1YQ5A

Prd1 vertex protein p5
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
144
structure length
144
Chain Sequence
b'GGVTDALSLMYSTSTGGPASIAANALTDFDLSGALTVNSVGTGLTKSAAGIQLAAGKSGLYQITMTVKNNTVTTGNYLLRVKYGSSDFVVACPASSLTAGGTISLLIYCNVLGVVSLDVLKFSLCNDGAALSNYIINITAAKIN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Minor capsid protein
publication title The structure of the bacteriophage PRD1 spike sheds light on the evolution of viral capsid architecture.
pubmed doi rcsb
source organism Enterobacteria phage prd1
molecule tags Viral protein
total genus 26
structure length 144
sequence length 144
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-02-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.670 Mainly Beta Sandwich Jelly Rolls Minor capsid protein. 1yq5A00
1YQ6A 1YQ5A 1YQ8A
chains in the Genus database with same CATH superfamily
5FZOA 2QNKA 3WDXA 3URFA 3VZKA 1PGL1 3WNKA 5CISA 4KNCA 1BBT2 2D43A 3IBMA 2VUDA 1AX1A 4NPRA 3FZ3A 1W2AX 1EAH3 2IXHA 3J7MA 2YYOA 2VBPA 4Z2WA 4UW3A 3O0VA 3HQUA 2HWD1 2Y60A 5A80A 5EQUA 4FT8A 3CBNA 3KV5A 3EJKA 2G9FA 1NLRA 2CHHA 3TEWA 1NZIA 3VKMA 1JYTA 3I54A 1HRI1 1MQTA 3IDEA 4NIHA 2NPIA 4QPGA 2A70A 3H8OA 2OA2A 4YSFA 1VPHA 2E7TA 2SBAA 1YC61 1H2MA 4HFSA 5A7QA 3SC7X 3FLRA 3D4KA 1NCRA 1AR71 2C1FA 2JIJA 1D4M3 4BQ3A 5ACA2 3NNFA 4Y1ZA 4FFHA 1JBCA 1H1IA 2A71A 3SMHA 1AYM3 4PDWC 5HCFA 2V09A 5FRAA 2IXJA 5L7OB 4LUKA 1IS5A 4M0NA 5FZ4A 5LA9A 4Q4V3 3AYAA 3PLQA 3UGHA 2HYKA 4MXWA 2XQRA 1JYCA 3NJXA 3JCIA 3N36A 3PL0A 4DUXA 4CCEA 2VZTA 5FK7A 4B7EA 1YJLA 4FPEA 2GU9A 2J1TA 4AGGA 1YWKA 5K9YA 2J42A 4LO7A 2IVJA 2QZ3A 4XUTA 3USSA 4A6SA 4AFMA 3H3UA 5L9VA 3KQRA 2WQZC 3SITA 3WP3A 4DEQA 1ENRA 3VBUC 2BZDA 1QEXA 1S0IA 3ZN4A 3NJVA 4DEVA 4GAZA 2GP3A 4AFBA 4AQ6A 4NVPA 4N7UA 2J1AA 1ND3A 4LMFA 2VC9A 5F3CA 2VU9A 2ZX1A 4EROA 3MF9A 4HKLA 4MGZE 3DXUA 1XYPA 1XB9A 2HWD3 4R9DA 2ENRA 3RMYA 1SLTA 4KWUA 1E5RA 5F6LB 1FYUA 1UU4A 2RDSA 3B00A 5C4WC 5HV0A 4HANA 4IEPA 3NVCA 3ZXDA 2ARBA 3WR0A 4PIZA 4Z1VA 5BY5A 4XHBA 3W9AA 5JI7A 1YFUA 1E57A 4QU2A 4B3NA 1OD3A 1HRI3 5F1RA 4ZS2A 5FPAA 4BQ2A 3USUB 4U2AA 1LOGA 4CSWA 5CFDA 1D0GA 4TYSA 1DYPA 2WO1A 3KCYA 5APAA 5FAXA 2ZGOA 5HI0A 1J1TA 1OVPA 3S30A 4DO0A 1AR73 1RXGA 5F5QA 3VBSC 2PHDA 5FZIA 1ULCA 4LBQD 3AX4A 1H8VA 1WGPA 2CGNA 2FCUA 1PM4A 4IV1B 4XILA 5EHDA 3VKOA 2BW8A 5IWFA 4QX0A 1L3JA 1H1AA 5K8SA 1OF4A 1SBEA 3KB5A 3VDDA 4F3JA 2R1DA 2BP6A 5FO9B 5IT6A 4TXWA 2XJQA 2YPJA 1QQP1 1CESA 3N9LA 2W5FA 5DAVA 3BIEA 3T3YA 2VNOA 1CD3G 4YLZA 1AL0G 4PJYA 1S0EA 2O8QA 4F83A 1HRV1 3IDBB 3ORJA 4LA3A 2Q30A 1AR92 3DPRB 4RA0A 5FK8A 3DEMA 5FZDA 3VBFC 3ZFFC 1PMHX 4D6SA 4C90A 5DUUA 4QX1A 3IAPA 4AVVA 1SFYA 3OEAA 4P9XA 5FZLA 2WZR2 3VD7A 1L7LA 1W8OA 1ULPA 4NO4A 4AEJA 4CCLA 1XBFA 1KD7A 5FZOB 4BK5A 2O14A 4KWKA 4KQ7A 4XJZA 5L9RA 4CU9A 4XUPA 4BISA 1H9WA 2X5IC 1Z7S2 2HKXA 5F6KA 3W59A 4AL9A 2DCJA 5FZMA 3NL1A 4O9EA 3VD9A 3R6SA 5T50A 3E1F1 4AR2A 2VOXA 2A6WA 2D5FA 1LOFA 2TNFA 2PA7A 1JW6A 1GQGA 3C7GA 2XJVA 3PNAA 2ZEYA 2Y6LA 1O4YA 2Q8CA 2L9LA 4PBPA 4JC1A 4MHRA 3VBOC 3CU7A 4IESA 1HN1A 4J1WA 5F3EA 3RRDA 4ZPIA 1F35A 1MQTB 2WT0A 3OD4A 1RUE2 4YVSB 1W8TA 3AP6A 3ZXAC 4QPGB 3O1SA 4CVUA 2TEPA 4AQSA 1OBNA 3ZFGA 1Q5OA 1U5IA 2HWB1 3WDYA 2VMEA 3EXUA 5DUWA 5A7WA 5A6YA 2ZGLA 1NCRB 1QJY1 3AMMA 4S2GA 5BNPB 4UWDA 5CYYA 3HAGA 3CO2A 4NIAA 4YGEA 3FBYA 1C1LA 1UXXX 2R32A 5FYUA 1QQP3 2YPDA 4BLIA 1XPWA 3K77A 3WSOA 2JG9C 2JICA 2W47A 4EE2A 2P3IA 1Q8QA 2VCMA 1OUSA 2IFRA 1QJZA 1ULDA 3ECQA 3KQ4B 4OUMA 2D6MA 2OXBA 1DZRA 3S5QA 1FOD1 1HRV3 2C9AA 1RUF2 4P5YA 3ZMOA 1OLQA 5IVJA 3WDVA 3WF4A 4K6BA 5FYBA 4AAPA 1J58A 5DZGA 4XOGA 3KD4A 1DLLA 3IT8A 4JGYC 5FY4A 4UW4A 5EJ1B 3H0OA 5LBFA 3OGVA 3RZHA 3MIEA 3C7OA 4YNIA 2MNGA 4MYEA 1V9U2 3RJ2X 1UAIA 2IXCA 3EHKA 1YQ5A 1ND3B 4HT1T 2WN3A 1LHVA 5K7PA 5K0UB 2YC0A 3LA3A 4ISRA 2JJ6A 4QHBA 5T3NA 2D6OX 4YARA 1VJ2A 2WAAA 4IUGA 4ARXA 3AM2A 1YI7A 5DAWA 2WA4A 5T54A 2R1BA 1WW6A 1NXD1 5C3QA 4IV3A 5LA1A 3T0DA 3JB8A 4MG2A 1WW4A 4WZFA 1U5ZA 2GC0A 4Q4X2 5JUVA 1JYIA 1AR81 1ZA4A 1ZZ9A 2PHWA 1H9PA 4LHKA 4W6XA 4L9BA 1FATA 5LBEA 3EMRA 2X29A 5BNNC 3J7NA 4IE5A 2ZGKA 3MHZA 3POIA 5IATA 4BQYA 4KH9A 5D2AA 5CFDB 2HWB3 3ILFA 1UKGA 1QXJA 3RS6A 4ASMB 2JEMA 3GZAA 4D94A 1IS6A 1JI6A 1QJY3 1STMA 4PF1A 1IKPA 1NAEA 4R4XA 5SV8A 1W9TA 3C3VA 1L7RA 4A45A 1UO9A 2W1UA 4AZZA 1R1A1 4D69A 4LNVA 2XVGA 4QU1A 4LJHA 3WOGA 1W05A 3MV11 2D3RA 2VVFA 4COWA 3POFA 1X50A 2CU5A 4CU7A 4GB32 1C3HA 1QIQA 3AXDA 3I2HA 1MR5A 1AX0A 1FOD3 3HPNA 1BXHA 5FO7B 4AFCA 4Y1YA 2EXIA 4XQ4A 2VQ0A 3V56A 2QDRA 5JZGC 2XJRA 5FPLA 4YYOA 2D93A 3HVDA 3M70A 1AL22 2QQJA 3DV8A 4BQXA 1J83A 2PAMA 2XB6C 4LBKA 2RS32 4YW4A 3HBKA 4A7ZA 4XETA 1RJ7A 2DU0A 5FZKA 1NY72 1NCQA 4GULA 5KXEA 1MS3A 1KXGA 4UBGA 3PVBB 1VBA2 3VBHA 1O5UA 3I59A 2QTWB 5JOYA 4A42A 2BPA2 1LODA 2VMGA 4P9IA 5JLVA 3A0KA 3U07A 3BU0A 1AJOA 2WZ8A 4CRQA 3O14A 1XE0A 2DFBA 1H1MA 3K51A 1B35C 3MUZ1 4Q0UA 5LK5A 1F4AA 1VRH1 4PIYA 2CL2A 2NMOA 3VBUA 3I7DA 1JZ4A 3LF7A 2DVBA 1JS9A 1JZ5A 1QGLA 1HDKA 1AR83 2R7EB 1F4HA 2JE9A 4IEWA 4CCKA 3NAPA 1J3QA 5A7NA 5A7OA 1YXWA 2VE1A 3UGFA 3CF6E 2GMEA 2B7YA 4Q4W2 3SISA 2WNUB 2RJKA 1VALA 3GDBA 3RYPA 4OHXA 3ETPA 4YRDA 3OUIA 1YQ8A 4WM8C 2MEV2 5C4WA 2E63A 2JDNA 4BA6A 5A7WB 1LGNA 2OPKA 4E2SA 4CUCA 1GKBA 4D7TA 1W6PA 3IZOA 1RUI1 1CIWA 1R1A3 2HWE1 5HCBA 3U1XA 3U4SA 4EWAA 4CCOA 2HEVF 1SZBA 1C8NA 4MHUA 2R041 3RZZA 4SBVA 5IVFA 1KDMA 3S7EA 2ZXQA 3QCWA 4AVCA 4OFGA 1A78A 1H6XA 5L73A 1SCRA 2JB4A 3AFKA 2FDGA 3KT4A 2GMMA 2ZBJA 5CA6A 1S0JA 1I6XA 4YZ1A 2ID4A 2UURA 5LY2A 5L36A 2WFPA 2LUWA 4BQWA 3TEYA 4XTMA 1R082 1WLCA 3AKPA 3MW3A 5E8AA 3TYJA 1F2NA 4M00A 4COZA 2HWF1 4JQTA 1JOPA 1LTEA 3VZJA 3LAGA 3POEA 4LBQB 4YW2A 5FTTC 4UFIA 