5I93A

Structure of mouse acireductone dioxygenase with ni2+ and 2-ketopentanoic acid in the active site
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
179
structure length
179
Chain Sequence
MVQAWYMDESTADPRKPHRAQPDRPVSLEQLRTLGVLYWKLDADKYENDPELEKIRKMRNYSWMDIITICKDTLPNYEEKIKMFFEEHLHLDEEIRYILEGSGYFDVRDKEDKWIRISMEKGDMITLPAGIYHRFTLDEKNYVKAMRLFVGEPVWTPYNRPADHFDARVQYMSFLEGTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase
publication title Metal-Dependent Function of a Mammalian Acireductone Dioxygenase.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
total genus 48
structure length 179
sequence length 179
ec nomenclature ec 1.13.11.54: Acireductone dioxygenase (Fe(2+)-requiring).
pdb deposition date 2016-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03079 ARD ARD/ARD' family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5i93A00
1I6XA 2XKPA 1UIKA 3E6CC 2GC0A 1DZTA 3DL3A 2IXIA 4R8HA 2QNKA 1ZZ8A 2UYAA 4HSLA 4O9GA 3BU7A 2CAVA 1YHFA 1FXZA 3GBFA 4KL1A 1QY4A 4Q0QA 4QGLA 4PIXA 4F7ZA 4JTOA 4QMAA 2E9QA 3KMHA 2PAMA 3UKVA 3G7DA 5E16A 5AVPA 3H7JA 3RYKA 3I59A 4YARA 4YNIA 3H1MA 5LRRA 3NJZA 3RZZA 4MGYE 3U0ZA 4WZCA 4BYYA 3EBRA 3I7DA 4MX3A 3ES1A 3ELNA 1NXMA 1XRUA 4D7TA 4EWAA 3KGLA 4XFBA 4LEJA 1CAVA 4E2GA 2GAUA 1NZCA 2ET1A 4Q0PA 5KBFA 1YWKA 3CJXA 3MYXA 1DGRA 4I09A 2ZCWA 4HLTA 4IEOA 2Q0AA 3E6DA 3SCFA 1NE4A 3I54A 1CAXA 3LAGA 5KHIA 2HKXA 1UIJA 2C0ZA 5I8SA 4NVPA 1J3RA 4HSJA 1OFNA 4HBNA 4KU8A 4KWKA 5I8TA 2EA7A 1X7NA 2XLFA 3EO6A 4BH9A 1CAWB 4L11A 2CV6A 4HVQA 1RUOA 3H3UA 4KU7A 2BNMA 3ETQA 1EY2A 1Q3EA 3RPQA 1YFXA 4P9GA 3H1YA 2GC2A 2OZ6A 4AVCA 4H7LA 5FCCA 1QXRA 1RTVA 1X8MA 1XE7A 2EVXA 4FBFA 3BPZA 5J48A 2VPVA 3EQEA 5I0TA 5F1RA 2BNNA 1UPIA 2MHFA 2PFWA 1X8EA 2GU9A 4J1XA 3OD0A 3BALA 1CAUA 3FHIB 2K9ZA 3PLQA 5BY5A 4XFCA 2GC3A 5D1IA 1EP0A 1O3TA 2GH2A 4Z82A 1EYBA 4IEZA 1G6NA 1UCXA 4CYDA 5JAXA 5FQ0B 5KHKA 3IWZA 1V70A 3FJSA 3H1WA 3SXWA 3SCGA 2IXKA 3DV8A 4LULA 2D5HA 4XFAA 2O8QA 4OLLA 3LA7A 2VQAA 2Y0OA 4HMZA 4KWJA 1ZZ9A 2CGPA 2MNGA 4Z07A 3RNSA 2ET7A 1O3QA 2Z69A 3CEWA 4XF0A 2B9UA 3S7EA 5C8WA 3NSTA 3QOPA 5E1RA 1XE8A 1CGPA 2BNOA 2QDRA 4D7SA 1O5UA 4UBGA 3U11A 1SEFA 4JV4A 1I5ZA 5JSOA 3PNAA 4QGNA 2PTMA 5JCTA 1FI2A 3BCWA 3LZZA 4AXOA 5FLIA 1LB2A 4X6RB 1YFWA 4F8AA 1FT9A 4LUKA 4K8FA 2PYTA 4QM9A 1J3PA 3MZHA 2XLGA 3IDBB 4I01A 4JTNA 1ZNPA 3VHRA 4LUMA 1J3QA 3WW2A 4EV0A 2UYBA 5FQ0A 3E6BA 3USSA 2D40A 3S0MA 3OTFA 2OZJA 4IEUA 3M70A 3E5XA 4KWLA 4QGMA 3UKTA 3D0SA 1J58A 4Q0VA 4IEWA 4IERA 2XKOA 3FZ3A 2H6CA 1PM7A 3SMHA 2OA2A 3RYRA 1O5LA 1O7FA 1ZVFA 1RGSA 2XGXA 4XFGA 3EHKA 2XHKA 2XL9A 4QX5A 3H50A 4B29A 4HVRA 5JSPA 1VR3A 5FPZA 4MGZE 1ZRDA 1OI6A 4YRDA 1IPKA 3IIAA 5HI0A 3LOIA 2ZKLA 4IETA 4FAHA 3R6SA 3QACA 4IEXA 2EAAA 1NE6A 2PAEA 4EROA 1CX4A 4N9IA 4RD7A 1O3RA 4IEVA 5I8YA 5I91A 3LWCA 4XF9A 1Y9QA 1J1LA 2PHDA 4R52A 4XFFA 4ZU4A 4WBBA 5T3NA 3KGZA 5LRSA 5JSRA 5LEJA 1H1IA 3ES4A 2KXLA 1VP6A 4ONUA 3O14A 3D0JA 2P17A 3KSCA 3OF1A 5LEKA 3NL1A 4MGKE 1UW8A 3ROUA 4DINB 4IEQA 1GQHA 1LRHA 4GULA 2PAKA 4O9EA 2GC1A 5CADA 1RC6A 4E2SA 1ZREA 1Y3TA 3OCPA 1OMIA 1TQ5A 4MGIE 3OGJA 3BB6A 3FX3A 2XL7A 3ST7A 4YYOA 4Q0UA 1OD5A 1ZZ7A 5I93A 1WLTA 1CAWA 5EFUA 2OPKA 5I0SA 1ZRFA 2IXCA 2K0GA 4XF3A 3KCCA 3CO2A 4I0AA 4Q29A 2Q30A 3NKTA 4JVAA 1ZRRA 1O4TA 2Q4SA 1YUDA 5FLJA 4I02A 3LA2A 1YLLA 3M3IA 2O1QA 3E5QA 1CAVB 5CVRA 4BHPA 3WW1A 3MPBA 4I3PA 2OYZA 4ZU5A 4PIYA 1SFNA 4XF4A 1CAXB 2BEOA 3HT1A 4MZUA 4UXAA 1LR5A 2F4PA 4XFHA 3IDCB 3TNQA 5FLHA 3H7YA 4FAGA 2QJVA 4META 5K8SA 4PIZA 3FFQA 4MV2A 4ORFA 4HVOA 3C3VA 1U12A 4PJYA 1Q5OA 3H3ZA 4LLOA 2CAUA 3L2HA 2FMYA 3S7IA 5FDBA 1O3SA 4YSFA 1PMIA 1GQGA 5BUVA 1QWRA 2PQQA 3NW4A 5KHHA 4X6QB 1SQ4A 3SHRA 2V09A 4Q0SA 4EWEA 5EZWA 1HW5A 4LA3A 3FE5A 2MPFA 1CAUB 3PVBB 2B5HA 1JUHA 5J7MA 4XEZA 2IXHA 4L2NA 3WW3A 3WW4A 4E2QA 5BV6A 4LTAA 1UD1A 3ZDSA 4EWDA 1IPJA 4QM8A 1DGWA 1DZRA 1WA4A 2ATFA 1RL3A 3GYDA 4LA2A 3RYPA 2DCTA 2HJIA 4N9HA 2Z2SB 4AVBA 4IEYA 5BXXA 5FPXA 5I0RA 3U10A 1ZRCA 3N4MA 2UY8A 5JR7B 3ACLA 3UKNA 1WGPA 1EPZA 1VJ2A 1ZZCA 4UBHA 2PA7A 4XF1A 2ETEA 3E5UA 2XLAA 1YFUA 4ZU7A 2WC2A 3HT2A 2Q1ZB 2UY9A 3CL1A 3CF6E 4HZFA 3D82A 2PHLA 3E97A 1QXJA 2VECA 5BPXA 4BIFA 1J59A 4I0BA 2FQPA 3JZVA 2BYVE 3NVCA 4QXKA 5I0UA 3H8UA 2BGCA 2B8MA 3HQXA 4AVAA 5KHJA 5C6CA 4I2OA 5J3UA 3DN7A 4XETA 2D5FA 3B02A 2H6BA 1H1MA 2WFPA 3H9AA 4AQ6A 3TNPB 3SCHA 2QVSB 2QCSB 3FWEA 3I59B 3EJKA 1ZX5A 5CU1A 2IC1A 4MH0E 4IEPA 4J1WA 3MDPA 3LA3A 4MUVA 3DKWA 1NYWA 1L3JA 2I45A 4FT8A 4TLFA 1RUNA 1LKNA 4HN1A 3CLPA 1Q43A 1X82A 4WVZA 1ZZ6A 2GZWA 2N7GA 2H0VA 4OFGA 4AQ2A 1ZZBA 2IXLA 3RDIA 4A2UA 4IESA 4HN0A 3IBMA 1YFYA 4XFIA 2IXJA 5KHGA 2D93A 3HIFA
chains in the Genus database with same CATH superfamily
