5I93A

Structure of mouse acireductone dioxygenase with ni2+ and 2-ketopentanoic acid in the active site
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
179
structure length
179
Chain Sequence
b'MVQAWYMDESTADPRKPHRAQPDRPVSLEQLRTLGVLYWKLDADKYENDPELEKIRKMRNYSWMDIITICKDTLPNYEEKIKMFFEEHLHLDEEIRYILEGSGYFDVRDKEDKWIRISMEKGDMITLPAGIYHRFTLDEKNYVKAMRLFVGEPVWTPYNRPADHFDARVQYMSFLEGTA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase
publication title Metal-Dependent Function of a Mammalian Acireductone Dioxygenase.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
total genus 48
structure length 179
sequence length 179
ec nomenclature ec 1.13.11.54: Acireductone dioxygenase (Fe(2+)-requiring).
pdb deposition date 2016-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03079 ARD ARD/ARD' family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5i93A00
3WW4A 5F1RA 4QMAA 3IDCB 4O9EA 2GZWA 1OD5A 4QM8A 2H6CA 4E2SA 1YWKA 3EO6A 2GAUA 3OCPA 1ZZCA 2UY9A 4YNIA 2PQQA 3M3IA 2BNMA 1CX4A 3MZHA 2IXHA 1ZX5A 3WW3A 4QX5A 4QM9A 3BPZA 2EAAA 4Q0QA 3C3VA 4MH0E 2Q4SA 2XGXA 5KHGA 4KL1A 5KHKA 3SCHA 1PM7A 1QWRA 1O3RA 1YHFA 4I2OA 2IXJA 3BCWA 3D0SA 4QGMA 3RYRA 5C8WA 5J3UA 1CAWB 1J3PA 4J1XA 1OFNA 2PHDA 4JV4A 1XE8A 4XEZA 2OPKA 4K8FA 4X6RB 5T3NA 2H0VA 2BNNA 4HMZA 3ROUA 2O8QA 2C0ZA 2IXKA 3QOPA 4IESA 1X7NA 4YYOA 4FAGA 1ZZBA 5I91A 1J3QA 3ACLA 5LRRA 2PAMA 5CVRA 4FBFA 1I5ZA 4XFGA 1O3SA 3LA2A 3CEWA 4BH9A 4BIFA 1YFUA 3E6BA 1ZZ7A 4ONUA 1ZNPA 4HVQA 1H1MA 2VQAA 4Q0PA 2IXCA 1LKNA 3FE5A 3NKTA 1EYBA 1VJ2A 5D1IA 1FXZA 2PA7A 1WLTA 1DZRA 5I8SA 5I0RA 2FMYA 5HI0A 3H1MA 3E5XA 4IEUA 3ES1A 4HSJA 4KWJA 1GQGA 5EZWA 1YFYA 4EWEA 5JSOA 4YRDA 4LUKA 3D0JA 1O4TA 4TLFA 4P9GA 1ZRCA 3DN7A 1WA4A 2OA2A 2UYBA 5I0TA 4EROA 4HVOA 5BPXA 1O7FA 2XLGA 5JCTA 3SHRA 2OYZA 1NYWA 2XKOA 3KMHA 2PAKA 4MUVA 1CAXB 3MPBA 3EBRA 4L11A 1HW5A 4J1WA 1NE4A 1TQ5A 1NXMA 1ZRDA 1DGRA 1RGSA 2EA7A 3IIAA 4XF0A 3RYPA 3PNAA 4X6QB 1CAVB 3H3UA 3I59B 2ZKLA 3R6SA 4RD7A 5KHJA 4MGZE 1H1IA 1J58A 2ET7A 3FJSA 2XL9A 4Q29A 1O3TA 4IEVA 4HBNA 1EY2A 4XFIA 3SCFA 3IWZA 4D7SA 4I01A 3CJXA 1XE7A 3HIFA 2CAVA 3E6DA 1G6NA 3H3ZA 4XFAA 1XRUA 2PHLA 4QGLA 5JSPA 4AQ6A 3H7JA 5KBFA 4I09A 4AVCA 1J1LA 1X8MA 1ZREA 4KWKA 5CU1A 3EQEA 3H7YA 3U11A 3TNQA 3NJZA 4KU7A 2MNGA 4FAHA 5J48A 4Z82A 3H1YA 5I8YA 3BALA 2ATFA 2FQPA 4OFGA 5E16A 3N4MA 1GQHA 1RUOA 3S0MA 4ORFA 2XLFA 1UIJA 2N7GA 3NW4A 1NE6A 3FFQA 1LRHA 3IBMA 1VP6A 1Y3TA 5LRSA 3CL1A 3LA7A 3E5UA 2VPVA 4Q0SA 1CGPA 2BGCA 1V70A 5FLHA 4MGKE 4IEXA 1IPJA 3OGJA 3ZDSA 4FT8A 4OLLA 2UYAA 2B5HA 4XFFA 1Y9QA 4PIZA 2ZCWA 4YARA 4MV2A 2I45A 5FPXA 1RL3A 3U0ZA 4O9GA 1QXJA 2IXIA 1ZRRA 5BY5A 4UBHA 4NVPA 3KCCA 4LEJA 4EWDA 4IEYA 3ETQA 2PYTA 3SXWA 4IEOA 2WC2A 3DV8A 4JTNA 1IPKA 5BXXA 4HN1A 2QCSB 4F7ZA 3FX3A 3UKNA 5JR7B 4WBBA 4HN0A 3QACA 3RYKA 3KGZA 3WW1A 5BUVA 3USSA 2VECA 4UBGA 2PFWA 3LA3A 1DZTA 2HKXA 2GC1A 3L2HA 2IXLA 2B9UA 4H7LA 3BU7A 2E9QA 1SQ4A 4QGNA 2D5FA 5K8SA 3I7DA 3CLPA 4I02A 3LZZA 3SCGA 5I0SA 2K0GA 4IETA 4LA2A 3KGLA 3DKWA 2GH2A 5FDBA 4Q0VA 4UXAA 4Q0UA 4AVBA 2D5HA 4XF1A 2K9ZA 2XKPA 2Q30A 2DCTA 4CYDA 1QXRA 3RNSA 1X8EA 5FQ0A 5EFUA 2IC1A 4I3PA 3KSCA 4JVAA 1J3RA 4BYYA 5FQ0B 3MYXA 2QNKA 2OZ6A 2D93A 2XLAA 4XFHA 1SFNA 3TNPB 2OZJA 3HT1A 4DINB 5C6CA 2GC3A 2V09A 2MHFA 3E5QA 3GBFA 2D40A 5AVPA 4HZFA 3S7EA 1YUDA 3OTFA 1L3JA 4IEPA 3FWEA 5LEKA 1Q5OA 1ZZ6A 4PIXA 1YFXA 1I6XA 4EWAA 1FT9A 5I0UA 3SMHA 4AVAA 2XHKA 2O1QA 3NL1A 4YSFA 5I8TA 2B8MA 3IDBB 4ZU5A 4N9HA 4QXKA 1FI2A 5KHHA 2GC2A 3JZVA 2ETEA 2MPFA 3H9AA 4R8HA 3UKTA 1UCXA 5JSRA 4HVRA 2P17A 2Q0AA 3FHIB 1DGWA 4WZCA 2CV6A 3CO2A 3I54A 4HSLA 3E6CC 1WGPA 4BHPA 4MGIE 3H1WA 1Q3EA 1RTVA 4XF9A 3EHKA 3UKVA 4MZUA 3BB6A 4A2UA 4IERA 1CAWA 1UW8A 4KU8A 3LWCA 4GULA 1ZRFA 4XFBA 4IEWA 1ZVFA 4AQ2A 3NSTA 1ZZ8A 3O14A 4HLTA 2ET1A 1LR5A 3RDIA 4IEQA 2CAUA 3E97A 4ZU7A 1PMIA 3OF1A 3CF6E 5LEJA 1CAUA 4XF4A 4E2QA 3VHRA 1EP0A 2BNOA 2GC0A 2CGPA 1CAUB 3PVBB 4L2NA 1J59A 1YLLA 1EPZA 4LTAA 4XETA 3D82A 3H8UA 1UPIA 2KXLA 4I0AA 4PIYA 3LOIA 1QY4A 3H50A 2Z69A 3LAGA 3OD0A 3ST7A 2HJIA 3ELNA 2Y0OA 4D7TA 3GYDA 1UIKA 4LUMA 5J7MA 3ES4A 2Q1ZB 1O5LA 2GU9A 4EV0A 2H6BA 4R52A 2UY8A 1ZZ9A 4XF3A 3M70A 4MGYE 4LULA 2PTMA 3S7IA 2BEOA 2QJVA 4META 2QVSB 5FLIA 4N9IA 1YFWA 3HT2A 3B02A 1JUHA 4JTOA 5CADA 3DL3A 3WW2A 5FLJA 2QDRA 1NZCA 1OI6A 5FCCA 4PJYA 1CAXA 1X82A 3NVCA 3MDPA 4ZU4A 4E2GA 5KHIA 3U10A 4LLOA 1LB2A 4MX3A 5FPZA 5E1RA 4WVZA 3G7DA 5BV6A 2WFPA 1RUNA 1UD1A 1CAVA 3FZ3A 1OMIA 3I59A 1O5UA 4B29A 2PAEA 1RC6A 1O3QA 3RZZA 4LA3A 1Q43A 1U12A 3EJKA 4AXOA 5I93A 3PLQA 2F4PA 2XL7A 2BYVE 4KWLA 4IEZA 4Z07A 5JAXA 1VR3A 3HQXA 4I0BA 2Z2SB 2EVXA 1SEFA 3RPQA 4XFCA 4F8AA
chains in the Genus database with same CATH superfamily