3KT7A 2W91A 2JKXA 2RHPA 4NJ4A 2V73A 2CGPA 3LOBA 4M3CA 4NMIA 1JZ6A 3ZYPA 4B1LA 1HQLA 3L9JT 4P14A 4BZ4A 3SEPA 1HJFA 4CA9A 4XIKA 1TQ5A 3ZFFA 3RZJA 1VRH3 4QM8A 2R062 2D6LX 4QB2A 3GCWA 4XF3A 3WEZA 3V0BB 1X9PA 3ZXEA 1FI2A 3NRUA 4AVTA 5LY1A 1PO22 3O1PA 2W52A 1H6YA 3KV6A 1Q56A 2VNRA 4IV3B 4WVZA 5FZBA 2Y33A 5FMDA 1EPZA 3J4UH 4I01A 1VAKA 1X9TA 3LOIA 2BOJA 4Q4Y2 4IEQA 2CAUA 3H7JA 1PVC1 2B9VA 2CV6A 1WCUA 1X33A 1XRUA 2VM9A 3ZYFA 4CP9A 1QKQA 1KS5A 1US2A 4NWWA 4XMIA 3Q9OA 2VMHA 3VL9A 4DXZA 1GICA 1W04A 4I02A 3ZXFA 2FZ2A 1V0AA 1AXKA 4Y1VA 5ABJC 1RUI3 2HWE3 1S0FA 3H50A 2QJVA 1C57A 3ACIA 1FV3A 4NROA 2R043 2BFUL 4CDXC 3IN9A 4MADA 1RVF1 1ZNPA 5EJ3A 4YZ4A 1BVVA 2Z4FA 2FDIA 3WF3A 1ZBA2 1QDCA 1F5FA 2DFCA 1W3XA 4RGAA 3TNPB 3DN7A 4DPNA 5F39A 4Q2FA 2RM21 4CXYA 3WUCA 2ZHNA 1VBE1 1RUG3 1GSLA 2BYVE 2VZRA 2WINB 4P9GA 3AP9A 3PURA 4BMBA 1BKZA 4XUNA 5FY8A 1GP5A 5FYYA 3ZDVA 1DGWX 3AC0A 4FXGB 5E88A 5I8YA 1A8MA 1R64A 5I0DA 2Y6GA 2HWF3 4NN0A 5C9AC 1JXNA 2GN3A 1QJU2 2JIGA 2XL7A 2ZTNA 4XF4A 2RR11 5H9SA 1K5MA 1EPWA 1UOBA 5GM0A 2PAEA 3WCSA 2LW8A 1NCQB 3ASIA 1DLCA 4NHLA 4BDVB 2VZVA 1PK6C 3FX3A 4XABA 5GLWA 3VBHB 3I59B 4ASKA 3B02A 1N1YA 1IS3A 2AEYA 4R52A 2XXZA 2JE8A 3EO6A 3DKWA 2IWGB 4TZDA 3H1WA 1W3VA 4K21A 4PF5A 1SFNA 3B3QE 1CVNA 1MEC3 2ADDA 2ORXA 2QDNA 3NQHA 4YW1A 4ATFA 2DURA 2RS52 4LKFA 1AR61 2WNEA 5BYNA 2P6HA 2YU2A 3VDCA 2XBO2 4IGOA 1VBB2 3NAPB 1PVC3 3AFGA 5A6ZA 1AUYA 4BB3A 3ENRA 5E16A 5DPNA 1NQJA 3BTYA 1SLIA 3ATGA 3DKQA 3JBG1 2RMU1 3MEPA 3M1HA 4A41A 1RUH2 1X82A 1BLZA 4LOTA 3V64A 4XMAA 5C4WB 1PNFA 4K3UA 4IEUA 2FHRA 4M4RA 3OSDA 3INAA 2FZ1A 1LU1A 5GKAC 4D8MA 3MIGA 2EALA 2W39A 4ITCA 4HK9A 1W6PB 2OT7A 4TLGA 1EUUA 2D6NA 2N7GA 1RVF3 1ZX5A 4MUVA 4XHXA 1EUTA 5FP3A 5J98B 5BNNA 1MZ6A 3ZYIB 5C3RA 3OGGA 1PGSA 4G3YC 5FP7A 2ZZQA 1Y9MA 3JZVA 3T4HB 4EV0A 2RM23 3AP4A 3IAQA 1U0AA 4JHZA 4K20A 5FCCA 1O3RA 2Z79A 5FZ0A 4YFWA 4QPYA 2IFWA 2LM3A 4NE9A 4JKLA 3FHQA 3AL6A 3WNMA 3ZXKA 1PMJX 3E6DA 1ZZ6A 1IG0A 1OHFA 3D82A 3IIIA 1G9BA 4V2VA 3QOPA 2PMWB 3H3ZA 2W9XA 1GNZA 1ZZBA 4LA2A 2RR13 4KGQA 4EN7B 1ZRRA 1XNTA 4M0HA 3LSDA 2CY6A 1ST8A 3OBAA 4FVVA 1W90A 1LHUA 1YQ2A 5J3UA 1K3IA 3IMNA 3POGA 4BMEA 4EQVA 4QB1A 3S5AA 4M3CB 4LQRA 1X8EA 5DZFA 1UWWA 3WHTA 4AEMA 5JZGA 3WQ7A 1S0DA 4QXKA 3ZFFB 4Y20A 2RDQA 4L8QA 1AR63 2BNNA 3ACFA 3FE5A 5JAXA 3U75A 4FPOB 4YG6A 3POWA 1W6MA 5FZHA 2VUAA 4N53C 3OF1A 2ATFA 3ON7A 1MS9A 1W9SA 3A4UA 4YG0A 5KHJA 2QQLA 5KXDA 1LOAA 4A2UA 2E7AA 4XUQA 3JBG3 3BU7A 2RMU3 4NAOA 4CP9B 4KWLA 2JDMA 3O5SA 2B42B 2K0GA 4URAA 2V5YA 2VXRA 4CEYC 2BUKA 3HNYM 1B35A 3I3DA 3OEBA 2JG8A 3ZOIA 4CP2A 1W0OA 4WVMA 4KU8A 2ZGSA 2ZX2A 4YFZA 1ASJ2 1GQPA 5FZ3A 4AHZA 2VBDA 3I2DA 1TMF2 1H2KA 4C8DA 1N3OA 2Y6HA 1J59A 3BKZA 2XGXA 2ZPXA 1C1FA 1US3A 1RUJ1 2D3PA 2FQPA 2VR4A 2RG4A 5T55A 5JPNB 4CDWC 4H3WA 3WX5A 4DUVA 2OPWA 3GF6A 5KWRA 2HEYF 4QQ2A 3W5NA 2PTMA 1VBC1 2WIIB 1FMD2 4Q0PA 4BHPA 3KV4A 1O4ZA 5F2SA 3GNEA 1GP6A 4ES9A 1GNHA 2QCSB 1JU4A 2WKKA 3OPZA 1SDDB 1X7NA 2Z2SB 3LPFA 1KEXA 3U10A 4XF1A 2ET7A 3MUY1 2H0VA 1BYHA 4RFT0 1K5MB 3GJBA 5C5TA 4Z92B 3MLKA 1MZEA 3SQOA 2XJPA 3FBMA 5FY5A 2WZPP 3A21A 3I3QA 4KGGA 1AVBA 1LU2A 2GAUA 3O1RA 3DL3A 3ACLA 3WDUA 3WNNA 5BPXA 4TLFA 5FLHA 1KRIA 2XDVA 1ZBE2 3D6EA 3OPWA 1MS1A 2VVDA 2VCAA 1PZ7A 3WQ1A 4W8JA 4BJ0A 4BXFA 3AZWA 1TNRA 1LR5A 2PHLA 4DXTA 3BOWA 1CWPA 5D8AB 5LEJA 2XONA 5CKQA 2JD4A 3O1OA 4U36A 2BWAA 2J1RA 1FT9A 4M3CE 2YDEA 3BOPA 3SCFA 1RMU2 3VKNA 5A3UA 1LKNA 2ZX0A 2VJXA 3K48A 1D4M1 5A1LA 4DUWA 1UY0A 2WQ8A 1KDKA 2WO7A 2PLV1 3LGRA 4CDQA 3RJRA 1RUJ3 5FUPA 4AEDC 1OMIA 1FPN2 4XE9A 4D3WA 5C70A 2YG0A 3BODA 4Y4RA 1DZTA 1Q8VA 5A7SA 3TOJA 1WCDJ 1WW7A 1AYM2 1WBLA 2F17A 4RR3C 3MIFA 4Q29A 1VBC3 4HVRA 5IUQA 1OURA 5I0TA 2W1WA 4Q4V2 1PX4A 2D6KA 3OUHA 5KBFA 2HEWF 2A3XA 4E27A 5LRSA 1WW5A 3T30A 4I0BA 3J8F2 2WO2A 1QWRA 4AF9A 1WWYA 2ILMA 4XXPA 3T2OA 1EV12 2P5BA 5C6CA 4RGGA 3LEMA 2A6ZA 2WT1A 5DDJ1 3I3MA 1LHOA 3A22A 3MBWA 5DUXA 1C28A 2CDOA 4NRMA 1UPSA 1ZREA 3PMSA 1LENA 4B1MA 1CONA 3I2FA 3M3IA 4PBOA 5FP9A 3W21A 3KGLA 1O3SA 2WLQA 1MS5A 1CX1A 3ZVXA 3HQXA 2VULA 1UZVA 2YMZA 1UD1A 1NYWA 4OZOA 4Y20B 5LBCA 5C9AA 1OF3A 2YB7A 5DG1A 1VMHA 3AKQA 2VZ1A 4GA9A 3GZTB 1E5SA 1OA3A 1W6MB 4H55A 3A23A 1FXZA 2Q5TA 1UYYA 2UY8A 2VMIA 3KHBA 4YGBA 1H8TC 1RUD1 1DIWA 1VAMA 4GMP1 3UV9A 1GWKA 3B94A 2BBVA 1QH6A 2D7FA 4HONA 5A32A 1W0NA 3O1TA 1YNAA 4UYBA 3WW1A 4C91A 1RHI1 3BN6A 2JG8B 3JD72 4WVMB 4HXCA 1OPMA 2W0XA 2PLV3 4GQ7A 3ZMNA 3WP5A 3MW4A 2DCTA 4O61A 4RQPC 4BIFA 1UMIA 2AC1A 3ES4A 3WD5A 5I0RA 3X29B 3LPGA 2X53S 3UKVA 5IHRA 4CEWA 3AB0A 3J9SA 4R8HA 3V0AB 2DBIA 3ME2A 2MPFA 2J7MA 2Y8KA 3I49A 4FAGA 4IEVA 2PHTA 3K75B 2WSUA 1CAWA 3HNBM 3I3BA 1PGW1 4L97A 4OCTA 4XC9A 3ZYRA 2VZ3A 4XJ9A 5A3TA 4JV4A 1NUKA 1OLME 4XPVA 1W39A 3SCHA 3LSEA 5AVPA 4AHWA 4GMP0 4HG6B 2JXAA 3ROUA 3WNXA 5B4XA 1NX9A 3VZOA 5LK7B 3ZSMA 1LESA 3LB9A 2BFUS 2B4KA 4Q0SA 4QPIA 5DDJ3 1MVQA 4P5HA 4QDSA 4E9KA 1GZTA 2W68A 4NHXA 2F6BA 3ZFEC 1RITA 1LNSA 3OBTA 2PQQA 4FFGA 4Y4YA 4BLJA 4ARYA 2ZMKA 5FZEA 1MZ5A 2XHKA 3NO8A 4I30A 3IDAA 1DGRN 4IDZA 1J3PA 3ZYGA 4BM8A 4XIOA 1DQ4A 3K4DA 4FQZA 4GJYA 4AQ2A 4YM0A 5CFCA 3AP7A 4MGYE 1QNYA 3Q8FA 4IEYA 4CDUA 4FSJA 3RVHA 1XC6A 3TNQA 1SMVA 2DUOA 1A6CA 4WM7B 5FLIA 3M3OA 2VXJA 4GMP3 1RUD3 2W1SA 2E33A 5B2GB 1CIYA 4UXAA 3H8RA 2NQYA 4AQTA 2B9UA 3PUIA 1O8SA 4HN0A 2HLEA 2AGSA 2WWSA 4K8FA 3LZZA 1OKQA 2ZABA 4BE3A 1RHI3 1XU2A 3KGZA 2FCTA 4LIUA 3WG4A 3ZSLA 2OX0A 2NZ9A 2C9KA 1PMIA 4UW5A 1TG7A 5LRRA 3K46A 2ADEA 2BGCA 3IKWA 4YGDA 3RDIA 2VQUA 4N53A 3T4VA 1SCSA 2XMLA 3AXEA 3EBRA 4CDQB 3E5QA 4H7LA 1DHKB 3ZXLA 1GR3A 1YLLA 2OYZA 3BYWA 4Q26A 3BTAA 4P9YA 2BBAA 2Y38A 1KJLA 2XVKA 1D7PM 2GP5A 3R4SA 4KG0A 3LE0A 1PZ9A 5CNAA 1XQNA 2ZKNA 3S6PA 5A3PA 