2RR13 1COV3 1BJQA 3O1VA 1OLME 2OXBA 4N7UA 3E6CC 1PO11 1NCRB 2QQWA 1ZA7A 3KF5A 1BEV2 3VBOA 3POIA 3M3QA 2WDBA 2ZX2A 2DF7A 4M0NA 1JZ2A 1AR81 2HWF1 1R083 1UY0A 1LHVA 1ODNA 1IS5A 3BU7A 3D5OA 3GBGA 4CDUC 3OY8A 5L9VA 1NAEA 3J9SA 2EIBA 2DTWA 2WYFA 3BOWA 3GHMA 4F7ZA 4QX0A 4QMAA 3N9LA 4FP3A 2OVUA 5FKBA 5FZ1A 5FO9B 4P5HA 3O1UA 1IHMA 4J25A 4Z1VA 3RYKA 3I59A 2JX9A 4YNIA 4CU6A 4YM1A 1ZM1A 3NJZA 3RZZA 4WZCA 2VOVA 3KQRA 3LCPA 3VBHA 4CDQA 1HXS2 1WW5A 2VW1A 3IT8A 4GALA 4HL0A 2D3SA 2MEV3 1CN1A 3OYWA 2CTVA 4MX3A 3ES1A 3BODA 4NJ4A 3NAPB 4P5YA 2XVKA 1X33A 3ELNA 1NXMA 1ZA4A 1W39A 4DQAA 2HWD2 4LEJA 1CAVA 1RUI1 1MVQA 1SDDB 4FPEA 1GZCA 1W05A 4Q26A 4S2HA 4YW6A 5IW0A 3VKMA 3WDXA 5A3OA 5EJZB 5KBFA 1QQP1 2G4IA 4PDWB 1DGRA 1O59A 2ZCWA 1QNYA 4E2GA 1RUF3 2LS6A 4QU2A 4RFRB 3I54A 3ZFGC 4OI2A 3ZXDA 4AK3A 1UKRA 5KHIA 1UIJA 2C0ZA 2R043 4Q4X1 4NVPA 3HVDA 3ZXLA 4FFFA 3TB0A 1MS4A 2L9LA 4PLMA 4HBNA 1GWKA 1SHWB 1OLRA 3FC0A 2VULA 4KU8A 3ILRA 1F5JA 1L7RA 1X7NA 2XLFA 3ZR6A 3K48A 1X50A 2D43A 1DGRN 1CAWB 3L9JT 4N43A 1RUOA 1EV13 2PLV3 5JXJA 1DQ6A 3CJIA 2DV9A 3KQ4B 2VCAA 1YQ8A 4HG6B 1TMF1 3JU9A 1XYNA 3N35A 4KGGA 2VQUA 3OEBA 2OZ6A 2YBSA 3ACGA 1KDMA 2V4VA 3LEGA 4YVWC 3N7KA 1VPHA 4H7LA 4LJHA 2VCBA 4U36A 5BNNA 1XE7A 1QOTA 2EICA 4L9BA 4J6GA 1MZFA 1YC61 1RUE3 3PHMA 1W6QA 2YG0A 3ZFEB 3O0WA 5F5IA 3OD0A 1DQ0A 5C3OA 4XACA 4ZY9A 3D3AA 1V00A 5IATA 2HBUA 2K9ZA 4NHLA 4ES9A 5DAPA 2QQUA 2WQ4A 4NRPA 1QJZA 4AG4A 4BE3A 1S2KA 4CEWB 3M7AA 4X8PA 3W58A 2R062 2RDRA 5C33A 4FSJA 2A6ZA 2VMFA 4JGZA 2O14A 1PVC2 3NWKA 2VXRA 2P5BA 1G6NA 2JWPA 4AFMA 4CYDA 3KV6A 4GJYA 4QX8A 3KHCA 2VOTA 5C3RA 1D2QA 1GOGA 5FQ0B 5ISLA 3IWZA 4EQVA 3SLIA 4YW4A 4K9SA 3FJSA 2QQOA 4XBNA 1V9U1 4GWJA 4CP0A 3B9IA 4QPGB 3SCGA 2WT0A 1DQ5A 5GALA 1US3A 3TEYA 2E6VA 2D5HA 5A80A 2O8QA 5CBLA 1ZBE3 3OBAA 3LA7A 3V0BB 2DTYA 5FYSA 2XR4A 1QDCA 5L9RA 3B94A 1G9BA 3HNMA 4KWJA 2OIIA 1FNZA 3EB7A 4HFSA 1GZTA 4Z07A 2ZJCA 1K5MA 5FZ7A 3MW4A 4OUMA 1GZWA 4AEJA 5GM0A 2WNUA 5J96B 1HB4A 2B9UA 4WVVA 5C8WA 3H8OA 3ZMOA 5FZBA 4NHXA 2JKXA 2BNOA 3RWNA 1FMD1 1PGW1 2QDRA 3POJA 4D7YA 3IN9A 3IDAA 5ABJA 1QNWA 4IV1C 1SEFA 2ZHKA 3IAQA 4Q4Y2 1LESA 1CPMA 1Q8QA 1K3IA 3PNAA 2XHNA 4D6QA 2C5DA 4O7XA 3KVAA 2W92A 5JCTA 1SMVA 3CHXA 4BQ2A 1OC1A 3V65A 1JUIA 4DXTA 3KS7A 4DS0A 3B9CA 3VZMA 2WFF2 3BIWE 3VZJA 5T5JA 1FOD2 3LSEA 1URXA 1XU2A 2CNAA 3MIHA 1IG3A 4QM9A 1HLCA 1C8NA 5FMDA 2NP0A 1ULEA 2I74A 4Y33A 3IDBB 2VW2A 5JMOA 1PIV2 1Y9GA 4PI2A 4QPIA 5T54A 2GDFA 4LUMA 1X9TA 4RS5B 4NROA 4WM7A 1AL21 2UYBA 2R7EB 5T52A 5G04L 3Q8AA 2HWF2 2XJPA 5L73A 3S0MA 3RZKA 4CP9A 4XQ4A 5IVYA 1PGL1 2RHPA 3OTFA 1MS5A 3RZJA 1JMUB 4H14A 1S4CA 3M3CA 1MZ6A 4IEUA 2XJSA 3AMPA 4QGMA 5FBJA 2QDNA 3UKTA 3WDWA 1J58A 1PMJX 1S0DA 4BZ4A 5C8CA 4IEWA 3KT1A 4ASKA 1CWPA 5DUUA 2C9AA 1IKPA 4PQ9A 4RHV1 4XUNA 5GJ6A 5LK5A 5BNPB 1S0BA 2AEYA 2W9XA 3PL0A 4KBBA 4AI9A 5IHRA 1ALYA 4B8EA 2XGXA 2WWUA 4XFGA 2DCKA 2VH9A 4LO5B 5JOXA 4OI0A 1FNYA 1VBE3 3H50A 3JQWA 4UT5A 4V2WA 1DLCA 4XOGA 3WP3A 4A3ZA 5ACA2 5FZ6A 1JZ3A 1RUH2 2E53A 5FY0A 1R092 2D6KA 3VBSB 1DGWX 1IPKA 1DQ4A 1NCRA 2E7QA 4GXLA 4FVVA 4MOAA 5FOJB 3B93A 4YM2A 1WW4A 1DYKA 4COZA 1NCQC 4LHNA 3VBUB 4MGTA 4UYBA 1UO9A 5L19A 4BM8A 2AZ5A 4DRVA 4E9KA 4N9IA 2RS12 5ANNA 1AR73 1QQP2 3DYPA 3IMNA 5I8YA 5FZ0A 1F8VA 1BKZA 1BXHA 2P4EA 1ENQA 1J1LA 3I3EA 1YI7A 5AC91 2PHDA 1JZ7A 2C26A 4A45A 4R52A 4Q4X2 5EP9A 3VL8A 3O1RA 4ZU4A 2BBVA 3MHZA 4BQ5A 3HNBM 5BNOC 1BLZA 3A0KA 2NQYA 5A3UA 2YC0A 5KXCA 1RMU1 2AH2A 3ZYJB 3ZSJA 5JSRA 4NRMA 4YVSB 2JIJA 2WZ8A 3P1IA 4Q4V2 3ES4A 2GMMA 1CR7A 3BPSA 2OQ7A 4W8JA 5F3EA 4BMEA 3I2DA 4K40A 2JECA 5KXBA 4MHUA 1LTEA 3POEA 4MXVA 1F15A 1C8M3 5GZFA 3NAPA 4Q1RA 4XJUA 1KGYA 4NHYA 3DYOA 1YQCA 3WQ7A 4B1MA 2P17A 3I49A 1W8ZA 3VBFB 4A7ZA 3I3DA 4AFDA 1RUD3 3VL9A 4AAPA 2VR4A 4MGKE 1Y7BA 3TAYA 2WYSA 1GNYA 4OULA 1GQHA 1LRHA 4PDWA 2UURA 3AZWA 5H9SA 4QT6A 4O9EA 2ZZJA 4GKYA 1WZXA 3ZIWA 1ZREA 1C5HA 4MGIE 1WA6X 3J7NA 2RS51 3T1LA 2JENA 4YG3A 2ZAHA 5APAA 4DPNA 5A3LA 4FP2A 1WLDA 3CZUA 4RQPC 2C24A 4FQ4A 2BOJA 1WLTA 5JOYA 1CAWA 3BTYA 4DIQA 4FOWA 1CVNA 3NJXA 4MLOA 1R1A2 1R64A 4LR4A 1VMJA 3VGIA 3WG1A 4BA6A 2IXCA 1LEMA 4K1YA 4A41A 1CPNA 2AEZA 2YZ4A 3VKLA 4AEMA 1SACA 3WUCA 3J8F3 4FOYA 5EQUA 1TNFA 4IE4A 1ND2B 1JYCA 4NIIA 3RI8A 3H3LA 1ZRRA 5HCAA 1XNBA 2BERA 1IQAA 5IJRA 1YUDA 3CQOA 2BTVC 2VU9A 2WNVB 1TE1B 3KZ4C 3PMEA 3M3IA 4K20A 4XMAA 3E5QA 5FY5A 3ZFEA 3OGSA 1IS3A 2A6WA 4P08A 3RMYA 2JDYA 5FZAA 4COWA 2A73B 1QJU1 4NUBA 3M8LA 5DAQA 1BCXA 4CEYC 1LOCA 4PLNA 1W0NA 3GM8A 3OBZA 5CKQA 1EUTA 1HN1A 3WQBA 3T30A 5CZKA 1KEXA 1XJAA 4HKOA 1P8JA 4UXAA 5JOZA 2YDEA 4CEWA 2F4PA 4HETA 3F2ZA 1PGW2 5A1LA 2BGOA 2OQ6A 3O1MA 3A7QA 5FLHA 1V6LA 5A3WA 4OYUA 4B4QA 2Y6JA 4IV3B 1GLHA 2VQTA 3B69A 3RJRA 1VB2A 1B35B 4U2AA 4CDWC 1D7PM 1WMDA 4HVOA 1W6MA 4LBMA 3T0DA 2WA3A 2GNDA 3H3ZA 5BY5A 4LLOA 1BMV2 3V0BA 1WUVA 1PO23 1TZOA 3ILNA 3MIDA 3AK0A 5EPAA 3L2HA 3R05A 3UV9A 2FMYA 3S7IA 1VBB2 2HWB3 4GH4B 4UAPA 3N36A 3N9QA 5FYYA 2JDKA 1QJY1 5FXWA 4AW7A 1H6YA 2FCVA 1AL22 1LOGA 2ZGRA 4FPFA 4AWDA 2ZACA 1HW5A 3WEZA 4CE8A 5CB7A 4C8DA 3S57A 2X09A 1JUHA 1RVF1 3WHUA 2HH9A 3HQRA 5FZFA 4QDSA 4Q1PA 3WW4A 2GP3A 5A6QA 4RHV2 4PHZA 3ZDSA 2HWC3 4JZRA 5C9AC 5SV5A 3O0XA 1IG0A 1IPJA 3VDCA 1GMMA 3B00A 3RWKX 1WA4A 2ATFA 1GFF2 4LA2A 5J98B 4WM8C 3OBTA 2G9FA 3I2GA 1D0HA 4FFGA 4AVBA 1E5HA 1PZ8A 2WT1A 3AKSA 4N9HA 5CFCA 1POQA 1JZ4A 4XJ8A 1IOAA 5FO8B 1LOEA 1ULGA 4P14A 1SG3A 2A1XA 3IZOA 2UY8A 4RS5A 4GMP1 3ACLA 3NV3A 1VBA3 1WGPA 3LFMA 4FTSA 2A3YA 5FP3A 1ZZCA 3AP6A 5FMOL 3VDAA 3TEZA 5JZGB 1ASJ3 3MLKA 2ZGLA 1LHWA 1S1AA 2BUKA 1AVBA 5DG1A 