3LA2A

Crystal structure of ntca in complex with 2-oxoglutarate
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
196
structure length
196
Chain Sequence
VETFERNKTIFFPGDPAERVYFLLKGAVKLSRVYEAGEEITVALLRENSVFGVLSLLTGNKSDRFYHAVAFTPVELLSAPIEQVEQALKENPELSMLMLRGLSSRILQTEMMIETLAHRDMGSRLVSFLLILCRDFGVPCADGITIDLKLSHQAIAEAIGSTRVTVTRLLGDLREKKMISIHKKKITVHKPVTLSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Global nitrogen regulator
publication title Structural basis for the allosteric control of the global transcription factor NtcA by the nitrogen starvation signal 2-oxoglutarate.
pubmed doi rcsb
source organism Anabaena
molecule tags Transcription
total genus 55
structure length 196
sequence length 196
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3la2A02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3la2A01
2CFXA 3UKVA 3CUQA 1LB2A 2K02A 4IVNA 1DDNA 3QU6A 2UXXA 4AIHA 4J1WA 2QQBA 4IERA 2MLKA 1IPJA 4GULA 5CADA 3BJ6A 2DU9A 2FRHA 4PDKA 2Z2SB 3VHRA 1XGOA 3RIRA 4Z07A 4KU7A 5KBFA 2P7VB 3LAJA 4M71A 1IN5A 1PMIA 4XSXF 1QXRA 1FXZA 4EM2A 1ZH5A 2YPRA 3ZN1A 4H0EA 5KHHA 5J8CA 2RQPA 5JSRA 3NL1A 4EWDA 2XGXA 2DPDA 1R36A 2HGCA 1DP7P 1Z6TA 5AVPA 3L7WA 5ERIA 5LHHA 2E1NA 2GAUA 4RGRA 1YYVA 3HTUA 4O6JA 2EFNA 3MDPA 3VEPA 3WTSC 1SQ4A 4EMSA 3E5UA 3ROUA 4G6QA 5BOXA 1BI0A 4D7TA 2VN2A 2D2WA 2CO5A 1J75A 5D8LB 1B4AA 5HDNA 1YFUA 1X3UA 5TJJA 3IWZA 3GXOA 3V7CA 4M9XA 3Q9SA 2JPBA 2Y48A 5JR3A 1EYBA 2MA3A 2DFIA 3RPUA 1NHAA 4HF1A 4RD7A 2PN6A 4HOBA 1TNSA 4MGRA 1AWCA 5J6XA 2B9UA 3VB2A 2B8MA 1H1IA 2C0ZA 3ZMSA 4PIXA 1IN4A 3F23A 4U7BA 2IXLA 1U5TC 1FYLA 4EM1A 1GQHA 4AIJA 5I0UA 4L9VA 2ZO4A 2BNOA 4I02A 2G7HA 3HRSA 4KWJA 2BGCA 4F8AA 3ISPA 1P4WA 1I1SA 1FZPB 4QM8A 4IETA 4UXAA 2EFOA 4B29A 1LR5A 2XKPA 1GXPA 2HEOA 2NRAC 1X82A 4MGKE 5E1RA 2N7GA 3KP7A 1J1LA 3EETA 5EFUA 4MV2A 4MZUA 5FDBA 5D6EA 3EJKA 1O5LA 3IDBB 3LA7A 2CG4A 1UW8A 4CGZA 3L00A 3BWGA 2FE3A 3MZYA 1ZREA 2CW0F 4CICA 3K1NA 1I1GA 4PGGA 2OPKA 5E16A 3ES4A 3EBRA 1B1BA 2UZKA 2EFWA 3E6BA 3WG9A 1LEAA 4K8FA 6PAXA 5LRSA 3SHFA 3KZZA 3PQJA 2HR3A 2XAJA 4LG0B 2P17A 4I09A 2Q0OA 2FNPA 1GVJA 5LEJA 3UKNA 4J1XA 1SMYF 1Y0UA 5BQTA 3S0MA 1IXCA 1UHWA 3S7IA 4U0YA 1OI6A 5J8FA 2LDUA 5H20A 3PQKA 5JR7B 1IRGA 4ZYGA 3T8RA 4Z82A 3I4PA 4BHPA 1BC8C 4LUKA 4I98B 2HQRA 4M72A 2QDRA 2ZJ2A 4ZYEA 5I8SA 1ZZ9A 3WW4A 2X0LA 4G9YA 4XSZF 2VBXA 1QZZA 3GBFA 1U8RA 2HS5A 2K7LA 2PAKA 4B8XA 5T3NA 1YS6A 1XB4A 4ZZDA 3I64A 2EWNA 4EJTA 2D5FA 2GC3A 2PHDA 2O61A 2DAOA 2E7WA 3GVAA 1D8KA 3GZ5A 2HTSA 2KKOA 1HSJA 5CVJA 1HW5A 2FF4A 2W57A 2GC0A 1SMTA 3WW1A 1QY4A 2KIUA 2XUBA 1O5UA 4Q0PA 4XFCA 2CGPA 3BZ6A 3ECHA 1J3RA 1REPC 2H0VA 4YYOA 3BROA 2LNBA 3TQNA 1G6NA 1P2FA 2GXBA 1F9NA 2ZMEB 1KYWA 3ZDSA 5FQ0B 3HOTA 1RZ4A 2EJRA 5E17F 1LKNA 1ZZ7A 3U9GA 4BAYA 1A04A 3OF1A 3SXYA 2B5HA 4OU0A 4AVAA 3DL3A 4GXOA 4L9JA 5BXXA 3IBMA 5FLXZ 5I0RA 4P9UA 5HVQC 2XAHA 2OA2A 3WGGA 4IEPA 5L3FA 2QM3A 2JZYA 1NYWA 3FWEA 5FB2A 1U5TB 4JBAA 4ZZLA 3G7DA 5FLIA 3HT2A 2BYVE 3CTAA 5J3UA 3REOA 2ESHA 3QPHA 1NE4A 2L01A 3SZTA 1I27A 2M5WA 2QBYA 4WZCA 3IL2A 3BDDA 5J7MA 1DGRA 3R0AA 1HW1A 1T2KA 3I59B 1OYYA 2QUFA 5HS9A 2ATFA 5I0SA 1R1TA 5DD4A 3ZMUA 3HRMA 1EV7A 2AS5F 5L3BA 5DUKA 4M73A 2XKOA 4I0BA 3M8EA 1BI2A 1W7PD 5I8TA 4HX7A 2ZNYA 1IZ1A 4ZU5A 2CV6A 1O7FA 4ESJA 2XV4S 4EQQA 2VECA 3E6CC 2YX7A 2FU4A 3HHHA 2HJIA 4HVQA 3OGJA 4EV0A 1XGMA 3SFZA 4YNIA 4BIFA 3IWFA 3BPZA 1YW8A 1ZZ6A 3F8FA 4EJUA 3KP4A 2XASA 2IRFG 1PM7A 3FXUA 2O1QA 4M9ZA 2OQRA 4N0BA 2ET1A 1LDKB 2Q0AA 1ON1A 1STZA 2VOOA 1R5GA 1MDMB 1EY2A 4AVBA 1O4TA 2QVSB 1TTYA 2EA7A 4E70A 3WE3A 1SFNA 2GWRA 3J7AO 3NRVA 3VODA 4R1HA 5JVTA 4A6DA 2I45A 3J80Z 1XSDA 2D1VA 3ZPLA 3D82A 5DUIA 3HHGA 3RYPA 2RGVA 4JK1X 1UIJA 2OYZA 2R3SA 1FC3A 2KJCA 4HV5A 3R61A 3EHKA 2V79A 5LGUA 3I0TA 1UCXA 4RAYA 1PP7U 3GLXA 2F5FA 3MYXA 5CVVA 4EJOA 1H9TA 4PIZA 1T38A 3BY6A 5LGNA 4X6RB 4KDPA 5JSOA 3K1MA 4TLFA 5FQ0A 3RKWA 4QXKA 2NYXA 3QPTA 1WKMA 3MAJA 2XLGA 3KCCA 3O3KA 2VE9A 3GW2A 1OKRA 5BMZA 2KXLA 2VBWA 3NQOA 4O9EA 5BPDA 5FO5A 4L5IA 2A5YB 4P96A 5H6RA 1USSA 4RGSA 4LLNA 3EQEA 4DINB 1ZN2A 3E5QA 2FMYA 4KN7X 1U5TA 4UVBA 3LWFA 4HN1A 2M8EA 3T8TA 1AOYA 5LLQA 1MD0A 3KLNA 1FBUA 4Q0SA 4E2QA 5DYMA 2NAZA 1FBSA 4U0WA 2XLFA 4MUVA 4KMFA 2JSCA 5A2QK 2MH2A 3W6KB 2FSWA 1SEFA 5K8SA 3I59A 2YSRA 5E8GA 2UY8A 5DD8A 4UV8A 1S29A 5HI0A 5D4SA 4XF9A 2H27A 4O9GA 1KA8A 1QZYA 2BE5F 4HBLA 1ZG5A 1U78A 2F5DA 1LNWA 2K86A 3RNSA 1DPRA 5E20A 2UYAA 4OMZA 2PQQA 3ERED 5F64A 1I5ZA 3WTXC 4HYEA 1O57A 1IPKA 5D8KB 2HDCA 2K4BA 3P7NA 2FXAA 2XHKA 3FE5A 4Y17A 1LEBA 1DGWA 1TNTA 2WV0A 4K2EA 1XD7A 4L5JA 4O3MA 1OR7A 3L09A 4IEXA 2VC0A 3HT1A 4Q0VA 4ENNA 1YFXA 3DXJF 4UUVA 4YRDA 5HLIA 5D5WB 2JPCA 4NHJA 2MC3A 3EUHA 1G3TA 3ZQ7A 3I71A 2E7XA 3IRQA 1SAXA 1RTVA 4F7ZA 3F6VA 1MDMA 2DI3A 3FXRA 3LSTA 2IXHA 2W84A 1YLFA 4HF0A 2OU2A 1UD1A 2CQKA 1SFEA 3MWMA 1BC7C 3IKVA 3CL1A 3HYIA 4YIFA 1XE8A 2W24A 4A2UA 3HRUA 3RKXA 1YS7A 3QACA 2PJPA 3BCWA 4G7HF 1WI9A 4AXOA 2FBHA 2GXGA 3LQRA 1WSUA 3H7YA 1GHCA 4ZH4F 3TGNA 5ICCA 2ZFWA 4Q48A 2PBIA 4ESFA 3BALA 1JE8A 4AQ6A 2UXNA 1UIKA 1JHFA 3CJXA 1XE7A 2VOPA 3BU7A 4YFXF 1R7JA 3H8UA 2IA0A 1ZAOA 3NW4A 