3LA2A

Crystal structure of ntca in complex with 2-oxoglutarate
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
196
structure length
196
Chain Sequence
b'VETFERNKTIFFPGDPAERVYFLLKGAVKLSRVYEAGEEITVALLRENSVFGVLSLLTGNKSDRFYHAVAFTPVELLSAPIEQVEQALKENPELSMLMLRGLSSRILQTEMMIETLAHRDMGSRLVSFLLILCRDFGVPCADGITIDLKLSHQAIAEAIGSTRVTVTRLLGDLREKKMISIHKKKITVHKPVTLSR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Global nitrogen regulator
publication title Structural basis for the allosteric control of the global transcription factor NtcA by the nitrogen starvation signal 2-oxoglutarate.
pubmed doi rcsb
source organism Anabaena
molecule tags Transcription
total genus 55
structure length 196
sequence length 196
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3la2A02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3la2A01
1YS7A 1O4TA 1ZLKA 4HYEA 3I7DA 1ONVA 1SEFA 2M87A 1W7PB 3DKWA 2HS5A 5CVVA 4RAZA 3BPXA 5ICFA 1U6GA 1D8JA 1UHWA 1TBXA 5BPXA 3G3ZA 4IHTA 4U88A 3REOA 1DPUA 4P9FA 1PP7U 1IRGA 4ESBA 1XB4A 1CX4A 4QXKA 1O3RA 1LDDA 3SXYA 2NAZA 2YX7A 4CHUA 4R79A 4LJZF 5F6FA 5ICEA 5JVTA 4HDVA 2OZJA 3RI4A 4YYOA 1OD5A 4HQMA 1YO5C 2F4PA 1HW1A 1P4XA 4XETA 1BOAA 2BEOA 1J2XA 3GVAA 3NVCA 3ECHA 1TQPA 1I1GA 1JUHA 3SZPA 3KP5A 4K2EA 1Y9QA 2ZO4A 3GUDA 1ZAOA 2NNNA 3JSPA 2VBYA 2NRAC 4LLLA 3BY6A 2FEZA 2MD5A 2O0YA 1UD1A 4EJOA 2PTMA 2RC4A 3QU3A 5ILUA 5E17F 1FI2A 3NW4A 3GYDA 2IP2A 2GC1A 3IHUA 4LLOA 4OLLA 3WODF 2D5HA 2UZKA 4ZH4F 3GZ6A 1X7NA 1QZYA 2YX4A 4Q4ZF 5E1RA 4O9EA 2A61A 3NL1A 4M6YA 5E20A 1G6NA 3ZDSA 4LK0F 3BOQA 5D6FA 4DNCA 1XN7A 2Q1ZB 2UYAA 1XDSA 4EJVA 2L4MA 3J81Z 3ELKA 1OMIA 2PI0A 1BN5A 3GZ5A 2OA2A 5FLIA 1G3SA 3U11A 4HF2A 1R58A 4EGYA 2IXHA 1CAUA 2XAGA 4HSJA 4MQ9F 1FSHA 4XLNF 1YYVA 1D8KA 4OFGA 1KA8A 1PUEE 2PQ8A 3LAPA 5EFUA 3H3UA 2L02A 3ELNA 5ICCA 1KQ0A 2CAUA 3WTWC 3N97A 1MJ9A 1P4WA 4N0BA 3LOIA 1QPMA 3OGJA 2P8TA 5JSOA 1FY7A 2JSCA 1A04A 2O8XA 3WGIA 2CQKA 1S29A 1UB9A 3CO2A 3LA2A 4A0YA 1KQ9A 3WW4A 1BC8C 3KMHA 4AVPA 2HQNA 4I0AA 4KWKA 1WQ2A 3K2ZA 4A5NA 4ZYHA 5FFXA 4AIJA 5FGMA 2MLGA 2EAAA 4EWEA 3V7RA 2OA4A 5ILVA 4NB5A 4HX7A 1U8RA 4XFAA 1T0FA 3MAJA 4MZUA 1J9IA 4OIPF 1EY2A 4RGXA 1MKMA 2JT1A 4LFUA 4LGWA 3ROUA 1T39A 1IUYA 3SFZA 2F5FA 3KP2A 3O3KA 1IPJA 2A68F 4LK1F 2ZCWA 3I4PA 4EMSA 2UXNA 1VP6A 1Q5OA 4KIFA 1WLTA 4IF4A 2WFPA 1T38A 3GW2A 2A6HF 4GGGA 2R7DA 4XBFA 4BHCA 3TDZC 4HX4A 3V8KA 4UV9A 3MEXA 3E3VA 1HSJA 3TO9A 4EJTA 2ESNA 3SCFA 2ZBKA 3CUQA 3HRMA 3WTSC 3S2WA 4R52A 2PAKA 1LB2A 1FOKA 3CLPA 3WW1A 2FU4A 4KICA 1VTNC 3MYXA 4H0EA 3WW2A 1ZREA 4ENJA 3GEZA 1UPIA 2BYVE 2PMUA 2UWMA 4MTEA 2VONA 1R00A 2H09A 4HQEA 5TJJA 3R6SA 1J3QA 1KYZA 4U0VA 4MGKE 3WTYC 4HLYA 2RDPA 3P9IA 6PAXA 1WRJA 3EETA 2Z9OA 3H1WA 2FA5A 4XFBA 2P7VB 2RN7A 5D5UB 4LULA 3E6DA 4LA3A 4XF1A 4HVQA 4M72A 1ZRFA 1Q43A 3F6VA 4F8AA 4XF0A 1IPKA 2ATFA 3ZPLA 2OYZA 1NE4A 2IRFG 3D0SA 2XROA 3B02A 1PP8F 1CGPA 3RJPA 3EUHA 5JI6A 1ZYRF 4ONUA 4UUVA 2HKXA 3DP7A 1T2KA 1J7KA 4EWAA 5D4RA 2KIUA 1KQ8A 3J7AO 1L0OC 3VB2A 2ESHA 3NRVA 1ZNPA 3CTAA 2HTSA 5J3UA 1UIKA 2PBIA 1XCVA 3HT1A 4HLTA 1HKQA 2XAFA 3Q5FA 1U5TC 3QACA 1YQAA 1Z6TA 4CO8A 3RZZA 4IJAA 5DCMB 4A5MA 2M5WA 2ZKZA 5C8WA 5DV5A 3F8MA 3BCWA 2CFXA 1ODDA 2ZJ2A 5F1RA 2ZMEB 4I98B 2O3FA 2Y0OA 3QAHA 4O3MA 1HKTA 1XSXA 2CSOA 3E6CC 3G73A 1U2WA 5HDKA 2H6CA 1B9NA 1LEBA 5H20A 2KIMA 4YFNF 2M30A 1R1UA 2ETHA 3ES4A 2K0GA 1K78B 1FBQA 2EV5A 1ZVFA 3RYRA 4KFCA 3LWFA 3GFIA 2W25A 2GA2A 1EPZA 2PAEA 4EM1A 2FBHA 3ES1A 2EFNA 3ERED 5IT9Z 4Q29A 3R0JA 4HSLA 4IEYA 3C1DA 3WG9A 2F5DA 1K78A 4L5JA 4UV8A 2YR2A 1ZG1A 2PFWA 4AXOA 4R8HA 3PFIA 4PIXA 4IEWA 4P5OA 4MGRA 1RI7A 3PVBB 3FMSA 1J0RA 3C7JA 1LQ1A 4D7TA 3ABUA 1J75A 3FXQA 4PDKA 2QM3A 1ZARA 2XGXA 2JPCA 3PLQA 3SHRA 4KIGA 5J6XA 3FHZA 2XAHA 4Q47A 2OPKA 5HI0A 3FM5A 4IESA 2XKPA 4HDUA 2OU2A 4RAYA 3BU7A 3UKNA 1FXZA 2DW4A 2Q8KA 5E1ZB 1R5HA 1BBYA 4L11A 2B0LA 4OIOF 1GXQA 5HLGA 1EYBA 1S6LA 2XL7A 5E16A 3CO7C 1J1LA 3FFQA 5ED4A 1NHAA 5JCTA 4Y15A 1S3JA 3WU0A 2QBYB 2B5HA 3TNQA 4U7BA 3R4KA 1JE8A 1HBXG 5D5VB 2GC3A 5LGNA 1R1TA 1XGOA 4LG0B 1MGTA 2JPBA 3U10A 5DD8A 5FFZA 2ZNYA 1SFXA 3E6MA 4MHGA 4M73A 1EH6A 1BIAA 4OINF 1W5TA 3HHHA 3K69A 2BNOA 1ON1A 5L3GA 5DYMA 4ZYEA 2NS0A 1I27A 5H6RA 2EVXA 1VR3A 5LRSA 1YUDA 3RDIA 3F8FA 3ZMZA 4KDPA 4Q0QA 3T0YA 2BNMA 4J1WA 4ZYGA 4M9XA 3R60A 3FHIB 4EQQA 2ET7A 3WTUC 4HW0A 4MEYF 5KHIA 1ZX5A 4MQVA 4UVAA 2K4JA 2VODA 3KLNA 5C6CA 3KGLA 3NSTA 3BP8A 2ZFWA 4DQ2A 3SXWA 3WGGA 2HYFA 4RGUA 1CF7A 4PZJA 2IC1A 3HIFA 4AVBA 1LJ9A 1LNWA 1I6XA 2DK5A 2XL9A 4M9ZA 4G6QA 1YFHA 2E1CA 4FHTA 3GFJA 5I91A 1LR5A 1RGSA 1YFUA 1H1MA 2P6TA 2D93A 2D2WA 4QM9A 1E2XA 3PQJA 2VOPA 1ZZ8A 3FMRA 5IT9K 4MGIE 1PM7A 2P5LC 3CL1A 1F1ZA 1F5TA 2QZ8A 3SZTA 3RTRA 2L4AA 1QBJA 4BQAA 4UVCA 1CAWA 5BUVA 3ZMSA 3BALA 1QY4A 1Y3TA 1JHFA 5ICGA 4HA8A 3V7SA 1UHMA 2FBKA 4OMZA 3RKXA 3OOPA 2XAJA 3LQQA 2Q2EA 3SMHA 4ON0A 3KCCA 2H27A 4I02A 5LRRA 2Q30A 2XLGA 2Y75A 3WTTC 4EVIA 3K1PA 2FMYA 2MA3A 2MNGA 3ZMUA 4HV6A 4CDGA 4M74A 3H1YA 5LEJA 1W7PA 4F7ZA 3ZN1A 4CICA 4XF3A 3USSA 5L3CA 2FRHA 4RGRA 3SHFA 1FX7A 3K9TA 2IJLA 5J7MA 2GXGA 5LHGA 2COMA 3V8LA 4AQ6A 3WTXC 2J5PA 4PJYA 