1UCXA 1BEV2 2IXKA 2OZJA 2XR4A 3ACHA 1RUC2 3I3EA 4ASLA 2DDUA 4HMZA 5FYIA 1SBDA 3BTXA 1HRV2 3AVRA 4Q1PA 1COV2 1WCKA 1N1SA 3PHMA 1QXPA 4CDWA 4I2OA 1YIPA 4GH4A 3GJAA 3RWKX 1HXS2 4COUA 2ZX4A 1O5LA 5LB6A 4QXBA 4AVSA 4DS0A 1WLTA 5JDBA 4LORA 1RYYA 5LWBA 1AR91 1OH3A 5BNOB 1OLRA 3W58A 3VD4A 2E6VA 2WZR1 5FP8A 4N43A 2HH9A 3CIHA 5C9AB 5LZ6A 4Y5TA 2A6XA 1LGCA 3KMHA 4KI5M 3OUJA 5FZ9A 2F4PA 2LRPA 1ND2C 2BNMA 3TEXA 1Z7S1 3Q8AA 1UQXA 5FIXA 2AENA 3VV1A 2WS92 4LBJA 3T2PA 4Y22A 4Q8KA 3ZPYA 5IVBA 5DAQA 3HMYA 4GWNA 3E5XA 5A32B 1CPMA 1BHGA 5EYYA 4OI2A 4CXWA 1UW8A 5GZGA 4XCAA 1YFWA 3S57A 4RS5C 5DZEA 3ETQA 5ERLA 4ZY9A 1GWLA 4P9WA 5FPZA 2VGDA 4YW7A 3VZNA 2RDNA 4LO8A 1RUE1 3K4AA 3B7MA 1R1ZA 4IXLA 4OMDA 3N35A 1UIKA 4E4HA 5GZDA 2R49A 4YM1A 2D98A 2EAAA 2QQVA 4G9SB 2Y0OA 4JKKA 5I0UA 4CEWB 3D0JA 3NSTA 4MXWB 4YVWC 4XFAA 1H0BA 4QD2A 2XJSA 3CJIC 3PDQA 3VBRA 1CAWB 2ZJCA 4O65A 3ZSEA 5CADA 4YZ3A 3PVNA 5HXMA 2CAVA 5I0SA 4QHZA 1LHNA 1O3QA 4OMCA 3E6CC 3D8CA 2YFZA 1JU3A 3MICA 2Y6KA 1IQDC 2KR2A 3MIDA 4E4ZA 3KVBA 1IS4A 4QPIB 1NA1C 2ZGPA 3MGUA 2IUWA 4OLLA 4QGLA 4EJRA 4BK4A 4RR3A 5BNOA 4NIDA 1RUF1 3CKHA 1AR93 1CZTA 4BXSV 3C7EA 1N47A 2VTFA 1W8UA 3QACA 2PAKA 4JRAA 3O1MA 2WZR3 4JGZC 1JYNA 2O0OA 1GMMA 4A7YA 2FMYA 2ZX3A 5CFCB 2RS12 2CTVA 4Y1UA 1V9U1 1SDWA 5A3OA 1EY2A 1MACA 3JQXA 1ENQA 2W3JA 4CDUB 1Z7S3 4DRRA 4A7KA 1TME2 2QQPA 5AC92 4TTGA 1UIJA 3RZGA 3GXUA 4AI8A 2GH8A 2EIDA 5H9PA 3QH6A 3RMXA 2W2IA 3RPQA 3WDWA 3KF3A 1LEMA 3OGJA 3OGSA 5FWEA 1W06A 5D21A 4LK6A 4XAAA 2VAUA 5FKCA 3IWZA 1RUE3 3DCQA 4B4PA 2V72A 4N53B 4NIGA 1S0BA 2HJIA 4MGSA 2XH6A 3VDDB 2VQTA 4AK3A 2J1EA 2BNOA 3N7JA 1UF2C 2OZ6A 2FMDA 3DYPA 1ALYA 4AI2A 4XDOA 2G9GA 5FBZA 4OI0A 3RSJA 2QBXA 2X10A 3MPPG 1AJKA 2RV9A 4I3PA 5FUIA 3D5OA 1U5XA 4ZU7A 2WLPA 3PJYA 4JQRA 2C0ZA 4JDMA 5C8WA 3H7YA 4PDWA 3CJXA 3KT1A 3G7DA 4MSVA 4F7ZA 2VL4A 1QJX2 4GB31 4JCKA 2VUCA 2G1MA 1RUF3 2JD9A 4GH4B 4MXVA 4RHV1 4KG8A 1UY4A 2QZ2A 2ZGQA 4FPFA 4ZHNA 2DCZA 3ZSJA 1BCXA 4ZXKA 4CPBA 1OA4A 3ACGA 3AMQA 4QMAA 5FXZA 3H8XA 4P02B 2JECA 2E32A 4FOYA 1UKRA 3O12A 4FXKB 4XZUG 2Q0AA 4ONUA 5FZ7A 5CKNA 1V9U3 4N43B 3GCXA 3FHIB 4MLOA 1NY71 2R16A 2UWCA 3KZ4C 3GBGA 3NW4A 3M3EA 1GLHA 1CZSA 3C7HA 5A3WA 1VBA1 1J1LA 3ZFEA 2JB8A 1I9RA 4L2NA 2CSGA 1OFSA 2WO3A 1CZVA 2G9ZA 3MYXA 4Y22B 4E8CA 3ZFGB 3TN92 1WBFA 1ZVFA 4CXXA 2ZKLA 4LHLA 1UOGA 4YG3A 1QNWA 5DAXA 4BPZA 2WFF2 4EN9B 1Z0HA 3O7OA 3M3CA 4K9SA 2ZAAA 1DCSA 3ZR6A 5FOBB 2JDHA 2VCBA 2CYFA 3AKSA 3PIJA 4PT6A 1U12A 4LR4A 3LEKA 4Q4W1 5L7OC 5A3NA 5FYVA 1LAJA 1WMEA 1V6LA 4XCBA 4L92A 3N7LA 5A6QA 2UYAA 2MEV1 1YQCA 1WZXA 5F5IA 4Y5Z0 3THDA 3VBRB 4EN0A 3Q8EA 3VBSA 5IVEA 1H2NA 4C0BA 1RUG1 1APNA 3I2IA 4W65A 1XJAA 4QGMA 2PELA 2WWJA 3FUOA 4DIQA 3BTZA 1LHWA 2Y6JA 5SV5A 3RZKA 3VL8A 3M2MA 4HZFA 3AKTA 4CCJA 2P3KA 4GB33 3BALA 2AR6A 2H6CA 3AMHA 5J96B 5LATA 2VMDA 1REFA 3NV2A 4IEOA 1WMDA 4RHV3 3LEIA 3UT0A 3QD6A 4RYDA 4RN5A 4A3XA 1IGOA 2ZGMA 2AREA 5FV3A 5G05L 3RYKA 2GZWA 4CCCA 1AL23 1KGYA 3VBFA 5JXGA 3K3OA 1R081 1WD3A 1CN1A 1JOJA 1HB3A 4LKEA 4OHZA 2D5HA 3U0ZA 4E2QA 2G19A 4N9IA 1MEC1 4QKDA 1SG3A 2VW0A 4QXCA 1VBA3 2BQPA 5LA2A 1C8M1 3WUDA 1R092 4GALA 3R4DB 4ORFA 3BPZA 4TWTA 1NLSA 5F8PA 3N7MA 2A5ZA 3HN3A 2VOVA 4QKFA 4CYDA 2WZEA 2X5IA 1S2EA 3FLPA 1F9KA 3ZX7A 5JOZA 1HV0A 4JDOA 2R061 3AMNA 1DQ5A 2YHJA 1SPPA 5CEHA 1ULOA 4FTBA 1Y3TA 1IKQA 5HXVA 1F31A 2VO5A 2K46A 3IMMA 5KC6A 4XFCA 2E7QA 3CNAA 4Q4Y1 3VBOA 4Y5SA 3S7IA 1ND2A 5F3GA 4Q4W3 2WNVC 4LLFA 3ILRA 4K8RB 2MEV3 1DQ6A 1V6MA 4AXOA 5JMOA 5KXBA 2CWSA 3WQ0A 4DINB 3KV9A 1DGLA 1MPXA 3GBWA 2W08A 3VB9A 3WXPA 5FZ6A 2ZCWA 3SLIA 3WZ1A 2W46A 2BWCA 2RM22 4RS5A 2IZWA 4WBBA 1SHWB 1VBE2 2DU1A 3BCWA 3DPRC 4N9HA 2GNDA 3T0BA 4PDWB 1VE0A 2IXLA 2V5DA 4XTPA 4C0HA 2Q1ZB 5FFOC 5IFPA 4KWJA 2NM1A 1PNGA 2JG9A 2C6SA 3D3AA 4S2DA 3OBZA 2W92A 3PU3A 1Q8OA 5FYSA 4FPJA 2UY9A 3CJIA 2AYHA 1AYN2 4YW6A 2OW4A 4B4RA 5J36A 2ARAA 3F95A 2HWC2 3IIAA 3CL1A 1GBGA 1R083 4LK7A 3A0NA 4PLOA 4ZXEA 4CUGA 3MIHA 2VZQA 1IHMA 5JR2A 5F32A 4I3GA 4RL7A 1RUNA 1QJU1 4JGYA 4XQWA 2XPJA 3VBUB 5HCHA 2ZOEB 1Z78A 1C8M3 5CG9A 1X8MA 2Q1MA 2YBSA 4E4DX 2I74A 2ZGNA 2P4EA 4Z82A 4UI9L 4QX8A 5FZAA 3ZFEB 4GD4A 2GC3A 2A73B 3NKTA 4XVHA 1MQTC 3FLTA 4MVTA 1NZCA 2R063 4YVSC 4Y3OA 4I0AA 3ZYJB 2JDUA 5FOJB 5FWJA 3N9MA 1ENSA 1ZYBA 4JGZA 2JDZA 1UPIA 1F5JA 2EIEA 2RS51 3NNMA 5BNQA 3OD0A 5FZGA 1DQ2A 1NCRC 4Q4Y3 5FY1A 3U14A 2A6VA 2EICA 5BNPC 1S55A 4QDRA 4Q0VA 5FMBA 2Z5WA 3THPA 1QOSA 3N4MA 4M01A 1OOPC 2RDRA 2ET1A 1RUH1 2P2KA 3ZKYA 1REDA 3P6BA 4META 1CAVA 3FN9A 1XSQA 3HOBA 5FY7A 4XW3A 5JXHA 3ALQA 2VZSA 1SACA 1VLNA 5T5OA 3OBRA 2QQNA 3VBSB 3HQRA 5LBBA 4DQAA 5JCTA 5HCAA 1TNFA 4E8DA 4J1XA 2FDKA 4QB6A 4AI9A 2R0FA 2VOWA 1PIV2 2DVFA 1ODMA 5H9RA 3V65A 4HVQA 1KQRA 4CCNA 3FWEA 2Z69A 4QPWA 1GWMA 1CJPA 1O7FA 3ZR5A 5GZCA 4H2AA 4FQ4A 1UZ0A 3C2UA 1W6OA 4YGCA 2IC1A 3ZPOA 1UU6A 2MHFA 1ND3C 1N3QA 2XLGA 4QHOA 4DXRA 4Z2AA 2B39A 1FNZA 5K0UC 3TWIA 1HX6A 2A1XA 2E9QA 3FUQA 1QJU3 3CZJA 4J25A 3VBFB 3N9QA 4YW5A 2R072 4IEXA 2YROA 3AZVA 1XSRA 4I0WB 4LBLA 2WDBA 4O9GA 1OQEA 4D7SA 2V4AA 3R05A 5J48A 5JOXA 1TEIA 1V6OA 2TUNA 4AGVA 5F37A 1V6NA 1G86A 4DY5A 4DXSA 2I2SA 2X5IB 1GOGA 4Y26A 1PVXA 1UMHA 4HOOA 4LKSA 1AHSA 2VVEA 4GWMA 1UX7A 4AGRA 2RS53 3FFZA 1SPPB 1YQ6A 2A75A 4MOAA 5FYZA 2XBO3 3EB7A 1TZOA 1VBB3 3LD8A 5FYCA 5C5UA 3WQBA 2YGMA 1JYVA 2NMNA 4EN8B 1VBD2 3VBOB 2WSVA 3Q8CA 4FFFA 3C7FA 1A8DA 1V00A 1Y7BA 1O8PA 1RUH3 4OHVA 3PVOA 3AJYA 5C33A 3VUOA 4XDQA 1BQPA 1LCLA 4ES8A 3BUCA 1RUJ2 5CAZA 4AW7A 2D3SA 4WM8A 4XQDA 1MS0A 1ASJ1 3ZO0B 5A1FA 2WN2A 2WNOA 3B5LB 1ACCA 3I2JA 2UWAA 1I5PA 4RS5B 4TN7A 4ISQA 5EJZB 1XE7A 3T09A 1PO12 3H1YA 1BMV2 4EN6B 3N9NA 1DQ1A 3UYJA 3FHAA 2YGLA 2JG9B 3RFRA 4YPJA 4AI3A 3IM0A 