3CO7C 3OD0A 2GZWA 4IEUA 4KL1A 2EB7A 4UVCA 1LJ9A 1EP0A 3M7GA 4UXNA 3F72A 4I3PA 4ZU7A 5ILVA 5TRDA 1FNNA 2V09A 2IXKA 1NE6A 3HUGA 3C3WA 4U88A 1PP8F 1MJBA 2FOKA 5D5XB 3R0JA 1R1UA 4NB5A 2HOEA 1BJAA 3V4GA 1Z7UA 5FLXK 4ZYDA 2RKHA 2C6YA 1ONVA 1TW3A 1B59A 3WTUC 4EWAA 1CAWB 3RI4A 2OD5A 1K7AA 1C0WA 1CAXB 2DO7A 1OD5A 2V6CA 4HSLA 3LFKA 3FFQA 4YSFA 3ZN0A 2LSOA 1CAUB 3O2PE 4NQWA 1P92A 4KICA 3T1BA 4R79A 3K69A 1GQGA 5FPXA 4KIGA 4HBNA 3S2WA 4YFNF 4META 5HOOA 3I5UA 3IKTA 4XBFA 4LK0F 1YIOA 5IT3A 1YUDA 2DLLA 4HLTA 4UBGA 4I2OA 5ED4A 2Y0OA 2IA2A 2GIVA 2A6HF 5ILSA 5JSPA 1OYIA 2GA2A 4L0YB 2EVXA 1WWXA 5A2QZ 2XVCA 3ELKA 2QBYB 3GO5A 3HRTA 3SHRA 3UKTA 5LHGA 3FHZA 3MZHA 1LRHA 4WBBA 1F1ZA 1E17A 4D7SA 2STWA 5CVRA 4IEQA 2HYFA 4OOIA 1HKTA 3ZMZA 4E2GA 1PUEE 4MHGA 2STTA 4UVAA 1J2XA 4ENKA 2COMA 2Z5UA 2XAQA 5FLJA 5DV5A 2QQAA 5FCCA 5JCTA 3KP2A 5HS8A 4P9GA 4BHCA 1TW2A 2EV0A 2V1DA 3FXQA 3WTYC 3F8CA 1JUHA 5D5UB 3ZP5A 3J80K 4QGLA 1SFXA 1VP6A 1MKMA 1EPZA 2VONA 5JFRA 3KSCA 3DP7A 2JTVA 3D0SA 4XLNF 5D5VB 4FT8A 5AIQA 3FM3A 4U7DA 1IN6A 5E8IA 4Q5SF 1W5SA 4WX9A 1YLLA 3CUOA 2RV8A 1QNTA 3RPQA 3HOSA 5H6QA 3DFGA 3MQ0A 4XF4A 5JAXA 4OIQF 2HWVA 3I54A 4ONUA 3SQNA 3LAGA 3EO6A 5E1XA 1FY7A 2EK5A 3CUQC 1YG2A 2UWMA 1Z05A 1G4DA 1WA4A 3HQXA 4LULA 3NEUA 3CEWA 5LHIA 2G9WA 4IHSA 1ZYRF 2HQNA 2M87A 4HN0A 4YARA 3M8FA 2V9VA 3CDHA 2HZTA 4ESBA 3WODF 3K0LA 1QGPA 3ZMVA 4HLYA 3FJSA 3NKTA 3FHIB 3AAFA 1BIBA 4CYDA 1Z91A 4IF4A 4HDVA 2VQAA 2DT5A 1CGPA 4I01A 1CAWA 4B09A 2CAVA 1IN7A 1LDDA 2NNYA 1TQ5A 2IVMA 2K9ZA 2WC2A 3SCFA 1CF7B 4Z2YA 3O14A 1CAXA 1ZLJA 1LDJA 2BBYA 1Y9QA 1L0OC 1SFUA 3GZ6A 3TO6A 1ZVFA 1U6GA 1CAUA 3V8LA 4HVOA 3GFJA 5K5QA 4JQFA 2QVOA 5KHJA 1LQ1A 1ZARA 3H50A 2B0LA 4IEWA 3C1DA 1MJAA 3B73A 1IN8A 2VE8A 1RL3A 3KEQA 1RIOH 3GEZA 3U11A 1X8MA 2Z33A 1BI1A 2D40A 1O7LA 3TNPB 4CDGA 4MGIE 2IJLA 1IAWA 2GH2A 4QWQA 2HFHA 3FZVA 5AONA 4MNUA 2Q2EA 3P9IA 2BNNA 3GYDA 3SCHA 1Q1HA 5KK1A 4XEZA 4QGMA 2QCSB 1WGPA 2LF8A 4OINF 1O3RA 3E97A 4AVPA 3GFIA 4H7LA 4L2NA 3ACLA 1UHMA 2F5CA 1ZRRA 1W7PB 4LJZF 2OBPA 3HSEA 4IRHA 4BNCA 2HKOA 2PI0A 2NS0A 1ZHFA 4P55A 3OV8A 4RGUA 1TQIA 4BYYA 3IDCB 4L11A 2Q1ZB 2XIGA 1SD4A 4RB0A 1FP1D 3OOPA 4N9IA 4WXDA 2PMUA 1B9NA 4WF2A 1YFYA 4XETA 3BPXA 1Z9CA 1FYKA 2XL7A 2H94A 2A68F 2BV6A 2P5LC 3DEUA 3IIAA 2RDPA 1Q3EA 5BPXA 3G3ZA 3KP6A 1S8NA 3GFMA 2FEZA 5KHGA 4KIBA 1HW2A 3V8JA 5CU1A 2D5HA 5AIPA 3RYRA 4DNCA 3KETA 3WGHA 3J81Z 4XF3A 3BJAA 4HMZA 3KP5A 3FX3A 4LEJA 3LAPA 2DQLA 2ZKZA 1DZTA 5FD6A 4EGYA 2ACJA 1YWKA 1RGSA 4ENMA 3OCPA 3R60A 1R1VA 3USSA 1OFNA 1ODDA 4S05A 3F3XA 4LLOA 3TO9A 5FPZA 2ET7A 1RC6A 1FOKA 3ST7A 3ZMTA 3K1PA 1ZX5A 2LF7A 2VODA 4A12A 2VBZA 4OIRF 1HQCA 3QU3A 3KGZA 4WVZA 5BV6A 5LBQA 4FBFA 4L0ZB 2ETHA 5FD5A 2PFBA 5LEKA 5K5RA 1YFHA 3WGIA 4ASNA 1YHFA 4LB5A 3PNAA 1CF7A 3QP6A 4M9SA 5BY5A 2QNKA 1FBQA 1ZRFA 3SMHA 2HTJA 1HBXG 1JXSA 1P4AA 5HDKA 3ES1A 3WU0A 4A0YA 3H92A 4Q47A 1P4XA 4RB2C 4MX3A 1RUOA 1U12A 4BHBA 1G3SA 3G73A 3E6MA 4UNOA 1Y3TA 5F1RA 1B6AA 1QO0D 4A0ZA 3JSPA 4EWEA 1XSXA 3ABTA 4IPAA 1K6OA 2MNGA 1ZRCA 5KHIA 4FX0A 3CLPA 3DN7A 2QLZA 3U0ZA 5K1YA 2HKXA 1JHHA 1J3PA 3C7JA 2IXIA 4HVRA 4LMYA 4AQ2A 2R7DA 4UHTA 3K2ZA 1WRJA 5JHUA 3ECOA 1ZZCA 2ADUA 3JAMZ 2TDXA 4QM9A 4IEZA 1D3YA 4MTEA 3WTTC 1H1MA 2PG4A 4I7HA 1W7PA 1J59A 3DKWA 2IW5A 3TNQA 2ELHA 4ORFA 2MPFA 3F6OA 1IW7F 4L9TA 2W85A 1O3SA 1WQ2A 3M3IA 1YO5C 1QWRA 1FPQA 1MGTA 4G94A 4AIKA 3GF2A 2UY9A 3BPVA 2QYOA 3EDPA 3DPTA 3H7JA 2L4AA 1QXJA 1UCRA 3JSOA 5KVRA 3FMRA 3RDIA 3TO7A 2R7FA 2QJVA 2ETEA 1SD6A 2A3SA 4PCQA 2O8XA 5HLHA 3JTGA 4WK8F 1XCBA 4OLLA 2PEXA 4HQEA 1B9MA 1XCVA 1Q5OA 3L9FA 4BQAA 2DTRA 3VFZA 1X7NA 1FP2A 3ML6A 1HXDA 1XDSA 2J5OA 2D93A 1S3JA 1EH7A 3WTZA 1IXSB 5FFZA 5DDGA 2Y75A 2EA4A 4XFFA 3JW4A 5IT9K 5DCMA 4XRFA 3D0JA 3KFWX 3HSFA 4HAMA 4HZFA 4XFAA 4ZYHA 4U0VA 4M6XA 5HDGA 1T98A 5BPIA 4KA4A 4IHTA 1K78B 4IJAA 3WW3A 3L2HA 3DPLC 5HS7A 3LZZA 3BJOA 4WXHA 3C18A 1R00A 2YX4A 4EGZA 3HSRA 2FQPA 4KIFA 1T0FA 2PYTA 3MPBA 4QX5A 3Q5FA 2OQGA 1G3YA 4EROA 4GYIA 2KIMA 2Z9OA 3MEXA 4RS8A 2ISZA 4HX4A 3P9CA 2IPQX 3WTVC 1HSTA 1ZGJA 3ETQA 5FLHA 1J7KA 4A0XA 4PJYA 5DCFA 2M30A 4IRGA 2RNJA 1F4KA 3KMHA 5E1ZB 4BXUA 1VR3A 2DW4A 3RYKA 2YU3A 3RJPA 2A07F 2W25A 1HKSA 5D4RA 2PAMA 1BIAA 3H3UA 3GYHX 1J58A 2GU9A 3H1WA 3N97A 4HLXA 2WTEA 2P7CB 2P4WA 1YW9A 2FBKA 1SD7A 1KQ8A 2CAUA 1FT9A 2MBFA 4PZJA 2LKPA 2DK5A 3COAC 1ZRDA 4HA8A 1YW7A 1ZNPA 2PTMA 4CZZA 3E5XA 5I93A 5F6FA 4LD5A 3QP5A 3ULQB 3RTRA 1FWZA 3TOAA 2PLYA 3PLQA 4P5OA 1P6RA 4YG2F 1KU9A 1USTA 4LA3A 2EFQA 2IT0A 4RB1A 2Q4SA 4LFUA 2VT3A 4LB6B 3TDZC 4ENJA 3S7EA 1UPIA 1S7AA 3E6DA 4P9FA 3PVBB 5I91A 2GC1A 2DCTA 1XSVA 1OPCA 3BOQA 5FFXA 2O03A 4KFCA 4HDUA 1H9GA 2JRTA 1V4RA 2EV5A 3GX4X 3M9AA 4TV7A 1R22A 1OMIA 2EV6A 2AXLA 2Z3YA 2VBYA 1ZG1A 1TQPA 2ESNA 2A61A 3LOIA 1KYZA 3I53A 3F8BA 5LGTA 1R23A 4UV9A 3QOPA 1Z1DA 2G7UA 3DQVC 2K0GA 2PMHA 3KLOA 2F5EA 1QBJA 3J81K 2ZKLA 3SCGA 5DEQA 1H0MA 1R58A 2Q30A 4FAGA 2P6TA 5EZWA 4PGHA 4NVPA 4A6EA 2WWYA 4EJVA 4N9HA 2OAZA 4XFIA 2XAFA 4OIOF 1W5TA 5L3DA 4HQMA 1K78A 4ETSA 2XLAA 3QAHA 2A69F 1CAVB 3R6SA 2GC2A 4MTDA 3CLOA 3MFKA 3ZMDA 4LLGF 2XAGA 2YR2A 1KGSA 1FLIA 1J3QA 1EH8A 4CXFA 