA 1H4GA 5DAVA 3HN3A 3MPPG 1S0EA 5I8TA 1DQ2A 1SHWB 3HAGA 1JZ5A 4OI2A 1PZ9A 4S2DA 2CGOA 3NAPA 3FHAA 3GDBA 5DAPA 3TYJA 3GBGA 3ZO0B 1DQ6A 5FZDA 1VBB2 5C3QA 1WA6X 4IERA 1C8M2 2WN2A 3BALA 3WQ7A 5CISA 3N9LA 3JZVA 2AACA 1F2NA 1ND3A 4BQ3A 2VNGA 3SITA 1K5MA 5FZOB 3VHRA 1PGW2 2IXHA 4GB31 1MQTB 1BMV1 1UD1A 4U2AA 5A80A 4XPVA 1CAUA 3OEAA 4QDRA 4PF5A 1OF4A 4Q4W3 2HWE2 5IAXA 2QDNA 4XFGA 1CAWB 2RDRA 5FMBA 4FAHA 2DU0A 1XC6A 1WLDA 3NKTA 2R042 3NJXA 4LBQA 1ZYBA 5SV5A 1JZ7A 2WKKA 5FYBA 2B7YA 5T50A 4E9KA 2OQ7A 1O6UA 1VALA 2RV9A 3D5OA 4NRPA 4XVHA 3POYA 2WZR3 1PNGA 3MLJA 1SFPA 4ASLA 2LROA 4A4AA 2FQPA 2R062 1RHI1 2DCTA 4NE9A 2P3YA 2VMHA 1ENXA 3Q8FA 1OLME 1W3XA 5BNOA 4QGLA 4WVWA 1EYBA 1MS1A 1NT0A 2CAUA 3AKPA 4CXXA 5J48A 5L36A 1OH3A 3I54A 2ZGMA 2HWF3 1YCIA 3VLBB 2QQPA 4KBBA 1MS9A 4XYXA 3BTXA 5A3OA 3S7IA 5LATA 3O1UA 4WVMB 4HPKA 4H55A 3QH6A 2GNTA 2ZJCA 4CA9A 1UQXA 2Z4FA 1Q8OA 1VBE2 3G7DA 4N43A 5FLHA 4EYUA 5C7GA 4I09A 4XETA 2ZACA 2PXJA 4AI8A 4HBNA 1H0BA 4UAPA 4FAGA 4XMAA 2PMWB 4NIDA 4P9JA 1RUD3 3RZKA 1UIJA 3MW2A 4LA2A 4LBQD 1POV0 1YFUA 2VULA 3IPVA 4JHZA 5FLJA 4HANA 1EAH2 2MEV1 3AYEA 1RUE1 2W08A 4N53C 4UOJA 4ZY9A 2GALA 4XACA 5DXDA 5F39A 4M4RA 4A7YA 2VG9A 4W4ZA 5CU1A 5LBCA 3HVDA 1RUH1 2OW4A 3AX4A 1JBCA 1COV3 2XJSA 3SQOA 4AVSA 2WL1A 3J9SA 5AVPA 3WCSA 3WINE 4BPZA 1O3TA 1I3HA 2XGXA 5L9BA 3RWNA 4DS0A 2EIGA 4AEJA 5J7MA 4AQ2A 1R083 5CBLA 4Y1ZA 4E4HA 1IG3A 4UFHA 1KXGA 2XUMA 4YRDA 5FYHA 3ZM8A 4DPNA 2Q4SA 1IHMA 1UCXA 4UI9L 5CFDA 2W3JA 1VPHA 1D4M1 1OMIA 4KBZA 5FYZA 3VKOA 1DG6A 4L92A 1UU4A 1CJPA 5FZHA 3KZ4C 1YQ5A 4N53B 2HEVF 2IVIB 3TN91 4GALA 2ZKLA 1CWPA 2RR12 4RR3A 5CIRA 5FYVA 1H8TB 1SDDB 1DZRA 1VB2A 2IXIA 2HWE3 4OHVA 1NX9A 4DINB 3VBHC 2X09A 2VCCA 3ON7A 3ZDVA 2QTWB 3V56A 1PX4A 3LOIA 3OOXA 3HT1A 3RGBA 1MS3A 5F7UA 1Y9QA 1IQDC 3RI8A 5KC5A 2OZJA 3W5MA 3BI3A 4PLOA 1ONAA 4FPFA 1JYIA 1X7NA 1QXPA 2D93A 3CZJA 2RJLA 2BWAA 4MXWB 4TXWA 2MNGA 3CJIA 3T08A 3WDVA 2Z79A 1ZA4A 4AEMA 4LKDA 4XUOA 5EWSA 2X10A 2ID4A 1W8WA 3K77A 1QJY3 1ULEA 1B35B 1S0GA 5LK7B 2PN5A 1WW5A 3C7GA 4RL7A 5GLUA 2VW0A 2LALA 2RJKA 4XTMA 3TWIA 3WP5A 3FUQA 5LASA 3VBHB 1FX5A 4CDXC 2VZ1A 4XQWA 4L0PA 1KDMA 1OXCA 2YDEA 2QQWA 2CGPA 5E6HA 4OUEA 1O8PA 2ZZJA 4UW3A 5APAA 3AMQA 1W6NB 2DUQA 2R072 1GQGA 2TNFA 3OPZA 4DRRA 1A8DA 1EAH3 1GZCA 2VCAA 2JWPA 1FV3A 1ZBA1 1OQDA 3WQBA 4K6BA 1PZ7A 3MIFA 1OHFA 2UWAA 2YB7A 3T0AA 1YRZA 1NKGA 4Q8KA 2XR4A 3AKSA 4ISRA 4P00B 4NMIA 1MZ6A 1SPPA 4S2FA 4A7ZA 4CXWA 1AZDA 4AF9A 2XPJA 3AZVA 1SLIA 2IUWA 1H8VA 5FWEA 4CDXB 4PF1A 1S0CA 1PVC3 1RUJ1 1WD3A 2RE9A 2XBO2 2IFWA 3VV1A 1BCXA 2WQ8A 4Y1UA 4DEVA 2ZAHA 4CRQA 1HQWA 1QJU3 4CP1A 3HQUA 4FCAA 4JX0A 2ET1A 1XXNA 3CF6E 3NW4A 4IESA 5FPVA 2VY0A 1RUOA 5L7OA 3GYDA 1PK6C 1KFUL 5DDJ2 5FXXA 1DZQA 3H50A 5FZAA 4LXLA 2JG8A 3U14A 3POFA 5D21A 2ENRA 1VBD2 5IK5A 4EN9B 4A41A 3QOPA 2RHPA 2WO2A 2GMPA 4ZZ8A 3ZXLA 1LOAA 1V6IA 3T2OA 1NZCA 3GXUA 1UMIA 3M3IA 4P14A 3T09A 3WY6A 5ISLA 2D44A 2SBAA 5BY5A 1AX0A 4AR2A 4Z92B 4IV1C 3U07A 4LKFA 4Y1YA 3D4KA 4R4ZA 3GBFA 1GZWB 2B8MA 3OBZA 5DPNA 1DLCA 2VD7A 4ZU4A 5FY8A 1N47A 4MSVA 1AR73 4KWUA 1ODMA 4ZHNA 2R7EB 2WJSA 1DP0A 1OC1A 2YG0A 2HWB1 1HW5A 1EV11 1ZM1A 2DFBA 2EXHA 1PK6B 2WA4A 3I59A 4OVEA 1AYN1 1J59A 5GALA 3DKWA 2YPJA 5JVVA 4KNCA 4F8AA 3VBSA 2BU9A 4GKXA 5C8CA 2HYXA 3S5AA 2VUJA 2FMDA 2GU9A 4XEZA 3DYPA 1HJFA 1W6OB 2PHXA 4GXLA 4AHXA 4IV1B 1FMD2 1Q8SA 2R30A 4QHOA 5AC93 2UURA 1CZTA 1LOFA 3VHNA 4B1MA 3MUZ1 2PYTA 1SDWA 3R4SA 4BZ4A 2CDOA 4BM8A 2B45X 1LOCA 1UAIA 2C9KA 4BA6A 3JQXA 4H7MA 4JGZA 4HFSA 2JDAA 2NN8A 2RMU2 4YG3A 1V6JA 5FOJB 1UPSA 4XF0A 4JRAA 3WNLA 2VZPA 3UGFA 1QJZA 3WW2A 3OG2A 1GV9A 4DQAA 2Q8EA 1ZREA 2BEOA 2VR4A 1ZZ8A 5H9SA 4KG8A 3NJYA 2ZZQA 1QXJA 4B4QA 3W20A 4E4ZA 1AR81 4QQ2A 4B4PA 5FZ7A 5L73A 3U37A 3O1PA 2EXKA 3TAYA 3Q9OA 3N9OA 4FVVA 1YUDA 4V2WA 2GC2A 5FIXA 1RXGA 1XQNA 2VAUA 5GLTA 4YZ3A 1LU2A 3MFCA 1PO22 1ULPA 2RM22 2F6BA 4NHMA 3LOBA 3ZYFA 3BUCA 5A6XA 4LO8A 4BCUA 5JSPA 1R093 3KS7A 1VAMA 2QZ3A 4IEZA 2HBUA 2LUWA 3FHQA 5FP7A 4WV8A 5FZOA 3JD72 3K51A 1H1IA 1MQTA 1H2LA 5J09A 1APNA 4XCBA 2VTXJ 2Y6KA 3UL2A 3VN4A 4E8CA 1S4CA 4M4PA 4MGTA 4JKKA 2J1UA 5ANQA 1RUF2 3NVCA 4QQLA 3RI9A 5JMCA 2ZX1A 4XE9A 4LR4A 3U10A 2EF6A 4L99A 4COZA 