1YQ5A

Prd1 vertex protein p5
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
144
structure length
144
Chain Sequence
GGVTDALSLMYSTSTGGPASIAANALTDFDLSGALTVNSVGTGLTKSAAGIQLAAGKSGLYQITMTVKNNTVTTGNYLLRVKYGSSDFVVACPASSLTAGGTISLLIYCNVLGVVSLDVLKFSLCNDGAALSNYIINITAAKIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Minor capsid protein
publication title The structure of the bacteriophage PRD1 spike sheds light on the evolution of viral capsid architecture.
pubmed doi rcsb
source organism Enterobacteria phage prd1
molecule tags Viral protein
total genus 26
structure length 144
sequence length 144
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-02-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.670 Mainly Beta Sandwich Jelly Rolls Minor capsid protein. 1yq5A00
1YQ5A 1YQ6A 1YQ8A
chains in the Genus database with same CATH superfamily
1UY3A 1EPZA 2WYSA 1VRBA 3OGVA 3VBOC 4JRLA 5H9RA 1ZZ6A 4FBFA 5I8TA 1MZ6A 2P3IA 2QJVA 3KCYA 4QX5A 5FPBA 5HCAA 3VDBA 2ID4A 2D43A 4AAXA 4V2VA 2ZGPA 5JMOA 1AJOA 1UY1A 1X9PA 3BU7A 3PUQA 3VBUB 3TN91 4ZZ8A 3OCPA 2DCKA 4BOWA 2BQPA 2GN7A 2RS31 1S2BA 1JHNA 1QNYA 5G04L 2CNAA 3VLBB 1DGWA 4PLMA 3CHXA 4BHPA 1PO23 4HVOA 5FZCA 4QX1A 4K40A 3W58A 4WM8C 2IXHA 1E5RA 1W6QB 3M1HA 5F2WA 1Y9QA 4Q0SA 5FYBA 3RYPA 1ZRCA 3B69A 3NAPA 4K1ZA 4X6QB 4Q4W3 4E27A 1GZ9A 4I0WB 4AI2A 1RUF1 1MS1A 1KITA 2D5FA 3PMSA 5DN2A 1YQCA 1X8EA 4P00B 3ME2A 1R64A 1HRI3 4XXAA 3VHOA 4CXXA 1Z0HA 2QQMA 2ZKLA 1CESA 1QMJA 1IZ3A 1KQRA 1NXD1 5ACA1 5JWPA 1GV9A 1XE8A 4XIKA 1ND2C 1N1SA 5D2AA 3MW4A 4OVEA 1BCXA 2ZOEB 3CIHA 4LO6B 5A6QA 5A80A 4EWEA 1GP6A 1L7RA 1RVF1 3LEIA 2BPA2 4CDWB 3ASIA 3AP7A 1X7NA 2W92A 1ZBA2 5JXJA 4QQOA 4RR3B 1BXHA 2MPFA 1F5JA 2YG0A 3OUHA 1SBDA 4BU2A 5J09A 2GNTA 1XNDA 3PU3A 4H2AA 3R0RA 3B3QE 4ASMB 2QQPA 1K5JA 1DF0A 3LEKA 3PMEA 1VAVA 4A6SA 1SFPA 4ZHNA 1YXWA 1YI9A 1N3OA 3JD71 2XLFA 4LHSA 1YLLA 3WG4A 1AYM3 1ENRA 1GU3A 5FZBA 2ZCWA 4E2GA 3SMHA 4XC9A 1SBFA 3WCSA 4RQPA 3ACIA 1GYKA 4YZ5A 1PGL2 4Y1ZA 5FZ8A 4QHOA 3OPWA 5GM0A 3O7OA 1V70A 4B7KA 4EZHA 3OD4A 4M0NA 2CDOA 1J3PA 1H2NA 1T6GC 3M4FA 4WVMA 2XL7A 4XE9A 2XJSA 4KU8A 1ULFA 4FOYA 2BOIA 1YJKA 5A3LA 5C8WA 4CDQC 4XF3A 3WCRA 2XKOA 4XBLA 1IS5A 2E53A 1NLRA 2R30A 4RGKA 1N3QA 1F8VA 4Y20A 2G1MA 5KHIA 1UMIA 1YIPA 1YIFA 2WWUA 1ONAA 4XJ8A 4I3GA 4BQ4A 5C8CB 5FMOL 2JXAA 1OI6A 4RHV2 4H55A 2ZGRA 1IPSA 1US3A 1VBC1 1QJX2 2OKXA 3GJBA 1AR62 4I2OA 1ZNPA 2QKDA 1FOD2 4FPKA 2IC1A 4B1MA 2B9UA 5GJ6A 2GC1A 1H4HA 3POYA 4PDWA 1OVPA 3NSTA 2VUDA 3TEYA 2J22A 2DU1A 3AZWA 4HPKB 4XCBA 4UFJA 1X8MA 3BVCA 1DYOA 4CDXB 4N53C 3LA2A 1Q56A 2P6HA 2VCBA 1LOFA 3ZFGB 3KT4A 5FKCA 4CZSA 3FHIB 2IXKA 3J4UH 3FJSA 3ZDSA 1RUJ3 1OBNA 2CAUA 1WZXA 2W94A 3K4AA 4ORFA 2CY6A 2WA4A 3OYWB 3HWJA 3EXUA 3POBA 4XQ4A 3N3HA 5JR7B 4QXKA 3GZTB 4B3NA 3SNMA 4J6GA 4DRRA 1UF2C 1LKNA 2PHRA 1ZBA1 4UYBA 4LXLA 4L0PA 4CEWB 2ARBA 1RUF3 2R1DA 5C3QA 4M3CA 4XURA 4JGZA 5F5QA 3M7AA 3MW3A 3H8UA 3C7GA 1OKOA 4KBZA 2XWBB 3NWKA 5FLJA 1VBB2 2VPVA 3P1IA 4IEUA 4J1WA 4YG6A 4I30A 4P5YA 1RYYA 5J7MA 2R0FA 1VBD2 2PLV2 1ODMA 3LAGA 1RC6A 4PQ9A 4RYDA 3ABZA 5FXXA 4FQ4A 5T3NA 1PGL1 4EE2A 4N9IA 1RVF3 3KHCA 4DXSA 1ZZ7A 1PM7A 4AEDB 5DAVA 4KGQA 1FAYA 4NRQA 2QBXA 3RZJA 1OA4A 2DCZA 4XJAA 4JKMA 1EYBA 4PI0A 3BTXA 3P3NA 1XE7A 2YMZA 2B4KA 2ES3A 3ILRA 4LHLA 4N43C 4AR2A 5C70A 3JD73 2VXJA 4HN1A 4A2UA 3PTRB 1QH7A 3NJXA 3ZN4A 2XJUA 1JYCA 4QGLA 4XTPA 2D6LX 3U4SA 3C7FA 2BBVA 4GH4B 4UT5A 1HXS2 2DBNA 5A3WA 3ZSJA 2WNVB 5ANNA 5GALA 3CO2A 4YVWB 1EUUA 1HJGA 5LA9A 3ATGA 1IKQA 3GHMA 1O5UA 1QJX1 5JR2A 1AL0G 1AR61 4XACA 2NZ9A 3PIGA 3P3PA 1FOD1 3C7EA 3MLLA 3AL5A 1SBEA 2OPKA 1XSQA 3K3NA 3LOIA 4U36A 3DECA 4Q0UA 3VBUC 3H8XA 4K1YA 1RUI2 2W5FA 1SMVA 1URXA 1YEWA 4AQTA 1QU0A 2Y6LA 2FDIA 3T2OA 1Q43A 1R082 5CB7A 4CCOA 3R05A 1K42A 3ZFFB 1Y43B 1AYN1 3ZXGA 2DUQA 3C2UA 1TEIA 4P9JA 2VTXA 2IXLA 4CSWA 1D0HA 1RITA 2A6ZA 2ZX2A 1C3HA 1GUIA 4EN9B 2DCJA 4QU1A 1JU3A 3MIDA 2WT2A 5FY0A 2WNOA 2HYXA 3PU8A 3ZFEB 4NHXA 4WM7A 3H9AA 1MZEA 2WINB 4XQWA 4JX0A 4XTMA 2ZAAA 3RDIA 5FXWA 3VBSA 4CP2A 4ES9A 4YVSA 2KR2A 5T55A 2GP3A 3W59A 3ZMOA 4AGVA 1CAVB 4M00A 5FY1A 4CYDA 2OZ6A 1VBB1 4OMDA 5IUQA 3O5SA 5FBZA 1FNZA 3O1TA 1H2KA 1UOGA 1D4M2 1HN0A 1MS4A 1VBD1 2PLV1 3OEAA 3GZEA 2WQZC 4QGNA 4R52A 3VKOA 4CDWC 2DVAA 1OF3A 1V9U2 2MEV2 2GALA 2ZPXA 1VBA2 4RGGA 1RUNA 3ACHA 3C7HA 4QB6A 1OA2A 4PQQA 1HRV2 1ZBA3 4OULA 3JZVA 4YM3A 2UU8A 2AEYA 4GB31 3OBRA 1QGLA 4JDMA 1Q8OA 1I5ZA 1OC1A 5JZGC 3USUA 3O1VA 4AI0A 2ZX3A 4AQSA 1V6MA 1TME2 3ZO0B 5ABJC 2ZGUA 5FZMA 1BJQA 4GMP0 2R7EB 1WW5A 1TMF3 5LZ6A 2ZGMA 3WDXA 1HXS1 3ZXLA 2ARAA 3AP6A 2J1UA 2DCYA 2GAUA 4IESA 5FZGA 2V73A 1LGBA 1XU1A 4RQPB 1V6KA 1LEMA 4AVSA 4E4ZA 5DUWA 4RS5C 3MGUA 3IDBB 4LKEA 3ZYGA 3LWCA 1QDOA 1TE1B 2QUOA 4MYEA 4AQ6A 4AYUA 5I0DA 5LEKA 4WVMB 2MHFA 3AZVA 1DGRN 1NCRA 4GKXA 4D7TA 2JICA 1RUOA 1SLTA 3RWNA 3T2PA 1QQP1 5FY8A 4Q4Y2 3RZMA 3T0DA 3VD4A 3OG2A 1XYNA 1RUI1 3KF3A 2PAEA 4IV1A 5C8CC 3IIAA 2PTMA 4WVWA 4TTGA 3WNLA 5C7GA 5JOYA 1R081 4Y1XA 4JGYB 1D2QA 1ZZ9A 4Y20B 5GZCA 2Y34A 4GXLA 4RHV3 4RSUA 3BUCA 5FZ1A 3ZXFA 1QJX3 1K5MB 1AR63 2Z2SB 5LRSA 3ZLIA 3WHUA 5FBJA 5J36A 1IGOA 5SV5A 3AYDA 1UWWA 2EIGA 2WZEA 4X6RB 3HN3A 4LUMA 1NX9A 5FKBA 2Y6JA 3ZM8A 4CDXC 4AAPA 1J59A 3WNNA 5EIYB 4MXVA 1R092 1MEC2 5FRAA 1BEV2 1ZZBA 3VZJA 2ZX0A 1XSRA 1BBT2 2WIIB 5CBLA 2VM9A 2WUHA 2PXJA 3D8CA 5GLVA 4BQYA 5FOJB 5HCFA 3RZKA 1H8TA 3USSA 5A3NA 2CGOA 2YZ4A 4WM8A 2GH2A 2A6XA 4OQ8A 1D4M1 3HOBA 3RZZA 1X33A 2JDKA 2A3YA 1W0PA 2MEV1 1V9U1 1F31A 1PO12 1VBA1 3GDBA 3VHPA 3WUCA 5A32A 1GWMA 3U07A 3D5OA 5C4WA 5DG1A 1CN1A 4MLOA 1IKPA 1ENSA 3DGTA 3HMYA 1H8VA 4FPFA 1ZRRA 2OVUA 1AR82 1WLTA 3JB8A 3IM0A 1ULGA 3KS7A 5FXZA 1TME1 2TUNA 4IEVA 4LR4A 3T09A 1UYXA 2WLQA 5FAXA 4YYOA 2AEZA 1VBB3 4CCNA 4XJUA 1GKBA 3UL2A 1LU1A 2ZEZA 2CDPA 1VBD3 2PLV3 3MPBA 4FPYA 2ZHNA 1GQPA 2FCVA 1AXKA 1K12A 5CFCB 2VVDA 4Q4V2 2OW4A 2OUJA 4Z2WA 3I59B 4XUPA 2VMGA 4IEZA 1HDKA 4GA9A 5HI0A 5JSPA 3BIEA 2VD7A 4IGOA 5F1RA 5IHRA 3CNAA 4BXFA 4AI1A 4Q4Y1 2HEWF 3EYPA 3J7NA 5FK8A 2EAAA 4HVRA 3U4XA 1RUC2 1G7YA 1HXS3 1FYUA 1GICA 2AGSA 1LOGA 2KA3A 4YVWC 1CWPA 1CIYA 1S0FA 3J26N 1IS3A 2IVJA 3POJA 3T0BA 4COWA 2VJXA 4XXPA 5I0TA 5E6HA 3WV6A 2VOTA 5CVRA 4CDQA 4K3UA 3A21A 2XVLA 1N3PA 1RJ8A 2ZJCA 3GZAA 4A7KA 3VN4A 1UXZA 1I1EA 5FWJA 1H0BA 2B42B 1F2NA 1DYPA 3IPVB 2K2SA 3TNPB 1RXFA 4PF1A 1RUI3 4CCCA 5C3SA 1B35B 1R091 3CBNA 3IIIA 4GWIA 5GLWA 4CE8A 1SDWA 3FE5A 1BEV1 3ZFFC 4PBOA 1E5SA 1R083 1FI2A 1U5YA 2W0XA 3BALA 2VBBA 2Y6KA 1H1AA 1ND3C 4XDQA 1Q8QA 2ZEYA 4KU7A 2Y60A 3IT8A 4TYSA 2YFZA 2EXIA 1PO11 1F9KA 3RMYA 4CUCA 1LU2A 4TLGA 3SCFA 3JBG2 4NIIA 5BYNA 4Y26A 3INAA 1W8TA 4N53A 3T0AA 1TNRA 4DXTA 3KLSA 3VDAA 1JZ4A 4N7UA 4WM7B 1AR81 5FYHA 2J1RA 1GZWA 3UGFA 3VZKA 3KQRA 4TWTA 1NZCA 1SPPA 4Q1PA 2P3YA 4OUMA 1W39A 4QQPA 3KCCA 4UF0A 1D4M3 2EICA 2UYAA 2XJQA 4HXCA 3GM8A 5DAQA 4OLLA 4MOAA 3N9LA 2MEV3 4YRDA 1V9U3 2DWRA 5FTTC 3BU0A 4DQAA 2PHUA 2P34A 4IGPA 1HRV3 4IEPA 4UBHA 3PJYA 4IUGA 4P08A 3D6EA 2BWAA 1YQ5A 1MQTC 1QEXA 5LA0A 3V0AB 4D6SA 2WL1A 1OUXA 3WP5A 4CUAA 4XHBA 1QJY2 3FLTA 1D2SA 5EWSA 5FZ7A 4NIAA 1TME3 1J3RA 3G6JB 4AG4A 2KM2A 2P3KA 3VD9A 5FUIA 1DG6A 2J1AA 2ZZQA 3PDQA 3ZSLA 3FC0A 1RUC1 3BB6A 5T52A 3AMHA 1W3XA 4XJZA 2VZ3A 1W2OA 4C0BA 2ZX1A 2OYZA 2OX0A 2R042 3LDKA 4N8MA 3WHTA 1QKQA 1PGSA 4Q29A 4N43A 4AFCA 1UN1A 4Y5SA 1UL9A 5FPUA 4FTBA 1VE0A 2A5ZA 2OUHA 1DU3D 1S0EA 1WLCA 1QXPA 5A1FA 4PJYA 1JBCA 4LLFA 1W6NA 4KMQA 2PHFA 2XOMA 1NCRB 2PMWB 3AL6A 2BDRA 3B5LB 4JGYC 4F83A 5FPXA 2YHJA 3FBMA 1WMXA 4W6YA 1ZVFA 3RJ2X 2H0VA 3IN9A 3ILFA 5I0RA 1X9TA 4Q4X2 3OGJA 3FWEA 4LEJA 3KQ4B 3NV2A 4FFHA 2FDFA 2Q1MA 1LODA 4Z92B 3UK9A 3UJOA 1HQWA 2YGMA 4NHYA 3RG0A 4FTSA 2I2SA 2YU1A 4QX3A 1JMUB 4QB1A 5LW9A 3RPQA 5LB6A 1MEC3 1BEV3 4FPGA 1BBT3 3NL1A 5FMCA 4Q5OA 2EIEA 1MZ5A 3QCWA 4MGYE 5C33A 4QKDA 3CZUA 2WFPA 1H8TB 1ULDA 4XYXA 2Q8DA 1JH5A 4J1XA 4ZS2A 4EQVA 1NA1B 3AZYA 1O3SA 1EAH2 2G9ZA 1PO13 2VBDA 3DEMA 1AR92 3LB9A 4NHKA 4ZU4A 3ZYFA 2Y0IA 2XHKA 3AKQA 1OD3A 3IMMA 4JAAA 2WYFA 2QNKA 3VD7A 4I3PA 2VOVA 1VLNA 1QJY1 5BXXA 2ZTNA 1APNA 5DPNA 3FN9A 2Y26A 3MUZ1 1J83A 1JI6A 3ZYPA 1DDLA 4AVTA 4YW1A 2ORZA 1PIV2 4B4RA 4DXZA 1PNGA 1SLBA 5CFCC 1QNWA 1A78A 4HG6B 4XZUG 4NIDA 1HQNA 3GYDA 4K8RB 4Q4V3 1LGNA 3ZYBA 2HWB2 3LSDA 3E5UA 2R041 5BNOB 2JDPA 5H9QA 2EIDA 1RUH2 5A3MA 1X50A 4PT6A 5T5OA 3VBHA 4AF9A 5ABJA 1YWKA 4LA2A 3WW4A 4HN0A 