3LA2A

Crystal structure of ntca in complex with 2-oxoglutarate
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
196
structure length
196
Chain Sequence
VETFERNKTIFFPGDPAERVYFLLKGAVKLSRVYEAGEEITVALLRENSVFGVLSLLTGNKSDRFYHAVAFTPVELLSAPIEQVEQALKENPELSMLMLRGLSSRILQTEMMIETLAHRDMGSRLVSFLLILCRDFGVPCADGITIDLKLSHQAIAEAIGSTRVTVTRLLGDLREKKMISIHKKKITVHKPVTLSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the allosteric control of the global transcription factor NtcA by the nitrogen starvation signal 2-oxoglutarate.
pubmed doi rcsb
source organism Anabaena
molecule tags Transcription
molecule keywords Global nitrogen regulator
total genus 55
structure length 196
sequence length 196
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3la2A02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3la2A01
1FNNA 2OZUA 5KHHA 4EJWA 4D7SA 4QGLA 4IEZA 3LAGA 2EA7A 4ENKA 1YFWA 2XL9A 1OI6A 5CVUA 2EJRA 3GEZA 4IEVA 2XUBA 4A0XA 4E70A 1B1BA 3HSRA 3QP6A 2XLAA 5CVIA 4P5OA 3I7DA 1WA4A 4U0WA 3D82A 4RAYA 1ZVFA 2MH9A 5E1ZB 1O4TA 4LGWA 4FX0A 3KLNA 5FFXA 3VEPA 1JXSA 4IEQA 3H1YA 5CVRA 2ATFA 3K0LA 2VN2A 4N9HA 2RVCA 1O3SA 1STZA 2OBPA 3F3XA 3H7YA 4MEXF 2MPFA 1Z6RA 2DPDA 3BJOA 5A2QZ 2GC1A 3KP6A 4OMZA 1X82A 4K2EA 4H0EA 4YFXF 1X7NA 4LB5A 2O3FA 2CSOA 2O61A 2D5FA 3HHGA 4I02A 5ICGA 2LNBA 3ISPA 1S8NA 5E17F 2NRAC 3CO6C 3S2WA 1YUDA 1Z05A 1Z91A 1YIOA 1HW5A 1R7JA 3WW1A 4MZUA 1K7AA 2EA2A 2KRFA 2ETHA 4UVAA 4PIZA 3M8FA 1ULYA 3KGLA 2QVSB 1CAUA 3WTYC 2PAEA 3KP7A 1TQ5A 1USSA 2QJVA 5FD6A 3BDDA 3ZP5A 4ESFA 3GYDA 3OOPA 5DUIA 3BPVA 5DCFA 4B8XA 3F21A 2VT2A 5HDKA 2EVXA 3F8BA 1ZARA 3CUQB 2NAZA 4OOIA 2K4JA 1ZYRF 3C3WA 1ZRFA 1Q1HA 1ZN2A 1G3YA 4UXAA 3ZMDA 3HRUA 3CO2A 5JSPA 2YR2A 2DBBA 5I91A 4X6QB 5LRSA 3J80K 2YX4A 3RKXA 3SXWA 1DZTA 5K5QA 4LLGF 1ZZ8A 1R36A 4XF0A 1R22A 4E2GA 3OF1A 2OQGA 4UUVA 1DGWA 3EQLF 2F5CA 4O9GA 4UVBA 3K1MA 3I53A 1T6SA 3USSA 2IXJA 5JHUA 2ESNA 2WFPA 5J8FA 1BI2A 3ELNA 2ZO4A 4EMSA 2MLKA 1H0MA 3O14A 3SHFA 1XSDA 3H1MA 1Q3EA 3I0TA 4KT5C 1OFNA 4HBNA 1EYBA 4LTAA 3ZMUA 3U2RA 4XETA 5D8LB 1W7PD 2VPVA 4HLTA 4MEYF 3CTAA 4BXUA 1W5TA 4UHTA 2ZBKA 2XAGA 5D5VB 2ISYA 1GQGA 3EDPA 4QGMA 4Z07A 4F8AA 2ET1A 4Z2YA 4PJYA 4OU0A 4KMFA 3QRFF 2IXKA 1S6LA 1U5TC 3O3KA 3DPTA 3GF2A 3GWZA 3GFMA 5AIQA 4M71A 1EY2A 5ILSA 2RC4A 3SZTA 2W85A 3ZDSA 1YS7A 4U7BA 3F8FA 2XHKA 1WI9A 1EH7A 5EEHA 1UIJA 4RGXA 3C7JA 4OIPF 4BAYA 2F2EA 3TNPB 2PQQA 1U2WA 4HQMA 3C1DA 5FLXK 1JHFA 1UB9A 2CGPA 3CJNA 1CAUB 1TW3A 3FX3A 2FOKA 1ZZCA 2FRHA 4L0YB 5J8CA 2XLGA 4WCGA 1XMAA 3ZMVA 2QCSB 1KU7A 4IHSA 4DINB 4UNOA 4LULA 1R58A 3ZMTA 5HS9A 5ICCA 1IAWA 4O6JA 4HF1A 3CUQA 1ZRCA 1HW2A 5HVQC 2L01A 4ONUA 1RIOH 2BGCA 2EV6A 3WW2A 1QO0D 4XFHA 1RI7A 2V9VA 5DDGA 2UXXA 4MTEA 4MV2A 3NW4A 2YX7A 1UIKA 5F6FA 4ZYHA 4G7HF 1UW8A 3MAJA 4HBLA 2BEOA 4FAGA 3HSEA 5E20A 2Z33A 1PP8F 2PAKA 3RTRA 3TO7A 2G7UA 4IEYA 1FPQA 3K1PA 1QPMA 4L9JA 2P6SA 2STWA 2B9UA 2IA1A 2EFPA 2QBYA 5KHJA 1HW1A 1HSTA 2ADUA 3MPBA 1G6NA 3WODF 2PAMA 4AVCA 1U5TB 4RB2C 1SFXA 3IRQA 4ASNA 2M45A 2ZJ2A 1F1ZA 2Q2EA 1LRHA 2D1VA 1G3TA 4CYDA 3ES1A 2HOEA 4U0YA 1FC3A 3IWFA 1D8KA 4R52A 3OV8A 1LEBA 3I58A 1OKRA 3ML6A 5LBQA 2J5PA 2KJCA 4O9EA 1IW7F 4MQVA 1ZZ6A 3FM5A 3OGJA 2HKXA 5HS7A 1P2FA 4ENMA 1LDDA 2HTJA 1FSEA 2JT1A 2CYYA 2D1HA 2EFNA 3KP3A 4HN0A 4KYWA 3FJSA 3SCHA 4AQ6A 1R00A 3QP5A 1J9IA 4YIIA 3BPZA 4L2NA 2Z3YA 3RKYA 2PLYA 5FPXA 1YW8A 1MDMA 5JFRA 2ZKLA 4OIRF 4MGKE 3M9AA 2DI3A 4KDPA 3D0JA 4LK0F 2HFHA 1X8EA 4X6RB 5LHGA 3R4KA 5ERIA 3NQOA 1QWRA 5JCTA 4QM9A 3RKWA 4OINF 3F6OA 3R0AA 2KKOA 3JAMZ 1E17A 3WTTC 1UHMA 3F8NA 1BIBA 3NSTA 3I4PA 2V1UA 2MNGA 3TDUC 2FBKA 3LA7A 1TQPA 5C8WA 3L09A 3V4GA 1J3PA 2CG4A 1R23A 2KIFA 3OD0A 5L3CA 2GA2A 1LJ9A 1T0FA 2D2WA 2FQPA 3WW4A 3B73A 1DUXC 3GBFA 1P4AA 2PI0A 3GXOA 2IT0A 3HT1A 1CAWA 2LSOA 4HX4A 3CDHA 4OMYA 3J81K 1ZH5A 4HMZA 1S29A 5LHIA 2D5HA 2GZWA 1OR7A 2FQ3A 3WTUC 2DAOA 1FI2A 1J0RA 2G7HA 4MQ9F 5D6FA 2PFWA 2HYGD 5I8SA 5E1XA 3I5UA 2NYXA 1A04A 5D4RA 1SAXA 3RZZA 4META 5EZWA 3UKTA 3QPHA 2VOOA 1L3LA 4DNCA 5CVJA 1H9TA 1JUHA 5AONA 4HOBA 4CICA 1P4WA 2IPQX 3HT2A 2VBWA 3ROUA 3K2ZA 1I6XA 3NEUA 1OYIA 2F4PA 3KP2A 1UCRA 4QXKA 3GFLA 4L11A 4L9TA 4FAHA 4MNUA 4A5MA 1KU2A 3ZMSA 1BM9A 1BBYA 1HKSA 3WGHA 1O5UA 4R79A 4FX4A 2VQAA 5CLSA 1XRUA 2F5FA 1QGPA 4M9ZA 1ZGJA 4NB5A 4IETA 4IRHA 2PHDA 2Q4SA 3QU6A 3OCPA 2EV5A 4OIOF 4XFGA 2ZKZA 5HLHA 4GXOA 1RZ4A 5ICFA 1XCBA 1DPUA 2DW4A 1TTYA 4XBFA 3AAFA 3EO6A 1QY4A 4RGUA 2A6HF 4U7DA 3T1BA 3WW3A 4IVNA 3J80Z 3KEQA 3MDPA 5IT3A 1WWXA 1NYWA 1CAXA 4YFKF 1L3JA 4HLYA 4IRGA 1X3UA 4D7TA 1LQ1A 2K02A 2QENA 4JTOA 4G9YA 3OTFA 4ENNA 5KHIA 2UYBA 1U8RA 2HDCA 5E1WA 3GVAA 3WGGA 2OZ6A 1C0WA 3S7EA 1WRJA 1YLLA 2XIGA 2UY9A 2K7LA 1R1UA 1T2KA 4JK1X 4ZYGA 4KU7A 1SFUA 3HRMA 3H50A 4IESA 5DD8A 3U1DA 2A07F 3G3ZA 3FFQA 2Y0OA 1ON1A 1LR5A 4L5JA 2IXLA 4HZFA 4P9UA 1YS6A 4IEWA 4PGHA 1J3QA 2ISZA 1J59A 1GXQA 2E7WA 4G6QA 2NNYA 1ZG3A 2QYOA 5D5XB 4Q0UA 1HBXG 3KP4A 3GYHX 3BALA 2FMYA 2JPBA 2E9QA 1GQHA 3PVBB 4MH0E 2H27A 2EB7A 4ORFA 3FM3A 1O57A 1XGOA 2QVOA 1K78B 2VC0A 2W25A 3EYYA 2JZYA 4A5NA 4BHBA 2UY8A 5FLIA 2E7XA 4MUVA 4IPAA 2R3SA 1IN7A 3HRTA 5FCCA 