3D5LA 2KIFA 1V70A 3F21A 2L54A 5I0TA 2EFPA 4O5VA 1T6SA 4JV4A 4RGXA 1XGSA 4GYGA 1ZLKA 3KGLA 5IT9Z 5JI6A 1LVAA 1I6XA 1ZZ8A 4CO8A 2QZ8A 2BEOA 1KQ9A 2FQ3A 5L3CA 1IRFA 1S7OA 1J0RA 3ELNA 2RN7A 1R5HA 3TOBA 3LQQA 1L3JA 3QRFF 4KWLA 1ULYA 4MGZE 4YFKF 1Q43A 2VXZA 4IRIA 3NSTA 4G6DA 2D45A 4XF0A 2MH9A 2XROA 3WTWC 1TQMA 4HV6A 1V3FA 1RI7A 4KMUX 2ISYA 4MEYF 4Q4ZF 3NJZA 4LA2A 1QPMA 1UFMA 2O8QA 3LA3A 3E3VA 3CF6E 1J9IA 2H6BA 1YFWA 2Z69A 4KU8A 3V7SA 1D5VA 4A5MA 4QGNA 3JAMK 2P5VA 3ABUA 2CSOA 3U1DA 4R8HA 4XLPF 4IEYA 1KU7A 4RB3C 2IC1A 4KNYA 5EEGA 3T0YA 4LTAA 2GA1A 1HKQA 3WW2A 5BS6A 4JTOA 2FNAA 4QMAA 4LLLA 3U2RA 4MH0E 3JTHA 5CVIA 2L02A 4LK1F 2CWEA 2KRFA 4WWCA 1MZBA 1L3LA 1KU3A 3JZVA 4KYWA 1JGSA 4X6QB 5ICGA 3I58A 1G3WA 3H3ZA 3P9KA 5EEHA 3TKYA 1NZCA 3U10A 5CYVA 1BN5A 4ON0A 1T39A 1S6LA 4KN4X 4R52A 3B02A 2PFWA 4XFGA 4MGYE 4FX4A 3HTSB 3CO2A 3FF5A 1DZRA 4G8XA 2GQQA 2L3DA 1IXRC 5E1WA 1WLTA 3T5XA 2JT1A 2F2EA 2XRNA 4LGWA 4XFBA 2ZCWA 2MLGA 2K4JA 2OZJA 1RUNA 2DK8A 3L2CA 3F8MA 3RZZA 4OMYA 1J5YA 3IRRA 3VOEA 3FZ3A 3WE2A 3GUDA 5E18F 1FSEA 4GCVA 1CAVA 3NVCA 4LG0A 2FA5A 3LA2A 4RAZA 1PDNC 5L3GA 5C6CA 2EAAA 1F5TA 2J5PA 2IXCA 2M1BA 2MHFA 3SXWA 1DUXC 3BP8A 3V7RA 4KT5C 2P5KA 4A5NA 5J48A 4Q0UA 2PAEA 1W4MA 4KWKA 4XFHA 2QENA 4S04A 1FI2A 2V1UA 3TDUC 4CHUA 5DCMB 2ZBKA 4GO1A 1SD5A 3RKYA 1OYWA 2O6GE 2V1XA 2EA2A 4HW0A 4Q0QA 4AD9A 1ZZBA 3IHUA 2DPUA 2IXJA 1U3EM 4EM0B 1CX4A 1U2WA 2ZNZA 1O3QA 4G7OF 4IEOA 3CUQB 3DV8A 4BH9A 3CJNA 4E2SA 3F8NA 1XRUA 1MJ9A 3OTFA 5HLGA 3PFIA 5I8YA 1GXQA 3WU1B 2WFPA 1E2XA 2IA1A 1RNLA 4JVAA 4G7ZF 5L3EA 4MQ9F 2VPVA 4GGGA 1QQIA 5ICFA 3O6BB 2H09A 1Z6RA 3LWCA 4JTNA 2CYYA 2DBBA 4PIYA 4AVCA 2RC4A 4HSJA 2OZ6A 2OA4A 1FYMA 5D6FA 4FAHA 2PQ8A 4IEVA 2ZMEA 3EQLF 1BM9A 1X8EA 3SZPA 5C8WA 3V8KA 3M1EA 3C3VA 2O3FA 4XF1A 2FBIA 4Y13A 5CJ9A 2VC1A 1TLHB 3H9AA 3H1YA 4L9NA 1D8JA 4EJWA 2F4PA 2Q8KA 5ICEA 2XL9A 4QLCU 3I7DA 5BUVA 4D0PA 1VTNC 1KQ0A 3HIFA 4IESA 2O0YA 5D1IA 3EYYA 1UB9A 2X4HA 1YTYA 3EYIA 4Q29A 1KU2A 4YIIA 1ZG3A 2UYBA 4KUMA 2KJBA 4Y15A 4WCGA 4L18B 4MEXF 5K5OA 3IC7A 4UBHA 5ILUA 2P6SA 3FM5A 2ZXJA 1VJ2A 4ZU4A 1XN7A 4I0AA 3N4MA 4HX8A 3KZYA 2L4MA 3GFLA 3Q9VA 3R4KA 4M74A 1K79A 3M70A 3GWZA 4IXAA 2HYGD 4WXCA 3BB6A 3FMSA 2E9QA 1O3TA 5CLSA 1TBXA 1BBYA 3KE2A 4MQVA 1XDUA 2H6CA 4DQ2A 1FX7A 1NXMA 1BI3A 1XMAA 3K9TA 2RVCA 5LRRA 2E1CA 2FMLA 3KEOA 1EH6A 5KHKA 2D1HA 4AWXB 3FMQA 2K27A 4OFGA 2BNMA 1FSHA 1DPUA 1IUYA 4FHTA 2Y0MA 1IF1A 1ZGAA 2M45A 2P8TA 3KP3A 1ON2A 3CO6C 2Z99A 1XGNA 3MCZA 4EVIA 2MD5A 2OZUA 4M6YA 3H1MA 2A6EF 3W6JB 2QQ9A 5CVUA 2IP2A 2DQRA 4HF2A 2PHLA 3F22A 2NNNA 3DF8A 2PA7A 5FGMA 1YQAA 4OIPF 4LUMA 1XMKA 2VT2A 1BOAA 2QWWA
chains in the Genus database with same CATH superfamily
4IVNA 1UG0A 2UXXA 2L9LA 4AIHA 4J1WA 5E88A 3HN1A 1DU6A 2DT6A 3S1MJ 3I8TA 3BJ6A 1C4RA 2DU9A 4NO4A 3VHRA 1XGOA 3BZKA 4KU7A 5F32A 5FZKA 4M6VA 1PMIA 1DBNA 4XSXF 4K21A 4EM2A 2VCAA 1RUG1 1UQXA 4CU7A 5J8CA 2XGXA 4BUPA 4FTHA 2HGCA 2VJJA 4E7KA 1NY72 2W0XA 4ZJZA 5FKCA 1Z6TA 3L7WA 4RGRA 2KHMA 1W36D 3VEPA 3FISA 4UFHA 1SACA 3EPZA 4AEJA 2VN2A 3K4ZA 2CO5A 2WNVA 2J1EA 1YFUA 1YQCA 3TB0A 1JKQC 2JB8A 4XUNA 5JR3A 1NHAA 2F4LA 3Q8AA 4JX5A 2PJRB 1UZZA 2F6BA 3ERMA 3VB2A 5ACA3 2B8MA 1H1IA 2C0ZA 2R1BA 4PIXA 3R05A 3VHPA 3F9KA 2JD4A 1HB4A 5LWBA 1ETYA 4NIHA 1D0HA 1GQHA 2AENA 3CNAA 2BW3B 1HXS3 4IV3B 3KYDB 4DZPA 2ADEA 2BGCA 1WJ5A 2WB1A 4F8AA 4RYDA 2EZLA 2GNMA 1XSQA 3FFZA 4UXAA 4UUSB 4B29A 4DXZA 2HEOA 4M3DA 1GXPA 3BUCA 2Y69H 2J1UA 5E1RA 1JXNA 1OCTC 3KQRA 3IDBB 4CGZA 2A5ZA 4BJ0A 1HKDA 1I9RA 1D0YA 1ZREA 1AX1A 4W6WA 4RAFA 4MGSA 2LROA 5HXVA 3M3OA 1Z0XA 2W68A 2UZKA 2BU9A 4AEDA 3E6BA 2RS33 1NLSA 1QJY3 1RJ7A 1JHNA 1OF4A 5LRSA 2LW8A 1CN1A 5BNOC 4OMDA 2XQXA 3SHFA 3FXLA 3F2ZA 1UY1A 2E32A 2W1SA 1U5XA 2YMZA 2QGUA 2P17A 4ZONA 4QWNA 2Q0OA 2FNPA 1NKGA 1GUUA 1SLAA 5LEJA 4J1XA 1SMYF 1D5YA 2KM2A 3HOVJ 3NKGA 4BLIA 3IB3A 3POIA 3WDVA 2HWB3 2JA7J 3OYGA 2QZ2A 4U0YA 1VLNA 1OI6A 5H20A 3PQKA 2A6VA 5GM0A 3ENRA 2Z16A 3OIQA 1WCMJ 3T0BA 1CPNA 1BC8C 5FRMA 4LUKA 2VVDA 2CJJA 1OD3A 3A0KA 1YRZA 1SLIA 3OYIA 3HOXJ 2QDRA 4NC6A 5I8SA 1ZZ9A 3KV9A 3WW4A 4G9YA 4IQ4A 4NN0A 5K7PA 3AX4A 1X2NA 2VBXA 3POGA 1QZZA 1SVMA 2WS92 3HEFA 3AK0A 1VQOI 3E1F1 5HXMA 4EJTA 4Q4W1 4AI2A 3VYSB 4XKWA 1REFA 1T0FC 2VASA 2DAOA 1PIV1 2Y8KA 3CDZB 5G04L 1NCQB 2GC0A 5KXBA 3WW1A 1XOYA 4HKOA 3BG9A 2KIUA 5A7QA 2XUBA 2Q8CA 3LFMA 5JOYA 4IHXA 1RUH3 3TQNA 4IQJA 1P2FA 3Q0WA 2KDZA 1F9NA 3AG3H 3B00A 1MBHA 3HOTA 1XE0A 5E17F 1H2LA 1HRI1 4BAYA 1A04A 4OUMA 2B5HA 2Y6FA 1DQ0A 1BBT2 4GXOA 5T5JA 3IBMA 4AHWA 4LK7A 5J4YA 4IEPA 4FE4A 3CF2A 3DPRC 5IK5A 1MMGA 3FWEA 3CMEI 3RQ4A 1I3HA 1FIAA 3HT2A 3CTAA 2R6QA 3QPHA 1NE4A 1I27A 4WZCA 3BDDA 2ZSIB 2KIQA 3R0AA 1UOJA 3TWIA 2ECBA 2V7FA 5HS9A 5IYYA 3LSEA 1GV9A 3WCSA 5JMOA 3ZMUA 4X0GA 3BTXA 3NQHA 4M73A 2XKOA 3M8EA 1BI2A 4HX7A 4TWTA 2ZNYA 5JPMB 4C9YA 1O7FA 3PFYA 3DECA 3WG2A 5DAVA 5DAPA 1LOGA 3OGJA 4OAZA 4EV0A 4AUXA 4RA2A 1AR82 3SFZA 1F36A 1T6GC 4F55A 1PO21 5FZHA 1C8M3 4K20A 4QPIB 2ZGLA 1T6BX 3VD9A 3S5AA 4DZJA 3GJAA 5KC5A 2BVVA 5E6HA 3N9QA 4BJ5C 1LDKB 2Q0AA 4D7MA 2CMPA 2VOOA 1MDMB 4LG3A 1URXA 3B93A 5J47A 4CSWA 3WE3A 1OQDA 1SFNA 2WAFA 