1RMU3

Three-dimensional structures of drug-resistant mutants of human rhinovirus 14
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
236
structure length
236
Chain Sequence
GLPTTTLPGSGQFLTTDDRQSPSALPNYEPTPRIHIPGKVHNLLEIIQVDTLIPMNNTHTKDEVNSYLIPLNANRQNEQVFGTNLFIGDGVFKTTLLGEIVQYYTHWSGSLRFSLMYTGPALSSAKLILAYTPPGARGPQDRREAMLGTHVVWDIGLQSTIVMTIPWTSGVQFRYTDPDTYTSAGFLSCWYQTSLILPPETTGQVYLLSFISACPDFKLRLMKDTQTISQTVALTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
publication title Three-dimensional structures of drug-resistant mutants of human rhinovirus 14.
pubmed doi rcsb
source organism Human rhinovirus 14
total genus 38
structure length 236
sequence length 236
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1988-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1rmu300
1RUC2 1POV1 2WWSA 1CJDA 4RQPB 3VDDA 1PO23 4GH4A 1TMF3 4Q4W2 2HWB2 1FPN2 1RVF2 4QPIA 1AR73 1E57A 1K5MC 4YVWA 3NAPB 1PO11 4CDQA 1FOD3 1RUJ2 1AR81 1OOPC 3CJIC 1NA1B 3VBOC 4RQPA 5BNOB 2TBVA 2R072 2BPA2 2HWD2 3S6PA 4GMP1 1RUC1 5BNNB 2RS53 2HWF3 1R092 1TME2 1OHFA 1AR62 1EV12 1QQP2 3NAPA 1ZBA3 3ZFEC 5D8AB 5C8CB 5DDJ2 1ZBE2 1FPN1 1NA1A 1PIV2 1RVF1 1B35B 2RMU1 5BNOA 1ND2C 4RS5C 1RUJ1 1MQTC 4FSJA 1RB8G 3JB8A 4GB31 5BNNA 4CEYC 1NCRC 2X5IB 1HQNA 1C8M2 1HXS2 5K0UB 2HWD1 1D4M3 5CFCB 5D8AA 5C8CA 3VBHB 5AC92 1F8VA 4PDWC 1TME1 1B35A 1SMVA 3TN92 5ABJB 1AR61 1RHI3 4Y4YA 1RUD3 5DDJ1 1POV3 3J8F2 1PIV1 2RR11 1CD3G 1QJU2 2X5IA 3DPRC 5J98B 4CDWB 4WM8B 5K0UA 5C9AB 5CFCA 3VBHA 2ZTNA 1DDLA 1HXS1 5ABJA 1Z7S3 1AR83 1HRV2 1H8TC 1BEV2 3VBSB 3TN91 4RHV2 1VBD3 1RUG1 4CDWA 4WM8A 5C9AA 1R082 4CDUC 1AL0G 3VBFC 1RUC3 2RS32 3J8F1 2MEV2 3FBMA 1QJU1 5GKAC 1HRI3 1FMD3 5L7OC 2HWC1 1RVF3 2RMU3 2WFF2 3VBSA 4AEDB 5CFDB 1VRH2 3JB4C 4CEWC 1VBE1 1HRV1 4GB33 3JBG2 1V9U3 1BBT1 1BEV1 1VBC2 1AYM2 1QJY2 4RHV1 1QJX2 2BFUL 2WZR3 1R081 2R041 5JZGC 1TME3 2MEV1 5CFDA 4AEDA 1RUI2 4RR3C 2R062 1R1A2 4FTBA 4JGYC 1AR91 2RR13 5LK7B 1NG0A 2WFF1 1PGL2 1K5MB 4Q4Y2 1VRH1 2GH8A 1AYN2 1OOPB 3JBG1 1MEC2 2BBVA 3CJIB 1VBA2 2PLV3 3VBOB 1QJY1 1QJX1 1RUE3 3ZFGC 5ACA2 4CDXC 2WLPA 1K5MA 1RUG3 1RUI1 2R061 4Q4X2 3ZFEB 2XPJA 1ASJ2 1RMU2 4N53C 1OOPA 2DF7A 3CJIA 2RM22 3VBOA 1PGL1 4Q4W1 4Q4Y1 1AL22 4JGZC 2HWB1 1ND2B 4IV1C 2HWC3 2IZWA 4LLFA 1MEC1 4NWWA 1VBA1 1IHMA 2WS92 3JD72 1PVC2 3ZFFC 1NCRB 4CEYB 1VBE3 4YVSC 3ZFEA 2QQPA 1BBT3 2HWE3 1OPOA 1VAKA 2R071 1COV3 4PDWB 1NCQC 1ND2A 2R043 4Q4X1 1RMU1 1MQTA 1R091 1EV11 2MEV3 1QQP1 5C8CC 4CEYA 1NCRA 1TMF2 2XBO2 1AL21 3DPRB 1ZBE1 5C4WC 1PGW2 3VBUC 1AR72 1AR93 1FOD2 2WS91 3JD71 2Y26A 4PDWA 4QPGC 4Z92B 1C8M1 1PO13 1POV0 1QJY3 3DPRA 2HWF2 5AC91 4CDUB 3VBFB 1X36A 1WCDJ 4N43C 4GMP3 1TMF1 1RUI3 2R063 2XBO1 4EJRA 2GSYA 1PGW1 4IV3C 5L7OB 5C9AC 1H8TA 4Q4W3 1ND3C 2HWB3 1FPN3 4RFT0 1MEC3 4GMP0 4CDUA 3VBFA 1RUJ3 1D4M2 2HWF1 5L7OA 1RHI2 2R073 3ZXAC 1VBB2 2HWD3 5FOJB 5BNPC 5JZGB 4WM7C 1RUD2 4FTSA 4Q4X3 2RS31 4RR3B 1RMU3 1R093 3VBRC 2ZAHA 1EAH2 1AR63 1EV13 1QQP3 4JGYB 5DDJ3 1ZBE3 1RUH2 1PIV3 4NWVA 3JD73 1VB4A 1Z7S2 5JZGA 1AR82 3VDDC 1RUF2 1GFF2 4GH4C 4RR3A 1VBC1 1AYM1 3ZFGB 1C8M3 1AUYA 1HXS3 2BFUS 1VBD2 4Q4V2 1RHI1 4QPIC 1VBB1 4JGYA 4CDXB 4YVWC 2RS12 1RUD1 1VB2A 4CDQC 5AC93 3TN93 1EAH1 4N53B 1HRI2 1FMD2 1R1A1 4RQPC 2XBO3 5A32B 4BCUA 1RUH1 3J8F3 4JGZB 1F2NA 1A6CA 4IV1B 2RMU2 1QJU3 3ZFGA 1Z7S1 1AYN1 4GB32 4RS5B 3ZFFB 4CDXA 1MQTB 1RUF1 1V9U2 2ZZQA 3NAPC 4YVSB 3IDEA 1NA1C 4N53A 1VBD1 4Q4V1 1HRV3 5BNOC 2WZR2 2RS11 5A32A 5ACA1 1BEV3 1NCQB 4JGZA 4IV1A 2FZ2A 1NY72 4RHV3 5BNNC 1HRI1 1FMD1 1R083 4RS5A 1ASJ1 3ZFFA 2RS33 5C4WB 2RR12 5D8AC 3VBUB 1PO22 2RM21 4YVSA 1B35C 1V9U1 1BMV2 1NCQA 4QPGB 2PLV2 2WFF3 1M06G 1PVC1 1VRH3 5J96B 2X5IC 1RUE2 2WZR1 3JBG3 1QJZA 5K0UC 1H8TB 1VBC3 1AYM3 5C4WA 5CFCC 3VBUA 1NY71 3VBHC 1W39A 1RUG2 1QJX3 1VBB3 1NOVA 5A33B 2RS52 4N43B 5ABJC 4SBVA 4QPGA 1ZBA2 1EAH3 1PO21 3M8LA 4IV3B 1R1A3 1AR71 1ND3B 1RUH3 2HWC2 2BUKA 4CDWC 1BMV1 4WM8C 2PLV1 1FOD1 1X33A 4Q4Y3 1VBE2 1AYN3 4CEWB 5A33A 3LOBA 1RUE1 5FMOL 1RUF3 4N43A 1BBT2 2HWE2 1VBA3 4IV3A 1COV2 4Q4V3 3VBSC 2RS13 2R042 5ACA3 2RS51 5BNPB 4WM7B 1ND3A 1ZBA1 4Y5Z0 3VBRB 2FZ1A 4CEWA 1ASJ3 2VQ0A 1AR92 4FTEA 2RM23 1AL23 3HAGA 5FMOS 1HX6A 4AEDC 5CFDC 5BNPA 3VDDB 4WM7A 2HWE1 1PO12 2WS93 1PVC3 4GH4B 1COV1 1C8NA 1D4M1 3VBRA 4QPIB 4YVWB 4CDQB
chains in the Genus database with same CATH superfamily
