3LA2A

Crystal structure of ntca in complex with 2-oxoglutarate
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
196
structure length
196
Chain Sequence
VETFERNKTIFFPGDPAERVYFLLKGAVKLSRVYEAGEEITVALLRENSVFGVLSLLTGNKSDRFYHAVAFTPVELLSAPIEQVEQALKENPELSMLMLRGLSSRILQTEMMIETLAHRDMGSRLVSFLLILCRDFGVPCADGITIDLKLSHQAIAEAIGSTRVTVTRLLGDLREKKMISIHKKKITVHKPVTLSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the allosteric control of the global transcription factor NtcA by the nitrogen starvation signal 2-oxoglutarate.
pubmed doi rcsb
source organism Anabaena
molecule tags Transcription
molecule keywords Global nitrogen regulator
total genus 55
structure length 196
sequence length 196
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3la2A02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3la2A01
4MH0E 2VE8A 5AVPA 1ZNPA 1YLFA 3R6SA 4EJWA 4QWQA 1FYLA 4QM8A 2XVCA 1YFHA 1U2WA 1VJ2A 5BMZA 2ESNA 1W7PB 1I27A 1MJBA 1TLHB 4IEVA 2P7VB 5DV5A 2ZO4A 1R23A 1CAXB 1ZHFA 4B29A 1YS7A 3KEQA 5FPZA 2PMHA 3MFKA 2ZCWA 2A69F 5JVTA 2FRHA 1R58A 1QXRA 1J59A 3REOA 4O9GA 4EJTA 4UXAA 3HRSA 5J3UA 1ON2A 4KFCA 3ZMUA 3ERED 2OZ6A 2BNMA 4H0EA 2F5EA 1IN7A 1V70A 4UVBA 3CUQB 5BUVA 3BWGA 3C7JA 4XFAA 3WW1A 2EVXA 4CYDA 3W6JB 2IPQX 5EEGA 1OYWA 1YFXA 4DNCA 1PMIA 3CUQC 2OA2A 3DEUA 1DZRA 2I45A 2ETEA 1IN4A 4OOIA 2RKHA 5FCCA 1K78A 1WRJA 3O14A 3ML6A 1IUYA 3RIRA 4KN7X 3Q9VA 3VFZA 2K02A 1ZZBA 3Q9SA 1B9MA 3F3XA 2KJBA 2Z33A 1RC6A 1NZCA 3IC7A 4G8XA 3HSFA 1Z6TA 5CYVA 1ULYA 1SFUA 1KU2A 3M9AA 3EQEA 4A5MA 3OCPA 1ZRFA 1FBQA 1ZX5A 4XRFA 1IXCA 4GYIA 4JV4A 3EO6A 3NKTA 1KU7A 3BB6A 2UY9A 1ZGAA 4MEXF 1ODDA 3IL2A 2QQ9A 4PZJA 3IBMA 3TOAA 3ZMSA 2P5VA 3H3UA 1IN6A 5E1WA 3F72A 2JZYA 3D5LA 4XSZF 1XD7A 4U0YA 4MEYF 3KP7A 5F64A 5DYMA 2HR3A 1ZLKA 4HF2A 1YW8A 5HLGA 2L4AA 2W25A 4A0XA 5E1XA 3H7YA 3NSTA 2M87A 2RQPA 1F5TA 5J7MA 1T39A 5E18F 2DTRA 3N97A 4OIPF 1OD5A 4WXHA 1R5GA 1YYVA 4N0BA 4XFHA 2DO7A 2OAZA 1ZRCA 2STWA 3J81K 3E6CC 5ERIA 1BOAA 4BAYA 3LZZA 1STZA 2C0ZA 5E20A 4HSJA 3ABTA 3E6MA 4LG0A 4YYOA 5LHIA 1OYIA 2M5WA 5HDNA 2G7HA 1LRHA 2ELHA 2IA0A 2KXLA 1X8MA 1WSUA 5L3GA 4XF9A 1BJAA 2TDXA 4PDKA 4MZUA 4MTEA 5D6FA 4HDUA 2L3DA 3BU7A 2PHLA 4Y17A 1YWKA 5FQ0B 1HSTA 5HLHA 3SMHA 1DPUA 2JTVA 2KIMA 3H1MA 1LVAA 1DPRA 4E2GA 4IF4A 3M3IA 3CUQA 1TW2A 3EBRA 1XRUA 1KYZA 1BIAA 5AIQA 4IRIA 3E5QA 1L0OC 4JK1X 4D7TA 4LB6B 5L3CA 4YIFA 4R8HA 5JR3A 4JBAA 3K1NA 2Z5UA 4XFIA 3S7EA 1J58A 3UKVA 1MDMB 1XGOA 5ILUA 3I59B 4CO8A 3CO7C 2O03A 4PIYA 2ZMEA 2EA2A 1USTA 3QAHA 1XE7A 4EVIA 5BXXA 4IEYA 4IEWA 4U88A 1BBYA 3L9FA 3LQRA 4M72A 2A6HF 2VT3A 3HUGA 4WCGA 5JHUA 4IRGA 1R22A 3NL1A 1T0FA 2HQRA 4GXOA 2H0VA 3V4GA 4M6XA 2CSOA 3TNQA 4L0YB 5I8YA 3QPTA 1QGPA 2XASA 3D0JA 3G7DA 1B1BA 5BPXA 2PBIA 2LDUA 1WKMA 2K27A 3CLPA 3I4PA 4LA2A 2L01A 3H7JA 1BI2A 1MJAA 4ASNA 2YU3A 4BH9A 3TQNA 1XGSA 5LGUA 3OF1A 1G4DA 1IPJA 1X3UA 3F8BA 1HXDA 1CAVB 1G3SA 1ZZ8A 3GFIA 2JSCA 3I64A 2R3SA 3SHRA 2G7UA 4HF0A 3JSOA 2X0LA 1IZ1A 4BYYA 5KHIA 5K1YA 4FBFA 3ELNA 2E9QA 3E97A 2ATFA 5FDBA 1S29A 4P55A 4XEZA 5J6XA 2XHKA 4G6QA 3S0MA 4UHTA 1XSVA 5FLHA 3GYHX 1ZVFA 2R7DA 2E7XA 3MZYA 4RAZA 4MTDA 1YFWA 3RJPA 2J5PA 4OIRF 4JTNA 3IRRA 2K0GA 1JXSA 5FB2A 1OR7A 4RAYA 2HYGD 3HRTA 1S8NA 3IWZA 1OPCA 4A6DA 5BS6A 1U6GA 5JFRA 1UW8A 1BC8C 3KE2A 4X6RB 3RZZA 3DFGA 2M45A 1ZRDA 3F8FA 3M8FA 4HZFA 1MD0A 4EJOA 2C6YA 2P5LC 3ES4A 2HOEA 2QVSB 2Z99A 3OOPA 1NXMA 2MC3A 5FQ0A 1Z6RA 5HS8A 1PP7U 3CEWA 2Q30A 2GZWA 3TNPB 3BPXA 4UBHA 3PQJA 1UCXA 1YO5C 4RD7A 2D45A 2ACJA 2FSWA 2OBPA 2F5CA 3FMSA 4A0YA 1PUEE 1O3RA 4OMYA 4BQAA 4RB1A 4KIFA 4HMZA 3DQVC 2YR2A 1TTYA 4RB0A 5DUIA 2QVOA 3KP5A 1W4MA 4O9EA 2EFWA 4RB2C 1BN5A 1OFNA 5JAXA 3KP6A 4LMYA 5H6RA 1XSXA 4JQFA 2Q2EA 3H92A 3KMHA 2UXNA 4LJZF 2RN7A 4UBGA 5F6FA 1KA8A 4L11A 2OYZA 1WLTA 2PEXA 4XFGA 5JI6A 1Z91A 4ENJA 5CLSA 2QUFA 1Z9CA 3CJNA 3EHKA 2FOKA 3V7CA 3J80Z 1I1GA 2HZTA 2ESHA 3IIAA 3F6VA 1LDDA 4XFFA 1FLIA 3K1PA 2EV6A 3VOEA 3FHZA 2V9VA 1C0WA 4HOBA 1U78A 4CXFA 3HYIA 4ZU7A 1ZH5A 2STTA 2CAVA 1DP7P 1YTYA 5BOXA 2GA2A 4MGRA 5JSOA 5ICEA 3GEZA 3RKXA 1B6AA 4M71A 3VEPA 2P7CB 5ICFA 4FAGA 3KP4A 1SFXA 1F4KA 3EETA 5FLIA 3GZ5A 2F4PA 2MH2A 1Y0UA 1P4WA 5D8LB 3SCHA 3R60A 2QYOA 5ED4A 2XIGA 4BHPA 1HSJA 3G3ZA 3TO9A 2VQAA 2HJIA 4D7SA 5I93A 4KA4A 4G6DA 2WFPA 4QXKA 3PLQA 3C3VA 3KGZA 2FBHA 3HT1A 5FFZA 2VPVA 1ZRRA 4KMUX 3VB2A 3TDZC 3U9GA 4KT5C 5CVVA 2DQLA 3O3KA 2CYYA 4AXOA 5TJJA 4M9XA 4M73A 1XGMA 3V7SA 2GAUA 2FBKA 5L3DA 4ON0A 1D8KA 2JT1A 3WU1B 1Q1HA 3F8CA 3G73A 4RGSA 4X6QB 4GGGA 1RUNA 1X7NA 4BHCA 3SXWA 3WE2A 1ZAOA 2XAJA 3M7GA 1MJ9A 1IW7F 2DBBA 3CUOA 3GXOA 3GZ6A 1DGWA 3K9TA 5D5WB 3OTFA 4WXCA 2FMLA 5EZWA 2PAKA 3T0YA 5ICGA 4PCQA 3LA7A 1J1LA 1O5LA 4XLNF 4ENMA 1EP0A 3WU0A 3J81Z 1J75A 2NYXA 4I98B 2ZNYA 5HS7A 4M74A 2EA7A 2HKXA 3TGNA 1QPMA 2XAHA 2QWWA 3HIFA 3UKTA 3E6DA 4U0WA 4OIQF 2IP2A 1GQGA 4N9HA 2W85A 1P2FA 3LOIA 1QNTA 4HX8A 2K7LA 1HKSA 4LUKA 2UY8A 3QP6A 1ZG3A 4U0VA 4LFUA 4A12A 3IKTA 1T38A 2PAEA 4GYGA 1S6LA 4HV5A 5CVUA 5E1RA 5LEKA 4BNCA 2WWYA 1FWZA 2YPRA 4A0ZA 5ILSA 3BOQA 2XAQA 2D40A 2UWMA 3WW3A 3LA2A 3K0LA 2Z9OA 2MLGA 3RTRA 3U11A 4Q0VA 4IRHA 1XCVA 