3LA2A

Crystal structure of ntca in complex with 2-oxoglutarate
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
196
structure length
196
Chain Sequence
VETFERNKTIFFPGDPAERVYFLLKGAVKLSRVYEAGEEITVALLRENSVFGVLSLLTGNKSDRFYHAVAFTPVELLSAPIEQVEQALKENPELSMLMLRGLSSRILQTEMMIETLAHRDMGSRLVSFLLILCRDFGVPCADGITIDLKLSHQAIAEAIGSTRVTVTRLLGDLREKKMISIHKKKITVHKPVTLSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the allosteric control of the global transcription factor NtcA by the nitrogen starvation signal 2-oxoglutarate.
pubmed doi rcsb
source organism Anabaena
molecule tags Transcription
molecule keywords Global nitrogen regulator
total genus 55
structure length 196
sequence length 196
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3la2A02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3la2A01
4ENKA 2JZYA 1LDDA 1Y9QA 5CVRA 2IA0A 3QAHA 4EWDA 2PAMA 2FNAA 2EJRA 4EV0A 4MTEA 4G6QA 1LNWA 1XMKA 4MEXF 4XF4A 3FE5A 4XF0A 3HSFA 2XAJA 1MKMA 5FQ0A 1IAWA 3QU6A 3R61A 1XSDA 2EB7A 3H3ZA 4L5IA 4OMYA 4YSFA 4KYWA 2DLLA 3SMHA 3TKYA 4FHTA 4Q5SF 4L9VA 1NXMA 4HDVA 5FCCA 3IBMA 5C8WA 3HQXA 1YW8A 4EGZA 4EJTA 2EA7A 4HX7A 3BPZA 1ZAOA 3TDZC 1W4MA 3EYIA 3H1WA 1YFHA 3R60A 4EROA 3WW2A 2FQ3A 3I5UA 3CO7C 3QRFF 1CAXB 3HUGA 4XF3A 1HKSA 1CGPA 1WSUA 4LJZF 1FP2A 3QU3A 2J5PA 4LB6B 1FNNA 5TRDA 1D8KA 1S7AA 2KXLA 1IF1A 4YG2F 3OGJA 1I1GA 2O1QA 5IT3A 4HQEA 4L9NA 2HDCA 3BU7A 1FWZA 2YPRA 5FFZA 2O8XA 3ZPLA 4QGLA 1MDMA 1PP7U 2KIMA 3SQNA 2QBYA 4XFFA 2FXAA 3BPVA 1SD7A 3FXQA 3RKXA 4L0YB 4HF1A 1OPCA 2IPQX 4EM2A 2PJPA 3E5UA 3GEZA 3UKVA 3Q5FA 4FAHA 4HA8A 3CJNA 4EJWA 5I8SA 4XLPF 1P4WA 4IEOA 3OF1A 2XL9A 2ISYA 3RPQA 4DINB 4J1XA 4RAZA 3C3VA 1HQCA 3CDHA 4K2EA 3FWEA 4RB0A 3P9IA 4L5JA 3BALA 3HOSA 4UUVA 4PZJA 2IXCA 1ZRRA 1ZX5A 3FX3A 3SZTA 5TJJA 2PTMA 5DCMA 4LA2A 2F5FA 4ENNA 3GBFA 2E7WA 3TOBA 2KJBA 4RS8A 2R7DA 2XKPA 4MX3A 3SCGA 5FO5A 1F4KA 5I0UA 5FB2A 5L3EA 4ASNA 4UV9A 1K79A 4FX4A 1LQ1A 1SMYF 4A0ZA 1KU9A 3FJSA 2RNJA 4HBNA 3DF8A 3L2HA 1ZZBA 1XE7A 4FX0A 3K1PA 3E6MA 3K9TA 4N9HA 3E6CC 2A69F 2QQ9A 5J8CA 5D5VB 3MQ0A 1UCRA 1O3RA 3FHZA 4M73A 1B6AA 1YLLA 1ZLJA 5ICEA 5LHIA 3IWZA 4GYGA 3JTGA 5DUIA 2H27A 4MGYE 2ZKLA 2VXZA 1YS6A 5J8FA 4Y17A 3KFWX 1QZZA 4OFGA 5HDNA 3SXYA 2DQRA 1VR3A 3S2WA 3F8FA 5CVIA 4L0ZB 1GQHA 3KP5A 1W7PB 5FLIA 1F9NA 4L2NA 1NE6A 1TQPA 1ZNPA 3E6BA 2KIUA 5LHHA 3CUQA 3CTAA 3L2CA 4GXOA 3KMHA 1XGSA 1ZGJA 4G9YA 4WWCA 3VEPA 4HF2A 1X82A 4RGSA 1J3QA 1O57A 1R1VA 1MD0A 3I53A 2D93A 4D0PA 1PP8F 2DW4A 1H9TA 2B5HA 4EWEA 1BI0A 2QLZA 2JTVA 1V70A 1AWCA 2WV0A 4CZZA 5E16A 2I45A 1S6LA 4AWXB 1Q5OA 1R5HA 4L9JA 1ZG5A 5DCFA 4AVAA 2QQAA 3RJPA 1S3JA 4JBAA 3ABTA 1DPUA 2CAUA 2M8EA 2XASA 4PIYA 2EA4A 3IDCB 1YWKA 2D1VA 1W7PA 2IW5A 3FZ3A 4HLTA 1QY4A 2PA7A 1YFWA 2HGCA 5DUKA 1VTNC 5A2QZ 3ZQ7A 3S7EA 2DFIA 1Y3TA 4ZU5A 4QGNA 3R0JA 2K4JA 2Q0OA 3ROUA 4PCQA 3KLOA 4YARA 4UNOA 1XDSA 3JTHA 2Q8KA 4MH0E 1G4DA 4PGHA 4XSXF 3CUQB 4CYDA 1ODDA 5JR7B 4DNCA 5I0SA 3BPXA 4MGKE 5FLHA 1MJAA 1BI2A 2M87A 4EWAA 5BPIA 1HW5A 4WXCA 4D7SA 2O61A 4MQVA 1E17A 4HX8A 1FYLA 1QWRA 2J5OA 1C0WA 1BOAA 5D5UB 1GXPA 2GC2A 1J58A 3IL2A 4U0YA 2V1XA 4RAYA 2YU3A 2K02A 1I5ZA 2GC1A 4A0YA 4XETA 3WU0A 1OKRA 3PQKA 4A5MA 3TGNA 1DGRA 1U78A 3GXOA 4X6QB 2GWRA 1U3EM 1O5UA 2XGXA 5D1IA 5AONA 1T2KA 2Q4SA 2CYYA 2FOKA 4EMSA 5ILUA 2FMYA 2O03A 4HQMA 1O7FA 4HSJA 1OYIA 3M1EA 4CHUA 2ET7A 1FBUA 3HRSA 4N9IA 5LGUA 4JK1X 4M9ZA 3K1NA 2RV8A 1Z1DA 2DK5A 1RL3A 4L9TA 1CF7A 2ESNA 2HS5A 1UCXA 5CADA 3GO5A 4HVRA 4UBGA 5DCMB 3LOIA 3KLNA 2IXHA 2UWMA 2IP2A 3CO2A 4XSZF 1YUDA 3WW4A 2CV6A 2PBIA 1G3TA 3KP3A 1IXSB 2HEOA 1ZRCA 4LUMA 2FNPA 4ZZDA 2ZCWA 3WTTC 1U5TC 2KKOA 4KIBA 2C6YA 2N7GA 4L11A 1K6OA 1JUHA 1QPMA 2VC0A 5F1RA 5JFRA 3D82A 3WE2A 2G7UA 2JSCA 1SFNA 4LD5A 5FQ0B 4ENJA 4ORFA 3DPLC 3KETA 1J2XA 5E17F 1SEFA 4O6JA 1EY2A 2HTSA 3NVCA 4MQ9F 4LG0A 3NKTA 1W5SA 3ZP5A 2XAFA 3E5QA 3F21A 4YFKF 4K8FA 1TW3A 4WX9A 2A6EF 3BZ6A 3PNAA 2V1UA 4OIQF 5K5RA 2V9VA 1SAXA 3GWZA 3J81K 4OMZA 1D8JA 4L18B 3H9AA 1XN7A 4U0VA 3NJZA 1BBYA 4JQFA 5KK1A 1HKTA 4XF1A 2LF7A 4HOBA 5KBFA 3RZZA 5D5XB 2P6SA 5LEJA 5FPZA 3V7SA 4MGIE 4Q0UA 4U7DA 4Q29A 3IIAA 2FSWA 1R1TA 4ON0A 1IN4A 1IXRC 1ON2A 3CO6C 4UHTA 2FRHA 1IPJA 4AIKA 4IF4A 4G94A 3I0TA 3TO9A 3E97A 3GX4X 5FLXK 4MGZE 5J48A 3D5LA 1HBXG 3PVBB 2HKOA 3RIRA 5KVRA 3WGHA 1CAUA 5BQTA 4NVPA 4IEPA 1K78A 1J7KA 1H1IA 2FBKA 1KYWA 1P2FA 2EFOA 5HLHA 2IXKA 1F1ZA 3ECHA 4Z07A 4BHCA 1Z6TA 2ATFA 4KT5C 2GXBA 4M6YA 2OA2A 3NW4A 2HZTA 2A07F 2DCTA 1NYWA 2KIFA 5HS8A 2VBWA 2MLGA 1L0OC 4UV8A 3J81Z 2CWEA 2PEXA 1YHFA 3L9FA 4UBHA 1IRFA 2IC1A 2LKPA 4RGXA 5T3NA 2RDPA 4R79A 2K86A 4I01A 3IKVA 4LLLA 3TDUC 1BI1A 4AVBA 2IT0A 5JCTA 3H7JA 1YLFA 3P9KA 1BI3A 4AD9A 4ESFA 1B59A 3J80Z 4IRHA 3PLQA 5FDBA 1HW2A 2GQQA 2HQRA 1KQ8A 5KHJA 4ZYDA 5BXXA 3GW2A 1QGPA 3I4PA 4EVIA 1Q3EA 3GZ6A 3JW4A 3ZMZA 3DPTA 1LKNA 3JAMZ 2UZKA 1FYKA 4GCVA 2XLGA 4PDKA 5AIPA 4KU8A 5J3UA 3Q9SA 2K9ZA 5JR3A 4KU7A 3NRVA 1MGTA 4XFCA 5FD5A 5CLSA 3WW1A 2H94A 1EYBA 3JSOA 4P55A 1FSHA 4CICA 3ISPA 1TW2A 2HQNA 2VT3A 1XSVA 4I2OA 3C3WA 2Z3YA 1MDMB 1UB9A 1SFUA 2MH9A 4I02A 2VC1A 3N97A 2Q1ZB 1WKMA 2EFQA 2V79A 5F64A 