2IFWA 4AQ6A 1UD1A 4V1PA 5DZGA 2YUEA 5B4XA 2Z4FA 4XUPA 3T0AA 3FUOA 2PTMA 2VVFA 2X8KA 2H6BA 3ZSJA 2DBNA 1TMF3 1GP5A 4Q4W2 2HWB2 5A7SA 1FPN2 5EPAA 1ENSA 1C3HA 2RDSA 2WQ8A 1AR73 3AVRA 3FJSA 5A7NA 1LGNA 3D5OA 5FXZA 3NAPB 1ULDA 1FOD3 4YGDA 2XHNA 3Q9OA 1AR81 1DGWA 2Q8CA 4BIFA 2LW8A 1POQA 4NR1A 1G9FA 3CJIC 5E6HA 4ASKA 5IAXA 2QDRA 1S55A 3B9IA 3AP9A 1YI7A 5GALA 4E4SA 1NYWA 1BLZA 1S0JA 3RG0A 1F4HA 3A7QA 1MACA 2A6ZA 2NP0A 1NLRA 1REEA 4XQWA 1UZ0A 4D6SA 5IVVA 2HWD2 3S6PA 1RJ8A 4Q27A 2OUJA 2BJSA 1GP4A 1RUC1 1UZVA 2HWF3 2VAUA 1X8EA 3OBZA 4W4ZA 1NQDA 3VD3A 4XJWA 3CZUA 4ZHNA 2WNUA 4JX0A 4QGMA 1HB2A 2UY8A 3PL0A 2UWCA 5JXGA 4YW1A 1B35B 5BNOA 1U5YA 2V4VA 1ND2C 1HKDA 1OLQA 3WF0A 4ES8A 1Q5OA 4FBFA 1H2KA 3U07A 2E63A 1OVPA 4NAMA 2A3WA 5BNNA 4CEYC 1NCRC 1HQNA 1YQ6A 4XZPA 5EWSA 5J37A 4KQ7A 1N3OA 3LIHA 1PHMA 2B5HA 3H8OA 4ZZ8A 1D4M3 3HN3A 5D8AA 5CFCB 5JXHA 2FCTA 1KITA 3OGJA 4Y3OA 4A3ZA 5LBFA 1NXMA 1F8VA 4PDWC 3LPFA 3OB8A 2AH2A 3ACGA 3A23A 2UWBA 3VKNA 3RZJA 4Y4YA 5GLUA 2QQIA 4P9YA 5DDJ1 2O14A 3TRSB 1V6MA 2KXLA 3VZKA 2JD4A 1E5RA 2DVAA 3BPSA 3IPVA 3K48A 4FPFA 4OI2A 5BNQA 4AEMA 3OY8B 4YZ2A 2YHJA 2WO1A 3OJBA 4WM8B 5K0UA 3UK9A 3S5QA 4EWAA 2ZHNA 3HQUA 3SH5A 2WO3A 1N1SA 4XZUG 1DDLA 5FO7B 2YDEA 1X50A 3POEA 4X8PA 3WD5A 4AFCA 5ABJA 5F5CA 4XUTA 3VKLA 1AF9A 1U5ZA 4Y22B 4ZPIA 4A42A 2EVXA 4MX3A 3ETPA 3WCRA 5M0TA 3C8XA 1VBD3 2JE7A 5C9AA 4XHXA 1ZA7A 5BUVA 3IB3A 1R082 1AL0G 1DG6A 4FOWA 3VHRA 3LEIA 5LZ6A 2FMYA 3GJBA 3J8F1 4NE9A 1LR5A 3FBMA 1YCIA 1HRI3 1MS5A 4NPLA 3FLTA 2JKBA 5FV3A 4QKBA 2D98A 1XYOA 4ARXA 3IAQA 2UURA 3WNMA 4ET7A 4P5YA 3BALA 2WFF2 3N35A 4UFKA 3VBSA 3KF3A 3KHBA 3WF3A 1X7NA 4CEWC 2DCJA 1HRV1 4NUBA 3V64A 5LBCA 3JBG2 1L7RA 1T6GC 1O7FA 2PA7A 3OUJA 1BBT1 2YZ4A 1BEV1 3H1WA 3AMQA 4UWDA 1S1AA 5FRAA 5JOWA 4I01A 4Z2WA 3MGUA 4RHV1 1QJX2 4YG0A 2X05A 4PF5A 4HK9A 4B1LA 1OQEA 3OGVA 5FBJA 5JZGC 2F17A 3MPPG 3IMMA 4MADA 4WZCA 5GLZA 2Y34A 2MEV1 3O1SA 4LITA 5CFDA 5T54A 1HB1A 4AEDA 4RR3C 2JG9A 1R1A2 2DCZA 2R062 4JV4A 1GQPA 5DAVA 3X29B 5HCHA 3J7LA 3BTXA 1G86A 1MZEA 1NKGA 4IEOA 4IEVA 2D6MA 3BB6A 4AVSA 5IFPA 4Q4Y2 3DV8A 1VRH1 1V6NA 1YWKA 3C7HA 4MO3M 4CCJA 3B7MA 5FY9A 1MEC2 2G1MA 4XIOA 3CJIB 1UZYA 1YQ5A 2V09A 4S2GA 5KXEA 1PK6A 4LBJA 4ATEA 3SXWA 4M0NA 3T3YA 2O1QA 1QJEA 1Y9QA 4ISRA 1RUE3 4XF9A 5FDBA 3W58A 2RE9A 3D6EA 4N9HA 2Y6LA 1QH7A 2AACA 1DZTA 4CDXC 1AXYA 3I2DA 5DPNA 4P08A 2VW2A 1K5MA 1RUG3 2HBUA 1RUI1 4I09A 2VVDA 3AP6A 2XPJA 1ASJ2 1LNSA 1XSRA 5JSRA 4K20A 4RGKA 3T30A 1LHVA 4QD2A 4G4FA 1HIXA 4NOTA 4AQTA 3KSCA 3MW4A 1CESA 3U10A 4YG3A 1PGL1 2QQUA 4Q4W1 4JGZC 2HWB1 1ND2B 2DVFA 1SLAA 3ATGA 4P14A 2ADEA 4PI0A 3SC7X 2HWC3 4HL0A 4LLFA 2ZEWA 3K3NA 2VZTA 2B7YA 2XOMA 3AVSA 1PVC2 3C7OA 1NCRB 4Y26A 4C0HA 4J25A 4CEYB 2LRPA 2Y0IA 2BGPA 3ASIA 3P3NA 2FDHA 3NJXA 4XJ8A 1DGLA 3I2KA 4AGRA 4UF0B 3WNKA 3ZM8A 2W2IA 3ZN6A 1K45A 3OBAA 4PDWB 3T2QA 2UYBA 5LY2A 1RMU1 1JYXA 3VN4A 2WA3A 4FOQA 1UQXA 2DFCA 4FQ4A 2P3IA 2C9KA 4QX2A 1GMMA 1SHWB 3AKRA 1W6OA 1PNGA 1D0HA 3KV5A 4PBPA 3VBUC 1K42A 3RWKX 1AR93 2F4LA 4D7YA 4IEWA 3KM5A 1UKRA 3ZXFA 4A4AA 4LBKA 1RJ7A 4QPGC 3KS7A 2XVKA 5K8SA 4Z92B 4C0BA 4HXCA 4LKDA 1H30A 3J7NA 4NRMA 1GUIA 4XOGA 1POV0 3GCXA 3MFAA 4HPKA 4KH9A 1X8MA 1GZWA 2A73B 2W1UA 3DPRA 4NN0A 3OGRA 1CAUA 4JKMA 4RN5A 1DYKA 2ZCWA 1FXZA 3MZHA 5FPBA 3LGRA 1WCDJ 1UY3A 1WUVA 1H9PA 1WBLA 1CAXA 3TBDA 1GOHA 5CKNA 3ZYIB 2WC2A 3CBNA 2R063 2GZWA 1SLIA 2VZ1A 1WMFA 3NJZA 2RHPA 3U1XA 3UKTA 4NIGA 3AB0A 4FI9A 1HB3A 1PGW1 2JDMA 4IV3C 4SLIA 5L9VA 1OI6A 5CFDB 4LO6B 5F5QA 4YW2A 4Y33A 4R4XA 3WF4A 5FQ0A 4AR2A 2XG3A 1CX1A 2YGLA 3WDWA 4RGAA 3HJRA 4QMAA 2AEZA 3CO2A 4RFT0 2H6CA 4Z82A 1MEC3 1IS3A 2WDBA 4AE2A 4GMP0 3VBFA 4UFIA 3A21A 4QGNA 5B2GB 3OYWA 5FZEA 1ZRDA 4OI4A 1BVVA 5DG2A 5A7QA 1RUNA 5L7OA 2CTVA 1W2OA 4LBQD 4QQ2A 4BQ2A 1RHI2 2R073 3ZXAC 5JZGB 4KWUA 5BNPC 4XTPA 4WM7C 1RUD2 3E5QA 2V73A 4DQAA 3K4DA 3I8TA 5F7UA 4RR3B 1DYOA 1R093 1D2SA 3IBMA 2VXRA 1O4TA 3VBRC 4AL9A 2ZAHA 4DOUA 5DXDA 1AR63 3O0XA 1QQP3 5FZCA 3FUQA 5FWJA 3IDBB 1WBFA 1ZBE3 2NQYA 2WSUA 1PIV3 4K40A 5EXOA 4KI5M 4CCMA 2VE1A 3HD8B 2P3YA 3I3BA 2CAUA 4XYXA 2WZEA 2BGOA 4LR4A 4NWVA 1J84A 2J1SA 2GALA 1W6PB 4LO8A 3VDDC 3WVJA 1VLNA 4AI8A 3B69A 3AP7A 3NKTA 3R4UA 1GNZA 4P5HA 4Y20A 5DABA 3P6BA 2EF6A 4TN7A 2BFUS 2E6VA 3DF0A 1PVXA 1W8OA 1N1VA 4CDXB 3ZXDA 4CCKA 4RYDA 1ENXA 1VB2A 2BP6A 4AF9A 4YFWA 5AC93 1O5LA 4FPYA 4EN9B 3UYJA 2QQOA 3GHMA 4OQ9A 2XB6C 3TN93 2EIEA 1UU4A 3B5LB 2Y6KA 2KA3A 1R1A1 3U14A 4JQRA 2I07B 4QB2A 2L9LA 2QQMA 3SITA 2OXBA 5ISLA 5SV5A 4JGZB 4HG6B 4OUEA 1NZIA 2RMU2 5KC5A 1QJU3 3ZFGA 5FY1A 2J1RA 4FPHA 1ZZ8A 5GLTA 1GZ9A 3KCXA 1ENQA 4GB32 1NLSA 4XFIA 3VD9A 1RUF1 2ZZQA 4QX7A 2A3XA 3LB9A 5F2WA 2XWJB 4DB5A 5KHGA 1JXNA 1GICA 5IVBA 1UOGA 1YFYA 2ZEZA 3M3OA 2RS11 3ZXEA 5A32A 5FZBA 1DZQA 4NRQA 5FO8B 1HDKA 2VO5A 4D6QA 1RITA 1UY2A 3OEBA 1I5ZA 2ET1A 4GKXA 4XF4A 4FPGA 3W59A 1DGRN 5GZCA 2A71A 1UIKA 5DAQA 4MV2A 3RRDA 4DINB 5C71A 2RV9A 4Y1XA 4UBHA 4RS5A 1ASJ1 2RS33 5HCAA 1CAVB 2PHXA 1RYYA 4HOOA 3EYPA 4LKFA 1U12A 2RR12 5FCCA 1OC1A 1PO22 4IE4A 4LBQB 2TUNA 2ZGLA 3VBUB 4TLFA 5LB6A 3RI9A 5JI7A 1W28A 1FNZA 1V9U1 4YZ5A 4QPGB 1HV0A 4QAWA 1LOFA 4CXWA 1PVC1 3AJYA 4TSVA 1LGBA 5JMCA 2FDIA 1YQ2A 4PF1A 1O91A 3I59B 4YZ3A 1VRBA 2PN5A 1VMHA 2LUWA 5IK8A 2WYSA 3KVAA 1NY71 3VBHC 4Y5TA 2GNDA 4N90A 4BMBA 4CU6A 4NHXA 4W6YA 5LWBA 4IEPA 1W0PA 2P3JA 2RS52 1XNKA 1LECA 2E7AA 3ZXKA 4GQ7A 3CJXA 3WLUA 3E6DA 4SBVA 1ULPA 1H2LA 2OPKA 3HVDA 1K12A 3L9JT 4IV3B 4MVTA 2FCUA 4W6XA 2PHUA 1C5HA 4FPKA 1QXPA 3WOGA 1XU1A 5FYYA 4XE9A 1O8SA 1UN1A 5L19A 1WD4A 4U2AA 1XYPA 4Q2FA 1ONAA 5E89A 2VCAA 1ZX5A 3WZ1A 4CDWC 2PLV1 1U5XA 4YWAA 1X33A 5ANQA 4NIHA 2NN8A 1HW5A 3OOXA 3JZVA 4XAEA 2J1EA 3U4XA 2FDGA 3O7OA 3CIHA 3H8UA 3IN9A 5FMOL 3SH3A 4Z1VA 3HQXA 1FI2A 5JWPA 4OCTA 5FY4A 1VBA3 3Q8FA 4IEZA 4QDRA 3UL2A 3OGGA 4D6RA 3UESA 3EBRA 2QJVA 4YW5A 3RJRA 5KHHA 2OZ6A 5J7MA 1JHNA 2R042 1SLTA 5BNPB 5JDBA 4QU1A 