2H0VA 4U0VA 1R1VA 3FXQA 2Y75A 1XGNA 3E6CC 2O1QA 5H6QA 2UYAA 3V8JA 2M30A 3DF8A 5HDGA 3M7GA 5DUKA 2DU9A 3Q9VA 3TO9A 2FNAA 3FF5A 3U11A 1QXRA 3MEXA 3ECHA 3BJ6A 2K0GA 2HJIA 2Q30A 1UD1A 3E5XA 3ABUA 3PQJA 3H3ZA 2D93A 3TQNA 3BY6A 3BPXA 2D45A 2IP2A 4ZYEA 3ELKA 1BC8C 1Q5OA 1DPRA 3E6DA 1X8MA 4P55A 2K4BA 1IXSB 2O0YA 5JR7B 2EWNA 3T5XA 2FA5A 5FDBA 3REOA 5K5OA 3GFJA 2UXNA 5BOXA 3IC7A 4HV5A 2L4MA 2ZFWA 2KIMA 2XKPA 3NJZA 4HVRA 5C6CA 3RIRA 1VR3A 5FB2A 3T8RA 3SCGA 2IC1A 4UBHA 1OYYA 3FMQA 1CAVB 2TDXA 3SFZA 3N97A 3W6KB 2JRTA 3RDIA 2GC3A 2Q1ZB 2EV0A 4EGZA 3ACLA 4GO1A 2BNNA 3QPTA 3HOTA 4UBGA 2R7DA 1YFHA 3TOBA 5KHKA 1BOAA 1BN5A 2VOPA 5TJJA 3Q5FA 2FXAA 3GO5A 3H3UA 3L2HA 1YO5C 2ZXJA 3HTUA 1I5ZA 1SMTA 1ONVA 1FBUA 4AVBA 3L9FA 4CHUA 3WGIA 1G3SA 4Q0PA 2M8EA 2QBYB 1D3YA 3MQ0A 3JTGA 5K8SA 1ON2A 5FLHA 1CF7A 1PUEE 3IKVA 5ED4A 2YSRA 4QMAA 4EJUA 2O6GE 5I0TA 4KWKA 2H09A 4L5IA 3QU3A 4I7HA 5JSOA 2A68F 3DP7A 3ZPLA 4G6DA 4BH9A 1XE7A 4PIXA 2HYFA 3TNQA 1ZRDA 1TNSA 1JHHA 3WG9A 2DPUA 3B02A 5K5RA 2QUFA 3F6VA 4NQWA 3EJKA 3LWCA 2AXLA 4NHJA 2K86A 5D4SA 4UV8A 4HN1A 2HKOA 3MZHA 4IJAA 3HUGA 4LLOA 5DCMA 4JTNA 2BBYA 3CEWA 3V8KA 2EAAA 2CFXA 3SQNA 4HX7A 3F8CA 4I0AA 2XROA 1NHAA 4EROA 4CXFA 1BI1A 1LB2A 1WKMA 5BS6A 2HGCA 1XDUA 1KA8A 4XLNF 3GZ6A 3LSTA 1J1LA 5I0RA 3PLQA 4KUMA 3SHRA 1SD4A 4GYIA 3UKNA 4HA8A 4MGZE 5E1RA 5ILVA 5D5UB 4TLFA 3M3IA 4FBFA 1YTYA 4XF3A 3KZYA 3DQVC 2A6EF 3O2PE 2QQBA 3R61A 1YQAA 1RNLA 3RI4A 1IUYA 1YWKA 5HLIA 3CUQC 1EPZA 3RNSA 1QQIA 3PNAA 1YW7A 2HWVA 2PBIA 4AVAA 2WWYA 4YIFA 3SZPA 3T0YA 4XSXF 4IEOA 3JTHA 1VP6A 1SD7A 5BXXA 4PDKA 2LF8A 1D8JA 1ZGAA 2MHFA 3KP5A 5LRRA 3P9CA 5J7MA 1VJ2A 3BJAA 1ODDA 1TLHB 1WLTA 1ZRRA 4O3MA 2PEXA 4A12A 4CO8A 1EP0A 2Q0OA 2YU3A 2WTEA 4NVPA 4I0BA 4LUKA 4IERA 5HLGA 1B9NA 4EWDA 4AWXB 5CYVA 5JAXA 2BYVE 1FT9A 3IIAA 2N7GA 4N9IA 4EJVA 1ZREA 3DPLC 1YYVA 5FFZA 3KSCA 3M70A 1FP1D 3VHRA 6PAXA 2KXLA 4MGRA 1FBSA 3FXRA 1EV7A 2YPRA 1W5SA 1FY7A 2IA2A 3CUOA 3FMSA 3IBMA 3LWFA 4E2SA 1PMIA 3MZYA 2B8MA 3LQQA 2JSCA 1LDKB 4HW0A 2EA4A 1KYZA 4ZH4F 2V79A 4OLLA 3LA2A 2IXCA 2GXGA 5EFUA 5F1RA 5I8YA 2XL7A 3R60A 2W84A 2L54A 2BV6A 4KWJA 1MJAA 1SQ4A 3ERED 5CU1A 1H9GA 3EYIA 2VONA 1O3RA 5D1IA 5DEQA 3LZZA 1KQ0A 2MLGA 1FYLA 1Z6TA 4KA4A 2V1XA 1QXJA 1XSXA 1AWCA 4FHTA 3W6JB 2W57A 2GA1A 1I1GA 2HS5A 3H1WA 4MGIE 3HQXA 1YLFA 1DZRA 4J1XA 4EV0A 2P7CB 2RNJA 4BQAA 1WQ2A 1TQMA 2JTVA 5IT9K 4EVIA 5BQTA 1YFYA 5KHGA 4EQQA 3ZN0A 4ZU5A 2IVMA 4WZCA 3BZ6A 1HQCA 4IRIA 5LHHA 2FU4A 1LDJA 1KQ8A 4AD9A 3HTSB 1RTVA 4PGGA 3BU7A 3UKVA 2B0LA 1L0OC 1SD6A 1YG2A 3E5QA 3GUDA 4A0ZA 3NVCA 5L3FA 4IEPA 4MGYE 2DTRA 1FX7A 2PJPA 2CAUA 2UZKA 1K78A 4LJZF 2B5HA 1E2XA 3DN7A 1HKTA 3O6BB 3JSOA 4N0BA 4HVQA 3EBRA 1OD5A 3CLOA 2V09A 4RD7A 5ILUA 3SXYA 3N4MA 1NE6A 4IF4A 3U9GA 3IWZA 1O5LA 2L3DA 3CF6E 2CAVA 4AIJA 4WVZA 3BCWA 4RB0A 3NRVA 4CGZA 2DFIA 4HF0A 1U12A 1MJBA 4J1WA 4F7ZA 5I0UA 2ET7A 2DQRA 2P7VB 2RGVA 5AIPA 4IHTA 1V3FA 5H6RA 2P5LC 3WTWC 4A2UA 3M8EA 3VFZA 5LGUA 2Z99A 1JGSA 5FGMA 3TGNA 3DKWA 3KETA 1PP7U 1CX4A 1U3EM 1D5VA 3E97A 4XFIA 1MJ9A 4QWQA 2PYTA 1U6GA 2GU9A 2P5VA 5TRDA 5F64A 3T8TA 1MGTA 2ZNZA 1ZHFA 3GX4X 2HEOA 4XF9A 4G7ZF 3GW2A 4G7OF 4KMUX 3QACA 1J5YA 2QM3A 5FQ0B 4H7LA 1ZAOA 5E8IA 1FSHA 4HLXA 1F9NA 5K1YA 5BPDA 2GXBA 3ZQ7A 2VBYA 1RUNA 4YARA 1B4AA 5J6XA 5L3EA 1LVAA 1CGPA 1EH6A 4KN7X 2IRFG 3K9TA 2GH2A 3MWMA 2C6YA 1WSUA 3IL2A 3VODA 3KGZA 3IDCB 4EWEA 2OA4A 2COMA 5BY5A 3BB6A 3VOEA 4ESBA 1XCVA 4MX3A 5CADA 2XASA 1B9MA 2QQ9A 4A6DA 2GC0A 4YRDA 2PHLA 2KIUA 1R1TA 3DEUA 4O5VA 3S7IA 4PCQA 2CQKA 2MBFA 4WK8F 3V7SA 5JR3A 4Q5SF 4M9SA 3ZMZA 4IEXA 3R0JA 1XD7A 2VBZA 4EM0B 3I59B 5HDNA 5BUVA 4HYEA 1P6RA 4Q47A 2FE3A 1UHWA 5I0SA 5D6EA 4P9FA 3F8MA 1JE8A 1GHCA 2NS0A 3C3VA 3BOQA 2GAUA 1S7AA 4ZYDA 2DK8A 1YW9A 4ESJA 1W7PB 1W7PA 2VE8A 2ZMEB 4Q0QA 2DCTA 2HZTA 2PMUA 4R1HA 5BV6A 4KU8A 4Q0SA 3FXUA 2LF7A 3NKTA 2KJBA 1SFNA 2Z5UA 3J7AO 4L18B 3I59A 2XGXA 2Q8KA 1BI3A 4WXDA 1HKQA 2HTSA 1YFUA 2H6CA 3DXJF 3V7RA 1J7KA 4HVOA 4LLNA 4CDGA 5DCMB 2OZJA 2C0ZA 5LLQA 5CVVA 4GCVA 1MDMB 4RGRA 4Y13A 2QQAA 4RB3C 2V1DA 1H1MA 2RN7A 1XGMA 1KYWA 1BI0A 1CAWB 2DT5A 3FHIB 4KN4X 4HDUA 2VXZA 3RYPA 5E16A 2IA0A 1EH8A 1P92A 5DD4A 5D8KB 4I98B 1KU3A 1I1SA 3E6MA 3M1EA 1IXRC 2HQRA 4HF2A 4EWAA 1UCXA 3RYKA 4LMYA 2Q0AA 4PZJA 2PQ8A 1KGSA 1KU9A 2QDRA 4IEUA 2RKHA 1RL3A 3HRSA 3J81Z 4S04A 2XLFA 1UPIA 5LEJA 1G3WA 2Y0MA 3WE2A 4RS8A 3QOPA 2MC3A 1S3JA 2GIVA 4EM1A 1SMYF 2NNNA 3BWGA 4RB1A 3BP8A 1O7LA 2ACJA 2A5YB 3SMHA 4I3PA 2VC1A 4KICA 2FBHA 1IN4A 4G8XA 2DLLA 5BMZA 4L9VA 3EUHA 5FO5A 2VT3A 3QAHA 3DV8A 4LFUA 3COAC 4Q29A 2OA2A 3WU1B 3ECOA 4HQEA 4S05A 1DDNA 4LG0A 1DGRA 3JW4A 4YYOA 1FWZA 3I64A 2QNKA 3VB2A 4ZZDA 2XAJA 2FBIA 3V8LA 1AOYA 3IDBB 3WTZA 5DYMA 1HSJA 5EEGA 2L02A 2LKPA 1USTA 1J3RA 2W24A 3L00A 1B6AA 5KK1A 3IRRA 4ZU7A 2PTMA 3CJXA 4LUMA 3FZ3A 3H7JA 1ZLKA 2OD5A 3WU0A 1GVJA 4JV4A 4HAMA 2Z9OA 3D5LA 4MTDA 2MD5A 1IN8A 2O8XA 3JAMK 3FE5A 3P9IA 5FLJA 2CWEA 3U0ZA 2HR3A 3RYRA 1Q43A 2A3SA 4UV9A 2G9WA 2VBXA 1B59A 3CL1A 3F22A 1FXZA 2DK5A 3ST7A 1QZZA 4BHPA 3HYIA 2L4AA 4I01A 4LA3A 4L9NA 5FLXZ 4Q48A 1FBQA 2XAQA 4XF1A 3H9AA 2LDUA 3FWEA 4M73A 3LA3A 1W4MA 2OU2A 