4MGSA 3WW4A 1V6MA 1W2UA 2QQVA 2BOJA 2HWB3 2VOTA 3KCYA 3ZLIA 1UQXA 2HEVF 2QDNA 1QJU3 4R9CA 4PLMA 1AR92 2JE7A 2H6CA 4E2SA 1YWKA 4QX0A 3AP7A 2J1TA 1JYCA 4JZRA 4GIQA 2PQQA 1ZA4A 5FY9A 2LROA 1G8WA 2VTFA 5CKQA 2DU1A 5FP8A 1CX4A 2OT7A 3LPGA 3UETA 1ZX5A 3K4DA 1RUJ1 4HKWA 1GANA 5B4NA 1GLHA 4FP3A 2A70A 1JN2P 4KGQA 4QM9A 4WM7A 5GLVA 2JDMA 4FFIA 1ULGA 3NV1A 5FMCA 4MH0E 1WWYA 4MYEA 4AL9A 2XGXA 3I8TA 5DZEA 3ENRA 2IWGB 4WM7B 2ZEXA 5LA2A 5KHKA 3SCHA 4CCMA 3N7LA 1C5HA 4ZZ8A 5JOYA 5FY5A 3KHCA 2FDFA 4QGMA 4XQWA 3CU7A 4P02B 4YLZA 4WM8C 5C8WA 5J3UA 1J3PA 3OYWB 3BTAA 5EJ1B 3T1MA 2PHDA 1PGL1 1S0GA 4XEZA 4R4ZA 3C7EA 2NN8A 2QQOA 5IWFA 2WAOA 3MFCA 2BNNA 3AMQA 4HMZA 2FCUA 2R073 2VOWA 3GDBA 4FQ4A 4Q4V3 1SPPA 1LOGA 4PQQA 2X05A 3AMNA 1GZ9A 5DG1A 2VL4A 1UZYA 2JD9A 3O1OA 2J1EA 4Y33A 5FP4A 2Q8CA 4DEVA 1I5PA 4MLOA 1SPPB 2D98A 1WW4A 3MLLA 1C5IA 5GM0A 4YYOA 1V6OA 3NKGA 3ACLA 4A6SA 4BPZA 1YQCA 5LA0A 3ZSLA 1OBNA 1YQ8A 4PCRA 1PVC3 2Y6FA 1I5ZA 3FC0A 3WF2A 3WXPA 3ZSKA 5F8PA 4D8MA 1JZ2A 3WDUA 5FR3A 1JHNA 1ONAA 1YFUA 1K5MA 3A23A 1OA4A 2WINB 1ZZ7A 4FO9A 3UGGA 1UWWA 4HVQA 4GWIA 1NT0A 1WD4A 1JYVA 2BBVA 2RMU1 3FN9A 1LKNA 1K5MB 1RUJ2 4GKXA 3NKTA 1QU0A 4CDUC 3PL0A 5D1IA 5J37A 4ZXKA 3HQRA 3C8XA 2XWJB 1FXZA 1WLTA 3VKFC 5I8SA 1N3QA 3J7NA 3QCWA 1AR73 1QJX3 1COV1 3E5XA 3GCXA 3H1MA 4KWJA 1YFYA 1OOPC 4LBJA 1PGL2 1JI6A 4YRDA 2P2KA 4K20A 2W52A 4GQ7A 1CJPA 5FY4A 3B5LB 3KF5A 4P9GA 1ZRCA 2PMWB 5F2SA 1YQ6A 1JZ7A 1LCLA 4JKKA 1GP6A 1AR61 4OUSA 5FJKA 2Q5TA 1QGLA 2WO3A 5BPXA 2XLGA 3SHRA 2OYZA 1C3HA 2E7QA 4GH4B 3AMHA 4Q8KA 3WDVA 2GSYA 2VCCA 2LM3A 4IGQA 1UY4A 2PHFA 3VUOA 2PAKA 3KMHA 4MUVA 1DBNA 1ST8A 2R0HA 1F9KA 1F31A 5IAXA 1OLME 2K2SA 3GHNA 4I30A 1W9FA 1X9TA 1ZBA1 1QXPA 2AACA 1DGRA 5JDBA 2EA7A 1QEXA 2HWC2 3IIAA 3IMNA 4XF0A 3C7GA 3RYPA 3WF3A 5CAZA 2AEYA 2RMU2 2DCJA 4AI1A 4Z2WA 3H3UA 1JU3A 1TMF3 3TEYA 5FBZA 4AZZA 1J1TA 3PTYA 4N7UA 1WD3A 1AYN3 3T2QA 1GZCA 3CZJA 2DCZA 1SLLA 4RHV1 3VD5A 4BJ0A 4EN0A 2RJLA 3LSEA 1O3TA 1UOFA 5FWEA 4YW5A 4NHLA 1AHSA 1EY2A 5HCAA 3AP5A 3U75A 2X5IA 1COV2 1WCSA 4I01A 4D7SA 1GP5A 1C8M3 4OI4A 2C6SA 3LGRA 3S30A 1V9U1 1VBD1 1GR3A 3JXSA 4ES8A 2X5IB 3DXTA 4L8QA 3CIHA 1QF3A 2BGOA 3THDA 1XSRA 3AKQA 2VMDA 3LEKA 4QGLA 3WDXA 4YVSC 4O61A 5JSPA 3KQ4B 2VOXA 2W46A 4XYXA 5KBFA 1AR62 4I09A 3KT7A 4Y22A 1J1LA 4CXYA 1L7QA 2CY6A 5FZEA 1IS3A 3OJBA 1YIFA 3H7YA 4AYUA 5A1LA 1UOBA 3NJZA 3POSA 2MNGA 1VPHA 3JU9A 3KF3A 4FAHA 1M06G 3H1YA 5FPLA 1E5SA 5GKAC 1RXFA 2VUJA 2ZHKA 2W1UA 4FOYA 1W0NA 3BALA 4BB3A 2ATFA 3T08A 2VBBA 1ZBA2 4Y1UA 1GQHA 2HYXA 5GZEA 4ZS2A 3MV11 4XBNA 4QD2A 2WWSA 4N8MA 2A6ZA 1MEC1 4H55A 5ISLA 1XXNA 1O4ZA 1LRHA 4LO4B 3TWIA 4RHV2 4UF0A 1T6BX 1PX4A 3CL1A 1HB3A 3E5UA 3LA7A 1LU1A 3R05A 1CGPA 1GNYA 1V70A 2WSUA 3MIHA 4MGKE 4L99A 1H0BA 2LRPA 4UF0B 5A70A 1HLCA 4XQDA 5ABJA 3ZDSA 3ZFEA 3PUIA 4FT8A 4JGYC 4LBLA 1V9U2 1WMEA 5L7OC 1VBD2 2JDPA 2W87A 1SZBA 5ABJB 2K46A 4P5YA 3ZFEB 4PIZA 2DVFA 2ZEWA 5FPXA 4GALA 4DRVA 3MIDA 1PZ7A 3O0VA 1RL3A 4M3CF 3RZGA 4NHKA 4AGGA 4JAAA 4OI0A 1QXJA 5FO9B 1GZWA 4W6WA 2IXIA 2XH6A 4B1MA 1A78A 2WIIB 3KCCA 5K7PA 1OPMA 4LEJA 3ETPA 4MOAA 4BQ3A 1GZWB 1OQEA 1W9TA 3ETQA 1DQ1A 2Y6LA 2RDRA 1I1EA 1PMHX 4JTNA 1QNYA 1NAEA 2ZKNA 2RE9A 1OURA 4G4FA 4LORA 5ANQA 3ZN5A 2HWE1 3FX3A 4PBOA 1GZTA 2CDOA 2J1RA 2VNGA 2BJSA 5ACA1 3RYKA 2WR9A 2A3YA 3KGZA 2VAUA 2QFEA 3MIEA 3TEXA 5BUVA 2ID4A 4AW7A 4C91A 4XCAA 4UBGA 4UWDA 3PUSA 1MEC2 1GMMA 3WDWA 1UU6A 1DZTA 3M3OA 1JYIA 1GU3A 5FZ6A 3W58A 1XOYA 2IXLA 5FMBA 5CFCC 1NY71 3BU7A 3WQ1A 5L9VA 3U4XA 2E9QA 4P9LA 4E4ZA 2D5FA 3CLPA 1NCRB 1YI7A 4QWNA 4AOCA 4K1YA 3MPPG 1H4GA 4QQHA 4BLIA 2PN5A 3WD5A 4QPIB 5CB7A 3SCGA 2WNVA 2VMEA 4TLGA 3RJ2X 3HR9A 4AHYA 1RUD1 1W6NA 4B7KA 3M3CA 5IVJA 5FDBA 1RIRA 4RQPC 2WNVB 1VE0A 4BMBA 4IW3A 2WNUA 3T4HB 4AVBA 1W6NB 3ZN6A 3A4UA 3AB0A 3PVNA 2RR12 4XF1A 1RJ7A 2V73A 1F2NA 2XKPA 4ZPIA 2CL2A 5GZFA 4S2HA 4HFSA 3RNSA 2G9GA 2O8OA 1W6QB 1RUH3 5IFPA 4XUQA 5FQ0A 4W6XA 2WN2A 2HYKA 2E32A 5BNNA 3QH6A 4W8JA 3OSDA 2OUHA 3KSCA 4JVAA 4E4HA 2B46X 2GALA 2OUJA 4ARXA 3O1PA 5FQ0B 4Z1VA 4KH9A 1JYWA 1GFF2 2HWE2 1BHGA 1ND3A 3ACHA 4BWOA 1DF0A 5BNNB 1PNFA 2YYOA 5ACA2 2E63A 5C5TA 1W0OA 4LOSA 4XPVA 5KC5A 2WNUC 2W1WA 2ADEA 1L7RA 4FPYA 2DURA 5F6LB 2A3XA 1ENSA 2GC3A 2MHFA 2C1FA 1W9YA 1QHDA 4LO6B 1NY72 1WLCA 3S7EA 5DPNA 3T0AA 4J25A 2JDKA 4UFIA 1L3JA 4KMQA 3U78A 5FZCA 2R061 2VMGA 2XJQA 1T6GC 3LFMA 4M4PA 5IJRA 5EJ3A 3MBWA 2UURA 2PLV1 4EWAA 5IK5A 1OXCA 2JEMA 1N1YA 1ND3C 1RUD3 3SMHA 1SG3A 3VD3A 3WG1A 1GWLA 2W9XA 3KVAA 1UYYA 3F95A 4XHXA 2C9AA 2GP5A 3NL1A 1MVQA 3NV4A 5FMDA 3N35A 2JIJA 1LHWA 2C9KA 5EHDA 1W9WA 1IS5A 4N9HA 4D3WA 5SV8A 2WZR1 5FZFA 2WQZC 1A8MA 1IKPA 2OW4A 5FKCA 4CTEA 2VZUA 1TME1 2WT2A 1UCXA 3CQOA 3I3BA 4UFJA 3UKTA 5JSRA 4FSJA 1IG0A 2Z79A 4YW1A 4GMP1 2NM1A 1DGWA 3VBUA 1NCQC 1V0AA 1MS9A 2CV6A 4QDSA 5DDJ1 5IVYA 3BN6A 4XVHA 4D6RA 2GNBA 1PK6B 3E6CC 1EV11 4AAPA 3GNEA 3VBUB 4HANA 2NYYA 1Q3EA 3D3AA 1ZBE1 1XQNA 5FO7B 4Y20A 4AFBA 2YY1A 3ZR6A 4KQ7A 4BA6A 1ULCA 2QZ3A 3I3QA 4JRAA 4DY3A 1C57A 2GNMA 5JI7A 1KFUL 4NIAA 4YM1A 4IERA 2ZGKA 4R4XA 1MS4A 2E6VA 5CEHA 4IUGA 3DYPA 1R083 1QJFA 5C8CC 4XUOA 1KXGA 1OH4A 1RMU2 2EIEA 1EPWA 2W2IA 3BTZA 3HBZA 3IMMA 3SC7X 1ZVFA 2A75A 2R062 4AQ2A 3NSTA 1ZZ8A 1ZM1A 3O14A 2DUQA 1WZXA 3NAPA 2JG8A 3RZJA 4Y5Z0 1YO8A 3VBRB 3AYEA 4XTPA 2PLV2 2VGDA 3V64A 2B4KA 1KRIA 3IAQA 3NAPB 4IEQA 3SH3A 5LASA 3UJQA 2CAUA 2Z42A 3E97A 4M3CE 5EXOA 2ZAAA 1PMIA 1GKBA 5JLVA 2DVGA 1SLAA 3OF1A 1DDLA 4XF4A 5LY2A 4JHZA 5JPMB 4DUVA 1EP0A 1S0EA 2CNAA 1AL23 2VG9A 2VW2A 3VBHA 3I49A 2WZR3 2WT1A 1H2MA 2VZVA 2WZR2 3WY6A 