1B4AA 1XDUA 4IEPA 1EPZA 5C8WA 5J48A 2LF8A 5EFUA 1UIKA 1FY7A 4XF4A 1YS6A 2DFIA 3DKWA 2GU9A 3H9AA 3HRUA 5FPXA 3K69A 1MZBA 4LULA 1YG2A 1REPC 6PAXA 1O3TA 2NNYA 2O0YA 4EWDA 4MQ9F 4META 1K7AA 1W7PA 3L7WA 4I2OA 4WX9A 3FZVA 4A2UA 1I6XA 1QO0D 1O5UA 3ZDSA 3BZ6A 5LRRA 4RGXA 4IERA 2OU2A 1FNNA 3QACA 4MHGA 3FJSA 4E2QA 1LEAA 3DPLC 1R00A 4KN4X 4M9ZA 1O7FA 2PQ8A 1OKRA 4ESBA 2CW0F 3EUHA 3H1YA 4WVZA 2VC1A 2EV0A 3LWFA 4IHSA 5FO5A 4FX4A 3V8KA 2XKPA 4OIOF 1JUHA 3H3ZA 4MX3A 2QENA 1ZZ9A 3PNAA 1Q5OA 1FSEA 1BIBA 1ZYRF 2KIUA 2QM3A 4HLYA 1T2KA 3EYYA 2Y75A 1ZREA 3QOPA 2DCTA 5K8SA 4O6JA 3WW4A 3NQOA 4PGGA 1Q3EA 2P8TA 4HBLA 5DD8A 2VOOA 3LAGA 3GVAA 3PFIA 3WTWC 1K6OA 2HTSA 1JHHA 2EK5A 2JPBA 5J8CA 1DUXC 4YG2F 1FOKA 3H1WA 3FM3A 1W5TA 1TBXA 3JTHA 1HKQA 1MGTA 5DEQA 2P6TA 2PFBA 3U2RA 4XFBA 3OV8A 2RVCA 3HQXA 5A2QZ 3FWEA 2B0LA 3KSCA 4Q47A 2GC2A 1U12A 3I59A 4K8FA 3HSEA 1TQPA 1KQ9A 5CVJA 5K5RA 4MGZE 3L2HA 4F8AA 3JZVA 1J3QA 1TQIA 4LTAA 3LSTA 3WTUC 1D5VA 2PTMA 3TO7A 4MGKE 1Y9QA 2ZMEB 2UYBA 3S2WA 4HDVA 3CDHA 1A04A 4R1HA 3BJAA 3N4MA 2EFOA 4IEXA 4XETA 4OMZA 3I71A 4EGZA 4AWXB 2QBYB 1KGSA 2CV6A 2EFPA 4HX7A 2M8EA 3GFLA 4M9SA 2AXLA 2D1HA 4DINB 2BE5F 4OLLA 4HF1A 1CX4A 5E1ZB 4Z82A 5D1IA 3WE3A 4WZCA 1J3PA 1U5TA 3K1MA 4LD5A 3F22A 3RNSA 4GCVA 3FF5A 5AIPA 4LLLA 2Z2SB 1GQHA 3GW2A 4TLFA 1JHFA 2VE9A 3WGGA 1O3SA 1IF1A 1AWCA 3ACLA 4LK1F 3BCWA 3GYDA 2GXGA 3LFKA 1X8EA 4YFNF 1YHFA 1KQ0A 2IW5A 4HN1A 3WODF 3USSA 3P7NA 3EYIA 2P4WA 1AOYA 1SD7A 1YW7A 3JAMK 4P9FA 4BXUA 1HBXG 4L9TA 4EROA 1QQIA 1R1TA 4AIKA 4HA8A 4MUVA 4KYWA 5IT9K 3WTVC 2FMYA 1U3EM 2D5HA 2L54A 1CAXA 5CU1A 3QPHA 2O61A 3JSPA 1BI1A 2RV8A 2GA1A 4XLPF 3MEXA 1EV7A 1FPQA 2DK8A 4AVBA 3SXYA 3ZN0A 3NJZA 4FHTA 1XCBA 2RC4A 3B02A 2GQQA 3IDBB 2FNPA 5IT3A 2MPFA 5I91A 4KUMA 4HAMA 3RPUA 1YIOA 2ZBKA 5HLIA 3GLXA 1CAWB 4KWKA 3D0SA 5E17F 2LF7A 1ZZ6A 3RKWA 3F6OA 2PQQA 3MPBA 3L2CA 4I0AA 5ILVA 1LEBA 3CTAA 2VN2A 4A5NA 1UHMA 4JVAA 1R5HA 4NQWA 4ORFA 3TDUC 5K5QA 5JR7B 2V6CA 2NAZA 3DP7A 2XAGA 1G6NA 2ET7A 2K4BA 5D5VB 4HLTA 4HQMA 2FQ3A 2O8QA 3EJKA 3WGHA 2PHDA 2CFXA 1FXZA 1H1MA 2PN6A 4LA3A 4PIZA 1VR3A 4GULA 1H1IA 4QGNA 2O8XA 4PGHA 3KETA 2IXLA 5DUKA 2Z3YA 4ETSA 2ZNZA 3GUDA 2ZXJA 2H94A 2A61A 1BM9A 2LNBA 1FZPB 3DN7A 3RYKA 3GFJA 3HTUA 3KGLA 5D4RA 1V4RA 3EQLF 1SMYF 3FZ3A 1XDSA 1T6SA 4AIHA 2Y0MA 5BV6A 2NRAC 3GF2A 4KNYA 5FGMA 3RYPA 3H50A 5AONA 1P4AA 2VODA 2VECA 3U1DA 5LHGA 1T98A 4G7ZF 4ZYDA 5KHGA 4IXAA 2H09A 5CJ9A 1HW2A 1E17A 4U7DA 4HLXA 1FP1D 4P5OA 4XF3A 5H20A 1TNTA 5K5OA 4CDGA 3P9CA 3DPTA 2Z69A 2ET1A 3VHRA 2A3SA 2OQRA 4ZZLA 1UHWA 5IT9Z 5E8GA 1TQMA 2VOPA 4JTOA 3GO5A 3PQKA 4G7HF 1ZG1A 3NRVA 4G7OF 4CHUA 2QCSB 3BALA 3MDPA 2K4JA 4LLGF 4R52A 3ELKA 2XL9A 2PJPA 4KIBA 1XN7A 2O3FA 1WI9A 2BBYA 3MYXA 5HDKA 3OGJA 2ADUA 3QU6A 4Z07A 1PM7A 1MDMA 3SCGA 4G9YA 5KHJA 4UV8A 4NHJA 1SMTA 5HI0A 3MCZA 4KIGA 5FD5A 1LR5A 2RGVA 5CVIA 4Q0UA 4QM9A 3GWZA 3HHHA 3ABUA 2DAOA 3FE5A 1IN8A 3C18A 3IKVA 4EQQA 1G3YA 2YSRA 1U8RA 3RI4A 1YFYA 1XE8A 3NVCA 5J8FA 1L3JA 2WV0A 2FBIA 2HEOA 2BNNA 2W84A 2F5FA 4ZYHA 2H6CA 2K86A 4L5JA 4H7LA 1EH8A 4AQ6A 2HYFA 2F5DA 3WTXC 5BPDA 4IPAA 5C6CA 4L5IA 2RNJA 5FLXZ 2PI0A 4Q0SA 3WTTC 1X82A 3ISPA 1RGSA 1FP2A 4AVPA 5LHHA 1CAUB 4UVAA 3BY6A 5HDGA 2QDRA 2VC0A 4HBNA 4ZU4A 3CL1A 5D8KB 3UKNA 5D6EA 3ULQB 5HVQC 1S7OA 2IXJA 4KWLA 2EFNA 1J5YA 5KHHA 4KU8A 1ZLJA 3ZPLA 1ONVA 3DL3A 2EFQA 2DPDA 5FFXA 2XUBA 4P9GA 1QY4A 2K9ZA 2DK5A 4AVCA 2VBWA 1VTNC 2BYVE 2UYAA 1SQ4A 2XLFA 4Y15A 5L3BA 1KYWA 1FT9A 1DZTA 2B9UA 1DGRA 4A6EA 2MD5A 5LRSA 3K2ZA 4HW0A 4ESFA 2D93A 4YIIA 1W7PD 1SD4A 4R79A 1OMIA 3M8EA 5BPIA 2E7WA 3ETQA 1QWRA 1H0MA 1GVJA 3ZMTA 4YRDA 3KFWX 3J7AO 4ONUA 5A2QK 1Z7UA 1FC3A 3QRFF 4HSLA 2PA7A 5JCTA 2L4MA 2XLAA 1YQAA 3ST7A 5D4SA 2FNAA 2IXHA 5H6QA 3KLNA 3CJXA 2EAAA 2HDCA 3CF6E 2MBFA 4MV2A 1ZG5A 2GC3A 3DV8A 5JSRA 1IAWA 3FXUA 3E5XA 2EV5A 1FBSA 4YFKF 3RPQA 4I7HA 1RI7A 4UVCA 2E1NA 4UNOA 2O1QA 1GHCA 1KU3A 1R1VA 3KCCA 2BEOA 2KIFA 5I8TA 4LK0F 1Y3TA 2J5OA 5BY5A 1NYWA 1UCRA 1UIJA 3LA3A 2HKOA 1SD5A 2MH9A 3NEUA 4IEQA 3IDCB 3HOTA 4ESJA 2CAUA 3JTGA 2HWVA 3ZMZA 2B5HA 2IXIA 3BROA 1QZYA 3BJOA 4ZYEA 3V8JA 3SFZA 1HW1A 4ENNA 4GO1A 2QJVA 2LSOA 4UV9A 1S3JA 3WTZA 4YSFA 4G94A 5I0RA 4XFCA 1I5ZA 4M6YA 3FXQA 5DCMB 3ROUA 2N7GA 4QX5A 2JPCA 1SFNA 2M1BA 2XL7A 5LEJA 1MKMA 4KU7A 3T8TA 2GH2A 3GX4X 2ISYA 5CADA 1L3LA 1WA4A 4KMFA 5L3EA 3CO6C 1P4XA 2P5KA 2LKPA 3MQ0A 1B59A 2DT5A 4CICA 3EDPA 2WC2A 4I02A 2PFWA 2VT2A 1JGSA 1U5TB 2IRFG 3LAPA 4E2SA 3L09A 5ICCA 1LDKB 1IN5A 2FQPA 2KRFA 1Z1DA 4LLOA 4MGYE 1UFMA 3P9IA 3ZN1A 4ZYGA 2HTJA 1VP6A 1S7AA 3ES1A 2DI3A 2FA5A 4HVRA 2GIVA 2EA4A 1FSHA 4HN0A 4UUVA 4EWEA 1PP8F 2PG4A 4RS8A 3M70A 1UPIA 2EB7A 1CF7B 4LG0B 2HGCA 3RYRA 1ZZ7A 4KL1A 4EM2A 2DLLA 3I58A 2AS5F 4EV0A 2M30A 2VXZA 3R4KA 4Q0QA 3CLOA 1QBJA 2KJCA 3D82A 1GXQA 4E70A 4RGUA 1H9TA 4IEZA 2ZKZA 2O6GE 4FX0A 5TRDA 2V1XA 3I0TA 4EM0B 2OZJA 5FD6A 4D0PA 3T5XA 1J2XA 4B8XA 1PDNC 3HTSB 1F9NA 4UXNA 2KKOA 1P92A 2IXCA 4K2EA 1E2XA 1USSA 4OU0A 2QLZA 1RZ4A 2Q0OA 3FXRA 3CO2A 5I0UA 1ZN2A 2A5YB 4L18B 1TNSA 4MGIE 3JAMZ 1NE6A 3F23A 5FLJA 2MLKA 4OINF 4QLCU 1OI6A 1J7KA 2QQBA 5F1RA 1CGPA 3BDDA 1O4TA 3COAC 4N9IA 