3LA2A

Crystal structure of ntca in complex with 2-oxoglutarate
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
196
structure length
196
Chain Sequence
VETFERNKTIFFPGDPAERVYFLLKGAVKLSRVYEAGEEITVALLRENSVFGVLSLLTGNKSDRFYHAVAFTPVELLSAPIEQVEQALKENPELSMLMLRGLSSRILQTEMMIETLAHRDMGSRLVSFLLILCRDFGVPCADGITIDLKLSHQAIAEAIGSTRVTVTRLLGDLREKKMISIHKKKITVHKPVTLSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Global nitrogen regulator
publication title Structural basis for the allosteric control of the global transcription factor NtcA by the nitrogen starvation signal 2-oxoglutarate.
pubmed doi rcsb
source organism Anabaena
total genus 55
structure length 196
sequence length 196
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3la2A02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3la2A01
2Q4SA 4XFIA 3BCWA 1ON1A 5EEHA 4ZU5A 3F8CA 5FLIA 2JRTA 1EP0A 2XAGA 4PGHA 4KYWA 2VBXA 5D8LB 2DU9A 3J80K 4JTOA 1LQ1A 2O1QA 2EFWA 2IRFG 4HQMA 1CAXA 2K0GA 5BY5A 2V1XA 2FBKA 2YU3A 4RAZA 5FD5A 3RIRA 3F6OA 3P7NA 4ENMA 4MV2A 1BJAA 1ZN2A 3DPTA 1Q5OA 2ZFWA 3KLOA 1IRFA 3LQQA 1FP1D 3REOA 3IKVA 3KCCA 2OBPA 4I0BA 2XGXA 1RL3A 4A0XA 3M3IA 2VBZA 1YW8A 4IEVA 1FBSA 1BIAA 1V70A 4MGKE 5JSOA 5K1YA 5IT9Z 4IXAA 3ZMTA 1BM9A 5FLHA 4BHBA 2W57A 1H1IA 2QYOA 4ZZDA 3FHIB 2D1VA 2ADUA 2V6CA 3E5QA 4LMYA 5DUKA 3OF1A 3RYRA 2O03A 4EJWA 4XF0A 3RNSA 2XASA 5TJJA 4IEYA 2C6YA 1PDNC 4I09A 1YS7A 3TDZC 1IPJA 4GYIA 1P4AA 4AVAA 1S7OA 1YQAA 1TNSA 4OMZA 2KRFA 3M8EA 1I6XA 1WRJA 1CAWB 4ONUA 1T0FA 2ETHA 1FYKA 3PVBB 1Z6RA 1AOYA 2M8EA 5CLSA 3GF2A 1G3WA 5J7MA 2ATFA 2DQLA 4UHTA 4JBAA 4XBFA 3SQNA 1JGSA 4IESA 2FXAA 1W7PB 3RKXA 5HS7A 4D7TA 1WWXA 3T5XA 2XROA 1RC6A 2F2EA 1S8NA 3KP4A 2KIMA 5ICFA 2IXKA 3MCZA 1ZLJA 1JE8A 1UD1A 4HLTA 5BPDA 2HKXA 3TDUC 4KIFA 1KU9A 3KP7A 4AQ2A 1ZGAA 1LNWA 5D4RA 1XGNA 2PEXA 5LRSA 4UV8A 2M5WA 3WGHA 1O5UA 4P96A 5D1IA 2ZBKA 2QWWA 4HLXA 4L9NA 2GXBA 2RVCA 2GZWA 3GFLA 2FOKA 1R36A 3ZMSA 3FZ3A 1YLFA 5K5OA 4M9ZA 2CAVA 1GXQA 1T98A 2OQGA 2UZKA 1HW1A 2Z99A 4I98B 2ELHA 4AIHA 3HSRA 1QY4A 1FI2A 4MGIE 1XMKA 4TLFA 1I5ZA 5CJ9A 4KL1A 3TO9A 4ON0A 1D8JA 4QLCU 2DTRA 2HTSA 3H7YA 1BI2A 4XETA 3C18A 3EQLF 2ET7A 1FY7A 4MQ9F 1I1SA 1YO5C 3WU1B 1DZRA 3RKYA 1B1BA 4RS8A 2QJVA 2DFIA 4XFFA 3WW1A 3TO6A 1R1VA 2QDRA 4HX7A 4IRHA 2PAEA 3KFWX 1ZVFA 4U0YA 3ZPLA 4H0EA 4EMSA 3BZ6A 3K1MA 5DV5A 1S6LA 4N9HA 3SXWA 2VC0A 1R58A 2P5KA 2DCTA 1NZCA 1T6SA 1ODDA 5DD4A 4R1HA 2YSRA 4LUKA 1BOAA 1TNTA 4FT8A 3FXUA 1U5TC 3CL1A 2C0ZA 3WGIA 3DN7A 4FX0A 5J8CA 3RZZA 3CUQB 3CUQC 3HSEA 3SCGA 1XMAA 5A2QZ 1X7NA 2EA2A 3N4MA 1TTYA 3JAMZ 4R8HA 3R0JA 3RDIA 3ZP5A 2IP2A 4F8AA 5FQ0B 3H1YA 1OYYA 4D7SA 2XLGA 2UWMA 2YX4A 4IRGA 1L3LA 2MPFA 2UXNA 3RTRA 5LBQA 3H3ZA 1SMTA 1R5GA 3ROUA 2D93A 3CLOA 5AIQA 3RKWA 1SMYF 1NE4A 1FOKA 3C3WA 3MYXA 2OU2A 3ZMUA 2Z33A 4GO1A 3U0ZA 2RNJA 2IPQX 1XN7A 2D5FA 2HFHA 4MNUA 2Q8KA 3NVCA 1SEFA 4HBNA 1YG2A 3H1MA 2DT5A 1J58A 2Z9OA 4ZYHA 3ABTA 4ZYEA 3U10A 1XCVA 2ET1A 1QBJA 2QUFA 4WXCA 3BY6A 3E5UA 3GBFA 4N0BA 4IJAA 2MNGA 1E17A 2KIUA 1LDJA 2Q1ZB 1CGPA 3HQXA 3K9TA 3WE3A 3FE5A 3IDBB 3UKTA 3KGZA 2IXJA 3H92A 2K4BA 3JZVA 1KQ8A 1W4MA 4I01A 4I0AA 4UV9A 2STTA 3SHRA 2MLGA 1BI1A 2PQQA 2EA4A 1UCXA 4LLGF 1S7AA 2ISZA 3FMRA 4B29A 1MDMA 2KXLA 2EAAA 2DK5A 1FBQA 1ULYA 2VN2A 1RI7A 3GFIA 1DZTA 5D6EA 4EM0B 3E6DA 1LEAA 2ZKLA 4A5NA 1GXPA 4E2GA 1SD6A 1DGRA 4HOBA 3MPBA 3S2WA 3HTSB 1WSUA 1J1LA 1JXSA 2P17A 1U8RA 1HKQA 1TQMA 5L3CA 2MH9A 2XAJA 2P7VB 3NL1A 1LEBA 2Q2EA 4A0YA 2P6SA 3OV8A 3WGGA 1SFXA 2HEOA 1RGSA 2V1UA 4PIZA 2CGPA 4XFGA 2H27A 3ACLA 4Z2YA 4EV0A 3OD0A 5JHUA 1P2FA 2B8MA 3O6BB 4YRDA 3QPTA 2VQAA 1J2XA 3ELNA 3EUHA 5D5WB 2FMLA 4PIYA 2CYYA 1Y3TA 4NB5A 4L5IA 4RGRA 3WW4A 4GGGA 1WGPA 2PI0A 3F6VA 4ZH4F 4MEYF 4UXNA 1RNLA 3U11A 2IXHA 1UB9A 3UKNA 3KP2A 3KP5A 3USSA 5ED4A 1OD5A 3WW2A 2CSOA 1CAVB 2UY9A 2OQRA 1EH8A 1YFYA 3R4KA 1PUEE 1MJAA 1YUDA 4A6DA 4L11A 1Z7UA 1UPIA 2CG4A 4FX4A 4P9UA 3GO5A 1F5TA 3R60A 2Q0AA 3FJSA 3KP6A 4OLLA 5L3DA 4Q0SA 1FSHA 2R3SA 2PMHA 4LK0F 4RB0A 2BNOA 2A07F 4RGUA 2UYBA 4LTAA 3E5XA 1I27A 4U7BA 2OZ6A 1SD4A 4E70A 3BJOA 3SZTA 4KN4X 3L2HA 2EK5A 2JT1A 2VXZA 2EVXA 5BPIA 2PLYA 1P92A 1FNNA 4AIKA 2WV0A 3E97A 3M9AA 1FWZA 4G7HF 1SD7A 3MFKA 1UCRA 4M6YA 1IW7F 4LD5A 3WTTC 3QU3A 2CW0F 4MTEA 1X8EA 2RV8A 4ESBA 4MGRA 3FM3A 2E9QA 4IERA 4MTDA 1KU7A 4CICA 5I8YA 3W6KB 3RI4A 4LEJA 5HDGA 2BGCA 4PDKA 5D8KB 1VR3A 3B73A 1YHFA 3CJXA 1LRHA 3LAGA 2PBIA 3HRTA 2PMUA 3IKTA 3LSTA 1GVJA 2B0LA 5H6QA 3KETA 3LA7A 1KA8A 2KJBA 1R1TA 2G7UA 1PMIA 1IN8A 1SD5A 2A69F 4OIRF 4EJOA 3S0MA 4NQWA 4L0ZB 2PQ8A 2UXXA 5FO5A 3KZZA 1G3TA 2QVSB 2P5LC 4O9EA 4EWAA 2FBIA 1WA4A 3L9FA 3GYHX 3CO6C 2GA1A 2MH2A 3CO7C 4YARA 2XAHA 1C0WA 5I0SA 1X8MA 1REPC 5DEQA 4LG0A 4LLLA 3LFKA 1D8KA 2FQ3A 2VOPA 1MDMB 3MEXA 1J7KA 4HVRA 1YIOA 3LAJA 3F23A 1R22A 1NE6A 2TDXA 4LLNA 4XFHA 2CQKA 1H0MA 4XFCA 4XRFA 2HOEA 3DQVC 3FMSA 3N97A 2FEZA 5I93A 1ZZ6A 1YTYA 5ICCA 1SFUA 1CF7B 4Q29A 4PCQA 4Y13A 1BI3A 2EV6A 1ZRRA 3H7JA 3Q9VA 3IBMA 3VOEA 2HTJA 3I54A 3RPQA 5JR7B 1I1GA 1O5LA 3NW4A 2UYAA 2E1NA 1H9TA 2ZCWA 3DKWA 4OINF 5F1RA 4OIOF 3G7DA 4Q4ZF 1K79A 3E6BA 3DXJF 5HLGA 1U3EM 