1RMU3

Three-dimensional structures of drug-resistant mutants of human rhinovirus 14
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
236
structure length
236
Chain Sequence
GLPTTTLPGSGQFLTTDDRQSPSALPNYEPTPRIHIPGKVHNLLEIIQVDTLIPMNNTHTKDEVNSYLIPLNANRQNEQVFGTNLFIGDGVFKTTLLGEIVQYYTHWSGSLRFSLMYTGPALSSAKLILAYTPPGARGPQDRREAMLGTHVVWDIGLQSTIVMTIPWTSGVQFRYTDPDTYTSAGFLSCWYQTSLILPPETTGQVYLLSFISACPDFKLRLMKDTQTISQTVALTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
publication title Three-dimensional structures of drug-resistant mutants of human rhinovirus 14.
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Virus
total genus 38
structure length 236
sequence length 236
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1988-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1rmu300
1COV3 1D4M2 1MEC3 2IZWA 2RM23 5AC92 3VBSA 5BNNB 4N43A 4FSJA 1AR92 3CJIC 1ASJ3 2PLV3 4QPIC 2WZR1 1VBA1 1RB8G 4CEWB 1VBD1 4GH4A 4RQPA 1RUF3 1TMF2 1PGL2 1K5MA 1POV3 4QPGB 5CFDA 2ZTNA 3JBG2 5DDJ1 4CDWA 5BNNC 1QJX3 1FPN3 4PDWB 4GMP3 1D4M1 4CEWC 5J98B 5AC91 2WS91 4YVSB 5FOJB 1GFF2 1RUC3 1AR91 4QPGC 2HWB3 2BFUS 1F8VA 1ND3A 1V9U1 2MEV1 3VBFC 3VBSB 4N43B 1HXS1 5J96B 4JGYA 4PDWC 1AR71 1TMF1 1PGL1 4AEDA 3JBG1 1BBT2 4GH4B 4RQPB 1RHI1 1K5MB 2R073 3VBSC 4CDWB 5L7OA 3M8LA 4N43C 3JB4C 5A33A 2RMU2 2XBO2 4Q4W3 4GH4C 4RQPC 4Q4X3 1ND3B 1R093 5D8AA 4CDQA 1AYN3 1RUJ3 1BBT1 4N53A 1RUD3 4JGYB 1AL22 1VRH3 1VBC3 4AEDB 4CDUA 1VBE3 3JD72 1AR63 1C8M2 1QQP3 1RUI2 1ND3C 2RMU1 4RHV2 1PIV2 5L7OB 2XBO1 5ACA1 2HWC3 4JGYC 4AEDC 4Y4YA 2QQPA 5C8CA 2WFF2 2HWF2 2X5IA 1AL21 1POV0 3FBMA 1FMD2 5D8AB 1AR83 1QJY1 4CDQB 4N53B 2HWD2 1IHMA 3JB8A 1VB4A 5ABJC 1AYM3 1RMU2 4GMP0 1C8M1 1RUI1 1NA1A 4RHV1 3J8F2 2RS12 2HWE3 2R062 3DPRA 4IV1A 5D8AC 3VBHA 1R1A2 4CDQC 1PVC3 1VBD2 1VAKA 1ZBE3 1ZBA2 4N53C 2WFF1 1FOD2 2HWF1 1RUG3 1EAH1 1FMD1 1COV2 1NCRA 1MEC2 5C8CB 4BCUA 2RM22 2X5IB 2HWD1 2R043 2WS92 1RMU1 3ZFGA 1R083 1ASJ2 3J8F1 2RS11 1TME3 3LOBA 2R061 4GB33 3ZFFC 1QJZA 1V9U2 2MEV2 1OOPB 1NA1B 4LLFA 1PO23 1RUF2 1HXS2 5C8CC 1R1A1 3VBRB 2TBVA 1ZBA1 1AR72 2X5IC 5CFCA 1RUE3 1FOD1 1QJX2 3NAPA 3VBHB 1MQTA 1FPN2 2DF7A 1COV1 4FTBA 1RHI2 1MEC1 1PO13 2RM21 1NCQA 5JZGA 1OOPC 1NA1C 4IV3A 1RUC2 1NCRB 1ASJ1 2PLV1 1CD3G 4WM8A 3VBRC 1PGW1 5A32A 3VBHC 1QJU3 3ZFGB 1RUF1 1POV1 1QJX1 3IDEA 1NCRC 2ZAHA 4YVSC 1FPN1 1A6CA 4NWVA 4FTEA 4GMP1 5CFCB 4YVWA 5CFDB 3TN93 3NAPB 3ZFGC 1MQTB 5K0UA 1RUC1 1SMVA 2HWB1 1B35A 1NCQB 1RVF3 1HRV3 5JZGB 4Q4W2 4RS5A 1DDLA 4Q4X2 5ACA2 1R092 2RS33 5CFCC 1K5MC 5CFDC 2WWSA 2RS53 3NAPC 5A32B 1MQTC 1RUD2 4CDWC 1VRH2 4FTSA 4EJRA 1NCQC 2R071 1QJY2 4WM7A 5JZGC 1VBE2 1NY72 4JGZA 1AR62 1EV13 1OHFA 4YVWB 2RR13 4Q4W1 4RR3A 4Q4Y3 3VBUA 4Q4X1 1B35B 4RFT0 5A33B 1R091 1RUH3 1AL0G 3S6PA 1AYN1 1RUJ1 1HX6A 5C9AA 1RUD1 5BNOA 1VRH1 1VBC1 1VBB3 4YVWC 1BMV2 3ZFEA 1EAH2 1WCDJ 1VBE1 5L7OC 1NY71 1AR61 1AYM2 1B35C 3JD73 1PIV3 4CDUB 2HWC1 1Z7S3 4Q4V3 1HRI3 1PVC2 1ZBE2 1C8NA 4SBVA 3VBUB 1RUG2 1BEV3 1AR81 1BMV1 4CDUC 5C9AB 2R042 5BNOB 1AYM1 1R082 1F2NA 2BUKA 2HWE1 3VBUC 2PLV2 4GB32 1PGW2 1VB2A 3VDDA 1PO22 2WZR3 3VBFA 1VBA3 1PVC1 1HQNA 1X36A 1ZBE1 5C9AC 5BNOC 1VBD3 1RUE2 4Y5Z0 3DPRB 1RUG1 4IV1B 5DDJ3 1CJDA 1H8TA 2WLPA 1NOVA 1PO12 2R041 5FMOS 1M06G 1D4M3 1R081 5AC93 2WS93 2ZZQA 1TME1 2HWB2 1AR93 3DPRC 4GB31 1QJU2 4IV1C 1V9U3 2MEV3 1PO21 4CEYA 1HXS3 3VDDB 1RUE1 1AR73 1TMF3 3VBFB 3JBG3 1PO11 2FZ1A 1RHI3 3TN92 2R072 1H8TB 1RVF2 1HRV2 3VDDC 1QJU1 4IV3B 5C4WA 2RS32 2RS52 1NG0A 4WM8B 1AYN2 1RUJ2 4CEYB 1H8TC 2BBVA 1BBT3 4CDXA 1VBC2 3TN91 4NWWA 4IV3C 2Y26A 1EV12 1QQP2 2RR12 4WM8C 1RVF1 1HRV1 5ABJA 2RMU3 4Q4Y2 1X33A 3VBOA 4CEYC 2XBO3 2HWC2 5K0UB 1RUH2 2RS31 5ACA3 5FMOL 5BNPA 2RS51 1ND2A 1OPOA 4RS5B 5C4WB 1VBB2 1AUYA 1AR82 1AL23 1QJY3 5K0UC 1EV11 2VQ0A 4CDXB 1QQP1 2RR11 4WM7B 1C8M3 1RUI3 4RS5C 2HWE2 4RHV3 2BPA2 1Z7S2 4Q4Y1 4JGZB 5C4WC 3HAGA 4Q4V2 2FZ2A 3CJIA 3ZFFA 5ABJB 1RUH1 1HRI2 4QPIA 2GH8A 3VBOB 1W39A 1BEV2 4RR3B 2BFUL 4CDXC 1VBB1 5BNPB 2WFF3 1ND2B 2HWF3 4WM7C 1EAH3 1FMD3 5BNNA 4Z92B 4JGZC 3JD71 1OOPA 2HWD3 4CEWA 1PIV1 3ZFEB 1RMU3 3VBOC 1TME2 1Z7S1 4RR3C 3VBRA 3J8F3 2RS13 2WZR2 4QPGA 1VBA2 4Q4V1 5BNPC 1E57A 2R063 1ND2C 1HRI1 2XPJA 1R1A3 4PDWA 3CJIB 1BEV1 2GSYA 3ZFFB 3ZXAC 5DDJ2 1ZBA3 4QPIB 5LK7B 1FOD3 3ZFEC 4YVSA 5GKAC
chains in the Genus database with same CATH superfamily