2VMHA 1TME2 5FPAA 4L2NA 1J59A 1YLLA 2Y6HA 4Z92B 1EPZA 1JODA 4LTAA 5DDJ3 5IVVA 2JG8C 3T4VA 3A21A 3C7OA 3IM0A 5LA9A 4I0AA 4PIYA 3Q8BA 4RR3A 1EV13 3A7QA 5KR7A 3AFGA 3VHOA 1Z0HA 1US3A 1S0FA 1W6MA 1TNRA 1ZBE2 2JDZA 5EJZB 2P3JA 2AH2A 4RR3B 1LHNA 3OEAA 4LKDA 2ZACA 1PM4A 2J1AA 1X33A 2ZGUA 1UMHA 2VXJA 2VVFA 1V6IA 2YV8A 4DEQA 1FV3A 1Q8VA 1FMD1 2J42A 3VBHC 2NMOA 3HN1A 1W8HA 2VVDA 3WCRA 4IV1C 3WP4A 4MHUA 2GU9A 4LK6A 3CMGA 3I2GA 1UO9A 1QNWA 2XBO3 4CPBD 2EIDA 4XJ8A 2BBAA 5JR2A 3RJRA 2QJVA 5DUUA 2ZEZA 4NJ4A 3ZDVA 2I74A 4H7MA 1HN0A 1MR5A 4QHOA 1QOOA 4JTOA 5CADA 4NRQA 3VBFA 5F37A 3O0WA 5A80A 1EAH1 3B9IA 1H2NA 1NZCA 1XNDA 5I0DA 3QBQA 3ILNA 4PJYA 5FPVA 1LOCA 3JB4C 3P3PA 4Q26A 3VBFB 3U10A 1EUUA 4XABA 4XUNA 5FPZA 2OIIA 1FNZA 4P9IA 3PIGA 1LOBA 2A6XA 3G7DA 3GF6A 4G3YC 5BV6A 1A8DA 1JZ8A 2DF7A 2WAAA 4JHTA 1CWPA 3I59A 4N7IA 4CPBA 3M4FA 5J09A 1O3QA 4AI8A 1BK1A 1MQTC 4Y3OA 3CJIA 4YGEA 1Q43A 4Q4X3 1JOPA 2EAKA 1AUYA 2EF6A 5L9RA 1AR83 3WOGA 2WRAA 4URAA 1JZ6A 3AZYA 2F4PA 2QZ2A 3CJIB 2RS32 4NIIA 3WNNA 1FMD3 4RYDA 5DG2A 1FMD2 4AEJA 2ZX1A 3JUUA 3VBOA 2JECA 3FL7A 1VR3A 1LGBA 2Z2SB 4L0PA 3AFKA 1QJY1 2XUMA 5LK5A 1RUG1 3K51A 4A45A 4AEDA 5JI9A 2AENA 3N9QA 2VZSA 1GV9A 3VBOB 1UZZA 2ZA9A 4PDWA 3SQOA 2IVIB 4Z8BA 3O0XA 4AEDB 4RFT0 4NMIA 2W92A 2GZWA 5J1XA 3WINE 3WQ7A 4BDVB 4E27A 2D3RA 1JW6A 5LB6A 3EO6A 5BNOC 3ILRA 5FV3A 3U37A 2GAUA 2DVBA 4C90A 1EAH2 1VAKA 3U14A 3LEMA 3IPVA 4IE4A 1IZ3A 5JZGA 3PJYA 3I2FA 3BYWA 2WQ4A 1CZSA 4Q1PA 2W1QA 3MZHA 1VBA1 1IG3A 4CCDA 2BPA2 3V56A 3WW3A 5JZGB 2BFUS 2VBPA 4JKLA 4Y5TA 2WA3A 3WZ1A 3MLJA 3N7JA 3VB9A 4PDWC 4GWNA 5JOWA 1LHOA 4ZZ5A 3X29B 4KL1A 1B35B 3H8XA 1PM7A 4XOGA 2BTVC 1YHFA 4I2OA 3BCWA 5J36A 4CEYA 1GYKA 2JD4A 3J9SA 4D7YA 1G86A 4YVWC 5FO8B 2QQLA 4W6YA 3ZXDA 4J1XA 3W5MA 1DGLA 1TG7A 2XJUA 4MXWA 3IN9A 4U2AA 1OFNA 4QKFA 1XE8A 2PHRA 4EJRA 1APNA 4MSVA 4XBLA 1G9CA 3CHXA 1H6XA 2Y60A 1BK0A 1S2KA 2H0VA 4GZ9A 3VDDA 3ROUA 1NA1C 4Y24A 2G9ZA 3DCQA 5CNAA 3ZVXA 3UJOA 1HDKA 1QJY2 1RUG3 1RUG2 1G9FA 4FCAA 4YW4A 2JB4A 3QOPA 1AL0G 1HXS1 3T2PA 2GNDA 4CCKA 4YWAA 3Q8EA 5IATA 5LY1A 4CEYC 2XG3A 1PO11 4YZ2A 2NZ9A 2VZPA 4YZ1A 4XFGA 2JB8A 2YHJA 4IGOA 4RSUA 2GMMA 4KBZA 1ULPA 3CEWA 4BH9A 2H0BA 1S0BA 4BIFA 4COYA 2MEV1 4ONUA 3M7AA 1H1MA 2XOMA 2VQAA 3VDDC 5BYNA 4G9SB 4YW3A 2AR6A 4QX8A 3OPZA 1VBA3 1VBA2 4IDZA 1PO21 2VZOA 4HETA 1BBT1 1LTEA 1JXNA 1FPN3 2PA7A 4A3XA 3AP9A 2B9VA 2VCMA 1BVVA 5FKBA 2VZRA 3AMMA 3BIEA 1DCSA 2D6OX 1SBFA 1BLZA 1XJAA 3ES1A 1GQGA 4HSJA 2NPIA 5EZWA 4EZ4A 2WUHA 1NQDA 3VDAA 4EWEA 5JSOA 4WVWA 4V1PA 4YFWA 2A7AA 3K4AA 5K0UA 2HWB1 5HCHA 3OGVA 4N43A 1O4TA 5HBAA 5LCWL 1QJU1 4SLIA 2BWCA 4ZKTB 3U4SA 1WA4A 4N43B 3USUA 1AF9A 1V6LA 2WKKA 4HVOA 3MICA 1HXS3 1HXS2 5IAVA 1XNTA 4A7ZA 1CQ9A 3I2IA 1XSQA 2P3YA 5DAQA 3M3QA 3LB9A 3HPNA 1CZVA 1PO12 2R043 4AGVA 1CAXB 3EBRA 1HW5A 3KV6A 2VXRA 3GZAA 4FFFA 2VE1A 3K2OA 3K46A 5F3IA 1H30A 4OQ9A 2DBIA 2MEV2 4OHWA 1EUTA 1XNCA 4X6QB 3AYDA 1CAVB 5C7GA 1PO23 2BWAA 1PO22 4OZOA 4LIVA 3R6SA 4DS0A 1JZ5A 1BBT2 5FUNA 4MGZE 2C24A 3FJSA 2XL9A 3LCPA 2YUEA 5K4LA 4BQ5A 1H9PA 1WLDA 5IT6A 4HBNA 5AFEA 3MF6A 2GMEA 2R071 3IWZA 2GDFA 4Q4V1 5FK7A 1RINA 4BM8A 4XJWA 3CJXA 4BQXA 5GZCA 1PIV1 3HIFA 2YB7A 4OYUA 3AVRA 5KWRA 1OC1A 4RGKA 1ENRA 3C2UA 2ZTNA 3UL2A 5C3PA 4ZXEA 1M4WA 1DZQA 2QKDA 1XE0A 1N1SA 2HWB2 4P9WA 2AYHA 5FPUA 4XFAA 1DHKB 3AX4A 4PLOA 1QJU2 3DF0A 1ODMA 1RJ8A 1W90A 2A6VA 4AQ6A 4DXSA 4WM8A 1PVC1 1XYNA 3H7JA 2VQTA 5AFBA 3K75B 1X8MA 1F35A 3WF1A 4AVVA 5FZKA 3NMBA 4WM8B 4YZ4A 1R1ZA 3A0KA 2QQWA 2RS51 3TNQA 5KXBA 3FHQA 3PVOA 3LOBA 1JZ3A 2Y6KA 5J48A 1F8VA 5C5UA 5F7UA 1U5YA 1U0AA 2HBUA 2VNOA 3ME2A 1HRV3 4FPHA 4JGZC 5I8YA 4XXPA 5C9AC 1J83A 1H1AA 1C4RA 3BU0A 3I97A 1SCSA 1WMFA 5E16A 4CVUA 1WMXA 3ZYRA 3ZFGC 2HBTA 3AC0A 4ORFA 3AKPA 2VUCA 1YIPA 2N7GA 1AR71 2IVJA 1QJX1 2Y34A 3BOPA 4XUTA 3NW4A 2X29A 4HKOA 1Q56A 4O65A 2CTVA 2VM9A 3IBMA 1VP6A 1VBB3 5F5CA 5L73A 1G9DA 1S0IA 3UNPA 3NNLA 3ZYBA 3LKJA 1CPNA 2DUPA 4QPWA 4EZHA 4I3GA 5FLHA 4E8DA 2V4AA 3AVSA 3VZMA 2R072 3POWA 4IEXA 4PT6A 4Q4V2 1JTZX 4EN7B 3OGJA 4XJ9A 1PIV3 4OZXA 1PIV2 5A1AA 1W06A 4AI0A 4CDUA 3OGGA 2VW1A 4MVTA 2LUWA 1GOHA 3BI3A 3LDBA 4XFFA 2YBPA 2C4XA 1JBCA 2Z4FA 3VZOA 2GN3A 2V4VA 3NNFA 3RWKX 4CDUB 3VD9A 4YARA 3PJQA 4BQYA 2I45A 4CXXA 1GSLA 3H8OA 4XJAA 3SNMA 3U0ZA 1DFQA 4AI3A 5A7OA 1W3XA 1PVC2 2CU5A 2D6NA 2R30A 2XJSA 3DXUA 4FI9A 3WUCA 4Z2AA 1OOPA 2ES3A 5AC93 5M0TA 2D44A 2DWRA 2F4LA 5BY5A 4NVPA 2NP0A 3WP5A 1W04A 4EWDA 3VKOA 4IEYA 2RS53 4JKMA 5A3MA 2RS52 2WZEA 1OOPB 2PYTA 2PHXA 3SXWA 4IEOA 4X8PA 2WC2A 1LENA 1TMF1 1IPKA 1K3IA 1ODNA 1QQP1 1VMHA 4HN1A 4OQ8A 1AYN1 5T5PA 3THCA 1WW7A 1IKQA 5BNPA 2CGOA 5F5IA 4WBBA 1IHMA 5JR7B 4OVEA 3HBKA 2XJVA 3QACA 4CUGA 4P9YA 3WP3A 3USSA 1WMDA 3AZVA 2BDRA 1AR72 3SLIA 1QJX2 1NLRA 2AZ5A 3CKHA 3D8CA 3DPRA 1C8M1 3KS7A 3LA3A 1VRH3 5FZAA 1QDOA 2HKXA 1LNSA 2JDUA 1SFPA 5FZIA 1IGOA 2WLQA 2B9UA 3MEPA 4H7LA 2UWAA 4YZ3A 5FZGA 2ZOEB 5C4WC 5E89A 4QGNA 1GP4A 3I7DA 3POJA 5FY0A 4UW4A 4GMP0 3WNOA 2ZHMA 4XMAA 5I0SA 2WDBA 5BNPC 2SBAA 4LA2A 5IYYA 2WFF1 2QQJA 4XURA 4LBOA 4ATEA 3N36A 3OB8A 1W99A 4C8DA 4RN5A 1QH7A 3KV9A 5T52A 4UXAA 1W8FA 4TSVA 3AP4A 3VN4A 3MW2A 