5I93A

Structure of mouse acireductone dioxygenase with ni2+ and 2-ketopentanoic acid in the active site
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
179
structure length
179
Chain Sequence
MVQAWYMDESTADPRKPHRAQPDRPVSLEQLRTLGVLYWKLDADKYENDPELEKIRKMRNYSWMDIITICKDTLPNYEEKIKMFFEEHLHLDEEIRYILEGSGYFDVRDKEDKWIRISMEKGDMITLPAGIYHRFTLDEKNYVKAMRLFVGEPVWTPYNRPADHFDARVQYMSFLEGTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Metal-Dependent Function of a Mammalian Acireductone Dioxygenase.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
molecule keywords 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase
total genus 48
structure length 179
sequence length 179
ec nomenclature ec 1.13.11.54: Acireductone dioxygenase (Fe(2+)-requiring).
pdb deposition date 2016-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03079 ARD ARD/ARD' family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5i93A00
4FAGA 5I8YA 2P17A 5JAXA 1ZRCA 3IDBB 4LUKA 1ZRDA 4LLOA 4IETA 1VP6A 1XRUA 3I54A 1EP0A 3O14A 1Q43A 5FPXA 1O3QA 3SMHA 3KCCA 2PAMA 4MGZE 1NZCA 3WW4A 4MGIE 3I7DA 2GC0A 4MZUA 3CJXA 4IEZA 3KGZA 3MYXA 4HVOA 3WW2A 1CAXA 4R52A 4I3PA 3ZDSA 2H0VA 1I5ZA 2PAEA 5KHJA 4XFCA 2PHLA 2D5HA 5FQ0B 1CAUA 4FAHA 1G6NA 3LA7A 1QWRA 4N9HA 3BCWA 1YLLA 5EFUA 5J7MA 5LEKA 1Y9QA 4MGYE 4LUMA 4BYYA 3FHIB 3OGJA 2VQAA 5FCCA 3CO2A 2OPKA 4YSFA 1ZVFA 3H3ZA 4B29A 3KGLA 3LA2A 4F8AA 1EY2A 4O9GA 3VHRA 3OTFA 4UBHA 2UY9A 1U12A 4ZU7A 3PLQA 2WFPA 3MDPA 2UY8A 4Q0PA 4Q29A 4KWJA 1O7FA 2PYTA 2V09A 3H7YA 1XE7A 4KWKA 1PM7A 2PHDA 1J58A 2PQQA 4I09A 4IEPA 4PIZA 4IEOA 5KHGA 1V70A 1RL3A 3E5UA 2ZCWA 1CGPA 3E6BA 4HVQA 4IEUA 2B8MA 3EJKA 2QDRA 1VJ2A 5FLJA 2GAUA 2IXKA 4OFGA 4BH9A 1UW8A 2QNKA 5LRSA 2Q4SA 2EAAA 5BXXA 5I0SA 1Y3TA 3BALA 4XFBA 5JR7B 2XL9A 5I91A 3PNAA 4EV0A 2GU9A 4N9IA 4XFGA 3SXWA 2IXLA 4LTAA 1O3SA 1ZRRA 5KHIA 3D0SA 1X8MA 1J3PA 2BNMA 2QJVA 3CF6E 4MGKE 4Q0QA 4MX3A 5I0UA 1J3RA 3ELNA 4XFFA 5J48A 1WLTA 2CAVA 4JVAA 3ROUA 4HLTA 4ZU4A 1UCXA 3DL3A 4DINB 4HVRA 1RUOA 3OD0A 4AVCA 5FQ0A 1WGPA 2GH2A 2WC2A 3UKNA 5KHHA 5JCTA 2B5HA 1TQ5A 1NE4A 4E2GA 3HT1A 4X6RB 3QACA 5E16A 1ZX5A 3E5XA 4ZU5A 2ZKLA 3NL1A 1RGSA 1YFYA 5I8SA 1H1MA 4YNIA 1J3QA 4ONUA 1DZTA 2CAUA 1RC6A 4D7TA 4XFHA 2IXIA 1NE6A 3CLPA 3TNPB 3U11A 2Q1ZB 4D7SA 1YFWA 4H7LA 3BPZA 3MPBA 2D5FA 3USSA 3I59B 3HIFA 2KXLA 3G7DA 4UXAA 4MUVA 3LOIA 2XGXA 3D0JA 4L11A 4JV4A 1UIKA 2F4PA 2FQPA 5BY5A 3PVBB 4HN0A 3NJZA 5FDBA 5K8SA 4XEZA 2Z69A 3FZ3A 1L3JA 3EO6A 3H8UA 4XF9A 3TNQA 1IPKA 1SQ4A 4QGNA 1J1LA 2I45A 1LR5A 4ORFA 4QMAA 1ZZ8A 2GZWA 1ZZCA 3NW4A 4L2NA 2Q30A 4J1XA 4I0BA 3ETQA 4Q0SA 1UPIA 4PIYA 3N4MA 2HJIA 5T3NA 4AVAA 4EWDA 4WVZA 4XFIA 4Z07A 1UIJA 1I6XA 1O5UA 2GC2A 4HN1A 1JUHA 4EWAA 5D1IA 2IXCA 3ES4A 4AXOA 4LULA 1YFXA 4HBNA 3E6DA 5I0RA 3M3IA 1VR3A 1OMIA 1ZZBA 2ETEA 5AVPA 3E6CC 4R8HA 4P9GA 2PTMA 3U10A 2GC1A 1PMIA 1YFUA 2D93A 1OD5A 1O5LA 3QOPA 2B9UA 4IEXA 4IESA 4E2SA 3SCFA 2OA2A 2D40A 5CU1A 2XLGA 4WBBA 1CAWA 1H1IA 1ZZ7A 3D82A 2Y0OA 3FFQA 2N7GA 4I01A 5E1RA 4I2OA 3OCPA 4MH0E 3C3VA 4QX5A 3WW3A 4TLFA 2OZ6A 3R6SA 3FJSA 3JZVA 3RPQA 5CADA 3ACLA 3M70A 5FLIA 3FX3A 3S7EA 4F7ZA 2BNNA 4XFAA 3S0MA 1CAXB 2XLFA 3HQXA 3UKVA 2MPFA 2HKXA 3I59A 3OF1A 1Q3EA 2IXHA 2XLAA 1ZREA 3H1YA 2Z2SB 4PIXA 2BGCA 2EA7A 4PJYA 5EZWA 4A2UA 4HSJA 1OFNA 4XETA 3RYRA 2FMYA 1ZZ6A 2C0ZA 4IERA 4HMZA 3FE5A 3IWZA 3H9AA 4O9EA 4WZCA 5HI0A 3E97A 2XL7A 5I93A 2K0GA 3RYPA 4GULA 5JSPA 5KHKA 3E5QA 4QGMA 4HSLA 3UKTA 1EPZA 3RZZA 5JSOA 2H6BA 4AVBA 4Z82A 4FT8A 2XKOA 2Q0AA 2E9QA 4FBFA 3L2HA 3KSCA 2ET7A 4XF1A 5J3UA 1DZRA 4OLLA 3DKWA 1FT9A 4IEQA 4META 5I0TA 3SCGA 4HZFA 2DCTA 4KU7A 1UD1A 2O1QA 1J59A 3EBRA 2BEOA 1XE8A 1DGRA 1O4TA 3H1WA 4LA3A 3SCHA 5CVRA 4BHPA 4BIFA 4XF3A 1GQGA 2ET1A 1CAVA 4LEJA 3B02A 4I02A 3LZZA 3WW1A 3NKTA 1EYBA 1RTVA 4Q0UA 1QY4A 4IEYA 1SFNA 2H6CA 1ZNPA 1HW5A 3H50A 3ES1A 1CX4A 5JSRA 3RYKA 4I0AA 4X6QB 2IXJA 3BB6A 1O3RA 4CYDA 2IC1A 2XHKA 4J1WA 1RUNA 3H1MA 4NVPA 2BNOA 4Q0VA 5FPZA 1YWKA 2EVXA 3EQEA 3GYDA 3IDCB 1ZZ9A 3NSTA 2UYAA 1YUDA 1FXZA 2PAKA 2GC3A 4QM8A 1QXJA 3EHKA 4JTNA 2UYBA 3H7JA 1IPJA 1OI6A 3RNSA 2K9ZA 1CAUB 5I8TA 3FWEA 1X7NA 4QGLA 4IEVA 3ST7A 3S7IA 2CV6A 4YRDA 1NXMA 4QXKA 5BPXA 3GBFA 5C8WA 5LRRA 1DGWA 2QCSB 3IIAA 4KWLA 3H3UA 4K8FA 3DN7A 3CL1A 2O8QA 1CAVB 5C6CA 1GQHA 3LAGA 5KBFA 2PFWA 4JTOA 4RD7A 3U0ZA 1QXRA 2BYVE 3LWCA 1O3TA 4AQ2A 4XF4A 2PA7A 4KL1A 4E2QA 3SHRA 2CGPA 5FLHA 1ZRFA 4XF0A 4LA2A 2QVSB 3KMHA 2ATFA 5LEJA 4KU8A 1X82A 5BV6A 1LKNA 1X8EA 5BUVA 2XKPA 4UBGA 3LA3A 1SEFA 1LRHA 4EWEA 1LB2A 4YYOA 3NVCA 2VECA 1YHFA 3RDIA 4EROA 2OYZA 4AQ6A 1NYWA 5F1RA 3BU7A 4IEWA 2MHFA 3DV8A 1WA4A 1CAWB 3MZHA 3CEWA 4QM9A 4MV2A 1FI2A 2VPVA 4YARA 2MNGA 3IBMA 3HT2A 2OZJA 1Q5OA
chains in the Genus database with same CATH superfamily