1JXSA 5DEQA 2KJCA 3WTYC 4LLNA 3DV8A 5ICFA 2D40A 2CSOA 2OZUA 1OI6A 1QBJA 3FMSA 1O4TA 1A04A 5HS7A 3J80K 3KEQA 3LWFA 3KE2A 2L4MA 5L3FA 5KHHA 3IWFA 2OQGA 3WODF 2Y0MA 5HLIA 4MNUA 3SZPA 2QENA 1LRHA 2DAOA 1T39A 1FX7A 2BYVE 3LA3A 3O14A 4MHGA 1YYVA 1SMTA 5BPDA 4IHTA 1J3PA 5J7MA 2EWNA 3U2RA 3P9CA 2GA1A 3SHFA 1F5TA 3AAFA 2Z69A 2OPKA 3O3KA 1UD1A 3LAJA 1CAUB 3MFKA 4G6DA 3SHRA 3LSTA 1KQ9A 3MZYA 3DL3A 4XFGA 1ZZ7A 2IRFG 4IEWA 2NNNA 3R6SA 5E1ZB 3REOA 2P5KA 4EM0B 4OIOF 2XAHA 1SFXA 2NS0A 1S8NA 2CG4A 4I09A 4RB3C 3B02A 2QWWA 1RUOA 1DZRA 3F3XA 3SCFA 2B8MA 2G9WA 5D6EA 3BDDA 4LG0B 2HWVA 2VECA 4P9UA 5K1YA 2A5YB 3HTUA 3V4GA 3J7AO 3HHGA 3USSA 3VOEA 5BMZA 2D45A 1BC8C 1WQ2A 3WGIA 1CF7B 2ZBKA 3V8JA 3ZMDA 1BIAA 2H6CA 1UIKA 5BS6A 4A5NA 1QQIA 3V7RA 2NAZA 2DT5A 4NHJA 4WK8F 3LA2A 1VP6A 1XCVA 3S0MA 5HDGA 3CUOA 2K7LA 2M30A 3HHHA 2LDUA 3RKWA 1USSA 3LZZA 2LF8A 6PAXA 4B29A 5E1WA 3U1DA 1BJAA 4UXAA 1ZRDA 1OFNA 3BCWA 5JSOA 2RGVA 1WLTA 4IERA 5DD8A 1PMIA 3F6VA 4YIFA 4WCGA 2BNNA 1REPC 1IPKA 1STZA 1YS7A 1J9IA 3OD0A 2VBYA 5BY5A 1R22A 4TV7A 4G7OF 1ZGAA 3W6JB 3M70A 4AVPA 2V09A 3KZYA 2QBYB 2RQPA 2KRFA 1WGPA 2ZKZA 2DI3A 2JPBA 5HDKA 1YW9A 4HV6A 4XRFA 2F5EA 3MPBA 2PMHA 1USTA 2HYGD 3F23A 3KP2A 4XF9A 4CXFA 2VE8A 4A6DA 2FA5A 2FQPA 2BE5F 5ILVA 2P7VB 3VB2A 2QDRA 4LK0F 3JAMK 2P8TA 3FXRA 1UIJA 3MYXA 1MJ9A 1TLHB 1D3YA 2O8QA 5HVQC 1RTVA 3OV8A 3GLXA 1RNLA 4KDPA 5FGMA 2G7HA 3U11A 1QXJA 4AIHA 2MD5A 5FD6A 4YFNF 2D5HA 3KP4A 4XFHA 4RGRA 1O5LA 3HRUA 1OMIA 5KHKA 3RNSA 4JTNA 4IEXA 4E2QA 5I8TA 5HLGA 1GVJA 1TNTA 2XAGA 1EH8A 1FY7A 4BYYA 5E18F 2R7FA 1V3FA 2X0LA 4LUKA 2MNGA 1MZBA 2HYFA 1TQIA 2XVCA 3WTZA 3UKNA 1IN6A 4R8HA 1JE8A 2L01A 4XBFA 1U8RA 3GFJA 4HV5A 4FBFA 3KGLA 4P96A 1ZZCA 5K8SA 1XGNA 4P5OA 3C7JA 1YFXA 1LVAA 1DGWA 1B9MA 3HSEA 3E5XA 2CQKA 2UXXA 5BUVA 2DK8A 1KA8A 2XUBA 3IDBB 1GHCA 4E2GA 2BNOA 1YFUA 1ZYRF 2MC3A 3G3ZA 1FXZA 4IEVA 2DBBA 5F6FA 4XFBA 4BHPA 2MA3A 3Q9VA 2NNYA 2O0YA 5DYMA 1WRJA 2NRAC 1YQAA 3CUQC 2W24A 4AQ6A 4IEZA 2F4PA 4G7ZF 3EUHA 4OIRF 1IZ1A 2MH2A 1W5TA 1D5VA 3QOPA 4AQ2A 3HTSB 4BH9A 4I0BA 2D1HA 2M5WA 4YYOA 2ZXJA 2GZWA 2E7XA 2PLYA 2PN6A 2Q30A 4NB5A 4BAYA 2PG4A 2D5FA 2A3SA 2XLAA 3L00A 1KU3A 4IVNA 4DQ2A 2FBHA 3RDIA 3ES1A 3H1YA 1GXQA 3D0SA 1BM9A 1X3UA 1IRGA 1IXCA 3K0LA 5ILSA 2E9QA 1ZHFA 3JZVA 3HT1A 3LAPA 1EH6A 4S05A 1J75A 2FEZA 3VODA 2VN2A 3NL1A 1U6GA 2YX7A 4HVOA 2H0VA 5CU1A 2CFXA 2GC0A 4PIZA 3GFMA 1I6XA 2QJVA 3I71A 4O5VA 1HSJA 2EK5A 2P7CB 4OINF 2EVXA 2L54A 2XKOA 2IVMA 2UYBA 1XMAA 3DP7A 5CVVA 1ZZ6A 3BJAA 3CEWA 2W25A 3MDPA 4IESA 2Z33A 1T98A 4QXKA 2OAZA 5D4RA 4Q4ZF 4IRGA 1CX4A 3QPHA 1FOKA 3WTXC 4WBBA 4KWKA 4GYIA 4KN4X 2IA2A 4FT8A 2F2EA 3EBRA 2UXNA 5DDGA 3V7CA 2VQAA 5CVUA 1ZH5A 3EHKA 3IRQA 4BIFA 4E70A 3T1BA 4S04A 3NEUA 4XLNF 1XE8A 2PFBA 1JGSA 1IN5A 5FLJA 3PQJA 5FLXZ 1AOYA 5E20A 3V8LA 2ZNZA 1XGOA 1T0FA 3CLPA 4KICA 5JI6A 5D8KB 4ZYEA 1CAXA 1U2WA 4B8XA 1YFYA 3ECOA 1FLIA 3I59A 5D5WB 3K1MA 2TDXA 3TOAA 3WGGA 5K5OA 3TO6A 4QWQA 3OCPA 3ZMSA 4PGGA 3LAGA 4F7ZA 2OA4A 1JHHA 2PAKA 2JT1A 4G8XA 3H92A 3WE3A 2RKHA 3BB6A 5BPXA 4HDUA 2QVOA 3GVAA 4MZUA 5ICGA 3U10A 1FPQA 3CF6E 5ICCA 4O3MA 1XDUA 5J6XA 1U12A 4Q0SA 1XD7A 4CO8A 1FC3A 2H6BA 2VE9A 1UHMA 3BP8A 3IKTA 3FZVA 1YIOA 2EAAA 3RKYA 3GF2A 2LSOA 3P7NA 4I0AA 3GZ5A 4HZFA 1LR5A 4A12A 2XHKA 5K5QA 3TNQA 3FHIB 2OU2A 3EDPA 4G7HF 5A2QK 2P5VA 5EEGA 4H7LA 2PI0A 4XFIA 2B0LA 3NQOA 3U0ZA 4HN0A 1L3LA 4HX4A 1SD6A 4A0XA 3QP5A 2IJLA 3GFIA 3QP6A 2E1NA 1LEAA 2ETEA 1XB4A 2K27A 1ZZ8A 5I91A 5ED4A 3KEOA 4ESBA 2HJIA 3GUDA 2PQQA 2Q2EA 5JAXA 5EFUA 1BC7C 2STTA 5BOXA 4U0WA 4WF2A 1YG2A 4HBLA 2XL7A 3FM5A 4Q0QA 4KWJA 1UW8A 2IXLA 2O3FA 2V6CA 4F8AA 4ZZLA 5LGTA 4FAGA 2YSRA 1RUNA 2ELHA 3M8FA 4LULA 1EH7A 1R1UA 4YNIA 4TLFA 2PYTA 2WWYA 4IXAA 3ETQA 1QO0D 3EQLF 5LHGA 3NSTA 2A6HF 4KFCA 1RI7A 3GYDA 4JVAA 1LEBA 3FXUA 4IEUA 4Q0PA 5DD4A 5H6RA 4ZYGA 3IRRA 2GH2A 1UHWA 1O7LA 4EGYA 2OD5A 1WWXA 3ELKA 4LLOA 4LB5A 4Z82A 2L3DA 4I7HA 4X6RB 2EV6A 2FMLA 2FU4A 1IN7A 1CAWA 3EQEA 4LGWA 3ML6A 3KP6A 3MEXA 3T5XA 4Y15A 3EETA 1CAVA 4Z2YA 2IXJA 1HW1A 5JSPA 5FPXA 1QXRA 4EM1A 1BN5A 2GXGA 2BV6A 3HYIA 3H50A 5BV6A 5IT9Z 3CJXA 3DQVC 5LBQA 1TQ5A 4HSLA 1ZVFA 1G6NA 2ISZA 3TQNA 1KYZA 3B73A 1KGSA 4CGZA 2EFWA 3ZMUA 2YX4A 2P6TA 1PM7A 4AXOA 4KN7X 3GFLA 2ZMEB 2P5LC 2W84A 2QYOA 3RYPA 1XRUA 3ZN0A 3SXWA 2GAUA 1Z6RA 2HTJA 2F5DA 2MLKA 2IA1A 1R00A 5I93A 2ESHA 3T8RA 2HR3A 4HF0A 4LEJA 2WTEA 4M9XA 2HFHA 1FBSA 1XSXA 2XAQA 1R23A 2ZO4A 1P6RA 3WTVC 2L4AA 3OOPA 3WU1B 3KP7A 3BROA 1S7OA 4IETA 5H6QA 3HOTA 2UY8A 2IXIA 3UKTA 2VPVA 3VFZA 4ZU4A 1LB2A 3SCHA 4LFUA 3HRMA 2Y0OA 2AXLA 2FF4A 2PAEA 2M1BA 2A68F 1FP1D 4WXHA 4U88A 3T0YA 1SQ4A 4D7TA 3F22A 2RVCA 5EZWA 3MAJA 3FMRA 3K2ZA 4ZU7A 2Z2SB 2YR2A 3C18A 4LMYA 4B09A 1H0MA 1YO5C 1O3QA 1U5TB 3WTWC 1R7JA 3LFKA 4M71A 4ESJA 2DTRA 1V4RA 5I8YA 5HI0A 1QNTA 2B9UA 2A61A 2F5CA 1K7AA 4KA4A 4J1WA 3U9GA 1OYWA 4KIFA 3IHUA 4N0BA 4RGUA 4U7BA 4IHSA 2PFWA 1OD5A 2Y75A 1LJ9A 2OBPA 1R36A 4LK1F 1NE4A 5H20A 2QVSB 1LDJA 2COMA 2AS5F 3FFQA 3H8UA 1YW7A 4HAMA 1MJBA 2VBZA 3L09A 2OYZA 2R3SA 1Z05A 4MUVA 1ZRFA 1X8MA 2ZNYA 1JHFA 2VOPA 3E3VA 2O6GE 2BBYA 1EV7A 4RD7A 1H9GA 2D2WA 2ADUA 3COAC 