1GQGA 3JTGA 2F2EA 2HTJA 1Q3EA 4M6XA 5BOXA 3U9GA 3HSRA 5DUIA 3L7WA 4XLPF 4FX4A 4WXHA 3JW4A 3FMQA 3HTUA 1XD7A 5LGUA 3HOTA 4I7HA 4AQ2A 4TLFA 5EEHA 1YLFA 3ZMTA 3MCZA 4EM0B 1BI0A 1F4KA 2OD5A 3KE2A 1PMIA 4ZU4A 3KEQA 2VBXA 1NXMA 1H9GA 3FZ3A 2EA2A 2H94A 4WX9A 4QMAA 1Y0UA 2VXZA 3ZN0A 1BI2A 3ZMVA 2P17A 4E2SA 5EZWA 4YG2F 1FP1D 1H1IA 2ELHA 2QWWA 4Z2YA 4IEPA 3FE5A 2EA4A 1OR7A 3F8CA 5D8KB 3L9FA 3T1BA 1V3FA 3KP7A 4GXOA 2O6GE 3D5LA 2MHFA 2B9UA 2BV6A 2KXLA 4KL1A 1HXDA 1G3WA 5ILSA 2PQQA 4LMYA 2XKOA 4QLCU 3HTSB 4UNOA 3M70A 1XGMA 3QPHA 4HV5A 1Z91A 2KJBA 5AIQA 4L0ZB 4IPAA 1NZCA 2XHKA 5HLIA 4ZZDA 2QCSB 4TV7A 5F64A 2FMLA 2BE5F 2UY8A 3HRUA 2H0VA 3TO6A 4XF9A 3F8BA 2WWYA 4P55A 1T6SA 3KEOA 3LQRA 2DPDA 2MPFA 5AIPA 1O7FA 1W7PD 3I64A 3KP4A 5L3DA 1U78A 3W6KB 1FYLA 4LD5A 3DXJF 2HDCA 1MJAA 3CO6C 4A0ZA 2QQ9A 4B8XA 4BHBA 1FBSA 1O7LA 4HBLA 4KWLA 2LF8A 3IRQA 3ML6A 2KJCA 2R7FA 2MH2A 3DQVC 5CVUA 2Z33A 1OPCA 4MV2A 1OYIA 1YTYA 1O5UA 2V1XA 2C0ZA 2PN6A 1SQ4A 2VT2A 4QWQA 3MDPA 3SCHA 1YW7A 4HN0A 3U0ZA 3ZP5A 4OIQF 1E17A 3I0TA 5CYVA 4P9UA 3RKYA 3I59B 3T8TA 2GA1A 3H7JA 1ZN2A 1IN7A 3IKTA 2IVMA 1S7OA 2XIGA 2C6YA 4XFCA 2EFQA 5J8CA 3I54A 3LWCA 2O03A 1JHHA 2V6CA 4IEXA 5FLHA 2K27A 2W85A 3F22A 4META 1FZPB 3ISPA 2ZKLA 2GH2A 2CO5A 2HWVA 3DFGA 4EGZA 1I5ZA 3MZHA 4J1XA 3BJAA 3RIRA 1EV7A 2W24A 1MD0A 1TTYA 4ENMA 3WTVC 3NEUA 5E8GA 3CLOA 3M9AA 4KMUX 1J58A 1J5YA 3ECOA 4ZZLA 3RPQA 4I3PA 2K4BA 2ADUA 3FZVA 2DLLA 5JR3A 1Z05A 2K7LA 2EB7A 1EP0A 1RNLA 1DP7P 3H8UA 5BQTA 1JXSA 3SCGA 4QGLA 5HVQC 4IVNA 1USSA 3J81K 1WGPA 5I8TA 1BIBA 1GHCA 1O3TA 3IBMA 4D0PA 3U2RA 2IXCA 2JZYA 3LZZA 1ZZ6A 5A2QZ 2BBYA 2ZNZA 3E5QA 2YSRA 4NVPA 2FQPA 2PEXA 3L09A 4AD9A 1BI1A 4S05A 4UBHA 3S7EA 5I0RA 2Z99A 1YW9A 4RD7A 3VODA 4D7SA 5HDNA 3P7NA 5D4SA 3VHRA 1ZLJA 1RUNA 3E5XA 2VT3A 4Y13A 1WWXA 4IEVA 1FNNA 4G6DA 3N4MA 3LA7A 2DU9A 4EROA 4E70A 3QU6A 4KYWA 1D5VA 4YSFA 5I93A 4S04A 4L5IA 2V1UA 1LRHA 4KN4X 4ZYDA 3IWFA 1K79A 5KHKA 5H6QA 4I09A 1HSTA 5DCMA 3EQEA 2STTA 1RZ4A 3O14A 1WI9A 3DPTA 4N9IA 1SFUA 1J59A 2ZMEA 3M3IA 2VE9A 3M7GA 2IA2A 5D1IA 1X82A 1QGPA 1S8NA 5E8IA 1XE8A 4O5VA 2G7HA 4LTAA 5KHHA 5FO5A 4NHJA 3TDUC 3L2HA 1G3TA 4FAGA 1T98A 1P92A 5I8YA 3JZVA 4LUKA 5KK1A 5CLSA 1IRFA 5LLQA 3QP5A 1OI6A 4Q0UA 1CAVB 4JQFA 2BGCA 5DD4A 3ABTA 2LNBA 3C3WA 3IDCB 3L2CA 4JBAA 5J8FA 1OFNA 4RGSA 1XMKA 3HOSA 1U5TB 4EWDA 3WTZA 4BHPA 4LB6B 1I1SA 2HZTA 2GXBA 4JTNA 3RYKA 2PJPA 1CAVA 1ZGAA 1F9NA 3D82A 3OCPA 4OIRF 4HZFA 4G94A 4ZU5A 4WZCA 2HOEA 4WXDA 2GC2A 2MH9A 1DZTA 3LSTA 3J80Z 3QOPA 4IRIA 3GX4X 4BH9A 1GXPA 4LEJA 1OYYA 5JFRA 1ZRRA 3Q9SA 2X4HA 2UYBA 2D45A 2WTEA 1ZRDA 4LA2A 4EJWA 1Z7UA 1WSUA 5BMZA 2DK8A 1IW7F 5FB2A 1ZZBA 4CYDA 2ISZA 2FQ3A 5CU1A 1QQIA 2L54A 2HYGD 3O6BB 1DGRA 2HR3A 1IF1A 3HSEA 3FX3A 4OMYA 4ZU7A 4O6JA 4YFKF 4MX3A 4HMZA 2QBYA 1KU2A 1KU9A 3KP6A 2MC3A 3GF2A 1R7JA 3RYPA 3T5XA 3TKYA 1L3JA 2DI3A 3HRSA 1ZZ7A 5TRDA 1TQ5A 3IWZA 2JTVA 4HOBA 4LG0A 2VC1A 2L01A 4AVAA 4GULA 2D40A 2A6EF 1V4RA 3QRFF 2P5VA 5FLJA 3CDHA 4XSXF 1Z9CA 4FX0A 1V70A 2M8EA 4Z07A 4Q48A 2G9WA 4UBGA 4IRHA 2PAMA 5I0TA 4YNIA 4P96A 1YIOA 5E18F 2QENA 1R5GA 5EEGA 3B73A 5K5RA 4KU7A 2DT5A 4ASNA 1O3SA 4RB2C 2RV8A 4I01A 2AS5F 2HJIA 1OKRA 5E1WA 4PIYA 3MFKA 3GO5A 1O3QA 1MZBA 5HS9A 4FBFA 2XLAA 4IHSA 2DPUA 4HBNA 5FLXZ 3KP3A 2WV0A 4B29A 1YS6A 5L3FA 3DN7A 3IKVA 3BB6A 1TQIA 2CWEA 1SFEA 2OAZA 4FT8A 4WBBA 5I0SA 1B6AA 4YRDA 4KT5C 1RC6A 3AAFA 1DDNA 3FF5A 1HQCA 2XV4S 4IEQA 4Q0VA 3GFMA 3GWZA 1H0MA 5K5OA 2XASA 2K02A 3SQNA 4RB3C 4IETA 3DPLC 3BROA 2WC2A 2DQRA 2VQAA 1XGNA 1IN4A 3NKTA 1IN6A 2FF4A 1R1VA 1UFMA 2FNPA 3OF1A 2D5FA 1WA4A 2TDXA 4G7OF 1FPQA 2VOOA 2GC0A 4Z82A 3TGNA 1IXRC 1D3YA 2A69F 1NYWA 3CEWA 1R22A 3CJXA 4GO1A 2XLFA 3WE2A 5JSPA 5HS8A 4CGZA 4HVOA 1K7AA 2ETEA 2D1VA 3F23A 2DAOA 2X0LA 2QJVA 3HRTA 2FNAA 1IN8A 1TW2A 4XEZA 2XUBA 2CGPA 1BI3A 2IPQX 2RKHA 3J80K 3HHGA 3HQXA 4YARA 5KHGA 1XCBA 4EM2A 3HYIA 2QYOA 2M1BA 2OQRA 3JTHA 4HLXA 3FWEA 5BY5A 2QUFA 2K9ZA 4RB1A 2GQQA 2PA7A 4HX8A 4XRFA 4LLNA 5HDGA 3K0LA 5LBQA 2P5KA 2QLZA 3EHKA 3WU1B 2GWRA 3RKWA 3MWMA 3CF6E 2ET1A 2V1DA 1W5SA 2EFPA 3FJSA 4MEXF 1UIJA 4L9JA 5I0UA 5FDBA 1ULYA 4HF0A 2XVCA 1RUOA 1UCXA 3I53A 1G4DA 2P6SA 2HQRA 1RIOH 3BPVA 3IL2A 4UXAA 3S0MA 1Z1DA 1TW3A 4OU0A 2Q0AA 3UKVA 1KU7A 1B9MA 4LB5A 1P6RA 4HF1A 5CVRA 3LA3A 1L3LA 4P9GA 3M1EA 1KYWA 1WKMA 4ESJA 3K1MA 3G7DA 1BC7C 3FXRA 4YIFA 2IXJA 2RQPA 3BJOA 1GQHA 4B09A 1VJ2A 2GAUA 2NNYA 5HLHA 4IEUA 3ZQ7A 5FPXA 4MGZE 3WE3A 4KN7X 1G3YA 3RPUA 1LDJA 4KWJA 3U1DA 5FLXK 3COAC 2V79A 4NQWA 4XFHA 1CAUB 2Y0MA 3C18A 4XSZF 2KIFA 3DL3A 4AWXB 3CUQC 1AOYA 3Q9VA 2O1QA 4L9NA 3E5UA 3I5UA 2EWNA 2Z5UA 1ZZ9A 2CAVA 3BJ6A 3H3ZA 4L2NA 4A0XA 4LUMA 3T8RA 2A07F 4BYYA 1SFNA 2PLYA 1FLIA 3TNPB 4BXUA 4KNYA 2OZUA 5HS7A 1REPC 3ACLA 2O8QA 3FM3A 1SD4A 1IXSB 1FC3A 2RVCA 2QNKA 4ENKA 3F21A 2EV6A 2FOKA 4YIIA 2B8MA 4DINB 1YWKA 1O57A 1P2FA 4ENNA 3H1MA 2LKPA 3BZ6A 2UXXA 3FXUA 2LSOA 4KU8A 1BJAA 1KU3A 4M71A 2PHLA 2A5YB 1ZG5A 1YLLA 2DQLA 2QDRA 2OZ6A 2E9QA 3GLXA 4WVZA 1USTA 3DV8A 3EYYA 3EDPA 1QXJA 2HEOA 1S7AA 2VBZA 2Z3YA 5D6EA 2OBPA 1SMYF 4CXFA 4M9SA 3BPZA 5BV6A 2ISYA 1IZ1A 1UCRA 2IA1A 3CUQB 1W4MA 2O61A 4IXAA 5ERIA 