2XAFA 4IETA 3FM5A 2H6BA 4EGYA 5DDGA 1D3YA 4HVOA 4EMSA 4XSXF 4FT8A 1JE8A 1EH7A 2V09A 3HSRA 3RKYA 3LAJA 4QGMA 1KU9A 2GWRA 4J1WA 2IA1A 2PYTA 2PLYA 4XBFA 1GXPA 1G3WA 3FX3A 4Q4ZF 2A6EF 1HKTA 2L02A 4LGWA 5E8IA 2BNOA 2FEZA 5KK1A 4AIJA 2HS5A 5L3FA 1CAWA 2OPKA 2VBXA 2VONA 2DQRA 4EJUA 1O57A 4EWAA 1FI2A 2DU9A 3I5UA 4AVAA 2P17A 2W24A 1ZGJA 3O6BB 5DCMA 2XRNA 2DW4A 1XB4A 4WBBA 5D5UB 3SQNA 1Q43A 1YLLA 4WF2A 1BC7C 2WTEA 4I09A 1UD1A 1BI0A 1YUDA 5T3NA 4L9JA 2XGXA 5FLXK 4KWJA 1NHAA 1IPKA 2DPUA 1HQCA 2MA3A 3B73A 2IA2A 1R1UA 4J1XA 2OQGA 3QP5A 2EWNA 1XMKA 3WW2A 2GC1A 2OD5A 5I8SA 5KVRA 3WTYC 3JW4A 1CF7A 1YFUA 3SZTA 4P96A 5LGNA 1LNWA 3I7DA 2UXXA 3HRMA 1EY2A 1FX7A 3HHGA 4YFXF 1XMAA 4WK8F 4NB5A 2PMUA 5EEHA 4L2NA 5KHKA 4I3PA 2GXBA 1J3RA 3HT2A 1FYMA 3GFMA 1J9IA 3NW4A 2FU4A 1QXJA 2IC1A 3KZZA 5JSPA 4BIFA 1RL3A 3QU3A 1IRFA 3KLOA 2BGCA 5DD4A 2BV6A 5LLQA 5D5XB 3WGIA 2CQKA 1IXSB 4S04A 4ENKA 3KP3A 3T1BA 2IT0A 2HFHA 1Z05A 1FBUA 4BHBA 2Y0OA 2PAMA 1B9NA 3LWCA 3R0JA 2E1CA 1V3FA 3OD0A 4LUMA 2FE3A 4IVNA 4AD9A 4IHTA 3MWMA 3I54A 1LJ9A 1EH6A 3MZHA 1WWXA 1IXRC 3KZYA 3GBFA 2CWEA 1OYYA 4Q5SF 1NE4A 2XV4S 4S05A 3SHFA 3KP2A 4L0ZB 2JRTA 4ZZDA 1EYBA 4RGRA 2NNNA 3E3VA 2Q8KA 1ZARA 4HV6A 3ZMDA 1UB9A 1FYKA 1LQ1A 4QMAA 3E5UA 3IRQA 4KDPA 3TOBA 4L9VA 3Q5FA 4Q29A 2QQAA 2V1DA 3BP8A 4Y13A 4PIXA 4TV7A 3ECOA 2D2WA 5HS9A 3MAJA 3W6KB 4RB3C 3ECHA 2IXKA 1CAVA 4LEJA 4AQ2A 4ZH4F 1SFEA 3E6BA 1SAXA 3FHIB 2XROA 4HX4A 2QNKA 3R61A 2ZJ2A 5BQTA 5DCFA 3R0AA 4XF0A 1BI3A 4WXDA 2YX7A 4Q48A 4O5VA 2CG4A 2OZUA 1DDNA 2Q1ZB 5I0TA 3ZMVA 4NVPA 2ZKLA 3C3WA 1KQ8A 1LDJA 4MQVA 2IJLA 4CZZA 2F2EA 3V7RA 1U5TC 3FMRA 3DXJF 2OA4A 2V79A 1RUOA 4LB5A 4CGZA 3T8RA 3RDIA 1TQ5A 4O3MA 4Z2YA 3J80K 1K79A 1SEFA 2P6SA 3WTSC 4PJYA 1XGNA 1SD6A 3ZP5A 4I01A 4U7BA 3FFQA 5HOOA 1W5SA 4IESA 5KBFA 2Y48A 1J0RA 4P9UA 2G9WA 4I0BA 2FF4A 2R7FA 1ZZCA 2X4HA 3DF8A 2Q4SA 2EJRA 1WQ2A 4IEOA 3I53A 2Q0AA 4WWCA 2D1VA 2W57A 3V8LA 2CO5A 1LKNA 5LBQA 1O7LA 2D5FA 3KEOA 1HW5A 3TO6A 4OFGA 1P6RA 2IVMA 4YARA 2ETHA 2H27A 4ZU5A 3F8NA 3IHUA 5I0SA 1ON1A 1QZZA 2RDPA 3IWFA 2ZFWA 2A68F 3F8MA 2XLGA 1G3TA 4L9NA 2VBZA 4DQ2A 2YX4A 1RNLA 4KICA 1K78B 2B8MA 4YNIA 5E16A 1RIOH 2A07F 4HVQA 1XSDA 1IRGA 4IEUA 2MHFA 2MNGA 3S7IA 3U0ZA 2FXAA 1TW3A 4HYEA 3F21A 1WGPA 3M1EA 1I1SA 3TKYA 3BJ6A 2CGPA 3BPZA 3PVBB 2QBYA 2VBYA 4HQEA 3C1DA 3LQQA 3VODA 2GC0A 3FMQA 3L00A 3ZQ7A 1R7JA 3HOSA 3SZPA 1H9GA 3AAFA 2QZ8A 1D8JA 3U10A 2UZKA 3H8UA 4B09A 1F1ZA 4MNUA 2XKOA 3SCFA 4IJAA 2HQNA 1R36A 4XF1A 3O2PE 5CVRA 1LB2A 4QGLA 3BPVA 4EM1A 1CAUA 2ISZA 4Q0PA 5LGTA 1RTVA 1YW9A 4EJVA 3WG9A 2NS0A 3P9KA 4FAHA 1O3QA 4LLNA 2COMA 4F7ZA 2V1UA
chains in the Genus database with same CATH superfamily
2VE8A 2AHQA 5D8AB 4EJWA 2R062 2DMNA 4H4KC 1VJ2A 4LBKA 4Y1XA 4AOCA 5A6ZA 2ESNA 1W7PB 1KJLA 3USUA 4XTPA 1TLHB 3FHQA 1ST8A 1MEC3 1X4PA 1H8TB 4MXWB 3C7EA 3MFKA 1W28A 3NAPB 2A6TA 1D0YA 1W6QB 1R58A 1J59A 4O9GA 2JG8B 5EGOB 4EZHA 4XM3A 3JU9A 2W1UA 4IQJA 5GJ6A 4KFCA 1W36D 3OYDA 1LOAA 4NR1A 1ETVA 4H0EA 1V70A 3HN1A 1UELB 3C7JA 3KF5A 3W6JB 1QEXA 2IPQX 2YFUA 1MEC1 3TEXA 2VJIA 3K4ZA 4COUA 3C7HA 3N7KA 3SFIA 2I45A 5C44J 4X6AJ 5FXWA 2ZB9A 3C7FA 5FCCA 1B72B 3O1OA 3BTIA 2GMMA 1IUYA 2XVKA 3RIRA 1WCSA 2DFCA 1ZZBA 1B9MA 1QA6A 3F3XA 2KJBA 1N47A 3IC7A 3HSFA 3WG7H 1QDCA 2DYCA 3TL4X 4XTMA 3CF5F 1SFUA 4OVEA 2W1OA 4GH4C 4Q1PA 1NG6A 5A1FA 2VQLA 1H0BA 2A3YA 4CYCA 4A3IJ 3UYJA 4JV4A 3HQRA 4L0PA 4E7LA 5FZDA 2JA8J 4Q4W3 3LOCA 4C0HA 4MEXF 2CTVA 1T2XA 3Q0WA 3I4MJ 4PZJA 4IE4A 5K0UA 1OBNA 4YVSB 2DDUA 4ITVA 1AR63 3F72A 2JZYA 4XSZF 1XD7A 4U0YA 5LBFA 1X1BA 5F3GA 1RUG1 5CPRB 2WWUA 2HR3A 2WKKA 2OKXA 1LGBA 1LU1A 1HRV2 2BQPA 1YIJI 2B4KA 4IOCF 3NSTA 2RQPA 2G1MA 1NKGA 4JHTA 3I4IA 1R9TJ 4PBOA 2YFZA 1OD5A 3W5NA 5GAGJ 1ZRCA 3J81K 5F39A 5ERIA 3LZZA 4Y20A 2UWCA 2JDMA 5L73A 2RDRA 2PHWA 4QD2A 1AYM1 3SLIA 4HSJA 3ABTA 3E6MA 4LG0A 5LHIA 1OYIA 4YIRX 1IRXA 2G7HA 5F9TA 5ANQA 2IA0A 2KXLA 4N8MA 1WSUA 3KVBA 3WVJA 1BJAA 4MTEA 4NOTA 3TAYA 4DZJA 1XQNA 4HPKB 4Y17A 2ZSIB 1HSTA 4B3NA 4AEDB 3WF3A 3K10A 4WVMA 2JTVA 1LVAA 3AG1H 1GNHA 4DOZA 3K48A 1SZBA 3M3IA 3EBRA 3BI3A 1BIAA 4IRIA 3W59A 4JK1X 1HOMA 3RQ4A 3JREA 1WLCA 3VDDA 2HDWA 1PX4A 5JR3A 3HDDA 4JBAA 5A7WB 2Y0SN 1C5IA 4QQPA 5FYZA 4XFIA 1TG7A 1RMU1 3CHXA 2NMNA 4D6RA 1R6RA 1NXD1 5C4WC 3AYEA 2VD7A 3H5NA 3PJQA 5B4XA 4PIYA 2ZMEA 1DQUA 3POBA 5DAQA 1ZA7A 1XE7A 4HPQA 3UV9A 4ZXKA 4IEYA 4QQHA 1BBYA 2XOMA 4W6WA 3L9FA 3HUGA 2VBDA 4IRGA 1A8MA 1W8TA 2QKDA 4JGYA 4AW7A 1T0FA 3OMYA 2X85A 4GXOA 2FJ1A 1ULEA 3DWLE 2HPMA 4M6XA 4C2TA 3OBRA 3G7DA 1W8HA 3A0NA 2RS12 3OJBA 2PBIA 2K27A 3O5SA 4RGAA 2E6VA 2NS8A 4FFIA 2VC9A 2D7FA 1H2LA 2YU1A 1BI2A 4ASNA 2E5NA 2W94A 3TQNA 4XJUA 1G4DA 4QX1A 5FMOS 1ZBE2 5DTDA 2JSCA 1TMF2 3PIOF 3WCRA 3SHRA 3JSOA 4RMNA 5KHIA 4BYYA 5K1YA 2BU9A 2W87A 2R5ZA 3WP3A 3DU5A 1TWHJ 1F5JA 4LJHA 5FP7A 2CQNA 2XHKA 1D2QA 4UHTA 1VBE2 3GYHX 2V6EA 3PHMA 3VBOC 2BY2A 2R7DA 3MZYA 4PF1A 1N1VA 2J5PA 4OIRF 4JTNA 5GLTA 3GNEA 2K0GA 1C8M2 5K7PA 1OR7A 2H1KA 1X50A 4I99C 3AMMA 1OPCA 4A6DA 5E89A 2CS3A 5J4YA 4IGPA 1U6GA 1QJZA 1UW8A 1BC8C 3KE2A 4X6RB 1G9DA 3RZZA 4A3ZA 4M3EA 1PNFA 2M45A 4FOWA 3VBUB 4HZFA 1MD0A 