4OIQF 3GUDA 2QNKA 3TOBA 2D5HA 1QWRA 2ZMEA 1D3YA 2MC3A 4N9IA 4JTNA 1OYWA 1IZ1A 2DLLA 3BU7A 3GFJA 5K8SA 4I7HA 3S7EA 2ZO4A 2VOOA 2RQPA 3FF5A 5J48A 5FFZA 1TQPA 5IT9K 5LGUA 1L0OC 5E1RA 5E20A 5J6XA 4G7OF 2OAZA 4E2SA 1CX4A 3RYKA 2M45A 3P9CA 1O7FA 1XD7A 3FMQA 1Z9CA 4QGLA 1E2XA 2V09A 1FSEA 5E8GA 5IT3A 2FF4A 4HX8A 4ZYGA 4Q47A 3WTXC 4Q0UA 2DPUA 5FLXZ 1QXRA 3DL3A 5KVRA 1RZ4A 2O6GE 1O3TA 2IW5A 2HQNA 2L4MA 3DV8A 3H1WA 5KHHA 1HKSA 1F9NA 4H7LA 3JSOA 2ZJ2A 1B59A 3Q9SA 2IT0A 4TV7A 3COAC 4XEZA 2X0LA 1ZRFA 3R0AA 2J5PA 2FNAA 3ES1A 2VBWA 3CF6E 1Z05A 3L09A 1FPQA 3H9AA 2HYFA 3QU6A 3GZ5A 2K7LA 4EJVA 4EGYA 4XFBA 4XSXF 3VB2A 5K5RA 3ULQB 4EJTA 4WK8F 4ORFA 4L5JA 1QO0D 3WTWC 1ZZCA 4XF3A 2LSOA 5FD6A 2VE9A 3JSPA 4LUMA 3KLNA 3PQKA 2QM3A 4QM8A 2H09A 4ZU7A 4L9TA 2CAUA 1ZHFA 5ICEA 1XRUA 4A5MA 1YYVA 1B4AA 4L2NA 3T0YA 3BOQA 3V4GA 5JFRA 5J8FA 5I8TA 3ZMVA 4S04A 1S3JA 3ZN0A 1RUNA 5JAXA 2IVMA 1ZYRF 2CWEA 5C8WA 2BV6A 2A61A 4BIFA 3I59B 1XSDA 5BMZA 3ELKA 1SFEA 1IN7A 3QP5A 5CADA 5CU1A 2PFWA 4MGZE 3GLXA 4MGYE 3HSFA 3QPHA 4GYGA 2XL9A 5FB2A 4PJYA 3F3XA 2NNNA 1ZZ9A 5HLHA 1IUYA 2OYZA 2Z2SB 3I53A 1RUOA 2KKOA 3QAHA 2IXLA 1IXCA 4LFUA 1TQ5A 3U2RA 5CVIA 4YFNF 3LAPA 4UNOA 3T8TA 3WTYC 1OPCA 3IRQA 2DPDA 4ENNA 1R5HA 4DNCA 2EV5A 2VBYA 2XIGA 3V7SA 3MWMA 4HQEA 3SHFA 1GHCA 3NKTA 2FE3A 5BOXA 1O3QA 1CAXB 3LA2A 4BQAA 4OFGA 4WVZA 1HW2A 2PAMA 3LQRA 2JPBA 2NNYA 3MZHA 1DUXC 3P9IA 4CO8A 4UVAA 3WE2A 1USTA 1IRGA 2VT2A 4UUVA 1UW8A 3J7AO 4LB5A 5A2QK 1T39A 1JHHA 1Z6TA 1B9MA 4META 3JAMK 2NS0A 2NAZA 5I91A 1MD0A 3JW4A 1ZNPA 3EHKA 4S05A 1Q43A 1ZZ7A 5FFXA 4KUMA 1HXDA 4LJZF 1MKMA 3KP3A 4I3PA 4HVQA 3P9KA 2P7CB 1FZPB 2VODA 1G4DA 3FM5A 4QWQA 2LF8A 3GFMA 1X82A 2H0VA 1ZARA 3KE2A 4G9YA 4IEWA 3U1DA 3WTVC 5T3NA 3W6JB 4I2OA 2F5EA 3MDPA 1QXJA 2OA4A 3DPLC 2Y48A 4RGSA 3WU0A 3T1BA 5BPXA 2ESNA 2P8TA 5ERIA 4B8XA 2FNPA 3NSTA 2Y0OA 5D4SA 1W5TA 5KK1A 4U7DA 2STWA 3V8LA 2EB7A 4M73A 5DCFA 5KHJA 2D1HA 2GC1A 1NYWA 3O3KA 5LGTA 3E6MA 3L2CA 4KMUX 2LDUA 4EROA 3V7CA 2GWRA 2QBYA 2Z69A 4FBFA 4U0VA 2GC3A 3LZZA 2VT3A 4HAMA 3TGNA 1K7AA 2HS5A 5AIPA 3I64A 2PJPA 3DEUA 5BXXA 1UIJA 1LDDA 1IN6A 3LWFA 4XLNF 2JSCA 3F8NA 4F7ZA 2WWYA 4BHPA 1XCBA 5F6FA 4KA4A 1U12A 1XGSA 2XV4S 4O9GA 3CJNA 4M9XA 4KU7A 1ZH5A 4L9JA 2LF7A 3SCFA 2EWNA 2WFPA 4MX3A 3IC7A 3D5LA 4HZFA 3ZN1A 4G7ZF 1CAUA 2D45A 3IWZA 3S7IA 2UY8A 3F21A 2EA7A 2J5OA 3EO6A 3IHUA 5LHGA 1KQ0A 2V1DA 4Z82A 2OZJA 2FA5A 2IA2A 1Z1DA 2DBBA 2VC1A 3FHZA 1SAXA 5J3UA 1B6AA 2O8XA 1J3QA 2QZ8A 4UVCA 2Q30A 4ASNA 3OTFA 4RB1A 1STZA 3WTUC 2XUBA 1ZLKA 2YR2A 4HF1A 4P5OA 1WLTA 2FQPA 4R79A 1VJ2A 5LHHA 4EM1A 4KFCA 4HV5A 4HF2A 1ZAOA 4IHTA 1BC8C 3VHRA 3HTUA 5JSRA 4HVOA 3I7DA 2O0YA 5JCTA 4M72A 3WW3A 3EYIA 1YW7A 4X6QB 3BALA 2GC2A 4WXDA 4GCVA 3ST7A 5BS6A 5LHIA 3TNQA 3FXRA 3TO7A 5ILSA 6PAXA 4UVBA 2Z3YA 1KYWA 5HDNA 3EBRA 2Q0OA 3R6SA 4EGZA 4NVPA 3BDDA 4Y17A 2RC4A 3TQNA 5JVTA 2GC0A 4YFXF 4QX5A 3KEOA 4ZZLA 2M30A 2O3FA 4P55A 4KMFA 1J0RA 1JHFA 3G3ZA 1CAWA 1EY2A 4QMAA 4HDUA 3CUOA 3MZYA 4RGXA 4IF4A 4Q5SF 3LWCA 3M8FA 2YX7A 4CZZA 2A6HF 5DCMA 4MH0E 1R7JA 2ISYA 5H20A 3IIAA 1Q1HA 1W7PA 2W25A 5L3GA 4CDGA 4ZU4A 1W5SA 1PP7U 5LGNA 5FPZA 4L18B 2JPCA 5CVVA 3KEQA 4XLPF 2H6BA 3G73A 4KWKA 1MZBA 5DD8A 3M70A 1EH7A 4A0ZA 3ISPA 2VECA 3UKVA 3M1EA 2L02A 5E16A 1LDKB 1DPUA 5KBFA 2IA1A 1X3UA 3EETA 3NRVA 1K6OA 3GZ6A 2XKPA 2WC2A 3BJ6A 5HI0A 5EEGA 2K27A 4Z07A 4ESFA 1ZZ8A 3LOIA 5E8IA 5D5UB 4KDPA 1L3JA 2I45A 2JTVA 4KWLA 5EFUA 3PNAA 4AVCA 1XSXA 3J81Z 1XE8A 4X6RB 3ML6A 2G9WA 2QLZA 2QVOA 4KT5C 1P6RA 3H3UA 2K86A 3NEUA 1K78A 1KQ9A 1USSA 4CXFA 4J1WA 2CO5A 2MHFA 3D0SA 1J3RA 3BPVA 3ZQ7A 4OOIA 1TW2A 4L0YB 4KNYA 1YFXA 2NYXA 4IEUA 5HLIA 2BNNA 1Y0UA 1KU3A 2EV0A 1XE7A 3KMHA 2V79A 1KGSA 1ZRDA 3C1DA 1AWCA 5JR3A 1IXSB 3J80Z 5AONA 1Z91A 1CAUB 4AQ6A 1XDSA 4J1XA 2N7GA 1HSJA 3HT2A 2BE5F 4MZUA 2K9ZA 1HQCA 2GAUA 1XSVA 3KZYA 2HWVA 1YWKA 2OD5A 3L7WA 1BN5A 5DYMA 1IAWA 3LA3A 5HDKA 1U5TA 1G3YA 2HGCA 3U9GA 2NRAC 4LB6B 3CUQA 4HF0A 1QQIA 3E3VA 4O5VA 4YIFA 3H8UA 1O3RA 5KHGA 4BXUA 1ON2A 4G6DA 1V3FA 4JVAA 5FDBA 4HLYA 1J9IA 1ZG3A 5LEKA 3WODF 5FQ0A 3D82A 5I0RA 4QXKA 4Q48A 4XF9A 1WKMA 3HT1A 2DAOA 3AAFA 2KIFA 3HHHA 4YIIA 4BAYA 5E1WA 2Y0MA 5L3BA 3V8KA 3OCPA 1DP7P 3RYPA 2YPRA 3I0TA 1UHMA 1FC3A 2M1BA 4YYOA 1WI9A 4LLOA 5EZWA 3QACA 1EV7A 3HUGA 1O57A 4MHGA 1HSTA 5JI6A 2GU9A 4XF4A 3ETQA 1XDUA 4P9GA 5CYVA 3O2PE 2ZNZA 5E17F 1U2WA 4HBLA 3TKYA 3F8BA 1QZZA 4I02A 1ONVA 3B02A 2E7XA 1P4WA 5CVUA 4R52A 1TBXA 5D5VB 1YW9A 1FLIA 3FFQA 5FLJA 5BUVA 4QM9A 5FLXK 4P9FA 3FZVA 4EVIA 4E2QA 3VFZA 4M74A 2PFBA 3HRSA 2RN7A 5DCMB 3VEPA 3PLQA 1NXMA 2DI3A 4K2EA 2QQ9A 1UFMA 1OYIA 2F5FA 1J3PA 1MJBA 4EQQA 1TQIA 5E18F 1BI0A 4XF1A 2O61A 3BROA 1HW5A 4WF2A 2XRNA 2QQAA 5H6RA 3IRRA 5I0UA 4WZCA 2COMA 2F5DA 5F64A 2XAQA 3FX3A 4OIPF 1EPZA 3QRFF 1F4KA 1YFHA 1R1UA 4RB3C 2XLAA 5AVPA 4PGGA 4DQ2A 2D40A 4AD9A 1GQHA 3OOPA 4KU8A 2FMYA 2HDCA 3HOTA 1FP2A 5BV6A 2A3SA 2QENA 2L3DA 2LNBA 4LG0B 4G8XA 3CDHA 1B9NA 4XSZF 4HV6A 3RPUA 2QQBA 2F4PA 1XGOA 3ZMZA 5FGMA 3QOPA 5HS9A 4WXHA 3F8FA 1K78B 1QGPA 3PFIA 4MQVA 3JTGA 3HHGA 1T2KA 4ENKA 1U78A 3O14A 4RAYA 4EM2A 2ZXJA 3NJZA 4KIBA 5LRRA 1QZYA 4CYDA 3IWFA 