1CAWB 4HYEA 3W6KB 4BQAA 1X7NA 1IUYA 5ERIA 3KZZA 1T6SA 3G7DA 2XRNA 4KL1A 3EYYA 1X8EA 1PUEE 5LLQA 5JVTA 3O2PE 3MZHA 2VT2A 3V8KA 3GYHX 1G3SA 4OIPF 1O3TA 3N4MA 3DEUA 2PHLA 5KHIA 4I3PA 4ONUA 4WXDA 5FFXA 1RIOH 2W85A 3RI4A 3SFZA 1H1MA 2NYXA 4XFAA 4GO1A 3WG9A 1P4AA 1XCBA 3PFIA 2LNBA 3ELNA 3C1DA 3QPTA 2GIVA 3FM3A 4KUMA 5LRRA 3R0AA 2HOEA 1HSTA 3M3IA 4KIGA 2PMUA 4JTOA 1VJ2A 4META 3HRTA 5D6FA 1EP0A 4LLGF 1TNSA 4ZH4F 5LRSA 2GA2A 4IEYA 4IRIA 4NQWA 4PJYA 4GULA 2PHDA 2Z99A 3OTFA 1KQ0A 2ACJA 3F8NA 1B1BA 2UYAA 2QNKA 3KCCA 4ZYHA 2M45A 4A6EA 4YFXF 2Y48A 4AIJA 4GGGA 3DXJF 2XV4S 1FSEA 4QGMA 5HOOA 3BY6A 4QM9A 4MGRA 3ZDSA 2VODA 5L3GA 1Z9CA 3F8BA 2CO5A 2MPFA 4UVCA 4MV2A 3LWCA 3WTUC 3DKWA 1ZARA 1B4AA 3BWGA 1DZTA 3E6DA 1Y0UA 1OR7A 1SD4A 5CYVA 2JPCA 4EQQA 1FZPB 3RYKA 3ERED 5E1RA 5IT9K 2K4BA 1E2XA 1ON1A 2WC2A 2XIGA 5JHUA 2RN7A 5C6CA 3I59B 1RC6A 2L02A 1UFMA 1J0RA 1FYMA 5E1XA 1O3SA 3RPUA 3BJOA 4HVQA 1HXDA 4KNYA 1Q43A 3ACLA 2BNMA 3LA7A 2Z9OA 1WI9A 1J3RA 2WFPA 2PQ8A 5AIQA 2VBXA 1GQGA 4RB2C 1LDKB 4EJVA 1IN8A 3EO6A 5I0TA 1B9NA 2DPUA 1R58A 1DPRA 1SFEA 1G3YA 4HLXA 2QZ8A 3F8CA 3I54A 3HT2A 1TTYA 3F8MA 2QQBA 4M74A 4BHBA 2ET1A 3H7YA 1KU7A 3CL1A 4HMZA 1BIBA 3IC7A 1NZCA 5CJ9A 1YTYA 2ETHA 1SD5A 4HLYA 3I58A 2Q0AA 1T38A 5L3BA 2DQLA 4XEZA 1Z91A 2BEOA 3FF5A 3M7GA 1J1LA 2QUFA 1I27A 4WZCA 4A2UA 1Z7UA 4OLLA 2CW0F 2MBFA 1HKQA 3LQRA 4WVZA 4P9FA 4IEQA 4CDGA 4OU0A 2P4WA 3G73A 3RTRA 2EA2A 3BOQA 2EFNA 5EEHA 1OYYA 1ULYA 2CAVA 3LQQA 1FT9A 1Q1HA 1TBXA 5LGNA 5CVJA 4O9GA 1ZLKA 5I0RA 1RZ4A 1ZN2A 4QX5A 3ULQB 4QMAA 1PDNC 1TQMA 3ES4A 3TNPB 4R52A 3DFGA 5D4SA 4UXNA 1WA4A 3FMQA 4PIXA 4AVCA 2E1CA 3HSRA 4OOIA 2ZJ2A 1FI2A 4Q48A 3M8EA 2EV0A 3ZMVA 2GC3A 3KGZA 3QACA 3D0JA 4ETSA 2VOOA 3TO7A 2X4HA 5DV5A 1DDNA 2EFPA 1U5TA 5D8LB 4QLCU 4KMFA 1W7PD 2ZFWA 2OZJA 1DP7P 2OZ6A 4M6XA 2DPDA 5KHGA 4LTAA 3EJKA 3ZMTA 4R1HA 2C0ZA 2VONA 2OQRA 4LA3A 5JSRA 2QM3A 1J5YA 1DUXC 2FBIA 1KU2A 2P17A 2K0GA 5AVPA 3O6BB 1ZREA 3I7DA 1P92A 4KWLA 5L3CA 5E8IA 4P9GA 3KSCA 2HKXA 1R5GA 3HIFA 4M9SA 3WTSC 1XGMA 2W57A 5HS9A 3JSPA 1FBQA 4KMUX 3VHRA 4E2SA 4BNCA 1ZG3A 4IPAA 2BGCA 2XROA 3R4KA 3BJ6A 4IJAA 1ZG1A 3I64A 1J59A 3K69A 4MEYF 1IW7F 3M9AA 4YIIA 1I1SA 5E8GA 4I98B 2MHFA 3S7IA 4QM8A 4O9EA 3ABUA 2Z5UA 2V1DA 3F6OA 2CGPA 2EV5A 2H09A 5LEKA 4Y13A 2STWA 3H1MA 1P4XA 3CLOA 3RYRA 1ZZ9A 3ST7A 3WW3A 2JRTA 2DU9A 2RC4A 4EJOA 5L3DA 1NHAA 2FE3A 2UY9A 2GU9A 4JV4A 1RGSA 3MCZA 2XLFA 4EJUA 4YRDA 4ENMA 2DO7A 1K78B 3T8TA 4M72A 4HN1A 4Q47A 4MTDA 4UVAA 4RB1A 3ZN1A 3L7WA 4H0EA 4UVBA 2QCSB 3MWMA 1L3JA 1QZYA 3F72A 1EPZA 3H3UA 1ONVA 4BXUA 1S29A 3DN7A 1CAVB 4HW0A 1G3WA 1UPIA 4Q0VA 2ZMEA
chains in the Genus database with same CATH superfamily
2O14A 2VMGA 2CGOA 1V9U3 5FBJA 1RINA 5FKNA 2LY1A 3ZVXA 1FMVA 4EV0A 1NAEA 1QQP2 3FISA 1H89C 4G6QA 3AK0A 4N43C 2VO5A 4XJ8A 4XF4A 1PNFA 1MKMA 2HWF2 3QU6A 3JQXA 1XSDA 4S2FA 1XE0A 1N3QA 3ZMOA 2OIIA 2DLLA 4Q5SF 3ZXDA 1NXMA 3JRAA 2VMIA 3HQXA 1YW8A 1YE9A 2J42A 2BY0A 4AE2A 4D1QA 2XUEA 5FYIA 3BPZA 5LA2A 4XJUA 1YX3A 1JYIA 1YFHA 2ZMNA 4NROA 1ZGWA 3QRFF 4YZ1A 1CAXB 1PO21 4HONA 1JYXA 1D1CA 4LJZF 4AI2A 2DVAA 4PI2A 2HPMA 1H2KA 3CJTB 4NRPA 1MBGA 2O9LA 4UFKA 1S7AA 5CAZA 1YJKA 2JG9B 2KFDA 4CXXA 4AF9A 3SH5A 5IT3A 1Z78A 2HDCA 3BU7A 1HB2A 2YPRA 2O8XA 3ZPLA 4QGLA 1CONA 2A6VA 3VBHA 2KIMA 2VC9A 2QBYA 4XFFA 4RAFA 2ZZQA 4LBMA 2ZC2A 3BPVA 2V6EA 3J7YJ 2NOJB 4HF1A 1OPCA 3O1UA 2IPQX 1LU2A 2PJPA 4ZXKA 1MMSA 2DN0A 4YVSA 4HA8A 3ZYPA 4IEOA 3OF1A 4CEWA 2XL9A 5D8AB 3NO8A 3OGRA 4GMP0 2BBVA 4OHXA 5EGOB 3CDHA 3MKZA 2WLPA 4K2EA 2PN5A 4AAXA 2WYFA 2VUMJ 4NC6A 3ZYHA 4L5JA 3BALA 1XNTA 3WQ1A 1X1BA 2D43A 4XUPA 5TJJA 1W99A 3C2GA 2R7VA 2E7WA 1BW6A 5JZGC 1Y1VJ 4RS8A 4CCOA 2L0KA 1BBT2 3SCGA 1IG7A 3LSKA 2VJJA 1K79A 3WF0A 4AHXA 4QIWN 2ZX0A 3FJSA 3HWJA 1GZ9A 1Y8QB 3DF8A 3L2HA 2ZAAA 2UURA 1XNDA 4YGBA 1VIWB 1IKPA 4Z8BA 3K9TA 4ARXA 3LFMA 4WM8C 5D5VB 3MQ0A 3FHZA 2JVHA 1LESA 3PL0A 4DO0A 2RS31 4W6XA 2JDMA 5DUIA 2H27A 1VI0A 1Z0HA 1QZZA 3SXYA 1VR3A 3BC8A 2G9ZA 1B09A 2EZLA 5F2WA 5CISA 4LNVA 3KP5A 3M07A 3QODA 5FLIA 1F9NA 2BERA 3T4HB 1NE6A 3AG4H 5LHHA 3CUQA 3L2CA 3C7FA 4MHRA 1KGYA 4BQ1A 2A73B 9ANTA 5GKAC 2WDBA 1OQEA 4LQRA 2LFBA 1R1VA 3N7JA 4FPFA 1QMJA 4RL7A 4A3DJ 1W6OB 1AX1A 1KQRA 1H9TA 2B5HA 4XJZA 1NK3P 3K70D 2OUMA 2WV0A 4CZZA 5IP9J 2Y6HA 4EATA 3N3HA 1S6LA 4LR4A 1UPSA 5DCFA 3WHBA 2QQAA 2WL1A 1N47A 3HM5A 2R043 4FO9A 1DPUA 2CAUA 2M8EA 5IVJA 3A4CA 4A3ZA 2XASA 2EA4A 3I4IA 3VKFC 4R4ZA 4AGGA 4W6WA 3FZ3A 4QHZA 3GTJJ 3RFRA 3OYDA 2JG8A 1DHKB 4ZU5A 2B45X 4QGNA 1FATA 4FPGA 4BQ2A 4QD2A 1RMU2 3KLOA 3M3OA 1XDSA 2Q8KA 4FTHA 5A6XA 2JE9A 2WAEA 1PYVA 4XN3A 1PHMA 5JR7B 4LO7A 3BPXA 5IYBJ 2CFOA 5CYYA 3CCJI 2O61A 1FYLA 3KPHA 1JTYA 3GTQJ 1QWRA 1YOVB 4BBRJ 1IC8A 4XMYA 1C0WA 1BOAA 5D5UB 1NCQC 1J58A 4FTBA 4LK6A 2AO9A 3SDGA 1DYPA 5G04L 1RKWA 3WU0A 4AEMA 1XNBA 3OYCA 1DGRA 5DN2A 3GXOA 1Y9MA 1O5UA 1T2KA 4ZDLA 2CYYA 5ILUA 2FMYA 4HQMA 2ICWG 5CKMA 4CHUA 2DJIA 1FBUA 2M0MA 4M9ZA 1QNWA 3POGA 2RV8A 2DK5A 4L9TA 1CF7A 2ZEXA 1B35B 4HVRA 3KD4A 5DCMB 3LOIA 2UWAA 2CQNA 4QHOA 2WR9A 3GM8A 3MLJA 1WMEA 3ZXFA 1GYKA 4XSZF 4E7KA 2Q8CA 1FNZA 1HXS3 1W8OA 1PO23 3BTXA 4RM2A 