1YQ5A

Prd1 vertex protein p5
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
144
structure length
144
Chain Sequence
GGVTDALSLMYSTSTGGPASIAANALTDFDLSGALTVNSVGTGLTKSAAGIQLAAGKSGLYQITMTVKNNTVTTGNYLLRVKYGSSDFVVACPASSLTAGGTISLLIYCNVLGVVSLDVLKFSLCNDGAALSNYIINITAAKIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein
molecule keywords Minor capsid protein
publication title The structure of the bacteriophage PRD1 spike sheds light on the evolution of viral capsid architecture.
pubmed doi rcsb
source organism Enterobacteria phage prd1
total genus 26
structure length 144
sequence length 144
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-02-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.670 Mainly Beta Sandwich Jelly Rolls Minor capsid protein. 1yq5A00
1YQ5A 1YQ6A 1YQ8A
chains in the Genus database with same CATH superfamily
1W0OA 2OUJA 4BQ1A 3FHIB 4TXWA 1H8TA 4QPWA 3C3VA 2CDOA 1IG3A 3ZXDA 4BISA 3BB6A 5FXWA 2YBKA 4WVMB 3RMYA 1NCRB 3MIGA 4PIZA 4F8AA 1H1AA 1XNDA 2UYBA 3DXUA 2VVFA 1WW5A 3AMQA 2DWRA 3ORJA 3TN92 1KS4A 2DVAA 2PAEA 4K6BA 4EWAA 2XVGA 2IXJA 1TNFA 4JQRA 4RN5A 5JI7A 4YGCA 2RS53 2WQZC 1VMFA 3AZYA 2ZTNA 4LOTA 5HCFA 4F3JA 5IVBA 1TME1 5F37A 1CAXA 5SV5A 4CPBA 5JSRA 1NE6A 5DAXA 3MIEA 3VZLA 4Y24A 3ITQA 3WQ0A 3LDKA 5L73A 1BBT2 5FR3A 1JOBA 3RZZA 1O8SA 1G7YA 1G9CA 3WNPA 3BTXA 1H6XA 4EJRA 1YNAA 4QKDA 5C5UA 1PGW2 3DYMA 3KV5A 2IFWA 5EJZB 1WLCA 2D6OX 2DFCA 4XBNA 3SCFA 4B3NA 4ZU7A 4M3CF 2HWE3 1CX4A 3NAPB 4IEPA 2ILMA 4PI0A 1BMV1 2J1TA 1US3A 4LO7A 1GMMA 1DYPA 1S4CA 2VVDA 3LEIA 5IWFA 1SEFA 2V5DA 4JTOA 4Y1VA 1OD3A 5FZCA 2PELA 4CXYA 2Q5TA 3OBRA 4CUGA 1HXS3 2VZ3A 4E4DX 4SBVA 1NCRC 1SLIA 2BTVC 4LUKA 4YVWB 2DYCA 1PNFA 1UAIA 2B45X 2YU2A 4WVMA 5A7WB 1NCRA 1CVNA 1AYN2 1FI2A 3VN4A 3GALA 2JXAA 1MPXA 5BUVA 3H9AA 4WV8A 4YFWA 4GJYA 4AHZA 3HQXA 5FO8B 5KXEA 1CAVB 5C71A 1QGLA 4URTA 1AR83 2Q8DA 5L9VA 5JSPA 1OOPB 4XDOA 1DQ0A 4NN0A 2PA7A 1SBDA 1Q8PA 1X7NA 2A1XA 2WN2A 4I3GA 4JHTA 5ANNA 1DZQA 1JN2P 2D3RA 2ZZJA 1GZCA 3OBTA 3PL0A 3PTRB 2BNOA 2ES3A 5FZ3A 4K8RB 1JYXA 2R30A 2XBO1 1WGPA 4Q5OA 1JZ4A 1AUYA 4NPMA 3AB0A 4A44A 1QOTA 1H2KA 5FUIA 2W0XA 5CKQA 1AX2A 3SXWA 4CP9B 3AFKA 1FOD2 3J4UH 2FDKA 2KA3A 3NAPC 1AJOA 1WW7A 4HSLA 1LHNA 3KQ4B 4ES9A 1PHMA 5J7MA 1IQAA 1B35B 3VBRB 3CZUA 4CCDA 2QTWB 2WNUA 2D7FA 1V0AA 1Y9GA 3SITA 4MGQA 2BYVE 4LBQB 2BPA2 3POFA 4ISQA 4G4FA 5C6CA 4PJYA 4YVWC 2GC1A 1PO13 4N9IA 4AFBA 1QJX3 3B3QE 4D7SA 4K9SA 1IOAA 2GNDA 4YVWA 2QQWA 2Z2SB 2WZR2 2AUYA 1UOBA 1O5UA 4IV1B 5DDJ3 3IPVB 1URXA 3T08A 1POV3 5JI9A 3J7HA 4G9SB 4AWDA 1KRIA 1JODA 4QMAA 1OOPC 4LHNA 5F3IA 4FP2A 3THPA 4AI0A 1TMF3 2BOJA 3MIFA 3NKGA 5T5LA 2C6SA 3PVOA 3I3MA 4Y3OA 1EV13 5JXIA 5EWSA 3CJXA 5J09A 4J6GA 2OPWA 1SLCA 3WCRA 1POQA 3TNQA 1G9BA 4FTEA 5L9BA 5FZ1A 3NNLA 4Q1RA 4CPBD 1QJU1 4P9GA 1UXZA 3AZZA 1XYOA 4A7ZA 4CP9A 1DGWX 1G8WA 5LA2A 4Z92B 1PIV3 3ZVXA 1QH7A 3GHMA 3VBRC 1B35C 1D2SA 4LKDA 4QHBA 1HQNA 3KWVA 1ZRIA 2DU0A 4C90A 3VBRA 1B35A 2AR6A 4QXKA 1JS9A 3N7MA 1GNYA 1UY2A 2KXLA 1ACCA 1R091 5JXHA 4DRRA 3WF4A 4E8DA 1NOVA 1SFPA 1PNGA 4IV1C 2WA4A 1GNHA 2IXCA 2LW8A 3PUIA 2VW0A 1H9PA 5FPAA 3RS6A 3FE5A 4IV1A 3H7YA 3KD4A 3IPVA 1KS5A 3WVJA 3M8LA 2IZWA 4FFHA 4AFAA 1DBNA 3HT1A 4X6QB 4OZOA 1ULFA 3N7LA 5IT6A 4RS5A 3POGA 3AM2A 3NSTA 1W2OA 3FHAA 3B9IA 3NMBA 1D7PM 1W6NA 5LBCA 1BK1A 2RG4A 3DN7A 4CEYA 1VB2A 4ZZ8A 3Q8FA 2ZHNA 3AKPA 1V6MA 2IXKA 2YC0A 2ARXA 4XQWA 1ENRA 3LQCA 3LIGA 3WEZA 4QHZA 4AHXA 5BNPA 3O1SA 5F32A 5FZAA 4AG4A 2BV4A 3E97A 4IE7A 1XNCA 4MH0E 1ZBE3 1UY3A 2R073 3AVRA 4UWDA 3R4UA 3SKJE 2WNVB 1AL0G 1WCKA 3V64A 3OGSA 1AX1A 2JD4A 3NO8A 4ZXKA 3U78A 3CO2A 3LFIA 2J1SA 5KXDA 1UU4A 4EN9B 1DQ5A 1MEC3 3ZFGC 4EV0A 4JKLA 1F35A 3HAGA 4W65A 4BOWA 1OVPA 3ZFGA 4CCEA 3ETPA 1YUDA 4DS0A 4K21A 4MXWB 1VRH3 1WLTA 3IAQA 4JX0A 1Q43A 3VDDA 4YZ3A 3WNMA 3OGVA 1HXS2 2G9GA 3UJQA 1W90A 5A6ZA 3E6CC 1ZREA 2IXIA 4HSJA 1CX1A 2DFBA 1OD5A 2JKXA 2TUNA 3M4FA 3U1XA 5FAXA 3SEPA 1LEDA 4ZU5A 1JYWA 3M2MA 4BB3A 5LASA 5A7PA 5A3NA 1Y3TA 3WHUA 2VTFA 3ZXFA 3GCXA 3I2KA 2N7GA 2BJSA 4Q4Y1 2JD9A 2GNMA 2WIIB 5C5TA 2J1UA 2HWF2 4ATEA 1NXD1 2QQLA 1KEXA 2XHNA 1GP4A 5FY8A 3NNJA 3NWKA 5A7SA 5FYUA 3AVSA 1KGYA 1CN1A 2WSVA 1UCXA 4RHV1 1DCSA 1PO23 2VZRA 1BZWA 3OUIA 2LS6A 4AVBA 4CA9A 2WA3A 1EUUA 2JEMA 5GZEA 3S7EA 1VBC2 4JZRA 2WNVC 3LE0A 3KV6A 5SV8A 4I30A 4JGZB 2B7YA 4I0BA 2ZS6B 1A8DA 2WNEA 4YGEA 2WNVA 2ZX1A 3ILRA 2VBBA 4P9IA 5FYMA 4ASLA 4K1ZA 3BKZA 5F5IA 2VUAA 3RRDA 4XVHA 3BPSA 2GNBA 3AKSA 1C8M3 3KV9A 2Q1MA 1W3XA 4XUNA 3S30A 3VBOA 3MW2A 5HV0A 4BXFA 2VCBA 5D8AB 5A1LA 1X82A 2VC9A 1ZBA1 2PAKA 2RMU1 1MS1A 3INAA 1C1FA 4A2UA 4MXWA 3K48A 2F17A 1AHSA 3IDCB 3FUOA 3P3NA 4ORFA 5T55A 3ZN6B 3M3EA 4AQTA 3PVBB 2WT0A 4XCAA 3U4SA 4DNYA 4C1WA 3D6EA 2CHHA 1CD3G 2ZMNA 3KCXA 1BK0A 4M01A 1XPWA 2ZHMA 2E7AA 2VMIA 3K75B 4CUAA 4Q0QA 2W95A 1HN1A 3WF1A 3ZSKA 3CIHA 5JXJA 2B5HA 1W0PA 1O8PA 2VQ0A 3ZFEB 4COWA 2VOKA 4UFMA 4A3ZA 2WNOA 3RI8A 5KHIA 1AL21 4YFZA 4HT1T 2DUOA 2BGCA 2BERA 2ZOEB 2GMPA 1EV12 1FAYA 2YB7A 1VRBA 3VL8A 3SCHA 2WS92 4B1LA 5B2GB 5GLZA 4LO6B 1AR91 3JD72 5HXVA 4JGZC 2FMDA 2OX0A 1N47A 3G7DA 2P17A 3DPRB 3EQEA 2ATFA 4JGZA 4ZU4A 4BQ3A 5F9TA 3TEYA 1PGL1 1CGPA 3AL6A 1ZZBA 1BHGA 3N9PA 4XHXA 4C0HA 2BQPA 1W28A 3J7LA 4LPLA 4CUBA 3VHRA 4HN1A 2WO1A 4DPNA 2AH2A 2MEV1 5D8AC 1WD3A 4DINB 1W8ZA 4LJHA 5FLJA 5TSWA 1LECA 4DXTA 5A70A 1MS9A 5CBLA 5A6XA 4IGOA 4EROA 3AMNA 5FCCA 5GLVA 3MF9A 4PIXA 1NZCA 1VAVA 3MIBA 4NMIA 4XACA 4XDPA 4Y1UA 5FKCA 2D6MA 1DDLA 3SEEA 1H4GA 1R1ZA 2EVXA 2RS12 3DYOA 4JV4A 3HOBA 4XDQA 2HEVF 2OZ6A 2DBNA 2ZGRA 2EAAA 1FNYA 1L7LA 4Y5TA 3S7IA 2XONA 2R063 4Z07A 1IPSA 3ZFEC 3SH5A 4P02B 4IDZA 1AYM2 4KG8A 4R9CA 4RGGA 5FY0A 4N43B 1LGCA 4QGLA 2FMYA 1REDA 4IGQA 5H9QA 3ZFEA 4B4RA 5I0RA 1XNBA 4GALA 1OFSA 2W1UA 3VD7A 2OZJA 4N8MA 4QDQA 4QWNA 1PZ8A 1UN1A 1QH6A 3T2QA 3VHOA 3ES4A 4LO5B 1ZX5A 1EYBA 1CPNA 1RUF1 1RYYA 5DABA 5L7OB 1E5IA 4AEKA 1NY71 2NM1A 4NJ4A 4PHZA 2VE1A 4U36A 4XAEA 3HIFA 4BPZA 1IPJA 2GC0A 2NZ9A 2ZACA 3DPRC 4FPGA 1EP0A 1TG7A 5LRSA 1XNTA 1WZXA 2GNTA 2EIEA 3TOJA 1R1A1 3PJQA 5A7OA 2HWB1 3U37A 3P5BA 2Y60A 4MSVA 1WA4A 3WY6A 4D94A 4EYUA 1UWWA 2ZX0A 3FUQA 3IBMA 3ZOIA 1W8HA 5K4LA 5AC91 2XJUA 1N3PA 1Q3EA 3B93A 2E51A 1UZYA 3H8RA 4YVSA 1GANA 4AXOA 3I4IA 4AVCA 5LEJA 5FLHA 2G4IA 3WD5A 3S0MA 4N7UA 1NQDA 1W03A 3I97A 1W05A 1ENSA 3A7QA 3X29B 2F4PA 3TNPB 1RMU1 3MI8A 1CZSA 1LOBA 1QOOA 1YHFA 2DDUA 4INDA 4EQVA 2IUWA 3VD4A 3URFA 4N43C 1DQ1A 4IXLA 5BY5A 1O5LA 1EAH3 5FMCA 1UIKA 3W21A 3WUCA 5T3NA 4N43A 1GP5A 4TSVA 1QQP2 1S1AA 4W6YA 2A70A 2X53S 2HLEA 1MQTB 4CZSA 2A6WA 4DY3A 2CY6A 5L7OC 1W6OA 1H9WA 2WKKA 3SH3A 5E8AA 1SQ4A 5L7OA 5EJ1B 4I0WB 4S2HA 2VCCA 2WZPP 5C33A 1DYKA 1F4AA 2NLRA 3ASIA 1SLLA 3WOGA 2JKBA 5FKBA 5FUPA 3JBG3 1O4YA 3RZMA 4LA3A 2JIGA 3IAPA 4CDUB 1GQHA 1VBD2 3Q9OA 1GWLA 2KD7A 4XMAA 2Y6FA 5IAVA 4C91A 2OVUA 4RYDA 1LGBA 3KT4A 4FI9A 1S55A 4XUPA 2VMEA 4A6SA 1KD7A 4LQRA 2ARBA 4BHPA 3USUB 5I0TA 2BUKA 2XWBB 1DF0A 4P9WA 1EY2A 2XBO2 3N35A 3PNAA 1KDMA 1JYVA 3PIJA 4UYBA 5J48A 1FT9A 4HN0A 1VJ2A 4BM8A 3WSOA 5LK7B 3M3QA 5FPVA 1KFUL 1V6KA 2A3YA 4NIDA 4FXGB 4YG6A 4WZCA 2DCKA 1HDKA 1YEWA 4W6WA 4MHUA 1JMUB 4UFJA 1IZ3A 1QXPA 1GOFA 3MFCA 3ZPYA 5BNNB 5LZ6A 2WINB 2B8MA 1RUH1 4LITA 3IMMA 4BQXA 1MQTC 1VAKA 4NOTA 2VNGA 4YM0A 4QKBA 4DO0A 3VZMA 4FCAA 3GBWA 5F3EA 3B5LB 2FCVA 2E9QA 3I3EA 1Q8SA 5LA1A 4FPOB 1J1TA 2E31A 1GBGA 4LKSA 1V6IA 1HRI2 5JIAA 5GLTA 2FQPA 2VNOA 1I3HA 4WZFA 4CDUC 2DUPA 2QQOA 4N7IA 5A3PA 1GR3A 4UFIA 5T5JA 3TN93 3ZO0B 2JG8A 4RQPA 4GULA 4CDUA 2RE9A 4JDOA 5EJ3A 5GJ6A 1K5MB 3V0AA 4JRAA 1F2NA 2YG0A 5FZ8A 1XNAA 1LOEA 1XQNA 2Q4SA 5KHJA 2W52A 5DAVA 4Z1VA 1ZRDA 2WZEA 3U4XA 3MPPG 1P8JA 3V56A 2WUHA 2VUCA 3USUA 1OQEA 4C1XA 4ARXA 4UFHA 4ZPIA 5FZ9A 4HZFA 3DCQA 4NE9A 4XE9A 1BBT3 1RVF1 3ACHA 4HVRA 3HVDA 1M06G 1N1YA 2O1QA 2P34A 4GKYA 4M4RA 4WVVA 2R0HA 3WP4A 4FVVA 1RUC2 3GCWA 1DQ2A 2Y0OA 1YFUA 1KFXL 5BV6A 4FBFA 5BNOB 3Q8EA 2WT2A 4AW7A 5LW9A 3MW3A 4R9DA 3ZYRA 1OLQA 1JUIA 3LGRA 1ASJ1 4GWNA 3BCWA 5LY1A 5FZ4A 4E8CA 1QJFA 3NVCA 1E5RA 1S2EA 2R49A 5FZFA 3NNGA 2EIDA 4NRMA 3VLBB 3AYDA 1DQ6A 1SBFA 4CCJA 4R4ZA 2PXJA 4KI5M 4KL1A 3U75A 5EZWA 2EXKA 1HX6A 1U12A 3ACFA 3K3NA 3DF0A 2ZKNA 5CIRA 2QQMA 4GXLA 5GKAC 5CAZA 4OYUA 1TEIA 4DFSA 2G9FA 2Q30A 4DEVA 2BW8A 2BVBA 1AR73 3I2JA 3LDRA 2SBAA 1AYN3 3H42B 4M4PA 1LOAA 4NPLA 4S2FA 3UT0A 2L9LA 5IVEA 2ZZQA 4K20A 1ND3B 3S5QA 