2PHDA 4A6EA 3L00A 5E1ZB 2X4HA 2RDPA 4L9VA 2GIVA 4BYYA 4BH9A 1YLLA 4HX4A 3D0JA 1CAVA 2EFPA 2EFOA 3I58A 4HN1A 1HKTA 1P4XA 1O3SA 5HVQC 2GA2A 4QGNA 4M6XA 3DFGA 1DGWA 3IDCB 3BJAA 2FU4A 1YS6A 3EJKA 4IEPA 3R61A 3JTHA 2A6EF 4A12A 1U5TB 3H50A 1FYLA 1ZREA 5LLQA 3CLPA 4ENJA 4OMYA 3DP7A 1IN5A 4NHJA 3EQEA 2B9UA 1UHWA 2ZMEB 3TOAA 4AVBA 5HOOA 3E6CC 1JUHA 2EFNA 3GXOA 2PA7A 4IHSA 1BIBA 4YSFA 1T38A 2ETEA 4M9SA 3T8RA 2HJIA 2BEOA 1PM7A 4OU0A 1J59A 4LK1F 1LKNA 3ZDSA 2XHKA 2GQQA 3HIFA 3C3VA 3ECHA 4A2UA 4PIXA 2B5HA 4UBHA 5CVRA 2PYTA 3QP6A 1O7LA 3K2ZA 4YG2F 2PG4A 1LR5A 3K1PA 3HYIA 2DQRA 2MD5A 3GVAA 4MEXF 2VPVA 2ZNYA 1IXRC 3F8MA 4RB2C 3BPXA 2CV6A 1HBXG 1FBUA 3ERED 1BBYA 3HOSA 2HZTA 2Y75A 3GX4X 3SMHA 4IEOA 4KN7X 4PZJA 3RJPA 2XVCA 2ACJA 1R00A 1DPRA 5ICGA 2P5VA 2W84A 1A04A 3SFZA 2OZUA 1FYMA 4IVNA 3IL2A 4CGZA 2EFQA 2E1CA 1FXZA 1VTNC 4FHTA 5JSPA 3ABUA 1Y9QA 5L3EA 4ETSA 4DINB 3MAJA 4M71A 2XL7A 2HKOA 2OPKA 3ES4A 1LJ9A 1EYBA 2BNMA 3HRMA 4G6QA 2A5YB 2DO7A 5HS8A 1QPMA 2MBFA 2ESHA 2JZYA 2AS5F 2OA2A 1ZG5A 2XAFA 1U6GA 1V4RA 3BWGA 4LA2A 2HQRA 4IPAA 2IJLA 4AXOA 2FSWA 1OR7A 2LKPA 2MA3A 2XLFA 3SZPA 3ZMDA 5DDGA 3KGLA 2K4JA 1FT9A 1CF7A 4WCGA 1SFNA 1XB4A 5K5QA 4IEXA 2IA0A 2WTEA 3CTAA 1QNTA 2R7DA 1NHAA 1DDNA 1UIKA 2PHLA 4KIGA 4GXOA 1PP8F 4O3MA 4HSLA 3FWEA 2PN6A 2D2WA 1IPKA 1G3SA 1F1ZA 1KYZA 4EJUA 5CVJA 1OI6A 2RKHA 3EYYA 3M7GA 4KICA 1TW3A 4EWEA 1LB2A 3TNPB 4IEQA 5FPXA 2HYGD 3PQJA 3DF8A 3HRUA 5LEJA 1RTVA 1TLHB 2VE8A 3I4PA 4HYEA 5FCCA 1MGTA 1G6NA 3F22A 4JK1X 4WBBA 5DUIA 4AWXB 4IETA 4BHCA 2ZKZA 1FX7A 3C7JA 4B09A 1YFWA 2A68F 1OMIA 2W85A 4XFAA 3EDPA 5D5XB 1IF1A 3VODA 2L54A 4AIJA 4HA8A 2MLKA 3V8JA 2FBHA 2E7WA 4HW0A 3NQOA 1XGMA 2GH2A 3FXQA 4HMZA 3BP8A 2O8QA 2DW4A 1BC7C 1EH6A 2RGVA 2Z5UA 2HR3A 4LA3A 2W24A 4O6JA 4HDVA 1RIOH 3K69A 2V9VA 4QGMA 3K1NA 2FRHA 2H94A 5I0TA 5C6CA 4CHUA 3GW2A 4IRIA 3KSCA 5BQTA 3BB6A 1Q3EA 4U0WA 1ZZBA 3F72A 2VONA 1OFNA 2DK8A 4UXAA 2IC1A 2L01A 4LGWA 4K8FA 5KHKA 2GXGA 1KU2A 5E1XA 4Q0PA 5KHIA 4G94A 2IXCA 4FAGA 4UBGA 1ZG1A 4KWJA 1H1MA 3Q5FA 4EWDA 3GYDA 4IEZA 3WG9A 3GWZA 1OKRA 4YNIA 4LULA 2PAKA 1H9GA 1VP6A 3SCHA 4GULA 1WQ2A 3K0LA 4AVPA 3CEWA 3WTZA 2QCSB 1SQ4A 2XKOA 2KJCA 3I5UA 2EJRA 2M87A 4HSJA 2L4AA 4WX9A 5TRDA 1J5YA 5ILUA 1R23A 5D6FA 5ILVA 3ECOA 1S29A 2R7FA 3MQ0A 2G7HA 1O4TA 2QBYB 1LVAA 1D5VA 2PTMA 4ZYDA 5L3FA 2IXIA 4BNCA 3BPZA 4MUVA 1GQGA 1ZRCA 2F5CA 3I71A 2P6TA 2AXLA 1ZX5A 1IN4A 1MJ9A 4Q0QA 2H6CA 4YFKF 3OGJA 1J75A 2CFXA 1YFUA 3GEZA 3I59A 2P4WA 4WWCA 5I8SA 3V7RA 3J81K 4HN0A 4JQFA 4RD7A 2BBYA 1ZGJA 2BYVE 3SXYA 3CO2A 1W7PD 4ESJA 4Y15A 4FAHA 3WTSC 4JV4A 4D0PA 4Q0VA 2K02A 4U88A
chains in the Genus database with same CATH superfamily
2Q4SA 1UY4A 2D6KA 3BCWA 3ZXSA 4ZU5A 2JSPA 2JRTA 3OS2A 5KAFC 1JU4A 3ZFGA 3QYBA 3ZXJA 1REDA 4JTOA 5C4WB 1CAXA 5BY5A 1FAYA 3N9QA 1D0XA 1RUD1 3A23A 2E51A 4TXWA 3DPTA 2ZFWA 5EJZB 1IRFA 3LQQA 2MG4A 1FP1D 3KCCA 4F92B 2Y6GA 2YFUA 4XAEA 4I0BA 3S1NJ 3AL0C 4QQOA 1OT5A 5JSOA 3GCMA 3ZMTA 1BM9A 3NAPA 3H3LA 4CDUB 2ADUA 1QH7A 5DUKA 2ZGTA 3DXTA 2R0HA 2O03A 4EJWA 5FY5A 1LENA 4DXZA 2C6YA 5IYYA 3TDZC 4E8DA 1G8XA 3NJXA 2PJRA 5IW0A 4FQZA 1TWCJ 1S2BA 4M0NA 1FTTA 4O65A 4E6KG 4UOJA 1CAWB 2ETHA 4BDVB 2DA5A 3TEXA 3PVBB 3MIGA 4X6AJ 1IS4A 1T95A 4JYKA 1MVQA 2PHFA 4UHTA 4DZGA 4NIGA 1GT0C 2RM22 1EV12 3BLYA 3M4OJ 2QKMB 4XQFA 3IAQA 1W7PB 4QHBA 2JG9B 5HS7A 1WWXA 3T5XA 1I9RA 2XROA 4DXRA 1RC6A 1S8NA 5ICFA 3FLPA 4DMIA 1R9TJ 3MCZA 3OYLA 2IXKA 5IWFA 1ZLJA 1JE8A 1ENHA 1VRBA 3SITA 3O0XA 4CDWC 4N90A 3VZMA 5BPDA 4J6GA 2R7SA 4AC0A 1LNWA 4N7IA 3VZKA 4NHXA 1XGNA 2PEXA 5LRSA 4UFKA 5IPAA 2PMZA 2E7TA 1O5UA 2RVAA 1X19A 2D3RA 5D1IA 2ZBKA 2EQRA 4XMYA 4L9NA 4PJLA 4UW6A 2BGPA 3ZMSA 4YVWC 1Z7S1 4NHKA 3R4DB 4C8DA 1T98A 4KT6A 2GALA 4LMFA 1RUF1 2KD7A 4NC7A 1IS3A 3HSRA 1QY4A 1FI2A 4MGIE 3N3HA 1MMAA 3NV4A 2ARCA 4QLCU 2DTRA 1U9OA 4XETA 1FJLA 4IQJA 3EQLF 4Y4YA 1FY7A 1I1SA 1YO5C 5F27A 3WU1B 4IV1A 3H1CA 2QDRA 2P1BA 5LBBA 3OYWA 4EEFG 4IRHA 2PAEA 2KL4A 3KFWX 1ZVFA 3S3NA 1SPPB 4QXCA 3WHTA 1H1AA 2ZGKA 2OCEA 3VKMA 4PUSA 3PIGA 4XMAA 2WLQA 4R1HA 1K61A 3NWKA 4GWIA 1SDWA 1N77A 3P5BA 1BOAA 5FPLA 5JXHA 1MS5A 4WM8A 4FT8A 2JDPA 3FXUA 2C0ZA 5J8CA 2JDZA 1Z3XA 4CCOA 1LJ7A 3FXLA 3ZSJA 5FPUA 1QGLA 1TTYA 3S2HJ 2J42A 1POV3 3WDUA 3HDDA 4IHVA 1ULGA 2OF7A 1W5CC 3ZFFC 2YX4A 3ALQA 1LAJA 5LBQA 2WWJA 1Y7BA 2JN6A 1YQ2A 3M3EA 3AMMA 3ROUA 5GLZA 2CUZA 1VBA2 3N9OA 5AIQA 3RKWA 3C3WA 1RESA 4DBQA 3S5QA 3ZMUA 4GO1A 4YZ1A 1RMU3 4XRSG 5J1RA 2HFHA 2HYXA 1LGNA 2BHZA 4Y5SA 4QHOA 2Q8KA 1SEFA 3H1MA 2DT5A 1WI3A 2MD0A 3WG1A 2Y8KA 3ABTA 2B46X 2ET1A 3BY6A 5FZBA 3GBFA 2E26A 3P3NA 5FYBA 2Q1ZB 1CGPA 2X10A 2WS93 3JD73 1O6UA 4DZJA 1AR73 1YOVB 3KGZA 2DUOA 1FEXA 3D4KA 3U1KA 2WZEA 5F08A 3PNVA 4B47A 4A3DJ 1OLTA 1QH6A 1W4MA 4I01A 4I0AA 4UV9A 3ME2A 3WZ1A 2VE1A 2GNMA 1BR4A 1F43A 3MF9A 2CUJA 3RRDA 2EA4A 1UCXA 3LB9A 3HN1A 1VE0A 5FXWA 1YYNA 3SEQA 3A2KA 1V0AA 1R1ZA 1D2SA 2ID4A 1FBQA 1OBNA 3GFIA 2XQRA 3IH3A 1OOPB 1OOPC 2ZKLA 2AO9A 4E2GA 2A6YA 1OA4A 3VZJA 3CD6I 1QDCA 2ZACA 3HTSB 3CJTB 5K7FA 5D21A 2WQZC 1ZBE3 1J1LA 3ZXKA 1U8RA 1HKQA 1AL22 1DQ5A 2FDKA 2XAJA 3R4SA 1E5HA 1U0JA 2P6SA 3UT0A 1SFXA 