1UZ0A 1MZEA 2PHRA 2WO2A 1CAUB 3NV3A 4XVHA 3N3HA 4QKFA 4ZZ5A 2VQTA 3MW3A 2GN7A 3C7OA 2ZX0A 2EF6A 3HD8B 3VBSA 1YWKA 2D97A 1LEDA 2BGOA 3AMMA 2WZEA 4LO6B 1J84A 4N43A 1AR92 4FSJA 5FUNA 4K8FA 1ZZBA 2EXKA 5C70A 2PLV3 5JSOA 5JOXA 3I2FA 4QPIC 2WZR1 4PBPA 1RB8G 3USUA 2JICA 4QX1A 2IXIA 2W87A 1NE4A 3DYMA 2D40A 2RVAA 5FYYA 3RJ2X 1RUF3 5FZ1A 2VUJA 1PGL2 5FZ7A 1POV3 1E5IA 5CFDA 2AZ5A 4Y1UA 5DDJ1 2W9XA 2CSGA 3DYPA 3D5OA 1BYHA 4RA0A 5DUUA 5BNNC 5BYNA 1POQA 4P9YA 3KWVA 1ACCA 3PVEA 1D4M1 1O59A 1UQXA 4P9WA 4XILA 4BLJA 2F17A 4YVSB 3LIGA 3PMSA 3DKWA 4QPGC 5JUVA 3ZKUA 5FZ3A 3KGZA 1LNSA 4BM8A 5FO8B 3CEWA 3L9JT 4GQ7A 5J96B 2FCUA 1W9TA 5IHRA 4TSVA 1TMF1 4CU9A 4ASKA 2OXBA 3JBG1 1UXXX 2C9KA 3ACGA 3FMGA 1VAMA 5T55A 3HJRA 1BBT2 4GAZA 3IIIA 5HBAA 3TBDA 5E16A 4V2VA 1H6YA 3C2UA 4L2NA 1ZREA 1LGBA 4WVMA 5FYIA 2R073 2WAAA 3ZOIA 2XMLA 1DLCA 1DCSA 2KR2A 3VBSC 5L7OA 5L9VA 5G05L 1F15A 1XYNA 4N43C 3VKFC 5A3NA 3JB4C 3MIDA 4JQTA 1W9YA 1G6NA 3J7LA 4FP2A 1S2KA 2EALA 5LWBA 4Q4W3 2WINB 4ZZ8A 5DAXA 1DHKB 4ZU4A 1CONA 2ZHMA 3ZLIA 3N7KA 1F9KA 4Z2WA 1R093 1TZOA 2VU9A 3J7NA 4ITCA 2JDAA 5C3RA 3I3BA 2KM2A 4DINB 1AYN3 2YBPA 1RUJ3 4AYUA 1OQEA 4RFRB 1YJLA 1AL22 5CKMA 3AZVA 1VRH3 3UJQA 3WHUA 2YFUA 4AEDB 1AZDA 1YQ8A 2W1WA 1MR5A 3VZJA 3CO2A 3NNFA 2OQ7A 3S5QA 4IGQA 3HNYM 2Q8EA 2WQ8A 2RDRA 2RMU1 5CA6A 1YFWA 1ENQA 3U37A 5GJ6A 2VMGA 2XBO1 1A3KA 3BOPA 4LKDA 1XPWA 4ONUA 5FP4A 4A3XA 2XLGA 3WQ1A 2EAAA 2GDFA 2HWC3 3B9CA 1W8TA 3WCRA 2QQOA 2Y34A 1YUDA 3AM2A 4KWUA 3ZYFA 4XJAA 3OGRA 4B4QA 3WG1A 3D4KA 1H6XA 3MIFA 2J1AA 1KDKA 4W8JA 2UY8A 2JD9A 3AP6A 4XUTA 4A3ZA 3M3EA 5IJRA 1WD4A 2BVVA 1XNDA 1DYKA 3MUY1 3PTRB 3OD0A 2R0FA 2CGNA 3K2OA 4XW3A 1CJPA 3BGAA 4N53B 1IHMA 2G9ZA 2ZGPA 4QX3A 1MS3A 3JB8A 1VB4A 4FP3A 4GMP0 5LBFA 3AFKA 1HJGA 2D5HA 4QQPA 4RHV1 2O8QA 1KFXL 2RS12 3J8F2 3AFGA 1UKGA 2DUQA 3WOGA 5IATA 4QKNA 2VMDA 3I2KA 4XMAA 5E6HA 2R062 4E4ZA 2C4XA 4EYUA 5FZLA 1O3QA 2VZQA 2W08A 2W95A 2QQLA 3VBHA 4MV2A 1RXGA 3H0OA 1VBD2 4D8MA 3ORJA 5BV6A 4XBLA 3ZSMA 1DQ1A 2D6MA 2R1DA 4EQVA 5BNQA 1F4HA 1EAH1 1DQ4A 1COV2 5F5IA 4XYXA 5C8CB 2V09A 2DU1A 4UFHA 4HKWA 2QJVA 4ZS3A 4M3CE 1Q8VA 4OFGA 2A6ZA 4AXOA 5HV4A 3OGSA 2WS92 4QDRA 5L9BA 3T0DA 2NYYA 1W3XA 3LA3A 1R083 2A7AA 1ASJ2 1UOFA 2HKXA 5FZ4A 3SH4A 1DZQA 5T5PA 5F1RA 2YC0A 1Q3EA 5FYMA 2W47A 2VZUA 2MEV2 5FP8A 3ZFFC 2BJSA 3ZPYA 4COUA 5CAZA 4NIGA 1PNGA 3K4AA 1F5FA 2GP3A 1R1A1 4HFSA 1L7LA 5IVJA 5DABA 3WDVA 2JG8A 4Q0QA 2RDNA 4KU7A 1FOD1 1OFNA 3NAPA 4AVCA 2ZGMA 1YEWA 3LIHA 3OYWB 2MPFA 5A1LA 3VD4A 4FTBA 1RHI2 1RYYA 4F83A 1PO13 5FY7A 1FT9A 1NCQA 2QZ2A 5JZGA 4NIDA 1OOPC 3ZN6A 1JZ6A 1SPPB 2UURA 4W6YA 2PHXA 2ZEXA 5ANNA 2WNVB 1NCRB 3NQHA 4FAHA 5FPVA 1P8JA 2PLV1 4K3UA 1PGW1 3AYCA 4XURA 4NAOA 3ZXLA 3MPPG 4W6WA 4UI9L 3VBHC 2VOKA 3ZFGB 3ZSJA 4E2QA 2VBDA 1H30A 3NV4A 3R0RA 1RUF1 1JU4A 3IMNA 4J6GA 4XBNA 4EWEA 2YBSA 1BHGA 1POV1 4UW3A 2QKDA 5K8SA 1UO9A 1WMEA 3C7EA 4IE0A 4TLGA 3JQWA 4D6QA 3VD7A 1OQDA 3GBFA 3SCFA 1S0DA 3IDEA 2Y6FA 3S7IA 4MGSA 2WRAA 3HEIA 2EXJA 3POSA 2Y6KA 4KMQA 3OPTA 3SH5A 4B4RA 3TN93 1J83A 4XF3A 1T6GC 4INDA 4NO4A 4QQ2A 2BEOA 2NMNA 1ZVFA 2QTWB 1CZVA 2DCYA 3HQXA 1EUUA 1QKQA 1XXNA 3M3CA 1W6QA 1S0EA 3AKSA 3URFA 1CAWA 4Q4X2 5GLVA 4MUVA 4MGZE 3RZHA 2XONA 2ZKLA 5FPXA 5FXZA 2PTMA 1G9AA 3NAPC 5A32B 2F4LA 1IZ3A 2A75A 1V6IA 5JR2A 2JB8A 2WLQA 4MZUA 5LRRA 4HK9A 3WF0A 4CDWC 3SCGA 2PQQA 2FMDA 2EA7A 2X05A 4I0BA 4EJRA 1NCQC 2R071 4A41A 2VZOA 4YW2A 4CRQA 5JZGC 4QX0A 4FPEA 3OBZA 1W3VA 4HETA 2R30A 5CVRA 3BUCA 1GZTA 2ARXA 1UN1A 1YI7A 1EV13 3V56A 3V0AB 1JYTA 1LOGA 3DKQA 1CQ9A 5I93A 5G04L 2RR13 3OY8A 2PHTA 1ZM1A 3O1SA 4Q4W1 2V4AA 4ZU7A 5FPAA 2WIIB 2ZX1A 1JU3A 4XHXA 5FYZA 1B35B 5A33B 1V6OA 5GM0A 1R091 3AJYA 3N9LA 4FFIA 5I0TA 3NNMA 5JSPA 4LUKA 3T1MA 3S6PA 1AYN1 3PNAA 1KEXA 1RUJ1 4MGIE 1ODNA 4TWTA 3UKTA 5T3NA 5I0RA 1VRH1 2ZPXA 3VUOA 3HN3A 2VTXJ 3HIFA 3Q8CA 5KHKA 1LHNA 3UK9A 1HLCA 2W92A 2ARCA 3RZMA 1FAYA 1CZTA 4YSFA 1YQ6A 2YMZA 5FZAA 4JTOA 2EICA 3KQRA 3LDKA 4FPLA 3O5SA 2HWC1 1KS5A 4W65A 2JDUA 2QQKA 4Q26A 5FTTC 1GWKA 2IXHA 3HBZA 5T5JA 2ET1A 2F6BA 1HRI3 1PVC2 2JDHA 3T2QA 4NAMA 3OG2A 1NQDA 5LATA 2WSVA 3B00A 3VBUB 4B1LA 2DUPA 1RUG2 5BPXA 3TYJA 2H6CA 4ZKTB 3POIA 2BNOA 5IVVA 1WZXA 3BKZA 3UGHA 3RZJA 2AH2A 4LNVA 5C9AB 1TEIA 3NMBA 3T4VA 1UY3A 1VIWB 4C1WA 2P6HA 3NJYA 2C5DA 2H0VA 2Z4FA 3TEYA 4Z8BA 5CEHA 4NROA 4ZS2A 4F7ZA 2O1QA 3P3NA 2PHUA 5DG2A 2XLFA 3S57A 4B1MA 4XZUG 2AGSA 4QWNA 4DIQA 3SEEA 4BOWA 4PQ9A 3LGRA 4XXPA 1FV3A 4K1ZA 2JE8A 4YNIA 3ZMOA 1W6OA 1IKPA 3KLSA 1VBD3 2GU9A 4CUAA 1LULA 1S55A 1URXA 1O8SA 1JN2P 1W03A 4UF0B 4EV0A 1H8TA 2ZABA 4Q0UA 1XSQA 4D3WA 1WW7A 5LY1A 4LULA 1ULCA 1S0IA 2E53A 5J7MA 4CPBD 3A21A 1IPKA 2ZS6B 3U10A 1FNYA 4Q0SA 1R081 5AC93 2WS93 1UZZA 3OD4A 3O0VA 4NE9A 1G9DA 1JYCA 2Y6JA 1MS9A 1SLAA 2HWB2 4LBOA 2VM9A 4OI0A 3FHIB 4AVTA 1DZTA 3ILNA 4R4ZA 3ZN5A 2WKKA 2XOMA 2JKXA 4IV1C 2MEV3 2Q30A 3OUHA 2ZJCA 3MFAA 4LBNA 1Q8PA 2J1VA 3VL8A 3PVBB 4OUEA 4CU8A 1H4GA 3E6CC 3E5UA 3LZZA 4OMDA 5EYYA 1AXYA 3AXEA 4PI2A 1UWWA 2E7AA 1Y7BA 2N7GA 1DGWA 1PO11 2VVEA 1RHI3 1XC6A 2WN3A 3CU7A 2WNOA 3MPBA 1B09A 4XDQA 2A6XA 4CCMA 4COZA 2J1EA 4FXKB 1QXRA 5AVAA 5JDBA 2D44A 4BQ5A 4FPCA 2DYCA 4UT5A 4BQWA 5JXIA 5FY0A 5FZ8A 3OPZA 2H0BA 1OFSA 3BOWA 4BWOA 4EN7B 4HSLA 1OXCA 2A3WA 5C4WA 2RS32 1DYPA 4KBBA 3UETA 3GNEA 3CDZB 1H2NA 5A7PA 3RG0A 4J25A 1CN1A 2IXCA 4IEVA 4UWDA 1W8UA 5J37A 5J09A 3AKRA 2DCKA 5FKCA 1H8TC 2CY6A 4Y5TA 3WR0A 1WCKA 5EV7A 4XFBA 4Q8LA 4QAWA 3O12A 3W20A 3O1TA 2VBPA 3TN91 2YBKA 3IT8A 1UYYA 3AB0A 4O9GA 4PCRA 3UKVA 2B39A 4IV3C 3U4XA 4OHZA 2JWPA 4B8EA 2OYZA 1X8EA 3VN4A 3GYDA 3Q8EA 2K9ZA 4Y24A 3X29B 5H9SA 4A44A 2BOIA 4QDQA 3FE5A 4NHKA 1RUH2 5FMOL 2YY1A 4K7JA 5F3GA 1ND2A 3ECQA 5F3CA 4RS5B 3K4ZA 2DVAA 2VNOA 1XOYA 3WF1A 5FY8A 1VBB2 4JVAA 4IETA 4XIKA 1AUYA 1SQ4A 3UGGA 1QEXA 1BVVA 1AR82 1VLNA 4QHOA 2VO5A 5FZ0A 4CP2A 4EZ4A 1DF0A 1GOGA 2VZ3A 5EHDA 5GLUA 1W6PA 2D3RA 1WCUA 1TQ5A 