4WM7B 3LZZA 4N9IA 4JDOA 4XQ4A 4DRRA 4OFGA 5FPLA 1ZBA1 3MUZ1 4Y5Z0 3VBRB 3VL8A 1G9DA 3WXPA 3RYRA 1FV2A 4S2HA 4YW4A 1AX1A 1OT5A 1EPWA 3PDQA 2VQ0A 3RZKA 3BODA 2DU1A 1SBDA 1YI9A 2YB7A 4GWMA 2CGOA 2AC1A 2GDFA 5GZDA 1AL23 1I1EA 3AZVA 5FMOS 2PHDA 4L92A 4LE4A 3ZYPA 2Z5WA 4HMZA 3W20A 4YGCA 3VDDB 2HWE1 5HXVA 4AI2A 3RPQA 5CBLA 2D6LX 2KM2A 2WS93 4COUA 3WHUA 2W47A 4CU7A 1COV1 3PUHA 1GP6A 3FHIB 2J1UA 1KS4A 3FFZA 4D69A 5DZFA 4BDVB 2TNFA 4NMIA 2W68A 5FXVA 4MGIE 1SLCA 1ZRIA 3M7AA 2BQPA 3JQXA 4AG4A 2P3KA 2W94A 3AKSA 3KT7A 2CGPA 3CMGA 2JDKA 3E5XA 5FPZA 2JD9A 4EE2A 1SZBA 1RUC2 1POV1 2A3YA 1CJDA 3PNAA 4LPLA 4BQ4A 4P9GA 3I2FA 3ZDVA 1PO23 1IPKA 1WMXA 4LKEA 4GH4A 4QX1A 3DCQA 3AL6A 2D3PA 5FZ4A 2W1QA 3CEWA 4XTMA 5GZEA 4QPIA 2G4IA 1E57A 4DZGA 1S2EA 1LOBA 2BU9A 4YVWA 3OF1A 1DP0A 3JQWA 4XFCA 2AEYA 1OOPC 1J1LA 1OVSA 2XJSA 3DEMA 3ZLIA 3CKHA 4AHZA 1DQ0A 1XRUA 4IERA 3OUIA 3VBOC 1JODA 4DUXA 1YFXA 2HH9A 2TBVA 2VW0A 4W6WA 3AM2A 2QQLA 2J1VA 4HN1A 2GNBA 4GMP1 3RS6A 2QTWB 2RS53 2VCBA 1DQ6A 3C7FA 4ZONA 1CONA 2QBXA 3WQBA 4WZFA 4B8EA 3VGIA 1EV12 4FPJA 3NAPA 4W8JA 3OG2A 5A1AA 2ID4A 5C8CB 5DDJ2 2VGDA 4Q0UA 2VL4A 4XABA 1CPMA 1RVF1 1W2UA 2D3RA 2PHRA 2YG0A 4UW4A 2DWRA 2RMU1 2ZX4A 3U37A 3D82A 3H3UA 5DN2A 1UX7A 1RUJ1 4A6SA 1G9BA 1MQTC 2YU2A 3O5SA 4GB31 1RB8G 3RZMA 5FZKA 5IUQA 5A7WB 4IE7A 1S0EA 4HANA 4DFSA 1WMEA 2XLGA 1C8M2 2ES3A 2XQXA 4CYDA 4OMCA 2VZQA 2AREA 5T55A 3WG2A 4LBMA 2D5HA 5JIUA 3PVEA 5IYYA 1JW6A 3VBHB 3IDCB 3ACLA 2JE8A 2E51A 5FYHA 1YO8A 3BTAA 5C33A 1B35A 5F3EA 2YPDA 4PHZA 5E8AA 3USUB 5I8YA 5KC6A 3KB5A 3KLSA 3KMHA 1LHNA 5EQUA 1OLME 4DRVA 3J8F2 2QVSB 3QOPA 2I2SA 4HLTA 5BYNA 3VHOA 2RR11 5IWFA 5JPMB 4XJZA 3POBA 4W65A 1V6LA 1W6MB 2ZHMA 5J98B 4CDWB 2VBPA 3C7GA 4HVQA 2QNKA 2DU0A 5CFCA 3G7DA 1C57A 1JYTA 1K5JA 2P6CA 1W9SA 2QZ2A 1PGSA 1WLDA 3D4KA 4P9IA 5CZKA 5JSOA 3LSEA 2VZVA 3FWEA 5A7OA 2WNVC 5LEKA 2VTXJ 1MZ5A 1OF3A 1HXS1 1JOPA 2VM9A 1I5PA 3JU9A 4DS0A 1Z7S3 4A41A 1AR83 1HRV2 1JOJA 2JDPA 5LEJA 3F95A 2CNAA 3WNOA 4NPMA 4IESA 1BEV2 5A70A 3POGA 4MHUA 3KVBA 3WW3A 1JI6A 4RHV2 1UYXA 2E53A 1TG7A 3OY8A 4WM8A 5A6XA 4LHLA 2VQTA 3PVNA 1RUC3 4LHKA 4L0PA 2CY6A 5APAA 1MS8A 4CCNA 4I0AA 5D2AA 1CR7A 2MEV2 2XJQA 3A0NA 3ES1A 4AZZA 3BKZA 1V6IA 2CYFA 3OEAA 1FMD3 2JB8A 2IXLA 4XF0A 1PX3A 4E4ZA 2YYOA 4YGEA 3HEIA 1ALYA 1RGSA 4Y22A 1GWMA 1S0FA 3LF7A 4OLLA 2ARBA 2J42A 4DXSA 3UKNA 2DUPA 2AZ5A 4MGKE 3AYDA 2DTWA 4EYUA 1KJLA 1VRH2 1WA6X 3JB4C 4DXZA 4AI9A 4UW3A 1PZ7A 4FFIA 4GJYA 5A3UA 2X10A 5FYVA 3O1MA 3KCCA 3ZR6A 3S57A 1PNFA 3WP6A 4TTGA 2D6OX 4R52A 3K4ZA 2ZABA 2DYCA 1OD5A 2WZR3 3HNYM 2R041 4MZUA 4O61A 5IVCA 2WZPP 3R4DB 3ZYJB 5HPOA 1LEDA 1BYHA 1OLMA 1LHWA 3GDBA 5I0RA 2K46A 3ENRA 3N9PA 2FDFA 1CZTA 3AX4A 1N1YA 1KGYA 1RUI2 1TEIA 2ZMNA 1UMIA 5FMDA 2J1TA 4CUBA 3N7JA 3CQOA 4D3WA 2OVUA 4GWJA 1LOAA 4JGYC 3VZJA 4TXWA 4AOCA 1YIPA 3MBWA 3ZSMA 5A6YA 5A3LA 4MOAA 1PGL2 3HQRA 1XNAA 1WZXA 2XKOA 4Q5OA 4EWEA 1AYN2 2VMDA 4EN8B 4S2DA 3E6CC 2YBSA 1OOPB 5I93A 1UYZA 5H9SA 4QB6A 1JYCA 1UU5A 1KRIA 1W6NB 5D21A 1LOCA 4AFAA 4D0QA 3VBOB 4HKOA 1S0GA 1QJY1 4CCLA 2E33A 4BISA 3BCWA 4LT5A 1W8WA 5ACA2 4BE3A 4B4PA 2GNTA 4TYSA 2ARCA 4DMIA 1OLRA 4P02B 5FZ6A 1IS5A 3CU7A 1Q8PA 2PYTA 2CAVA 4L97A 5CG9A 2ZX0A 3LEMA 1OF4A 1VPHA 4BZ4A 4AFMA 3TEWA 1RMU2 3NSTA 1GANA 1CJPA 3AKQA 2DF7A 2GP5A 3KT4A 1O4ZA 2VNVA 3GZUC 1C4RA 3CJIA 3NJVA 4HT1T 5I8SA 2VUJA 3NL1A 3O14A 4X8NA 3WCSA 5JOXA 1XU2A 2LTNA 2VCMA 3SEPA 3WV6A 3VD4A 2D40A 5FP3A 2FDJA 2DURA 2WNUC 2P2KA 4MG2A 4COWA 5FXXA 2ERFA 4BMEA 5E1RA 2VUCA 3TNQA 2Q8EA 1ZRCA 1A8DA 1US2A 1B09A 4NIIA 2EIBA 1GSLA 2WL1A 1QOTA 1F5JA 2FHRA 3A22A 3VZLA 3MW3A 1BBT3 3MO4A 5FZFA 1YFUA 2G19A 2PFWA 1JH5A 2PMWB 4I0WB 4IXLA 4INDA 4QX3A 1O8PA 3AYAA 2W39A 1WW6A 3VB9A 1NCQC 1S0IA 1UZZA 3O1PA 1ND2A 2OKXA 4Q4X1 2P34A 4CA9A 1N47A 2BVBA 1W03A 2BYVE 2RJ2A 1EV11 2MEV3 1EY2A 2JDUA 4CEYA 1NCRA 2FMDA 5K9YA 2KR2A 2P6HA 4UI9L 4DXRA 1QGLA 5C4WC 1PGW2 2R49A 4XCAA 2BRTA 5FYZA 2OX0A 4EWDA 4ES9A 5LA0A 3D0JA 4H2AA 2Q1ZB 4UF0A 1Y4WA 4LBLA 2VC9A 4ZU5A 5EYXA 5FY7A 1RL3A 2WNVB 4PDWA 3T2PA 3WP5A 4CRQA 5FUNA 4P00B 4LUMA 5DUWA 4CP0A 3I49A 4LNVA 4PIYA 1C8M1 1AX2A 1PO13 2WO2A 1NX9A 4PJYA 4Y5SA 4GA9A 1ZZ7A 3IKWA 4YRDA 4XMAA 4LLOA 1WLWA 2P5BA 4M4RA 1Q8OA 1XNTA 2H0BA 1X36A 3NMBA 4MXVA 2HBTA 1Q8QA 3DUIA 1AVBA 3J9SA 3DYMA 1TMF1 1RUI3 2G9GA 5FXWA 4RL7A 4EJRA 1ODNA 2XKPA 2EA7A 4XETA 5FYSA 4BU2A 5C9AC 3DECA 1CQ9A 1H2MA 4AHXA 4IW3A 2AGSA 4FO9A 4Q4W3 4TZDA 2HWB3 1FPN3 5LK5A 3CL1A 3I2HA 5FZ9A 3ZYBA 3PMEA 1MS4A 1KXGA 1L7LA 1X9PA 5FFOC 1QNYA 5L73A 2VBBA 1HQWA 1RINA 1WW7A 1CPNA 5JR7B 3KHCA 4H55A 1IS4A 3W5MA 4I2OA 3SQOA 3MIFA 4O9EA 5AVAA 3WG3A 2ARXA 4QQPA 2HWF1 3HOBA 3NNJA 5FTTC 4YW6A 2GNMA 3BPZA 2ZBJA 3O1VA 2HWD3 5FOJB 1Z78A 1W90A 2Y60A 2X09A 3GM8A 3KD4A 2DFBA 4FTSA 2R32A 2QQVA 1RMU3 1W3VA 2IWGB 3NKGA 1KDKA 2BNOA 5FPVA 3UV9A 2ZJCA 3MV11 4M01A 4YM1A 3WT3A 1E5SA 3VKFC 4JGYB 4DEVA 2HEYF 4YM3A 1OA2A 3E97A 3PIJA 3ST7A 3D0SA 2W5FA 3MV01 3K75B 3RWNA 4Q26A 2JDZA 1OQDA 1ULGA 3H7YA 3EB7A 1J3QA 5DQ0A 2PHWA 2ZS6B 3MLJA 1VB4A 4LHSA 4I3PA 3J7MA 2Z79A 4UBGA 4NJ4A 5BPXA 4TLGA 4GULA 5HV0A 3ZXJA 1YJKA 2CWSA 1RUF2 3ILFA 3NO8A 5G04L 