1DYKA 2P6CA 1VB4A 3I7DA 4GMP3 3VBUA 1ASJ2 4A2UA 4CCJA 2JG9C 5CFCA 2W92A 5LZ6A 3OF1A 3FFZA 5ACA3 2FDJA 1TME1 1D2SA 4AI0A 2BZDA 2E7QA 4IEPA 3C7OA 4Q8LA 1J1LA 4TTGA 2BV4A 2ET7A 4CDWC 3ROUA 5FPLA 4CYDA 5BNNC 3UYJA 2C4XA 3ZN6B 1GMMA 4NPRA 4QGNA 5FO8B 1K45A 1OA3A 5BNPC 2Y6FA 2ZMKA 3ZPYA 1UMHA 2Y60A 4EZHA 2A6VA 3WF1A 4AEDC 2PAEA 4WVMA 4O61A 3FN9A 5IAVA 1UYZA 3LA2A 4LLFA 1C5IA 4XBNA 3ZXDA 1T6BX 3TNQA 1NY71 5LBBA 3ZFGC 2JG9B 1FMD3 4GB32 5DUWA 3KF3A 1BMV2 1AL23 2VZOA 1RXFA 5FY9A 3H7YA 2DUPA 1PO13 5A3MA 3N7LA 2PAKA 4LQRA 5A3NA 3N4MA 2FBEA 3D0SA 3TEXA 2HJIA 3VZLA 4CDWB 4EQVA 5I0SA 2IXCA 2ZHKA 4JRLA 4L9BA 2YUEA 1AR61 2WYFA 2CTVA 5BNNB 3C7EA 1Y43B 4LHSA 5GM0A 3S7EA 5KXBA 1ND2C 1UX6A 2XDVA 4FPYA 3BKZA 4YFWA 1JYXA 4MV2A 5TSWA 3T2QA 4AEDB 3H3UA 3VDDC 4IEUA 1RHI2 4QU2A 2WC2A 4EE2A 5KR7A 1RUG3 1V9U1 3E5QA 3ZFGB 1RL3A 1UU5A 4B3NA 2JKBA 4AWDA 3CU7A 2EVXA 3OTFA 4YM2A 3VKFC 1SG3A 3CZUA 3E6BA 4YG6A 3GBWA 4P9LA 4D6QA 1UXZA 4YM0A 2VGDA 3WDXA 3C2UA 4AYUA 3AKQA 5A70A 1H8TA 2RDNA 1QKQA 2VOXA 1KQRA 2VTXA 3HN1A 3TRSB 1ND2B 4IUGA 4XW3A 1MS0A 3OCPA 4PHZA 5LA0A 1V70A 2D5FA 3M2MA 3VDDB 1ULOA 3ZMNA 1XB9A 4CCNA 3BOWA 4OFGA 4URTA 5F5QA 5A1FA 2MEV2 1RUE2 5T52A 5T3NA 3S5QA 3T1MA 3J7LA 2JDZA 1GR3A 2QQJA 1UL9A 4XFHA 5LRRA 1CPNA 4ARYA 1MZFA 2PQSA 1KFXL 3N9NA 2GZWA 4BOWA 1TG7A 2JB8A 4BQ4A 4BB3A 4A6OA 4K3UA 3ZLIA 4Q4X3 5FYYA 1UF2C 1AYM3 3AKRA 3AL5A 5C33A 3DKQA 3WHTA 2I2SA 1FPN3 1B35A 2RS11 3J26N 2JD4A 4RYDA 2PHRA 1S0JA 3MF9A 2YC2A 2A3XA 2YMZA 3VUOA 1D4M2 1XNDA 4M3CF 4HONA 3VBHA 5IK8A 1PIV3 4CE8A 4Z2AA 5B2GB 3DYMA 2WINB 4D69A 2WFF3 1XU1A 5FMCA 1QIQA 4JGYC 3TN92 3O5SA 4MGIE 3RZMA 4UW4A 3WUCA 2W5FA 4LORA 2WNEA 3H42B 1W6NA 3THDA 1YJKA 3AP4A 3H8RA 2KA3A 2VQAA 3VHPA 3D3AA 2RS51 4AFCA 1XOYA 2OUJA 3NV2A 4LA3A 3GZUC 3KMHA 1LHOA 2WZPP 3MUY1 3VBOB 3VKNA 1XNBA 1R1A1 1W6PB 3PMEA 1NQJA 5I8YA 1N3QA 4XXAA 1ZRRA 1HN1A 1MR5A 1O3RA 4HSJA 4ES9A 3PIJA 2CY6A 3E5XA 4JV4A 4O9EA 4CDXA 5C4WB 2CAVA 2CL2A 1DLLA 2BYVE 3VZOA 2VPVA 4JGYB 4X6RB 5FBZA 5LBEA 1CAVB 4ASMB 5JOZA 1UZWA 2RDSA 3NNJA 4QT6A 4V2VA 5LBFA 2OYZA 3UGHA 5LEKA 2WQZC 2Z42A 4BXSV 2AGSA 2IFRA 2W1WA 1DQ1A 1CN1A 1OA4A 2ORZA 4GAZA 4NO4A 4AFBA 1YFYA 1AR91 3NSTA 3ZXGA 3IIIA 4Q4V3 4XJ9A 1JU3A 4OMDA 1R1ZA 1JODA 3SCFA 3T2TA 3BU0A 1U5ZA 5KXCA 2DFCA 5B4NA 3R4UA 4NROA 2ZHMA 5A3WA 2WS91 1ZRCA 3SKVA 3FX3A 2XOMA 1JOPA 2KD7A 3DYOA 3ZX7A 1LOGA 3WXPA 2A3WA 2BQPA 1OF3A 2R0FA 1VRH3 3FC0A 2UY8A 4YVSC 1ZBA2 1F31A 5IATA 1OFNA 2KR2A 1V0AA 2P6HA 1FATA 1Y3TA 2ZEXA 3WNMA 5AFEA 1GZWA 4QPIB 1I1EA 1BYHA 1HQLA 2BP6A 1D0GA 4P9WA 5F3IA 1WCQA 1KJLA 2TBVA 1RITA 4QPGC 3AJZA 3B5LB 4LBMA 2GP5A 2BERA 1URXA 1PK6A 2EA7A 1RUJ2 3NRUA 4J1WA 4JHTA 1HKDA 2ADDA 4YM3A 3AC0A 4CP2A 1DQ5A 1PMJX 4YGEA 2BGCA 1WD4A 3ZN5A 4CEWC 1TE1B 1VAKA 2X8KA 5DAXA 5IVBA 2GC0A 4QM9A 2O1QA 1XNCA 3RVHA 3MEPA 4DXTA 3E6CC 1JN2P 3T4VA 4YVSB 3NNMA 1GFF2 3LQCA 1W6OA 5JZGC 3RMXA 4LPLA 1SLCA 1KS5A 4IV1A 1JHJA 4S2GA 5C71A 5LA9A 1W8UA 3ZSKA 5JPMB 4S2HA 1OOPC 4YZ5A 2A6XA 3L9JT 4Q0VA 1PGL1 3DF0A 2E33A 2D5HA 1F4HA 1YJLA 2NZ9A 5DZFA 1LRHA 2HWD1 4QPGB 3KT4A 3NMBA 1VBC1 2Y26A 4PLMA 5JXJA 3PUHA 3TOJA 3PTRB 3LA7A 1S2KA 1UOFA 2DURA 3HQRA 4M00A 4OUSA 4D3WA 3IAPA 5CG8A 2EXJA 2XJQA 4CU6A 2XB6C 3EB7A 3IM0A 4UF0B 4CEWB 3AMNA 3AMHA 5EPAA 3HR9A 3ZYPA 2DVDA 2WZ8A 3HBZA 4NVPA 5A3TA 5EFUA 3O0VA 4B7KA 1MVEA 1TNRA 3I2GA 2ZGUA 2HWB2 3B3QE 4EN7B 1EV12 5FOBB 4PJYA 5JSOA 5JZGB 2UU8A 2P17A 3ZXFA 1AYN2 4ZS3A 4H14A 4H3WA 4R9CA 2FHRA 2QQLA 2F17A 1OOPB 1W39A 1KS4A 1WW6A 3ENRA 4BXFA 5HCFA 1O91A 3ES4A 3RYRA 3T0BA 5C9AC 1OUXA 3G6JB 3X29B 3AP7A 5FPXA 2SLIA 1IOAA 4E2GA 5I91A 4W6YA 2JDNA 4UXAA 4OI0A 4MGZE 1LHNA 5D8AC 3JBG3 3M3OA 2H6CA 1HRI1 2XQXA 2BW8A 4JAAA 2Q0AA 1RYYA 1RUC1 2BNMA 2HWC1 2VM9A 2C0ZA 1W9FA 2O8QA 2JIGA 2ILMA 2Y38A 4DOUA 2Q8OA 1UY2A 3AFGA 2VBBA 3OGRA 1RMU2 3H8UA 5FZMA 4LULA 1W2TA 4RHV3 4LNVA 1QF3A 5JXIA 4UFKA 1TMF3 1ZBE1 3ES1A 3LWCA 1OQ1A 3GGLA 1CIWA 2NQYA 1S0DA 4LO7A 3AP9A 5C9AB 3WF4A 1AR82 1UIKA 3A0NA 3ZN6A 4XQ4A 1C1LA 2HKXA 3HOBA 1BVP1 2CV6A 2VO5A 3K3NA 5D8AB 5C5UA 1I6XA 4D7TA 2DVFA 4WZFA 4MHUA 3VZJA 4CU7A 4CDQC 2X29A 5F37A 1BZWA 2JDUA 5FPAA 1L7LA 1US3A 2JG9A 1IQAA 1US2A 1NYWA 3WEZA 1XYOA 4K1YA 1U0AA 1S2EA 