3I97A 3PUQA 3L2VA 2CGPA 2ADEA 3TRSB 2FUG2 2F4LA 3ACLA 5L73A 1F31A 3OD0A 2BW3B 4F55A 3OYHA 4XURA 2RNGA 2OIIA 2WAQN 1ORKA 3ZQHA 1J2XA 3CMEI 3T1MA 2FMLA 2VJIA 1KQRA 4PIYA 2VW2A 4NB5A 2OPWA 1IV8A 3AYDA 2PI0A 4ZH4F 4ZPIA 4XKWA 5FZ9A 3UKNA 5LASA 1WMEA 4Y1UA 5DAXA 2R7TA 3QQAA 2H1LA 1JOBA 2Y6JA 3ZSKA 2WINB 2CSOA 1CAVB 3CP8A 1GOHA 3O8HA 1AHSA 5SV5A 1EH8A 4XUPA 3FLRA 3LKJA 1YUDA 4Y33A 1Z7UA 4BY1J 4GWMA 1HN0A 4FX4A 4DRVA 2Q0AA 5IK5A 5FZOA 4OLLA 2R3SA 4J01A 1WJEA 2A07F 5F7UA 4RGUA 1W0UA 2OTJI 1NCRC 1XNKA 3MIBA 5BNGA 2IVIB 2FOWA 4QT6A 1TWGJ 1HV1A 1UF2C 2L7ZA 4E70A 3UNPA 3BJOA 2G9ZA 1GMMA 4HG2A 3LSJA 2WV0A 1LFBA 3MFKA 1PK6C 1EF4A 5GAHJ 3BG9A 1RPWA 5FXZA 3N9LA 1PVC2 3POGA 1W1WE 4QPOA 4IERA 3JRAA 1KU7A 3W6KB 3RI4A 2VQUA 4LEJA 3CCVI 5HDGA 4D6RA 1ND2B 1Q8QA 5ACA2 4DYCA 3WUCA 4CDWA 4BKXA 3ZQLA 2IS2A 2AC1A 2CMPA 3LAGA 2PBIA 1XBFA 1X4PA 1MNDA 1LCLA 3UJOA 5KHDA 1XU2A 4BQ4A 4EJOA 4NQWA 2AH2A 2UXXA 5KNLA 3KZZA 3OYDA 2GOMA 2E33A 3HJEA 5IFPA 4YARA 3AG3H 2CRGA 2Q8OA 5F3CA 2XAHA 3UV9A 4COWA 4YVWA 5E3LA 5DEQA 5FYHA 2DOFA 3IMNA 2FQ3A 4IGPA 1MDMB 4XLAA 2GM4A 1VBD3 2Y26A 4QIWN 1YIOA 2VNRA 4BE1A 3GHNA 2IS6A 5E8AA 1WMXA 2MW8A 3RWNA 4B43A 3JCUC 4XRFA 4YZ5A 1JZ2A 5CFDC 1ETVA 1YTYA 4NUBA 2ZMKA 4AHWA 1G9CA 3ZYGA 2O8OA 4XLFA 2EV6A 1QJU1 1ZRRA 3CMAI 3I54A 1LOBA 1O5LA 1BK1A 3K4LA 1HXS2 2UYAA 4FVVA 3M4FA 2VMDA 5F1RA 1RUG2 3OB8A 2KP6A 1A6CA 2G9FA 4IE6A 1OVPA 2YBSA 2R5ZB 2QNKA 3TOBA 2XG3A 3UGGA 1QWRA 4A41A 2W00A 4JTNA 2DLLA 1JXNA 3GFJA 4I7HA 2BY1A 3VD3A 5A32B 4P9WA 3ZFFA 4JCKA 2VOOA 2R073 2XJRA 1QPIA 2BUKA 4QDRA 5J48A 5IT9K 4RAFA 1L0OC 4V2GA 5E20A 2KMUA 4BQOA 3VUOA 5KXCA 4PQQA 2DA1A 2K2SA 1LODA 1KZHA 4IX7A 1JTYA 1WW7A 3Q8FA 4QGLA 2VMGA 2KZVA 1ERDA 2FF4A 4PI2A 4ZONA 3WXPA 1IG3A 1QJZA 5KVRA 1RZ4A 1LVKA 2O6GE 3KWVA 4N4NB 2WSUA 5KHHA 4H7LA 2F48A 3JSOA 1B59A 1O4YA 4EZ4A 3MICA 4C91A 1OCTC 1WJAA 5J1UA 3DWLE 4AOCA 2XPWA 3VBRB 1ZRFA 3VBRC 2VBWA 5A6YA 1IC8A 1S2KA 1VBB1 3CESA 2R062 3TWIA 1OKQA 4XCBA 5F9TA 4BQYA 3ZIWA 4EGYA 3INAA 4XJ9A 4XSXF 4Q4W1 5K5RA 2OTLI 1SFOJ 4LIVA 3ZKYA 5KAIC 3PIOF 1DQ4A 2WS92 2EILH 2WY8Q 2D3SA 3JD72 5EYYA 3PQKA 2QM3A 1AR72 4QM8A 4XORA 4ZU7A 5ICEA 1Y4WA 5B4XA 4Y20B 3TEWA 2VKVA 2LY1A 3T0YA 4WZFA 5IVEA 4IV3B 4R9BA 2A73B 2ZGLA 1AR63 1L7QA 1S3JA 1FMD3 2FDHA 4D9JA 4JX0A 2CWEA 2C26A 1HRV3 3TAYA 4BIFA 3N9NA 1XSDA 5BMZA 3U21A 3ELKA 2LRPA 3KZIC 2PLV1 4CU6A 3PDQA 5CU1A 3GLXA 2O5RA 4L99A 2DA6A 2RDRA 4D69A 3BTXA 2JDYA 1W8UA 5HLHA 4AQSA 2H1KA 2EIEA 1TQ5A 1GNHA 3U2RA 4YFNF 4A3LJ 1UY1A 3WTYC 1DLLA 1UAAA 5K7PA 2DPDA 2I07B 4DNCA 3V7SA 2XIGA 3G71I 1N3QA 2AQFA 1C28A 2HU9A 4XOGA 5ABJC 3I3BA 2PN5A 1HW2A 2PAMA 1SLAA 2JPBA 2NNYA 1AR82 3H5AA 4CDXC 1BW6A 3V0AB 1S0EA 2F6BA 4H7MA 4CO8A 2HDWA 4QU1A 3JQXA 3AM2A 4UUVA 4MIMA 2PXJA 4J19A 5EIYB 2XAUA 1T39A 1Z6TA 2WB1A 1SHWB 2NAZA 1NCRA 1K4TA 2BWCA 4W97A 1ITYA 4NOTA 5DDJ1 2HWE1 3ZPYA 2VNOA 1XX5A 4WVVA 5DZGA 1U5ZA 4I3PA 2HH9A 3P9KA 2P7CB 4IE4A 2HOSA 1NX9A 1RUJ1 1OVSA 2X6OA 4FPEA 3KE2A 1PK6A 2P3IA 1YIFA 5T3NA 3W6JB 2DA7A 3MDPA 4AE2A 2ELJA 3WU0A 4BM8A 3T1BA 1GZWB 3POBA 4ES9A 2Y34A 3PUBA 4LO4B 1GU3A 1OKOA 4URTA 3CCJI 2VZPA 4NWVA 1NYWA 2BV4A 3E6MA 4PJNA 4K9SA 4XNFA 3ACHA 2QBYA 2Z69A 4FBFA 5DMYA 1H4GA 2GC3A 4CYCB 3LZZA 2X5IA 5C9AC 3BPSA 4AVZA 3ECQA 2VT3A 5AIPA 3NV1A 2GNBA 2BPA2 5BXXA 3LDBA 3LWFA 3BR0A 4Q5OA 3J7AY 1ZYBA 1OPOA 5F6FA 5C44J 3WNLA 2IFRA 1U12A 3FUQA 4AHZA 1XGSA 1P8JA 3CJNA 4M9XA 2WIIB 2Y0SA 4YZ3A 1LOEA 5CKTA 3AP9A 2R043 4ZYAA 2Q8DA 4CCJA 1GZ9A 2WFPA 4QTRA 3D5LA 5IUQA 2MSYA 4HZFA 2CHHA 4N53B 4N53C 2D45A 3IWZA 4Y5Z0 1RUH2 2XPJA 2J5OA 1YIJI 4BEHB 2RS52 2IA2A 2VC1A 3FHZA 1SAXA 3U4XA 2QEXI 1B6AA 2QZ8A 3CCRI 3L2RA 1IS6A 1NA1B 4UVCA 5DUUA 4ASNA 3OTFA 1CZSA 3U78A 1V5EA 3L9JT 4B3AA 4CP9B 2LTPA 2WZR3 2XUBA 4E7JA 5CYYA 3TW7A 4B3XA 1EA3A 2JKBA 2FQPA 2WT1A 1ZK8A 5LHHA 1EUTA 1W04A 5BYNA 3C7HA 1VQPI 3PMSA 2CQXA 3VHRA 2VMFA 2RV9A 1PUFB 3I7DA 4M72A 2P3JA 4X6QB 1W0PA 4NE9A 5J40A 1N3OA 2GC2A 2NMNA 2DF7A 4GCVA 1QJX1 5BS6A 3ZIXA 3TNQA 3FXRA 3TO7A 5ILSA 6PAXA 2AXTC 5C4XJ 2ZHKA 1QJY3 3VYTB 1KYWA 4M3DA 5HDNA 1ULDA 2Q0OA 2MGQA 4EGZA 3BDDA 1GFF2 1RUI1 1EUUA 5A6QA 1PO13 2RC4A 2ZGOA 3A7QA 2YPJA 4OVEA 4QX5A 3KEOA 5FPVA 2VQGA 2CY6A 4X1EA 3KYDB 1IKQA 5IP9J 3IDAA 4QMAA 2CNAA 1RUC3 4RR3B 4V2WA 4RQPA 4A3CJ 4IF4A 4Q5SF 5A3TA 2XSJC 3ZM8A 1AHDP 1UX7A 2HYJA 3CF2A 4N7UA 3BTIA 5LZ6A 4C30A 1R7JA 1Q1HA 3OS1A 4AI2A 2W25A 3ZSEA 5FUPA 1SLCA 1OLQA 4L18B 4UF0A 1BR1A 1P7JA 2RR13 3IB3A 2K40A 4FE7A 3OYEA 4NRQA 1UYXA 5DG1A 4KWKA 3H8OA 2QQIA 1TZOA 2VQLA 5DD8A 4CXWA 2VOWA 3PL8A 3ZYPA 2DV9A 5JLXA 3CDLA 5A80A 1UU6A 2BERA 2Z42A 2IVJA 2L02A 1N1YA 3FL7A 1DPUA 2I2SA 1RRJA 3EETA 5H9PA 1AR92 4XQ4A 1TP4A 2WC2A 1O8SA 1V9U3 3A0NA 4Z07A 2IZWA 4JRAA 2D98A 1MS0A 2VASA 3HM5A 5D5UB 3WF4A 1V6LA 2PELA 4QU2A 1L3JA 2I45A 2BVMA 2HYKA 3AP4A 3VKOA 5A7SA 4AVCA 3PNAA 3J81Z 1ZR2A 1XE8A 2E32A 1H2NA 3NEUA 4K1ZA 2YFZA 1K78A 1USSA 4CXFA 4IHWA 4UW3A 1J3RA 1WA6X 3A0KA 3PJRA 2WNVB 3ZQ7A 1TW2A 3VDDA 2GP3A 4KNYA 1YFXA 1Y0UA 2EV0A 5KXBA 4NAMA 4Q8KA 2W0XA 3K70C 1ZRDA 3C1DA 4F3QA 2B4KA 2PHWA 1CAUB 1HRV2 4J1XA 1YI2I 4MZUA 3ZXFA 2OD5A 5APAA 3L7WA 3LE0A 