2FD5A 3O0XA 4XJ9A 3H0GJ 2W48A 2VJJA 3BKZA 2QVSB 2Z99A 1NXMA 1W3VA 2C4XA 2HEYF 1PP7U 3C7GA 3VHNA 3LOBA 2WO3A 2AR6A 5FZ3A 1US3A 3TNPB 1YO5C 4ZONA 1AR91 1LGNA 2OBPA 1PUEE 1O3RA 1YXWA 2A6VA 1KFUL 3DQVC 3POSA 1W4MA 4O9EA 4RB2C 4DUWA 1PMHX 1BN5A 1ETYA 2R1BA 3KP6A 4LMYA 3VBUC 2EXHA 3H8OA 4JQFA 2XPWA 2K9MA 2DUPA 4BQ2A 3MUY1 3OYBA 4UBGA 5C4XJ 1KA8A 2R7UA 4N43A 1WLTA 1LFBA 2LTPA 3U1KA 4XFGA 4BL0B 1A31A 2KDOA 3RZJA 4YG6A 5A6YA 3F6VA 1FLIA 3K1PA 4PJNA 3OYNA 1UMIA 1C0WA 4HOBA 1VBA3 1U78A 4MHUA 2VQTA 1GZ9A 4ZU7A 4P14A 2JA7J 3USUB 1QHGA 4E27A 2CWSA 2CAVA 3ECQA 3ABKH 2AO9A 5A1AA 4D6SA 4BXSV 3EETA 4RHV2 5AC93 4DXSA 2F4PA 2MH2A 2JDKA 1TZOA 4B4CA 3SCHA 3R60A 2BV4A 1GU3A 2VTXA 4WM7C 4OWRB 5B66C 1F35A 1Y9MA 2YMZA 1GV2A 4XOPA 2VQAA 4D7SA 4G6DA 3C3VA 1BJQA 1VPHA 4F52A 4P5YA 1ZM1A 4LOTA 3U9GA 1HLVA 1RINA 5IYDJ 3KCXA 5DMYA 1C1LA 1AHDP 5FZ7A 4IL6C 1NCQC 3EUHC 5J47A 3QLQA 2J22A 2RMU1 1XGMA 4FCAA 3EYPA 2NYYA 3V7SA 5F3CA 4ON0A 2FBKA 1I5PA 4BIOA 3P3NA 1Q1HA 1F15A 3F8CA 1OOPA 3WLUA 1GWKA 3BUCA 3IAQA 4ARXA 4BQNA 2XAJA 3M7GA 2DBBA 1JHJA 1X58A 3HC7A 3K3NA 3VDBA 4Z6YA 1KJRA 1RESA 1LESA 2ARXA 4NPMA 1W9YA 1GV5A 4YVWA 2PAKA 2CSGA 3KHCA 1FAYA 2W4SA 3WNPA 1S0EA 1EP0A 1HB4A 3NWKA 3S30A 2YYOA 2NYXA 4I98B 3KD4A 3HNYM 2EXJA 2F6CA 1IQDC 2GNDA 2EA7A 5JXGA 4A3XA 3OYEA 3UKGA 1QPMA 4ES9A 3HIFA 3E6DA 1YJWI 3CBNA 4YVSC 1GQGA 4N9HA 2W85A 4XIDA 5FKLA 3P3PA 3G1MA 1P2FA 1QNTA 4HX8A 1AL23 3MIDA 4GAZA 1K5MC 4LUKA 1AX1A 1S0JA 4LFUA 2XBO1 2FZ2A 4MGQA 3IKTA 1T38A 2PAEA 1R091 4AZZA 2DUOA 1K12A 1MS9A 2IFWA 4CDWB 5E1RA 5LEKA 5HBAA 2WWYA 1DU3D 4MVTA 5ILSA 2ZXQA 3BOQA 2XAQA 2D40A 2XJRA 1R1A2 1UU6A 1ND2C 2WL1A 2MLGA 4Q0VA 4RS5A 3OIQA 1XCVA 4RSUA 4OHWA 4S2HA 2PMZN 4IEPA 5C8WA 1CIWA 5FXXA 1K5MB 1H6YA 2A6YA 2DFIA 4PDWA 5DAPA 5FP9A 5FPXA 2XR4A 5BNPA 1K5JA 4V19K 1NY71 5DUVA 5DZEA 1AXYA 4LITA 1MZEA 4MQ9F 4C30A 5KXDA 4JDMA 4META 3ZFGB 1QKQA 2LW8A 3L7WA 4N4OB 3M07A 1GUUA 2HVQA 1AL21 2V5DA 1QJEA 3TP3A 1BW5A 3LNQA 3CCVI 5FZFA 1UU4A 4DQAA 2KR2A 1WJ5A 1RUD3 4B3XA 3K4LA 4M9ZA 1NA1A 4ESBA 1CQ9A 3H1YA 2EV0A 1EAH3 3ZLIA 1VBD2 4OIOF 5FO5A 1H30A 3WG3A 3H3ZA 1FMD3 3WF2A 1ZZ9A 3FK7A 4FPKA 3MEPA 4E8CA 1ZYRF 2KIUA 2QM3A 1AL0G 2ZX0A 1LHWA 3JBG1 4UW6A 3QOPA 1R1ZA 1W6MA 4GB33 2R92J 5FJHA 1S0BA 2XGCA 4O6JA 2Z5WA 3BTLA 1S0DA 1IUFA 3WTWC 4QAWA 5FZLA 2HTSA 3SDGA 2EK5A 4DS0A 1I1EA 3M2MA 1DUXC 1NY72 4LIUA 1W5TA 1TBXA 1HV1A 5EV7A 1HKQA 2CYFA 5DEQA 3D4KA 1KZHA 3HBLA 1D4M3 2PFBA 1VQ5I 4XFBA 3Q3SA 3FXKA 4LQRA 4AVTA 2JDPA 1U12A 4K8FA 3SEPA 1TQPA 5CVJA 4MGZE 1OLQA 1TQIA 1BJZA 3LSTA 1D5VA 2I5UA 3AZVA 2PMWB 3LDRA 3M1HA 4E7IA 3I3EA 4R1HA 2P2KA 4BQYA 2R7QA 3OL4A 2DMUA 3OS2A 1OISA 2EFOA 4OMZA 3WF0A 1E5IA 1KGSA 4XORA 2CV6A 2MEV3 3ZYIB 1QOOA 4Y7NJ 1NLSA 3GFLA 2D1HA 4DINB 2GIZA 3WT3A 2L9SA 1WMXA 4QX0A 2NS7A 1CX4A 4Z82A 1JGGA 4WZCA 4OUSA 1J3PA 4LD5A 2FZ1A 3PUSA 3AK0A 3U4XA 1WKYA 4TLFA 5FYBA 3VBRB 3N7JA 3OEAA 4JGZB 3LFKA 4YFNF 1NCRB 4PLOA 2VNRA 2VLAA 2IW5A 3R4SA 2BFUS 2VMCA 3USSA 2P4WA 3J7NA 4AEDC 2Y8KA 1MBGA 1JH5A 4CCKA 2XJPA 4G9SB 3C8XA 2RV9A 3ABMH 2LKSA 4QKBA 4S2DA 1QQIA 2XJSA 1VAMA 4TYSA 4XAAA 4HA8A 5BNNB 2BVBA 4UB8C 2DA2A 3IPVA 1CAXA 3ZOIA 2YUEA 4YZ4A 3DYPA 1H89C 2O61A 3K7AJ 2GA1A 4XLAA 2UWBA 4NHXA 4AVBA 1BEV1 3SXYA 2GN7A 3ZN0A 3LPGA 3AP7A 5IT3A 1ETWA 1DQ5A 3RPUA 5HLIA 1ETOA 4V2FA 3GJBA 1YIFA 4UAPA 3D0SA 2EIBA 1ZZ6A 3RKWA 1QRYA 5ILVA 2M3AA 1QJFA 1FOWA 4K1YA 1SFOJ 1UHMA 4XJAA 4ORFA 3Q9OA 1W2UA 4AK3A 2WV1A 4ZDLA 3U14A 1REEA 2ZGNA 3A1YA 3MIEA 2VUMJ 1OSGA 4HQMA 1P8JA 2AEZA 2O8QA 1UU5A 1YJNI 2DBNA 5D8AA 4YZ3A 1ODMA 2YC2A 3VDAA 4LA3A 4PIZA 2AYHA 1VR3A 1DDLA 5I0DA 1H1IA 4QGNA 5FREA 2J1SA 3S57A 2M0MA 1CD3G 2CL2A 4AG4A 5FFOC 3MN2A 4B1LA 2ZXJA 5FZAA 3V65A 1A6QA 2LNBA 3VDCA 2DTWA 3DN7A 2L9LA 3RZKA 3GFJA 5EQUA 2CFOA 1B35C 2F17A 3WG4A 2VPLA 2KQRA 1XDSA 1SBFA 5D21A 2NRAC 3JBG2 2L7MP 4YW5A 2VECA 2VODA 4AI9A 5LHGA 1T98A 4NHKA 4AC0A 2Q8CA 3ZRGA 5KHGA 5LY1A 2NOJB 1E17A 3MW2A 4HLXA 1FP1D 4P5OA 3LSRA 4O61A 1TNTA 4XF3A 3RQ0A 3P9CA 1YC61 2C26A 2I2SA 3ILFA 5JOXA 2KPMA 5CFDC 2OQRA 3RI9A 1W0PA 4CU9A 2WNVC 5E8GA 1TQMA 4JTOA 4Q4X3 2CDOA 2WB1A 3PQKA 4G7HF 1ZG1A 2LY1A 2JE9A 2HWF3 3ZDVA 2BY3A 2B7EA 4UI9L 2K4JA 4S0HB 3M3OA 4FP2A 2W2IA 4II2A 5IVBA 2DFHA 1WI9A 2BBYA 4QHOA 2WSUA 5JMCA 3CCRI 1W8WA 4INDA 3VHPA 1MDMA 4G9YA 1HB1A 3JD72 5KHJA 4UV8A 2KL4A 4BMEA 5A3PA 1GVDA 1SMTA 2CU7A 3O1UA 5A6QA 3MCZA 4KIGA 5FD5A 1LR5A 2RGVA 1BEV3 3M3EA 2OQ7A 4OHYA 2XH6A 3H8XA 2DAOA 3FE5A 3IKVA 5LY2A 3AG2H 2JQ7A 4NRPA 4XQDA 3K6GA 4GH4A 4M3FA 5J8FA 4AFCA 4LBOA 3O1RA 3HKZN 1PO11 2WV0A 2RM21 5D2AA 1QOTA 2HEWF 1IRZA 3EB7A 4YW3A 1IS3A 1T08B 4CXXA 1WA6X 4H7LA 2ZZJA 3TBIA 1G2HA 4M3CF 2LBFA 4F93B 3WTXC 1IC8A 4HK9A 1YHQI 1CESA 4K8RB 5DG1A 5FLXZ 5ABJA 4FTSA 4Q0SA 1GYKA 1N1SA 2M2EA 1RGSA 1X82A 4GMP1 1FP2A 1CAUB 3J7HA 2QDRA 3LSHA 2OCEA 5D8KB 1NG0A 3UKNA 3SITA 4FVVA 2IXJA 4KWLA 5KHHA 4KU8A 3DLLF 1ONVA 3FHAA 3AB0A 4BQQA 3DL3A 2EFQA 5EPAA 5FFXA 2IEKA 2WS91 2X6YA 2VTXJ 4XQ4A 4X1EA 4I0WB 1RVF2 2VBWA 2UYAA 1SQ4A 1MNDA 2XLFA 2DA4A 2FDHA 4Y15A 1DGRA 2AXTC 2MD5A 1JS9A 1C8M3 4HW0A 2E2HJ 4AI2A 5K7HA 1BZWA 2GMPA 2LY9A 3U37A 1FMD1 1WCUA 3M8EA 