4HPKA 4BE1A 3LSKA 5JVTA 4HOOA 3J80Z 1E57A 4F3JA 2IUWA 4AG4A 4IL7A 4JK1X 4LHSA 1OLTA 3K4LA 1GYKA 5KWRA 4AI0A 5LGUA 4CXWA 4IGOA 2XDVA 4KT6A 3GLXA 1GOGA 4XIKA 3MYXA 1H9TA 2VQGA 5DABA 4C8DA 2D3PA 4PIZA 5IY5H 4X6RB 4KDPA 5DN2A 2DFBA 3SKJE 5A6YA 1WBLA 2A6XA 5FQ0A 1MS1A 2RR12 4QXKA 2W52A 4ZC3A 2R49A 3QPTA 3ZOBA 1WH7A 1SFKA 3MAJA 3ALQA 2RDNA 2XLGA 5DDJ3 4LPLA 3TL4X 4Q4V1 3MKZA 3O3KA 2VE9A 3IPVA 1IHMA 1OKRA 5BMZA 3ACIA 3NQOA 2WV1A 3GM8A 1YE9A 3QOEA 1USSA 4RGSA 3EQEA 3E5QA 2FMYA 2K2SA 1T33A 3T8TA 1AOYA 3HOUJ 5IOYA 5H9PA 5J37A 1HLCA 2W94A 4M3GA 2NAZA 3LL7A 2FOWA 3LNQA 1NXD1 1NLRA 1RXGA 4D3WA 1X4PA 1UXZA 5K8SA 2HYJA 4DXSA 3Q8CA 2ID4A 1JHJA 1S29A 5D4SA 2MD0A 2UWCA 3CIHA 1JYVA 2JDUA 4HBLA 2A73B 3P6BA 2ZPXA 3U1KA 2K86A 1DPRA 5E20A 1RRJA 5F64A 1A8MA 1L7RA 1Q8PA 5BNOA 1XPXA 1IPKA 5FP3A 2ZS6B 1K5MC 2K4BA 3P7NA 2QF7A 4P1WA 2W2IA 3GCXA 3H3LA 3I2OA 2EIGA 2WAQN 1XD7A 1AYN1 4XJ8A 4UUVA 4AM3A 4NHJA 2LY1A 3EUHA 3LCPA 2B9SA 1SC7A 3T2TA 1RTVA 3DU6A 1FMWA 4D0QA 3H8RA 2IS1A 1MPXA 3KZ4C 1YLFA 4HF0A 2AQEA 2R7WA 2DYRH 1BC7C 4PQ9A 4I6ZA 4FFIA 2OC6A 4A6SA 5CFCB 2C1FA 4FOYA 2QQKA 3BCWA 2WNUC 4G7HF 4AXOA 2AQFA 2FBHA 4LORA 5FZDA 2WA0A 1V55H 4ZH4F 4UFLA 2BERA 1W6OB 5FJHA 4Q48A 5GTHC 2PBIA 4XUPA 4A3MJ 1JZ7A 3ZXAC 1D1CA 5HNFA 1UIKA 4EYUA 3IN9A 4YW6A 3AM2A 1TME2 5FUPA 3CJXA 2Q8OA 1FJLA 2VOPA 3BU7A 3PTYA 1I3AA 1ZAOA 3CO7C 4KL1A 2EB7A 3AC0A 4Q8LA 1SVLA 3ZSMA 4DFSA 3LIGA 4UXNA 2VUCA 1OUXA 5ILVA 1QJFA 3H5RA 2D6LX 4YLZA 4MVTA 1NE6A 4QQHA 4CP1A 2F5VA 2FOKA 5D5XB 3R0JA 1NH3A 1LNSA 4NB5A 2HOEA 1TG7A 3V4GA 3A02A 2RKHA 1LUJB 4V2FA 1B35A 1B59A 3WTUC 2EIJH 5E3OA 1CAWB 1Y6IA 3NJVA 1C0WA 1W8OA 2MEV1 1QRYA 2V6CA 1RXFA 3MI8A 1CAUB 1W06A 3DPRA 5L19A 4DYRA 4KICA 3NJYA 1VB4A 3PUBA 2E35A 2PHXA 4AFAA 5DAQA 3A22A 5FPXA 2P37A 3SDBA 5F3GA 4YFNF 5FP8A 5HOOA 3IKTA 4XQDA 3QH6A 2M0MA 5BNQA 4AHYA 3OYFA 5FZGA 1YUDA 1BVP1 3PU8A 4UBGA 1W6PB 5ED4A 1S0FA 2GIVA 4LBQD 3WR0A 5FKOA 5FZ3A 1W0TA 4L0YB 1WZXA 2C9KA 5FV3A 2EVXA 3FK6A 2XVCA 4FPEA 1F8VA 3GXUA 4RS5B 4GH4A 1MZ6A 5LHGA 2TCTA 3FHZA 5L9BA 1LRHA 1V0AA 3P3PA 3ZKUA 1W6MA 4M00A 1QJX2 2E63A 4PLNA 3HM5A 2VB6A 1ASJ1 5CVRA 3RCOA 4K6BA 4Q1RA 1LU2A 1KJLA 1RETA 2VTXA 1LHNA 2BHYA 2QQAA 2QSFX 2VZOA 4XHBA 3KZIC 4TN7A 1TP4A 1X19A 5HS8A 4P9GA 4B48A 2EV0A 2DA4A 1APNA 3ZYFA 2FCUA 3F8CA 1JUHA 5LA0A 4AQTA 5D5UB 3J80K 1LESA 1VP6A 1EPZA 3TP0A 2W1UA 3UGFA 3DP7A 3G1OA 2JDNA 4Q4W3 2AEZA 4FT8A 2E1MC 4U7DA 3AFKA 5E8IA 2F4IA 1PIV3 2WYFA 3L2RA 4WX9A 3LE0A 4YZ1A 2JDZA 3CUOA 1FATA 4QX0A 4Y26A 4OHVA 2Y0IA 1HN1A 3DFGA 4FCAA 4OIQF 2HWVA 2P34A 3LAGA 3SH4A 1FY7A 2EK5A 1W2UA 1W6NA 2CW7A 3MVPA 2UWMA 2XPWA 3MIDA 1X9TA 3THPA 2ZX0A 2G9WA 5CIRA 5L7OC 1US2A 4C2TA 4DY5A 2DTYA 4RDUA 3ZMVA 2QQLA 3FHIB 1BIBA 3TN93 1VMHA 3A2KA 3DBHB 4HDVA 5C8CC 2DT5A 1CGPA 5KXCA 3HBLA 2CAVA 1IN7A 1LDDA 4GAZA 1TQ5A 2JG8C 1FNYA 4PCRA 4WM7A 3VHOA 9ANTA 5GLTA 2BBYA 1SFUA 3JD72 4ZS2A 1ZRIA 5JI9A 2XXZA 4P9WA 1XJAA 1Y1WJ 2TNFA 3TEDA 5DUUA 1ZARA 3C1DA 4KMQA 4OVEA 1DP0A 2DTWA 4TLGA 1X8MA 2Z33A 2A3YA 1BI1A 3DKYA 1O7LA 2A6YA 4CDGA 4BOWA 2IJLA 1QPIA 2W47A 1DQ6A 3BCBA 4QWQA 1FTTA 5FBZA 3ZFEA 5FXWA 3TOJA 4A7ZA 2LKXA 5C3RA 1H2KA 1X3WB 1Z3XA 1XBFA 4FPJA 4QGMA 2QCSB 1TWHJ 1CR7A 3M4FA 1VMFA 1YNAA 3N9MA 4H7LA 4L2NA 2QSHX 4W50A 1ND2B 1W7PB 2LREA 1WCKA 4DBQA 2EZHA 1BR4A 3B9CA 2ZGPA 3PVNA 3AYDA 3VB9A 1K5MA 2V6EA 5IJRA 5J1YA 1TMF1 4EN6B 1W2NA 3OV8A 5ABJB 1PO23 4QX8A 3M3YJ 4BYYA 2WFF2 1Y0NA 4L11A 2Q1ZB 4WXDA 1SD4A 2DA2A 4WF2A 4XETA 1Z9CA 4BPZA 1ZBA2 1G9BA 4BY7J 1IDYA 3S15J 4AVSA 1D1BA 5JLVA 2P5LC 3DEUA 2RDPA 3VZKA 1LHWA 1HDDC 3AJZA 4JCKA 1B8IA 3BR5A 2ZTNA 4XF3A 3LAPA 4JRLA 2WNUA 5GTIC 4ZXKA 2K85A 1BCXA 1SCSA 5C44J 4ENMA 1R1VA 1JU3A 1PZ9A 2DUOA 2V9PA 2ET7A 4E7JA 1RC6A 2ZC2A 1WPKA 1WJFA 1XMXA 3W6VA 1MH4A 3QLQA 5CISA 4J25A 1ZX5A 2VE1A 3I3LA 3NV1A 3MKWB 2VODA 3I3BA 4A12A 1QJZA 5FO8B 2JA6J 1HQCA 4GWIA 2ETHA 1IQDC 2WZR2 3RKQA 5K5RA 4CP2A 2JDHA 1KJRA 2IGKA 5C9AC 4Q4V3 1YHFA 3I2GA 4IE6A 4M3CB 3I2KA 2QNKA 5CA6A 3BTIA 3C7FA 3SMHA 1ULFA 3HQRA 5HDKA 3ES1A 2WL1A 2I74A 4QDRA 2HXOA 4RB2C 4II2A 2B4KA 4UW6A 1MZ5A 4BZ4A 5F1RA 1QO0D 2OKXA 3JSPA 3CP2A 4DEQA 5AFEA 2VOWA 2WLQA 4IPAA 4PI0A 2QLZA 3IH3A 3D5RC 5F5CA 2C5DA 4HVRA 3C7JA 3POFA 4YG6A 5LB6A 4ZZ5A 1FX5A 2JVGA 2YG0A 2L7ZA 1H6XA 5FY5A 2K40A 4AQ2A 5FZBA 5LK5A 1WRJA 3I55I 1JMUB 4XUQA 2JX9A 1APLC 4AVVA 4K1YA 1X58A 4IEZA 1H1MA 3X29B 3DKWA 2IW5A 5FYHA 2ELHA 4IE7A 1N3OA 2CV0A 2XB5A 2YC4A 4N53B 4ZKTB 4OI0A 1V6IA 1A8DA 1Q1VA 2KPMA 1O6UA 3EDPA 4R9BA 4BQ5A 3OYMA 1AYN3 2E60A 1PX4A 3RQIA 5KVRA 3VBUA 1QXPA 5FZ1A 2R7TA 5J40A 1TEIA 2QJVA 2WN3A 1MQTC 4PDWB 1OLQA 3CJIB 4AE2A 2O8XA 3VKMA 1NCRC 4FETA 4RHV3 2OUMA 3G1MA 3CBNA 4NHMA 5FYSA 4BB3A 1RYYA 3RZGA 2DDUA 4BQAA 2DTRA 1HXDA 1XDSA 4PLMA 4GWMA 2HWC2 1IXSB 2FBEA 5DDGA 4XMAA 4UW3A 1XXNA 1PVC1 3JW4A 5IT9K 5DCMA 1N1TA 2W1WA 1MS9A 3E1SA 4XFAA 4ZYHA 3PHMA 4CEWB 1T98A 4XE9A 3DPLC 2YXSA 3BYWA 4LOCA 1R00A 2YX4A 4KIFA 1C5IA 4QB6A 3ZQQA 4QX5A 2JE9A 4EN0A 4EROA 2KIMA 5L7OA 2ISZA 5FPLA 2IPQX 2E31A 2UV1A 2Y6LA 3WT3A 2WSUA 5M0TA 1HSTA 5FLHA 2JIGA 1J7KA 2KFDA 4PJYA 5FO7B 5DCFA 2VW0A 2JG8A 4BXUA 1DLLA 1EF4A 3LGRA 2MEV3 