3NJZA 2JRTA 5D5XB 2FE3A 4A6DA 3TOAA 3JAMZ 3LAGA 4JV4A 2V09A 1FWZA 4IEOA 2PMHA 4OOIA 3UKTA 3WW3A 3I58A 3F72A 3DF8A 4HAMA 4WF2A 3TO7A 4ETSA 5LHIA 2IXKA 2PHDA 3H7YA 3EJKA 3S7IA 3IRRA 2RGVA 2HKOA 3I59A 5FD5A 4R1HA 2DFIA 2VC0A 1X8EA 4G7ZF 3R61A 4ORFA 4AIKA 5BXXA 4MGYE 1B4AA 3NQOA 4U0WA 3E97A 3H92A 3PNAA 1YW8A 1P4AA 1U12A 5JSRA 3O2PE 5AONA 5BPDA 1R23A 2NYXA 4GYIA 3HSFA 1DPRA 4H7LA 1O5LA 3TQNA 3OD0A 2Y48A 2IW5A 3MZYA 3GYHX 4BIFA 4MNUA 4PGGA 3BDDA 5DUKA 1IAWA 4BAYA 2MLKA 2IA0A 2L3DA 2R3SA 4WCGA 3KLOA 5CVJA 3MQ0A 4EJUA 2E1NA 2QVSB 5K1YA 1QXRA 2G7UA 3P9CA 2FBIA 2J5OA 5KHJA 3D0JA 2Z69A 5KVRA 3JSOA 4UHTA 5JAXA 3EO6A 4A12A 1RL3A 2I45A 2DO7A 4KIBA 2Q4SA 2KKOA 2RNJA 4UVBA 3E6BA 1CAXB 2AXLA 4ESFA 4U7DA 4L9TA 3EYIA 4QGMA 3ZMDA 4E2QA 1FYMA 5K8SA 2Q0OA 4AIHA 4WK8F 2FSWA 2QQAA 1YFYA 3VFZA 1HW2A 2CW0F 2FXAA 2F5CA 4A2UA 3V7CA 4XFGA 1ZHFA 5KBFA 1HW5A 3M8FA 1OYWA 3KGZA 4IEZA 1LDKB 4A6EA 2A3SA 1CAXA 3QP6A 3WGHA 1GVJA 3EQLF 3M8EA 4JK1X 1TQMA 5D5WB 4QX5A 1YFWA 3ST7A 2CG4A 2GZWA 4Y17A 5FPZA 3KETA 5I8SA 2DBBA 2IXIA 1K6OA 2VECA 4JVAA 5JR7B 1TLHB 3KSCA 4X6QB 2D1HA 4L9VA 5BS6A 3OV8A 2VBWA 1YHFA 5D8LB 4Q0SA 5FD6A 3ETQA 1ON2A 3IIAA 1J3RA 1XRUA 1UW8A 2VN2A 4XFFA 2Z2SB 2GIVA 3C3VA 2DCTA 4I2OA 1YFXA 2DTRA 3TOBA 2IT0A 4O9GA 2YU3A 4XF4A 4WXCA 2H6BA 1B1BA 5J48A 4QM8A 2VPVA 5K5QA 1XGSA 5LHHA 3JAMK 3IDBB 1DUXC 1SD6A 2EA7A 2V9VA 1ZZCA 1XSVA 3F3XA 1X8MA 1ZRCA 2HFHA 3CUOA 3GXOA 3EBRA 3QPTA 1SAXA 4E2GA 1STZA 2EV0A 1SD5A 2STWA 4Q0PA 4HVRA 4PGHA 1BM9A 4I0BA 1ZH5A 4L0YB 3I71A 1XE7A 5AVPA 2LDUA 3F8NA 1U5TA 1HKSA 3LAJA 5DEQA 3W6JB 1QZZA 2PG4A 2KRFA 1X3UA 5JHUA 5LEKA 4WWCA 4AVCA 2ACJA 4BNCA 2GU9A 4KUMA 1FSEA 4MUVA 1Q1HA 4FAHA 3P9KA 1TNSA 5CVIA 4QGNA 2W84A 2CYYA 2BNNA 3KFWX 3DEUA 3K1NA 1DGWA 1AWCA 1Z6RA 4RB0A 2E7WA 5BPIA 5A2QK 1C0WA 3MPBA 1R36A 5CADA 1TNTA 2QQBA 1LKNA 5DCFA 2PFBA 2K86A 1DZRA 4MH0E 3R0AA 3HT2A 3GFLA 2EFWA 1H9TA 2UY9A 3VEPA 3V8JA 1IN5A 4PCQA 4GCVA 3GBFA 5FQ0B 5E1XA 4N9HA 3H50A 3HUGA 1XMAA 4UXNA 1PDNC 4U0YA 4GYGA 5CJ9A 2XAQA 4JTOA 5T3NA 1SMTA 1FYKA 2P4WA 4KMFA 4HN1A 4KA4A 1MDMB 1ZGJA 4G9YA 1JGSA 5FCCA 4L18B 5FQ0A 4X6RB 2HGCA 2CV6A 3RNSA 4G8XA 1CF7B 2M45A 1QNTA 1QO0D 1MJBA 2EJRA 2EFOA 2YPRA 5LGTA 4LLGF 1XDUA 1IXCA 5IT3A 4PIZA 2XRNA 1MDMA 4XFIA 2OQGA 2F5EA 1FP2A 4G7HF 5L3BA 4MTDA 3V4GA 4YFXF 3LFKA 1EH8A 2P7CB 1LVAA 2ZXJA 5L3EA 2MBFA 2VE8A 3OTFA 1YG2A 2LF7A 3BWGA 3IC7A 1U3EM 1XSDA 3H9AA 1EH7A 2W57A 4Q5SF 2IXLA 1FT9A 3CJNA 1CAWB 2N7GA 3PQKA 1LEAA 1QWRA 3L00A 2QVOA 5HOOA 4RS8A 3ULQB 1KGSA 4EV0A 1NE6A 1SD7A 3KZYA 1FBUA 3F6OA 4K8FA 2EK5A 3KZZA 3VOEA 1ZG3A 4CZZA 1RTVA 4IERA 5DDGA 2E7XA 2PYTA 1B59A 4IRGA 1J3PA
chains in the Genus database with same CATH superfamily
2J42A 2XONA 3CU7A 4AWDA 5B3SH 2PHWA 3AG4H 1PMHX 5L9VA 3AKZA 3DKWA 1W9WA 3SEZA 2W00A 4BZ4A 3TL4X 3BPXA 1HB2A 1GANA 4F92B 1U6GA 4QKBA 4U88A 4MYEA 5JZGA 4LKSA 5K4LA 2XGCA 4M4RA 2LP0A 1KS5A 4LR4A 1O3RA 2OUMA 4CUGA 2AACA 1MQTC 4DRRA 4HDVA 2O14A 4HQMA 2OX0A 1EAH1 1Z7LA 3T0AA 4A69C 1OCZH 1P4XA 1YQ5A 3D1NI 1QPIA 4Z1VA 1IPSA 2J1AA 4QX2A 1TQPA 4RQPB 2BV4A 3OPTA 1I1GA 3ORJA 4A3EJ 3SZPA 1V9U3 1PO23 5LBBA 2ZO4A 2BVBA 3VHOA 3VZJA 5EZHA 2NRAC 4LLLA 1PK6B 2O0YA 5FIXA 3L2RA 4EJOA 3S30A 3NMBA 1VBC3 1WUVA 4HNUA 1Y0NA 2R16A 2DUPA 2VOXA 4OQ9A 2GC1A 1PNFA 3FISA 4N53C 3APBA 4OLLA 2XBO1 1EKEA 1W0PA 2ZGKA 4AYUA 1X7NA 3B9CA 2BY3A 2WT1A 4CVUA 4Q4ZF 4XHBA 5E1RA 2XJRA 4O9EA 3CD6I 3OGRA 3QYEA 4FTBA 1SVOA 1G6NA 3BOQA 3PJYA 4E7SA 2MGQA 1XN7A 4IGPA 2E5ZA 4EJVA 2LTPA 3EUAA 5GADJ 1VQOI 2KRHA 3X29B 5FLIA 3U11A 2E5NA 5CFDA 4EGYA 1W6NB 4R9CA 3GF6A 3DCFA 4L99A 2YYOA 4LBMA 2NOJB 1FSHA 4XLNF 1PUFB 2CV1A 3IDEA 1OLQA 2RS33 2PQ8A 5EFUA 2Z16A 3BCAA 5FLVA 3WQ1A 4OQ8A 2ORXA 3ELNA 4N43C 3LNQA 2WNUC 2CAUA 3WTWC 3N97A 1JYTA 1GZCA 1GZTA 4FCYA 1SZBA 4Y22B 5JSOA 2ERFA 2X8KA 4QKDA 2CGOA 1UYPA 2UV1A 1S29A 1LCLA 5DM6F 3GJBA 4KWKA 4ZYHA 5FFXA 5J1UA 3BOWA 5FGMA 2EAAA 3V7RA 2FD5A 3CJIA 4XE9A 3KV5A 2BRTA 1U8RA 4XFAA 2E60A 4OIPF 2RR12 3B6AA 2QQOA 4GIQA 1AKHA 1P7JA 3O3KA 2LY1A 4LBQB 3U37A 1LPQA 1VP6A 4UF0A 4AM3A 3ZDVA 1UHSA 4GGGA 2R7DA 5M5YJ 3MEXA 3FBMA 1RXFA 3A2KA 4YG0A 3WTSC 5FXVA 4XC9A 1LB2A 1FOKA 2Y60A 1RIRA 3CLPA 2FU4A 1APNA 3WW1A 4QU2A 4BEHB 2BP6A 5A3OA 3VYRB 2BYVE 1OH4A 4C2UA 4H2AA 2VONA 2H8RA 1R00A 1XS9A 1Y9MA 5TJJA 1R5ID 5ABJC 1AYM3 4H4KC 2X48A 4LBKA 2W91A 3B9IA 1JYIA 3VDDB 1D1BA 2HDWA 1YIFA 4NC6A 2L9SA 2RDPA 3WG2A 1JN2P 3LFMA 5FRMA 1WRJA 1R091 2Z9OA 3H1WA 2R5YA 3M1CA 1V9U2 3E6DA 1HB3A 3GTOJ 1F4AA 4ZZ5A 2VQ0A 3VHNA 1V6LA 4GRIA 2XVLA 2PN5A 2PMWB 4XF0A 1IPKA 4FPFA 2IRFG 3D0SA 4LMFA 2C1FA 2F4IA 4C1WA 2D6LX 2AEZA 3EUHA 3PO3J 2HYXA 5JI6A 4ONUA 4UUVA 2HKXA 1YIJI 1SLIA 1TME1 3HBZA 4NHKA 2W1QA 3FHAA 1L0OC 5FKCA 4EYUA 2ESHA 5C44J 1ZNPA 1BVP1 3CTAA 4CEWA 4FFFA 4Y1YA 1RR7A 1XCVA 1LOCA 1RR8C 3HT1A 4M3CA 2VMCA 3Q5FA 4BS9A 3VBHB 1UY4A 2ZKNA 5DCMB 1W3XA 4A5MA 2M5WA 3KYCB 1FNZA 2QQVA 4QDRA 5C8WA 1AXKA 2ZJ2A 5GM0A 4QPIC 1H4GA 1ND2A 4A93J 5APAA 3P5JA 3PMEA 2DA6A 3MV11 1U0AA 2IBDA 4CDXC 3DEEA 4IZZA 3PJRA 2Z42A 5JUVA 3MN2A 1LEBA 1G86A 2G0EA 1IV8A 4LIUA 2B7YA 3HNMA 2F6CA 5I0DA 2K3PA 4AFAA 5G04L 1YRNB 1NOVA 1OBNA 1H2NA 