4FAGA 1OC1A 3ZXKA 2Y34A 5BNPC 2DCKA 2P17A 5JAXA 1J83A 3LSEA 3ZYGA 4C0HA 1ZRDA 5FUNA 2GNMA 1LHUA 1LOFC 3Q8FA 2QQMA 2X53S 3MEPA 1Q43A 3N9PA 1M4WA 4RGAA 1YRZA 2VMIA 2ZGQA 3J7NA 1OXCA 3KCCA 4Y1YA 4XUNA 3SMHA 1OFSA 3JB4C 5A1LA 5BNOB 4P5HA 4QXBA 3T1MA 4DXSA 1EUUA 5DAXA 1V6KA 1W8TA 2DUOA 2JB4A 4Y20A 3KGZA 4XW3A 2E7QA 1UXXX 5FZ9A 4HVOA 2WINB 4DFSA 1WUVA 1D2SA 3T0AA 4XQWA 2PAEA 2D7FA 3T4HB 2VBDA 2PHLA 2V72A 1EAH3 4GB31 4GMP3 1BMV1 5FQ0B 3B9IA 4N43A 2VMCA 4FAHA 3T2PA 1G6NA 3B9CA 1SBDA 1WKYA 2V5YA 1RMU1 4M3CA 2ZJCA 1IPSA 3KV9A 2JDUA 4OUEA 1NLRA 1QWRA 4YZ1A 1F15A 2EXIA 4FPYA 1V9U3 3BCWA 1FOD3 3TB0A 1OPMA 3LEIA 4XJZA 5FPLA 1DF0A 2EXJA 3O1OA 1EPWA 5J7MA 5FYSA 1MACA 1O59A 1Y9QA 3AL5A 3DGTA 4MGYE 5EYXA 2P3IA 3U14A 3FHIB 3WG2A 1BEV1 4Q4X1 4BYYA 1ZBE1 2D6PA 2VNRA 4S2DA 5FCCA 3CO2A 4QD2A 4BU2A 4UAPA 4W6YA 3WNLA 5JSPA 4IV3A 3H3ZA 4B29A 3GJAA 1GFF2 3KGLA 1NKGA 3HBZA 4LKFA 4WM7A 1QOTA 2W9XA 3O1RA 5DXDA 1XYPA 1OH4A 2ZA9A 4ZU7A 3INAA 1JYCA 1I3HA 2YXSA 3PLQA 4AOCA 1MQTC 5CFCA 4LKSA 4LIVA 4XPVA 3I3MA 1R64A 4Q29A 3HN1A 1O7FA 1UKRA 1IQDC 1OH3A 3OSDA 4Y4RA 3OY8A 2KR2A 4LKDA 1UYYA 1PM7A 3AZWA 1J58A 1SLBA 3LFMA 2PQQA 2PLV1 5EJ3A 4LORA 4I09A 3LDBA 3ZYHA 5ACA2 4N53A 5DN2A 5A7OA 5TSWA 4CP1A 3GCWA 5ERLA 2XXZA 3ZKUA 1V70A 2JKBA 4INDA 4Y22B 3T2TA 1PVC3 1CGPA 3LIGA 5GZEA 4B8EA 4LR4A 4X8PA 2WLQA 2XJVA 3WNMA 4RS5B 4IEUA 4HVQA 1BJQA 3PTRB 4CUBA 1UY4A 2E7TA 3HQUA 1V6LA 3KLSA 4M00A 4GH4B 5A7NA 1LODA 3J8F2 5FLJA 4Q27A 3RZKA 3IAPA 5CIRA 1COV1 2QTWB 5BYNA 1QJU2 2P6HA 3GDBA 4Q8LA 1C5IA 4LO4B 2C24A 1ULPA 3ZR5A 5JDBA 1FX5A 3OPWA 2R32A 1W9WA 4D94A 1B35A 4XFBA 2XL9A 3PNAA 5KXEA 3CJIA 1G9FA 4N9IA 4NHXA 5FAXA 1U5ZA 1H1AA 1HKDA 4DS0A 4FPKA 1O3SA 4XCAA 3BYWA 3BU0A 2J1AA 4DY3A 1RMU3 1Q8QA 1CQ9A 4MGKE 5J36A 4MX3A 2HYXA 1K45A 2YUEA 4XILA 5D8AB 3ELNA 3FUOA 3C7GA 2ZEYA 4HKLA 4F83A 1YYNA 3WZ1A 4JVAA 1GNHA 3ROUA 5CKMA 3LPGA 4DRVA 1QJY1 4NHMA 1XU1A 2ZS6B 4TLGA 2WZPP 1JZ3A 1E5IA 2ZOEB 3ILNA 5GZGA 2GP3A 1VBB3 1RUF1 3QLQA 4H14A 3P3PA 1GWLA 4AVCA 5J96B 4KMQA 4Y5Z0 3K3NA 3U4SA 2RV9A 2XWJB 3KT1A 5F8PA 3ZFFB 4COYA 4JRLA 4Q8KA 5JCTA 1NE4A 2VTXA 2BBVA 3M1HA 3N9OA 5FZLA 5C3PA 4TSVA 2WLPA 3WDVA 3RZMA 1WBLA 2D3SA 1LGCA 4ZPIA 1VRH1 1DQ5A 3PMSA 1JYNA 3NL1A 2PLV2 1J3QA 1JHJA 5JMOA 2VZPA 2Q8OA 3VZLA 5IHRA 4R9DA 1RC6A 4LBQB 4CU8A 1QDOA 2VH9A 2ZGNA 4M3CF 5CAZA 3CLPA 1RVF2 5JR2A 3LF7A 4DPNA 1PMJX 5FTTC 3B00A 4D7SA 2GALA 1YFWA 4GWJA 3IDEA 4LBKA 4B1MA 3KHBA 3RVHA 2Q8DA 3USSA 1HXS3 3T08A 2EAKA 2KXLA 3G7DA 4OHYA 4UXAA 3LOIA 1OQEA 4LBMA 1VALA 1W6MA 4AI1A 3POIA 4CDWB 5BNNC 2J1VA 3V65A 2DVFA 2J1TA 4M4RA 1G86A 2HWB3 2QFEA 3OOXA 5FO9B 4LE3A 2EXHA 1L3JA 3EO6A 5LB6A 4COVA 3FFZA 5GALA 1SQ4A 2HLEA 2YGMA 4QGNA 1H9PA 4WVVA 2VY0A 3A0NA 5F2WA 3HEIA 3WSOA 2R073 1F4HA 4AFBA 4XJAA 3ZPOA 1JI6A 2CWMA 3ZR6A 1LOFA 2ARAA 2D44A 3OGRA 3W59A 2JDMA 1QJY3 3WP6A 5FZGA 4OUMA 3UJQA 4BM8A 2A7AA 1SMVA 3F95A 1G9AA 3MIHA 3WF1A 4CPBA 2GNDA 1LHNA 1REEA 2RJLA 4NE9A 4ZZ8A 4AVAA 4Q4V1 3VD7A 1NG0A 1HRV3 1Z7S3 3I8TA 3POWA 5IFPA 1XNTA 3C2UA 2D3RA 3Q9OA 4HN1A 5DAPA 5DDJ1 2FDJA 2Z79A 4TN7A 3VN4A 1D4VB 5EV7A 3GALA 3VD3A 5T54A 3JBG1 1YFXA 2WZR1 1UO9A 2QQIA 1APNA 4AI0A 4FFFA 1ZZBA 2ETEA 1KS5A 3OGSA 1DCSA 1MVEA 5AVPA 4R8HA 3EB7A 2GC1A 3U78A 1GICA 2ORZA 5FPBA 2JD4A 2J1RA 1PMIA 3ECQA 5FMCA 2BRTA 4P9LA 4N53C 4XUPA 3LSDA 5FO7B 5T5JA 3WF3A 4FOYA 4IEXA 3WP5A 3WXPA 4LKEA 3I97A 5FZBA 2QQUA 3PJQA 1CIYA 3WT3A 2Y6HA 5JPNB 5BNOC 3D82A 1YQ5A 1D4M1 1IS4A 4LLFA 2W52A 4XJWA 2N7GA 3W9AA 1AZDA 2ADDA 1LGBA 3LKJA 3OCPA 4UWDA 1NCRA 1QJEA 3C3VA 3I3BA 4K9SA 4MH0E 4Q2FA 3RRDA 4IGOA 4AEDA 4U2AA 4LK7A 4B7KA 1GZTA 4LBLA 4NIHA 2HWE3 3WDTA 3ACLA 5C8CB 4IXLA 2ENRA 4PT6A 4F7ZA 2BNNA 3VBUB 4ARXA 5L7OC 1KJLA 1CAXB 3HJRA 4IE4A 2ZACA 4QPWA 3UKVA 2MPFA 1DFQA 3C7EA 1XNCA 2HKXA 2VUDA 3LOBA 3I59A 1ST8A 3QD6A 4OHWA 1A78A 3ZMOA 2XJSA 1NA1A 2AC1A 3RGBA 1IGOA 2GNBA 4BXFA 3O1TA 3SEEA 4XURA 2GN3A 4PIXA 2B39A 1CD3G 4GWNA 1UWWA 5DPNA 4BMBA 4PJYA 1A34A 3EYPA 3H42B 4HSJA 3ZSKA 2QQVA 4AI3A 4XETA 1WCQA 3UGGA 2WFF3 3TN91 5CYYA 3OBTA 2KA3A 2FMYA 3G6JB 2C0ZA 3UT0A 1XSRA 4HMZA 5CBLA 1HRV1 1Z7S1 5HBAA 1FV2A 5DG1A 5CZKA 4MLOA 2VOVA 2Y6KA 3BODA 4MGSA 5HCHA 1U5XA 3AYAA 3ACFA 3FLTA 4GULA 3JBG3 5LA1A 2WAAA 2HH9A 1K3IA 1UZYA 2WZR3 3WLUA 2V5DA 2VZ1A 3WQ1A 2DURA 5H9QA 4CDXC 1MR5A 4HPKA 3MGUA 4HSLA 3UKTA 3ZXLA 4XJ9A 5A80A 4AI2A 2WBKA 2ZHLA 5I0DA 3HAGA 3FUQA 5FXZA 3AMNA 1MZEA 4L8QA 2WNOA 2WQ8A 4BQXA 2IUWA 4LE4A 2JWPA 1ODMA 1HJFA 1WA6X 3SH4A 4UFIA 4YPJA 4DRRA 4COZA 1YQ8A 4BQWA 1S0GA 1XNKA 1RUI3 2RMU2 3VZOA 4QQOA 3T2QA 4CDUA 4G3YC 1XOYA 2WR9A 1VLNA 5ACA1 2VW1A 1H9WA 1UD1A 2O1QA 3OYWA 4R9AA 3LDKA 1QJY2 1PIV3 4KQ7A 4HG6B 1HJGA 4AQSA 1XE8A 1YI9A 4GQ7A 4QX7A 4CCLA 1UXZA 1SDDB 5EHDA 4DEVA 1V6MA 1Q8VA 1EUTA 4I02A 2HWE1 1URXA 3OUJA 4NAMA 3PL0A 5CFCC 1AR62 2PELA 3ZKYA 1CPNA 4XABA 5GLTA 1HDKA 3MO4A 3QH6A 5F32A 1JOPA 4AVVA 1W99A 1RTVA 5IVBA 3ZO0B 2XMLA 1ZBE2 2X5IA 4Q1RA 1JZ7A 2CDPA 4IEYA 4FP2A 5FYUA 3K4AA 2H6CA 3B3QE 5C5TA 1HX6A 1K5JA 4FTBA 2A6ZA 1HW5A 3J4UH 2WS91 2FDIA 3GZUC 1GV9A 2R1DA 4NR1A 1CN1A 1UF2C 4RYDA 5JSRA 1JTZX 2A5ZA 3MHZA 2FCVA 4I0AA 2IXJA 1LOBA 3ZN6B 4CUGA 4XACA 1OHFA 3MIGA 1JYVA 4MXVA 4L9BA 4UW4A 3O0WA 1BBT2 1CIWA 1DLCA 4K8RB 4XMAA 2RM21 2W95A 3POGA 3OB8A 3DPRB 3JD71 2JIJA 4J1WA 2ZGRA 2BNOA 1YEWA 4FXGB 1UY1A 2JKXA 2C9AA 2ZKNA 3CJIC 3EQEA 1RUJ1 5C4WB 3IDCB 1N3QA 1ZBA2 4AFMA 3A23A 4OVEA 2XQXA 2HWD2 1RITA 4ES9A 1BXHA 4LBJA 4CDWC 2BOJA 4QM8A 2PN5A 5BNNB 5LA0A 4JTNA 1UY0A 2FDHA 3WUDA 5B4XA 1QU0A 1QIQA 3BTZA 5A3OA 4TTGA 