4LLOA 5K0UC 1EV11 2JDYA 1XNKA 1JOPA 4QU1A 1R1ZA 2RR11 3C7HA 3QOPA 2JX9A 4IEWA 4MHUA 3PUHA 1C8M3 4P08A 1RUI3 4XUQA 2HWE2 4CP9A 4LO5B 4YZ2A 5JWPA 2OUHA 5C4WC 1V70A 4Q4V2 3LSDA 1WLWA 5FBJA 4JKLA 4AZZA 3RZLA 2FZ2A 4M3CB 1WCQA 4JKMA 4EROA 3VGIA 4DXSA 2P17A 3I7DA 4WVVA 4LK7A 2Q4SA 2V73A 3KV4A 5BNPB 3BTZA 5EZWA 3WDWA 4A6SA 3TNPB 4H2AA 4WM7C 2ETEA 4DZGA 4GXLA 4JGZC 5A7WB 4JZRA 3KT1A 4QXKA 2GALA 4OHVA 2WYFA 1X9TA 3KHBA 2LALA 1GQGA 4KWJA 4AI9A 5A7OA 4XEZA 3ZFEB 4YARA 1EUTA 3FWEA 3PDQA 4G4FA 3SH3A 1VBA2 2V4VA 1ND2C 1HRI1 3FL7A 3H8XA 3NKGA 3EXUA 4B7EA 1I9RA 3CIHA 3M7AA 2A6WA 3T0BA 3W9AA 4A7ZA 3OGJA 3ZFFB 1H0BA 3LOIA 5E89A 5L73A 3WP6A 4QM8A 1SPPA 1ZZ8A 3UNPA 1NLSA 2I45A 5GKAC 3I4IA 2WQ4A 4AGGA 3J7HA 2VH9A 3PUIA 1G9FA 5CADA 1SZBA 1S0CA 2RM23 3VZKA 3KHCA 2NM1A 1W0OA 4AG4A 4EWDA 3ZXDA 1FXZA 5F6LB 4HPKB 1LRHA 3N9NA 1ENSA 4X6RB 4CYDA 1ALYA 5I8TA 4BE3A 4LHNA 4CEWB 3HT1A 1WA6X 2YB7A 5E1RA 1W6NA 2J1TA 2IUWA 3GZEA 3NJZA 3ZIWA 2AEYA 1UYZA 1VBD1 4GH4A 4FOVA 1ZA4A 2E33A 1K5MA 4KQ7A 4AAPA 2ZTNA 5IK8A 2G9FA 4IUGA 2CU5A 4HN0A 3ABZA 2WA3A 5CG8A 1UY4A 4XFCA 1QJX3 1Z0HA 1LODA 2R16A 4PDWB 5IW0A 3PJQA 4M0HA 1EYBA 1FV2A 3I97A 5IVFA 1W28A 2G19A 3VKNA 4NR1A 3GBWA 1T2XA 2WS91 5AC91 2TEPA 2ZGQA 3SHRA 1RTVA 2YGMA 1YRZA 3JU9A 1L3JA 1N3QA 3TNQA 1GMMA 2HWB3 2BFUS 2J22A 4FFFA 1LHWA 3LEIA 1OD3A 1KFUL 2MEV1 4IEQA 3U4SA 2QQMA 1Q8SA 3VBFC 1FI2A 4XF9A 2Q8CA 2X10A 1E5SA 2OQ6A 4R4XA 1PK6A 3NV2A 4XTMA 4JGYA 4CCKA 4L99A 4LITA 3H8RA 5CZKA 3RI9A 1DGWX 5IK7A 1SCSA 2VMFA 3KCYA 5FO9B 4DRVA 4HK8A 4NN0A 4RQPB 1GNHA 1RHI1 4Q8KA 4AHZA 3ZXFA 3V0AA 5T50A 5H9PA 4FPJA 3UT0A 1PNFA 2ZGNA 4LO8A 4CDWB 2O8OA 3M8LA 4AFDA 5A33A 1W6MB 1WBLA 2GZWA 1XYOA 4W6XA 2LROA 2RJ2A 1IQDC 1HKDA 1LHOA 1GZWA 1XU2A 4FPFA 3LE0A 4GH4C 2ADDA 1QH6A 5FZMA 4JQRA 1Y4WA 2J1UA 1ND3B 3UKNA 4TYSA 1EPWA 4I0WB 3KCCA 1MPXA 4XQDA 1UIJA 4YG6A 2QDNA 3D8CA 4AHWA 3TB0A 3BU7A 4CDQA 4Y1VA 5KHHA 2JDPA 3WX5A 2WL1A 3INAA 2VCBA 1MACA 1DYOA 1UOJA 3E1F1 5EJZB 3RZZA 2ES3A 3BTYA 5F37A 1TE1B 2ZGSA 1RJ8A 2VULA 1A78A 1V6LA 2TUNA 3KB5A 4F8AA 1AR63 5FWJA 3B9IA 3KSCA 4CU6A 1PIV2 1Z78A 3RMYA 4URAA 1PK6C 3GDBA 3BVCA 4JGYC 2VZPA 2VAUA 4NPLA 4AFMA 2WSUA 3BPZA 3VKMA 1J1LA 1JYWA 2Z2SB 4BQ3A 2WFF2 2LTNA 1GWMA 1OA3A 2C24A 2HWF2 2X5IA 1POV0 3FBMA 1FMD2 5D8AB 1AR83 1F5JA 1NAEA 1RJ7A 1VPHA 3MIHA 4I30A 3OEBA 4CXXA 1H1AA 1TVGA 2HWD2 3ZM8A 2Y8KA 5DAQA 2WBKA 1AYM3 1RMU2 4IE7A 3PUQA 1C8M1 5F5CA 1RUI1 4LR4A 5IAVA 1H8VA 1DBNA 2AR6A 1LJ7A 5DXDA 2HWE3 5GALA 3POYA 4Q0VA 3T30A 4Q27A 1ZZCA 3RQ0A 4L9BA 2XUMA 4BH9A 5FPLA 5JOWA 5FYSA 4ET7A 5EIYB 1NXD1 4Y33A 5F2SA 3VKOA 4CDQC 4JAAA 1VAKA 3WUCA 4GWNA 1KITA 1ZBA2 1XU1A 2VMIA 3MZHA 1KD7A 1UYPA 1Q8QA 2JIJA 4HKLA 3MI8A 2CWMA 1YO8A 1X50A 5FK8A 4QB6A 1MEC2 5I8SA 5A1AA 1QDOA 4BCUA 1K3IA 4FFGA 3PUAA 2Y64A 3ZDSA 5CKNA 5LK5A 3AZWA 4AI3A 1I1EA 4HN1A 4P9JA 3EQEA 1YI9A 3EO6A 1QH7A 3VZNA 5FP7A 1QJFA 4A2UA 4B4PA 2EIBA 1V6NA 3ZIXA 1U12A 3KT4A 4GB33 1QJZA 1V9U2 2ZHLA 2B46X 3FLPA 3N7LA 5F9TA 4QXCA 1I6XA 5LRSA 1NA1B 1J3RA 4PQQA 3SMHA 5KC6A 2WJSA 5A3PA 2GNBA 3OBTA 3T4HB 5EWSA 2IXLA 4RD7A 4GKYA 2X5IC 5CFCA 1RUE3 4DXTA 4OHXA 2VTFA 4KG8A 4PBOA 2JKBA 4LOTA 3GJBA 1FPN2 4FPHA 4Q5OA 3VD5A 3ZYPA 3VD9A 1CVNA 2RM21 4CUGA 1W9WA 3OBAA 3GCXA 4XC9A 1YCIA 3ZXEA 1RUC2 3I2DA 3IMMA 4TXWA 3IPVA 1U5XA 4XF0A 5F5AA 3JXSA 3VBRC 2GMPA 3DXUA 3I2IA 2GC0A 1MZ6A 1S0BA 4R9CA 2P5BA 1SLTA 2BP6A 3QH6A 4Z07A 2E32A 1SBEA 4QQOA 3ACLA 5C3QA 5DZEA 1JOBA 1QJX1 1V6JA 2C26A 4LBQD 3FHAA 2ZAHA 4AL9A 3Q8AA 3B01A 1QIQA 1AJKA 2P6CA 4JTNA 4DUXA 1PHMA 1H1MA 2ZCWA 4XDOA 4YVWA 4YW4A 2WZPP 2YZ4A 2ZXQA 4LXLA 3USSA 5ANQA 2R49A 2FDGA 1MQTB 2ENRA 2VXRA 1HB2A 2BDRA 3VHNA 2VXJA 4ZPIA 2HWB1 4IW3A 5CIRA 4NUBA 1HRV3 4RS5A 4QGLA 1N47A 1UY1A 5DQ0A 4NMIA 1XNBA 4G9SB 5ACA2 2ERFA 3C8XA 3LEGA 2ZMLA 3ZR5A 3ZPOA 4AGVA 5LW9A 5CFCC 2PELA 1JYIA 5CFDC 4QHBA 1QOOA 3AVRA 1QWRA 5CKQA 3VDBA 1RUD2 1X8MA 2JE9A 1XSRA 2RG4A 2K0GA 4LBLA 1QOTA 1UXZA 2VR4A 3H50A 2WO7A 5E8AA 1ZZ6A 4FTSA 3A4UA 5HCHA 1GLHA 1AHSA 4EWAA 5AFBA 1VBE2 2ZGUA 2YG0A 1O91A 3IKWA 1NY72 5JPMB 3WHTA 5F2WA 1OF3A 2EXHA 5FWEA 3O1MA 3ZX7A 1L7RA 2VTXA 5DZFA 2E9QA 1HN1A 3PURA 3I49A 1OH4A 4MVTA 5LA1A 2ZA9A 4IL7A 4X6QB 3RGBA 3W59A 2YPDA 1JODA 2RE9A 1UNBA 2NPIA 3GM8A 3HR9A 5T5OA 4GD4A 5HCFA 5B2GB 1SACA 4YYOA 5JPNB 1GOFA 2A3XA 4GULA 1J1TA 1Y9GA 2ORZA 2VPVA 4Q0PA 1HX6A 3VL9A 1SDWA 5BNOA 5FYHA 4ARXA 3OF1A 3P5BA 2ZGTA 4YVWC 3PJYA 2PHLA 3ZSLA 3ZFEA 3GZUC 1F35A 1G86A 1HN0A 4E9KA 2FDIA 1MS0A 2BGPA 1BK0A 2GN3A 5L7OC 5A6ZA 1K42A 1UOBA 1K5JA 5CYYA 5DPNA 1AR61 2C0ZA 1MVEA 3T1LA 3WF3A 3L2HA 3N4MA 1S2BA 1PIV3 4CDUB 1LU1A 3HBKA 5C6CA 1REFA 4COWA 3I2JA 1J59A 3DN7A 4BDVB 1JHJA 2OA2A 1REDA 1PZ8A 3NNLA 4ISQA 4AVAA 1ZBE2 2Q1FA 3K75B 2JDNA 1HV1A 1ULOA 4R9AA 4MGTA 1MS1A 1BEV3 5IFPA 1AR81 1WWYA 4KWKA 1DZRA 2D6OX 4BK4A 3NJXA 4BZ4A 3BYWA 1SLBA 1BMV1 5LZ6A 1D2QA 4XJ8A 4LBQB 2ZGKA 1Q8OA 2R042 4QX5A 4XHBA 4CCOA 3DCQA 3KV9A 2ZGLA 3VDCA 1AYM1 1I3HA 2XQRA 3B94A 1F2NA 4IEPA 4YZ3A 2NN8A 4OYUA 3RI8A 4ES8A 5JOYA 2HWE1 1GOHA 5H9RA 4JC1A 4KG0A 3AC0A 4C90A 4MXWA 4YM2A 4RYDA 2BV4A 4XQWA 1LOAA 4ARYA 3QLQA 1NLRA 1PO22 2DFBA 4YFWA 5LBBA 2PXJA 3V0BA 