1TT5B 3LWFA 3GFIA 4EM1A 3VDBA 1JZ7A 3JRDA 3BR5A 3R0JA 4HSLA 3KV9A 2CWMA 1Z77A 2XR4A 2F5DA 5FBJA 1K78A 5C3SA 1TC3C 2ECCA 1HLCA 4PIXA 4IEWA 2RMU1 3A0NA 3QCWA 3ZMNA 4EE2A 1TL8A 2P34A 2VI6A 3C7JA 1F15A 1LQ1A 1H88C 2UWCA 4D7TA 2NPIA 3VHPA 4PDKA 3LDBA 2R063 3SHRA 2D7FA 5J6XA 5FKOA 1MH3A 3MKYB 4UFLA 2OPKA 5HI0A 5KAIC 3OYWA 2DOFA 5EIYB 1W8NA 3LPGA 2PHUA 4W6XA 2L5QA 2Q8KA 1WWYA 3AL0B 2CUFA 1QNYA 3DLAA 2B0LA 3CDZB 4OVEA 5FY5A 1LNSA 2M0CA 3CMMA 1GXQA 5HLGA 1RUI3 3W5MA 1RHI1 3CO7C 4A42A 2W39A 4FPHA 1NHAA 5JCTA 4Y15A 5C8CA 2QBYB 3QQAA 4JYKA 2HI3A 3K4BA 3FHQA 2WB1N 5D5VB 5LGNA 1R1TA 2HXIA 3U10A 3ZXFA 3IPVA 4HPKA 5FFZA 3L2UA 4XTPA 4AAPA 4FPGA 3VZNA 4DEQA 2FHRA 3VL8A 3ZQCA 1SFPA 3CMYA 3HHHA 5L3GA 2XB0X 4ZYEA 1AF9A 3M7AA 4JGYB 1K5MA 2GMMA 1N77A 1G7YA 1HV0A 4DRVA 1DQUA 3ZYFA 4Q0QA 1KJLA 3S1MJ 3T0YA 4R4XA 2BNMA 4J1WA 2VZ3A 1US3A 1NA1C 5EHDA 4HW0A 4MEYF 5LWBA 5KHIA 4Q5OA 1JYWA 5FY0A 1SFKA 5HV4A 2VODA 2Y31A 4DJAA 4NN0A 2ZX1A 4K1YA 3PIPF 5DDJ1 5LBFA 2W0XA 1CF7A 1SVMA 2IC1A 3HIFA 1W05A 1JI6A 5BNNC 2W47A 1GP6A 2DK5A 4G6QA 4AGGA 1YFHA 3UGGA 3VBRA 4BOWA 1LR5A 1RGSA 1YFUA 4II2A 1H1MA 2D93A 1W8UA 2WZ8A 3PQJA 2VOPA 1C3HA 3FMRA 1COV2 1QJX2 3DGTA 4M4PA 1IS4A 4XORA 1F1ZA 3VYTB 5LD2C 4MXVA 1XYOA 1JZ6A 2L4AA 1QBJA 3KWVA 5DAVA 1CAWA 5FOBB 3USUB 5GAHJ 1OKOA 3BALA 1I39A 1JI8A 5ICGA 4HA8A 1NLRA 1IOAA 3OSFA 1MEC2 2PMZN 4NIHA 2XAJA 1D2QA 3LQQA 3ASOH 4IX7A 3QPLA 5C70A 3M8LA 4PJJA 4CDUC 3H9GA 1F31A 4CDGA 4Z6YA 5FYIA 5D8AA 2X5IC 3N3HA 4CCDA 2HOSA 2R1BA 5LHGA 3F95A 2COMA 3V8LA 1W0TA 2R062 4FXGB 4CCEA 1JS9A 2C9AA 1QQP3 1MBHA 4D9JA 5IVYA 3ZN5A 2HTJA 3ZSJA 5JXGA 4GB31 4RR3B 5BOXA 1RUJ2 1TT0A 3CCMI 1JH5A 4XLPF 4FX4A 1AHDP 2EIMH 3JW4A 2XJPA 1ND3B 3I3QA 4QTRA 4COVA 3ZYBA 2UU8A 2WO7A 1RUI2 1RPWA 1BI0A 3AXDA 4IKFA 3OUJA 2EPFA 5FUIA 4AFBA 3O5SA 4JOMA 2VBXA 3BCBA 1NXMA 3FZ3A 2EA2A 2H94A 3FXOA 1WMDA 2ZGLA 3I2HA 4E2SA 2WLQA 5EZWA 3PUIA 1FP1D 2ELHA 5T50A 3SITA 3ABKH 1IKQA 4ES8A 1OR7A 3F8CA 4NROA 4QWNA 3L9FA 2VW1A 4E8DA 1UMHA 2B9UA 1B72A 2YU1A 3MF6A 3AG2H 3RGBA 3M3EA 2BV6A 2GALA 3O1MA 3BR2A 2KM2A 2VC9A 4CP9A 5FROA 3M70A 4E7IA 1U8BA 3W6VA 1XGMA 2XWJB 2RE9A 3QPHA 5FZOA 3O1PA 3ITQA 1HXS1 5F37A 2I07B 4OUMA 2XHKA 1BKZA 4ZZDA 2QCSB 5FBZA 3DYPA 2AREA 4EJRA 2UY8A 5LA2A 3ZCOA 3HRUA 2H0VA 1IZ3A 3WLUA 4XF9A 4P55A 3GZUC 4AEDB 3L2YA 2XBO3 3K4AA 3WDYA 3W59A 2MPFA 1O7FA 5FZ9A 4QXCA 4LD5A 4YWAA 1CONA 1ETVA 3LPFA 1N47A 4L0PA 4BHBA 2KQRA 4HBLA 4KGQA 4KWLA 1D0GA 2LF8A 3U07A 4ARYA 4YG3A 3W21A 3ML6A 2R7FA 2MH2A 1SDDB 1V5FA 1XC5A 5DMYA 1MMGA 4MV2A 1BL0A 1X1CA 1JJ8C 1VMJA 5E8AA 1O5UA 2L9RA 3HNYM 2EIGA 5F8PA 1YC61 3GZTB 2YB7A 4HN0A 3U0ZA 2ZXQA 3ZP5A 3I0TA 4P9UA 2C24A 4QPWA 3T8TA 4YELA 1AVBA 2GA1A 5AFEA 2KRCA 3KHBA 4JRAA 2XIGA 4CCOA 2C6YA 2EFQA 3ZXJA 5JMOA 4V2FA 3Q8EA 1BXHA 1HV1A 2K27A 4JX4A 2E36A 2CL2A 3BR0A 3OYHA 2CO5A 3DFGA 1I5ZA 2E34A 3OIQA 4N43A 3BJAA 1EV7A 1MD0A 4Z8BA 3DPRC 5ANQA 4X6AJ 5E8GA 3V0BA 3CLOA 1OOPC 1VQ9I 4KI5M 1OQDA 2JA8J 3SH4A 3VKFC 1J58A 1RUD3 1H89C 3BODA 4AAXA 4ZZLA 5KR7A 4GH4B 1EP0A 2UWAA 1RNLA 4RGKA 1DP7P 1VE0A 3Q0WA 3SCGA 5HVQC 1USSA 3J81K 2VM9A 1BIBA 4XKCA 3IT8A 3GCWA 2B39A 2HEYF 2V26A 1XYNA 4ZDLA 3HOZJ 2VUCA 3IAQA 2BBYA 2ZNZA 3HPGA 4C0HA 2L9LA 3S7EA 2Y6LA 5I0RA 1YW9A 4CXXA 5IT6A 5HDNA 4DIQA 3CF5F 2COBA 2VW0A 4NPMA 1ZLJA 1URXA 2VT3A 1HQLA 5TGTA 1R093 1VAMA 2B45X 1VQ5I 4KQ7A 1W3VA 2Y30A 5K0UA 4B43A 3O0WA 2VB6A 2VXDA 5FMBA 4ZYDA 3HN3A 3IWFA 4NJ4A 1HSTA 4IV3C 1IRZA 3O14A 5DN2A 3KLSA 5ABJA 1SFUA 1DGWX 2DT7B 2VE9A 1UKGA 4LKEA 1WJFA 1TME3 4K40A 2IA2A 1UXZA 3OYEA 5E8IA 4QT6A 4DZGA 1PHMA 3FUQA 4CU8A 2OS2A 1XE8A 3AMPA 3PL0A 1X36A 5FO5A 3TDUC 2W2IA 5I8YA 3M1HA 5CLSA 2VL4A 3C7HA 1JTZX 5LLQA 4W4ZA 3SDGA 1OI6A 1JHNA 1CAVB 1YOVB 2FDIA 4M6VA 1PVC1 5A7OA 3ABTA 2KLOA 4COUA 4RGSA 1XMKA 1IQAA 2VQLA 5J47A 4IEJA 1YI7A 3NNFA 4YVSA 2DYSH 3D82A 4HZFA 2QDNA 2HOEA 3I2FA 2ZXWH 1VBD1 4A3DJ 1C57A 2L7ZA 2Z1DA 4Q4V1 1X9PA 1QOTA 3OPWA 5FYZA 5J1YA 3Q8FA 4JQRA 3CBNA 2MFZA 2ZXHA 4CTEA 3BG9A 4JGZB 1H8AC 4XUOA 1OFSA 2RNGA 3OBRA 1WSUA 5BMZA 1GSLA 4QPIA 1ENSA 1XG1A 1VAVA 2VVFA 2ZZJA 3N36A 5JOZA 2ISZA 2NLRA 1W6QB 3UV9A 5EYYA 3PM1A 1RUD2 2EZKA 1IF1A 3OYLA 3AZXA 4GWJA 2CJJA 4OMYA 2RMU3 2MEV1 5KC6A 1A6QA 4QHZA 1XB9A 4HMZA 3KP6A 5L7OB 1L7LA 2JTVA 4JX5A 5AFBA 4AVAA 3OY9A 3VBUC 2JMWA 1UAIA 1Z9CA 1MIJA 4FX0A 2JEMA 4XRSG 3C2UA 5HBAA 4YM2A 4H55A 5I0TA 2BOLA 4YZ3A 4JDMA 5K5RA 5FYHA 1JYXA 1XU1A 2DT5A 1O3SA 4JC1A 5A3PA 1XTAA 2RV8A 2AS5F 1NUKA 3VWBA 5E1WA 4MGQA 3GO5A 3EXUA 1MZBA 4DZJA 4DPNA 1RHI3 2Y2ZA 4IHSA 2DPUA 2BXZA 4RS5B 2DYCA 2YBSA 3KP3A 3VDCA 1RUE3 2HWB2 3O1UA 1TQIA 1UX7A 5EDNA 5GTIC 1VBB3 1VIWB 4AG4A 1B6AA 4Q4W2 2VE1A 2GSYA 1DDNA 1KXGA 3IZOA 2XQRA 2DOEA 4K1ZA 4IEQA 2ARCA 4BQYA 4N90A 3SQNA 5JR2A 3P5BA 3BROA 2Q8CA 1YQ8A 2VQAA 4BQXA 1UFMA 5CNAA 2Y9ZA 1WA4A 2TDXA 4G7OF 1FPQA 2VOOA 4EN8B 2GC0A 5FMOS 1POGA 4YFZA 3DCQA 5G05L 1R22A 4IQJA 5HS8A 3PU8A 1DQ1A 2ETEA 3E7LA 3ZFGB 3BG6A 2DAOA 5DDJ3 3NNGA 4HEA2 1XPWA 4RAFA 3JBG2 2BBAA 3PUHA 2IPQX 2VZOA 1ACIA 5F1JA 1NA1A 2VOWA 1QH6A 2EF6A 4HLXA 2KZGA 2ENRA 4CZCA 1KEXA 3GZAA 4RLFA 1Y6IA 4HX8A 4LLNA 3K0LA 5BNNA 2F4MB 1C8M2 3CF6E 