2CDPA 1JYIA 3KT7A 3E5UA 2XWJB 2JKBA 1VRH1 2JG9C 1OVSA 2XLAA 5BNPA 4JQRA 5AC92 3HT2A 3O5SA 5TSWA 3UETA 4CCOA 5LWBA 3ZXGA 3A21A 1W8UA 4Y4YA 3CF6E 2EIDA 2J22A 3M2MA 4KQ7A 1OQEA 1RUG1 2PLV2 2RMU3 1QXJA 2VECA 4DO0A 5BPXA 4P9LA 2VTFA 5ERLA 3SH4A 1UN1A 3TN93 1J59A 1NZIA 1H2NA 2D6LX 1Z0HA 3AXDA 3W5MA 2BYVE 1DF0A 3MO4A 2ZBJA 2B8MA 3HQXA 3BTXA 2DVGA 2NLRA 5I0DA 3MGUA 4EN6B 4P9IA 4DZGA 1XE0A 4BOWA 3VBUA 5C6CA 4I2OA 3LEMA 1F9KA 3P3NA 2D5FA 1GNZA 3S5QA 3WSOA 1ZBA1 4ARYA 2WR9A 4DEVA 5FY9A 3EXUA 3FWEA 3I59B 3I8TA 4QPGC 4YM0A 4DXSA 4OUSA 1OH4A 3FFZA 2BZDA 2J1SA 1SFYA 1UOGA 4SLIA 4Y5TA 1ND3B 4MG2A 1UU4A 1GU3A 5GLUA 2VCCA 3VBHB 1UF2C 3MDPA 2GSYA 1HQLA 3B3QE 3BTAA 3APBA 4Q4W3 5FY8A 1BEV1 1AXKA 4QHBA 5FK8A 1UXZA 2A70A 2GN7A 4TLFA 2BW8A 4B7EA 2ZEYA 3VBRC 2TUNA 2VNRA 4LBQD 3U1XA 1X82A 1EAH1 1ZZ6A 2YHJA 3MLLA 4UF0A 4KBZA 4EN8B 3FBMA 1ZZBA 1J83A 1OLQA 2DVBA 3RDIA 2YU1A 3VD7A 1BQPA 4BK4A 1W6OB 3VBFA 1W90A 4IE0A 4TTGA 2WZR2 4INDA 4XIKA 1U0AA 5KHGA 3DPRB 4BXSV 2VO5A 3PMSA 4KG8A 5FZDA 1QHDA 4JRAA 5C4WC 1UIKA 4L0PA 2WQ8A 2ZHNA 4NWVA 3RS6A 1PO13 1W3VA 4CCEA 3C7OA 3LGRA 1ZZ8A 2UYAA 1XNCA 4NHMA 2A3XA 2XJTA 4O9GA 1APNA 5A70A 3AJZA 1AR83 3HQUA 1FXZA 1QJU2 1HKDA 2XWBB 2CYFA 4KH9A 4LO6B 3WF0A 2FZ2A 2V72A 3GBFA 4XUQA 5B2GB 1QY4A 1A3KA 2W47A 3VB9A 1W2NA 4AHZA 2HWD1 4BLJA 2HYXA 4AI1A 4JTOA 4ZZ8A 4LNVA 2IFWA 2PAMA 2WS92 2JDUA 1IKQA 4A6OA 3UKVA 2P6HA 3G7DA 3QH6A 3O7OA 4CUBA 3A0NA 3H1MA 4XCBA 5LRRA 5L7OC 2FDJA 4CCKA 3FMGA 1HN0A 1JS9A 4R9BA 4EYUA 5JR2A 4N53A 1ND2A 2XG3A 3EBRA 4RGGA 4Y1UA 4D69A 4RGKA 1OVPA 5IVVA 2R072 1TEIA 3POFA 1H8TB 4LIUA 1MZEA 4P9WA 1UXXX 2WNVA 4D7TA 4GKXA 1VB4A 3DKQA 1N3OA 4XFBA 4A3XA 1HRV2 4QX2A 4BQ1A 1W8OA 2D44A 1UWWA 4M0HA 3SISA 1M06G 2TBVA 2VZ3A 3GZUC 1RUI3 2ET1A 4Q0PA 2VVDA 4CDXC 4CU8A 2ZX1A 3OSDA 4DY5A 4I09A 4JGZB 1OPOA 5FZIA 1UPSA 4HLTA 1G9FA 5EWSA 2Q0AA 5EJ1B 2Q8EA 3SCFA 3VBSC 5DZEA 3LAGA 1QJY2 5AFBA 1BVVA 2ID4A 1ULOA 5J09A 4AF9A 1W2AX 1SFPA 2WQZC 1VBC3 4AFBA 5EXOA 2XUMA 3JBG3 2PELA 4JHZA 4NAMA 4BQXA 1BBT2 5ANQA 2KD7A 5I8TA 5HXMA 1W6PA 4IV3A 3EO6A 1RVF2 3NRUA 4JGYC 4NPRA 2ZZQA 5H9RA 1XBFA 3IKWA 1B35A 1IS6A 3F95A 4BH9A 3AXEA 1LGBA 2EXHA 2VUJA 1AZDA 4YG0A 4BJ0A 1NX9A 3AYDA 4KU7A 4IUGA 1K5MB 1UZWA 4BWOA 2BNMA 4AHWA 1EY2A 3V0AB 4P9GA 2W1WA 3DYMA 4QX3A 1TMF3 3HWJA 4O65A 3DUIA 4LBLA 5DZGA 2R061 2Z5WA 4YVSC 3J7LA 1ODMA 3Q9OA 1X8MA 1EUUA 2YGMA 4L99A 4URAA 3VDDC 1VIWB 4GWNA 4PCRA 2BNNA 4AVTA 3ME2A 3LPFA 4JX0A 3O1SA 2PQSA 4UI9L 5DDJ3 2ZGKA 2W87A 4GIQA 4J1XA 2VW0A 1HJFA 3O12A 5IK4A 2B9VA 3Q8BA 1FV3A 4XDQA 3FHIB 4FFHA 2QKDA 3WCSA 3WG2A 1AYM3 2VOWA 3AZXA 1VRH2 4Y22B 1IZ3A 1TME3 2VZTA 3CZJA 4XILA 5E8AA 1LHUA 3IMMA 3P5BA 3J26N 3PUQA 5D1IA 1CX1A 3OG2A 2W94A 1HJGA 5JAXA 4E8DA 4Z92B 4WM7B 1N3QA 3ZOIA 3H1WA 3SXWA 4LHLA 4WZFA 4AOCA 4KI5M 2ZABA 4LORA 2EF6A 3ZPYA 3ZYFA 3MIBA 3Q8FA 1V9U3 4Q4Y1 3N9MA 3WV6A 1Y4WA 4QB6A 5C8CB 1LJ7A 2GMEA 2V73A 3PVNA 2CDOA 1NLQA 2VQAA 4HMZA 2YFUA 4NIGA 4XJWA 3ZO0B 4E27A 4P9XA 5CG8A 4QQHA 2VGDA 5GKAC 3N9PA 2ZKNA 4LKSA 3EYPA 2IWGB 2WFF1 3UT0A 1OQ1A 1FOD1 4KNCA 4UW6A 4Y1VA 3CEWA 4XF0A 3ACHA 3S7EA 5E1RA 1RUC1 1XE8A 3TOJA 3AFGA 4PF1A 2BPA2 2FHRA 4CCJA 1O5UA 4UBGA 4ET7A 1PIV1 3NJYA 1FMD3 1BK1A 2XDVA 5A1AA 3H8XA 3AL5A 4OHVA 5FZ3A 5KWRA 1PNGA 1I5ZA 2VNOA 4IL7A 1V0AA 3N9NA 5JSOA 4QGNA 4EZHA 1FI2A 1J84A 1QXPA 2AREA 1AYN3 2AENA 5EYXA 1EAH2 3K2OA 4AE2A 4NIDA 2EIEA 2D7FA 2W5FA 3HOBA 3O0VA 4QX1A 4CTEA 3VD9A 4LUKA 5L36A 2JE7A 2GNTA 2PYTA 2YPJA 3MZHA 1JODA 4UFMA 4K21A 2J1AA 3WDYA 4I01A 3KVBA 4FPOB 1V6OA 1YO8A 4P00B 3IPVB 1ZNPA 3VHRA 5CAZA 4AHXA 4EV0A 2ZA9A 1AR93 5IVBA 3USSA 1ND3A 5ACA1 2D40A 1RUH1 1F4AA 2VNVA 1R091 1Z7S3 4LBKA 5IUQA 5DUXA 2TNFA 2VBPA 4QB1A 4KWLA 1CQ9A 4C90A 3D0SA 3ZX7A 4GH4C 5HCBA 2JDHA 3ZR5A 2H6CA 1PM7A 2WO2A 2BRTA 1O5LA 1A6CA 2RS11 2ZX4A 3FN9A 3QD6A 1ZVFA 1RGSA 4XURA 3WR0A 2JD9A 1AF9A 2XHKA 1RUJ2 1W6OA 2XL9A 2EXKA 4QX5A 1W0PA 4BQ4A 4CU9A 1K5JA 3DPRA 4M00A 4E4DX 4RR3C 3BKZA 1LOAA 2R32A 2W95A 4HK9A 2R0FA 3T2OA 4W6WA 2ZKLA 5IFTA 3MICA 4XCAA 4QKNA 4JQTA 3R6SA 1W28A 4LO7A 4IEXA 4Q4V1 3FHQA 1JZ6A 1IGOA 2D98A 2X29A 5A3TA 1OH3A 4WVWA 2VUCA 1BVP1 1AJOA 3HBKA 3POWA 4WV8A 1SLTA 2GNMA 3OPZA 3VHNA 1MS1A 1OOPB 2BU9A 2CWSA 4D8MA 5I91A 3LWCA 4XF9A 1Y9QA 1SBDA 3MF9A 4XJAA 5FY7A 1N1TA 2HEVF 4I0WB 5CFDB 5JZGC 3AM2A 5JIUA 2WSVA 4WBBA 1WKYA 5DG2A 1X9PA 5F5QA 1UY2A 4QKFA 5FZGA 2QQLA 4F3JA 3WG4A 2P34A 5HCFA 5LBEA 3WOGA 4AI0A 1RMU3 1E57A 2HWC2 3WD5A 1LGCA 1UYPA 2ADEA 2WAOA 3MW2A 5DUVA 4AGRA 2KXLA 3T1MA 5GZCA 4ONUA 3ZVXA 3O14A 2CGOA 1H8TA 4PLOA 2JD4A 3PDQA 2VMHA 3CIHA 2XBO2 2SBAA 4N8MA 3KSCA 3VBOC 5HPOA 4C1WA 5LEKA 1R1A1 1RJ8A 2DURA 2Y6KA 4UOJA 4NIHA 2FDKA 1W9FA 1DU3D 2D97A 5FJKA 1BZWA 1XSQA 1JYTA 3T3YA 5H9PA 2ZEZA 1OD3A 2HWE2 3K4ZA 4GULA 1VBA2 4QPYA 1VBD1 2PAKA 2LROA 2GC1A 3INAA 5CNAA 1VMHA 1RC6A 5JDBA 4FI9A 5A6XA 1Y3TA 4MVTA 3H0OA 1TQ5A 4Z2WA 2BOIA 3ST7A 2XL7A 3ZN6B 4ZHNA 4A4AA 1W6MB 1MEC3 1NA1B 5GZEA 1OD5A 4BMBA 4K8RB 4HVQA 4W6XA 2JDZA 3ZLIA 5EFUA 4AEDB 5JLVA 2AGSA 5FYUA 2VJXA 2WWJA 1UZVA 4Y3OA 2K0GA 5GLZA 3VBHC 1GP6A 4CDQC 3POGA 3V0AA 1F35A 1JHJA 2J1UA 1QJX2 3ZSKA 4AL9A 4LPLA 3OGRA 4OVEA 1QH6A 2C6SA 