2QDNA 1HKSA 3ZR8X 2LD5A 2ZHNA 3BPSA 3H3UA 4LBKA 3RG0A 2KR2A 1WD4A 2P4WA 4Y1XA 3MLJA 2FBKA 4IL6C 1FT9A 4RMNA 2IS2A 5FREA 1OLME 1AR61 1KDKA 1XNDA 1YW7A 1ENRA 2ZMEC 1ZNPA 4G3YC 4KNCA 2FDHA 5I93A 2VTXJ 3PO2J 2RDQA 3U14A 2RS52 2R061 1H4GA 5T5LA 4YG2F 2R1DA 2HQ5A 1IKQA 3SKVA 5FPUA 2XVGA 4OQ9A 4E8CA 2LKSA 4LB6B 4C3HJ 4Q5OA 1V6OA 3TDZC 5A3NA 4FVVA 2WNEA 3E6DA 3PVBB 4L99A 2DMPA 1JUSA 5GZEA 2DCTA 3BOQA 1XSVA 5FFXA 3O1UA 1O8PA 4XIDA 5FY9A 3JRHA 1OMIA 1ASJ3 1W0PA 1LHUA 3WNXA 1UYXA 5IPAA 4JGZB 1WMEA 4YGDA 2A61A 2DA6A 1A35A 3DEEA 1QDCA 1X1CA 2XJUA 3QOPA 1EJ9A 5DTDA 1VBC2 3KLOA 1QBJA 4URTA 3DBRB 1D4M2 2ZKLA 3SCGA 1H0MA 2QKLB 4PGHA 1I39A 2BFUS 3VYRB 1R082 2R0HA 2XVKA 5BNGA 2OAZA 5JZGB 5HODA 1W5TA 4XURA 1HX6A 2XLAA 1CAVB 1YIJI 1MIJA 1SBEA 2YC2A 2VPLA 4MTDA 5IVJA 1LOBA 4B4RA 3MFKA 3PIPF 4LR4A 2NMOA 2YUSA 1UG2A 1J3QA 1EH8A 4DW6A 4E4SA 4J19A 4TSVA 1OCPA 1JT0A 3TBIA 2F17A 4GYGA 2OS2A 1ZLKA 4YRVA 1H0BA 3V0BA 2BOIA 5C4WC 1E5HA 2WZPP 5BNNB 4A3XA 2FQ3A 4P5YA 4CDWB 1IRFA 5C9AA 1L7QA 2J1AA 3DEMA 2H1LA 5L36A 1SDDB 1S7OA 4Y1ZA 1Y9MA 5A6QA 2I07B 2GOMA 3TOBA 3QRFF 3NV2A 1ULYA 5A3UA 1Q43A 1R6RA 1SPPA 3HNYM 3S16J 4IRIA 3WG4A 2F6CA 5EGOA 1S55A 4G6TB 2RDSA 2QKDA 4BDZA 1UOFA 1OURA 2K3FA 3BIWE 4KMUX 3NJZA 3ZYRA 5HCHA 1UFMA 4RQPC 1BXHA 4A6OA 5FXVA 1OQYA 1J9IA 2H6BA 4BBRJ 3CCUI 3INAA 1D5VA 1JOPA 4QGNA 3ABUA 2CSOA 1P9QC 4R8HA 2ZGTA 2HVRA 4XMIA 4A7YA 1DQUA 1KU7A 4GMP1 3VDCA 4LMFA 2M2EA 5BS6A 2R4GA 2ZBJA 3C7EA 3N9PA 4BIOA 1TE1B 5K9YA 5FYIA 4D94A 1OFSA 2XJSA 3JTHA 1TWGJ 2L02A 3Q9OA 2QEXI 1RUJ2 4LK1F 2KRFA 4WWCA 4Q4Y1 1MZBA 2IGNA 2MG4A 3GTPJ 4KYWA 1JGSA 4X6QB 5EYXA 3TW6A 3CCLI 3I58A 3P9KA 3TKYA 5CYVA 2HWF2 5LFAA 5C3EJ 1T39A 1QHDA 4RFRB 3B02A 3EB7A 3MFCA 5JXIA 2EZKA 1W8WA 3SLIA 2H0BA 1DZRA 3VKLA 2DCYA 1FOD2 2JT1A 3K48A 3S3MA 4DUXA 1NCRA 4ASMB 1VBE1 3HJEA 3CCVI 4UF0A 4OMYA 1S72I 2L9RA 1J5YA 5IT6A 4DYQA 3ZFFA 3WE2A 4DOZA 1WMXA 1D2QA 4LIVA 2JK3A 3FKIJ 1K83J 3PSFA 3W58A 2X10A 2VQHA 3C7OA 2A7AA 4R9CA 5L3GA 4EATA 1F5TA 2IXCA 3USUA 2DVDA 4Y22A 5JIUA 2BVMA 1OPMA 2MHFA 3OSDA 3A23A 3N9OA 2W92A 1IS4A 3V7RA 5J48A 2NZ9A 4L5EA 1A6QA 2AR6A 4XFHA 2COBA 5CNAA 2RJ2A 1W6QA 1JYNA 4S04A 1FI2A 3H42B 4CHUA 3S3NA 4GO1A 1FOXA 1BOBA 2BW8A 3RKYA 4COWA 1OYWA 2VMCA 3K6GA 2EA2A 2XPVA 1LODA 2RMU1 4Y7NJ 3WDYA 2DPUA 2IXJA 4MXWA 1U3EM 3KPHA 1RUE2 4Q27A 4BY1J 2DFEA 2ZX2A 2ZNZA 4OAYA 1O3QA 1XQNA 4BQNA 4LKSA 2X5IC 3A03A 4XUTA 3CUQB 2BY1A 4E2SA 2J1VA 3F8NA 1XRUA 1MJ9A 1W36C 3MHZA 5HV4A 5HLGA 1GXQA 4WM8B 1RNLA 4G7ZF 4A7KA 1R4NB 2VPVA 2VXDA 1QQIA 3OBRA 2H09A 1KD7A 1Z6RA 2OW4A 2QQ8A 4UW5A 4XLHA 3IMMA 4AVCA 1O8SA 1J83A 1FV3A 2OZ6A 4CPBA 4FAHA 2PQ8A 4FE7A 4IEVA 4ZTJA 2ZMEA 2WT2A 3VDDB 1BM9A 5A3OA 2JWPA 3M2MA 1GV5A 2O3FA 4R9AA 3H5NA 2FBIA 3O1TA 2MYSA 4Y1YA 1BBT3 1MBGA 3CP8A 1AL22 5CJ9A 1K4TA 2W08A 3OSFA 3T08A 2VC1A 1TVGA 3LEGA 3HNBM 3V42A 3H1YA 1JYTA 3DGTA 4EJWA 4LE4A 2Q8KA 1SLBA 3WQ7A 3AFGA 2BPA2 2FD8A 4IESA 3FLTA 2RHPA 2O0YA 3AFHA 1QIQA 3K4NA 4QX3A 3MBWA 4AFDA 4ITCA 1JT6A 2LM3A 2KJBA 4Y15A 4WCGA 4MEXF 1AR72 1WBFA 4CDXB 5ERLA 1VJ2A 4Y4YA 4JHZA 4NHLA 4SLIA 3N4MA 2BDRA 3KZYA 4N7UA 4QKDA 3GFLA 2WLPA 4M74A 2X6XA 4BS9A 1UKRA 4WXCA 3BB6A 1UMQA 2VVFA 3VBRA 5CLSA 1AHDP 1S2BA 1BI3A 3AMMA 4GZ9A 2CHHA 3IAS2 4BE3A 1N1YA 2RVCA 5KR7A 3AKSA 2D1HA 3SEZA 3TEXA 1W8ZA 1MNMC 2BNMA 3FLPA 3VBSB 2DA3A 4JYKA 2DOEA 2EIEA 3VWBA 1IF1A 4NRQA 1GP4A 1GKBA 3VKOA 4XBQA 1ON2A 3RZMA 4EVIA 3FL7A 1Q8OA 2CS3A 2DQRA 4JAAA 2NNNA 4K7JA 1VIWB 1HQWA 5F3IA 1XMKA 2QWWA 5C4WA 1V6KA 3CC4I 3UKVA 2YY1A 4DQAA 2K02A 3K4MA 4BQ2A 1DDNA 1U0JA 4SBVA 4DB5A 4O65A 1JS9A 3MD2A 2FMDA 1EV11 2MLKA 1G9FA 1AKHA 4PHZA 1YO8A 3W21A 3RIRA 4Z07A 5KBFA 1ETXA 3QQAA 2HBTA 2L9VA 3H0GJ 2VOTA 1QXRA 1ULOA 3MIHA 4GB31 1DFQA 1ZH5A 5L73A 3DYMA 3MMYB 2BJSA 2X6YA 1RUI1 5JSRA 1AR63 4RQPA 4EWDA 4E7ZA 2DPDA 4I99C 2V4VA 1R36A 5M5WJ 2GOXB 2E1NA 2CU7A 4XAEA 5F27A 2R063 2L5QA 3E5UA 3ROUA 4G6QA 2ZHKA 5BOXA 1PGW2 1XU2A 2OPWA 2IGMA 5CQGA 4RGKA 2R5ZB 1WW5A 3CC2I 2J42A 1W2TA 2VOXA 3PJQA 2VZUA 5FY8A 1X3UA 5TJJA 1H4HA 4M9XA 1S9HA 5M5YJ 4CEYB 1EYBA 4Q1PA 1XYPA 2MA3A 1XNKA 2E34A 2DFIA 1OLMA 3ABKH 1NUKA 2PN6A 1TNSA 4ANJA 1LGNA 4Y3OA 2H1KA 1GWMA 4RN5A 1IN4A 2OJED 3LSMA 5JHFA 3WHUA 3O5SA 4QQ2A 2Q5TA 4NMIA 4XR6A 5B3SH 4L9VA 1PO11 1SAUA 4GJZA 5I0UA 1CVNA 2BNOA 1BLZA 3D4KA 2XPJA 1UO9A 1MZFA 4KWJA 3ZQFA 1CX1A 1I1SA 1YXWA 1FZPB 3J4UH 3KIOA 3G6EI 3WG1A 1W0OA 2EFOA 4N43C 1IG0A 1LR5A 4MGKE 3IT8A 2N7GA 3EETA 5EFUA 5LY2A 2XVLA 2VKHA 4MZUA 4BK4A 5D6EA 2NP0A 1GZCA 2DCEA 3L00A 2XWBB 3BWGA 3WHTA 2OPKA 1UY4A 3BR6A 1X50A 3UESA 2C26A 5EF6A 5IOZA 6PAXA 1BMV1 1CWPA 5ANQA 3KZZA 3ZQHA 5A7PA 1FOYA 1BK1A 1OF3A 2XAJA 3CZ6A 4W97A 4LG0B 4YGCA 2ZJRF 5F2WA 1R091 4PJMA 1RHI1 3C8XA 2WADA 4XUOA 3S0MA 1ST8A 1R71A 2XSDC 4YVWB 3AKQA 2HWC1 4HNTA 2EXKA 1AU7A 2WO7A 3P1IA 1UMHA 4CE8A 5KXDA 2BOLA 4B4QA 3KHBA 2HQRA 2D7FA 4ZYEA 4KBZA 2WN2A 4XSZF 4HEA2 2VR4A 2UURA 2GN7A 2Y0SA 1YS6A 4ZZDA 3I64A 3H0OA 1QMJA 3THTA 3I56I 2J1SA 3BN6A 4CDUC 1GZ9A 1QDOA 3T0AA 2KKOA 3AP5A 3M07A 2JEMA 1AA7A 3DEWA 2W57A 1IV6A 4GMP3 5IVEA 3AG2H 1ZA4A 2CQQA 4AR2A 4BXSV 2ZKNA 1O5UA 4Q0PA 1ETWA 2EALA 4XFCA 3UETA 