2FDKA 2GBYA 3OEBA 1JKRC 2VOTA 3LFIA 4CEYC 4BBRJ 2XVCA 4XMYA 3I53A 1G4DA 2P6SA 5FFOC 5A7SA 3S0MA 3K4CA 4D7NA 3FUOA 4E7JA 3HOXJ 1I3QJ 3OMYA 3WNKA 1KU7A 4LB5A 1T0FC 5FJKA 3LA3A 4I0WB 2HWF1 2Y38A 4P9GA 4B7EA 3ON7A 5LCWL 1KYWA 1WKMA 3KD4A 4YIFA 2RQPA 2NP0A 2EINH 1ZGWA 1RUF1 2NNYA 5HLHA 3N7MA 5F0FA 3ZQ7A 4A45A 4LHKA 3AMHA 3RPUA 1LDJA 1CX1A 5FLXK 3COAC 2V79A 4XLFA 4CDUA 1R081 4XFHA 1CAUB 2EQRA 5FP7A 2Y0MA 3AP5A 1OJLA 3H8OA 4BCUA 3AKTA 4XSZF 4UUSB 5F5AA 2HQ5A 3NWTA 4MHRA 2JECA 3WP6A 2X5IA 2O1QA 2DFBA 4ISQA 4FTHA 3E5UA 4EN0A 3GZEA 3I5UA 4YZ1A 2X9DA 3C7EA 3RSJA 2CAVA 1RUE2 2W92A 4L2NA 4A0XA 4LUMA 2A07F 4K6BA 1GT0C 4BIOA 4HKLA 1V6OA 1VBB2 3LEIA 1A78A 2X85A 3SYTA 1CIWA 3ACLA 2O8QA 3JCIA 3FM3A 4ZDPA 1K6YA 3BIEA 5GKAC 2RVCA 1RINA 1B8IA 4ENKA 3F21A 2EV6A 1MACA 4LJHA 4UUTA 3PL8A 5H9QA 1YWKA 2A75A 4RMNA 1PNGA 3H1MA 4B8EA 5T55A 3FXUA 2LSOA 4KU8A 1BJAA 4D8MA 4CPBA 2GP5A 2A5YB 3AMMA 2DQLA 3QH6A 2E9QA 2M9HA 4Q4Y1 3WV6A 1HXS3 3DTEA 4QDQA 2OBPA 4CXFA 2XOMA 4M9SA 1IZ1A 1UCRA 2JE8A 2RDQA 1W4MA 1RVF1 3WX5A 4P9IA 2EICA 1MSEC 1PO12 4IGOA 2FE3A 3J8F1 3TOAA 5TISC 3JAMZ 4JV4A 3WHCA 3HOUJ 4CDWC 3LDKA 2PMHA 4OOIA 2JE7A 1XC6A 4WF2A 3DF8A 4HAMA 3TO7A 1ETYA 4RM2A 4YW5A 2RGVA 1EV11 3AB0A 1WCKA 5FD5A 1PGL1 2CUJA 2HPIA 2WYFA 1NK2P 1TZLA 1J83A 1B4AA 3NQOA 4U0WA 4CCNA 3RZDJ 2P3KA 3CDIA 3PJQA 1YW8A 1H6YA 2Q8EA 1OUXA 2KT0A 5BPDA 1SAUA 3AC0A 1K3IA 1V5GA 2D3PA 1O5LA 3K10A 1UF2C 4Y1VA 2Y48A 3L2VA 1NH3A 2C5DA 2YV8A 5C9AB 2IW5A 1IDZA 5CIRA 2Y6GA 1NLQA 4MNUA 4PGGA 1YCIA 3BDDA 5DUKA 1IAWA 2E7TA 3PNVA 4N7UA 1YQCA 1VZ0A 5FZAA 2MLKA 2IA0A 1LFBA 5IVVA 3RQ4A 4PJ0C 3KM5A 3MQ0A 4IV1C 5K1YA 4PDWA 1QXRA 5JLVA 2J5OA 3D0JA 4YG6A 5KVRA 4AL9A 5JAXA 3BR6A 3FMGA 4IDZA 2Y0SN 5FKKA 3WHUA 4QHBA 2PJRB 3E6BA 1ZBA2 4U7DA 3OYAA 5BNOB 4PHZA 2IAIA 4L9TA 1VBE1 3ZMDA 3ZPOA 5K8SA 5A7PA 1WVRA 2H0BA 3JBG1 1OH3A 3MMYB 1HW2A 2CW0F 5CZKA 4A2UA 1ZHFA 5KBFA 5A7WB 3ILFA 1VRH2 2JDPA 3ZSLA 3OSDA 3K4DA 3W3CA 2B46X 5DUVA 3V64A 1E5HA 1V6IA 1Q8QA 4AHZA 4MOAA 1NTCA 3KETA 5I8SA 4IL6C 3MHZA 2A6ZA 3OYFA 4BJ5C 3S3NA 3KSCA 1L7RA 3JXSA 2GH8A 2D1HA 2DWRA 2CUEA 2WT2A 4L9VA 1X19A 1OHFA 1VQNI 5FXWA 1B09A 4RBOA 1T56A 4Q0SA 3HQUA 2XXZA 4RA0A 2JKXA 4XM3A 1DQ2A 2GIVA 2WL1A 2DCTA 4DYRA 4CYCB 4LO8A 4XF4A 4WXCA 3S5AA 4ATEA 5HCHA 3AZYA 2RJ2A 4ZTFA 3LOCA 4AI1A 1QHDA 4WZFA 1A35A 2ZX2A 5LY1A 2EA7A 1ZZCA 1X1PA 5JVVA 1XSVA 1Z21A 1X8MA 3T30A 2HFHA 3GXOA 5FJ8J 3EBRA 4AQSA 3QPTA 2VKHA 5J4YA 4E2GA 1STZA 1VAKA 5C3OA 3BTIA 3FL7A 4LOTA 2ZA9A 4HVRA 1ZH5A 3F8NA 3ZYRA 1U5TA 3LAJA 4FE4A 1LOBA 3I2JA 3HN1A 1NCQB 1QZZA 2WAOA 2IXSA 4QQPA 1W36C 3D6EA 4FFGA 3DEWA 1TNSA 3FIWA 5CVIA 1SEUA 2Y26A 2W84A 3KFWX 2KFDA 2WQ8A 3DEUA 3LL7A 5T5LA 1Z6RA 1S0IA 4RB0A 3OWTA 1X50A 4XAEA 4PT6A 5BPIA 3O0XA 4BPZA 1C0WA 4F55A 4FVVA 3MIFA 1PVC3 1MBJA 1F35A 4HL0A 3HXLA 4WM8C 2IUWA 2F48A 2K86A 4MH0E 3N9LA 3HT2A 3GFLA 2EFWA 1Q8SA 4J25A 3NO8A 5HXVA 1K83J 3HUGA 4NRQA 1XMAA 3A23A 4UXNA 1ETQA 1N78A 3G2BA 3RWNA 4B44A 4E4ZA 4XTMA 2W95A 4HN1A 1I50J 1VBD3 2KDZA 4Q4V3 5C3PA 2TUNA 4LK6A 2VQGA 1JGSA 5FCCA 5FQ0A 2PELA 4NBQA 1BQPA 1MJBA 2EJRA 2EFOA 2YPRA 4LLGF 1XDUA 2WLPA 2MSYA 5IT3A 2V1NA 1SPPB 2XRNA 2DA3A 1IS5A 2OQGA 1X3WB 2VVEA 2QF7A 4MTDA 5BYNA 4YFXF 2AQEA 4Q4X3 1EH8A 2CV2A 5L3EA 3VKNA 1BOBA 1YEWA 4EZ4A 3HNBM 3C7OA 1FOXA 2LROA 1WKYA 4HETA 1U3EM 2JUCA 3MIGA 2W57A 3IN9A 1JU3A 3ZYGA 3ULQB 4LBNA 1ORKA 4FE7A 3LEMA 1NE6A 2JB8A 3KZYA 3GHMA 5K7HA 4B1RA 1AHSA 2YS9A 3F6OA 2LD5A 4BGDA 3KZZA 2D3SA 4IERA 2E71A 3PIJA 2RS51 3U4XA 4RLQA 4IRGA 3RZLA 3OSGA 1ONVA 5DABA 1SEFA 2M87A 3RVHA 1K4SA 1Q1VA 1B35C 5C5UA 1RC9A 3IH2A 1XSRA 1STMA 1GKBA 3VBSA 1W2TA 4RAZA 4COWA 1GBGA 3W58A 4YVWC 1TBXA 1A3KA 5F08A 3TBDA 1EJ9A 5FRAA 2BWAA 4P9FA 1CX4A 3S1QJ 5LBCA 3ZFFC 2DJIA 3SXYA 3DXUA 2BZTA 3HPHA 4R79A 3JQXA 1MW7A 2BGOA 3DECA 3OL3A 3ZQFA 1OD5A 1VRH1 4DNYA 1FNYA 1MPXA 5L36A 3VSKA 3I3EA 3EYPA 2BEOA 2YPJA 3UR3C 1JUHA 5DUWA 3ZYIB 4DBRA 5J3LA 2VMGA 4L9BA 1T2XA 4LHNA 3JSPA 3BTXA 2K9SA 2VBYA 3BY6A 5JOXA 2OV7A 2P5BA 2PTMA 3GLLA 5C33A 2RC4A 3QU3A 5ILUA 1UZCA 4BLJA 3GYDA 4CP0A 1JOJA 4LLOA 3S93A 1UQXA 3V0AB 1AR72 2L2OA 1ZKGA 4ZH4F 2DOAA 3ACIA 2IVJA 2OUHA 2YX4A 1C5HA 2ZABA 4ZC3A 2ZHMA 2ZGTA 3NL1A 1CIYA 2BFUL 5E20A 2PMZA 3F9KA 4DNCA 3ZLIA 2L4MA 3J81Z 1OMIA 1FX5A 1BN5A 3GZ5A 1G3SA 1PZ7A 1R58A 2IXHA 1D0YA 1FYUA 4AYBN 4U36A 5IUQA 3TEWA 4NWVA 4AGRA 4ZY9A 4HSJA 2IGOA 2ARAA 1YYVA 3D8CA 4OFGA 1KA8A 3LAPA 3UK9A 5A33B 4Q4X2 2IS4A 2R6QA 2CWSA 1GP4A 2EXIA 1MJ9A 2HWF3 4DUVA 4RAGA 1FY7A 4C2TA 2JSCA 1A04A 1XXNA 3JRIA 1UB9A 3CO2A 3LA2A 1RUF3 4UW6A 2WS92 1MMSA 3ZOBA 1QHHD 2HH9A 4A5NA 4AIJA 3I2DA 4PQ9A 3A0BC 2ME6A 1R083 4EWEA 2MLGA 5C4XJ 5IW0A 1RUG1 1PGW1 2OA4A 3K4MA 4UF0B 2RDRA 4NB5A 4HX7A 4XMIA 1T0FA 3MAJA 4MZUA 4LO5B 2XVKA 1MKMA 3PDQA 2E1MC 1T39A 3EMRA 5GPAA 2ELJA 2PLV1 1IPJA 2A68F 4FOQA 2P2KA 4KIFA 4IF4A 3GW2A 1SDWA 1FPN3 4XBFA 4BHCA 3TDZC 4UV9A 3SLIA 1FV3A 4X1EA 2DCJA 3K77A 2YC2A 4PBPA 5F3GA 3TO9A 3SCFA 2LC2A 4LORA 3ZGKA 2G4IA 5A3TA 4YM0A 5LZ6A 5A1LA 1LKXA 5IP6A 1DIWA 3FK7A 4KICA 3MYXA 2R5YB 2VZTA 5FO8B 1ZREA 4ENJA 2PMUA 2JG8A 4RL7A 3VZKA 2H09A 3RPUD 2R92J 3S5QA 1J3QA 3KVAA 4U0VA 