3RSJA 4UFHA 5CU1A 4RR3A 3M3CA 3DL3A 4XFAA 4KU8A 3AZZA 3KCYA 1CZSA 2ZGRA 1VBB1 5F2SA 3DKWA 1SCSA 1UOJA 2PHFA 2RS12 3GBWA 3H9AA 4FFHA 4AFDA 4BQ1A 4CDQC 1XYNA 5FP8A 3VUOA 3BU0A 2NYYA 4IUGA 2XGXA 3OPTA 4ZXKA 2XJRA 4WVVA 1MZFA 2AENA 1W6QB 1LODA 5FZGA 2RJKA 4RQPC 5EP9A 2EXKA 4OUMA 4FAGA 1UCXA 1W6PA 4BCUA 3I3DA 1RUH1 3UJOA 1F2NA 3TB0A 3I4IA 4OVEA 5KXCA 5IK4A 1AYN1 4QWNA 4CDXA 2V5DA 1APNA 3GYDA 1V9U2 3TOJA 1OA4A 1IG0A 4ZU7A 1HV1A 4ZKTB 4LJHA 2VCCA 1A8MA 3AL5A 4YG6A 1C1FA 2JWPA 1DF0A 2OQ7A 1H1IA 2XJPA 3WINE 1NA1C 4AHWA 2RDNA 1H4HA 1VBD1 4Q4V1 1UO9A 3QD6A 5JIAA 5KHKA 5FZDA 5ACA1 4PQQA 5CADA 2VVEA 1NCQB 4JGZA 3CNAA 1G8WA 4XJ9A 3EO6A 2FZ2A 1NY72 4M3CB 4XW3A 1HRI1 1NXD1 5DAPA 1IPSA 5FZ1A 3HMYA 1JOBA 2OYZA 2FBEA 1SPPB 1R083 4J6GA 1QXRA 1IGOA 1WCQA 3NNMA 3GGLA 2ORZA 1QWRA 4UFMA 5C4WB 2A1XA 5EZWA 3T1LA 4D8MA 2PAKA 2JICA 4DO0A 3VHPA 3L2YA 5FPAA 1JZ5A 3J4UH 4BQXA 1LU2A 5I0DA 1W9TA 2E7QA 2PLV2 2WFF3 4LMFA 5FZHA 3R05A 4FVVA 5J96B 4IE6A 3LIGA 4E4DX 2P17A 2PXJA 2X5IC 4XBQA 3JBG3 4HSLA 2WZ8A 1LGCA 5JOYA 1QJZA 2OW4A 5JXJA 1CAVA 1DCSA 1NT0A 2ZKNA 3VHNA 1J58A 4ONUA 4LBQA 4R9BA 4FPOB 1DFQA 3MFCA 3VBUA 3RJ2X 3EQEA 1QJX3 5T5PA 5JZGA 5A33B 2ZGTA 2XVGA 4BA6A 1DLLA 3POFA 1W05A 2QE3A 4NAOA 4QPGA 1ZBA2 4K3UA 2YBKA 4L11A 2QQWA 2EXHA 4B3NA 1R1A3 2VULA 1F5FA 1YUDA 4JCKA 1SLBA 1AJOA 1XE0A 1ULCA 3RDIA 3I59A 1BMV1 1OPMA 1IS6A 1QDOA 1BKZA 2DCYA 2XJUA 4Q4Y3 4YM0A 5T52A 1VBE2 3S5AA 2A6WA 4ZS3A 4CEWB 2OUHA 5FPUA 4GAZA 1RUE1 1RUF3 1WA4A 1JZ7A 2HWE2 5DZEA 3USSA 1LESA 2VZ3A 1BK0A 4IV3A 1COV2 1OA3A 1SBFA 2VOWA 1ZZ9A 4LO7A 3RGBA 2CDOA 4CP9B 4DY5A 4CP2A 4LULA 1Q3EA 2RS13 3BYWA 1UYPA 4C8DA 2PAEA 3AZYA 2LROA 1UW8A 3ZKUA 4AGGA 4HVOA 3QH6A 3UT0A 2Y6FA 1GZTA 3H1MA 1CGPA 2HJIA 1ASJ3 5LA1A 3JXSA 4BH9A 4YARA 5KBFA 5E16A 4C1WA 4JHTA 1C28A 4NO4A 1W8TA 4DUVA 4A2UA 1MPXA 1W9WA 5CYYA 5BY5A 5I0UA 5BNPA 2ETEA 3FFQA 3B9CA 4WM7A 1WCUA 1W8FA 5FZ3A 3WHTA 3JUUA 1PVC3 2WT2A 3L2HA 4QDQA 5GM0A 5FYIA 4QHZA 2Q8OA 4YGBA 1Y7BA 2W92A 4XMIA 3VBRA 4OHYA 1O3QA 2B45X 4CXYA 1ULOA 2QUOA 3ZO0B 3N4MA 3DYPA 3I3EA 2XJVA 2ZMKA 1CAWB 3AP5A 1IZ3A 3N9LA 3Q8EA 4CDQB 5C5TA 1GQHA 3VZOA 1WD3A 5CNAA 3INAA 2ZPXA 4YW7A 3MIBA 2WKKA 4JQTA 1YHFA 1FV3A 1NAEA 2WQZC 4IE5A 4RQPB 4XFFA 3MIHA 3T0DA 4DY3A 3VDDA 2O8QA 5FMBA 4FFGA 4Y1UA 1OSGA 4QXCA 5KXDA 4ASLA 2VECA 2OQ6A 3W21A 2YFUA 3AP4A 1RVF2 3ZN5A 4FPEA 3U0ZA 4JRLA 3I7DA 4HVRA 3R4SA 4B29A 1Y9GA 3F2ZA 2MPFA 1RUJ2 1NQJA 4FOVA 1HN1A 1GNYA 5LY1A 4D7TA 4YSFA 3S7IA 1SG3A 1NA1B 4FPLA 4F8AA 4G9SB 1UY0A 4LO5B 5BV6A 4YZ4A 3BOPA 1M4WA 1YLLA 1VJ2A 5FIXA 4I0BA 3WDVA 4E4HA 3H3LA 1MR5A 2IXJA 4AVVA 1F9KA 3TEYA 1H8VA 4NHLA 1UYYA 1LTEA 5F6KA 1OH4A 4ARYA 3LEKA 3MF9A 2C24A 4Y4RA 1ZBA3 3HIFA 3ZFEC 2W9XA 1W3XA 5FJKA 1UPSA 2ZHLA 3WUDA 4EN0A 3MW2A 4LA2A 4JTOA 4HZFA 4OZXA 5CKQA 5A6QA 3ORJA 4LE3A 4XAAA 5IVYA 4RS5C 1D0GA 4FSJA 5TSWA 3JB8A 3LCPA 3AMHA 1ZRRA 3WF1A 1Y9MA 1C1LA 1NE4A 1UIJA 2X5IB 4KGQA 1JZ8A 5DUVA 3K2OA 1HXS2 4EZHA 4YFZA 1JYNA 3WP4A 4BQ5A 3GJAA 4QX8A 2ILMA 4ZY9A 1JU3A 2A6YA 5HBAA 5C8CA 1WW4A 2MHFA 1H1MA 3URFA 4UFJA 4J1WA 1A34A 5C5UA 1C5IA 1TME1 3K77A 1SMVA 2VR4A 1AR61 1RHI3 3ILRA 3V0BB 2XWBB 1HB4A 2EIGA 4I3GA 3SCFA 1RUD3 1JZ3A 1POV3 2DUQA 1PIV1 2W0XA 2ZOEB 5A7WA 4KBZA 3WNXA 1VE0A 4XPVA 3E1F1 1SFNA 5I0TA 5JOZA 1DQ5A 1XPWA 2BEOA 4KWJA 2J22A 4QQLA 3WDTA 2PHTA 3VD7A 4AQSA 4CE8A 2R1BA 4CCEA 2VPVA 2QCSB 3K4AA 3SCHA 2ZTNA 3VBHA 1DYPA 2RDRA 5CG8A 1EPZA 2UWAA 2VJXA 3APBA 4XF3A 4NHMA 2WJSA 3POWA 1XSQA 3U4SA 1PZ9A 5IJRA 3USUA 1O3RA 5DG1A 4E8CA 4UOJA 5FZ7A 1H8TC 1VMFA 3N7KA 3VDCA 2YXSA 4OUSA 4U36A 2Z42A 2YY1A 3OCPA 4XC9A 4BWOA 5I8TA 3R6SA 3FC0A 2QZ3A 3TN91 1W6MA 5FYMA 4CDWA 2WFPA 4CVUA 4CDUC 4AXOA 3LDKA 2DVGA 2WT0A 4ITCA 5B4NA 2XQRA 3ZSLA 3B94A 4QXHA 2WO7A 5K4LA 3UNPA 1QJU1 2ZX2A 5GKAC 3FHQA 3M70A 3IZOA 3KV9A 3ZKYA 1O3SA 2GN7A 4QT6A 1IPJA 2VD7A 1RVF3 1SFPA 3MDPA 3MLLA 1PMIA 2RMU3 3CLPA 5JMOA 4A6OA 2YROA 2EALA 2JDNA 1VBE1 1IQDC 3KGZA 3MLKA 4GB33 4IGQA 1JUIA 1OD3A 2Y0OA 5CB7A 3N9NA 1VBC2 1AYM2 4DNYA 2VBDA 2V72A 1QJY2 2B8MA 1Y43B 1DIWA 3ZMOA 3A4UA 1R1ZA 3S30A 3WSOA 4LKSA 3HBZA 2R7EB 4B7KA 5GZGA 1G9CA 5CVRA 4GALA 3NWKA 1QKQA 4PT6A 3NQHA 2VNGA 5FKBA 3VDAA 3ZSEA 1G9AA 2Q0AA 1H2NA 3PUAA 4AI3A 4FTBA 4YPJA 2VY0A 3LFMA 2A75A 2NM1A 4LO4B 4E2QA 4LOSA 3AJZA 1H9WA 1H0BA 2EXIA 2RR13 2VUAA 5ERLA 1YNAA 2HYXA 1N3QA 2VH9A 1JYIA 1DLCA 2Y64A 1DBNA 3RMYA 4Q8KA 3RZGA 1XJAA 2B42B 3FL7A 3QBQA 4UW5A 5HXMA 1BK1A 2BBVA 3T09A 2W87A 4QPWA 4TWTA 3BTYA 4JAAA 1MS0A 1LENA 3PTYA 1VAVA 5HCFA 1XNBA 3MIDA 1V00A 5FZOB 3WG1A 5IW0A 4NRPA 4XCBA 3AXDA 5HI0A 4Q4X2 3OPWA 3ZFEB 5C3PA 5JI9A 4N53C 1OOPA 3IIIA 1W8ZA 1W6NA 1OURA 4QM9A 2RM22 3I54A 1OBNA 3VBOA 4GD4A 3T0BA 4LXLA 4P9XA 1ZRFA 4IV1C 5LW9A 2WWJA 5FUIA 5F37A 2IZWA 4MXWB 4YLZA 3RNSA 1VBA1 1IHMA 5CISA 3ZFFC 5CEHA 3MYXA 1VR3A 1XC6A 1J1TA 4OMDA 2GMPA 3WR0A 4H7LA 1MS3A 3NNFA 3N36A 4LTAA 1QOSA 2BNNA 4YVSC 4AGVA 2JE9A 3SCGA 1O6UA 4OHXA 1SEFA 1OPOA 4BB3A 3AK0A 4GJZA 1Y3TA 2WNEA 4QHBA 3GNEA 3ITQA 4I02A 5IK7A 2R043 1JTZX 4WVMA 4XFGA 4XJAA 2VZRA 3W9AA 1UOFA 4V2WA 5F1RA 1MQTA 5FYUA 3WP3A 1PZ8A 3KGLA 2BWAA 4A7YA 1RUOA 1DGWX 4QXKA 1TMF2 2WIIB 3AZWA 4UFLA 