4QPIB 5F5IA 3RFRA 4F8AA 5K0UB 3BKZA 2NPIA 3Q8AA 1GP4A 4CVUA 3ZXEA 4NVPA 1AL22 2J1EA 4LMFA 5JCTA 5EZWA 4AHZA 3ITQA 4KGGA 1LTEA 1RUC3 2VW0A 4EV0A 1KS4A 4NN0A 4QMAA 3KB5A 3RYRA 3WDVA 1GSLA 4Q4X1 3LA7A 1KDMA 1BK1A 4DPNA 3NV3A 3S57A 3T4VA 2VMDA 4YW5A 3HQUA 2D6PA 3MF6A 4OI1A 2O8OA 4QHZA 3B9IA 5CFDC 1DBNA 2QZ3A 3O0XA 2CU5A 4WVZA 5FIXA 5L9VA 2DVFA 5FZIA 3WEZA 5KXCA 4AVVA 3VDDB 1GBGA 2GNMA 1XU2A 2WS91 3VV1A 5E1RA 2D98A 5EHDA 4CEYB 4XF4A 2R063 1MS8A 4OHZA 1JOPA 2VBPA 2D7FA 1IOAA 1JYNA 4YM2A 4CCEA 2JE9A 1O4YA 3ZMNA 3H7YA 3K2OA 2HKXA 3AM2A 4IV3A 1ALYA 3AP9A 5C9AA 3ST7A 5KHGA 3I97A 2EAKA 4XFIA 1EAH1 4O9GA 1AR91 1COV2 4CUBA 4GD4A 2X5IC 4MZUA 5A33A 3GHNA 3JBG3 5A7WA 5A7PA 3VBFA 5C3PA 3AKPA 4IDZA 3WY6A 3WW1A 3E6CC 1W03A 4UOJA 5ACA2 1A8DA 3BYWA 3LQCA 1F35A 2C9AA 1LOEA 5JXGA 1J3QA 4LBJA 1XC6A 5FWEA 1W6OA 5EYXA 4GQ7A 4AQ2A 5IVCA 3KSCA 2ZHMA 1JYIA 2E6VA 2P37A 2TNFA 1SFYA 5EFUA 2JG9B 2JIJA 3T4HB 3WSOA 3NNLA 1TZOA 4YNIA 1CAXB 2I74A 4IETA 3NKGA 1WWYA 1QOSA 1LNSA 2QQVA 5FYUA 3OJBA 2VU9A 2YFUA 1R1ZA 4IW3A 4CDUA 2JDMA 5B4XA 1DLLA 1LHUA 3WT3A 3FX3A 2HWB1 3GCWA 4Y5TA 2F4PA 5HXVA 1DGWX 3K51A 3K75B 1VPHA 1RUH1 2W95A 2VZOA 2VH9A 1OOPB 3M3IA 1XNKA 1QJY3 1QOOA 1NG0A 1V6JA 5JIAA 2V5YA 4AL9A 3POIA 1KRIA 1AL21 3ON7A 5DDJ2 1UW8A 2WO7A 5C5UA 1UY4A 3TEWA 3VBRB 2QQJA 4QM9A 2Z79A 2Z42A 3BOPA 5CISA 5IVFA 2WJSA 3ZN6A 4YGEA 3J7HA 2D6MA 4LO7A 3ZKUA 1SHWB 4D7YA 2B45X 2R043 4I02A 3ZXKA 3OGGA 4UI9L 2BFUS 1O4TA 5T5PA 4TZDA 2XL9A 5A7SA 3HT2A 1PX3A 2ZHKA 1AR72 1H9PA 3I3BA 3L2HA 4W8JA 2V4VA 1ZRIA 5JOWA 4WZFA 5JI9A 1ZBE1 4MADA 2VW1A 3FUQA 1LENA 2SLIA 2W08A 5E16A 1TVGA 2LRPA 1VBC2 4GAZA 2VZSA 3LPGA 1UOFA 2UWBA 3UJQA 1PMJX 1W9WA 3DPRC 4Q4X3 3UKVA 4AI8A 2E7AA 4OI0A 5DMYA 2GZWA 3IDCB 4AI3A 5CEHA 1W6PA 1SG3A 1DQ0A 2BGPA 4X8PA 4NAOA 1JODA 3J8F3 3OB8A 2XONA 5KHHA 3SKVA 1COV1 1PZ8A 3AXDA 2D3PA 1NY71 5IK7A 2DUPA 2PHTA 2D5HA 5D21A 3WNKA 3NV4A 1PMIA 4A42A 2Y38A 2VL4A 3NMBA 2XHNA 3LFIA 4HMZA 4EWDA 2ZX4A 3PUAA 3MEPA 4KBBA 4XFHA 5FZ0A 3V65A 2L9LA 5FYIA 1SLAA 3PVBB 1ND3A 1LHVA 1UPIA 1GNHA 4B4PA 1VJ2A 5BV6A 2AZ5A 1CD3G 2PAKA 2P3JA 1XNBA 4QPGC 4MXWB 1W9YA 3WR0A 4RD7A 1NA1C 2J7MA 4HT1T 1PZ7A 4KI5M 3KGZA 3WQ7A 3Q8EA 4EZ4A 2H6BA 1EAH3 2JG8B 4DUXA 1AR93 1V00A 4Q0VA 1NLSA 2VQ0A 5KHKA 5CG8A 2DYCA 3KV9A 2WNUB 3T2QA 3NW4A 2YBSA 2Q8CA 3DV8A 2HWD2 2R32A 5FYZA 4BA6A 1JU4A 4LKSA 4NWWA 1BVP1 1CZSA 2X8KA 3RNSA 2ZGQA 3LDRA 5A3TA 2JE8A 2NYYA 2V09A 4JKKA 1LCLA 4HKLA 5ERLA 3J9SA 4V1PA 4BISA 3WQ0A 1WLWA 3CJIC 5DDJ1 1PIV3 4RFRB 3AB0A 3WF1A 4OI2A 5DABA 1UU5A 1OF4A 2RJKA 1IHMA 3N9MA 3AKTA 5F32A 1C28A 1MQTA 1S0DA 4DNYA 3ZYRA 4YW6A 2HWB3 4HK9A 4R8HA 1G9BA 3S30A 1ENXA 1RUH3 4KWKA 2JDNA 4K7JA 2DVDA 1UY0A 4QPIC 5I0SA 2W47A 1AR71 1DQ6A 3OF1A 1PNFA 2EIBA 2PELA 2OT7A 1S2EA 2W91A 3VBHB 2XGXA 2G19A 5A6ZA 2O0OA 3POGA 4JHZA 3HQXA 3QD6A 1CX4A 2R0HA 4JTOA 4X8NA 4AK3A 2LW8A 2R49A 3AC0A 2VZRA 1I5PA 4EWAA 2LS6A 5FP8A 3U1XA 3GALA 3OY8A 2W46A 4LITA 4Y22A 5L9BA 4GWMA 4BQ3A 4XJWA 2DTYA 1BMV2 5HBAA 5GLZA 3RZLA 1REFA 3ECQA 3PVOA 2XDVA 1WMEA 3ZYIB 5L7OB 1UYYA 1DGRA 3PNAA 5IAVA 5A7OA 1NQJA 2VOXA 4LORA 4J25A 3KVAA 4COZA 2AUYA 2D3RA 4CEYC 2VZPA 2FCTA 3TN93 4URAA 4JHTA 5BNPA 3B7MA 2RS33 2WKKA 1VAMA 3JUUA 1AYN2 3H50A 4GWNA 1U5IA 1POV0 3AJYA 2FZ2A 4OCTA 3M3QA 2PHWA 4QDRA 2JWPA 3O1MA 4EROA 3R6SA 1PVXA 3H8RA 1TNFA 2N7GA 1W8NA 2XR4A 4DMIA 1NAEA 1JZ7A 4L92A 4JC1A 1H1MA 4IV3B 5FFOC 5A7NA 4ES8A 2CWMA 2BWCA 1COV3 3N7MA 2ZGKA 3WF3A 2RDQA 5BNNB 2GN3A 3RI9A 4BYYA 2W68A 1XQNA 4P9YA 1H9WA 3MZHA 2HEVF 2DUOA 3M3EA 2HWD1 3LZZA 5A7WB 3RQ0A 5ACA3 3VBFB 2BYVE 1V0AA 5F3EA 3NQHA 1Y9GA 1UNBA 3I2IA 3L9JT 1Q5OA 3PTYA 1O5LA 1UZWA 4LOTA 1EPWA 5IVBA 2O14A 4L97A 1NCQC 2AYHA 4COUA 2GC2A 3FBYA 3NVCA 1W6OB 1Q8VA 4A3XA 2AR6A 2P6CA 2XJTA 5JSRA 3KT1A 1HN1A 3WDWA 2QVSB 4GB32 3DKWA 4MGIE 4G9SB 2F4LA 2XB6C 1OOPC 2XH6A 1MVEA 1UO9A 4D8MA 4LT5A 1PHMA 1PZ9A 1PVC2 3D0SA 3IDAA 4XFBA 3WDYA 4GJYA 5D8AB 1ZZCA 2CGNA 1PK6C 1VBE2 5HCBA 1LULA 5C3OA 1P8JA 1YO8A 3HN1A 4K20A 5FPAA 4XUTA 5DDJ3 3BTYA 4LIVA 2BRTA 2GU9A 3N9NA 1G9CA 3O1OA 3I2FA 1VP6A 3SLIA 4LO5B 5HCHA 3I49A 4PLNA 5GZEA 2PHLA 3HIFA 5GZFA 1BMV1 1UD1A 2ZMNA 2C1FA 1KS5A 2VG9A 1M4WA 2ZMLA 2ET1A 2VAUA 1QQP2 1W2NA 3ZPYA 2CYFA 1OLRA 2E33A 1AR73 5CZKA 4R4ZA 1VRH2 2WO2A 3I3DA 4XMIA 1RXGA 2WDBA 4LLOA 2A6WA 5A70A 2VY0A 3THCA 3VL9A 4FOVA 1CZTA 1H2LA 1CAUA 1NQDA 5A7QA 1F4AA 5ISLA 2DBIA 3MV11 2XBO2 1O59A 1VBC3 2FCUA 1FATA 2BU9A 5HXMA 4YW7A 3UETA 4JDOA 2RV9A 2WQ4A 4YG3A 3T1MA 1NLQA 1RUE2 2RM22 4H7LA 2CAVA 4Q1RA 4YG0A 1UMHA 1JXNA 4AXOA 4D6QA 3FHQA 3VZNA 1SEFA 5L9RA 3RJRA 4RFT0 1M06G 1OLMA 3CF6E 3NJZA 5CFDA 3A0NA 3NAPB 1LHNA 1NUKA 1NE4A 4YWAA 3VKFC 5FJHA 1RL3A 4LBQA 4NE9A 1G9FA 2BTVC 1C8NA 3H3ZA 4W50A 4XF0A 5KBFA 2VCMA 2BP6A 2JB4A 3KF5A 4HOOA 4FT8A 2HWE1 2BW8A 5FJKA 5I8SA 2Y6FA 4FP3A 1KFXL 2X29A 4EN0A 3AXEA 2NN8A 3DCQA 1JYTA 3H42B 2FD8A 2GMMA 3EBRA 3P5BA 4FXKB 4GZ9A 4RR3C 3ILNA 2JG8C 3WVJA 4W65A 5AFEA 2WT1A 3WXPA 5JMCA 2X5IA 3S0MA 1HB4A 2VOWA 3FFZA 3N9PA 4QHBA 5FUNA 3PUHA 4YARA 3W5NA 3E6DA 4M01A 1BQPA 2VE1A 1ZM1A 3HNMA 3N4MA 2O1QA 1YC61 1FPN2 2EXHA 5J1XA 2YV8A 2HWD3 1PVC1 2XQRA 3THPA 1W90A 2G4IA 2GH8A 3NKTA 2ERFA 1VBE1 3TOJA 2JIGA 3B00A 3MIBA 1ZZ8A 1J1TA 5FMOS 1DZTA 4BQXA 3NNMA 4K9SA 2A75A 3G7DA 2VVFA 5F8PA 2VZVA 4E4SA 1IQAA 4P14A 1K3IA 1IG0A 1GWKA 3ACLA 5LATA 4ZU7A 1LHOA 1XE0A 4GKYA 1OSGA 2A7AA 4KNCA 4BDVB 2OA2A 2YUEA 4XFFA 4K21A 5J48A 4K6BA 2C24A 2CSGA 1KJLA 2RR12 3K46A 4BM8A 2VUAA 1VR3A 1OQEA 1VRH1 4UAPA 4IE4A 4YM0A 5F3IA 4LHKA 5C71A 5FZ6A 3UNPA 4R4XA 4GALA 4BQ5A 3LD8A 3V0BA 4WZCA 1HJFA 2XBO1 3NO8A 2Q4SA 4BZ4A 4A4AA 1CX1A 1HB1A 2RDSA 2YC0A 2VZUA 3KCXA 4A7ZA 4FPLA 4P9GA 1JOJA 4ISRA 2FMYA 2RM21 1FOD3 1NE6A 1RUE1 3H1WA 2BJSA 3M8LA 4HBNA 4P9WA 3VBOA 3WW3A 3K4DA 2EA7A 4FAGA 2OZJA 5LEJA 4WVVA 1HKDA 1OLQA 2Y6GA 4PDWB 5J98B 5SV8A 3POWA 3S7EA 2VUJA 3ZFGC 2OXBA 5ANQA 4OHVA 5LA2A 3SEPA 3TWIA 4FTEA 4ZXKA 2VMFA 3QACA 3U10A 3I4IA 3HQRA 4HANA 3AMNA 4XJ9A 3VKMA 2YROA 4P5HA 1AYN3 1H6XA 3DPRA 3ELNA 5A3UA 3RRDA 4SBVA 2Q1FA 2WBKA 1RHI2 3C3VA 1OQ1A 4CEWC 4XDPA 2B39A 2A70A 2VECA 2XMLA 4IE6A 5H9PA 4Z2AA 5DUUA 3AVSA 4COYA 2OIIA 2EF6A 5DXDA 2PFWA 2VTFA 4M3CB 4CTEA 1SLCA 4JGZB 1FPN1 1ND2A 4SLIA 1OFNA 2XLGA 1H1IA 2ZZJA 3FLPA 2XVKA 4LBQD 3VDCA 4ONUA 4QT6A 4AFMA 4Y4RA 4A7YA 4LE4A 3PUSA 4AEDC 1G9AA 2ZABA 1GNYA 5EQUA 4BMEA 1C8M2 1Z7S2 3F2ZA 4R9DA 2QQLA 2OQ7A 4NAMA 4QX0A 2E9QA 3SITA 1G6NA 1PX4A 4GB33 5FP7A 3W9AA 4H14A 1OPMA 1W3VA 5F39A 2UY8A 5A3PA 1T2XA 5BY5A 4D7SA 2ADEA 4GH4C 1L7QA 1PVC3 2RR11 2J42A 2WNVC 5CG9A 3BCWA 1VBE3 1GNZA 3ZSKA 1WA6X 4OHXA 5CKMA 3SISA 3ETPA 2YYOA 3A23A 4HVQA 1TQ5A 2Y33A 3OUJA 5IATA 5FQ0A 4UW4A 5FO9B 2F17A 1AXYA 3SXWA 2ARXA 4NHMA 5IK4A 1RTVA 2IUWA 2FDKA 1I9RA 5JOXA 3QBQA 4UFMA 4YZ4A 1ULCA 4D69A 1QQP3 5J37A 3GZUC 1BLZA 5CKNA 4CP0A 2WFF2 1JN2P 4JTNA 4Q26A 2R1BA 2Y6HA 1VRH3 2SBAA 3MIEA 1KXGA 2B5HA 2EVXA 4OHWA 3THDA 4M3CF 4TSVA 4BH9A 5IVEA 2XBO3 1DLCA 3WNOA 1W0OA 3U37A 1RHI1 3EJKA 1NT0A 2RM23 1RUE3 3PIJA 4HFSA 1GLHA 3NAPC 1WLDA 3LGRA 1AXZA 3ZFEC 4B4QA 3JXSA 4ATEA 4DEVA 1YNAA 5C6CA 3HBKA 1X82A 3H8OA 1W6MA 1UOJA 2BVBA 3W5MA 2QE3A 2PQSA 5JIUA 1MPXA 1GMMA 1RJ7A 4LBQB 5IWFA 3VBSB 5FO7B 1VIWB 2XUEA 3HPNA 4YVSB 4JDNA 4OUSA 3AMQA 4HSJA 1OURA 2HBTA 2UWCA 4CP9A 4LNVA 2Q8EA 4S2GA 4E2SA 5GZGA 2WZ8A 1C8M1 1Z7S1 3LFMA 1L3JA 1VBA3 1BK0A 4NROA 4W4ZA 2A1XA 2ADDA 4A41A 2BNNA 1X36A 4DEQA 2E32A 2X53S 2JKXA 4Q2FA 4O7XA 5T50A 3VB9A 3NNGA 4IL7A 2WSVA 5F7UA 1FPN3 3USUB 3QH6A 3WG2A 1ZA7A 1W8HA 3SH3A 2A3WA 3OTFA 4GWJA 2E31A 4ZU5A 4RQPC 2ZS6B 4E8DA 3HEIA 1HB3A 1VMHA 4FFFA 2C6SA 4P9LA 2D40A 1U0AA 4XIOA 2E63A 3I54A 3WW2A 2EXJA 4XMAA 5IK5A 5C5TA 1YFXA 4D0QA 1GZTA 1POQA 5FYMA 4LTAA 5FZ4A 4QQLA 4B7EA 3HD8B 1SCRA 4Q4Y3 1Y9MA 1PK6A 3OBAA 1QIQA 2WFF1 4KWUA 3TBDA 4ARYA 1OVSA 2QQNA 1BZWA 3Q8FA 4BK4A 2RS12 2UURA 2D44A 3ZXDA 4IV1B 3ZDVA 3SC7X 1H6YA 1K5MC 1LOCA 4G4FA 4IEYA 2DTWA 5J96B 4QKFA 2HBUA 1WMDA 1Y7BA 3VBUA 4PDWC 2V5DA 2HWF2 3DKQA 4GMP1 4HL0A 1KDKA 2V72A 2VNRA 3DUIA 3PHMA 1YFWA 4XF9A 5F2SA 3RS6A 3T3YA 2DCTA 1RGSA 3NJYA 4Q0QA 3HAGA 4Y1VA 3U78A 1QY4A 2WS92 3DL3A 1R093 2HWC2 2Z4FA 4MGQA 4MSVA 5F5AA 1EP0A 2KXLA 1CQ9A 1N1VA 3M3CA 5EYYA 3BPZA 3PVEA 3A22A 2B46X 2ZGTA 3CDZB 3X29B 2WRAA 3LA3A 3B02A 5G05L 1YJLA 2ENRA 3BN6A 5LBCA 2JJ6A 2K46A 2BFUL 1RHI3 3CJXA 4WM8B 2WLPA 2VGDA 3AYCA 4HETA 5BNQA 5JAXA 2HEYF 2GP5A 1BYHA 5A32B 3HNYM 