4OULA 5LK5A 1JXNA 4XBQA 2J1RA 3ECQA 4Y26A 1LAJA 2PMWB 3UNPA 1AR81 4XUTA 3UJOA 1UMZA 2XJVA 3GGLA 3PVEA 1XXNA 2ZGKA 1KXGA 2ZEXA 4PLOA 1WWYA 2A3XA 1RL3A 4EWEA 3N7KA 3ZXAC 3NW4A 4MGIE 4GB32 4MHRA 4QQ2A 2JICA 4ZS3A 3JXSA 2WO3A 4B8EA 3HNYM 1HW5A 2ZGMA 3NV2A 1HQWA 3SNMA 1ENXA 1SACA 3ACGA 4IE6A 4L8QA 1JYCA 4UF0B 3U07A 5BNOC 3MPBA 4HBNA 5DPNA 3BTZA 1RC6A 3WNKA 2Q0AA 3ZFFB 1FX5A 1AR62 5EV7A 5BNOA 1JZ8A 2RR12 1DGWA 3AFGA 1RITA 5CA6A 3KQRA 1N3QA 3PURA 4FT8A 2P1BA 2AC1A 5I91A 1X33A 5FYHA 4D6QA 1S2BA 1W8WA 1L7QA 2E33A 3MDPA 3O12A 2YMZA 3OPTA 3GBGA 3POIA 1ULDA 2W47A 3GZEA 4LOSA 4DUVA 4KGQA 1NKGA 1UNBA 2J1EA 2Q8OA 1PO11 3VZJA 2HWD2 1VBE1 3NV4A 1ALYA 1UQXA 2BGPA 4Q4Y2 3N4MA 1OQ1A 1CAWB 1R081 2WZR3 3ZSJA 1ZZCA 4C0BA 5DDJ1 1ND3C 3ZYJB 2QE3A 5FP9A 2TBVA 2BDRA 3GXUA 2UYAA 1LJ7A 4Q8LA 1HJGA 5FYVA 1ND3A 3CEWA 1S0CA 3KB5A 1ULCA 2X5IA 2ZGPA 5FZLA 1ZA7A 3I2FA 5JR7B 4OVEA 2W3JA 4AVTA 2GU9A 4M3CE 3QOPA 3VZNA 3ZR5A 2V4AA 3TRSB 1G9DA 5FOBB 4FPYA 4BDVB 2X05A 1D4M3 1W9YA 3I3BA 4FO9A 2OXBA 5FY9A 2XL9A 4OMDA 4DMIA 4OHYA 2DF7A 3UV9A 1W6MB 4DRVA 3S57A 3KLSA 2VTXJ 5F2WA 2AGSA 2YGMA 1AXKA 4GQ7A 3FL7A 4UF0A 3IDBB 3BIEA 1PK6B 2EALA 3AYAA 4LORA 1NCQB 1ZBA2 4Q4X1 4BXSV 4L92A 3AYEA 2ZAAA 1HB3A 1IS5A 4UAPA 2DURA 5AFBA 4KU8A 5LATA 5FPXA 4OZXA 3E1F1 3RQ0A 3E5UA 5FY7A 3LKJA 1W3VA 1IG0A 2JIJA 4KH9A 4XFCA 5GM0A 5C3OA 2WN3A 5T5PA 4XC9A 2BRTA 4XURA 2VZQA 5F1RA 2JB4A 1Y4WA 1OXCA 3HWJA 3MUZ1 2D3PA 1UMHA 2DU1A 2JDMA 3RG0A 5C7GA 2ZHLA 1CIYA 1LOFC 1VAMA 4JKMA 1YI9A 2ID4A 2XLAA 1AJKA 4D3WA 3I59A 5FK7A 4YW3A 3ZLIA 5HI0A 3N9NA 1XE7A 2WYSA 3WW2A 1W04A 1QMJA 3VB9A 1PGL2 2A6YA 1W6MA 2WZ8A 4HKLA 5FPLA 1IHMA 2BEOA 4GKXA 4QKFA 4DUWA 3LOBA 2CSGA 4AVSA 3M70A 2VJXA 1JU3A 4I02A 3ACLA 3RYPA 1PK6C 2WT1A 3KVAA 5FJHA 3L9JT 3SQOA 1NCQC 1RXGA 2ZABA 4HPKA 2I45A 4GAZA 3ACIA 2XXZA 5E88A 1PK6A 4I3PA 1HQLA 1QJY1 4YM2A 1STMA 5ERLA 4AEMA 4MGTA 3OYWA 3OCPA 4A6OA 4P14A 3ZXKA 4DXSA 2VOXA 3WDXA 4QKNA 2WO2A 2AZ5A 4QXBA 1QNWA 4MGKE 4B1MA 1YJLA 1AR72 1SFNA 1W6QB 2Y6KA 3B69A 3KZ4C 4XJWA 2NQYA 4CEWB 5JUVA 2P6HA 3NQHA 1IS4A 1AVBA 1I9RA 2JG9B 2BNMA 4QPYA 2XJQA 3H0OA 1RXFA 1BEV1 1XRUA 3BOPA 1QU0A 1W8FA 2NP0A 4CCNA 4FPLA 2HWF3 3OBAA 1YXWA 3MW4A 5FY1A 4KGGA 2D6NA 3BUCA 2AYHA 3K77A 2OIIA 1WMXA 4XABA 5GALA 1NY72 1V6LA 3FLRA 3JU9A 2FZ2A 2P6CA 2ZEYA 3H1YA 3PUHA 5CYYA 4LT5A 4X8PA 2ETEA 4FXKB 4OI0A 3WW4A 4UFLA 1C28A 1COV1 1VBC3 5FQ0B 1CZVA 4FOQA 2HWB2 3A23A 1LHVA 1QXJA 1UY0A 1VBA1 1H30A 2PLV1 2VTXA 5CG9A 4WM8B 3BOWA 2XOMA 4YLZA 4IGPA 4JQTA 5C3SA 5C3RA 4K1YA 5AC92 4YW7A 5DZGA 4BMEA 3WX5A 3O1PA 1RHI1 4XCBA 2C9AA 2ZXQA 1RUD1 4AHYA 1N3OA 1CESA 3VDCA 3NAPA 4OHXA 4XMIA 3ZDSA 5A80A 5LCWL 3OGGA 5EHDA 4Y1ZA 5JR2A 2EF6A 1YYNA 3APBA 2QDNA 2VNVA 2ZGQA 3T2PA 1VP6A 4HFSA 1W0NA 3T1MA 3BI3A 4O61A 3W58A 2EAKA 3RJRA 3RWNA 4KG0A 2YC4A 3HN3A 3MV11 1H8VA 5G05L 4HK8A 4KWJA 4IEVA 3ZIWA 1DYOA 4FP3A 1V9U1 1W6QA 2JG9C 5A7WA 4P9XA 5FYSA 3MV01 5CFCB 1PZ9A 2H6CA 3C7FA 2AENA 4QAWA 3UGHA 2JG9A 3MLJA 4BQYA 3GDBA 3AP5A 4LBLA 2HYKA 2NMOA 4IETA 3ZYFA 4P5YA 4URAA 3T3YA 1CAVA 4MVTA 3IMNA 2XLGA 1OOPA 3ON7A 4TTGA 3CZJA 5JZGB 2VM9A 2Y8KA 4AHWA 3O1UA 4NRPA 1D4M2 4PBOA 4ZS2A 4I2OA 2WS93 2VOTA 3C8XA 2QKDA 1AXZA 3HD8B 2QJVA 3WF2A 4Y22B 3ZSMA 3JD73 5A1AA 1S0DA 1VBB1 3AYCA 3LSEA 1TVGA 2JDNA 4OFGA 4OUMA 4WM8C 4Y1YA 5CFDB 5FQ0A 2XPJA 4DEQA 4OCTA 3WDYA 2K0GA 4HLTA 4LLOA 1ODMA 4IL7A 2OT7A 4OHZA 5A33B 4CCMA 3J7MA 4XJZA 3RNSA 4LBQA 4XILA 4FTBA 3VKLA 4QX1A 3AJYA 4N90A 5FIXA 2BWAA 2RS13 4DXZA 1UX6A 1EPZA 1DLCA 2YZ4A 4D7YA 5CFCC 3DUIA 2WWSA 1PMJX 5IK4A 4FFFA 4YGBA 3NJVA 1RINA 2R061 3MUY1 4RFRB 5CFCA 1RUH2 1W99A 3RWKX 3Q8BA 1JI6A 4YZ5A 1AYM3 5I93A 4QX3A 5F3CA 1O4TA 3ATGA 5JZGC 4JVAA 5ACA1 3HBZA 3RPQA 5IVJA 5A6YA 1KITA 4XFAA 1NX9A 2QQKA 1F31A 5JZGA 2E7QA 1XC6A 4ZHNA 3WDUA 2UY9A 4QXCA 1W6PB 4XJ9A 5FZKA 5BYNA 4AAPA 4AI9A 3GZUC 1DLLA 1ZRFA 1H6YA 2E6VA 2ZEWA 1RUE1 3HPNA 4V2WA 2Y6LA 5CFDC 4HVQA 1CQ9A 4AEJA 3H8OA 5K0UB 3DEMA 3N3HA 2QDRA 1KJLA 1ONAA 1WW4A 5CFDA 5FPUA 1O6UA 3MFAA 5CADA 4KU7A 1C3HA 1TME3 3IM0A 4QB6A 3OTFA 3T4VA 2VMHA 4AE2A 4HXCA 3SH4A 3ZYBA 4LO8A 4BJ0A 1GZWB 2RS31 1MZ5A 4F7ZA 2VMFA 4QQHA 4LLFA 1O3QA 5L9RA 4XETA 1I5PA 4A41A 3K4AA 4Z82A 3OF1A 4TZDA 1WLWA 2Q8CA 3O0WA 4RL7A 1ULPA 1WMEA 4LIUA 5FP3A 4OQ9A 4Q4V1 1QY4A 4AFDA 1ASJ2 4UW4A 1QNYA 4E4ZA 3KF5A 1GSLA 2WFPA 2ZGSA 3ALQA 5FMOL 5LA9A 4ASKA 1WBFA 4XHBA 5A3MA 4FPCA 1D0GA 1H2LA 2WLPA 4COVA 1QQP3 4H7MA 2WRAA 5FYCA 2XG3A 1F15A 4TWTA 4O7XA 4XUQA 2EXIA 4ZKTB 4BMBA 5ABJB 4Y4YA 2VNRA 3KT7A 1RUG2 2PTMA 3ZYHA 1W6PA 2ERFA 5I8YA 2QFEA 2P3IA 5EYYA 1HRV2 1PVC1 3W5NA 2QQUA 3J8F1 3ENRA 5K0UC 1PMHX 2R6QA 4M3CB 1LGNA 2F4LA 1H0BA 1UD1A 4NWVA 5JPNB 4L99A 5K0UA 1HV0A 4HG6B 2R1DA 5J36A 1VBD3 3H3ZA 1OF3A 2WL1A 3MBWA 4HK9A 2QUOA 5IYYA 5FP8A 4JDMA 3HEIA 2D44A 2Y0IA 1Y9MA 1GZWA 4IEOA 2GMMA 3CBNA 3LDBA 4FOWA 1Z7S1 5IAXA 5JOZA 2YUEA 2JDHA 2VULA 2XBO3 1J3RA 2XJTA 5FO7B 1MS5A 5CISA 5FOJB 4NHYA 4CCKA 4GMP0 1X9PA 5M0TA 2H6BA 5I0DA 3MLLA 4XXAA 4KBBA 4QGNA 4QDRA 3SC7X 4LBQD 5JOXA 4JTNA 1UYZA 3AP7A 5CKMA 4DY5A 3HN1A 1HLCA 2PHTA 1FNZA 3WNOA 5HCBA 1ZM1A 2YGLA 4FQZA 1RIRA 2R7EB 1OVSA 3AL5A 3HNMA 3CMGA 4CU7A 5ABJC 1UZ0A 3PLQA 5I8SA 3OY8B 1EUTA 1VBE2 1C4RA 2XH6A 3WDVA 1BXHA 3OD4A 1FPN2 2VOWA 3T0AA 2JDYA 2CNAA 1K3IA 1HRI3 3ZYGA 1OPMA 2P5BA 2VZOA 4PT6A 4M3CA 4A45A 1RUJ1 3ZYPA 1CR7A 2XWJB 3FBMA 5FK8A 2WFF2 4LKFA 1HB2A 4C8DA 3A22A 3WW1A 4QU1A 1DHKB 1NAEA 1U0AA 2H0BA 2YFZA 5KC5A 3WG3A 1FMD2 1C5HA 1PX3A 3ILNA 4LE4A 2CL2A 3H7JA 5D8AA 1V6NA 2RM21 1GZTA 4WVZA 5A32B 3RZLA 3LD8A 4Q4W1 4QT6A 2XGXA 4L2NA 4XJUA 3QD6A 4GH4B 2ZGUA 3ZN6A 2PYTA 3T4HB 1BBT1 1ST8A 5LA0A 3OG2A 3GZAA 3GZTB 4XF3A 5FXZA 1C5IA 1LODA 4YZ4A 4QQOA 1RUC3 1K42A 2I74A 2J1AA 3H3UA 4Q4X2 5HBAA 3ZM8A 1UF2C 5EIYB 4EWDA 2ADEA 4KQ7A 2XJRA 3B9CA 5BXXA 4E2GA 5JOWA 2D3SA 2WDBA 3FFQA 3KCCA 2LUWA 3LAGA 2TNFA 4ASMB 4DZGA 2W08A 1HB1A 4FOVA 3N9MA 4LA2A 4LMFA 4XPVA 3DKWA 4MLOA 3F2ZA 4K40A 5H9PA 4FFGA 2ZBJA 3LWCA 1UOGA 4L97A 1CWPA 1IQDC 3OY8A 4P00B 3UL2A 1N1TA 1BVP1 2SLIA 3AMMA 3T09A 4AEDB 2YBPA 1D0HA 2D6KA 2ZCWA 3U14A 5IJRA 3N9QA 2P3KA 5C3PA 3DPRA 1QKQA 1IS6A 4Q0PA 4AL9A 4ET7A 3RDIA 2XVLA 4BZ4A 1JOPA 1TME2 1IGOA 4NVPA 4DOUA 5KXBA 4QB1A 3D3AA 1ULOA 4UW6A 1CAUB 3T2OA 2OS2A 2JB8A 1L7RA 1RUI1 1O3TA 3ZMNA 4JC1A 1O7FA 2BVVA 5A32A 4GH4C 1XJAA 3E5QA 3VUOA 4GH4A 4XFHA 3WDTA 4B4QA 5JMCA 1DGRN 2PQSA 4GB33 4PCRA 3IDEA 2HYXA 1OSGA 1WCSA 2CYFA 2FZ1A 4LK7A 3WP3A 2IVIB 5FRAA 4EZHA 1OH3A 1QJY2 2JECA 2ZGLA 3ME2A 2FHRA 1BMV2 1O3RA 1AR63 1FOD1 2RR13 2R041 1YQ2A 2GSYA 1DG6A 1ZA4A 1GOGA 1H1IA 2D93A 1DQ4A 2WJSA 4IUGA 4Q0VA 3N7JA 1N1SA 2B39A 5T5OA 1UKGA 3RYRA 5JVVA 4BLIA 4FSJA 2J42A 4E2QA 4BQ5A 4AEDC 1J83A 1J59A 2EIGA 2HWD3 3B01A 4YNIA 1BEV2 2D6LX 1ZYBA 2YPJA 4Q4Y3 4WM7B 3ZYIB 2E53A 2R0FA 3TB0A 3OPWA 1F8VA 4BCUA 5FZEA 2VVEA 3W9AA 1PX4A 1H2NA 1X8MA 4XOGA 5JAXA 3MEPA 3UYJA 4BIOA 1TNRA 1JU4A 4ZY9A 1T2XA 2ZAHA 1UIJA 4XQ4A 1BLZA 1SFYA 3PTYA 2C4XA 2XUEA 5DQ0A 4TLGA 3ZKYA 2HWC1 1DIWA 3VBSB 3A0NA 2VY0A 3ZSLA 5EP9A 1HV1A 1XYNA 1GQGA 1VBA2 2PLV2 4XJAA 4LBMA 2RV9A 3K2OA 4AGRA 5L19A 1ZZ6A 4CU6A 4YW1A 4AF9A 1UKRA 5GLUA 4ARYA 1RHI2 4IEUA 3O7OA 1DFQA 1RUD2 1FV2A 4AQSA 2ZGOA 3P6BA 3O0VA 2IXHA 4FPEA 5FP4A 1JOJA 2A73B 2DV9A 1OUXA 2X8KA 1ZBA3 2W46A 3HQRA 4GIQA 4JHZA 1MVEA 2V4VA 4K8FA 4DB5A 1NA1B 2ENRA 3JB4C 2BNNA 4P9YA 3RSJA 3WP6A 1MQTA 2D5HA 4QX0A 3M7AA 2DVDA 1SCSA 2ZGTA 3UKVA 3CJIB 5FDBA 1V9U2 1OKOA 4EE2A 3VDBA 2EIBA 2DCTA 4AI8A 4WM7C 5KXCA 1QF3A 2MHFA 2VOVA 1YIPA 1ZZ9A 1JHJA 3DGTA 4Y5SA 5DG1A 1GU3A 1MS4A 1SCRA 3EO6A 3WT3A 2X10A 4AQ6A 4I0AA 5EPAA 2RS51 4FPJA 5FY4A 1SLAA 2P4EA 1JUHA 1V00A 3HJRA 5FZIA 2VZSA 1W2NA 2YFUA 4PI2A 2JDPA 3VBSC 1UXXX 1YCIA 2PHDA 4NHLA 4AR2A 1T6BX 3F95A 4CSWA 4XFGA 4AVAA 3VBSA 2A7AA 2MPFA 1QJU2 1Q8OA 1VBB2 4QPGB 4RR3B 4BH9A 5AFEA 2FD8A 1MZFA 3VGIA 3BODA 4LBJA 1AZDA 4QB2A 1SLTA 4G3YC 5D2AA 2ZPXA 1W8TA 2Q8EA 1O4ZA 5BNNC 2K9ZA 2UWCA 4YG3A 4CDXB 3AX4A 1E5SA 2HWE1 3AJZA 5BNNA 1OURA 2CGPA 4IW3A 1C8NA 1CJDA 1NA1C 4AGGA 3MGUA 1A6CA 1G6NA 2G1MA 2LALA 5CVRA 5F6KA 4LE3A 1R092 3LFMA 4OHVA 4A3XA 4BE3A 4CCOA 1NA1A 3CQOA 3ELNA 3AXEA 3CJIC 5HV4A 1VR3A 1LR5A 4O9GA 2DCYA 1HXS1 4NIIA 2PHLA 3AZVA 4QPIB 5C8WA 3TEWA 1QDOA 4LBOA 4Y1XA 3V65A 3ZN4A 4MG2A 2W2IA 2UY8A 1NG0A 2A5ZA 2P2KA 2WR9A 3H8UA 4W50A 1K12A 4NIAA 4DIQA 5IK7A 3PMEA 3UGFA 1K5MC 3NRUA 1Z0HA 4GJZA 5ACA2 5KHKA 4OHWA 1K5MA 5DMYA 4LK6A 