5DZFA 5I8TA 3RG0A 4A3XA 4AZZA 1N47A 3BOWA 4RQPA 4DY5A 1X7NA 1RUJ2 1XNBA 1TMF2 4QGLA 4IEVA 5DAQA 1GKBA 1DYOA 1W9TA 5GZDA 1K5MB 5FYMA 3WUCA 3MBWA 4RR3C 4C91A 2WN2A 4COUA 2QCSB 3VZMA 1LOAA 5J09A 1A8DA 2RR12 4KWLA 4XVHA 1BLZA 3TAYA 1PIV1 4L99A 2ZEXA 4I30A 4EYUA 4WM8A 3CL1A 3PIGA 4MGTA 3X29B 3LD8A 5A7WA 4OHXA 1AXKA 1CAVB 1GQHA 1EV13 3LAGA 3N3HA 3D5OA 4XTMA 3N7JA 4NIIA 1G9BA 3LEKA 4LQRA 4AGVA 1NCRC 1JBCA 2ZGSA 4QXCA 2P4EA 2HWF3 4RD7A 2JG9A 1OLQA 2VU9A 2ZGTA 4NHYA 5ABJA 4AQ2A 5K0UA 1WMDA 1O3TA 2SBAA 1CZSA 2YFZA 3RJRA 2D3PA 1ZRFA 5F39A 1NXD1 1RUE3 3NO8A 2YHJA 4EN8B 2W5FA 4KGGA 1SCSA 2VOKA 3CZJA 5LEJA 2BPA2 3RQ0A 2A71A 4QKDA 1H2LA 4CE8A 2XVLA 5LK5A 2HWC2 2CDOA 4Y1UA 4UBGA 3RSJA 1HRI3 1UOGA 4EWEA 1LB2A 3KV5A 1RUI2 2RMU3 2VAUA 1ULGA 1HV0A 2DVAA 1QKQA 2OYZA 1CZVA 5A6YA 2MHFA 2WDBA 1QQP3 3TOJA 3ZFGA 3GNEA 1AYM1 1CAWB 1RJ8A 1WCDJ 1R1A2 1X9TA 4MV2A 1PVXA 4LO5B 3VBRB 4LHKA 4ZY9A 5AFBA 3ETPA 3SC7X 1BK0A 5A3LA 5A3WA 4CDWA 1RHI1 1RUG1 3GZTB 4NO4A 1PGW1 5E8AA 2VMGA 1ACCA 2OQ7A 2WZR2 5I8YA 3NKGA 4GZ9A 1AR93 3J7MA 4QHZA 1FOD1 3MLJA 2C4XA 4LIUA 2JDAA 4O61A 3ZSJA 5FBJA 4IETA 1XBFA 1VP6A 1Y4WA 5L7OB 3K4DA 3FMGA 1V6OA 1EP0A 3O14A 1O3QA 2BWCA 1I1EA 2VQTA 1R091 1V0AA 1UU6A 1BEV3 4MGZE 4YGDA 4RGGA 1C4RA 4M4PA 3WW4A 2DTYA 3I3QA 4Q4Y1 3I7DA 4AHZA 5GLVA 5C8CA 3ZYPA 3VBRC 4YZ2A 3QH7A 2C5DA 1AX0A 4D3WA 3WCSA 2YROA 3MYXA 2HEYF 4K1ZA 1CAXA 4MVTA 5FYHA 2OX0A 1NLSA 3M7AA 4I3PA 2H0VA 4OCTA 4CDQC 1B35C 1WMFA 1I5ZA 2VCBA 3NAPC 2ZZJA 4FPJA 1AVBA 4IE6A 4XFCA 5DABA 2Z42A 4CU6A 1J84A 5IT6A 4LO8A 1E5SA 4YZ3A 4CP0A 3MIEA 2GSYA 1OOPB 2RJ2A 2FDGA 4N9HA 2ZX2A 1F35A 5AC92 3PURA 4DXRA 3R4UA 2BVVA 5G04L 3WDYA 1HIXA 4LUMA 1JH5A 3AKSA 4MOAA 5LASA 3MUZ1 5HV4A 3N35A 4JDNA 2EIGA 1V6JA 2VQAA 1RJ7A 5IVYA 4CDQB 4YSFA 2OIIA 4RHV2 5IWFA 1JODA 1VPHA 1ND2A 2WWSA 1PX4A 5IATA 2JB8A 2W94A 2YDEA 4F8AA 4O9GA 4DMIA 4ZS2A 4UBHA 2UY9A 2QQOA 1KFXL 3AP7A 4LT5A 2VZVA 4YLZA 3AM2A 1KGYA 2WFPA 3WG3A 5L19A 4ARYA 4H3WA 1ENXA 4EN6B 1EAH1 4GB33 4GMP1 2G9FA 5JPMB 2V09A 4QDSA 5FYTA 3O1UA 1Q8PA 1XE7A 4P08A 2G1MA 3HBKA 1GMMA 4OMDA 4M3CE 5FKCA 1AJKA 1IG0A 1NCRB 2XJTA 1QJU3 1V9U1 4PIZA 2AZ5A 3T0DA 4JQTA 1VBC3 1RHI3 2DF7A 2HWD3 3JB8A 3E5UA 3VBSA 4XZPA 2PHRA 5FBZA 2ZCWA 4XHBA 2X8KA 4K1YA 4AK3A 2WRAA 1W6PB 4XUOA 4Y1XA 3PVOA 4Q4X3 1RUH1 4Y33A 3JQWA 2O8OA 3WCRA 2B8MA 4JKKA 5C9AB 3V0BA 5FZEA 5KR7A 3MW4A 3W58A 2GAUA 4OFGA 1NA1C 1RUF3 1W6NA 2C9KA 1NY72 1ULFA 1DG6A 2QNKA 2C26A 1W06A 2VQUA 4SBVA 3ZN4A 1AYN1 5FY8A 3ZN5A 5CKNA 4BA6A 4XOGA 1PK6A 3SITA 5FYBA 4AEMA 2F6BA 1W9SA 1MS8A 2ZMNA 1G7YA 2FMDA 1Y3TA 2BTVC 3ZYBA 4BQYA 3RZJA 3BALA 1GZ9A 2GH8A 2DU0A 4R4XA 5I91A 1LEDA 2YG0A 4EE2A 4XFGA 4TZDA 2IXLA 3ILFA 4DQAA 1REFA 2BZDA 5KHIA 3PUIA 1DQ4A 3D0SA 2QJVA 4Q0QA 1PO22 3W21A 4AG4A 5JXIA 4UOJA 1NCQA 4IE0A 3URFA 5J48A 3NV2A 5HXMA 5AC91 4YW3A 1GOGA 2A3YA 3R4SA 4XAAA 3MPPG 2PHTA 3MFCA 4ZU4A 3BTXA 1OKQA 3K4ZA 3AZYA 3DL3A 3KS7A 4KGQA 4HVRA 1YCIA 1Z0HA 4OULA 2VMDA 3OD0A 5FQ0A 1W8FA 1WGPA 3UKNA 1QOOA 1YQ6A 4V1PA 5KHHA 4EZHA 1OBNA 3CBNA 2B5HA 1W8NA 3THTA 2XVGA 1B35B 3HT1A 5EIYB 1R1A1 3GZEA 2ZZQA 4YG3A 5E16A 2R49A 3E5XA 5A7PA 1KFUL 4P5YA 1N1TA 4OYUA 2ZKLA 3HMYA 1WW5A 2VTXJ 1RGSA 4FPCA 1H1MA 4YNIA 1SPPB 1S0JA 3ME2A 1FMD1 4XBQA 3T4VA 1GZCA 2RVAA 1RIRA 1WD3A 4QT6A 2VNOA 1MS5A 1DQ0A 2A6WA 1NE6A 5FYCA 1HRV2 1Z7S2 2R071 2ZGKA 4QQPA 3U11A 3Q8BA 2G9GA 1W8ZA 2Q1ZB 2VNGA 1VBB1 2CSGA 1F9KA 2YV8A 5C3QA 4ATEA 3BPZA 3NJVA 1GZWA 5T5PA 2HBUA 4M01A 1N3PA 4MHRA 4AVTA 2RM22 1GU3A 1SDWA 3D0JA 3ZXEA 1J1TA 4C8DA 4JV4A 4JZRA 1UIKA 2GMPA 2VG9A 2FQPA 1A6CA 1ZRIA 3MLKA 4QKBA 5FR3A 4UT5A 1YO8A 5IAXA 4JGYA 1VRH3 2Z69A 3ORJA 4HK9A 2XJUA 1ZA7A 3TEYA 4UFJA 3DYMA 2ARCA 4XF9A 3TNQA 1WCUA 2BU9A 3A4UA 4IE7A 1AX2A 4JQRA 3AC0A 4RFT0 4NAOA 4WZFA 1PO21 2F17A 2ZEWA 3C7OA 3M3CA 2I45A 1HB4A 4JDMA 4LBQA 4ORFA 5IUQA 3IZOA 1TME2 1AL21 2GZWA 4CEYC 1ALYA 1QJX2 3WDWA 3NW4A 1Z78A 5C8CC 2Q1MA 4YVWA 3AP5A 4OZXA 4GA9A 2HEWF 5AC93 4JCKA 4A6OA 3ETQA 4EN7B 5FZ0A 3POFA 1HXS1 4PIYA 1C1FA 2Y6JA 4QX0A 1W6QA 3C8XA 1BVP1 5T3NA 3RFRA 3E1F1 4BE3A 5A3TA 5IVVA 1YC61 2G19A 3ZPYA 4Z2AA 2W3JA 4Z07A 4G4FA 1O5UA 4XHXA 1JUHA 4AQTA 5J1XA 5D1IA 2IXCA 1W39A 3W20A 2HWB1 1OLMA 2D6LX 4S2FA 5SV8A 4XDPA 4GB32 1BMV2 2J1EA 1C1LA 4D69A 2JICA 3U75A 1VR3A 3GHNA 4YFZA 3AZZA 1MEC3 2XB6C 1O6UA 1KJRA 3TRSB 5FOBB 2WNUB 3E6CC 1MS1A 4P9GA 2WT1A 1DBNA 3VKMA 5FZKA 1KQRA 2X09A 2R043 2JIGA 4MG2A 4IV3C 2E33A 1QJFA 4O65A 4Z2WA 1IHMA 2D93A 5A3PA 1HB1A 1OD5A 2WT0A 4CCOA 5E88A 3FLRA 1FYUA 4CCKA 1STMA 1HN0A 3SCFA 2OA2A 2CU5A 2W1WA 2GMEA 2DWRA 2XLGA 1H1IA 3VGIA 1XXNA 5IK5A 4JGZC 4YVSC 2YPDA 1YI7A 1ZZ7A 2IFRA 5KC5A 4A3ZA 3K2OA 2E63A 3FFQA 1FV3A 3I4IA 2UU8A 5KXDA 1PGW2 4I2OA 3WW3A 4QPYA 4TLFA 2JX9A 3J7HA 3JZVA 4PLNA 1D7PM 4UFLA 5FLIA 1X36A 1QHDA 3IT8A 3T30A 3S7EA 3VDDC 4CPBD 1W2UA 5A1AA 4ZXKA 4AHXA 2VE1A 2VUAA 3P6BA 1RUD2 3AFKA 2WS92 4GD4A 4ZS3A 3HQXA 3ZOIA 1UMZA 3V0AA 2Y60A 1H2KA 4NUBA 4M0NA 4YVSB 3WHTA 4IV1C 1O4YA 1PO23 2VBBA 3WV6A 2QQNA 5F2SA 5EJ1B 2QQKA 4XUTA 4UW3A 3PTYA 3OBZA 4D7YA 1ZREA 4UW5A 1W6MB 4GMP0 2EA7A 3O0VA 1VBA3 4A2UA 3CHXA 2HEVF 1OFNA 4N7IA 4IQPA 5JOZA 1AL22 2J1UA 1RVF3 3M3QA 3RYRA 