1UL9A 3GALA 4EN0A 2Q30A 3NKTA 3HN1A 3UNPA 4AEKA 1GZ9A 5HV0A 1O4TA 4UW3A 2Q4SA 3MBWA 1D4VB 5DQ0A 3MI8A 5C70A 4BXFA 1YLLA 3AJYA 5FYMA 5C3SA 1AR61 1RXFA 3WW1A 1QH7A 1JI6A 5AVAA 1BMV1 2BDRA 5FIXA 5J36A 1TVGA 1SFNA 4LITA 1U5ZA 4XF4A 2XJUA 3P3PA 1CAXB 1FPN1 3ZKUA 3HT1A 4MZUA 5CFCB 1DGLA 1VAKA 2RR11 4Y22A 1RUC2 4IE6A 3AC0A 4OQ8A 1VBB1 3D6EA 3MLJA 1OUXA 2BQPA 2Q5TA 4N43C 1N1VA 1QKQA 3AKQA 3PTYA 3CJIC 3H7YA 3AP9A 1OURA 3BI3A 2OUHA 5FWEA 3UGFA 2W1QA 4CUCA 1JYNA 1RINA 5JWPA 1JTZX 4META 4P02B 5K8SA 1QJFA 2WO3A 3HPNA 1FATA 5FPAA 1AXZA 1LGNA 4YW7A 3TRSB 4CXXA 2WINB 2CL2A 3ZIXA 1Q5OA 1XC6A 4IQPA 5BNNC 1XSRA 1D4M2 3GZAA 4W6YA 1Q8PA 2B45X 1W8WA 3H8RA 1YXWA 1RHI2 2VZPA 2VE1A 3CNAA 2W0XA 3H42B 3NMBA 4HT1T 4N7IA 5E6HA 3W59A 1OBNA 4JKKA 3A4UA 2RG4A 3OB8A 4AGVA 1S0FA 4V2VA 5FO7B 3M1HA 4K1ZA 5BUVA 5K0UB 3S5AA 2Y6LA 1LHNA 2AYHA 4ES8A 3NW4A 5KHHA 3TYJA 3WF4A 4DB5A 4GMP0 2J1TA 2YU2A 4EWEA 1GP5A 2Q1MA 3ACFA 4P9JA 5F9TA 4LA3A 3FE5A 1K12A 1CAUB 2ZGTA 2WN2A 2QZ2A 4R4ZA 4CZSA 4IGOA 4JGZC 2E63A 2QQVA 1N1SA 2ZGUA 3RMXA 2GNBA 4LTAA 4XBLA 3SITA 1UD1A 2WLPA 3AL6A 3ZPOA 5JUVA 1YJLA 2ZMLA 4MHRA 4BISA 1QOSA 2HLEA 4FQZA 1RL3A 2VMCA 3GYDA 3N7LA 1JOPA 1LNSA 3UJQA 2HJIA 4Z8BA 1QU0A 2Z2SB 4IEYA 1PGSA 4NN0A 5FPXA 2ZHLA 1GBGA 1AL0G 2JB4A 1ZRCA 1XNKA 2W1SA 3IPVA 3JB8A 4RSUA 3N4MA 1K5MC 1Y43B 1KRIA 4XBQA 3THCA 4MYEA 3UKNA 5EYYA 1EPZA 1V6MA 2PLV1 2VVEA 1ENRA 2WNUC 4GMP3 2G9GA 3CBNA 3GJAA 4X8NA 2ZEWA 4AQSA 3AMHA 4O61A 4PBOA 4UF0B 4OHXA 1VAMA 1UU6A 4LHKA 3NKGA 5G05L 4C1XA 5ABJC 4QPWA 2ZPXA 4YZ5A 4CCNA 1VBC2 1YFUA 3ZSMA 3T4HB 2PHWA 3O1TA 5F3GA 5FP8A 5HCHA 5A33B 3AFKA 2Q1ZB 2UY9A 4FCAA 2ERFA 4W4ZA 3ORJA 1NY71 3RQ0A 3CL1A 4FPKA 2PHLA 3GDBA 2RS32 1Q56A 2J1RA 4XTMA 3MIEA 1S55A 1CESA 4QX7A 3ZFFB 5J1XA 2A71A 3K3NA 3SH3A 1W2TA 3HJRA 1SLCA 4EN7B 4BIFA 4MO3M 3WF2A 5CIRA 1RUG3 2FQPA 3LEKA 1OKOA 3H8UA 2BGCA 4E4SA 2Y64A 4QPIC 5LA9A 5LBBA 2YB7A 1AX1A 1QIQA 1QMJA 2Y0IA 4QU1A 4WM7C 1PVXA 4XETA 4Y1YA 3B02A 4ASLA 2WFPA 3ETPA 2XVGA 3ZYHA 3SCHA 2R30A 5BYNA 1ULPA 2BFUL 2P1BA 4NO4A 5LY1A 3RZGA 1OOPA 1VBD2 2WZR1 2QTWB 1NKGA 5C8CC 1GICA 4N53B 1KFXL 1ACCA 4R9DA 4S2GA 5CFDA 3OOXA 3MPPG 4BQ3A 1AHSA 1ZBE1 2XJQA 1LAJA 3U78A 5IVJA 3DKWA 4Y5SA 5FZOB 4LBJA 2ZXQA 1RUNA 1BEV3 3NO8A 1TME2 4HN1A 4AZZA 2XB6C 1FYUA 2VZ1A 2O8OA 4LQRA 1LHOA 1QOOA 2GZWA 4WVZA 2DUQA 2HEYF 2R1BA 4Y24A 3SEEA 2ILMA 1H2LA 3LPGA 3OUIA 5JPMB 1RB8G 4IESA 3FLPA 4YGEA 4HN0A 5DN2A 1NCRC 1YFYA 4XFIA 4M01A 1E5RA 2WS91 4L92A 1EPWA 4LBQB 2IXJA 5FP9A 1WCSA 1I6XA 3V56A 3WNMA 4ZXKA 5A7SA 3AVRA 2GC0A 3AMMA 3PIJA 3GNEA 3MV11 2KR2A 4D3WA 2IXIA 1W6PB 3VKFC 2BFUS 1PM4A 2QNKA 2WZEA 1SLAA 2CGNA 4CXYA 2RV9A 3KV4A 2D6NA 4GB32 3ZN6A 1AR62 2R071 1HXS3 3AP5A 2B42B 5F2SA 2JE9A 1NA1A 5CISA 4KL1A 1G9CA 3NNJA 4Q0QA 4QGLA 1PK6A 2CWMA 1H8VA 2VG9A 1HRV1 2W46A 1JBCA 1FPN2 2E9QA 4AEDA 4CDUB 3KMHA 2RR12 1COV2 1GR3A 5D21A 5AVPA 5T50A 2YGLA 4FPHA 1ULDA 3AKRA 3H7JA 1SCSA 4YARA 4XDOA 1LCLA 1S2BA 1R082 3NAPC 1XPWA 5F2WA 4MGYE 4EZ4A 3K75B 1OA3A 4BYYA 4ZKTB 2JDPA 1KD7A 4FXKB 1BBT1 3VV1A 1N47A 1Q8SA 1OSGA 3ITQA 1LU1A 4GWMA 3PJYA 1OA4A 1US2A 3WX5A 3J4UH 3ZSLA 2AC1A 4AQTA 4BLIA 4PDWC 5FZ8A 3V64A 2BV4A 2OX0A 1QDOA 1Q8VA 1GSLA 5JOWA 3ZKYA 2NMNA 2GAUA 1NZCA 3I2HA 3N3HA 4QQ2A 4UFIA 4H7MA 1VBE1 3MYXA 4BK5A 1GWMA 1UOBA 3CDZB 3W21A 2V5YA 3WQ1A 4IEOA 3E6DA 2BWCA 4DY3A 1NE4A 1CAXA 2HKXA 1W0OA 1GWLA 2B7YA 1W2OA 2C4XA 3JD73 3FLRA 2ZGMA 5I8SA 5D2AA 5AFEA 2MEV2 1PMHX 4M3CB 5A7NA 1DZQA 4HSJA 5D8AB 1OFNA 1TG7A 4GJZA 4RYDA 2JG8A 5FUNA 2EA7A 1DYOA 3U75A 4H55A 2DBIA 4JAAA 2WLQA 3LB9A 3M3EA 3RI9A 1DQ2A 5DUWA 3NJVA 3H3UA 4OHYA 1O91A 2ADDA 2BP6A 3AZYA 1PZ9A 3ETQA 1RUF2 4QXHA 1U5IA 2BWAA 1NUKA 1YFXA 4XVHA 3H1YA 2QBXA 5LY2A 4DMIA 4JC1A 2GC2A 2R042 1YIPA 4AVCA 1O4ZA 5IVFA 2VZUA 1OFSA 2KA3A 3ZFEC 2ZHMA 4YPJA 5KC6A 5J48A 3BPZA 5K0UA 4MGQA 4KWUA 5FRAA 2JDNA 3LSDA 1PVC3 4LHSA 3EQEA 1M4WA 5F1RA 4YVWB 1UPIA 1Z78A 2W1UA 1EV12 1U5YA 2PFWA 4Y1ZA 1X8EA 3ZN5A 1C8M1 2GU9A 2UWCA 1MPXA 2QFEA 4ZONA 1KS4A 2YV8A 3BALA 1CAUA 1HRI3 1SLIA 3PVOA 4CEWC 2RM23 4HPKA 2OT7A 3WY6A 5E89A 1RUD1 4RL7A 5F6LB 1UAIA 3J7MA 5C3QA 2P6CA 3DGTA 2GC3A 1L7LA 3MEPA 1DHKB 1UKGA 1S0JA 3MW3A 1I1EA 2GH2A 4YM3A 3AB0A 5FZLA 3RZLA 5JI9A 4CPBD 4Z82A 4BU2A 1NY72 3BN6A 1UCXA 1RUE2 4OMDA 1S0GA 4OQ9A 1C1LA 2P3IA 3WNOA 1NLRA 4XQDA 5J37A 1KITA 2ZGOA 3FBYA 1LOFA 5F5CA 3DV8A 2EAKA 4XFAA 3LIHA 3WZ1A 5FZ4A 4XXAA 2Y0OA 3NV4A 4LBNA 1TNRA 3AMQA 1VALA 1CZVA 5SV8A 4IXLA 1V6NA 3RNSA 2ET7A 4IE7A 5FPUA 5JXHA 1O3QA 2X10A 2Z69A 2EXIA 2DUPA 2BBAA 1AJKA 5LA1A 3AX4A 3NSTA 1FOD3 5LW9A 1CGPA 4Q2FA 2OUJA 5A33A 4D7SA 1JYWA 2P2KA 3K4AA 1YYNA 3U11A 2AR6A 1PX4A 3SEPA 2QE3A 2P3KA 4JV4A 1ZBE2 2FZ1A 5FKCA 3THTA 3VD3A 4HK8A 3ZFFA 4A7KA 1PIV3 1GUIA 1REEA 3T09A 2D3PA 2PHFA 5FXVA 4AR2A 3VUOA 1UNBA 2Y26A 4ASMB 2PTMA 3AZVA 3BCWA 5A7WB 4R4XA 5CFCC 2HWF3 1F5FA 2WUHA 1XYPA 3LZZA 3CU7A 3KB5A 1LB2A 4ZPIA 3N7MA 1FT9A 1WMEA 3KLSA 2C9KA 3WNXA 1UX7A 4K8FA 4DUVA 4RS5C 2DWRA 2QZ3A 4LKDA 2J1EA 2XLGA 2WRAA 2VZSA 3CKHA 1LU2A 3KM5A 1XQNA 1W8FA 4YZ3A 1RUJ1 4JTNA 4BB3A 1J3QA 3WW2A 2VY0A 4DNYA 4UWDA 1UZZA 2A6YA 2YBPA 3G6JB 3TBDA 3C2UA 2YROA 5ACA3 5BNPC 