1CPMA 2XJSA 2DTYA 2E63A 3EYPA 2VBDA 4RR3C 4QPGC 2VD7A 2W68A 5IFPA 4NHKA 1REEA 1RUE2 2IWGB 3AMHA 1D4VB 5FWEA 1W39A 4QPGA 2VCMA 3FWEA 2WAOA 3ETQA 3ZPOA 3AP4A 3OUHA 1VBC1 4XF4A 5D21A 2HWB3 3NV3A 5LB6A 2VECA 4CDXC 2RS32 2Z42A 5AC93 4BQWA 4KNCA 1LOCA 4CDXA 1WUVA 2ZEZA 4NO4A 4PBPA 3W59A 3VKOA 4CP0A 1XNKA 1LCLA 2O14A 1J3QA 5J3UA 4BA6A 4E2SA 4YRDA 1JHNA 1K45A 1YWKA 3GNEA 3GBFA 5FBJA 1F5JA 1SZBA 5DUVA 3EB7A 4QPIC 1GQPA 3MLKA 3QLQA 4N53B 3WNNA 4Q4V2 1GZ9A 1QJX1 4QPIA 3WP5A 1GYKA 2RJ2A 5JXGA 1NT0A 5B4NA 2YXSA 5APAA 3OEBA 4GZ9A 2EXJA 1UU6A 1LU2A 1ZRCA 5DZEA 5FZGA 1W9FA 1POV1 4M0NA 3CL1A 1GUIA 3LEKA 4JCKA 4Z2AA 2ZJCA 3A21A 4QHOA 4Y33A 4CDWB 3KHCA 4RHV2 1E5HA 1H4HA 2GP5A 2Y33A 5F7UA 1TMF1 1VALA 1U5YA 4CP1A 3K4DA 5HCHA 4R52A 3V0BB 2VAUA 1VMHA 3VBUB 2FDIA 1UYXA 1EV11 1PVC2 3OGRA 5E1RA 2WWJA 3WINE 3IDAA 2WS91 3J7NA 3VZKA 1DGRA 1W8OA 5FMBA 5F5AA 1PVXA 3H1WA 2ZKLA 2QNKA 5A3WA 1OT5A 1DGLA 3ZFFC 3WR0A 1UOJA 2A6ZA 4XBLA 5FMOS 5DAQA 3HT2A 1PIV1 3ZFFA 1JYTA 2VMGA 2HBTA 1B09A 2RMU2 5FWJA 1KQRA 4XTMA 3I7DA 3MYXA 1Z7S2 1MS3A 4OI1A 4AI3A 2CAUA 1O3SA 2K46A 2VBPA 4KWLA 4XF1A 3ROUA 2D6PA 2K2SA 3QH6A 3VDAA 1GICA 1XOYA 3CDZB 3PVNA 3FJSA 3BGAA 4META 4N53C 3AZXA 4COYA 2HKXA 2ZX3A 1NLQA 4O65A 1UU5A 5FPBA 1IKPA 2RJLA 3IWZA 1YQCA 2JDKA 5IHRA 4K7JA 2JDZA 3VD5A 4B7EA 4LEJA 4N9HA 4YGDA 1BCXA 1CAWA 2WABA 3AP6A 2C0ZA 1ZNPA 5GZCA 2P37A 1AL22 4WBBA 4CDWC 5F6LB 2Z5WA 1RUH3 5F5CA 2EICA 1DZRA 2VCAA 2W92A 2KR2A 2GZWA 3Q8CA 4ITCA 3VL9A 3QBQA 4HKOA 1Q56A 3RZKA 4Y20B 3KHBA 3VBUC 5KWRA 1LOFA 2RDRA 1AR92 4LBKA 1A34A 1DP0A 2UWBA 3OGJA 3V0BA 4XQDA 1S0EA 3VBUA 3TEZA 1J58A 2KM2A 1O91A 1ND2B 1UW8A 2G9ZA 3BN6A 3H8XA 1V6OA 3O1OA 1RUJ2 1ZBE1 1JZ6A 2R071 3H50A 1IKQA 2ORXA 4L11A 3POBA 2AEZA 2MEV2 1OA2A 2GN7A 5FXVA 4BQ4A 1M4WA 2IC1A 1MEC1 4I01A 2VU9A 1S0BA 1LHUA 3AK0A 1NCQA 2RM22 3I2DA 4B7KA 3O14A 4JAAA 4Q4W2 2LM3A 1G86A 3PMSA 4R4XA 3RZJA 2XHKA 1PZ7A 1VRH1 2W5FA 3KGZA 1UY4A 1RVF3 1MS8A 1MS0A 3GYDA 4MXVA 4AFMA 4NIHA 4GMP3 4HOOA 4Q29A 2HH9A 5T52A 3K3OA 1S0IA 2BP6A 3TWIA 3MF6A 4QX2A 4D8MA 4XXPA 1UX7A 3KT1A 2WBKA 4V1PA 2BFUL 2ARCA 1ASJ3 4QGMA 3FC0A 4NHXA 3TYJA 3N9LA 3WLUA 2WNUB 1KJRA 3EBRA 4B4PA 1QEXA 3WZ1A 1RUF2 4HONA 4HVOA 5LEKA 1T6GC 3KVBA 1QQP1 4YPJA 3C7OA 2QZ2A 4Y20A 2I2SA 5FJKA 4COZA 5LWBA 1PO21 1JZ5A 2C24A 2E7TA 1ND2C 4PLMA 3WW3A 1RUG3 4OMCA 2VZPA 4XAAA 4ZXEA 1GV9A 3I2HA 3SHRA 2B9VA 1R1A2 1ND2A 3LIHA 5GZFA 3RI9A 4DQAA 4FAGA 5BNQA 1HRV3 4IE5A 4D69A 1W2AX 2C5DA 4BIFA 1XE8A 3MIDA 4XFBA 3H1MA 3I2IA 4IEZA 3WQ7A 3USSA 3ZSEA 1VBD1 3AP9A 1RUI2 3BTAA 2W1WA 4XF0A 1C8M1 1I6XA 4JDNA 5DXDA 2XB6C 4K3UA 4IEWA 2HBUA 1UY1A 2IVJA 4QU2A 4UT5A 1HIXA 1OBNA 1NLRA 3I3QA 3I8TA 3EXUA 5LRRA 1LULA 1QWRA 2W87A 2ADDA 4AQ2A 1SDDB 2DCZA 4S2DA 3THCA 1RMU2 3UKTA 4A42A 5EQUA 4QX8A 2YU1A 4E4HA 4GWIA 3O1MA 4JRLA 3LA7A 4CEWC 3QACA 4FPFA 3FLPA 4NHMA 2VW1A 2J1VA 1SBEA 2FBEA 2VZTA 3LOIA 5FFOC 4CEWA 1FYUA 5ANQA 2R042 2VXJA 4QQPA 1UMIA 1UOFA 2W39A 2JJ6A 4BYYA 1VMJA 2CU5A 2WNUC 4IE0A 1GFF2 4U2AA 1W2UA 3BIWE 4H7LA 5A7QA 3QCWA 3SMHA 3P1IA 3POSA 3T30A 4CP2A 3HR9A 4NROA 2PHRA 3CU7A 4ATFA 1PM4A 3NNFA 4GWMA 2CGNA 1NUKA 1G9FA 2AREA 1RB8G 2W94A 1X9TA 1C1LA 4RSUA 5DUWA 3CNAA 4E27A 1VBE3 5D1IA 3ZX7A 2UWAA 5AVPA 3C7GA 1LU1A 1I1EA 1R083 4V2VA 3KCYA 3FBYA 5GZDA 1FPN3 1OC1A 1Z78A 2PHUA 1HRI1 2BGOA 5EYXA 3NKTA 1JZ7A 3IN9A 3OJBA 2PHXA 2YV8A 2CWMA 2Z69A 3HMYA 4WM8A 2HEYF 4RS5B 5FP7A 2QQVA 2WFF3 2W91A 1NQJA 1YO8A 4UI9L 1W6NB 2HWC2 3JQWA 5AVAA 4CEYB 1AX0A 3D5OA 3MICA 1C57A 2B42B 4IESA 2DUQA 1FMD3 5BNPB 1W9WA 1LHWA 3POWA 3DL3A 4R9BA 3BPZA 4BWOA 1ENQA 3U0ZA 1QOSA 4Q8KA 2Y38A 5I8TA 2F6BA 3RFRA 2B46X 2QQIA 4ZONA 2GH2A 4YYOA 4LHLA 2CTVA 2C26A 5FYYA 5FBZA 3T0BA 5FZBA 1RUC1 4Q4X3 1E57A 4MYEA 3K51A 3ZFGB 3IZOA 1ZVFA 3WNLA 3IIAA 5C3QA 3VDDB 3CF6E 2FCUA 2ZX2A 4XTPA 5GLWA 5LBBA 4GD4A 1RTVA 4PF5A 2I07B 3U10A 1YLLA 5C70A 1CJPA 1U5XA 4MX3A 1TQ5A 3NJZA 2VH9A 3BVCA 4XFFA 4TN7A 1OH4A 4CDQB 4Y22A 5J37A 1GLHA 4E9KA 4Y5Z0 2YBSA 4AVVA 2OQ6A 4CE8A 4A4AA 3AXDA 1SDWA 4LTAA 4QQLA 2RS52 5F3GA 4RS5C 1UZVA 4MADA 3AC0A 1W8UA 2WC2A 3RVHA 2XVKA 1SHWB 3GHNA 4TLFA 1YFXA 4OUSA 3FHQA 4CEYC 5J1XA 1WCQA 4NAOA 4HL0A 5BNPC 3UESA 5A33A 1RVF2 4MGYE 1DU3D 1APNA 4PIYA 4UW3A 1QHDA 3BU7A 3S6PA 1BJQA 2YDEA 1RJ7A 1JZ3A 2IFRA 1NYWA 4Z2WA 2A6VA 3PUQA 4Q26A 1WW6A 5F5QA 2W1QA 3WV6A 2PN5A 3OSDA 2D40A 1W9TA 4GB31 3WQBA 3CKHA 2HWE2 5JMOA 1YQ5A 1WA6X 1LNSA 4SLIA 2XLFA 3JZVA 1QJY3 4W4ZA 3VBOB 1J84A 1Y7BA 3L2YA 1AR61 2CGOA 1EAH1 4WVWA 2RR11 2OPKA 3RJ2X 3LB9A 3VDDC 3ZN5A 4AGVA 4FOYA 3GJAA 4P9JA 4B29A 2FDFA 2J7MA 5K7PA 1S0FA 3B00A 1XYPA 1Q8QA 4J25A 2Q1ZB 3VZOA 4FPKA 5FLIA 4LR4A 2AACA 3O1RA 3JQXA 4Q2FA 3NJYA 1VPHA 2VQUA 2YC2A 4CDQC 1HB4A 2EXHA 3I3DA 3HQUA 4HANA 2JWPA 3H3LA 3ZR6A 3R6SA 1OLME 4CDQA 5FREA 1QXRA 4IERA 3WF3A 2HWD1 3KSCA 3EMRA 4Z8BA 1BEV3 1UYYA 3WXPA 3JBG1 4YW5A 1AR82 2OQ7A 3CHXA 5H9RA 1OQDA 3PDQA 4XFIA 4J1XA 3WG4A 3N36A 3RGBA 5C8CB 1SLBA 4MGSA 5T50A 5A3TA 5J98B 5A3OA 1N1VA 1BQPA 5F2SA 1Q5OA 4AOCA 3T2TA 1S2KA 1LRHA 2VMDA 1CZTA 4H14A 5LBFA 1WLDA 5A3UA 2DTWA 1XB9A 2WO7A 5CG8A 4A7YA 1WMDA 3PJYA 3B02A 4Q1PA 1SPPB 4HMZA 4ES8A 1O59A 1COV3 3N9OA 4YWAA 1YQ8A 3WG1A 2FDJA 1SMVA 1VBA3 1REFA 2PLV3 3K46A 4AAXA 5IK8A 3D4KA 1LB2A 5IVFA 3Q8AA 2PHFA 5A1FA 4L9BA 3LA3A 4XYXA 1RHI3 3VBOC 4Q27A 4O9EA 1RUD3 5DAWA 2ZGNA 2BWCA 2BZDA 3NL1A 5CKNA 4ZZ5A 2CDPA 2D98A 4YM3A 1ODNA 3PUAA 1PMIA 2GC3A 2V73A 3FX3A 5BPXA 3WG2A 3I49A 1CONA 5JWPA 4S2GA 3POYA 2ARAA 5FZ6A 4BQ2A 4YZ1A 2QQPA 1PO12 3MZHA 1QJX2 5K9YA 5A3LA 3I54A 1V70A 1I5ZA 4J1WA 4MO3M 2XUMA 2LTNA 2PAMA 5A7NA 3ES1A 3UGGA 1RGSA 1OKQA 1R082 1MACA 5ABJA 3FLTA 5DZFA 3P3PA 1V9U3 1D2QA 5DDJ2 2JX9A 3WUDA 1RUNA 1S0JA 1WBLA 3LZZA 1NXMA 4QM9A 2CV6A 3ZDVA 5HPOA 2GC2A 4LXLA 3L2HA 1JW6A 4YW2A 5F8PA 3TN91 5C8CC 4IV3B 2O0OA 1WD4A 4LUMA 1TMF2 5KBFA 5IW0A 1Q8VA 1YJKA 5C8CA 3O0XA 4Q0UA 5FY5A 3VD3A 4EN7B 4HKWA 3JCIA 3BYWA 2PHWA 2VZ1A 4UXAA 4QX5A 2Y6HA 3G6JB 5FYTA 1JBCA 3RMXA 3UETA 4P9LA 4NAMA 1XBFA 1LEMA 3OUJA 1QJU3 3R4SA 1VBB3 5CEHA 1SPPA 1HKDA 1IS3A 3OPZA 3PHMA 5DAPA 4OI2A 3PIGA 4MUVA 5JOYA 1DZTA 3ZMOA 1PIV2 1X50A 4CTEA 4EN6B 4D0QA 4YW4A 2VW2A 3LEGA 3LEMA 1PGW1 2LROA 2Y64A 3D0JA 4RFT0 5CB7A 3E5XA 1OFNA 4RGAA 4PF1A 1ZZ8A 4UFKA 5FUNA 4YSFA 2FCTA 3OBZA 2JE8A 4A7KA 2NN8A 4NPRA 1JZ2A 1PM7A 4YVSB 1UPSA 1LOGA 2D97A 2ORZA 5FTTC 4H55A 1J3PA 1R093 4CYDA 1XU2A 3ST7A 3A4UA 3EJKA 4LKEA 3RZGA 1YQ6A 2RHPA 2GAUA 2JENA 1UZZA 2YPDA 3POJA 1LENA 2QCSB 4TYSA 5A6QA 2GH8A 1VE0A 4IEXA 4OI4A 2LRPA 3IKWA 4LHSA 3WNXA 3PU3A 3M3CA 1AR71 3DKQA 1AYN1 3OD0A 4CXXA 2VL4A 1POV0 1LTEA 2VPVA 3FFZA 4IQPA 4IV3C 1SG3A 3ZXEA 4AK3A 5ACA3 4IV3A 3D8CA 1LHOA 4PLNA 5JCTA 5KR7A 3GM8A 3AKRA 1UZWA 4NR1A 3T1LA 1W6OB 3TEXA 4NIGA 4MOAA 4FTSA 1UYPA 3M1HA 5ISLA 2ZMKA 5IFTA 1AXYA 5FZHA 5I0SA 2XR4A 3GF6A 1ZBE2 4X8NA 5K8SA 1RUE3 2R072 3DXTA 4UBHA 1NE4A 5I0UA 2VGDA 2QQNA 2RDNA 4QD2A 4JGYB 3VBHB 3GJBA 2ZHKA 1MEC2 3AKQA 2C9KA 1S0GA 4OLLA 1BKZA 3AMPA 5IUQA 2RS33 3K4ZA 4YVSC 2QQJA 2ET1A 2J22A 5F39A 2W9XA 3VKFC 1VRH2 5FV3A 2B9UA 3WCSA 2O8OA 4BK5A 1Y9QA 2DVGA 1J1LA 2HJIA 5FZ0A 2NPIA 5FYBA 2YYOA 3AZWA 4E4SA 4XF9A 1LKNA 4COUA 1V6JA 2XJPA 2XQXA 4MV2A 4LHKA 3THDA 4NUBA 4Q4V3 1YFWA 5IVCA 3LSDA 4XIOA 4AEDA 2Q1FA 5HCAA 3BTYA 2C1FA 1TZOA 1F5FA 2WZR1 2W1SA 3LPFA 3OOXA 1YFYA 1QIQA 5FYZA 3FMGA 1GWKA 4XZUG 5FZDA 2XKOA 2V09A 3OB8A 2FDHA 5FXXA 2WYFA 2AEYA 3B94A 4AYUA 3S5AA 3JB8A 5G04L 1CAUA 1PO22 4RHV3 5FO9B 2GP3A 2Z4FA 4M0HA 1W8NA 1W2TA 2XKPA 3LF7A 4YZ2A 1U5ZA 5KHGA 3DYPA 3W5MA 4HETA 1OA4A 1D4M1 1COV2 1NLSA 4YW6A 1JH5A 1PVC3 2Y26A 3J8F3 2WSUA 4JGYC 3TAYA 2A6XA 2YHJA 4PQQA 3VBHC 4BLJA 2PQQA 2WLQA 3VHPA 3THTA 2VZUA 2JG8B 3C7HA 4GA9A 2BFUS 2A75A 2VMCA 4JGYA 4RQPB 5LBEA 3VBHA 1UL9A 3V0AB 3NJXA 1PGSA 3R4DB 2OYZA 1C8M2 2A71A 3D82A 4D6SA 4D6RA 1XSQA 4PDWB 2GN3A 3BALA 3BU0A 2RMU3 1G9AA 4FQ4A 2YROA 4JKKA 4W6XA 3DV8A 1Z7S3 4LULA 3M3IA 4BK4A 5FZOB 2G19A 4OQ8A 1ZRRA 4F83A 1X8EA 1ULEA 3PU8A 4CDWA 5FYIA 4W8JA 4KWUA 1FATA 4CVUA 5JDBA 1MZEA 3JUUA 2VR4A 3KS7A 4YARA 3HNBM 5B4XA 1US2A 1Y43B 2GDFA 2VXRA 3KM5A 1BVVA 2CAVA 4WM7A 4RA0A 1A3KA 2H0VA 3ZKUA 3O5SA 1R64A 2D5FA 5H9SA 5IVYA 3IT8A 1RJ8A 1AL23 3D0SA 4Q0SA 3UKNA 2D43A 4R9AA 3HBKA 1EPWA 4ONUA 5CU1A 1MR5A 5DN2A 1XE0A 2PFWA 5FZMA 2ZX4A 4FFIA 2R32A 3ZXLA 2GALA 4AFCA 1AR93 4RD7A 1VLNA 2VQAA 4XJ8A 2VO5A 1GOHA 2ZMLA 1NZIA 4MZUA 2ZA9A 3R05A 5JSOA 2JG8C 4RQPC 1FXZA 