1DGWA 3VZMA 4HKWA 3AYCA 2XHNA 5FJHA 5FPVA 4HLTA 5IK8A 1FMD1 2CWMA 1Q3EA 2Z42A 4OZXA 1W99A 1XNDA 4YM2A 3ZXJA 2F4LA 2UWBA 1POV0 3IPVA 1C5IA 4XF9A 4ZU5A 4XACA 1Q8SA 3LDKA 1JYWA 4HPKA 1EAH2 4IGQA 2E31A 4RSUA 4JGYB 3VHOA 5KHHA 2VH9A 4QXHA 1PM7A 1HLCA 5KXCA 1XYNA 3OJBA 2VY0A 4MGTA 1ZA7A 5FJKA 2WAOA 1DZQA 4OYUA 4Y33A 3VDAA 3WW3A 3SCGA 2WNUC 3ILNA 4CU8A 4GJZA 4FOVA 4I09A 3J7HA 3KVAA 2JKBA 1TE1B 3MF6A 4JGZB 1ZBE1 3U11A 3KCXA 3LA7A 5E89A 3W20A 1SLAA 3SH5A 2A3WA 1W28A 1OA2A 4XJ8A 1JUIA 3HN1A 1D4M2 4ZZ5A 5HV4A 2JDPA 3KSCA 4OUSA 1IPJA 5BNNB 2KD7A 2YY1A 4XURA 4ATEA 1BVP1 3S0MA 2WR9A 2GH2A 4UFLA 3H9AA 1CAVB 1KITA 1RMU1 4RD7A 3WF2A 1ASJ3 4IV3C 4K7JA 3U78A 4AHYA 1DBNA 5F7UA 2Y64A 4AG4A 1PZ8A 5ABJA 1JZ3A 1S0GA 3M3QA 2K2SA 4OI4A 4MGKE 4CDXA 4BQ5A 5I93A 2EIBA 2WNVA 5IVCA 4XJWA 1SEFA 2GNTA 1W6QA 2LS6A 2VW2A 4R9CA 1FMD3 2EF6A 2GN7A 4QQPA 1RIRA 4ZZ8A 3WP4A 5HPOA 4GKXA 1QMJA 1W8FA 1PGL2 4AFDA 3J8F1 4LTAA 2VBBA 3KHCA 5JZGB 3ZM8A 5GLVA 2ERFA 1EV11 5FZCA 3O1VA 2P34A 4NPLA 4QQLA 2ZEWA 5CZKA 1H30A 2HWD2 5FZ1A 5JIAA 3R4UA 3UKNA 4NHKA 3WF0A 2ZAHA 2Q8EA 3NKGA 1FAYA 3CZUA 1W9WA 4GXLA 4GWJA 4IGPA 1BBT1 3Q8BA 1PK6A 3R0RA 4K1ZA 1OFNA 5ANQA 4NHMA 4NUBA 2AZ5A 4BH9A 3OGRA 1K45A 1OXCA 3N7KA 4X6QB 1QOOA 1HRI2 2W94A 3HD8B 2NLRA 2Q4SA 3RI9A 4CE8A 3WG3A 1RUD2 3PUSA 1ZBE3 1D2QA 2P3JA 1B35B 1Y43B 3OB8A 4PCRA 4B7KA 1GUIA 1JMUB 1AR72 2W95A 1RHI2 3BVCA 2QKDA 1OQ1A 2WJSA 3I2KA 2PQSA 4UF0A 4JVAA 2YFUA 3WHUA 3SKVA 3E6BA 3NMBA 2FDHA 4YVSA 3FFQA 4XZPA 1DYKA 2XKOA 4PLMA 1RMU3 3MIBA 1OC1A 1OT5A 1UZWA 4JZRA 2CGOA 3JD71 3AZXA 2VNVA 5DABA 2E53A 2X8KA 5ACA1 4WM8B 4R9AA 3RYRA 3HR9A 5I8TA 5GZEA 4OHWA 4TSVA 1WLDA 2RJLA 2H6BA 2PYTA 1PGW2 2DUPA 2P3YA 1SQ4A 1FPN3 2Y0IA 1AXZA 2YC2A 2ZZJA 4M4PA 5IJRA 5FXVA 3UJOA 4COVA 5BNPA 5L19A 3HT2A 3HNMA 1KFUL 3RZLA 5KC5A 4FTSA 1OKOA 1OOPA 1SLCA 2PHXA 2AH2A 1HB1A 1LJ7A 2Y26A 3LFMA 3DECA 3I97A 4LLOA 4Q8LA 2UU8A 2YC4A 4UFMA 4W4ZA 4UT5A 1NCQC 1UY2A 5I8SA 1GQHA 1UU5A 1Y4WA 2RJ2A 3I8TA 3OCPA 3J8F3 4J6GA 3VBHC 3WG2A 4LIVA 1DGRA 1VRBA 4K1YA 4YWAA 3ITQA 1YFYA 5F2WA 3ZYHA 5C8CC 4B8EA 1EV13 3AKRA 3IPVB 5F9TA 2GNMA 3WINE 3CEWA 1QF3A 1QY4A 3H3LA 1GYKA 4HPKB 2J22A 2W1QA 3D0SA 1BBT3 1DQ0A 4IEZA 4OQ8A 1YYNA 2EIGA 4JTOA 4A44A 4Q5OA 2DTYA 1G9DA 3EYPA 5JSRA 3NAPC 1JTZX 3IB3A 1BK1A 1GZCA 2D6PA 5BXXA 3L2HA 5C71A 4HVOA 3AYEA 5K0UA 1C5HA 3WW4A 5F5AA 2K9ZA 4S2FA 4LO5B 1CX4A 3ABZA 5FYHA 2WT2A 1RC6A 2YBKA 2RVAA 4LBNA 3WT3A 1PHMA 4AWDA 5J7MA 2XUMA 4LKDA 5JWPA 2PHFA 2R30A 5E6HA 2I45A 2BVBA 3AYDA 3HJRA 2P37A 3LIHA 3RI8A 4NPMA 4LHSA 3VGIA 3BI3A 1HKDA 4EWDA 3GBFA 5FPUA 5IVYA 4UOJA 5ACA3 3JD73 1W2OA 4CUAA 4CEYA 5FP4A 5AFBA 4FI9A 2VCCA 3DYOA 1QQP2 4QX7A 1RXFA 4ZS3A 5FUNA 3FC0A 3UETA 4BQ4A 1UOFA 5ABJB 3PTRB 1LOCA 3N9PA 2I07B 2PHUA 4KBBA 3VHPA 4BOWA 1IPKA 2ZEZA 1Y9QA 4GWIA 5DXDA 4AVBA 4CDXB 1O91A 5A7PA 2WNVB 1OD5A 3MFCA 4IW3A 1TVGA 1V6JA 1AX2A 1WA6X 2PHRA 4XYXA 1W6QB 5ANNA 4L0PA 4XF0A 4EYUA 5IFTA 1W6NA 3MLJA 4QM9A 4OQ9A 2P6CA 2GC2A 3PUQA 1BEV1 4QWNA 2BOIA 1NOVA 1O3TA 1RUC1 1A34A 1F8VA 2ZS6B 4JAAA 3UGGA 1UYPA 1VIWB 2WUHA 2SLIA 1VR3A 3K3NA 3OTFA 4YM3A 3LFIA 1G8WA 1COV1 2FCVA 2E26A 2XWJB 3AZZA 1HXS1 4CUBA 2O1QA 4PQQA 2OVUA 3WG1A 3UNPA 2GNBA 3U37A 4BCUA 5LCWL 1DU3D 1PK6B 3POBA 5FZFA 2X05A 3OG2A 5FY9A 3MDPA 3GHNA 4XFHA 3MV01 2D97A 2DYCA 1RINA 1YFXA 4W50A 4AFAA 4D7YA 1ONAA 2G4IA 5FPBA 1QH7A 4QGNA 2B45X 1W8WA 2XVLA 1W8NA 1ZRIA 3FL7A 4X8NA 3LEGA 3PJQA 5T5PA 5JXJA 1JZ7A 2HWB2 2JDKA 2A6YA 3CDZB 3OYWA 3RZMA 3CLPA 1S2KA 4UBHA 1XNKA 2JENA 1W2UA 3I2GA 1QJY2 2P17A 2ZMLA 2WYFA 3DYMA 3NV4A 5FMOL 4MO3M 5CIRA 2WS91 2A7AA 4UF0B 4NRQA 4CPBD 1NXMA 1GU3A 1KFXL 2VNGA 3B9IA 5T52A 1K12A 4XXAA 2ORZA 2WNUA 3DF0A 2ZGRA 4AHXA 5FR3A 2D40A 3T08A 4WV8A 4L99A 2WYSA 3ZKUA 2DVDA 2KXLA 1JHJA 1D4VB 5DN2A 4KBZA 3GZUC 1RL3A 2ARCA 1QJEA 2DVGA 4MZUA 4KU7A 1FOD2 2XLAA 2ZHLA 1Y9GA 3O0WA 5FQ0A 2FD8A 4AEDA 5DMYA 1POQA 3LWCA 2PXJA 3P1IA 5F3IA 4XFBA 4LE3A 1OOPB 3AL5A 4XFFA 5ISLA 1K5MC 4QX2A 1N1TA 3KLSA 1BEV3 1RUC3 3MPBA 1PX3A 4LXLA 1GZ9A 4OI1A 1CAUA 4IE7A 2D44A 4FPCA 1UOJA 4RGKA 1J3RA 4P9LA 5CB7A 1COV3 2BERA 4PHZA 1F15A 3F2ZA 3UESA 1D2SA 3TEZA 3TB0A 4XDPA 1HXS3 4MGQA 3OPTA 5FDBA 3ZIWA 2CNAA 4LBQA 1BZWA 3GALA 4B4QA 4L11A 5EPAA 2YU1A 1AR82 3CHXA 4FPHA 1VP6A 1VMFA 2DWRA 4P08A 3ELNA 5D8AC 5IK7A 2IXIA 1OH4A 3C8XA 2XJTA 3P3PA 1JN2P 1KS4A 1W9FA 2QQIA 2RS11 4LBOA 5EFUA 4QQHA 5FKBA 2VTXJ 3KM5A 2QQUA 1FV2A 3SKJE 4Q4X1 4DMIA 3V0BA 4N7IA 2KA3A 4Z8BA 5LW9A 1ZRFA 2DCKA 2VUJA 1MS4A 1TME1 4AI0A 2WS93 5AC91 1H2LA 4HSLA 4XBQA 1H8TA 4FCAA 1QOTA 4W6YA 2ZACA 1R1A2 2JWPA 2QFEA 4CZSA 3SH4A 1NLQA 4MV2A 2C26A 4AEKA 4F8AA 3GZEA 4CEYB 2XG3A 3JQWA 1QJFA 3FJSA 1LB2A 1P8JA 4AOCA 5G04L 4RQPA 5GJ6A 1M06G 4CP0A 1JUHA 3RNSA 3NV3A 4Q1RA 4UFHA 5JOWA 3APBA 1V70A 4XAEA 3H1MA 4FPGA 4OUEA 1Q8PA 4OULA 2VZUA 2P1BA 3MO4A 4CDWB 5K4LA 1UY1A 4PI2A 5A6XA 1W6NB 2YXSA 1HV1A 5D1IA 4IQPA 4QKBA 4V1PA 4W6WA 2GC1A 1CR7A 1UZYA 2LTNA 3VD5A 2EAKA 4EZHA 1RTVA 4RHV2 5IAXA 1W2NA 3PMEA 3RWNA 3L2YA 1AL21 2HBTA 1DG6A 1O6UA 4LHNA 2H0BA 2RS31 2VPVA 1WD4A 4SLIA 1QJX1 4Z07A 3VKFC 1SLLA 5EXOA 2W87A 3WF1A 1VRH2 4O7XA 1U5YA 1YCIA 4QX5A 1GANA 1LULA 1H4HA 4P9JA 3LDRA 3IDCB 5HBAA 5FLJA 1W8HA 3B69A 4IE0A 4V2WA 4WZCA 4COYA 5C8CA 1CQ9A 1QDOA 1NG0A 2RS13 5C3PA 3O0XA 4Y24A 5E1RA 3ZN6A 4Q4X3 1IG3A 3LQCA 2JG8C 2FBEA 1G7YA 4E2GA 1TME3 3OYWB 5FXXA 5J37A 2ZA9A 5J1XA 5AC93 3TBDA 3PUHA 1B09A 4HKOA 5JI9A 2OS2A 3WP6A 1XNCA 4LEJA 4FPYA 1T6BX 1RUI2 4XJAA 3WLUA 2HWE2 3QBQA 4A3ZA 1I3HA 2ZEXA 1H4GA 1YO8A 3TN91 3JB4C 2R042 4H14A 4Y1XA 1JYXA 3B93A 2BEOA 2WFF1 3ZIXA 4PIXA 5KHKA 3QLQA 3VN4A 1YUDA 4JKMA 1UL9A 1E5HA 1S0CA 2EXHA 2VMCA 3HT1A 4WVVA 2ES3A 3RQ0A 4B29A 5CVRA 4KL1A 4UFJA 4ET7A 