4MGSA 3LF7A 4XDPA 1ETOA 2EZIA 1BQPA 5L9RA 2C6SA 1DF0A 3D82A 5LD2C 3PO2J 2HWB2 3VZMA 5FQ0B 3D3AA 4AEJA 2W1WA 3DPLC 2JXAA 1Z7S2 5E17F 3OGSA 5C9AB 1RETA 3JBG3 3CU7A 3W3CA 1EY2A 1STMA 1YITI 1WVRA 3NKTA 1WJ5A 1W0PA 4AEKA 2A1XA 2JENA 2MG4A 2C1FA 2LVSA 1TW3A 4WX9A 2A6EF 3FHNA 3PNAA 4PLNA 4OIQF 1NA1B 2LR8A 1SAXA 5DG2A 3T0AA 2OVUA 5TGTA 1K4SA 1HRV2 4NQWB 3WHCA 3L2YA 1PMHX 5KK1A 5FFOC 4G12A 3PUHA 5FPZA 2V7FA 2DT6A 4II2A 4Q29A 4UUTA 2FSWA 4EN7B 3HKZN 1V5FA 4RHV1 1ON2A 2DCZA 2JX9A 1GOHA 5FUIA 5FPBA 3DPRC 3UV9A 3TO9A 5FLXK 5J48A 3WG7H 2OCCH 4XQWA 2QQ8A 3S2HJ 4FTSA 5FZ4A 2W48A 4IEPA 5L73A 1DQ5A 2EFOA 5FZCA 2BXZA 3X29B 3TEXA 4NAMA 1Z6TA 2YC0A 4E7JA 2XONA 3RQ4A 4C90A 3NW4A 2DCTA 1ETKA 1NYWA 5AC93 1W03A 3MBWA 4UV8A 1ZA4A 4W8JA 3J81Z 4NC7A 4BQXA 1X9TA 2EAKA 1YHFA 2LM3A 4FCYA 2IC1A 4RGXA 4I3GA 2RDPA 5DUXA 4L0PA 4R9CA 1MEC1 2WAFA 2I5UA 4Y1VA 2BY3A 5JCTA 2A6TA 3VZNA 1YLFA 5DUVA 1B59A 1AR91 4IL6C 3VV1A 1PVC1 2XDVA 5FDBA 4P9JA 1H2MA 3KV6A 1HW2A 2GQQA 5BNNB 2RS33 5CA6A 1KQ8A 4ZYDA 1QGPA 1VMJA 4EVIA 2OW4A 1SC7A 5J40A 3DPTA 2XBO3 2E5NA 1QZEA 2K9ZA 3N9QA 1RUG1 3KHCA 4XQ4A 5GP9A 2J1VA 4P55A 1FSHA 4CICA 3NAPB 2L9RA 2CV1A 3MUZ1 4I30A 2IGNA 5DAXA 1ZR4A 1UB9A 2MH9A 2VC1A 1UF2C 4XOTA 2Q1ZB 1LCLA 1JXSA 2KJCA 1NK2P 4LLNA 3FK7A 1UHSA 2CSOA 5DDJ2 1OI6A 4GB32 3FMSA 4D6SA 4CCLA 5HS7A 3KEQA 3LWFA 3K7AJ 5KHHA 4UY8I 3SH4A 2OQGA 2GSYA 3WP4A 4HG2A 2QENA 1Y39A 2VOVA 3RPUD 2DAOA 2Z16A 1K6YA 2BYVE 4PJLA 4FVVA 3SHFA 4SLIA 1OQYA 3USUB 2LBFA 4YZ4A 4LO4B 2HWC2 2W39A 3H9GA 1V6LA 3MFKA 4CDQA 4G6DA 5A6YA 4CCMA 4PT6A 1YEWA 5IK7A 1T2XA 1W2AX 2BW3A 3C2HA 2GIZA 3R6SA 2IBDA 5E1ZB 3OPWA 3L2RA 4LHLA 3CDLA 4EM0B 2ENRA 5EZHA 2XAHA 3ZYIB 1BEV1 2NS0A 2R93J 3B02A 2QWWA 1RUOA 3RSJA 3BG6A 2HVQA 1VRBA 3BDDA 1JYNA 3OEBA 1ND2C 2TBVA 3BTJA 2WNUC 2G0EA 3HTUA 4NO4A 4OHVA 3E7LA 5C44J 1AX2A 5BMZA 2YMZA 4PF1A 4BQ5A 4NOTA 1WQ2A 3H0GJ 3WGIA 2R7TA 2WJSA 4N8MA 4QPIB 1ZM1A 4GD4A 2VB6A 3ILFA 1OKQA 2LUWA 4CDWA 3KV9A 1LKXA 2A3WA 2H6CA 2FD8A 4DYCA 1RUC1 1QQIA 3PUSA 2NAZA 3AVSA 4D7YA 5E3NA 5LWBA 5FYVA 2VL8A 1XCVA 1R49A 5JDBA 3M4FA 1USSA 3LZZA 2LF8A 6PAXA 3CCYA 2JWTA 1BJAA 5JOZA 1OFNA 3LFIA 3QD6A 2RGVA 1WLTA 2VNOA 1D0GA 1V5GA 5JLVA 1W36D 4WCGA 1REPC 1LOFC 2ZGTA 1IPKA 2BHZA 1SDDB 1GMMA 1W28A 4LKFA 2ZJRF 5GJ6A 2QBXA 4XJAA 1CWPA 1R22A 4QDRA 2C4XA 1WJFA 3Q8EA 3VDBA 1EAH1 5FPAA 5J1RA 2XGDA 1S7EA 2RQPA 5CQGA 4LBNA 5HDKA 1VBA1 1UX6A 2PMHA 3OYBA 3KP2A 4CXFA 2FA5A 3D1NI 5EWSA 1W6PA 4CUBA 2X6YA 3JAMK 4Y26A 2P8TA 2E2IJ 3VSLA 3MYXA 3PMSA 4BK5A 1TLHB 1F4HA 4XUNA 1IQAA 1RNLA 4FPCA 4FPKA 3VYUB 4LBQB 3PUQA 1YJ9I 1XQNA 4YFNF 2D5HA 3BUCA 3TP3A 4CA0A 3VHOA 1O5LA 5LFAA 1KS5A 3BQZA 1S0EA 1AYN3 1EH8A 2DCYA 2X0LA 5FZ6A 3J7HA 3L2UA 3S32A 2EH3A 1F31A 5FRAA 3UKNA 1JE8A 1JZ7A 1DZQA 3POJA 3DBHB 3KF5A 5FROA 3K4NA 3GFJA 2GMMA 4P96A 2HBTA 1XGNA 3POWA 2IVIB 3C7JA 2HWC1 1YJLA 2EBIA 3HSEA 2CQKA 1RUD1 2P37A 1J1TA 5IPAA 1C8M1 1PIV3 4GKYA 4LHSA 3FK6A 1YNAA 2LD5A 5FY5A 3A0HC 4WVWA 1TZOA 1H2LA 5JR2A 3KVAA 4E6KG 4LO8A 2O0YA 4W97A 2NRAC 1LNSA 1X58A 4ZDPA 5A3OA 1DDLA 2YV8A 5IAVA 2RDRA 3HC7A 1WCKA 4D8MA 4OIRF 1HQNA 1W5TA 4B1RA 5FYSA 2X05A 1I1EA 4AQ2A 2WUHA 1E5RA 3NMBA 2D1HA 4YYOA 2PLYA 3L9JT 1A8MA 1O91A 4JHTA 2MEV2 4JDOA 2A3SA 2XLAA 2BBAA 3BR0A 5EG0A 5E8AA 4YVSC 3N9MA 1UU5A 2FBHA 2FCVA 3ZYFA 1VLNA 2WA4A 4S2DA 2RNGA 1GXQA 1AR81 3OYNA 3MW2A 5A3UA 4ZZ5A 2E7AA 5EYXA 2B9SA 3SITA 4QX0A 3HT1A 1VBB2 4S05A 1J75A 2FEZA 1W3XA 3AG2H 2VN2A 3NL1A 5HBAA 2AEZA 4E4DX 4HVOA 1SLCA 2W7NA 2CFXA 1N77A 2E71A 1NG6A 5E3OA 3CMGA 2RR13 5CVVA 5KR7A 3BJAA 4CDQC 1T98A 2VNVA 1WD3A 3B94A 4TSVA 2ZKNA 3FMGA 4UOJA 1WW4A 3PTYA 1SBDA 3K77A 2ES3A 1RUG3 3U1XA 2UXNA 5DDGA 2GBYA 3V7CA 2VQAA 1GVDA 4YEJA 3AL0C 1HX6A 4QB2A 1XPXA 2PFBA 3JCIA 1FOD2 1IN5A 3TEZA 2W2IA 5C9AA 3NAPA 5FLJA 3ZYRA 2AXTC 4EEFG 4OUSA 4DEQA 5FUNA 3V8LA 4HT1T 2W1UA 1GP6A 2LS6A 3AKPA 3ASIA 3PNYA 5FKBA 4E27A 3LSIA 3J7MA 1XGOA 1BR1A 1T0FA 4Y4YA 4KICA 5D8KB 4ZYEA 3DTIA 1DGWY 2I10A 2ZXWH 1DCSA 5K5OA 1F15A 4QWQA 2KLOA 2HYKA 3ZXKA 2LP0A 4P9LA 1IDYA 2CW7A 2RKHA 3ZXGA 4HDUA 3ZFGB 3PUBA 2JRMA 4YG6A 2DA2A 3W9AA 1AR62 3OBZA 2Y38A 2DVDA 1U12A 1Q8SA 4Q0SA 1XD7A 1GDTA 5IJRA 1G7YA 1WGXA 5IHRA 2ZGKA 2E53A 2P3YA 4G9SB 1UAAA 1QDCA 2KM2A 4DRRA 1YIOA 3UJOA 2EAAA 4K21A 1RVF1 3RKYA 3W59A 2WRAA 1LFPA 4A12A 1NXD1 4Y1UA 5K5QA 2J22A 3WXPA 1RUC2 4G7HF 1ORKA 4HKOA 2B0LA 2VMCA 4AI9A 3LPGA 3PHMA 3GFIA 3OIOA 1LEAA 1IKQA 2VQ0A 1EAH2 5CBLA 2HJIA 2STTA 5BOXA 3DLAA 2DOEA 5JOYA 3FM5A 2YFUA 4QKNA 4F8AA 1RUNA 4TZDA 2ELHA 2VW2A 3M8FA 2E1OA 3CJQB 1EH7A 2RREA 3SFIA 1BEV2 1AF9A 3HR9A 2BFUL 3MIFA 3ETQA 1UOGA 2HU9A 1I5PA 1WCSA 4OUEA 1H88C 1LEBA 3FXUA 1WHUA 4M3FA 4IEUA 2AHQA 5DD4A 3AM2A 5GZCA 1UY2A 3IRRA 1S0CA 3UK9A 3GLLA 2FX0A 1R092 4UFLA 2EIBA 2FU4A 5FKMA 4LKEA 3RCOA 1GZWA 4B8EA 2YY1A 3ZN6B 3KP6A 3T5XA 3A0BC 5L36A 1CAVA 4XILA 4CU6A 1YRNA 1HW1A 1BK1A 3O12A 4GAZA 5JSPA 2D6LX 3CCQI 3WP5A 4HSLA 2KQRA 5C4XJ 4Q4V1 2R92J 1UG2A 3KVBA 1KYZA 4P9WA 4Y52J 2YX4A 5A7NA 2P6TA 1R1A3 2LG4A 1TME3 2ZMEB 4K40A 4AGRA 3SXWA 1RUH3 1X9PA 2JKXA 2Y0SA 2GAUA 1Z6RA 3F95A 4RN5A 5F3IA 4PK4A 3O1SA 2V5YA 1OSGA 2JG9C 1ODNA 2E7QA 4XXAA 