3E6DA 4IE4A 2VZVA 1HN0A 4FPHA 2O8QA 1RUJ3 1F9KA 1ZZ7A 5E89A 5L36A 2Y6JA 1TE1B 4EN8B 3U11A 5KC6A 3SCGA 3SKVA 4PDWC 5EFUA 2MEV3 2X29A 4PQ9A 2WAAA 2WWUA 4CUCA 3LA2A 1BYHA 1AF9A 4M00A 4PDWA 4H2AA 1UPIA 3ABZA 2DVBA 3MHZA 4ISRA 2RJKA 2RM23 2NYYA 4EN0A 5C4WB 3SISA 4XZPA 4Q4W3 5IATA 1H1MA 2DCJA 2Y34A 3C2UA 5FZOA 4YG0A 2IXLA 1YRZA 4LIVA 2NMNA 5FPZA 1OMIA 4GMP1 3CJIA 1WKYA 3ZIXA 2WQ8A 4LBNA 2UU8A 2R1BA 2Y6GA 2QVSB 5CNAA 1WMFA 2R062 5EXOA 3VBFB 3VD9A 2FDGA 1GNZA 2DBIA 4QXHA 3PUSA 4FAHA 3A0KA 5T54A 2BBAA 3LCPA 2JDUA 3NV1A 1MVQA 4RGKA 1QJEA 1U5IA 2BU9A 2OKXA 3AKTA 3C7EA 5IVVA 1F4HA 2HWF1 3ILFA 1CIWA 3NNMA 4XEZA 1RUF3 5HXMA 2JDAA 4UW5A 2XL7A 5C9AB 2XDVA 2V72A 4CCLA 3KV4A 3W20A 4RR3A 3KF3A 4NWWA 3DECA 1RUG1 3FN9A 3I2GA 4CRQA 1KDKA 1R1A3 3IB3A 1HRV1 4QX7A 2Z79A 4UBGA 2HEWF 1MZ6A 2VUJA 3FZ3A 5E6HA 2X5IB 3UK9A 4AZZA 2YY1A 5J96B 2P3JA 5JLVA 2E26A 4AI2A 3MO4A 5FMDA 2QZ3A 1RUI3 5C4WC 1OHFA 2E32A 4KBZA 5LY2A 3R0RA 4LO4B 3KGLA 3VV1A 5C4WA 3SLIA 1ULGA 4LNVA 1L3JA 1UO9A 3ZXJA 3I2OA 2QBXA 2A3WA 3ZXGA 1RMU3 5JPMB 1X36A 3J9SA 3VBFC 1W9SA 1VIWB 2V5YA 3VKNA 4BU2A 2RDSA 3VBFA 3LPGA 1GP6A 3J26N 4X6RB 2GMEA 3WHTA 5KHHA 1EAH2 1FOD3 2R16A 2JE7A 2R043 1OI6A 4R8HA 2JE9A 4YM1A 4QM8A 5CZKA 4CU9A 3RZHA 2BBVA 3VKMA 1JTZX 4CU8A 3M3OA 3O1TA 1OPOA 2B4KA 3T0DA 1H8TB 4Y4RA 1GKBA 1OLMA 4KWKA 5DUUA 4CCCA 5C9AC 2DVFA 2TEPA 4IEYA 4I09A 1XSRA 5C9AA 5E16A 1XU1A 4P5HA 3J8F2 3CLPA 1A78A 5DG2A 5GZGA 3KMHA 4H3WA 4QDSA 1YC61 2ET7A 3JBG2 1OLRA 2WQ4A 3JD71 3OEAA 3EHKA 4MGZE 5DUXA 1FPN1 2BOIA 5FZ7A 2X5IC 3B7MA 4IEQA 4AI1A 3WF0A 4UOJA 3WQ1A 4GWJA 1GWMA 4OUEA 4EZ4A 3VHNA 5JIUA 1CAXB 4XUOA 3POEA 1WCUA 2VUDA 3I59B 3RYKA 2WFF1 1OA3A 2HWC3 1A8MA 4D7TA 1WCDJ 3MIHA 1JYIA 4DUXA 1FMD1 2RDQA 2UURA 3O1VA 1VB4A 2OW4A 2OUHA 2XMLA 4NRQA 1IPKA 3IIIA 4L0PA 4CXWA 2P3YA 1FV3A 1W06A 4N53A 2RVAA 4DXRA 1JYNA 2OA2A 2RS11 3TBDA 1K5JA 1RUOA 2EA7A 2VQTA 4KMQA 1QJZA 1LESA 5IK5A 4HPKB 2CWSA 4P08A 1YIFA 3E6BA 1YI7A 1QDCA 3QH7A 2X09A 1OUSA 2MNGA 4XIKA 3OYWB 1AYM1 3WDWA 1H8TC 1OF4A 4XW3A 1H2MA 2XQRA 1HJFA 2VG9A
chains in the Genus database with same CATH topology
1YQ5A 1YQ6A 1YQ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YQ5 A;  1YQ6 A;  1YQ8 A; 
#chains in the Genus database with same CATH topology
 1W0O A;  2OUJ A;  4BQ1 A;  3FHI B;  4TXW A;  1H8T A;  4QPW A;  3C3V A;  2CDO A;  1IG3 A;  3ZXD A;  4BIS A;  3BB6 A;  5FXW A;  2YBK A;  4WVM B;  3RMY A;  1NCR B;  3MIG A;  4PIZ A;  4F8A A;  1H1A A;  1XND A;  2UYB A;  3DXU A;  2VVF A;  1WW5 A;  3AMQ A;  2DWR A;  3ORJ A;  3TN9 2;  1KS4 A;  2DVA A;  2PAE A;  4K6B A;  4EWA A;  2XVG A;  2IXJ A;  1TNF A;  4JQR A;  4RN5 A;  5JI7 A;  4YGC A;  2RS5 3;  2WQZ C;  1VMF A;  3AZY A;  2ZTN A;  4LOT A;  5HCF A;  4F3J A;  5IVB A;  1TME 1;  5F37 A;  1CAX A;  5SV5 A;  4CPB A;  5JSR A;  1NE6 A;  5DAX A;  3MIE A;  3VZL A;  4Y24 A;  3ITQ A;  3WQ0 A;  3LDK A;  5L73 A;  1BBT 2;  5FR3 A;  1JOB A;  3RZZ A;  1O8S A;  1G7Y A;  1G9C A;  3WNP A;  3BTX A;  1H6X A;  4EJR A;  1YNA A;  4QKD A;  5C5U A;  1PGW 2;  3DYM A;  3KV5 A;  2IFW A;  5EJZ B;  1WLC A;  2D6O X;  2DFC A;  4XBN A;  3SCF A;  4B3N A;  4ZU7 A;  4M3C F;  2HWE 3;  1CX4 A;  3NAP B;  4IEP A;  2ILM A;  4PI0 A;  1BMV 1;  2J1T A;  1US3 A;  4LO7 A;  1GMM A;  1DYP A;  1S4C A;  2VVD A;  3LEI A;  5IWF A;  1SEF A;  2V5D A;  4JTO A;  4Y1V A;  1OD3 A;  5FZC A;  2PEL A;  4CXY A;  2Q5T A;  3OBR A;  4CUG A;  1HXS 3;  2VZ3 A;  4E4D X;  4SBV A;  1NCR C;  1SLI A;  2BTV C;  4LUK A;  4YVW B;  2DYC A;  1PNF A;  1UAI A;  2B45 X;  2YU2 A;  4WVM A;  5A7W B;  1NCR A;  1CVN A;  1AYN 2;  1FI2 A;  3VN4 A;  3GAL A;  2JXA A;  1MPX A;  5BUV A;  3H9A A;  4WV8 A;  4YFW A;  4GJY A;  4AHZ A;  3HQX A;  5FO8 B;  5KXE A;  1CAV B;  5C71 A;  1QGL A;  4URT A;  1AR8 3;  2Q8D A;  5L9V A;  5JSP A;  1OOP B;  4XDO A;  1DQ0 A;  4NN0 A;  2PA7 A;  1SBD A;  1Q8P A;  1X7N A;  2A1X A;  2WN2 A;  4I3G A;  4JHT A;  5ANN A;  1DZQ A;  1JN2 P;  2D3R A;  2ZZJ A;  1GZC A;  3OBT A;  3PL0 A;  3PTR B;  2BNO A;  2ES3 A;  5FZ3 A;  4K8R B;  1JYX A;  2R30 A;  2XBO 1;  1WGP A;  4Q5O A;  1JZ4 A;  1AUY A;  4NPM A;  3AB0 A;  4A44 A;  1QOT A;  1H2K A;  5FUI A;  2W0X A;  5CKQ A;  1AX2 A;  3SXW A;  4CP9 B;  3AFK A;  1FOD 2;  3J4U H;  2FDK A;  2KA3 A;  3NAP C;  1AJO A;  1WW7 A;  4HSL A;  1LHN A;  3KQ4 B;  4ES9 A;  1PHM A;  5J7M A;  1IQA A;  1B35 B;  3VBR B;  3CZU A;  4CCD A;  2QTW B;  2WNU A;  2D7F A;  1V0A A;  1Y9G A;  3SIT A;  4MGQ A;  2BYV E;  4LBQ B;  2BPA 2;  3POF A;  4ISQ A;  4G4F A;  5C6C A;  4PJY A;  4YVW C;  2GC1 A;  1PO1 3;  4N9I A;  4AFB A;  1QJX 3;  3B3Q E;  4D7S A;  4K9S A;  1IOA A;  2GND A;  4YVW A;  2QQW A;  2Z2S B;  2WZR 2;  2AUY A;  1UOB A;  1O5U A;  4IV1 B;  5DDJ 3;  3IPV B;  1URX A;  3T08 A;  1POV 3;  5JI9 A;  3J7H A;  4G9S B;  4AWD A;  1KRI A;  1JOD A;  4QMA A;  1OOP C;  4LHN A;  5F3I A;  4FP2 A;  3THP A;  4AI0 A;  1TMF 3;  2BOJ A;  3MIF A;  3NKG A;  5T5L A;  2C6S A;  3PVO A;  3I3M A;  4Y3O A;  1EV1 3;  5JXI A;  5EWS A;  3CJX A;  5J09 A;  4J6G A;  2OPW A;  1SLC A;  3WCR A;  1POQ A;  3TNQ A;  1G9B A;  4FTE A;  5L9B A;  5FZ1 A;  3NNL A;  4Q1R A;  4CPB D;  1QJU 1;  4P9G A;  1UXZ A;  3AZZ A;  1XYO A;  4A7Z A;  4CP9 A;  1DGW X;  1G8W A;  5LA2 A;  4Z92 B;  1PIV 3;  3ZVX A;  1QH7 A;  3GHM A;  3VBR C;  1B35 C;  1D2S A;  4LKD A;  4QHB A;  1HQN A;  3KWV A;  1ZRI A;  2DU0 A;  4C90 A;  3VBR A;  1B35 A;  2AR6 A;  4QXK A;  1JS9 A;  3N7M A;  1GNY A;  1UY2 A;  2KXL A;  1ACC A;  1R09 1;  5JXH A;  4DRR A;  3WF4 A;  4E8D A;  1NOV A;  1SFP A;  1PNG A;  4IV1 C;  2WA4 A;  1GNH A;  2IXC A;  2LW8 A;  3PUI A;  2VW0 A;  1H9P A;  5FPA A;  3RS6 A;  3FE5 A;  4IV1 A;  3H7Y A;  3KD4 A;  3IPV A;  1KS5 A;  3WVJ A;  3M8L A;  2IZW A;  4FFH A;  4AFA A;  1DBN A;  3HT1 A;  4X6Q B;  4OZO A;  1ULF A;  3N7L A;  5IT6 A;  4RS5 A;  3POG A;  3AM2 A;  3NST A;  1W2O A;  3FHA A;  3B9I A;  3NMB A;  1D7P M;  1W6N A;  5LBC A;  1BK1 A;  2RG4 A;  3DN7 A;  4CEY A;  1VB2 A;  4ZZ8 A;  3Q8F A;  2ZHN A;  3AKP A;  1V6M A;  2IXK A;  2YC0 A;  2ARX A;  4XQW A;  1ENR A;  3LQC A;  3LIG A;  3WEZ A;  4QHZ A;  4AHX A;  5BNP A;  3O1S A;  5F32 A;  5FZA A;  4AG4 A;  2BV4 A;  3E97 A;  4IE7 A;  1XNC A;  4MH0 E;  1ZBE 3;  1UY3 A;  2R07 3;  3AVR A;  4UWD A;  3R4U A;  3SKJ E;  2WNV B;  1AL0 G;  1WCK A;  3V64 A;  3OGS A;  1AX1 A;  2JD4 A;  3NO8 A;  4ZXK A;  3U78 A;  3CO2 A;  3LFI A;  2J1S A;  5KXD A;  1UU4 A;  4EN9 B;  1DQ5 A;  1MEC 3;  3ZFG C;  4EV0 A;  4JKL A;  1F35 A;  3HAG A;  4W65 A;  4BOW A;  1OVP A;  3ZFG A;  4CCE A;  3ETP A;  1YUD A;  4DS0 A;  4K21 A;  4MXW B;  1VRH 3;  1WLT A;  3IAQ A;  4JX0 A;  1Q43 A;  3VDD A;  4YZ3 A;  3WNM A;  3OGV A;  1HXS 2;  2G9G A;  3UJQ A;  1W90 A;  5A6Z A;  3E6C C;  1ZRE A;  2IXI A;  4HSJ A;  1CX1 A;  2DFB A;  1OD5 A;  2JKX A;  2TUN A;  3M4F A;  3U1X A;  5FAX A;  3SEP A;  1LED A;  4ZU5 A;  1JYW A;  3M2M A;  4BB3 A;  5LAS A;  5A7P A;  5A3N A;  1Y3T A;  3WHU A;  2VTF A;  3ZXF A;  3GCX A;  3I2K A;  2N7G A;  2BJS A;  4Q4Y 1;  2JD9 A;  2GNM A;  2WII B;  5C5T A;  2J1U A;  2HWF 2;  4ATE A;  1NXD 1;  2QQL A;  1KEX A;  2XHN A;  1GP4 A;  5FY8 A;  3NNJ A;  3NWK A;  5A7S A;  5FYU A;  3AVS A;  1KGY A;  1CN1 A;  2WSV A;  1UCX A;  4RHV 1;  1DCS A;  1PO2 3;  2VZR A;  1BZW A;  3OUI A;  2LS6 A;  4AVB A;  4CA9 A;  2WA3 A;  1EUU A;  2JEM A;  5GZE A;  3S7E A;  1VBC 2;  4JZR A;  2WNV C;  3LE0 A;  3KV6 A;  5SV8 A;  4I30 A;  4JGZ B;  2B7Y A;  4I0B A;  2ZS6 B;  1A8D A;  2WNE A;  4YGE A;  2WNV A;  2ZX1 A;  3ILR A;  2VBB A;  4P9I A;  5FYM A;  4ASL A;  4K1Z A;  3BKZ A;  5F5I A;  2VUA A;  3RRD A;  4XVH A;  3BPS A;  2GNB A;  3AKS A;  1C8M 3;  3KV9 A;  2Q1M A;  1W3X A;  4XUN A;  3S30 A;  3VBO A;  3MW2 A;  5HV0 A;  4BXF A;  2VCB A;  5D8A B;  5A1L A;  1X82 A;  2VC9 A;  1ZBA 1;  2PAK A;  2RMU 1;  1MS1 A;  3INA A;  1C1F A;  4A2U A;  4MXW A;  3K48 A;  2F17 A;  1AHS A;  3IDC B;  3FUO A;  3P3N A;  4ORF A;  5T55 A;  3ZN6 B;  3M3E A;  4AQT A;  3PVB B;  2WT0 A;  4XCA A;  3U4S A;  4DNY A;  4C1W A;  3D6E A;  2CHH A;  1CD3 G;  2ZMN A;  3KCX A;  1BK0 A;  4M01 A;  1XPW A;  2ZHM A;  2E7A A;  2VMI A;  3K75 B;  4CUA A;  4Q0Q A;  2W95 A;  1HN1 A;  3WF1 A;  3ZSK A;  3CIH A;  5JXJ A;  2B5H A;  1W0P A;  1O8P A;  2VQ0 A;  3ZFE B;  4COW A;  2VOK A;  4UFM A;  4A3Z A;  2WNO A;  3RI8 A;  5KHI A;  1AL2 1;  