2QQUA 3HPNA 3SITA 1HQNA 1GR3A 1X36A 4URTA 4QQLA 5FO7B 5BNOC 4BQXA 1WW4A 2YYOA 2WA4A 3DPRB 3ILFA 2XJQA 4I09A 3TEXA 1QY4A 3JUUA 1CJDA 4FOYA 3WG2A 1NOVA 5FY1A 2WFPA 1XBFA 2QQIA 4LKFA 4YW6A 1L7QA 2VMHA 1LESA 4YRDA 2VVDA 4AGRA 5FYTA 4XCAA 4XJ9A 1IOAA 4BLIA 4I01A 1RXFA 4DY5A 1AR93 2YFZA 3PLQA 4GB31 3T2OA 4AQ2A 4EN9B 4H14A 5HPOA 1ULEA 1QJU2 1VAVA 1A8DA 1V9U3 5KHIA 1US3A 4KNCA 2I74A 4CEYA 4CTEA 4L0PA 5HCBA 3VKLA 5L9RA 2YV8A 5JXHA 4AVBA 3VDDB 1RUE1 4LUMA 5DAWA 3VBFB 3ON7A 4X8NA 2XB6C 2ZX2A 2XJPA 1XE7A 3RPQA 4CU7A 5F7UA 2FZ1A 4GJYA 5FY4A 2JG9B 1ENXA 1NUKA 2JB4A 3SKVA 3IM0A 3TRSB 5JI9A 4DY3A 2YGLA 1RVF2 2PYTA 1BVP1 4HKOA 5FFOC 5K4LA 2ZHNA 3WDTA 3SKJE 2VZVA 2Q8OA 3AKTA 3KVAA 3VHRA 4OI4A 4Z82A 2RS52 1YLLA 2VOVA 4WM8B 4DUWA 2JG8C 5KC5A 3WF2A 4HONA 1NKGA 1YNAA 2YU1A 1UZWA 3U07A 4XIOA 1PMHX 2ARAA 4W50A 1OA4A 1BBT3 3SCHA 1GICA 1VBC2 2PHDA 4L11A 4AOCA 4DO0A 3RYPA 2EIDA 3DXTA 1IS5A 1EY2A 3C3VA 3FC0A 4FCAA 4KGQA 4NWWA 5FQ0B 4UW5A 4CP1A 3CJXA 4XUPA 4LEJA 1QQP2 5ABJA 1HRV1 1WLCA 1DQ6A 2V5DA 3MW2A 2XG3A 3LFIA 4Q4Y2 2O0OA 1E5HA 3KV5A 3OGVA 4CEYC 5HXMA 4QB1A 3UJOA 1W90A 5C3SA 4U2AA 3HWJA 5ACA3 2IWGB 2FBEA 1JH5A 5T54A 3AKQA 5GLWA 1GANA 3KGLA 1REEA 5BUVA 3ZXGA 4F3JA 2P1BA 1AL23 2WNUB 4ZONA 1VMHA 2UU8A 4GWIA 3THDA 4CCLA 3OEAA 1A34A 1UF2C 2AUYA 2EAKA 2VQ0A 1H1IA 4CDXB 4FVVA 4P5HA 5JMCA 2X53S 3GGLA 3KM5A 2D3PA 3ST7A 1Z7S2 4YW1A 2G4IA 1TNRA 4Y20B 1O4ZA 1YIFA 3HAGA 2TNFA 1UMIA 3CJIA 4QT6A 4AFCA 2VOWA 3I59B 1G9BA 2VOTA 2GH8A 4AFAA 1SFPA 2Y0IA 3GALA 3RVHA 2E6VA 2G1MA 3CBNA 3VBOB 2GMEA 3MV11 1O3TA 4WZFA 4RR3B 3GCWA 2BFUL 3AMHA 1KQRA 2B8MA 2DV9A 1CAUA 1C28A 2OVUA 4D94A 4BMEA 5L36A 2XVGA 4PIZA 3THPA 3U1XA 5K7PA 1RL3A 4XJZA 1VMFA 5F8PA 1CZSA 4AI8A 5DUWA 5FY9A 1SLCA 1CIWA 3N7JA 3T2PA 4JKKA 2J1RA 3J9SA 3NNJA 2G9GA 2ORXA 1PIV1 5J1XA 5FZEA 3S30A 1CAVB 1KGYA 3D0JA 2D98A 1VALA 2RS13 3J8F3 3SISA 2WZR2 3V64A 2V72A 3ZSKA 4HANA 2R063 4K40A 4D7SA 1O5LA 2XL9A 3WP5A 4ATEA 1ZYBA 2BGCA 1N1VA 3LSEA 4U36A 2XPJA 1BEV1 2WABA 3QCWA 4KI5M 4QPIB 1CAXB 5DDJ2 4XUOA 2QDRA 5LK7B 3OJBA 1KJRA 2QQJA 3B93A 4AVVA 5A7NA 4YVSA 3I54A 5A3WA 4CUCA 1COV3 1D4M2 2QQNA 3BU0A 2IZWA 3H3ZA 2FDJA 5LY2A 2Z79A 1XNCA 5BNNB 4P9GA 4KU8A 4XTPA 5GZEA 3IWZA 3UYJA 3CJIC 1ASJ3 1QHDA 3N35A 2GC2A 4YW7A 4CP0A 3R05A 4XFHA 4NHXA 1V00A 4EN6B 3Q9OA 3PHMA 3I3DA 2QCSB 4Y4RA 4FFHA 2DCTA 3MW4A 3AJZA 3LDRA 4AWDA 4QKBA 4HVQA 5FLIA 1TMF2 4HMZA 2NLRA 4QPGB 3JBG2 3ZYGA 4ES9A 3O1PA 3AX4A 1W9FA 2PQSA 4HZFA 4PF1A 4FOQA 4YFZA 4E2GA 3CZUA 1PX3A 1Y3TA 2VNVA 5J98B 4BB3A 3KS7A 1ULDA 5KR7A 1LOEA 1GFF2 1HQLA 3AK0A 4ZHNA 1AR91 1WMDA 3B3QE 3OPWA 2BTVC 2B42B 5LA0A 1V9U1 2DVBA 4Y22B 1JTZX 3VBSB 3WV6A 4N43B 2XVLA 3TEZA 4LO4B 1ZRFA 2HEWF 3POBA 2ZKNA 4AEDA 4KBZA 3USUB 1PGL1 3P3PA 4HBNA 3IDBB 1RC6A 4AR2A 3NV1A 2E63A 3A23A 3LWCA 3AMPA 1BJQA 2QNKA 3MLKA 4LOSA 1N3PA 2WUHA 5IVEA 3NO8A 1T6BX 3VHPA 3V65A 2VZSA 1SDDB 2D6NA 5KHGA 1QF3A 3S7EA 2RMU2 5A3UA 4KL1A 5LEKA 2Q0AA 2BBAA 2DWRA 4AF9A 4LHLA 1W8WA 1QGLA 2XBO2 4P9LA 1FX5A 4EN0A 1M4WA 2J42A 4OCTA 4OHWA 4OMCA 4Q4X3 1C5IA 2L9LA 4JHZA 5FCCA 4A42A 3E97A 1JMUB 3MIGA 2GP5A 3G7DA 4LQRA 4QXHA 4D7YA 1I5PA 3NRUA 3UESA 4YZ5A 1BBT1 4N53A 2OS2A 1W99A 5FYBA 4A6OA 1VBC3 1QXJA 3T2TA 1GQPA 5DAVA 3Q8BA 4CDUA 2FQPA 3AYAA 3E5QA 2W94A 3T3YA 4CA9A 3AP9A 3JD72 4NRMA 2ZACA 2FCTA 2CYFA 1VMJA 1QQP3 1OKOA 1XNTA 2PFWA 4AK3A 4RHV2 1APNA 3VV1A 2XJUA 2P3JA 5L7OB 3UGFA 1W0NA 2PAMA 4E8CA 5KWRA 5F3IA 5ACA1 2YC4A 2O14A 4NVPA 4YZ1A 3NW4A 1IGOA 4P00B 3WLUA 1LENA 2YROA 5CU1A 4AEDC 2VZ1A 3R4DB 5SV8A 5C7GA 3WF4A 4BMBA 1DQ2A 4UOJA 1GWLA 3H7JA 4PHZA 3THCA 4XACA 5A3LA 1HDKA 1OPMA 2WDBA 3LDBA 3CNAA 4HLTA 2LUWA 4OI1A 3U11A 4IEOA 1AL21 4XFAA 5A6QA 5KHJA 3GXUA 5HI0A 1XJAA 2HEYF 3AP7A 1C5HA 3ATGA 4UBHA 1LKNA 1IS6A 1ZA7A 3H7YA 5IYYA 3WEZA 2NZ9A 5A7QA 2RDSA 3H8UA 4MGYE 5J36A 3I3QA 4D0QA 1YYNA 4N9IA 4XE9A 3DPRA 1JHNA 1U5YA 4DEVA 2UWCA 4L92A 1LTEA 2ZHKA 3RNSA 1R1A2 3OYWA 4JRAA 1PVC3 4AHXA 4N53C 3FUOA 4PI0A 4H7MA 4E4HA 5IFTA 1FOD2 1DGLA 1RUG3 4ZY9A 2D93A 1S2EA 2WNVA 1NCRA 2DFCA 4AI1A 3BN6A 5GZFA 1LR5A 1GZCA 2D6PA 4X8PA 1OVPA 3WNKA 5ERLA 4Z1VA 3GF6A 2Z42A 4HSJA 1MS5A 5EFUA 3N7MA 3IDCB 3ZFGA 2VD7A 4MGQA 5H9QA 5EJ1B 1O8PA 5CNAA 3J8F1 2RS11 3TOJA 4R9DA 1GUIA 4IDZA 3VDAA 2R061 2ZX4A 2B4KA 4N7UA 1OOPB 1ZRIA 2VMEA 1JYVA 2A1XA 4UFIA 3ME2A 4LLFA 5FREA 1RUF2 2VOXA 1HXS2 5C8CC 1AXZA 5A3MA 2Y38A 3ACHA 4K1YA 3H9AA 1AR72 5LB6A 2PHFA 4P5YA 3WZ1A 4GA9A 4GALA 2Q8DA 2XVKA 3IB3A 3VBHB 5A3TA 4C0HA 1VR3A 3B02A 5FUPA 1COV1 1SCRA 1XQNA 2OUJA 3DGTA 3ZKYA 1WMFA 4M01A 4DPNA 2EIEA 4CVUA 4ZXEA 1HB3A 2BWAA 2VQAA 2HBTA 2LRPA 5E88A 1OT5A 4YPJA 1R64A 1IG3A 1QXPA 1UAIA 5LA9A 1ASJ1 1XB9A 1CD3G 2ZMKA 4WM8A 4XMIA 4E27A 5FDBA 2XQXA 3UV9A 2P2KA 2FD8A 5A32A 4AQ6A 1OLME 1G9CA 3K48A 3TWIA 3ZYBA 2WNEA 4ASMB 3RZGA 2OX0A 1UY2A 5IUQA 4BK5A 1YHFA 3ZN4A 1DIWA 1SBFA 5LCWL 3H1YA 3GZAA 4Y1XA 2VCCA 3EHKA 1AJOA 3H8OA 3W5NA 1IPJA 1DFQA 1W04A 3HQUA 2XLAA 2XL7A 3KD4A 3KZ4C 4XUNA 5AVPA 2WNVC 1NCRC 1JZ4A 5FZHA 5DZGA 1CPMA 2JE7A 2KXLA 1WW5A 2ZGRA 3NAPB 3WQ0A 5JSRA 2D6KA 3ZFGC 2KA3A 4HG6B 4BPZA 4CZSA 5CBLA 1B35A 1NCQB 1UCXA 5JZGB 4Q4W2 4FT8A 3RRDA 1GZ9A 