2E32A 3UYJA 4Q4Y2 3AMQA 3H9AA 3DKQA 4LBNA 2MEV2 1W6OB 3A21A 2VCMA 5HI0A 1OD3A 2X29A 3ILRA 4GXLA 1JS9A 4A4AA 3KF5A 5FY5A 2P5BA 1R081 5BNPA 1GNYA 3RWNA 4QPGC 3ZSLA 1C8M3 1QF3A 4AFCA 1FOD2 1LOCA 1LTEA 1UYXA 1UQXA 1ZA4A 3E5QA 2ILMA 5C9AA 3SNMA 2D6NA 1PZ8A 3AVRA 4LHSA 3D3AA 2IVJA 3J7LA 1ENQA 4K20A 1WW7A 1UMIA 1WBFA 3THPA 4FFGA 2R041 3VHPA 1UZZA 4AAXA 1TNRA 4JX0A 5A70A 3WG1A 1PK6B 5CFCB 3WOGA 4MXWB 2ZGLA 1OVPA 3PJYA 4GIQA 2RE9A 4KNCA 1OUXA 4UFMA 1XSQA 2R16A 4DUVA 5FP4A 1TME3 1DZRA 2ZXQA 3DKWA 2NYYA 1QJX3 2VQ0A 5LBFA 1FT9A 2R072 1IKQA 4PI0A 3I2IA 2ARBA 1PGSA 4BWOA 1AL0G 3RZHA 3TYJA 3EBRA 2WZEA 1MQTA 1HV1A 1DGRA 1O4TA 3H1WA 3WEZA 3AXEA 3V0AB 1LAJA 1YQ2A 2ADEA 4XF3A 1GQGA 3AK0A 3AMHA 1K5MC 3CMGA 2WSUA 2Y0IA 2VOTA 3FC0A 1TEIA 1RUJ3 1TMF3 4BK4A 5FUIA 2RG4A 2W2IA 1GYKA 3NKTA 4N8MA 2VCAA 1GLHA 5FZ3A 2NN8A 4HKOA 1UU5A 2DCZA 1JZ5A 4GH4C 4UW6A 3VZKA 4HOOA 3ZXFA 2RDSA 1E57A 4JDOA 4PDWB 1ND2C 4MHUA 2XUMA 5HV0A 4GJZA 1ZNPA 5FK8A 1VBD3 2JDPA 2LS6A 2LUWA 3VBSC 1SZBA 1LU2A 3ES1A 1HQNA 3ZM8A 1H8VA 1CX4A 1S55A 1NY71 2TEPA 3I2DA 4URTA 3NV4A 5ISLA 2EICA 3BUCA 1LHOA 3BB6A 2B4KA 3OPZA 4HFSA 3VZNA 2W0XA 2ZX0A 5FZ4A 3V0BB 4EN9B 1TVGA 4DIQA 2QZ2A 1SFPA 4Y5TA 3NAPB 4PI2A 2JE8A 2WKKA 1RUNA 2DBNA 3B93A 4KG0A 5FYZA 3D6EA 1XYOA 2AEZA 4QQ2A 4WM7B 1JYXA 1OOPC 4ATFA 2RDQA 2CWSA 1W3XA 2PAKA 1QMJA 1QXJA 3EHKA 2HWF1 3H7JA 4PF1A 5FZAA 2RR13 1CONA 1OI6A 4GJYA 1M06G 2RDRA 3V56A 2VMEA 1UY3A 4NMIA 1XPWA 1DP0A 3HN3A 1CAUB 3OY8B 4W65A 2WS93 1ZBA1 1P8JA 5JI9A 4L92A 3ST7A 4NOTA 3KF3A 3KQRA 2UWBA 4YRDA 5F3EA 1NXMA 2R062 1WW4A 2DCJA 4K7JA 3H8XA 3WF0A 3GBFA 5K7PA 4R4ZA 5LRRA 1DGWA 5JVVA 3ZN6A 3RI9A 3IIAA 1IS3A 4RS5A 3ZFEC 2V4AA 1HLCA 2O14A 1WCSA 3AP4A 2O8QA 3N9NA 4SLIA 5CKQA 1W3VA 2JE7A 2LRPA 1HB3A 1QOSA 3O0XA 4OHVA 4CVUA 1GQPA 5KBFA 2Y26A 4YVWB 4OI0A 3SLIA 1JU3A 4JKMA 1YQCA 1GOHA 1X50A 3USUB 2JDHA 1TZOA 4B1LA 1XNAA 1UYZA 5FIXA 1KRIA 1RUG3 3LWCA 1D2QA 2WT2A 4EQVA 4XF4A 3BI3A 3SHRA 2WO3A 2R061 1AR61 3KV4A 2QBXA 4KH9A 2VC9A 4WVMB 2VMHA 3LFIA 1SLTA 2RS11 4YW6A 4LA2A 3WHUA 3AJZA 1TNFA 4FCAA 2WN3A 3ZFEB 5B4NA 4S2HA 4KU8A 4CUCA 4EZ4A 3HOBA 4IV1A 1R093 5BV6A 1LHWA 3OBAA 1HQLA 3M3OA 4ISQA 2BGPA 1O8PA 2WUHA 1SEFA 2ZGUA 2ZPXA 3LA3A 4XXPA 3V64A 2NMOA 3IKWA 5A3UA 1AR92 1RB8G 1YHFA 4XDQA 1XNDA 5CG8A 2WL1A 1X9PA 2AYHA 4IEWA 2B46X 3DV8A 4K3UA 3VKNA 5GZFA 3CEWA 1JUIA 2PHWA 5LBEA 4FQZA 1XQNA 3UESA 2MEV3 3WY6A 3OJBA 5KC6A 4YARA 5BNQA 2QQJA 2EF6A 2QQWA 3JD72 4CCJA 5F37A 3IBMA 3BTYA 1GOFA 4BISA 1ASJ1 3S30A 2FDKA 3JCIA 3NMBA 1PVC1 2VUJA 4BDVB 1GSLA 3O7OA 5K0UB 1ZRCA 2BUKA 4AFDA 4LUKA 1RUE1 3OGGA 3GF6A 3BGAA 5KWRA 4AFAA 2DDUA 2ID4A 2WZ8A 1IOAA 4YGCA 3CZUA 5LATA 2FDFA 1W0PA 1OA2A 4QWNA 1QEXA 4UI9L 5CG9A 3WNKA 1HRI1 2GC0A 1AR82 4OI2A 4RR3A 4MZUA 4W50A 5A7SA 1VBD2 3A0KA 4FPOB 5A6ZA 1BHGA 2VBPA 1RXGA 2YC4A 5FRAA 3TN92 1RHI2 4HONA 4R52A 2D6MA 2RS12 3AKPA 5FXVA 5C9AC 3HQRA 4HETA 2HWE2 3K77A 4WM8C 1JZ2A 3ZFGB 4YM1A 4QDRA 5T50A 3FBYA 2D6OX 3N9LA 4LPLA 1NOVA 2D6KA 3I2FA 5F3IA 4CEYA 1BBT3 3I2JA 3POBA 4HANA 1F5FA 2I74A 3A22A 2D98A 1AR91 1QJU1 5G05L 5LBBA 2BVBA 3TEZA 2OPWA 2QKDA 4XQDA 2J22A 2VUCA 2W92A 3J8F1 4YZ5A 5LEKA 3HNMA 2W1SA 3QBQA 3POJA 1S4CA 2R7EB 3OGJA 1U5YA 4BIOA 4BQ5A 3GHMA 5DQ0A 2X05A 4AEDB 4AI9A 1CX1A 4FFIA 5FZIA 4P9XA 1PNGA 2WYSA 1ZVFA 4QX2A 3TWIA 3VV1A 4CDUC 3B94A 3LA2A 3UGHA 1JHNA 5IK7A 1EY2A 3VHRA 1GNZA 1SHWB 2P3KA 1QJZA 3AZXA 1U12A 4B4RA 2VZTA 1HQWA 3O12A 5FZ6A 5FYIA 4C1WA 4XYXA 1MS0A 3MDPA 2UY8A 3J26N 4UFKA 5HXVA 2ZHNA 4KWJA 2EIDA 2PYTA 3AFGA 4A45A 3H7YA 5FPAA 1NA1B 4NWVA 2X5IC 3NRUA 1GWMA 1AYN2 3P1IA 1W8UA 2MEV1 1UMHA 4IEPA 1VBE3 2WO1A 2VOWA 5FP3A 4ASLA 2TUNA 4FPEA 4QAWA 3HPNA 5LK7B 4IEOA 2BGOA 4G9SB 1KXGA 3IB3A 2YBSA 1RL3A 1SLIA 4RL7A 4CU7A 1JZ4A 4IL7A 2IZWA 1H2NA 4XXAA 1AR72 2ZGMA 3E6BA 4YW5A 5JXGA 4QDQA 4V2WA 2PHUA 3MUY1 3K48A 3NJYA 1ENSA 2WWUA 3EJKA 4NIAA 3M4FA 1KS4A 1VJ2A 3RI8A 2WA4A 1KITA 1V00A 1JMUB 1R082 2DUPA 3ACHA 5FMBA 1ULDA 3MI8A 1LU1A 3SKJE 2Q4SA 5LRSA 2EAAA 5BXXA 1ZYBA 3HVDA 3VDDA 1S1AA 4I3GA 3ZX7A 4DXTA 4CEWA 1D0HA 3Q8EA 4NPRA 2Z5WA 2Q5TA 3ZYFA 2XQRA 3GBGA 5FZ8A 4EV0A 4PDWA 1PHMA 4KBZA 3SXWA 1XJAA 4LNVA 4FPFA 2JG8A 4LTAA 4QPGA 3FBMA 3WD5A 4CDXA 1J3PA 3CU7A 3KM5A 2BNMA 1LCLA 2AENA 2XOMA 3ZFFC 3JU9A 5JOWA 1MVQA 5I0UA 4CDUB 1FMD3 2QE3A 4BQ3A 1GWKA 1N1VA 5EXOA 4XFFA 4N7UA 3GM8A 2JDKA 5APAA 5BNPB 3S5AA 2CAVA 3WQ0A 3LEGA 4HLTA 3WINE 4ASMB 3UJOA 3R05A 5L73A 4FFHA 4DINB 3AKQA 1PIV2 2E6VA 2Y38A 1WLWA 2YYOA 3DXTA 1W0NA 3TEXA 5C7GA 2YZ4A 1A8MA 2WC2A 5C71A 2DU1A 3B5LB 3VDCA 1B09A 1G8WA 4MO3M 3UETA 4CCDA 1NAEA 1SLCA 2CGNA 2J7MA 3QACA 2LW8A 3H3LA 4ZU5A 1LNSA 3W5NA 1DZQA 1IZ3A 5A3NA 2QQLA 3MW2A 3WQBA 4CCCA 2VZOA 1YFYA 3F2ZA 4HT1T 4YW7A 5I8SA 1LECA 4U36A 1DZTA 1H4HA 2Z4FA 2EIBA 2CAUA 3ZSEA 2A3WA 4CXYA 4LO7A 2WIIB 4XFHA 5E89A 5SV5A 3KWVA 2WSVA 1H6XA 5JXHA 2J1SA 5EPAA 3TNPB 1OKOA 1POV3 4CXWA 1VRH2 3K75B 4GH4A 3B7MA 4H7LA 4ISRA 3VBHC 2D5FA 4PBPA 4W8JA 3GCXA 3HIFA 1D4M3 4IE5A 4M3CB 2XPJA 2XDVA 3UGFA 2DBIA 4L11A 2K2SA 1OURA 4PCRA 2P3JA 5FFOC 2XH6A 4OI4A 4RHV3 5BY5A 2WYFA 5FMDA 3PVBB 2IVIB 3NJZA 4QX3A 3IAQA 4XEZA 1Y43B 5FZ1A 4DB5A 3FZ3A 2ZTNA 4P9IA 2DVDA 