4YFZ A;  4HT1 T;  2DUO A;  2BGC A;  2BER A;  2ZOE B;  2GMP A;  1EV1 2;  1FAY A;  2YB7 A;  1VRB A;  3VL8 A;  3SCH A;  2WS9 2;  4B1L A;  5B2G B;  5GLZ A;  4LO6 B;  1AR9 1;  3JD7 2;  5HXV A;  4JGZ C;  2FMD A;  2OX0 A;  1N47 A;  3G7D A;  2P17 A;  3DPR B;  3EQE A;  2ATF A;  4JGZ A;  4ZU4 A;  4BQ3 A;  5F9T A;  3TEY A;  1PGL 1;  1CGP A;  3AL6 A;  1ZZB A;  1BHG A;  3N9P A;  4XHX A;  4C0H A;  2BQP A;  1W28 A;  3J7L A;  4LPL A;  4CUB A;  3VHR A;  4HN1 A;  2WO1 A;  4DPN A;  2AH2 A;  2MEV 1;  5D8A C;  1WD3 A;  4DIN B;  1W8Z A;  4LJH A;  5FLJ A;  5TSW A;  1LEC A;  4DXT A;  5A70 A;  1MS9 A;  5CBL A;  5A6X A;  4IGO A;  4ERO A;  3AMN A;  5FCC A;  5GLV A;  3MF9 A;  4PIX A;  1NZC A;  1VAV A;  3MIB A;  4NMI A;  4XAC A;  4XDP A;  4Y1U A;  5FKC A;  2D6M A;  1DDL A;  3SEE A;  1H4G A;  1R1Z A;  2EVX A;  2RS1 2;  3DYO A;  4JV4 A;  3HOB A;  4XDQ A;  2HEV F;  2OZ6 A;  2DBN A;  2ZGR A;  2EAA A;  1FNY A;  1L7L A;  4Y5T A;  3S7I A;  2XON A;  2R06 3;  4Z07 A;  1IPS A;  3ZFE C;  3SH5 A;  4P02 B;  4IDZ A;  1AYM 2;  4KG8 A;  4R9C A;  4RGG A;  5FY0 A;  4N43 B;  1LGC A;  4QGL A;  2FMY A;  1RED A;  4IGQ A;  5H9Q A;  3ZFE A;  4B4R A;  5I0R A;  1XNB A;  4GAL A;  1OFS A;  2W1U A;  3VD7 A;  2OZJ A;  4N8M A;  4QDQ A;  4QWN A;  1PZ8 A;  1UN1 A;  1QH6 A;  3T2Q A;  3VHO A;  3ES4 A;  4LO5 B;  1ZX5 A;  1EYB A;  1CPN A;  1RUF 1;  1RYY A;  5DAB A;  5L7O B;  1E5I A;  4AEK A;  1NY7 1;  2NM1 A;  4NJ4 A;  4PHZ A;  2VE1 A;  4U36 A;  4XAE A;  3HIF A;  4BPZ A;  1IPJ A;  2GC0 A;  2NZ9 A;  2ZAC A;  3DPR C;  4FPG A;  1EP0 A;  1TG7 A;  5LRS A;  1XNT A;  1WZX A;  2GNT A;  2EIE A;  3TOJ A;  1R1A 1;  3PJQ A;  5A7O A;  2HWB 1;  3U37 A;  3P5B A;  2Y60 A;  4MSV A;  1WA4 A;  3WY6 A;  4D94 A;  4EYU A;  1UWW A;  2ZX0 A;  3FUQ A;  3IBM A;  3ZOI A;  1W8H A;  5K4L A;  5AC9 1;  2XJU A;  1N3P A;  1Q3E A;  3B93 A;  2E51 A;  1UZY A;  3H8R A;  4YVS A;  1GAN A;  4AXO A;  3I4I A;  4AVC A;  5LEJ A;  5FLH A;  2G4I A;  3WD5 A;  3S0M A;  4N7U A;  1NQD A;  1W03 A;  3I97 A;  1W05 A;  1ENS A;  3A7Q A;  3X29 B;  2F4P A;  3TNP B;  1RMU 1;  3MI8 A;  1CZS A;  1LOB A;  1QOO A;  1YHF A;  2DDU A;  4IND A;  4EQV A;  2IUW A;  3VD4 A;  3URF A;  4N43 C;  1DQ1 A;  4IXL A;  5BY5 A;  1O5L A;  1EAH 3;  5FMC A;  1UIK A;  3W21 A;  3WUC A;  5T3N A;  4N43 A;  1GP5 A;  4TSV A;  1QQP 2;  1S1A A;  4W6Y A;  2A70 A;  2X53 S;  2HLE A;  1MQT B;  4CZS A;  2A6W A;  4DY3 A;  2CY6 A;  5L7O C;  1W6O A;  1H9W A;  2WKK A;  3SH3 A;  5E8A A;  1SQ4 A;  5L7O A;  5EJ1 B;  4I0W B;  4S2H A;  2VCC A;  2WZP P;  5C33 A;  1DYK A;  1F4A A;  2NLR A;  3ASI A;  1SLL A;  3WOG A;  2JKB A;  5FKB A;  5FUP A;  3JBG 3;  1O4Y A;  3RZM A;  4LA3 A;  2JIG A;  3IAP A;  4CDU B;  1GQH A;  1VBD 2;  3Q9O A;  1GWL A;  2KD7 A;  4XMA A;  2Y6F A;  5IAV A;  4C91 A;  2OVU A;  4RYD A;  1LGB A;  3KT4 A;  4FI9 A;  1S55 A;  4XUP A;  2VME A;  4A6S A;  1KD7 A;  4LQR A;  2ARB A;  4BHP A;  3USU B;  5I0T A;  2BUK A;  2XWB B;  1DF0 A;  4P9W A;  1EY2 A;  2XBO 2;  3N35 A;  3PNA A;  1KDM A;  1JYV A;  3PIJ A;  4UYB A;  5J48 A;  1FT9 A;  4HN0 A;  1VJ2 A;  4BM8 A;  3WSO A;  5LK7 B;  3M3Q A;  5FPV A;  1KFU L;  1V6K A;  2A3Y A;  4NID A;  4FXG B;  4YG6 A;  4WZC A;  2DCK A;  1HDK A;  1YEW A;  4W6W A;  4MHU A;  1JMU B;  4UFJ A;  1IZ3 A;  1QXP A;  1GOF A;  3MFC A;  3ZPY A;  5BNN B;  5LZ6 A;  2WIN B;  2B8M A;  1RUH 1;  4LIT A;  3IMM A;  4BQX A;  1MQT C;  1VAK A;  4NOT A;  2VNG A;  4YM0 A;  4QKB A;  4DO0 A;  3VZM A;  4FCA A;  3GBW A;  5F3E A;  3B5L B;  2FCV A;  2E9Q A;  3I3E A;  1Q8S A;  5LA1 A;  4FPO B;  1J1T A;  2E31 A;  1GBG A;  4LKS A;  1V6I A;  1HRI 2;  5JIA A;  5GLT A;  2FQP A;  2VNO A;  1I3H A;  4WZF A;  4CDU C;  2DUP A;  2QQO A;  4N7I A;  5A3P A;  1GR3 A;  4UFI A;  5T5J A;  3TN9 3;  3ZO0 B;  2JG8 A;  4RQP A;  4GUL A;  4CDU A;  2RE9 A;  4JDO A;  5EJ3 A;  5GJ6 A;  1K5M B;  3V0A A;  4JRA A;  1F2N A;  2YG0 A;  5FZ8 A;  1XNA A;  1LOE A;  1XQN A;  2Q4S A;  5KHJ A;  2W52 A;  5DAV A;  4Z1V A;  1ZRD A;  2WZE A;  3U4X A;  3MPP G;  1P8J A;  3V56 A;  2WUH A;  2VUC A;  3USU A;  1OQE A;  4C1X A;  4ARX A;  4UFH A;  4ZPI A;  5FZ9 A;  4HZF A;  3DCQ A;  4NE9 A;  4XE9 A;  1BBT 3;  1RVF 1;  3ACH A;  4HVR A;  3HVD A;  1M06 G;  1N1Y A;  2O1Q A;  2P34 A;  4GKY A;  4M4R A;  4WVV A;  2R0H A;  3WP4 A;  4FVV A;  1RUC 2;  3GCW A;  1DQ2 A;  2Y0O A;  1YFU A;  1KFX L;  5BV6 A;  4FBF A;  5BNO B;  3Q8E A;  2WT2 A;  4AW7 A;  5LW9 A;  3MW3 A;  4R9D A;  3ZYR A;  1OLQ A;  1JUI A;  3LGR A;  1ASJ 1;  4GWN A;  3BCW A;  5LY1 A;  5FZ4 A;  4E8C A;  1QJF A;  3NVC A;  1E5R A;  1S2E A;  2R49 A;  5FZF A;  3NNG A;  2EID A;  4NRM A;  3VLB B;  3AYD A;  1DQ6 A;  1SBF A;  4CCJ A;  4R4Z A;  2PXJ A;  4KI5 M;  4KL1 A;  3U75 A;  5EZW A;  2EXK A;  1HX6 A;  1U12 A;  3ACF A;  3K3N A;  3DF0 A;  2ZKN A;  5CIR A;  2QQM A;  4GXL A;  5GKA C;  5CAZ A;  4OYU A;  1TEI A;  4DFS A;  2G9F A;  2Q30 A;  4DEV A;  2BW8 A;  2BVB A;  1AR7 3;  3I2J A;  3LDR A;  2SBA A;  1AYN 3;  3H42 B;  4M4P A;  1LOA A;  4NPL A;  4S2F A;  3UT0 A;  2L9L A;  5IVE A;  2ZZQ A;  4K20 A;  1ND3 B;  3S5Q A;  4OUL A;  5LK5 A;  1JXN A;  4XBQ A;  2J1R A;  3ECQ A;  4Y26 A;  1LAJ A;  2PMW B;  3UNP A;  1AR8 1;  4XUT A;  3UJO A;  1UMZ A;  2XJV A;  3GGL A;  3PVE A;  1XXN A;  2ZGK A;  1KXG A;  2ZEX A;  4PLO A;  1WWY A;  2A3X A;  1RL3 A;  4EWE A;  3N7K A;  3ZXA C;  3NW4 A;  4MGI E;  4GB3 2;  4MHR A;  4QQ2 A;  2JIC A;  4ZS3 A;  3JXS A;  2WO3 A;  4B8E A;  3HNY M;  1HW5 A;  2ZGM A;  3NV2 A;  1HQW A;  3SNM A;  1ENX A;  1SAC A;  3ACG A;  4IE6 A;  4L8Q A;  1JYC A;  4UF0 B;  3U07 A;  5BNO C;  3MPB A;  4HBN A;  5DPN A;  3BTZ A;  1RC6 A;  3WNK A;  2Q0A A;  3ZFF B;  1FX5 A;  1AR6 2;  5EV7 A;  5BNO A;  1JZ8 A;  2RR1 2;  1DGW A;  3AFG A;  1RIT A;  5CA6 A;  3KQR A;  1N3Q A;  3PUR A;  4FT8 A;  2P1B A;  2AC1 A;  5I91 A;  1X33 A;  5FYH A;  4D6Q A;  1S2B A;  1W8W A;  1L7Q A;  2E33 A;  3MDP A;  3O12 A;  2YMZ A;  3OPT A;  3GBG A;  3POI A;  1ULD A;  2W47 A;  3GZE A;  4LOS A;  4DUV A;  4KGQ A;  1NKG A;  1UNB A;  2J1E A;  2Q8O A;  1PO1 1;  3VZJ A;  2HWD 2;  1VBE 1;  3NV4 A;  1ALY A;  1UQX A;  2BGP A;  4Q4Y 2;  3N4M A;  1OQ1 A;  1CAW B;  1R08 1;  2WZR 3;  3ZSJ A;  1ZZC A;  4C0B A;  5DDJ 1;  1ND3 C;  3ZYJ B;  2QE3 A;  5FP9 A;  2TBV A;  2BDR A;  3GXU A;  2UYA A;  1LJ7 A;  4Q8L A;  1HJG A;  5FYV A;  1ND3 A;  3CEW A;  1S0C A;  3KB5 A;  1ULC A;  2X5I A;  2ZGP A;  5FZL A;  1ZA7 A;  3I2F A;  5JR7 B;  4OVE A;  2W3J A;  4AVT A;  2GU9 A;  4M3C E;  3QOP A;  3VZN A;  3ZR5 A;  2V4A A;  3TRS B;  1G9D A;  5FOB B;  4FPY A;  4BDV B;  2X05 A;  1D4M 3;  1W9Y A;  3I3B A;  4FO9 A;  2OXB A;  5FY9 A;  2XL9 A;  4OMD A;  4DMI A;  4OHY A;  2DF7 A;  3UV9 A;  1W6M B;  4DRV A;  3S57 A;  3KLS A;  2VTX J;  5F2W A;  2AGS A;  2YGM A;  1AXK A;  4GQ7 A;  3FL7 A;  4UF0 A;  3IDB B;  3BIE A;  1PK6 B;  2EAL A;  3AYA A;  4LOR A;  1NCQ B;  1ZBA 2;  4Q4X 1;  4BXS V;  4L92 A;  3AYE A;  2ZAA A;  1HB3 A;  1IS5 A;  4UAP A;  2DUR A;  5AFB A;  4KU8 A;  5LAT A;  5FPX A;  4OZX A;  3E1F 1;  3RQ0 A;  3E5U A;  5FY7 A;  3LKJ A;  1W3V A;  1IG0 A;  2JIJ A;  4KH9 A;  4XFC A;  5GM0 A;  5C3O A;  2WN3 A;  5T5P A;  4XC9 A;  2BRT A;  4XUR A;  2VZQ A;  5F1R A;  2JB4 A;  1Y4W A;  1OXC A;  3HWJ A;  3MUZ 1;  2D3P A;  1UMH A;  2DU1 A;  2JDM A;  3RG0 A;  5C7G A;  2ZHL A;  1CIY A;  1LOF C;  1VAM A;  4JKM A;  1YI9 A;  2ID4 A;  2XLA A;  1AJK A;  4D3W A;  3I59 A;  5FK7 A;  4YW3 A;  3ZLI A;  5HI0 A;  3N9N A;  1XE7 A;  2WYS A;  3WW2 A;  1W04 A;  1QMJ A;  3VB9 A;  1PGL 2;  2A6Y A;  1W6M A;  2WZ8 A;  4HKL A;  5FPL A;  1IHM A;  2BEO A;  4GKX A;  4QKF A;  4DUW A;  3LOB A;  2CSG A;  4AVS A;  3M70 A;  2VJX A;  1JU3 A;  4I02 A;  3ACL A;  3RYP A;  1PK6 C;  2WT1 A;  3KVA A;  5FJH A;  3L9J T;  3SQO A;  1NCQ C;  1RXG A;  2ZAB A;  4HPK A;  2I45 A;  4GAZ A;  3ACI A;  2XXZ A;  5E88 A;  1PK6 A;  4I3P A;  1HQL A;  1QJY 1;  4YM2 A;  1STM A;  5ERL A;  4AEM A;  4MGT A;  3OYW A;  3OCP A;  4A6O A;  4P14 A;  3ZXK A;  4DXS A;  2VOX A;  3WDX A;  4QKN A;  2WO2 A;  2AZ5 A;  4QXB A;  1QNW A;  4MGK E;  4B1M A;  1YJL A;  1AR7 2;  1SFN A;  1W6Q B;  2Y6K A;  3B69 A;  3KZ4 C;  4XJW A;  2NQY A;  4CEW B;  5JUV A;  2P6H A;  3NQH A;  1IS4 A;  1AVB A;  1I9R A;  2JG9 B;  2BNM A;  4QPY A;  2XJQ A;  3H0O A;  1RXF A;  1BEV 1;  1XRU A;  3BOP A;  1QU0 A;  1W8F A;  