4FPKA 5A3OA 4YGBA 5CG8A 4QXBA 4NROA 3DPRC 1NQJA 1UPSA 1WKYA 2Q30A 3URFA 3I2HA 4CYDA 3KV4A 3MW3A 4E4DX 1YXWA 4YVSA 3WSOA 1U5XA 1R093 1UU5A 2WWUA 5FP9A 1UL9A 1TMF2 1QQP3 2HEYF 5FP3A 1QQP2 1XBFA 3N9MA 3WV6A 1AYN2 1Q8QA 3MYXA 2YFUA 4AFAA 1POQA 2OZ6A 2V5YA 1LOFC 1ZA7A 2QQMA 1SFNA 5T50A 2PQSA 5AVAA 2OVUA 3DYOA 3AM2A 1CPMA 4DINB 2RS13 1C8M2 4P5HA 1PMJX 2CSGA 2P1BA 1K12A 5KC6A 1F4HA 1W8TA 2XDVA 3NO8A 1OLRA 5LWBA 4HZFA 2XQXA 3M1HA 2VC9A 4NPLA 3WQBA 3J8F3 3FWEA 2BOIA 4QX1A 5F3CA 3E1F1 4YW6A 3WNPA 1FT9A 1MZEA 2WFF3 2W47A 2WFF2 4Y22B 3EYPA 4XXAA 1TZOA 4JDMA 4YG6A 3OBAA 4DUWA 4ZY9A 4BXSV 2O1QA 2PHWA 4JGYA 3I3EA 2VH9A 3SH5A 1RB8G 3NNMA 1DYKA 5L7OA 4ZU5A 1TE1B 4QXKA 3JD71 5KHHA 2GC2A 1HKDA 2Z5WA 1LEMA 4XAAA 1Q8SA 3JZVA 4PI0A 4JGYB 4LMFA 3N9PA 2P17A 2Q0AA 2JENA 5EPAA 5L7OB 3ZYHA 3LIGA 4WV8A 3FHIB 2FDKA 2D3SA 4A7YA 4WZCA 4A7KA 3CO2A 1JU4A 1ULDA 5CA6A 1BXHA 3I54A 2XR4A 4A3ZA 2YU2A 1W6PA 1IQDC 4TZDA 3DUIA 4HK9A 5FUIA 3IIIA 1RTVA 1WLWA 3WX5A 3ZYPA 4XF9A 1JH5A 1W6PB 1R64A 1Y43B 3ZM8A 2W95A 2YPDA 2FMDA 3ACGA 1CAWA 3O7OA 3PMEA 3LWCA 4GULA 4NAMA 1W05A 1UMZA 4CCNA 2ZBJA 3NNGA 3RWNA 3KCXA 1XNAA 4CEWC 4P00B 1QOTA 4LBQD 2LW8A 4LK7A 2ET1A 4TWTA 5CKNA 1LR5A 4WVMA 2RVAA 1H8VA 3T30A 3ZXJA 4NE9A 4C0HA 2QUOA 2VW0A 2WS93 5CFCA 1RUH1 5KXCA 5JXHA 1AYM3 2G4IA 2DVDA 1MZFA 3OY8A 3CF6E 4LIUA 2YMZA 1CAUA 5CFCB 2HWF3 3VHRA 2GC0A 3LDKA 1GOGA 3JD73 2A1XA 3JD72 3PMSA 5H9SA 1CAUB 5A32A 2TBVA 3HNBM 4RQPA 3PVBB 1DQ5A 1VB4A 3TN93 2Y38A 3AXEA 4XETA 4RQPB 3ORJA 3QH7A 4LBQA 3H8UA 4QU2A 2KXLA 1U5ZA 2XJRA 4UT5A 4DPNA 4ITCA 4XW3A 1C1LA 2Z69A 3IZOA 2ADDA 2YPJA 2YU1A 3LAGA 3OD0A 4AG4A 1CESA 2D6PA 5FZLA 1C28A 1AX1A 2HJIA 4BK5A 4NN0A 2W0XA 2BV4A 5C3RA 5F5AA 3FUQA 3KT1A 4XCBA 5H9PA 4OHZA 4HONA 1XPWA 1UIKA 1XU1A 5J7MA 1C8NA 1NXD1 3K3NA 1O5LA 5FYBA 4EV0A 3T0BA 2H6BA 2C26A 2VTXJ 3ATGA 1OLMA 1WBLA 3MF9A 1UNBA 3VZLA 5IFTA 3I3MA 2WNUB 3OPTA 3ZN6B 2R49A 3J26N 1YFWA 3HT2A 4AVSA 1C1FA 1RUH2 2EIGA 5JMCA 5EYYA 2DCYA 3UK9A 2BVVA 4R9DA 5GLUA 2ZGNA 3DL3A 5FLJA 3WW2A 4EN9B 3S6PA 3SEPA 4DY5A 4OCTA 1OI6A 4QDRA 5FCCA 5L36A 2UWBA 2VUAA 3M2MA 1VRBA 2RJKA 1DU3D 5G05L 3WQ0A 5A3UA 1YEWA 1HJFA 3GM8A 5EQUA 2XJPA 4F83A 1ND3B 4LNVA 3ZYFA 4CU6A 4JRLA 1SLTA 3RRDA 4IE5A 1FX5A 1YC61 1DLLA 2BQPA 4YW2A 5LZ6A 1RUNA 1O5UA 4A4AA 1R081 2B7YA 1VIWB 2E31A 3LFIA 4RS5A 5FOBB 4CDWC 2J1UA 1Q8OA 3PVEA 2Q1FA 2XVLA 3WLUA 4OULA 1NCQA 4LQRA 1BZWA 2BYVE 4IEZA 1G7YA 1H6YA 4Z07A 2OKXA 4Y26A 3ZX7A 1RUD2 5JAXA 1NCQB 3IAPA 1O59A 3CDZB 3HQXA 3ZIWA 4DMIA 2EVXA 1SEFA 4LHSA 4N53C 1FV2A 4D0QA 2WLPA 4XFCA 5F1RA 2JE8A 4E8CA 3D5OA 5BNQA 3WHUA 2A3WA 5D8AC 1AL21 3RI8A 4LKSA 1W28A 5FYIA 5C8CA 2QQPA 4QM8A 4RS5C 3MUZ1 2VZ3A 3OCPA 1ZZCA 2UY9A 4YNIA 2VCAA 1W8UA 5C8CB 2Q8OA 3A0NA 4CSWA 1UKGA 1R1A1 3KD4A 3VZJA 1CONA 2JDYA 5T55A 3ACIA 4XJZA 5EP9A 1PX3A 1OHFA 2IXHA 3B93A 5IK7A 4P9JA 3DGTA 3MFAA 4LKEA 2BERA 3AKSA 3J7MA 1BVP1 4QX5A 3VD4A 1AXYA 1DYOA 2JIGA 3VV1A 3MLKA 2DFBA 4NPMA 1X9PA 2Q4SA 4Y20B 5KHGA 4QKBA 4CP9A 2JG9C 4NIGA 2E33A 2P6HA 5FFOC 1QWRA 1R082 3UESA 4AF9A 4ASKA 4CDQC 5JPNB 5A6YA 1HRI1 4UW3A 3RYRA 4W50A 3W21A 2EXIA 4QKNA 4QPGC 2TNFA 4CP9B 4FXKB 3ZFFC 4BE3A 4DFSA 3AJZA 3OUJA 2JKBA 4XDQA 2XBO1 4JV4A 3HWJA 1UF2C 2ZMNA 4HPKA 4Q4W3 4K8FA 1A3KA 4X6RB 4NIHA 3WR0A 2DFCA 2QBXA 2CYFA 5C3OA 4K9SA 1XNBA 1N3OA 2JG8B 1OVSA 3MO4A 3GCWA 4H2AA 1IOAA 2IXKA 1GWMA 4XUPA 2FDIA 4BISA 1VLNA 1JMUB 4IESA 4WVVA 1CX1A 4HL0A 4MADA 4V2VA 1AL22 2Y6JA 1J3QA 1O8SA 4A44A 1H8TC 3SH4A 2NQYA 4XDOA 3JCIA 4IV1A 1W39A 5HXVA 1AXZA 3VBHB 2FZ1A 4BXFA 1O3SA 4AI9A 4R9AA 1QH6A 4IV1B 5GLTA 2FCVA 3P3NA 5DDJ2 5FRAA 5A3WA 2A71A 4D6SA 3E6BA 3BGAA 1R1A3 3R4SA 4K21A 1R1A2 1ZNPA 2WYFA 1EV12 3LEGA 3PUHA 4IV3A 5A7SA 3WP6A 1GWKA 3B3QE 3ITQA 2ARCA 3FE5A 2XMLA 4Q4X1 5FXXA 2Q8EA 3W9AA 4BZ4A 4YFZA 1AR81 4FPGA 5B4XA 1JYXA 1W6MB 4GJYA 4Q4Y1 5H9RA 2OXBA 4P08A 3VLBB 1RUC3 4QDQA 5FYUA 1ENQA 3MHZA 1A6CA 1DZRA 3HD8B 5FZMA 3VBRC 1HRI3 5I0RA 1HRI2 1G9AA 1JS9A 5HCBA 5JOXA 1UXZA 5T5LA 3ZYJB 1J84A 4LBKA 2AUYA 2XBO2 4LUKA 1SLBA 4YM0A 3OBRA 4MG2A 1OA2A 4IV3C 1Y7BA 4TLFA 5F5QA 1MQTA 4BQWA 5LBCA 1S55A 2YXSA 3CNAA 1E5HA 2UYBA 4BCUA 5FBJA 3WG3A 3WF4A 1CD3G 4YM2A 4EROA 4LPLA 3ZR5A 4BK4A 2TEPA 1MQTB 3OD4A 3DECA 5DN2A 1O7FA 2ZZJA 5JCTA 5DUWA 3OG2A 2J22A 1RUI3 3PTRB 1QIQA 2CGNA 1GICA 1O91A 3MPBA 2XUEA 3NRUA 5FZ9A 1NE4A 1TQ5A 3S5QA 3LPFA 1WW6A 1RGSA 2ZGPA 1E5IA 3ZSMA 4XE9A 1XYPA 3PNAA 1VBE1 2ZGMA 2R32A 4CCEA 3I59B 4Q4X2 2ZKLA 1W2NA 5BNOA 3GJBA 3KLSA 3WDYA 1AR82 1H1IA 2VBDA 1VAVA 2ET7A 4Q4Y3 1DQ0A 4N90A 4Q4Y2 3SISA 5BNOB 2RDSA 5JIAA 5FPBA 4DQAA 4LXLA 2W08A 1S2EA 1XYOA 4XFIA 4DXZA 1UYPA 3GZEA 3KZ4C 3POGA 4MHRA 1OD3A 3VBSA 2WQ8A 1WCUA 4TXWA 1G6NA 2IZWA 5C3QA 4COUA 3NQHA 4YZ5A 2OX0A 1XRUA 1RYYA 1D2QA 2PHLA 2XHNA 3KB5A 4FOWA 4LKFA 4PDWB 4DB5A 1ZYBA 4ISQA 4YVWA 4YM3A 2P4EA 4JQRA 1T2XA 3VZKA 1GUIA 4AVCA 5FYZA 3WNKA 1FOD1 4CRQA 1Y4WA 2ARBA 2Y26A 4YVWB 1ZREA 4KWKA 4GKYA 3OBTA 5CU1A 5EIYB 2J1SA 3U11A 3ZXEA 4KU7A 1NA1A 3I2DA 5F3GA 4Z82A 4DZGA 3IPVB 1YJKA 4JC1A 4LO5B 1W8OA 3VBSC 1NA1B 3B7MA 2FQPA 4OFGA 1BCXA 1FPN1 1S0JA 2A5ZA 2ZAHA 3J4UH 5FYMA 3RGBA 3T09A 4CU9A 3MIBA 1LB2A 1UXXX 4B3NA 2JKXA 