4FPOB 4QB2A 3MIGA 3H0OA 2E7QA 2XJVA 3GBFA 4UXAA 4M4RA 3I2KA 1AR83 1XPWA 1UX7A 5C4WB 3IMNA 5JUVA 1O6UA 4AEKA 2HH9A 3DF0A 3SEEA 2Z69A 1XYOA 1WD3A 2ZEXA 2BZDA 5IW0A 3RVHA 3WZ1A 1STMA 4CDWA 2A73B 2W87A 4DOUA 1W2UA 4RR3A 3P6BA 4IEQA 4R9CA 1C8M3 1Z7S3 2W9XA 3E5XA 4LA3A 1L7LA 5FZKA 3RZHA 1CIWA 5CKQA 3ETQA 1F4HA 4XABA 3CLPA 5JZGA 2BNOA 1CPNA 2AREA 4INDA 2QFEA 3DYMA 1E5HA 1OD5A 5IVVA 4JV4A 1UZVA 2VMEA 4CP1A 4BIFA 1SACA 3E1F1 4Y4YA 1T6BX 3D3AA 1HW5A 3CEWA 1JOBA 1LAJA 5GLUA 3FZ3A 2RS11 2YC4A 3ZKYA 3UGHA 1QWRA 3ZXJA 2WNEA 4RS5A 4CCMA 3DXTA 5FZOA 3MYXA 2ILMA 3KV4A 4LHNA 2JENA 3ROUA 1UYZA 3TRSB 5JXIA 1HX6A 2PYTA 5FLHA 3ALQA 2R16A 3OGRA 5CYYA 1CAWA 4CCKA 3BOWA 3KT7A 4UFKA 1XXNA 5KHJA 5A1LA 4CCJA 4CDQB 2HWF1 4N90A 5JLVA 1YHFA 1B35C 1DFQA 2WQ8A 5C8CA 2GMPA 1ZBE2 4FFIA 2KD7A 2HWC1 2ZKNA 1AUYA 3KV6A 1SZBA 1WCDJ 4LK6A 4UW6A 4V2WA 5AVAA 1YYNA 2VVEA 2JECA 4BE3A 4L2NA 4IEOA 5FPLA 1PO21 2YC2A 4BQ1A 1I3HA 3ZSEA 5K8SA 3T08A 3PVNA 4ZKTB 3UT0A 4EYUA 1YUDA 1W8UA 1QJZA 1WMFA 3W21A 3N7JA 5EJZB 3KVBA 3CQOA 4XCAA 1W0NA 4CDXA 3RGBA 5FYSA 4YZ1A 4GMP3 4LPLA 1NY72 1W8FA 2XWJB 1DQ1A 2WN3A 4WM7C 5JPMB 4KG8A 1YQ6A 4G3YC 4L99A 4OHYA 4BWOA 4P9IA 4N53B 1UIKA 3OYWA 2NMOA 3I8TA 3QH7A 1W6MB 4NWVA 4OFGA 5CA6A 3WF2A 5IAXA 1J84A 1SDDB 1GZWB 3B9CA 2VNGA 1MS9A 1ACCA 1SPPB 1FT9A 1WCKA 2VMIA 4ASLA 4BK5A 5GKAC 1C1FA 4CEWA 1MACA 4L9BA 1GQGA 2D6NA 4UF0B 5E88A 5KR7A 3OUIA 2IZWA 1BHGA 3WG3A 4CU6A 1H4GA 4QAWA 4CU8A 2F6BA 3T30A 2QCSB 1AYM1 3MLKA 3IWZA 5JPNB 3MIHA 3R4UA 3URFA 1ODNA 5FY9A 5AVPA 2VZ1A 1ASJ2 1CZVA 1ST8A 1UCXA 4N7IA 2FBEA 2YBKA 5LBFA 1IG3A 2D3SA 4AEDA 4FPEA 2V4AA 5DUXA 5EJ1B 3POSA 4XBQA 4Z82A 4BLIA 3ORJA 1C5IA 1U5ZA 3AP5A 1RIRA 1RUD2 1Y3TA 2ETEA 4YSFA 3WUDA 1S0IA 4MV2A 1WD4A 4NR1A 5FYYA 1KGYA 4QD2A 5DAWA 1YFUA 1U5XA 2FDHA 4OMCA 2P4EA 1ZRDA 4AE2A 4DB5A 1NCRC 4XW3A 1UY2A 4N43B 4JCKA 4YW4A 3NV1A 1DQ5A 3MF9A 4Y5Z0 5FY5A 1W6NB 2BNMA 2DFCA 2XXZA 2W52A 4I01A 3H1MA 4UBGA 4YVWA 2QQOA 5FUPA 4Z1VA 2RS13 1V6LA 2BEOA 4UWDA 2YGLA 4I09A 4QDQA 1UX6A 2YU2A 4LBNA 3PLQA 3KD4A 4QXCA 5FPVA 1RINA 5E89A 2QZ2A 4LKDA 1E5IA 2JD9A 3IKWA 5L36A 2HWF3 2W3JA 1QHDA 4O9EA 3MFAA 5A3OA 4B1LA 4URTA 3ZFFA 4NRPA 4ITCA 4H3WA 5CAZA 2WS93 3NNFA 3KZ4C 4MGSA 2HWC3 4QQ2A 2VUCA 1VAKA 1RUJ1 4XQDA 1LGCA 1VB4A 4B8EA 3N36A 3JQXA 4C0HA 4CCLA 5L73A 5I93A 3AMPA 1H8TC 3AYAA 4QX2A 3AX4A 2WWJA 4R9BA 4YFWA 5B4NA 3I3EA 5JDBA 1VMFA 4FP2A 2XVGA 4IERA 1O3QA 3ZFEA 4P02B 4FCAA 4IE0A 2WC2A 4AHYA 4JKLA 3I2OA 4XPVA 2VC9A 4UFIA 4XFCA 4FI9A 5FYCA 3OSDA 1CAVA 2GNDA 5C4WC 1C5HA 1JYXA 4NIGA 2DURA 5EV7A 4BMBA 3VZOA 3BI3A 1F15A 1QJU2 3JCIA 5JOZA 3D4KA 3LIHA 3GCXA 3WNMA 2CTVA 5FZLA 4O61A 4YLZA 1ASJ1 1NKGA 1NYWA 1SQ4A 3K4ZA 5F9TA 1H30A 1GFF2 1DQ4A 1W8WA 2LALA 4LK7A 4DIQA 3BIWE 1QF3A 1RUD1 4LE3A 5BNOC 1OPOA 5EJ3A 1ENQA 3I2JA 4XEZA 2Y8KA 1V6OA 2YDEA 3AFGA 5F6LB 4PIZA 4PLOA 4XUOA 1S55A 2YB7A 5K0UC 3LE0A 2WA3A 5JZGB 1LB2A 5DQ0A 3ENRA 2VW2A 1DP0A 2VMHA 3R4SA 1JZ2A 2AC1A 1SLIA 5ABJB 4W6WA 1TMF2 4M0HA 4AFDA 5DZFA 5FZEA 1AL23 3V64A 3VGIA 1GOFA 1FV3A 3VHNA 2JDHA 4R9AA 3OD0A 4Q27A 5T5LA 4I0BA 1YQ8A 4DXRA 2WT0A 2K9ZA 2QQUA 5L19A 4RS5B 1IS6A 1UQXA 2NM1A 3ACGA 2IWGB 4L8QA 1UPSA 1E57A 3ES1A 5CU1A 5FY7A 5FZOB 1NXMA 5LASA 2ZEWA 3O1UA 3S5QA 1MS5A 3POEA 5GLTA 2D6KA 1W9FA 2YPDA 1HV0A 4RA0A 1JYWA 1RUG2 3SH4A 1CAWB 2UYBA 4D6RA 5TSWA 3VDDC 4JGYA 2GDFA 2ZA9A 4XVHA 4XUNA 1ZBE3 1ZRFA 5FZ9A 2FHRA 4LIUA 1S4CA 3MFCA 5F5CA 1CONA 4JQRA 3OOXA 4LO4B 4B29A 3IAPA 3OBZA 3QLQA 5EXOA 1ULEA 2AENA 1K5MA 4N9HA 4ZS3A 3NNJA 3AZZA 3ZIWA 5C3RA 4CA9A 1DHKB 3SH5A 5LA1A 3I7DA 3BGAA 4YGDA 4EJRA 3TEZA 5KXEA 2P17A 4M3CE 3HNBM 1UIJA 5KWRA 5L7OA 4OI4A 5C9AB 2TEPA 1FXZA 5AC92 3WOGA 1HIXA 3RI8A 4XUQA 1REDA 2NQYA 4QXHA 2VCAA 5IK8A 3WD5A 3I2DA 2X05A 1UKRA 1QJU1 2DDUA 4O65A 5IJRA 5A33B 2HWE2 2YPJA 1Q3EA 5FZFA 4DY5A 2JG9C 1GR3A 3GBGA 1JUHA 4FPCA 3LKJA 4K8FA 1XB9A 1CJPA 1V6IA 3UKNA 1AVBA 3ZR6A 2VCCA 2HYKA 3DN7A 1GWLA 3E97A 1QH6A 1WBLA 2LTNA 3ACFA 3B93A 4TXWA 1D4VB 5FMBA 2ZACA 3I2GA 3AJZA 4QKBA 4QGMA 3VD3A 4PCRA 4QX8A 4CDUB 1JZ8A 2RDNA 3OEBA 5LY1A 3FL7A 4OZXA 1KFUL 2VMCA 3IAQA 3NJVA 4ET7A 3VZMA 4Q8LA 3O0WA 5KXBA 2ZGNA 1O3TA 5HV4A 1TMF1 1ZREA 1ASJ3 1ULOA 1RMU2 3VBRC 1R1A2 5CFCA 2W1WA 1Y4WA 5FY4A 3SHRA 3NRUA 3PL0A 1PMHX 5CADA 5LCWL 1VB2A 3I59A 1RUD3 3IZOA 1KJRA 3CMGA 1OH3A 4QKNA 1UOBA 4E2QA 1JYVA 3OBTA 3ZN6B 1UZYA 4FVVA 2PAMA 1OA3A 1LESA 4YW2A 4BCUA 4DINB 4BJ0A 1AX2A 2EXKA 2GSYA 3MI8A 4XZPA 1RUG1 2VNOA 5AFBA 2WR9A 1F5FA 3CKHA 4E8CA 2W1SA 4XAAA 4PHZA 1TG7A 1W28A 5T5JA 3EB7A 3ZYHA 4S2DA 4RHV1 5F37A 4CXWA 4JVAA 1G9DA 1XNCA 3DYPA 5FV3A 3U11A 4AFBA 4Y33A 2ZGLA 5DAXA 1SCSA 2ZGSA 3IPVA 1JHJA 1OLME 4NUBA 2XPJA 4LULA 4C91A 2VZTA 2JB8A 1B35A 1WGPA 4Y1YA 1W6PB 4AZZA 2BERA 1JS9A 5AC91 1DZRA 4E9KA 3UKTA 1WCQA 3A0KA 4TLFA 1LRHA 1XYPA 1U12A 2YBPA 4AWDA 4UFLA 1V6NA 4FFGA 2D97A 3N7LA 3O0VA 4DS0A 2K0GA 2IVIB 4HSLA 2H6CA 1ND3B 5F6KA 4CU7A 4U2AA 3LSEA 5JI7A 3MPPG 1OKQA 1W99A 4A3ZA 1W04A 1FMD2 1H2MA 3WDTA 4YFZA 2WNUC 5FPZA 5CIRA 2BGOA 2O8QA 1CJDA 3O1PA 4Y24A 2WN2A 1XOYA 2FZ1A 1QJEA 1QJU3 1W05A 2BBAA 4S2FA 3MHZA 2DFBA 4PBPA 4ZONA 3ZXAC 2GMEA 2BOJA 2JDYA 2WO3A 5FP4A 1OHFA 5FDBA 4AW7A 1RMU1 1R1A1 1PGW2 3ZYJB 1IPKA 1EUTA 3O1SA 1ZA4A 2XKPA 1CVNA 1JTZX 2VNVA 3WX5A 5CNAA 2LROA 4LKFA 4AI9A 1GOGA 1SLLA 3V0AA 2WZR2 4CUGA 5M0TA 2JDAA 2OQ6A 4D3WA 1W2AX 3EMRA 1AZDA 2R6QA 1YCIA 2VTXJ 4DUWA 1MQTB 4MHUA 1IPJA 2X10A 3VBHC 4GIQA 4JRAA 5FZ3A 4BPZA 1UZ0A 3HR9A 4UFHA 4ZXEA 1YI7A 5IVJA 4ISQA 3LDBA 2IXCA 4ATFA 2NP0A 4QX7A 4C1WA 2J1TA 2ZHLA 4NPMA 3RWKX 3T2TA 2ZGOA 3VUOA 1Z78A 3TB0A 4A44A 1HLCA 3ZIXA 3ZOIA 3U0ZA 2RE9A 2ZAHA 3OY8B 1REEA 4Y22B 3WQBA 3Q8BA 5I91A 4AOCA 5L7OC 2WZPP 3DYOA 3N9QA 5GZDA 1S1AA 5J3UA 3CU7A 2UY9A 1XJAA 1RUG3 3EQEA 3FLRA 3J7LA 5FMDA 3WNXA 2I45A 2QQIA 1RB8G 3BPSA 2DVGA 4BB3A 4EN6B 1O8SA 3B01A 3JU9A 4KH9A 1A6CA 4MGKE 1W8ZA 2RHPA 2DVBA 2GC0A 1W8OA 1K45A 2OS2A 5BNPB 3IBMA 4QDSA 1O91A 2PA7A 4WV8A 4Z8BA 1W2TA 4E4DX 4EN7B 5A6YA 3Q9OA 4GJZA 3IDEA 4IV3C 3U75A 4AVCA 1MZFA 5D1IA 1QXJA 1GANA 4YPJA 5C9AC 2AACA 2ET7A 1FMD1 5BNNC 2ORXA 1IS4A 3DXUA 2A3XA 5AC93 4XHXA 3VBFC 2CL2A 2QTWB 5FYVA 3JQWA 4HKOA 4UW5A 3JB4C 4Y3OA 2P2KA 4AFAA 5T54A 1LOAA 2ZXQA 4IE7A 2HWE3 1CR7A 3QOPA 3UGGA 4RGAA 4QPGA 4JQTA 1JZ6A 1LECA 2QQWA 4WBBA 4KL1A 1NA1A 2Q0AA 1WUVA 1PGW1 2LUWA 4TN7A 3UV9A 5LRRA 5A6XA 1S0BA 3M3OA 1HRV1 2JX9A 4CDUC 1ZX5A 2NLRA 2R072 2WZR1 3H3LA 2A6YA 2J1VA 2Z5WA 4Q8KA 5I8YA 3VHRA 1UU6A 5D8AC 3KGLA 3AKSA 5DUVA 5LBBA 4E4HA 4C8DA 1W06A 1POV1 4S2HA 3LCPA 2ATFA 2RVAA 3AYEA 2VO5A 3K77A 4ASKA 4IXLA 4QU2A 2ZBJA 3H3UA 2CHHA 2HJIA 4CPBA 3CJIA 1FX5A 4KQ7A 1Q8PA 5DAPA 1RMU3 2PQQA 3TAYA 1R1A3 3MLJA 5BNOA 5K4LA 4YM1A 1US2A 2C26A 2H0BA 4QQHA 3OGSA 4HLTA 5DG2A 1O3RA 2XJRA 4MUVA 4EN8B 5IT6A 4QPIA 5K0UA 5EPAA 1O8PA 3M2MA 2J1SA 3GGLA 1DGLA 3ES4A 4JZRA 1A34A 2UWAA 1XRUA 3OPZA 3H7JA 4F7ZA 1W9TA 5FCCA 3D82A 3MO4A 1FNYA 2VZQA 5BPXA 3S5AA 1YQ2A 1OMIA 1CAUB 1XNAA 4HZFA 4Z07A 1FV2A 4D94A 1S2KA 2BUKA 2QQKA 4COVA 5KXDA 2FQPA 4UW3A 4XAEA 4LJHA 1UYPA 5IFPA 5APAA 2C4XA 3VDDA 4CEYA 1UXXX 2E7TA 5FP9A 3H1YA 2XQXA 3LF7A 2XLAA 5I0UA 5CFDB 1GOHA 1MEC1 4C1XA 4LBMA 2D93A 2JEMA 2R062 4RL7A 1BBT1 3CZJA 4QPWA 1AX0A 5FO8B 4IEWA 4XF1A 2P1BA 1CPMA 4ZY9A 4FOQA 1G8WA 3HT1A 4CCDA 2Y64A 1OT5A 2IXJA 4FQZA 2CV6A 5H9SA 4M4PA 2AH2A 3B94A 3R4DB 4Q0PA 3C8XA 4OYUA 3S7IA 3UESA 4NIHA 1FMD3 2WWSA 2R071 4NPRA 1DQ2A 2WSUA 1WKYA 2W39A 2X5IB 1CGPA 4ZPIA 2BVVA 1YRZA 2Q1ZB 4LBKA 3TNQA 2JG9A 2PHXA 4QXBA 1BVVA 3ZR5A 1LJ7A 4MVTA 3W20A 1CAXA 2Q30A 1OFSA 2TBVA 1NCQA 3K3OA 5FK7A 4AEMA 2E26A 2Q8OA 1B09A 2BV4A 3VZLA 4C90A 2VXRA 4ARXA 1UZZA 4BQ2A 3F95A 4AGGA 1SFNA 4KG0A 4Q4V1 5HPOA 4YGBA 2P5BA 2GNBA 3MW2A 4A6OA 4MG2A 2VULA 2RJLA 1OOPA 2WZR3 3MBWA 3AKRA 1MS0A 1EY2A 1QXRA 1LEDA 3PJQA 3IB3A 1EV12 1YFYA 3FUOA 2QDNA 3GBWA 3AK0A 3WQ1A 3O1RA 1POV3 2W1QA 2RR13 2RS52 1C57A 3LIGA 2XG3A 4HK8A 4MO3M 3VBRA 4META 3C7OA 3SQOA 1NZIA 2RMU2 4LQRA 4DUVA 1MS3A 4FXGB 4CPBD 4FPJA 1UU4A 1OQDA 1GQHA 4W6XA 3OPTA 4XOGA 5DZEA 3V0BB 1VALA 2W2IA 1O4ZA 3CL1A 2VQTA 3O12A 3LEGA 3O14A 5JSOA 3SKJE 4FSJA 3BODA 4PF5A 1UAIA 5LK5A 3VBOB 4YW3A 1S0GA 2B8MA 3K48A 2DV9A 4OQ9A 1JZ5A 2IFRA 2FDGA 1LOFC 2VR4A 4IQPA 2R061 5LY2A 1Q8SA 3THTA 1HQLA 1PO22 1W6QA 2B7YA 5LBEA 4RN5A 5BNPC 1OUSA 3UYJA 5DZGA 5FXVA 3POFA 2XJPA 3RZGA 4XDOA 3DPRB 3WLUA 4Q4W2 3ZN5A 1C4RA 1MR5A 4AHXA 4PI2A 2B9VA 3J8F2 4FAHA 4BLJA 