2JG8A 5FK8A 1QWRA 1HQLA 2ME6A 3ABLH 3B3QE 4YRDA 5F6KA 4K20A 2WNUB 1ZBA1 2HWD2 5A2QK 1OQ1A 1UZ0A 2L4MA 1QJY3 3ST7A 3KLNA 2E33A 1ACIA 2HDCA 4M3BA 3CF6E 4CP0A 1ZG5A 2GC3A 1IAWA 2JDZA 1DHKB 2Z1DA 2R7SA 3WNNA 2Q8DA 2X51A 1K42A 4UVCA 1R1VA 5FMDA 2BEOA 1PK6B 2KIFA 4GB31 3AKQA 4LK0F 2QFEA 2DMQA 2NVQJ 1UCRA 1UIJA 4GKXA 3BTYA 3LA3A 1Q8PA 1IG7A 3THCA 3NEUA 3UJOA 4IEQA 3IDCB 3HOTA 4ESJA 3JRGA 5GZDA 3FXOA 3ZMZA 1AYN2 1FATA 3OGVA 2P34A 2LC2A 2IXIA 5C8CC 3AP9A 3V8JA 2EILH 4GO1A 2LOOA 3KHBA 1W06A 2V5YA 3HPNA 1WCQA 4G94A 1TME3 4M6YA 5L19A 2N7GA 2JPCA 4AHXA 3T2QA 2P37A 1B09A 5LEJA 3MKWB 1W36C 1MKMA 5B5EC 4XBLA 3T8TA 4HFSA 3GX4X 5F2WA 1AKHA 5CADA 3DYMA 3DPUA 3HL2A 2EIDA 1POV1 3MQ0A 3IB3A 2VT2A 4BDZA 1AX2A 3S1MJ 3RZGA 4GMP3 2IRFG 4CUCA 3OYWB 4CCJA 3POWA 2QA4I 1ODNA 2IGNA 4LLOA 3PL8A 5KAFC 5A1LA 3VBRA 1UZVA 1YNAA 2XG3A 5F6LB 1WJDA 2VXRA 3K4JA 3WUDA 2DI3A 4BQ1A 2EA4A 4BA6A 2V72A 2JXAA 1KD7A 4HN0A 1UMQA 4EWEA 2QSFX 1LOBA 3M70A 1UPIA 1CF7B 4XIKA 4LG0B 2HGCA 3RYRA 1ZZ7A 1WJAA 1IHMA 4LXLA 3I58A 2AS5F 5CG8A 4JAAA 2XB5A 3AZYA 4Q0QA 4JKKA 3OYCA 1GXQA 2BERA 1JZ6A 4Y22A 1H9TA 3D5OA 5FZ9A 2A70A 4FX0A 5GP9A 2RM22 4I30A 3OR1C 4B8XA 1PDNC 4A3EJ 2E1OA 1F9NA 1Y9GA 2IXCA 1YX3A 3S3OA 2Q0OA 3FXRA 2A5YB 4UY8I 4L18B 1TNSA 3J9SA 4ZPIA 5ACA2 3OD4A 4MGIE 2WADA 5A7OA 3AG4H 2VB6A 4Q4Y2 2MLKA 4N43B 1PM4A 4H2AA 5FZGA 5F1RA 3G4SI 5FKCA 3DUIA 3FM5A 3NNMA 5H9PA 4EGYA 4XVHA 3L2VA 4HVOA 1DGRM 4B4QA 4EMSA 4GD4A 4FT8A 1JE8A 3OYHA 3MI8A 4NC7A 3LAJA 1YO8A 1SFPA 2GWRA 1UYYA 3J7ZI 1G3WA 5H2FC 3CCLI 1TWFJ 3FX3A 5FUNA 5T5LA 5GLUA 5FZOA 3ZSKA 5E8IA 1QJY2 1E3HA 2HS5A 5L3FA 2OPKA 2NVYJ 4BQ3A 1FI2A 4RFRB 4JRLA 2XMLA 1EKEA 1MS5A 1Z7S1 3CZUA 3RWNA 5A33B 1TVGA 2LD5A 3A4CA 1E5RA 1UD1A 4M0HA 1D1CA 3LPFA 1YUDA 4TSVA 2ZX1A 2DPUA 3CCEI 4UUSA 2IA2A 3THPA 5ACA1 4KT6A 1R1UA 5FY9A 4XHXA 1ZGWA 4JYKA 3K77A 2D6NA 4RQPA 3ZMOA 2VZ1A 2XQXA 1YFUA 2LY2A 1FTZA 2O8KA 5CKQA 4BU2A 1VBE1 4AI3A 1JMUB 4WM7A 3DPRC 2UXXA 3BQYA 3IIIA 4YFXF 1VMJA 5EEHA 1MW7A 1Q56A 5FPVA 1E5HA 5FXZA 3NNJA 4NC6A 1N1TA 3DLAA 2BBVA 2DFFA 3GFMA 3J8F1 3FUOA 3NW4A 4B4RA 1QXJA 2IC1A 4TLGA 3C7OA 3A2KA 1AR62 2VKVA 4QQ2A 3VD4A 2FHRA 3KP3A 2B45X 5FZ1A 4BDYA 4BHBA 2PAMA 1B9NA 2HEVF 2E1CA 3KT1A 4KQ7A 1FOD2 2X05A 4NBQA 2FE3A 3MWMA 1WWXA 5CIRA 4PFPA 4HRIA 4S05A 3KP2A 3B9IA 4L0ZB 3NWTA 5AFBA 2GNMA 4LK6A 2HWB1 3E3VA 4HV6A 5A6XA 1F2NA 2PHUA 3BZKA 5J1RA 3SJMA 4KDPA 3TOBA 4XKVA 2QQAA 1QQP1 2V1DA 4B47A 1IG3A 3HJEA 4Z1VA 4TV7A 2LUWA 1K5MA 2WLPA 1HN1A 3ECOA 3BCBA 3AZWA 4FOYA 2Z16A 3GTLJ 1SHWB 3W9AA 4AQ2A 1M06G 1CZTA 5IY5H 4GWNA 5FIXA 3FHIB 2XROA 4HX4A 1GWLA 4JKMA 1RUJ2 2QTWB 3R0AA 4XF0A 1BI3A 1J09A 2XC7A 1NX9A 4MXWA 4NVPA 1PGW1 3KS7A 3QH7A 4N7UA 1LDJA 3HOYJ 4YW4A 3HOXJ 3VSKA 2F2EA 4ET7A 4Y5Z0 3PL0A 2BY0A 2DJIA 3T0BA 3DBLB 3LSGA 4O3MA 4Z2YA 2IGKA 1HC8A 4Y4YA 1K79A 5JZGB 3RFRA 3BPSA 3AP5A 4OULA 4JQRA 1V9U1 3NAPA 2OXBA 1XU2A 3PIJA 2G9WA 4I0BA 3AP6A 3CC7I 2FD8A 1JZ5A 1OXCA 5FLVA 5FMOL 3O0WA 1ZR4A 5FBZA 2XSJC 5LBQA 1O7LA 2DODA 3WQ0A 2XJUA 5JVGF 2IGMA 4IUGA 4OFGA 2IVMA 2ETHA 2K46A 4ZU5A 1PMJX 5I0SA 4MGTA 1P7IA 2NVTJ 3IWFA 3SQOA 4XW3A 1VE0A 2VBZA 1RNLA 5E16A 1RIOH 2A07F 2EF6A 3E1SA 4YLZA 2HBUA 4TZDA 4IEUA 2YBSA 5L7OB 2MNGA 3MHZA 3WHUA 1FMWA 2CGPA 2VQHA 2VBYA 4HXCA 3H9QA 5FMBA 5A3LA 5FZKA 2WA0A 3C1DA 1RHI2 1CZSA 2GC0A 3L00A 1EAH1 3S16J 3WNMA 3ZYFA 3PUFA 2QQJA 1ZQ3P 4XRMA 1UXXX 5IVJA 1XBFA 3RZOJ 4MNUA 2XKOA 3BN6A 4H3WA 5K0UB 4IJAA 2HQNA 1OLMA 1WW5A 4ZKTB 1LB2A 2CW8A 5CVRA 5FPAA 5FYHA 3K2OA 1IZ3A 1N3PA 1JHNA 1BKZA 3LFMA 2ZGRA 1YW9A 2DA7A 3P9KA 4FAHA 1O3QA 1YITI 1Y7BA 2WA3A 1QF3A 5FRAA 1Q8SA 5BNPB 3R6SA 1NQJA 3EMRA 4NDLA 3MF6A 4A4AA 1WCMJ 2VR4A 5JLVA 1GDTA 3MW3A 4FCYA 3PNTA 1SLCA 1I27A 3IH3A 3MO4A 2RDSA 1SLAA 4BLJA 1CAXB 1QIQA 4B29A 1YS7A 5FPZA 4DIQA 3VV1A 4C8DA 5DAXA 3VD5A 3X2QH 2RAEA 2VNOA 4IX7A 4W1UA 2R5YA 4YPJA 1ASJ3 2XF7A 2RJLA 5LD2C 5J3UA 1U8BA 1ON2A 3ERED 2D3SA 3VZNA 5DXDA 4UVBA 3R05A 2BXYA 2JA2A 4C3HJ 3WW1A 2ZEZA 5FK7A 5EEGA 5CG9A 5A7WA 2IXSA 4XNFA 3SEEA 1YQ6A 1RIRA 2ZOEB 1PMIA 2VOTA 2QQLA 2ETEA 4QPIB 2OW4A 1K78A 4IHWA 4PJ0C 3UNGC 3O14A 3QYBA 4K40A 5IK8A 2QEXI 4L5EA 1FNZA 2BVVA 3Q9SA 2Z33A 4PJMA 1MQTC 3H35A 1NZCA 1LPQA 4G8XA 1UOJA 3L1PA 1YQ8A 1BK0A 5M3MJ 4FQZA 3ZXSA 3NJVA 4R9CA 2ADDA 3H1CA 3AYCA 3M9AA 3EQEA 1BBT3 4A5MA 1HV0A 3OCPA 3ZFEA 4EZ4A 5A33A 3SNMA 2DXIA 3NKTA 1PNGA 3BB6A 2XF6A 4OUEA 5KWRA 4FFGA 2VW2A 1MBFA 2UY9A 3AXEA 1ZGAA 1ODDA 2CUEA 3IL2A 4A6OA 1HF0A 3CJIA 4XDOA 4AVVA 1GKBA 1V0AA 3MKZA 1IN6A 2BZDA 5E1WA 3D5LA 4IW3A 2VVFA 3KP7A 1QU0A 2VCMA 1DFQA 5F64A 5DYMA 5LCWL 1COV3 3L9JT 1UZYA 5HLGA 2W25A 5DUUA 3H7YA 4O65A 4W97A 1OVPA 2M87A 3GTGJ 1F5TA 2V9PA 3LSDA 2DOEA 1T39A 3BQZA 2DTRA 1ND3C 2CQ7A 2KLOA 2Y69H 2W3JA 1R5GA 1YYVA 2FDJA 3SISA 2E71A 1BOAA 4BAYA 1STZA 1DYPA 4P9JA 2C0ZA 4HKLA 5E20A 4J01A 4YYOA 3WP6A 3GTKJ 2M5WA 5HDNA 1AXKA 1IS5A 5J96B 1LRHA 2ELHA 1FEXA 3J7YJ 4FASD 1X8MA 2V9KA 1POGA 2RJKA 3CCSI 2TDXA 4PDKA 4OAYA 3BTZA 5D6FA 4HDUA 1WCDJ 3BU7A 3DGTA 1AR82 1YWKA 4QX8A 4CDXB 1GICA 2ZGSA 4CDWC 3W20A 3OGRA 3ETPA 1JYXA 2WY8Q 1RUI1 2J1RA 3CUQA 1XRUA 4DFSA 4QU2A 1KYZA 5AIQA 1RUG2 2K9SA 2P0WA 4D7TA 