1RUH3 2YBKA 1CJDA 1O8PA 1PO21 1W9SA 2OZJA 2ZX0A 1X36A 3AKTA 3E5XA 5FZOA 3LOBA 4Q0VA 2G19A 3GZTB 3UGGA 4LIVA 2XKOA 3FZ3A 3J7HA 5HXVA 1A34A 1O4YA 5HBAA 1O7FA 1MVEA 4YGDA 4ZS2A 2VD7A 1UY3A 3JXSA 2RS13 2FCTA 5T5PA 1OPMA 1MS0A 2DUOA 1QQP3 3S30A 5LA0A 2TEPA 1SBFA 4OCTA 2E7AA 4LBQA 1NQDA 1YQ2A 2Z42A 2C1FA 4MGZE 1ZRDA 1G9AA 3VBUC 1KJRA 4I3GA 4FPYA 5K7PA 4YRDA 3C7HA 3HMYA 1HV1A 4Q4X3 3IIAA 4XJ9A 3KV5A 5HI0A 1WD3A 1DIWA 2VBDA 3BVCA 1E5SA 4AFAA 1MS3A 3QACA 2X5IB 1V6JA 2HWC1 1W8NA 1RITA 2PAEA 2GP5A 4EROA 4Q4V3 1CX4A 4RN5A 1H2MA 1OUSA 2EIGA 1S0IA 5DZFA 1C57A 4RD7A 2D6OX 1QF3A 5A6YA 5FYBA 1VBE2 2XBO1 3AKPA 3P6BA 3I2OA 1O3RA 1NCQB 3DF0A 4CDUA 4YFWA 4JKMA 4M4RA 4YLZA 5CG9A 4WVMB 2DU0A 1VE0A 2LTNA 2YY1A 3BGAA 4PF5A 4XFFA 5FYTA 2HWE1 4A42A 1VBA1 4FPLA 3VZOA 2VUDA 5T3NA 3RZMA 2DCZA 3I2FA 1HB3A 4YZ2A 3WNKA 5LEJA 1H1IA 4NR1A 4YW1A 1ENSA 3VBFC 2BVVA 1AR72 1YNAA 2ZAAA 1VP6A 1OKQA 1OF4A 3NNGA 4AVSA 4HKLA 4YW2A 3D0JA 4ISRA 4HKWA 1WWYA 5FP4A 4KMQA 3OD4A 2XONA 3WP5A 4CUAA 1KDKA 3OF1A 3QBQA 1GOFA 2FDFA 3C7GA 4OI4A 5FBZA 3VZKA 4DINB 3UK9A 2LALA 1R1A3 2Y8KA 1YIFA 4NHKA 4BQWA 2EXJA 3B5LB 1H30A 1QJX1 2RMU1 4A44A 5DXDA 4CUGA 1VLNA 2NM1A 3L2YA 3VD4A 2ORZA 2VCMA 3PTRB 2RE9A 2E31A 5K4LA 3DECA 3OGJA 3FX3A 4M3CA 4NIAA 1C8M2 2JICA 3KF3A 5D8AA 3PVEA 5FZMA 3GF6A 2WABA 3MF6A 3ZFGA 2WT2A 1W8TA 1MS8A 1ZZ7A 1RUD2 4CA9A 3WT3A 5FMBA 3B7MA 1N3PA 4UW5A 5I0SA 1XB9A 1WMXA 4N53C 4RQPB 3ZSEA 3USUB 1ND2C 4KG0A 2E7TA 3JCIA 3LKJA 3KCCA 5C5UA 5KXEA 3CO2A 1REDA 4UFJA 2WNVC 4Q29A 4DXRA 4Q4W1 1A78A 4JVAA 4P9YA 3SKVA 2FDHA 2GH8A 4GA9A 3X29B 2WSUA 3R4UA 2R0HA 5FMCA 5C3PA 3MIGA 4I02A 5FLJA 4FTEA 4YVWA 2O1QA 4HXCA 3ZXKA 1MACA 2VMIA 5CVRA 4BHPA 3MPBA 3D8CA 2OYZA 4XC9A 4CCLA 5IT6A 4ZU5A 1D4M1 1RJ7A 3WNNA 4DOUA 4PIYA 3LQCA 3J8F2 3KD4A 4CP1A 1RHI1 4IV3C 5B4XA 2Q8DA 1I5PA 3LEIA 4CEYB 1B35C 1UYXA 4RA0A 3MIFA 1MZ5A 4PBPA 1JN2P 2X05A 1VBB3 3TNQA 3W20A 3POYA 5F7UA 1SDWA 1W99A 5JXGA 1NLSA 5FUPA 2X53S 1CJPA 4FO9A 5LA2A 2P37A 1AL23 4MV2A 4FXGB 3C3VA 4HONA 1U12A 1FV2A 1POV1 1T6GC 1G7YA 2BGPA 1J1TA 4COVA 4CDWB 2Y33A 2OKXA 3HD8B 1JYVA 2Y6GA 1UZ0A 4RHV3 5FDBA 1A8DA 4OUEA 1SBEA 3IM0A 3KT4A 2K2SA 4QD2A 2IFRA 3KHBA 1ZRIA 3BU0A 2RDSA 5CKMA 2VTXA 1UMIA 3ZYBA 3ZXJA 4X6QB 3SHRA 2V09A 1JU3A 4Q0SA 2VBBA 2WAAA 2VZOA 1DQ1A 2DVAA 3M4FA 1STMA 2F6BA 2MPFA 3WUDA 3PVBB 2B5HA 4LBOA 1PO22 2IUWA 2XVLA 3FHAA 5GZGA 2E51A 4XEZA 2IXHA 4L2NA 4LKEA 3ZM8A 3WW3A 3WDUA 2IZWA 4IGPA 3POSA 4IV1A 5A7WA 4EJRA 1NQJA 1ULCA 2HWB2 2XJVA 4GD4A 5FY1A 1V6KA 2LM3A 2PXJA 3GCXA 5D8AC 2PN5A 1T6BX 3SQOA 2F17A 2DCTA 1VBC1 2GALA 2RDQA 2YUEA 3MUZ1 4W65A 3JBG1 5FZHA 3ZDVA 4OHZA 1GNHA 5C9AB 3U07A 5CKNA 5IFPA 5BXXA 5LASA 5I0RA 3U10A 1MS9A 1IQDC 5FPLA 5AC93 2FDGA 5A3MA 4LKFA 2PHXA 4GQ7A 3PU3A 5A3NA 2RS31 4B4RA 3O1PA 1DG6A 4WM8B 3W5NA 1DP0A 4NE9A 5JR7B 1LODA 1UYZA 4MGSA 5T55A 1VJ2A 3KV9A 2PHTA 4IE5A 3THDA 4MSVA 3WVJA 2Y38A 3VHPA 1IPSA 2YC2A 3OUHA 5H9QA 3PURA 5FJHA 1C28A 2BJSA 3JD72 1CD3G 4ARXA 2ZGQA 4D6SA 2WC2A 4AYUA 5FV3A 1UY4A 4ATEA 3D82A 2QQJA 1O6UA 1F31A 2ZX3A 2JG9B 1JOBA 3E97A 5JXIA 5DDJ1 1VAVA 2J1VA 3IAPA 1ASJ2 5DMYA 3WLUA 2V4AA 4QXBA 2I07B 4LE4A 5FXZA 1UOJA 3JZVA 3NVCA 4QXKA 5I0UA 4ZZ5A 3VN4A 1WD4A 4NOTA 4QQOA 2RS53 2W2IA 1JH5A 3HAGA 1AYM1 1PK6B 5A1FA 4QKBA 2X5IA 1TME1 3ENRA 4AVAA 4CVUA 1DFQA 4OHWA 3DN7A 1WW6A 2H6BA 2ENRA 3TWIA 3BUCA 5F3IA 3H9AA 1B09A 1ND3C 4AQ6A 1AUYA 4F83A 1DYPA 2QCSB 1FX5A 1G86A 3EJKA 1N1YA 1NCQA 4Y5Z0 2WBKA 1NG0A 2RMU2 1OHFA 1W8HA 4C91A 4URTA 3TN92 2IC1A 3HBZA 2WZR3 4ITCA 5GLVA 4IEPA 4WVMA 4J1WA 1HRI2 1MQTB 1YEWA 2WA4A 2RM22 2X8KA 2DU1A 3LA3A 4FOVA 4MUVA 4W50A 3WINE 4QXCA 2CY6A 4YW5A 3DCQA 3VKOA 4Q27A 4XXPA 5HV4A 3LIGA 1CONA 4GB31 2YMZA 2N7GA 5BNOA 1PHMA 3IDEA 3ZXFA 2YFZA 2WWSA 2H0VA 3DPRC 3FLTA 1S0CA 3GJBA 4NPLA 3E1F1 1QJU3 2IXLA 3U37A 3VBRB 4A2UA 5C7GA 3IBMA 4D0QA 5DAXA 1COV1 3K77A 2ZGSA 2JDMA 2D93A 3AP4A 1OLMA 2WS93 3HIFA 3R4DB 4Q4W2 3AZZA 2XKPA 1XU1A 1DZTA 2JG8B 2GMPA 3DL3A 3FUQA 4Q5OA 5LB6A 1OF3A 1R081 4R8HA 1QJEA 2WZPP 2NYYA 1AYN1 4HSLA 2YPDA 2IVIB 5IYYA 2XPJA 2KM2A 3URFA 1UOFA 2FBEA 1ENXA 5C4WB 3HNYM 2CAVA 2WIIB 1YHFA 4DXZA 4NMIA 2G1MA 2HEWF 2DYCA 2R073 4TSVA 4XUOA 2ZGPA 4PIXA 5GLTA 4B4PA 5FZCA 3RRDA 1F2NA 1HRV3 1DDLA 2ARCA 4B7KA 3GZEA 4RQPA 5E16A 4UFLA 2VAUA 3USUA 1HX6A 1WLCA 2NZ9A 4EN9B 5JVVA 4CCCA 1GYKA 1AR91 1PO12 5FYVA 1H8TC 3SKJE 1Z7S1 1CZTA 3U0ZA 4QQLA 1QJY3 2MEV1 1AR82 4FPCA 4CSWA 2FD8A 3I7DA 1JU4A 1UMHA 1JYXA 3D4KA 1BBT3 5DABA 3VKNA 5JPNB 5L7OB 4HPKB 3PUAA 2P3YA 1XRUA 4EWAA 1RVF3 3KGLA 4XW3A 4DRRA 4AI8A 1RYYA 4KGQA 1SLLA 3LE0A 2A6VA 4QDQA 3LDKA 1RUF1 3K3OA 1GOHA 1YWKA 4G3YC 3CJXA 5DAWA 4CCDA 4XMIA 3AP7A 2XH6A 4RFT0 2R041 4K3UA 3WG3A 2R49A 2ZOEB 4CDXB 2X5IC 3LF7A 3BYWA 1JXNA 4CEYA 1J3RA 2G9ZA 4COYA 1DCSA 1NXD1 1KS5A 3ZYIB 4KWKA 2W68A 5FPVA 3N9OA 2JB8A 5C71A 1L7QA 2YC4A 4UW4A 4TWTA 1EV11 4NPMA 1RIRA 2CV6A 3AYAA 1S0EA 2Y6FA 1A8MA 4L11A 4LOTA 1RUI2 4YWAA 4LO4B 2XQRA 1VMFA 3HR9A 4TZDA 5T5OA 3B01A 3FL7A 4JGYB 1Q3EA 3ALQA 3WF3A 1G9DA 3RPQA 2VMDA 3T4VA 4CDWA 4I30A 5EV7A 4OI1A 4E4HA 5KC5A 2ES3A 4JDOA 3JBG2 1O8SA 5FCCA 1QXRA 1C5IA 1RTVA 1VRH3 2EVXA 4D6RA 4FBFA 3I3BA 1R1ZA 