1VBE3 1VBE2 3MI8A 1MS5A 4CP2A 1POV3 4FTSA 2J7MA 1HN1A 4NRMA 3FBYA 5FK8A 4K7JA 4CEYB 2VOVA 4FFGA 5LRSA 5F6KA 4MXWB 4PLNA 3THTA 2VPVA 5IVBA 2ZX4A 3LD8A 1BQPA 4M3CA 4XJUA 1WBFA 4AR2A 2GMPA 4RGGA 2ZHNA 3KHBA 1UZWA 2ENRA 5B2GB 3VDDB 1JYTA 4OLLA 4A6OA 2B5HA 4XACA 3C7HA 5FMOS 4UFHA 3GZTB 4LO8A 4M0NA 4QQLA 4B8EA 1KFXL 2ZCWA 2E7AA 3ZXAC 4JCKA 1AZDA 1PZ9A 2VZ1A 2XXZA 3IDAA 2R041 1TEIA 4CZSA 5T54A 4CCLA 1US2A 3NJYA 1RHI3 4KNCA 1FOD3 3B94A 1FOD2 3PDQA 3DYMA 1QKQA 1ZRRA 4UBHA 4XBQA 1S4CA 3TEZA 2D43A 1KITA 2RDNA 2FBEA 4C0BA 1H2KA 2F17A 1NZIA 2Y64A 2YFZA 5ANNA 3ZYGA 1Y9GA 4LHLA 1SFYA 1WCDJ 4FQZA 4COZA 1IS4A 1VMFA 3KT4A 2EXHA 2QCSB 4F7ZA 3UKNA 1D0GA 1FPN2 5A6ZA 4RGAA 3WW1A 1ND2A 3ZKYA 2KA3A 2YBKA 1E5RA 4M00A 5JXJA 2YGMA 5EWSA 3Q9OA 4Y4RA 3V0AA 5CFDA 2GC1A 2WO1A 2ZZQA 5FXWA 3ZXKA 2RV9A 1KDKA 4FPFA 4XDPA 5DAVA 4D69A 1WUVA 2R16A 1SQ4A 1HB2A 4CUAA 1LGCA 2Q1MA 4I02A 1X50A 3HNYM 4FOVA 5F3EA 5K0UB 4XC9A 3W5NA 1VBC3 5FREA 3ZIXA 3R0RA 2VY0A 5CG9A 3IDEA 5FZBA 2DDUA 2JWPA 3USUB 4LO7A 2ZGOA 3DKWA 4YGDA 2VO5A 2GH2A 2HWD3 1ND2C 1K5JA 2W68A 4Q0VA 2E7TA 1LODA 2ZGSA 2R042 4M4RA 3ZPOA 1HRV1 1UY2A 2K9ZA 4JDNA 1BKZA 3D4KA 4PI2A 5CFDC 1Z78A 3PIJA 2DTWA 1DQ2A 1O8PA 1NOVA 1F5FA 2DCTA 3IT8A 1QXRA 4GJZA 1Z7S3 3VL8A 3WUDA 1X8EA 3POFA 5FWJA 3K48A 5EFUA 3LDRA 3LF7A 4UAPA 3TBDA 2PHUA 4AFDA 4DRRA 4DXRA 2IC1A 5CZKA 3WVJA 2UWCA 4I3PA 2A6YA 1BYHA 2AEZA 3OOXA 4BYYA 4EN8B 4QXHA 2LS6A 1MS0A 3EB7A 3JBG3 2QNKA 1VBB1 3FLRA 2D93A 1STMA 2BUKA 5IHRA 3AYAA 1V6JA 4IXLA 2RM23 1GBGA 4XFHA 2FDHA 2Y8KA 1REEA 1KDMA 2CWSA 4AI2A 4RL7A 3T3YA 1LGNA 4JGZA 5DABA 3T2OA 5C9AA 1W2AX 4LHKA 4Q1RA 3KWVA 4L97A 3E5QA 3ZXGA 5C6CA 4AQSA 1SACA 1BEV3 1KJRA 4TN7A 4JGZB 5FYYA 3ZFGA 2P3IA 2I07B 2OQ7A 2WNEA 5C9AB 2XVGA 1YUDA 1AVBA 4XHBA 3OTFA 4XAEA 1OKQA 1B09A 1ASJ3 3GBWA 3GXUA 4IEPA 4K6BA 5LEKA 4BU2A 1Q5OA 1ZZ6A 1V6NA 3PU8A 1ENXA 3EXUA 4YPJA 1QJEA 1YFXA 3OUIA 3W20A 4CDXA 5AC91 4HXCA 3RZLA 1UYXA 3POEA 4P9XA 5I0UA 3PURA 1LHUA 1CIWA 2XHKA 4Y1ZA 4BQ4A 3GHMA 2ZXQA 1PVXA 3THPA 4ASLA 5FYCA 5DQ0A 4YSFA 1HRV2 3MIFA 3UYJA 2B8MA 3IDBB 3NJXA 2YC0A 3BKZA 1FI2A 1AR93 4DOUA 3FHAA 2ETEA 2MPFA 1XB9A 3H9AA 2VULA 1VAMA 4LOTA 5GLZA 5CBLA 4OMDA 5FOJB 4FXGB 4INDA 5H9QA 3I2JA 2JJ6A 3T2TA 3AMPA 4P14A 3KVBA 5C33A 3AKRA 5LK7B 1VRH1 4HG6B 4HSLA 4CDXC 3B00A 1HQNA 1ZRIA 3IB3A 3WNMA 4MGIE 1VBB2 3PHMA 3WG4A 4BHPA 5DAPA 2Y6GA 2EXJA 3EHKA 5GALA 2AGSA 5TSWA 1OQ1A 1D0HA 1N1TA 3BB6A 5A3PA 4AFCA 5IVEA 3HAGA 3OYWA 1UW8A 4COVA 4KU8A 2DVAA 2XJTA 1SLIA 4FTBA 5FY8A 4XFBA 2EALA 2KM2A 1KQRA 1H9WA 1HJGA 4KG8A 4GB31 2B45X 4HLTA 4IL7A 4M0HA 5APAA 2VZQA 5AC92 2WN3A 3MW4A 4JX0A 3RDIA 3UGHA 2IUWA 4ATFA 5C4WA 4ZU7A 5DUXA 2PELA 4PQ9A 3B69A 5FZ8A 2RHPA 1R091 1UX6A 4M01A 4WM7C 3V65A 4E2QA 4H3WA 5C4WB 4NWWA 4B4QA 3ECQA 1SLCA 2XWBB 4UFMA 3ZKUA 4NR1A 1OPOA 3FMGA 2YC4A 4GWJA 5BNPB 3Q8AA 4QX3A 5E88A 3WEZA 4EN6B 2XPJA 2WZ8A 4C1XA 2RS11 1VRH2 3ZYIB 2VD7A 1OSGA 1MS3A 1W8ZA 2HWC1 4LE3A 4YW7A 1QY4A 3DPRB 1HIXA 2VNVA 5F39A 3H50A 4EE2A 1RUJ3 5LBEA 5FP7A 3SITA 2GNTA 3AL6A 4IE6A 4UFKA 2DYCA 3ILFA 3J8F1 2FHRA 2ILMA 3ELNA 5DAXA 4AHZA 5E6HA 2Y0OA 4D7TA 1SMVA 5J98B 2NMNA 2D7FA 3I3DA 5FXVA 2OQ6A 1LOFA 4HKLA 3HEIA 2A6WA 3ZSJA 5F2WA 4AFMA 3MV01 1F15A 2UY8A 1V6KA 2CDPA 4GB33 4GB32 3H3LA 2RDQA 4XF3A 4DNYA 3S7IA 1K5MC 2BEOA 4LJHA 3RVHA 3OGRA 3SEEA 2QVSB 1QDCA 4BQ2A 4N9IA 1YRZA 1RUE1 4HT1T 5DZFA 3B02A 2VMCA 1JUHA 4R9BA 3APBA 4GH4A 2OS2A 1R092 2QDRA 4YVSB 3LSDA 2KD7A 5IVCA 3HQUA 2QE3A 2R0FA 3NVCA 3MDPA 4ZU4A 5KHIA 2FDJA 3B9CA 3UT0A 2EICA 2D6KA 3O12A 2QQKA 4WZFA 3S5AA 2FCTA 4XILA 3T0DA 4MX3A 2UU8A 1D7PM 2WSVA 5E1RA 3ZXFA 5A3NA 2AC1A 3N3HA 4WVZA 4YG3A 5JWPA 4PBPA 3O1UA 2RS12 4FVVA 1UD1A 3FZ3A 1OMIA 3LE0A 2F6BA 2HWC3 2WA4A 3AL5A 2DBNA 1KD7A 4QX7A 1RC6A 2RMU3 4ASMB 2WL1A 2X53S 3RZZA 1CN1A 2BGPA 4LA3A 3NV3A 1U12A 4AE2A 4GH4C 1DQ4A 3J8F2 3OUHA 3RMXA 5T5JA 3PLQA 1H4HA 4KWLA 4NHYA 3U1XA 2PHTA 4ISRA 2DUOA 2WS91 5DAWA 1COV3 1AYM1 1YCIA 2DCKA 3RPQA 2YBSA 5FZ4A 2HWF1 3GALA 2KR2A 1SBDA 4QMAA 1UY0A 5C71A 5L19A 3IDCB 3WCSA 4O9EA 1WA6X 2L9LA 5GJ6A 3S57A 2WNOA 1OD5A 3FUOA 3NV2A 1MZ5A 2SLIA 1K42A 1RUE3 1A34A 1VMJA 1RUE2 5C70A 3K3OA 4FOQA 2ZS6B 1AR63 1QMJA 1UZ0A 4XIOA 4CEWA 1NLQA 2ZGRA 3MGUA 3DEMA 3TN91 1OA3A 2WO2A 1DQ6A 3FFZA 3TB0A 4RA0A 3M3IA 4CEWB 2VR4A 3RSJA 2ZGQA 5KXDA 3QD6A 2BNMA 5CISA 2ZABA 4ARYA 1L7LA 3AKTA 4CU7A 3PUAA 4W65A 4B4RA 3OBZA 2ARAA 3ZXLA 2VMIA 2X5IC 2YG0A 1JYNA 4QU1A 3BPZA 5JOZA 2EAAA 3KV5A 3IKWA 4Q0QA 3C3VA 2ARXA 2IFWA 4QAWA 1S0CA 1ZBA3 1MS8A 5T5OA 5C3SA 1UZVA 4FPEA 3RZMA 3BTYA 3KQRA 3PU3A 3OPWA 5F32A 1O3RA 2IXJA 3D0SA 4QX2A 2Q8DA 2GN7A 3VDBA 1CAWB 1RVF1 1RITA 1Y9MA 4V2WA 2Y0IA 3TEWA 4RHV3 3VHNA 2JDNA 5FIXA 3I4IA 2OPKA 3JQXA 1URXA 5T3NA 1XNKA 1OVPA 2ZHLA 2O8QA 2WS92 2C0ZA 4K1ZA 2P34A 3K4ZA 3FLTA 4WVMB 1AYM2 1POV0 2GP3A 1HB4A 1OUSA 1V9U3 3WT3A 1VBD3 2HWF2 5CKMA 4AVTA 1X7NA 3O1TA 4FAGA 1ZZBA 4ZHNA 5I91A 3OY8B 3GZUC 5KXEA 1AX0A 2J1VA 5LRRA 4Y1YA 4K40A 4CUBA 3VD7A 2LALA 4MGQA 1FAYA 1LECA 2PAMA 2RG4A 2X09A 1UMIA 5CVRA 5LBFA 3RI9A 2RR11 4Y1XA 4UW5A 1MS1A 2OPWA 5A32B 3TN92 1UAIA 1JHJA 1HV0A 3LA2A 4LBNA 3VHPA 3WF0A 3AZXA 2FZ2A 5FYSA 3CZUA 5FYHA 