5DM7F 1BN5A 5DYMA 1IAWA 1U5TA 3G6JB 4LHLA 4LB6B 3JRDA 3CUQA 5IHRA 3E3VA 4YIFA 2VOVA 1ON2A 3I55I 2GSYA 1VBC1 4HT1T 1TME2 4JVAA 2J1VA 4CDXA 4L0PA 1W6QB 3H36A 1ZG3A 1WJBA 5LEKA 1JYCA 4H2AA 5FQ0A 4QKFA 3WP3A 3VDBA 1V55H 3I4NJ 3O1RA 2RDNA 2KIFA 5EYXA 3GTGJ 2DBNA 3DEWA 2O8KA 2HWF1 1DP7P 2K9QA 2EIKH 1GZTA 4NPRA 4QPIA 4LOCA 4XJWA 1X2NA 2WAQA 2RMU1 3KV6A 4B1LA 4E9KA 2JKXA 2M1BA 3EYPA 4YYOA 3PVNA 5CKQA 4CDQC 1W9FA 1VF9A 3ESWB 3LGRA 5FY8A 4YGCA 4MHGA 2R93J 1COV1 5HPOA 1HSTA 2WA3A 2LBFA 3P6BA 2WUHA 3LIHA 4XF4A 3ETQA 5CYVA 3O2PE 4R4ZA 1DF0A 4I02A 1ONVA 3B02A 2ID6A 1JZ3A 3HGYA 5CVUA 2WFF2 2VUAA 3FFQA 2RS31 2EXHA 1X1PA 5A1AA 3UETA 5GLUA 2G1MA 3HG9A 3I2OA 1R1A1 3O1PA 2QQ9A 1W6PB 5JHFA 4CZSA 2JIJA 3RZOJ 2HQAA 1UOJA 1MJBA 2OXBA 3K4JA 1TQIA 4D0QA 4XF1A 1QHDA 5C9AA 1X1BA 3GTLJ 1RUF3 1CIYA 4RHV1 5B2GB 5I0UA 4WZCA 5IVBA 2WN2A 3KV5A 3G1OA 2DBIA 4OIPF 3DF0A 1WCSA 3QRFF 2B9VA 4H4KC 1F4KA 1YFHA 3PJQA 5F2WA 2XLAA 3OS0A 4PGGA 4EN6B 3AVRA 4ARXA 1JKOC 1W2OA 4XR6A 1QHHD 4BE3A 2FMYA 3S3MA 1H8TC 1U5YA 5BV6A 5FMOS 2LNBA 1X50A 4G8XA 2XB6C 4HV6A 2F4PA 1CZTA 2L9RA 5FGMA 2L9VA 3AYCA 5A1FA 1LECA 4WXHA 3CJIB 2GIZA 2R042 1W8OA 4YW1A 3Q8AA 3HHGA 2XB0X 1T2KA 4ENKA 5K0UB 3R0RA 3P5JA 4RAYA 2QSFX 2ZXJA 2WT2A 2GXAA 3NJZA 1JW6A 1QZYA 4KITB 2PHDA 4CCNA 1G9AA 1H2MA 3FN9A 4UFMA 2X4HA 3OR1C 4BYYA 1SVMA 4Y5TA 1YLLA 4W6XA 2EFPA 3FHAA 2EFOA 5C3OA 1KDKA 4HN1A 1K83J 1WJCA 3IAPA 3HMYA 1OA3A 4I99C 1YS6A 4UFLA 4A6OA 4BQ5A 3WX5A 2XQXA 4A12A 3H50A 1QA6A 2ZXHA 4FFFA 4OMYA 3EQEA 4QWNA 1W9SA 2ZMEB 3AFHA 1A5JA 2EFNA 3OYIA 2LY2A 1VQOI 4AI1A 4FSJA 2VQHA 1MEC1 1T38A 1PM7A 3KF5A 1J59A 4NHYA 2ZGSA 3POSA 3LSMA 2B5HA 4YW5A 5M3FJ 4YG2F 2FMDA 1PO12 2G4IA 4Z1VA 2MD5A 3CZUA 4MEXF 4A3KJ 1UYPA 2ZNYA 1HDKA 4RB2C 2CV6A 1ZBA3 4HKLA 4BY7J 1VMFA 4IKFA 3BI3A 1RUC2 3AC0A 2P81A 4BWOA 4PJ0C 3A0HC 2XVCA 1R00A 4AI3A 2W84A 1A04A 2OZUA 4JGZC 3LCPA 1LOGA 1BJQA 3IL2A 2E1CA 2LH9A 3ZQIA 5KR7A 3O0WA 1A35A 1D1AA 3WU2C 3NNGA 1EYBA 4CPBA 2R7WA 5LCWL 4ISRA 1N1VA 5HS8A 4G6TB 1QPMA 3USUB 1NY72 4LHSA 2AS5F 1ETWA 3UNGC 1U6GA 2ZJQF 3AL6A 4M3CB 4LA2A 4IPAA 4M3CE 2IJLA 2FSWA 4CSWA 4DJAA 2YU9J 2XLFA 3VBSB 3SZPA 2VTXA 3VBSC 5DDGA 4EN8B 1TL8A 1FT9A 2QDNA 1SFNA 1XB4A 5K5QA 4IEXA 2JDMA 2C4XA 1AVBA 2IA0A 4A44A 3HC7A 2D44A 2YGLA 3O0VA 1XMXA 4FI9A 1JBCA 1QNTA 3P1IA 1DDNA 2XBO2 4KQ7A 1PP8F 1DGWX 2QKDA 4LITA 1X4OA 5KCMA 5FRNA 1ASJ2 3B00A 2PN6A 2D2WA 4YM2A 1F1ZA 4EJUA 5FMDA 3EYYA 5K7ZA 2J1UA 1LB2A 3TNPB 1NG6A 1AYN1 4WV8A 5LEJA 1RTVA 2VE8A 3WNOA 1G6NA 3CCLI 2BXZA 2OKXA 1S0JA 3NV2A 1FOYA 4XFAA 2L54A 4L92A 3DEEA 1ETOA 2JDNA 3NQOA 3AZWA 2HEVF 2Z5UA 3C7EA 2HR3A 4LA3A 4O6JA 1G86A 1G8WA 3HXLA 3BU0A 3WG3A 2R7OA 5EHDA 2GP5A 4V19K 3GJBA 2W1QA 3K1NA 1DHKB 2CUEA 1PZ8A 5EEAA 3PU8A 5C6CA 4CHUA 3GW2A 3B9IA 3BB6A 3K48A 4U0WA 3F72A 3APBA 1FOD2 4UXAA 4B44A 1A6QA 4GALA 4K8FA 5KHKA 4G94A 2IXCA 2BY0A 2NN8A 2UWBA 4ITCA 1Z3YA 4KWUA 4KWJA 3Q5FA 4EWDA 3WG9A 2XGDA 3K0LA 3MN2A 1WVRA 3U37A 2R5YA 3G6EI 2QCSB 1ETYA 1SQ4A 3VSKA 2F4IA 1AXYA 2KJCA 2WLPA 3I5UA 3OIQA 2EJRA 2M87A 3HL2A 2NVXJ 2M0CA 5TRDA 3S30A 3OBRA 3H8XA 1Z21A 3PNYA 4II2A 3NNJA 2NZ9A 4R4XA 1O4TA 4ZYDA 5L3FA 3BPZA 4BNCA 4MUVA 1ZRCA 1RVF1 2AXLA 1ZX5A 1UZ0A 1ULFA 2H6CA 2XWBB 1QJU3 5HXMA 3NQHA 1H8TA 5JI7A 1YFUA 4M3CF 5LFAA 3CKHA 5C70A 1VQNI 1GWLA 2YC4A 2EIDA 5DUVA 5JVVA 1ZGJA 5ERLA 3RQ0A 1ULOA 5EJCA 1FPN3 1TT5B 4RAGA 4XBLA 2BFUS 3CO2A 2DA3A 4PDWB 4I30A 1WCKA 1VQLI 2K02A 2FDIA 1SPPA 1HJGA 1I3HA 2WRAA 4XFIA 3SYTA 4IUGA 3F8CA 5LA9A 2PHUA 3E0JB 4KYWA 2G19A 4XJZA 5D8LB 4O7XA 5FZHA 2GNDA 3J80K 1A8DA 4BQXA 4N43C 2WAOA 2K0GA 1JUIA 4ZS3A 3LDKA 3EUHC 1VQ9I 2YU3A 4RAZA 5FD5A 1AX2A 3ZFEB 4ENMA 2X53S 1KITA 4AZZA 1ZN2A 2IUWA 3KLOA 1W8TA 1JUPA 2KISA 1D4M2 3IKVA 2OBPA 1HB1A 1WUVA 3HPGA 1RL3A 1YW8A 1KS5A 3AMHA 2JB8A 5FLHA 3SC7X 1H1IA 1W2UA 2QYOA 2KR2A 2ZEZA 4L9BA 1WCMJ 3N36A 3HKZN 3E5QA 1ZM1A 3DYMA 3RYRA 2IGMA 4BZ4A 2LTNA 3FXKA 4NNJA 4IEYA 1YC61 3VBUC 1PDNC 5J37A 1IPJA 4AVAA 1S7OA 1YQAA 4MXVA 3SNMA 1TT0A 3M8EA 1VFCA 2ZHNA 1YE9A 4Q4W3 1DGWY 1FYKA 3OPTA 1DGLA 1Z6RA 2M8EA 5CLSA 5BNOC 3L1PA 3M7AA 1G3WA 5IT6A 2ATFA 4KBZA 2VOXA 3ZN6B 4JBAA 4XJAA 4XBFA 4GRIA 2GMPA 4IESA 2LM3A 3BVCA 2VB6A 3RKXA 2CH0A 5B66C 4JGZA 3WLUA 1JH5A 1C8M1 2F2EA 1REFA 5FKBA 1ZBA2 2W2IA 1QF3A 2DMUA 2IEKA 3TDUC 2DFFA 1OLME 4FPYA 3THPA 3O1OA 1ZGAA 1R5ID 2PLV3 2EALA 3GTOJ 4Y1XA 1GP6A 4PF5A 4NN0A 4P96A 2GN7A 3N7JA 5JXGA 3G4SI 4Q4X1 3SH4A 2GZWA 4XDQA 4AFBA 2FOKA 1TE1B 3FZ3A 3ABLH 4M9ZA 2W39A 5DAVA 1V6KA 2CV0A 4HRIA 1GXQA 2VR4A 2UZKA 2Z99A 1RC9A 4I98B 2ELHA 1S0DA 1URXA 3Q8CA 5FJKA 3PTYA 2A3WA 1XMKA 1I5ZA 5CJ9A 4AQTA 4YGBA 4AEDC 5FY9A 1GV5A 2ZAAA 3C18A 2ET7A 1B1BA 4RS8A 3VZNA 3WW1A 3TO6A 1S2EA 4GKYA 3PVOA 2KRCA 5JOXA 5FUIA 3FXMA 4U0YA 3ZPLA 2DUQA 3PU3A 4H0EA 4EMSA 3BZ6A 3K1MA 3OYNA 3ZDVA 2Y6HA 4N9HA 3SXWA 1GWKA 4YGDA 5F8PA 5CAZA 4AHYA 4L8QA 5GM0A 3VWBA 3KEYA 1YHQI 3CNAA 1RUJ3 3CL1A 1MSFC 4YZ4A 3WGIA 3RZZA 2QKLB 1XC5A 4GAZA 3LSRA 4IZZA 2V73A 1YJWI 5EZHA 2FDFA 3R0JA 3LEIA 2IP2A 1PHMA 2HI3A 1OD3A 5JIAA 1L3LA 2W91A 3ZOIA 2LD5A 5LATA 2ZGRA 1G9FA 5A7QA 1SMTA 1J1TA 4R9CA 2V4JC 2D93A 3CLOA 1SMYF 1NE4A 3RQ4A 3A22A 