4B09A 4XEZA 4EJOA 4HX8A 3K1NA 3IKTA 5BPXA 4P9GA 4LLLA 2D40A 2O8QA 1FYKA 1ZZ7A 3ETQA 5JI6A 1H1IA 4HSLA 5FQ0A 4I09A 2OQRA 4TV7A 1ZNPA 3WE3A 3DFGA 2MH2A 2IXIA 2R7FA 4KFCA 2IJLA 3KCCA 1Y9QA 2M1BA 2XAHA 2ZCWA 2VODA 4XSZF 4A6EA 3U10A 1FZPB 4YSFA 2MA3A 4UVCA 1PDNC 2CV6A 3FHZA 4BHCA 1LKNA 4Z82A 2F5DA 2XVCA 4BIFA 3C18A 4I2OA 3L7WA 1T98A 3LFKA 1MKMA 1XMKA 3Q9SA 2QWWA 1R5GA 4GGGA 4A0YA 3G73A 3P9KA 1S7OA 1T39A 5FD5A 2P17A 1DP7P 3BROA 1J2XA 1Z1DA 4BNCA 3MCZA 2P6TA 1F4KA 1IN6A 2PFBA 5I8TA 1ZZBA 1V70A 3DL3A 3ULQB 1MZBA 5FPZA 3PFIA 1VTNC 2IXHA 1UFMA 4JBAA 4BYYA 1SD5A 4KIBA 5HI0A 3V7CA 4LD5A 4UXNA 4WXHA 4FT8A 5LEKA 2ZMEA 1LEAA 3JZVA 1O7FA 4KNYA 2WV0A 4WWCA 2FMLA 1FP2A 2PMHA 1ZG5A 4PIYA 3RPUA 5E18F 4RGSA 1IPJA 2RQPA 3LAJA 4Q0VA 1XB4A 2FSWA 1K79A 3S0MA 1BJAA 2E1NA 4P96A 1MD0A 5HOOA 1RC6A 3KLOA 3EHKA 4KIGA 3TKYA 5JVTA 3JSPA 2OPKA 1XDSA 4WBBA 1O3TA 1OMIA 4LB6B 3TO6A 4M6XA 2RV8A 3TOAA 1R5HA 3E3VA 1NE4A 4OIQF 3RJPA 4WF2A 2OYZA 1V4RA 3F72A 2OAZA 1Y0UA 3EETA 1IZ1A 3KEOA 2ESHA 1IXCA 1XN7A 1G4DA 3K69A 4XFCA 3G7DA 4HDVA 1BIAA 4DQ2A 2XKOA 2Z69A 3GLXA 2EFOA 1TQIA 4EGYA 4HV6A 3MYXA 5HS8A 4AIHA 5JSRA 5CJ9A 4OFGA 1QBJA 5H20A 1FYMA 3HOSA 4QLCU 1BC7C 3KZZA 3TDZC 2XAFA 1ZLJA 4LG0B 4AVPA 1HXDA 3PQKA 2RDPA 4QGNA 4XFFA 5KBFA 4Q4ZF 2I45A 2CO5A 3I71A 2VE9A 1Z7UA 2K9ZA 1CF7B 1YHFA 1Y3TA 4XFBA 2ETEA 2QZ8A 5ICEA 4KWLA 4ENJA 4Y15A 4LEJA 1TBXA 4E2QA 4R8HA 1F5TA 5T3NA 1I27A 2EFQA 2CW0F 4KIFA 3LQRA 1YFXA 3I54A 4XF4A 5AVPA 5J48A 1LNWA 2M5WA 1K6OA 4M74A 5LGNA 1J58A 3GFIA 1SEFA 3LOIA 2UWMA 2GWRA 2WC2A 1XE8A 2XV4S 4WXCA 4D0PA 3L2CA 4LK1F 4WX9A 5L3GA 3IHUA 4G94A 3H8UA 2EFWA 4KL1A 5IT9Z 1CAXB 2O03A 3KFWX 4XRFA 2F5EA 4GULA 5A2QK 2BE5F 3GZ5A 1IRFA 1FOKA 1CAVA 2A61A 4HSJA 2EK5A 3D0SA 2P5KA 3R6SA 3F23A 3E5UA 1T38A 4YNIA 3RPQA 1KQ9A 2STTA 1OPCA 3WTSC 3MFKA 4QM8A 2HQNA 2BNMA 1QNTA 2IW5A 1IRGA 2A69F 3NL1A 4IXAA 5KVRA 1TW2A 4K8FA 2Y48A 3KMHA 4M72A 3HHHA 4YG2F 1PM7A 2QLZA 1ZX5A 2FF4A 1ZZ9A 5L3BA 1TNTA 1WGPA 1SFEA 5L3DA 4AXOA 1OYWA 1P4XA 1U5TA 5J3UA 4ETSA 1ZG1A 4QX5A 4YFNF 1XSVA 2FEZA 2M87A 2V6CA 4ON0A 2K27A 5LGTA 4L0ZB 2X4HA 2GC2A 2PA7A 1QZYA 1FLIA 3FZVA 3KE2A 4RAZA 1Z9CA 4EJTA 2X0LA 4Y17A 3WTXC 1XGSA 1REPC 3WTVC 2PN6A 1NXMA 3CLPA 4ZZLA 3LAPA 5E8GA 3ZN1A 4M9XA 4XFAA 2JPCA 2DQLA 1IF1A 1RGSA 2PG4A 2ELHA 2VECA 2H94A 4CZZA 3HIFA 4AQ2A 3ES4A 2E1CA 2J5OA 4MHGA 5D5WB 1J75A 1GXPA 1O3QA 2P4WA 4ZU4A 2P8TA 3HSFA 2AS5F 3CO7C 4JQFA 4M6YA 1IPKA 3P7NA 2XRNA 1RUOA 3SCFA 2Z2SB 4AIKA 1IN5A 4XLPF 4GYGA 2FNPA 3H92A 1U78A 2GQQA 4EM2A 1NZCA 3EQEA 2BNOA 2DO7A 2H6BA 4LA2A 4JVAA 3ABTA 4U88A 3E6BA 5BPIA 4B29A 5I93A 3FMRA 2ZNYA 5DV5A
chains in the Genus database with same CATH superfamily
1FNNA 1YI2I 2OPTA 2WT2A 2LKSA 4IEZA 2EA7A 3H0DA 4QB1A 2RNGA 4UFKA 4CPBA 4AZZA 2J1SA 3BG5A 4FFHA 3HSRA 2XLAA 5CVIA 3FIWA 4P5OA 4QSHA 1ALYA 2JECA 2MH9A 4CP9A 3G6JB 4IO9F 1O4TA 5CNAA 1ULDA 1D4M1 5FPUA 4IEQA 5DQ0A 3I4IA 1SFYA 4GXLA 2RVCA 3F3XA 2OBPA 3H7YA 3HMYA 4MEXF 3S5AA 1NA1A 3GXUA 1QRYA 2EZLA 1CZSA 5H9PA 2WAQN 2DPDA 1VBA1 3AKSA 5A2QZ 2GC1A 3OG2A 1X82A 4OWRB 4HKLA 4H0EA 4LB5A 2O3FA 2CSOA 3TB0A 3WF4A 2C9AA 2VJXA 3TL4X 5E17F 3PSFA 2NRAC 3CO6C 3ZSLA 2AQEA 1YIOA 1AL23 3CNAA 3WW1A 4MZUA 2KRFA 5FBJA 2HDDA 1H2NA 1HLVA 3ME2A 1N1SA 1BZWA 1CAUA 2A6VA 3WTYC 4UYBA 3UGHA 3JD72 1VBC1 1IQDC 5EQUA 3KYDB 5FD6A 4ZPIA 4ESFA 5HDKA 3J7LA 1V9U1 1VRH1 1RUD1 1ZRFA 5F32A 5D2AA 3ZMDA 3CO2A 2HLEA 5GAGJ 2YR2A 3VZOA 2YX4A 2HWF2 4FQZA 4D8MA 5LCWL 2DYCA 1UAAA 1W9WA 4LKFA 4O9GA 4O7XA 1WJ5A 3I53A 1PUFB 3IP4B 3S3OA 4ISQA 3KEYA 4UF0A 1SVMA 5J8FA 1BI2A 3E0JB 4EMSA 2DYSH 1H0MA 3S93A 3SHFA 1DZQA 3AKPA 3ABZA 3PUIA 2WV1A 2VZOA 4H55A 2CRGA 4KT5C 2R1BA 1Q8SA 4LTAA 4HPKA 4XETA 1OCTC 2WBMA 4MEYF 3IH2A 1UELB 3MD2A 4L97A 3SH5A 4UHTA 4AAPA 4TWTA 1GQGA 1PIV3 3K4CA 1VMJA 3LE0A 4F8AA 3GCMA 5LD2C 4PJYA 4OU0A 1NLSA 3QRFF 1XE0A 2ZMEC 1MVEA 2Y2ZA 1IG3A 1M06G 3GF2A 1ULGA 1NCQA 3K4BA 4M3GA 2A5ZA 4M71A 1AZDA 3BG3A 5ILSA 3SZTA 2A3WA 1YS7A 1UO9A 2KZVA 1W6NA 5FZ1A 2XHKA 1WI9A 3I8TA 2VQCA 2XF7A 3C7JA 4P9XA 5A32B 3AJZA 4BAYA 2SLIA 4P00B 3QYBA 3TNPB 5FYTA 4HQMA 4AFAA 4E7ZA 3LDKA 3RKQA 2LMDA 5FLXK 4UW3A 1CAUB 2FOKA 1ZZCA 1SBEA 5J8CA 3WP6A 2BZTA 2V5DA 1KU7A 5LWBA 2DVBA 1MVQA 2ZABA 3MV11 4LULA 1R58A 5ICCA 1IAWA 2JG9C 1YI7A 1AL21 1DGRM 3CUQA 1ZRCA 2JG9B 2XPJA 1OQYA 5EYXA 2Y64A 2D7FA 2YY1A 4DPNA 4PLOA 1CIWA 1HRV1 3H5AA 3BR5A 4TYSA 3IPVB 4C3IJ 1GMMA 1V6MA 5A33A 4HBLA 1A6CA 5E20A 2Z33A 3EYPA 4AVTA 2LRPA 2RQQA 4IEYA 1KS5A 1FPQA 3IKWA 4YG6A 4L9JA 4QQHA 2QBYA 1G6NA 1VBE1 3WODF 4D7MA 3ABKH 3S5QA 2M45A 1LRHA 5ACA3 1AJKA 4IQ4A 4JDMA 4LE4A 4WM7A 5J36A 4CYDA 3NNJA 2HOEA 1H2KA 4H2AA 2HOAA 2L9RA 5LBQA 4CDXC 4G6TB 4B47A 1ULFA 4PHZA 1IW7F 5JMCA 3RQIA 1FPN1 1VE0A 1R093 2HKXA 5HS7A 4M6VA 4X1EA 5DAPA 4K21A 4ENMA 3WEZA 5EJ1B 1YCIA 3GLLA 2EFNA 4KYWA 1KQRA 4DZJA 4AQ6A 1UG0A 3QP5A 4B1LA 2MEV3 4YIIA 1WUVA 4PSXA 2Z3YA 2OTLI 3HNYM 3AL0B 1YW8A 2ZKLA 2HVRA 4E7JA 3D0JA 4AHYA 1VBC3 5BNPB 1F5JA 3ACFA 5DM7F 4RHV3 1QWRA 1WPKA 2M4GA 1CESA 1ONAA 5FKKA 3RKWA 5JDBA 3F6OA 3R0AA 3AXEA 1BIBA 3NSTA 4YW4A 1PGL2 3VKFC 2DT6A 1Y9GA 1DQUA 5F37A 1K6YA 2L7ZA 1TQPA 4XLFA 