1WCSA 5FP3A 4CRQA 5K9YA 1G86A 1HRI2 1XNTA 3E5QA 3JBG1 2ARCA 2FMDA 4NMIA 3KM5A 1WBFA 4QWNA 4JGZC 3GJAA 5JXHA 4AGRA 4IGQA 2FDJA 5EP9A 3ZSMA 3APBA 1AHSA 3KMHA 2CWSA 1WA4A 4MXWA 2JKBA 3AP4A 3BTAA 1ND2B 3M70A 3I3QA 1QJFA 4Y1UA 5F3CA 1WW7A 2A71A 1WW4A 2JDZA 2RG4A 4NHLA 1QDCA 2JG8A 3HBZA 4NRMA 4QPGB 4YZ3A 1N47A 1ZYBA 3J7MA 5FOBB 1A3KA 3KV5A 3Q8CA 2W1UA 2WNUA 3N7KA 4F3JA 1I6XA 1AJKA 3ZPOA 2R073 1UMZA 1MVQA 3U14A 4IEXA 4DFSA 4PIXA 1AYM2 2CGPA 3AZXA 4BXSV 1D7PM 4LOSA 3HJRA 3WP6A 1EV11 1ULPA 2C0ZA 2HLEA 3SCGA 4KWJA 4XETA 3BTZA 2RS51 2YXSA 1N1TA 2WABA 2RMU1 1DCSA 2VQAA 5F3GA 3A7QA 3EHKA 4DRVA 1JZ3A 3CJIB 2RJ2A 2IFWA 2Q5TA 1KD7A 3WP3A 3AVRA 3LEMA 1GP5A 3L2YA 4XILA 5FQ0B 3FMGA 3SCHA 2C9KA 3PURA 2YY1A 4GULA 3RYKA 1AX1A 2JD4A 3RMXA 2WFF3 1JW6A 1W9SA 3A4UA 2Y0OA 3MDPA 3PUIA 4KWLA 5IYYA 2ZMKA 1NOVA 2D6OX 5K7PA 2QDRA 3N9OA 4NPLA 4A45A 4CXYA 4OZOA 4LBOA 3I2HA 4ZZ5A 3TYJA 1AF9A 2NMNA 1JUIA 1HV1A 1KEXA 2EALA 2WAOA 2VQUA 4LO8A 5E8AA 1OH4A 3WDUA 3WF4A 3HVDA 3KWVA 3N35A 4HPKA 4Q4W1 3WINE 2PN5A 1S0JA 5BUVA 3LOBA 1PM4A 3FFQA 4LBLA 3VL8A 3J8F1 4FPHA 3GF6A 3WF0A 3ZFGA 3E6BA 4OUEA 4P9XA 3S6PA 2MNGA 1HRI1 4IE5A 5FLIA 1O7FA 4I0AA 4LUKA 3TN92 4PIYA 4HKWA 4XFAA 3VBSC 1RUJ2 2RS32 5FYTA 1WW6A 4YVSC 5FR3A 3T1LA 2PHDA 4AHWA 4YZ2A 1UKGA 4DO0A 4AVBA 1D0GA 1C1LA 5B2GB 2E51A 3WG1A 3GXUA 2G9FA 1J58A 3FHAA 1DZQA 3MUY1 4QPYA 1QOTA 3EO6A 2WO1A 4CP9B 4NJ4A 5BNNA 1VMJA 1RUF2 2I07B 2LM3A 5LWBA 2GC3A 3VKNA 2DF7A 1IQDC 1LHWA 4YGCA 2WAAA 5KC5A 3RSJA 4MGTA 4BIOA 2G9GA 4MX3A 4L11A 4HONA 1J1LA 4MHRA 3V56A 3VD5A 2JE7A 4XBNA 4DZGA 5KC6A 3AMMA 2X09A 4MH0E 3KHBA 1GZCA 1HB2A 5FREA 5LK7B 1DYKA 2C5DA 2JDUA 2RDRA 5FZHA 1RVF2 4BQWA 5FZAA 1PIV1 1NCQB 3TEXA 3AFKA 4FO9A 4AEJA 4FOWA 1OXCA 2IXIA 5IFTA 1DIWA 2OPWA 4AVAA 1LR5A 1BKZA 4XFGA 3WP4A 5IVYA 2BGCA 3JD72 4DY3A 5D8AA 4CU9A 2DU0A 3GNEA 4GH4A 4NOTA 1EV13 5A1AA 3MIFA 2WNVA 3WNPA 1XBFA 4QM8A 1N1YA 2RS53 1S0CA 4IV1C 4NO4A 3LPFA 1PK6B 2RMU3 2A6VA 2VOKA 4MGZE 3D0JA 3VKLA 1A8MA 3MICA 2XUMA 1WCUA 5JVVA 5HV0A 4H7MA 3I3MA 3ZVXA 3ZX7A 1LOBA 5FZDA 3MV01
chains in the Genus database with same CATH topology
1YQ5A 1YQ6A 1YQ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YQ5 A;  1YQ6 A;  1YQ8 A; 
#chains in the Genus database with same CATH topology
 1UY3 A;  1EPZ A;  2WYS A;  1VRB A;  3OGV A;  3VBO C;  4JRL A;  5H9R A;  1ZZ6 A;  4FBF A;  5I8T A;  1MZ6 A;  2P3I A;  2QJV A;  3KCY A;  4QX5 A;  5FPB A;  5HCA A;  3VDB A;  2ID4 A;  2D43 A;  4AAX A;  4V2V A;  2ZGP A;  5JMO A;  1AJO A;  1UY1 A;  1X9P A;  3BU7 A;  3PUQ A;  3VBU B;  3TN9 1;  4ZZ8 A;  3OCP A;  2DCK A;  4BOW A;  2BQP A;  2GN7 A;  2RS3 1;  1S2B A;  1JHN A;  1QNY A;  5G04 L;  2CNA A;  3VLB B;  1DGW A;  4PLM A;  3CHX A;  4BHP A;  1PO2 3;  4HVO A;  5FZC A;  4QX1 A;  4K40 A;  3W58 A;  4WM8 C;  2IXH A;  1E5R A;  1W6Q B;  3M1H A;  5F2W A;  1Y9Q A;  4Q0S A;  5FYB A;  3RYP A;  1ZRC A;  3B69 A;  3NAP A;  4K1Z A;  4X6Q B;  4Q4W 3;  4E27 A;  1GZ9 A;  4I0W B;  4AI2 A;  1RUF 1;  1MS1 A;  1KIT A;  2D5F A;  3PMS A;  5DN2 A;  1YQC A;  1X8E A;  4P00 B;  3ME2 A;  1R64 A;  1HRI 3;  4XXA A;  3VHO A;  4CXX A;  1Z0H A;  2QQM A;  2ZKL A;  1CES A;  1QMJ A;  1IZ3 A;  1KQR A;  1NXD 1;  5ACA 1;  5JWP A;  1GV9 A;  1XE8 A;  4XIK A;  1ND2 C;  1N1S A;  5D2A A;  3MW4 A;  4OVE A;  1BCX A;  2ZOE B;  3CIH A;  4LO6 B;  5A6Q A;  5A80 A;  4EWE A;  1GP6 A;  1L7R A;  1RVF 1;  3LEI A;  2BPA 2;  4CDW B;  3ASI A;  3AP7 A;  1X7N A;  2W92 A;  1ZBA 2;  5JXJ A;  4QQO A;  4RR3 B;  1BXH A;  2MPF A;  1F5J A;  2YG0 A;  3OUH A;  1SBD A;  4BU2 A;  5J09 A;  2GNT A;  1XND A;  3PU3 A;  4H2A A;  3R0R A;  3B3Q E;  4ASM B;  2QQP A;  1K5J A;  1DF0 A;  3LEK A;  3PME A;  1VAV A;  4A6S A;  1SFP A;  4ZHN A;  1YXW A;  1YI9 A;  1N3O A;  3JD7 1;  2XLF A;  4LHS A;  1YLL A;  3WG4 A;  1AYM 3;  1ENR A;  1GU3 A;  5FZB A;  2ZCW A;  4E2G A;  3SMH A;  4XC9 A;  1SBF A;  3WCS A;  4RQP A;  3ACI A;  1GYK A;  4YZ5 A;  1PGL 2;  4Y1Z A;  5FZ8 A;  4QHO A;  3OPW A;  5GM0 A;  3O7O A;  1V70 A;  4B7K A;  4EZH A;  3OD4 A;  4M0N A;  2CDO A;  1J3P A;  1H2N A;  1T6G C;  3M4F A;  4WVM A;  2XL7 A;  4XE9 A;  2XJS A;  4KU8 A;  1ULF A;  4FOY A;  2BOI A;  1YJK A;  5A3L A;  5C8W A;  4CDQ C;  4XF3 A;  3WCR A;  2XKO A;  4XBL A;  1IS5 A;  2E53 A;  1NLR A;  2R30 A;  4RGK A;  1N3Q A;  1F8V A;  4Y20 A;  2G1M A;  5KHI A;  1UMI A;  1YIP A;  1YIF A;  2WWU A;  1ONA A;  4XJ8 A;  4I3G A;  4BQ4 A;  5C8C B;  5FMO L;  2JXA A;  1OI6 A;  4RHV 2;  4H55 A;  2ZGR A;  1IPS A;  1US3 A;  1VBC 1;  1QJX 2;  2OKX A;  3GJB A;  1AR6 2;  4I2O A;  1ZNP A;  2QKD A;  1FOD 2;  4FPK A;  2IC1 A;  4B1M A;  2B9U A;  5GJ6 A;  2GC1 A;  1H4H A;  3POY A;  4PDW A;  1OVP A;  3NST A;  2VUD A;  3TEY A;  2J22 A;  2DU1 A;  3AZW A;  4HPK B;  4XCB A;  4UFJ A;  1X8M A;  3BVC A;  1DYO A;  4CDX B;  4N53 C;  3LA2 A;  1Q56 A;  2P6H A;  2VCB A;  1LOF A;  3ZFG B;  3KT4 A;  5FKC A;  4CZS A;  3FHI B;  2IXK A;  3J4U H;  3FJS A;  3ZDS A;  1RUJ 3;  1OBN A;  2CAU A;  1WZX A;  2W94 A;  3K4A A;  4ORF A;  2CY6 A;  2WA4 A;  3OYW B;  3HWJ A;  3EXU A;  3POB A;  4XQ4 A;  3N3H A;  5JR7 B;  4QXK A;  3GZT B;  4B3N A;  3SNM A;  4J6G A;  4DRR A;  1UF2 C;  1LKN A;  2PHR A;  1ZBA 1;  4UYB A;  4LXL A;  4L0P A;  4CEW B;  2ARB A;  1RUF 3;  2R1D A;  5C3Q A;  4M3C A;  4XUR A;  4JGZ A;  5F5Q A;  3M7A A;  3MW3 A;  3H8U A;  3C7G A;  1OKO A;  4KBZ A;  2XWB B;  3NWK A;  5FLJ A;  1VBB 2;  2VPV A;  3P1I A;  4IEU A;  4J1W A;  4YG6 A;  4I30 A;  4P5Y A;  1RYY A;  5J7M A;  2R0F A;  1VBD 2;  2PLV 2;  1ODM A;  3LAG A;  1RC6 A;  4PQ9 A;  4RYD A;  3ABZ A;  5FXX A;  4FQ4 A;  5T3N A;  1PGL 1;  4EE2 A;  4N9I A;  1RVF 3;  3KHC A;  4DXS A;  1ZZ7 A;  1PM7 A;  4AED B;  5DAV A;  4KGQ A;  1FAY A;  4NRQ A;  2QBX A;  3RZJ A;  1OA4 A;  2DCZ A;  4XJA A;  4JKM A;  1EYB A;  4PI0 A;  3BTX A;  3P3N A;  1XE7 A;  2YMZ A;  2B4K A;  2ES3 A;  3ILR A;  4LHL A;  4N43 C;  4AR2 A;  5C70 A;  3JD7 3;  2VXJ A;  4HN1 A;  4A2U A;  3PTR B;  1QH7 A;  3NJX A;  3ZN4 A;  2XJU A;  1JYC A;  4QGL A;  4XTP A;  2D6L X;  3U4S A;  3C7F A;  2BBV A;  4GH4 B;  4UT5 A;  1HXS 2;  2DBN A;  5A3W A;  3ZSJ A;  2WNV B;  5ANN A;  5GAL A;  3CO2 A;  4YVW B;  1EUU A;  1HJG A;  5LA9 A;  3ATG A;  1IKQ A;  3GHM A;  1O5U A;  1QJX 1;  5JR2 A;  1AL0 G;  1AR6 1;  4XAC A;  2NZ9 A;  3PIG A;  3P3P A;  1FOD 1;  3C7E A;  3MLL A;  3AL5 A;  1SBE A;  2OPK A;  1XSQ A;  3K3N A;  3LOI A;  4U36 A;  3DEC A;  4Q0U A;  3VBU C;  3H8X A;  4K1Y A;  1RUI 2;  2W5F A;  1SMV A;  1URX A;  1YEW A;  4AQT A;  1QU0 A;  2Y6L A;  2FDI A;  3T2O A;  1Q43 A;  1R08 2;  5CB7 A;  4CCO A;  3R05 A;  1K42 A;  3ZFF B;  1Y43 B;  1AYN 1;  3ZXG A;  2DUQ A;  3C2U A;  1TEI A;  4P9J A;  2VTX A;  2IXL A;  4CSW A;  1D0H A;  1RIT A;  2A6Z A;  2ZX2 A;  1C3H A;  1GUI A;  4EN9 B;  2DCJ A;  4QU1 A;  1JU3 A;  3MID A;  2WT2 A;  5FY0 A;  2WNO A;  2HYX A;  3PU8 A;  3ZFE B;  4NHX A;  4WM7 A;  3H9A A;  1MZE A;  2WIN B;  4XQW A;  4JX0 A;  4XTM A;  2ZAA A;  3RDI A;  5FXW A;  3VBS A;  4CP2 A;  4ES9 A;  4YVS A;  2KR2 A;  5T55 A;  2GP3 A;  3W59 A;  3ZMO A;  4AGV A;  1CAV B;  4M00 A;  5FY1 A;  4CYD A;  2OZ6 A;  1VBB 1;  4OMD A;  5IUQ A;  3O5S A;  5FBZ A;  1FNZ A;  3O1T A;  1H2K A;  1UOG A;  1D4M 2;  1HN0 A;  1MS4 A;  1VBD 1;  2PLV 1;  3OEA A;  3GZE A;  2WQZ C;  4QGN A;  4R52 A;  3VKO A;  4CDW C;  2DVA A;  1OF3 A;  1V9U 2;  2MEV 2;  2GAL A;  2ZPX A;  1VBA 2;  4RGG A;  1RUN A;  3ACH A;  3C7H A;  4QB6 A;  1OA2 A;  4PQQ A;  1HRV 2;  1ZBA 3;  4OUL A;  3JZV A;  4YM3 A;  2UU8 A;  2AEY A;  4GB3 1;  3OBR A;  1QGL A;  4JDM A;  1Q8O A;  1I5Z A;  1OC1 A;  5JZG C;  3USU A;  3O1V A;  4AI0 A;  2ZX3 A;  4AQS A;  1V6M A;  1TME 2;  3ZO0 B;  5ABJ C;  2ZGU A;  5FZM A;  1BJQ A;  4GMP 0;  2R7E B;  1WW5 A;  1TMF 3;  5LZ6 A;  2ZGM A;  3WDX A;  1HXS 1;  3ZXL A;  2ARA A;  3AP6 A;  2J1U A;  2DCY A;  2GAU A;  4IES A;  5FZG A;  2V73 A;  1LGB A;  1XU1 A;  4RQP B;  1V6K A;  1LEM A;  4AVS A;  4E4Z A;  5DUW A;  4RS5 C;  3MGU A;  3IDB B;  4LKE A;  3ZYG A;  3LWC A;  1QDO A;  1TE1 B;  2QUO A;  4MYE A;  4AQ6 A;  4AYU A;  5I0D A;  5LEK A;  4WVM B;  2MHF A;  3AZV A;  1DGR N;  1NCR A;  4GKX A;  4D7T A;  2JIC A;  1RUO A;  1SLT A;  3RWN A;  3T2P A;  1QQP 1;  5FY8 A;  4Q4Y 2;  3RZM A;  3T0D A;  3VD4 A;  3OG2 A;  1XYN A;  1RUI 1;  3KF3 A;  2PAE A;  4IV1 A;  5C8C C;  3IIA A;  2PTM