2PQSA 2YC2A 3MIEA 4WM7B 5A6XA 1A6IA 3UJQA 1HX6A 3MW2A 1W8NA 4XUOA 3GTQJ 3HBKA 3J8F1 1ND2A 2VPLA 2JECA 4HBNA 4Q27A 1J58A 3WNNA 2Z9OA 1WCUA 4ZYEA 3U10A 3RKQA 1QVUA 2JA8J 4N0BA 2ZKNA 5BNPC 1MS4A 2Y6KA 4CRQA 1E17A 3GTMJ 5EG0B 2JUCA 3HQXA 1CVNA 4NR1A 3WE3A 3IDBB 5GKAC 1JTXA 4R9AA 2K4BA 2JG8C 3R05A 3JZVA 1BKZA 1LHUA 1KQ8A 3WG7H 2J7MA 1SLTA 3SHRA 5M5WJ 3VHNA 3BKZA 2P0WA 4CP1A 1IOAA 4DUVA 1MDMA 4MGSA 2KXLA 3OGVA 1I50J 4YVSB 3M3QA 4P08A 4BE2A 4BQ1A 1UAIA 3HNMA 1ULYA 1JT0A 3OR2C 2AR6A 5D6EA 3E6DA 2LY9A 4FTEA 1LEAA 4LXLA 3DPRB 5F5QA 1GXPA 2E35A 5TGTA 2ZXWH 1PGSA 3JRFA 3I2HA 4DGWB 1YRNB 2JWPA 4BXFA 3GLLA 2P17A 3HNYM 2W9XA 2MH9A 1PMHX 1F35A 4TN7A 1QJX3 2Q2EA 3OV8A 2O9LA 4M4RA 2HEOA 1RGSA 2V1UA 4DEQA 2VD7A 5JHUA 4OI0A 1SCSA 1PGL2 1NTCA 1FPN2 5DQ0A 1UOGA 2XJUA 1RUI3 4YRDA 3QPTA 4N43A 4AYUA 2BQPA 2ORZA 3EUHA 3GTKJ 2QGUA 4AU7A 5HCHA 4B1MA 4RGRA 3Q3SA 3WW4A 4GGGA 1WGPA 5M5YJ 4C0BA 4XTPA 3S16J 2PHRA 4MEYF 1K5MB 3WG4A 2DDBA 3KP5A 5F3IA 3USSA 4U36A 1OD5A 4LE4A 5H2FC 2OQ7A 5F39A 4HFSA 4IQPA 2E34A 1YFYA 3R4KA 3DTIA 2RDQA 2CG4A 1HOMA 3OYKA 3GO5A 2A5ZA 4AFMA 3FJSA 4E7KA 2P6CA 5L3DA 4Q0SA 4YWAA 5FZGA 4RB0A 3VGIA 4GD4A 5DAPA 1Q8PA 1I27A 2VCCA 4B4RA 5IK8A 5EJ1B 3M3YJ 2W52A 3SZTA 1BR2A 4LBKA 2EK5A 2XSDC 2JT1A 5BNOA 1I5PA 3POIA 2VXZA 3ZQGA 2CL2A 1P92A 1FNNA 4AIKA 2D6OX 5DXDA 4G7HF 5FV3A 1IDZA 3QU3A 1X8EA 5F6KA 4XUQA 1AZDA 1VAMA 4E4SA 4W65A 2VZOA 3NWTA 3HQRA 5I8YA 2GMMA 4HKOA 4F52A 4PDKA 5D8KB 2CGNA 3FBNB 3B73A 3CJXA 4DOZA 3CQZJ 1LRHA 1QQP1 1TMF3 3HRTA 5CKNA 2M7AA 1QNWA 4W4ZA 5JOYA 1MMDA 2DVAA 2VGDA 4Y20A 5H6QA 2R7ZJ 5BNNB 2G7UA 1OPMA 5E6HA 4OIRF 4FCYA 4I6ZA 4XAAA 2AEZA 2AUYA 1WFXA 4AM3A 4O9EA 3L9FA 4RS5B 5FP3A 1MR5A 4NC6A 4BGDA 2R0QC 4Y4RA 4YG0A 1C0WA 5I0SA 2VKDA 1LE8B 2EAKA 4LG0A 2YMZA 4XVHA 4S0HB 2VOPA 4LO8A 5CG8A 2YV8A 3MEXA 4AUXA 1J7KA 5FXXA 3QH7A 4AEDA 4Y52J 2L2OA 1MH3A 2LVSA 4GFBA 4C2TA 4XFHA 3GCXA 1NH3A 3CP2A 4GJYA 2HOEA 3DQVC 4M00A 3ABKH 2HWC3 1Q8SA 1ZZ6A 4BJ6C 1GV9A 2HOTA 5FO9B 5EV7A 1IG7A 4OMCA 4FOWA 2BBAA 1BI3A 5D8AC 2CS3A 3H7JA 1V6NA 3VOEA 2HTJA 2HWF3 4FXKB 2L9LA 2M3AA 1WGXA 4NDLA 5JZGC 4Z2WA 3V0AA 2ZEYA 2XJQA 1H9TA 2ZCWA 2QA4I 3DKWA 4OIOF 1K79A 1PZ9A 1IUFA 1COV3 3DXJF 2NLRA 4FTSA 2ZHMA 3CMMA 1AX1A 4OIQF 1GWMA 4YFZA 4D6QA 2R7UA 2P3YA 3S7EA 1OUSA 2CW7A 5FKMA 3VBHB 3FF5A 1IDYA 4LOTA 3D1NI 5E1RA 2JDUA 4IO9F 5IATA 2BOJA 4JZRA 2VUJA 1X1AA 2HWB3 1XD7A 3FMQA 1E2XA 2LREA 4AYBN 5HNFA 1FSEA 1N25A 1A8MA 4Q4Y1 5E8GA 5IT3A 5EGOA 2VJJA 4ZYGA 4Q47A 4Q0UA 3VBOC 1QXRA 3DL3A 3I2DA 5DABA 1MMGA 2FBEA 2C9KA 2C6SA 4C3HJ 4ZZ5A 1HKSA 1RJ7A 3F0CA 2JE8A 2ZJ2A 2HWD2 4R9DA 1H6XA 3Q9SA 2IT0A 1ULCA 4EATA 1N1SA 2J5PA 1QJEA 2KIQA 2VXDA 5FZCA 5GZGA 2JG8A 1S0FA 3L09A 2CW8A 1FPQA 3J7NA 1JS9A 2K7LA 2CV2A 4EJVA 1OHFA 3W21A 4B4QA 5A33A 1HRI1 2NQYA 1QO0D 4GH4B 5GP9A 1L7RA 4GH4C 5F0HA 2L5QA 1DQ0A 1PX3A 2VE9A 1Z0HA 3BQZA 4B8EA 4CEWB 1OC1A 1UU5A 4A5MA 1YYVA 1UKGA 3HOWJ 3BOQA 3T30A 3FBIB 5A3MA 2QSHX 5JFRA 3MEPA 5J8FA 4JC1A 3ZMVA 2VJ4A 5IYBJ 4IHYA 4XDPA 3ZN5A 1GDTA 2W48A 5JLWA 1FTZA 1AX0A 2DT7B 1ZYRF 1FX5A 3ZN4A 2ZOEB 2ORXA 2BV6A 2KDOA 5FZ8A 3I59B 1NA1A 5FIXA 4RN5A 4YZ2A 4CP9A 5FREA 2I5UA 5TSWA 2PFWA 1QOTA 4XILA 3WQ7A 3KD4A 4NRMA 2NNNA 4QQ2A 1LOCA 2Z2SB 2IXLA 3WHCA 1ENXA 5A6ZA 4LFUA 1JHNA 9ANTA 4BDYA 2CGOA 3IRQA 1R5HA 2ZXQA 1MEC3 2XH6A 3ZFGC 2VBYA 3KIOA 4ZC3A 2W94A 3O7OA 2YG0A 4HQEA 1LGCA 4DEVA 1O3QA 2F6CA 1CAXB 3LA2A 4BQAA 2JA6J 3LQRA 1SCRA 3X29B 5HV4A 1MS1A 3UGHA 1DDLA 4V1PA 4ZTJA 4UVAA 5DM6F 1RUE2 1UW8A 4RR3A 4ZXKA 3J7AO 1GNZA 2A1XA 5A2QK 4DXSA 3RFRA 3JAMK 1VQ7I 4E4HA 1PNFA 1PYVA 4WVMA 2V5DA 1ZZ7A 3F9KA 1PVEA 4KUMA 3NAPC 1MKMA 2QQJA 3KP3A 4P00B 3DECA 4HVQA 2BRTA 1VLNA 4OAZA 2VTXJ 4QWQA 3GFMA 3ACFA 3NAUA 4EN0A 4YM0A 3VL9A 3U1DA 4XLEA 3WTVC 1D4VB 1YNAA 4P02B 2XF5A 3L2QA 2VC9A 2PJRB 1DYPA 1NG7A 3WDXA 4LHNA 5FLMJ 4LORA 2P8TA 2ZABA 3NSTA 4P9IA 1CJDA 2GN3A 5D4SA 4U7DA 2STWA 3AJYA 3BOWA 5KHJA 2RM21 1EV11 4KG8A 4Q8LA 2XB5A 2D1HA 1E5IA 1ZA7A 3QYFA 3O3KA 1U0AA 4JKLA 2LYCA 2LDUA 1ENRA 1GP5A 3V7CA 3RMYA 4EROA 1MBFA 2A71A 3S14J 3AG4H 3BTYA 5IVFA 4HAMA 3TGNA 1LTEA 2Z1DA 1B35C 3AFGA 5B1AH 3S3OA 2ARBA 1TMF2 2WWYA 5C3SA 5C5TA 1XCBA 3F2ZA 2CQNA 2XV4S 2HVRA 4CVUA 3BUCA 4KU7A 2K9SA 2EZHA 1UZCA 3H9QA 1C57A 1Z0XA 1XNAA 4G7ZF 1CAUA 3C8XA 1AYN3 4FISA 3ZO0B 4DS0A 4XOPA 2EA7A 4AGGA 3EO6A 2W4SA 5L9VA 2L9SA 3HNBM 2TCTA 2V1DA 5IVCA 5D8AA 1Z1DA 3QLQA 2E7AA 4AVTA 1TZLA 5DTDA 3SLIA 5J3UA 4BXSV 2M8GX 1AJOA 5FPAA 3V0BA 5KC6A 1IG0A 2VZRA 1W6QA 4IV1B 4P5OA 2VZSA 1VJ2A 5AC91 1M4WA 2HWC2 3OYWB 3H5NA 4HF2A 1ZAOA 4IHTA 4W8JA 3LPFA 1GV2A 5C8CC 5JSRA 3WW3A 1TWFJ 1YW7A 1B72B 2ZGUA 4WXDA 3ST7A 1ZTRA 1KEXA 4UVBA 2YBPA 3ZLIA 3U4SA 3BG5A 2IBDA 4LR4A 4WM8B 4MFEA 4MGQA 5EQUA 2K3FA 1HLCA 2EPFA 5JVTA 2GC0A 2V7FA 4YFXF 3ASOH 4ZZLA 2E2IJ 2O3FA 1E3PA 1J0RA 3G3ZA 2LROA 5FY0A 2QZ3A 3VN4A 2V6EA 2VH9A 5CFCC 1VBA1 2W68A 1IGOA 3MIFA 2FJ1A 1W6PA 2NP0A 2YPDA 3ZX7A 2XRLA 3AZYA 3BTLA 2HWB2 1W5SA 3Q0UA 1JKQC 3DUIA 2WQ4A 1RVF3 2VG9A 4FXGB 2A75A 4AL9A 2DDAA 3CCQI 4Y7NJ 2FDJA 3TEZA 2Q1FA 4HXCA 4LKFA 2XPUA 4QXHA 5EZGA 3JRHA 3O1SA 5FZLA 5A7OA 2CQ7A 2VECA 4XE9A 1GLHA 5FPBA 1GQPA 2IA1A 