2VCBA 5HV0A 4OHVA 4Q5OA 4JQTA 4DO0A 3J7LA 4ET7A 2ZX3A 4Q0PA 1W8WA 2IXCA 5A7WA 4LBQB 1W9SA 3TRSB 4H14A 5D2AA 5ABJC 1EYBA 1VJ2A 3ZFEC 3TOJA 2WO7A 4A41A 4CXWA 5A7WB 3RQ0A 4GAZA 4FPLA 2NLRA 3I2OA 4DIQA 1UY1A 2FMYA 5HI0A 1MEC3 1RVF3 4IEUA 1RVF2 1W03A 2WBKA 2YROA 1OH3A 4XZUG 4B7EA 3I2KA 1PHMA 2O0OA 5IUQA 4EYUA 3VKNA 3D0JA 1NCRA 3P6BA 2W94A 3HMYA 1KS4A 3NWKA 4QPIA 3DN7A 4HOOA 4O7XA 4FTEA 4CDWA 2OA2A 3AP6A 1DGRN 3H42B 5I0TA 4GD4A 5FAXA 1LJ7A 3ALQA 4OI1A 4QB6A 4E4SA 3INAA 2D6LX 4CDWB 1NYWA 2XKOA 1SDWA 2R7EB 5FXZA 3VKMA 3RS6A 5A6QA 1RXGA 2JX9A 2RJ2A 2W39A 4OI2A 5FZ0A 3POYA 2RR13 4N53A 4QXCA 2E51A 3POBA 4L11A 1W6QA 4J1WA 4UI9L 5CYYA 3WHTA 3R4UA 4NPRA 3WG2A 1REFA 1NXMA 3O1SA 1ZRDA 1NCRC 4N53B 5D8AA 4CE8A 4CU8A 2WWJA 4QPIC 3POIA 3L2YA 3RZKA 1ULFA 4L92A 5GZGA 5D8AB 3BPSA 3GBGA 4RD7A 5KHJA 5FZ7A 2WNVC 1J58A 2HWE3 4RS5B 4AAXA 1YJLA 4AEKA 4Q4W1 4AWDA 5ACA3 4TYSA 4LT5A 4Q29A 4IEVA 4Y1VA 3SCFA 5FYTA 3O1VA 2B42B 1XE7A 1O4YA 2D97A 4QQPA 1QJZA 2Y33A 1PZ8A 4Q2FA 4CCOA 3M3EA 3RG0A 2CAVA 2G9FA 3E6DA 4NOTA 2A73B 3H3ZA 1WCQA 1WCKA 2JG9A 1RMU1 5IK8A 5JXGA 4CDQA 1KS5A 5BNNC 1KJLA 4QPGA 2JG9B 2QQNA 1FATA 3ZFFA 4X8NA 3EMRA 4CDQB 3BIWE 4BMEA 4QPGB 3EQEA 3ZFFB 2LTNA 2W91A 5LW9A 5FUPA 2BP6A 3NNJA 2WZPP 4KGGA 3N7KA 1ULEA 1PNGA 4C1WA 2DTYA 2VNRA 2W3JA 5FY1A 1IPSA 1W6OA 3F2ZA 3N4MA 4GWMA 1UX7A 1RUC1 1RUOA 4QB1A 3S0MA 4D6QA 1H8TA 2XLFA 1UIJA 2QQIA 1W6OB 1PK6A 1CIYA 4PHZA 1XU2A 5IVFA 4NWVA 4Q27A 3VDCA 1H8TB 1NE6A 1OLQA 2DU0A 3FFQA 2C5DA 3U07A 2WYSA 3VL9A 3ZSEA 1Y3TA 3BTXA 4Q4W2 1CJDA 2BFUL 1FNYA 1S2BA 4Q0SA 2BGCA 3ZOIA 2XQRA 5DUVA 2VVEA 3MUY1 1IPJA 4HPKB 4QQOA 1Q8PA 4XMIA 1CR7A 4CP1A 4Y5SA 5EYXA 2UYAA 2P37A 3L9JT 1NUKA 1UU4A 1YYNA 3O5SA 3WNLA 4EQVA 1N47A 2JE9A 3RZHA 1DP0A 3ABZA 1ACCA 1AX2A 1Y9QA 5ERLA 5FZ1A 1RMU3 1RUI1 4MV2A 1D4M1 1OFSA 4IE7A 4OMCA 5FZHA 1GQPA 4LR4A 3VBRA 1PK6C 2R063 3VBUC 4O9GA 5CIRA 5FY7A 3HJRA 2PLV3 2YC2A 4BIOA 4AGRA 2GH8A 1OQDA 1W2TA 4K8RB 1V00A 1SDDB 1LULA 2XB6C 3KM5A 5J96B 1GNZA 5FMOL 3DV8A 1ULOA 2QTWB 3LIHA 2D6MA 4AEMA 3HN3A 5BXXA 4IV3B 4XTMA 1GNHA 1YQ5A 3JB8A 2TUNA 1MZ6A 1D2SA 1KEXA 2DV9A 2V5DA 3PUQA 1PGW1 4HK8A 1ALYA 1F4AA 1RUC2 1X36A 4HN0A 1TME3 1GOFA 1IS6A 4E9KA 2VECA 3ZMOA 3AZZA 1DIWA 3G6JB 2PFWA 4GMP3 3D6EA 3NAPC 4B4PA 3J7HA 1G9BA 2BU9A 3L2HA 5FZOA 4NO4A 3AZWA 2ZMKA 1N1VA 4FFHA 4AHWA 1ZBE3 1SHWB 3GGLA 2R1BA 4NAOA 1UOJA 5FZOB 5K8SA 1LU2A 4LHNA 4OUMA 2HLEA 4UYBA 1HX6A 5FYVA 5L9BA 3TYJA 3LZZA 3DKQA 2RS31 4LITA 2K0GA 4IETA 2JICA 3OEBA 4XQ4A 3O1MA 1PGSA 1DYPA 3KGLA 3MIGA 2ORZA 4RFRB 4KWUA 4XIKA 4Q8LA 1H2LA 3H0OA 3Q8CA 1RUI2 1D4M3 4ZS3A 3WDTA 1D4M2 1FYUA 1W8NA 4Q0UA 2D5HA 5A1FA 1U5IA 4URTA 5GLWA 4RR3C 1LAJA 2CHHA 1UYZA 5JIUA 3ACFA 2ZGTA 2BVBA 2ZX0A 1OUXA 1VALA 2WT0A 3BUCA 4AHXA 4TTGA 5GZDA 2YGLA 4NRPA 1POV1 4AK3A 5A6XA 3N9NA 1J3RA 1K45A 2WJSA 1S1AA 2W1SA 1PGW2 2X10A 2XLAA 3O1RA 1AJOA 3TNPB 3UGFA 2HEWF 2OZJA 1TVGA 5E8AA 3HT1A 4BOWA 3LQCA 2WABA 3VKLA 5LA1A 4FPOB 1W3VA 4CP0A 5FZDA 4OHXA 4ZONA 1OF3A 3N9OA 2V09A 4ES9A 2EIBA 3GBFA 3N9LA 3K77A 4GXLA 2D40A 5AVPA 2XVKA 5DZGA 3VBSB 5A7QA 4FBFA 5HCFA 1CVNA 3VBFC 2E53A 3VZNA 1LHVA 2BW8A 4UOJA 1RHI1 2RS33 4BLJA 4PIXA 4DXTA 1I6XA 1LESA 4PF1A 2QQUA 2CWMA 5IW0A 3ASIA 5A7NA 4AVAA 3N7MA 1D4VB 4BQ1A 2E26A 2VZTA 5D21A 5DMYA 3UV9A 5I8TA 1CZTA 4CA9A 4QHZA 2ZJCA 3AK0A 3TAYA 1VB2A 1DGWX 1E57A 1NKGA 4U36A 5LBBA 4R8HA 3CJIC 4HVRA 4CCCA 2VUDA 1UN1A 1YI9A 3A22A 1EAH3 4NIDA 4NHMA 3AJYA 1NG0A 3WNXA 2VQ0A 5A3TA 2EXKA 1WGPA 1HQWA 3M8LA 1YQ2A 1HB1A 3VBOC 3H1WA 1NLSA 2ZEYA 4AEDC 3V0BA 3P1IA 3UKVA 2FD8A 1B35A 3RFRA 4KI5M 4MZUA 4A2UA 4MXVA 1VBC1 4QHBA 4M3CB 4K3UA 4F3JA 3V0BB 2ORXA 2YZ4A 4W4ZA 1JOBA 3RMYA 2BRTA 2HH9A 1ZRFA 2HWD1 4J6GA 4B1LA 1AJKA 3ON7A 3R4DB 4IEWA 4IE0A 4LE4A 5A3LA 3NJVA 3BODA 1OKOA 1RHI2 1LOAA 3C7FA 5JZGC 2ZX2A 1P8JA 4DUXA 1Z7S1 5K9YA 2G19A 1QJY3 3HOBA 3HVDA 4LBMA 2BZDA 4QPYA 3BOWA 1B35C 3HNMA 5LEJA 3ZPYA 3OGSA 2YDEA 4IQPA 1OF4A 1JUIA 2BNOA 5IK4A 1XC6A 4QB2A 2PXJA 2AREA 2CGPA 3JBG1 3QLQA 4XZPA 1DLCA 4FP2A 4OUEA 1F5JA 4PF5A 1HQLA 2RM21 3B01A 3FLPA 4GA9A 4KG0A 2W5FA 1HV1A 1RUF1 4QKDA 4CCJA 5EV7A 1REDA 5G04L 4MGTA 3D82A 1ND2B 3Q8FA 1LOEA 1UPIA 4L9BA 5SV5A 5JXIA 3FBMA 3LOIA 3VGIA 2V72A 1BEV1 1I3HA 5HXMA 1S0DA 2JDAA 3AXDA 5A33A 3SKJE 2D3PA 5CFDB 1MVEA 4Y4YA 3V0AB 3ST7A 1ASJ1 4S2DA 5JVVA 2ZPXA 1SCRA 5A33B 1VBC2 2R1DA 2X8KA 4UW6A 1MACA 3LEIA 4QQ2A 2XONA 3W59A 3GYDA 4LUMA 3CBNA 2ZMLA 3ES4A 1LEDA 5JUVA 1YNAA 2HWD2 2VOKA 2Q1ZB 3JQWA 1DG6A 3SKVA 4R52A 1BMV1 4S2FA 4FPJA 1ZZ9A 5DXDA 1TNFA 1SBEA 3M70A 2IFRA 2PTMA 4LULA 4MGYE 3AYCA 4YG0A 1UKRA 5FZ3A 3ZMNA 3ZN4A 4AQTA 4CUCA 4OHYA 1W2OA 4META 5FLIA 1Z7S2 1AR91 4COWA 1MPXA 2JDHA 3GJAA 4JDOA 5LATA 2P3KA 5A7PA 4D94A 2R6QA 3H8RA 1W0PA 1JOJA 1KGYA 2P6CA 4NUBA 1CAXA 1X82A 3JBG2 4E2GA 3ZO0B 2JXAA 1PO13 1AXKA 2O14A 2RM22 4I0WB 4LLOA 1RUF3 4FPCA 5JMOA 1RUF2 5F9TA 2VJXA 3BVCA 1BJQA 4SBVA 2WFPA 5FTTC 1CAVA 4LLFA 1IQAA 1WW5A 1O6UA 2MEV3 2P5BA 2VU9A 4N43C 4QT6A 5HV4A 5K0UC 1NX9A 4S2GA 2PAEA 4B29A 2VTXA 1BEV2 4YGCA 5HPOA 1OT5A 2I2SA 3EJKA 3P5BA 5FJHA 1BBT3 4AXOA 1UOGA 1ASJ2 2ERFA 4MO3M 3ZFGB 5I93A 2VQUA 2VMFA 1JZ4A 1N3PA 1UY3A 2B39A 2XL7A 2ZGLA 4KBBA 3T1LA 1I9RA 2G1MA 4IGPA 4NHXA 1QOSA 4UFLA 4I0BA 2FDGA 4CDXB 4A42A 1BMV2 4F8AA