5L3CA 1GT0C 4YIFA 4XUTA 2ZEYA 3KV4A 3S7EA 1JOBA 1W2OA 3FKIJ 4RM2A 1O91A 3I8TA 1XGOA 3I59B 2BTVC 2BXZA 2K3PA 5FZ6A 3OB8A 3AL5A 2MW8A 4JOMA 1USTA 3DKQA 3QAHA 2DVFA 2O0OA 1VQ9I 2ILMA 5BXXA 1TT0A 1Y39A 3LQRA 3K4NA 5FPUA 3B69A 2A6HF 2VT3A 4WCGA 4AGGA 4JQTA 2A05A 5ABJC 3NL1A 3HOUJ 2HQRA 4A3KJ 1WW6A 1NG7A 3W21A 3PNVA 1BR4A 3V4GA 3KT4A 5FPLA 3TNQA 1V6NA 3NV1A 3T0DA 3KYLA 2LDUA 3LD8A 4HEA2 4AQSA 3I4PA 2ERFA 4LA2A 4E4DX 3ZFGC 1A3KA 1DQ0A 2VZTA 1ULCA 4BLIA 2ZZQA 1IPJA 1HDDC 4K9SA 4B44A 4IXLA 3F8BA 2I07B 1CAVB 2DYRH 1LOFC 2VMEA 3GFIA 4D7YA 4HF0A 4ZHNA 2X0LA 5FZCA 3BT9A 4B1MA 4RLQA 3VBHC 3E97A 2ICWG 5JIUA 5A7NA 5FDBA 1S29A 4XEZA 2JG8C 1XSVA 3CDLA 2NN8A 3ZIWA 2E7XA 4UFJA 4RAZA 1LFUP 1IV6A 4BGDA 2VCBA 2XWJB 4RA0A 1H9PA 2IVIB 3GM8A 2CDPA 2UURA 5F5AA 5FB2A 4DBRA 3DTEA 3D8CA 4GA9A 4RAYA 1JUMA 4DW6A 3HRTA 1PGSA 1LOGA 1JOJA 4L92A 4N53C 1QJU2 5FRMA 4CDQB 1TT5B 3BG7A 3DFGA 1V00A 1XU1A 4BY1J 2VUCA 1R083 2C6YA 1A6CA 1FPN2 1TL8A 1GBGA 2AQFA 4P1WA 3NV2A 3MPPG 3AZXA 1RXGA 2MC3A 1Z6RA 3FBMA 3OY9A 2Q30A 2P6CA 4HOOA 3NNGA 4RD7A 3I3LA 2D45A 2ACJA 2FSWA 3PM1A 2QQNA 5JR2A 3FMSA 4LOCA 4R4XA 4OMYA 4AI0A 4R9AA 5H9RA 2RQQA 5AC91 5C8CA 4BJTA 4RB0A 3E1F1 1W9SA 2QVOA 5T5OA 2EFWA 1TMF1 2Y30A 1JZ4A 3VBSC 2FCUA 3H92A 2BHZA 2KMUA 3K4CA 2JENA 1NCRC 2RN7A 1SANA 4L11A 3M8JA 4QHBA 2PEXA 3ACFA 2E1MB 5JI6A 1T8IA 1D0XA 2QUFA 1Z9CA 3CJNA 1JKPC 3JRAA 4E7KA 1B8IA 3V7CA 3J80Z 1EAH2 2ESHA 4WM8B 2D6PA 3O1TA 2R16A 2WBKA 1QOSA 3FHZA 5IJRA 3TEYA 3N05A 5LA9A 3HYIA 3M4FA 4CCMA 3HOVJ 2STTA 2ZS6B 4XJ8A 3FFZA 1IPSA 1HQNA 2GM4A 1ZA4A 2GA2A 1NLRA 3POIA 4Y22B 5ICEA 3GEZA 3HOWJ 5FJKA 4FI9A 4AI1A 2JE8A 5F3EA 1TWCJ 5FR3A 1B6AA 3A03A 1XXNA 3KP4A 4E6KG 2M7BA 1F4KA 5FV3A 1DQ2A 4IV3A 1HA8A 2QYOA 1BA5A 1V6JA 1APLC 3TO9A 3PTYA 3VBFC 4WV8A 2WNUA 2FX0A 1RKTA 2GLOA 3PLQA 2MC4A 5HPOA 2VMDA 4NAOA 1XC6A 4BM8A 2MGQA 4AYBA 3VB2A 4OI4A 4XBNA 1Q1VA 4AYBN 3V64A 1OQEA 4H55A 3G1LA 5TJJA 4NAMA 4RAFA 5E3NA 3ZMNA 1IKQA 2R041 3Q8EA 2IFRA 2D3PA 4WZFA 1OLME 2HWE3 3WE2A 5F0CA 1MJ9A 3UL2A 3CUOA 3PUBA 2RS52 3ZSLA 5D5WB 3OTFA 1RPWA 2FMLA 1UPSA 3IKWA 3RSJA 4RM3A 4XLNF 2H1LA 1J75A 4W50A 3ZXEA 2RE9A 5HS7A 4M74A 3WDWA 2L9RA 4UYBA 2RREA 4GFBA 2QWWA 4OIQF 1GSLA 3MLJA 1GV9A 2IP2A 3TRSB 2XJQA 3CJTB 2ADEA 1MACA 2K7LA 3P1IA 2DVDA 2RMU3 1QHDA 1ZG3A 4U0VA 1WH5A 3CZJA 4LO4B 4GYGA 2FDFA 2OIIA 3VD3A 5GPCA 2YPRA 4A0ZA 1W39A 2WS92 1ULOA 3WW3A 2R042 3GLLA 4F91B 2Z9OA 3RTRA 3U11A 4GIQA 4RQPC 1OCTC 4QPYA 3JQXA 3ZOBA 2LF8A 1QJX2 4P9WA 1VLNA 1YS6A 3DKWA 1Z0HA 3H9AA 5CKNA 2WSVA 3K69A 1OQYA 3DECA 4LULA 3QODA 1YG2A 1REPC 1AHSA 1O3TA 4YGDA 1R082 2BY1A 2AACA 1BHGA 1YQ2A 3PURA 1QO0D 4QQLA 3ZDSA 3IH2A 4MO7A 4IERA 1U5ZA 1Y56A 3LIGA 3QACA 4UWDA 3SH4A 4MHGA 3FJSA 3DKYA 1W9FA 4E2QA 3DPLC 1X1CA 4KN4X 4QT6A 4FETA 3BOWA 2PQ8A 3KWVA 1OKRA 4Y33A 3W2WA 2R071 3BIEA 3BR0A 4M6VA 4XIOA 1Z3XA 3JRIA 4P9IA 3VGIA 3V0AA 3LWFA 1RHI3 1H8TC 2XKPA 3PNAA 5FUIA 1Q5OA 2W92A 1FSEA 4UOJA 2VOVA 1FOXA 1UYPA 1PO21 1R1A1 2AC1A 2Y75A 1ZREA 2WZ8A 5KC6A 3LE0A 3ABZA 1XPXA 3KX2A 5K8SA 3MZ8A 3DBHB 4PGGA 2CWMA 1F5FA 3H5AA 3BTJA 4EEFG 1CPNA 2VOOA 1L7QA 3GVAA 5LWBA 3UJQA 3B00A 3PFIA 2VGDA 1SMVA 4DZGA 5J8CA 4YG2F 3FLPA 3ZQHA 1R081 4A3MJ 1MGTA 2P6TA 2VQ0A 4XURA 3VDDB 3E7LA 4BZ4A 1E0EA 3OV8A 1Z7S2 5A2QZ 5FZEA 3K4MA 2GC2A 1PVXA 3ZM8A 3HSEA 2JVGA 5FKNA 3L2UA 4F8AA 3CP2A 1KONA 1J3QA 4E4ZA 3FLRA 3WTUC 3BTCA 2PTMA 1Y9QA 2ZMEB 3S2DJ 2UYBA 4HDVA 3ZQGA 1A04A 3RI8A 3N4MA 2ZXWH 4IEXA 4EGZA 3NMBA 2VJXA 4EN0A 4XMAA 4YG0A 5M5XJ 1PYVA 3I2DA 2AXLA 4HF1A 3WE3A 1OUXA 4E4HA 3DTKA 3F22A 1NT0A 4QWNA 3FF5A 4NIDA 2V26A 4Y1UA 2JDYA 3DPRB 3I3BA 1GQHA 1KEXA 2WYSA 3GW2A 3LSIA 2KZVA 2VE9A 3WGGA 1XNTA 1Q8OA 2QZ2A 4RN5A 3BR1A 4D1QA 5IWFA 4JC1A 3WHTA 4HN1A 3U21A 3NAPC 4XLCA 4FPHA 5HV0A 3JAMK 1Z67A 1MR5A 4V2WA 2COBA 3W2VA 2R5ZB 4ZS3A 3THDA 4BE0A 3WP5A 1C28A 1PVC1 4NO4A 4N7IA 3CCMI 1SFYA 1U3EM 1SDWA 2VQCA 5GADJ 2DBIA 1S2BA 1JYVA 1SCSA 1MVEA 4YW2A 1FPQA 3ZXDA 4LE3A 5FP8A 4FHTA 2XUEA 3A7QA 1VQ8I 1XCBA 2WABA 2FDKA 1ENRA 2YGMA 4MHRA 1R4MB 2GQQA 2PHXA 2FNPA 1X19A 3M3CA 4KUMA 5I91A 2X6WA 1WMEA 4UW3A 3GLXA 3WNOA 2D6LX 4GXLA 3CTAA 3VZLA 2X8KA 1R5HA 1W6OA 2NAZA 4FPGA 3ZVXA 1G6NA 5F7UA 4OZOA 1UZCA 5D5VB 3EJKA 4LOSA 4NHMA 2OTJI 5DG2A 2C9AA 3WGHA 2PHDA 1FXZA 1H1MA 3RZDJ 2PN6A 4M01A 4QKNA 1OURA 4GULA 2O8XA 4PGHA 3KETA 5A3NA 4D3WA 1N75A 2Z3YA 1VBC2 4PT6A 1SCRA 1DGLA 3GUDA 2GMEA 5ISLA 2H94A 2EALA 2A61A 4U87A 3OL3A 1VB4A 3PNYA 4ARYA 4AVZA 3W6VA 1W8FA 3V42A 4N43C 1OCCH 5APAA 3CDIA 1W6PB 3QH6A 5FWJA 1V4RA 3FZ3A 4CDUA 1CX1A 3I55I 5H9QA 2JICA 2Y0MA 3HB9A 3SC7X 2Y2ZA 3RYPA 5AONA 1JTZX 5JZGA 1UF2C 3HNMA 2N8GA 2D6OX 4FTBA 2HI3A 2HU9A 4U7DA 1RMU3 5K9YA 1FV2A 4COWA 2QCOA 3VHRA 1US2A 3DEMA 1UHWA 4TWTA 2IS2A 2VOPA 4FXKB 3IAS2 4F55A 1C3HA 5EG0B 4ISRA 1H4HA 2WAEA 3AL0B 1T6BX 1GZWB 2LRPA 1IOAA 4CHUA 1JN2P 4LLGF 4C91A 2ORZA 3Q8AA 4YZ1A 2ZACA 2G0EA 4K7JA 3OGJA 5JXJA 3N9MA 4Q4Y3 3X29B 4B7KA 4MFEA 3T4VA 1DYOA 1AR71 4NHJA 1NTCA 3GWZA 3I4NJ 3FLTA 5L7OA 1RUC1 4KMQA 2R063 3VD7A 2W08A 5KC5A 2JA5J 1LU2A 3HQUA 2JWTA 4FQGA 1AKHB 1OCPA 1H9WA 3ZFEC 1L3JA 2WAOA 1FOYA 2HWD1 3PUHA 5IK5A 2HEOA 3BIWE 