1GP4A 4LKDA 1X3UA 1POQA 4V2FA 1W6NB 5EEGA 3PNTA 1AYM2 5T55A 4YW2A 4OHYA 4KDPA 1OF4A 4XN3A 4KWLA 3TW6A 3DTEA 1O91A 3I2IA 3ML6A 1DFQA 2QVOA 1LHVA 1P6RA 1Y56A 3H3UA 4LJHA 1MBEA 4K40A 1KQ9A 2OX0A 2MHFA 3C7OA 5K0UA 5F5CA 5ISLA 1R083 3BPVA 4E7HA 2RS13 4L0YB 1UELB 2NYXA 5HCBA 2BNNA 3KMHA 1AL21 5JR3A 1UMHA 3WDYA 2E5NA 3PUFA 4BISA 4RGKA 3AG1H 4AQ6A 3NNMA 5FP7A 3HT2A 1LKXA 2BE5F 1UMZA 4Q4V3 3UK9A 3M07A 1L7LA 1HQCA 2GAUA 2IGKA 1S9HA 1W99A 1YWKA 3LA3A 2HGCA 3U9GA 2JJ6A 2M7BA 2GBYA 3CCYA 4FQGA 1KD7A 3UGFA 4B48A 1C1LA 4JHTA 2P2KA 4EZHA 3VD5A 4BXUA 4G6DA 5F5IA 3OUJA 4E4DX 1J9IA 3OL4A 4BMEA 2X85A 2ZX2A 5I0RA 2EF6A 2EIGA 2RREA 4QX3A 3HT1A 2DAOA 2BDRA 3AL0B 2H8WA 1DQ6A 4BAYA 1UY2A 2Y0MA 2KQRA 3T0DA 1UHMA 2PX9A 1QU0A 4MHUA 4HNTA 2NS7A 1WI9A 1WH5A 5FKCA 3OSDA 2R4GA 1C8M3 1EV7A 3O8GA 1O57A 3OUIA 1NT0A 1W06A 2X8KA 2GU9A 4MO3M 2ZX0A 4UUSA 4MXWA 3VZLA 5JVGF 5E17F 1YITI 4FQ4A 1JZ8A 1BOBA 4QB6A 4XHBA 5A3WA 5J4VA 3ZKUA 4OI1A 2WN3A 4QM9A 5FLXK 1T56A 4P9FA 2V72A 4E2QA 2J1RA 3W59A 2EINH 1W2TA 5DCMB 5IP7J 4Q4X3 1SLBA 5JR2A 1NXMA 2DI3A 2HVSA 1BBT3 3TBDA 1POGA 2LUWA 1PVC1 1S72I 3C2BA 1OA2A 2F5FA 1BI0A 1FNYA 4SLIA 4D5FA 3BROA 1HW5A 3BCAA 3A01A 5ACA1 1B35A 1BW5A 2OUJA 4S2HA 5CISA 4B7EA 3OBZA 3OOXA 4CDWB 2COMA 2EH3A 3A4CA 2F5DA 4YG3A 5F64A 4GDFA 1PGW2 3LIGA 4M3CA 2O14A 2W95A 1TWAJ 4RB3C 4QPYA 4NQWB 5IVVA 1DU0A 2VMEA 2ARXA 2CUFA 2D40A 3OUHA 4DNYA 2QQOA 1GQHA 2YC0A 5H9QA 2A6VA 2HDCA 2J1AA 1UO9A 2EBIA 2A3SA 4YVWB 1UOFA 4HETA 3CDHA 5LBFA 2VZ1A 4B7KA 3RPUA 1H0BA 1V6MA 3M2MA 5IAXA 3F8FA 5FWJA 3PFIA 3GXUA 4MQVA 3I3EA 1U5IA 2ZX3A 2Y9YA 1U78A 3O14A 4EM2A 1SANA 3IPVB 3PIJA 4LBNA 3MD2A 3T0BA 1ONAA 1W6OA 1X1DA 4N4OB 4CYDA 2AZ5A 3IWFA 4A3GJ 2R1BA 1WBFA 1Y0NA 3L00A 3MMYB 4E7LA 5A7WA 5E3OA 4P9LA 4L9VA 5C8CA 1O8PA 5DN2A 4BJ5C 1WWYA 3I58A 3TN92 1HKTA 1HXS1 2VMCA 2OUHA 3OBAA 1V54H 3ZXLA 3DFGA 2W1WA 4CUBA 1NLRA 5IYDJ 3JBG2 2FU4A 1RUG1 1PIV2 3EJKA 1F36A 1ALYA 4ARYA 3R61A 3JTHA 1ZREA 1H2KA 4XDOA 2LMDA 3J8F3 4A3MJ 4XPVA 1HKDA 1OCRH 3DP7A 4HPKA 3U14A 4PLNA 3C2GA 4AVBA 4PBOA 1JUHA 4Q26A 3T09A 2PA7A 2FZ1A 3ZFFB 4YSFA 2ETEA 4M9SA 5CFCA 4CCMA 2HJIA 3EMRA 3N35A 4LK1F 1LKNA 2XHKA 1MS8A 3C3VA 3ECHA 4PIXA 1VQKI 4CU9A 2PYTA 3LPGA 2A05A 3K2ZA 2DFEA 1JYXA 4ZDOA 1PO23 2O7OA 3HYIA 3MFAA 4OQ9A 2ZEXA 4CCEA 1MZ5A 3VL8A 1FBUA 2ZBJA 4ASLA 3HUGB 1AJKA 3ILFA 1E57A 1D0ZA 3A21A 3VPRA 4LO6B 2R16A 1UY0A 4XONA 4IEOA 3GNEA 4PZJA 3RJPA 1E3OC 3SEZA 3AKRA 5ICGA 5GZEA 3SFZA 1RKWA 3CMYA 3AKTA 4BU2A 2DCZA 4KJZA 3VBFA 4CGZA 1FXZA 2R061 4FHTA 4AGRA 2ZGPA 2R7VA 1XSQA 3ABUA 5KXDA 4AYBA 1MQTA 3MKWB 5EP9A 4ETSA 4M71A 1SVOA 2ZB9A 3DBLB 3X2QH 1O4XA 1JI6A 2DT6A 1XNBA 4G6QA 4QX7A 4MOAA 1NK3P 1FOXA 2WS91 3JD71 3WP6A 2ESHA 3CC4I 3GCWA 5JOZA 5L7OC 4JGYC 2WO3A 1V4RA 2HQRA 3A1YA 2KDZA 3ITQA 4AXOA 3I4IA 2MA3A 3ZMDA 1QJFA 2DCYA 1R091 4NMIA 2K4JA 1CF7A 4D1QA 2WTEA 3CTAA 1C3HA 1IJWC 1JGGA 3AP6A 3ZYIB 2XJSA 2JEMA 5CA6A 1MPXA 4UWDA 2M4GA 5CPRB 3ZFEA 1XYOA 4KIGA 3GZTB 3ACGA 3K4DA 2WKKA 1R082 1WZXA 3E7LA 2RS12 3FWEA 1IPKA 1SFYA 5CVJA 4PBPA 4NROA 5LB6A 3MF6A 5FUNA 4FOYA 4XRSA 1G9DA 4FTBA 3BT9A 4YW4A 1X3ZB 3I4PA 4OUEA 4KNCA 2I74A 2OUMA 3J4UH 1QOOA 4Q4V2 4JX4A 4XICA 4WBBA 4CH7A 2YXSA 2ZKZA 3C7JA 1YFWA 1HF0A 3TEYA 1LNSA 2W85A 5GPCA 5D5XB 4QQLA 4AIJA 1YO8A 2LLKA 3HOVJ 1US3A 1AR81 2GMEA 3PO2J 2ME6A 3TMOA 4HW0A 2WBKA 3Q8EA 2D6MA 2D6PA 3BTZA 5AVAA 1TVGA 3O1TA 1EH6A 2YY1A 3K4KA 2W24A 4S2FA 1RIOH 3VZOA 1NCRB 3VD4A 1QQP3 3ASNH 5JPNB 2VAUA 2FRHA 2DFBA 2PMZN 4IRIA 3KSCA 2JJ7A 1ZZBA 2VONA 2DK8A 1OLRA 1XPXA 4LGWA 3I4MJ 3PUIA 3WUDA 3C7FA 1PK6B 2BW8A 2DFCA 5KC5A 1GLNA 3GWZA 4YNIA 2PAKA 5J09A 3D5RC 3T2TA 3OOUA 3SCHA 3MFCA 3L2YA 4A4AA 4CCDA 3GZNB 3WTZA 3H35A 5FZ1A 3QWLA 3MGUA 5GZDA 2Z16A 2L4AA 2IGOA 1R23A 2E53A 4OQ8A 4QSHA 5ILVA 1S29A 4QKBA 5C5UA 4PSWA 3GTPJ 1BBT2 2C24A 3HVDA 3S6PA 2JUGA 2QBYB 1LVAA 1D5VA 2PTMA 2VTFA 4KMQA 2XHNA 5FROA 4AG4A 2X5IC 3I71A 2P6TA 1SG3A 2DWRA 1IN4A 5J47A 1UJ8A 5GLVA 3NNFA 3RJRA 4HL0A 3GEZA 1T08B 4WWCA 2A6WA 3V7RA 4K3UA 1YJNI 4HN0A 4JQFA 4RD7A 2BBYA 1JUMA 2HBTA 3MO4A 4F93B 2LRDA 4GXLA 3VYUB 2VNGA 5L9RA 3J7MA 2DMQA 4Y15A 4GKXA 2VXRA 2V1NA 3WTSC 4D0PA 4U88A 5FZIA 2M34A 3SISA 1RUH1 4UFIA 1ON1A 5EEHA 2NMOA 4AAPA 1GUIA 5CFDB 3RCOA 5HNHA 2E1MB 2XAGA 2RS51 2E1MC 1W9YA 2DU9A 4E7IA 3I3DA 1LQ1A 1HIXA 3N9MA 3QD6A 3NO8A 2DJIA 3OY8A 2Y33A 2PHXA 2WY7Q 3VHPA 2FBKA 4OHWA 2VUCA 1NCQC 4OUMA 2AACA 1GBGA 3K10A 1KFUL 3H42B 4Q4Y3 5F3GA 1LFPA 4IEVA 4XZPA 2JICA 4LHKA 2ELKA 1V70A 2DCEA 3OYGA 5IT9Z 1LGBA 4BHBA 4P9JA 2DYRH 3FHIB 2D1VA 2V6CA 4LMYA 3M3OA 4WM7A 1QNYA 3OF1A 3WQ0A 4XF0A 2XASA 3LOCA 5TJJA 1RHI3 1E5RA 3O12A 3IH2A 1YS7A 2E19A 4GYIA 3OJBA 1P4AA 3J8F2 4DRRA 3BIEA 4QD2A 2QQWA 2GOXB 4OMZA 2KRFA 5C3PA 1X9PA 2QQKA 2OT7A 4ONUA 1W9TA 3VKLA 1AOYA 4QHZA 4RQPC 3GF2A 3OYMA 5B1BH 2DQLA 3SQNA 5JPMB 1JGSA 2BOIA 1Q8VA 1U9NA 1PO22 3H5RA 1SBEA 3FBYA 1SAUA 4D7TA 4BJTA 4PJJA 4QB1A 2F17A 5A7PA 4UF0B 3KP4A 1HV0A 1RMU2 3LEMA 2WDBA 4PF1A 1UD1A 4YVSA 1YIPA 3CZ6A 4AAXA 4KIFA 1KU9A 2A6XA 3KP7A 1ND3C 4QKDA 4UV8A 2M5WA 1BEV3 4D7MA 3WGHA 4XMIA 1K45A 2K3PA 1AR91 1GSLA 2FCUA 1LHOA 3TEDA 5L7OA 4JGYA 2GXBA 