4NE9A 3WTYC 4HLYA 2W48A 5FKBA 2DCYA 5KWRA 2XSJC 4M3CF 1S0FA 3OIPA 2FA5A 2DURA 3OEAA 2WINB 3GTGJ 5FZ1A 1LHUA 3ABZA 3L1PA 4AZZA 1ULFA 1E57A 5CKMA 1RVF3 4F8AA 4IE6A 2FZ2A 1P9QC 5T52A 2ZAAA 2OYZA 3KV4A 2DYRH 1S0GA 3J8F3 4GWNA 4FPCA 1PP8F 1CGPA 1DF0A 3O1SA 3RJPA 2E7QA 1ZYRF 1UL9A 3S32A 3FKJA 3LSJA 1ZR2A 1T2KA 4NRMA 4CDQB 3ME2A 4EWAA 5D4RA 3FBIB 1KQ8A 1MBEA 3MIEA 3M3QA 3I3DA 3M4OJ 5J3UA 1ONAA 1SFYA 2ZJCA 3RS6A 1ZQ3P 1ND2B 1Z6TA 2R5ZB 2QGUA 1ODNA 1K4TA 5IVFA 2ZKZA 1BBT1 1W6PB 2KIQA 1ODDA 3OYJA 3ZSEA 2ZMEB 3TBIA 1AR91 3OS1A 3GNEA 3QAHA 4RFT0 1HKTA 1U9OA 2JG9A 4D7YA 2H6CA 2A70A 3I4IA 4YFNF 2WZPP 3WUCA 1R1UA 1K78B 1MMAA 3RYRA 4FQGA 5C71A 2W25A 4LBQD 1EPZA 3E0JB 3HJRA 2FBHA 4EEFG 1UELB 3ES1A 3PUBA 5IT9Z 4IEYA 5E3LA 3C1DA 4NDLA 5A3UA 1QXPA 3VBOC 4L5JA 4OAZA 2FX0A 2Q8OA 4LOCA 4JGYC 4R8HA 3PFIA 1D4M2 3OYWB 3T09A 1BJZA 4S2FA 1FMWA 1QEXA 1D0HA 5EGOA 5JI7A 3ZKUA 3ABUA 1J75A 1WLDA 4RHV1 2XGXA 3PLQA 2XAHA 2WO1A 1U5XA 3ZQQA 1A31A 4MXWA 1TMF3 2XKPA 5C5TA 2OU2A 3I49A 4PSWA 5C8CB 1VQ4I 3AKQA 3UKNA 1UAAA 3Q8CA 5A1AA 2WV1A 2LMDA 4WVWA 1BBYA 3MBWA 4L11A 4QQ2A 4YW4A 4QAWA 1EYBA 5BNPC 1YQ6A 1J1LA 4XUNA 3WU0A 5LB6A 2EZIA 1NAEA 3L2WA 1Y56A 2WRAA 3SKVA 1VQ6I 1AX0A 2GC3A 1FOD1 1XGOA 4LG0B 1Z7S3 3SH3A 1MGTA 5DD8A 1ZTRA 2ZNYA 1SFXA 3NAPC 3E6MA 2JA5J 4V2GA 3WNMA 1BIAA 5EZGA 4LBOA 2ICWG 4TTGA 3PNYA 2TBVA 4YZ2A 2FZ1A 3WDTA 5DYMA 3J7LA 2WZR2 3VZMA 2NS0A 3FFZA 4YM3A 1QF3A 1HRV2 2JDYA 1AYN2 1BK0A 2Y6KA 5FPUA 1VI0A 4ZYGA 4XILA 4EQQA 3O1RA 4OI0A 5FY7A 1V0AA 1UXXX 3OYGA 5JZGC 5ACA1 4Y1UA 3SNMA 4UVAA 1LOEA 2VAUA 2XSDC 2K4JA 3UT0A 1H8TB 3N7JA 1AL22 4L5EA 4I3GA 2VZUA 2K9LA 4MSVA 4DQ2A 3SXWA 3CNAA 3FKIJ 1IQDC 3IDAA 2HYFA 4RGUA 3FBYA 3K4NA 1OA4A 5C4JJ 1ZBE2 1LJ9A 4M3GA 2XL9A 5E89A 4C91A 4FHTA 1H9PA 2VTFA 3GFJA 3ENRA 4QM9A 1FV2A 2WBKA 4MGIE 1BK1A 1MR5A 3SZTA 4LK7A 3WQBA 4M3BA 2HWC1 5FP8A 5L9RA 1MNMC 5BUVA 2D6NA 5FZ8A 3NWSA 1JTXA 1JHFA 4M3EA 2DCEA 2FBKA 3RKXA 2L9NA 1OISA 2WAQA 5D8AB 4GA9A 2Q2EA 2OIIA 4YLZA 3J4UH 3KCCA 5IFPA 2BPA2 5LRRA 5F9TA 2Y75A 3WTTC 2R0FA 1SLLA 1W0OA 2RS11 2FMYA 2J1UA 3ZMUA 3S6PA 3G1OA 4XQ4A 3H1YA 4AVSA 5LEJA 1K61A 3ZIWA 3H9JA 1LEMA 3ZN1A 4XF3A 3W9AA 3USSA 5L3CA 4WVVA 3WZ1A 5EJCA 1MS4A 1POV1 5CFDC 2RM23 1UY0A 2GXGA 4CA9A 1KD7A 1RMU1 3WTXC 2J5PA 4GMP1 1HRI2 3AL6A 1TMF2 2GLOA 1YIPA 2F2EA 1SLBA 1R1A3 3U9GA 4CRQA 1REDA 2J1EA 3L7WA 4UY8I 1ST8A 2RS53 1WCMJ 4Y52J 3GM8A 3G6EI 3THPA 4WXHA 3HTUA 2YBKA 3HOTA 4D0QA 4TLFA 2SLIA 3UKGA 1YLFA 4AEDC 1F4KA 2OD5A 3KE2A 5F6KA 2R7UA 1QNWA 4RQPA 3K4KA 4QMAA 1Y0UA 3ZN0A 3ZMVA 3ILNA 1Z7S2 4MFDA 3BG7A 4YG2F 2DCZA 3CJIC 2BW8A 1DGLA 1LHWA 3KB5A 2OKXA 4CP9B 4IEPA 1PK6A 4A3IJ 2VBDA 2Q1FA 2EA4A 5FZ0A 2P1BA 3AG3H 3KP7A 2O6GE 1NG6A 3CZUA 4WM7C 4Y5TA 2MHFA 5FZOB 2Y6FA 1B35A 1CZSA 1QDOA 5HCFA 2KXLA 4KL1A 1HXDA 1G3WA 2VOVA 1MQTB 2E2JJ 4XRMA 4A4AA 1DU6A 4XXAA 3RJRA 2VQTA 3MPPG 5DZGA 1QMJA 4Y1ZA 2KJBA 3SEEA 5AIQA 3AK0A 1NZCA 2OXBA 4BKXA 2WN2A 3PVNA 3W5NA 4AF9A 5F64A 2FMLA 1DYOA 3GGLA 2VG9A 2EIJH 1W6NA 2PHFA 3SJMA 3ABMH 2HOAA 2CDPA 2ZB9A 2DPDA 5T5OA 2JENA 3GDBA 3ZN6B 5AIPA 3I64A 1W7PD 3KP4A 1U78A 3W6KB 5KHDA 3DXJF 1GOGA 4N53B 4BDZA 1MJAA 5IWFA 3CO6C 4A0ZA 2QQ9A 1YRZA 4B8XA 1FBSA 3ALQA 2JVGA 5F3EA 4L92A 1IS6A 1TP4A 2ZGOA 3BZCA 2HVQA 2R93J 1N3QA 3EUHC 5CVUA 4AEMA 4QQOA 1WD4A 3LDRA 3B6CA 4FO9A 2NM1A 5FV3A 3U78A 3HKZN 2GOMA 5FKLA 1W90A 1JZ2A 5FMOL 5BNQA 2WA3A 2C0ZA 3WP5A 1SQ4A 3OYIA 1ERDA 5FZMA 4QWQA 4XBNA 1QJY2 3SCHA 3HMYA 3DKXA 1POV0 2YFUA 2FUG2 4S2GA 4AEKA 4CEWC 1W06A 3I59B 4Z2WA 4GMP0 4XUTA 3H7JA 1ZN2A 3UJQA 3SEQA 1VALA 3IKTA 4CUBA 2VASA 4N43B 4XFCA 3C7GA 2WNUB 5FXXA 3LWCA 2RM22 5LATA 2W1WA 1JHHA 3V0BB 3KCXA 2V6CA 2MABA 1RETA 4XCAA 2W85A 3F22A 4JP0A 4META 3ISPA 5IYYA 1W03A 2GH2A 1RUG3 2BWCA 4QB1A 1R1A2 1SACA 4NPLA 1PVEA 4J1XA 3RIRA 2W24A 1TTYA 3WTVC 3KX2A 2JDNA 4KMUX 3M9AA 3ESWB 1N1SA 1OVPA 2JA2A 2PLV3 3RPQA 2K4BA 3VDDA 3DKYA 1A8DA 1DQ0A 2K7LA 3JD71 3K3OA 2NVTJ 3OGVA 3H8UA 5BQTA 4ZZ8A 1W28A 1CWPA 2ZS6B 5I8TA 2LTNA 2JXAA 2JZYA 3KZ4C 5AC93 2JB4A 1BI1A 4PFPA 4FPOB 2HBUA 1T33A 2XJUA 3RSNA 4RD7A 1JZ3A 2JDHA 3WG7H 3S8PA 5D4SA 1RUNA 4Y13A 4IEVA 5FKMA 1QJEA 4XN3A 3OR1C 4G6DA 4JDOA 4ZPIA 1W2UA 4EROA 4XJ8A 4AC0A 5IK5A 5IP7J 1OLME 3R05A 1W6MA 1D5VA 4F3QA 4A3BJ 3BYWA 2AHQA 1LEDA 5H6QA 5DCMA 3EQEA 5IY5H 3HWJA 3DPTA 4N9IA 1J59A 4B1MA 2AH2A 3RQIA 3RZKA 3M3IA 2XF5A 4FASD 4U2AA 2W7NA 3MI8A 1A34A 5D1IA 2CV0A 1QGPA 4OCTA 2D6KA 3HC7A 5IYDJ 1V6NA 3AYEA 4LTAA 3R4DB 4NHJA 4RSUA 3L2HA 3WT3A 4BK5A 3EUKL 4LUKA 2IS2A 1ENXA 1I9RA 4W1UA 1IRFA 4CCCA 3FHNA 3QP5A 2W87A 2ZTNA 4ANJA 4BMBA 1YRNA 3AJYA 3C3WA 3IDCB 1H2MA 4YW3A 2VZQA 5CKQA 1SLTA 2YU9J 4EWDA 3WTZA 4B1LA 4UWDA 3J9SA 4ZJZA 3HBLA 1I1SA 2WFF1 1AR93 2HZTA 5J37A 5FZGA 5FZ6A 4QDSA 3A4UA 2VOKA 4WZCA 2EH3A 1NCRC 4WXDA 5GZFA 4K21A 2QTWB 4BU2A 5CG8A 3QOPA 1ETKA 4NIAA 4RS5C 4CDXB 1QJU1 3ZR5A 4IRIA 4BH9A 1GXPA 4LEJA 3VBRC 3N7LA 2L9VA 2A6WA 2D45A 2DUOA 1LE8A 4ET7A 4LA2A 1Z7UA 2G9FA 2VNVA 3DXTA 4Q26A 2DK8A 3OOXA 5T5JA 1XYPA 5CU1A 1G2HA 1DGRA 1W6OB 3HSEA 3FX3A 2K46A 2R041 1RUC2 4O6JA 4MX3A 2IFRA 4AI0A 1WLCA 2QBYA 5F3IA 1UYYA 2QQJA 3T5XA 4FISA 3HRSA 4RHV3 2G19A 