2NP0 A;  4CCN A;  4FPL A;  2HWF 3;  3OBA A;  1YXW A;  3MW4 A;  5FY1 A;  4KGG A;  2D6N A;  3BUC A;  2AYH A;  3K77 A;  2OII A;  1WMX A;  4XAB A;  5GAL A;  1NY7 2;  1V6L A;  3FLR A;  3JU9 A;  2FZ2 A;  2P6C A;  2ZEY A;  3H1Y A;  3PUH A;  5CYY A;  4LT5 A;  4X8P A;  2ETE A;  4FXK B;  4OI0 A;  3WW4 A;  4UFL A;  1C28 A;  1COV 1;  1VBC 3;  5FQ0 B;  1CZV A;  4FOQ A;  2HWB 2;  3A23 A;  1LHV A;  1QXJ A;  1UY0 A;  1VBA 1;  1H30 A;  2PLV 1;  2VTX A;  5CG9 A;  4WM8 B;  3BOW A;  2XOM A;  4YLZ A;  4IGP A;  4JQT A;  5C3S A;  5C3R A;  4K1Y A;  5AC9 2;  4YW7 A;  5DZG A;  4BME A;  3WX5 A;  3O1P A;  1RHI 1;  4XCB A;  2C9A A;  2ZXQ A;  1RUD 1;  4AHY A;  1N3O A;  1CES A;  3VDC A;  3NAP A;  4OHX A;  4XMI A;  3ZDS A;  5A80 A;  5LCW L;  3OGG A;  5EHD A;  4Y1Z A;  5JR2 A;  2EF6 A;  1YYN A;  3APB A;  2QDN A;  2VNV A;  2ZGQ A;  3T2P A;  1VP6 A;  4HFS A;  1W0N A;  3T1M A;  3BI3 A;  4O61 A;  3W58 A;  2EAK A;  3RJR A;  3RWN A;  4KG0 A;  2YC4 A;  3HN3 A;  3MV1 1;  1H8V A;  5G05 L;  4HK8 A;  4KWJ A;  4IEV A;  3ZIW A;  1DYO A;  4FP3 A;  1V9U 1;  1W6Q A;  2JG9 C;  5A7W A;  4P9X A;  5FYS A;  3MV0 1;  5CFC B;  1PZ9 A;  2H6C A;  3C7F A;  2AEN A;  4QAW A;  3UGH A;  2JG9 A;  3MLJ A;  4BQY A;  3GDB A;  3AP5 A;  4LBL A;  2HYK A;  2NMO A;  4IET A;  3ZYF A;  4P5Y A;  4URA A;  3T3Y A;  1CAV A;  4MVT A;  3IMN A;  2XLG A;  1OOP A;  3ON7 A;  4TTG A;  3CZJ A;  5JZG B;  2VM9 A;  2Y8K A;  4AHW A;  3O1U A;  4NRP A;  1D4M 2;  4PBO A;  4ZS2 A;  4I2O A;  2WS9 3;  2VOT A;  3C8X A;  2QKD A;  1AXZ A;  3HD8 B;  2QJV A;  3WF2 A;  4Y22 B;  3ZSM A;  3JD7 3;  5A1A A;  1S0D A;  1VBB 1;  3AYC A;  3LSE A;  1TVG A;  2JDN A;  4OFG A;  4OUM A;  4WM8 C;  4Y1Y A;  5CFD B;  5FQ0 A;  2XPJ A;  4DEQ A;  4OCT A;  3WDY A;  2K0G A;  4HLT A;  4LLO A;  1ODM A;  4IL7 A;  2OT7 A;  4OHZ A;  5A33 B;  4CCM A;  3J7M A;  4XJZ A;  3RNS A;  4LBQ A;  4XIL A;  4FTB A;  3VKL A;  4QX1 A;  3AJY A;  4N90 A;  5FIX A;  2BWA A;  2RS1 3;  4DXZ A;  1UX6 A;  1EPZ A;  1DLC A;  2YZ4 A;  4D7Y A;  5CFC C;  3DUI A;  2WWS A;  1PMJ X;  5IK4 A;  4FFF A;  4YGB A;  3NJV A;  1RIN A;  2R06 1;  3MUY 1;  4RFR B;  5CFC A;  1RUH 2;  1W99 A;  3RWK X;  3Q8B A;  1JI6 A;  4YZ5 A;  1AYM 3;  5I93 A;  4QX3 A;  5F3C A;  1O4T A;  3ATG A;  5JZG C;  4JVA A;  5ACA 1;  3HBZ A;  3RPQ A;  5IVJ A;  5A6Y A;  1KIT A;  4XFA A;  1NX9 A;  2QQK A;  1F31 A;  5JZG A;  2E7Q A;  1XC6 A;  4ZHN A;  3WDU A;  2UY9 A;  4QXC A;  1W6P B;  4XJ9 A;  5FZK A;  5BYN A;  4AAP A;  4AI9 A;  3GZU C;  1DLL A;  1ZRF A;  1H6Y A;  2E6V A;  2ZEW A;  1RUE 1;  3HPN A;  4V2W A;  2Y6L A;  5CFD C;  4HVQ A;  1CQ9 A;  4AEJ A;  3H8O A;  5K0U B;  3DEM A;  3N3H A;  2QDR A;  1KJL A;  1ONA A;  1WW4 A;  5CFD A;  5FPU A;  1O6U A;  3MFA A;  5CAD A;  4KU7 A;  1C3H A;  1TME 3;  3IM0 A;  4QB6 A;  3OTF A;  3T4V A;  2VMH A;  4AE2 A;  4HXC A;  3SH4 A;  3ZYB A;  4LO8 A;  4BJ0 A;  1GZW B;  2RS3 1;  1MZ5 A;  4F7Z A;  2VMF A;  4QQH A;  4LLF A;  1O3Q A;  5L9R A;  4XET A;  1I5P A;  4A41 A;  3K4A A;  4Z82 A;  3OF1 A;  4TZD A;  1WLW A;  2Q8C A;  3O0W A;  4RL7 A;  1ULP A;  1WME A;  4LIU A;  5FP3 A;  4OQ9 A;  4Q4V 1;  1QY4 A;  4AFD A;  1ASJ 2;  4UW4 A;  1QNY A;  4E4Z A;  3KF5 A;  1GSL A;  2WFP A;  2ZGS A;  3ALQ A;  5FMO L;  5LA9 A;  4ASK A;  1WBF A;  4XHB A;  5A3M A;  4FPC A;  1D0G A;  1H2L A;  2WLP A;  4COV A;  1QQP 3;  4H7M A;  2WRA A;  5FYC A;  2XG3 A;  1F15 A;  4TWT A;  4O7X A;  4XUQ A;  2EXI A;  4ZKT B;  4BMB A;  5ABJ B;  4Y4Y A;  2VNR A;  3KT7 A;  1RUG 2;  2PTM A;  3ZYH A;  1W6P A;  2ERF A;  5I8Y A;  2QFE A;  2P3I A;  5EYY A;  1HRV 2;  1PVC 1;  3W5N A;  2QQU A;  3J8F 1;  3ENR A;  5K0U C;  1PMH X;  2R6Q A;  4M3C B;  1LGN A;  2F4L A;  1H0B A;  1UD1 A;  4NWV A;  5JPN B;  4L99 A;  5K0U A;  1HV0 A;  4HG6 B;  2R1D A;  5J36 A;  1VBD 3;  3H3Z A;  1OF3 A;  2WL1 A;  3MBW A;  4HK9 A;  2QUO A;  5IYY A;  5FP8 A;  4JDM A;  3HEI A;  2D44 A;  2Y0I A;  1Y9M A;  1GZW A;  4IEO A;  2GMM A;  3CBN A;  3LDB A;  4FOW A;  1Z7S 1;  5IAX A;  5JOZ A;  2YUE A;  2JDH A;  2VUL A;  2XBO 3;  1J3R A;  2XJT A;  5FO7 B;  1MS5 A;  5CIS A;  5FOJ B;  4NHY A;  4CCK A;  4GMP 0;  1X9P A;  5M0T A;  2H6B A;  5I0D A;  3MLL A;  4XXA A;  4KBB A;  4QGN A;  4QDR A;  3SC7 X;  4LBQ D;  5JOX A;  4JTN A;  1UYZ A;  3AP7 A;  5CKM A;  4DY5 A;  3HN1 A;  1HLC A;  2PHT A;  1FNZ A;  3WNO A;  5HCB A;  1ZM1 A;  2YGL A;  4FQZ A;  1RIR A;  2R7E B;  1OVS A;  3AL5 A;  3HNM A;  3CMG A;  4CU7 A;  5ABJ C;  1UZ0 A;  3PLQ A;  5I8S A;  3OY8 B;  1EUT A;  1VBE 2;  1C4R A;  2XH6 A;  3WDV A;  1BXH A;  3OD4 A;  1FPN 2;  2VOW A;  3T0A A;  2JDY A;  2CNA A;  1K3I A;  1HRI 3;  3ZYG A;  1OPM A;  2P5B A;  2VZO A;  4PT6 A;  4M3C A;  4A45 A;  1RUJ 1;  3ZYP A;  1CR7 A;  2XWJ B;  3FBM A;  5FK8 A;  2WFF 2;  4LKF A;  1HB2 A;  4C8D A;  3A22 A;  3WW1 A;  4QU1 A;  1DHK B;  1NAE A;  1U0A A;  2H0B A;  2YFZ A;  5KC5 A;  3WG3 A;  1FMD 2;  1C5H A;  1PX3 A;  3ILN A;  4LE4 A;  2CL2 A;  3H7J A;  5D8A A;  1V6N A;  2RM2 1;  1GZT A;  4WVZ A;  5A32 B;  3RZL A;  3LD8 A;  4Q4W 1;  4QT6 A;  2XGX A;  4L2N A;  4XJU A;  3QD6 A;  4GH4 B;  2ZGU A;  3ZN6 A;  2PYT A;  3T4H B;  1BBT 1;  1ST8 A;  5LA0 A;  3OG2 A;  3GZA A;  3GZT B;  4XF3 A;  5FXZ A;  1C5I A;  1LOD A;  4YZ4 A;  4QQO A;  1RUC 3;  1K42 A;  2I74 A;  2J1A A;  3H3U A;  4Q4X 2;  5HBA A;  3ZM8 A;  1UF2 C;  5EIY B;  4EWD A;  2ADE A;  4KQ7 A;  2XJR A;  3B9C A;  5BXX A;  4E2G A;  5JOW A;  2D3S A;  2WDB A;  3FFQ A;  3KCC A;  2LUW A;  3LAG A;  2TNF A;  4ASM B;  4DZG A;  2W08 A;  1HB1 A;  4FOV A;  3N9M A;  4LA2 A;  4LMF A;  4XPV A;  3DKW A;  4MLO A;  3F2Z A;  4K40 A;  5H9P A;  4FFG A;  2ZBJ A;  3LWC A;  1UOG A;  4L97 A;  1CWP A;  1IQD C;  3OY8 A;  4P00 B;  3UL2 A;  1N1T A;  1BVP 1;  2SLI A;  3AMM A;  3T09 A;  4AED B;  2YBP A;  1D0H A;  2D6K A;  2ZCW A;  3U14 A;  5IJR A;  3N9Q A;  2P3K A;  5C3P A;  3DPR A;  1QKQ A;  1IS6 A;  4Q0P A;  4AL9 A;  4ET7 A;  3RDI A;  2XVL A;  4BZ4 A;  1JOP A;  1TME 2;  1IGO A;  4NVP A;  4DOU A;  5KXB A;  4QB1 A;  3D3A A;  1ULO A;  4UW6 A;  1CAU B;  3T2O A;  2OS2 A;  2JB8 A;  1L7R A;  1RUI 1;  1O3T A;  3ZMN A;  4JC1 A;  1O7F A;  2BVV A;  5A32 A;  4GH4 C;  1XJA A;  3E5Q A;  3VUO A;  4GH4 A;  4XFH A;  3WDT A;  4B4Q A;  5JMC A;  1DGR N;  2PQS A;  4GB3 3;  4PCR A;  3IDE A;  2HYX A;  1OSG A;  1WCS A;  2CYF A;  2FZ1 A;  4LK7 A;  3WP3 A;  2IVI B;  5FRA A;  4EZH A;  1OH3 A;  1QJY 2;  2JEC A;  2ZGL A;  3ME2 A;  2FHR A;  1BMV 2;  1O3R A;  1AR6 3;  1FOD 1;  2RR1 3;  2R04 1;  1YQ2 A;  2GSY A;  1DG6 A;  1ZA4 A;  1GOG A;  1H1I A;  2D93 A;  1DQ4 A;  2WJS A;  4IUG A;  4Q0V A;  3N7J A;  1N1S A;  2B39 A;  5T5O A;  1UKG A;  3RYR A;  5JVV A;  4BLI A;  4FSJ A;  2J42 A;  4E2Q A;  4BQ5 A;  4AED C;  1J83 A;  1J59 A;  2EIG A;  2HWD 3;  3B01 A;  4YNI A;  1BEV 2;  2D6L X;  1ZYB A;  2YPJ A;  4Q4Y 3;  4WM7 B;  3ZYI B;  2E53 A;  2R0F A;  3TB0 A;  3OPW A;  1F8V A;  4BCU A;  5FZE A;  2VVE A;  3W9A A;  1PX4 A;  1H2N A;  1X8M A;  4XOG A;  5JAX A;  3MEP A;  3UYJ A;  4BIO A;  1TNR A;  1JU4 A;  4ZY9 A;  1T2X A;  2ZAH A;  1UIJ A;  4XQ4 A;  1BLZ A;  1SFY A;  3PTY A;  2C4X A;  2XUE A;  5DQ0 A;  4TLG A;  3ZKY A;  2HWC 1;  1DIW A;  3VBS B;  3A0N A;  2VY0 A;  3ZSL A;  5EP9 A;  1HV1 A;  1XYN A;  1GQG A;  1VBA 2;  2PLV 2;  4XJA A;  4LBM A;  2RV9 A;  3K2O A;  4AGR A;  5L19 A;  1ZZ6 A;  4CU6 A;  4YW1 A;  4AF9 A;  1UKR A;  5GLU A;  4ARY A;  1RHI 2;  4IEU A;  3O7O A;  1DFQ A;  1RUD 2;  1FV2 A;  4AQS A;  2ZGO A;  3P6B A;  3O0V A;  2IXH A;  4FPE A;  5FP4 A;  1JOJ A;  2A73 B;  2DV9 A;  1OUX A;  2X8K A;  1ZBA 3;  2W46 A;  3HQR A;  4GIQ A;  4JHZ A;  1MVE A;  2V4V A;  4K8F A;  4DB5 A;  1NA1 B;  2ENR A;  3JB4 C;  2BNN A;  4P9Y A;  3RSJ A;  3WP6 A;  1MQT A;  2D5H A;  4QX0 A;  3M7A A;  2DVD A;  1SCS A;  2ZGT A;  3UKV A;  3CJI B;  5FDB A;  1V9U 2;  1OKO A;  4EE2 A;  3VDB A;  2EIB A;  2DCT A;  4AI8 A;  4WM7 C;  5KXC A;  1QF3 A;  2MHF A;  2VOV A;  1YIP A;  1ZZ9 A;  1JHJ A;  3DGT A;  4Y5S A;  5DG1 A;  1GU3 A;  1MS4 A;  1SCR A;  3EO6 A;  3WT3 A;  2X10 A;  4AQ6 A;  4I0A A;  5EPA A;  2RS5 1;  4FPJ A;  5FY4 A;  1SLA A;  2P4E A;  1JUH A;  1V00 A;  3HJR A;  5FZI A;  2VZS A;  1W2N A;  2YFU A;  4PI2 A;  2JDP A;  3VBS C;  1UXX X;  1YCI A;  2PHD A;  4NHL A;  4AR2 A;  1T6B X;  3F95 A;  4CSW A;  4XFG A;  4AVA A;  3VBS A;  2A7A A;  2MPF A;  1QJU 2;  