1RUE1 2NN8A 1PZ7A 1PX3A 3ACIA 2VPVA 3NNMA 5I0TA 2MHFA 4QWNA 4JDMA 1XNAA 5DAVA 5FYHA 4AI3A 4JKLA 4R9AA 4AAXA 3PJQA 3UYJA 1GQPA 3VDDB 5B4NA 2W3JA 2NMOA 5LBCA 3NQHA 5F32A 1OXCA 1TMF2 1W6NB 3BOPA 2I2SA 2B4KA 2VMEA 1UQXA 1H9PA 1WCDJ 3PLQA 4XFCA 5A7PA 1W2UA 4IGQA 2ZEXA 4LOSA 3RZHA 1H4GA 3NV1A 1EP0A 1O3TA 3GHNA 4IDZA 1ZBA3 1WBLA 2VZVA 1EYBA 4IEZA 4NRQA 2QQMA 1LECA 2VZRA 5KHKA 3OUJA 5DDJ2 2E32A 5GZDA 1V70A 5C9AA 3DXUA 3IB3A 1MEC1 2Q8OA 1HB1A 1WCKA 2XXZA 4YZ4A 2IXKA 3RJ2X 2WN3A 2WNEA 4LULA 4WM8A 1H6XA 4OLLA 1AYM2 3QLQA 4TLGA 4MADA 1QGLA 2DVDA 5FXXA 3KCXA 3WP6A 1HDKA 3I2IA 1ZZ9A 2EALA 4Y4RA 2CGPA 2GN3A 2MNGA 1H0BA 2H0BA 2VXJA 4UFKA 1EAH3 5FUIA 5F37A 3AYCA 2RJ2A 4QHZA 3VHOA 4BPZA 1PNFA 4MXWB 3QOPA 5FREA 1HIXA 3ZMNA 2W39A 2XUEA 4TYSA 2DDUA 2Y34A 2VZQA 1YQ6A 3O1OA 3QH7A 4QHOA 1C3HA 1V9U2 3DXTA 2R16A 1KJLA 3SH5A 2JG9A 4A7YA 4Y20B 4YGBA 2WJSA 3HEIA 2W91A 4IW3A 3TEWA 2B46X 3WDVA 4FTBA 5EHDA 2RJKA 2W52A 4XJZA 4QKDA 4AXOA 2B39A 5FLIA 4X6RB 1AX2A 1SZBA 1YFWA 4F8AA 1WW7A 2OS2A 2VC9A 1H2KA 4ZS3A 1LEDA 3ATGA 1J3PA 3JB4C 5IAXA 2HWD3 4N90A 4XUTA 4AGGA 1FMD2 2JXAA 3POBA 3PUHA 5A7OA 2Q8CA 2Y6HA 3ECQA 5F8PA 3AYEA 2OPWA 1SLBA 2YYOA 1KQRA 2LRPA 2A6XA 2J42A 5FQ0A 1OT5A 1RUJ3 5FR3A 3E6BA 4Y1XA 1AYN2 2UWAA 2A3WA 1KXGA 5CEHA 5FZKA 4M4PA 1MQTA 3AVSA 5LCWL 4QPGA 4XABA 3NNLA 3M70A 3R4SA 3KWVA 4YFZA 1LENA 3LDBA 5FAXA 2UU8A 5FZ9A 4A6SA 4XHBA 4IERA 2ZS6B 3SMHA 2OA2A 2Y60A 3RYRA 2QQPA 3IIIA 1YCIA 2IVJA 3PU8A 4Y26A 3VBRA 3EHKA 3GBWA 2PMWB 3LDRA 3BTZA 1AR92 4L8QA 4B29A 2AACA 2Z4FA 3SC7X 4HVRA 4H3WA 5A6ZA 1Z7S2 4RGAA 5F6KA 5JSPA 1SPPB 5K9YA 1VR3A 5FPZA 3RGBA 1OI6A 2DVFA 1PGL2 2ORXA 5FYZA 4QQPA 5M0TA 1ST8A 1K42A 3ZFGB 1XYOA 3KCYA 3LOIA 1I9RA 1WBFA 4LMFA 4IETA 3ZYRA 4FAHA 4NAOA 2EAAA 5F3CA 1HQNA 1AXYA 1OOPC 1Q8OA 1NE6A 1XOYA 4OZOA 1DBNA 4RR3B 5C4WA 1AR71 2RDNA 4E8CA 2ZMKA 5FK7A 2V5DA 3K4DA 3WF1A 5CFDC 4DUXA 3MV01 4IEVA 1AX0A 2XBO3 1OQDA 4YZ1A 3HN3A 4XIOA 4HANA 1YI9A 4XUPA 2VNGA 2VMGA 4K7JA 4SBVA 3VLBB 2R063 4COUA 2FCUA 2D6MA 3I2JA 3KGZA 2WKKA 2HWE3 2ZMNA 5LRSA 2XOMA 4UFHA 5F39A 2JDAA 1UY1A 5BNQA 4BDVB 3MUY1 3RSJA 5EIYB 3U4XA 2HBTA 2QUOA 4TXWA 5L7OA 3GXUA 3OGGA 3JUUA 3VZLA 3WDTA 1G8WA 3WHTA 2W08A 1VRBA 2RVAA 5A32B 1QEXA 3NL1A 4JDNA 4XDPA 1UW8A 2DBNA 3EMRA 3M3OA 4Q8LA 4XTPA 3ROUA 1JOJA 4LE3A 5IK5A 4IEQA 5IK8A 4QAWA 5EJ3A 1ONAA 3ILFA 3VBOB 1NA1C 5FYIA 5CADA 2CHHA 1RMU2 1QJX3 4E2SA 1PK6C 4CDXA 3OCPA 3LD8A 1H9WA 1OMIA 3UESA 1JZ5A 3BB6A 4AEDC 2A5ZA 4L97A 3VBSA 2RJLA 4M3CE 4YYOA 4Q0UA 3OY8B 3DEMA 4XE9A 3ZXEA 1RXGA 4PT6A 5DPNA 2O0OA 5I93A 4Q4Y3 4OZXA 1JW6A 4K6BA 2PHUA 3ZN4A 5FMOS 2OPKA 5CYYA 3TEXA 5IK7A 3SNMA 1ZRFA 4JGYA 1DLLA 1MQTC 5LBFA 4BIOA 4DEQA 3J8F1 4XF3A 2WFF3 4ZXEA 2R6QA 3ZYPA 4BQYA 3UL2A 4I0AA 3T2TA 3T0AA 1H4HA 2DCJA 1JZ8A 4CDQB 1RUC3 1MEC2 2FDIA 2VL4A 2RS52 3MFCA 4AI2A 3OYWB 2DFCA 1JHNA 4XAEA 1W9YA 3ON7A 3ABZA 1GANA 3LA2A 4YVSA 3OPTA 1POV0 3GCWA 3R0RA 1CAVB 1GKBA 1W9TA 4IV1B 3VDDA 4I3PA 5FY4A 4C0HA 1WLWA 3Q8CA 1W6NA 3PUIA 4S2FA 4XAAA 3T2PA 2JG8C 2UWBA 1D4M3 5A7QA 2BEOA 2CU5A 4G4FA 3VDBA 1H1AA 1LR5A 1RHI3 3IDCB 1CIWA 3JQXA 4XFHA 2SLIA 4LK6A 1D2SA 1YRZA 2JJ6A 2Z79A 4YW3A 1LULA 4ATFA 4JRLA 2DCYA 4QB2A 3RFRA 1XXNA 4FAGA 2QJVA 4B1LA 2HYKA 5FPBA 3OEAA 3S6PA 4N43B 1HXS1 1F4HA 3I2KA 1T2XA 3FFQA 4H2AA 4PIZA 4TN7A 5IWFA 3RG0A 4AFCA 3CJIB 3Q8EA 3OJBA 4ORFA 4YG6A 5JIAA 2AUYA 2JE8A 1OA2A 1R093 4PJYA 2WL1A 4CPBA 2CSGA 1W3XA 2K46A 4R9CA 5K0UC 1POV3 4QDRA 2CAUA 2E33A 5C5TA 5GLWA 1GP4A 2HWB1 2QQKA 5LK7B 4V1PA 1O3SA 5BNNB 4XHXA 3WP4A 1PMIA 3WNPA 4YSFA 4BCUA 1GQGA 3U14A 2BVBA 1QWRA 2QQIA 3I3QA 4AVVA 4CU7A 1NT0A 2PQQA 3A22A 4OMCA 5FTTC 4MXWA 4PI0A 1SQ4A 1W6QB 3C8XA 4E4ZA 3WQ0A 2VUAA 2ARBA 5EZWA 4CRQA 2R1DA 2ZTNA 1W03A 3PIGA 4B3NA 5KR7A 4Y20A 3T2QA 5J7MA 3LFIA 5FOBB 1W06A 1NOVA 3PUSA 1GV9A 4E2QA 1UU5A 5BV6A 5IAVA 4LT5A 3A23A 4XQWA 4EWDA 5FFOC 4QM8A 1DGWA 1DZRA 1K45A 3QCWA 1LOFC 1WCUA 1I3HA 1W04A 1UYYA 3C7FA 2XMLA 3JD71 2ARAA 3NV2A 4JCKA 3RYPA 2VVFA 4GWIA 1U5XA 4M3CF 5LATA 4FPJA 4NWWA 5T5LA 1MR5A 2JEMA 1HV0A 3WNLA 5KXDA 4DFSA 4Q8KA 1LOBA 3WXPA 4XYXA 3I97A 2Q1FA 2RS33 1ASJ1 4JHTA 1V6IA 2LW8A 4S2DA 2XJRA 4UBHA 4FOQA 2JIGA 4LLFA 1SCRA 1WCQA 4YGCA 2PA7A 5BNOB 1YJKA 2QQNA 4AHYA 4XF1A 3K46A 1GZWB 2VM9A 2ARXA 4FFIA 3RVHA 2ETEA 2WNUB 2NPIA 4G9SB 4XZPA 1UX6A 3CMGA 5FYCA 3ZFFC 4Z2AA 4ZU7A 1KFUL 2E26A 3OGVA 1FAYA 3NNFA 4LK7A 5FWJA 1Y9MA 2LUWA 4CP2A 5ABJB 1PVC1 5CA6A 4EE2A 4GH4A 2VQ0A 4HZFA 1BK0A 5E88A 1REFA 5L9BA 4HOOA 4LXLA 5FZEA 3ASIA 3TN91 2D3RA 3C7EA 4D94A 1VBD3 2YXSA 1SPPA 5JI7A 3T08A 2FMDA 1HRI1 4I0BA 4PQQA 5IVEA 2RM21 4DUWA 4CCMA 2A75A 3I4IA 1CZSA 4C0BA 2OW4A 3WCRA 3VD5A 1S2EA 1HB2A 5A3PA 5KHJA 4GAZA 5IVCA 5J3UA 2PHRA 4LO8A 4RR3A 2DFBA 1E5IA 2A7AA 1H1MA 4CXWA 3VZNA 2VOKA 1CIYA 4XPVA 4GZ9A 2P3JA 3TNPB 5LZ6A 2QVSB 4QPIB 3GGLA 1ZX5A 5CU1A 1ULFA 1BHGA 3OPWA 5FP7A 2VOXA 3I3MA 3BIEA 3U4SA 4MH0E 1RUG2 4FPGA 1D0GA 4CP9B 3FUOA 4ISQA 3ZYGA 1HQWA 5JMCA 3W9AA 3AMNA 2WO7A 1NYWA 1L3JA 2I45A 1YQ5A 3MFAA 4FT8A 2WO1A 1LKNA 1BYHA 1W9WA 5JZGA 1C4RA 2WNOA 3CLPA 3T0BA 1Q43A 2ZGNA 1ZBA2 3UJOA 1XNTA 4GB33 2VTXJ 2D6PA 3THPA 5F5AA 1AR63 1WMFA 1UMZA 4OFGA 1UZYA 1XNDA 3OBRA 4AQ2A 1ZYBA 3K51A 3ZXAC 4XZUG 3UGHA 1IS4A 2F4LA 5A32A 2XQXA 2J7MA 3N7JA 1FPN3 1C1FA