3BZ6A 3ECHA 2P6HA 4Y20B 4YYOA 1AX2A 3O1MA 4YM0A 1W05A 4Q4Y3 4CP9B 2LR8A 3ZSEA 1AF9A 3ZDSA 5A3MA 4XDQA 3OF1A 2CWMA 3VZJA 3SXYA 2YBKA 3MGUA 3OL4A 4OU0A 4RR3C 2R5YA 3AVSA 3IMNA 4IV3A 5BXXA 3MV01 5A1LA 5I0RA 1W8FA 4A3LJ 3ASIA 4JQRA 3I2IA 1SBDA 3OBZA 2RS51 3C7GA 2QM3A 2JZYA 5FZ0A 1D2SA 2XQRA 3LDKA 1VBE3 1RUF2 1AYM1 4XLAA 3G7DA 4UUSA 4QKFA 3RZDJ 1SLLA 1DYPA 3A4UA 3ILFA 5CKNA 4QPYA 3HBZA 1YITI 2GN3A 1LENA 3RWKX 5LZ6A 4LO6B 2DMTA 3ORJA 4MXVA 5FMDA 1KQRA 3IL2A 2RJLA 3VD7A 2OCCH 1DF0A 1DGRA 4FSJA 1T2KA 1JZ8A 1OYYA 5CAZA 2QUFA 2ATFA 5I0SA 1R1TA 5DD4A 2G19A 3HRMA 3H8XA 3KV6A 3GBWA 1EV7A 2AS5F 2B42B 4I0BA 1IZ1A 2BY3A 4ZU5A 4A44A 1SG3A 4LLFA 3ZMNA 2XV4S 1NG6A 4BDVB 1Z77A 3E6CC 2JDAA 2FU4A 2BZTA 3VBHB 1CJDA 5FYYA 4GXLA 1U0AA 4YIRX 1H8VA 3IWFA 3JRFA 4YGBA 2WSVA 1YW8A 3MW4A 4EJUA 4QQLA 4KISA 2IRFG 2V26A 4JKLA 2O1QA 1UHSA 2YUEA 1R49A 4UW4A 4PFPA 3I3DA 2IVJA 2WBMA 2OUJA 2LALA 4CA0A 5FMCA 2I8DA 5GZDA 4E70A 3EUKL 2GWRA 2KZVA 3OYNA 3VODA 4R1HA 2I45A 1R1A2 2VZ3A 3D82A 3W2VA 2HH9A 3OY9A 1JTXA 3M1HA 5DUIA 1NCQA 3HHGA 3OOUA 2ADDA 2ZOEB 2RGVA 4FTSA 2OYZA 1FC3A 4HV5A 5F2SA 3U21A 1KDMA 3GLLA 1UCXA 4F91B 1PP7U 3PUIA 1X1BA 1MVQA 2R0QC 3ETPA 3M8LA 2VL4A 5LA1A 3WDUA 3WOGA 3TMOA 3C2BA 4XOPA 5IUQA 3AG1H 1CJPA 3ZQGA 3ZPOA 4N4OB 3V65A 5SV5A 2VZQA 1UZWA 4M0HA 3RKWA 2JG9B 4YW7A 5FYCA 5HLTA 1W5CC 3JCUC 1QNWA 3CD6I 3OS0A 3CCQI 3GTJJ 3ZFGB 4A3GJ 2KXLA 3DCQA 2VBWA 3HUGB 1DCSA 5FO5A 3UJOA 4P96A 2WNVB 1ZN2A 5HCFA 4A3EJ 1YI9A 4FXKB 2XBO1 4UVBA 2C9AA 5A32A 1OQEA 4HN1A 1JOJA 1QVTA 3NWSA 5LLQA 5C5TA 5IFPA 1VFCA 1QOOA 1J1TA 2QA4I 2QQMA 2XLFA 2QTWB 5A2QK 1SEFA 1N77A 3K46A 1RUJ1 4N43A 3CMAI 2HU9A 2UY8A 3ZCOA 3OYHA 3VZMA 5DD8A 5JOXA 1H30A 3LMMA 2HWF1 1KA8A 2JQ7A 1QZYA 2W48A 3P5JA 4GQ7A 3Q0VA 5A7SA 2XR4A 1KGYA 3ERED 4GA9A 5KAIC 3BR2A 1ZBA3 1I5ZA 3WTXC 2VY0A 1X1DA 4WVMB 3WNOA 3QYEA 2CTVA 2HDCA 3AVRA 3TAYA 2FXAA 2XHKA 5EQUA 4H55A 4W8JA 1QF3A 2WV0A 4K2EA 4L5JA 3MZ8A 3C7HA 4O3MA 1GP6A 3L09A 4COYA 4Q0VA 4ENNA 1W8UA 5D5WB 3O1SA 4GWJA 4I76A 3I71A 2E7XA 2WB1N 4F7ZA 3C2UA 1EV13 1MDMA 4H3WA 2IXHA 1Y56A 3S8PA 2W84A 4OI1A 1UD1A 3MWMA 2X1CA 2VOVA 3HB9A 3CL1A 1I6HJ 4YIFA 1NA1C 2WUHA 2W24A 4AHZA 1XS9A 3HRUA 4GB33 4BQYA 1YS7A 5LATA 1QQP2 1Q8QA 2Y33A 1PX3A 1RUI3 1AR92 3KF5A 3B7MA 3TGNA 5ICCA 1WVRA 2HYKA 4GALA 2LLKA 4JX0A 2HWD2 3BALA 1JE8A 1COV2 4AQ6A 5GJ6A 1IJWC 1XE7A 2EAKA 4RBOA 3UNGC 3SFIA 1V9U1 2DCJA 4LE3A 3NW4A 2GZWA 2QZ3A 4BE2A 5LBEA 3HQUA 3OOXA 5DZFA 4UVCA 4CZCA 2CYFA 3ITQA 2N8GA 3M7GA 5IP9J 4I3PA 4ZU7A 5TRDA 2V09A 1TZOA 1Q8VA 2IXKA 4PQQA 2WO2A 3I97A 1PP8F 1MJBA 2NMNA 4TZDA 2P81A 4XABA 4YG3A 3FXMA 4ZYDA 3A01B 2CY6A 3AL5A 2W5FA 3WQBA 4AL9A 4HSRA 1GWKA 5ANNA 4RR3A 1TC3C 3WD5A 3RI4A 2OD5A 2VCMA 1YIPA 1PO13 1CAXB 2GNDA 1OD5A 2KT0A 1NG0A 3OB8A 5JLXA 1OCCH 3O2PE 2YFZA 1P92A 1AL21 3AYEA 1MBKA 1GQGA 4JDMA 2R7VA 4FQZA 3S2WA 4UB6C 4MG2A 4LK0F 1YIOA 4I2OA 3WQ1A 1ND2C 2IA2A 2DDBA 3OY8A 4XTMA 1CD3G 2GNTA 5ILSA 1NG7A 4BMEA 4LHNA 1QJU2 3ELKA 1W0NA 4YM3A 1ZELA 3AKTA 1MEC2 5DG2A 2R7ZJ 2XB6C 3IM0A 3ILNA 1R093 1RHI3 3WSOA 4WBBA 4AQSA 3LF7A 4JP0A 3F0CA 4D7SA 1CQTA 3WXPA 3LOBA 1NK3P 5C3OA 2HYFA 1OOPC 2HWC3 4YGEA 2STTA 4DS0A 4UVAA 2D6OX 1YJ9I 5JPNB 4FOVA 4ENKA 5CKMA 5DV5A 2O8KA 3BGAA 4O7XA 3ZYPA 3SITA 5DMYA 3S17J 2V1DA 2CUFA 3FXQA 4XBNA 3WTYC 3JUUA 4C0HA 3OYAA 2W9XA 2GXAA 1VALA 1QOSA 4QGLA 2WO1A 1MKMA 3OG2A 5JFRA 4Q2FA 4WZFA 3KSCA 1W6OA 2JTVA 3D0SA 4XLNF 1TZLA 1QJY1 3FM3A 1W5SA 1VQPI 4ES8A 4KG8A 1YLLA 4A3IJ 5FPBA 4KI5M 2RV8A 1SFYA 3ASOH 3HOSA 3G71I 1VB2A 4XF4A 5GAHJ 1ODMA 5EIYB 3SQNA 3EO6A 1JYCA 3O0WA 4HPKB 1R9TJ 1W0UA 2OX0A 1Z05A 1SCRA 2HWB1 1E3HA 1G4DA 1WA4A 4IHVA 3S30A 3FUOA 3W2AA 3CEWA 3J8F2 4IHSA 2M87A 4Z1VA 1MR5A 5KNLA 2DOAA 3O1PA 3M8FA 3CDHA 3K0LA 4RLFA 4ESBA 2JDYA 3CDIA 4P00B 4AHXA 3NKTA 4CYCB 3AAFA 4CYDA 4JGYB 1Z91A 2VL8A 2XAUA 3VBOC 2VQAA 4I01A 5EEAA 1CAWA 2OQ6A 2NNYA 3GTGJ 1VBA2 1SLTA 1CF7B 5FAXA 2Y2ZA 1LDJA 1PVXA 4DGWB 4LXLA 3MKLA 3TO6A 3H35A 1CAUA 3FXJA 4UI9L 3V8LA 1DIWA 3GFJA 5K5QA 3VBFB 2RS53 4U87A 2JDKA 5KHJA 1LQ1A 2V5DA 1REEA 2B0LA 1AYM3 3ZLIA 1MJAA 3HR9A 1PGW1 1IN8A 4A42A 3IPVB 3JRDA 3KEQA 1RIOH 1OISA 3GEZA 3U11A 1XYOA 2D40A 2VQCA 2GH8A 5EG0A 2EH3A 2A3XA 2LY9A 4XXAA 1D4VB 1GP5A 2HFHA 3FZVA 4MNUA 2TUNA 4CPBD 3P9IA 3SCHA 2PXJA 4XEZA 1WD3A 1WGPA 2JUGA 1O3RA 3E97A 3ACLA 1MS8A 2F5CA 3HPNA 2HWE2 2ZEXA 2DMNA 4D5FA 2HKOA 4CU8A 3ZN4A 1AJKA 3GGLA 4ZTFA 4Y52J 2PI0A 5GLUA 3MICA 1D4M3 1JBCA 2D44A 4RGUA 3KVAA 5C70A 4QX2A 1JU4A 3IDCB 5F7UA 4AEKA 4OZXA 1R083 4RB0A 1FP1D 4N9IA 2PMUA 1GNHA 3BPXA 1FYKA 2XL7A 5BNOB 1YJNI 2A05A 2W91A 1S8NA 1X4OA 3GFMA 1RUD2 4IO9F 2XF7A 4KIBA 4D69A 5CU1A 3NNJA 5AIPA 1NA1A 4DNCA 4AEDC 3WGHA 3J81Z 4EQVA 4HMZA 4LEJA 3VD5A 1ETQA 2DQLA 1S2KA 1YWKA 3USSA 3F3XA 2WAOA 1N78A 3TO9A 3GZUC 3MW3A 3LSPA 1FOKA 3ST7A 4IHWA 2X8KA 4ZXEA 3S5QA 4N4NB 5J3LA 5JXGA 5A7NA 3CZJA 2KZGA 5FK7A 1SZBA 3AXDA 3QU3A 3LSHA 3AXEA 5FD5A 4JRAA 2WYSA 3PTRB 1YJWI 1UKGA 1YX3A 4LB5A 2XOMA 4XQWA 3ZYIB 4LO5B 1FBQA 5CKTA 4XORA 5FPAA 1AUYA 2VQTA 4H4KC 4OUSA 3GTMJ 3SH3A 2FZ1A 2SBAA 5EPAA 2AGSA 2XBO3 1RUOA 4AAPA 1VRH2 1G3SA 1DU3D 2WQ8A 2Y6KA 4UNOA 1Y3TA 1B6AA 