5G05L 1AL21 1EP0A 2GH2A 2YGMA 4RGGA 4LA3A 5EHDA 1AR72 4OHVA 1PMHX 1IKPA 1L7QA 2JKXA 2Q1MA 3THCA 4K8FA 1FOD2 2LS6A 2WS91 3JD71 1BCXA 2UU8A 2VW1A 4HK8A 1SBEA 3NJYA 4FP3A 2ZHKA 1JZ2A 2GP3A 2JDAA 4NROA 2W3JA 2JEMA 5AFEA 2JXAA 4ZS2A 5FK8A 1QJY3 1YFWA 3IMNA 2C4XA 3ZDSA 4QDSA 1CVNA 2HWF2 5FYTA 3OD4A 4AAPA 1YYNA 2Z69A 3LAGA 4CDUB 4Q1PA 1CZVA 1V0AA 4HONA 3V65A 4AVAA 4AVTA 1XE8A 4N43C 1I6XA 3LA3A 3FN9A 3POJA 2XBO1 2WNVA 4R9DA 1OKOA 2DBIA 4A44A 3O1UA 3NV2A 1UPIA 1SFYA 4FP2A 4PI2A 2Y6GA 3WX5A 1LEMA 2R0FA 1FNYA 2VU9A 1BHGA 1GV9A 4BYYA 5DUXA 1PM7A 1ND3C 4LBOA 4GWNA 5FY0A 3IT8A 1QNWA 1KFUL 2D43A 5LRSA 2OIIA 3P1IA 5F32A 3ROUA 2E26A 1UOBA 2VMGA 1W8HA 4BPZA 1IOAA 1D4M2 2BNMA 3BTZA 4BQYA 3T2TA 1HLCA 4A3XA 3ES4A 4FXGB 2JG8C 4KBBA 1ZM1A 4XFHA 4OULA 2YC4A 2ZMLA 3RVHA 2DCKA 3MIEA 3BI3A 1VBB2 3V56A 1JYVA 4C91A 1LHOA 3DN7A 4PIZA 5C7GA 4PLMA 3WW2A 4EN6B 4XIKA 4Q4X3 5JXIA 1QU0A 1W9FA 1AXZA 3H3ZA 5FWEA 4EROA 4AVCA 5LBBA 2IVJA 1EV13 4W50A 1W2NA 3ABZA 2WUHA 4IEXA 2DUOA 4XVHA 3B00A 5DDJ3 5FREA 2Q1FA 2P4EA 4P9LA 1RUH2 2K9ZA 4BLJA 1IQAA 1MVEA 1SQ4A 5FMCA 3M3IA 2WAAA 2WWUA 5DAXA 2XLFA 4CU8A 3T08A 3BN6A 2AR6A 4K1ZA 2WNOA 3AYCA 4GZ9A 2PQQA 1GFF2 5C3SA 1VBC1 4H14A 2JDHA 2VZOA 1AYM1 1GZCA 5LATA 1C8M3 4M3CE 2CGNA 2ZAAA 2OPWA 1VBD2 1GOFA 4Q4V2 4CCCA 2XLAA 4JGYA 2CL2A 2ZX3A 2BERA 2WLQA 4OHZA 4LK7A 5IT6A 2OS2A 4CUGA 4KMQA 3SISA 1EAH1 4N53B 5T3NA 2BGCA 1HRI2 3HBKA 3ZMNA 4CSWA 3UETA 2YV8A 1LCLA 2ZZJA 4Q0VA 3J8F3 1A6CA 3NNGA 4IV1B 3M3QA 2TEPA 2ZACA 3MIGA 4CXXA 3I2GA 1G6NA 4X6RB 3RFRA 4YZ1A 1Z7S1 3ZYGA 4WVMB 3LA2A 3ZFFB 2D97A 1CIYA 4IE0A 1MQTB 4IEYA 2A5ZA 4KG8A 3LOIA 5JPNB 4KWKA 5FZMA 4AQ2A 1DHKB 4YVSB 4GKYA 3MHZA 4CU9A 3I2JA 1EYBA 2E7TA 2Q30A 3PUQA 2JDYA 1HRV3 2PELA 1W6QA 5C3OA 1PX4A 2D6KA 5BNOC 1H6XA 4M3CF 3LDBA 3ACFA 1LULA 5A1FA 1BEV3 1T2XA 3WNPA 3POIA 4AK3A 4BLIA 1X82A 3TNPB 3MPBA 1TNFA 4RHV3 4MSVA 3THPA 5BNNC 2V4AA 1FMD1 1W04A 2DVBA 4MGYE 4D94A 3AKTA 1OH3A 3BIWE 3ZYRA 4PIXA 2R30A 5KHIA 3LEGA 3AMPA 3SKVA 5D8AC 5C3RA 2C1FA 3KWVA 4IEUA 2RM21 2AYHA 3T4VA 3KT1A 3HT2A 4LIUA 2QQJA 4NHKA 5LA2A 4E2GA 1UY1A 2BWCA 2ENRA 4HETA 1BMV2 5L9BA 3ME2A 1NCQA 3LA7A 4Z2AA 5JLVA 4QB1A 2EICA 1VRH3 3LDRA 4M3CA 3R0RA 5FJHA 3BOWA 1QHDA 1RUE2 1SPPA 2D93A 2WZR1 1LOGA 3D8CA 5K0UC 1HJGA 2MNGA 4QKDA 5C4WA 3M2MA 3SKJE 4YNIA 1S0CA 2P1BA 5IVFA 1RUG2 1VBB3 3N9MA 1CX4A 4G3YC 2VMCA 4MGSA 3AKPA 1SDDB 4N43B 5ABJC 4IGPA 4Z07A 5DAWA 3Q8BA 5FY5A 1OFSA 2DTYA 1WGPA 3M8LA 5F6LB 5JSPA 1CIWA 2XDVA 2VOXA 2VQUA 3ALQA 2D6NA 2IXIA 4FXKB 2CU5A 1AR71 1ND3B 1RUH3 2BUKA 2HWC2 4IGOA 4BJ0A 5A3PA 1XNDA 2J1AA 5IFTA 1FOD1 2IVIB 3RZZA 4JDMA 4NIDA 3Q8CA 1ULEA 4WVWA 2SBAA 1P8JA 2I45A 4Q0PA 4XBLA 1AYN3 1N1TA 1SACA 4MGQA 5A33A 2IFRA 3PJQA 3LOBA 3PHMA 1REFA 5AFBA 5F3CA 3AFGA 4XUOA 4XDPA 1Q8SA 2BOJA 2JG8B 3T1MA 2WBKA 4OI0A 2CSGA 4Q4V3 4X6QB 1OXCA 4DXTA 3AMNA 3VBSC 5A3MA 5ACA3 4R8HA 1W0NA 1RXGA 5F9TA 1FAYA 2RG4A 1VMJA 4QU2A 3TEZA 2CV6A 1KDMA 3W5NA 2FCVA 3KQ4B 3I3MA 4CEWA 4RFRB 1QY4A 2XL7A 2JIGA 4YM2A 1AR92 1AZDA 5KXBA 3B3QE 5FPXA 2BW8A 5F39A 2HLEA 1Q56A 2QQKA 3FLRA 3HAGA 1WWYA 1XB9A 2FQPA 2XUEA 4XF1A 1HX6A 3QACA 3DXTA 4CP9A 4AEDC 5CFDC 5KWRA 4JVAA 3VL9A 1ZA4A 1GWKA 2JG9C 5FLHA 2C26A 3RYKA 4XXAA 1ENRA 3OTFA 4LOTA 4Y1ZA 4BOWA 2ARAA 1BVP1 1D4M1 4IDZA 4KG0A 4L99A 4OYUA 3DYOA 3PJYA 4XFBA 1ZZBA 2YU1A 3C2UA 1LAJA 5FY8A 3S0MA 1F31A 3DKQA 2JECA 3GALA 2NMNA 2BV4A 3UJQA 3ZVXA 3SLIA 2ZGUA 3PLQA 4LUKA 2ORXA 2WWSA 5FLJA 1PK6C 2W46A 3WQ0A 2ET7A 2YFZA 1U5IA 1XE7A 2VMHA 3ZOIA 2VTXA 3PURA 2W08A 5EJ1B 2F6BA 4LBNA 2XR4A 3KV4A 3WW1A 1MS9A 3S7EA 3VDBA 4JTNA 2OZJA 4XDQA 1G7YA 1K5MC 4ZZ5A 1WLTA 4AFBA 2ZGSA 3OGSA 3ZR5A 1CAWA 1PO11 2IXKA 2WNUB 3ZPYA 1W2AX 4CDQA 5LCWL 3SNMA 3I2IA 3MI8A 4Y1YA 2WSVA 4XUNA 2W52A 4B7EA 2GN3A 2H0VA 4RQPA 5IAVA 5BNOB 1NZCA 2R16A 3KZ4C 2R072 1MZ6A 4XXPA 3ZN4A 2BPA2 2HYKA 2WAOA 2EIDA 2QQNA 1SDWA 2VOKA 3FLPA 1UNBA 4A7KA 4O9GA 5BNNB 4FOYA 3EMRA 3GBGA 1ZYBA 3AZXA 4F83A 1R092 1TME2 2W1WA 1LOEA 3B93A 4AAXA 1OHFA 1AR62 1HN0A 1QQP2 1O4YA 4Q0SA 4AWDA 4B1MA 4JHZA 1E5HA 5D8AB 2RDQA 1TZOA 3NVCA 1ZBE2 4COYA 2N7GA 1FPN1 1BJQA 1NA1A 1PIV2 1AHSA 2A6XA 1BXHA 1V70A 1GNHA 2WR9A 4QX5A 2CDPA 3HWJA 1SLLA 3WQ7A 5KHJA 1KFXL 2WA4A 4F7ZA 4BXSV 2FDKA 2Q8DA 1FT9A 3IWZA 3E6BA 5IVEA 4MH0E 2O0OA 2RVAA 2WQ4A 3JCIA 3IPVB 3NW4A 4N8MA 5C3QA 5K0UB 2Y8KA 4CCOA 2HWD1 2NZ9A 2VMFA 5CKMA 4COZA 3PU8A 4K9SA 4N7UA 4CCDA 3H8RA 5GLWA 5FOBB 3QH7A 1ODMA 5FP9A 5AC92 5J36A 4UW6A 3I3QA 3FBYA 3PMSA 3RMXA 3TN92 5ABJB 3BIEA 2ZEYA 3WNNA 1A78A 1ZZ6A 4RA0A 5EFUA 3NRUA 5EV7A 1WW5A 4KNCA 4EN7B 5SV8A 2YBPA 2BOIA 4GWIA 3BGAA 5LA9A 1CD3G 1QJU2 1Z0HA 2X5IA 2D44A 3DXUA 1NLQA 3DPRC 4K8RB 4YYOA 5C6CA 5C9AB 1JYWA 3CHXA 1URXA 4FT8A 4FPCA 4LK6A 2G9FA 3OUHA 4QXBA 1GQGA 1KD7A 1JHJA 5FYCA 4KL1A 1DZRA 4C90A 2ZEXA 3TWIA 3V0BA 4O7XA 4MGTA 1O5UA 1I3HA 3H1YA 5I0SA 5EIYB 3ZPOA 4FQZA 3VBSB 4XBNA 1YEWA 4LHNA 2Y6JA 4K21A 4AEJA 1RUG1 2VNRA 4FAHA 3WEZA 5A7PA 3VBFC 1QXJA 3WNLA 2RS32 5A3OA 1J83A 1BQPA 5T50A 4GIQA 2GC0A 3EJKA 4JRAA 3RI8A 4QPYA 4HKLA 2XUMA 5L7OC 1JBCA 1UZWA 3N7LA 1RC6A 2HWC1 2Y33A 3IM0A 4ORFA 3IIAA 4DUWA 4MGZE 4META 3UGHA 4AEDB 4IETA 3KQRA 