4UAPA 1OUXA 3KWVA 5A3LA 1C4RA 1N1VA 1RUG2 3GM8A 1XU1A 5FQ0B 2VMFA 2BVVA 3ZDSA 4AEDB 2Y34A 2VW1A 4FTEA 4OHYA 1JZ8A 2XWBB 2GSYA 2HWF2 2NN8A 1T2XA 2QVSB 5A33A 3N9OA 3RG0A 4RR3B 1JODA 1OI6A 4CU6A 1O59A 4NRPA 3SHRA 4C1XA 1CAUB 3LIGA 4WVWA 5C3OA 4FOQA 1HB4A 5EZWA 5GLUA 2RS33 1LOBA 4P00B 1QJX3 4DRVA 4HSJA 1OPOA 1YIFA 3WV6A 5LA0A 2WL1A 3NNLA 3NWKA 3NNGA 1W9YA 4MGIE 1SFPA 1ULGA 2EA7A 4NIIA 4LITA 1MEC2 2Q8OA 1UMZA 1O4TA 4QX3A 1NE6A 3CQOA 1HB2A 3E97A 2QQKA 4WM7C 5CKMA 1D0HA 2GALA 1A3KA 1C8M2 1ODNA 3B01A 4JHTA 5FYTA 4RFRB 4AE2A 1PVC2 1RGSA 4NOTA 2QQMA 1PO21 4HN1A 3N3HA 4XFGA 1S4CA 2QQWA 3WVJA 4BU2A 1FNYA 1XXNA 1GZWA 2BU9A 2ETEA 1W03A 1N3PA 3H8UA 3ZN5A 4A6OA 4BQ1A 1Q43A 4IV1C 1WCQA 1R091 4DOUA 1XE8A 4LBMA 1IZ3A 4PI0A 5T5JA 3MZHA 1GOFA 4BIOA 4QDQA 3SXWA 3NJYA 4CDQC 1J84A 4JTNA 1T6GC 4EZ4A 2FDJA 4ZONA 3TN93 1H8TB 3E5UA 1S2BA 1RVF2 4OVEA 1X36A 2WFF3 1CPNA 3LA2A 5EIYB 1ZZ8A 2ZHKA 3OY8A 5JVVA 5LEKA 1MZFA 4GKYA 2WWUA 4D0QA 1ZRDA 1DDLA 1UY3A 4RQPB 3VD3A 5BUVA 2VG9A 4ZU4A 1ZBA1 3A7QA 2DF7A 1JZ2A 3THTA 3PIGA 3DUIA 4FFIA 3WNLA 3BIWE 1NKGA 4YVWA 1REEA 2BGPA 1LECA 3J7LA 2VOTA 2XLFA 1HQNA 2RR12 2BDRA 3OOXA 4QT6A 2AUYA 1WUVA 3P5BA 5IK5A 5GLTA 4NAMA 3M7AA 3QH7A 5C3SA 2WABA 5EV7A 3NJZA 2B46X 1ULEA 4FP2A 3WNPA 3ZSKA 2QE3A 3KCCA 5DUVA 4AYUA 1I5ZA 1WMFA 4QAWA 4S2HA 5FO8B 4LO4B 1YHFA 3K4ZA 2R0HA 1G6NA 2ZHMA 3BB6A 1M4WA 4GZ9A 1NA1A 2J1UA 3MW2A 4MH0E 1ULFA 1AXYA 1AYN1 3AP5A 1RUOA 1NQDA 1AR62 4JRLA 1AF9A 2HWC1 4X8PA 4XUOA 5JPMB 1GFF2 2CDPA 1RJ8A 1UYZA 4QPGC 5IW0A 1OQDA 1QHDA 2DBNA 3GYDA 3WW2A 1PO23 5C8CB 1V6KA 2PN5A 1GNYA 3JBG2 1IPSA 2RMU2 3AMPA 5GLZA 3ZN6B 3JU9A 1WKYA 1R093 2XBO1 4FAHA 1VBB1 4Q27A 4PQ9A 4GIQA 1UNBA 4MX3A 3POSA 4XEZA 1NE4A 3HBZA 3VHNA 4AAXA 1JHNA 3AZYA 4HL0A 4URTA 5JIUA 1MVEA 1XNBA 2DV9A 4LULA 1XNAA 4X6RB 5EWSA 4CEWC 3VKLA 2VD7A 3JUUA 3MFAA 3VHRA 3ZYBA 4DFSA 1OLMA 2J1VA 1JOBA 2BV4A 3PU8A 5D8AA 1CGPA 1UYXA 1ZM1A 3WDTA 3P3NA 3HIFA 4M3CF 1YEWA 3AJZA 1EP0A 2AACA 4QQOA 5KR7A 1DP0A 1GP4A 3RGBA 1ZBA3 2WA3A 2WQ4A 4QKNA 1MS8A 3POJA 1LOEA 3T1MA 1DYOA 3AVSA 5FMOS 5GALA 5T5LA 3O1UA 3B9CA 1DF0A 3EQEA 4QPIC 5FBJA 1CJDA 4LUMA 4CP1A 2RE9A 3LCPA 3UKTA 2VOKA 4FBFA 4LOSA 1CAXA 4XJUA 3PVEA 5DAPA 5BV6A 5A33B 2VTXA 1YRZA 2Y6FA 5JSPA 1E5IA 1VBE3 2X09A 3CMGA 1ZRCA 2XKPA 3WCRA 5FXWA 4NR1A 1BK0A 4XBNA 1UX6A 2HBUA 1PIV1 4NHYA 1KJRA 3UK9A 5A70A 4D6QA 2ZMNA 5CFCC 3VLBB 3BPSA 3W5MA 3KS7A 5AFEA 1SBFA 4CCMA 1AYN3 1WMXA 2OQ6A 3KF5A 5GZFA 4CDUC 1WLWA 2HWC3 4LE4A 4D6RA 3SEEA 5IAVA 5TSWA 2WBKA 1VB4A 1GOHA 1W0PA 2BJSA 2DTWA 2J1SA 3DGTA 5CFDC 4CCDA 2OUJA 5DQ0A 5FMCA 1HW5A 3ZXGA 5I91A 3M4FA 2R071 1WCSA 3I4IA 3K2OA 1XOYA 1W2TA 2NYYA 4LO6B 2BGOA 3LKJA 3T2TA 1GZWB 3PTYA 3UL2A 2B5HA 5FPXA 2JDYA 2VECA 3G6JB 2VZPA 1FX5A 1ND2B 1S1AA 3THCA 5CG8A 4FO9A 4G4FA 5EP9A 1POV1 5FREA 5F5CA 3VDDC 1K5JA 2BRTA 1L7QA 4DY3A 4UW6A 2DCYA 3BGAA 5J09A 1G9AA 5IYYA 1WA4A 1YJKA 4LT5A 1BJQA 2Q1FA 2Q8DA 4DB5A 4ZKTB 4C1WA 1IOAA 1URXA 2PFWA 1TMF1 2WC2A 3OY8B 4LPLA 4N90A 2OKXA 4DZGA 3LDBA 1NT0A 5JSOA 1VBD1 2ZGUA 3ES1A 1VBC2 1HN0A 3HWJA 1EYBA 2C4XA 3ZLIA 3J26N 5L7OA 1UN1A 5CBLA 2FDFA 4IE4A 1LEDA 3U4XA 3V0AA 2VZOA 4R4ZA 4PLNA 4FPLA 1QXRA 4YVWB 3CJIB 5EYXA 4GH4C 4CTEA 5FZ8A 3TAYA 3WY6A 2ZGTA 4AVAA 2JE7A 1PIV3 2BTVC 2EXJA 2VQAA 1PO11 3AK0A 4FOWA 4BYYA 5JXIA 2YZ4A 3WNOA 2WRAA 2DVAA 4HETA 4Q0QA 1BMV1 2V4VA 5LASA 3DXTA 3MLLA 1LOFC 2DUQA 3HEIA 4N43C 1NA1B 3VZLA 2XJUA 4IL7A 1ZZCA 3SNMA 2XUEA 2KM2A 1V6IA 3FMGA 2ARXA 2OIIA 2UYBA 1G9CA 1ZZ7A 2EVXA 4IE6A 2IVIB 4JDNA 3UJQA 1QU0A 2JDAA 5A1AA 5H9QA 5DG2A 2HYXA 5JR7B 2R073 2A3YA 3T1LA 1EAH1 4XBLA 3ZFGC 1UZZA 4HBNA 1LRHA 4XFIA 2OUHA 5IK4A 1VB2A 3VDBA 1ENXA 1LGBA 4YW3A 5KHIA 2OQ7A 2C24A 2B8MA 3GGLA 1K42A 2YUEA 2NP0A 1IQAA 1POV3 1HJGA 4WM7A 3SH3A 2PLV2 3USUA 2YV8A 4E4SA 2YBPA 1HQWA 5A3MA 4EWEA 3H42B 3NNJA 1VMJA 5CU1A 1YI9A 1TMF3 1HIXA 3VBRC 1OSGA 5M0TA 4FPKA 3I2OA 3POYA 1VBD3 4R9BA 5L9BA 4DNYA 1GV9A 4IV1A 1RB8G 2O8OA 1FPN1 2TBVA 4AI1A 4JX0A 4BWOA 2GDFA 3PUAA 1W8ZA 5B4NA 2AEZA 1AZDA 3ST7A 3M8LA 2C5DA 2EXKA 4INDA 1AYM1 2QQOA 2QUOA 1I1EA 4N8MA 4H7MA 1JH5A 4UFKA 1XYOA 4Q4V1 3T0AA 2XOMA 2JX9A 5DDJ2 5C7GA 1W6OB 1CAXB 2R6QA 4IETA 5FYMA 1OVSA 5BNOC 5AVAA 1UXZA 4YZ5A 4IERA 4FP3A 1PO13 4K40A 4NWVA 5KHGA 4KMQA 2XQXA 1G9FA 2LALA 5FY0A 4A4AA 3T2QA 5JMCA 5IVVA 3DPRA 3TRSB 2GMPA 3GHMA 1VAVA 2XL9A 2E51A 1DFQA 2LROA 3JXSA 4YZ2A 3NV1A 4HK8A 3MI8A 1SLBA
chains in the Genus database with same CATH topology
1YQ6A 1YQ5A 1YQ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YQ6 A;  1YQ5 A;  1YQ8 A; 
#chains in the Genus database with same CATH topology
 5FZO A;  2QNK A;  3WDX A;  3URF A;  3VZK A;  1PGL 1;  3WNK A;  5CIS A;  4KNC A;  1BBT 2;  2D43 A;  3IBM A;  2VUD A;  1AX1 A;  4NPR A;  3FZ3 A;  1W2A X;  1EAH 3;  2IXH A;  3J7M A;  2YYO A;  2VBP A;  4Z2W A;  4UW3 A;  3O0V A;  3HQU A;  2HWD 1;  2Y60 A;  5A80 A;  5EQU A;  4FT8 A;  3CBN A;  3KV5 A;  3EJK A;  2G9F A;  1NLR A;  2CHH A;  3TEW A;  1NZI A;  3VKM A;  1JYT A;  3I54 A;  1HRI 1;  1MQT A;  3IDE A;  4NIH A;  2NPI A;  4QPG A;  2A70 A;  3H8O A;  2OA2 A;  4YSF A;  1VPH A;  2E7T A;  2SBA A;  1YC6 1;  1H2M A;  4HFS A;  5A7Q A;  3SC7 X;  3FLR A;  3D4K A;  1NCR A;  1AR7 1;  2C1F A;  2JIJ A;  1D4M 3;  4BQ3 A;  5ACA 2;  3NNF A;  4Y1Z A;  4FFH A;  1JBC A;  1H1I A;  2A71 A;  3SMH A;  1AYM 3;  4PDW C;  5HCF A;  2V09 A;  5FRA A;  2IXJ A;  5L7O B;  4LUK A;  1IS5 A;  4M0N A;  5FZ4 A;  5LA9 A;  4Q4V 3;  3AYA A;  3PLQ A;  3UGH A;  2HYK A;  4MXW A;  2XQR A;  1JYC A;  3NJX A;  3JCI A;  3N36 A;  3PL0 A;  4DUX A;  4CCE A;  2VZT A;  5FK7 A;  4B7E A;  1YJL A;  4FPE A;  2GU9 A;  2J1T A;  4AGG A;  1YWK A;  5K9Y A;  2J42 A;  4LO7 A;  