chains in the Genus database with same CATH topology
3WW4A 1V6MA 1W2UA 2HWB3 3KCYA 2HEVF 2QDNA 1QJU3 4R9CA 4PLMA 1AR92 2JE7A 2H6CA 4E2SA 1YWKA 3AP7A 1JYCA 4GIQA 2PQQA 1ZA4A 1G8WA 2DU1A 1CX4A 1ZX5A 1RUJ1 4HKWA 1GANA 1GLHA 4FP3A 2A70A 1JN2P 4KGQA 4QM9A 4WM7A 5GLVA 1ULGA 3NV1A 4MH0E 4MYEA 2XGXA 3I8TA 5DZEA 3ENRA 2IWGB 4WM7B 5KHKA 3SCHA 3N7LA 1C5HA 5JOYA 4QGMA 4XQWA 3CU7A 4YLZA 4WM8C 5C8WA 5J3UA 1J3PA 3OYWB 3BTAA 3T1MA 2PHDA 1PGL1 1S0GA 4XEZA 4R4ZA 2NN8A 3MFCA 2BNNA 3AMQA 4HMZA 2R073 2VOWA 4FQ4A 4Q4V3 1LOGA 3AMNA 1GZ9A 5DG1A 1UZYA 4MLOA 3MLLA 2D98A 1WW4A 5GM0A 1C5IA 4YYOA 1V6OA 3NKGA 3ACLA 4BPZA 3ZSLA 4PCRA 1PVC3 1I5ZA 3FC0A 3WXPA 3ZSKA 3WDUA 1JHNA 1ONAA 1YFUA 1K5MA 4FO9A 1OA4A 2WINB 1ZZ7A 4HVQA 2BBVA 1WD4A 2RMU1 1LKNA 1K5MB 1RUJ2 4GKXA 3NKTA 1QU0A 4CDUC 5J37A 5D1IA 4ZXKA 2XWJB 1FXZA 1WLTA 3VKFC 5I8SA 1N3QA 3QCWA 1AR73 1QJX3 1COV1 3E5XA 3H1MA 4KWJA 1YFYA 1OOPC 4LBJA 1PGL2 4YRDA 2P2KA 4K20A 2W52A 4GQ7A 1CJPA 3B5LB 4P9GA 1ZRCA 1LCLA 1AR61 4OUSA 2Q5TA 1QGLA 5BPXA 2XLGA 3SHRA 2OYZA 1C3HA 2E7QA 4GH4B 3AMHA 4Q8KA 3WDVA 2GSYA 2LM3A 3VUOA 2PHFA 2PAKA 3KMHA 4MUVA 1DBNA 2R0HA 1F9KA 1F31A 2K2SA 3GHNA 4I30A 1ZBA1 1QXPA 1DGRA 5JDBA 2EA7A 2HWC2 3IIAA 3IMNA 4XF0A 3RYPA 5CAZA 2RMU2 2DCJA 4AI1A 4Z2WA 3H3UA 1TMF3 5FBZA 1J1TA 3PTYA 4N7UA 1WD3A 1AYN3 1GZCA 4RHV1 2DCZA 1SLLA 4EN0A 2RJLA 3LSEA 1O3TA 4YW5A 4NHLA 1AHSA 1EY2A 5HCAA 3AP5A 2X5IA 1COV2 1WCSA 4I01A 4D7SA 1C8M3 4OI4A 3LGRA 3S30A 1V9U1 1VBD1 1GR3A 4ES8A 2X5IB 4L8QA 1QF3A 3AKQA 4QGLA 3WDXA 4YVSC 5JSPA 2VOXA 4XYXA 5KBFA 1AR62 4I09A 3KT7A 4Y22A 1J1LA 2CY6A 1IS3A 3OJBA 1YIFA 3H7YA 4AYUA 3NJZA 3POSA 2MNGA 3JU9A 4FAHA 1M06G 3H1YA 5GKAC 2VUJA 2ZHKA 4FOYA 3BALA 2ATFA 4Y1UA 1ZBA2 1GQHA 5GZEA 4XBNA 4QD2A 2WWSA 2A6ZA 1MEC1 4H55A 1XXNA 1O4ZA 1LRHA 4LO4B 3TWIA 4RHV2 3CL1A 3LA7A 3E5UA 3R05A 1LU1A 1CGPA 1V70A 2WSUA 3MIHA 4MGKE 4L99A 1H0BA 1HLCA 4XQDA 5ABJA 3ZDSA 3ZFEA 4FT8A 4JGYC 4LBLA 1V9U2 1WMEA 5L7OC 1VBD2 5ABJB 3ZFEB 4PIZA 2DVFA 5FPXA 4GALA 4DRVA 3MIDA 1PZ7A 3O0VA 1RL3A 4NHKA 4AGGA 4JAAA 4OI0A 1QXJA 5FO9B 1GZWA 4W6WA 2IXIA 2XH6A 1A78A 2WIIB 3KCCA 5K7PA 1OPMA 4LEJA 1GZWB 1OQEA 3ETQA 1DQ1A 1I1EA 4JTNA 1QNYA 2ZKNA 2RE9A 4G4FA 3ZN5A 2HWE1 3FX3A 4PBOA 2VNGA 5ACA1 3RYKA 3KGZA 2A3YA 5BUVA 2QFEA 3MIEA 4AW7A 4C91A 4UBGA 1MEC2 3WDWA 1UU6A 1DZTA 3M3OA 1JYIA 3W58A 2IXLA 5CFCC 1NY71 3BU7A 3WQ1A 3U4XA 2E9QA 4P9LA 4E4ZA 2D5FA 3CLPA 1NCRB 1YI7A 4BLIA 4K1YA 3MPPG 1H4GA 4QQHA 2PN5A 3WD5A 4QPIB 5CB7A 3SCGA 2WNVA 3RJ2X 3HR9A 4AHYA 1RUD1 1W6NA 4B7KA 3M3CA 5FDBA 1RIRA 4RQPC 2WNVB 4BMBA 4AVBA 2WNUA 1W6NB 3ZN6A 3A4UA 3AB0A 3PVNA 2RR12 4XF1A 1RJ7A 2V73A 1F2NA 2XKPA 2CL2A 5GZFA 4S2HA 4HFSA 3RNSA 2G9GA 2O8OA 1W6QB 1RUH3 5FQ0A 4W6XA 2HYKA 5BNNA 3QH6A 2OUHA 3KSCA 4JVAA 2B46X 2GALA 2OUJA 5FQ0B 4Z1VA 4KH9A 1GFF2 2HWE2 1ND3A 4BWOA 5BNNB 1DF0A 1PNFA 2YYOA 5ACA2 2E63A 1W0OA 4XPVA 5KC5A 2WNUC 4FPYA 2DURA 5F6LB 2A3XA 1ENSA 2GC3A 2MHFA 2C1FA 1QHDA 4LO6B 1NY72 1WLCA 3S7EA 1L3JA 2R061 2VMGA 2XJQA 1T6GC 5EJ3A 2UURA 2PLV1 4EWAA 5IK5A 2JEMA 1N1YA 1ND3C 1RUD3 3SMHA 3WG1A 4XHXA 2C9AA 3NL1A 1MVQA 3NV4A 3N35A 1LHWA 4N9HA 1IS5A 4D3WA 5SV8A 2WZR1 2WQZC 1A8MA 1IKPA 2OW4A 4CTEA 2WT2A 1TME1 3UKTA 1UCXA 5JSRA 4FSJA 2Z79A 4YW1A 4GMP1 2NM1A 1DGWA 3VBUA 1NCQC 1MS9A 2CV6A 5DDJ1 2GNBA 1PK6B 3E6CC 1EV11 3GNEA 3VBUB 4HANA 2NYYA 1Q3EA 4AFBA 1ZBE1 1XQNA 5FO7B 4Y20A 2YY1A 4KQ7A 4BA6A 1ULCA 2QZ3A 4JRAA 4DY3A 1C57A 2GNMA 5JI7A 1KFUL 4YM1A 4IERA 2ZGKA 4R4XA 1MS4A 2E6VA 1R083 5C8CC 1KXGA 1RMU2 1EPWA 3HBZA 1ZVFA 2A75A 2R062 4AQ2A 3NSTA 1ZZ8A 1ZM1A 3O14A 2DUQA 3NAPA 2JG8A 4Y5Z0 1YO8A 3VBRB 3AYEA 4XTPA 2PLV2 2VGDA 3V64A 1KRIA 3NAPB 4IEQA 3SH3A 3UJQA 2CAUA 2Z42A 3E97A 4M3CE 5EXOA 2ZAAA 1PMIA 1GKBA 5JLVA 2DVGA 1SLAA 3OF1A 1DDLA 4XF4A 5JPMB 1EP0A 1S0EA 2CNAA 1AL23 2VG9A 2VW2A 3VBHA 2WZR3 2WT1A 1H2MA 2WZR2 3WY6A 2VMHA 1TME2 4L2NA 1J59A 1YLLA 1EPZA 4LTAA 5DDJ3 2JG8C 3IM0A 4I0AA 4PIYA 4RR3A 1EV13 3AFGA 3VHOA 1Z0HA 1S0FA 1W6MA 1TNRA 1ZBE2 2JDZA 2P3JA 2AH2A 4RR3B 1LHNA 2ZACA 1X33A 2ZGUA 2YV8A 2VVFA 1V6IA 1FV3A 1Q8VA 1FMD1 3VBHC 2NMOA 3HN1A 2VVDA 3WCRA 4IV1C 3WP4A 2GU9A 1QNWA 2XBO3 4XJ8A 3RJRA 2QJVA 5DUUA 2I74A 4H7MA 1MR5A 1QOOA 4JTOA 5CADA 3VBFA 3O0WA 1EAH1 3B9IA 1H2NA 1NZCA 1XNDA 3QBQA 3ILNA 4PJYA 1LOCA 3JB4C 3P3PA 4Q26A 3VBFB 3U10A 5FPZA 2OIIA 1FNZA 4P9IA 1LOBA 2A6XA 3G7DA 3GF6A 4G3YC 5BV6A 1A8DA 2DF7A 3I59A 4N7IA 3M4FA 5J09A 1O3QA 4AI8A 1BK1A 1MQTC 3CJIA 4YGEA 1Q43A 4Q4X3 2EF6A 2EAKA 1AUYA 1AR83 3WOGA 3AZYA 2F4PA 2QZ2A 3CJIB 2RS32 1FMD3 5DG2A 4AEJA 1FMD2 2ZX1A 3JUUA 3VBOA 2JECA 1VR3A 1LGBA 2Z2SB 3AFKA 1QJY1 2XUMA 5LK5A 1RUG1 3K51A 4AEDA 5JI9A 2AENA 1GV9A 3VBOB 1UZZA 2ZA9A 4PDWA 4Z8BA 3O0XA 4AEDB 4RFT0 2GZWA 3WINE 3WQ7A 4E27A 2D3RA 1JW6A 3EO6A 5BNOC 3ILRA 2GAUA 2DVBA 4C90A 1EAH2 1VAKA 3IPVA 1IZ3A 5JZGA 3PJYA 2WQ4A 4Q1PA 3MZHA 1VBA1 2BPA2 3V56A 3WW3A 5JZGB 2BFUS 2WA3A 3WZ1A 3MLJA 3N7JA 4PDWC 4GWNA 5JOWA 1LHOA 3X29B 4KL1A 1B35B 1PM7A 4XOGA 2BTVC 1YHFA 4I2OA 3BCWA 5J36A 4CEYA 1GYKA 2JD4A 3J9SA 4D7YA 1G86A 4YVWC 5FO8B 4W6YA 3ZXDA 4J1XA 1DGLA 