1W8TA 2KLOA 1RINA 5CFDB 2RS51 3WNOA 2X6XA 3W2WA 1W6OB 2P3IA 2VG9A 2Y26A 5LY1A 4XCAA 3WW4A 2VB6A 1W36D 2Y9ZA 1P4AA 3GXOA 3HT1A 1CAWA 3VUOA 5ISLA 3AP5A 5GJ6A 1ZH5A 1NLQA 4XIOA 1KDKA 5LHIA 2L7FP 1CJDA 4BDZA 3WTUC 1J0RA 2Y34A 1BR4A 3KHCA 3F0CA 4MQ9F 1OJLA 1NZIA 2D97A 5DPNA 4NE9A 3I5UA 1W36C 4FPFA 5D4RA 4BISA 4FASD 4META 5EZWA 1L3LA 4DNCA 1TWCJ 3I2IA 4P9LA 1JUHA 3GZEA 5FMDA 2IPQX 4LBQD 3HT2A 3K7AJ 3ROUA 3K2ZA 4NHXA 5CISA 1OYIA 2I8DA 3BT9A 4A69C 1GV5A 3Q3SA 4L9TA 5KXEA 3AKRA 3ZMSA 1BM9A 1MBGA 1BBYA 5KXCA 5EHDA 4FX4A 1WCQA 4M9ZA 3DKYA 4IETA 2YU9J 2PHDA 4QIWN 1VB2A 4WV8A 4C90A 4DW6A 3LOBA 2EV5A 4OIOF 2X5IC 2ZKZA 1RZ4A 2XJVA 3OYIA 2AGSA 5FO9B 3BTXA 1DPUA 2QQJA 1H88C 1TTYA 2VKHA 5L7OC 2BU9A 4RGUA 4U7DA 1GUIA 5FYIA 2HWF3 3WW3A 3OL4A 2DBIA 3D5RC 5D8AC 2YBKA 5LA1A 3KEQA 1XU1A 4XJZA 3LPFA 5FPAA 4Z8BA 3LSKA 5IP6A 4HLYA 4YW6A 3BPSA 1X3UA 3FFZA 2K02A 2G0EA 5JLWA 1LOEA 3H3LA 4G9YA 4RGAA 3CJIB 1NQJA 5FPVA 1BXHA 4BQNA 4BLJA 1EV11 2XIGA 3KPHA 2OXBA 2K7LA 4W6WA 5IATA 5A80A 4YVWC 3LSEA 1SFUA 4ZHNA 5DD8A 1U0AA 3FFQA 4N43B 1XYNA 3HM5A 5GKAC 3ZQHA 4L5JA 4XDPA 5LK5A 4E6KG 5FRMA 3GJAA 4IEWA 1WW5A 3OYHA 2X1EA 1UMHA 2DUQA 1J59A 3FXMA 2WA3A 2Q2EB 5D5XB 4Q0UA 2K9MA 4XKWA 2FMYA 2E9QA 3VDAA 1OFSA 4CP2A 2H27A 2EB7A 5BNOB 3FM3A 3AZYA 3WQ0A 1XGOA 1K78B 2X85A 3Q9OA 1XNDA 2VC0A 2J42A 5FUPA 2UY8A 3PJRA 5FLIA 2E7XA 1ND2B 4MUVA 4XBNA 2WZ8A 5DUUA 1IN7A 3QYEA 2XJTA 3O1OA 1R1VA 4BUPA 2EPFA 2Y75A 3POJA 3B3QE 1XGNA 3E6CC 4M3CB 2O1QA 2VUMJ 2IXSA 5IAXA 3V8JA 5GPCA 1R1ZA 3LEIA 5FAXA 2XBO3 3TO9A 3OUHA 1H8TB 3O5SA 4A7ZA 3U11A 3WHUA 2K0GA 5B1BH 1GNYA 3TW7A 3V0BA 3E5XA 4DEVA 3LNQA 1AR81 1X1CA 2HVQA 2R7SA 3TQNA 2D45A 3V65A 3VN4A 2W2IA 3E6DA 1VBD2 2VW1A 4KG8A 1U8BA 3DPRB 4XPVA 4COVA 4XE9A 3NJYA 4XN3A 5IVCA 1AYM3 1US2A 1V6OA 2O0YA 1W9SA 3MN2A 3CQOA 3REOA 4Q4V1 5K5OA 1J84A 3OD4A 1R4NB 2JDNA 4DY3A 5BOXA 3KM5A 3GTPJ 2HWD1 2NQYA 3T8RA 2HOSA 3UGGA 1OYYA 3FMQA 5DDJ2 2TDXA 1RMU3 1XNBA 4D3WA 4ZS2A 2GC3A 4P1WA 1MW7A 5LW9A 5B4NA 1ZBA1 3LCPA 1JYXA 1NAEA 1BN5A 4HL0A 1FJLA 3OIPA 1IRXA 4NHMA 3L2HA 1YO5C 1PIV1 4Y4YA 2E32A 5GADJ 3MUZ1 2W00A 4A3LJ 2JMWA 2DURA 1G3SA 4Q0PA 1HRI3 5LB6A 2CFOA 1SACA 3RJRA 4IX7A 1MNEA 2ZFUA 1XSQA 5HNHA 2WFF1 4XRSA 4FP3A 5ED4A 4QPIA 3SEZA 1N1YA 5IVYA 4A3DJ 2ZB9A 2HPIA 3B7MA 4I7HA 2IS2A 2GP3A 2A68F 2PN5A 1S7EA 4URAA 4E7KA 3AP6A 3DWLE 5DAQA 3FBMA 3T0BA 2DPUA 5K5RA 1REEA 1MEC1 2EF6A 2LOOA 4FE7A 5EJ3A 4YLZA 3GZAA 3O12A 1W8HA 2AXLA 2K86A 5D4SA 1UU6A 1CPMA 2Y8KA 2HKOA 5FFOC 3HUGA 3HOYJ 4JRAA 5DCMA 4UI9L 1P8JA 3V8KA 2EAAA 3SQNA 3K70D 3JRGA 3F8CA 4EROA 2K5CA 3AVRA 5FP8A 2QE3A 1GZCA 1LB2A 1WKMA 1SAUA 1KA8A 4RSUA 1QVUA 3GZ6A 2M2EA 2DU1A 1C8M2 5ILVA 3A0NA 5D5UB 5DUXA 4HNTA 4OUEA 3HUGB 2ZX4A 2HYJA 1COV1 4XF3A 2A6EF 3MKZA 4PJNA 3RI4A 4CEWB 1K42A 2E7QA 5HLIA 3CUQC 3K4NA 3RNSA 5FLMJ 1YW7A 5M0TA 3BTCA 2RHPA 4URTA 2D6PA 5HCAA 1LGCA 1VP6A 4LITA 2HWD3 3VDDB 2DVAA 4COWA 4PDKA 1R6RA 5ERLA 4B8EA 3JRCA 5J7MA 2AXTC 1ODDA 1TLHB 1OHFA 2WNOA 2Y6KA 2YU3A 3Q0VA 4IERA 4EWDA 3NARA 4XAAA 5T5OA 2UUZA 1FT9A 2N7GA 5C70A 3ASIA 4ZZ5A 4XABA 4XQWA 2I5UA 4MGRA 3A03A 2KHMA 2QQ8A 2DYRH 1FY7A 1WW4A 5GLWA 3CUOA 1OFCX 3L2VA 4A3EJ 1PO23 2VMHA 1OC1A 4Q27A 3MZYA 2B8MA 3S2HJ 1GBGA 4HW0A 2EA4A 1OUSA 1DF0A 4UT5A 2XL7A 3SDGA 2XPWA 2W84A 2L54A 4M3FA 4PT6A 1D2QA 4AFMA 4YZ5A 1D2SA 5CU1A 3ZM8A 5E88A 2VONA 1O3RA 3O0XA 5D1IA 1W39A 4OI0A 1BJQA 2YUSA 4AI1A 2K40A 1QXJA 5EV7A 4NHLA 2GA1A 2LLKA 4O61A 3H1WA 2YU1A 3K4AA 1DZRA 4J1XA 2P7CB 2RNJA 4F83A 4BJ5C 5IT9K 2R0FA 1ULCA 1CZVA 5BQTA 2DCYA 1WMDA 1YFYA 4AGVA 4ZZ8A 4KT6A 2QZ3A 1SDWA 1I3AA 1HQCA 1X4OA 4PF5A 3RSNA 1KQ8A 1MBHA 4XILA 3BOPA 5FIXA 3JQXA 3QWLA 2BY1A 2Y6LA 1BBT2 4D9JA 3ZPYA 3GUDA 4MGYE 3PL8A 2DTRA 4QHZA 4TXWA 2CAUA 4E7SA 3KVBA 4LJZF 1HKTA 1V6IA 2OVUA 3HXLA 3EBRA 1QGLA 2E60A 3CLOA 4XLEA 5ILUA 2VQTA 2QBXA 4YGDA 4Y3OA 3U9GA 5M3FJ 3I2HA 2L3DA 4RB0A 4C91A 4AFCA 4CGZA 4BQ3A 4NOTA 2KDZA 5F2SA 4HF0A 1A5JA 1U12A 4FXGB 1NG0A 4EN6B 3MLLA 1Z0HA 4YVSA 3QBQA 4GIQA 1GOFA 1G2HA 1Y0NA 1AR61 2QUOA 4A2UA 1ZYBA 3DYPA 5LGUA 1JGSA 3KETA 1PP7U 1CX4A 1U3EM 2M7AA 4ZC3A 1URXA 1OVPA 3ONQA 2PYTA 1U6GA 4ZTJA 3HOZJ 2XJUA 3GX4X 2ZHKA 4XORA 2WR9A 4FFIA 1CR7A 1JOPA 4KMUX 4DOUA 1DGLA 5FQ0B 2DA5A 5E8IA 4XUOA 4ES8A 4LO7A 2GN3A 3TRSB 5FY7A 4MIMA 3OSFA 4LK6A 1RUNA 2PJRB 2VTXJ 5L3EA 3FHAA 1CGPA 3K9TA 4QX1A 2W1OA 3I3LA 1AA7A 1Q1VA 1POV1 3VODA 1DQ4A 1YIPA 3JBG3 1ND3B 2COMA 3BB6A 1HJGA 4XIDA 3FBNB 4XOPA 3WT3A 2ZC2A 2VL4A 3MUY1 4B7KA 3PVNA 4D6SA 2KIUA 3DEUA 4O5VA 3V7SA 4M9SA 3ZMZA 3R0JA 5DABA 1W05A 5JIAA 1GV2A 3EUHC 3DTIA 4HYEA 2DTWA 4R9BA 1DYKA 3U1XA 1R081 1S7AA 4ZYDA 4AG4A 3POSA 4NNJA 4Q0QA 2R7TA 2R0QC 1O4ZA 4R1HA 5BV6A 2LF7A 1IG0A 3IDEA 5IJRA 2I10A 3AMPA 2XGXA 2YGLA 5FZ9A 2Q8KA 1I39A 1ASJ2 3HOVJ 1YFUA 1NX9A 3M1HA 4RGGA 5EP9A 2VE1A 2OZJA 2VNGA 3Q8AA 5CVVA 3BR3A 2V1NA 1S0CA 4Y52J 4RGRA 4Y13A 2E35A 3P1IA 2QQAA 2OUHA 4LIUA 2XMLA 1WLWA 1XGMA 3I2JA 1CAWB 4KN4X 4HDUA 1XG1A 3O8GA 2NYYA 3CZ6A 4I98B 3ACIA 4HF2A 1CZTA 2C1FA 4EWAA 4CDWB 3RYKA 1R1A2 2GOMA 2JE8A 3ZXSA 1AXYA 1KGSA 4PFOA 2ZJQF 3HRSA 1G8WA 1EAH3 4OI4A 3L9JT 2LH9A 2Y0MA 3WE2A 3M3OA 4RS8A 3QOPA 4KMQA 