1Q8O A;  1VBB 2;  4QPG B;  4RR3 B;  4BH9 A;  5AFE A;  2FD8 A;  1MZF A;  3VGI A;  3BOD A;  4LBJ A;  1AZD A;  4QB2 A;  1SLT A;  4G3Y C;  5D2A A;  2ZPX A;  1W8T A;  2Q8E A;  1O4Z A;  5BNN C;  2K9Z A;  2UWC A;  4YG3 A;  4CDX B;  3AX4 A;  1E5S A;  2HWE 1;  3AJZ A;  5BNN A;  1OUR A;  2CGP A;  4IW3 A;  1C8N A;  1CJD A;  1NA1 C;  4AGG A;  3MGU A;  1A6C A;  1G6N A;  2G1M A;  2LAL A;  5CVR A;  5F6K A;  4LE3 A;  1R09 2;  3LFM A;  4OHV A;  4A3X A;  4BE3 A;  4CCO A;  1NA1 A;  3CQO A;  3ELN A;  3AXE A;  3CJI C;  5HV4 A;  1VR3 A;  1LR5 A;  4O9G A;  2DCY A;  1HXS 1;  4NII A;  2PHL A;  3AZV A;  4QPI B;  5C8W A;  3TEW A;  1QDO A;  4LBO A;  4Y1X A;  3V65 A;  3ZN4 A;  4MG2 A;  2W2I A;  2UY8 A;  1NG0 A;  2A5Z A;  2P2K A;  2WR9 A;  3H8U A;  4W50 A;  1K12 A;  4NIA A;  4DIQ A;  5IK7 A;  3PME A;  3UGF A;  1K5M C;  3NRU A;  1Z0H A;  4GJZ A;  5ACA 2;  5KHK A;  4OHW A;  1K5M A;  5DMY A;  4LK6 A;  1CPM A;  2XJS A;  2DTY A;  2E63 A;  3EYP A;  2VBD A;  4RR3 C;  4QPG C;  2VD7 A;  2W68 A;  5IFP A;  4NHK A;  1REE A;  1RUE 2;  2IWG B;  3AMH A;  1D4V B;  5FWE A;  1W39 A;  4QPG A;  2VCM A;  3FWE A;  2WAO A;  3ETQ A;  3ZPO A;  3AP4 A;  3OUH A;  1VBC 1;  4XF4 A;  5D21 A;  2HWB 3;  3NV3 A;  5LB6 A;  2VEC A;  4CDX C;  2RS3 2;  2Z42 A;  5AC9 3;  4BQW A;  4KNC A;  1LOC A;  4CDX A;  1WUV A;  2ZEZ A;  4NO4 A;  4PBP A;  3W59 A;  3VKO A;  4CP0 A;  1XNK A;  1LCL A;  2O14 A;  1J3Q A;  5J3U A;  4BA6 A;  4E2S A;  4YRD A;  1JHN A;  1K45 A;  1YWK A;  3GNE A;  3GBF A;  5FBJ A;  1F5J A;  1SZB A;  5DUV A;  3EB7 A;  4QPI C;  1GQP A;  3MLK A;  3QLQ A;  4N53 B;  3WNN A;  4Q4V 2;  1GZ9 A;  1QJX 1;  4QPI A;  3WP5 A;  1GYK A;  2RJ2 A;  5JXG A;  1NT0 A;  5B4N A;  2YXS A;  5APA A;  3OEB A;  4GZ9 A;  2EXJ A;  1UU6 A;  1LU2 A;  1ZRC A;  5DZE A;  5FZG A;  1W9F A;  1POV 1;  4M0N A;  3CL1 A;  1GUI A;  3LEK A;  4JCK A;  4Z2A A;  2ZJC A;  3A21 A;  4QHO A;  4Y33 A;  4CDW B;  3KHC A;  4RHV 2;  1E5H A;  1H4H A;  2GP5 A;  2Y33 A;  5F7U A;  1TMF 1;  1VAL A;  1U5Y A;  4CP1 A;  3K4D A;  5HCH A;  4R52 A;  3V0B B;  2VAU A;  1VMH A;  3VBU B;  2FDI A;  1UYX A;  1EV1 1;  1PVC 2;  3OGR A;  5E1R A;  2WWJ A;  3WIN E;  3IDA A;  2WS9 1;  3J7N A;  3VZK A;  1DGR A;  1W8O A;  5FMB A;  5F5A A;  1PVX A;  3H1W A;  2ZKL A;  2QNK A;  5A3W A;  1OT5 A;  1DGL A;  3ZFF C;  3WR0 A;  1UOJ A;  2A6Z A;  4XBL A;  5FMO S;  5DAQ A;  3HT2 A;  1PIV 1;  3ZFF A;  1JYT A;  2VMG A;  2HBT A;  1B09 A;  2RMU 2;  5FWJ A;  1KQR A;  4XTM A;  3I7D A;  3MYX A;  1Z7S 2;  1MS3 A;  4OI1 A;  4AI3 A;  2CAU A;  1O3S A;  2K46 A;  2VBP A;  4KWL A;  4XF1 A;  3ROU A;  2D6P A;  2K2S A;  3QH6 A;  3VDA A;  1GIC A;  1XOY A;  3CDZ B;  3PVN A;  3FJS A;  3BGA A;  4MET A;  4N53 C;  3AZX A;  4COY A;  2HKX A;  2ZX3 A;  1NLQ A;  4O65 A;  1UU5 A;  5FPB A;  1IKP A;  2RJL A;  3IWZ A;  1YQC A;  2JDK A;  5IHR A;  4K7J A;  2JDZ A;  3VD5 A;  4B7E A;  4LEJ A;  4N9H A;  4YGD A;  1BCX A;  1CAW A;  2WAB A;  3AP6 A;  2C0Z A;  1ZNP A;  5GZC A;  2P37 A;  1AL2 2;  4WBB A;  4CDW C;  5F6L B;  2Z5W A;  1RUH 3;  5F5C A;  2EIC A;  1DZR A;  2VCA A;  2W92 A;  2KR2 A;  2GZW A;  3Q8C A;  4ITC A;  3VL9 A;  3QBQ A;  4HKO A;  1Q56 A;  3RZK A;  4Y20 B;  3KHB A;  3VBU C;  5KWR A;  1LOF A;  2RDR A;  1AR9 2;  4LBK A;  1A34 A;  1DP0 A;  2UWB A;  3OGJ A;  3V0B A;  4XQD A;  1S0E A;  3VBU A;  3TEZ A;  1J58 A;  2KM2 A;  1O91 A;  1ND2 B;  1UW8 A;  2G9Z A;  3BN6 A;  3H8X A;  1V6O A;  3O1O A;  1RUJ 2;  1ZBE 1;  1JZ6 A;  2R07 1;  3H50 A;  1IKQ A;  2ORX A;  4L11 A;  3POB A;  2AEZ A;  2MEV 2;  1OA2 A;  2GN7 A;  5FXV A;  4BQ4 A;  1M4W A;  2IC1 A;  1MEC 1;  4I01 A;  2VU9 A;  1S0B A;  1LHU A;  3AK0 A;  1NCQ A;  2RM2 2;  3I2D A;  4B7K A;  3O14 A;  4JAA A;  4Q4W 2;  2LM3 A;  1G86 A;  3PMS A;  4R4X A;  3RZJ A;  2XHK A;  1PZ7 A;  1VRH 1;  2W5F A;  3KGZ A;  1UY4 A;  1RVF 3;  1MS8 A;  1MS0 A;  3GYD A;  4MXV A;  4AFM A;  4NIH A;  4GMP 3;  4HOO A;  4Q29 A;  2HH9 A;  5T52 A;  3K3O A;  1S0I A;  2BP6 A;  3TWI A;  3MF6 A;  4QX2 A;  4D8M A;  4XXP A;  1UX7 A;  3KT1 A;  2WBK A;  4V1P A;  2BFU L;  2ARC A;  1ASJ 3;  4QGM A;  3FC0 A;  4NHX A;  3TYJ A;  3N9L A;  3WLU A;  2WNU B;  1KJR A;  3EBR A;  4B4P A;  1QEX A;  3WZ1 A;  1RUF 2;  4HON A;  4HVO A;  5LEK A;  1T6G C;  3KVB A;  1QQP 1;  4YPJ A;  3C7O A;  2QZ2 A;  4Y20 A;  2I2S A;  5FJK A;  4COZ A;  5LWB A;  1PO2 1;  1JZ5 A;  2C24 A;  2E7T A;  1ND2 C;  4PLM A;  3WW3 A;  1RUG 3;  4OMC A;  2VZP A;  4XAA A;  4ZXE A;  1GV9 A;  3I2H A;  3SHR A;  2B9V A;  1R1A 2;  1ND2 A;  3LIH A;  5GZF A;  3RI9 A;  4DQA A;  4FAG A;  5BNQ A;  1HRV 3;  4IE5 A;  4D69 A;  1W2A X;  2C5D A;  4BIF A;  1XE8 A;  3MID A;  4XFB A;  3H1M A;  3I2I A;  4IEZ A;  3WQ7 A;  3USS A;  3ZSE A;  1VBD 1;  3AP9 A;  1RUI 2;  3BTA A;  2W1W A;  4XF0 A;  1C8M 1;  1I6X A;  4JDN A;  5DXD A;  2XB6 C;  4K3U A;  4IEW A;  2HBU A;  1UY1 A;  2IVJ A;  4QU2 A;  4UT5 A;  1HIX A;  1OBN A;  1NLR A;  3I3Q A;  3I8T A;  3EXU A;  5LRR A;  1LUL A;  1QWR A;  2W87 A;  2ADD A;  4AQ2 A;  1SDD B;  2DCZ A;  4S2D A;  3THC A;  1RMU 2;  3UKT A;  4A42 A;  5EQU A;  4QX8 A;  2YU1 A;  4E4H A;  4GWI A;  3O1M A;  4JRL A;  3LA7 A;  4CEW C;  3QAC A;  4FPF A;  3FLP A;  4NHM A;  2VW1 A;  2J1V A;  1SBE A;  2FBE A;  2VZT A;  3LOI A;  5FFO C;  4CEW A;  1FYU A;  5ANQ A;  2R04 2;  2VXJ A;  4QQP A;  1UMI A;  1UOF A;  2W39 A;  2JJ6 A;  4BYY A;  1VMJ A;  2CU5 A;  2WNU C;  4IE0 A;  1GFF 2;  4U2A A;  1W2U A;  3BIW E;  4H7L A;  5A7Q A;  3QCW A;  3SMH A;  3P1I A;  3POS A;  3T30 A;  4CP2 A;  3HR9 A;  4NRO A;  2PHR A;  3CU7 A;  4ATF A;  1PM4 A;  3NNF A;  4GWM A;  2CGN A;  1NUK A;  1G9F A;  2ARE A;  1RB8 G;  2W94 A;  1X9T A;  1C1L A;  4RSU A;  5DUW A;  3CNA A;  4E27 A;  1VBE 3;  5D1I A;  3ZX7 A;  2UWA A;  5AVP A;  3C7G A;  1LU1 A;  1I1E A;  1R08 3;  4V2V A;  3KCY A;  3FBY A;  5GZD A;  1FPN 3;  1OC1 A;  1Z78 A;  2PHU A;  1HRI 1;  2BGO A;  5EYX A;  3NKT A;  1JZ7 A;  3IN9 A;  3OJB A;  2PHX A;  2YV8 A;  2CWM A;  2Z69 A;  3HMY A;  4WM8 A;  2HEY F;  4RS5 B;  5FP7 A;  2QQV A;  2WFF 3;  2W91 A;  1NQJ A;  1YO8 A;  4UI9 L;  1W6N B;  2HWC 2;  3JQW A;  5AVA A;  4CEY B;  1AX0 A;  3D5O A;  3MIC A;  1C57 A;  2B42 B;  4IES A;  2DUQ A;  1FMD 3;  5BNP B;  1W9W A;  1LHW A;  3POW A;  3DL3 A;  4R9B A;  3BPZ A;  4BWO A;  1ENQ A;  3U0Z A;  1QOS A;  4Q8K A;  2Y38 A;  5I8T A;  2F6B A;  3RFR A;  2B46 X;  2QQI A;  4ZON A;  2GH2 A;  4YYO A;  4LHL A;  2CTV A;  2C26 A;  5FYY A;  5FBZ A;  3T0B A;  5FZB A;  1RUC 1;  4Q4X 3;  1E57 A;  4MYE A;  3K51 A;  3ZFG B;  3IZO A;  1ZVF A;  3WNL A;  3IIA A;  5C3Q A;  3VDD B;  3CF6 E;  2FCU A;  2ZX2 A;  4XTP A;  5GLW A;  5LBB A;  4GD4 A;  1RTV A;  4PF5 A;  2I07 B;  3U10 A;  1YLL A;  5C70 A;  1CJP A;  1U5X A;  4MX3 A;  1TQ5 A;  3NJZ A;  2VH9 A;  3BVC A;  4XFF A;  4TN7 A;  1OH4 A;  4CDQ B;  4Y22 A;  5J37 A;  1GLH A;  4E9K A;  4Y5Z 0;  2YBS A;  4AVV A;  2OQ6 A;  4CE8 A;  4A4A A;  3AXD A;  1SDW A;  4LTA A;  4QQL A;  2RS5 2;  5F3G A;  4RS5 C;  1UZV A;  4MAD A;  3AC0 A;  1W8U A;  2WC2 A;  3RVH A;  2XVK A;  1SHW B;  3GHN A;  4TLF A;  1YFX A;  4OUS A;  3FHQ A;  4CEY C;  5J1X A;  1WCQ A;  4NAO A;  4HL0 A;  5BNP C;  3UES A;  5A33 A;  1RVF 2;  4MGY E;  1DU3 D;  1APN A;  4PIY A;  4UW3 A;  1QHD A;  3BU7 A;  3S6P A;  1BJQ A;  2YDE A;  1RJ7 A;  1JZ3 A;  2IFR A;  1NYW A;  4Z2W A;  2A6V A;  3PUQ A;  4Q26 A;  1WW6 A;  5F5Q A;  2W1Q A;  3WV6 A;  2PN5 A;  3OSD A;  2D40 A;  1W9T A;  4GB3 1;  3WQB A;  3CKH A;  2HWE 2;  5JMO A;  1YQ5 A;  1WA6 X;  1LNS A;  4SLI A;  2XLF A;  3JZV A;  1QJY 3;  4W4Z A;  3VBO B;  1J84 A;  1Y7B A;  3L2Y A;  1AR6 1;  2CGO A;  1EAH 1;  4WVW A;  2RR1 1;  2OPK A;  3RJ2 X;  3LB9 A;  3VDD C;  3ZN5 A;  4AGV A;  4FOY A;  3GJA A;  4P9J A;  4B29 A;  2FDF A;  2J7M A;  5K7P A;  1S0F A;  3B00 A;  1XYP A;  1Q8Q A;  4J25 A;  2Q1Z B;  3VZO A;  4FPK A;  5FLI A;  4LR4 A;  2AAC A;  3O1R A;  3JQX A;  4Q2F A;  3NJY A;  1VPH A;  2VQU A;  2YC2 A;  4CDQ C;  1HB4 A;  2EXH A;  3I3D A;  3HQU A;  4HAN A;  2JWP A;  3H3L A;  3ZR6 A;  3R6S A;  1OLM E;  4CDQ A;  5FRE A;  1QXR A;  4IER A;  3WF3 A;  2HWD 1;  3KSC A;  3EMR A;  4Z8B A;  1BEV 3;  1UYY A;  3WXP A;  3JBG 1;  4YW5 A;  1AR8 2;  2OQ7 A;  3CHX A;  5H9R A;  1OQD A;  3PDQ A;  4XFI A;  4J1X A;  3WG4 A;  3N36 A;  3RGB A;  5C8C B;  1SLB A;  4MGS A;  5T50 A;  5A3T A;  5J98 