2IVJ A;  2QZ3 A;  4XUT A;  3USS A;  4A6S A;  4AFM A;  3H3U A;  5L9V A;  3KQR A;  2WQZ C;  3SIT A;  3WP3 A;  4DEQ A;  1ENR A;  3VBU C;  2BZD A;  1QEX A;  1S0I A;  3ZN4 A;  3NJV A;  4DEV A;  4GAZ A;  2GP3 A;  4AFB A;  4AQ6 A;  4NVP A;  4N7U A;  2J1A A;  1ND3 A;  4LMF A;  2VC9 A;  5F3C A;  2VU9 A;  2ZX1 A;  4ERO A;  3MF9 A;  4HKL A;  4MGZ E;  3DXU A;  1XYP A;  1XB9 A;  2HWD 3;  4R9D A;  2ENR A;  3RMY A;  1SLT A;  4KWU A;  1E5R A;  5F6L B;  1FYU A;  1UU4 A;  2RDS A;  3B00 A;  5C4W C;  5HV0 A;  4HAN A;  4IEP A;  3NVC A;  3ZXD A;  2ARB A;  3WR0 A;  4PIZ A;  4Z1V A;  5BY5 A;  4XHB A;  3W9A A;  5JI7 A;  1YFU A;  1E57 A;  4QU2 A;  4B3N A;  1OD3 A;  1HRI 3;  5F1R A;  4ZS2 A;  5FPA A;  4BQ2 A;  3USU B;  4U2A A;  1LOG A;  4CSW A;  5CFD A;  1D0G A;  4TYS A;  1DYP A;  2WO1 A;  3KCY A;  5APA A;  5FAX A;  2ZGO A;  5HI0 A;  1J1T A;  1OVP A;  3S30 A;  4DO0 A;  1AR7 3;  1RXG A;  5F5Q A;  3VBS C;  2PHD A;  5FZI A;  1ULC A;  4LBQ D;  3AX4 A;  1H8V A;  1WGP A;  2CGN A;  2FCU A;  1PM4 A;  4IV1 B;  4XIL A;  5EHD A;  3VKO A;  2BW8 A;  5IWF A;  4QX0 A;  1L3J A;  1H1A A;  5K8S A;  1OF4 A;  1SBE A;  3KB5 A;  3VDD A;  4F3J A;  2R1D A;  2BP6 A;  5FO9 B;  5IT6 A;  4TXW A;  2XJQ A;  2YPJ A;  1QQP 1;  1CES A;  3N9L A;  2W5F A;  5DAV A;  3BIE A;  3T3Y A;  2VNO A;  1CD3 G;  4YLZ A;  1AL0 G;  4PJY A;  1S0E A;  2O8Q A;  4F83 A;  1HRV 1;  3IDB B;  3ORJ A;  4LA3 A;  2Q30 A;  1AR9 2;  3DPR B;  4RA0 A;  5FK8 A;  3DEM A;  5FZD A;  3VBF C;  3ZFF C;  1PMH X;  4D6S A;  4C90 A;  5DUU A;  4QX1 A;  3IAP A;  4AVV A;  1SFY A;  3OEA A;  4P9X A;  5FZL A;  2WZR 2;  3VD7 A;  1L7L A;  1W8O A;  1ULP A;  4NO4 A;  4AEJ A;  4CCL A;  1XBF A;  1KD7 A;  5FZO B;  4BK5 A;  2O14 A;  4KWK A;  4KQ7 A;  4XJZ A;  5L9R A;  4CU9 A;  4XUP A;  4BIS A;  1H9W A;  2X5I C;  1Z7S 2;  2HKX A;  5F6K A;  3W59 A;  4AL9 A;  2DCJ A;  5FZM A;  3NL1 A;  4O9E A;  3VD9 A;  3R6S A;  5T50 A;  3E1F 1;  4AR2 A;  2VOX A;  2A6W A;  2D5F A;  1LOF A;  2TNF A;  2PA7 A;  1JW6 A;  1GQG A;  3C7G A;  2XJV A;  3PNA A;  2ZEY A;  2Y6L A;  1O4Y A;  2Q8C A;  2L9L A;  4PBP A;  4JC1 A;  4MHR A;  3VBO C;  3CU7 A;  4IES A;  1HN1 A;  4J1W A;  5F3E A;  3RRD A;  4ZPI A;  1F35 A;  1MQT B;  2WT0 A;  3OD4 A;  1RUE 2;  4YVS B;  1W8T A;  3AP6 A;  3ZXA C;  4QPG B;  3O1S A;  4CVU A;  2TEP A;  4AQS A;  1OBN A;  3ZFG A;  1Q5O A;  1U5I A;  2HWB 1;  3WDY A;  2VME A;  3EXU A;  5DUW A;  5A7W A;  5A6Y A;  2ZGL A;  1NCR B;  1QJY 1;  3AMM A;  4S2G A;  5BNP B;  4UWD A;  5CYY A;  3HAG A;  3CO2 A;  4NIA A;  4YGE A;  3FBY A;  1C1L A;  1UXX X;  2R32 A;  5FYU A;  1QQP 3;  2YPD A;  4BLI A;  1XPW A;  3K77 A;  3WSO A;  2JG9 C;  2JIC A;  2W47 A;  4EE2 A;  2P3I A;  1Q8Q A;  2VCM A;  1OUS A;  2IFR A;  1QJZ A;  1ULD A;  3ECQ A;  3KQ4 B;  4OUM A;  2D6M A;  2OXB A;  1DZR A;  3S5Q A;  1FOD 1;  1HRV 3;  2C9A A;  1RUF 2;  4P5Y A;  3ZMO A;  1OLQ A;  5IVJ A;  3WDV A;  3WF4 A;  4K6B A;  5FYB A;  4AAP A;  1J58 A;  5DZG A;  4XOG A;  3KD4 A;  1DLL A;  3IT8 A;  4JGY C;  5FY4 A;  4UW4 A;  5EJ1 B;  3H0O A;  5LBF A;  3OGV A;  3RZH A;  3MIE A;  3C7O A;  4YNI A;  2MNG A;  4MYE A;  1V9U 2;  3RJ2 X;  1UAI A;  2IXC A;  3EHK A;  1YQ5 A;  1ND3 B;  4HT1 T;  2WN3 A;  1LHV A;  5K7P A;  5K0U B;  2YC0 A;  3LA3 A;  4ISR A;  2JJ6 A;  4QHB A;  5T3N A;  2D6O X;  4YAR A;  1VJ2 A;  2WAA A;  4IUG A;  4ARX A;  3AM2 A;  1YI7 A;  5DAW A;  2WA4 A;  5T54 A;  2R1B A;  1WW6 A;  1NXD 1;  5C3Q A;  4IV3 A;  5LA1 A;  3T0D A;  3JB8 A;  4MG2 A;  1WW4 A;  4WZF A;  1U5Z A;  2GC0 A;  4Q4X 2;  5JUV A;  1JYI A;  1AR8 1;  1ZA4 A;  1ZZ9 A;  2PHW A;  1H9P A;  4LHK A;  4W6X A;  4L9B A;  1FAT A;  5LBE A;  3EMR A;  2X29 A;  5BNN C;  3J7N A;  4IE5 A;  2ZGK A;  3MHZ A;  3POI A;  5IAT A;  4BQY A;  4KH9 A;  5D2A A;  5CFD B;  2HWB 3;  3ILF A;  1UKG A;  1QXJ A;  3RS6 A;  4ASM B;  2JEM A;  3GZA A;  4D94 A;  1IS6 A;  1JI6 A;  1QJY 3;  1STM A;  4PF1 A;  1IKP A;  1NAE A;  4R4X A;  5SV8 A;  1W9T A;  3C3V A;  1L7R A;  4A45 A;  1UO9 A;  2W1U A;  4AZZ A;  1R1A 1;  4D69 A;  4LNV A;  2XVG A;  4QU1 A;  4LJH A;  3WOG A;  1W05 A;  3MV1 1;  2D3R A;  2VVF A;  4COW A;  3POF A;  1X50 A;  2CU5 A;  4CU7 A;  4GB3 2;  1C3H A;  1QIQ A;  3AXD A;  3I2H A;  1MR5 A;  1AX0 A;  1FOD 3;  3HPN A;  1BXH A;  5FO7 B;  4AFC A;  4Y1Y A;  2EXI A;  4XQ4 A;  2VQ0 A;  3V56 A;  2QDR A;  5JZG C;  2XJR A;  5FPL A;  4YYO A;  2D93 A;  3HVD A;  3M70 A;  1AL2 2;  2QQJ A;  3DV8 A;  4BQX A;  1J83 A;  2PAM A;  2XB6 C;  4LBK A;  2RS3 2;  4YW4 A;  3HBK A;  4A7Z A;  4XET A;  1RJ7 A;  2DU0 A;  5FZK A;  1NY7 2;  1NCQ A;  4GUL A;  5KXE A;  1MS3 A;  1KXG A;  4UBG A;  3PVB B;  1VBA 2;  3VBH A;  1O5U A;  3I59 A;  2QTW B;  5JOY A;  4A42 A;  2BPA 2;  1LOD A;  2VMG A;  4P9I A;  5JLV A;  3A0K A;  3U07 A;  3BU0 A;  1AJO A;  2WZ8 A;  4CRQ A;  3O14 A;  1XE0 A;  2DFB A;  1H1M A;  3K51 A;  1B35 C;  3MUZ 1;  4Q0U A;  5LK5 A;  1F4A A;  1VRH 1;  4PIY A;  2CL2 A;  2NMO A;  3VBU A;  3I7D A;  1JZ4 A;  3LF7 A;  2DVB A;  1JS9 A;  1JZ5 A;  1QGL A;  1HDK A;  1AR8 3;  2R7E B;  1F4H A;  2JE9 A;  4IEW A;  4CCK A;  3NAP A;  1J3Q A;  5A7N A;  5A7O A;  1YXW A;  2VE1 A;  3UGF A;  3CF6 E;  2GME A;  2B7Y A;  4Q4W 2;  3SIS A;  2WNU B;  2RJK A;  1VAL A;  3GDB A;  3RYP A;  4OHX A;  3ETP A;  4YRD A;  3OUI A;  1YQ8 A;  4WM8 C;  2MEV 2;  5C4W A;  2E63 A;  2JDN A;  4BA6 A;  5A7W B;  1LGN A;  2OPK A;  4E2S A;  4CUC A;  1GKB A;  4D7T A;  1W6P A;  3IZO A;  1RUI 1;  1CIW A;  1R1A 3;  2HWE 1;  5HCB A;  3U1X A;  3U4S A;  4EWA A;  4CCO A;  2HEV F;  1SZB A;  1C8N A;  4MHU A;  2R04 1;  3RZZ A;  4SBV A;  5IVF A;  1KDM A;  3S7E A;  2ZXQ A;  3QCW A;  4AVC A;  4OFG A;  1A78 A;  1H6X A;  