4YZ2A 4A0ZA 2YZ4A 1XSXA 4X6AJ 1K6OA 2YS9A 2MNGA 4FX0A 2NLRA 5A6XA 4HSTA 1TT0A 3HAGA 5LBFA 5FZOA 4LMYA 4C91A 2ZABA 1RUJ3 1PVEA 4UHTA 3IIIA 3I3MA 1SBFA 1LCLA 1ZZCA 4IV1C 3JAMZ 1DYOA 2HWF3 2X05A 5K4LA 3VPRA 5ACA2 1D3YA 4MTEA 1BL0A 1N47A 4MFEA 2PG4A 5JDBA 1ND2A 1W7PA 1J59A 1CZVA 5IP7J 2JE8A 2PLV1 4QHZA 1RUC2 2BTVC 1IW7F 5FKKA 2DFCA 3FHQA 1QWRA 4G94A 4AAXA 4AIKA 4FOQA 1CZSA 1W9FA 1YJKA 2QQWA 2LYCA 3H7JA 4JGZC 1QXJA 1OC1A 1G7YA 3BKZA 4YPJA 1ND3B 4ARYA 1OOPA 4RGAA 1LOCA 3ZDVA 2C6SA 1VQ9I 3JTGA 3CHXA 3K75B 2BZDA 3JQXA 1XCBA 4OLLA 3OGRA 1UOGA 4HQEA 4RFT0 5FZ6A 3L9FA 4XILA 1FEXA 2RS32 1X7NA 5D8AB 1EH7A 3LDBA 3VSLA 5F08A 5FFZA 1D0XA 2VZSA 5A1FA 4XFFA 2IFRA 3OYCA 2VXRA 3HSFA 4HZFA 2AC1A 4U0VA 3KV4A 1WZ2A 1JZ3A 4P9IA 5BPIA 2QSGX 4R4ZA 4LBLA 1K42A 4B47A 3CJRB 3LZZA 3C18A 1ZBE2 2YGLA 4EGZA 5FKNA 5BNNC 4G9SB 3ZXDA 3MPBA 1BW5A 1X2MA 2YROA 1BEV2 4PJNA 2EBIA 3EMRA 4CDWC 1HV0A 1G3YA 1YQ5A 4GYIA 5K7FA 1WCQA 2DA5A 3ZN6B 3MEXA 4HX4A 4CU6A 5JR2A 3KCXA 1ZGJA 3ETQA 5FWEA 3BR0A 4NDLA 3C2GA 5CEHA 5GP9A 3MF9A 1W6NB 3B3QE 3VBOA 4K8RB 2VG9A 1F4KA 4YW1A 1OCZH 2Z1DA 2PAMA 1UU5A 4XL9A 1BIAA 3OBAA 1J58A 1XU1A 2IGOA 3PURA 2P7CB 1AL23 5T5PA 3J7YJ 3GZTB 1F31A 1QNYA 2H8RA 4AOCA 5F6LB 3GF6A 2DK5A 3COAC 1P7IA 4HA8A 1UYZA 4QDQA 4L9BA 2ZGSA 1A31A 3QP5A 1JUIA 1IV8A 1RINA 4CCLA 2ZGOA 1P6RA 3HBKA 1KU9A 2YV8A 1USTA 1DU0A 2YU9J 4LA3A 2ZXHA 4C0BA 3M7AA 4RB1A 3TW7A 4LFUA 2VT3A 1IGOA 1WH5A 3BQZA 2VMIA 1G9AA 5IVFA 1JZ4A 1LAJA 2GC1A 1OPCA 4FOWA 4JDNA 5FY1A 4KFCA 2Y6JA 3I9V2 2JRTA 5AVAA 2VUDA 2EV5A 3GX4X 3M9AA 1R22A 3BODA 2Z3YA 4RAGA 3WP3A 4COZA 2VBYA 1ZG1A 1TQPA 2ESNA 1AXYA 3I53A 2LS6A 5IVBA 5LGTA 2RREA 1UX6A 4XRSA 3Q0UA 5H9QA 2E2JJ 4YEJA 1K5MB 5IYBJ 1UNBA 3RI9A 1HDPA 4FPYA 2FQ4A 4QPWA 1WW6A 2PMHA 3I2HA 5C7GA 3J81K 1OVPA 2A6WA 3ZIXA 2QQOA 1F5JA 5DEQA 1DQ2A 1B72A 5EZWA 4YZ4A 1JJ8C 2HVSA 4NWWA 2QKMB 2DOFA 1FYUA 3SH5A 4HQMA 2HNHA 4ETSA 3QAHA 5DAXA 3TEWA 3W5MA 4LLGF 1C8M2 1WLWA 2XAGA 2YR2A 1KGSA 1QHGA 2D6KA 1FLIA 2CQXA 3OYJA 3F21A 1B8IB 3EUHC 3FIWA 3WVJA 4O5VA 1XGSA 5GZGA 3JBG1 3ABZA 4N90A 1I6XA 1VQNI 5B4XA 4B1LA 3ZVXA 2BEOA 4DUWA 2VNVA 1V00A 4LBMA 3PL8A 3WF2A 4Y4RA 1AR91 3K4BA 2ZGQA 3K3NA 2VZTA 3ELNA 1GSLA 5IW0A 4NIGA 4MGZE 4YFKF 4IEJA 4B43A 4G6DA 2D45A 1Y39A 4FFFA 4XBLA 2JWTA 2ISYA 1MS0A 3RJ2X 2JDMA 1QPMA 3PNTA 1HCRA 1Z21A 5IK8A 2VZPA 3NAPC 4KU8A 1YFWA 3HGGA 4OYUA 1GQPA 4AFBA 5GAEJ 3JAMK 2P5VA 5M3MJ 2CQNA 4M0NA 5DDJ2 4JX4A 4IEYA 4AF9A 4IV1A 2GA1A 1R64A 1O4YA 1W04A 1HKQA 3OS2A 3TN91 1ERDA 3PUSA 3JRAA 1B35C 4OWRB 3AL6A 4WVWA 4QQOA 3U2RA 3ONQA 4MH0E 5CVIA 3OPWA 5FFOC 2WWJA 2VBPA 3JZVA 1ACIA 3H3ZA 3BOPA 5EEHA 1W8HA 3U10A 4JGZA 2IWGB 4ON0A 1YEWA 1YRNA 4P08A 2BVLA 4XQ4A 3FF5A 3WHBA 4V19K 5CFDC 4G8XA 4IUGA 2GQQA 2JVHA 5E1WA 2R93J 2VQLA 3T5XA 1WLTA 2F2EA 4YW3A 4Y1VA 3QYBA 1WMFA 1U9OA 5T5OA 4BACA 5F0HA 2EXJA 1PGL1 4XFBA 3MPPG 2EZIA 2YBPA 1RUNA 3F8MA 4GMP0 4K3UA 3O0XA 4UYBA 2M34A 3RZZA 1LGCA 3NAUA 3AKRA 3M3CA 1KRIA 3IRRA 3GZNB 3FZ3A 3GUDA 5E18F 1PUFA 2A71A 4GCVA 3KWVA 1CAVA 4GH4C 3PJYA 1PDNC 3PNVA 4E7LA 5C6CA 2EAAA 3BIEA 2RM21 5T50A 2O14A 3IV5A 3SXWA 2XHNA 2O0OA 5FP9A 4M3FA 3BP8A 4XKBA 4DUVA 1QU0A 3HMYA 3VLBB 2LH9A 1W28A 4XPVA 4BMBA 3BG7A 2R0FA 4E27A 3S14J 3GZEA 4CTEA 5BNNA 1REDA 1OCOH 5DCMB 4D6SA 3WDWA 2P3IA 3QBQA 1VQKI 4EE2A 1SD5A 3FBIB 4CDWA 1YI7A 2JRMA 3IDEA 4Q4X1 2Y6HA 2WR9A 2YYOA 4XACA 5FKBA 3DF0A 2XJVA 1RUG2 1CESA 1U2WA 1LHOA 3G6JB 3S1RJ 3DV8A 2NXNB 5TISC 3RMYA 1WJDA 5I0DA 3S3OA 3OTFA 4MHRA 1G8WA 2JXAA 5JVGF 1S1AA 4MQ9F 2VULA 4GGGA 2DN0A 5ICFA 1LVKA 1VF9A 2NPIA 2ZGKA 5C8CB 4YW4A 5DS9A 1Y9GA 1FIPA 4B44A 4HSJA 3IZOA 2J1TA 3KV5A 5GLWA 2OA4A 1FYMA 5GPAA 2JICA 5D6FA 3AJYA 4X8NA 3OPZA 3EQLF 3OYWA 3SZPA 2YPDA 3JCIA 1F4AA 2WBKA 4A3JJ 3M1EA 5FZMA 4DBRA 4AWDA 5CG8A 1LOAA 3TP3A 1VRBA 2HLEA 2PLV3 1PMHX 4WM7C 1C3HA 3H9AA 2PX9A 1AHSA 1DZQA 2F4PA 4ATEA 5ICEA 3I7DA 5BUVA 1VTNC 3CZUA 2AH2A 3HIFA 3S2HJ 1YOVB 5D1IA 1RMU1 1UB9A 2J1RA 3CLQA 5FZ8A 3O8GA 2BBVA 4YIIA 2UYBA 4N7IA 2CU5A 4L18B 1AX0A 3IC7A 3THCA 3GTKJ 2P6SA 3FM5A 1U5ZA 1AZDA 2ZJCA 4ZU4A 2E5ZA 2BWCA 4HX8A 2KRHA 3PUHA 5CYYA 3Q9VA 2DA1A 4ASKA 3ZFEC 3GWZA 1WUVA 2DV9A 3FXKA 2BRTA 2E9QA 4XM3A 1WFXA 2DMUA 3KE2A 4MQVA 3GHMA 1E5IA 3PMSA 4MFDA 1NXMA 1XMAA 2V5YA 3QH7A 5FZAA 1JKPC 3K9TA 5LRRA 3KEOA 1EH6A 3FMQA 3BTCA 5FWJA 4E9KA 1A6CA 3DYPA 3SC7X 3BG3A 1IUYA 4FHTA 2Y0MA 3RWNA 1BK0A 2M45A 3BQYA 3KP3A 2AXTC 3LSJA 5DUWA 3CO6C 5E79C 2Z99A 3MCZA 2WAAA 3DTIA 1JZ2A 4LK6A 2OZUA 1BYHA 3W6JB 1WLCA 1C57A 5FYMA 5EYYA 2PHLA 2JIJA 3F22A 3RZKA 4NPRA 5FKLA 1YQAA 2H8WA 4LUMA 3ZMOA 4RHV1 2ZGNA 4LO7A 1CIWA 3DLAA 1BOAA 2OVUA 1RKWA 2CFXA 3CUQA 3LD8A 1W1WE 1OPOA 1LB2A 2O9LA 4V2VA 1H89C 4FISA 3ABMH 4Q4W2 4J01A 4NAOA 2B63J 1QHHD 2EIKH 2FHRA 1S4CA 3V0BB 1UY2A 1GR3A 4PF1A 2FRHA 2Z2SB 4AYBA 4M71A 1IN5A 3VZLA 1FXZA 5C9AB 5T54A 3WNKA 3ZN1A 5KHHA 1GVDA 1DP7P 3NAPA 1SPPB 3U78A 1K6YA 3HEIA 5EGOB 1JGGA 5ERIA 5LHHA 5DZGA 3TEYA 4OMCA 2VI6A 3N36A 5DM6F 3ZYHA 3W5NA 4O6JA 4CCMA 2EFNA 1HRI2 4ASLA 3WTSC 1SQ4A 2LG4A 2ARXA 4EMSA 3W9AA 4A3ZA 3B94A 4QPQA 5EZHA 2D2WA 1J75A 5D8LB 5HDNA 3CU7A 3GXOA 1DGRM 4PT6A 4BEHB 5EHDA 5FLVA 1ULPA 4FFHA 