A;  4WVW A;  4TTG A;  3WNL A;  5C7G A;  5JOY A;  1R08 1;  4Y1X A;  4JGY B;  1D2Q A;  1ZZ9 A;  4Y20 B;  5GZC A;  2Y34 A;  4GXL A;  4RHV 3;  4RSU A;  3BUC A;  5FZ1 A;  3ZXF A;  1QJX 3;  1K5M B;  1AR6 3;  2Z2S B;  5LRS A;  3ZLI A;  3WHU A;  5FBJ A;  5J36 A;  1IGO A;  5SV5 A;  3AYD A;  1UWW A;  2EIG A;  2WZE A;  4X6R B;  3HN3 A;  4LUM A;  1NX9 A;  5FKB A;  2Y6J A;  3ZM8 A;  4CDX C;  4AAP A;  1J59 A;  3WNN A;  5EIY B;  4MXV A;  1R09 2;  1MEC 2;  5FRA A;  1BEV 2;  1ZZB A;  3VZJ A;  2ZX0 A;  1XSR A;  1BBT 2;  2WII B;  5CBL A;  2VM9 A;  2WUH A;  2PXJ A;  3D8C A;  5GLV A;  4BQY A;  5FOJ B;  5HCF A;  3RZK A;  1H8T A;  3USS A;  5A3N A;  2CGO A;  2YZ4 A;  4WM8 A;  2GH2 A;  2A6X A;  4OQ8 A;  1D4M 1;  3HOB A;  3RZZ A;  1X33 A;  2JDK A;  2A3Y A;  1W0P A;  2MEV 1;  1V9U 1;  1F31 A;  1PO1 2;  1VBA 1;  3GDB A;  3VHP A;  3WUC A;  5A32 A;  1GWM A;  3U07 A;  3D5O A;  5C4W A;  5DG1 A;  1CN1 A;  4MLO A;  1IKP A;  1ENS A;  3DGT A;  3HMY A;  1H8V A;  4FPF A;  1ZRR A;  2OVU A;  1AR8 2;  1WLT A;  3JB8 A;  3IM0 A;  1ULG A;  3KS7 A;  5FXZ A;  1TME 1;  2TUN A;  4IEV A;  4LR4 A;  3T09 A;  1UYX A;  2WLQ A;  5FAX A;  4YYO A;  2AEZ A;  1VBB 3;  4CCN A;  4XJU A;  1GKB A;  3UL2 A;  1LU1 A;  2ZEZ A;  2CDP A;  1VBD 3;  2PLV 3;  3MPB A;  4FPY A;  2ZHN A;  1GQP A;  2FCV A;  1AXK A;  1K12 A;  5CFC B;  2VVD A;  4Q4V 2;  2OW4 A;  2OUJ A;  4Z2W A;  3I59 B;  4XUP A;  2VMG A;  4IEZ A;  1HDK A;  4GA9 A;  5HI0 A;  5JSP A;  3BIE A;  2VD7 A;  4IGO A;  5F1R A;  5IHR A;  3CNA A;  4BXF A;  4AI1 A;  4Q4Y 1;  2HEW F;  3EYP A;  3J7N A;  5FK8 A;  2EAA A;  4HVR A;  3U4X A;  1RUC 2;  1G7Y A;  1HXS 3;  1FYU A;  1GIC A;  2AGS A;  1LOG A;  2KA3 A;  4YVW C;  1CWP A;  1CIY A;  1S0F A;  3J26 N;  1IS3 A;  2IVJ A;  3POJ A;  3T0B A;  4COW A;  2VJX A;  4XXP A;  5I0T A;  5E6H A;  3WV6 A;  2VOT A;  5CVR A;  4CDQ A;  4K3U A;  3A21 A;  2XVL A;  1N3P A;  1RJ8 A;  2ZJC A;  3GZA A;  4A7K A;  3VN4 A;  1UXZ A;  1I1E A;  5FWJ A;  1H0B A;  2B42 B;  1F2N A;  1DYP A;  3IPV B;  2K2S A;  3TNP B;  1RXF A;  4PF1 A;  1RUI 3;  4CCC A;  5C3S A;  1B35 B;  1R09 1;  3CBN A;  3III A;  4GWI A;  5GLW A;  4CE8 A;  1SDW A;  3FE5 A;  1BEV 1;  3ZFF C;  4PBO A;  1E5S A;  1R08 3;  1FI2 A;  1U5Y A;  2W0X A;  3BAL A;  2VBB A;  2Y6K A;  1H1A A;  1ND3 C;  4XDQ A;  1Q8Q A;  2ZEY A;  4KU7 A;  2Y60 A;  3IT8 A;  4TYS A;  2YFZ A;  2EXI A;  1PO1 1;  1F9K A;  3RMY A;  4CUC A;  1LU2 A;  4TLG A;  3SCF A;  3JBG 2;  4NII A;  5BYN A;  4Y26 A;  3INA A;  1W8T A;  4N53 A;  3T0A A;  1TNR A;  4DXT A;  3KLS A;  3VDA A;  1JZ4 A;  4N7U A;  4WM7 B;  1AR8 1;  5FYH A;  2J1R A;  1GZW A;  3UGF A;  3VZK A;  3KQR A;  4TWT A;  1NZC A;  1SPP A;  4Q1P A;  2P3Y A;  4OUM A;  1W39 A;  4QQP A;  3KCC A;  4UF0 A;  1D4M 3;  2EIC A;  2UYA A;  2XJQ A;  4HXC A;  3GM8 A;  5DAQ A;  4OLL A;  4MOA A;  3N9L A;  2MEV 3;  4YRD A;  1V9U 3;  2DWR A;  5FTT C;  3BU0 A;  4DQA A;  2PHU A;  2P34 A;  4IGP A;  1HRV 3;  4IEP A;  4UBH A;  3PJY A;  4IUG A;  4P08 A;  3D6E A;  2BWA A;  1YQ5 A;  1MQT C;  1QEX A;  5LA0 A;  3V0A B;  4D6S A;  2WL1 A;  1OUX A;  3WP5 A;  4CUA A;  4XHB A;  1QJY 2;  3FLT A;  1D2S A;  5EWS A;  5FZ7 A;  4NIA A;  1TME 3;  1J3R A;  3G6J B;  4AG4 A;  2KM2 A;  2P3K A;  3VD9 A;  5FUI A;  1DG6 A;  2J1A A;  2ZZQ A;  3PDQ A;  3ZSL A;  3FC0 A;  1RUC 1;  3BB6 A;  5T52 A;  3AMH A;  1W3X A;  4XJZ A;  2VZ3 A;  1W2O A;  4C0B A;  2ZX1 A;  2OYZ A;  2OX0 A;  2R04 2;  3LDK A;  4N8M A;  3WHT A;  1QKQ A;  1PGS A;  4Q29 A;  4N43 A;  4AFC A;  1UN1 A;  4Y5S A;  1UL9 A;  5FPU A;  4FTB A;  1VE0 A;  2A5Z A;  2OUH A;  1DU3 D;  1S0E A;  1WLC A;  1QXP A;  5A1F A;  4PJY A;  1JBC A;  4LLF A;  1W6N A;  4KMQ A;  2PHF A;  2XOM A;  1NCR B;  2PMW B;  3AL6 A;  2BDR A;  3B5L B;  4JGY C;  4F83 A;  5FPX A;  2YHJ A;  3FBM A;  1WMX A;  4W6Y A;  1ZVF A;  3RJ2 X;  2H0V A;  3IN9 A;  3ILF A;  5I0R A;  1X9T A;  4Q4X 2;  3OGJ A;  3FWE A;  4LEJ A;  3KQ4 B;  3NV2 A;  4FFH A;  2FDF A;  2Q1M A;  1LOD A;  4Z92 B;  3UK9 A;  3UJO A;  1HQW A;  2YGM A;  4NHY A;  3RG0 A;  4FTS A;  2I2S A;  2YU1 A;  4QX3 A;  1JMU B;  4QB1 A;  5LW9 A;  3RPQ A;  5LB6 A;  1MEC 3;  1BEV 3;  4FPG A;  1BBT 3;  3NL1 A;  5FMC A;  4Q5O A;  2EIE A;  1MZ5 A;  3QCW A;  4MGY E;  5C33 A;  4QKD A;  3CZU A;  2WFP A;  1H8T B;  1ULD A;  4XYX A;  2Q8D A;  1JH5 A;  4J1X A;  4ZS2 A;  4EQV A;  1NA1 B;  3AZY A;  1O3S A;  1EAH 2;  2G9Z A;  1PO1 3;  2VBD A;  3DEM A;  1AR9 2;  3LB9 A;  4NHK A;  4ZU4 A;  3ZYF A;  2Y0I A;  2XHK A;  3AKQ A;  1OD3 A;  3IMM A;  4JAA A;  2WYF A;  2QNK A;  3VD7 A;  4I3P A;  2VOV A;  1VLN A;  1QJY 1;  5BXX A;  2ZTN A;  1APN A;  5DPN A;  3FN9 A;  2Y26 A;  3MUZ 1;  1J83 A;  1JI6 A;  3ZYP A;  1DDL A;  4AVT A;  4YW1 A;  2ORZ A;  1PIV 2;  4B4R A;  4DXZ A;  1PNG A;  1SLB A;  5CFC C;  1QNW A;  1A78 A;  4HG6 B;  4XZU G;  4NID A;  1HQN A;  3GYD A;  4K8R B;  4Q4V 3;  1LGN A;  3ZYB A;  2HWB 2;  3LSD A;  3E5U A;  2R04 1;  5BNO B;  2JDP A;  5H9Q A;  2EID A;  1RUH 2;  5A3M A;  1X50 A;  4PT6 A;  5T5O A;  3VBH A;  4AF9 A;  5ABJ A;  1YWK A;  4LA2 A;  3WW4 A;  4HN0 A;  4QPI B;  5F5I A;  3RFR A;  4F8A A;  5K0U B;  3BKZ A;  2NPI A;  3Q8A A;  1GP4 A;  4CVU A;  3ZXE A;  4NVP A;  1AL2 2;  2J1E A;  4LMF A;  5JCT A;  5EZW A;  4AHZ A;  3ITQ A;  4KGG A;  1LTE A;  1RUC 3;  2VW0 A;  4EV0 A;  1KS4 A;  4NN0 A;  4QMA A;  3KB5 A;  3RYR A;  3WDV A;  1GSL A;  4Q4X 1;  3LA7 A;  1KDM A;  1BK1 A;  4DPN A;  3NV3 A;  3S57 A;  3T4V A;  2VMD A;  4YW5 A;  3HQU A;  2D6P A;  3MF6 A;  4OI1 A;  2O8O A;  4QHZ A;  3B9I A;  5CFD C;  1DBN A;  2QZ3 A;  3O0X A;  2CU5 A;  4WVZ A;  5FIX A;  5L9V A;  2DVF A;  5FZI A;  3WEZ A;  5KXC A;  4AVV A;  3VDD B;  1GBG A;  2GNM A;  1XU2 A;  2WS9 1;  3VV1 A;  5E1R A;  2D98 A;  5EHD A;  4CEY B;  4XF4 A;  2R06 3;  1MS8 A;  4OHZ A;  1JOP A;  2VBP A;  2D7F A;  1IOA A;  1JYN A;  4YM2 A;  4CCE A;  2JE9 A;  1O4Y A;  3ZMN A;  3H7Y A;  3K2O A;  2HKX A;  3AM2 A;  4IV3 A;  1ALY A;  3AP9 A;  5C9A A;  3ST7 A;  5KHG A;  3I97 A;  2EAK A;  4XFI A;  1EAH 1;  4O9G A;  1AR9 1;  1COV 2;  4CUB A;  4GD4 A;  2X5I C;  4MZU A;  5A33 A;  3GHN A;  3JBG 3;  5A7W A;  5A7P A;  3VBF A;  5C3P A;  3AKP A;  4IDZ A;  3WY6 A;  3WW1 A;  3E6C C;  1W03 A;  4UOJ A;  5ACA 2;  1A8D A;  3BYW A;  3LQC A;  1F35 A;  2C9A A;  1LOE A;  5JXG A;  1J3Q A;  4LBJ A;  1XC6 A;  5FWE A;  1W6O A;  5EYX A;  4GQ7 A;  4AQ2 A;  5IVC A;  3KSC A;  2ZHM A;  1JYI A;  2E6V A;  2P37 A;  2TNF A;  1SFY A;  5EFU A;  2JG9 B;  2JIJ A;  3T4H B;  3WSO A;  3NNL A;  1TZO A;  4YNI A;  1CAX B;  2I74 A;  4IET A;  3NKG A;  1WWY A;  1QOS A;  1LNS A;  2QQV A;  5FYU A;  3OJB A;  2VU9 A;  2YFU A;  1R1Z A;  4IW3 A;  4CDU A;  2JDM A;  5B4X A;  1DLL A;  1LHU A;  3WT3 A;  3FX3 A;  2HWB 1;  3GCW A;  4Y5T A;  2F4P A;  5HXV A;  1DGW X;  3K51 A;  3K75 B;  1VPH A;  1RUH 1;  2W95 A;  2VZO A;  2VH9 A;  1OOP B;  3M3I A;  1XNK A;  1QJY 3;  1QOO A;  1NG0 A;  1V6J A;  5JIA A;  2V5Y A;  4AL9 A;  3POI A;  1KRI A;  1AL2 1;  3ON7 A;  5DDJ 2;  1UW8 A;  2WO7 A;  5C5U A;  1UY4 A;  3TEW A;  3VBR B;  2QQJ A;  4QM9 A;  2Z79 A;  2Z42 A;  3BOP A;  5CIS A;  5IVF A;  2WJS A;  3ZN6 A;  4YGE A;  3J7H A;  2D6M A;  4LO7 A;  3ZKU A;  1SHW B;  4D7Y A;  2B45 X;  2R04 3;  4I02 A;  3ZXK A;  3OGG A;  4UI9 L;  2BFU S;  1O4T A;  5T5P A;  4TZD A;  2XL9 A;  5A7S A;  3HT2 A;  1PX3 A;  2ZHK A;  1AR7 2;  1H9P A;  3I3B A;  3L2H A;  4W8J A;  2V4V A;  1ZRI A;  5JOW A;  4WZF A;  5JI9 A;  1ZBE 1;  4MAD A;  2VW1 A;  3FUQ A;  1LEN A;  2SLI A;  2W08 A;  5E16 A;  1TVG A;  2LRP A;  1VBC 2;  4GAZ A;  2VZS A;  3LPG A;  1UOF A;  2UWB A;  3UJQ A;  1PMJ X;  1W9W A;  3DPR C;  4Q4X 3;  3UKV A;  4AI8 A;  2E7A A;  4OI0 A;  5DMY A;  2GZW A;  3IDC B;  4AI3 A;  5CEH A;  1W6P A;  1SG3 A;  1DQ0 A;  2BGP A;  4X8P A;  4NAO A;  1JOD A;  3J8F 3;  3OB8 A;  2XON A;  5KHH A;  3SKV A;  1COV 1;  1PZ8 A;  3AXD A;  2D3P A;  1NY7 1;  5IK7 A;  2DUP A;  2PHT A;  2D5H A;  5D21 A;  3WNK A;  3NV4 A;  1PMI A;  4A42 A;  2Y38 A;  2VL4 A;  3NMB A;  2XHN A;  3LFI A;  4HMZ A;  4EWD A;  2ZX4 A;  3PUA A;  3MEP A;  4KBB A;  4XFH A;  5FZ0 A;  3V65 A;  2L9L A;  5FYI A;  1SLA A;  3PVB B;  1ND3 A;  1LHV A;  1UPI A;  1GNH A;  4B4P A;  1VJ2 A;  5BV6 A;  2AZ5 A;  1CD3 G;  2PAK A;  2P3J A;  1XNB A;  4QPG C;  4MXW B;  1W9Y A;  3WR0 A;  4RD7 A;  1NA1 C;  2J7M A;  4HT1 