4YZ5A 2BNNA 2XAUA 1MBJA 5HLTA 4ZYHA 2KISA 4L5JA 2LLKA 1EH8A 2HYFA 2VQUA 4WVWA 1SPPA 5BPDA 3TMOA 5C6CA 2E2JJ 4DPNA 1I39A 4FPLA 1KS4A 2YU9J 4L8QA 4P9LA 4A7ZA 3CJQB 4HBNA 2C6SA 2ZFUA 5F27A 5D6EA 1F8VA 2HVRA 1EPWA 4QX7A 2DCYA 1VIWB 1W6NB 4CUGA 2DPDA 1QY4A 3J4UH 3VZJA 4AVCA 5TISC 4OMDA 5LA1A 2I10A 1OQDA 2JVHA 3AKRA 1X3ZB 1LOEA 1ETKA 3HMYA 1KYWA 1FT9A 4NWWA 2B9UA 3LL7A 5LRSA 3K2ZA 3WF1A 2VM9A 2DURA 3VLBB 4R79A 1OMIA 2TBVA 3ETQA 4XAEA 1Z78A 1P9QC 4W4ZA 1ZYBA 1W03A 1K83J 1KS5A 3ZMTA 4CZCA 4ONUA 4FPEA 4HSLA 2PA7A 3CQOA 3FBNB 1YI7A 1MS0A 1SVLA 5BNNC 4PDWC 1RJ8A 5D4SA 1U0JA 1OVSA 1D2SA 3OY8A 1W0UA 3CJXA 5IW0A 2E26A 3HAGA 2MBFA 1WVRA 3DV8A 4M3DA 5JSRA 2R072 2KRCA 4M00A 1VZ0A 3BVCA 4RL7A 3E5XA 3FUQA 2HWC2 3ZYPA 2R93J 5KXBA 3RPQA 4HSTA 4KITB 2E1NA 1GHCA 4AI8A 3WINE 4Q4V3 5LA2A 2VOWA 1S55A 5IAVA 4Y1VA 5EJCA 2HOAA 1TE1B 3INAA 3T2TA 3QQAA 1JW6A 4OCTA 2HWVA 3QCWA 3BROA 1QZYA 3BJOA 4YW1A 3SFZA 2WIIB 1HW1A 1X3WB 2Y38A 2ZEWA 2DDBA 4UV9A 4YSFA 3FXQA 3ROUA 2VIXA 3I49A 1SFNA 1DF0A 3HG9A 3PMEA 2HWF1 4GZ9A 2HOTA 4QPGA 2GH2A 1BR1A 4RDUA 4MLOA 1G59A 1L3LA 3IAM2 3LMMA 1LGCA 4UUSB 3FK6A 2LKPA 2DT5A 3S8PA 4XOGA 3EDPA 3VYRB 2VZQA 1H2MA 4LT5A 4RR3A 1JGSA 4NC8A 5FYIA 3P6BA 2W1SA 1JUSA 4E2SA 2PN5A 4LHLA 4OHVA 3TEWA 1LDKB 4UF0B 4XICA 3BTXA 4FE4A 2R061 2YU2A 3ZN1A 4YG3A 1IKPA 4HVRA 2BFUL 1PZ9A 1CR7A 4JP0A 1PP8F 4RS8A 1YRZA 1QJX1 1J84A 2F4OB 4KL1A 3MLLA 1S2KA 4DJAA 4PLNA 2A7AA 1MS1A 5BNOB 4IV1A 5EP9A 3D3AA 2AEYA 3D82A 5IT6A 1R64A 1KFXL 4IEZA 2ZKZA 2O6GE 5C3OA 5TRDA 2V1XA 1KGYA 4ISQA 4D0PA 3T5XA 1J2XA 1AL22 3HN3A 4N53A 1P92A 4K2EA 2QLZA 2WDBA 1AZDA 5I0UA 4F83A 3ASNH 3K2AA 1LOCA 1RVF3 2ZAHA 3ME2A 1UKRA 5B3SH 2M7AA 3V0BA 2YXSA 4BQ4A 2HQ5A 5T52A 1G7YA 1PGL2 3J26N 3JB8A 4P08A 3OS0A 4AAPA 2OPWA 3BDDA 4N9IA 1S72I 2XAFA 2AQEA 5DZGA 4EQVA 2H6BA 1GP6A 1D3YA 1YYNA 4CP2A 3GZNB 1CN1A 4DMIA 4QGMA 3ACGA 4J1WA 2W47A 4XBFA 3AKPA 1GXPA 2WR9A 2Y64A 4NWVA 1O4XA 5FY0A 4JX0A 4ATEA 4LGWA 3ZKYA 2FEZA 3HM5A 5KK1A 5DDJ3 1SAUA 2VONA 1BR2A 4EJUA 1O57A 4EE2A 1MIJA 2P17A 2W24A 3O6BB 5DCMA 5FPBA 2P5BA 4WBBA 2G9FA 1YLLA 2AENA 3LDKA 2M4KA 1Q8VA 1XTAA 2XGEA 1F43A 2MEV1 1WJFA 4L9JA 2XGXA 2R7WA 5FAXA 5T3NA 5DS9A 1IPKA 3HBZA 2RM23 3TP0A 5FP4A 2V4VA 5FZ4A 1VQ7I 2SBAA 2E7AA 4J1XA 2OQGA 3A0KA 1XMKA 2GC1A 2K2SA 3OYIA 2OD5A 3A23A 4V1PA 5KVRA 3WTYC 3JW4A 1UY1A 1TME2 3HWJA 3NJYA 3SZTA 4P96A 1EJ9A 4IV3C 1EV12 1RB8G 3I7DA 5CKMA 3LF7A 3WV6A 3POGA 3HRMA 5A3WA 1BW6A 1EY2A 2W68A 2ZGTA 4NB5A 2PMUA 2WNUC 3O1SA 3MMYB 5KHKA 4I3PA 2GOMA 1IGOA 1J3RA 3BODA 1FX5A 4JDOA 1J9IA 1ERDA 2FU4A 3KZZA 4BIFA 2XVLA 4HL0A 3WEZA 4CDQA 3QU3A 4YGBA 3KLOA 2BV6A 1Z77A 5LLQA 3WGIA 2CQKA 4PCRA 2VXJA 1GNYA 4ENKA 4BS9A 5FZHA 3GHNA 3T3YA 1NK3P 3KV6A 2HWB3 1AYM3 1Z05A 2Y0OA 5DAWA 3N3HA 3ZXAC 1A5JA 1JTYA 3M3YJ 4IHTA 3AG3H 3I54A 4Y5SA 1W3XA 3J7AY 2VNGA 1SLLA 4Q5SF 5A32B 1NE4A 1H6XA 2XV4S 2AGSA 4NIHA 1EYBA 4FXGB 4RGRA 2P4EA 4B4PA 3VL9A 2Q8KA 1ZARA 1UB9A 1Z7LA 2D5VA 4Q29A 1PO12 3F95A 3Q0UA 4Y13A 1XYOA 2RJ2A 4PIXA 4Z2WA 4LHKA 1EUTA 1KDKA 4YM0A 2UWAA 3W6KB 4QXBA 4FTEA 5FXVA 4RB3C 4XUOA 2WQZC 5A3UA 5TSWA 3U1XA 2MABA 1S9HA 1IS6A 1RITA 1QH7A 2XONA 1WMDA 2YGLA 4PJLA 4X0GA 2XPVA 3K4AA 2M34A 2DYSH 3TN93 2EIJH 1SBEA 1YEWA 5BQTA 1PUFB 4WXDA 4Q48A 2OQ6A 2CG4A 2OZUA 4DEVA 5FWEA 5I0TA 2ECBA 4CVUA 3FDYA 3HGGA 2XBO3 4CZZA 3FMRA 3DXJF 3KIOA 4ZTFA 1PGL1 2OA4A 2UV1A 5M3FJ 3CCUI 3V0AB 5A70A 5GZEA 3IMMA 1KXGA 1OCRH 4PDWB 4PSWA 4RGGA 1C8M1 2BVMA 3DBRB 2RS32 2HZDA 2LREA 3OOXA 1V6MA 4U7BA 3FFQA 1ACCA 1UMHA 5HOOA 1FV3A 4QPQA 2QQWA 2CNAA 1JBCA 2Y48A 2CMPA 3H0OA 3DF8A 3DEWA 2EJRA 1WQ2A 4IEOA 3WDVA 3ZSEA 3I53A 3MFCA 3LSJA 2OPTA 4UFKA 1K61A 2CO5A 1LE8B 3MIBA 3KLSA 4BJ6C 4F92B 3IMNA 2JEMA 4Q26A 3KEOA 4C3IJ 1VRH2 3TO6A 5IHRA 4YARA 2J1AA 1LVKA 2JUGA 2RDPA 1MMDA 3MIHA 4QPIA 4E7JA 1JI6A 1AR72 2XJTA 4K1ZA 1K78B 3ZXJA 1W2AX 4EN9B 1XSDA 1MS8A 2LROA 4HVQA 4D5FA 3VYSB 1VQ6I 3WDYA 2P6HA 1LEDA 2H0BA 2J1VA 3S7IA 3U0ZA 2FXAA 2X29A 1TW3A 2JIJA 3OBZA 5L9BA 3ZFFA 1OFCX 5G05L 1QGLA 1UOFA 3BPZA 1IDZA 4O7XA 4HQEA 3WUCA 4MG2A 1HKDA 3FMQA 3KV9A 2WB1N 3ZQ7A 2YBPA 3OBTA 4ASLA 1H9GA 1D8JA 3QYEA 3U10A 2J1EA 2UZKA 2YUSA 1FYUA 5KCMA 4F3QA 3H8UA 5L9VA 1FOD3 3VHOA 5LBCA 3SCFA 4CEWB 5F37A 4XF1A 3O2PE 3BPVA 2HYKA 3OUHA 2WT2A 1E5SA 3ZXLA 5J1UA 2B9VA 5LGTA 1V6KA 2LTNA 4FE7A 3K4BA 4F7ZA 2V1UA 3AMHA 3AJZA 4MH0E 1ZNPA 4QM8A 1WWYA 5DUWA 5BNOC 1HRI1 1FOD1 5BMZA 5IVFA 3CC4I 3GBWA 5LK5A 3THTA 2TNFA 1MJBA 4XK4A 4BJ0A 2P7VB 5DV5A 2ZO4A 5EYXA 4A3FJ 1ZHFA 3PDQA 2PMHA 5GTIC 1I50J 5CQGA 2A69F 2VAUA 2FRHA 2ZX3A 1QXRA 5KR7A 3AZZA 3ONQA 2YROA 3REOA 3WQBA 4EJTA 4UXAA 2QSHX 3V0BB 2W0XA 2BW8A 3K3OA 1JKQC 3G2BA 3ZMUA 3WQ1A 2ZJPF 1SLIA 1HX6A 5CQEA 3CUQB 2OV7A 5BUVA 3RZMA 3HJRA 4ZZ5A 1R4NB 4MADA 3N7MA 2R1DA 1YFXA 3NNLA 1IO2A 1IQAA 4CDXA 3NARA 4DNCA 2HYJA 3VYUB 1W6OB 3T2OA 4CXWA 3PVNA 2OA2A 1X1AA 3DEUA 4OOIA 5EJ1B 4BEHA 1R71A 1U5YA 5C9AC 4H7MA 1PJRA 2NVUB 2K02A 4XR6A 3PSFA 4HPKA 1RC6A 1OPOA 1AU7A 1OH4A 3B6AA 1Z6TA 3MW4A 1ULYA 3JRBA 1KU2A 2H8WA 2C24A 1VNDA 2LM3A 5FJ8J 1EF4A 5F2SA 2F5VA 1OPMA 1DYKA 4LKSA 1ZRFA 1ZX5A 1KU7A 5L9RA 5C9AB 2QQ9A 3IBMA 3TOAA 1AR81 1CJDA 