3ZXGA 5TRDA 3KYDB 2L7KA 5SV8A 3SFIA 1P7IA 4GULA 4TLGA 2HPMA 2OVUA 1RXGA 4XSXF 5LBEA 1FAYA 4B3NA 2QA4I 1U5ZA 5JXJA 3VBOA 5J4VA 2VCBA 5AC92 1YIOA 1R5GA 3B73A 1JXNA 1I1EA 4JGYA 3OYKA 3MUZ1 1IGOA 4RB2C 3IAS2 4E8CA 4I01A 1OCOH 2HJIA 1X1BA 2LY9A 4FBFA 1EUUA 1YS6A 3PUQA 1GVDA 5L3FA 4MO7A 3IKVA 3QWLA 4QKFA 3BB6A 2CWEA 3O12A 1FOD3 2VY0A 3T1MA 3HOYJ 1DFQA 1FMD1 3CIHA 5IOYA 3JB8A 3JUUA 4FSJA 1JGGA 4YRDA 1YI9A 1RC6A 3U75A 1HQCA 5L73A 2XV4S 2HWE1 2YC4A 4GXLA 4P08A 4MHUA 2JE9A 2YFZA 5BNPA 3GFMA 5K5OA 2XASA 4RB3C 1O4YA 1HQWA 1IN6A 3LSMA 3LOBA 5J96B 1R1VA 2ZGMA 4PF1A 1OA3A 4UW4A 2D5FA 5FUNA 2HWD1 4J6GA 5FAXA 1YJLA 3TGNA 1IXRC 2A69F 5ACA3 3NAPA 5FYTA 2QQMA 4GO1A 3BIWE 4F91B 2AEYA 1NA1B 5JSPA 1OR7C 1KGYA 1K7AA 3NV4A 4B4CA 4XICA 2X0LA 3BR1A 1WCQA 4QX0A 3HRTA 2DA4A 3AP9A 1GUIA 1JUIA 1IN8A 1Y8RB 2A6YA 4QSHA 2NN8A 1TW2A 4I6ZA 2XUBA 3C2GA 2LG4A 2RKHA 2X05A 4ASLA 3HQXA 3HHGA 2L7MP 1XBFA 5KHGA 1XCBA 5C3EJ 3AJZA 4EM2A 4Y26A 4HFSA 2HVRA 1CQ9A 2X6XA 4EN9B 4FXKB 3T4HB 3FWEA 1CPMA 1PIV1 3HEIA 5BY5A 1KZHA 5GP9A 5EJ3A 2GQQA 4K9SA 2WWJA 1HJGA 3RMYA 2HWC3 3GBGA 2XG3A 2NMOA 3EHKA 5A6XA 2GWRA 4DXTA 1O8PA 3MWMA 3BTCA 4PLOA 1WW4A 4IHYA 4B4PA 1UIJA 4L9JA 5FDBA 2X53S 4P9YA 4AK3A 1WH5A 4RR3A 2VZRA 5E3NA 1S0BA 1O4ZA 1RUOA 2OF7A 3BPVA 4CA0A 3S3MA 1RUH1 2ZHNA 1POQA 4G12A 2RS13 1LFUP 1WI3A 2R7OA 5GPCA 2G9GA 5C4WC 3OL4A 3O8GA 1TW3A 2CSGA 4OU0A 4JKMA 4Q2FA 5CVRA 3GJAA 4IE4A 4NC7A 1HCRA 4IQPA 4OHWA 5F32A 1VPHA 3K1MA 2WAFA 2IXJA 2W82A 1WJEA 2IEKA 2V9PA 1GV9A 4PI2A 4B09A 2O7OA 4MGZE 1O6UA 3WE3A 4Y1XA 4YM1A 3UNPA 2DMTA 1BEV2 3Q8BA 1QIQA 1ZA7A 5H9RA 2LFBA 1RJ7A 2NVXJ 2NVQJ 3C18A 2KIFA 3POYA 3FXJA 4XKVA 4TN7A 3Q9VA 4DS0A 2DA7A 3A1YA 4R9BA 5EG0B 2R7SA 1ZZ9A 3BJ6A 2R7QA 1LVKA 3H0GJ 3DEMA 1IV6A 4NHXA 4XOPA 2P81A 3T8RA 1QOSA 2BU9A 2WAAA 5A7QA 4NHYA 4DB5A 1A6CA 3LSGA 1MS5A 4LIVA 4E7KA 1OQ1A 3PHMA 2QNKA 1BMV1 3TW7A 1IRXA 2ZHKA 4BDVB 2QQIA 3TN93 4DINB 4AEDA 1WZXA 3HAGA 4ENNA 2LUWA 4BJ0A 2E53A 1ASJ1 4M71A 1KU3A 3I2KA 2M34A 1G8XA 2VH9A 3LEKA 3GTKJ 1YLLA 2QDRA 2DA2A 2R073 1CZTA 3GLXA 2J1SA 4M3CE 4DEVA 1USTA 3DV8A 2ZOEB 3WD5A 1ETOA 2IS1A 2Z3YA 5D6EA 4EZHA 2VZVA 3DF0A 4WM7A 5FZFA 1VBA1 2IA1A 1GR3A 5L9BA 3CUQB 3N9MA 4IHVA 1GWKA 3VD3A 1GDTA 4IXAA 1HN1A 2JRTA 2WNVC 4A6DA 3LAGA 1FWZA 4IEOA 5EPAA 3MIDA 4YGEA 4ETSA 1SBDA 2PHDA 3H7YA 4NHLA 2M4GA 5K0UC 4R1HA 2DFIA 4A44A 1X8EA 3Q9OA 4I76A 1AU7A 1CN1A 1FIPA 4G7ZF 4JDNA 3R61A 4AIKA 4MGYE 4LO6B 5FY4A 4AYBA 5F04A 2ECBA 5JSRA 4UFKA 3O2PE 3V42A 4H3WA 3N9QA 1R23A 3HSFA 5DAXA 4H7LA 5JXHA 3TQNA 4NO4A 3OD0A 2W46A 1AA7A 2GNMA 2H1LA 1AR61 1HB1A 1PO22 3H3LA 4OZOA 4OI2A 1GV2A 2R3SA 2OJED 1HF0A 5CVJA 5E3OA 2E1NA 2BW3B 3P9CA 5KHJA 2AYHA 1VBC2 3ZQHA 4GH4A 2YU2A 3GCMA 4UHTA 2R7EB 3EO6A 4RA2A 4P9XA 4G9SB 5M5WJ 3A0HC 1CJDA 4KIBA 2ZGPA 2KKOA 4UVBA 2AXLA 4ESFA 3M4FA 3FK6A 5B4NA 2AR6A 3KYLA 1FYMA 5JXIA 2Q0OA 2WWSA 3H5AA 3H5RA 2FSWA 1JKQC 5ANNA 1OFCX 4YVSC 3GBWA 2WO3A 2CRGA 3VFZA 1YX3A 2P4EA 1UX6A 4CU9A 3TEXA 1CQTA 1LDKB 1CAXA 5FWJA 2K9QA 3WGHA 4OI4A 3DPRB 4R4ZA 4JK1X 1OOPB 5D5WB 3JD73 5KNLA 5JWPA 2CG4A 2XDVA 2RS32 3IM0A 5JR7B 1TLHB 1JBCA 5FZ4A 3UNGC 4RDUA 5BS6A 3BTLA 2W1OA 4URTA 1WBFA 3TN92 2A71A 3IIAA 1J3RA 1CR7A 1NY72 3C3VA 3I2OA 4BM8A 2YGLA 1REFA 4MFEA 2WO2A 2R072 3MF9A 1XGSA 5LFAA 5LHHA 3JAMK 2B42B 3IDBB 4LXLA 2Y69H 5EXOA 2CQXA 1ZRCA 3HL2A 3ZXEA 4PLMA 5HNFA 1WH7A 4UFJA 2OW4A 3VGIA 2M0MA 4PGHA 1XE7A 1ZR4A 3B69A 1HKSA 3MIHA 3PO2J 3FDYA 2WYSA 2Z4FA 2KRFA 4IV3B 5JHUA 2DVFA 5LEKA 3P3PA 4AFCA 2ACJA 2F4LA 4BNCA 4KBZA 2DDBA 5EP9A 1Q1HA 4QGNA 4FQZA 5M3MJ 3VPRA 5GLUA 3K1NA 1DGWA 3NV1A 1W0NA 3J7MA 2BOJA 3JB4C 1OLTA 3H42B 5CFCC 5FY8A 3K46A 2CW8A 3ZQLA 3VKMA 2OQ7A 4ZKTB 1AYM2 4P9JA 4JGZA 4ZS3A 2GNBA 1JHJA 3R0RA 4ABZA 2R0HA 3WNLA 1SMVA 3POSA 2UY9A 3VEPA 4GCVA 2WFF3 3R4SA 5FQ0B 1WCSA 3H50A 1U5IA 4B48A 2XAQA 3LMMA 4JTOA 4Z2AA 1D5YA 2XJSA 1OT5A 1LHVA 5FKNA 4KMFA 2K3FA 3VV1A 2YGMA 5L7OA 1T95A 3VN4A 4A3CJ 4XUQA 2A5WA 4L18B 3LKJA 4DY3A 1QJU3 4X6RB 2RR11 2VCAA 2HGCA 3H3VK 4QQHA 4XJWA 4G8XA 3SZGA 3POJA 1QO0D 2Y9YA 1QHGA 2VD7A 1XPXA 1WCUA 3LD8A 1WFXA 5GLWA 2F5EA 3THCA 1D1CA 4LQRA 1NCRA 4P02B 3ZVXA 3KIOA 4C9YA 4QPYA 1GZ9A 2A3WA 2LOOA 1OF3A 3OTFA 2R043 4RS5A 3BWGA 1DDLA 3IC7A 1GLNA 1RB8G 4XYXA 4BXFA 4Q5SF 1FT9A 3PQKA 5HOOA 2FMDA 3H5NA 2IGMA 4J19A 1UU6A 3OD4A 4EV0A 2Q1MA 5F5QA 4WVMB 4COYA 4J01A 1FBUA 1DGRM 4V2WA 4KT6A 3VOEA 3VBUB 1V6JA 3K3NA 4KBBA 3T4VA 1RTVA 1MS8A 2PYTA 1AR83 1ZRIA 4DUWA 2JJ6A 1W9SA 1QA6A 1V9U1 1J3PA 1ZLKA 3TWIA 4XAAA 3DPUA 4FP3A 2E35A 1W7PB 3BQZA 2HS5A 1NLSA 1NG7A 1W8OA 2FBEA 2BUKA 3U21A 1D8JA 4JQTA 1UHWA 1FMD3 3AVSA 4IHTA 1YJWI 3REOA 2DFFA 1UZ0A 2DFEA 1PP7U 1XB4A 4QXKA 4UFHA 2HWE3 4CU7A 4XZUG 4TZDA 4MIMA 2NAZA 5FP3A 5A1FA 2WADA 5F6FA 4XJAA 5E6HA 5CKNA 2OZJA 4E27A 3IP4B 3AFHA 1W8ZA 1YO5C 2F4PA 1S0DA 2GNTA 3TYJA 2HWD3 1MBKA 4K7JA 2PQSA 1BOAA 1Q8PA 4HANA 3NVCA 4XLEA 2I2SA 3OR2C 3KP5A 3ZR6A 1F5JA 3WP3A 4BE0A 4XQDA 2NNNA 1SVLA 1KRIA 3T2PA 3UGFA 2HDDA 3ZM8A 2FEZA 2MD5A 4QPGC 3CP2A 3WF1A 1X2NA 5E17F 1FI2A 1XQNA 1W8HA 2IP2A 3KVBA 4N7IA 1JT0A 2DDUA 2GMPA 1LHOA 1Y43B 2BOIA 3IAM2 5HPOA 1LHNA 1PIV3 2JIJA 2XJQA 1QZYA 1PZ9A 