T;  1PZ7 A;  4KI5 M;  3KGZ A;  3WQ7 A;  3Q8E A;  4EZ4 A;  2H6B A;  1EAH 3;  2JG8 B;  4DUX A;  1AR9 3;  1V00 A;  4Q0V A;  1NLS A;  2VQ0 A;  5KHK A;  5CG8 A;  2DYC A;  3KV9 A;  2WNU B;  3T2Q A;  3NW4 A;  2YBS A;  2Q8C A;  3DV8 A;  2HWD 2;  2R32 A;  5FYZ A;  4BA6 A;  1JU4 A;  4LKS A;  4NWW A;  1BVP 1;  1CZS A;  2X8K A;  3RNS A;  2ZGQ A;  3LDR A;  5A3T A;  2JE8 A;  2NYY A;  2V09 A;  4JKK A;  1LCL A;  4HKL A;  5ERL A;  3J9S A;  4V1P A;  4BIS A;  3WQ0 A;  1WLW A;  3CJI C;  5DDJ 1;  1PIV 3;  4RFR B;  3AB0 A;  3WF1 A;  4OI2 A;  5DAB A;  1UU5 A;  1OF4 A;  2RJK A;  1IHM A;  3N9M A;  3AKT A;  5F32 A;  1C28 A;  1MQT A;  1S0D A;  4DNY A;  3ZYR A;  4YW6 A;  2HWB 3;  4HK9 A;  4R8H A;  1G9B A;  3S30 A;  1ENX A;  1RUH 3;  4KWK A;  2JDN A;  4K7J A;  2DVD A;  1UY0 A;  4QPI C;  5I0S A;  2W47 A;  1AR7 1;  1DQ6 A;  3OF1 A;  1PNF A;  2EIB A;  2PEL A;  2OT7 A;  1S2E A;  2W91 A;  3VBH B;  2XGX A;  2G19 A;  5A6Z A;  2O0O A;  3POG A;  4JHZ A;  3HQX A;  3QD6 A;  1CX4 A;  2R0H A;  4JTO A;  4X8N A;  4AK3 A;  2LW8 A;  2R49 A;  3AC0 A;  2VZR A;  1I5P A;  4EWA A;  2LS6 A;  5FP8 A;  3U1X A;  3GAL A;  3OY8 A;  2W46 A;  4LIT A;  4Y22 A;  5L9B A;  4GWM A;  4BQ3 A;  4XJW A;  2DTY A;  1BMV 2;  5HBA A;  5GLZ A;  3RZL A;  1REF A;  3ECQ A;  3PVO A;  2XDV A;  1WME A;  3ZYI B;  5L7O B;  1UYY A;  1DGR A;  3PNA A;  5IAV A;  5A7O A;  1NQJ A;  2VOX A;  4LOR A;  4J25 A;  3KVA A;  4COZ A;  2AUY A;  2D3R A;  4CEY C;  2VZP A;  2FCT A;  3TN9 3;  4URA A;  4JHT A;  5BNP A;  3B7M A;  2RS3 3;  2WKK A;  1VAM A;  3JUU A;  1AYN 2;  3H50 A;  4GWN A;  1U5I A;  1POV 0;  3AJY A;  2FZ2 A;  4OCT A;  3M3Q A;  2PHW A;  4QDR A;  2JWP A;  3O1M A;  4ERO A;  3R6S A;  1PVX A;  3H8R A;  1TNF A;  2N7G A;  1W8N A;  2XR4 A;  4DMI A;  1NAE A;  1JZ7 A;  4L92 A;  4JC1 A;  1H1M A;  4IV3 B;  5FFO C;  5A7N A;  4ES8 A;  2CWM A;  2BWC A;  1COV 3;  3N7M A;  2ZGK A;  3WF3 A;  2RDQ A;  5BNN B;  2GN3 A;  3RI9 A;  4BYY A;  2W68 A;  1XQN A;  4P9Y A;  1H9W A;  3MZH A;  2HEV F;  2DUO A;  3M3E A;  2HWD 1;  3LZZ A;  5A7W B;  3RQ0 A;  5ACA 3;  3VBF B;  2BYV E;  1V0A A;  5F3E A;  3NQH A;  1Y9G A;  1UNB A;  3I2I A;  3L9J T;  1Q5O A;  3PTY A;  1O5L A;  1UZW A;  4LOT A;  1EPW A;  5IVB A;  2O14 A;  4L97 A;  1NCQ C;  2AYH A;  4COU A;  2GC2 A;  3FBY A;  3NVC A;  1W6O B;  1Q8V A;  4A3X A;  2AR6 A;  2P6C A;  2XJT A;  5JSR A;  3KT1 A;  1HN1 A;  3WDW A;  2QVS B;  4GB3 2;  3DKW A;  4MGI E;  4G9S B;  2F4L A;  2XB6 C;  1OOP C;  2XH6 A;  1MVE A;  1UO9 A;  4D8M A;  4LT5 A;  1PHM A;  1PZ9 A;  1PVC 2;  3D0S A;  3IDA A;  4XFB A;  3WDY A;  4GJY A;  5D8A B;  1ZZC A;  2CGN A;  1PK6 C;  1VBE 2;  5HCB A;  1LUL A;  5C3O A;  1P8J A;  1YO8 A;  3HN1 A;  4K20 A;  5FPA A;  4XUT A;  5DDJ 3;  3BTY A;  4LIV A;  2BRT A;  2GU9 A;  3N9N A;  1G9C A;  3O1O A;  3I2F A;  1VP6 A;  3SLI A;  4LO5 B;  5HCH A;  3I49 A;  4PLN A;  5GZE A;  2PHL A;  3HIF A;  5GZF A;  1BMV 1;  1UD1 A;  2ZMN A;  2C1F A;  1KS5 A;  2VG9 A;  1M4W A;  2ZML A;  2ET1 A;  2VAU A;  1QQP 2;  1W2N A;  3ZPY A;  2CYF A;  1OLR A;  2E33 A;  1AR7 3;  5CZK A;  4R4Z A;  1VRH 2;  2WO2 A;  3I3D A;  4XMI A;  1RXG A;  2WDB A;  4LLO A;  2A6W A;  5A70 A;  2VY0 A;  3THC A;  3VL9 A;  4FOV A;  1CZT A;  1H2L A;  1CAU A;  1NQD A;  5A7Q A;  1F4A A;  5ISL A;  2DBI A;  3MV1 1;  2XBO 2;  1O59 A;  1VBC 3;  2FCU A;  1FAT A;  2BU9 A;  5HXM A;  4YW7 A;  3UET A;  4JDO A;  2RV9 A;  2WQ4 A;  4YG3 A;  3T1M A;  1NLQ A;  1RUE 2;  2RM2 2;  4H7L A;  2CAV A;  4Q1R A;  4YG0 A;  1UMH A;  1JXN A;  4AXO A;  4D6Q A;  3FHQ A;  3VZN A;  1SEF A;  5L9R A;  3RJR A;  4RFT 0;  1M06 G;  1OLM A;  3CF6 E;  3NJZ A;  5CFD A;  3A0N A;  3NAP B;  1LHN A;  1NUK A;  1NE4 A;  4YWA A;  3VKF C;  5FJH A;  1RL3 A;  4LBQ A;  4NE9 A;  1G9F A;  2BTV C;  1C8N A;  3H3Z A;  4W50 A;  4XF0 A;  5KBF A;  2VCM A;  2BP6 A;  2JB4 A;  3KF5 A;  4HOO A;  4FT8 A;  2HWE 1;  2BW8 A;  5FJK A;  5I8S A;  2Y6F A;  4FP3 A;  1KFX L;  2X29 A;  4EN0 A;  3AXE A;  2NN8 A;  3DCQ A;  1JYT A;  3H42 B;  2FD8 A;  2GMM A;  3EBR A;  3P5B A;  4FXK B;  4GZ9 A;  4RR3 C;  3ILN A;  2JG8 C;  3WVJ A;  4W65 A;  5AFE A;  2WT1 A;  3WXP A;  5JMC A;  2X5I A;  3S0M A;  1HB4 A;  2VOW A;  3FFZ A;  3N9P A;  4QHB A;  5FUN A;  3PUH A;  4YAR A;  3W5N A;  3E6D A;  4M01 A;  1BQP A;  2VE1 A;  1ZM1 A;  3HNM A;  3N4M A;  2O1Q A;  1YC6 1;  1FPN 2;  2EXH A;  5J1X A;  2YV8 A;  2HWD 3;  1PVC 1;  2XQR A;  3THP A;  1W90 A;  2G4I A;  2GH8 A;  3NKT A;  2ERF A;  1VBE 1;  3TOJ A;  2JIG A;  3B00 A;  3MIB A;  1ZZ8 A;  1J1T A;  5FMO S;  1DZT A;  4BQX A;  3NNM A;  4K9S A;  2A75 A;  3G7D A;  2VVF A;  5F8P A;  2VZV A;  4E4S A;  1IQA A;  4P14 A;  1K3I A;  1IG0 A;  1GWK A;  3ACL A;  5LAT A;  4ZU7 A;  1LHO A;  1XE0 A;  4GKY A;  1OSG A;  2A7A A;  4KNC A;  4BDV B;  2OA2 A;  2YUE A;  4XFF A;  4K21 A;  5J48 A;  4K6B A;  2C24 A;  2CSG A;  1KJL A;  2RR1 2;  3K46 A;  4BM8 A;  2VUA A;  1VR3 A;  1OQE A;  1VRH 1;  4UAP A;  4IE4 A;  4YM0 A;  5F3I A;  4LHK A;  5C71 A;  5FZ6 A;  3UNP A;  4R4X A;  4GAL A;  4BQ5 A;  3LD8 A;  3V0B A;  4WZC A;  1HJF A;  2XBO 1;  3NO8 A;  2Q4S A;  4BZ4 A;  4A4A A;  1CX1 A;  1HB1 A;  2RDS A;  2YC0 A;  2VZU A;  3KCX A;  4A7Z A;  4FPL A;  4P9G A;  1JOJ A;  4ISR A;  2FMY A;  2RM2 1;  1FOD 3;  1NE6 A;  1RUE 1;  3H1W A;  2BJS A;  3M8L A;  4HBN A;  4P9W A;  3VBO A;  3WW3 A;  3K4D A;  2EA7 A;  4FAG A;  2OZJ A;  5LEJ A;  4WVV A;  1HKD A;  1OLQ A;  2Y6G A;  4PDW B;  5J98 B;  5SV8 A;  3POW A;  3S7E A;  2VUJ A;  3ZFG C;  2OXB A;  5ANQ A;  4OHV A;  5LA2 A;  3SEP A;  3TWI A;  4FTE A;  4ZXK A;  2VMF A;  3QAC A;  3U10 A;  3I4I A;  3HQR A;  4HAN A;  3AMN A;  4XJ9 A;  3VKM A;  2YRO A;  4P5H A;  1AYN 3;  1H6X A;  3DPR A;  3ELN A;  5A3U A;  3RRD A;  4SBV A;  2Q1F A;  2WBK A;  1RHI 2;  3C3V A;  1OQ1 A;  4CEW C;  4XDP A;  2B39 A;  2A70 A;  2VEC A;  2XML A;  4IE6 A;  5H9P A;  4Z2A A;  5DUU A;  3AVS A;  4COY A;  2OII A;  2EF6 A;  5DXD A;  2PFW A;  2VTF A;  4M3C B;  4CTE A;  1SLC A;  4JGZ B;  1FPN 1;  1ND2 A;  4SLI A;  1OFN A;  2XLG A;  1H1I A;  2ZZJ A;  3FLP A;  2XVK A;  4LBQ D;  3VDC A;  4ONU A;  4QT6 A;  4AFM A;  4Y4R A;  4A7Y A;  4LE4 A;  3PUS A;  4AED C;  1G9A A;  2ZAB A;  1GNY A;  5EQU A;  4BME A;  1C8M 2;  1Z7S 2;  3F2Z A;  4R9D A;  2QQL A;  2OQ7 A;  4NAM A;  4QX0 A;  2E9Q A;  3SIT A;  1G6N A;  1PX4 A;  4GB3 3;  5FP7 A;  3W9A A;  4H14 A;  1OPM A;  1W3V A;  5F39 A;  2UY8 A;  5A3P A;  1T2X A;  5BY5 A;  4D7S A;  2ADE A;  4GH4 C;  1L7Q A;  1PVC 3;  2RR1 1;  2J42 A;  2WNV C;  5CG9 A;  3BCW A;  1VBE 3;  1GNZ A;  3ZSK A;  1WA6 X;  4OHX A;  5CKM A;  3SIS A;  3ETP A;  2YYO A;  3A23 A;  4HVQ A;  1TQ5 A;  2Y33 A;  3OUJ A;  5IAT A;  5FQ0 A;  4UW4 A;  5FO9 B;  2F17 A;  1AXY A;  3SXW A;  2ARX A;  4NHM A;  5IK4 A;  1RTV A;  2IUW A;  2FDK A;  1I9R A;  5JOX A;  3QBQ A;  4UFM A;  4YZ4 A;  1ULC A;  4D69 A;  1QQP 3;  5J37 A;  3GZU C;  1BLZ A;  5CKN A;  4CP0 A;  2WFF 2;  1JN2 P;  4JTN A;  4Q26 A;  2R1B A;  2Y6H A;  1VRH 3;  2SBA A;  3MIE A;  1KXG A;  2B5H A;  2EVX A;  4OHW A;  3THD A;  4M3C F;  4TSV A;  4BH9 A;  5IVE A;  2XBO 3;  1DLC A;  3WNO A;  1W0O A;  3U37 A;  1RHI 1;  3EJK A;  1NT0 A;  2RM2 3;  1RUE 3;  3PIJ A;  4HFS A;  1GLH A;  3NAP C;  1WLD A;  3LGR A;  1AXZ A;  3ZFE C;  4B4Q A;  3JXS A;  4ATE A;  4DEV A;  1YNA A;  5C6C A;  3HBK A;  1X82 A;  3H8O A;  1W6M A;  1UOJ A;  2BVB A;  3W5M A;  2QE3 A;  2PQS A;  5JIU A;  1MPX A;  1GMM A;  1RJ7 A;  4LBQ B;  5IWF A;  3VBS B;  5FO7 B;  1VIW B;  2XUE A;  3HPN A;  4YVS B;  4JDN A;  4OUS A;  3AMQ A;  4HSJ A;  1OUR A;  2HBT A;  2UWC A;  4CP9 A;  4LNV A;  2Q8E A;  4S2G A;  4E2S A;  5GZG A;  2WZ8 A;  1C8M 1;  1Z7S 1;  3LFM A;  1L3J A;  1VBA 3;  1BK0 A;  4NRO A;  4W4Z A;  2A1X A;  2ADD A;  4A41 A;  2BNN A;  1X36 A;  4DEQ A;  2E32 A;  2X53 S;  2JKX A;  4Q2F A;  4O7X A;  5T50 A;  3VB9 A;  3NNG A;  4IL7 A;  2WSV A;  5F7U A;  1FPN 3;  3USU B;  3QH6 A;  3WG2 A;  1ZA7 A;  1W8H A;  3SH3 A;  2A3W A;  3OTF A;  4GWJ A;  2E31 A;  4ZU5 A;  4RQP C;  2ZS6 B;  4E8D A;  3HEI A;  1HB3 A;  1VMH A;  4FFF A;  2C6S A;  4P9L A;  2D40 A;  1U0A A;  4XIO A;  2E63 A;  3I54 A;  3WW2 A;  2EXJ A;  4XMA A;  5IK5 A;  5C5T A;  1YFX A;  4D0Q A;  1GZT A;  1POQ A;  5FYM A;  4LTA A;  5FZ4 A;  4QQL A;  4B7E A;  3HD8 B;  1SCR A;  4Q4Y 3;  1Y9M A;  1PK6 A;  3OBA A;  1QIQ A;  2WFF 