4K40A 3H8UA 4QQLA 1VB4A 1IPKA 3OYWB 3VBFC 2FD8A 4CU9A 2JEMA 5F6KA 2Y6FA 1BK1A 1J1LA 1CVNA 3JXSA 1PZ7A 4QMAA 2WNVA 5FZOB 4YGEA 3KVAA 3DUIA 1GR3A 1FNZA 5A32A 4CTEA 2ZMLA 4L2NA 1XE0A 3CKHA 1F4AA 4J1XA 4A7ZA 3EXUA 4I0BA 4JAAA 5FWEA 1AR73 3U1XA 3N4MA 1DIWA 1HRI2 2OXBA 4P9WA 4A41A 5GLWA 3VD5A 1KEXA 2XJQA 4N53B 3VHOA 4RA0A 4EWDA 1T2XA 4LOTA 5LZ6A 4XFIA 4NHKA 1MS3A 1I6XA 1UIJA 2GC2A 3K51A 2WQZC 3HWJA 1Q8SA 4QQHA 2AEYA 3LGRA 4AXOA 3I2HA 4FOQA 5IVFA 1DQ2A 2AGSA 4LULA 3WF2A 3THCA 1FNYA 1IQAA 4BXSV 5FXWA 4IW3A 5I0RA 5JWPA 1OMIA 5LWBA 2QUOA 4DNYA 2ZGOA 5ANQA 1AJOA 4YG6A 4GAZA 1PGL2 3U10A 4YGBA 5C3OA 1AL23 1Q8OA 1W9YA 1W8OA 2HWB2 5FPUA 3OPTA 3VZJA 1O5LA 3QOPA 1RUI1 3USUA 4DOUA 4IESA 2PQSA 3U07A 4E2SA 1DU3D 2I07B 5EQUA 1HB2A 1CAWA 1CJPA 2P1BA 2V4VA 2W47A 4BJ0A 4E27A 2JD9A 4ASKA 1W6QB 3DECA 5IFTA 2Y0OA 3S57A 5E6HA 2G9ZA 5L36A 4I01A 1DGWX 1CZTA 5GKAC 3KZ4C 1V6IA 4QX5A 5D8AA 4B4QA 2OZ6A 1WLDA 3FJSA 4E4ZA 5IAVA 1ULCA 4RHV1 3RPQA 4IV3B 2AR6A 3M70A 1K5MA 4XZUG 3SH3A 5CADA 5K0UC 4FSJA 5FMOL 3FX3A 1MEC1 1OVSA 2OVUA 5HCBA 2LTNA 4ITCA 3S0MA 1PX3A 2BV4A 1W8HA 1OQDA 4NIGA 2XLFA 1JXNA 2B9VA 2WNUA 4URAA 2RS51 1WD4A 4AVSA 4EN0A 1RUC3 4H55A 2WNVC 3AYCA 4HXCA 3DEMA 3SQOA 3ZFFA 2GDFA 2IXHA 2WABA 2Z2SB 5F3CA 5FY9A 1RINA 2QDNA 3AJYA 1AXZA 5EZWA 3ASIA 4AHYA 2XBO1 1Y7BA 4Y1ZA 4D0QA 2JG9B 1QJX1 4QB6A 2UURA 2UWCA 4CUAA 1MS4A 1ZZ6A 1OF3A 3KQ4B 3UL2A 1SBEA 4Q4V3 2ZBJA 1OLME 4GKXA 2XG3A 4QB1A 4O9EA 4FQ4A 5A7QA 2XL7A 4DEQA 1I9RA 1T6BX 2K0GA 3RYPA 2WA3A 3BVCA 3SISA 2JG8C 4H2AA 1VMJA 3MIDA 4AI8A 1BYHA 4A44A 2VZUA 1GUIA 3LIHA 2Y64A 4XCBA 4HL0A 4KG8A 4XIKA 5F5QA 1RUH2 1UYPA 2H6BA 2P2KA 2YB7A 1WWYA 3ATGA 4FI9A 2VJXA 4AVBA 4FT8A 4XBLA 1PGL1 2RS31 2XKOA 2JE9A 3NNMA 2Q0AA 3CJIB 3VBRA 3L2HA 3KSCA 2ET7A 4LMFA 4AR2A 4YWAA 2P6CA 3R0RA 1W04A 5J3UA 1O91A 4OLLA 3DCQA 4ZONA 4IEQA 4JKLA 1PO11 1RVF1 3ACIA 4META 4YFWA 4AYUA 1H8TA 5I0TA 3ZYRA 4NRMA 3SCGA 4HZFA 4KU7A 2BOIA 4QPGB 4W4ZA 5FYYA 3JUUA 2CYFA 1VAKA 4JHTA 4CDXB 3PIJA 4JHZA 2BEOA 1FPN3 3POSA 3SCHA 3VBHA 1R1ZA 4LA3A 1GP5A 4DZGA 5FPXA 1UN1A 3LQCA 3VBSB 3WDUA 4BCUA 4BIFA 5GZCA 1JYWA 4E4SA 1VIWB 2W08A 1UOBA 1CAVA 3B02A 2AH2A 1C8M1 3VUOA 2WWJA 2Y33A 4H7MA 1DGRN 1L7LA 3DF0A 2CNAA 1H6YA 3FN9A 1U5IA 5JLVA 4OMCA 2OT7A 2XUEA 2Y8KA 4XDOA 5GLZA 3IDAA 1EYBA 4CCNA 1IG3A 4QKNA 3ZSMA 1Y9MA 3BKZA 3FL7A 5FO8B 4DUWA 1OSGA 4Q0UA 1QY4A 4Z8BA 1F8VA 3WNXA 5F5IA 1OQ1A 1VRBA 1SFNA 3D4KA 3T09A 4OQ8A 5F6LB 2PMWB 1JZ8A 1XU2A 3H50A 4MADA 1PZ9A 1W2AX 2E31A 1PM4A 1COV2 2D97A 3AMPA 5FK7A 1OUSA 2XBO3 5JI7A 3RYKA 5LA9A 2RMU1 3ZIWA 1LJ7A 4XMIA 3ZIXA 3WDXA 2GP5A 1O3RA 1L7RA 4NJ4A 1QQP1 2RDNA 3H1MA 4NVPA 5FPZA 3WX5A 3ZFGC 3CQOA 4LHLA 2XJPA 1ND2B 4NIDA 3GYDA 2XONA 1PK6C 1TMF1 1AR81 3RMYA 5FZDA 1ZZ9A 3VDDB 1IKPA 3UV9A 3VKOA 4FTEA 2NQYA 1FXZA 1ONAA 2EIEA 2GC3A 3PHMA 3PU3A 4LK6A 1R092 5A1FA 1GANA 2UYBA 1A3KA 1IPJA 2HWC3 2TNFA 3VHNA 3C7HA 5CISA 2K9ZA 5JUVA 2FHRA 2ZX4A 1UNBA 4QU2A 4CCMA 3I3EA 2HYKA 4J25A 1AR63 4XTPA 3OGVA 1UZ0A 5HPOA 3BN6A 1DDLA 2DUQA 3IIIA 2CTVA 4Q1PA 3KT7A 2VTFA 2CV6A 1PNFA 1QQP2 2CHHA 1ASJ2 2XVKA 3LEMA 4CRQA 5F5AA 5BPXA 4Y1VA 2RS32 1H8TC 5C8WA 5JOYA 1DYKA 3VBUA 1I5PA 5IVCA 5ACA3 1AYM2 3SKVA 3THDA 5FWJA 1H30A 3ENRA 4FP3A 4K8FA 2A6YA 1OT5A 3APBA 3MIBA 4IUGA 2VOXA 2VVFA 4QPIA 2YY1A 3J9SA 5FKBA 4DO0A 5C6CA 2YGLA 4Q4V2 3MF6A 5LY1A 1RUD1 4HKWA 4UF0A 4DXZA 4JTOA 1F2NA 2RR11 2RJKA 1YJKA 2A1XA 2K46A 2R30A 5EWSA 4XC9A 1REDA 3NQHA 4BB3A 3ZXJA 3VDBA 3O1VA 5JIUA 2RHPA 2WO7A 3GGLA 4Z92B 4GKYA 3PMEA 2CGPA 5FLHA 3AP6A 3FLPA 1ZBA3 4LHNA 4XF0A 1C8M2 3KMHA 5J37A 2ZHMA 1S0DA 3ZVXA 5FP7A 1QNWA 4QHBA 1X82A 3AVSA 1AX1A 4RN5A 3KD4A 5BUVA 4CA9A 2XKPA 2XWBB 2PXJA 2YBKA 5DAWA 1JN2P 4W6XA 1QH7A 4YYOA 1ULEA 3KHCA 4AQ6A 1NYWA 4AE2A 4E4DX 4AEKA 3VKLA 1WA4A 3HNBM 4LXLA 1IS5A 2WNEA 4NPLA 3MZHA 3JQXA 2JECA 4QM9A 1CWPA 4A6SA 2AREA 2VXJA 2DFBA 2VM9A 3VKFC 3H8OA 1AR83 2B42B 2PHXA 2NMNA 3RWKX 1BBT1 1VBC1 3HT2A 3T2OA 1BVVA 2OZJA 4MYEA 3WP4A 1N3OA 4Y4YA 3T0BA 3I2OA 3ACGA 5D2AA 1EV12 2RS13 3IDBB 3NV1A 4LLOA 4CP2A 1RUH3 5KXCA 3M2MA 3KB5A 4RQPB 4WVMA 1XRUA 4Q4W1 4A7KA 2VVEA 3I54A 4AF9A 1S0EA 2HWF2 3NWKA 2PAMA 3ZLIA 1SPPA 4UYBA 4PQQA 2Q8EA 1ND3B 3WNPA 1NZCA 4IV1B 4QKFA 4MGIE 4BQ4A 1XYNA 2WNVB 5FZOA 3AKTA 1AYN3 4YVWC 3IM0A 3CJXA 3N9QA 3P3NA 3QCWA 1H0BA 4IEZA 1DHKB 1C28A 4NROA 1NZIA 3EMRA 2R0FA 4LO6B 4UF0B 2E51A 3WW2A 1UOFA 3MV01 4J6GA 4RS5C 3TBDA 4XAEA 3VBFA 2XBO2 4OZOA 2VCCA 3ZDSA 3ZXDA 1VMHA 2ZAHA 3ZDVA 3TEWA 2W87A 5KHJA 2GNTA 2D5HA 4F3JA 1CAUA 1G9DA 1SG3A 1DYPA 5LW9A 4CSWA 2O0OA 1RUD3 2B45X 3LA7A 4QX1A 4YW1A 4YW4A 5CEHA 2OQ6A 2YBPA 1O4ZA 2XR4A 4NPMA 4Y22A 3S6PA 5IYYA 1JU4A 5A6XA 5CNAA 3OUHA 2VNVA 2SLIA 3WP3A 1LOGA 2VMFA 4GWMA 1YLLA 2VR4A 1UOJA 2BDRA 5EFUA 5FZCA 3KVBA 3VDAA 3VD4A 1JZ6A 4L0PA 4MGQA 1VBA2 3OD4A 2OPKA 3PUQA 1HN1A 1D0GA 2F4LA 2ZX1A 1MPXA 1S2KA 5HCAA 5A33A 3D8CA 3OTFA 1COV3 2LM3A 2WFF2 2D43A 1SLLA 3LB9A 3MV11 3PUSA 4XJ8A 1KD7A 4FOVA 4Q0PA 4GALA 4YVSA 5FP9A 2YPJA 4CCEA 2BBAA 3N36A 2YU2A 4YG0A 5LBCA 1W2OA 4AHWA 2DFCA 3MF9A 4RGKA 1AYM3 2EXKA 2R0HA 3NNFA 4FOWA 4KWKA 2PHDA 4C0BA 4A7YA 2I2SA 5A6QA 4C90A 1UKGA 4PLOA 3I3DA 3FHQA 1VAVA 4AEDC 2NPIA 