3T8RA 2CSGA 4A44A 2HR3A 2WTEA 3WZ1A 4XL9A 2W91A 4M9XA 3PIGA 1XSXA 2GNMA 2GNBA 4NN0A 5CKNA 1P6RA 3ZYJB 3ACIA 2L4AA 3OOPA 3I2OA 1AR61 3KP7A 3BROA 4IETA 3ETPA 5F0FA 1D4M1 1O4YA 3BZCA 2VPVA 3SCHA 3EUKL 4D7TA 5D2AA 2RVCA 2R30A 1W9WA 5FIXA 2JA2A 1XB9A 3DEMA 3WNKA 2JE8A 3C18A 2WSVA 4B1LA 3CDIA 3WP6A 5CFDA 2X5IB 1WCDJ 1G2HA 3WTWC 2R7XA 4X0GA 4NE9A 1S4CA 4GMP3 1V4RA 1QQP1 2HEVF 1QNTA 5E3MA 1K7AA 4J1WA 2CJJA 2JDUA 5E88A 3S8PA 4RGUA 4U7BA 4IHSA 2Q5TA 4OHYA 2Y75A 2OBPA 1R36A 1YO8A 3AX4A 3LSDA 4C30A 2AS5F 3AMNA 3H35A 2OYZA 1B8IB 4UFJA 1Z05A 1H4GA 2VOPA 4FOWA 1MEC3 2Y0SN 1UAIA 3VD4A 2AEYA 3W6KB 3DEWA 5FZDA 3BYWA 5ERIA 1T6SA 5C4JJ 4B44A 3BG3A 1PUEE 5JVTA 3M3EA 3V8KA 1O3TA 5KC5A 3N4MA 1D0ZA 1K83J 4LKDA 4Y33A 3B6CA 4UW5A 4WXDA 2I2SA 3FLRA 1LHOA 5A7SA 2QEXI 5LY2A 3I4MJ 2Y31A 1P4AA 1FEXA 4AEDA 3ELNA 4YG0A 1YI9A 3C1DA 2GIVA 1JTXA 3M3IA 4QXBA 3RZDJ 5F04A 1UYPA 2CQQA 5D6FA 2WT2A 2WSUA 1QJY2 4G4FA 2GA2A 3RI9A 1CZTA 2XQRA 4NQWA 4LBQA 4D7MA 3RQ0A 2Z99A 5BNPB 2DA5A 1BXHA 4AR2A 3OTFA 3RZMA 3ZQGA 1GT0C 3F0CA 2AACA 1B1BA 2UYAA 2PJRB 1W2OA 4A3GJ 3DKXA 3T30A 1C28A 4GGGA 3DXJF 2XV4S 2VZVA 1FSEA 2WINB 3BY6A 2VZRA 2L7MP 1MMAA 5J09A 2CO5A 2W52A 2A05A 3DKWA 2P81A 3BWGA 1US3A 4P9YA 1Y0UA 3C8XA 1OR7A 3LSGA 3ZIWA 3IH4A 3W21A 5CYVA 3G1OA 2JPCA 5BNOC 2GN3A 3WQBA 2YU2A 2IS4A 5JUVA 1TZLA 2CH0A 5IT9K 1QNYA 2BP6A 2E31A 2DCKA 2WC2A 2XIGA 2HWB1 5C6CA 1VBD3 3J7LA 3ACGA 1HB3A 4YM0A 2HNHA 2YUEA 5JXIA 1U5IA 2YPJA 1J0RA 3DYMA 2A6ZA 3D4KA 2PMWB 4ZS3A 5FYMA 4UW4A 1GV9A 1Q43A 3S1NJ 2Z1DA 1JW6A 2Z9OA 3H3LA 1G9CA 5AIQA 2WAQN 1GQGA 3EO6A 2MC4A 1B9NA 2DPUA 1R58A 1G3YA 1PO13 3VBHC 3JR9A 2QZ8A 3F8CA 1TVGA 2HLEA 2HBUA 3F8MA 4BHBA 2ET1A 3H7YA 3CL1A 3BR3A 3TL4X 4NWWA 2VMEA 1PGL1 1YTYA 2VH9A 2DV9A 1CD3G 2ETHA 2H1KA 5DAQA 1T38A 4IO9F 4ES8A 4BU2A 5C3EJ 1Z91A 2BEOA 1XSQA 4AI3A 4A2UA 4HEA2 1Z7UA 3BT9A 2ZMLA 1Y43B 3DGTA 3T0BA 2CW0F 2MBFA 1HKQA 3LQRA 1QJY1 3LD8A 2KR2A 5E3LA 1I9RA 4QQLA 1OCRH 2WBKA 5FY0A 2P4WA 3RWNA 2XB5A 2VY0A 2WAQA 2EA2A 2VNRA 3ABMH 2JDPA 4RR3C 1OYYA 4ZC3A 3C7GA 3SKJE 2JD4A 3MKLA 2VMHA 5F0HA 3LQQA 1FT9A 5JPNB 4EN6B 5CVJA 5I0RA 3VDXA 4BUPA 1RZ4A 4YM1A 3WHTA 2Y33A 1RHI3 2XPVA 3N7KA 3QWLA 4JHZA 1CQ9A 1LFBA 2R072 2QQPA 4AVCA 1KRIA 4RLFA 1OUXA 2LBFB 3P6BA 3HSRA 2ZJ2A 1FI2A 4Q48A 3M8EA 4OULA 5J36A 1WFXA 1YQCA 2GC3A 4YW3A 3TOJA 4ITCA 3V56A 4XHBA 3J9SA 1DDNA 1U5TA 3FBNB 1BVVA 3WNPA 4KMFA 3H8OA 3EPZA 1Z7LA 1X2NA 4M6XA 5FUPA 2OPWA 1A8DA 4LTAA 3EJKA 3ZMTA 2VONA 4ZTFA 4UAPA 5T52A 4BJTA 4D5FA 2OQRA 3POFA 5F2SA 3Q8BA 2MD0A 3WP3A 1J5YA 1DUXC 2ZHLA 3QOEA 3B6AA 3JB4C 5IYCJ 4NR1A 3FLTA 1P92A 5CEHA 3LE0A 5BNNA 5E8IA 2DBIA 2HKXA 1AR83 3NWSA 2WZR1 3B7MA 2PLV2 2W57A 4JGZC 2BW8A 3WINE 1S0FA 3VHRA 4BNCA 2JJ7A 2BGCA 1IQDC 1AL21 2XROA 1XC6A 1ZG1A 2ELJA 3K69A 1IW7F 1SHWB 3HZJA 4V2FA 3WNLA 4CEWC 3R05A 3ABUA 2Z5UA 2V1DA 3FXJA 1OT5A 5LEKA 4DNYA 4COZA 3LDBA 1X3ZB 3RYRA 3WF2A 4DGWB 1DLCA 2DU9A 5L3DA 5L9VA 1YIFA 3BTCA 1RGSA 2EXIA 2XLFA 5IFTA 3POSA 2M8GX 4XNFA 2ADEA 1K78B 5GLWA 4M72A 3CCEI 1RUI2 1WJCA 1VRH2 5JOXA 2RDQA 4Q47A 4MTDA 4RB1A 2JUGA 2P5BA 5GZDA 3ZN1A 2E35A 4UVBA 1BVP1 1UQXA 3GGLA 4XKVA 1RUJ1 4DZPA 3IPVB 2JUCA 3CP8A 1UWWA 4DUWA 1EPZA 2AH2A 1CAVB 3VBUC 2O7OA 1UPIA 4Q0VA 4Y4RA 4OZXA 4ENKA 5K0UC 1Y9QA 2IA0A 2ZEWA 4PHZA 1NCRA 2VUCA 4IE5A 4CEYA 4M4RA 1PNGA 4EWDA 4LOSA 1XMKA 3F2ZA 4GRIA 3OUJA 2JEMA 2DCEA 4S0HB 2R7WA 3PIOF 4FISA 2HPIA 1YQ5A 1JUMA 2MSYA 1BJZA 1YRZA 3H3ZA 2W46A 2IS6A 4KYWA 1TWFJ 3ERMA 5FCCA 1ULPA 5C8WA 1N1TA 3PIJA 2JG9A 4HX7A 3C7OA 1W4MA 1H9WA 3EYIA 4RSUA 2EXHA 3H1WA 3KQRA 3R60A 1FMD2 4AYBA 1AL22 3CO7C 2X29A 4NBQA 4CCDA 3RZHA 3QH7A 1D7PM 2GP5A 4Q2FA 4XOGA 1VBA2 3K4KA 1EV12 4LB6B 4ZXEA 1FNNA 2K5CA 1D8KA 3RQIA 2Z4FA 3L2QA 1H9PA 1I1GA 3AP4A 4ANJA 3DWLE 4BMEA 1PP7U 3W2VA 3ZGKA 2ZSIB 3KT1A 3C2BA 4HKLA 3AP6A 3WQ7A 5DABA 3RKXA 1W0NA 2ADDA 4EM2A 5ACA3 4BJ5C 2YGMA 3J7ZI 3GEZA 3CC7I 4EJWA 5I8SA 4P5HA 4K6BA 4QX1A 1NT0A 1Z67A 3MPPG 1EPWA 2TNFA 2FZ1A 3ZFGA 1DQ0A 3DXTA 2ISYA 4DINB 1UMIA 4J1XA 1BJQA 3OGGA 1PX3A 4B3AA 2RM23 2CQ7A 1JZ2A 1OOPC 5CZKA 2VVEA 4OQ8A 5LB6A 5FO9B 1MZEA 5KXCA 1B72A 2HWE3 2TRTA 2IXCA 1QGLA 1ZX5A 3FX3A 3A22A 1MVQA 2PTMA 4LA2A 4YRVA 1V9U2 2F5FA 4ENNA 3OYHA 5GAEJ 3BODA 1CX1A 2XKPA 1YQ6A 2M4GA 5FLVA 1F4KA 3IM0A 5FB2A 1FOYA 4ASNA 1E3HA 5IY5H 2PHUA 4FX4A 4F91B 4IQJA 1LQ1A 2QKMB 3O5SA 1BOBA 4B3NA 1ZZBA 1N3OA 2Q8DA 4FX0A 3K1PA 3Q3SA 3AYEA 5K7HA 5J8CA 2K3PA 1UCRA 2IFRA 2QE3A 1O3RA 3H5NA 1MQTA 1YLLA 3WU2C 1JJ6C 5T54A 1W9SA 5LHIA 3P5JA 3JTGA 4JGYA 4MGYE 1B8IA 2VXZA 1YS6A 4MFDA 4CDXB 3OD4A 3KFWX 1XTAA 2OKXA 1UELB 5HDNA 2DQRA 3IH3A 4OZOA 5A3WA 3A23A 3S2WA 3F8FA 1OQDA 2XHNA 1LOCA 2BOJA 3OG2A 4FE4A 1S0BA 2R062 1W0UA 4L2NA 4RGAA 1TQPA 1ZNPA 4AYUA 5ABJB 3BTIA 4GXOA 3KMHA 1M06G 1U0JA 1WH5A 3KZIC 1QKQA 1MS5A 3VEPA 1X82A 2ZHMA 1J3QA 4HSTA 3VHNA 1VNDA 1EUUA 4D0PA 4K1YA 3WF4A 2DW4A 2VLAA 2C5DA 1VMFA 5I0DA 1LGNA 1AWCA 1V70A 4COUA 4Q4V2 5E16A 1V5EA 3SEEA 4IL7A 1W8UA 3AVRA 4AWXB 3U4XA 5BNNC 4AVAA 4ZY9A 1S3JA 2VQUA 2YC2A 1V6IA 2ZFUA 3BG9A 1SPPB 1ZK8A 3F9KA 2XF6A 3W58A 4IUGA 2D1VA 3HG9A 1CN1A 3BPSA 3N36A 1QY4A 5EPAA 4IOAF 4ITVA 5H9PA 1VALA 3KQ4B 