4GXLA 4ZU4A 2JG9B 2ZX1A 3H50A 4BQ3A 1PM4A 3UGGA 1JZ4A 3FMGA 3POSA 3IAPA 3DGTA 1V9U3 1UX6A 3A0KA 4LQRA 4HN0A 5EJZB 2WABA 4P9WA 2Q4SA 3PUIA 2A70A 2J7MA 1UXXX 1LRHA 2VMEA 5GZFA 3B01A 3UKVA 3T2OA 2BFUL 4QQHA 1R081 4IL7A 4PQ9A 4S2FA 3PVOA 3Q8AA 4Q1RA 1UU6A 2VNOA 1QDCA 2G9ZA 3KF5A 1TME3 1PK6B 5F3GA 1H4GA 4AYUA 5JR2A 1GU3A 2VMIA 1F4AA 4PLNA 2BBAA 2V5YA 4M0HA 1K3IA 3M1HA 4NVPA 4R4ZA 5K7PA 1WMDA 1UXZA 1AR91 2E32A 3WDUA 1NG0A 2WFF1 5LK7B 2GC2A 3G6JB 3V0AA 1K5MB 2EAAA 4AEKA 4E27A 3TAYA 2OA2A 5FLIA 5J1XA 1TVGA 2GH8A 1OKQA 1XOYA 3JBG1 4MLOA 1F35A 4CTEA 3HT1A 1VBA2 2PLV3 2ZGKA 4R9CA 4CPBA 5E88A 5KR7A 1IKQA 3OD0A 4H3WA 1QJX1 3EHKA 3O1OA 2P37A 2B4KA 3OBTA 3ZFGC 5HCBA 5J48A 4MUVA 4MYEA 4QKFA 5FZLA 2ZGMA 1RTVA 3GZEA 3NV1A 4XURA 2JJ6A 3AMMA 1GKBA 4ZXEA 5FP4A 2WLPA 4JC1A 3WW4A 1GR3A 1UF2C 4E9KA 3O1TA 2R061 1IG3A 5C8WA 4E2SA 4XDOA 4LORA 2GAUA 3ZYFA 4A45A 4CP1A 3RZHA 3ZN6B 4A7ZA 5A3TA 2XL9A 5JVVA 4KGGA 2OT7A 4Q4Y1 1AL22 2VQAA 2Z2SB 1LB2A 4Q8LA 1UKGA 1HJFA 2D3SA 5IK5A 1MEC1 5H9PA 4NWWA 4EV0A 2WYFA 5GJ6A 3ZYHA 1ZVFA 2WS92 3JD72 5FZOA 3U11A 1X9TA 1QF3A 1VBE3 3C7EA 2SLIA 3CZJA 5IATA 5FP7A 1W6OB 3J7HA 2EAKA 1AJKA 2NLRA 3ZFEA 1OMIA 4CPBD 1BZWA 1DQ4A 4O65A 2QQPA 2HWE3 1GLHA 2A7AA 4BM8A 2VXJA 1VAKA 1MVQA 2R071 1FYUA 1COV3 4JKLA 3TEXA 5LASA 2NMOA 2DCTA 3C3VA 1KQRA 4UAPA 5J3UA 4Z8BA 1LOFC 4XJUA 1JMUB 5FO9B 3M3EA 1OFNA 5FUPA 4XQDA 1R091 2XONA 3GCWA 4MXWA 2EXJA 1GWLA 2IC1A 5DUUA 1QQP1 4HPKB 1UMHA 4Q29A 3U75A 5C8CC 2NPIA 3FHAA 1GZWB 3N9QA 2XBO2 3DPRB 1CAUB 1ZBE1 2W95A 4M00A 2C6SA 2B9UA 3GF6A 3WF2A 3D3AA 2W1SA 3ECQA 1CAXB 1W8NA 1AX0A 1YQ8A 3PU3A 4C1XA 3ZSKA 2Y26A 5JAXA 3HPNA 4L8QA 3N9OA 4DPNA 2CWMA 3THDA 1J3PA 3PIGA 3CDZB 3UGFA 5AVPA 4L9BA 5FQ0B 3OPZA 1D4VB 4BK5A 1H1AA 2XVLA 4EQVA 5T5JA 2QKDA 2Q5TA 3HN1A 2HEWF 5FZ8A 5AC91 3RZLA 3BVCA 4FCAA 4LIVA 3VBFB 1DGRA 2YMZA 4CUCA 3BUCA 4GMP3 4HKWA 3VKMA 3OYWB 3ETQA 4OZOA 5I91A 2VTFA 2PHLA 3PUSA 2GSYA 4N7IA 3WY6A 2VUDA 4JZRA 5L7OB 1KJRA 3OBRA 1H8TA 4K1YA 3ELNA 1DQ1A 3AYEA 4BIOA 2I74A 3GHNA 2DV9A 3ON7A 3GZAA 1QH6A 3FZ3A 4CDUA 1NUKA 3AXEA 3K3OA 1RUJ3 4K6BA 1FX5A 1TNRA 1YRZA 4J1XA 1JUHA 1QJFA 1S4CA 5FYBA 4XACA 3ZXLA 3ZIWA 1W0OA 3SHRA 3V0AB 5JUVA 4NHYA 1GOGA 3SEEA 5CIRA 3U78A 2YC2A 1S0DA 4AW7A 5C70A 4CZSA 2XMLA 3P3PA 2R6QA 1HQLA 4QM8A 4NPRA 2IXHA 4BK4A 2RS31 3O12A 4Y20B 1UMZA 3ILNA 5D1IA 1EAH2 5A6ZA 1CWPA 3BU7A 2PQSA 2Y38A 1V6OA 4DIQA 4Y24A 1V6KA 1XXNA 2WRAA 4NIAA 5FBZA 4AVBA 5DMYA 4RD7A 1SCRA 2VG9A 4EZ4A 1S0BA 1ACCA 3P5BA 5A80A 3WG4A 2X29A 1YC61 2GC3A 4CUAA 1XBFA 1S2KA 3JD73 1Z7S2 1AR82 1VP6A 5EJ3A 3VZNA 1UY4A 1UWWA 2ZA9A 4BHPA 3O1RA 1YXWA 4UT5A 2HKXA 3B02A 3RYPA 3H8XA 4GH4C 2KD7A 3LE0A 2W91A 3IDAA 3ZFGB 1AUYA 1HXS3 3MICA 4URAA 5BXXA 4QPIC 1RHI1 3FX3A 1JZ6A 3PTRB 4YVWC 3RQ0A 1RUD1 3WDYA 4PBOA 1TQ5A 2RJLA 2GMEA 1RXFA 3SH4A 2JB4A 2UYAA 3HNMA 4JDNA 2GC1A 2VOVA 3VZMA 4XHBA 4K7JA 5FKCA 3WQ1A 1FMD2 3H7JA 2HEVF 2BDRA 2XBO3 5A32B 3MUY1 4HSJA 1DQ2A 1FATA 2WINB 2IXCA 1WCSA 4QX0A 1WLCA 4OI1A 3M4FA 1S2BA 5T5OA 1L3JA 2LALA 3AC0A 1R64A 4I30A 2BTVC 1YJLA 2E9QA 4RS5B 5L9RA 3PVBB 3O0VA 5F8PA 1ZREA 3LKJA 2VZPA 3NAPC 3O0WA 3QLQA 3NNLA 1T6BX 5LBEA 2GU9A 3J26N 2BVVA 3IDEA 3K51A 1PMJX 4N53A 1GYKA 4RSUA 2WZR2 1YIFA 3MF6A 4L2NA 4R9AA 2UY9A 2XXZA 2ZXQA 5H9QA 2ZKLA 2XHKA 1UL9A 4IV1A 1Q43A 2ADDA 1N3PA 4IEQA 3ZX7A 2Y6HA 5EYYA 2YPJA 3EXUA 1UAIA 4XILA 1QIQA 1QOOA 3ZFFA 2X53S 1I9RA 4B4RA 2ZGNA 2VZUA 4B4QA 3T4HB 2C9AA 5ANNA 4HBNA 1E5IA 1JS9A 2QDNA 4URTA 4M4PA 4DEQA 4YVSA 5F5IA 5J09A 1OUXA 1EUTA 1OUSA 3LSDA 4Y1VA 1XQNA 2QFEA 5F5AA 4AI0A 1B35C 2B9VA 2AUYA 4H7MA 5JCTA 1O3TA 2B46X 2WT1A 1W8UA 2ZGQA 3NV3A 3THTA 1YQCA 1VIWB 5CAZA 1M06G 2XH6A 4QGLA 3KV6A 5IHRA 4JKKA 3ACHA 4ATFA 1MS1A 3VKOA 1WCKA 3NV4A 5CA6A 4OHWA 1H8TB 1KS5A 1VBC3 1QMJA 1AYM3 1ULFA 1LJ7A 5CFCC 4XUQA 5LRRA 1ZZCA 1W2TA 1W39A 2ATFA 2YC0A 2K0GA 1NOVA 3LFIA 1V6JA 1STMA 4XEZA 5IVJA 4ISQA 4WV8A 4OQ8A 1JU4A 2JIJA 1Q8VA 2ZGPA 1A3KA 1D2QA 4FFFA 4LEJA 4PLOA 2BZDA 3ZXGA 3HNBM 2E31A 2GMMA 2VZSA 2CHHA 4QQOA 3I97A 1EAH3 1PO21 2VOTA 3MEPA 1DU3D 2IUWA 3LWCA 1QEXA 1KEXA 4YW3A 2A6VA 3TYJA 2WN3A 3LD8A 5FK7A 3I2OA 1H6YA 3ACIA 4WM8C 5FZIA 1AXKA 1W9YA 1REDA 3LQCA 4F3JA 1F15A 3ZIXA 4IQPA 5FZ0A 5FR3A 2D5FA 1EUUA 2D7FA 4QKNA 5L36A 2PAMA 2O8OA 5GLVA 4N43A 4P9JA 1BBT2 5FZAA 1LKNA 3GBFA 1OQ1A 4QHOA 1VALA 4Q0QA 3QCWA 3LPGA 2C0ZA 4KU7A 5FAXA 3VV1A 4BQWA 3VLBB 1J3RA 2F4PA 3H42B 1TE1B 1LHUA 1RIRA 2RS51 4UYBA 3HR9A 2DDUA 1ZNPA 1ND3A 1W99A 3GZTB 5F3IA 2FD8A 1O59A 3GXUA 2FZ1A 1NE6A 3POYA 2JENA 5T5LA 1ST8A 4COVA 2B39A 3WUCA 4WVZA 1J59A 2C5DA 4V2VA 1U0AA 4FTEA 2DVDA 2LM3A 1GBGA 5A3WA 1WKYA 3SMHA 4AI1A 2R1DA 2RM23 2JG8A 4HFSA 4ASMB 4D7SA 1JN2P 5A3NA 4BXFA 4AHYA 4WBBA 1W06A 2K2SA 5HV4A 3N3HA 4KWLA 3AFKA 3FE5A 4PCRA 1US3A 1CN1A 3VD5A 4MHRA 2XJTA 1PO12 3N7MA 4GH4B 3E5UA 2JX9A 3OSDA 1C8NA 3CF6E 3H0OA 5H9RA 4QPIB 4E8DA 1LU1A 1XNCA 2WN2A 4YVWB 5A1LA 3WDXA 4UXAA 2R0HA 1D7PM 3K46A 1VAMA 2D6PA 2ZGOA
chains in the Genus database with same CATH topology