1W05A 3GHMA 3HVDA 5I0DA 1G7YA 3ES1A 3GJAA 5A7SA 1UD1A 1R092 1K45A 1X9PA 2RS33 2V5YA 1JS9A 4TLFA 1K5MC 2WNUA 3UL2A 5JXGA 3AZXA 1ULFA 4LE3A 1H2LA 1LGCA 4XXAA 4E4SA 1VRH2 3ZXJA 4PT6A 1VE0A 2XHKA 2Y0OA 3ASIA 2W46A 1QJY2 2IXJA 2YHJA 5FZGA 4E4DX 2B7YA 1YJKA 2QZ3A 3D82A 4MSVA 4Y20A 1OD5A 4ISRA 2OPKA 3I59A 3LPFA 3MIBA 5FY5A 1GQHA 3BTAA 1FNZA 1OHFA 1UYXA 2DBIA 2W2IA 1CPNA 1O4YA 3D0SA 2OKXA 5C33A 5JAXA 2BZDA 4YM0A 2R0HA 4ZU5A 4RR3A 3M3QA 3VBUA 4Q4X1 1U5IA 1ST8A 2ET7A 1RUH3 1JBCA 4D6SA 2AEZA 5F6KA 1JI6A 1W6QB 1U0AA 5FBZA 1XE0A 5FYVA 5C9AA 2HYXA 2DCJA 3H1MA 3CZJA 1EP0A 2ZZJA 1VBC1 1VBB3 2QE3A 3O7OA 4H3WA 1N1YA 3OCPA 4MO3M 5FP3A 1PMIA 1CAVA 3WD5A 3MEPA 3HMYA 1F4AA 2D6LX 2QQVA 2I2SA 1NZIA 4FPOB 1B35C 3JD73 5DAPA 4OQ9A 5C8WA 1Y9MA 4NHMA 2FDKA 3K4DA 1YC61 1OI6A 2Z5WA 4XDPA 4YGBA 4C8DA 5KXDA 4A7KA 1D4VB 2EXIA 2Y6GA 4O9EA 3HN1A 4LO7A 2HH9A 3K51A 4JX0A 4Q4V3 1AX1A 4UF0A 5FR3A 2NMOA 3OY8B 4QB2A 4FBFA 1CWPA 1JXNA 2HEVF 1LB2A 1C8NA 1KJLA 1V0AA 4Y26A 4SBVA 1GV9A 3CQOA 4YG3A 3POFA 3MO4A 4OUSA 4MXVA 1H2MA 5FZDA 2GNMA 5T5LA 1PM4A 2BQPA 2BW8A 1IKQA 2VC9A 4LBMA 1I5ZA 2RJKA 1S1AA 3VLBB 4D6RA 2DTWA 1R082 5GZDA 4QX8A 1RGSA 1WA4A 2QVSB 2XUEA 2IFWA 2BUKA 2CWSA 2CHHA 3SEPA 3VBUC 1VB2A 2Q1ZB 4Q29A 2R7EB 4RGGA 1VBA3 1C4RA 3LA7A 3TAYA 3A0NA 1NQJA 2QQWA 1PVC1 4LHKA 3HQRA 5C9AC 4QMAA 3IN9A 1S0GA 3THTA 1H9WA 3R6SA 2XJSA 2ID4A 3AVSA 1RUG1 3N9OA 1C3HA 4UFKA 2Y33A 4IV1B 5FXVA 4BXSV 3CF6E 2P37A 2WLPA 1PO12 3C7GA 5LBEA 3O1VA 4JCKA 2VJXA 3WY6A 2W39A 4QD2A 4A45A 1SBDA 4XCBA 5FMOS 3U75A 4DB5A 4DRRA 4IEZA 1M06G 5EPAA 4Y22A 3T0AA 4MX3A 3MFCA 3OTFA 1J3QA 2SLIA 3WNPA 4FOWA 1DGRA 1N1SA 3KV6A 4BA6A 1QU0A 1UY0A 4BQ2A 3R4UA 1MVQA 4LIVA 2ZMNA 3ROUA 1QDCA 2DVDA 4GJZA 2A6VA 3O14A 1AVBA 4AW7A 2E26A 5IVYA 1HXS3 4IGPA 2QUOA 1AR73 4XQ4A 3WG4A 2ZOEB 4DFSA 4E8DA 4CXYA 1W6OB 4WZCA 4J1XA 1YFYA 4NPRA 3WW1A 4AQSA 3TN92 3IDAA 5DMYA 3A7QA 1Q56A 4FXGB 4NPMA 5A80A 3RWKX 3FLTA 5DG1A 4AEMA 5GZGA 4JRLA 3O1RA 2W68A 3O0WA 3FZ3A 4IERA 1H8TB 2B5HA 5DUVA 2WR9A 2CAVA 2GC1A 3SXWA 5FLHA 1BQPA 4XF4A 3AMNA 4IV3B 2UYAA 1WD3A 2X09A 3ZDVA 4CCEA 4C91A 4JDOA 4QX7A 5C71A 2RJLA 5IAXA 3S5AA 4XJWA 4BQ1A 1TNFA 4UFMA 1GP6A 3AP5A 3IZOA 3PVOA 2Q1MA 2K46A 3DEMA 3ZYJB 4CPBA 5B4NA 2PMWB 2ZEZA 4DXRA 5FK7A 2WYSA 3MGUA 1EV12 5JIAA 4B29A 2JDKA 3CHXA 1ZZ7A 5JCTA 2DU0A 1MS4A 2RR12 4M3CA 4DQAA 4ATFA 2OZJA 4HOOA 1XRUA 3L2YA 2JECA 1HV0A 5FIXA 5K0UB 2ADEA 1ENRA 1V6MA 1UPIA 2RS31 4LBJA 1LCLA 5BNPA 5IVCA 3J7MA 1UOGA 2CDPA 1OPOA 4MOAA 1STMA 2GC3A 4O65A 1JZ8A 2WWUA 5M0TA 4OUMA 1ULPA 5KXCA 5A7WA 5C4WB 3NVCA 3ZYHA 3WNNA 3BIEA 1GP4A 3J4UH 5GZCA 4RN5A 5JVVA 2E7QA 3ELNA 1GP5A 1QJY3 1DGRN 2B9UA 1OA2A 4FQZA 4XZPA 1VP6A 4I02A 5FZ9A 1ZRDA 3BTXA 5C5TA 3K77A 1LOCA 3E6DA 1BZWA 4IE6A 5IK4A 2VNGA 4LKEA 4WM7B 3N9PA 4RS5C 2SBAA 3ACFA 3E5XA 3ZVXA 3ZR6A 4JGZB 4TN7A 2E51A 1Q43A 4DNYA 1DP0A 1JZ7A 3ZFFA 3WT3A 1RUH1 1HRI2 2MNGA 1DLLA 2ZEYA 4HVRA 2D5FA 4NIAA 3OOXA 4LPLA 2W5FA 4OHYA 1W39A 2NP0A 1ULGA 4A4AA 5BXXA 2D7FA 5SV5A 1VBB1 2CDOA 2XDVA 1BLZA 2WFF3 3GZTB 4XFGA 5FLJA 4AE2A 2HWF3 1ND2B 1PX4A 2CV6A 1UPSA 2VUCA 1RUNA 2PN5A 5EYXA 1FMD3 3ITQA 3K46A 5F39A 5IK5A 1GNZA 4HPKA 1OKQA 3JD71 5FV3A 4CCCA 3FFQA 4V1PA 2DUOA 1OOPA 2HWD3 3VB9A 3POWA 1OMIA 5FZBA 4CEWA 3MHZA 1RMU3 2VW2A 1O4TA 5FXWA 4YM3A 1W6PB 3EB7A 3QACA 2A71A 1TME2 4TZDA 2D3SA 5IWFA 5BNPC 4Q4V1 4YWAA 2UWAA 5FRAA 3Q8FA 3AP4A 2VGDA 2P34A 3ETQA 2DURA 4YW5A 4BIOA 3WNOA 1LOBA 4COYA 4CP9B 4LT5A 1XYPA 5FOBB 3M70A 4PDWA 3ZXAC 2C9AA 2GSYA 3MF6A 1ZBA3 4NRPA 3ZFEC 4AFBA 1WBFA 3MDPA 3AL6A 3BODA 4QGMA 3J26N 4IE4A 4BYYA 1MEC3 3AL5A 5AC92 3BPSA 2FDFA 1W2OA 4M00A 5HXVA 1D2SA 1WMXA 2QBXA 5F5QA 2VCMA 4XFIA 3NKTA 2AYHA 4XETA 5LASA 1VBA1 4CCNA 1VRBA 1N3OA 2FHRA 5I8YA 5F32A 4WVZA 2XJTA 2R1BA 4RQPA 3WINE 3BI3A 4NHYA 5IVBA 3EBRA 1CESA 3JQXA 3T08A 3RJRA 4CDWA 3S0MA 2CAUA 2DTYA 3CKHA 1FPN3 1W6MA 4GMP3 4LTAA 2Y6LA 2XJRA 5KXBA 4QM9A 4CEWC 4CSWA 5FOJB 1DG6A 1ZRCA 1RUC3 5JOZA 3A22A 4EE2A 1QNWA 1F8VA 3WP3A 1ND3A 2VQUA 4TTGA 1UZYA 1QOSA 2YC2A 5FZCA 1HXS1 2YU2A 3VZOA 4EN8B 1WUVA 4PDWC 2W52A 3BIWE 3M1HA 1AR71 1G8WA 2CNAA 2VUDA 2WWJA 2BYVE 2Z69A 2DVFA 3HNMA 2P3IA 1W6NB 1QMJA 1UMHA 4JDNA 3SC7X 4K8RB 1NT0A 4XOGA 4GH4B 3ZYIB 1X7NA 4LBKA 4BU2A 1JUHA 1IPSA 1K5MB 4P9IA 3VZMA 5A3OA 5A70A 3P1IA 2WQZC 3VHOA 1OQ1A 3T09A 1KRIA 3WVJA 1AX2A 4LA2A 4AI0A 5DN2A 5EXOA 2W1SA 4XF1A 3WSOA 3H3LA 2UYBA 4QPWA 2XH6A 1D7PM 2BU9A 3U0ZA 2VECA 4LMFA 4Q2FA 2ARBA 5LBCA 4NHLA 4COVA 3FN9A 4J1WA 4RQPC 1MZ5A 3WNMA 4GKXA 5FZFA 5D8AA 3NNGA 3WW2A 4HL0A 4LKSA 3C7FA 3ETPA 1PK6B 2NQYA 2A6YA 3D6EA 3B69A 1RUD3 3AYDA 4JGYB 2R32A 1KS4A 3POEA 1BCXA 2XR4A 3POGA 2WT0A 2UY9A 2LM3A 4MH0E 2QFEA 3DECA 2VZTA 1VBE3 2ZX3A 4RSUA 4I2OA 3FUQA 4YZ4A 5I91A 5J3UA 1RITA 1C8M2 1RUI2 4UAPA 1ND3C 5FZ6A 4MGKE 5D2AA 4O61A 3B7MA 3KCXA 4AHYA 3IAPA 1OURA 2WN2A 5B4XA 3FX3A 2XWJB 1NE6A 2BNNA 3QBQA 5GLTA 1UW8A 4HXCA 1GKBA 1UZVA 3CMGA 3MLJA 1ZX5A 2VNRA 4Y4YA 5FAXA 1VJ2A 3WCSA 1MZFA 5FPBA 2QQPA 1GZWB 1YXWA 4HT1T 5FYUA 1W9SA 4PJYA 3WW3A 1US2A 1W2TA 1QJY1 2DDUA 4YW3A 5JR7B 1JW6A 1JZ5A 1C57A 1PZ9A 3PUSA 4A7YA 5A1FA 4CDQB 3H1WA 3POJA 3IAQA 4K9SA 4SLIA 1GU3A 1UX7A 