2RJLA 1MNDA 3C2BA 2A61A 4M6YA 3BKZA 4LK0F 4YW2A 2Q1ZB 2UYAA 3SQOA 1DU3D 1EAH3 3ELKA 4XIKA 2PI0A 2OA2A 4C1XA 3N35A 1QRYA 4HF2A 2P3IA 2KDOA 5FZLA 1CAUA 4BY7J 2DVBA 2XAGA 1RUH3 1D8KA 4W50A 3BVCA 4AI2A 4CEYB 2L02A 2KR2A 3HGGA 1P4WA 3MLLA 2CGNA 5IAVA 3LSHA 4N0BA 1IO2A 3LOIA 3MIBA 2K9MA 2V4JC 2E31A 3TEYA 4UW3A 2YDEA 3CQZJ 1KQ9A 3WW4A 4AVPA 1BJQA 4I0AA 1PVXA 3K2ZA 1HDDC 2GN7A 2W3JA 5C4WA 3JRBA 2J1TA 5ILVA 1H4HA 2NQYA 1AR82 4PDWC 4BQ2A 1AZDA 1EY2A 2VO5A 4RGXA 2AZ5A 4LGWA 4LE3A 3SFZA 1IHMA 2F5FA 2X6OA 3KP2A 2ZEZA 1NK3P 3ACGA 1UZWA 4LKDA 2ZCWA 3I4PA 4EMSA 4DY5A 2XAUA 1Q5OA 1WLTA 3I3MA 1T38A 3MD2A 5EQUA 4H7MA 4HX4A 3RZGA 1PYVA 3E3VA 1HSJA 4EJTA 2ESNA 2ZBKA 3LSEA 3GTLJ 3HRMA 5IATA 1ENQA 3S2WA 1V6MA 4R52A 5K9YA 4URAA 3CP8A 2HZDA 3GEZA 1S1AA 4C0BA 3OB8A 4HQEA 2MD0A 3R6SA 5FYUA 1QQP2 2IVIB 4FTSA 4MGKE 5EJ1B 2ZJQF 3P9IA 3LSIA 1VRBA 2P7VB 5ISLA 4DGWB 3WDVA 2RN7A 2W94A 5FRNA 5D5UB 4LULA 4E4DX 2RDNA 3FLRA 4HVQA 3RKQA 4XF1A 1VBA3 1Q43A 2JQ7A 3F6VA 1E5RA 3B94A 1QJX1 1COV1 2ATFA 1NE4A 5KCMA 3T1LA 1W2NA 2R1DA 2Y8KA 3AKRA 3DP7A 1SCSA 2WABA 1J7KA 4UAPA 2V5DA 1MEC1 2AGSA 2X1CA 1YITI 1FATA 4CDWB 5IAXA 1YHQI 2WDBA 2A6VA 4HOOA 2HTSA 1HDPA 5KC5A 1MS9A 4XL9A 2PBIA 1UOFA 5CAZA 1S9HA 2X09A 4HLTA 3WF3A 5CISA 2PJRA 2XAFA 2V9KA 1EAH2 1U5TC 2WNVA 1YQAA 5BNOA 4S2DA 4CO8A 3JRCA 3AP4A 1I5PA 3RZZA 3WNNA 4HNTA 5FXZA 1GQPA 2E33A 5DV5A 3F8MA 2CU5A 5IK4A 1AR63 4EN7B 2CFXA 1YJNI 3MW3A 3QBQA 4P00B 5A7WA 2R061 4TXWA 4GKXA 2Y0OA 3RG0A 4O3MA 3PFYA 3WQ0A 3LE0A 1J84A 2CSOA 2LH9A 3GCXA 1U2WA 1RUJ1 2R7RA 2OT7A 5HDKA 1B9NA 2F4OB 1N25A 1NG0A 2KIMA 2FQ4A 4IV1B 3ES4A 2XBO2 1Y8QB 2K0GA 5FK7A 4HSRA 4JX0A 3P3NA 1MNEA 1ZVFA 4KFCA 3B3QE 1BR2A 1RUI1 2PAEA 2ZJPF 2D43A 3POEA 3BQYA 3ERED 5EGOB 4BMEA 4F83A 1VFCA 4PSXA 3C7FA 3HD8B 2FDGA 4UW5A 2Y34A 4UV8A 2YR2A 2PFWA 1GNHA 4AXOA 2XUEA 4P5OA 4MGRA 3IH3A 1RI7A 4PFOA 1BZWA 3FMSA 3H35A 2HBTA 2ZX3A 1UJ8A 3FXQA 3CCJI 5F5IA 2QM3A 2JPCA 2NOGA 4KIGA 1GOHA 5T54A 2QQUA 3CCUI 4Q47A 4HDUA 4FQ4A 2AO9A 2ZJRF 4A7ZA 4RAYA 3BU7A 5C3RA 5E1ZB 4G3YC 1MS3A 4YW1A 1R5HA 1NCQA 4OIOF 2X1DA 2VNRA 1UY2A 2XL7A 3B7MA 1EF4A 5ED4A 3DLLF 2B5HA 1YE9A 3OYBA 3TNQA 3R4KA 2VVDA 2KP6A 4XPVA 2A5ZA 1JE8A 4FOWA 3ZOIA 1LAJA 4CZSA 3LSRA 4PJMA 3AFGA 2R7TA 4DUXA 1VF9A 1CD3G 4M73A 1ETWA 3CZJA 1EH6A 4OINF 3KQRA 1W5TA 3NAUA 4CCMA 1A36A 3K69A 3NNJA 3K4LA 4HKOA 2Y33A 2AUYA 2V4VA 2Z79A 1F4HA 1I27A 1VR3A 3ZXSA 5LRSA 3RDIA 2P3JA 3VBSC 4KDPA 2ZGRA 3AKPA 4GWMA 3R60A 3FHIB 4PQQA 1GV5A 3M3CA 2JDKA 3OUIA 3TP0A 2VQHA 4N4NB 2YZ4A 3A7QA 3PUSA 3NSTA 2ZFWA 4JCKA 3WGGA 1BHGA 4PZJA 4W8JA 3WNPA 4AVBA 1I6XA 1R092 1SANA 4M9ZA 1H6XA 1H8VA 1BCXA 4X8NA 5DG1A 3WDXA 3E1SA 4WM8B 3PURA 2P6TA 5HCAA 2EZHA 2R0QC 1E2XA 1ZZ8A 2QCOA 5IT9K 3CLQA 2P5LC 4EATA 5CFCA 3CL1A 2D97A 2IFWA 3RCOA 3RTRA 4LE4A 5FLMJ 4UVCA 2XC7A 3K2OA 3WUDA 1QY4A 1Y3TA 4AW7A 1TME2 3V7SA 4OMZA 1UMQA 2I5UA 4A3ZA 3SMHA 4ON0A 3OS0A 2CW7A 3A03A 4QX7A 2Q30A 2XLGA 3V65A 1ALYA 3FLPA 1KDKA 4EVIA 2MA3A 4LPLA 4XKBA 2MNGA 1UNBA 4M74A 5A6ZA 4DFSA 4ZS2A 4MGSA 4PJNA 4F7ZA 3NQHA 2D98A 4CICA 3JRAA 2FRHA 3OUHA 4RGRA 1YX5A 2CUZA 4XQWA 1FX7A 4XOGA 2RV9A 2OCCH 3ZYHA 4AQ6A 1BR1A 2DA1A 2C9KA 4PJYA 1MZFA 4N4OB 5KXEA 4QPOA 2FCUA 3JTGA 2XB6C 2JJ7A 3INAA 1Q3EA 4M6XA 3RZMA 3HSRA 5DUIA 1LGNA 5DUXA 4E4SA 2VXRA 4XJUA 4LLFA 2DJNA 5A80A 1E5SA 1HA8A 3D5OA 4AUXA 3I56I 3X2QH 3ZMTA 3MCZA 3UESA 3QH7A 1VB2A 1KITA 1PMIA 2L7FP 3PVOA 3KEQA 1H9GA 3H8XA 1XSQA 1GUUA 1B35B 2VXZA 3S17J 4HPQA 2JDMA 2EALA 2AENA 3HJEA 5IK8A 5GLTA 2ZHLA 3CC4I 1N1TA 5BNGA 2WBMA 2K40A 4S0HB 3WF2A 3GTMJ 2QWWA 3HOVJ 4NQWB 3A0KA 4YVWB 1MBGA 1T08B 4D69A 1DYKA 2RMU2 1S2KA 1Z0XA 5D8KB 2ZSHB 3T1BA 1V3FA 4GXOA 1JOPA 5GZGA 3D5LA 2VMFA 3BTAA 1YYNA 3ZFFB 2WKKA 2P6CA 4QX8A 1S5LC 2VLAA 2NZ9A 3V0AA 2PQQA 1AL0G 5FMCA 4KG8A 4UNOA 1LU1A 1W1WE 4GB33 1CZVA 4MGTA 4DZPA 1JUPA 4M3FA 3PVEA 1Z91A 4L0ZB 3OYCA 1RHI2 1KQRA 1F2NA 2ZACA 3ZFEC 3J7ZI 2B9SA 2BE5F 2JG8C 1IUFA 2BXYA 2GOXB 2VNGA 2JDZA 2WWYA 2HEWF 4YEJA 1FMVA 3KEOA 1NKGA 2LVSA 2VJ4A 5A33A 1LFPA 1TWHJ 3M3YJ 2QSHX 3CCSI 1TWGJ 4B3XA 1FYLA 2J1RA 3R4UA 4AVVA 3D5SC 1C8NA 1O7LA 3DWLE 1V6KA 4QPGA 2KJCA 5GZCA 1AX1A 5M0TA 1E3PA 3M8JA 1RUD1 3DQVC 3DYOA 5A3WA 4E7HA 1OYIA 4RM3A 1YTYA 2YROA 2PN6A 2VT2A 2VMHA 3PSIA 5DPNA 2XHNA 1GYKA 2XGDA 5CPRB 1C28A 4U87A 5DDJ2 4Y20B 2VBPA 3RKYA 2B4KA 3CESA 1E3OC 2ARBA 3QYBA 4HK9A 2IVMA 1W39A 1ULCA 5A3NA 2O03A 4IEXA 5IP9J 2ILMA 3AYAA 1WMEA 5LK5A 1N75A 4CP2A 1XX5A 2HWVA 4EGZA 2W08A 5A6QA 2HWB1 2IWGB 4HRIA 3NEUA 5KAFC 2JG9C 4JHZA 2ELKA 1J5YA 4Q4W1 3ECOA 4RN5A 1W04A 5FZEA 2ADUA 3FZVA 2GXAA 2WA4A 1Z05A 2E1MB 2EB7A 2QQPA 2R7VA 4A3FJ 4UYBA 3THDA 2W4SA 4QGLA 1XNCA 4IVNA 1WGPA 1MMDA 1O3TA 2IXCA 3RI8A 3RWKX 3LZZA 1ZZ6A 2AXTC 1R6RA 3O1VA 3ECQA 1T6GC 3E5QA 1HOMA 4NVPA 2K9NA 3WF0A 2PEXA 3L09A 3M07A 4AD9A 4S05A 4UBHA 1U5YA 2GNDA 2Z99A 3H0OA 1W6MB 3QLQA 3VODA 4D7SA 4JHTA 4CDQA 3BTYA 3A01B 3P7NA 3TW6A 2QSGX 1Z67A 4HG6B 3E5XA 4OULA 4GB32 4HG2A 3CC2I 1WWXA 1ETXA 1D7PM 4DBQA 4P9LA 3N4MA 4YZ4A 2WR9A 2OC6A 2R7WA 2P0WA 2VMEA 1AJOA 3QU6A 4UFIA 4KYWA 1UYZA 2BQPA 4L5IA 4LOSA 1WZ2A 1XNBA 2WIIB 2R5ZA 1QJX3 1COV3 2VNOA 4I09A 3ZQGA