2IFWA 4AQ6A 1UD1A 4V1PA 5DZGA 2YUEA 3FUOA 2PTMA 2VVFA 2X8KA 2H6BA 3ZSJA 1TMF3 4Q4W2 2HWB2 1FPN2 1ENSA 1C3HA 1AR73 3FJSA 1LGNA 3D5OA 3NAPB 1ULDA 1FOD3 4YGDA 3Q9OA 1AR81 1DGWA 4BIFA 4NR1A 1G9FA 3CJIC 2QDRA 1S55A 3B9IA 3AP9A 1YI7A 5GALA 4E4SA 1NYWA 1S0JA 3RG0A 2NP0A 1MACA 2A6ZA 1NLRA 1REEA 4XQWA 2HWD2 3S6PA 1RJ8A 4Q27A 2OUJA 1RUC1 2HWF3 1X8EA 1NQDA 4XJWA 2WNUA 4QGMA 2UY8A 2UWCA 4YW1A 1B35B 5BNOA 1U5YA 1ND2C 1HKDA 1OLQA 4ES8A 1Q5OA 4FBFA 1H2KA 3U07A 2E63A 2A3WA 5BNNA 4CEYC 1NCRC 1HQNA 4XZPA 5EWSA 5J37A 4KQ7A 1N3OA 1PHMA 2B5HA 1D4M3 5CFCB 5D8AA 1KITA 3OGJA 1NXMA 1F8VA 4PDWC 2AH2A 2UWBA 3VKNA 4Y4YA 5GLUA 4P9YA 5DDJ1 3TRSB 1V6MA 2KXLA 3VZKA 2JD4A 2DVAA 3IPVA 3K48A 4FPFA 4OI2A 5BNQA 4AEMA 3OY8B 4YZ2A 2YHJA 3OJBA 4WM8B 5K0UA 3UK9A 4EWAA 2ZHNA 3SH5A 1N1SA 1DDLA 5FO7B 2YDEA 1X50A 4X8PA 3WD5A 4AFCA 5ABJA 3VKLA 1AF9A 1U5ZA 4Y22B 2EVXA 4MX3A 3WCRA 1VBD3 2JE7A 5C9AA 4XHXA 5BUVA 1R082 1AL0G 1DG6A 4FOWA 3VHRA 2FMYA 3J8F1 1LR5A 3FBMA 1YCIA 1HRI3 1MS5A 3FLTA 2JKBA 2D98A 1XYOA 2UURA 3BALA 2WFF2 3N35A 3VBSA 1X7NA 4CEWC 2DCJA 1HRV1 3V64A 3JBG2 1T6GC 1O7FA 2PA7A 1BBT1 2YZ4A 1BEV1 3H1WA 3AMQA 1S1AA 5FRAA 5JOWA 4I01A 4Z2WA 3MGUA 4RHV1 1QJX2 4YG0A 4PF5A 4HK9A 1OQEA 5JZGC 3MPPG 4WZCA 5GLZA 2MEV1 5CFDA 4AEDA 5T54A 4RR3C 2JG9A 1R1A2 2DCZA 2R062 4JV4A 3X29B 1G86A 1MZEA 4IEOA 4IEVA 2D6MA 3BB6A 4AVSA 4Q4Y2 3DV8A 1VRH1 1V6NA 1YWKA 3B7MA 1MEC2 4XIOA 3CJIB 1UZYA 2V09A 4S2GA 5KXEA 1PK6A 4LBJA 4ATEA 3SXWA 4M0NA 2O1QA 1Y9QA 4ISRA 1RUE3 4XF9A 5FDBA 3W58A 2RE9A 3D6EA 4N9HA 1QH7A 1DZTA 4CDXC 1AXYA 3I2DA 2VW2A 1K5MA 1RUG3 1RUI1 4I09A 2VVDA 3AP6A 2XPJA 1ASJ2 5JSRA 4K20A 1LHVA 4QD2A 4G4FA 1HIXA 4AQTA 3KSCA 3MW4A 1CESA 3U10A 4YG3A 1PGL1 4Q4W1 4JGZC 2HWB1 1ND2B 2DVFA 1SLAA 3ATGA 4P14A 2HWC3 4HL0A 4LLFA 2B7YA 1PVC2 4CEYB 1NCRB 4Y26A 4C0HA 2Y0IA 3ASIA 3P3NA 4XJ8A 1DGLA 4AGRA 3ZN6A 4PDWB 2UYBA 1RMU1 3VN4A 2WA3A 4FOQA 2DFCA 4FQ4A 2P3IA 3AKRA 3VBUC 1W6OA 1PNGA 1D0HA 4PBPA 1AR93 4D7YA 4IEWA 3KM5A 1UKRA 3ZXFA 4LBKA 1RJ7A 4QPGC 3KS7A 2XVKA 5K8SA 4Z92B 4C0BA 1H30A 4XOGA 1POV0 4HPKA 3MFAA 4KH9A 1X8MA 1GZWA 2A73B 3DPRA 4NN0A 1CAUA 1DYKA 2ZCWA 1FXZA 3MZHA 3LGRA 1WCDJ 1WUVA 1H9PA 1WBLA 1CAXA 3TBDA 3ZYIB 2WC2A 2R063 2GZWA 1SLIA 3NJZA 1WMFA 3UKTA 2RHPA 3AB0A 1PGW1 4IV3C 4SLIA 1OI6A 4LO6B 5F5QA 4YW2A 5FQ0A 4R4XA 2XG3A 2YGLA 3WDWA 4RGAA 4QMAA 3CO2A 4RFT0 2H6CA 4Z82A 1MEC3 1IS3A 4AE2A 4GMP0 3VBFA 4QGNA 5B2GB 3OYWA 1ZRDA 4OI4A 1BVVA 5DG2A 1RUNA 5L7OA 2CTVA 4LBQD 4QQ2A 1RHI2 2R073 3ZXAC 5JZGB 5BNPC 4XTPA 4WM7C 1RUD2 3E5QA 2V73A 4DQAA 3I8TA 4RR3B 1R093 1D2SA 3IBMA 2VXRA 1O4TA 3VBRC 4DOUA 2ZAHA 5DXDA 1AR63 3O0XA 1QQP3 3FUQA 3IDBB 1WBFA 1ZBE3 2NQYA 2WSUA 1PIV3 4K40A 5EXOA 3HD8B 2CAUA 4XYXA 4LR4A 4NWVA 2GALA 1W6PB 4LO8A 3VDDC 3WVJA 1VLNA 4AI8A 3B69A 3AP7A 3NKTA 3R4UA 1GNZA 4P5HA 4Y20A 2EF6A 2BFUS 2E6VA 3DF0A 1PVXA 1N1VA 4CDXB 3ZXDA 1ENXA 1VB2A 4AF9A 4YFWA 5AC93 1O5LA 4FPYA 4EN9B 3GHMA 3TN93 2XB6C 1UU4A 3B5LB 2KA3A 1R1A1 4JQRA 2I07B 3SITA 5SV5A 4JGZB 2RMU2 5KC5A 1QJU3 3ZFGA 4FPHA 1ZZ8A 5GLTA 1GZ9A 3KCXA 1ENQA 4GB32 1NLSA 4XFIA 1RUF1 2ZZQA 2A3XA 3LB9A 2XWJB 4DB5A 5KHGA 1JXNA 1GICA 1YFYA 3M3OA 3ZXEA 2RS11 5A32A 1DZQA 5FO8B 1HDKA 1RITA 1I5ZA 2ET1A 4GKXA 4XF4A 4FPGA 3W59A 1DGRN 5GZCA 2A71A 1UIKA 3RRDA 4MV2A 4DINB 4Y1XA 4UBHA 4RS5A 1ASJ1 2RS33 5HCAA 1CAVB 2PHXA 1U12A 2RR12 5FCCA 4LBQB 1PO22 3VBUB 2TUNA 2ZGLA 4TLFA 3RI9A 5JI7A 1FNZA 1V9U1 4YZ5A 4QPGB 1HV0A 1LOFA 1PVC1 3AJYA 4TSVA 1LGBA 5JMCA 1O91A 3I59B 4YZ3A 2PN5A 5IK8A 2LUWA 1NY71 3VBHC 2GNDA 4N90A 4BMBA 4W6YA 4IEPA 1W0PA 2P3JA 2RS52 1XNKA 1LECA 2E7AA 3ZXKA 4GQ7A 3CJXA 3WLUA 3E6DA 4SBVA 2OPKA 1H2LA 3L9JT 4MVTA 1G9CA 4W6XA 4IV3B 2PHUA 1C5HA 4FPKA 1QXPA 3WOGA 1XU1A 4XE9A 1UN1A 5L19A 1WD4A 4U2AA 1XYPA 4Q2FA 1ONAA 5E89A 4CDWC 1ZX5A 3WZ1A 2PLV1 1U5XA 1X33A 2NN8A 1HW5A 3JZVA 3U4XA 3O7OA 3H8UA 3IN9A 5FMOL 3SH3A 4Z1VA 3HQXA 1FI2A 5JWPA 1VBA3 3UL2A 4IEZA 3OGGA 3EBRA 2QJVA 4YW5A 3RJRA 5KHHA 2OZ6A 5J7MA 1JHNA 2R042 1SLTA 5BNPB 5JDBA 4WM7B 3LZZA 4N9IA 4JDOA 4XQ4A 4DRRA 4OFGA 1ZBA1 4Y5Z0 3VBRB 3VL8A 1G9DA 3WXPA 3RYRA 1FV2A 4S2HA 4YW4A 1AX1A 1EPWA 2VQ0A 3BODA 2DU1A 1SBDA 1YI9A 4GWMA 2CGOA 2GDFA 5GZDA 1AL23 1I1EA 3AZVA 5FMOS 2PHDA 4L92A 4LE4A 3ZYPA 2Z5WA 4HMZA 4YGCA 3VDDB 2HWE1 5HXVA 4AI2A 3RPQA 5CBLA 2D6LX 2KM2A 2WS93 4COUA 3WHUA 1COV1 3FHIB 3FFZA 1KS4A 4D69A 5DZFA 2TNFA 2W68A 4MGIE 1SLCA 3M7AA 2BQPA 3JQXA 4AG4A 2P3KA 3AKSA 3KT7A 2CGPA 3E5XA 5FPZA 1RUC2 1POV1 2A3YA 1CJDA 3PNAA 4P9GA 1PO23 1IPKA 4GH4A 2D3PA 3CEWA 4XTMA 5GZEA 4QPIA 2G4IA 1E57A 4DZGA 1LOBA 4YVWA 3OF1A 3JQWA 4XFCA 1OOPC 1J1LA 2XJSA 4AHZA 1DQ0A 1XRUA 4IERA 3VBOC 1YFXA 2TBVA 2VW0A 4W6WA 3AM2A 4HN1A 2GNBA 4GMP1 3RS6A 2RS53 1DQ6A 1CONA 4WZFA 4B8EA 3VGIA 1EV12 4FPJA 3NAPA 5C8CB 5DDJ2 2VGDA 4Q0UA 1CPMA 1RVF1 1W2UA 2D3RA 2PHRA 4UW4A 2DWRA 2RMU1 2ZX4A 3D82A 3H3UA 1G9BA 1RUJ1 1MQTC 1RB8G 3O5SA 4GB31 5IUQA 1S0EA 4HANA 4DFSA 1WMEA 2XLGA 1C8M2 2ES3A 4CYDA 2AREA 5T55A 3WG2A 4LBMA 2D5HA 5JIUA 3PVEA 1JW6A 3VBHB 3IDCB 3ACLA 2E51A 1YO8A 3BTAA 5C33A 1B35A 5E8AA 3USUB 5I8YA 5KC6A 3KB5A 3KLSA 3KMHA 1LHNA 4DRVA 3J8F2 2QVSB 3QOPA 2I2SA 4HLTA 5BYNA 3VHOA 2RR11 5JPMB 4XJZA 4W65A 1V6LA 1W6MB 2ZHMA 5J98B 4CDWB 4HVQA 2QNKA 2DU0A 5CFCA 3G7DA 1C57A 2QZ2A 3D4KA 1PGSA 1WLDA 4P9IA 5JSOA 3LSEA 3FWEA 2WNVC 