chains in the Genus database with same CATH topology
2RR13 1COV3 1BJQA 4N7UA 3E6CC 1PO11 1NCRB 3VBOA 1BEV2 3M3QA 2ZX2A 4M0NA 2DF7A 1AR81 2HWF1 1R083 1LHVA 3BU7A 1IS5A 3D5OA 3GBGA 4CDUC 3OY8A 3J9SA 2DTWA 3BOWA 3GHMA 4F7ZA 4QMAA 4FP3A 2OVUA 5FO9B 4P5HA 1IHMA 4Z1VA 3RYKA 3I59A 2JX9A 4YNIA 4YM1A 1ZM1A 3NJZA 3RZZA 4WZCA 2VOVA 3KQRA 3LCPA 3VBHA 4CDQA 1HXS2 1WW5A 2VW1A 3IT8A 4GALA 4HL0A 2D3SA 2MEV3 1CN1A 3OYWA 2CTVA 4MX3A 3ES1A 3BODA 3NAPB 2XVKA 1X33A 3ELNA 1NXMA 1ZA4A 1W39A 4DQAA 2HWD2 4LEJA 1CAVA 1RUI1 1MVQA 4FPEA 4Q26A 1GZCA 3WDXA 4E2GA 4S2HA 3VKMA 5KBFA 1QQP1 2G4IA 4PDWB 1DGRA 2ZCWA 1QNYA 1RUF3 4QU2A 3I54A 3ZFGC 4OI2A 3ZXDA 4AK3A 1UKRA 5KHIA 1UIJA 2C0ZA 2R043 4Q4X1 4NVPA 3ZXLA 3TB0A 1MS4A 4PLMA 4HBNA 1OLRA 3FC0A 2VULA 4KU8A 3ILRA 1F5JA 1X7NA 2XLFA 3K48A 1X50A 2D43A 1DGRN 1CAWB 3L9JT 4N43A 1RUOA 1EV13 2PLV3 1DQ6A 3CJIA 2DV9A 1TMF1 3JU9A 1XYNA 3N35A 4KGGA 2OZ6A 1KDMA 4YVWC 3N7KA 4H7LA 4U36A 5BNNA 1XE7A 1QOTA 4L9BA 4J6GA 1MZFA 1RUE3 3PHMA 1W6QA 3ZFEB 3O0WA 3OD0A 1DQ0A 1V00A 2K9ZA 4NHLA 4ES9A 4AG4A 2WQ4A 1QJZA 4BE3A 1S2KA 4CEWB 3M7AA 4X8PA 3W58A 2R062 5C33A 4FSJA 2A6ZA 4JGZA 1PVC2 3NWKA 2VXRA 1G6NA 4AFMA 4CYDA 1D2QA 5FQ0B 3IWZA 3SLIA 4YW4A 4K9SA 3FJSA 4XBNA 1V9U1 4CP0A 3B9IA 4QPGB 3SCGA 2WT0A 1DQ5A 5GALA 2E6VA 2D5HA 2O8QA 5CBLA 1ZBE3 3V0BB 3LA7A 2DTYA 1QDCA 1G9BA 3B94A 4KWJA 2OIIA 1FNZA 4HFSA 4Z07A 2ZJCA 1K5MA 3MW4A 4OUMA 1GZWA 4AEJA 5GM0A 2WNUA 5J96B 2B9UA 4WVVA 5C8WA 3ZMOA 3RWNA 2BNOA 1FMD1 1PGW1 2QDRA 4D7YA 3IN9A 5ABJA 1QNWA 4IV1C 1SEFA 2ZHKA 4Q4Y2 1LESA 1CPMA 1Q8QA 3PNAA 2C5DA 5JCTA 1SMVA 3V65A 1JUIA 3KS7A 4DS0A 3B9CA 3VZMA 2WFF2 3BIWE 3VZJA 5T5JA 1FOD2 3LSEA 1URXA 1XU2A 2CNAA 3MIHA 4QM9A 1HLCA 1C8NA 2NP0A 1ULEA 2I74A 3IDBB 2VW2A 1PIV2 4QPIA 5T54A 2GDFA 4LUMA 4RS5B 4WM7A 1AL21 2UYBA 5T52A 2HWF2 2XJPA 5L73A 3S0MA 4XQ4A 1PGL1 2RHPA 3OTFA 1MS5A 4H14A 3M3CA 4IEUA 1MZ6A 4QGMA 2XJSA 3AMPA 5HCAA 2QDNA 3UKTA 3WDWA 1J58A 1S0DA 4BZ4A 5C8CA 4IEWA 3KT1A 5DUUA 2C9AA 1IKPA 4PQ9A 4RHV1 5GJ6A 5LK5A 5BNPB 1S0BA 4KBBA 1ALYA 4B8EA 2XGXA 4XFGA 2DCKA 2VH9A 4LO5B 5JOXA 4OI0A 1FNYA 1VBE3 3H50A 3JQWA 4XOGA 3WP3A 5ACA2 1RUH2 2E53A 1R092 2D6KA 3VBSB 1DGWX 1IPKA 1DQ4A 1NCRA 2E7QA 4GXLA 4FVVA 5FOJB 3B93A 4YM2A 1WW4A 1DYKA 4COZA 1NCQC 4LHNA 3VBUB 5L19A 4BM8A 2AZ5A 4DRVA 4N9IA 2RS12 1AR73 1QQP2 3IMNA 5I8YA 1F8VA 1BKZA 1BXHA 1ENQA 1J1LA 5AC91 1YI7A 2PHDA 4R52A 4Q4X2 3VL8A 4ZU4A 2BBVA 5BNOC 3A0KA 2NQYA 2YC0A 5KXCA 1RMU1 2AH2A 3ZYJB 3ZSJA 5JSRA 4YVSB 4Q4V2 3ES4A 2GMMA 1CR7A 4BMEA 3I2DA 4K40A 2JECA 5KXBA 1LTEA 4MXVA 1C8M3 5GZFA 3NAPA 4Q1RA 4XJUA 3WQ7A 2P17A 3VBFB 4A7ZA 4AFDA 1RUD3 3VL9A 4MGKE 3TAYA 1Y7BA 4OULA 1GQHA 1LRHA 4PDWA 2UURA 3AZWA 5H9SA 4QT6A 4O9EA 2ZZJA 4GKYA 3ZIWA 1ZREA 1C5HA 4MGIE 3T1LA 2RS51 2JENA 4YG3A 2ZAHA 4DPNA 5A3LA 4FP2A 1WLDA 4RQPC 4FQ4A 1WLTA 5JOYA 1CAWA 4FOWA 1CVNA 4MLOA 3VGIA 1R1A2 3WG1A 4LR4A 4BA6A 2IXCA 1LEMA 4K1YA 1CPNA 3VKLA 2YZ4A 4AEMA 1SACA 3WUCA 3J8F3 4FOYA 1TNFA 1ND2B 1JYCA 3RI8A 1ZRRA 1XNBA 1IQAA 1YUDA 2BTVC 2VU9A 2WNVB 1TE1B 3KZ4C 3PMEA 3M3IA 4K20A 4XMAA 3E5QA 3ZFEA 1IS3A 2A6WA 3RMYA 4COWA 2A73B 1QJU1 3M8LA 1BCXA 4CEYC 1LOCA 4PLNA 4HKOA 4UXAA 5JOZA 2YDEA 4CEWA 2F4PA 4HETA 1PGW2 5FLHA 1V6LA 4B4QA 4IV3B 1GLHA 3B69A 3RJRA 1VB2A 1B35B 4U2AA 4CDWC 1WMDA 4HVOA 1W6MA 4LBMA 2WA3A 2GNDA 3H3ZA 4LLOA 1BMV2 3V0BA 1WUVA 1PO23 3ILNA 3MIDA 3AK0A 3L2HA 3R05A 3UV9A 2FMYA 3S7IA 1VBB2 2HWB3 4GH4B 3N36A 1QJY1 4AW7A 1AL22 1LOGA 2ZGRA 4FPFA 4AWDA 2ZACA 1HW5A 5CB7A 1JUHA 1RVF1 3WHUA 4Q1PA 3WW4A 4RHV2 3ZDSA 2HWC3 5C9AC 5SV5A 3O0XA 1IPJA 3B00A 1WA4A 2ATFA 1GFF2 4LA2A 5J98B 4WM8C 3OBTA 2G9FA 1D0HA 4AVBA 1PZ8A 2WT1A 3AKSA 4N9HA 5CFCA 4XJ8A 1IOAA 5FO8B 1LOEA 1ULGA 4P14A 2UY8A 4RS5A 4GMP1 3ACLA 3NV3A 1VBA3 1WGPA 4FTSA 2A3YA 1ZZCA 3AP6A 5FMOL 5JZGB 1ASJ3 3MLKA 2ZGLA 1LHWA 1S1AA 2BUKA 1AVBA 5DG1A 1JYIA 3KT7A 3E5UA 2XWJB 2JKBA 1VRH1 2JG9C 2XLAA 5BNPA 4JQRA 5AC92 3HT2A 3O5SA 5TSWA 3ZXGA 4Y4YA 3CF6E 3M2MA 4KQ7A 1OQEA 1RUG1 2PLV2 2RMU3 1QXJA 2VECA 5BPXA 4P9LA 3SH4A 3TN93 1J59A 1UN1A 2D6LX 1H2NA 3AXDA 1Z0HA 2BYVE 1DF0A 2ZBJA 2B8MA 3HQXA 2DVGA 2NLRA 3MGUA 4EN6B 4P9IA 4DZGA 4BOWA 3VBUA 5C6CA 4I2OA 1F9KA 3P3NA 2D5FA 1GNZA 1ZBA1 3EXUA 3FWEA 3I59B 3I8TA 4QPGC 4YM0A 4OUSA 3FFZA 1SFYA 4SLIA 1ND3B 1UU4A 5GLUA 3VBHB 1UF2C 3MDPA 2GSYA 1HQLA 3B3QE 3BTAA 3APBA 4Q4W3 1BEV1 1AXKA 4QHBA 2A70A 4B7EA 2GN7A 4TLFA 2BW8A 3VBRC 2TUNA 2VNRA 4LBQD 1X82A 1EAH1 1ZZ6A 2YHJA 3MLLA 4EN8B 3FBMA 1ZZBA 1OLQA 2DVBA 3RDIA 1BQPA 1W6OB 3VBFA 2WZR2 4INDA 4XIKA 1U0AA 5KHGA 3DPRB 3PMSA 4KG8A 1QHDA 4JRAA 5C4WC 1UIKA 2ZHNA 4NWVA 3RS6A 1PO13 3LGRA 1ZZ8A 2UYAA 1XNCA 4NHMA 2A3XA 2XJTA 4O9GA 1APNA 3AJZA 1AR83 1FXZA 1QJU2 1HKDA 2XWBB 2CYFA 4KH9A 4LO6B 2FZ2A 3GBFA 5B2GB 1QY4A 1A3KA 4AHZA 2HWD1 4BLJA 4AI1A 4JTOA 4LNVA 2IFWA 2PAMA 2WS92 1IKQA 3UKVA 3G7DA 3QH6A 3O7OA 3A0NA 3H1MA 5LRRA 5L7OC 3FMGA 4R9BA 4N53A 1ND2A 2XG3A 3EBRA 4RGGA 4Y1UA 4D69A 2R072 1TEIA 1H8TB 1MZEA 4P9WA 2WNVA 4D7TA 4GKXA 1VB4A 4A3XA 1N3OA 4XFBA 4BQ1A 1HRV2 2D44A 4M0HA 3SISA 1M06G 2TBVA 3GZUC 1RUI3 2ET1A 