5KHGA 5GM0A 2NP0A 2AACA 4AWDA 4D6QA 1UZWA 2A6VA 5J98B 1W9FA 4ET7A 1LESA 3S5QA 1NUKA 4P9JA 2NZ9A 4JRAA 1N1SA 1ZBE3 4Q4W3 4L97A 1CESA 4WM8B 1C8NA 2QDRA 3B01A 1NT0A 5D8AC 1LENA 1E5HA 2IXKA 1NQJA 1UW8A 4BH9A 2X5IB 5DDJ2 4Q4Y3 3HR9A 1PMHX 2B7YA 2FZ1A 1CJDA 1UPSA 1VMFA 5F3GA 3OBRA 5I0SA 2DTWA 3SEPA 3P5BA 3KT4A 3NNJA 5T5LA 1RXFA 4LBQD 4O7XA 5JR7B 2OW4A 4FO9A 1GP6A 3M3EA 2GU9A 3WNNA 1VBE1 5KXBA 1LULA 3O1PA 5FY7A 4BQ2A 1ZRRA 4E4HA 5C5UA 1OOPA 3SH5A 4YM2A 1X8MA 3RZGA 5JMCA 2VW0A 3CF6E 1GP4A 1J3RA 5DUVA 1Q56A 1W28A 3O1MA 4KWUA 5E1RA 5IJRA 1JW6A 1WLTA 1C57A 4Z1VA 1XB9A 1YJLA 1UCXA 1W03A 1TG7A 4CZSA 4HK8A 1US2A 2BFUL 3GJBA 4YZ4A 2ORXA 5F7UA 5IVEA 3GBWA 3CDZB 4AAPA 1RUOA 4FTSA 1RMU2 2G4IA 1PVC2 2GH2A 2E26A 1AF9A 2ARXA 2Y6LA 4CEYB 2ZHKA 5F9TA 4WV8A 4P14A 2EALA 3RMXA 1SACA 2BQPA 4OHZA 1TQ5A 4XQ4A 4ZXEA 4YW2A 4BQ1A 2E7AA 2NLRA 4E2GA 5FZFA 2QQPA 4X6RB 1K42A 5T52A 2VZQA 1ZX5A 2PHFA 3WG4A 4Y26A 4AW7A 1POV0 5H9PA 1WMXA 3WQ7A 1POQA 4D8MA 1C5HA 2KM2A 1JOBA 4ONUA 1LOEA 5T55A 2ZX3A 3Q8AA 4FVVA 4D7TA 2VO5A 2Y6GA 2HWD1 2IXIA 3K3OA 5A3MA 2QZ3A 3RS6A 1SLAA 4CXXA 2OS2A 4R9BA 2VULA 1BCXA 1X33A 1SFYA 3BIWE 5T5OA 3MPBA 4OI1A 1O8SA 4QPIB 2P3YA 1W6NB 3I59B 5ABJB 2A6XA 1AR71 3GXUA 5L9BA 3AL6A 4MUVA 3JBG2 4E8CA 1G9CA 1FAYA 2XGXA 1W2TA 2VXRA 1UU4A 5F5CA 1UAIA 2F4PA 3L2YA 2FCUA 4MXWA 1VE0A 5LCWL 3IN9A 5HCFA 4HN0A 2LALA 5FDBA 5K8SA 2RS52 3VBOB 1KDKA 3ALQA 2GMMA 4CP9B 1N1YA 3UNPA 2P34A 1DQ6A 2L9LA 1HXS2 4CDQA 3AMMA 1NX9A 4Y3OA 4QHOA 1NCQC 2VZRA 4IDZA 3WNOA 1LR5A 4K21A 3T1LA 4ZKTB 1MZFA 4XIOA 1ZZ8A 1ZZCA 1GBGA 3AYDA 1POV1 4IGPA 3NNGA 4LITA 1VBE2 2Q30A 3ZYJB 4OQ9A 1VBA1 5CFDA 2VD7A 1YNAA 2VW2A 3IMMA 3MICA 4Q0SA 1UPIA 2W68A 4LJHA 1S0BA 2VVDA 2HJIA 5DUWA 4RQPC 4D6SA 5L9RA 5DG2A 5FPVA 3HD8B 4TYSA 4WVZA 4LOSA 3N7MA 4EWAA 2ES3A 1ND3C 2FZ2A 3I2KA 5JZGC 4NWWA 2A70A 2DV9A 1RUC2 1K12A 2JDNA 2FBEA 3ES4A 4Q26A 1ODNA 2A3XA 2ERFA 1R083 1S0FA 2YC0A 1QH6A 2Q1FA 1W6PA 2DYCA 1R1A3 2TBVA 4HBNA 1DLLA 4LBOA 1WW6A 3E6DA 3OEBA 3MW3A 5K4LA 1RUG2 3M3IA 2W91A 4QB2A 2W46A 3ZFEA 4AL9A 2BP6A 4BOWA 4DUXA 1RYYA 1F31A 3DXUA 4QPIC 4BK5A 4TXWA 2PTMA 4XBNA 5LA2A 5ABJC 1OLRA 4NN0A 1BQPA 1YFUA 1RUC1 2JDYA 3O5SA 5A32B 4E8DA 3PU8A 2WJSA 5C70A 5K9YA 2DVBA 3H0OA 2B9UA 5JIAA 3VBUC 3KCXA 2D40A 5CU1A 1FMD2 4S2GA 3LCPA 3MIFA 4WBBA 5JZGA 4AEJA 4Q4W2 3DYOA 3VBOA 5IK8A 1U0AA 1ENRA 4A42A 1QDCA 5FZMA 4CP9A 2C6SA 2WFF1 5FUPA 1F5JA 5DDJ3 5DUUA 3TN93 1W2NA 1IS6A 2J42A 2W1UA 1NCQB 3BOPA 3RZLA 3R6SA 3U37A 3WVJA 3IMNA 4JGYB 2A75A 3AZVA 3IPVA 1YIPA 2BERA 4TWTA 2VGDA 2W39A 4Q5OA 5FJHA 1OA4A 3C7FA 3HNYM 4Y20B 3MLLA 4XFAA 5D21A 4HPKB 3UK9A 3DPRA 4FPGA 4GWIA 3ABZA 1OA3A 5FZ7A 1S2BA 4B4PA 3LPFA 3VL8A 2R1BA 2VZ3A 3OF1A 5A33B 2BW8A 1Q3EA 5C4WA 3VLBB 4N43B 4BLJA 4KI5M 2X10A 2JJ6A 2XLAA 1MEC2 3H1YA 1CPMA 5JZGB 4D6RA 5DUXA 2BGCA 4ZZ5A 2JENA 2R042 3LE0A 2JXAA 2ZGPA 3BPSA 1WLCA 2WAOA 1PO13 2A73B 2YFUA 3NV3A 1BZWA 4AGGA 1OF4A 4IERA 5FXXA 3O1SA 3A7QA 1JYTA 3FE5A 3IWZA 1ND3A 3OG2A 5ANNA 3U4XA 1JOJA 2BWAA 3NAPA 1QXPA 4WZCA 2R6QA 3E97A 3ON7A 4V2VA 5I93A 3PDQA 4COWA 4N43C 2UWAA 5GLUA 1W05A 2BFUS 1BKZA 2AUYA 1W90A 3MFAA 4B7EA 4B3NA 3OEAA 4YM3A 1RUE2 5KHKA 1JYIA 4QGMA 3VBFB 4ES8A 3LDRA 2RS53 1EPZA 3RZZA 3BIEA 3W5MA 1WZXA 5FOJB 2XHNA 5JSOA 1VBC2 2LROA 1UZVA 4Z82A 2V73A 1CR7A 5A7WB 3H8RA 2VZSA 4FBFA 2E9QA 4WVWA 1UY2A 1H4GA 2ZMKA 5FY0A 4Q4X2 4XUQA 1TE1B 1MZ5A 1Y9GA 3R4DB 2YMZA 4XF1A 1NLQA 2OUJA 4XE9A 4AGRA 4QX8A 3WF4A 5AVAA 1RUF2 1XC6A 3IPVB 2DCTA 3ZXGA 3BTAA 1J59A 4E9KA 4BZ4A 2W1QA 2HBTA 4RFRB 1LEMA 1LGNA 4NRQA 1EAH2 2FCTA 4EJRA 3RJ2X 5C3SA 4KBBA 5CVRA 2ZEZA 1S2EA 3I2GA 4PHZA 3FHAA 4BHPA 3WR0A 2ET1A 5H9RA 5FYVA 4LEJA 4RR3B 2XJRA 3LZZA 3WW1A 1DQ1A 3ZXAC 5BNNA 2CY6A 1BEV2 2JG9C 1E5RA 2WNUC 4X8NA 1FATA 2Q8CA 2RS33 2R063 4QXHA 5DAVA 5JXJA 2DCYA 2KD7A 3OUIA 3VL9A 3ITQA 1UL9A 1UX7A 2VL4A 4CEWB 1W8WA 2JDZA 5CB7A 5IK4A 2WQ4A 4JGZB 3AKRA 4XJUA 2DVGA 2JG8B 4X6QB 5FMOS 3CNAA 4N90A 1ZM1A 5FP8A 3NNLA 4PLMA 1FPN1 4CYDA 2IC1A 3POEA 4PF5A 2XHKA 3PUAA 3VBHB 1W6OA 4Q0VA 1WMEA 1YWKA 1GZWB 2EVXA 3N7LA 4PDWC 4JGYC 1V9U2 5EJZB 5FREA 1QGLA 5GJ6A 4IGQA 3PVNA 3NSTA 5DMYA 1ASJ3 1YXWA 2UYAA 4CEWC 1YUDA 1VAMA 3GZAA 1UX6A 5H9SA 4FXKB 1MS9A 5LY2A 5FZHA 4MSVA 4P00B 3N9MA 3RNSA 5FV3A 1VB2A 1YIFA 5C3RA 4FPHA 2P37A 4UFHA 4C1XA 4P02B 3POYA 3FWEA 1SCRA 1MZ6A 1US3A 2GN7A 4RSUA 5CFDC 3S7IA 5M0TA 4ZHNA 4QXKA 1WCKA 1TME1 3NJXA 5B2GB 3ZMNA 3AXDA 3L9JT 5CA6A 4NHLA 2RM23 3JD73 1DGLA 1MQTB 2IWGB 1OPOA 3AP9A 3T3YA 3H3UA 2CL2A 4JC1A 1QNYA 1V6NA 1S0CA 5EP9A 3DN7A 5C33A 1KDMA 3KV6A 2C1FA 5FY1A 4BLIA 3VB9A 2IFWA 1T6GC 4P9YA 5JOXA 2BJSA 2PFWA 4QU1A 5FY4A 1S0IA 2YC2A 1NQDA 3AB0A 1QXRA 5CFDB 3U0ZA 2BYVE 2HWC1 5DZEA 2WO2A 3KCYA 4R9CA 4OUSA 1W0OA 1SBFA 1LHVA 2CGOA 3VD9A 2PA7A 3J8F3 1H8TB 4JGZA 4KL1A 2NM1A 4E2QA 3B69A 5L7OA 4Y24A 1H2MA 2OKXA 2QVSB 2ATFA 1VBB2 3DPRC 3K46A 2OUHA 4NRPA 4PQ9A 1D4M2 3PUHA 1AUYA 1VBD1 3Q8CA 5EYYA 4M0HA 4BMEA 5DZGA 4Y5SA 4I0WB 1LKNA 1L7QA 1X8EA 2ZAAA 3CIHA 4PBOA 5FJKA 3VBOC 4WM7C 5C4WC 4W6WA 5IVJA 1LRHA 2YU1A 4K6BA 5BNOA 2H0BA 4YM0A 1C3HA 3NVCA 2VECA 1PO12 3RDIA 4EROA 5IW0A 1AXYA 2ZABA 5F1RA 4FPLA 3BU7A 3ZYIB 3PVEA 3AYEA 1EV11 4BPZA 3I49A 3AX4A 2PLV3 1FI2A 3N7KA 2VPVA 2MNGA 1ULOA 2E53A 1AHSA 3DYPA 5L9VA 1FPN2 5AFEA 3M8LA 1Q5OA