2DU1A 4BIOA 3WOGA 3LFUA 3GFLA 2LALA 1VBE3 1R36A 4RL7A 1YLFA 5K5OA 2CAVA 4Z92B 1HW1A 2ENRA 4JDNA 4CU8A 4TLFA 1Q1VA 4KL1A 1VQ6I 4ON0A 2YB7A 3B94A 4QX0A 2Q8CA 2HTSA 1BI2A 1PMJX 1Y39A 1UOBA 5FBZA 1DZRA 2DFIA 3VDDC 1R1VA 1O4ZA 2Y0IA 5AFBA 2E31A 1D1BA 1ZBE2 3AK0A 1XNCA 2Y69H 4DBRA 3HWJA 1MACA 4PCRA 1R58A 3ZXDA 2XWJB 2RE9A 1BMV2 4IEJA 4IGOA 4LUKA 4UAPA 3ZQFA 5GJ6A 5HV0A 5GTIC 2TRTA 1U5TC 1W0OA 4GB31 4FX0A 4PLMA 2VCMA 3CUQB 3WP5A 5ABJB 4QB2A 3CUQC 3HSEA 1TME1 2VJ5A 3SCGA 4TSVA 4LO5B 2LG4A 4U87A 2EA2A 3N4MA 4CDXB 3KF3A 3KX2A 3RZGA 4R8HA 5B3SH 3RDIA 4W6YA 4F8AA 2WJSA 4ASMB 1UZWA 3OGGA 2BZTA 5FQ0B 5KWRA 3LSPA 1OYYA 1NQJA 2XLGA 4D7SA 4IRGA 2MPFA 2WADA 2DFHA 3VKNA 1FIAA 3DU5A 3H3ZA 4CEYC 2RM23 4C0HA 3DKXA 1FMVA 4QPIC 2E6VA 3MYXA 2KPMA 2OU2A 5LK5A 1KRIA 2F4MB 2Z33A 1XYNA 3FK6A 3U0ZA 2RNJA 2D5FA 4LLFA 3KYCB 4MNUA 2VBBA 3G1LA 4YGEA 3NVCA 2ID3A 5JXJA 4OMDA 4ZYHA 2WFF1 1ZQ3P 1QBJA 5BNQA 3E5UA 2QBXA 4MG2A 5BNNA 2MNGA 2RJKA 2KIUA 3IDEA 4FPHA 1X3WB 3AVSA 3K9TA 3FE5A 5E3MA 3IP4B 1XU1A 4DUWA 2IXJA 2Y30A 3H92A 3B6CA 4RS5A 3BOPA 2E7QA 4S2GA 3EUKL 4TWTA 2MLGA 3K3NA 2KA3A 1UXXX 5C9AB 1B09A 4HNVA 3CDZB 2BGOA 1WLWA 3U07A 1S7AA 4B29A 4BMBA 4HEA2 4BLJA 1T6GC 3JQWA 1W03A 3W2VA 4CXYA 2DK5A 2XUMA 2VN2A 1DZTA 3S17J 4IOAF 5JWPA 3Q8BA 4EN7B 3L2UA 3RVHA 5AC93 3S2WA 1JXSA 3CJQB 2Y60A 2FD8A 3RZMA 3PM1A 3CIHA 4JRLA 4LK6A 2CDPA 5G05L 2P7VB 3NL1A 3FDYA 4OAYA 4KISA 4NHMA 4YLZA 3WGGA 4FFGA 4PIZA 4RA0A 5T5OA 4MO7A 4QPWA 1UKRA 4EV0A 3TP0A 4ZJZA 1P2FA 1DP3A 2R041 4AEJA 1VBD2 2VQAA 3LMMA 2LC2A 4QPGC 3ELNA 1T8IA 4FP3A 1G9BA 5D5WB 1NCQA 1RB8G 5A3OA 4QKNA 3WV6A 3C2HA 1HDDC 4L5IA 3F6VA 2BXYA 2VNVA 1RNLA 4ZDLA 2IXHA 1UB9A 1BHGA 4M3FA 3AKZA 4IL6C 2NVYJ 4CPBD 2FQ4A 1VBA3 2A70A 2UY9A 1K12A 3KVAA 5CQGA 1PUEE 4IE0A 4XC9A 3EPZA 4PQ9A 4L11A 4G9SB 5C33A 1T6BX 1UPIA 4Y24A 5FKKA 1DP0A 2UUZA 1F5TA 3R60A 1CJPA 1FSHA 4UI9L 3HOYJ 3WQ1A 4ZXEA 3DCQA 4D3WA 3H3VK 3K70D 2LP0A 2OZ6A 2O0OA 5FOJB 2X29A 3ZCOA 2AHQA 2ECBA 1A36A 1I3QJ 2WNUA 1DQUA 5BPIA 2PLYA 5IAVA 2R072 4UW5A 3M8LA 3E97A 3M9AA 1RHI2 1FWZA 2ZFUA 1PO11 2B9SA 1UCRA 4HOOA 4LD5A 3LFIA 1VZ0A 5IOZA 2B7YA 2RV8A 4MGRA 3FM3A 3CLQA 2OQ6A 2QQNA 5LW9A 1H8AC 3GBGA 1RUC1 4XK4A 2BGCA 4FPKA 4E7SA 2WT0A 2R0FA 1YHFA 1V6IA 1J09A 3OGSA 5FJHA 1H8VA 2VZ3A 3IKTA 1ND3A 1N78A 3BYWA 4CEWA 1GVJA 2B0LA 3KETA 4Q2FA 1S55A 1PJRA 2KJBA 1R1TA 2ARAA 1IN8A 3IAM2 2A69F 3S0MA 3SZGA 2JD9A 2PQ8A 5FO5A 1HDPA 1G3TA 4RGAA 1CZVA 2P5LC 1VQ4I 4EWAA 4QPQA 1K42A 1WA4A 5FWEA 1BZWA 3CO7C 3BGAA 4H3WA 2D3PA 3A02A 2HOAA 1JU3A 1K4SA 3MVPA 4LLLA 3K75B 4RDUA 4M3EA 5FZ7A 2X6XA 4XJUA 2C5DA 2W08A 1NY71 2JVHA 1BEV2 2A7AA 3ZQQA 4LK7A 4UB8C 5GZFA 3PVEA 2QF7A 3F23A 1R22A 2UV1A 5LD2C 5CKMA 2RQQA 1NE6A 4LLNA 2WAEA 1RUD3 2CQKA 2ZX1A 3T2OA 5M3MJ 1VBE2 3N97A 5FMCA 4GWNA 2FEZA 5I93A 5TISC 2WB1N 5EJ3A 3ZSMA 5ICCA 1SFUA 2J1EA 4Q29A 4PCQA 2EXIA 2ZSIB 3POEA 5C4WC 1AR62 3K4AA 4M4PA 1FMD2 1VRH1 1WCDJ 5LWBA 1I1GA 4LBQA 1RXGA 2XBO1 3ZMOA 2HQ5A 3NMBA 4OINF 1ASJ1 3TYJA 4Q4ZF 3LF7A 1KONA 3MUZ1 4BQ3A 1U3EM 3WINE 1GYKA 3K7AJ 1Q8OA 3ZR5A 4CDUC 4RM2A 5HLTA 5CIRA 4NIAA 4AIDA 5FFZA 4XHXA 2DCJA 4CEYA 3M1HA 4AFDA 4K1YA 5LGUA 5J6XA 2WAFA 1PVC3 2DOEA 4E2SA 3K3OA 4MFDA 2OV7A 2M45A 3P9CA 3AYEA 1PX4A 4LPLA 1O7FA 4CDQB 3ZOBA 2V09A 2CDOA 5ACA3 1JZ7A 2MYSA 3L2WA 4HX8A 5C3EJ 3WTXC 4P5HA 3K4ZA 3MLKA 2XVGA 2IW5A 2HQNA 2L4MA 3H1WA 1CESA 4EJRA 2Y0SN 1FOD1 4TV7A 2JG9C 4C90A 3COAC 4XEZA 5LA0A 3MKZA 3R0AA 2FNAA 3J7YJ 3CF6E 1Z05A 1ZELA 2XDVA 4BB3A 3H9AA 1HLVA 5A3NA 1OCCH 2ECCA 2HYFA 3BR6A 3T08A 3DYPA 3BZKA 3GZ5A 2ZJPF 1ZGWA 4FPFA 1Z7S3 4INDA 3VB2A 2B39A 5C3QA 2JE9A 5GADJ 3HPHA 2R5YB 1DYOA 4WK8F 2F5VA 4ORFA 4M0HA 4KGGA 4BK4A 1E5SA 1ZZCA 4XF3A 4LUMA 3KLNA 1OUXA 2JDHA 1AKHA 1XG1A 2H09A 2CAUA 2K9MA 4LIUA 1APNA 1XRUA 4C1XA 1B4AA 2BTVC 1JODA 2HNHA 3LD8A 1OQ1A 1APLC 3POWA 2LR8A 5FFOC 2X51A 5IOYA 5FZ6A 1H8TB 5FZKA 2A61A 1HXS3 1SFEA 1YX3A 2VVFA 1IN7A 3U75A 1HB3A 5CADA 1RUG3 5LA1A 1XE0A 4MGYE 3QPHA 2XL9A 3W58A 5AC92 3F3XA 4QPGA 5CEHA 2I8DA 3HZJA 3I53A 2W92A 1RUOA 2OYZA 3B69A 3QAHA 1IXCA 3W20A 1B72A 2Y2ZA 4HANA 4YG6A 2H0BA 3LAPA 3AKSA 1V00A 1OPCA 3ETPA 3V56A 4NIIA 4ENNA 1MBKA 5A7NA 2EV5A 4NAOA 1SLIA 1WKYA 2VZQA 3NV3A 3NKTA 5BOXA 3WVJA 4WVZA 1E3HA 3PO3J 4UB6C 3SKJE 5C7GA 3MKLA 3MZHA 2D5VA 2EXKA 1DUXC 2WZR2 3P9IA 3WE2A 1YJLA 4Y22A 1D4M1 1JJ8C 1DYKA 4CUAA 2VT2A 1RXFA 1ZRIA 1JHHA 1B9MA 2YBKA 4META 2NS0A 2WYSA 5I91A 4XXPA 1MD0A 3JW4A 1ZNPA 1RJ8A 4S05A 3EHKA 1Q43A 1HJFA 5FFXA 2AREA 3O1UA 1X36A 1HXDA 4LJZF 2QQVA 5T52A 3UL2A 2WL1A 2WBMA 3I2GA 2M4KA 2VODA 1SDDB 2IXSA 2LF8A 1QJY2 2R063 1QKQA 4IEWA 4X8PA 4JKMA 2RHPA 1KJLA 2DVFA 1QXJA 1FOWA 2OA4A 4D7YA 3DPLC 3OYAA 4QX8A 5BPXA 5GZCA 3IM0A 2ESNA 5ERIA 4BQWA 1IRZA 4B8XA 2FNPA 3NRUA 2VIXA 2KM2A 4M3BA 1JKRC 1B8IA 1W5TA 4G3YC 3V8LA 2DODA 2EB7A 2WWSA 1W8HA 3IIIA 1MIJA 2HVQA 1W6NA 2R30A 2K46A 2GC1A 4JHZA 5LGTA 1WMFA 2KT0A 2A5WA 2DVBA 3L2CA 4KMUX 1VAVA 4KGQA 2G9GA 1TWHJ 2GWRA 4JGZB 1R4MB 4HONA 4DXTA 1ZBA1 1R093 3TL4X 3I64A 1X9TA 2PJPA 2RR12 3HOBA 1PVXA 3THCA 5FYIA 2QZ2A 3F8NA 3G1MA 1OISA 4KA4A 1OSGA 3MKYB 2IS1A 2HBUA 3KHCA 3BG3A 2Q5TA 2CWMA 4L9JA 3SCFA