2HGCA 5DUKA 5A2QZ 1AJKA 1P7IA 1UYYA 2JIGA 1VBC2 4MYEA 5BNPC 1VQ5I 2E63A 2Q1FA 2Q0OA 5K7ZA 4PCQA 1HKDA 2OTLI 4AHZA 5A3TA 4MH0E 1W39A 2EALA 4XSXF 3K4MA 2VU9A 1G9AA 5CFCA 1ODDA 3LCPA 4DNCA 4FPOB 1MJAA 1BLZA 4BLJA 1BI2A 1AYN1 2M87A 1HW5A 2WWJA 4D7SA 4OAYA 1E17A 2Y34A 2J5OA 1JTZX 1VE0A 1GXPA 2DTWA 3IL2A 2V1XA 4NJ4A 1I5ZA 1L7QA 4A0YA 4A5MA 4LPLA 1C8M2 5FPVA 1S1AA 1YXWA 4Q1RA 3ZQQA 1U3EM 2XGXA 1QIQA 5IK4A 2M9HA 1BMV1 2D6NA 3AZXA 4EMSA 4Y22B 2O03A 2BHYA 1JT6A 1OYIA 2C26A 2ET7A 3HRSA 3HOZJ 5A7OA 5LGUA 3I3BA 4QX3A 4YPJA 2HXIA 1OFCX 3K1NA 3BR5A 5BNPA 3OS2A 5IK8A 2HS5A 4NIIA 5CADA 1CIYA 2KP6A 2HWD3 3KLNA 4R9DA 2IXHA 2UWMA 1AU7A 2TEPA 3AKZA 3ENRA 5CFCC 3VD9A 2W9XA 1U9NA 1YUDA 2FOWA 4W65A 3NJVA 1OCPA 4JC1A 3PJQA 2NPIA 3OB8A 4YVWA 2ZCWA 2EF6A 4AFMA 2KKOA 2R042 1F8VA 1U5ZA 1JUHA 1WW6A 4YM2A 5JFRA 2R32A 2G7UA 2Y8KA 5LA0A 2ID3A 2KISA 3H36A 1RJ7A 3RWKX 2M3AA 1SEFA 1A6IA 2ZGUA 3KLSA 4O6JA 4XACA 4GMP1 3NVCA 2ZHKA 5IATA 2RJ2A 3MFAA 4LG0A 2UWBA 3E5QA 1ZQ3P 1RMU3 4XJ9A 3LSRA 2LRPA 2O0OA 2XQXA 4A42A 1XSRA 2A3YA 3LFUA 2OX0A 3BZ6A 3K2AA 2V1UA 3J81K 1C4RA 4OMZA 3S5AA 2F4IA 5C9AC 4QPIA 4DZJA 3H9AA 1XN7A 4BPZA 4C2UA 4U0VA 3NJZA 5DDJ1 4CDXC 1QJU2 1V54H 1KEXA 5JOWA 2JA7J 4LORA 4P00B 3HDDA 5KBFA 3RZZA 5D5XB 1ULCA 5LEJA 3VB9A 4PJJA 2DODA 2G9GA 4MGIE 3AL0B 4U7DA 5BNGA 3RZJA 2VKDA 2FDGA 5F27A 5M3FJ 2F6CA 3DECA 2ILMA 4HL0A 2YBKA 5FTTC 5DAPA 4Y1ZA 3E97A 3D5LA 3PVBB 5J1UA 4N53B 3OBRA 5J4YA 1QHDA 4JGYC 3BG7A 2BZTA 3RIRA 4HPQA 3G1MA 3S1RJ 5LZ6A 3HNBM 4O7XA 3WNOA 2VNGA 4GXLA 2DMQA 3CKHA 1H8TB 4M0NA 4C1WA 4O65A 2NS7A 2HZTA 1T08B 4B4RA 1L0OC 3AYDA 1MH4A 3AXDA 2PEXA 5F5AA 4UBHA 5CQEA 3BIEA 2GALA 3VBRC 4MHUA 3FDYA 3IKVA 4RBOA 2X1EA 4LLLA 3VBOA 1BI1A 4AVBA 3W2AA 2IT0A 2R0QC 5D21A 1I3QJ 3H7JA 1VQ8I 3BTAA 1R091 4CU8A 4AD9A 1JODA 5LBEA 2P34A 1MZ5A 4PJ0C 1TWAJ 2JVGA 2HQRA 5LA9A 1W8WA 5BXXA 2VKHA 1Q3EA 3GZ6A 2I07B 1LUJB 4PBOA 3Q9SA 3DTKA 1AR92 5JR3A 2YXSA 2XGCA 5GZFA 5FD5A 5HPOA 5CLSA 4HK9A 3BCAA 1TW2A 1HRV3 1XU1A 4XAAA 1H2NA 3VYSB 5E6HA 1WKYA 3HL2A 1RJ8A 2W94A 1SFUA 4I02A 1NOVA 1DQ2A 4IGOA 2BGOA 2EFQA 1W36C 1UZCA 1JH5A 3WTYC 2ZZJA 3DV8A 3JCUC 5ICFA 4MFEA 2EIMH 5AC91 4QXCA 1XPWA 2W1QA 2JMWA 5FWEA 4IE6A 3KE2A 4QX2A 4QQOA 2BWAA 2V72A 5EXOA 4H3WA 1UU4A 2L4MA 2XJTA 5L3FA 1QPIA 4NIAA 4MNUA 3SZPA 1CJPA 5FKCA 4ET7A 4II3A 3QYBA 1JI8A 1T39A 1FX7A 3H42B 4MGQA 3LA3A 3O14A 1YYVA 1SMTA 2OTJI 4IHTA 2P3KA 4RAGA 1C8NA 3ASNH 3P9CA 2GA1A 1UD1A 3FUQA 3LAJA 3LSTA 5EJZB 1XNAA 3HBLA 4V1PA 4XFGA 1ZZ7A 3PJRA 3G6JB 3CF2A 1DIWA 1PMJX 4H7MA 2XB0X 3REOA 3ZLIA 4PCRA 4OIOF 1FAYA 4MO3M 4I09A 4RB3C 1RUE2 1P8JA 1FTZA 1NCRB 1W8ZA 5FO7B 1SEUA 3F3XA 3SCFA 1RESA 5B66C 2B8MA 2G9WA 1WZXA 5LK5A 5D6EA 4PDWB 2IS1A 3ZKYA 4F93B 3VOEA 1RUF2 1FJLA 1EA3A 3V8JA 1KS4A 4FCAA 3RZLA 2GNTA 1UMZA 2QQIA 1WMDA 1WJEA 4LITA 3V7RA 2SLIA 4NHLA 2Y6JA 3CNAA 4WK8F 2BXYA 1KDMA 5HDGA 1O59A 1RUJ3 3HHHA 3E1F1 3VBSC 4JGZA 2E34A 4J00A 2RAEA 2QQMA 5E1WA 3OPTA 2B63J 3U1DA 1RXFA 4UXAA 1PZ9A 3BCWA 5JSOA 5JPMB 2VE1A 5C4WB 3F6VA 1KJLA 5J37A 3VBOC 1UYZA 1ETVA 5BY5A 1ZGAA 3W6JB 4AVPA 2V09A 2JE7A 2QTWB 2J1RA 1MNMC 2VI6A 5HCBA 2JPBA 1YW9A 3ZDVA 1ZELA 4XRFA 2F5EA 3SEQA 1USTA 2HYGD 3F23A 4A6DA 5A3NA 4MSVA 1S5LC 2FQPA 3A4UA 1MNEA 3VB2A 2YHJA 1RYYA 1Z7S1 2ID4A 1POV0 4HK8A 2O8QA 4KDPA 4PJMA 3U11A 1QXJA 4AIHA 4I99C 1UMQA 3VBSA 3Q8AA 1Z3YA 2HOAA 4JTNA 4ZKTB 1ZBA3 5I8TA 2YBSA 3UNPA 1GVJA 1TNTA 2Y0IA 5E18F 1HV0A 2R7FA 1YJWI 1MMDA 2JIJA 1MZBA 2XVCA 4A3EJ 2IVJA 5F8PA 1TEIA 2PHWA 1COV2 2VR4A 3HKZA 2L01A 1V9U1 2Z79A 2E5ZA 2M7AA 2ZJQF 4FBFA 3KGLA 3ZQLA 2WQZC 1H8AC 4WVVA 1LVAA 3IAPA 5FK7A 1DGWA 1ULDA 3E5XA 2WZR2 3USUA 5E79C 2LRDA 2UXXA 1YJNI 1CESA 1X1AA 1KA8A 5LY1A 1GHCA 2BNOA 2VW1A 2DF7A 3VGIA 1ETQA 2J1SA 1XYPA 3G3ZA 1FXZA 3ZIXA 2R7UA 5F6FA 5AFBA 3SH3A 4BHPA 4L99A 2NNYA 3VL8A 3I55I 1X4PA 3CF5F 4YGCA 5JZGB 1QJX2 1D2QA 4YGDA 4COYA 2ZGLA 1MIJA 1IZ1A 2BVVA 3MI8A 1JZ6A 4BH9A 4I0BA 2GZWA 2E7XA 1DGWX 2PN6A 3AMMA 4IV1C 4NB5A 1JS9A 4ZONA 1UZZA 1UOFA 4IVNA 2ZHNA 2RS11 3RDIA 5A7WB 1OLTA 5FZ7A 1V6MA 3D0SA 4BLIA 1EUTA 1IRGA 5HV0A 2YB7A 4XXPA 1IXCA 2R7RA 3AFKA 2E9QA 2P6CA 5APAA 1OCCH 4QAWA 1EH6A 2JICA 3BG5A 3ZQCA 4IHVA 2YX7A 1TWHJ 1HA8A 5FYHA 5L7OB 3ZKUA 2X09A 4CYCB 4CZSA 3FXKA 5T5JA 4HNUA 2QJVA 3I71A 4O5VA 3QH6A 2EK5A 2WO1A 3RMXA 1C3HA 5IT6A 1WUVA 2L54A 5EIYB 2UYBA 1XMAA 1OH3A 4QXKA 4AFCA 5FR3A 4Q4ZF 1DU0A 3HBZA 1OF4A 4KN4X 2IA2A 2ARBA 3EBRA 3VKNA 1QOTA 3RZOJ 4BL0B 1ZH5A 2F5VA 1CZSA 4E70A 2RMU3 4RQPC 3NEUA 4XLNF 1XE8A 3VBSB 4AQSA 1L7RA 3Q8CA 4ASLA 3PVNA 1ETYA 3PQJA 2WFF1 5FZFA 1AOYA 1ZBA1 1OBNA 3CLPA 5JI6A 4B43A 4GJZA 1QH6A 2VJ4A 1U2WA 1YFYA 1VB4A 3LEGA 5D5WB 4HPKB 4GJYA 2AENA 2RVAA 3CP2A 3VYRB 1K61A 2VQHA 4PGGA 3LAGA 4PDWC 4F7ZA 4JYKA 1NLQA 4INDA 2OA4A 5FJKA 1CR7A 5FV3A 3WE3A 5GZEA 3CCUI 3QPSA 1NCRC 5BPXA 4CEWB 5J4VA 2QVOA 1A36A 3N9PA 3U10A 3SDBA 5ICCA 3PUAA 2UUZA 2MEV3 4RDUA 3PTRB 1TNFA 1FC3A 1R5ID 2H6BA 2QDNA 1DQ6A 1J84A 3JQWA 3G71I 3BP8A 3IKTA 4GQ7A 3GF2A 2LSOA 2ZACA 1LOAA 4I0AA 3GZ5A 4WM7B 1VBB3 1S72I 3WF1A 3TNQA 3TB0A 2OU2A 3EDPA 5A2QK 1Y56A 3VDDA 2D7FA 4H7LA 4A3MJ 2PI0A 2WYSA 3NQOA 3AXEA 4HN0A 2NVYJ 