2AEYA 5F5IA 1MEC1 2VQTA 2ARCA 1VMHA 3NO8A 2J42A 3AFKA 2VQ0A 4LLOA 2BWCA 5T55A 3V65A 1F35A 3JB4C 4CDWA 4RN5A 1KDKA 2RS31 2ETEA 4Z07A 4N7UA 5H9QA 5HI0A 1F5FA 5BNNA 3WP3A 2KM2A 4XUQA 1O5UA 1QMJA 1QNYA 2XL7A 4U36A 2DU1A 1YYNA 1F4AA 1OVPA 1ZRIA 3IDBB 1S55A 3AP5A 4CCCA 4LBJA 4MGSA 1QQP1 3K4ZA 4GD4A 1TME2 2VXRA 4AEDA 4X8NA 5FUIA 4QKDA 3ITQA 4CDQB 2VUAA 3AK0A 3ALQA 4OULA 3M3QA 2ZGKA 5C3RA 1MZEA 2WT1A 3FLRA 1DYPA 2DBNA 1LJ7A 3ZFGA 2D3PA 3TEYA 3V0BB 1RUI3 4HMZA 4COUA 3TEZA 2JB4A 5GZDA 3A22A 2YROA 1UZZA 1H9PA 4G3YC 4HXCA 3WG3A 3W5NA 2D7FA 4HVRA 5IVYA 5FRAA 4Z1VA 4JQTA 1NY72 2AEZA 2GNBA 4IEXA 3VGIA 2AC1A 2W9XA 4B29A 2XHKA 3MIGA 4LO4B 5FPZA 3AMPA 1GWKA 3O1SA 1PX3A 4Q4Y1 1DGLA 1LNSA 1GKBA 1VR3A 3VB9A 1WMXA 4KGQA 3KCXA 4HKOA 4N9IA 4RGKA 2IC1A 5FXVA 5K4LA 1A6CA 2A7AA 4OUMA 3PTYA 1J3PA 5K7PA 1FOD1 1AR62 2XG3A 1RMU3 4HLTA 5FMOS 4XJZA 1EY2A 4EWEA 2JENA 3UJOA 1QU0A 4EROA 2VZTA 3OB8A 3WHUA 4RS5C 1VRBA 2VXJA 5D2AA 2Y6LA 5DG1A 2DBIA 1BBT1 3S30A 5A1AA 1RVF3 2WWJA 1N1VA 2HYKA 1V9U2 3ASIA 3J8F1 3KV5A 4AI2A 3ZMOA 3ILFA 1Z7S1 5B4XA 3POEA 3ZR5A 2W94A 3JXSA 3LAGA 5DN2A 1F9KA 3CO2A 5FY7A 4LO5B 3VL9A 4JDNA 1LESA 1DFQA 1H2NA 1LHWA 3WV6A 4HK8A 3GNEA 1WWYA 3A4UA 2R6QA 4QMAA 4XOGA 3ZR6A 1D7PM 1H1AA 4BQXA 4D0QA 3H1MA 1VBA3 4K40A 2WQ4A 2RJ2A 1BLZA 4G4FA 4D6SA 4YW5A 3HBKA 5IFTA 2OS2A 2V73A 3GHNA 1YI7A 4V1PA 4CXYA 1W8NA 1Z0HA 4SLIA 1EPWA 3LB9A 2D6KA 3I3DA 3ZKUA 3Q8CA 1W6MB 1DDLA 2TUNA 4RS5B 5CA6A 4Y20B 2LRPA 1W0OA 2PLV3 3AZZA 5CZKA 4HN0A 3VBOA 1AL0G 3LFIA 5CNAA 3UK9A 1W6PA 1IPKA 1W8OA 5KC6A 4UBHA 3I2HA 3WW1A 2WSVA 4N8MA 2VMDA 2ARXA 2BJSA 5DMYA 1XE8A 5C4WA 1OLQA 4NWWA 1SEFA 3FE5A 2WO1A 5EXOA 1YQ6A 1XSRA 2WSUA 1PM4A 4JGYA 1NOVA 4MYEA 5FPBA 2OA2A 3T30A 5LEJA 2RS12 1CAVA 1VBB3 3T1LA 1WBFA 1C8M3 2CDPA 3ZXJA 2QE3A 4JZRA 5FJHA 5K0UC 4MGQA 1HIXA 2P3IA 2A6WA 4FPKA 5IT6A 4ZONA 3ZYJB 1OFSA 1W9YA 2QJVA 3UESA 4M3CE 3N7KA 1QJEA 2DDUA 3EJKA 4AVCA 5EZWA 3HPNA 1JUIA 2QCSB 4C0BA 3K4AA 3BIWE 4FPGA 5FZFA 2A1XA 4ZXKA 3JCIA 3RYPA 2B9UA 2PQQA 2R043 4FPHA 4AQTA 5CEHA 2RS52 3FFQA 3AYAA 2X05A 5FR3A 3IKWA 4LOTA 3UKVA 1FYUA 1C3HA 3P3NA 2GN3A 2IXKA 3JUUA 4QM8A 3CNAA 1DYOA 1R1A2 3B93A 3NKGA 4QPIA 4OQ8A 4RD7A 2R063 3DGTA 5FKBA 5K0UB 2B42B 1VJ2A 1RJ8A 4MADA 4DRVA 1QJX1 2E7TA 1HB3A 3FMGA 1CZVA 4NRQA 2WBKA 1GANA 2R1BA 1DGWX 1WKYA 3KV9A 4UFMA 1UU6A 1YHFA 1LODA 3MF6A 4ZPIA 5FP8A 4LMFA 1NCQC 5JR7B 3BTAA 3J7NA 4GH4C 3SKJE 4RFT0 2BVVA 4UYBA 3HQXA 1S0IA 4A45A 3J7MA 4QX7A 5IVVA 3F95A 1VBE3 2VOTA 2XJTA 4QB6A 4QQHA 2ZXQA 4YVSA 3KVBA 1AR92 4Q5OA 3RS6A 3OBAA 4AQSA 5FY4A 3KQRA 1ZRDA 2Q1FA 5ABJC 4BQWA 4YG0A 2Z69A 3ZPOA 1HXS1 1POV3 4HK9A 4YW7A 3AVRA 5FY5A 4WM8C 3ZYHA 5FQ0B 1PGSA 2NLRA 2WS92 5EYYA 3WQ1A 5F3CA 3MGUA 1HB2A 4QPGA 3SMHA 3WF0A 1AVBA 4INDA 3MIBA 4LBLA 3RWKX 3DV8A 3MV01 1XE7A 5A33B 2DVGA 4XABA 3CJXA 4RQPA 1NCQB 2D6NA 4UF0A 4WBBA 1C4RA 2Q8CA 4CEWA 5FO9B 1OSGA 4ZKTB 4GH4B 3OY8B 1DQ0A 2ZGQA 4K9SA 5KBFA 1XPWA 3SLIA 2CNAA 1AHSA 3ZKYA 1JS9A 1JYVA 4ZZ5A 4YWAA 4GULA 4PBOA 3ME2A 4AGVA 4Y22B 5ABJB 2AENA 2GH8A 1E5HA 1QY4A 1OOPA 5FZ0A 1H1MA 5A7WB 4MG2A 3UETA 4WM8B 4IEWA 1UX7A 4UFJA 5EV7A 1CPMA 5IW0A 1CJDA 2WDBA 5LWBA 5FO7B 3FZ3A 2RR13 3BYWA 5FJKA 1VMFA 4LE3A 3SXWA 1T2XA 2B46X 4AVTA 1W8HA 3DUIA 1D2QA 3VHOA 1G7YA 1BHGA 5HCAA 2VNVA 3NJVA 1PGL2 3ZXKA 2HH9A 2FDKA 2HWD2 1AXYA 1VBC2 1CZSA 1BKZA 1J1TA 2Y33A 1R1A3 2WNVC 4K21A 1A78A 1RC6A 2WN3A 2Q30A 4GWJA 1T6GC 2JIJA 4PBPA 4MZUA 3H8XA 2CSGA 2WIIB 4FI9A 2OPWA 3TEWA 3LEMA 5C9AA 5JAXA 1HLCA 4XMIA 5JOYA 4A3ZA 1WCUA 5BYNA 3FBYA 1S2BA 1VP6A 1ENSA 5FYSA 2A70A 3M8LA 2EXIA 2QQOA 2PFWA 4R52A 5E1RA 3KGLA 3GCXA 3RZLA 4EJRA 1R64A 4Q27A 1WGPA 1H4HA 1V6LA 4HG6B 1IPSA 4AEKA 4BQ5A 1D4VB 1HRV1 2IZWA 3H3ZA 4LITA 4AZZA 4IW3A 4C1WA 2JXAA 4DFSA 2WNVB 3VD7A 4R9DA 1BEV1 1LECA 2R073 3B01A 3AZYA 1X50A 3W59A 5JSRA 3N35A 2QFEA 1J58A 1HRI2 1TQ5A 1G9FA 3VD9A 1MS4A 1AJKA 1RGSA 1YQ2A 1RUC2 2HWC2 4KU7A 1YXWA 2FZ1A 2ZCWA 2GNDA 4LK7A 1Q8VA 2XQRA 1V6MA 2ZEWA 2EIBA 1WBLA 1LHVA 2H6BA 2ES3A 3ACHA 4FP2A 1ZBE2 2DCJA 4YYOA 3ZYIB 2XBO3 1Q3EA 1U12A 1MZ5A 2CU5A 2YFUA 1O3QA 2YBKA 4YPJA 3V0BA 4YNIA 1NAEA 5LA1A 2D43A 4BH9A 3MDPA 5FBJA 1BK1A 1W28A 3SCHA 4MVTA 3WF3A 2H0VA 5T5LA 2YU2A 3MV11 3EXUA 