5LEKA 1MZ5A 3JU9A 1HXS1 4DS0A 1Z7S3 1AR83 1HRV2 1JOJA 5LEJA 2CNAA 4IESA 1BEV2 3WW3A 4RHV2 2E53A 3OY8A 4WM8A 4LHLA 4LHKA 3PVNA 1RUC3 2CY6A 1MS8A 4I0AA 1CR7A 2MEV2 2XJQA 3A0NA 3ES1A 1V6IA 2CYFA 1FMD3 4XF0A 2IXLA 4E4ZA 2YYOA 4YGEA 1ALYA 1RGSA 4Y22A 1S0FA 4OLLA 2ARBA 3UKNA 2DUPA 2AZ5A 4MGKE 3AYDA 2DTWA 1KJLA 1VRH2 3JB4C 4DXZA 4UW3A 1PZ7A 3KCCA 1PNFA 3WP6A 2D6OX 4R52A 2ZABA 2DYCA 1OD5A 2WZR3 4MZUA 2R041 2WZPP 3R4DB 3ZYJB 1LEDA 1BYHA 1LHWA 5I0RA 3ENRA 3AX4A 1N1YA 1RUI2 1TEIA 2ZMNA 3N7JA 4D3WA 2OVUA 4JGYC 1LOAA 3VZJA 5A3LA 1YIPA 3ZSMA 1PGL2 4EWEA 2XKOA 1AYN2 4EN8B 4S2DA 3E6CC 1OOPB 5I93A 5H9SA 1KRIA 1JYCA 1UU5A 1W6NB 4AFAA 1LOCA 3VBOB 4HKOA 1S0GA 1QJY1 3BCWA 4LT5A 5ACA2 4BE3A 4B4PA 2GNTA 4TYSA 4DMIA 1OLRA 1IS5A 3CU7A 1Q8PA 2PYTA 2CAVA 4L97A 5CG9A 2ZX0A 4BZ4A 4AFMA 1RMU2 3NSTA 1GANA 1CJPA 3AKQA 2DF7A 3KT4A 4NOTA 1O4ZA 3GZUC 4HT1T 1C4RA 3CJIA 5I8SA 2VUJA 3NL1A 3O14A 4X8NA 3WCSA 5JOXA 1XU2A 2LTNA 3WV6A 2D40A 2DURA 2WNUC 2P2KA 4COWA 2ERFA 4BMEA 5E1RA 3TNQA 1ZRCA 1A8DA 1B09A 2WL1A 1GSLA 1QOTA 1F5JA 2FHRA 3VZLA 3MW3A 1BBT3 1YFUA 2PFWA 4IXLA 1JH5A 4I0WB 4INDA 3AYAA 2W39A 1WW6A 1NCQC 1S0IA 1UZZA 1ND2A 4Q4X1 2P34A 1N47A 2BVBA 2BYVE 1EV11 2MEV3 1EY2A 4CEYA 1NCRA 2FMDA 5K9YA 5C4WC 1QGLA 1PGW2 2R49A 4EWDA 4ES9A 3D0JA 2Q1ZB 4LBLA 4ZU5A 3WP5A 5EYXA 1RL3A 2WNVB 4PDWA 4CRQA 4LUMA 5DUWA 4CP0A 4LNVA 4PIYA 1C8M1 1AX2A 1PO13 4PJYA 4GA9A 1ZZ7A 3IKWA 4YRDA 4XMAA 4LLOA 1WLWA 1Q8OA 2H0BA 1X36A 4MXVA 3J9SA 1Q8QA 3DUIA 1AVBA 1TMF1 1RUI3 2G9GA 4RL7A 4EJRA 2XKPA 2EA7A 4XETA 5C9AC 1CQ9A 1H2MA 4AHXA 2AGSA 4FO9A 4Q4W3 4TZDA 2HWB3 1FPN3 5LK5A 3CL1A 3PMEA 1MS4A 1KXGA 5FFOC 1QNYA 5L73A 1HQWA 1RINA 1WW7A 1CPNA 5JR7B 4I2OA 4H55A 1IS4A 3MIFA 4O9EA 5AVAA 3WG3A 2ARXA 4QQPA 2HWF1 5FTTC 2GNMA 3BPZA 2ZBJA 2HWD3 5FOJB 1Z78A 3KD4A 2DFBA 4FTSA 2R32A 1RMU3 2IWGB 3NKGA 1KDKA 2BNOA 3UV9A 2ZJCA 4M01A 4YM1A 3WT3A 3VKFC 4JGYB 2HEYF 4YM3A 1OA2A 3E97A 3ST7A 3D0SA 3RWNA 4Q26A 2JDZA 1OQDA 1ULGA 3H7YA 1J3QA 2PHWA 2ZS6B 3MLJA 1VB4A 4I3PA 5BPXA 2Z79A 4UBGA 5JZGA 4GULA 3ZXJA 1YJKA 2CWSA 1RUF2 3ILFA 3NO8A 3RSJA 5CU1A 4RR3A 3M3CA 3DL3A 4XFAA 4KU8A 3AZZA 3KCYA 2ZGRA 1VBB1 3DKWA 1SCSA 2PHFA 2RS12 3GBWA 3H9AA 4BQ1A 4AFDA 4CDQC 1XYNA 3VUOA 2NYYA 2XGXA 4ZXKA 2XJRA 4WVVA 1MZFA 2AENA 1W6QB 1LODA 2RJKA 4RQPC 2EXKA 4OUMA 4FAGA 1UCXA 1W6PA 4BCUA 1RUH1 3UJOA 1F2NA 3TB0A 3I4IA 4OVEA 5KXCA 5IK4A 1AYN1 4CDXA 1APNA 3GYDA 1V9U2 3TOJA 1OA4A 4ZKTB 1HV1A 1A8MA 4YG6A 1C1FA 4AHWA 1DF0A 2XJPA 1H1IA 3WINE 1NA1C 5JIAA 1H4HA 1VBD1 4Q4V1 3QD6A 5KHKA 5ACA1 5CADA 2VVEA 1NCQB 4JGZA 3CNAA 1G8WA 4XJ9A 3EO6A 2FZ2A 1NY72 4M3CB 4XW3A 1HRI1 1NXD1 3HMYA 2OYZA 2FBEA 1R083 4J6GA 1QXRA 1IGOA 1QWRA 5C4WB 5EZWA 3T1LA 2PAKA 2JICA 3VHPA 3L2YA 3J4UH 1LU2A 2E7QA 2PLV2 2WFF3 3R05A 4FVVA 5J96B 4E4DX 2P17A 2X5IC 4XBQA 3JBG3 4HSLA 5JOYA 1LGCA 1QJZA 2OW4A 1CAVA 2ZKNA 3VHNA 1J58A 4ONUA 4LBQA 4R9BA 4FPOB 1DFQA 3MFCA 3VBUA 3RJ2X 3EQEA 1QJX3 5T5PA 5A33B 2ZGTA 2XVGA 4BA6A 1DLLA 2QE3A 4QPGA 1ZBA2 4K3UA 4L11A 2EXHA 4B3NA 1R1A3 2VULA 1F5FA 1YUDA 4JCKA 1SLBA 1AJOA 3RDIA 1ULCA 3I59A 1BMV1 1OPMA 1IS6A 1QDOA 1BKZA 2DCYA 2XJUA 4Q4Y3 4YM0A 5T52A 1VBE2 2A6WA 4CEWB 2OUHA 1RUE1 1RUF3 1WA4A 2HWE2 5DZEA 3USSA 1LESA 4IV3A 1COV2 1OA3A 1SBFA 2VOWA 1ZZ9A 4LO7A 4ZU7A 4DY5A 4CP2A 4LULA 1Q3EA 2RS13 2PAEA 3AZYA 1UW8A 4AGGA 4HVOA 3QH6A 1CGPA 3H1MA 2HJIA 1ASJ3 4BH9A 4YARA 5KBFA 5E16A 4C1WA 1C28A 4NO4A 4A2UA 5BY5A 5I0UA 5BNPA 2ETEA 3FFQA 3B9CA 4WM7A 3WHTA 3JUUA 1PVC3 2WT2A 3L2HA 5GM0A 2Q8OA 4YGBA 1Y7BA 3VBRA 4XMIA 4OHYA 1O3QA 2B45X 2QUOA 3ZO0B 3N4MA 2XJVA 2ZMKA 1CAWB 3AP5A 1IZ3A 4CDQB 1GQHA 3VZOA 1WD3A 5CNAA 3INAA 2ZPXA 3MIBA 2WKKA 1YHFA 1FV3A 2WQZC 4RQPB 4XFFA 3MIHA 4DY3A 3VDDA 2O8QA 4Y1UA 1OSGA 5KXDA 4ASLA 2VECA 3AP4A 1RVF2 3ZN5A 4FPEA 3U0ZA 4JRLA 3I7DA 4HVRA 3R4SA 4B29A 2MPFA 1RUJ2 1NQJA 4FOVA 4D7TA 4YSFA 3S7IA 1NA1B 4FPLA 4F8AA 4G9SB 4LO5B 5BV6A 4YZ4A 3BOPA 1M4WA 1YLLA 1VJ2A 4I0BA 3WDVA 1MR5A 2IXJA 4AVVA 1F9KA 1H8VA 4NHLA 1LTEA 5F6KA 3MF9A 1ZBA3 3HIFA 3ZFEC 3WUDA 1UPSA 2ZHLA 4EN0A 3MW2A 4LA2A 4JTOA 4HZFA 4OZXA 4LE3A 4RS5C 1D0GA 4FSJA 5TSWA 3JB8A 3LCPA 3AMHA 1ZRRA 1C1LA 1NE4A 1UIJA 2X5IB 4KGQA 5DUVA 4YFZA 1HXS2 3WP4A 2ILMA 2A6YA 5HBAA 5C8CA 1WW4A 2MHFA 1H1MA 3URFA 4J1WA 1C5IA 1TME1 1SMVA 1AR61 1RHI3 3ILRA 3V0BB 2XWBB 2EIGA 4I3GA 3SCFA 1RUD3 1POV3 2DUQA 1PIV1 2W0XA 2ZOEB 3WNXA 4XPVA 1SFNA 5I0TA 5JOZA 1DQ5A 2BEOA 4KWJA 4QQLA 3WDTA 4AQSA 2PHTA 2R1BA 2VPVA 2QCSB 3SCHA 2ZTNA 3VBHA 1DYPA 5CG8A 1EPZA 2UWAA 3APBA 4XF3A 4NHMA 2WJSA 3POWA 1PZ9A 3USUA 1O3RA 5DG1A 1H8TC 3N7KA 2YXSA 4OUSA 4U36A 2Z42A 2YY1A 3OCPA 4BWOA 5I8TA 3R6SA 3FC0A 2QZ3A 3TN91 1W6MA 4CDWA 2WFPA 4CDUC 4AXOA 2DVGA 2WT0A 4ITCA 3ZSLA 3B94A 1QJU1 2ZX2A 5GKAC 3M70A 1O3SA 2GN7A 4QT6A 1IPJA 1RVF3 3MDPA 3MLLA 1PMIA 2RMU3 3CLPA 2YROA 2EALA 3MLKA 1VBE1 3KGZA 4GB33 1JUIA 2Y0OA 5CB7A 1VBC2 1AYM2 4DNYA 1QJY2 2B8MA 1Y43B 1DIWA 3ZMOA 3A4UA 1R1ZA 3S30A 3HBZA 4B7KA 5GZGA 5CVRA 4GALA 3NWKA 1QKQA 2VNGA 3ZSEA 1G9AA 2Q0AA 1H2NA 4AI3A 4FTBA 2VY0A 2A75A 2NM1A 4LO4B 4E2QA 3AJZA 1H9WA 1H0BA 2VUAA 2EXIA 2RR13 1YNAA 1N3QA 2VH9A 1JYIA 1DBNA 3RMYA 4Q8KA 2B42B 3QBQA 4UW5A 1BK1A