3G1OA 5IVBA 4P9JA 4DXSA 5CQGA 2H8RA 2JDKA 1O7LA 3T0AA 1YJKA 1E3PA 3I2KA 4I3PA 1JZ2A 4QT6A 4G8XA 3ZKUA 3RZHA 3ZYGA 1H89C 4Q29A 2R7RA 2R5YA 1OURA 1TZOA 4Z6YA 4PJ0C 4S05A 1D5YA 5K7PA 2P2KA 1DDNA 1IRZA 3JRFA 3WF0A 4GFBA 1DGRA 3JW4A 4L0PA 3ZFEB 4YYOA 3U75A 3SQOA 1OD3A 2R7OA 4AK3A 1LODA 3SFIA 1RUH1 5C4WC 5DYMA 5EEGA 1N77A 2RR12 2L02A 3ZMNA 1USTA 2W24A 2QQIA 4NBQA 1PK6B 5FP3A 1B6AA 1PVC2 3ZPOA 2KM2A 3CJXA 5FZ7A 4Y20B 3O7OA 5F5IA 4JV4A 4HAMA 1V0AA 1PK6A 2Z9OA 3D5LA 4D5CA 2LW8A 3N36A 1WJEA 1Q43A 4OI1A 2A3SA 4UV9A 3OYJA 2VBXA 1FXZA 2DK5A 3ST7A 1QZZA 1ENRA 4I01A 1MS8A 2CV1A 4AFDA 2VZRA 3BQYA 3HEIA 3FISA 2E19A 4EJOA 3S6PA 3K46A 2AREA 3IKTA 1BA5A 4AEDB 3VBHB 2J22A 3WNLA 5IP7J 5JI6A 1H1IA 1REDA 2KZGA 2RM21 4TV7A 5C8CB 1NA1B 1ZNPA 4KNCA 2IXIA 4JGZB 3MIBA 4FFFA 1IO2A 1N47A 2XAHA 4QPIB 4UF0B 1JZ5A 4IOAF 1ZBE3 2KP6A 2QKDA 5T50A 3MGUA 4XJAA 3M3YJ 3ZYBA 2ZCWA 3INAA 4A6EA 1OCCH 3HOUJ 1PDNC 1RUG1 3WHCA 2CV6A 4NIHA 4XAEA 4N4OB 2F5DA 2XVCA 1UN1A 2E7TA 5IP9J 2CQNA 3C18A 4BGDA 1PO13 2PMZN 1T98A 3U21A 1XMKA 1X4PA 1R5GA 4N7IA 3HEFA 3G73A 3P9KA 2IWGB 4IE0A 5CBLA 3KVAA 1I1EA 3N9NA 1CQTA 3V42A 2IVIB 5T55A 2X1DA 5I8TA 3JREA 3ZFGC 3PFIA 3LSHA 3VBRA 3VKLA 1RESA 5HI0A 4KIBA 4A4AA 3DPUA 1GWMA 4LD5A 4UXNA 3HN3A 2ZMEA 3THDA 2YBPA 2WV0A 2B42B 4WWCA 2Y9YA 1FP2A 4UFMA 1AX2A 3RPUA 4YW2A 4UW6A 1ULOA 2WZR2 2A73B 2L9SA 1K79A 3RZDJ 4WZFA 3SITA 1DQ6A 2E1NA 2IVJA 2WO7A 1TMF1 1FIPA 5GLTA 1RC6A 5KC5A 1U5ZA 5GM0A 2R062 5JVTA 3JSPA 3TN93 4AUXA 4IL6C 4QPWA 3WCRA 3TOAA 1AKHA 5F1JA 4FQGA 3ZYIB 1Y1WJ 4YM3A 2PHXA 1VMFA 2WT1A 2NMOA 5J1XA 3KEOA 1IXCA 1HC8A 5A7OA 1G4DA 3K69A 3BG7A 2B39A 2RS33 4BXSV 1QHGA 2DDUA 2XKOA 2Z69A 1Z77A 1TQIA 4EGYA 4HV6A 2E53A 5JSRA 2HDWA 4OFGA 1H9WA 4ZKTB 4CCOA 1FYMA 3ZYFA 2VPRA 3TDZC 2HXIA 2VMCA 3B00A 4LG0B 1Q8PA 2VMFA 3PQKA 1JYCA 2CHHA 2RDPA 4XFFA 4CYCB 2XGCA 2R1DA 4Q4ZF 5JWPA 2I45A 4LBLA 2K9ZA 2DFHA 1SG3A 1CF7B 2QKLB 3FHQA 1LU1A 2KD7A 1RUG3 2QZ8A 4ENJA 4E2QA 4R8HA 4AM3A 1NH3A 1S0IA 1ZBA2 3HAGA 5J48A 3I3MA 1ZBE1 2EXKA 3WV6A 1Y4WA 3PUFA 4BMEA 4K1YA 4QX3A 4TLGA 1SEFA 1RKWA 4EZHA 1JKQC 2WC2A 1XE8A 2JE7A 4WXCA 3H8UA 5L3GA 1ETVA 4G94A 5E8AA 1ENSA 3WUDA 1DYPA 3KS7A 4BQWA 3AG3H 3BTJA 1T33A 1RUI2 2CV2A 3D0SA 2P5KA 5A1AA 3OBTA 1VBD1 4C0BA 3E5UA 5EGOB 2GMEA 1I6HJ 3O1MA 3Q8BA 3KCYA 1ASJ3 5DAXA 4DO0A 1KQ9A 2OTJI 4WM7B 3R4DB 4L9BA 4A7YA 2HQNA 4NIDA 1X33A 4K8FA 3KMHA 4M72A 1IHMA 3M4FA 3HHHA 3HB9A 2QLZA 2HBTA 3G1LA 4ASMB 1ZX5A 1S2EA 5J98B 2LG4A 1ZZ9A 1KRIA 2B45X 2V4VA 1SFEA 5L3DA 4AXOA 2JA7J 4RQPA 3BCAA 2YMZA 2E2JJ 3PSIA 2ZHLA 4ETSA 4QX5A 1RUD3 2V6CA 4ON0A 2K27A 5LGTA 2X4HA 1GDTA 1QZYA 3NV2A 1MNMC 3FUQA 1ZK8A 5HBAA 4EJTA 3JD73 4HRIA 1REPC 1M4WA 2CDPA 1HRV2 4CE8A 1QXPA 1F4AA 4XFAA 2JPCA 1IF1A 4FTHA 4N53C 4K9SA 2VECA 1AL22 3ES4A 4PFPA 3CDZB 5CFDC 1DBNA 5L19A 2H1KA 2QA4I 5C3OA 1MS9A 1GXPA 3SKVA 4ABZA 3CZUA 1PZ8A 3FUOA 4RS5C 2Y6HA 2E7AA 4AIKA 3T1MA 3BIEA 2YDEA 1UQXA 4OAZA 2D3PA 4GKXA 2JD9A 2FCVA 2ZNYA 1FOXA 1WJCA 4G12A 3QH7A 4DZPA 1EAH1 3Q0WA 5KHHA 5FKNA 5FK7A 1UY4A 1VQ9I 4LIVA 1X50A 2CMPA 2JSPA 3PO2J 3PHMA 2WA0A 3N9OA 1POQA 3NJXA 5CVUA 5CFDA 4IEVA 3HD8B 1E5IA 3ZQLA 4C0HA 1TC3C 1Y56A 4A0XA 2NP0A 2HZDA 4CDXB 3QP6A 1VQ7I 5E6HA 4OHWA 3I7DA 4RAYA 1W06A 1EAH2 3KLNA 3VEPA 5FY9A 1RRJA 3H1YA 2VN2A 2P0WA 1O3SA 3NJVA 3FLPA 2MPFA 3W3CA 1Z6RA 2SBAA 3I2FA 3BJOA 5JI7A 2W94A 3FL7A 4OMZA 1RVF3 4Z92B 3ZQIA 1K5MA 4K2EA 3CU7A 4A45A 1K5MB 3HHGA 3I97A 4DUWA 2GDFA 4DEQA 1S5LC 3S2WA 3JD71 4HSRA 1Z05A 4Y1YA 3BIWE 4AC0A 2GH8A 3I9V2 3PTYA 3MLKA 5K9YA 5LA9A 2BUKA 3I3DA 3EB7A 3M8FA 4XHBA 4RS5A 5FY8A 3KGLA 4I30A 3WZ1A 5F6KA 3ZOIA 2PAEA 2D44A 1TQ5A 1LTEA 1UOJA 2K85A 2I07B 4XLAA 3GYDA 1SVOA 2QTWB 4B8XA 3EPZA 1A31A 2KL4A 3F21A 2B4KA 2OX0A 4YZ1A 1D0XA 2JRMA 1ETKA 2EVXA 3ZXLA 2RS52 3F8BA 3CUQB 2JG9A 4MLOA 2EQRA 2NAZA 2K4JA 3C3WA 5A3LA 4QX0A 3BCBA 4UXAA 2VZPA 3CJQB 3KB5A 2P34A 1G7YA 3RKXA 1VIWB 1XPWA 1ZZ8A 1R36A 5FXWA 4XF0A 4RA0A 3PNVA 5J1RA 1QOTA 4UUVA 1DGWA 4XJWA 3K1MA 3BR6A 1U5XA 5J4VA 1OXCA 4QX8A 5KNLA 3FKIJ 4E7HA 3MHZA 5HV0A 2ZO4A 2BOIA 2MLKA 3JBG2 3O14A 3IUOA 4WVMB 1DP3A 3K4MA 2EH3A 3U2RA 4JCKA 4LBQA 3G6EI 1BHGA 4LBQB 3CMGA 3WVJA 2XOMA 4DOZA 1O59A 2ZBKA 1WD3A 4QAWA 3C8XA 5D5VB 2ISYA 1QQP1 2E33A 4AGGA 1V6NA 1UY1A 4Z2YA 1KJRA 1MS0A 4KMFA 1OLQA 4BDVB 2IXKA 1S6LA 3LKJA 3O3KA 3DPTA 4XCBA 2VMGA 4GB31 5AIQA 3HPGA 2ADDA 3SH3A 1EY2A 1W6MB 1UWWA 4XACA 4BOWA 1SBDA 3PU3A 4RGXA 1VBE2 4J25A 2F2EA 5IUQA 1S0BA 4IE5A 1R71A 1TT5B 4OCTA 3I4MJ 2FRHA 4L0YB 3BG6A 3N9LA 5LZ6A 1JUPA 3CDIA 2BVBA 1Z7S3 3CIHA 4HFSA 4BZ4A 2VQUA 3OGVA 3ZMTA 3RRDA 4O6JA 2HVSA 2IFWA 4FOYA 2M7BA 1IUFA 4BEHB 2AHQA 4ONUA 1JU4A 2DN0A 3WW2A 3AMMA 3HG9A 3H0OA 1RI7A 2V9VA 5DDGA 4MTEA 3CZJA 4MV2A 1DP0A 3NW4A 5CFCA 1UIKA 5F6FA 3VBOA 3VKNA 1O8PA 2E36A 1C28A 3NWKA 3CP8A 1PP8F 2PAKA 1SLTA 3RTRA 3OOXA 4BBRJ 3USUB 2WADA 2G7UA 4GD4A 3K1PA 3I3QA 3PUQA 2ICWG 4FPOB 1QPMA 1GQPA 2P6SA 5BNOA 2B9UA 2IA1A 5KXBA 1HW1A 3TEXA 3MPBA 4Q4Y3 2A6TA 4RL7A 1U5TB 1SFXA 1IJWC 1F1ZA 1PHMA 3JB8A 2Q2EA 3ZGKA 3HR9A 1WFXA 5K7ZA 3AJYA 1G3TA 1U5YA 4A7KA 1FC3A 3OV8A 5EZHA 1LUJB 2DMNA 3I58A 2FMDA 3JRAA 1OKRA 3ML6A 5H9RA 3H35A 