4Q0PA 2VVDA 4CDXC 2ZX1A 4DY5A 4I09A 4JGZB 1OPOA 1UPSA 4HLTA 1G9FA 5EWSA 2Q0AA 3SCFA 3VBSC 5DZEA 3LAGA 1QJY2 5AFBA 1BVVA 5J09A 4AF9A 4AFBA 2WQZC 1VBC3 5EXOA 2XUMA 3JBG3 2PELA 1BBT2 5I8TA 1W6PA 4IV3A 3EO6A 1RVF2 4NPRA 4JGYC 2ZZQA 5H9RA 3IKWA 4BH9A 1B35A 1IS6A 3AXEA 1LGBA 2EXHA 2VUJA 1AZDA 4YG0A 3AYDA 4KU7A 4BWOA 1K5MB 2BNMA 4AHWA 1EY2A 3V0AB 4P9GA 1TMF3 3HWJA 3DUIA 4LBLA 5DZGA 2R061 2Z5WA 4YVSC 3Q9OA 1X8MA 4L99A 2YGMA 3VDDC 1VIWB 4GWNA 4PCRA 2BNNA 4AVTA 3ME2A 5DDJ3 2ZGKA 4GIQA 4J1XA 2VW0A 3O12A 5IK4A 1FV3A 4XDQA 3FHIB 2QKDA 3WCSA 3WG2A 1AYM3 2VOWA 3AZXA 1VRH2 4Y22B 1IZ3A 1TME3 4XILA 5E8AA 1LHUA 5D1IA 3J26N 5JAXA 4Z92B 4WM7B 1N3QA 3H1WA 3SXWA 4LHLA 4WZFA 2ZABA 2EF6A 3ZPYA 3MIBA 4Q4Y1 1V9U3 3WV6A 5C8CB 1LJ7A 2GMEA 2V73A 3PVNA 2VQAA 4HMZA 4XJWA 3ZO0B 4E27A 4P9XA 5CG8A 4QQHA 2VGDA 5GKAC 2ZKNA 2IWGB 2WFF1 1OQ1A 1FOD1 4KNCA 4UW6A 4Y1VA 3CEWA 4XF0A 3S7EA 5E1RA 1RUC1 1XE8A 3TOJA 3AFGA 2BPA2 2FHRA 1O5UA 4UBGA 1PIV1 1FMD3 1BK1A 4OHVA 5KWRA 1PNGA 1I5ZA 2VNOA 4IL7A 5JSOA 4QGNA 1FI2A 1QXPA 2AREA 1AYN3 2AENA 5EYXA 1EAH2 4AE2A 2D7FA 3O0VA 4CTEA 4LUKA 5L36A 2JE7A 2GNTA 2PYTA 2YPJA 3MZHA 4K21A 3WDYA 4I01A 4FPOB 1V6OA 1YO8A 3IPVB 1ZNPA 3VHRA 5CAZA 4AHXA 4EV0A 2ZA9A 1AR93 3USSA 1ND3A 5ACA1 2D40A 1RUH1 5IUQA 1R091 1Z7S3 4LBKA 5DUXA 2TNFA 4KWLA 1CQ9A 4C90A 3D0SA 3ZX7A 4GH4C 5HCBA 2H6CA 1PM7A 1O5LA 1A6CA 2RS11 2ZX4A 3QD6A 1ZVFA 1RGSA 3WR0A 1AF9A 2XHKA 1RUJ2 1W6OA 2XL9A 2EXKA 4QX5A 1W0PA 3DPRA 4M00A 4E4DX 4RR3C 1LOAA 2R32A 4HK9A 2R0FA 4W6WA 2ZKLA 3MICA 3R6SA 4LO7A 4IEXA 4Q4V1 1IGOA 2D98A 2X29A 4WVWA 1BVP1 1AJOA 3POWA 4WV8A 1SLTA 2GNMA 3OPZA 3VHNA 1MS1A 1OOPB 5I91A 2CWSA 3LWCA 4XF9A 1Y9QA 1SBDA 3MF9A 4XJAA 1N1TA 2HEVF 4I0WB 5CFDB 5JZGC 3AM2A 5JIUA 2WSVA 4WBBA 5DG2A 5F5QA 4F3JA 3WG4A 2P34A 5HCFA 3WOGA 4AI0A 1RMU3 1E57A 2HWC2 3WD5A 1LGCA 3MW2A 4AGRA 5DUVA 2KXLA 3T1MA 5GZCA 4ONUA 3ZVXA 3O14A 2CGOA 1H8TA 4PLOA 2JD4A 2VMHA 2XBO2 2SBAA 3KSCA 3VBOC 4C1WA 5LEKA 1R1A1 1RJ8A 2DURA 1DU3D 2D97A 1BZWA 5H9PA 2HWE2 4GULA 1VBA2 4QPYA 1VBD1 2PAKA 2GC1A 3INAA 5CNAA 1RC6A 5JDBA 1Y3TA 4MVTA 3H0OA 1TQ5A 4Z2WA 3ZN6B 3ST7A 2XL7A 1W6MB 1MEC3 1NA1B 5GZEA 1OD5A 4BMBA 4W6XA 2JDZA 5EFUA 4AEDB 5JLVA 2AGSA 5GLZA 3VBHC 2K0GA 4CDQC 3V0AA 1QJX2 3ZSKA 4OVEA 1QH6A 1UL9A 3GALA 4EN0A 2Q30A 3NKTA 3HN1A 4AEKA 1GZ9A 1O4TA 4UW3A 2Q4SA 1D4VB 3MI8A 1YLLA 3AJYA 1AR61 3WW1A 1QH7A 5AVAA 1BMV1 5J36A 1SFNA 1U5ZA 4XF4A 2XJUA 3P3PA 1CAXB 1FPN1 3HT1A 4MZUA 5CFCB 1DGLA 1VAKA 2RR11 4Y22A 1RUC2 1VBB1 3D6EA 3MLJA 2BQPA 2Q5TA 4N43C 1N1VA 1QKQA 3AKQA 3PTYA 3CJIC 3H7YA 3AP9A 2OUHA 1RINA 5JWPA 1JTZX 4META 5K8SA 1FATA 3TRSB 1AXZA 1LGNA 2WINB 2CL2A 3ZIXA 1Q5OA 4IQPA 5BNNC 1D4M2 3GZAA 4W6YA 1Q8PA 2B45X 1YXWA 1RHI2 3CNAA 4HT1T 2W0XA 3W59A 4N7IA 3A4UA 4AGVA 1S0FA 5FO7B 5K0UB 3M1HA 4K1ZA 5BUVA 4ES8A 1LHNA 2AYHA 3NW4A 5KHHA 3TYJA 4DB5A 4GMP0 4EWEA 2Q1MA 4P9JA 5F9TA 4LA3A 3FE5A 1CAUB 2ZGTA 2QZ2A 4R4ZA 4CZSA 4JGZC 2E63A 1N1SA 2ZGUA 3RMXA 2GNBA 4LTAA 4XBLA 3SITA 1UD1A 2WLPA 1YJLA 2ZMLA 1QOSA 4FQZA 1RL3A 3GYDA 3N7LA 3UJQA 2HJIA 4Z8BA 1QU0A 2Z2SB 4IEYA 1PGSA 4NN0A 5FPXA 2ZHLA 1GBGA 1AL0G 1ZRCA 1XNKA 3IPVA 3JB8A 4RSUA 3N4MA 1K5MC 1Y43B 1KRIA 4XBQA 3UKNA 4MYEA 5EYYA 1EPZA 1V6MA 2PLV1 2VVEA 1ENRA 2WNUC 4GMP3 2G9GA 4X8NA 4AQSA 3AMHA 4PBOA 4OHXA 1VAMA 1UU6A 4LHKA 3NKGA 4C1XA 5ABJC 2ZPXA 4YZ5A 1VBC2 1YFUA 3ZSMA 2PHWA 5A33B 3AFKA 2Q1ZB 2UY9A 4FCAA 2ERFA 1NY71 3RQ0A 3CL1A 4FPKA 2PHLA 2RS32 1Q56A 4XTMA 3ZFFB 3MIEA 1S55A 1CESA 2A71A 3SH3A 1SLCA 4EN7B 4BIFA 5CIRA 1RUG3 2FQPA 3H8UA 2BGCA 4E4SA 4QPIC 1AX1A 1QMJA 2Y0IA 4WM7C 1PVXA 4XETA 4Y1YA 3B02A 4ASLA 2WFPA 2XVGA 3SCHA 2R30A 5BYNA 4NO4A 2BFUL 1OOPA 1VBD2 2WZR1 5C8CC 1GICA 4N53B 1KFXL 4R9DA 4S2GA 5CFDA 3MPPG 1AHSA 1ZBE1 2XJQA 3DKWA 4LBJA 1RUNA 1BEV3 3NO8A 1TME2 4HN1A 2XB6C 1FYUA 2O8OA 1LHOA 1QOOA 2GZWA 4WVZA 2DUQA 2HEYF 2R1BA 4Y24A 2ILMA 1H2LA 5JPMB 1RB8G 4IESA 3FLPA 4YGEA 4HN0A 1NCRC 1YFYA 4XFIA 4M01A 4L92A 2WS91 1EPWA 4LBQB 2IXJA 1WCSA 1I6XA 3V56A 4ZXKA 2GC0A 3AMMA 4D3WA 3GNEA 2IXIA 1W6PB 3VKFC 2BFUS 2QNKA 1SLAA 2CGNA 4GB32 2D6NA 3ZN6A 1AR62 2R071 1HXS3 3AP5A 2B42B 2JE9A 1NA1A 4KL1A 1G9CA 4Q0QA 4QGLA 1PK6A 2CWMA 1H8VA 2VG9A 1HRV1 1JBCA 1FPN2 2E9QA 4AEDA 4CDUB 3KMHA 2RR12 1COV2 1GR3A 5AVPA 5T50A 2YGLA 4FPHA 1ULDA 3AKRA 3H7JA 1SCSA 4YARA 1LCLA 1S2BA 1R082 3NAPC 4MGYE 1OA3A 4BYYA 4ZKTB 4FXKB 1KD7A 1BBT1 3VV1A 1N47A 1Q8SA 1OSGA 1LU1A 4GWMA 3PJYA 1OA4A 3ZSLA 3WX5A 3J4UH 4AQTA 4BLIA 4PDWC 3V64A 1QDOA 1Q8VA 1GSLA 5JOWA 2NMNA 2GAUA 1NZCA 4QQ2A 3N3HA 4H7MA 1VBE1 3MYXA 2V5YA 3WQ1A 4IEOA 3E6DA 2BWCA 4DY3A 1NE4A 1CAXA 2HKXA 1W0OA 2B7YA 3JD73 3FLRA 2ZGMA 5I8SA 5AFEA 2MEV2 4M3CB 1DZQA 4HSJA 5D8AB 1OFNA 2JG8A 2EA7A 4H55A 4JAAA 2WLQA 3LB9A 3M3EA 3RI9A 1DQ2A 5DUWA 3H3UA 4OHYA 1O91A 3AZYA 3ETQA 1PZ9A 1RUF2 1U5IA 2BWAA 1YFXA 3H1YA 4DMIA 4JC1A 2GC2A 2R042 1YIPA 4AVCA 1O4ZA 1OFSA 2KA3A 3ZFEC 2ZHMA 5KC6A 5J48A 3BPZA 5K0UA 5FRAA 3LSDA 1PVC3 3EQEA 1M4WA 5F1RA 4YVWB 1UPIA 1Z78A 1EV12 1U5YA 2PFWA 4Y1ZA 1X8EA 3ZN5A 1C8M1 2GU9A 2UWCA 2QFEA 1KS4A 2YV8A 3BALA 1CAUA 1HRI3 1SLIA 3PVOA 4CEWC 2RM23 4HPKA 3WY6A 5E89A 1RUD1 4RL7A 5F6LB 1UAIA 3DGTA 2GC3A 3MEPA 1DHKB