1;  4KWU A;  3TBD A;  4ARY A;  1OVS A;  2QQN A;  1BZW A;  3Q8F A;  4BK4 A;  2RS1 2;  2UUR A;  2D44 A;  3ZXD A;  4IV1 B;  3ZDV A;  3SC7 X;  1H6Y A;  1K5M C;  1LOC A;  4G4F A;  4IEY A;  2DTW A;  5J96 B;  4QKF A;  2HBU A;  1WMD A;  1Y7B A;  3VBU A;  4PDW C;  2V5D A;  2HWF 2;  3DKQ A;  4GMP 1;  4HL0 A;  1KDK A;  2V72 A;  2VNR A;  3DUI A;  3PHM A;  1YFW A;  4XF9 A;  5F2S A;  3RS6 A;  3T3Y A;  2DCT A;  1RGS A;  3NJY A;  4Q0Q A;  3HAG A;  4Y1V A;  3U78 A;  1QY4 A;  2WS9 2;  3DL3 A;  1R09 3;  2HWC 2;  2Z4F A;  4MGQ A;  4MSV A;  5F5A A;  1EP0 A;  2KXL A;  1CQ9 A;  1N1V A;  3M3C A;  5EYY A;  3BPZ A;  3PVE A;  3A22 A;  2B46 X;  2ZGT A;  3CDZ B;  3X29 B;  2WRA A;  3LA3 A;  3B02 A;  5G05 L;  1YJL A;  2ENR A;  3BN6 A;  5LBC A;  2JJ6 A;  2K46 A;  2BFU L;  1RHI 3;  3CJX A;  4WM8 B;  2WLP A;  2VGD A;  3AYC A;  4HET A;  5BNQ A;  5JAX A;  2HEY F;  2GP5 A;  1BYH A;  5A32 B;  3HNY M;  4FPO B;  4QB2 A;  3MIG A;  3H0O A;  2E7Q A;  2XJV A;  3GBF A;  4UXA A;  4M4R A;  3I2K A;  1AR8 3;  1XPW A;  1UX7 A;  5C4W B;  3IMN A;  5JUV A;  1O6U A;  4AEK A;  2HH9 A;  3DF0 A;  3SEE A;  2Z69 A;  1XYO A;  1WD3 A;  2ZEX A;  2BZD A;  5IW0 A;  3RVH A;  3WZ1 A;  1STM A;  4CDW A;  2A73 B;  2W87 A;  4DOU A;  1W2U A;  4RR3 A;  3P6B A;  4IEQ A;  4R9C A;  1C8M 3;  1Z7S 3;  2W9X A;  3E5X A;  4LA3 A;  1L7L A;  5FZK A;  3RZH A;  1CIW A;  5CKQ A;  3ETQ A;  1F4H A;  4XAB A;  3CLP A;  5JZG A;  2BNO A;  1CPN A;  2ARE A;  4IND A;  2QFE A;  3DYM A;  1E5H A;  1OD5 A;  5IVV A;  4JV4 A;  1UZV A;  2VME A;  4CP1 A;  4BIF A;  1SAC A;  3E1F 1;  4Y4Y A;  1T6B X;  3D3A A;  1HW5 A;  3CEW A;  1JOB A;  1LAJ A;  5GLU A;  3FZ3 A;  2RS1 1;  2YC4 A;  3ZKY A;  3UGH A;  1QWR A;  3ZXJ A;  2WNE A;  4RS5 A;  4CCM A;  3DXT A;  5FZO A;  3MYX A;  2ILM A;  3KV4 A;  4LHN A;  2JEN A;  3ROU A;  1UYZ A;  3TRS B;  5JXI A;  1HX6 A;  2PYT A;  5FLH A;  3ALQ A;  2R16 A;  3OGR A;  5CYY A;  1CAW A;  4CCK A;  3BOW A;  3KT7 A;  4UFK A;  1XXN A;  5KHJ A;  5A1L A;  4CCJ A;  4CDQ B;  2HWF 1;  4N90 A;  5JLV A;  1YHF A;  1B35 C;  1DFQ A;  2WQ8 A;  5C8C A;  2GMP A;  1ZBE 2;  4FFI A;  2KD7 A;  2HWC 1;  2ZKN A;  1AUY A;  3KV6 A;  1SZB A;  1WCD J;  4LK6 A;  4UW6 A;  4V2W A;  5AVA A;  1YYN A;  2VVE A;  2JEC A;  4BE3 A;  4L2N A;  4IEO A;  5FPL A;  1PO2 1;  2YC2 A;  4BQ1 A;  1I3H A;  3ZSE A;  5K8S A;  3T08 A;  3PVN A;  4ZKT B;  3UT0 A;  4EYU A;  1YUD A;  1W8U A;  1QJZ A;  1WMF A;  3W21 A;  3N7J A;  5EJZ B;  3KVB A;  3CQO A;  4XCA A;  1W0N A;  4CDX A;  3RGB A;  5FYS A;  4YZ1 A;  4GMP 3;  4LPL A;  1NY7 2;  1W8F A;  2XWJ B;  1DQ1 A;  2WN3 A;  4WM7 C;  5JPM B;  4KG8 A;  1YQ6 A;  4G3Y C;  4L99 A;  4OHY A;  4BWO A;  4P9I A;  4N53 B;  1UIK A;  3OYW A;  2NMO A;  3I8T A;  3QH7 A;  1W6M B;  4NWV A;  4OFG A;  5CA6 A;  3WF2 A;  5IAX A;  1J84 A;  1SDD B;  1GZW B;  3B9C A;  2VNG A;  1MS9 A;  1ACC A;  1SPP B;  1FT9 A;  1WCK A;  2VMI A;  4ASL A;  4BK5 A;  5GKA C;  1C1F A;  4CEW A;  1MAC A;  4L9B A;  1GQG A;  2D6N A;  4UF0 B;  5E88 A;  5KR7 A;  3OUI A;  2IZW A;  1BHG A;  3WG3 A;  4CU6 A;  1H4G A;  4QAW A;  4CU8 A;  2F6B A;  3T30 A;  2QCS B;  1AYM 1;  3MLK A;  3IWZ A;  5JPN B;  3MIH A;  3R4U A;  3URF A;  1ODN A;  5FY9 A;  5AVP A;  2VZ1 A;  1ASJ 2;  1CZV A;  1ST8 A;  1UCX A;  4N7I A;  2FBE A;  2YBK A;  5LBF A;  1IG3 A;  2D3S A;  4AED A;  4FPE A;  2V4A A;  5DUX A;  5EJ1 B;  3POS A;  4XBQ A;  4Z82 A;  4BLI A;  3ORJ A;  1C5I A;  1U5Z A;  3AP5 A;  1RIR A;  1RUD 2;  1Y3T A;  2ETE A;  4YSF A;  3WUD A;  1S0I A;  4MV2 A;  1WD4 A;  4NR1 A;  5FYY A;  1KGY A;  4QD2 A;  5DAW A;  1YFU A;  1U5X A;  2FDH A;  4OMC A;  2P4E A;  1ZRD A;  4AE2 A;  4DB5 A;  1NCR C;  4XW3 A;  1UY2 A;  4N43 B;  4JCK A;  4YW4 A;  3NV1 A;  1DQ5 A;  3MF9 A;  4Y5Z 0;  5FY5 A;  1W6N B;  2BNM A;  2DFC A;  2XXZ A;  2W52 A;  4I01 A;  3H1M A;  4UBG A;  4YVW A;  2QQO A;  5FUP A;  4Z1V A;  2RS1 3;  1V6L A;  2BEO A;  4UWD A;  2YGL A;  4I09 A;  4QDQ A;  1UX6 A;  2YU2 A;  4LBN A;  3PLQ A;  3KD4 A;  4QXC A;  5FPV A;  1RIN A;  5E89 A;  2QZ2 A;  4LKD A;  1E5I A;  2JD9 A;  3IKW A;  5L36 A;  2HWF 3;  2W3J A;  1QHD A;  4O9E A;  3MFA A;  5A3O A;  4B1L A;  4URT A;  3ZFF A;  4NRP A;  4ITC A;  4H3W A;  5CAZ A;  2WS9 3;  3NNF A;  3KZ4 C;  4MGS A;  2HWC 3;  4QQ2 A;  2VUC A;  1VAK A;  1RUJ 1;  4XQD A;  1LGC A;  1VB4 A;  4B8E A;  3N36 A;  3JQX A;  4C0H A;  4CCL A;  5L73 A;  5I93 A;  3AMP A;  1H8T C;  3AYA A;  4QX2 A;  3AX4 A;  2WWJ A;  4R9B A;  4YFW A;  5B4N A;  3I3E A;  5JDB A;  1VMF A;  4FP2 A;  2XVG A;  4IER A;  1O3Q A;  3ZFE A;  4P02 B;  4FCA A;  4IE0 A;  2WC2 A;  4AHY A;  4JKL A;  3I2O A;  4XPV A;  2VC9 A;  4UFI A;  4XFC A;  4FI9 A;  5FYC A;  3OSD A;  1CAV A;  2GND A;  5C4W C;  1C5H A;  1JYX A;  4NIG A;  2DUR A;  5EV7 A;  4BMB A;  3VZO A;  3BI3 A;  1F15 A;  1QJU 2;  3JCI A;  5JOZ A;  3D4K A;  3LIH A;  3GCX A;  3WNM A;  2CTV A;  5FZL A;  4O61 A;  4YLZ A;  1ASJ 1;  1NKG A;  1NYW A;  1SQ4 A;  3K4Z A;  5F9T A;  1H30 A;  1GFF 2;  1DQ4 A;  1W8W A;  2LAL A;  4LK7 A;  4DIQ A;  3BIW E;  1QF3 A;  1RUD 1;  4LE3 A;  5BNO C;  1OPO A;  5EJ3 A;  1ENQ A;  3I2J A;  4XEZ A;  2Y8K A;  1V6O A;  2YDE A;  3AFG A;  5F6L B;  4PIZ A;  4PLO A;  4XUO A;  1S55 A;  2YB7 A;  5K0U C;  3LE0 A;  2WA3 A;  5JZG B;  1LB2 A;  5DQ0 A;  3ENR A;  2VW2 A;  1DP0 A;  2VMH A;  3R4S A;  1JZ2 A;  2AC1 A;  1SLI A;  5ABJ B;  4W6W A;  1TMF 2;  4M0H A;  4AFD A;  5DZF A;  5FZE A;  1AL2 3;  3V64 A;  3VGI A;  1GOF A;  1FV3 A;  3VHN A;  2JDH A;  4R9A A;  3OD0 A;  4Q27 A;  5T5L A;  4I0B A;  1YQ8 A;  4DXR A;  2WT0 A;  2K9Z A;  2QQU A;  5L19 A;  4RS5 B;  1IS6 A;  1UQX A;  2NM1 A;  3ACG A;  2IWG B;  4L8Q A;  1UPS A;  1E57 A;  3ES1 A;  5CU1 A;  5FY7 A;  5FZO B;  1NXM A;  5LAS A;  2ZEW A;  3O1U A;  3S5Q A;  1MS5 A;  3POE A;  5GLT A;  2D6K A;  1W9F A;  2YPD A;  1HV0 A;  4RA0 A;  1JYW A;  1RUG 2;  3SH4 A;  1CAW B;  2UYB A;  4D6R A;  5TSW A;  3VDD C;  4JGY A;  2GDF A;  2ZA9 A;  4XVH A;  4XUN A;  1ZBE 3;  1ZRF A;  5FZ9 A;  2FHR A;  4LIU A;  1S4C A;  3MFC A;  5F5C A;  1CON A;  4JQR A;  3OOX A;  4LO4 B;  4B29 A;  3IAP A;  3OBZ A;  3QLQ A;  5EXO A;  1ULE A;  2AEN A;  1K5M A;  4N9H A;  4ZS3 A;  3NNJ A;  3AZZ A;  3ZIW A;  5C3R A;  4CA9 A;  1DHK B;  3SH5 A;  5LA1 A;  3I7D A;  3BGA A;  4YGD A;  4EJR A;  3TEZ A;  5KXE A;  2P17 A;  4M3C E;  3HNB M;  1UIJ A;  5KWR A;  5L7O A;  4OI4 A;  5C9A B;  2TEP A;  1FXZ A;  5AC9 2;  3WOG A;  1HIX A;  3RI8 A;  4XUQ A;  1RED A;  2NQY A;  4QXH A;  2VCA A;  5IK8 A;  3WD5 A;  3I2D A;  2X05 A;  1UKR A;  1QJU 1;  2DDU A;  4O65 A;  5IJR A;  5A33 B;  2HWE 2;  2YPJ A;  1Q3E A;  5FZF A;  4DY5 A;  2JG9 C;  1GR3 A;  3GBG A;  1JUH A;  4FPC A;  3LKJ A;  4K8F A;  1XB9 A;  1CJP A;  1V6I A;  3UKN A;  1AVB A;  3ZR6 A;  2VCC A;  2HYK A;  3DN7 A;  1GWL A;  3E97 A;  1QH6 A;  1WBL A;  2LTN A;  3ACF A;  3B93 A;  4TXW A;  1D4V B;  5FMB A;  2ZAC A;  3I2G A;  3AJZ A;  4QKB A;  4QGM A;  3VD3 A;  4PCR A;  4QX8 A;  4CDU B;  1JZ8 A;  2RDN A;  3OEB A;  5LY1 A;  3FL7 A;  4OZX A;  1KFU L;  2VMC A;  3IAQ A;  3NJV A;  4ET7 A;  3VZM A;  4Q8L A;  3O0W A;  5KXB A;  2ZGN A;  1O3T A;  5HV4 A;  1TMF 1;  1ZRE A;  1ASJ 3;  1ULO A;  1RMU 2;  3VBR C;  1R1A 2;  5CFC A;  2W1W A;  1Y4W A;  5FY4 A;  3SHR A;  3NRU A;  3PL0 A;  1PMH X;  5CAD A;  5LCW L;  1VB2 A;  3I59 A;  1RUD 3;  3IZO A;  1KJR A;  3CMG A;  1OH3 A;  4QKN A;  1UOB A;  4E2Q A;  1JYV A;  3OBT A;  3ZN6 B;  1UZY A;  4FVV A;  2PAM A;  1OA3 A;  1LES A;  4YW2 A;  4BCU A;  4DIN B;  4BJ0 A;  1AX2 A;  2EXK A;  2GSY A;  3MI8 A;  4XZP A;  1RUG 1;  2VNO A;  5AFB A;  2WR9 A;  1F5F A;  3CKH A;  4E8C A;  2W1S A;  4XAA A;  4PHZ A;  1TG7 A;  1W28 A;  5T5J A;  3EB7 A;  3ZYH A;  4S2D A;  4RHV 1;  5F37 A;  4CXW A;  4JVA A;  1G9D A;  1XNC A;  3DYP A;  5FV3 A;  3U11 A;  4AFB A;  4Y33 A;  2ZGL A;  5DAX A;  1SCS A;  2ZGS A;  3IPV A;  1JHJ A;  1OLM E;  4NUB A;  2XPJ A;  4LUL A;  4C91 A;  2VZT A;  2JB8 A;  1B35 A;  1WGP A;  4Y1Y A;  1W6P B;  4AZZ A;  2BER A;  1JS9 A;  5AC9 1;  1DZR A;  4E9K A;  3UKT A;  1WCQ A;  3A0K A;  4TLF A;  1LRH A;  1XYP A;  1U12 A;  2YBP A;  4AWD A;  4UFL A;  1V6N A;  4FFG A;  2D97 A;  3N7L A;  3O0V A;  4DS0 A;  2K0G A;  2IVI B;  4HSL A;  2H6C A;  1ND3 B;  5F6K A;  4CU7 A;  4U2A A;  3LSE A;  5JI7 A;  3MPP G;  1OKQ A;  1W99 A;  4A3Z A;  1W04 A;  1FMD 2;  1H2M