3C7HA 2UWBA 2ZGLA 1VMJA 2WAOA 3PU3A 3PUAA 4GWIA 4ONUA 4Y33A 1ZZ6A 4Q29A 4GJYA 3BPZA 4K8RB 4LTAA 5DDJ3 2BNNA 5J98B 4UFIA 4KL1A 1GNZA 2OPKA 2WZR1 3J4UH 5JPNB 4XXPA 2UY9A 1HV0A 1JOJA 2ATFA 1VBD3 1QNWA 3ZYGA 1MEC2 3MZHA 3ZYBA 2JDHA 4YVWC 3GCWA 1CAWA 4YW1A 4AFDA 5K9YA 1NCRC 1YIFA 4BK4A 3HEIA 4HOOA 2RS32 1LR5A 2ZX0A 3ABZA 1M4WA 2HWF1 4XQDA 2ZEZA 2WZEA 2OIIA 1QQP2 1Y4WA 1LU1A 2D97A 4L8QA 4NHXA 5FZEA 4XBLA 4XFIA 3UKTA 1I5ZA 2J1SA 3B02A 4UW5A 1NLSA 1CX4A 1RUD1 1I5PA 4Y5TA 5C70A 1YQ8A 3WG2A 2AZ5A 2WNOA 2W1QA 1Q8QA 1HJGA 4DO0A 1UPIA 5IJRA 2XXZA 1E5IA 3ETQA 4QX5A 4AOCA 1UYXA 5I0RA 4YVWB 4EWAA 1S0FA 1CESA 1NCRB 3B7MA 3N9QA 2XLFA 4BK5A 1OLRA 1COV1 1AX1A 1E57A 1W2OA 2X5IC 4FXGB 4LJHA 5ANNA 4DZGA 5IVCA 2NMOA 3BTYA 2R16A 2XVKA 1YWKA 2A6ZA 3SNMA 4FPJA 3ZIWA 5BPXA 4DXRA 1C28A 3HNYM 1W6MA 3VZMA 2OVUA 5IUQA 1OURA 2E9QA 1GP6A 1R081 3BOPA 4RS5A 2QDRA 4Q4Y2 2W39A 4Y20A 4Y3OA 1W0PA 2BVBA 3T3YA 1NG0A 1ALYA 3O1MA 2RMU3 3OUHA 5CYYA 1IS3A 1FOD2 1CR7A 1H6XA 5BNPB 1JZ4A 4Y5SA 2WO7A 4BHPA 5C8WA 5KXDA 2YYOA 4XAAA 4B7EA 2PHFA 1W2NA 2W87A 2VTFA 3IT8A 5GZEA 5FLIA 3NNGA 2GC3A 1YLLA 2PA7A 4BJ0A 4COYA 4AVBA 5A3UA 1BBT2 1O3SA 2HWE1 2X5IB 2HBTA 1OT5A 3KV6A 4EV0A 3AB0A 3JQWA 2C1FA 3B9IA 1Z7S2 2IXJA 1PO23 1EPZA 2RM23 3LDBA 5SV8A 1QDCA 5BXXA 2WFPA 3N3HA 1I9RA 2CWMA 1JHNA 3POJA 3OGGA 4DY3A 4N53A 3JD73 3N7MA 4Z2WA 5F6KA 1OKQA 4TLGA 3A7QA 1ULGA 3USUB 1VLNA 2BTVC 2PTMA 1RUF3 2LS6A 3BN6A 1YIPA 1WCSA 4QX3A 4E27A 3SH4A 4META 3VKLA 5A7OA 3K46A 3DL3A 1QJY1 3C3VA 1ASJ3 1OD5A 1WMDA 3QD6A 3SCGA 2ZMLA 5F6LB 4QQOA 3H7JA 4Y5Z0 1X9TA 2QVSB 5L9VA 3BVCA 5A3LA 3IDCB 3DPRC 5KXEA 1RUH2 3H8OA 2ZKNA 2W1SA 3P1IA 5K0UA 1UZVA 4CEYC 2AREA 4IGOA 4FQZA 4MXWA 4XZUG 4NHLA 5AFBA 3POGA 3PIGA 3PVBB 4AHZA 4L11A 1XE0A 4E8DA 1KITA 2QQMA 2E6VA 1OPMA 4E4SA 2WRAA 4M3CB 4QX0A 3PJQA 4YM1A 4NHYA 1CD3G 1N1TA 1B09A 1F15A 2VECA 3H1YA 5FZ1A 3KF5A 2EAKA 4QPWA 1NE6A 4QD2A 1ENQA 1XYPA 2VZQA 5DAQA 5H9RA 1ENRA 2YC4A 4GB33 4J6GA 3HIFA 3DPRB 4AI9A 2P3KA 4RGGA 4DB5A 2ZGPA 5FZ3A 2ZBJA 4XHBA 1JH5A 5I0TA 5FZ4A 5FQ0A 1PVC1 3RJ2X 1X8EA 2MPFA 3AP6A 4CEYB 1W05A 2OT7A 2VMCA 4I30A 5FZCA 1G9AA 3OUIA 2AUYA 4NPLA 4CCOA 2J22A 4YARA 3WNXA 4Y26A 5JOXA 1KGYA 3MIEA 4HVQA 4NPMA 3T4HB 5LW9A 3LD8A 4F3JA 1QJU1 5A33A 4XCAA 4Q0UA 3AXDA 4AW7A 3QBQA 4QKBA 1W6QB 4O9GA 2OQ6A 4GH4A 1UXXX 1RHI3 2UYBA 1IZ3A 1WLTA 2FZ2A 3OPTA 4P5YA 1ST8A 2D3RA 3PVEA 5FYUA 2Y0OA 4W6WA 2MHFA 3FLPA 1QJX2 1OKOA 1Q5OA 1VAVA 2ZS6B 5A6ZA 3U0ZA 4Y22A 4BDVB 1OUSA 5ABJA 4OYUA 5DABA 1FNYA 1VIWB 3IPVB 5A7WA 1A3KA 4RA0A 4WM8A 4BQ2A 1ACCA 2D3SA 2XJRA 3RPQA 1MACA 1SBEA 3KSCA 2D6PA 1BK0A 4FOVA 4I3GA 4LOSA 2VW2A 4WZCA 3SC7X 3I2IA 1UKRA 3AM2A 4FFIA 1K3IA 5A6QA 3MI8A 4XUTA 3GALA 4J1XA 4JDMA 3EBRA 3SHRA 3KCYA 3PL0A 4W65A 1CX1A 4COVA 1AR71 3LDKA 3Q8AA 5FXZA 4XUPA 1U5XA 1HXS2 4EN0A 3VD4A 2JDPA 5FCCA 1DGWA 2RG4A 3UV9A 4AAXA 1JMUB 2MEV3 1RUE3 3KCCA 3I2JA 2GN7A 4EWDA 1HDKA 4KI5M 4BYYA 1RUH3 2D6LX 3PUSA 2V4AA 5BNQA 3AZWA 1HN0A 4Q0QA 5GZFA 3VBRC 1UKGA 5F9TA 4XBQA 1QDOA 5FZLA 2O8OA 4PI2A 5IK4A 1HB1A 1KEXA 2XKOA 1BJQA 2JJ6A 3BCWA 3K3OA 3IDEA 4KGGA 1YFWA 5AC91 4XURA 1V00A 1FXZA 4CP9B 1NA1C 4CUAA 1W9TA 4C90A 2ZHNA 3KHBA 5CB7A 3WOGA 1CAXB 1D4M3 4NAMA 1UYYA 4YGDA 5FZ9A 5I0UA 3LF7A 3U4XA 4P9YA 3S57A 2J1TA 4R4XA 2DCYA 2BRTA 4HZFA 4C1XA 4OHZA 3TN93 2E7AA 3K2OA 1AXKA 3I2OA 2ZEYA 2WNVA 4FPCA 1CONA 1S0BA 2FDFA 2VUCA 3ELNA 3MFAA 3VBRB 2B5HA 3OGSA 4IE6A 4N7IA 4P9GA 4TSVA 3LEKA 4QQPA 3WW4A 2WNUC 4AAPA 5E8AA 4EZ4A 3PLQA 1DCSA 4OZXA 2WT2A 1NA1B 2NYYA 3GF6A 1Q8PA 4CTEA 2YZ4A 2BFUL 1GUIA 3M1HA 1R091 4NIAA 5JR2A 3HNMA 3IIAA 4GWMA 3ZSMA 4ITCA 5LB6A 5GLZA 4MOAA 4CDUC 1QJX3 3OUJA 3MIDA 2BOJA 5E89A 1X33A 4D7SA 2QQKA 4IEVA 2HLEA 1C5HA 4JKLA 2A5ZA 2R32A 3FBMA 4FOYA 3DEMA 4NAOA 5FV3A 5HXVA 3WNKA 5J3UA 2G1MA 1W3VA 4MXVA 4TZDA 4XF4A 4GMP1 4UT5A 2WLQA 1NLRA 2WNUB 2K9ZA 3CMGA 4XJWA 3RNSA 3TNPB 1P8JA 4LHNA 2JG8C 4NRMA 3VZNA 1XU2A 3FHIB 5ACA1 2VMFA 4XILA 5G04L 1HRV2 4MO3M 2Y0IA 5FKCA 1W8TA 1RINA 3ECQA 4XUNA 1BEV2 4LK6A 2I07B 3SEPA 5K8SA 2KXLA 3O0XA 3MO4A 1SBDA 1ZBA3 2QZ2A 2O0OA 3AXEA 4CDUB 2I74A 3DXUA 3UT0A 2A6YA 4UWDA 5KHGA 2Y6JA 2QQIA 1GP5A 1GP4A 4GZ9A 3KVAA 2YY1A 3I2KA 3EQEA 5DZGA 3O1TA 1X8MA 5F2SA 