4OLLA 4PLNA 3RSJA 5ABJC 5EQUA 2XGXA 2XWBB 2E31A 3FHQA 1NA1A 1LHVA 5FKBA 1BK1A 1GSLA 1F31A 3D3AA 4N8MA 1LHUA 3LQCA 2A5ZA 4IEXA 2P3YA 1OC1A 2K2SA 3FJSA 3WXPA 4IV1A 5D8AC 2B9VA 2IXKA 1YQ2A 3R4SA 5GLZA 3GHNA 3PMEA 4LIUA 3OUIA 5L19A 1ZBE3 1AX0A 2VBBA 2WFF1 4QQHA 2DBNA 2HWF1 3CLPA 3IBMA 3WDXA 1Y9QA 4M4RA 1GNYA 1FMD1 5KXEA 1H2KA 5FPZA 5EJ3A 3AKPA 1W06A 2RM22 2X5IB 2HWD1 2R043 3NSTA 5FZOB 4CXWA 5AFEA 4DMIA 1UMZA 4P02B 1RMU1 3I2HA 3ACIA 1O7FA 4IESA 4WVWA 2Q5TA 4MADA 1WKYA 2AENA 2IVIB 4NJ4A 2B45X 2D43A 2ILMA 1SLIA 1TME3 2VVFA 3O1OA 1PM7A 1O3RA 3RFRA 1IS4A 2C6SA 1X82A 2VCAA 3CL1A 1LAJA 3LOBA 1IS3A 4XFFA 3WDUA 1LGNA 2W91A 3OUJA 1PO23 3WNXA 4UBGA 1DQ0A 4OZXA 3DYOA 4BHPA 3IIAA 4LK6A 2TBVA 1NZCA 2HBUA 4FPGA 1ZBA1 4R52A 3VBRB 2ZAAA 1GYKA 1YFXA 2BWCA 2YUEA 4OVEA 1V6KA 5FUIA 2J7MA 5C8CA 1QJX2 2JD4A 4HVOA 4QKDA 5LA2A 2JDZA 1HW5A 1MQTA 1RINA 4UFLA 2DF7A 1LU2A 3AZZA 1S4CA 2CTVA 1MEC1 3QD6A 1J3PA 4I3GA 3PU3A 3NJVA 3RYKA 1ZNPA 2JXAA 2DCZA 4K21A 4BIFA 3I2GA 1NA1C 3NL1A 1ODMA 1OSGA 2DVGA 4IV3A 4KGGA 5FPUA 5KBFA 2RV9A 1WGPA 3KF3A 4XBQA 3WDYA 1YQCA 1OUSA 1W2NA 4O7XA 4LE4A 2ZGOA 1QJEA 1W8FA 1GBGA 1W0PA 4DEQA 4LA3A 5J48A 4Q1PA 1QJU3 2JEMA 4KWLA 2Y60A 2MHFA 5HV0A 4MHRA 3TEWA 5CB7A 4PIYA 1LOFA 1OLRA 2XXZA 3JCIA 5CISA 1E5RA 1ONAA 2PAEA 3MICA 3OBRA 4YVSC 4CCDA 1FPN1 1A6CA 3OB8A 4LHSA 4NWVA 1DQ5A 2OT7A 4GMP1 4FTEA 5CFCB 3LAGA 1JYNA 4RL7A 5CFDB 2GNTA 1HB1A 1ZZ9A 2XKOA 4S2GA 2WT2A 5K0UA 1S0FA 1RUC1 1SMVA 2VZRA 5IT6A 3RS6A 4IXLA 4JHTA 2AACA 4DS0A 4IGOA 4XABA 2BERA 2IFRA 1RVF3 5A6YA 3O1UA 3B5LB 2XKPA 4M4PA 2GNDA 1DDLA 1SFNA 4FAGA 3IPVB 3DV8A 2HYKA 3LPGA 3MUZ1 4C1XA 4KH9A 4QXBA 3LEMA 3LKJA 2WWSA 2RS53 3HOBA 1HJFA 2X8KA 3BCWA 3M2MA 4UW6A 4XAEA 1MQTC 3E6BA 4DOUA 3F2ZA 2P3KA 2E7TA 3EYPA 5FXXA 5BY5A 2VG9A 4E2SA 2EVXA 4RGKA 4WM7A 5JMOA 1YQ5A 1U5ZA 4GWJA 4R8HA 5JI7A 3A0KA 2YPJA 3LB9A 1PGSA 4JGZA 1AR62 3I3EA 2VW1A 1W2UA 3OGGA 4PLMA 4Y3OA 1S0JA 2OW4A 4FPYA 2JJ6A 3K3NA 4QU2A 1H4HA 4YVWB 2VMCA 4WVMB 3LF7A 5F3EA 3WNLA 2VY0A 2YXSA 4B7KA 4QX2A 2WO3A 4Q4Y3 4AAXA 1C1FA 1O5UA 3HT2A 1OBNA 4RFT0 4PF5A 1LOFC 3H3UA 3RZKA 2XHNA 2PA7A 1AL0G 1W8ZA 2W1QA 3LA2A 4GZ9A 4LBQA 4N7IA 1JZ3A 1XE8A 1RUD1 3WP4A 3P6BA 1WW6A 2RDQA 3PTYA 3WW4A 3W21A 1BKZA 1W8OA 3M3IA 1BMV2 1EAH2 1WCDJ 3GBGA 1RIRA 1VBE1 1O3SA 1NY71 4QPYA 4M3CF 4S2DA 1AYM2 2VUAA 2A3YA 2EIGA 4LORA 5FMBA 4K20A 4M0NA 2PHWA 4NRQA 2VE1A 1JZ2A 3KT7A 4PIXA 4K6BA 1Z7S3 1OVSA 3ZMNA 2LW8A 1OLMA 3KF5A 3FLRA 1HB4A 4AVSA 2A73B 3EJKA 4I3PA 3U14A 2WC2A 1J58A 1MS8A 4GWMA 1QNYA 4MLOA 1D0HA 1H9PA 4L8QA 4B3NA 4C0BA 1K12A 4I0AA 2PAKA 1HIXA 4AQTA 4CDUC 3WUDA 5TSWA 5FZIA 1OLQA 3RDIA 1RUOA 1A8MA 2WAOA 5BNOB 2CGPA 5I0UA 4Y1YA 3I3MA 4FI9A 4P14A 5ISLA 1UU6A 5FMCA 4OULA 5A6XA 1O6UA 2PLV2 4GB32 3MIEA 1PGW2 2WZ8A 4UXAA 2OZ6A 3LFMA 3VDDA 2WZR3 1UKRA 3VBFA 4AI2A 3K3OA 3NWKA 3O0XA 2I07B 3PIJA 4ZXKA 4D69A 1ZBE1 2H6BA 4N9HA 4NIHA 2VL4A 3LEKA 3AXDA 1RUE2 1NLQA 2VW0A 4Y5Z0 1CR7A 3DL3A 2JG9A 3ZYRA 3ZXKA 2CGOA 1YIPA 5DDJ3 1WLDA 3SLIA 4FPKA 5EP9A 4UYBA 1IG0A 3FFZA 2WO1A 3OSDA 2JENA 2R041 4IQPA 2YDEA 3SNMA 3VZLA 1D4M3 1WCSA 4EZHA 2HLEA 2HJIA 4META 2ZZQA 2P4EA 1W8HA 3EMRA 5CG9A 1TME1 4ASLA 3DPRC 3PIGA 4AEJA 3W5MA 1PO21 4QHZA 4NIIA 2BNMA 3I8TA 1HQWA 4MXWB 1N1TA 4MYEA 3AMQA 1JOJA 1TMF3 5D1IA 3V0BB 3APBA 3JBG3 4DUVA 3PL0A 5FQ0A 4BQYA 4YM1A 1FYUA 4BISA 4XAAA 5FMDA 5C3OA 4LJHA 2R072 2JG8B 1IQAA 5FZKA 1SEFA 1ZRRA 1OH3A 1JYXA 4Z2AA 1PVXA 1JUIA 1OF4A 4FQ4A 4ORFA 1HRV2 3I2OA 1NYWA 3N36A 4CE8A 3VDDC 3N9QA 3ZN6B 4XJUA 1QJU1 3BB6A 4Q1RA 1TG7A 3LD8A 3WG3A 1NG0A 1SLLA 5HCAA 2JG9C 2F4PA 2UWBA 3JZVA 1AYN2 1RUJ2 2OPWA 3RWNA 4CEYB 1KDMA 4OI2A 2BOJA 4JV4A 1CX4A 2BBVA 4CDXA 5C5UA 4H55A 2FDHA 2Y26A 2R6QA 3DUIA 4OZOA 1NXMA 2ATFA 2CL2A 4JDMA 4RGAA 4WM8C 4DXZA 1RVF1 2AREA 4OQ8A 1PZ7A 2RMU3 3AZYA 3KMHA 3MYXA 5FYCA 1W8NA 1X33A 1BXHA 3M4FA 2JIGA 4QDSA 5APAA 3VBOA 2XBO3 1CIYA 2HWC2 4Y1ZA 4YG0A 3MBWA 4V2WA 3ENRA 2RS51 4YGCA 4L97A 4NOTA 5C3PA 4MG2A 3MV01 4QGNA 3W58A 4W4ZA 1PMJX 1CAWB 2W1UA 5FJKA 3QH7A 1EPZA 1SG3A 3RMXA 1NX9A 1Y43B 2GMMA 1UIKA 4S2FA 3ZSEA 1CX1A 2IC1A 2Y6HA 4GIQA 2BRTA 5FP9A 4FO9A 1QQP1 4N90A 3PVNA 4WBBA 4IE5A 2W0XA 2RHPA 4CCJA 4IEYA 5DUXA 1C1LA 4RHV3 2BPA2 4Q4Y1 2ZEWA 3KVBA 1LECA 3ILRA 2AC1A 2J1SA 3AYEA 3PU8A 2OIIA 4WV8A 5ABJB 1CGPA 5T52A 4QPIA 1CAXA 2C1FA 4R9BA 4D7TA 2WNUC 5JIUA 1UU4A 3DF0A 4UW4A 4BJ0A 5JXJA 1DU3D 1BEV2 3U78A 2FCVA 4S2HA 4CDXC 2LS6A 4Y5SA 5FZOA 4AEKA 4BQ4A 2GAUA 1D0GA 2FMYA 5FJHA 4PLOA 3WQ7A 5K9YA 1EAH3 1WLTA 2ZBJA 5BNNA 4Z92B 1FATA 2KD7A 3HNBM 2WT1A 3M3OA 3ZO0B 4P9XA 5D21A 2A70A 1Q5OA 4YLZA 3BALA 1UU5A 4YGEA 3VBOC 4YGDA 3VBRA 1Z7S1 3H42B 2W3JA 3ALQA 4RR3C 4CUBA 3RYRA 3VD3A 4QPGA 1SHWB 1AXKA 1E57A 3FBYA 1AF9A 4H7LA 1W2AX 3MLLA 4XPVA 1XNAA 4UFJA 3WQBA 4BXFA 5LEJA 1R1A3 3CJIB 1KXGA 2GH2A 1UL9A 1LEMA 4IEUA 3SQOA 3F95A 1YFUA 2BVBA 1FOD3 2XJVA 3ES4A 3G6JB 2IVJA 3KQ4B 5JLVA 2JDMA 1SFYA 1UX6A 3MF9A 3N9MA 1OUXA 4G3YC 2X29A 5I0SA 3LCPA
chains in the Genus database with same CATH topology