A;  3WDT A;  4YFZ A;  2WNU C;  5FPZ A;  5CIR A;  2BGO A;  2O8Q A;  1CJD A;  3O1P A;  4Y24 A;  2WN2 A;  1XOY A;  2FZ1 A;  1QJE A;  1QJU 3;  1W05 A;  2BBA A;  4S2F A;  3MHZ A;  2DFB A;  4PBP A;  4ZON A;  3ZXA C;  2GME A;  2BOJ A;  2JDY A;  2WO3 A;  5FP4 A;  1OHF A;  5FDB A;  4AW7 A;  1RMU 1;  1R1A 1;  1PGW 2;  3ZYJ B;  1IPK A;  1EUT A;  3O1S A;  1ZA4 A;  2XKP A;  1CVN A;  1JTZ X;  2VNV A;  3WX5 A;  5CNA A;  2LRO A;  4LKF A;  4AI9 A;  1GOG A;  1SLL A;  3V0A A;  2WZR 2;  4CUG A;  5M0T A;  2JDA A;  2OQ6 A;  4D3W A;  1W2A X;  3EMR A;  1AZD A;  2R6Q A;  1YCI A;  2VTX J;  4DUW A;  1MQT B;  4MHU A;  1IPJ A;  2X10 A;  3VBH C;  4GIQ A;  4JRA A;  5FZ3 A;  4BPZ A;  1UZ0 A;  3HR9 A;  4UFH A;  4ZXE A;  1YI7 A;  5IVJ A;  4ISQ A;  3LDB A;  2IXC A;  4ATF A;  2NP0 A;  4QX7 A;  4C1W A;  2J1T A;  2ZHL A;  4NPM A;  3RWK X;  3T2T A;  2ZGO A;  3VUO A;  1Z78 A;  3TB0 A;  4A44 A;  1HLC A;  3ZIX A;  3ZOI A;  3U0Z A;  2RE9 A;  2ZAH A;  3OY8 B;  1REE A;  4Y22 B;  3WQB A;  3Q8B A;  5I91 A;  4AOC A;  5L7O C;  2WZP P;  3DYO A;  3N9Q A;  5GZD A;  1S1A A;  5J3U A;  3CU7 A;  2UY9 A;  1XJA A;  1RUG 3;  3EQE A;  3FLR A;  3J7L A;  5FMD A;  3WNX A;  2I45 A;  2QQI A;  1RB8 G;  3BPS A;  2DVG A;  4BB3 A;  4EN6 B;  1O8S A;  3B01 A;  3JU9 A;  4KH9 A;  1A6C A;  4MGK E;  1W8Z A;  2RHP A;  2DVB A;  2GC0 A;  1W8O A;  1K45 A;  2OS2 A;  5BNP B;  3IBM A;  4QDS A;  1O91 A;  2PA7 A;  4WV8 A;  4Z8B A;  1W2T A;  4E4D X;  4EN7 B;  5A6Y A;  3Q9O A;  4GJZ A;  3IDE A;  4IV3 C;  3U75 A;  4AVC A;  1MZF A;  5D1I A;  1QXJ A;  1GAN A;  4YPJ A;  5C9A C;  2AAC A;  2ET7 A;  1FMD 1;  5BNN C;  2ORX A;  1IS4 A;  3DXU A;  2A3X A;  5AC9 3;  4XHX A;  3VBF C;  2CL2 A;  2QTW B;  5FYV A;  3JQW A;  4HKO A;  4UW5 A;  3JB4 C;  4Y3O A;  2P2K A;  4AFA A;  5T54 A;  1LOA A;  2ZXQ A;  4IE7 A;  2HWE 3;  1CR7 A;  3QOP A;  3UGG A;  4RGA A;  4QPG A;  4JQT A;  1JZ6 A;  1LEC A;  2QQW A;  4WBB A;  4KL1 A;  1NA1 A;  2Q0A A;  1WUV A;  1PGW 1;  2LUW A;  4TN7 A;  3UV9 A;  5LRR A;  5A6X A;  1S0B A;  3M3O A;  1HRV 1;  2JX9 A;  4CDU C;  1ZX5 A;  2NLR A;  2R07 2;  2WZR 1;  3H3L A;  2A6Y A;  2J1V A;  2Z5W A;  4Q8K A;  5I8Y A;  3VHR A;  1UU6 A;  5D8A C;  3KGL A;  3AKS A;  5DUV A;  5LBB A;  4E4H A;  4C8D A;  1W06 A;  1POV 1;  4S2H A;  3LCP A;  2ATF A;  2RVA A;  3AYE A;  2VO5 A;  3K77 A;  4ASK A;  4IXL A;  4QU2 A;  2ZBJ A;  3H3U A;  2CHH A;  2HJI A;  4CPB A;  3CJI A;  1FX5 A;  4KQ7 A;  1Q8P A;  5DAP A;  1RMU 3;  2PQQ A;  3TAY A;  1R1A 3;  3MLJ A;  5BNO A;  5K4L A;  4YM1 A;  1US2 A;  2C26 A;  2H0B A;  4QQH A;  3OGS A;  4HLT A;  5DG2 A;  1O3R A;  2XJR A;  4MUV A;  4EN8 B;  5IT6 A;  4QPI A;  5K0U A;  5EPA A;  1O8P A;  3M2M A;  2J1S A;  3GGL A;  1DGL A;  3ES4 A;  4JZR A;  1A34 A;  2UWA A;  1XRU A;  3OPZ A;  3H7J A;  4F7Z A;  1W9T A;  5FCC A;  3D82 A;  3MO4 A;  1FNY A;  2VZQ A;  5BPX A;  3S5A A;  1YQ2 A;  1OMI A;  1CAU B;  1XNA A;  4HZF A;  4Z07 A;  1FV2 A;  4D94 A;  1S2K A;  2BUK A;  2QQK A;  4COV A;  5KXD A;  2FQP A;  4UW3 A;  4XAE A;  4LJH A;  1UYP A;  5IFP A;  5APA A;  2C4X A;  3VDD A;  4CEY A;  1UXX X;  2E7T A;  5FP9 A;  3H1Y A;  2XQX A;  3LF7 A;  2XLA A;  5I0U A;  5CFD B;  1GOH A;  1MEC 1;  4C1X A;  4LBM A;  2D93 A;  2JEM A;  2R06 2;  4RL7 A;  1BBT 1;  3CZJ A;  4QPW A;  1AX0 A;  5FO8 B;  4IEW A;  4XF1 A;  2P1B A;  1CPM A;  4ZY9 A;  4FOQ A;  1G8W A;  3HT1 A;  4CCD A;  2Y64 A;  1OT5 A;  2IXJ A;  4FQZ A;  2CV6 A;  5H9S A;  4M4P A;  2AH2 A;  3B94 A;  3R4D B;  4Q0P A;  3C8X A;  4OYU A;  3S7I A;  3UES A;  4NIH A;  1FMD 3;  2WWS A;  2R07 1;  4NPR A;  1DQ2 A;  2WSU A;  1WKY A;  2W39 A;  2X5I B;  1CGP A;  4ZPI A;  2BVV A;  1YRZ A;  2Q1Z B;  4LBK A;  3TNQ A;  2JG9 A;  2PHX A;  4QXB A;  1BVV A;  3ZR5 A;  1LJ7 A;  4MVT A;  3W20 A;  1CAX A;  2Q30 A;  1OFS A;  2TBV A;  1NCQ A;  3K3O A;  5FK7 A;  4AEM A;  2E26 A;  2Q8O A;  1B09 A;  2BV4 A;  3VZL A;  4C90 A;  2VXR A;  4ARX A;  1UZZ A;  4BQ2 A;  3F95 A;  4AGG A;  1SFN A;  4KG0 A;  4Q4V 1;  5HPO A;  4YGB A;  2P5B A;  2GNB A;  3MW2 A;  4A6O A;  4MG2 A;  2VUL A;  2RJL A;  1OOP A;  2WZR 3;  3MBW A;  3AKR A;  1MS0 A;  1EY2 A;  1QXR A;  1LED A;  3PJQ A;  3IB3 A;  1EV1 2;  1YFY A;  3FUO A;  2QDN A;  3GBW A;  3AK0 A;  3WQ1 A;  3O1R A;  1POV 3;  2W1Q A;  2RR1 3;  2RS5 2;  1C57 A;  3LIG A;  2XG3 A;  4HK8 A;  4MO3 M;  3VBR A;  4MET A;  3C7O A;  3SQO A;  1NZI A;  2RMU 2;  4LQR A;  4DUV A;  1MS3 A;  4FXG B;  4CPB D;  4FPJ A;  1UU4 A;  1OQD A;  1GQH A;  4W6X A;  3OPT A;  4XOG A;  5DZE A;  3V0B B;  1VAL A;  2W2I A;  1O4Z A;  3CL1 A;  2VQT A;  3O12 A;  3LEG A;  3O14 A;  5JSO A;  3SKJ E;  4FSJ A;  3BOD A;  4PF5 A;  1UAI A;  5LK5 A;  3VBO B;  4YW3 A;  1S0G A;  2B8M A;  3K48 A;  2DV9 A;  4OQ9 A;  1JZ5 A;  2IFR A;  2FDG A;  1LOF C;  2VR4 A;  4IQP A;  2R06 1;  5LY2 A;  1Q8S A;  3THT A;  1HQL A;  1PO2 2;  1W6Q A;  2B7Y A;  5LBE A;  4RN5 A;  5BNP C;  1OUS A;  3UYJ A;  5DZG A;  5FXV A;  3POF A;  2XJP A;  3RZG A;  4XDO A;  3DPR B;  3WLU A;  4Q4W 2;  3ZN5 A;  1C4R A;  1MR5 A;  4AHX A;  4PI2 A;  2B9V A;  3J8F 2;  4FAH A;  4BLJ A;  1WCS A;  5FP3 A;  4CRQ A;  5K9Y A;  1G86 A;  1HRI 2;  1XNT A;  3E5Q A;  3JBG 1;  2ARC A;  2FMD A;  4NMI A;  3KM5 A;  1WBF A;  4QWN A;  4JGZ C;  3GJA A;  5JXH A;  4AGR A;  4IGQ A;  2FDJ A;  5EP9 A;  3ZSM A;  3APB A;  1AHS A;  3KMH A;  2CWS A;  1WA4 A;  4MXW A;  2JKB A;  3AP4 A;  3BTA A;  1ND2 B;  3M70 A;  3I3Q A;  1QJF A;  4Y1U A;  5F3C A;  1WW7 A;  2A71 A;  1WW4 A;  2JDZ A;  2RG4 A;  4NHL A;  1QDC A;  2JG8 A;  3HBZ A;  4NRM A;  4QPG B;  4YZ3 A;  1N47 A;  1ZYB A;  3J7M A;  5FOB B;  1A3K A;  3KV5 A;  3Q8C A;  2W1U A;  2WNU A;  3N7K A;  4F3J A;  1I6X A;  1AJK A;  3ZPO A;  2R07 3;  1UMZ A;  1MVQ A;  3U14 A;  4IEX A;  4DFS A;  4PIX A;  1AYM 2;  2CGP A;  3AZX A;  4BXS V;  1D7P M;  4LOS A;  3HJR A;  3WP6 A;  1EV1 1;  1ULP A;  2C0Z A;  2HLE A;  3SCG A;  4KWJ A;  4XET A;  3BTZ A;  2RS5 1;  2YXS A;  1N1T A;  2WAB A;  2RMU 1;  1DCS A;  2VQA A;  5F3G A;  3A7Q A;  3EHK A;  4DRV A;  1JZ3 A;  3CJI B;  2RJ2 A;  2IFW A;  2Q5T A;  1KD7 A;  3WP3 A;  3AVR A;  3LEM A;  1GP5 A;  3L2Y A;  4XIL A;  5FQ0 B;  3FMG A;  3SCH A;  2C9K A;  3PUR A;  2YY1 A;  4GUL A;  3RYK A;  1AX1 A;  2JD4 A;  3RMX A;  2WFF 3;  1JW6 A;  1W9S A;  3A4U A;  2Y0O A;  3MDP A;  3PUI A;  4KWL A;  5IYY A;  2ZMK A;  1NOV A;  2D6O X;  5K7P A;  2QDR A;  3N9O A;  4NPL A;  4A45 A;  4CXY A;  4OZO A;  4LBO A;  3I2H A;  4ZZ5 A;  3TYJ A;  1AF9 A;  2NMN A;  1JUI A;  1HV1 A;  1KEX A;  2EAL A;  2WAO A;  2VQU A;  4LO8 A;  5E8A A;  1OH4 A;  3WDU A;  3WF4 A;  3HVD A;  3KWV A;  3N35 A;  4HPK A;  4Q4W 1;  3WIN E;  2PN5 A;  1S0J A;  5BUV A;  3LOB A;  1PM4 A;  3FFQ A;  4LBL A;  3VL8 A;  3J8F 1;  4FPH A;  3GF6 A;  3WF0 A;  3ZFG A;  3E6B A;  4OUE A;  4P9X A;  3S6P A;  2MNG A;  1HRI 1;  4IE5 A;  5FLI A;  1O7F A;  4I0A A;  4LUK A;  3TN9 2;  4PIY A;  4HKW A;  4XFA A;  3VBS C;  1RUJ 2;  2RS3 2;  5FYT A;  1WW6 A;  4YVS C;  5FR3 A;  3T1L A;  2PHD A;  4AHW A;  4YZ2 A;  1UKG A;  4DO0 A;  4AVB A;  1D0G A;  1C1L A;  5B2G B;  2E51 A;  3WG1 A;  3GXU A;  2G9F A;  1J58 A;  3FHA A;  1DZQ A;  3MUY 1;  4QPY A;  1QOT A;  3EO6 A;  2WO1 A;  4CP9 B;  4NJ4 A;  5BNN A;  1VMJ A;  1RUF 2;  2I07 B;  2LM3 A;  5LWB A;  2GC3 A;  3VKN A;  2DF7 A;  1IQD C;  1LHW A;  4YGC A;  2WAA A;  5KC5 A;  3RSJ A;  4MGT A;  4BIO A;  2G9G A;  4MX3 A;  4L11 A;  4HON A;  1J1L A;  4MHR A;  3V56 A;  3VD5 A;  2JE7 A;  4XBN A;  4DZG A;  5KC6 A;  3AMM A;  2X09 A;  4MH0 E;  3KHB A;  1GZC A;  1HB2 A;  5FRE A;  5LK7 B;  1DYK A;  2C5D A;  2JDU A;  2RDR A;  5FZH A;  1RVF 2;  4BQW A;  5FZA A;  1PIV 1;  1NCQ B;  3TEX A;  3AFK A;  4FO9 A;  4AEJ A;  4FOW A;  1OXC A;  2IXI A;  5IFT A;  1DIW A;  2OPW A;  4AVA A;  1LR5 A;  1BKZ A;  4XFG A;  3WP4 A;  5IVY A;  2BGC A;  3JD7 2;  4DY3 A;  5D8A A;  4CU9 A;  2DU0 A;  3GNE A;  4GH4 A;  4NOT A;  1EV1 3;  5A1A A;  3MIF A;  2WNV A;  3WNP A;  1XBF A;  4QM8 A;  1N1Y A;  2RS5 3;  1S0C A;  4IV1 C;  4NO4 A;  3LPF A;  1PK6 B;  2RMU 3;  2A6V A;  2VOK A;  4MGZ E;  3D0J A;  3VKL A;  1A8M A;  3MIC A;  2XUM A;  1WCU A;  5JVV A;  5HV0 A;  4H7M A;  3I3M A;  3ZVX A;  3ZX7 A;  1LOB A;  5FZD A;  3MV0 1; 
#chains in the Genus database with same CATH homology
 1YQ5 A;  1YQ6 A;  1YQ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...