5BUVA 1O59A 5T54A 1FMD1 1NXMA 1AL21 1RUJ3 1PO11 1LCLA 3POWA 1KJRA 5FUPA 3I49A 1ODNA 4EN8B 4QGMA 3HJRA 1UZYA 4NN0A 1H30A 4IETA 3ZFEC 5CVRA 3MHZA 2B39A 4YVWA 1AUYA 4P5HA 4ISQA 3U4SA 3W21A 1NZIA 3ZSEA 5LCWL 2NP0A 1WW7A 2AH2A 2P34A 3ACGA 1QWRA 2ZX3A 2YBPA 1ZZBA 2V4VA 4YSFA 4GKYA 1LOFC 4DUXA 2WZR2 1SLAA 3Q8BA 3I2FA 1G6NA 2Q1ZB 5KHJA 5EIYB 2E26A 1W9WA 4LO6B 4BISA 3LGRA 1OH4A 5EQUA 5JUVA 4WM7C 1RUG1 3ACLA 4KWJA 4JGZC 2R1DA 5FUNA 1W90A 1GNHA 3H3LA 3LIGA 1LGNA 2V72A 4OQ9A 4P02B 2ORXA 4QXBA 2DVAA 1HQNA 2HWF2 2UWCA 4FQ4A 1G86A 5FZBA 5LK5A 1JYCA 2EIDA 2D6MA 3HT2A 5F8PA 1SFNA 4YW2A 5BNPA 4AK3A 3KT1A 3HWJA 3CBNA 4NIIA 3N9PA 3N36A 5EJZB 5JOWA 3ZFEB 4ES8A 1SBFA 3MW4A 4ARXA 3P6BA 1QXRA 1IKPA 2HWB3 2PHTA 1EV13 2X5IA 1IS5A 3U11A 1RUD2 4BWOA 4O65A 1AYN3 5D1IA 2FCUA 5A3PA 2B9VA 5EJ1B 5A7PA 2P2KA 4IGPA 2J1AA 2RVAA 4OI4A 4WM7B 4N9HA 4CCLA 4AGGA 5CG9A 1JUHA 1MQTC 2L9LA 2V5YA 1SMVA 1COV2 1X82A 3RRDA 2JE7A 3USUA 3GJAA 1XRUA 1K42A 1ND2A 1PVXA 3D8CA 3SEEA 4Q4X1 1AYM1 5GZGA 1FT9A 1GWMA 3WDUA 3VBUC 2A75A 1N3OA 3IMMA 3VDDA 5CFCC 1F5JA 1FPN1 1R082 4XIKA 3QLQA 1G9BA 4W6XA 4Y1XA 4I2OA 4A6SA 4OMCA 4COWA 4MGYE 2PHWA 3GJBA 5F5AA 2XKPA 4OCTA 1PIV1 3CDZB 3LEIA 2VZRA 3UGGA 5HPOA 2WFF1 3FWEA 1YEWA 3BU7A 4W8JA 1SLTA 4XIOA 4GQ7A 2WABA 1AR83 3LSEA 1G9DA 1GU3A 2JD9A 2LM3A 2VNOA 3ZVXA 3IB3A 1V6KA 1W03A 4IE0A 5FTTC 2BBVA 3KGZA 1JZ6A 4M3CA 4FTEA 4HETA 2WR9A 3DCQA 4DXSA 4YZ4A 2GSYA 1WCDJ 3VBUB 3FL7A 5CFCB 2GMMA 3KHCA 2VMIA 1PMHX 1UOBA 2XLAA 2VZ3A 2CWSA 2W47A 3H0OA 4DUWA 3JB8A 4Q1RA 2G4IA 2VL4A 3DPRA 4MGKE 2ZGTA 1LGCA 2VOVA 3OGVA 3R4DB 4LBKA 5C3PA 4QX8A 5JXHA 5IVFA 1UN1A 4O7XA 4AHWA 1BQPA 5FK8A 4K1ZA 4ATEA 3LFMA 4CEYA 2K2SA 2V09A 4M0HA 4ZU5A 5FDBA 4LHLA 4LBOA 5FZKA 2XH6A 1QJY2 4NHKA 4AE2A 2VOKA 4OI1A 1N1SA 1GZ9A 3RG0A 2VCMA 1J3QA 1W6QA 1TME3 1XNAA 4P9XA 2HEWF 1LENA 4BIOA 3POSA 4Q4V1 5FZGA 1H2MA 3RZZA 4NOTA 4AGRA 2JECA 2W46A 3NWKA 4I0BA 3LE0A 4JC1A 4MLOA 4YFZA 3CIHA 1WA4A 2BDRA 3MW3A 2JEMA 4QXCA 5EP9A 4QPYA 3B9CA 4PT6A 1VRH1 5F32A 3O0WA 1GWLA 4A44A 1H8TC 4XHXA 2VBDA 2ZX4A 3IZOA 1JXNA 4PDWC 4FBFA 1J84A 3WNNA 1UMZA 3RZJA 1RB8G 3NV3A 4MX3A 3WD5A 1PVC2 3PMSA 5FZ8A 1O7FA 2ZHLA 1DQ4A 5FPUA 1AR63 2Q1MA 5DUXA 4QDSA 5HBAA 3BB6A 1QJU2 1XJAA 4XZPA 1JZ3A 4FOQA 2EAAA 1LKNA 1JZ8A 1X9PA 4HT1T 5F5CA 2NM1A 1B35C 4A42A 2JE9A 1GOFA 1ZA7A 1V9U3 4CP9A 3WR0A 3QACA 4JTNA 4PDWB 2QQUA 4Q0SA 4HKLA 5F2WA 2XJPA 3QH7A 4Z8BA 1ULFA 5IVEA 1CAXA 1DIWA 1JTZX 3S0MA 3OD0A 3K4DA 5JWPA 4H2AA 2X53S 3GHMA 4DMIA 3KD4A 2ZGSA 1AF9A 2W68A 3TB0A 2VU9A 3CQOA 1Z78A 2Y6HA 4BU2A 4YZ1A 3PDQA 3C7FA 3VBRA 3ORJA 4CVUA 2QNKA 1AR72 2Q5TA 2ZGOA 4HL0A 2JX9A 4XDQA 1O4ZA 2QUOA 5KHHA 1RTVA 1UOGA 2VC9A 4IDZA 1V6OA 4JVAA 3MLLA 3WCRA 1JOBA 2O14A 2DF7A 4IE7A 1NA1A 2PAMA 2XL9A 1ZZ7A 3MYXA 4NUBA 3VDCA 5A7QA 3EYPA 4Z82A 4LEJA 4KG0A 2RDQA 4UBGA 2Y64A 4K8FA 4QHZA 2ZPXA 3UKNA 1UY0A 1OI6A 2QQVA 1TZOA 1JYTA 1TVGA 5AC92 5JZGA 5IFPA 3JBG1 2RS13 1Q43A 5DG2A 3AJYA 2EIEA 5IK7A 2JKXA 1VE0A 3KLSA 4R8HA 3ZOIA 2F4PA 3C8XA 1SACA 3U75A 2WNUA 4XF3A 3WDWA 2A71A 2P1BA
chains in the Genus database with same CATH topology
1LOEA 1WUVA 1O4YA 1DBNA 2XVLA 4RHV1 1TMF1 5J37A 1PHMA 1DGRN 2ZAAA 4L97A 4GWNA 4HVOA 1ZVFA 4NWVA 2TEPA 1QOSA 4FPLA 2BFUS 4GIQA 1NE4A 2RS53 3ZFFC 1UW8A 1XYNA 4CDUA 4XJUA 3FLTA 1SLLA 2VVFA 3WT3A 3IMNA 4IL7A 3SH3A 3LCPA 1ULCA 4BIFA 4DXZA 1L3JA 5FFOC 5KHIA 1R092 4I01A 4H7LA 2R0HA 3OBRA 5E88A 1AXZA 5J96B 1NXD1 3E97A 3A0KA 5D8AA 2GNMA 4FSJA 3PNAA 2WWSA 3WP6A 3LA3A 4BMBA 4GMP0 4Y24A 1QOOA 3ZFFB 3OYWB 1GICA 1U5IA 1AR93 1WLCA 3O12A 3APBA 5ACA2 4R9BA 1QHDA 2E53A 3MLKA 3W58A 4IQPA 1CVNA 3PVOA 2WS93 2VW1A 3N7JA 4KWLA 1FI2A 1RUI1 4I3PA 4E2SA 1REFA 1WMFA 1GYKA 2AR6A 2QKDA 4I0WB 1SQ4A 2C5DA 4IEQA 3VZKA 2EALA 1SLBA 1AX2A 2LTNA 4FPOB 1ZRFA 4C0HA 3ZFEA 4AFAA 3IBMA 4EN6B 1HV1A 4CDQA 5FREA 4HKWA 2DWRA 4BLJA 4IV3C 2H0BA 1AL22 2BUKA 2GH2A 1PO12 4Q4W1 2VNRA 2BPA2 1HX6A 3VBFC 4IEOA 4WM7A 4KU8A 1IGOA 4GA9A 4BE3A 5T5JA 4KQ7A 4OLLA 1RMU1 1SCSA 1DF0A 2PHUA 1OPOA 1QH6A 2OUHA 1OQEA 4XJ8A 4KWKA 2D40A 2P37A 4PIZA 4KH9A 5E16A 3H9AA 1CQ9A 4AQ6A 1RVF1 4LBNA 1YNAA 1RUG2 3HD8B 2HWD3 1VBC3 4K7JA 3WG1A 4IV3B 3D6EA 1LEDA 5I8SA 2D98A 3PHMA 2Z2SB 3R05A 3OBTA 