2VUJA 3I56I 1SD6A 4A0XA 5T5LA 3QP5A 2D6KA 3QP6A 2E1NA 3SISA 4KT6A 2K27A 1IUFA 4ZYAA 5KWRA 1BC7C 3TN91 4WF2A 4PDWA 4Q1PA 4AAPA 2DTYA 2R7ZJ 4KWJA 2IWGB 2R0HA 2O8OA 2IXLA 2O3FA 2ZEZA 3IAQA 4ZZLA 3ZM8A 1RVF2 1R1UA 4TLFA 2WWYA 1GUIA 1T56A 3H5AA 1K5JA 1QO0D 4KGGA 1Q8VA 2X5IA 2A6HF 2VJ5A 4A3KJ 1DP0A 3N7LA 1MMGA 4NUBA 4YW6A 4XORA 1JOBA 4UFHA 4ZYGA 1UU6A 4KITB 3BLYA 4UI9L 5B4XA 1PVC3 1MZFA 1W6QB 3ELKA 2JDYA 5BYNA 4Y20A 3SNMA 5HCFA 3PFYA 3LB9A 3OBTA 5GLTA 3FXLA 4CCCA 3WLUA 2OQ7A 3TN92 3OIPA 1IN7A 3H0OA 4R9AA 4G3YC 3B93A 1SFPA 4FOVA 2Y9ZA 5F5QA 4Y15A 2IUWA 2IXJA 1FPN3 5ACA1 2KA3A 4NIDA 5FPXA 4BY1J 3CJRB 1TNRA 5FYTA 1WW5A 1GZTA 4GFBA 2BV6A 1MMNA 3RS6A 1SVLA 3CJXA 2A6YA 3DQVC 5LBQA 3NNMA 1WW7A 3B73A 1FOD1 2XJUA 3VBUB 3BZKA 2JQ7A 4AXOA 4KN7X 2W84A 1EV11 4GA9A 3ZN0A 2YFZA 2K9QA 3PVEA 3A03A 1PK6B 2HWF3 3GCWA 2MLKA 2M7BA 3U21A 2MEV1 3O1VA 1XOYA 3HPNA 2HEWF 1ZYBA 2QSGX 4LEJA 1RR7A 2XVLA 2QKLB 1XJAA 3Q0VA 3AP7A 5GAGJ 2X6WA 3WDUA 1UOJA 1PM4A 5FZ0A 5IW0A 3ZN6A 3NARA 1BR4A 3WU1B 1RRJA 2V9KA 1NX9A 4TTGA 5H6QA 1GNHA 3UKTA 1DBNA 2AQEA 1LB2A 4LFUA 2AXLA 2EIEA 2ARAA 1FP1D 2WNVC 4NIGA 4E4ZA 3MAJA 4P08A 2KMUA 3S57A 2BFUS 3GHMA 3WV6A 4BE3A 1W06A 4FPYA 1OHFA 4B09A 1H0MA 3I2GA 1WLDA 1GUUA 1YO5C 3O0XA 4YW4A 1U5TB 3JD71 3LFKA 4M71A 1JT0A 3HN3A 1SLBA 5LBBA 2EXJA 3IN9A 1H8VA 2F5CA 1OA3A 4KA4A 3RGBA 2JJ6A 4PUSA 4QKFA 1OYWA 4KIFA 3IHUA 4N0BA 2CGNA 1QJU1 2WY7Q 4G6TB 4JP0A 1OD5A 1GLNA 3TEWA 4TYSA 4LK1F 2VZ1A 1LDJA 4YG3A 4FSJA 4HAMA 2VBZA 1PGSA 2R3SA 3ZR8X 4XW3A 2XVKA 3H8RA 1ZRFA 3ZXJA 1LEDA 2W82A 3HGGA 2ZNYA 4GKXA 4X6AJ 3HMYA 3OYWB 4N4OB 5FZBA 2D2WA 2ADUA 1IDZA 1CAWB 4HYEA 1HB1A 2OC6A 1IUYA 1S0DA 1N78A 3CJIA 4FOQA 4EYUA 1RXGA 4FQZA 2XRNA 3PSIA 1X8EA 3S3MA 5KAFC 2IXSA 1GICA 2DTZA 3MZHA 2OCEA 2VT2A 5EEAA 3ABLH 3DEUA 2PHLA 5KHIA 2W85A 3RI4A 1H1MA 4XFAA 4GO1A 3WG9A 4FE7A 3EB7A 4CXWA 3AL6A 3PFIA 1DU3D 4KGQA 3QPTA 4JCKA 2LOOA 1YHQI 3V42A 3LSMA 5KNLA 4JTOA 1VJ2A 3WG1A 3HRTA 4LLGF 3I2IA 3M8LA 2FBEA 2CYFA 4HG6B 4GULA 2D98A 1UY0A 4AI0A 2RDSA 1KQ0A 2QUOA 4WVMA 2VAUA 5JVGF 2QNKA 4ZYHA 2M45A 4A6EA 2Y48A 4Q8KA 1ACIA 4F3JA 4BQOA 3P3NA 5JMCA 3O0WA 4QGMA 2ZGPA 5HOOA 4A69C 3VBHB 4QM9A 2KHMA 3ZDSA 1A5JA 1REEA 5L3GA 1Z9CA 4XC9A 4RFT0 3LQCA 4MV2A 3WTUC 4B47A 1ZARA 1B4AA 1IV6A 3ECQA 3E6DA 4FPEA 4Q4W3 3E0JB 3OSGA 3UGGA 4LBJA 1TP4A 4EQQA 4FFFA 4YW5A 2LALA 2R1BA 3ERED 4CP1A 3S14J 3GJBA 2K4BA 3S6PA 2DDUA 3ZOBA 2DA1A 3ALQA 1X1PA 1UYXA 1SCSA 5C8CC 2PMZN 4UUSB 2BJSA 5ABJC 1RKTA 3I59B 2CWSA 2Y6KA 1MS4A 2DCJA 2LK2A 5E1XA 4YW2A 5J96B 4BXSV 4HVQA 3K4LA 1D0YA 1PX4A 1VBC1 1SLTA 3LA7A 1WI9A 2P1BA 2B46X 2K2SA 4CDUC 2WFPA 1LTEA 4TXWA 3POEA 2VBXA 5EG0B 4RB2C 4EJVA 3NV2A 1IN8A 1R081 4HLXA 3PVOA 1TTYA 2GXAA 2FZ2A 1BIBA 4AW7A 2V4VA 3IC7A 4CVUA 1L7LA 2QQWA 5CJ9A 5CFDB 1BZWA 2DFCA 3DF0A 2DQLA 3IPVA 4XEZA 3VKLA 4R9BA 1J1LA 1I27A 4KI5M 4RS5C 4YWAA 4OLLA 4WVZA 1W0OA 4P9FA 4A41A 3R4UA 1YX5A 3AFGA 4BA6A 1AZDA 2JDAA 4OU0A 2DA3A 3BOQA 2ERFA 2EFNA 5JIUA 1WI3A 2VQCA 4WM8A 2CAVA 2D44A 3OYIA 4XVHA 5FP3A 4AVVA 4HRIA 4W50A 1BBT1 3ZSMA 2DU1A 1ZN2A 4C8DA 2XOMA 1PIV1 2E2JJ 3DKQA 1LOGA 2QZ2A 3VWBA 1O4ZA 3GTOJ 1FTTA 3GDBA 2EINH 1GWKA 4M3BA 3BR6A 1ZBE1 3TNPB 4XLEA 1W9FA 3OUIA 3FMQA 1HXS2 4PIXA 2KL4A 3QLQA 5FKOA 2E1CA 1UZWA 3K3NA 2MABA 3IV5A 3MKYB 2UV1A 4YIRX 2HVRA 2EV0A 3ZMVA 1OF3A 1R083 3KGZA 4ETSA 3NV3A 2VOOA 3VSKA 2VGDA 5D8LB 4QLCU 4QPGB 4XLHA 3UYJA 1W7PD 1KXGA 3E1SA 4R1HA 1AL0G 4W1UA 2BV4A 2QM3A 2FBIA 2P17A 1V6JA 3T4VA 5L9BA 3DTEA 2WNUB 3AZWA 1XU2A 1HV1A 4R4XA 4KQ7A 4RFRB 5L3CA 3KSCA 1V6OA 1GBGA 3HIFA 1RUD2 4M9SA 5FZHA 3UJQA 3JSPA 3IIIA 4E2SA 4IPAA 1R4NB 2XH6A 4IJAA 1J59A 2L9NA 3CDZB 4MEYF 3P1IA 2FD5A 3M9AA 1I1SA 4CDWC 4AVSA 3IMMA 2E7TA 3S7IA 4O9EA 4N43A 4P02B 3F6OA 2CGPA 4Q4Y1 2H09A 4Y13A 2STWA 2E2HJ 1X2MA 3H1MA 3DPRB 4XKBA 4PSWA 1ZZ9A 3ST7A 2WS93 3WW3A 1R6RA 2GMEA 2RC4A 1JZ4A 2XSDC 1NHAA 2GU9A 4JV4A 1HJFA 3OL3A 1T33A 4FFIA 5D8AA 4M3CA 1GKBA 2ID6A 5KXEA 2JG8C 1FIAA 2GH8A 3L7WA 4H0EA 2ELKA 4H14A 1FV3A 2ECBA 2QCSB 1WJBA 3VUOA 3KS7A 2FDJA 4FXKB 3H8XA 2WO2A 1ONVA 3FBYA 2RS52 3VDDB 1OXCA 1S29A 2W47A 3DN7A 4HW0A 5CKQA 1D0HA 4RYDA 3X2QH 2ZFWA 5GADJ 1G59A 1ENSA 1UN1A 1TMF1 2JZYA 5CVRA 3ABZA 1WCQA 1NCQB 2QGUA 4A3XA 4GWJA 4UW3A 2WWUA 2RR11 1FYUA 2VCMA 1WBFA 2DMUA 1S0GA 1LNWA 4MEXF 3FE5A 2XAJA 2VZ3A 5FQ0A 1IAWA 3THDA 4ARYA 1D4M2 3Q8FA 3R61A 1JU3A 4L5IA 3RJRA 4NMIA 5F0CA 4YSFA 4YVWB 3SMHA 3TKYA 4L9VA 1AYM1 3IBMA 4EGZA 5FPUA 1W8TA 4NHKA 5FP4A 1ZAOA 3TDZC 1AR82 2XBO2 1OCZH 2Y9YA 3KYLA 2PLV3 4N7IA 4EROA 3WW2A 2FQ3A 1OVPA 3U4SA 3HUGA 4XF3A 2WQ8A 1CGPA 4CCKA 2X85A 2YYOA 1Y6IA 1FP2A 4A3LJ 4DPNA 2J5PA 5HNHA 5TRDA 2YU9J 3A7QA 2DXIA 1RUI1 3OOUA 3PNTA 1IF1A 4YG2F 4QPWA 2VCCA 2HQ5A 4JKMA 4HQEA 4L9NA 1FWZA 5FFZA 3H9JA 2OF7A 1ZBE2 5DDJ3 4HNVA 5FBZA 4P9XA 2WFF3 2Y30A 4OHWA 3FXQA 3HN1A 5FLMJ 2RMU1 2J1AA 2E51A 4XLPF 1LECA 4JOMA 4F52A 3MICA 3EUHC 1ND3B 4NWVA 2QQKA 2XGEA 4CSWA 1X50A 4K20A 3RPQA 3C3VA 5TISC 1A6CA 4PF5A 1PVEA 2CW8A 3ZXAC 4D94A 1I3AA 3LSHA 1JI6A 3FWEA 3ZFEB 1UZ0A 4RB0A 4PZJA 4CH7A 3CIHA 3SZTA 5DCMA 2MGQA 1MPXA 3MIHA 3JREA 3TOBA 3ZOIA 2AQFA 1JU4A 5FO5A 3M3YJ 3VBRA 3H1CA 