chains in the Genus database with same CATH topology
4FAGA 3ZXKA 5BNPC 2DCKA 2P17A 5JAXA 3LSEA 3ZYGA 4C0HA 1ZRDA 2GNMA 1LHUA 1LOFC 2X53S 3MEPA 1Q43A 4RGAA 1M4WA 5FPXA 1YRZA 2VMIA 2ZGQA 3KCCA 4Y1YA 3SMHA 1OFSA 3JB4C 4P5HA 3T1MA 1V6KA 2DUOA 4Y20A 3KGZA 4XW3A 2E7QA 4HVOA 2WINB 4DFSA 1WUVA 1D2SA 4XQWA 2PAEA 2D7FA 2PHLA 1EAH3 4GB31 4GMP3 1BMV1 5FQ0B 3B9IA 4N43A 4FAHA 1G6NA 3B9CA 1SBDA 2V5YA 4M3CA 1RMU1 2ZJCA 1NLRA 1QWRA 4YZ1A 2EXIA 4FPYA 1V9U3 3BCWA 1FOD3 3TB0A 1OPMA 4XJZA 1DF0A 2EXJA 1EPWA 5J7MA 1MACA 1Y9QA 3DGTA 4MGYE 5EYXA 4BYYA 2P3IA 3FHIB 3WG2A 1BEV1 4Q4X1 1ZBE1 2D6PA 2VNRA 4S2DA 5FCCA 3CO2A 4QD2A 4W6YA 4IV3A 3H3ZA 4B29A 3KGLA 1GFF2 3HBZA 4WM7A 1QOTA 5DXDA 1XYPA 2ZA9A 4ZU7A 3INAA 1JYCA 1I3HA 2YXSA 3PLQA 5CFCA 1MQTC 4XPVA 4Q29A 3HN1A 1O7FA 1UKRA 3OY8A 1PM7A 3AZWA 1J58A 1SLBA 2PQQA 2PLV1 5EJ3A 5ACA2 4I09A 4N53A 5TSWA 4CP1A 1V70A 2JKBA 4INDA 4Y22B 3T2TA 1PVC3 1CGPA 5GZEA 4B8EA 4LR4A 4X8PA 2WLQA 2XJVA 4HVQA 4RS5B 4IEUA 1BJQA 2E7TA 3KLSA 1V6LA 4M00A 4GH4B 1LODA 3J8F2 5FLJA 4Q27A 5CIRA 1COV1 5BYNA 1QJU2 4Q8LA 1C5IA 4LO4B 5JDBA 1FX5A 2R32A 4D94A 1B35A 4XFBA 2XL9A 3PNAA 5KXEA 3CJIA 1G9FA 4N9IA 5FAXA 1U5ZA 1H1AA 1HKDA 4DS0A 4FPKA 1O3SA 4DY3A 1RMU3 1Q8QA 1CQ9A 4MGKE 5J36A 4MX3A 2YUEA 4XILA 5D8AB 3ELNA 3FUOA 4HKLA 4F83A 1YYNA 3WZ1A 4JVAA 1GNHA 3ROUA 4DRVA 1QJY1 4NHMA 1XU1A 2ZS6B 2WZPP 2ZOEB 3ILNA 5GZGA 1VBB3 1RUF1 3QLQA 4H14A 3P3PA 4AVCA 5J96B 4Y5Z0 2XWJB 3KT1A 3ZFFB 4COYA 4JRLA 4Q8KA 5JCTA 1NE4A 2BBVA 3M1HA 4TSVA 2WLPA 3WDVA 1WBLA 2D3SA 1LGCA 1VRH1 1DQ5A 3PMSA 3NL1A 2PLV2 1J3QA 3VZLA 2Q8OA 4R9DA 1RC6A 4LBQB 1QDOA 2VH9A 2ZGNA 4M3CF 5CAZA 3CLPA 1RVF2 4DPNA 5FTTC 3B00A 4D7SA 2GALA 1YFWA 3IDEA 4LBKA 3USSA 1HXS3 2EAKA 2KXLA 3G7DA 4OHYA 4UXAA 3LOIA 1OQEA 4LBMA 1VALA 1W6MA 4AI1A 4CDWB 5BNNC 3V65A 2DVFA 1G86A 2HWB3 2QFEA 5FO9B 4LE3A 2EXHA 1L3JA 3EO6A 4COVA 3FFZA 5GALA 1SQ4A 2YGMA 4QGNA 1H9PA 4WVVA 2VY0A 3A0NA 2R073 4AFBA 4XJAA 2CWMA 1LOFA 3W59A 2D44A 3WP6A 1QJY3 4OUMA 3UJQA 4BM8A 2A7AA 1SMVA 1G9AA 3MIHA 2GNDA 1LHNA 1REEA 2RJLA 4AVAA 4Q4V1 1NG0A 1HRV3 1Z7S3 3I8TA 3POWA 3C2UA 4HN1A 2D3RA 3Q9OA 5DDJ1 2Z79A 3VN4A 1D4VB 5EV7A 3GALA 5T54A 3JBG1 1YFXA 2WZR1 1APNA 4AI0A 1ZZBA 2ETEA 1KS5A 1MVEA 5AVPA 4R8HA 2GC1A 1GICA 3THTA 2JD4A 3ECQA 1PMIA 5FO7B 4P9LA 5T5JA 4N53C 3LSDA 4FOYA 4IEXA 3WP5A 3WXPA 3PJQA 3WT3A 5JPNB 5BNOC 3D82A 1D4M1 1IS4A 4LLFA 2W52A 4XJWA 2N7GA 3W9AA 1AZDA 5E1RA 1LGBA 3LKJA 3OCPA 1NCRA 3C3VA 4MH0E 3RRDA 4K9SA 4Q2FA 4AEDA 4U2AA 4B7KA 4LBLA 2HWE3 3WDTA 3ACLA 5C8CB 4IXLA 2ENRA 4F7ZA 2BNNA 3VBUB 5L7OC 1KJLA 1CAXB 2ZACA 3UKVA 2MPFA 1DFQA 3LOBA 1XNCA 2HKXA 3I59A 3QD6A 4OHWA 1A78A 3ZMOA 2XJSA 1NA1A 1IGOA 2GNBA 2GN3A 4PIXA 2B39A 1CD3G 4GWNA 4BMBA 4PJYA 4HSJA 3ZSKA 4AI3A 4XETA 2WFF3 3TN91 3OBTA 2KA3A 2FMYA 3G6JB 2C0ZA 4HMZA 5CBLA 1HRV1 1Z7S1 5HBAA 1FV2A 5DG1A 4MLOA 2VOVA 3BODA 1U5XA 3AYAA 3FLTA 4GULA 3JBG3 1UZYA 2WZR3 3WLUA 3WQ1A 2DURA 5H9QA 4CDXC 1MR5A 4HPKA 3MGUA 4HSLA 3UKTA 3ZXLA 4XJ9A 4AI2A 2ZHLA 3HAGA 3FUQA 3AMNA 1MZEA 4L8QA 4LE4A 3SH4A 4DRRA 4COZA 1S0GA 1XNKA 1RUI3 2RMU2 3VZOA 4QQOA 4CDUA 4G3YC 1VLNA 5ACA1 2VW1A 1H9WA 1UD1A 2O1QA 3OYWA 4R9AA 1QJY2 1PIV3 4KQ7A 4AQSA 1XE8A 1YI9A 4GQ7A 1V6MA 1Q8VA 4I02A 2HWE1 1URXA 5CFCC 1AR62 2PELA 1CPNA 5GLTA 1HDKA 3QH6A 4AVVA 1RTVA 3ZO0B 1ZBE2 2X5IA 4Q1RA 4IEYA 4FP2A 2H6CA 3B3QE 1HX6A 4FTBA 2A6ZA 1HW5A 3J4UH 2WS91 3GZUC 1GV9A 2R1DA 4NR1A 1CN1A 1UF2C 5JSRA 1JTZX 2A5ZA 4I0AA 2IXJA 1LOBA 3ZN6B 1OHFA 3MIGA 4MXVA 4L9BA 4UW4A 3O0WA 1BBT2 1CIWA 4XMAA 2RM21 3DPRB 3JD71 4J1WA 2ZGRA 2BNOA 4FXGB 2ZKNA 2C9AA 3EQEA 3CJIC 1RUJ1 5C4WB 3IDCB 1N3QA 1ZBA2 4AFMA 4OVEA 5JZGA 1RITA 2HWD2 4ES9A 1BXHA 4LBJA 4CDWC 4QM8A 5BNNB 2PN5A 4JTNA 3WUDA 1QU0A 5DZFA 5I8TA 3RG0A 4A3XA 1N47A 3BOWA 4RQPA 4DY5A 1X7NA 1RUJ2 1XNBA 1TMF2 4QGLA 4IEVA 1GKBA 5GZDA 1K5MB 3WUCA 4RR3C 4C91A 4COUA 2QCSB 3VZMA 1LOAA 5J09A 1A8DA 2RR12 4KWLA 3TAYA 1PIV1 4L99A 4I30A 4WM8A 3CL1A 3X29B 4OHXA 1AXKA 1CAVB 1GQHA 1EV13 3LAGA 3N3HA 3D5OA 4XTMA 3N7JA 1G9BA 4AGVA 1NCRC 1JBCA 2ZGSA 2HWF3 4RD7A 2ZGTA 2VU9A 1OLQA 2JG9A 5ABJA 1O3TA 4AQ2A 5K0UA 1WMDA 2SBAA 3RJRA 2D3PA 1ZRFA 1NXD1 1RUE3 3NO8A 2YHJA 4EN8B 4KGGA 1SCSA 2VOKA 5LEJA 2BPA2 3RQ0A 2A71A 1H2LA 2XVLA 5LK5A 2HWC2 4Y1UA 4UBGA 3RSJA 1HRI3 4EWEA 1LB2A 1RUI2 2RMU3 1ULGA 1HV0A 2DVAA 1QKQA 2OYZA 2MHFA 1QQP3 3TOJA 3ZFGA 3GNEA 1AYM1 1CAWB 1RJ8A 1WCDJ 1R1A2 4MV2A 1PVXA 4LO5B 3VBRB 4LHKA 5AFBA 5A3LA 4CDWA 1RHI1 1RUG1 3GZTB 4NO4A 1PGW1 5E8AA 2WZR2 2VMGA 5I8YA 3NKGA 1AR93 1FOD1 3MLJA 3ZSJA 5L7OB 4IETA 1VP6A 3FMGA 1V6OA 1EP0A 3O14A 1O3QA 2BWCA 1I1EA 1R091 1UU6A 1BEV3 4MGZE 4YGDA 4RGGA 1C4RA 3WW4A 2DTYA 4AHZA 4Q4Y1 3I7DA 5GLVA 5C8CA 3ZYPA 3VBRC 4YZ2A 3QH7A 2C5DA 1AX0A 4D3WA 3WCSA 2YROA 3MYXA 2HEYF 4K1ZA 1CAXA 4MVTA 3M7AA 1NLSA 4I3PA 2H0VA 4CDQC 1B35C 1WMFA 1I5ZA 3NAPC 2ZZJA 4FPJA 1AVBA 4XFCA 2Z42A 5IT6A 4LO8A 4YZ3A 4CP0A 3MIEA 2GSYA 1OOPB 4N9HA 2ZX2A 5AC92 3R4UA 2BVVA 3WDYA 1HIXA 4LUMA 1JH5A 3AKSA 3N35A 4JDNA 2EIGA 1V6JA 2VQAA 1RJ7A 4CDQB 4YSFA 2OIIA 4RHV2 1ND2A 2WWSA 2YDEA 4F8AA 4O9GA 