2XJUA 2YC0A 3VBFB 3USSA 3WW3A 2N7GA 1VBA1 2VMGA 4OHXA 3CEWA 1NQDA 2ZGRA 5GZCA 3LZZA 3WDTA 2YXSA 4AG4A 1O4TA 3W9AA 4X8PA 1U5YA 3SISA 3CL1A 3JU9A 2WLPA 4PQ9A 1ZZCA 5LRSA 1BXHA 1SCRA 2PLV1 4XFFA 4B8EA 2ZTNA 1ULDA 3RMYA 1N1YA 2NPIA 4CP0A 3D0JA 3NJZA 5J36A 4AFMA 2C9AA 1QGLA 1YI9A 5I93A 1MS5A 3H1WA 2UYAA 4Q1PA 3V0AB 4MUVA 4Q4X2 2G9GA 1AYM2 1HRI3 2XLGA 4G9SB 3WVJA 1M06G 1RUC3 2HWC3 2XJVA 3NV4A 1FPN2 1VBB1 2YHJA 1C8M1 2E63A 3BODA 4PCRA 2YV8A 3AKTA 5BV6A 4RGAA 4FTSA 4HSLA 1PGW1 1PIV2 3R6SA 1EP0A 1ZBE3 4LUMA 2WFF2 4MH0E 2IWGB 4B4RA 2W0XA 3NAPC 4JTOA 2D6OX 1C57A 1S1AA 1KRIA 3J8F2 3FJSA 1QH7A 3M7AA 2R041 1ND3C 3M3EA 4P9IA 3WQ0A 1K5MC 1GLHA 2DVBA 3ZDSA 4BQ1A 1G9CA 5A32B 3URFA 1DHKB 5KHKA 4XFAA 2ZMNA 3WP4A 2R061 4AHYA 1MEC3 3AYCA 1A8MA 3MPBA 4Y4YA 2WA3A 5FMOL 3DN7A 4FTBA 2RS33 1AJOA 3M4FA 3NAPB 3ILRA 4LE4A 1GBGA 3V64A 1F8VA 4F83A 4R9AA 1QQP3 1ND3B 1QOTA 1VBE1 3INAA 4TYSA 3WDYA 1FV2A 1K5MB 4YGBA 5BNOC 4Y1VA 3AZXA 4Q4V2 4YGCA 2XWBB 1CAUB 1POV1 4PDWA 1RIRA 1EAH1 1N3PA 2AYHA 3LKJA 4N43C 1FAYA 4LBQB 1PZ8A 1VRH2 2G9FA 4YW4A 5H9PA 4DY5A 5JI9A 3EHKA 4JQRA 4QXKA 4M0NA 2DUOA 2DCKA 3LSDA 4Q4Y3 5BNOB 4ORFA 3VBOC 3WG4A 1H9WA 2DV9A 1OA2A 3ZSLA 4FT8A 3KB5A 1FOD3 1V6NA 5EJ3A 5FAXA 4I02A 5JI7A 1NCQA 1W2UA 4HPKB 5AVAA 5C4WC 3OY8A 2DCZA 4N43B 1LB2A 2RR11 2WT0A 1BBT3 1GSLA 2PHLA 3OGJA 2ZGNA 2ERFA 3RDIA 2DYCA 3J8F3 4E2QA 5CADA 5CFDC 4LT5A 1Z7S3 3AMMA 1ZZ9A 2DTWA 2VOWA 4A7KA 4HN1A 3TBDA 1MS8A 4RR3C 3IN9A 5L19A 4YW3A 3ST7A 3OD4A 5T5OA 2E51A 3IWZA 2VVDA 4XFCA 3WZ1A 1REDA 1DZTA 4F7ZA 4IXLA 5DUVA 4CZSA 4PLNA 3VL8A 3RQ0A 1H2KA 1LEMA 2DTYA 4UW6A 3VKMA 2XWJB 2ZA9A 4QPIC 4NR1A 5CFDB 4FP3A 1TEIA 5F1RA 1J3RA 4JDOA 5T5PA 4OHYA 1WLWA 2IXLA 3I2DA 4XF1A 3CJIC 1LGBA 1IS4A 3PJYA 2K0GA 3MICA 4RR3B 3R0RA 5GJ6A 1DU3D 5DUUA 1WMEA 1FNZA 1C8NA 2R071 4JCKA 1ZNPA 4XFBA 1LOBA 3JBG2 3WX5A 4ATFA 4FO9A 1BVVA 2YGMA 3S6PA 1Y7BA 3O7OA 3OYWA 3KM5A 4RSUA 3ZFFA 4C91A 1REEA 4FPEA 2BNOA 4RHV2 4LHKA 1TMF2 3EO6A 3CJIB 2XBO1 3B94A 3ZN4A 3GZTB 3GZAA 2I45A 4L2NA 1WW4A 2GMEA 2OZ6A 3RYKA 4RQPC 4WVVA 5GLVA 3NL1A 4AI3A 1G8WA 5GLWA 2A73B 3THPA 1PMIA 4FOWA 4AXOA 3FUOA 5DDJ1 1JW6A 2JICA 2VH9A 2A3YA 4BMEA 1X36A 1VBD1 2CGNA 1XNKA 1LHUA 3MIHA 4PIYA 5KWRA 1CGPA 1KD7A 4E4DX 3ZYRA 5DZEA 5L7OC 1PM7A 4D94A 2ARBA 3ATGA 5HCBA 4RQPB 4M01A 3WLUA 1HXS3 4XTPA 4PIXA 1GQHA 5C6CA 3RJRA 5CAZA 1C1FA 1PNFA 2VVEA 1RUI2 1IPJA 2GAUA 2ZABA 3OJBA 4IV3A 2GDFA 3ILNA 4LUKA 3RSJA 2YGLA 4AVVA 3PVNA 3VBFA 4D7YA 5GKAC 5JDBA 5L7OB 4WVZA 2JG8B 1IS6A 4X6QB 4K20A 5EYXA 4Q4W2 3THTA 3SH5A 3D82A 4ZU7A 3VBSC 2PHDA 4SBVA 2GC1A 1TNFA 2P3JA 5C8CC 4Q26A 1SFYA 4N90A 2RMU1 1NCRA 3I4IA 3I8TA 1O5LA 5JIUA 2W52A 3WUDA 1RUNA 3K48A 3CLPA 2ZOEB 4AI1A 4OHWA 2ZX2A 3L2HA 3V0AA 3E5UA 1RVF2 1DGRA 1IKQA 3I59B 3ZIXA 4YLZA 4DNYA 3O14A 3B69A 1LTEA 1ZX5A 1PO21 2RM21 1WCKA 2R49A 3VBSB 3ZXAC 4A3XA 1Q56A 3JD71 4TLFA 4FXKB 5C8CB 3AYDA 1VBA2 1RJ7A 4YZ2A 3UJQA 2FMYA 3M3CA 4TWTA 5JCTA 1RUF1 5JIAA 4IEYA 4XF9A 2Z5WA 3NV1A 2NMNA 4Q0PA 1YFXA 3L2YA 4I0AA 1ASJ1 5A32A 3HMYA 2PLV2 2CYFA 4JGZB 4Q2FA 2PELA 3ZXEA 4QHBA 1LULA 4BLIA 3B00A 5JLVA 3P3PA 2HEYF 1YO8A 1HRV3 3E6DA 1MVQA 3M70A 4XJAA 1D0HA 3KT7A 3QCWA 1BEV3 2XVGA 1H4GA 3MPPG 5I8TA 1S0EA 1DQ2A 3HAGA 4OI2A 1PZ9A 4S2DA 2CGOA 3NAPA 3TYJA 3GBGA 3ZO0B 1DQ6A 1VBB2 4IERA 1C8M2 3BALA 3WQ7A 3JZVA 1F2NA 1ND3A 2VNGA 3SITA 1K5MA 3VHRA 1PGW2 2IXHA 4GB31 1MQTB 1BMV1 1UD1A 4U2AA 4XPVA 1CAUA 4PF5A 4Q4W3 2HWE2 2QDNA 4XFGA 1CAWB 4FAHA 2DU0A 1WLDA 3NKTA 2R042 4LBQA 1ZYBA 5SV5A 2WKKA 2B7YA 5T50A 4E9KA 1VALA 3D5OA 3POYA 2WZR3 1PNGA 3MLJA 4ASLA 2FQPA 2R062 1RHI1 2DCTA 2VMHA 1ENXA 5BNOA 4QGLA 4WVWA 1EYBA 1MS1A 2CAUA 5L36A 3AKPA 5J48A 3I54A 2ZGMA 2HWF3 1YCIA 3VLBB 2QQPA 4KBBA 1MS9A 4XYXA 3S7IA 4WVMB 4HPKA 4H55A 3QH6A 2GNTA 2ZJCA 4N43A 3G7DA 1Q8OA 1VBE2 5FLHA 4I09A 4XETA 2ZACA 4AI8A 4HBNA 1H0BA 4FAGA 4XMAA 4P9JA 1RUD3 1UIJA 3MW2A 4LA2A 4LBQD 1POV0 1YFUA 2VULA 3IPVA 5FLJA 4HANA 1EAH2 2MEV1 3AYEA 1RUE1 2W08A 4N53C 2GALA 5DXDA 4A7YA 2VG9A 5CU1A 1RUH1 2OW4A 3AX4A 1JBCA 1COV3 2XJSA 4AVSA 2WL1A 3J9SA 5AVPA 3WCSA 3WINE 4BPZA 1O3TA 1I3HA 2XGXA 3RWNA 4DS0A 2EIGA 4AEJA 5J7MA 4AQ2A 1R083 5CBLA 4Y1ZA 4DPNA 1KXGA 2XUMA 4YRDA 2Q4SA 1IHMA 1UCXA 