B;  5A3O A;  1N1V A;  1BQP A;  5F2S A;  1Q5O A;  4AOC A;  3T2T A;  1S2K A;  1LRH A;  2VMD A;  1CZT A;  4H14 A;  5LBF A;  1WLD A;  5A3U A;  2DTW A;  1XB9 A;  2WO7 A;  5CG8 A;  4A7Y A;  1WMD A;  3PJY A;  3B02 A;  4Q1P A;  1SPP B;  4HMZ A;  4ES8 A;  1O59 A;  1COV 3;  3N9O A;  4YWA A;  1YQ8 A;  3WG1 A;  2FDJ A;  1SMV A;  1VBA 3;  1REF A;  2PLV 3;  3K46 A;  4AAX A;  5IK8 A;  3D4K A;  1LB2 A;  5IVF A;  3Q8A A;  2PHF A;  5A1F A;  4L9B A;  3LA3 A;  4XYX A;  1RHI 3;  3VBO C;  4Q27 A;  4O9E A;  1RUD 3;  5DAW A;  2ZGN A;  2BWC A;  2BZD A;  3NL1 A;  5CKN A;  4ZZ5 A;  2CDP A;  2D98 A;  4YM3 A;  1ODN A;  3PUA A;  1PMI A;  2GC3 A;  2V73 A;  3FX3 A;  5BPX A;  3WG2 A;  3I49 A;  1CON A;  5JWP A;  4S2G A;  3POY A;  2ARA A;  5FZ6 A;  4BQ2 A;  4YZ1 A;  2QQP A;  1PO1 2;  3MZH A;  1QJX 2;  5K9Y A;  5A3L A;  3I54 A;  1V70 A;  1I5Z A;  4J1W A;  4MO3 M;  2XUM A;  2LTN A;  2PAM A;  5A7N A;  3ES1 A;  3UGG A;  1RGS A;  1OKQ A;  1R08 2;  1MAC A;  5ABJ A;  3FLT A;  5DZF A;  3P3P A;  1V9U 3;  1D2Q A;  5DDJ 2;  2JX9 A;  3WUD A;  1RUN A;  1S0J A;  1WBL A;  3LZZ A;  1NXM A;  4QM9 A;  2CV6 A;  3ZDV A;  5HPO A;  2GC2 A;  4LXL A;  3L2H A;  1JW6 A;  4YW2 A;  5F8P A;  3TN9 1;  5C8C C;  4IV3 B;  2O0O A;  1WD4 A;  4LUM A;  1TMF 2;  5KBF A;  5IW0 A;  1Q8V A;  1YJK A;  5C8C A;  3O0X A;  4Q0U A;  5FY5 A;  3VD3 A;  4EN7 B;  4HKW A;  3JCI A;  3BYW A;  2PHW A;  2VZ1 A;  4UXA A;  4QX5 A;  2Y6H A;  3G6J B;  5FYT A;  1JBC A;  3RMX A;  3UET A;  4P9L A;  4NAM A;  1XBF A;  1LEM A;  3OUJ A;  1QJU 3;  3R4S A;  1VBB 3;  5CEH A;  1SPP A;  1HKD A;  1IS3 A;  3OPZ A;  3PHM A;  5DAP A;  4OI2 A;  3PIG A;  4MUV A;  5JOY A;  1DZT A;  3ZMO A;  1PIV 2;  1X50 A;  4CTE A;  4EN6 B;  4D0Q A;  4YW4 A;  2VW2 A;  3LEG A;  3LEM A;  1PGW 1;  2LRO A;  2Y64 A;  3D0J A;  4RFT 0;  5CB7 A;  3E5X A;  1OFN A;  4RGA A;  4PF1 A;  1ZZ8 A;  4UFK A;  5FUN A;  4YSF A;  2FCT A;  3OBZ A;  2JE8 A;  4A7K A;  2NN8 A;  4NPR A;  1JZ2 A;  1PM7 A;  4YVS B;  1UPS A;  1LOG A;  2D97 A;  2ORZ A;  5FTT C;  4H55 A;  1J3P A;  1R09 3;  4CYD A;  1XU2 A;  3ST7 A;  3A4U A;  3EJK A;  4LKE A;  3RZG A;  1YQ6 A;  2RHP A;  2GAU A;  2JEN A;  1UZZ A;  2YPD A;  3POJ A;  1LEN A;  2QCS B;  4TYS A;  5A6Q A;  2GH8 A;  1VE0 A;  4IEX A;  4OI4 A;  2LRP A;  3IKW A;  4LHS A;  3WNX A;  3PU3 A;  3M3C A;  1AR7 1;  3DKQ A;  1AYN 1;  3OD0 A;  4CXX A;  2VL4 A;  1POV 0;  1LTE A;  2VPV A;  3FFZ A;  4IQP A;  4IV3 C;  1SG3 A;  3ZXE A;  4AK3 A;  5ACA 3;  4IV3 A;  3D8C A;  1LHO A;  4PLN A;  5JCT A;  5KR7 A;  3GM8 A;  3AKR A;  1UZW A;  4NR1 A;  3T1L A;  1W6O B;  3TEX A;  4NIG A;  4MOA A;  4FTS A;  1UYP A;  3M1H A;  5ISL A;  2ZMK A;  5IFT A;  1AXY A;  5FZH A;  5I0S A;  2XR4 A;  3GF6 A;  1ZBE 2;  4X8N A;  5K8S A;  1RUE 3;  2R07 2;  3DXT A;  4UBH A;  1NE4 A;  5I0U A;  2VGD A;  2QQN A;  2RDN A;  4QD2 A;  4JGY B;  3VBH B;  3GJB A;  2ZHK A;  1MEC 2;  3AKQ A;  2C9K A;  1S0G A;  4OLL A;  1BKZ A;  3AMP A;  5IUQ A;  2RS3 3;  3K4Z A;  4YVS C;  2QQJ A;  2ET1 A;  2J22 A;  5F39 A;  2W9X A;  3VKF C;  1VRH 2;  5FV3 A;  2B9U A;  3WCS A;  2O8O A;  4BK5 A;  1Y9Q A;  2DVG A;  1J1L A;  2HJI A;  5FZ0 A;  2NPI A;  5FYB A;  2YYO A;  3AZW A;  4E4S A;  4XF9 A;  1LKN A;  4COU A;  1V6J A;  2XJP A;  2XQX A;  4MV2 A;  4LHK A;  3THD A;  4NUB A;  4Q4V 3;  1YFW A;  5IVC A;  3LSD A;  4XIO A;  4AED A;  2Q1F A;  5HCA A;  3BTY A;  2C1F A;  1TZO A;  1F5F A;  2WZR 1;  2W1S A;  3LPF A;  3OOX A;  1YFY A;  1QIQ A;  5FYZ A;  3FMG A;  1GWK A;  4XZU G;  5FZD A;  2XKO A;  2V09 A;  3OB8 A;  2FDH A;  5FXX A;  2WYF A;  2AEY A;  3B94 A;  4AYU A;  3S5A A;  3JB8 A;  5G04 L;  1CAU A;  1PO2 2;  4RHV 3;  5FO9 B;  2GP3 A;  2Z4F A;  4M0H A;  1W8N A;  1W2T A;  2XKP A;  3LF7 A;  4YZ2 A;  1U5Z A;  5KHG A;  3DYP A;  3W5M A;  4HET A;  1OA4 A;  1D4M 1;  1COV 2;  1NLS A;  4YW6 A;  1JH5 A;  1PVC 3;  2Y26 A;  3J8F 3;  2WSU A;  4JGY C;  3TAY A;  2A6X A;  2YHJ A;  4PQQ A;  3VBH C;  4BLJ A;  2PQQ A;  2WLQ A;  3VHP A;  3THT A;  2VZU A;  2JG8 B;  3C7H A;  4GA9 A;  2BFU S;  2A75 A;  2VMC A;  4JGY A;  4RQP B;  5LBE A;  3VBH A;  1UL9 A;  3V0A B;  3NJX A;  1PGS A;  3R4D B;  2OYZ A;  1C8M 2;  2A71 A;  3D82 A;  4D6S A;  4D6R A;  1XSQ A;  4PDW B;  2GN3 A;  3BAL A;  3BU0 A;  2RMU 3;  1G9A A;  4FQ4 A;  2YRO A;  4JKK A;  4W6X A;  3DV8 A;  1Z7S 3;  4LUL A;  3M3I A;  4BK4 A;  5FZO B;  2G19 A;  4OQ8 A;  1ZRR A;  4F83 A;  1X8E A;  1ULE A;  3PU8 A;  4CDW A;  5FYI A;  4W8J A;  4KWU A;  1FAT A;  4CVU A;  5JDB A;  1MZE A;  3JUU A;  2VR4 A;  3KS7 A;  4YAR A;  3HNB M;  5B4X A;  1US2 A;  1Y43 B;  2GDF A;  2VXR A;  3KM5 A;  1BVV A;  2CAV A;  4WM7 A;  4RA0 A;  1A3K A;  2H0V A;  3ZKU A;  3O5S A;  1R64 A;  2D5F A;  5H9S A;  5IVY A;  3IT8 A;  1RJ8 A;  1AL2 3;  3D0S A;  4Q0S A;  3UKN A;  2D43 A;  4R9A A;  3HBK A;  1EPW A;  4ONU A;  5CU1 A;  1MR5 A;  5DN2 A;  1XE0 A;  2PFW A;  5FZM A;  2ZX4 A;  4FFI A;  2R32 A;  3ZXL A;  2GAL A;  4AFC A;  1AR9 3;  4RD7 A;  1VLN A;  2VQA A;  4XJ8 A;  2VO5 A;  1GOH A;  2ZML A;  1NZI A;  4MZU A;  2ZA9 A;  3R05 A;  5JSO A;  2JG8 C;  4RQP C;  1FXZ A;  3E6D A;  4IE4 A;  2VZV A;  1HN0 A;  4FPH A;  2O8Q A;  1RUJ 3;  1F9K A;  1ZZ7 A;  5E89 A;  5L36 A;  2Y6J A;  1TE1 B;  4EN8 B;  3U11 A;  5KC6 A;  3SCG A;  3SKV A;  4PDW C;  5EFU A;  2MEV 3;  2X29 A;  4PQ9 A;  2WAA A;  2WWU A;  4CUC A;  3LA2 A;  1BYH A;  1AF9 A;  4M00 A;  4PDW A;  4H2A A;  1UPI A;  3ABZ A;  2DVB A;  3MHZ A;  4ISR A;  2RJK A;  2RM2 3;  2NYY A;  4EN0 A;  5C4W B;  3SIS A;  4XZP A;  4Q4W 3;  5IAT A;  1H1M A;  2DCJ A;  2Y34 A;  3C2U A;  5FZO A;  4YG0 A;  2IXL A;  1YRZ A;  4LIV A;  2NMN A;  5FPZ A;  1OMI A;  4GMP 1;  3CJI A;  1WKY A;  3ZIX A;  2WQ8 A;  4LBN A;  2UU8 A;  2R1B A;  2Y6G A;  2QVS B;  5CNA A;  1WMF A;  2R06 2;  5EXO A;  3VBF B;  3VD9 A;  2FDG A;  1GNZ A;  2DBI A;  4QXH A;  3PUS A;  4FAH A;  3A0K A;  5T54 A;  2BBA A;  3LCP A;  2JDU A;  3NV1 A;  1MVQ A;  4RGK A;  1QJE A;  1U5I A;  2BU9 A;  2OKX A;  3AKT A;  3C7E A;  5IVV A;  1F4H A;  2HWF 1;  3ILF A;  1CIW A;  3NNM A;  4XEZ A;  1RUF 3;  5HXM A;  2JDA A;  4UW5 A;  2XL7 A;  5C9A B;  2XDV A;  2V72 A;  4CCL A;  3KV4 A;  3W20 A;  4RR3 A;  3KF3 A;  4NWW A;  3DEC A;  1RUG 1;  3FN9 A;  3I2G A;  4CRQ A;  1KDK A;  1R1A 3;  3IB3 A;  1HRV 1;  4QX7 A;  2Z79 A;  4UBG A;  2HEW F;  1MZ6 A;  2VUJ A;  3FZ3 A;  5E6H A;  2X5I B;  3UK9 A;  4AZZ A;  2YY1 A;  5J96 B;  2P3J A;  5JLV A;  2E26 A;  4AI2 A;  3MO4 A;  5FMD A;  2QZ3 A;  1RUI 3;  5C4W C;  1OHF A;  2E32 A;  4KBZ A;  5LY2 A;  3R0R A;  4LO4 B;  3KGL A;  3VV1 A;  5C4W A;  3SLI A;  1ULG A;  4LNV A;  1L3J A;  1UO9 A;  3ZXJ A;  3I2O A;  2QBX A;  2A3W A;  3ZXG A;  1RMU 3;  5JPM B;  1X36 A;  3J9S A;  3VBF C;  1W9S A;  1VIW B;  2V5Y A;  3VKN A;  4BU2 A;  2RDS A;  3VBF A;  3LPG A;  1GP6 A;  3J26 N;  4X6R B;  2GME A;  3WHT A;  5KHH A;  1EAH 2;  1FOD 3;  2R16 A;  2JE7 A;  2R04 3;  1OI6 A;  4R8H A;  2JE9 A;  4YM1 A;  4QM8 A;  5CZK A;  4CU9 A;  3RZH A;  2BBV A;  3VKM A;  1JTZ X;  4CU8 A;  3M3O A;  3O1T A;  1OPO A;  2B4K A;  3T0D A;  1H8T B;  4Y4R A;  1GKB A;  1OLM A;  4KWK A;  5DUU A;  4CCC A;  5C9A C;  2DVF A;  2TEP A;  4IEY A;  4I09 A;  1XSR A;  5C9A A;  5E16 A;  1XU1 A;  4P5H A;  3J8F 2;  3CLP A;  1A78 A;  5DG2 A;  5GZG A;  3KMH A;  4H3W A;  4QDS A;  1YC6 1;  2ET7 A;  3JBG 2;  1OLR A;  2WQ4 A;  3JD7 1;  3OEA A;  3EHK A;  4MGZ E;  5DUX A;  1FPN 1;  2BOI A;  5FZ7 A;  2X5I C;  3B7M A;  4IEQ A;  4AI1 A;  3WF0 A;  4UOJ A;  3WQ1 A;  4GWJ A;  1GWM A;  4OUE A;  4EZ4 A;  3VHN A;  5JIU A;  1CAX B;  4XUO A;  3POE A;  1WCU A;  2VUD A;  3I59 B;  3RYK A;  2WFF 1;  1OA3 A;  2HWC 3;  1A8M A;  4D7T A;  1WCD J;  3MIH A;  1JYI A;  4DUX A;  1FMD 1;  2RDQ A;  2UUR A;  3O1V A;  1VB4 A;  2OW4 A;  2OUH A;  2XML A;  4NRQ A;  1IPK A;  3III A;  4L0P A;  4CXW A;  2P3Y A;  1FV3 A;  1W06 A;  4N53 A;  2RVA A;  4DXR A;  1JYN A;  2OA2 A;  2RS1 1;  3TBD A;  1K5J A;  1RUO A;  2EA7 A;  2VQT A;  4KMQ A;  1QJZ A;  1LES A;  5IK5 A;  4HPK B;  2CWS A;  4P08 A;  1YIF A;  3E6B A;  1YI7 A;  1QDC A;  3QH7 A;  2X09 A;  1OUS A;  2MNG A;  4XIK A;  3OYW B;  1AYM 1;  3WDW A;  1H8T C;  1OF4 A;  4XW3 A;  1H2M A;  2XQR A;  1HJF A;  2VG9 A; 
#chains in the Genus database with same CATH homology
 1YQ5 A;  1YQ6 A;  1YQ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...