2J5PA 3FXKA 5A3TA 3FM5A 2J1EA 3AMNA 1P2FA 1WBLA 1ETQA 3W6VA 2HTJA 4YRVA 2VOXA 2D1HA 3KP3A 2PQSA 2ZMNA 3JRIA 3FJSA 4BXXJ 3BPZA 1GNZA 1GZWB 4NIIA 4AAXA 5BNOC 3RSJA 3TP0A 1HXS2 4MYEA 5B1AH 3RKYA 1H4GA 2PLYA 5FPXA 4D69A 1WMFA 5JFRA 1W90A 4QHOA 1A8DA 2WA4A 4MOAA 3VBFB 4X6RB 5SV8A 5LHGA 5ERIA 2OF7A 4XTPA 3AFHA 4XQFA 4PJMA 4CUCA 5JCTA 1LOGA 4DYQA 4BS9A 3AKTA 4IDZA 3F8NA 2X6OA 2WABA 1XNTA 3WP4A 4P9WA 4RLFA 3K48A 2MNGA 3TDUC 2QQNA 1QDOA 5C8WA 5BNNB 3OJBA 1J3PA 2KIFA 3OD0A 2GA2A 3JB4C 3WR0A 4TTGA 5KAFC 1HQLA 2BP6A 3WINE 3OBAA 2C4XA 4XM3A 1UG2A 4IZZA 4FTSA 3B73A 4IL7A 5F8PA 1MS1A 1VBC2 1VBA3 3GBFA 2IT0A 4UW5A 1AKHB 3J81K 3LSJA 2GZWA 2JD4A 2FQ3A 5A3MA 3E7LA 3WP5A 2DAOA 4QKBA 1SLAA 5FXZA 2W95A 2HWC1 3NKGA 4BDYA 5D6FA 2PFWA 5D8AB 2NYXA 2LY1A 4AW7A 1SAXA 4IHVA 3VBSB 2OJED 4BKXA 2NVTJ 2VXDA 4MFDA 4HOBA 5L36A 1W0OA 4HOOA 3OGGA 2JJ7A 4A6OA 4CDUC 1P7JA 3NEUA 2F4PA 1WMXA 4FAHA 4MNUA 4IHXA 1HN1A 1WLCA 3A0HC 1KU2A 3FHNA 1OPOA 1ST8A 3JCUC 1NLRA 3GCXA 1BVP1 3WGHA 1PVC1 3POYA 3AFGA 4BMBA 2DUPA 1YXWA 4NB5A 4EZ4A 4DUVA 1A36A 5FPLA 3OCPA 4TZDA 4Q4Y2 4XFGA 4GXOA 5ICFA 4BLIA 2R5ZB 2ZX1A 1FOYA 2VJ5A 1UZ0A 1X9PA 1N78A 4CYCA 2A6HF 3B94A 3WDVA 4E8DA 3BTZA 3W9AA 3OYLA 4K3UA 2QDNA 5C3EJ 3UJQA 3M3EA 2HBUA 3WU2C 3MVPA 4RN5A 2XB0X 3VDDC 4YFKF 3ZFGB 1L3JA 4IRGA 2B63J 4YPJA 3CMAI 1FEXA 3LPGA 1K4SA 1HX6A 4W8JA 1ZBE2 2ZX2A 4FPEA 5KHIA 4XDOA 2UYBA 1U8RA 2XHNA 4E8CA 3GVAA 3WGGA 2Y6GA 4DQAA 2OZ6A 1C0WA 2VI6A 4Q4W1 3HQRA 4C9YA 3AG2H 2EBIA 2WNUA 1MNDA 4M3CE 4L92A 4A3KJ 3P3PA 1OT5A 3H50A 3M8LA 4IESA 4WVWA 1I3QJ 2A07F 3NV1A 2Y0OA 1NA1C 4IEJA 3ZMOA 4OHXA 3WQBA 2IXLA 1YS6A 3NNMA 4PGHA 2R041 2ISZA 2E7WA 4G6QA 2VOWA 2NNYA 3AMQA 3VDDA 1HBXG 5J3LA 3KP4A 3DLLF 1X3ZB 1DQ1A 1N3PA 4MH0E 4GKYA 3KIOA 2VTFA 5FXXA 4X6AJ 3H0GJ 1QOSA 2W25A 2JZYA 4BQ2A 2X8KA 2HWE1 2O5RA 4PQQA 2YFZA 1WH7A 1PVC3 3OSDA 2DCEA 2R7VA 1NCRB 2R3SA 1C1FA 2H0VA 4PDWC 4XOTA 2ZTNA 3QPLA 1H6YA 3FXQA 1QJX1 4DXRA 3GMEA 2WY7Q 1ZR2A 1ERDA 1X58A 2UYAA 2XJSA 1LENA 3AKQA 2M30A 5HDGA 3M7GA 5J96B 2L2OA 2Z1DA 2YU2A 4ZONA 2WZR1 3FF5A 1JOJA 3VD3A 1QXRA 1RB8G 3MEXA 3ECHA 2JKXA 2HJIA 1UD1A 3BZCA 2D93A 4Q5OA 3FKJA 3BY6A 1DDLA 3GDBA 1DPRA 4H14A 1KS4A 3C7HA 4WM8B 3OYWB 5B2GB 5A32A 1JI8A 1IXSB 2XF5A 5JR7B 3T5XA 2VAUA 2FA5A 1IC8A 4PJLA 3UETA 2WNUB 4ZTFA 4HV5A 5A3UA 2L4MA 5HODA 5ACA1 5F08A 5FB2A 2Q8EA 3SCGA 2IC1A 3CESA 2D6KA 4UBHA 4PDWA 1CAVB 4XKCA 3N97A 2ZEXA 5E89A 3UJOA 1R083 2Q1ZB 3ECQA 3AMHA 4CVUA 4CDXA 4GO1A 2BNNA 1YX3A 4QQLA 2VTXA 3HOTA 2R7DA 1YFHA 1B09A 2RS12 1SDDB 3DF0A 4RFT0 1RUG2 2VOPA 2VBDA 3Q5FA 3KYLA 3PUBA 2VQHA 5DAWA 3H3UA 3ASOH 3A2KA 1FBUA 5M5WJ 5C3RA 1YNAA 4XJUA 2RMU2 4RA2A 3WGIA 3PVEA 3AYCA 4JX0A 2OC6A 2VVEA 4YG3A 4MGTA 4BA6A 2BY0A 3J26N 3L2RA 2ZGOA 3IKVA 4JP0A 4QMAA 4ASKA 4FPCA 4KWKA 4HPKB 3ERMA 3EMRA 2H09A 4L5IA 4ZJZA 3QU3A 2XB5A 3ZPLA 1L7LA 2E1OA 2W82A 2HYFA 1TNSA 4GWIA 3SC7X 2COBA 4M3BA 2QUFA 4M0HA 4NQWA 2BTVC 1W8UA 3EJKA 1YJLA 3UKGA 2ZGRA 1O6UA 2LTNA 5L9RA 4CDQC 2JQ7A 4OUSA 2HYKA 1XJAA 1ZELA 4HN1A 4IJAA 4LKEA 4UUSA 4LLOA 2KRCA 1UX6A 4XC9A 1U5IA 4Q26A 3CEWA 3WDWA 5GAEJ 3J7ZI 1PZ9A 4HX7A 4JGYA 4NPLA 2UU8A 3I2OA 2EZKA 4I0AA 3PIGA 3ZVXA 2GNMA 4L8QA 3OPZA 2NZ9A 9ANTA 1SLCA 1XDUA 4NAMA 2NN8A 5FMBA 4XLNF 3RZMA 4YVWB 4W65A 3D6EA 1SD4A 3QODA 4GYIA 1FOD3 1E57A 1OOPC 1XTAA 4TLFA 4BU2A 1YTYA 3KZYA 1SLBA 1A6QA 1X1DA 3O2PE 3SEQA 1RNLA 3OBZA 3TEWA 4OHVA 1R64A 2MW8A 1YWKA 1EPWA 2OPWA 2W39A 2LVSA 2VD7A 3LGRA 1WCKA 2ZSIB 2W48A 1OVSA 4P02B 3T0YA 5CKMA 1GLNA 5HNFA 3VL9A 1SD7A 1CIYA 3CC7I 5FZHA 4C1XA 1D8JA 1DQ2A 3KP5A 4KGGA 2BY3A 4ZXEA 1E3HA 2WNUC 4P14A 4YW1A 3BJAA 3G4SI 4A12A 3W20A 2M9HA 2Q0OA 2YS9A 4NVPA 4N4NB 2CH0A 4LUKA 4HKOA 5HLGA 4MHUA 1W0NA 4ITCA 4BQXA 1BK1A 4QPIC 3K4DA 3GZUC 4N9IA 4EJVA 2QQKA 1H1AA 2B7EA 3M70A 1FP1D 4JGZC 1S72I 4AHXA 5FYZA 6PAXA 2O8KA 1EV7A 1CN1A 4LO5B 3T2PA 4RHV2 3ALQA 3FMSA 3LWFA 2FOWA 4E2SA 2PHRA 1PMIA 1YEWA 1Z21A 3T1LA 3LQQA 3T2OA 4AEDC 5EG0B 1I3HA 5IHRA 1LDKB 5C4JJ 4ZH4F 4OLLA 5EFUA 1F9KA 1CWPA 5F1RA 4UUTA 2LUWA 1QA6A 4ARYA 4DS0A 2BV6A 3H42B 1MJAA 1FX5A 3WDUA 1HIXA 1OISA 4B3XA 3EYIA 1C57A 1RVF2 3POWA 1ODNA 5FO7B 2ZGSA 4GRIA 5DEQA 3DBHB 1KQ0A 2MLGA 2VNRA 1MBJA 2V1XA 1XB9A 1XSXA 1QJU1 3UESA 3W6JB 3GTLJ 2WS92 5ANNA 1PGW2 4QXBA 1I1GA 2AEZA 4PCRA 2L9NA 2WZEA 3KQRA 4C2UA 3PNTA 4GMP3 1NKGA 3SDBA 1WQ2A 1TQMA 4W6YA 3TBDA 4AI9A 4KH9A 4Y1XA 4XR6A 4CTEA 2R072 1W8OA 2TUNA 5KHGA 4H7MA 4EQQA 2HQAA 1ITYA 1OSGA 4DJAA 5GZFA 3ZQCA 3ZN0A 1YRZA 3WX5A 2IVMA 4WZCA 4BY1J 3CKHA 1R082 4XLCA 5F0CA 5JXGA 2FU4A 1B35B 3HTSB 1BK0A 5C4XJ 3BU7A 4NPMA 4BB3A 1L0OC 2MFZA 1SD6A 3E5QA 3NVCA 4R9DA 1A6IA 2EIMH 1LFBA 1FX7A 2WIIB 2UZKA 4EYUA 1JYIA 5FRAA 4N0BA 1REFA 5FYSA 4RD7A 1MH4A 2ZGNA 2XJQA 3AX4A 2CQ7A 2MD0A 1SLLA 2QQOA 2CAVA 2TNFA 5M3MJ 2CJJA 3DEEA 1TVGA 2DFIA 1U9OA 4XK4A 5I0UA 2XVGA 2ET7A 1T2XA 1VBB2 2RGVA 4IHTA 2CWSA 1V3FA 1X2NA 2XONA 1W3XA 3M8EA 2Z99A 4JQRA 3TGNA 4PJJA 2W5FA 2ARXA 2L7KA 4CDWC 1I9RA 2JDMA 3N3HA 3DXTA 1MGTA 1W8WA 1FMD1 1DGWY 1UXXX 4DMIA 1J5YA 4CPBD 2QM3A 3VD5A 4XBLA 1B8IA 1QJFA 5TISC 1LEMA 1PIV2 1HDKA 5C8CA 2FDIA 2IGNA 1GT0C 1WJFA 2GXBA 1W6QA 4YARA 1UJ8A 