5L73 A;  1SCR A;  2JB4 A;  3AFK A;  2FDG A;  3KT4 A;  2GMM A;  2ZBJ A;  5CA6 A;  1S0J A;  1I6X A;  4YZ1 A;  2ID4 A;  2UUR A;  5LY2 A;  5L36 A;  2WFP A;  2LUW A;  4BQW A;  3TEY A;  4XTM A;  1R08 2;  1WLC A;  3AKP A;  3MW3 A;  5E8A A;  3TYJ A;  1F2N A;  4M00 A;  4COZ A;  2HWF 1;  4JQT A;  1JOP A;  1LTE A;  3VZJ A;  3LAG A;  3POE A;  4LBQ B;  4YW2 A;  5FTT C;  4UFI A;  3KT7 A;  2W91 A;  2JKX A;  2RHP A;  4NJ4 A;  2V73 A;  2CGP A;  3LOB A;  4M3C A;  4NMI A;  1JZ6 A;  3ZYP A;  4B1L A;  1HQL A;  3L9J T;  4P14 A;  4BZ4 A;  3SEP A;  1HJF A;  4CA9 A;  4XIK A;  1TQ5 A;  3ZFF A;  3RZJ A;  1VRH 3;  4QM8 A;  2R06 2;  2D6L X;  4QB2 A;  3GCW A;  4XF3 A;  3WEZ A;  3V0B B;  1X9P A;  3ZXE A;  1FI2 A;  3NRU A;  4AVT A;  5LY1 A;  1PO2 2;  3O1P A;  2W52 A;  1H6Y A;  3KV6 A;  1Q56 A;  2VNR A;  4IV3 B;  4WVZ A;  5FZB A;  2Y33 A;  5FMD A;  1EPZ A;  3J4U H;  4I01 A;  1VAK A;  1X9T A;  3LOI A;  2BOJ A;  4Q4Y 2;  4IEQ A;  2CAU A;  3H7J A;  1PVC 1;  2B9V A;  2CV6 A;  1WCU A;  1X33 A;  1XRU A;  2VM9 A;  3ZYF A;  4CP9 A;  1QKQ A;  1KS5 A;  1US2 A;  4NWW A;  4XMI A;  3Q9O A;  2VMH A;  3VL9 A;  4DXZ A;  1GIC A;  1W04 A;  4I02 A;  3ZXF A;  2FZ2 A;  1V0A A;  1AXK A;  4Y1V A;  5ABJ C;  1RUI 3;  2HWE 3;  1S0F A;  3H50 A;  2QJV A;  1C57 A;  3ACI A;  1FV3 A;  4NRO A;  2R04 3;  2BFU L;  4CDX C;  3IN9 A;  4MAD A;  1RVF 1;  1ZNP A;  5EJ3 A;  4YZ4 A;  1BVV A;  2Z4F A;  2FDI A;  3WF3 A;  1ZBA 2;  1QDC A;  1F5F A;  2DFC A;  1W3X A;  4RGA A;  3TNP B;  3DN7 A;  4DPN A;  5F39 A;  4Q2F A;  2RM2 1;  4CXY A;  3WUC A;  2ZHN A;  1VBE 1;  1RUG 3;  1GSL A;  2BYV E;  2VZR A;  2WIN B;  4P9G A;  3AP9 A;  3PUR A;  4BMB A;  1BKZ A;  4XUN A;  5FY8 A;  1GP5 A;  5FYY A;  3ZDV A;  1DGW X;  3AC0 A;  4FXG B;  5E88 A;  5I8Y A;  1A8M A;  1R64 A;  5I0D A;  2Y6G A;  2HWF 3;  4NN0 A;  5C9A C;  1JXN A;  2GN3 A;  1QJU 2;  2JIG A;  2XL7 A;  2ZTN A;  4XF4 A;  2RR1 1;  5H9S A;  1K5M A;  1EPW A;  1UOB A;  5GM0 A;  2PAE A;  3WCS A;  2LW8 A;  1NCQ B;  3ASI A;  1DLC A;  4NHL A;  4BDV B;  2VZV A;  1PK6 C;  3FX3 A;  4XAB A;  5GLW A;  3VBH B;  3I59 B;  4ASK A;  3B02 A;  1N1Y A;  1IS3 A;  2AEY A;  4R52 A;  2XXZ A;  2JE8 A;  3EO6 A;  3DKW A;  2IWG B;  4TZD A;  3H1W A;  1W3V A;  4K21 A;  4PF5 A;  1SFN A;  3B3Q E;  1CVN A;  1MEC 3;  2ADD A;  2ORX A;  2QDN A;  3NQH A;  4YW1 A;  4ATF A;  2DUR A;  2RS5 2;  4LKF A;  1AR6 1;  2WNE A;  5BYN A;  2P6H A;  2YU2 A;  3VDC A;  2XBO 2;  4IGO A;  1VBB 2;  3NAP B;  1PVC 3;  3AFG A;  5A6Z A;  1AUY A;  4BB3 A;  3ENR A;  5E16 A;  5DPN A;  1NQJ A;  3BTY A;  1SLI A;  3ATG A;  3DKQ A;  3JBG 1;  2RMU 1;  3MEP A;  3M1H A;  4A41 A;  1RUH 2;  1X82 A;  1BLZ A;  4LOT A;  3V64 A;  4XMA A;  5C4W B;  1PNF A;  4K3U A;  4IEU A;  2FHR A;  4M4R A;  3OSD A;  3INA A;  2FZ1 A;  1LU1 A;  5GKA C;  4D8M A;  3MIG A;  2EAL A;  2W39 A;  4ITC A;  4HK9 A;  1W6P B;  2OT7 A;  4TLG A;  1EUU A;  2D6N A;  2N7G A;  1RVF 3;  1ZX5 A;  4MUV A;  4XHX A;  1EUT A;  5FP3 A;  5J98 B;  5BNN A;  1MZ6 A;  3ZYI B;  5C3R A;  3OGG A;  1PGS A;  4G3Y C;  5FP7 A;  2ZZQ A;  1Y9M A;  3JZV A;  3T4H B;  4EV0 A;  2RM2 3;  3AP4 A;  3IAQ A;  1U0A A;  4JHZ A;  4K20 A;  5FCC A;  1O3R A;  2Z79 A;  5FZ0 A;  4YFW A;  4QPY A;  2IFW A;  2LM3 A;  4NE9 A;  4JKL A;  3FHQ A;  3AL6 A;  3WNM A;  3ZXK A;  1PMJ X;  3E6D A;  1ZZ6 A;  1IG0 A;  1OHF A;  3D82 A;  3III A;  1G9B A;  4V2V A;  3QOP A;  2PMW B;  3H3Z A;  2W9X A;  1GNZ A;  1ZZB A;  4LA2 A;  2RR1 3;  4KGQ A;  4EN7 B;  1ZRR A;  1XNT A;  4M0H A;  3LSD A;  2CY6 A;  1ST8 A;  3OBA A;  4FVV A;  1W90 A;  1LHU A;  1YQ2 A;  5J3U A;  1K3I A;  3IMN A;  3POG A;  4BME A;  4EQV A;  4QB1 A;  3S5A A;  4M3C B;  4LQR A;  1X8E A;  5DZF A;  1UWW A;  3WHT A;  4AEM A;  5JZG A;  3WQ7 A;  1S0D A;  4QXK A;  3ZFF B;  4Y20 A;  2RDQ A;  4L8Q A;  1AR6 3;  2BNN A;  3ACF A;  3FE5 A;  5JAX A;  3U75 A;  4FPO B;  4YG6 A;  3POW A;  1W6M A;  5FZH A;  2VUA A;  4N53 C;  3OF1 A;  2ATF A;  3ON7 A;  1MS9 A;  1W9S A;  3A4U A;  4YG0 A;  5KHJ A;  2QQL A;  5KXD A;  1LOA A;  4A2U A;  2E7A A;  4XUQ A;  3JBG 3;  3BU7 A;  2RMU 3;  4NAO A;  4CP9 B;  4KWL A;  2JDM A;  3O5S A;  2B42 B;  2K0G A;  4URA A;  2V5Y A;  2VXR A;  4CEY C;  2BUK A;  3HNY M;  1B35 A;  3I3D A;  3OEB A;  2JG8 A;  3ZOI A;  4CP2 A;  1W0O A;  4WVM A;  4KU8 A;  2ZGS A;  2ZX2 A;  4YFZ A;  1ASJ 2;  1GQP A;  5FZ3 A;  4AHZ A;  2VBD A;  3I2D A;  1TMF 2;  1H2K A;  4C8D A;  1N3O A;  2Y6H A;  1J59 A;  3BKZ A;  2XGX A;  2ZPX A;  1C1F A;  1US3 A;  1RUJ 1;  2D3P A;  2FQP A;  2VR4 A;  2RG4 A;  5T55 A;  5JPN B;  4CDW C;  4H3W A;  3WX5 A;  4DUV A;  2OPW A;  3GF6 A;  5KWR A;  2HEY F;  4QQ2 A;  3W5N A;  2PTM A;  1VBC 1;  2WII B;  1FMD 2;  4Q0P A;  4BHP A;  3KV4 A;  1O4Z A;  5F2S A;  3GNE A;  1GP6 A;  4ES9 A;  1GNH A;  2QCS B;  1JU4 A;  2WKK A;  3OPZ A;  1SDD B;  1X7N A;  2Z2S B;  3LPF A;  1KEX A;  3U10 A;  4XF1 A;  2ET7 A;  3MUY 1;  2H0V A;  1BYH A;  4RFT 0;  1K5M B;  3GJB A;  5C5T A;  4Z92 B;  3MLK A;  1MZE A;  3SQO A;  2XJP A;  3FBM A;  5FY5 A;  2WZP P;  3A21 A;  3I3Q A;  4KGG A;  1AVB A;  1LU2 A;  2GAU A;  3O1R A;  3DL3 A;  3ACL A;  3WDU A;  3WNN A;  5BPX A;  4TLF A;  5FLH A;  1KRI A;  2XDV A;  1ZBE 2;  3D6E A;  3OPW A;  1MS1 A;  2VVD A;  2VCA A;  1PZ7 A;  3WQ1 A;  4W8J A;  4BJ0 A;  4BXF A;  3AZW A;  1TNR A;  1LR5 A;  2PHL A;  4DXT A;  3BOW A;  1CWP A;  5D8A B;  5LEJ A;  2XON A;  5CKQ A;  2JD4 A;  3O1O A;  4U36 A;  2BWA A;  2J1R A;  1FT9 A;  4M3C E;  2YDE A;  3BOP A;  3SCF A;  1RMU 2;  3VKN A;  5A3U A;  1LKN A;  2ZX0 A;  2VJX A;  3K48 A;  1D4M 1;  5A1L A;  4DUW A;  1UY0 A;  2WQ8 A;  1KDK A;  2WO7 A;  2PLV 1;  3LGR A;  4CDQ A;  3RJR A;  1RUJ 