5CFDA 1D4M1 1OMIA 3VKOA 1DG6A 4L92A 1UU4A 1CJPA 3KZ4C 4N53B 2HEVF 3TN91 4GALA 2ZKLA 2RR12 4RR3A 5CIRA 1H8TB 1DZRA 1VB2A 2IXIA 2HWE3 4OHVA 4DINB 3VBHC 3V56A 3LOIA 3HT1A 1MS3A 1Y9QA 3RI8A 5KC5A 2OZJA 4PLOA 1ONAA 4FPFA 1JYIA 1X7NA 1QXPA 2D93A 2RJLA 2BWAA 4MXWB 2MNGA 3CJIA 3WDVA 2Z79A 1ZA4A 4AEMA 5EWSA 1QJY3 1ULEA 1B35B 1S0GA 5LK7B 2PN5A 1WW5A 4RL7A 5GLUA 2VW0A 2LALA 2RJKA 4XTMA 3TWIA 3WP5A 3FUQA 3VBHB 1FX5A 4CDXC 4XQWA 1KDMA 2YDEA 2CGPA 2ZZJA 4UW3A 3AMQA 1W6NB 2DUQA 2R072 1GQGA 2TNFA 3OPZA 4DRRA 1A8DA 1EAH3 1GZCA 1FV3A 1ZBA1 1OQDA 4K6BA 1PZ7A 3MIFA 1OHFA 2UWAA 1YRZA 4Q8KA 3AKSA 4ISRA 1MZ6A 4S2FA 4A7ZA 2XPJA 1AZDA 4AF9A 3AZVA 1SLIA 1H8VA 4CDXB 1S0CA 1PVC3 1RUJ1 1WD3A 2RE9A 2XBO2 2IFWA 3VV1A 1BCXA 4Y1UA 2ZAHA 4CRQA 1HQWA 1QJU3 4CP1A 4FCAA 2ET1A 1XXNA 3CF6E 3NW4A 4IESA 2VY0A 1RUOA 5L7OA 3GYDA 1PK6C 1KFUL 5DDJ2 1DZQA 3H50A 2JG8A 2ENRA 1VBD2 5IK5A 4EN9B 3QOPA 2RHPA 2GMPA 3ZXLA 1LOAA 1V6IA 1NZCA 3M3IA 4P14A 3WY6A 2D44A 2SBAA 5BY5A 1AX0A 4Z92B 4IV1C 3U07A 4Y1YA 3D4KA 4R4ZA 3GBFA 1GZWB 2B8MA 4ZU4A 1N47A 4MSVA 1AR73 2WJSA 2HWB1 1HW5A 1EV11 1ZM1A 2DFBA 2EXHA 1PK6B 2WA4A 3I59A 4OVEA 1AYN1 1J59A 5GALA 3DKWA 2YPJA 5JVVA 4KNCA 4F8AA 3VBSA 4GKXA 5C8CA 2VUJA 2FMDA 2GU9A 4XEZA 1W6OB 2PHXA 4GXLA 4AHXA 4IV1B 1FMD2 1Q8SA 2R30A 5AC93 2UURA 3VHNA 1LOFA 2PYTA 1SDWA 3R4SA 4BZ4A 4BM8A 2B45X 1LOCA 1UAIA 4BA6A 3JQXA 4H7MA 4JGZA 2NN8A 2RMU2 4YG3A 1V6JA 5FOJB 1UPSA 4XF0A 4JRAA 1QJZA 3WW2A 1ZREA 1GV9A 4DQAA 2BEOA 5H9SA 1ZZ8A 4KG8A 2ZZQA 1QXJA 4B4QA 4E4ZA 1AR81 4QQ2A 4B4PA 5L73A 2EXKA 3TAYA 3Q9OA 4FVVA 1YUDA 2GC2A 1XQNA 5GLTA 4YZ3A 1LU2A 3MFCA 1PO22 2RM22 2F6BA 4NHMA 3LOBA 4LO8A 4BCUA 5JSPA 1R093 3KS7A 1VAMA 2QZ3A 4IEZA 2LUWA 4WV8A 3JD72 3K51A 1H1IA 1MQTA 1H2LA 5J09A 1APNA 3UL2A 3VN4A 5JMCA 1RUF2 3NVCA 4QQLA 3RI9A 2ZX1A 4XE9A 4LR4A 3U10A 2EF6A 4L99A 4COZA 1DYKA 1VB4A 3I7DA 4GMP3 3VBUA 1ASJ2 4A2UA 5CFCA 2JG9C 3OF1A 3FFZA 5ACA3 1TME1 1D2SA 4AI0A 2E7QA 4IEPA 4Q8LA 1J1LA 2ET7A 4CDWC 3ROUA 4CYDA 5BNNC 3ZN6B 4NPRA 4QGNA 5FO8B 1OA3A 5BNPC 2ZMKA 3ZPYA 2A6VA 4AEDC 2PAEA 4WVMA 3LA2A 4LLFA 1C5IA 4XBNA 3ZXDA 3TNQA 1NY71 3ZFGC 2JG9B 1FMD3 4GB32 5DUWA 1BMV2 1AL23 3H7YA 2DUPA 1PO13 5A3MA 3N7LA 2PAKA 3N4MA 2FBEA 3D0SA 2HJIA 3VZLA 4CDWB 5I0SA 2IXCA 2ZHKA 4JRLA 4L9BA 2YUEA 1AR61 5BNNB 2CTVA 1Y43B 5GM0A 3S7EA 5KXBA 1ND2C 1UX6A 4FPYA 4YFWA 4MV2A 5TSWA 4AEDB 3H3UA 3VDDC 4IEUA 1RHI2 4QU2A 2WC2A 1RUG3 1V9U1 3E5QA 3ZFGB 1RL3A 1UU5A 4B3NA 2JKBA 4AWDA 3CU7A 2EVXA 3OTFA 4YM2A 3VKFC 3E6BA 4YG6A 3GBWA 4P9LA 4YM0A 2VGDA 3WDXA 3C2UA 4AYUA 3AKQA 1H8TA 1QKQA 2VOXA 1KQRA 3HN1A 3TRSB 1ND2B 4XW3A 1MS0A 3OCPA 1V70A 2D5FA 3M2MA 3VDDB 3ZMNA 3BOWA 4OFGA 4URTA 5F5QA 2MEV2 1RUE2 5T52A 5T3NA 3T1MA 2JDZA 1GR3A 5LRRA 1UL9A 4XFHA 1CPNA 1MZFA 1KFXL 2GZWA 4BOWA 4K3UA 4Q4X3 1UF2C 1AYM3 3AKRA 5C33A 3WHTA 2I2SA 1FPN3 1B35A 2RS11 3J26N 2JD4A 2PHRA 1S0JA 3MF9A 2A3XA 2YMZA 3VUOA 1D4M2 1XNDA 4M3CF 3VBHA 5IK8A 1PIV3 5B2GB 2WINB 4D69A 2WFF3 1XU1A 3TN92 4JGYC 3O5SA 4MGIE 4UW4A 3WUCA 2WNEA 1W6NA 1YJKA 3AP4A 2KA3A 2VQAA 3VHPA 2RS51 4AFCA 2OUJA 3NV2A 4LA3A 3GZUC 3KMHA 1LHOA 2WZPP 3VBOB 3VKNA 1XNBA 1R1A1 1W6PB 3PMEA 1NQJA 5I8YA 1N3QA 4XXAA 1ZRRA 1MR5A 1O3RA 4HSJA 4ES9A 2CY6A 3E5XA 4JV4A 4O9EA 4CDXA 5C4WB 2CAVA 2CL2A 1DLLA 2BYVE 3VZOA 2VPVA 4JGYB 4X6RB 5FBZA 1CAVB 4ASMB 4QT6A 2OYZA 5LEKA 2WQZC 2Z42A 2AGSA 2IFRA 1DQ1A 1CN1A 1OA4A 4NO4A 4AFBA 1YFYA 1AR91 3NSTA 3ZXGA 4Q4V3 4XJ9A 3SCFA 1R1ZA 3T2TA 1U5ZA 5KXCA 2DFCA 3R4UA 2ZHMA 2WS91 1ZRCA 3FX3A 3ZX7A 1LOGA 3WXPA 2A3WA 2BQPA 2R0FA 3FC0A 1VRH3 4YVSC 2UY8A 1ZBA2 1F31A 1OFNA 1FATA 1Y3TA 5AFEA 1GZWA 4QPIB 1I1EA 1BYHA 1HQLA 4P9WA 1D0GA 1KJLA 2TBVA 1RITA 4QPGC 3AJZA 3B5LB 4LBMA 1URXA 1PK6A 2EA7A 1RUJ2 4J1WA 1HKDA 4YM3A 4CP2A 1DQ5A 4YGEA 2BGCA 1WD4A 3ZN5A 4CEWC 1TE1B 1VAKA 2X8KA 2GC0A 4QM9A 2O1QA 1XNCA 3MEPA 3E6CC 1JN2P 4YVSB 1GFF2 1W6OA 5JZGC 3RMXA 1SLCA 1KS5A 4IV1A 4S2GA 3ZSKA 5JPMB 4S2HA 1OOPC 4YZ5A 2A6XA 3L9JT 4Q0VA 1PGL1 3DF0A 2D5HA 5DZFA 1YJLA 2NZ9A 1LRHA 2HWD1 4QPGB 3KT4A 1VBC1 2Y26A 4PLMA 3TOJA 3LA7A 1S2KA 2DURA 4D3WA 4M00A 4OUSA 5CG8A 2EXJA 2XJQA 2XB6C 3IM0A 4CEWB 3AMNA 3AMHA 3HR9A 3ZYPA 2DVDA 3HBZA 4NVPA 5EFUA 3O0VA 4B7KA 1MVEA 1TNRA 5JSOA 2ZGUA 