1B4AA 4B3AA 2VMDA 4RAGA 4RM3A 1EH6A 5EYRA 1HOMA 3MWMA 3PNYA 1Y43B 1JT6A 2C6YA 1WSUA 3IL2A 1JMUB 3KGZA 1AHSA 2WAAA 4ESBA 3JRDA 4UFIA 1XCVA 2BDRA 2XASA 3H3VK 4IKFA 3UNGC 3AYEA 4AHZA 2E1MC 1UYYA 1POV0 2F6CA 1OLMA 2W46A 5EIYB 2CQKA 4BM8A 4COYA 5JR3A 2ZGKA 5JXIA 5IOZA 2A5WA 1XD7A 2VBZA 1BBT1 1VNDA 5CKTA 3I59B 5HDNA 1WLDA 3GBWA 2VXJA 1P6RA 2X6YA 4Q47A 3F8MA 2O8OA 1GHCA 4BACA 4BQ5A 3BOQA 2GAUA 1W28A 2DA6A 3LEMA 1Q8VA 3ZFEA 2BW8A 5A7SA 4I0WB 4XBQA 2TCTA 4XOGA 2ZBJA 2PMUA 1NCQC 4Q0SA 5A7NA 1WVRA 2P3JA 2HWC3 2Z5UA 4LKSA 3LFMA 2AENA 3J7AO 4L18B 2VNOA 3RQ0A 2XH6A 3H8XA 5JXJA 3MKYB 3PMSA 2HEYF 4NIGA 1BI3A 4WXDA 3MF6A 1W99A 5DUWA 4Q1RA 1S0FA 2H6CA 2JWPA 3DXJF 2W08A 5M5YJ 3V7RA 4CCNA 4CDGA 1QDCA 5DCMB 1N3QA 2VZTA 5JOYA 3LSPA 4Q1PA 1Z7LA 3VBRB 1MMSA 3WNNA 1LFPA 2V1DA 1H1MA 2RN7A 1GZ9A 5EXOA 3PURA 1KYWA 1BI0A 2DT5A 3CC4I 2VXZA 2E5ZA 1E5SA 2D5VA 5E16A 5A6QA 1P92A 5IYYA 3LQCA 2JUGA 4X0GA 2VIXA 1W1WE 1QJY3 2RS32 5EF6A 3DTKA 4KISA 2HQRA 3MKWB 4CH7A 4LMYA 3C7OA 4PZJA 2PQ8A 1EV13 1KU9A 2RKHA 1AR73 1RL3A 2YXSA 4S04A 5C4WA 5LEJA 1NQDA 3OYWA 1SFPA 1S3JA 2GIVA 1SMYF 2L9VA 5DDJ3 2ZZJA 2KT0A 1MZ5A 5C4WB 2R6QA 2WSVA 1KZHA 3TN92 2A3YA 2ACJA 2KISA 2A5YB 1JJ8C 3SMHA 5FZKA 1R9TJ 4ISRA 2DLLA 2H1LA 2NS7A 3M1CA 4L9VA 2G4IA 1FPN3 1DG6A 2X9DA 4HEA2 3QAHA 1H8VA 1O91A 3COAC 3M4OJ 2OA2A 3WU1B 1RHI1 1FMVA 1F36A 5FK8A 2RMU3 5J09A 3O1VA 3DLAA 4CXXA 3J8F1 1FWZA 1OOPB 3I64A 4A44A 4HG6B 2VJIA 4LT5A 2XAJA 1TP4A 1COV2 3V8LA 3C2BA 2BV4A 4INDA 1H8TC 4B4RA 1JZ3A 3FXJA 3IIIA 1VPHA 1F15A 5KK1A 2ME6A 2R071 1JTYA 2FJ1A 4BJTA 2R5ZA 3D8CA 4QQPA 1BR2A 4J6GA 4WM7C 1ACCA 3OR1C 2CQXA 4M4PA 2V4JC 4MTDA 3DECA 4CZCA 1IN8A 5FZGA 4Y7NJ 2O8XA 3WDTA 1AR93 4CDQB 3P9IA 2CWEA 3U0ZA 3RYRA 1H2MA 3QYFA 2Y60A 3IZOA 1IZ3A 1B59A 1QHDA 1GV9A 1XSRA 3K51A 4YGBA 5C9AB 1W9TA 4XHXA 1XBFA 2K9QA 1LU2A 2YBSA 2DWRA 5BYNA 1VFCA 1FBQA 3BU0A 1TMF3 3IMNA 3FWEA 4CU9A 2M3AA 1W4MA 3PUAA 2R073 4XEZA 1H4HA 4HX8A 3K1NA 4P9GA 4LLLA 2R7ZJ 1VAKA 2D40A 2O8QA 1FYKA 2NPIA 3ZCOA 5FQ0A 2W91A 4JC1A 2RJKA 2KDOA 4OQ9A 3K77A 2CUEA 2WFF2 1VI0A 5KCMA 3WE3A 4O65A 1AR91 4BQ1A 4JX6A 2WLQA 3BOWA 4RHV1 1LOCA 2WB1N 3TP3A 1RXGA 1Y9QA 2DFFA 2M1BA 5FPBA 1JW6A 3A0BC 1G8XA 2A6WA 3VKOA 1OLME 2VODA 3S1QJ 3HQUA 1FZPB 4Q8KA 2V9KA 4YSFA 4UVCA 1DIWA 4BHCA 3ZSEA 4DFSA 2ILMA 5DXDA 1ZA4A 4BIFA 2QQPA 3X2QH 3LOCA 4JZRA 2JG8B 1HCRA 3T09A 5F3GA 1AYM2 4GGGA 2F4MB 3BTIA 1WJDA 4LBNA 5DDJ1 1DP7P 2ZX0A 3CBNA 4NWVA 2HWD2 4EATA 2ELJA 1ND3C 1W8ZA 5F04A 1UFMA 4BYYA 2W1QA 1VBB3 5IAVA 4WXHA 4FT8A 5LEKA 1LEAA 3O1TA 3OMYA 4UFJA 4BWOA 2EAKA 3E1F1 1BL0A 2WZR3 1QJY2 4KNYA 1UU4A 2PMHA 1ZG5A 5SV5A 4U36A 5E18F 4Q0VA 3J7AY 2FSWA 2QGUA 3S0MA 1MD0A 1D0GA 1W6OA 5HOOA 4BE3A 3LSDA 3KLOA 4DB5A 1YRNA 3RI8A 3JUUA 4R9AA 1J1TA 1O3TA 3ABMH 1XMXA 4M6XA 1WCDJ 1IKQA 3RJPA 1YQ5A 5DS9A 1NCRC 4WF2A 3U4SA 1V4RA 4BK5A 3VBRC 2ZSHB 2HWC2 3TMOA 2NVUB 2NOGA 1AUYA 3EETA 2WUHA 1BEV2 5A70A 3UL2A 3EXUA 2ESHA 4F3QA 4XUNA 3VSKA 4KI5M 5JHFA 2JDYA 3KT4A 1U0JA 3G7DA 5DTDA 5KAIC 2DA4A 1FTZA 4DQ2A 3EUAA 2EFOA 2WQ8A 2D6NA 3MYXA 5HS8A 4AIHA 4R4ZA 3KZZA 3DTEA 1MZEA 3KLSA 5FWEA 2WQZC 2WDBA 4JDOA 4XJ8A 1Y6IA 1ZLJA 3JRBA 2XRLA 2BWAA 3CJTB 2ORZA 2M4KA 2VE9A 1MIJA 3VPRA 4XFBA 2GLOA 4CXWA 2D6MA 4KWLA 4LEJA 4QKNA 1TBXA 3A0KA 2QSFX 5T3NA 2EFQA 2JUCA 1MMAA 2VUCA 1H0BA 1QJX3 1YFXA 4S2DA 3SEEA 3ACHA 4PBPA 2ARCA 2XVKA 2JA2A 3OBRA 3ZR8X 1HXS1 1JTZX 2BERA 4V19K 3LOIA 4M00A 2WN2A 2XV4S 3A01B 3L2CA 4WX9A 3VBUA 1JOBA 2EFWA 5EJZB 3ASNH 4JRLA 1OR7C 4XRFA 2F5EA 3HJEA 3USUA 4A3CJ 2BE5F 5A1LA 4M01A 1IRFA 1FOKA 2A61A 1APNA 1HF0A 4AE2A 4HSJA 1GVDA 3R6SA 1RIRA 1T38A 4YNIA 3VBOB 5HCBA 4WVMA 2QSHX 2C6SA 5B66C 2CGNA 3UGFA 3MFKA 5ANQA 2BW3A 4QM8A 2BNMA 1IRGA 4FSJA 4IXAA 3T3YA 2Y48A 1NOVA 1PM7A 3ZN6A 4P9YA 2FF4A 1UOFA 1AR83 1MQTB 4BK4A 4A3JJ 5KHDA 2CS3A 1N3OA 3VBSC 1SCRA 4CA9A 4Y5Z0 1X19A 1U5TA 3RFRA 5J3UA 2Q5TA 3ZXKA 4YFNF 1XSVA 4AIDA 1OA4A 2X05A 3TEZA 1JU3A 1Y7BA 2GC2A 1FLIA 2QKMB 2X0LA 4R9CA 2NMNA 5L7OA 4Y17A 2NXNB 3ZYJB 3NAPA 1XGSA 5IFPA 4QDRA 4NJ4A 5IVJA 3SH4A 3VKMA 4KWUA 5JXHA 2M34A 3DU6A 4M9XA 2DQLA 1RGSA 1US3A 4NR1A 2ELHA 2W4SA 3K4JA 4II2A 3HIFA 4LHKA 4AQ2A 2R7QA 5TSWA 4LHNA 4BPZA 3HGGA 2ZEWA 1J75A 4KBZA 1X1BA 4YZ4A 1O3QA 2VOKA 2P4WA 3IT8A 4Q2FA 3OYMA 1W0PA 2LP0A 2P8TA 2Q1FA 5ABJC 4C2TA 1JODA 5C3SA 2ZX3A 3P3NA 4BE1A 3KF5A 2Z2SB 1D4M3 1D1BA 3H8RA 4DXTA 1SVLA 4W50A 3IAPA 2DO7A 3T2QA 2H6BA 1K61A 3UYJA 2BXYA 1V5EA 4HG2A 3S8PA 4QB2A 5KXDA 1Q56A 4Q4W2 3E6BA 5BPIA 1W6MA 3FMRA 1PUFA 2ZS6B 2NVXJ 3KD4A 1QQP2 4F91B 4UB6C 4CCCA 2H8WA 4EJWA 1L7RA 4D7SA 4I99C 2WNVB 2XL9A 1YQCA 3GHMA 3GEZA 2M0MA 4BBSJ 1UY2A 2GSYA 1JKRC 3ZN5A 4FPHA 1MEC3 3S17J 1AF9A 5DN2A 1B1BA 1ZGWA 3D82A 1UX7A 2VCAA 3PM1A 4LGWA 4FO9A 2ZXIA 2WWJA 5CVRA 2WNVA 3G1MA 1KFXL 2CNAA 3H5RA 1KD7A 3W5MA 1H9PA 2H0BA 1AL0G 5C3PA 4IXLA 4JGZA 2LM3A 1QPIA 1F35A 2CU7A 4YFXF 2D5FA 5LFAA 1LVKA 4I02A 5ICGA 1HDDC 2LNBA 3ISPA 4AU7A 1ZBA3 1YUDA 1Z91A 3HVDA 4AOCA 2ZMLA 3F95A 2F5VA 1K7AA 2ETHA 5ABJA 4AWDA 1Z78A 2JA6J 1X9TA 3DYOA 2ZHMA 2QVSB 2GP5A 5EPAA 1VAMA 1USSA 2DA3A 3OOPA 2C5DA 1H8TA 1W6PA 5DCFA 1YIFA 2R93J 4CU8A 1RR7A 1ZARA 3CCJI 1JYTA 