4MXWA 2XJUA 4U2AA 3IN9A 1OFNA 1XE8A 2PHRA 4EJRA 1APNA 4MSVA 4XBLA 1G9CA 1S2KA 2H0VA 3VDDA 3ROUA 1NA1C 4Y24A 5CNAA 3ZVXA 3UJOA 1HDKA 1QJY2 1RUG3 1RUG2 1G9FA 4FCAA 4YW4A 3QOPA 1AL0G 1HXS1 2GNDA 4CEYC 2XG3A 1PO11 4YZ2A 2NZ9A 4YZ1A 4XFGA 2YHJA 4RSUA 2GMMA 3CEWA 4BH9A 4COYA 2H0BA 1S0BA 4BIFA 2MEV1 4ONUA 3M7AA 1H1MA 5BYNA 2VQAA 3VDDC 4G9SB 4YW3A 2AR6A 3OPZA 1VBA3 1VBA2 1PO21 4HETA 1BBT1 1LTEA 1JXNA 1FPN3 2PA7A 4A3XA 3AP9A 1BVVA 3AMMA 2D6OX 1SBFA 3ES1A 4HSJA 5EZWA 1GQGA 2NPIA 4EWEA 1NQDA 5JSOA 4WVWA 4V1PA 4YFWA 2A7AA 5K0UA 2HWB1 4N43A 1O4TA 5HBAA 1QJU1 4SLIA 2BWCA 4ZKTB 1WA4A 4N43B 3USUA 1AF9A 1V6LA 2WKKA 4HVOA 3MICA 1HXS3 1HXS2 4A7ZA 1CQ9A 3M3QA 3LB9A 1PO12 2R043 4AGVA 1CAXB 3EBRA 1HW5A 2VXRA 3GZAA 1H30A 2MEV2 4OHWA 1XNCA 4X6QB 3AYDA 1CAVB 1PO23 2BWAA 1PO22 3R6SA 4DS0A 1BBT2 4MGZE 3FJSA 2XL9A 3LCPA 2YUEA 1H9PA 1WLDA 5IT6A 4HBNA 5AFEA 3MF6A 2GMEA 2R071 3IWZA 2GDFA 4Q4V1 5GZCA 1RINA 4BM8A 4XJWA 3CJXA 1PIV1 3HIFA 5KWRA 3UL2A 1ENRA 3C2UA 2ZTNA 1M4WA 1DZQA 2QKDA 4P9WA 1N1SA 2HWB2 2AYHA 4XFAA 1DHKB 3AX4A 4PLOA 1QJU2 3DF0A 1RJ8A 2A6VA 4AQ6A 4WM8A 1PVC1 1XYNA 3H7JA 5AFBA 1X8MA 4AVVA 4WM8B 4YZ4A 1R1ZA 3A0KA 2RS51 3TNQA 5KXBA 3PVOA 3LOBA 5J48A 1F8VA 1U5YA 1U0AA 2VNOA 3ME2A 1HRV3 4FPHA 4JGZC 5I8YA 4XXPA 5C9AC 1H1AA 1C4RA 1SCSA 1WMFA 5E16A 3ZYRA 3ZFGC 4ORFA 3AKPA 1YIPA 2N7GA 1AR71 1QJX1 3BOPA 3NW4A 2X29A 4HKOA 1Q56A 5L73A 2CTVA 1G9DA 3IBMA 1VP6A 1VBB3 1G9AA 1S0IA 3LKJA 1CPNA 2DUPA 4I3GA 5FLHA 3VZMA 2R072 3POWA 4IEXA 4Q4V2 4EN7B 1JTZX 3OGJA 4XJ9A 1PIV3 4OZXA 1PIV2 4AI0A 4CDUA 3OGGA 2VW1A 4MVTA 2LUWA 4XFFA 1JBCA 3VZOA 2GN3A 4CDUB 4YARA 3PJQA 2I45A 1GSLA 4XJAA 3SNMA 3U0ZA 1DFQA 4AI3A 1PVC2 2D6NA 2R30A 2XJSA 3WUCA 1OOPA 2ES3A 5AC93 2D44A 2DWRA 5BY5A 2NP0A 4NVPA 3WP5A 4EWDA 3VKOA 4IEYA 2RS53 5A3MA 2RS52 1OOPB 2PYTA 2PHXA 3SXWA 4IEOA 4X8PA 2WC2A 1LENA 1TMF1 1IPKA 1QQP1 4HN1A 1AYN1 5T5PA 1WW7A 1IKQA 5BNPA 2CGOA 5JR7B 4WBBA 1IHMA 4OVEA 2XJVA 3QACA 4P9YA 3WP3A 3USSA 1WMDA 3AZVA 1AR72 3SLIA 1QJX2 1NLRA 2AZ5A 3D8CA 3DPRA 1C8M1 3KS7A 3LA3A 1VRH3 1QDOA 2HKXA 1IGOA 2WLQA 2B9UA 3MEPA 4H7LA 2UWAA 4YZ3A 2ZOEB 5C4WC 5E89A 4QGNA 3I7DA 4UW4A 4GMP0 2ZHMA 4XMAA 5I0SA 5BNPC 2SBAA 4LA2A 2WFF1 4ATEA 4LBOA 3N36A 1QH7A 5T52A 4UXAA 4TSVA 3AP4A 3VN4A 3MW2A 4FPKA 5CG8A 4YGBA 3DPRC 1NQJA 1UPSA 2Q30A 3URFA 4CYDA 3MW3A 4E4DX 1YXWA 4YVSA 1U5XA 1R093 1UU5A 1UL9A 1TMF2 1QQP3 2HEYF 1QQP2 3WV6A 1AYN2 1Q8QA 3MYXA 4AFAA 2OZ6A 2V5YA 1LOFC 5T50A 1SFNA 5AVAA 2OVUA 3AM2A 1CPMA 4DINB 2RS13 1C8M2 4P5HA 5KC6A 3NO8A 1OLRA 4HZFA 3M1HA 3J8F3 3FWEA 1FT9A 1MZEA 2WFF3 2WFF2 4Y22B 4XXAA 4JDMA 4YG6A 2O1QA 2PHWA 4JGYA 3SH5A 2VH9A 1RB8G 1DYKA 5L7OA 4ZU5A 1TE1B 4QXKA 3JD71 5KHHA 2GC2A 1HKDA 2Z5WA 1LEMA 1Q8SA 3JZVA 4JGYB 5L7OB 2P17A 2Q0AA 2JENA 4WV8A 3FHIB 2D3SA 4A7YA 4WZCA 4A7KA 3CO2A 1ULDA 5CA6A 1BXHA 3I54A 1W6PA 4TZDA 3DUIA 4HK9A 1RTVA 1WLWA 3WX5A 3ZYPA 4XF9A 1JH5A 1W6PB 1Y43B 2FMDA 1CAWA 3O7OA 3PMEA 3LWCA 4GULA 1UMZA 2ZBJA 3RWNA 3KCXA 4CEWC 1QOTA 4LBQD 2ET1A 4TWTA 1LR5A 4WVMA 3ZXJA 1H8VA 4C0HA 2QUOA 2VW0A 2WS93 5CFCA 1RUH1 5KXCA 1AYM3 2G4IA 2DVDA 1MZFA 3OY8A 3CF6E 2YMZA 1CAUA 5CFCB 2HWF3 3VHRA 2GC0A 3JD73 3JD72 3PMSA 5H9SA 1CAUB 5A32A 2TBVA 4RQPA 3PVBB 1DQ5A 1VB4A 3TN93 2Y38A 3AXEA 4XETA 4RQPB 3QH7A 4LBQA 3H8UA 4QU2A 2KXLA 1U5ZA 2XJRA 4DPNA 4ITCA 4XW3A 1C1LA 2Z69A 2YPJA 3LAGA 3OD0A 4AG4A 1CESA 2D6PA 1C28A 1AX1A 2HJIA 4NN0A 2W0XA 3FUQA 3KT1A 5H9PA 4OHZA 1UIKA 1XU1A 5J7MA 1C8NA 1NXD1 1O5LA 4EV0A 2H6BA 3ATGA 1WBLA 3MF9A 3VZLA 2WNUB 3ZN6B 2R49A 3J26N 1YFWA 3HT2A 4AVSA 1C1FA 1RUH2 2EIGA 5JMCA 5EYYA 2DCYA 3UK9A 2BVVA 4R9DA 5GLUA 2ZGNA 3DL3A 5FLJA 3WW2A 4EN9B 3S6PA 4DY5A 1OI6A 5FCCA 5L36A 2UWBA 2VUAA 3M2MA 2RJKA 1DU3D 3WQ0A 2XJPA 4F83A 1ND3B 4LNVA 4JRLA 1SLTA 3RRDA 1FX5A 2BQPA 1DLLA 4YW2A 1RUNA 1O5UA 1R081 2B7YA 1VIWB 4RS5A 5FOBB 4CDWC 1Q8OA 3PVEA 2XVLA 3WLUA 4OULA 1NCQA 1BZWA 2BYVE 4IEZA 1G7YA 4Z07A 4Y26A 3ZX7A 1RUD2 5JAXA 1NCQB 3HQXA 3ZIWA 4DMIA 2EVXA 1SEFA 4N53C 1FV2A 2WLPA 4XFCA 5F1RA 3D5OA 5BNQA 3WHUA 2A3WA 5D8AC 1AL21 3RI8A 5C8CA 2QQPA 4QM8A 4RS5C 3OCPA 1ZZCA 2UY9A 4YNIA 5C8CB 2Q8OA 3A0NA 1UKGA 1R1A1 3KD4A 3VZJA 1CONA 5T55A 4XJZA 1OHFA 2IXHA 3B93A 5IK7A 4P9JA 3DGTA 3MFAA 3AKSA 4QX5A 1BVP1 1AXYA 3VV1A 3MLKA 2DFBA 4Y20B 2Q4SA 5KHGA 2JG9C 5FFOC 1QWRA 1R082 4AF9A 5JPNB 4CDQC 1HRI1 4UW3A 3RYRA 2EXIA 4QPGC 2TNFA 4FXKB 3ZFFC 4BE3A 4DFSA 3AJZA 4XDQA 2JKBA 2XBO1 4JV4A 3HWJA 1UF2C 2ZMNA 4HPKA 4Q4W3 4K8FA 1A3KA 4X6RB 3WR0A 2DFCA 2CYFA 4K9SA 1XNBA 1N3OA 2JG8B 4M3CF 1IOAA 2IXKA 1VLNA 4IESA 4WVVA 4HL0A 1AL22 1J3QA 1H8TC 3SH4A 2NQYA 3JCIA 4IV1A 1W39A 5HXVA 1AXZA 3VBHB 2FZ1A 1O3SA 4R9AA 1QH6A 4IV1B 5GLTA 5DDJ2 3P3NA 5FRAA 2A71A 3E6BA 3R4SA 1R1A3 4K21A 5T5LA 1R1A2 1ZNPA 4Z92B 1EV12 4IV3A 3WP6A 3B3QE 3W9AA 3FE5A 4BZ4A 4Q4X1 4YFZA 1AR81 4FPGA 1W6MB 4Q4Y1 5H9RA 3VLBB 1RUC3 1ENQA 1A6CA 1DZRA 3HD8B 3VBRC 1HRI3 5I0RA 1HRI2 5HCBA 5JOXA 3ZYJB 4LBKA 2AUYA 2XBO2 4LUKA 1SLBA 4YM0A 3OBRA 1OA2A 4IV3C 1Y7BA 4TLFA 5F5QA 1MQTA 1S55A 2YXSA 3CNAA 2UYBA 4BCUA 3WG3A 4EROA 1CD3G 4YM2A 2TEPA 1MQTB 3OD4A 1O7FA 2ZZJA 5JCTA 5DUWA 1RUI3 2CGNA 1GICA 1O91A 3MPBA 1NE4A 1TQ5A 1WW6A 1RGSA 2ZGPA