1MZEA 2PHRA 1CAUB 3NV3A 3N3HA 3MW3A 2GN7A 2ZX0A 2EF6A 3HD8B 3VBSA 1YWKA 2D97A 1LEDA 3AMMA 4LO6B 4N43A 4FSJA 1AR92 4K8FA 1ZZBA 2EXKA 5JOXA 2PLV3 5JSOA 4QPIC 2WZR1 4PBPA 1RB8G 3USUA 2JICA 2IXIA 1NE4A 2D40A 3RJ2X 1RUF3 2VUJA 1PGL2 1POV3 5CFDA 2AZ5A 4Y1UA 5DDJ1 5DUUA 3D5OA 1BYHA 4RA0A 5BNNC 5BYNA 4P9YA 3PVEA 4P9WA 1D4M1 4XILA 4BLJA 4YVSB 3PMSA 3DKWA 4QPGC 3KGZA 4BM8A 5FO8B 3CEWA 3L9JT 4GQ7A 5J96B 4TSVA 1TMF1 3JBG1 3FMGA 1VAMA 5T55A 1BBT2 5HBAA 3TBDA 5E16A 3C2UA 4L2NA 1ZREA 1LGBA 4WVMA 2R073 3VBSC 5L7OA 1CGPA 1XYNA 3VKFC 4N43C 3JB4C 3MIDA 1G6NA 4FP2A 1S2KA 2EALA 4Q4W3 2WINB 1DHKB 4ZU4A 1CONA 2ZHMA 3N7KA 1F9KA 4Z2WA 1R093 2VU9A 4ITCA 2KM2A 4DINB 1AYN3 1RUJ3 4AYUA 1OQEA 1YJLA 1AL22 3AZVA 1VRH3 3UJQA 3WHUA 4AEDB 1AZDA 3VZJA 1MR5A 3CO2A 2RMU1 5CA6A 1YFWA 1ENQA 5GJ6A 2VMGA 2XBO1 1A3KA 3BOPA 4A3XA 4ONUA 2XLGA 3WQ1A 2EAAA 2GDFA 2HWC3 3B9CA 3WCRA 1YUDA 3AM2A 4XJAA 4B4QA 3WG1A 3D4KA 3MIFA 1KDKA 2UY8A 3AP6A 3M3EA 1WD4A 2BVVA 1XNDA 1DYKA 3OD0A 2R0FA 2CGNA 4XW3A 1CJPA 4N53B 1IHMA 2ZGPA 1MS3A 3JB8A 1VB4A 4FP3A 4GMP0 3AFKA 2D5HA 4QQPA 4RHV1 2O8QA 1KFXL 2RS12 3J8F2 3AFGA 1UKGA 2DUQA 3WOGA 4XMAA 2R062 4E4ZA 1O3QA 2W08A 3VBHA 4MV2A 3H0OA 1VBD2 5BV6A 4XBLA 3ZSMA 1DQ1A 2D6MA 2R1DA 5BNQA 1EAH1 1DQ4A 1COV2 4XYXA 5C8CB 2V09A 2DU1A 4HKWA 2QJVA 4M3CE 1Q8VA 4OFGA 2A6ZA 4AXOA 2WS92 2NYYA 3LA3A 1R083 2A7AA 1ASJ2 3SH4A 2HKXA 5F1RA 1DZQA 5T5PA 2YC0A 1Q3EA 3ZFFC 2MEV2 5CAZA 3ZPYA 4COUA 1PNGA 1F5FA 1R1A1 4HFSA 3WDVA 2JG8A 4Q0QA 4KU7A 1FOD1 1OFNA 3NAPA 4AVCA 2ZGMA 3OYWB 2MPFA 4FTBA 1RHI2 4F83A 1PO13 1FT9A 1NCQA 2QZ2A 5JZGA 1OOPC 3ZN6A 2UURA 4W6YA 2PHXA 2WNVB 1NCRB 4FAHA 2PLV1 4K3UA 1PGW1 3AYCA 3ZXLA 3MPPG 4W6WA 3VBHC 2VOKA 3ZFGB 3ZSJA 4E2QA 4XBNA 1H30A 3NV4A 3R0RA 1RUF1 4EWEA 3IMNA 4J6GA 4UW3A 1POV1 2QKDA 5K8SA 1WMEA 3JQWA 1OQDA 3GBFA 3SCFA 1S0DA 3IDEA 3S7IA 2EXJA 3POSA 3SH5A 4B4RA 3TN93 4XF3A 1T6GC 4INDA 4NO4A 4QQ2A 2BEOA 2NMNA 1ZVFA 2DCYA 3HQXA 1QKQA 1XXNA 3M3CA 1W6QA 1S0EA 3AKSA 3URFA 1CAWA 4Q4X2 5GLVA 4MUVA 4MGZE 2ZKLA 5FPXA 2PTMA 1G9AA 3NAPC 5A32B 1IZ3A 2A75A 1V6IA 4MZUA 2WLQA 5LRRA 4CDWC 4HK9A 3SCGA 2PQQA 2FMDA 2EA7A 4I0BA 4EJRA 1NCQC 2R071 4CRQA 4YW2A 5JZGC 4FPEA 4HETA 2R30A 5CVRA 2ARXA 1UN1A 1YI7A 1EV13 3V56A 3V0AB 1LOGA 1CQ9A 5I93A 2RR13 3OY8A 2PHTA 1ZM1A 4Q4W1 4ZU7A 2WIIB 2ZX1A 4XHXA 1B35B 5A33B 1V6OA 5GM0A 1R091 3AJYA 5I0TA 5JSPA 4LUKA 3T1MA 3S6PA 1AYN1 3PNAA 1RUJ1 4MGIE 4TWTA 3UKTA 5T3NA 5I0RA 1VRH1 2ZPXA 3VUOA 3HIFA 5KHKA 1LHNA 3UK9A 1HLCA 1FAYA 4YSFA 2YMZA 4JTOA 3KQRA 4FPLA 4W65A 3O5SA 2HWC1 1KS5A 4Q26A 5FTTC 2IXHA 3HBZA 5T5JA 2ET1A 2F6BA 1HRI3 1PVC2 1NQDA 2WSVA 3B00A 3VBUB 2DUPA 1RUG2 5BPXA 3TYJA 2H6CA 4ZKTB 2BNOA 2AH2A 4LNVA 5C9AB 1TEIA 1VIWB 4C1WA 2C5DA 2H0VA 4Z8BA 4F7ZA 2O1QA 3P3NA 2PHUA 5DG2A 2XLFA 2AGSA 4BOWA 4PQ9A 3LGRA 4XXPA 1FV3A 4K1ZA 4YNIA 3ZMOA 1W6OA 1IKPA 3KLSA 1VBD3 2GU9A 1LULA 1S55A 1URXA 1JN2P 4EV0A 1H8TA 2ZABA 4Q0UA 4D3WA 1WW7A 4LULA 1ULCA 1S0IA 2E53A 5J7MA 1IPKA 2ZS6B 3U10A 1FNYA 4Q0SA 1R081 5AC93 2WS93 1UZZA 3OD4A 3O0VA 1G9DA 1JYCA 1MS9A 1SLAA 2HWB2 4LBOA 4OI0A 3FHIB 4AVTA 1DZTA 3ILNA 4R4ZA 3ZN5A 2WKKA 4IV1C 2MEV3 2Q30A 2ZJCA 3MFAA 4LBNA 1Q8PA 3VL8A 3PVBB 1H4GA 3E6CC 3E5UA 3LZZA 5EYYA 1AXYA 3AXEA 2E7AA 2N7GA 1Y7BA 1DGWA 1PO11 2VVEA 1RHI3 3CU7A 3MPBA 1B09A 4XDQA 2A6XA 4COZA 4FXKB 5AVAA 1QXRA 5JDBA 2D44A 4FPCA 2DYCA 3OPZA 2H0BA 1OFSA 3BOWA 4BWOA 4EN7B 4HSLA 2A3WA 5C4WA 2RS32 1DYPA 4KBBA 3GNEA 1H2NA 3RG0A 1CN1A 2IXCA 4IEVA 5J37A 5J09A 3AKRA 2DCKA 1H8TC 2CY6A 3WR0A 1WCKA 5EV7A 4XFBA 4Q8LA 3O12A 3TN91 3IT8A 3UKVA 3AB0A 4O9GA 4PCRA 2B39A 4IV3C 3U4XA 4OHZA 4B8EA 2OYZA 1X8EA 3VN4A 3GYDA 2K9ZA 4Y24A 3X29B 5H9SA 3FE5A 4NHKA 1RUH2 5FMOL 2YY1A 4K7JA 1ND2A 3ECQA 4RS5B 2DVAA 2VNOA 1VBB2 4JVAA 4IETA 4XIKA 1AUYA 1SQ4A 1BVVA 1AR82 1VLNA 4CP2A 1DF0A 5GLUA 1W6PA 2D3RA 1TQ5A 4LLOA 5K0UC 1EV11 1XNKA 4Y1ZA 1R1ZA 2RR11 3QOPA 2JX9A 4IEWA 5JWPA 1C8M3 4YZ2A 1RUI3 2HWE2 4LO5B 2OUHA 5C4WC 1V70A 4Q4V2 3LSDA 1WLWA 2FZ2A 4M3CB 4EROA 3VGIA 2P17A 3I7DA 4WVVA 2Q4SA 2V73A 5BNPB 5EZWA 3WDWA 3TNPB 4WM7C 2ETEA 4DZGA 4GXLA 4JGZC 3KT1A 4QXKA 2GALA 4OHVA 4KWJA 2LALA 1GQGA 4XEZA 3ZFEB 4YARA 3FWEA 4G4FA 3SH3A 1VBA2 1ND2C 1HRI1 3NKGA 3EXUA 4B7EA 1I9RA 3M7AA 2A6WA 4A7ZA 3W9AA 1O3SA 3OGJA 3ZFFB 1H0BA 3LOIA 5E89A 5L73A 3WP6A 4QM8A 1ZZ8A 1NLSA 2I45A 5GKAC 3I4IA 2WQ4A 4AGGA 2VH9A 5CADA 1G9FA 1S0CA 2RM23 3VZKA 2NM1A 1W0OA 4AG4A 4EWDA 1FXZA 5F6LB 4HPKB 1LRHA 4X6RB 1ENSA 4CYDA 1ALYA 5I8TA 4BE3A 4LHNA 4CEWB 3HT1A 5E1RA 1W6NA 3NJZA 3ZIWA 1VBD1 4GH4A 4FOVA 1ZA4A 1K5MA 4KQ7A 2ZTNA 5IK8A 2G9FA 4HN0A 2WA3A 5CG8A 4XFCA 1QJX3 1Z0HA 1LODA 2R16A 4PDWB 3PJQA 4M0HA 1EYBA 1FV2A 3VKNA 4NR1A 3GBWA 5AC91 2WS91 2TEPA 2ZGQA 3SHRA 1RTVA 2YGMA 1YRZA 3JU9A 1L3JA 1N3QA 3TNQA 2HWB3 2BFUS 1LHWA 1KFUL 2MEV1 4IEQA 1Q8SA 3VBFC 1FI2A 4XF9A 4R4XA 1PK6A 3NV2A 4XTMA 4JGYA 4L99A 3RI9A 1DGWX 5IK7A 1SCSA 3KCYA 5FO9B 4DRVA 4HK8A 4NN0A 4RQPB 1GNHA 1RHI1 4Q8KA 4AHZA 3ZXFA 3V0AA 5T50A 5H9PA 4FPJA 1PNFA 2ZGNA 4LO8A 4CDWB 2O8OA 3M8LA 4AFDA 5A33A 1W6MB 1WBLA 2GZWA 1XYOA 4W6XA 1HKDA 1LHOA 1GZWA 1XU2A 4FPFA 4GH4C 1QH6A 4JQRA 1ND3B 3UKNA 4TYSA 1EPWA 4I0WB 3KCCA 4XQDA 1UIJA 4YG6A 2QDNA 3D8CA 4AHWA 3TB0A 3BU7A 4CDQA 4Y1VA 5KHHA 3WX5A 2WL1A 3INAA 1MACA 3RZZA 2ES3A 1TE1B 2ZGSA 1RJ8A 2VULA 1A78A 1V6LA 