1OQEA 4JDNA 3H9JA 4OOIA 5FBZA 1JT0A 1W3VA 2MGQA 1ZYRF 1Q1HA 1ZN2A 2ERFA 5EGOA 1NY72 1TME3 4LO4B 1AYN1 5D8AA 5JSPA 1UMQA 5I91A 3J80K 3SXWA 2VMEA 4LLFA 4LLGF 2K9SA 3OF1A 2OQGA 2DOEA 5FZ6A 2F5CA 2V5YA 5IK7A 1JZ6A 1T6SA 4BJ6C 2VOTA 3USSA 3WNKA 2DA2A 3OOUA 1LOAA 1AHDP 2RAEA 3TWIA 2R063 2MEV2 2JDUA 4OUMA 4CCEA 2VU9A 3H1MA 3OYKA 2WNVC 1Q3EA 4X8NA 3I0TA 3OYGA 1I50J 1OFNA 4HBNA 2A71A 2CU5A 3ZMUA 4N90A 4QU1A 1W7PD 5FUNA 2EXJA 3B69A 2YC0A 5J40A 4IHYA 3WD5A 1WCSA 3S57A 4QGMA 1D7PM 3HOXJ 2ET1A 2R7WA 3MIGA 1GNHA 1ZTRA 3RQ4A 1Q8QA 1X2MA 1S55A 1A35A 2JEMA 2WWSA 1C5HA 2LYCA 1T95A 4QXHA 2VASA 1OQ1A 3OYEA 4FOQA 1BCXA 3GTKJ 2W85A 3ZDSA 3F8FA 3WDXA 1EH7A 5EEHA 1AYN2 4FCAA 1UIJA 5IYDJ 4ZYAA 1W0TA 1HN0A 1IV6A 4OIPF 2ADEA 2RDNA 2WRAA 1VRH2 2ZGMA 3C1DA 1JHFA 1SHWB 1UB9A 4XKBA 2CGPA 3CJNA 1UF2C 1TW3A 4C3JJ 4DGWB 3K10A 4PI2A 4AYBN 5FMCA 2KPMA 2ZEZA 4U87A 5GZDA 4LXLA 2JIGA 2QCSB 2OQ7A 3RCOA 2E1MB 4DINB 4CP0A 1RITA 4BQQA 5C9AA 1YJNI 2AR6A 5HVQC 2L01A 1G9FA 1RIOH 3FMGA 4NN0A 4XFHA 2UXXA 1YRNB 5LA0A 2DA7A 4CDQA 4EN7B 4QU2A 1RUF3 4OZOA 3LIHA 2YX7A 4ZYHA 4G7HF 2M0CA 3MAJA 1E0EA 2BEOA 3KQ4B 4FAGA 3HSEA 5C7GA 2Q8DA 1QZEA 2DXIA 5BNNC 2F6BA 2XVLA 3AM2A 4E7IA 2W47A 4SBVA 4ATEA 5C33A 1AR63 1SFOJ 2STWA 1GOGA 2EFPA 5KHJA 3NV3A 1HSTA 1UMIA 3PUSA 1RUH3 4B4CA 2P6HA 4AVCA 4A3GJ 1UKGA 4RB2C 2E6VA 3IRQA 4ASNA 1TWAJ 3OSGA 5AC93 3ZFFA 3ES1A 1CPNA 4Q4X2 3SEPA 3IWFA 4R52A 1IS3A 4AEJA 3N7MA 3O1PA 2VQGA 2BVVA 2KJCA 4O9EA 3P5JA 4C2MJ 4C8DA 4MQVA 4CUBA 1RUI1 3O0VA 3IMMA 5GPAA 1Y9MA 1LDDA 4QB6A 4XW3A 2L5QA 1CX1A 2JENA 1CJPA 2CYYA 2VBBA 1K4TA 3Q0UA 1DLCA 3SCHA 2XPVA 2VPLA 1J9IA 1LGBA 1KGYA 4YFZA 1ULEA 4PQ9A 3R4UA 4L2NA 1IS5A 2DODA 1MDMA 1NUKA 4OIRF 3M9AA 2EICA 1JZ7A 2K9LA 2HFHA 2XSJC 1JTXA 1HXS3 3OPWA 4I6ZA 2P6CA 4M3EA 3NQOA 2HEVF 3AB0A 4D0QA 4BXFA 5CKQA 3ZR5A 2R043 4OINF 3JAMZ 2KKOA 5BNPA 1E17A 3WTTC 1RUI3 3I4PA 2V1UA 2ARBA 5K4LA 4FISA 5T5PA 1V00A 2FBKA 3LA7A 2LROA 1AJOA 2FZ1A 1AU7A 3L09A 3V4GA 1IQAA 2CG4A 1R23A 1WHUA 1T0FA 4XMAA 5T54A 2WO2A 1UOBA 4RS5B 3MZ8A 3BQZA 4EN0A 1CVNA 2O9LA 1YOVB 4YVWA 2PI0A 2F48A 2LSOA 4HX4A 4OMYA 2LD5A 2EIEA 4SLIA 1XNAA 1Y8QB 1S29A 2D5HA 1OR7A 2ZACA 1RUC2 2W1SA 1FMWA 2G7HA 5DG1A 2HYGD 4S0HB 5E1XA 5I8SA 1RUC3 4IE6A 1KJLA 3AC0A 1GKBA 2V73A 1SFKA 1O4YA 3RWNA 3UKTA 3S2DJ 2UURA 4F93B 3OUIA 3I4NJ 5CVJA 1H9TA 2LBFA 5AONA 3AP9A 1SCSA 1P4WA 2VBWA 1I5PA 3DEMA 5C5UA 1I6XA 1LOBA 4NQWB 4H4KC 1E3OC 3KP2A 1UCRA 4RBOA 3GFLA 3SJMA 1ZM1A 3HGYA 3G71I 2O0OA 4J19A 4R79A 2VQAA 5CLSA 1XRUA 2F5FA 1QGPA 4CA0A 2R5YB 3PIOF 2ZXWH 2ZMKA 4BQOA 5CB7A 3VZNA 2JDPA 1XNKA 1ENHA 2ZJRF 3OEBA 2TEPA 2Y0SA 3QQAA 4D6QA 4OI2A 4QX7A 2K3FA 1POV3 3T1BA 4QHBA 1VQ4I 5FR3A 1R49A 4LO8A 3RZLA 2TRTA 1NYWA 4AI2A 1CAXA 1AXZA 2BOLA 1RC9A 5FYUA 1AVBA 2E31A 1HJFA 4WM8A 3H8OA 2Z79A 1FATA 3EUKL 3VBHA 2X09A 3NNGA 4NHKA 2HDCA 3HOBA 3TN91 3BUCA 2W7NA 3S1RJ 1VQ8I 2DJNA 1JHNA 2NOJB 1FYUA 1POGA 1UYPA 4OAYA 3HRMA 3HN1A 1OCRH 3U1DA 4YEJA 3HNMA 4ARXA 3FLTA 3N7LA 2DCKA 3LDBA 4GB33 4HZFA 2RS31 2EILH 4XUPA 1J3QA 5F39A 2RM22 2E51A 2K9NA 1YYNA 1OA3A 3LEKA 2HNHA 2VNVA 3GYHX 3BALA 1PO12 1QJU3 1MS4A 2JPBA 2CSGA 3NAPB 4YFWA 1GQHA 3MKLA 5HV4A 1GP6A 3PVBB 2DOFA 4HT1T 3OPTA 4RR3B 4ORFA 1JZ8A 2VOVA 2A3XA 1ETXA 3KT1A 1KXGA 3OYCA 2BOJA 1UKRA 3OIQA 3DKQA 2ME0A 2QVOA 3L2WA 3PJQA 3EYYA 4MHRA 3GTMJ 4A5NA 4BHBA 3NO8A 2JIJA 1V6LA 4E4HA 5EYYA 5FJ8J 4IPAA 1TNRA 4XZPA 5H9QA 5IY5H 2FDHA 5L7OB 4U0VA 3HPNA 3CLQA 2O7OA 4COZA 1XU2A 4CRQA 4DIQA 3K75B 1C8M3 2YPJA 3AG1H 2J1RA 3T2TA 3QPSA 5DUKA 3A7QA 4ANJA 2FNAA 3UR3C 1NK2P 2PLV1 1W2NA 5CFCC 3BJ6A 2RR11 3PQJA 3H3ZA 1BW6A 2BVMA 2CUJA 2XGEA 1X3WB 3BPXA 3VYTB 1DU3D 2IP2A 3GTGJ 2JVGA 3R05A 2K4BA 2EWNA 3MFAA 3GTOJ 3GFJA 2AQFA 1UZZA 2GXAA 5JZGC 5AFBA 3IC7A 1QH7A 2ZFWA 3AG4H 4HVRA 5C6CA 3RIRA 4QQ2A 1VR3A 4D7NA 1TG7A 3VHOA 5GLZA 2FCTA 3SFZA 3VV1A 1BW5A 1RHI3 2JRTA 4N43A 4V2GA 3RDIA 1AYM1 5FZDA 2EV0A 2VCBA 4K6BA 4EGZA 1RUF2 3MLJA 1Y39A 4B44A 3N7KA 1HB1A 3JQWA 4QWNA 3QPTA 3HC7A 4UBGA 1XS9A 1A3KA 5LATA 1BOAA 3RS6A 2HYXA 3W2AA 3WOGA 4MXVA 4YG0A 1I5ZA 4XUTA 3POFA 4FETA 1ONVA 4AVBA 5FZEA 3L9FA 2EXHA 1FMD2 2VVFA 4E27A 2OQ6A 4NAOA 1AR92 5FKMA 1UXZA 1CF7A 1PUEE 1DCSA 1OCOH 2JB4A 2YSRA 4DUXA 4EJUA 3D5SC 3GZNB 3MMYB 5I0TA 2DFCA 1BLZA 2ZHNA 3MW2A 1VBB1 3DP7A 1PNFA 4G6DA 3K3OA 3MI8A 3B02A 1APLC 1VQPI 4LPLA 5IYBJ 4F52A 3LWCA 4EJRA 4V1PA 4M3DA 5M5XJ 4RMNA 4UV8A 1N25A 1ASJ1 5F9TA 1EA3A 2W52A 3BTYA 4GA9A 1VBD3 3FC0A 5F7UA 2R061 3C7FA 1WW6A 3FDYA 1N1TA 3R4SA 2BBYA 2QF7A 1BOBA 3VLBB 2CFXA 2XROA 1NHAA 2BGOA 1ZR4A 4CXFA 1BI1A 4NC7A 1PM4A 1FMD3 1AR71 4ZS3A 2HGCA 3LSTA 1J1LA 3GJBA 3B6CA 1W2AX 3PLQA 3SHRA 3UKNA 2RG4A 2JA8J 3N7JA 3M3IA 2IEKA 2R7EB 1MS3A 1STMA 1XPXA 5AVAA 2NVYJ 1IUYA 1QQIA 3E1SA 2HWVA 2PBIA 3KX2A 4XLHA 4AVAA 3SISA 5HXVA 2WWYA 1SANA 4YIFA 1RHI2 1PGW1 4XSXF 1DQ5A 4IEOA 5JPMB 2HWB1 5IYCJ 3VBSA 4LOSA 2LF8A 1ZGAA 2MHFA 1R092 5LRRA 2ORXA 4CCJA 1LAJA 1VJ2A 3KWVA 3Q8FA 3VYRB 5CQEA 4O3MA 2PEXA 4J01A 4CO8A 2W68A 1EP0A 4OMDA 4I0BA 1LFUP 1LHUA 5CPRB 4Y1VA 1K12A 1B9NA 4AWXB 2WKKA 2OW4A 5JAXA 4BCUA 3DPLC 3KSCA 2R16A 4IQPA 4GMP0 4N53A 5JLVA 2VR4A 4Q4W3 3VHRA 3ZLIA