4UAPA 4HF1A 1W8NA 4LHLA 1ALYA 4MGRA 4CDXA 1AWCA 5F6KA 3WZ1A 1VNDA 5J6XA 2DXIA 4U7BA 5B4NA 5LBCA 2IXLA 2GLOA 1MSEC 1SFPA 4M3EA 1FYLA 4EM1A 3FK7A 5CFDA 2ZO4A 3ESWB 1IZ3A 4GKYA 3HRSA 1S0DA 1MH3A 2HEVF 3LPFA 4C1XA 1HDKA 1RUC1 4IETA 1QGLA 2ZEWA 5C33A 3T2PA 1MQTB 1LE8B 3RJRA 3LDRA 1ETKA 3OS1A 3LA7A 2CG4A 2NVTJ 1UW8A 3J9SA 1NCRB 5F39A 1MS3A 3OMYA 3MZYA 2CW0F 1OXCA 4CICA 3K1NA 1PO22 2AHQA 3EBRA 2JD9A 4B8EA 3JB8A 1B1BA 2EFWA 4UF0B 3VBUC 1SMVA 3LIHA 4KH9A 3WG9A 3DKQA 1LEAA 4K8FA 4QX7A 2OV7A 5KCMA 3AL0C 4Y5Z0 4U2AA 3JBG3 1YHQI 1FMD1 5FPVA 3W20A 4QKBA 2RVAA 3UKNA 3WCRA 1Y0UA 5BQTA 2O7OA 1HRV1 1IXCA 2D6NA 4O61A 3S7IA 2XJRA 5EJ1B 2KQRA 1KEXA 1AR93 1JH5A 5J8FA 2LDUA 5JR7B 1OBNA 3T8RA 1H8TC 4Z82A 4B3NA 1W6QB 3I4PA 2NVYJ 2MC4A 4BHPA 4HETA 1W3XA 4M72A 3EUAA 2I5UA 1UY0A 4NROA 2ZMKA 1ZBE1 5GZCA 2Y38A 2K7LA 2PAKA 3WQ0A 4B8XA 3RZLA 3ZXSA 4E7IA 1XB4A 3LB9A 2EWNA 3OUHA 2PHDA 1BEV1 5FUNA 2O61A 5A1AA 2C24A 4YM1A 1LFBA 3B9IA 2X85A 1D8KA 3KT7A 3GZ5A 4Z2AA 2HTSA 1W90A 4MIMA 5BNPB 3L2QA 1HW5A 1V6MA 1SMTA 3DUIA 2JMWA 4BXXJ 4P02B 4U36A 2JG9C 2VMGA 3GZAA 3B6AA 1OVSA 1BW6A 1GU3A 2DA7A 1REPC 2H0VA 3BTLA 1NY71 5FIXA 2GXBA 2ZMEB 1KYWA 3CDLA 4BDYA 1OKQA 4J00A 2EJRA 3K7AJ 1LKNA 4HKLA 4ISRA 3ZXKA 4GFBA 4BQQA 5TSWA 1TNFA 2R042 1AXKA 4AVAA 3DL3A 4IQPA 2LTPA 4L9JA 3KT4A 3WV6A 2NS7A 2PN5A 1OQ1A 2XAHA 1VQ5I 4YG0A 5GALA 2OA2A 1BA5A 5A3PA 5L3FA 3QPSA 1NYWA 1R4MB 1U5TB 1Y4WA 2DVBA 5FLIA 5B1AH 4LHKA 1UN1A 5D2AA 1QJU3 2BYVE 3UK9A 3ZO0B 3KHCA 3ACGA 1GDTA 3ZKYA 2DVFA 3REOA 2VIXA 2P3JA 1VPHA 2ESHA 3FC0A 4XLFA 2HI3A 2DTZA 2ERFA 3OUIA 2L01A 4I3GA 2M5WA 2QBYA 1D1AA 2CL2A 1K3IA 4FI9A 5J96B 3I59B 3OEAA 2RM23 4CXXA 1AYN2 4RL7A 3PO3J 1HJGA 3U75A 4R4XA 1UJ8A 4AI1A 5A7OA 5L9RA 5L3BA 5DUKA 3N35A 1W7PD 3OGVA 3HPHA 1GNZA 5IAXA 4HK9A 2VECA 2YX7A 2LBFA 4E4ZA 4HVQA 3PM1A 4Q4X3 3F8FA 2XASA 3T1MA 1PM7A 3FXUA 4M9ZA 2AO9A 2OQRA 2ET1A 2FDFA 3IH4A 3ZGKA 3AMQA 1ON1A 2D3SA 4CCCA 4XXPA 4NUBA 1R5GA 1EY2A 1FMVA 2BWAA 1ORKA 2QVSB 5H2FC 5C4WB 4MGQA 5EZGA 4JOMA 3UGGA 3BOWA 3WX5A 4K40A 4OI4A 2D1VA 3ZPYA 3IDAA 3RYPA 3RSNA 2B39A 1UIJA 2R3SA 2ES3A 2KJCA 3R61A 2PHFA 2ZMNA 3RSJA 2E51A 1POV1 3SEPA 5FXZA 2F5FA 3HDDA 2V9KA 4EJOA 4Y20A 2WS91 3O8HA 3BY6A 3AP9A 2B45X 5LGNA 5JSOA 4RQPB 2ZGUA 4CP9A 3MO4A 3K1MA 1DGWY 2MEV2 3MKYB 2ARAA 3K10A 3ACFA 3MIEA 4JHTA 1RMU3 3CQZJ 3GW2A 4LBOA 4ZDOA 5FYZA 4O9EA 3CMGA 5BPDA 3CCRI 3K70C 4DINB 2W95A 4KN7X 1WLDA 3NWKA 3LWFA 4PFOA 2M8EA 5A33B 3LKJA 3POJA 4S2GA 5DYMA 1VAMA 4LQRA 3H8OA 3T1LA 4U0WA 2OXBA 4DXTA 1UOBA 2HWE3 4MUVA 2VGDA 5SV8A 2JSCA 1BBT1 2MH2A 3W6KB 2FSWA 4M01A 5FY4A 1VI0A 5E8GA 1DHKB 1AXZA 3FLRA 4LKDA 2YU2A 2CW8A 2H27A 3OD4A 1ASJ2 2BY0A 1U78A 1LOFC 2F5DA 1LNWA 4AW7A 3ILRA 1XC5A 2UYAA 4OMZA 4XDOA 3IAM2 4HYEA 2LY2A 4Z2WA 3VBHA 1JYIA 3IUOA 5D8KB 2CUJA 3UKGA 2ORZA 4BA6A 2M7AA 3FE5A 1LEBA 1DGWA 3T2OA 1GT0C 3HT1A 3Q8BA 1W2OA 3ZR6A 2QQVA 4NPLA 1HB1A 1YFXA 5HLIA 3R0RA 2BUKA 3WDTA 2MC3A 2W4SA 4CH7A 2UUZA 1UYYA 3ZFFC 3ZQ7A 5JIAA 2DT7B 3IRQA 5D21A 1GZWB 1H8TA 2DI3A 3LSTA 3E0JB 1PGSA 4PJJA 3HKZA 1VQMI 4NE9A 2OU2A 5K0UC 1SFEA 3IKVA 4NHKA 3BTJA 4ZPIA 1AR81 1XE8A 2V1NA 4AU7A 2PHRA 2ZJQF 4RLQA 1WI9A 4G12A 2JKBA 3LQRA 2C4XA 2MSYA 2D6MA 3H7YA 1GHCA 4GDFA 1OH3A 2ZFWA 2X5IB 3BG6A 1V54H 4ESFA 4FFGA 3A1YA 4CDQC 1ENHA 3GMEA 1NK2P 1JHFA 2XONA 4YFXF 2NOGA 3H8UA 4PK4A 2EXIA 3O1OA 3OD0A 1EAH2 4IEUA 2OF7A 1VRH3 2JG9A 4JGYC 1EP0A 1VQ6I 3F72A 2X09A 2KDOA 2M4KA 4CCEA 1FNNA 3HOBA 3ZFGA 3K2AA 1LFUP 3HUGA 3C3WA 4U88A 4N8MA 4Y5TA 1R1UA 3MFAA 5GLZA 1JTZX 4KQ7A 1Z7UA 2C6YA 1ONVA 2PMZA 3VBFC 4EWAA 4QU1A 3SEQA 4LKEA 4QPGB 1D0GA 1K7AA 5DAWA 2Y0SN 2DO7A 1F2NA 2RR11 5FYUA 2KL4A 1BZWA 1WKYA 3FFQA 4YSFA 1K45A 3ZN0A 2P5BA 5F1JA 4QD2A 3WP6A 4NQWA 2XUMA 1RUC3 1UZ0A 4UB8C 1RVF2 4QT6A 4L97A 2G9ZA 2R5YB 2EQRA 1OA4A 2JE7A 4HBNA 2LUWA 2A5WA 4CUAA 1WI3A 1UL9A 1TMF2 5IT3A 2V4JC 4NC7A 3ECQA 4HLTA 3IH2A 3JXSA 3OYLA 4QX1A 4D9JA 5JSPA 4WVMA 1OYIA 3PSIA 4UFMA 2GA2A 2WT1A 1EUTA 1PK6B 1LJ7A 1ETOA 1S7EA 4GJYA 2IVIB 5DUXA 4OUEA 3HRTA 3RZHA 2DBNA 3JB4C 1FMD3 5IYCJ 2A1XA 2ME0A 3HG9A 4W6YA 5A6ZA 4E6KG 2B9VA 1HRV3 1E17A 1IC8A 2HDDA 2STWA 5FZLA 3ZQCA 1HKTA 1OLRA 1HQLA 1YQ6A 2XB0X 4QB2A 3ZMZA 3VBRC 1J2XA 4YVSC 2XAQA 5E3MA 5JCTA 2ILMA 3KP2A 2EXHA 5DZEA 5H9SA 2R92J 5C71A 4EN8B 4JX6A 2Q1MA 1ZBE3 1WCSA 2D5VA 1DGRN 2VONA 3FKJA 3DTKA 2CWSA 3LSIA 5FR3A 1BEV3 1IUFA 2EIDA 1IN6A 4Q5SF 2J7MA 4NAMA 1UXXX 2XPUA 3BR1A 3MQ0A 5JAXA 1STMA 3U37A 5EJ3A 5E1XA 2CH0A 3V56A 3HQXA 4YZ3A 5LHIA 2RS12 1ZYRF 3VDBA 2CDPA 1MMDA 1CONA 2V9VA 2HZTA 3KD4A 2W1OA 3WODF 4TTGA 4BQXA 1Z3YA 1TME1 5FMOL 5F9TA 3L2VA 3A01A 1HF0A 3S32A 1IRZA 4XLEA 4B09A 1Z7S2 4FASD 1ZTRA 2K9ZA 5F3CA 2WC2A 1IG3A 3AG4H 3O14A 1CAXA 3JQWA 3T4HB 1BQPA 4XAAA 2YU1A 1WJCA 1MNDA 1Y9QA 3E7LA 3GZ6A 3UJQA 5J1RA 2YPJA 1WGXA 1H6YA 3DPUA 4JQFA 2QVOA 1ULGA 3H50A 3O7OA 3I3EA 4F93B 3B73A 2WO3A 3JRCA 2VE8A 1RL3A 4KJZA 5EJCA 2BQPA 2VNGA 5LA9A 4BU2A 3TNPB 2Y6GA 1IAWA 2GH2A 3MUZ1 5A32B 3WNLA 5AONA 3K4KA 2Q2EA 2BNNA 3GYDA 1Q1HA 5KK1A 3GJBA 1ZKGA 2VM9A 3BTZA 5J1UA 3PNYA 1S0IA 3VKNA 1LOFA 4AVPA 2VJIA 3GFIA 1TWAJ 1UHMA 1ZRRA 4LJZF 2OBPA 4N43B 4BNCA 4UFKA 2CFOA