2HWB2 3B3QE 4EN7B 1EV12 5FOBB 4PJYA 5JZGB 2UU8A 2P17A 3ZXFA 1AYN2 4H14A 4H3WA 4R9CA 2FHRA 1OOPB 1W39A 1KS4A 1WW6A 3ENRA 5HCFA 1O91A 3ES4A 3RYRA 5C9AC 3X29B 3G6JB 3AP7A 5FPXA 2SLIA 1IOAA 4E2GA 5I91A 4W6YA 4OI0A 4UXAA 4MGZE 1LHNA 5D8AC 3JBG3 3M3OA 2H6CA 1HRI1 2BW8A 4JAAA 2Q0AA 1RUC1 2BNMA 2HWC1 2C0ZA 2O8QA 2ILMA 2Y38A 4DOUA 2Q8OA 3AFGA 1RMU2 3H8UA 4LULA 4RHV3 4LNVA 1QF3A 1TMF3 1ZBE1 3ES1A 3LWCA 1OQ1A 1CIWA 2NQYA 1S0DA 4LO7A 3AP9A 5C9AB 1AR82 1UIKA 3A0NA 3ZN6A 4XQ4A 1C1LA 2HKXA 1BVP1 2CV6A 5D8AB 1I6XA 4D7TA 2DVFA 4WZFA 3VZJA 4CDQC 2X29A 1BZWA 2JG9A 1IQAA 1NYWA 1XYOA 4K1YA 1U0AA 1MEC1 3NO8A 3AFKA 2VQ0A 4LLOA 2BWCA 5T55A 3V65A 4CDWA 3JB4C 1KDKA 2RS31 2ETEA 4Z07A 4N7UA 5H9QA 5HI0A 1F5FA 5BNNA 3WP3A 2KM2A 1O5UA 1QMJA 1QNYA 2XL7A 4U36A 2DU1A 1YYNA 3IDBB 1S55A 3AP5A 4LBJA 1QQP1 1TME2 2VXRA 4AEDA 4X8NA 4CDQB 2VUAA 3AK0A 3ALQA 4OULA 3M3QA 2ZGKA 1MZEA 2WT1A 3FLRA 1DYPA 3ZFGA 1LJ7A 3V0BB 2D3PA 1RUI3 4HMZA 4COUA 5GZDA 2YROA 1UZZA 1H9PA 4G3YC 3WG3A 2D7FA 4HVRA 5FRAA 4Z1VA 1NY72 2GNBA 4IEXA 3VGIA 4B29A 2XHKA 3MIGA 4LO4B 5FPZA 3AMPA 4Q4Y1 1DGLA 1GKBA 1VR3A 4KGQA 3KCXA 4HKOA 4N9IA 2IC1A 1A6CA 2A7AA 4OUMA 3PTYA 1J3PA 5K7PA 1FOD1 1AR62 2XG3A 1RMU3 4HLTA 5FMOS 4XJZA 1EY2A 4EWEA 2JENA 3UJOA 1QU0A 4EROA 3WHUA 4RS5C 5DG1A 3S30A 1BBT1 1RVF3 1N1VA 2HYKA 1V9U2 3ASIA 3J8F1 4AI2A 3ZMOA 3ILFA 1Z7S1 3VL9A 3LAGA 1F9KA 3CO2A 4LO5B 4JDNA 1LESA 1DFQA 1H2NA 1LHWA 3WV6A 4HK8A 3GNEA 3A4UA 2R6QA 4QMAA 4XOGA 1H1AA 3H1MA 1VBA3 4K40A 2WQ4A 4G4FA 4YW5A 2V73A 3GHNA 1YI7A 4V1PA 1Z0HA 4SLIA 1EPWA 3LB9A 2D6KA 1W6MB 1DDLA 2TUNA 4RS5B 5CA6A 4Y20B 1W0OA 2PLV3 3AZZA 4HN0A 3VBOA 1AL0G 5CNAA 3UK9A 1W6PA 1IPKA 5KC6A 4UBHA 3WW1A 2WSVA 2ARXA 1XE8A 5C4WA 1OLQA 4NWWA 1SEFA 3FE5A 5EXOA 2WSUA 4JGYA 1NOVA 4MYEA 2OA2A 5LEJA 2RS12 1CAVA 1VBB3 3T1LA 1WBFA 1C8M3 3ZXJA 2QE3A 5K0UC 1HIXA 2P3IA 2A6WA 4FPKA 5IT6A 3ZYJB 1OFSA 2QJVA 4M3CE 3N7KA 3EJKA 4AVCA 5EZWA 1JUIA 2QCSB 4C0BA 4FPGA 3BIWE 4ZXKA 3JCIA 3RYPA 2B9UA 2PQQA 2R043 4FPHA 4AQTA 2RS52 3FFQA 3AYAA 3IKWA 3UKVA 1FYUA 1C3HA 3P3NA 2GN3A 2IXKA 3JUUA 4QM8A 3CNAA 3B93A 1R1A2 3NKGA 4QPIA 4RD7A 2R063 3DGTA 5K0UB 2B42B 1VJ2A 1RJ8A 4DRVA 1QJX1 2E7TA 3FMGA 1GANA 2R1BA 1DGWX 4AGVA 5JOZA 1UU6A 1YHFA 1LODA 3MF6A 1NCQC 5JR7B 3BTAA 4GH4C 4RFT0 2BVVA 3HQXA 1S0IA 1VBE3 2XJTA 4QQHA 4YVSA 1AR92 3RS6A 4AQSA 1ZRDA 3KQRA 5ABJC 4YG0A 2Z69A 1HXS1 1POV3 4HK9A 4WM8C 5FQ0B 1PGSA 2NLRA 2WS92 5EYYA 3WQ1A 3MGUA 4QPGA 3SMHA 1AVBA 4INDA 3MIBA 4LBLA 3DV8A 1XE7A 5A33B 2DVGA 3CJXA 4RQPA 1NCQB 2D6NA 4WBBA 4CEWA 1C4RA 5FO9B 1OSGA 4ZKTB 4GH4B 3OY8B 1DQ0A 2ZGQA 4K9SA 5KBFA 3SLIA 2CNAA 1AHSA 4GULA 4PBOA 3ME2A 4Y22B 5ABJB 2AENA 2GH8A 1QY4A 1OOPA 1H1MA 4WM8B 4IEWA 5EV7A 1CPMA 1CJDA 5FO7B 3FZ3A 2RR13 4LE3A 3SXWA 2B46X 4AVTA 3DUIA 1D2QA 3VHOA 1G7YA 5HCAA 1PGL2 3ZXKA 2HWD2 1AXYA 1VBC2 1BKZA 1J1TA 1R1A3 2WNVC 4K21A 1A78A 1RC6A 2Q30A 1T6GC 4PBPA 4MZUA 2WIIB 5C9AA 5JAXA 1HLCA 4XMIA 5JOYA 5BYNA 3FBYA 1S2BA 1VP6A 1ENSA 2A70A 3M8LA 2EXIA 2PFWA 4R52A 5E1RA 3KGLA 4EJRA 4Q27A 1WGPA 1H4HA 1V6LA 4AEKA 1D4VB 1HRV1 2IZWA 3H3ZA 4DFSA 4C1WA 2JXAA 2WNVB 4R9DA 1BEV1 1LECA 2R073 3B01A 3AZYA 1X50A 3W59A 5JSRA 3N35A 2QFEA 1J58A 1HRI2 1TQ5A 1G9FA 1MS4A 1AJKA 1RGSA 1RUC2 2HWC2 4KU7A 1YXWA 2FZ1A 2ZCWA 2GNDA 1Q8VA 1V6MA 1WBLA 1LHVA 2H6BA 2ES3A 4FP2A 1ZBE2 2DCJA 4YYOA 3ZYIB 2XBO3 1Q3EA 1U12A 1MZ5A 1O3QA 3V0BA 4YNIA 2D43A 4BH9A 3MDPA 1BK1A 3SCHA 4MVTA 2H0VA 5T5LA 3EXUA 2UWBA 2ZGLA 4ONUA 1ZZ6A 4Q29A 3BPZA 4LTAA 5DDJ3 2BNNA 5J98B 4KL1A 1GNZA 2OPKA 2WZR1 3J4UH 5JPNB 4XXPA 2UY9A 1HV0A 1JOJA 2ATFA 1VBD3 1QNWA 3ZYGA 1MEC2 3MZHA 4YVWC 1CAWA 4YW1A 4AFDA 5K9YA 1NCRC 1YIFA 2RS32 1LR5A 2ZX0A 1M4WA 2HWF1 4XQDA 2OIIA 1QQP2 2D97A 1LU1A 4L8QA 4XBLA 4XFIA 3UKTA 1I5ZA 3B02A 4UW5A 1NLSA 1CX4A 1RUD1 3WG2A 2AZ5A 1Q8QA 1UPIA 3ETQA 4QX5A 5I0RA 4YVWB 4EWAA 1S0FA 1CESA 1NCRB 3B7MA 2XLFA 1OLRA 1COV1 1AX1A 1E57A 2X5IC 4DZGA 4FXGB 2NMOA 2R16A 2XVKA 1YWKA 2A6ZA 3SNMA 4FPJA 3ZIWA 5BPXA 1C28A 1W6MA 3VZMA 2OVUA 5IUQA 2E9QA 3BOPA 1R081 4AVAA 4RS5A 2QDRA 4Q4Y2 2W39A 4Y20A 1W0PA 2BVBA 1NG0A 1ALYA 2RMU3 1IS3A 1FOD2 1CR7A 5BNPB 4BHPA 5C8WA 5KXDA 2YYOA 4B7EA 2PHFA 3IT8A 5GZEA 5FLIA 2GC3A 1YLLA 2PA7A 4COYA 4AVBA 1BBT2