2TUNA 3KB5A 4F8AA 1AR63 3B9IA 3KSCA 1PIV2 1Z78A 3RMYA 1PK6C 4JGYC 4AFMA 2WSUA 3BPZA 3VKMA 1J1LA 2Z2SB 2WFF2 2LTNA 2HWF2 1OA3A 2X5IA 1POV0 3FBMA 1FMD2 5D8AB 1AR83 1F5JA 1RJ7A 3MIHA 4I30A 1H1AA 2HWD2 1AYM3 1RMU2 1C8M1 1RUI1 4LR4A 1H8VA 1DBNA 2AR6A 1LJ7A 5DXDA 2HWE3 5GALA 3POYA 4Q0VA 4Q27A 1ZZCA 3RQ0A 4L9BA 2XUMA 4BH9A 5JOWA 1NXD1 3VKOA 4CDQC 4JAAA 1VAKA 3WUCA 4GWNA 1KITA 1ZBA2 1XU1A 2VMIA 3MZHA 1KD7A 4HKLA 1Q8QA 3MI8A 2CWMA 1YO8A 1X50A 1MEC2 5I8SA 1QDOA 4BCUA 3ZDSA 5LK5A 3AZWA 4AI3A 1I1EA 4HN1A 4P9JA 3EQEA 1YI9A 3EO6A 1QH7A 3VZNA 4B4PA 4A2UA 1V6NA 3ZIXA 1U12A 3KT4A 4GB33 1QJZA 1V9U2 2ZHLA 2B46X 3FLPA 3N7LA 5F9TA 5LRSA 1I6XA 1NA1B 1J3RA 3SMHA 5KC6A 2WJSA 2GNBA 3OBTA 5EWSA 2IXLA 4RD7A 4GKYA 2X5IC 5CFCA 1RUE3 4OHXA 4KG8A 4PBOA 2JKBA 1FPN2 4FPHA 3ZYPA 1CVNA 2RM21 1YCIA 3ZXEA 1RUC2 3I2DA 4XF0A 3IPVA 1U5XA 3VBRC 2GMPA 2GC0A 1MZ6A 1S0BA 4R9CA 1SLTA 3QH6A 4Z07A 1SBEA 4QQOA 3ACLA 5DZEA 1QJX1 1V6JA 4LBQD 2ZAHA 3B01A 1AJKA 4JTNA 1PHMA 1H1MA 2ZCWA 4YVWA 4YW4A 2WZPP 2YZ4A 3USSA 2R49A 1MQTB 2ENRA 2VXRA 3VHNA 2HWB1 5CIRA 1HRV3 4RS5A 4QGLA 1N47A 1XNBA 4G9SB 5ACA2 2ERFA 2ZMLA 4AGVA 1JYIA 5CFCC 2PELA 5CFDC 4QHBA 1QOOA 1QWRA 1RUD2 1X8MA 2JE9A 3RPQA 2K0GA 4LBLA 1QOTA 4FTSA 3H50A 5E8AA 1ZZ6A 3A4UA 1GLHA 1AHSA 4EWAA 5AFBA 1VBE2 2ZGUA 1O91A 3IKWA 1NY72 5JPMB 3WHTA 2EXHA 3ZX7A 5DZFA 2E9QA 4MVTA 2ZA9A 4IL7A 4X6QB 3W59A 2RE9A 2NPIA 3HR9A 5T5OA 5HCFA 5B2GB 1SACA 4YYOA 5JPNB 4Q0PA 2A3XA 4GULA 1J1TA 2VPVA 1HX6A 3VL9A 1SDWA 5BNOA 3OF1A 2ZGTA 4YVWC 3PJYA 2PHLA 3ZSLA 3ZFEA 3GZUC 4E9KA 1G86A 1MS0A 2GN3A 5L7OC 1AR61 2C0ZA 1MVEA 3T1LA 3L2HA 3N4MA 1S2BA 1PIV3 4CDUB 1LU1A 5C6CA 1REFA 4COWA 1J59A 3DN7A 2OA2A 1REDA 1PZ8A 4ISQA 4AVAA 1ZBE2 1HV1A 4R9AA 1MS1A 1BEV3 1AR81 4KWKA 1DZRA 2D6OX 4BZ4A 1BMV1 1SLBA 1D2QA 4XJ8A 4LBQB 2ZGKA 1Q8OA 2R042 4QX5A 4XHBA 2ZGLA 1AYM1 1I3HA 3B94A 1F2NA 4IEPA 4YZ3A 2NN8A 3RI8A 4ES8A 5JOYA 2HWE1 5H9RA 4JC1A 4KG0A 4C90A 4MXWA 4YM2A 4XQWA 1LOAA 3QLQA 1NLRA 1PO22 2DFBA 4YFWA 3V0BA 3SITA 1HQNA 1GR3A 1X36A 4URTA 4QQLA 5FO7B 5BNOC 1WW4A 2YYOA 2WA4A 3DPRB 3ILFA 2XJQA 4I09A 1QY4A 3JUUA 1CJDA 4FOYA 3WG2A 1NOVA 2WFPA 2VMHA 1LESA 4YRDA 2VVDA 4AGRA 4XJ9A 1IOAA 4BLIA 4I01A 4DY5A 1AR93 3PLQA 4GB31 4EN9B 4AQ2A 4H14A 1ULEA 1QJU2 1VAVA 1A8DA 1V9U3 5KHIA 4KNCA 2I74A 4CEYA 4CTEA 5HCBA 3VKLA 2YV8A 4AVBA 3VDDB 1RUE1 4LUMA 3VBFB 4X8NA 2XB6C 2ZX2A 2XJPA 1XE7A 2FZ1A 2JG9B 1ENXA 3IM0A 3TRSB 5JI9A 4DY3A 2YGLA 1RVF2 2PYTA 1BVP1 4HKOA 5FFOC 2ZHNA 3WDTA 2Q8OA 3AKTA 3VHRA 4OI4A 4Z82A 2RS52 1YLLA 2VOVA 4WM8B 2JG8C 5KC5A 1YNAA 3U07A 4XIOA 1OA4A 1BBT3 3SCHA 1GICA 1VBC2 2PHDA 4L11A 3RYPA 1IS5A 1EY2A 3C3VA 3FC0A 4FCAA 4KGQA 4NWWA 5FQ0B 4UW5A 4CP1A 3CJXA 4LEJA 1QQP2 5ABJA 1HRV1 1WLCA 1DQ6A 3MW2A 2XG3A 4Q4Y2 2O0OA 4CEYC 3UJOA 4U2AA 3HWJA 5ACA3 2IWGB 2FBEA 1JH5A 5T54A 3AKQA 5GLWA 1GANA 3KGLA 1REEA 5BUVA 3ZXGA 4F3JA 1AL23 2WNUB 2UU8A 1UF2C 2AUYA 2EAKA 2VQ0A 1H1IA 4CDXB 4FVVA 4P5HA 5JMCA 2X53S 3KM5A 2D3PA 3ST7A 1Z7S2 4YW1A 2G4IA 1TNRA 4Y20B 1O4ZA 1YIFA 3HAGA 2TNFA 4QT6A 3CJIA 4AFCA 2VOWA 3I59B 1G9BA 2GH8A 4AFAA 2Y0IA 3GALA 2E6VA 3VBOB 2GMEA 1O3TA 4WZFA 4RR3B 2BFUL 3AMHA 1KQRA 2B8MA 2DV9A 1CAUA 1C28A 2OVUA 4D94A 4BMEA 5L36A 2XVGA 4PIZA 3THPA 5K7PA 1RL3A 4XJZA 4AI8A 5DUWA 1SLCA 1CIWA 3N7JA 3J9SA 2G9GA 1PIV1 3S30A 1CAVB 3D0JA 2D98A 1VALA 2RS13 3J8F3 3SISA 2WZR2 3V64A 3ZSKA 4HANA 2R063 4K40A 4D7SA 1O5LA 2XL9A 3WP5A 4ATEA 1ZYBA 2BGCA 1N1VA 3LSEA 4U36A 2XPJA 1BEV1 3QCWA 5DDJ2 4QPIB 1CAXB 2QDRA 5LK7B 3OJBA 1KJRA 3B93A 4AVVA 4YVSA 3I54A 1COV3 1D4M2 2IZWA 3H3ZA 2Z79A 1XNCA 5BNNB 4P9GA 4KU8A 4XTPA 5GZEA 3IWZA 3CJIC 1ASJ3 1QHDA 3N35A 2GC2A 4CP0A 3R05A 4XFHA 1V00A 4EN6B 3Q9OA 3PHMA 2QCSB 2DCTA 3MW4A 3AJZA 4AWDA 4HVQA 5FLIA 1TMF2 4HMZA 2NLRA 4QPGB 3JBG2 3ZYGA 4ES9A 3AX4A 4HZFA 4FOQA 4YFZA 4E2GA 1Y3TA 5J98B 3KS7A 1ULDA 1LOEA 1GFF2 1HQLA 3AK0A 1AR91 1WMDA 3B3QE 2BTVC 2B42B 1V9U1 2DVBA 4Y22B 1JTZX 3VBSB 3WV6A 4N43B 2XVLA 4LO4B 1ZRFA 2HEWF 1PGL1 2ZKNA 4AEDA 3USUB 3P3PA 4HBNA 3IDBB 1RC6A 3NV1A 2E63A 3LWCA 3AMPA 1BJQA 2QNKA 3MLKA 1N3PA 3NO8A 3VHPA 3V65A 2D6NA 5KHGA 1QF3A 3S7EA 2RMU2 4KL1A 5LEKA 2Q0AA 2DWRA 4AF9A 4LHLA 1QGLA 2XBO2 4P9LA 1FX5A 4EN0A 1M4WA 4OHWA 4Q4X3 1C5IA 5FCCA 3E97A 3MIGA 3G7DA 4YZ5A 4D7YA 1BBT1 4N53A 1VBC3 1QXJA 3T2TA 4CDUA 2FQPA 3AYAA 3E5QA 3AP9A 3JD72 2ZACA 2CYFA 2PFWA 1QQP3 4AK3A 4RHV2 1APNA 3VV1A 2XJUA 2P3JA 5L7OB 2PAMA 5KWRA 5ACA1 4NVPA 4YZ1A 3NW4A 1IGOA 3WLUA 1LENA 2YROA 5CU1A 4AEDC 3R4DB 5SV8A 4BMBA 1DQ2A 3H7JA 5A3LA 5C8CA 1HDKA 1OPMA 4HLTA 4OI1A 3CNAA 3U11A 2LUWA 5KHJA 4IEOA 1AL21 4XFAA 5HI0A 3AP7A 2HEYF 1C5HA 3ATGA 4UBHA 1LKNA 1IS6A 3H7YA 2NZ9A 3H8UA 4MGYE 5J36A 1YYNA 4N9IA 4XE9A 3DPRA 1JHNA 1U5YA 2UWCA 4L92A 1LTEA 2ZHKA 3RNSA 1R1A2 3OYWA 4JRAA 1PVC3 4AHXA 4N53C 3FUOA 4H7MA 1FOD2 1DGLA 1RUG3 2D93A 2WNVA 1NCRA 2DFCA 4AI1A 5GZFA 1LR5A 1GZCA 2D6PA 4X8PA 4Z1VA 3GF6A 2Z42A 4HSJA 1MS5A 5EFUA 3N7MA 3IDCB 3ZFGA 5H9QA 5CNAA 3J8F1 2RS11 3TOJA 4R9DA 2R061 2ZX4A 4N7UA 1OOPB 3ME2A 4LLFA 5FREA 1RUF2 2VOXA 1HXS2 5C8CC 1AXZA 5A3MA 2Y38A 4K1YA 3H9AA 1AR72 2PHFA 3WZ1A 4GA9A 4GALA 2XVKA 3VBHB 4C0HA 1VR3A 3B02A 1COV1 1SCRA 1XQNA </