4DMIA 4UBHA 2UY9A 1KFXL 3AP7A 4LT5A 4YLZA 3AM2A 2WFPA 3WG3A 5L19A 4H3WA 1ENXA 4EN6B 1EAH1 4GB33 4GMP1 2G9FA 5JPMB 2V09A 1Q8PA 1XE7A 4M3CE 1AJKA 1NCRB 2XJTA 1QJU3 1V9U1 4PIZA 2AZ5A 1VBC3 1RHI3 2DF7A 2HWD3 3JB8A 3E5UA 3VBSA 4XZPA 2PHRA 5FBZA 2ZCWA 4XHBA 2X8KA 4K1YA 4AK3A 1W6PB 4Y1XA 3PVOA 4Q4X3 1RUH1 3JQWA 2O8OA 3WCRA 2B8MA 5C9AB 3V0BA 3MW4A 3W58A 2GAUA 4OFGA 1NA1C 1RUF3 1W6NA 2QNKA 1NY72 1ULFA 1DG6A 4SBVA 3ZN4A 1AYN1 3ZN5A 4BA6A 4XOGA 1PK6A 3SITA 4AEMA 2F6BA 2ZMNA 1MS8A 1G7YA 2FMDA 1Y3TA 2BTVC 3BALA 1GZ9A 2GH8A 2DU0A 4R4XA 5I91A 1LEDA 4XFGA 4TZDA 2IXLA 3ILFA 4DQAA 1REFA 5KHIA 1DQ4A 3D0SA 2QJVA 4Q0QA 1PO22 4AG4A 1NCQA 3URFA 5J48A 3NV2A 5AC91 4YW3A 2A3YA 3R4SA 3MPPG 2PHTA 3MFCA 4ZU4A 1OKQA 3KS7A 3AZYA 3DL3A 4KGQA 4HVRA 1YCIA 1Z0HA 4OULA 3OD0A 5FQ0A 1WGPA 3UKNA 1QOOA 4V1PA 5KHHA 2B5HA 2XVGA 1B35B 3HT1A 1R1A1 4YG3A 2ZZQA 5E16A 2R49A 3E5XA 1KFUL 1N1TA 2ZKLA 3HMYA 1WW5A 1RGSA 4FPCA 1H1MA 4YNIA 1S0JA 3ME2A 1FMD1 4XBQA 1GZCA 1RIRA 1WD3A 4QT6A 2VNOA 1MS5A 1DQ0A 2A6WA 1NE6A 1HRV2 1Z7S2 2R071 2ZGKA 4QQPA 3U11A 2G9GA 2Q1ZB 2VNGA 1VBB1 1F9KA 2YV8A 4ATEA 3BPZA 1GZWA 5T5PA 4M01A 1N3PA 4AVTA 2RM22 1SDWA 3D0JA 3ZXEA 1J1TA 4JV4A 1UIKA 2GMPA 2VG9A 2FQPA 1A6CA 3MLKA 1YO8A 4JGYA 1VRH3 2Z69A 4HK9A 2XJUA 4XF9A 3TNQA 3A4UA 1AX2A 4JQRA 4RFT0 4WZFA 1PO21 4JDMA 3M3CA 4LBQA 2I45A 4ORFA 5IUQA 1TME2 1AL21 2GZWA 4CEYC 1ALYA 1QJX2 3WDWA 3NW4A 1Z78A 5C8CC 2Q1MA 4YVWA 3AP5A 4OZXA 4GA9A 2HEWF 5AC93 4JCKA 3ETQA 4EN7B 1HXS1 4PIYA 1C1FA 4BE3A 1W6QA 1BVP1 5T3NA 3ZPYA 4Z07A 4G4FA 1O5UA 4XHXA 1JUHA 4AQTA 5D1IA 2IXCA 1W39A 2HWB1 2D6LX 4S2FA 5SV8A 4GB32 1BMV2 1C1LA 4D69A 2JICA 1VR3A 3GHNA 4YFZA 3AZZA 1MEC3 2XB6C 1KJRA 3TRSB 5FOBB 2WNUB 3E6CC 1MS1A 4P9GA 2WT1A 1DBNA 3VKMA 1KQRA 2R043 4IV3C 4Z2WA 1IHMA 2D93A 1OD5A 2WT0A 5E88A 3FLRA 1FYUA 3SCFA 2OA2A 2GMEA 2DWRA 2XLGA 1H1IA 3VGIA 1XXNA 5IK5A 4JGZC 4YVSC 1YI7A 1ZZ7A 2IFRA 5KC5A 2E63A 3FFQA 1FV3A 3I4IA 2UU8A 5KXDA 1PGW2 4I2OA 3WW3A 4QPYA 4TLFA 2JX9A 3JZVA 4PLNA 5FLIA 1X36A 1QHDA 3IT8A 3S7EA 3VDDC 1W2UA 4ZXKA 4AHXA 2VUAA 1RUD2 3AFKA 2WS92 3V0AA 3HQXA 1UMZA 1H2KA 4YVSB 4M0NA 3WHTA 4IV1C 1O4YA 1PO23 3WV6A 4UW3A 3PTYA 4D7YA 1ZREA 4UW5A 1W6MB 4GMP0 2EA7A 3O0VA 1VBA3 4A2UA 2HEVF 1OFNA 4N7IA 4IQPA 5JOZA 1AL22 1RVF3 3M3QA 3RYRA 4Q4Y2 3AMQA 3H9AA 4LBNA 2MEV2 1W6OB 5HI0A 2X29A 3ILRA 4GXLA 5BNPA 1R081 3RWNA 4QPGC 3ZSLA 1C8M3 1QF3A 4AFCA 1FOD2 1LOCA 1LTEA 3E5QA 1ZA4A 2ILMA 5C9AA 3SNMA 2D6NA 1PZ8A 1ENQA 4K20A 1WW7A 1WBFA 3THPA 2R041 3VHPA 1UZZA 1TNRA 3WG1A 1PK6B 5CFCB 3WOGA 4MXWB 2ZGLA 3PJYA 4GIQA 2RE9A 4KNCA 2R16A 1TME3 1DZRA 3DKWA 2NYYA 1QJX3 2VQ0A 1FT9A 2R072 1IKQA 2ARBA 1PGSA 4BWOA 1AL0G 3TYJA 3EBRA 1MQTA 1HV1A 1DGRA 1O4TA 3H1WA 3AXEA 3V0AB 4XF3A 1GQGA 3AK0A 3AMHA 1K5MC 2WSUA 2Y0IA 3FC0A 1TEIA 1RUJ3 1TMF3 1GYKA 3NKTA 1GLHA 2NN8A 4HKOA 1UU5A 2DCZA 4GH4C 4UW6A 3VZKA 3ZXFA 1E57A 4JDOA 4PDWB 1ND2C 2XUMA 1ZNPA 1VBD3 2LUWA 3VBSC 1LU2A 3ES1A 1HQNA 2TEPA 1H8VA 1CX4A 1S55A 1NY71 3I2DA 4URTA 3NV4A 1LHOA 3BB6A 3OPZA 4HFSA 3VZNA 2W0XA 2ZX0A 3V0BB 4EN9B 2QZ2A 3NAPB 1RUNA 2WKKA 3B93A 4KG0A 3D6EA 1XYOA 4QQ2A 4WM7B 1OOPC 4ATFA 2CWSA 2PAKA 1QMJA 1QXJA 3EHKA 2HWF1 3H7JA 2RR13 1CONA 1OI6A 1M06G 3V56A 3OY8B 1CAUB 4W65A 2WS93 1ZBA1 5JI9A 4L92A 3ST7A 4NOTA 3KQRA 2UWBA 4YRDA 1NXMA 2R062 1WW4A 2DCJA 4K7JA 3GBFA 5K7PA 4R4ZA 5LRRA 1DGWA 5JVVA 3ZN6A 3RI9A 3IIAA 1IS3A 4RS5A 3ZFEC 1HLCA 1WCSA 3AP4A 2O8QA 4SLIA 2JE7A 1QOSA 3O0XA 4OHVA 5KBFA 4OI0A 2Y26A 4YVWB 3SLIA 1X50A 3USUB 1KRIA 1RUG3 3LWCA 1D2QA 2WT2A 4XF4A 3SHRA 2R061 1AR61 4KH9A 4WVMB 2VMHA 3WHUA 1SLTA 2RS11 4LA2A 3AJZA 1TNFA 4FCAA 3ZFEB 4S2HA 4KU8A 4IV1A 1R093 5BV6A 1LHWA 1HQLA 3M3OA 4ISQA 2ZGUA 3LA3A 1SEFA 2ZPXA 4XXPA 3V64A 2NMOA 3IKWA 1RB8G 1AR92 1YHFA 4XDQA 1XNDA 5CG8A 2WL1A 2AYHA 4IEWA 4K3UA 2B46X 3DV8A 3VKNA 5GZFA 3CEWA 1JUIA 2PHWA 4FQZA 1XQNA 3WY6A 2MEV3 3OJBA 5KC6A 4YARA 5BNQA 2EF6A 3JD72 3IBMA 1ASJ1 3S30A 3JCIA 1PVC1 2VUJA 1GSLA 3O7OA 5K0UB 1ZRCA 2BUKA 4AFDA 4LUKA 1RUE1 3OGGA 3GF6A 5KWRA 4AFAA 4YGCA 1IOAA 1W0PA 1OA2A 5CG9A 1HRI1 2GC0A 1AR82 4OI2A 4RR3A 4MZUA 1VBD2 3A0KA 4FPOB 5FRAA 3TN92 1RHI2 4R52A 2D6MA 2RS12 3AKPA 5C9AC 4HETA 2HWE2 4WM8C 3ZFGB 4YM1A 5T50A 3FBYA 2D6OX 1NOVA 2D6KA 4CEYA 1BBT3 4HANA 1F5FA 2I74A 2D98A 1AR91 1QJU1 2BVBA 2QKDA 4XQDA 3J8F1 4YZ5A 5LEKA 3QBQA 4BIOA 3OGJA 1U5YA 3GHMA 4AEDB 4P9XA 1PNGA 3TWIA 1ZVFA 3VV1A 4CDUC 3B94A 3LA2A 1JHNA 5IK7A 1EY2A 3VHRA 1GNZA 2P3KA 1QJZA 3AZXA 1U12A 4B4RA 1HQWA 3O12A 4C1WA 4XYXA 1MS0A 3MDPA 2UY8A 3J26N 5HXVA 2ZHNA 4KWJA 2PYTA 3AFGA 3H7YA 1NA1B 4NWVA 2X5IC 1AYN2 2MEV1 4IEPA 1VBE3 4ASLA 2VOWA 2TUNA 4FPEA 5LK7B 4IEOA 4G9SB 1KXGA 1RL3A 1SLIA 4RL7A 4IL7A 2IZWA 1H2NA 4XXAA 1AR72 2ZGMA 3E6BA 4YW5A 2PHUA 3K48A 1ENSA 3EJKA 3M4FA 1KS4A 1VJ2A 3RI8A 2WA4A 1KITA 1V00A 1R082 2DUPA 1ULDA 3MI8A 1LU1A 5LRSA 2Q4SA 2EAAA 5BXXA 1ZYBA 3VDDA 1S1AA 4I3GA 4CEWA 1D0HA 4NPRA 2Z5WA 2Q5TA 3GBGA 4EV0A 4PDWA 1PHMA 3SXWA 4LNVA 4FPFA 2JG8A 4LTAA 4QPGA 3FBMA 3WD5A 4CDXA 1J3PA 3CU7A 3KM5A 2BNMA 1LCLA 2AENA 3ZFFC 5JOWA 3JU9A 1MVQA 5I0UA 4CDUB 1FMD3 2QE3A 5EXOA 1N1VA 4XFFA 4N7UA 5BNPB 2CAVA 3WQ0A 4HLTA 3WINE 4ASMB 3UJOA 3R05A 5L73A 4DINB