4URTA 3RMYA 2P5VA 3H3UA 1AX0A 2HWF2 1A8DA 1UYXA 3JRHA 2ZEXA 2VOKA 4Q27A 4XBQA 4PQ9A 3ITQA 1ULGA 3JR9A 2BWCA 2EXKA 2NM1A 4EN7B 4HF2A 1YW8A 5FYSA 4D8MA 4A0XA 4COVA 3OYFA 5F08A 3AMNA 5JXIA 2CUZA 2MEV2 3RGBA 5A7PA 2VOXA 3SKVA 1RMU2 3HUGB 4NRMA 3ZN6A 3BR5A 1PIV1 2PHRA 2R32A 4FOQA 1HRV3 4XC9A 4WXHA 2JD4A 5JZGC 1TNRA 1A36A 4D69A 2BP6A 2ZMNA 3RVHA 3VBOA 2VVEA 2IS1A 2VCCA 2B42B 3O8HA 2V4AA 3CD6I 1MH3A 5B4NA 1B72A 1JU3A 1WPKA 1JZ2A 1TWGJ 1LHUA 4QXHA 3WHBA 3BG5A 3WNLA 3H42B 2ZX4A 4MZUA 5CZKA 4WM7B 2FCTA 3SEZA 3SEQA 2HWE1 2VO5A 3CLQA 1VBD1 2PLV3 4Y1YA 4IDZA 2X48A 5LATA 4DY3A 3VKLA 3PUQA 3PFYA 4NHYA 5FY8A 1JUIA 5HLHA 1DPUA 3WDTA 2KIMA 3UESA 3I2GA 1CONA 2WS93 3AKZA 3POEA 2ZABA 4HNTA 4MXVA 5B1AH 3E5QA 1I3HA 1L0OC 1PIV3 4Z92B 3GTJJ 2VJ5A 4LB6B 1ITYA 4R8HA 3TBDA 2QUOA 1RUF1 2Z5UA 3UKVA 1MDMB 1R093 5IK4A 1IV8A 4V2GA 3VBUA 1URXA 5C3RA 3CO7C 3CESA 2RR11 4P00B 5C8CB 3VPRA 4NIIA 2EA2A 1PZ7A 1DU0A 3N9NA 2O5RA 1MZFA 4QB1A 1W6NA 4AYUA 4EVIA 4IEWA 3OOUA 4U88A 1JODA 4M72A 2P3IA 1XMXA 3KYCB 1R22A 2WO7A 4QX3A 3WSOA 3CCQI 1W0OA 3CP8A 4B43A 1FMVA 5FTTC 1ENQA 1B8IB 3BR2A 1CQTA 3QPTA 1DLCA 4Y20B 4YW6A 1QGPA 4WM8A 3D0JA 3AM2A 1B1BA 3ZXFA 5CBLA 3CLPA 5JOYA 2L01A 3H7JA 5IVEA 3GXUA 3JXSA 1D4M1 2EBIA 1OHFA 1XGSA 5LGUA 5LBBA 1VFCA 1RUD1 1X3UA 1NAEA 4GKYA 1G3SA 5H9SA 2Y31A 1HIXA 2R3SA 4M3CE 2EZIA 4M4RA 1DQ4A 4B3AA 2CU5A 2HNHA 2IWGB 3T1MA 1ZR2A 2WQ4A 4P55A 4AF9A 5JIAA 5J6XA 1OF3A 4G6QA 3S0MA 5FLHA 1ZVFA 2DOFA 3Q8FA 2RR12 5FBJA 3AP4A 5IP7J 5J40A 3OR2C 3IRRA 5GZGA 4A41A 2L0KA 4CXYA 4DXZA 2HYGD 5A3TA 4J19A 4OQ9A 3AL0C 1S8NA 2HH9A 3TWIA 5BS6A 2PHTA 3MF9A 3J8F2 5CFCA 4XL9A 1RUE3 3NWSA 3WY6A 1JYTA 5EZGA 3F8FA 1JTXA 1ZRDA 2WINB 4EJOA 3ZYJB 4XCBA 3IH4A 2QQVA 1UZZA 3ES4A 4CU7A 2OUHA 3A02A 2VBPA 3UETA 2Y9YA 5FQ0A 4QIWN 2W91A 3CEWA 4JX5A 2GZWA 4A6SA 1MQTB 4UBHA 1UCXA 4Q8LA 2F5CA 2JK3A 4A0YA 2YPJA 4RB1A 4KIFA 4HMZA 3P5JA 3IT8A 2YR2A 1V5GA 3KP5A 1OFNA 3VYTB 1BCXA 5C4JJ 5H6RA 1XSXA 1V5EA 4LJZF 1YRNA 5F6FA 5F5IA 1T56A 3AX4A 2OYZA 1OJLA 5IK7A 1LUJB 5CLSA 3EHKA 4AHZA 1I1GA 3IIAA 1LDDA 2VMHA 4FPYA 4XFFA 1VF9A 3LEGA 2ZBJA 4Q4V1 4ZJZA 4XLFA 5ERLA 1W8ZA 2EV6A 3VOEA 4LNVA 3OSGA 5CKTA 2L2OA 4RHV3 4CXFA 1ZH5A 2CV1A 2B46X 4D7MA 2OCCH 4GWIA 1YTYA 4MGRA 5JSOA 4RS5C 1I3AA 2OUJA 1FTTA 3RKXA 5SV8A 2EAKA 1AJKA 5T54A 5ICFA 4FAGA 1L7RA 2VVDA 4CCOA 3GZ5A 1Y0UA 4LLFA 4V2VA 5D8LB 4Q4W2 4A42A 2VZVA 4DUVA 1AR92 5ED4A 1ZRIA 2Q1FA 4CDWA 4IE0A 4I3GA 3IN9A 2VJ4A 3I2HA 2BUKA 3CKHA 1HSJA 3G3ZA 2ID4A 5AC92 2VUAA 4UT5A 4KA4A 4A7KA 2WFPA 4QXKA 4U2AA 4TN7A 1GUIA 3I2IA 5AVAA 2FBHA 3HT1A 5FFZA 3S93A 2E5ZA 4KGQA 3S5AA 1ZRRA 2JB4A 3TDZC 3AMPA 5FLMJ 2Q8OA 2L7KA 4KT5C 2DU1A 5A7SA 2DQLA 1GMMA 2CYYA 1S2EA 4AXOA 4OHZA 5GM0A 4JDNA 4M9XA 4M73A 3NV3A 5L3DA 5C70A 2LRDA 2JT1A 3WU1B 3G73A 1G9AA 2QQOA 4RGSA 4Y3OA 2GNBA 4X6QB 5JWPA 1RUNA 2R5YB 3TOJA 4GWJA 4BHCA 3SXWA 3LEIA 1MNMC 2HQAA 1AYN1 4FTHA 3W2AA 4PFOA 3CDZB 3GXOA 3GZ6A 1SFKA 2WQ8A 4M4PA 1WFXA 2R7ZJ 1VRH1 5EZWA 3T0YA 1WD4A 5ICGA 1PO13 2WAQN 3LA7A 1J1LA 1JKOC 5IUQA 3TN92 4AQTA 3WU0A 2W1QA 2K5CA 4XJWA 2ZNYA 3R4DB 2FCVA 2K9NA 3MV11 2XAHA 3S32A 1LKXA 3LSEA 1ETQA 4LBJA 1K4SA 3GCWA 3LQCA 1D0ZA 5HNFA 3I2KA 1YJKA 3LOIA 1F36A 4YM3A 1M1EB 2X5IB 4UB6C 1AUYA 3QP6A 2L7FP 2GNTA 2CRGA 1COV1 1ULFA 4PF5A 1S6LA 2LR8A 5E3LA 3SH5A 4ATFA 2ZXHA 3WD5A 5JOWA 2CGOA 3ERMA 3NRUA 3LA2A 3K0LA 1K3IA 3AJYA 5DM7F 1B4AA 1HRV1 3BR6A 4XHBA 1EPZA 5J48A 2ME0A 3CJIC 3W5MA 1GP5A 1UIKA 4S2FA 1FY7A 4PK4A 2TEPA 2GU9A 3WG1A 3SYTA 4AL9A 3HRUA 2GXAA 1MZBA 2JN6A 4IV1B 1KQRA 2WRAA 1K7AA 4OI2A 2VH9A 2RNGA 2QSGX 4A2UA 4W8JA 1W99A 2ID3A 2XSDC 3PIPF 2OU2A 3ZGKA 2EZKA 2W7NA 4JCKA 1N3OA 2VZSA 1LEAA 3C2GA 1ND3A 1QZEA 1O7FA 4IHVA 4EN8B 2L9NA 3EUHA 2HWC1 4HT1T 5JLXA 3H9GA 3VUOA 3IM0A 1JJ8C 2XBO2 3V8KA 1PHMA 4GB32 2EIMH 4MX3A 3JRFA 3WDXA 2VKDA 3M7AA 4BQXA 2Y6LA 1MSEC 2PXJA 3O1PA 3DXUA 3H8RA 1X4OA 1Y4WA 2NMOA 3JCIA 2QBXA 2DCTA 2F4LA 4URAA 1A35A 1MSFC 4MSVA 1ULPA 2P8TA 4HBLA 3JRCA 5DD8A 1P7JA 4PI0A 4A3GJ 3IPVB 1K6OA 3Q0VA 1JHHA 2J1UA 2JPBA 2E19A 3WP4A 1FOKA 2LALA 2YBKA 3H1WA 4Q4W1 1HRI3 3JTHA 3IUOA 4KG0A 2KP6A 4BE3A 3U2RA 1MBEA 2WJSA 1LEMA 2RVCA 2OX0A 2V1NA 2QF7A 2A6ZA 3FWEA 1PVC2 4Q47A 3I59A 3S6PA 3D5RC 1S0FA 1KQ9A 4N90A 5J36A 2NOGA 2HXIA 2QZ3A 1W6PA 2X6OA 3BJAA 4BACA 1RYYA 5F32A 3PVEA 3POFA 3QPLA 3FN9A 2P3KA 4XKWA 1UO9A 2IZWA 5G04L 4AWXB 2RMU2 2QBYB 1TME1 3LB9A 2ECCA 2LYCA 1RUC2 2DDAA 4HX7A 3RCOA 3GTOJ 4M9SA 2WT1A 1EA3A 2BE5F 1OLRA 1T6GC 1Z3YA 1B35A 4OLLA 1LFPA 1NA1B 3SH3A 3K1MA 4BMBA 3RNSA 5E3MA 5AIPA 5EGOA 2Z2SB 3BLYA 2D98A 1VBA1 1JHFA 1IF1A 5GLZA 1AWCA 4LK1F 3BCAA 2GXGA 2VXDA 2DA1A 1LTEA 3EUAA 1YHFA 1KQ0A 4OMCA 1AOYA 2WNVA 1SD7A 4Y5TA 1YW7A 1S1AA 4FPJA 4P9FA 1LOFA 2NVXJ 4L9TA 4EROA 5E88A 3WF4A 2E31A 4KYWA 5IT9K 1SVMA 3WTVC 1BL0A 4MIMA 4Q4Y1 3UGHA 3OIOA 1SEUA 1GZWA 1RJ7A 3ZFFB 4S2GA 3JSPA 2X10A 2XB6C 2YG0A 4Q4X2 1G8XA 4DB5A 4AFAA 4XLPF 4NPLA 3MEXA 2DK8A 3HPGA 2BWAA 5LB6A 5A32A 5FY4A 2VMFA 1XSRA 5J98B 3RMXA 2MPFA 5K7FA 3WNXA 4HAMA 3VZMA 1CAWB 4KWKA 3DKXA 2LF7A 5E17F 2OJED 2PQQA 2BHYA 3L2CA 2XHNA 5C3SA 4I0AA 1NCQB 5LW9A 3UNPA 5DN2A 4A5NA 5LA0A 3ZFFC 3N7LA 4NQWA