2CU5A 5I0UA 5L3EA 4B7KA 1SMYF 4A0ZA 1KU9A 1F36A 4URTA 1VQLI 4XLCA 4HBNA 1HN1A 5JXGA 2WZ8A 4XHXA 3LSJA 3WQ0A 3AKQA 3E6CC 4K3UA 4HPKA 3KEYA 2QQ9A 4LG3A 1RMU1 1B6AA 3Q9OA 1ZLJA 2X6OA 3IWZA 2GLOA 3AKSA 4H55A 2X9DA 2ZKLA 4LBKA 3ZX7A 5J8FA 2B7EA 1FMD3 2XMLA 2CV2A 1VAKA 1JZ8A 1C5HA 4L0ZB 1TC3C 4QDQA 1S55A 1VBA3 3AG3H 3E6BA 1Y7BA 3N9OA 2KIUA 3CTAA 4UB8C 1ENHA 1ZGJA 4G9YA 3B9CA 3OY8B 2VM9A 4QB1A 3LIHA 4RGSA 1HRI3 3GZUC 1O57A 5AFEA 2D6OX 3FUOA 4CP0A 3I53A 2D93A 1ENQA 1PP8F 2VPLA 2DUPA 5DG1A 4YZ2A 1BI0A 1WA6X 2JTVA 4RLQA 4YZ3A 4XKWA 4E9KA 3GZNB 2A5WA 2JK3A 1XBFA 3RJPA 2Y26A 1GWMA 1QJFA 4JBAA 3OR1C 5CB7A 4LE3A 5JXHA 2RM22 2KRCA 4PIYA 3VYTB 1ND3C 5A70A 2XWJB 1W7PA 4UB6C 1CQTA 4HLTA 1D0XA 3WG4A 1YFWA 1VQ7I 2R041 3ZQ7A 1Y3TA 3VN4A 2CUJA 3HXLA 3G2BA 3R0JA 5A1LA 1ASJ3 2BOIA 4OHZA 2YS9A 3A1YA 4BJ6C 3I3QA 5FPLA 3QQAA 3WR0A 1W6PB 4UNOA 3LNQA 3BTZA 3JTHA 5CIRA 1AYN2 5KXDA 3HQUA 2WV1A 3K4ZA 3CUQB 4CYDA 5FOBB 3B01A 2L2OA 4XLAA 1E3PA 5FYCA 2XAUA 2R5YA 3S1MJ 5FLHA 4CDUA 1URXA 4JKKA 4LOCA 5BPIA 3M1HA 4BQWA 1REDA 1YQ2A 4BB3A 4MQVA 1SFOJ 2GM4A 1SMVA 1YI2I 1W8FA 3QCWA 5FP8A 4U0YA 1HQWA 4RAYA 2YU3A 2GC1A 3OEAA 5H9QA 4ZDOA 3LEKA 3ZXSA 1OKRA 3PQKA 2VZQA 3TGNA 2M34A 3WCRA 5GPAA 2X5IC 3WOGA 3O1RA 4HSJA 1E0EA 4I6ZA 3OYGA 2VOKA 4RS5B 4Y1XA 2P3IA 4N9IA 3IUOA 2F6BA 3LL7A 2BQPA 2CY6A 1RL3A 2IEKA 5C5UA 3R4DB 2ESNA 2GP3A 3JRBA 1UCXA 4BJ0A 3GO5A 2W92A 2L7FP 2VTFA 5IYDJ 5SV5A 3N9NA 3MIEA 2DFHA 2IP2A 4XBQA 5FZIA 1LFUP 4BGDA 3R0RA 5K4LA 3MN2A 1D2SA 1LHNA 4IHXA 4L5EA 2HEOA 1ZRCA 4BDYA 4LUMA 1VBE3 2Y6FA 1JUIA 3WTTC 5K7PA 1U5TC 4KIBA 2C6YA 1LU1A 4L11A 1NG7A 4ZJZA 1QPMA 3ZSEA 3WE2A 4Q4X1 4DRVA 4A3CJ 1SFNA 4LD5A 3I3DA 4ORFA 3KETA 1J2XA 4RQPB 5E89A 3O7OA 1X1CA 4FFGA 3WNNA 1VBC3 5IVBA 2KIQA 2BZDA 2JDKA 4ISRA 4MQ9F 2A70A 5IFPA 1OA2A 3ZP5A 3K4DA 2XAFA 2ZB9A 3OUHA 3F21A 2FDIA 3RSNA 4BQ4A 1IG3A 5EV7A 2XWBB 4AZZA 1QJZA 3DKYA 2ZTNA 5K5RA 3DLLF 2RS13 2V9VA 4BY7J 4CDWB 3GWZA 3JD73 4PI0A 2MYSA 4TLGA 5BNOB 5ANNA 1RUG2 4L18B 2LKSA 1PVXA 4DY5A 1BBYA 2DU0A 4JQFA 2CMPA 4DBQA 3WNXA 2LF7A 1H4HA 3D6EA 4GH4A 4AHWA 2B39A 1AYM2 5FZLA 1IS6A 4Q0UA 3IIAA 4CEYC 1VQ9I 1C8M3 4J25A 2XXZA 1RITA 1IXRC 3KT7A 2FRHA 5FZKA 3K46A 3I0TA 2VQTA 3GX4X 4RHV2 3AKRA 4Z92B 2HKOA 4V19K 1CAUA 5BQTA 4GIQA 2XF5A 4CCNA 4U2AA 1H1IA 1KYWA 2NMOA 1P2FA 5HLHA 5IVCA 4YW7A 2IXKA 1F1ZA 4M6VA 2HWD2 2IFWA 3FFZA 4BHCA 2DDBA 3UGHA 4KT5C 2GXBA 4M6YA 3NNFA 3GJAA 4H2AA 2A07F 5HS8A 3LOCA 3FBIB 2W00A 5FMBA 2CWEA 4E7SA 3LIGA 3ITQA 4N43B 3MF9A 1IRFA 1UG0A 3TEDA 2LKPA 2DVFA 4R79A 4I01A 2P0WA 1QQP3 4CP2A 2VOXA 1LOFA 3TDUC 5IVYA 2TCTA 3I3LA 4F55A 3N7MA 2BGPA 5DS9A 4XRSA 1BI3A 4ESFA 1IGNA 2O8KA 1P7JA 3KB5A 1FPN1 3AFHA 3MD2A 2RHPA 4Y1YA 3POYA 3V0BA 3GW2A 3K10A 2VBBA 5F3EA 5B1BH 4TWTA 3JW4A 3ZMZA 3JAMZ 4PDKA 5AIPA 3ZFFA 1LE8A 3PURA 4KU7A 4AGVA 1MGTA 5J98B 1HRV1 3WW1A 2ZXHA 1F5JA 3UT0A 5CG9A 1POV3 3FXMA 2EICA 5F9TA 2HQNA 2VT3A 1XSVA 1QJU3 2Z3YA 3WG2A 4AL9A 5FZEA 4KISA 2ZAHA 4NAOA 2H0BA 1WKMA 2V79A 3I2FA 1DLLA 3O8GA 1KDKA 1CPMA 4CP9B 5FY8A 4XBNA 1QBJA 2YROA 2LY9A 3J80K 2EXKA 1IS4A 3IWFA 1VAVA 5FYZA 1IHMA 1LRHA 3NAUA 1J83A 1K12A 1NA1A 5JLXA 2VOTA 3ORJA 4P5YA 2DURA 4YGEA 2CUZA 1GZWB 4XN0A 2WO7A 1ENRA 5CG8A 3SZGA 5C3PA 4AFDA 2Z69A 1SBEA 3O3KA 4B3XA 2G19A 1WMXA 3MZYA 3S3NA 1OH4A 5GZGA 4IEWA 2P5KA 4XQDA 2DA6A 1U9OA 3PU3A 1S8NA 2IS2A 3W6VA 3DU5A 1RUH2 5A3LA 2HWF1 3FL7A 1DZRA 1WWYA 4XBLA 1WH7A 1GOFA 1VB2A 4QKDA 3VDAA 2RDNA 4P9UA 2RJKA 5K1YA 1KONA 4S2HA 3V4GA 1N1VA 3USSA 1B35A 2D45A 1BC8C 4BQ3A 2R1DA 1K45A 3H0DA 1CF7B 2VVDA 3M3CA 4DZGA 2WNEA 3ZMDA 3VZLA 4X8PA 2R4GA 1DQ1A 2I8DA 1UIKA 3OY9A 5FZAA 2DT5A 1POQA 3W20A 1PJRA 2A3XA 4CUCA 2K7LA 2M30A 1VZ0A 1S2BA 2LDUA 4AYBN 4NDLA 3LEMA 3V0AA 4W4ZA 3GTMJ 2LREA 1UXZA 3OYFA 4B29A 4ZS2A 1ZRDA 1QDOA 3GNEA 2IGOA 2KPMA 5B2GB 3TBIA 3VKOA 5DD8A 1PMIA 4C3JJ 3MFCA 2BNNA 3I4NJ 1STZA 1EJ9A 3OD0A 2HXOA 3NV1A 4QKBA 2BU9A 4G7OF 2R49A 2LKXA 3KZYA 2QBYB 1LGCA 2R0FA 1WGPA 1XS9A 4XJWA 2ZKZA 1OLRA 4EE2A 3UNGC 4HV6A 1F43A 1QHGA 1A34A 2NM1A 4XABA 3UESA 1V0AA 5ILVA 3TP0A 2P7VB 3U78A 3B00A 3SEPA 2W1SA 3FXRA 1UIJA 2ZGRA 4Y7NJ 4WVMB 4W6YA 1D3YA 1LHUA 1R71A 3ACFA 2IGKA 1RTVA 3GLXA 2W87A 5FGMA 3D5OA 2AYHA 1TT5B 2MD5A 5FD6A 2W08A 4NC8A 3KP4A 1APLC 4HSRA 3NRUA 5KHKA 4AHYA 3RNSA 2ZXQA 5M5YJ 2E6VA 2VCAA 1RUE3 4H4KC 3DCQA 4XCBA 1FY7A 4Y5TA 3TAYA 1RC9A 4BE2A 4LUKA 2MNGA 1CZVA 2HYFA 4OI2A 5LA1A 3BU0A 1IN6A 4R8HA 3GZAA 2NVXJ 4B4QA 3QPLA 1QJX1 3K4CA 3AZVA 4HOOA 5F08A 1U8RA 5K8SA 4EQVA 4AQTA 4BE1A 5C3SA 4E4HA 4OI4A 5JMOA 4AI8A 2RJLA 1BR2A 2DK8A 3UKGA 1SACA 4FOYA 4IXLA 4E2GA 1ETWA 4DBRA 2MC3A 4TN7A 1WJAA 1W8NA 1NQDA 1VF9A 2DBBA 2XJSA 1RUH1 5KHDA 5DYMA 3CUQC 2W24A 2KDOA 1EF4A 1LEMA 1POGA 4ZPIA 4AQ6A 4IEZA 2F4PA 4G7ZF 3EUHA 2VPRA 1KITA 1HLVA 2MH2A 3AJYA 5IAXA 3QOPA 3HTSB 1W6MA 1G86A 5FYUA 1JZ3A 1FOWA 3TW7A 2JA5J 2Y6LA 4LLFA 2QSFX 2PG4A 2HDWA 1KU3A 1W5CC 3G6EI 1R9TJ 2XJVA 1MBEA 4E7ZA 3ES1A 4MIMA 5JHFA 3H1YA 4EJRA 1QXPA 4RA0A 3R4SA 1X3UA 3ZN4A 5KXBA 4IHWA 3K0LA 5ILSA 1VBD2 1GFF2 1ZHFA 3JZVA 4WZFA 4LIVA 3HEFA 2HOTA 3K48A 4XZPA 3LAPA 1Z7S3 4IKFA 3SEZA 3OYKA 4OAZA 3JBG2 2VVFA 1IS5A 4DB5A 4ATEA