3;  5FUP A;  4AED C;  1OMI A;  1FPN 2;  4XE9 A;  4D3W A;  5C70 A;  2YG0 A;  3BOD A;  4Y4R A;  1DZT A;  1Q8V A;  5A7S A;  3TOJ A;  1WCD J;  1WW7 A;  1AYM 2;  1WBL A;  2F17 A;  4RR3 C;  3MIF A;  4Q29 A;  1VBC 3;  4HVR A;  5IUQ A;  1OUR A;  5I0T A;  2W1W A;  4Q4V 2;  1PX4 A;  2D6K A;  3OUH A;  5KBF A;  2HEW F;  2A3X A;  4E27 A;  5LRS A;  1WW5 A;  3T30 A;  4I0B A;  3J8F 2;  2WO2 A;  1QWR A;  4AF9 A;  1WWY A;  2ILM A;  4XXP A;  3T2O A;  1EV1 2;  2P5B A;  5C6C A;  4RGG A;  3LEM A;  2A6Z A;  2WT1 A;  5DDJ 1;  3I3M A;  1LHO A;  3A22 A;  3MBW A;  5DUX A;  1C28 A;  2CDO A;  4NRM A;  1UPS A;  1ZRE A;  3PMS A;  1LEN A;  4B1M A;  1CON A;  3I2F A;  3M3I A;  4PBO A;  5FP9 A;  3W21 A;  3KGL A;  1O3S A;  2WLQ A;  1MS5 A;  1CX1 A;  3ZVX A;  3HQX A;  2VUL A;  1UZV A;  2YMZ A;  1UD1 A;  1NYW A;  4OZO A;  4Y20 B;  5LBC A;  5C9A A;  1OF3 A;  2YB7 A;  5DG1 A;  1VMH A;  3AKQ A;  2VZ1 A;  4GA9 A;  3GZT B;  1E5S A;  1OA3 A;  1W6M B;  4H55 A;  3A23 A;  1FXZ A;  2Q5T A;  1UYY A;  2UY8 A;  2VMI A;  3KHB A;  4YGB A;  1H8T C;  1RUD 1;  1DIW A;  1VAM A;  4GMP 1;  3UV9 A;  1GWK A;  3B94 A;  2BBV A;  1QH6 A;  2D7F A;  4HON A;  5A32 A;  1W0N A;  3O1T A;  1YNA A;  4UYB A;  3WW1 A;  4C91 A;  1RHI 1;  3BN6 A;  2JG8 B;  3JD7 2;  4WVM B;  4HXC A;  1OPM A;  2W0X A;  2PLV 3;  4GQ7 A;  3ZMN A;  3WP5 A;  3MW4 A;  2DCT A;  4O61 A;  4RQP C;  4BIF A;  1UMI A;  2AC1 A;  3ES4 A;  3WD5 A;  5I0R A;  3X29 B;  3LPG A;  2X53 S;  3UKV A;  5IHR A;  4CEW A;  3AB0 A;  3J9S A;  4R8H A;  3V0A B;  2DBI A;  3ME2 A;  2MPF A;  2J7M A;  2Y8K A;  3I49 A;  4FAG A;  4IEV A;  2PHT A;  3K75 B;  2WSU A;  1CAW A;  3HNB M;  3I3B A;  1PGW 1;  4L97 A;  4OCT A;  4XC9 A;  3ZYR A;  2VZ3 A;  4XJ9 A;  5A3T A;  4JV4 A;  1NUK A;  1OLM E;  4XPV A;  1W39 A;  3SCH A;  3LSE A;  5AVP A;  4AHW A;  4GMP 0;  4HG6 B;  2JXA A;  3ROU A;  3WNX A;  5B4X A;  1NX9 A;  3VZO A;  5LK7 B;  3ZSM A;  1LES A;  3LB9 A;  2BFU S;  2B4K A;  4Q0S A;  4QPI A;  5DDJ 3;  1MVQ A;  4P5H A;  4QDS A;  4E9K A;  1GZT A;  2W68 A;  4NHX A;  2F6B A;  3ZFE C;  1RIT A;  1LNS A;  3OBT A;  2PQQ A;  4FFG A;  4Y4Y A;  4BLJ A;  4ARY A;  2ZMK A;  5FZE A;  1MZ5 A;  2XHK A;  3NO8 A;  4I30 A;  3IDA A;  1DGR N;  4IDZ A;  1J3P A;  3ZYG A;  4BM8 A;  4XIO A;  1DQ4 A;  3K4D A;  4FQZ A;  4GJY A;  4AQ2 A;  4YM0 A;  5CFC A;  3AP7 A;  4MGY E;  1QNY A;  3Q8F A;  4IEY A;  4CDU A;  4FSJ A;  3RVH A;  1XC6 A;  3TNQ A;  1SMV A;  2DUO A;  1A6C A;  4WM7 B;  5FLI A;  3M3O A;  2VXJ A;  4GMP 3;  1RUD 3;  2W1S A;  2E33 A;  5B2G B;  1CIY A;  4UXA A;  3H8R A;  2NQY A;  4AQT A;  2B9U A;  3PUI A;  1O8S A;  4HN0 A;  2HLE A;  2AGS A;  2WWS A;  4K8F A;  3LZZ A;  1OKQ A;  2ZAB A;  4BE3 A;  1RHI 3;  1XU2 A;  3KGZ A;  2FCT A;  4LIU A;  3WG4 A;  3ZSL A;  2OX0 A;  2NZ9 A;  2C9K A;  1PMI A;  4UW5 A;  1TG7 A;  5LRR A;  3K46 A;  2ADE A;  2BGC A;  3IKW A;  4YGD A;  3RDI A;  2VQU A;  4N53 A;  3T4V A;  1SCS A;  2XML A;  3AXE A;  3EBR A;  4CDQ B;  3E5Q A;  4H7L A;  1DHK B;  3ZXL A;  1GR3 A;  1YLL A;  2OYZ A;  3BYW A;  4Q26 A;  3BTA A;  4P9Y A;  2BBA A;  2Y38 A;  1KJL A;  2XVK A;  1D7P M;  2GP5 A;  3R4S A;  4KG0 A;  3LE0 A;  1PZ9 A;  5CNA A;  1XQN A;  2ZKN A;  3S6P A;  5A3P A;  1UCX A;  1BEV 2;  2IXK A;  2OZJ A;  2XR4 A;  3ACH A;  1RUC 2;  3I3E A;  4ASL A;  2DDU A;  4HMZ A;  5FYI A;  1SBD A;  3BTX A;  1HRV 2;  3AVR A;  4Q1P A;  1COV 2;  1WCK A;  1N1S A;  3PHM A;  1QXP A;  4CDW A;  4I2O A;  1YIP A;  4GH4 A;  3GJA A;  3RWK X;  1HXS 2;  4COU A;  2ZX4 A;  1O5L A;  5LB6 A;  4QXB A;  4AVS A;  4DS0 A;  1WLT A;  5JDB A;  4LOR A;  1RYY A;  5LWB A;  1AR9 1;  1OH3 A;  5BNO B;  1OLR A;  3W58 A;  3VD4 A;  2E6V A;  2WZR 1;  5FP8 A;  4N43 A;  2HH9 A;  3CIH A;  5C9A B;  5LZ6 A;  4Y5T A;  2A6X A;  1LGC A;  3KMH A;  4KI5 M;  3OUJ A;  5FZ9 A;  2F4P A;  2LRP A;  1ND2 C;  2BNM A;  3TEX A;  1Z7S 1;  3Q8A A;  1UQX A;  5FIX A;  2AEN A;  3VV1 A;  2WS9 2;  4LBJ A;  3T2P A;  4Y22 A;  4Q8K A;  3ZPY A;  5IVB A;  5DAQ A;  3HMY A;  4GWN A;  3E5X A;  5A32 B;  1CPM A;  1BHG A;  5EYY A;  4OI2 A;  4CXW A;  1UW8 A;  5GZG A;  4XCA A;  1YFW A;  3S57 A;  4RS5 C;  5DZE A;  3ETQ A;  5ERL A;  4ZY9 A;  1GWL A;  4P9W A;  5FPZ A;  2VGD A;  4YW7 A;  3VZN A;  2RDN A;  4LO8 A;  1RUE 1;  3K4A A;  3B7M A;  1R1Z A;  4IXL A;  4OMD A;  3N35 A;  1UIK A;  4E4H A;  5GZD A;  2R49 A;  4YM1 A;  2D98 A;  2EAA A;  2QQV A;  4G9S B;  2Y0O A;  4JKK A;  5I0U A;  4CEW B;  3D0J A;  3NST A;  4MXW B;  4YVW C;  4XFA A;  1H0B A;  4QD2 A;  2XJS A;  3CJI C;  3PDQ A;  3VBR A;  1CAW B;  2ZJC A;  4O65 A;  3ZSE A;  5CAD A;  4YZ3 A;  3PVN A;  5HXM A;  2CAV A;  5I0S A;  4QHZ A;  1LHN A;  1O3Q A;  4OMC A;  3E6C C;  3D8C A;  2YFZ A;  1JU3 A;  3MIC A;  2Y6K A;  1IQD C;  2KR2 A;  3MID A;  4E4Z A;  3KVB A;  1IS4 A;  4QPI B;  1NA1 C;  2ZGP A;  3MGU A;  2IUW A;  4OLL A;  4QGL A;  4EJR A;  4BK4 A;  4RR3 A;  5BNO A;  4NID A;  1RUF 1;  3CKH A;  1AR9 3;  1CZT A;  4BXS V;  3C7E A;  1N47 A;  2VTF A;  1W8U A;  3QAC A;  2PAK A;  4JRA A;  3O1M A;  2WZR 3;  4JGZ C;  1JYN A;  2O0O A;  1GMM A;  4A7Y A;  2FMY A;  2ZX3 A;  5CFC B;  2RS1 2;  2CTV A;  4Y1U A;  1V9U 1;  1SDW A;  5A3O A;  1EY2 A;  1MAC A;  3JQX A;  1ENQ A;  2W3J A;  4CDU B;  1Z7S 3;  4DRR A;  4A7K A;  1TME 2;  2QQP A;  5AC9 2;  4TTG A;  1UIJ A;  3RZG A;  3GXU A;  4AI8 A;  2GH8 A;  2EID A;  5H9P A;  3QH6 A;  3RMX A;  2W2I A;  3RPQ A;  3WDW A;  3KF3 A;  1LEM A;  3OGJ A;  3OGS A;  5FWE A;  1W06 A;  5D21 A;  4LK6 A;  4XAA A;  2VAU A;  5FKC A;  3IWZ A;  1RUE 3;  3DCQ A;  4B4P A;  2V72 A;  4N53 B;  4NIG A;  1S0B A;  2HJI A;  4MGS A;  2XH6 A;  3VDD B;  2VQT A;  4AK3 A;  2J1E A;  2BNO A;  3N7J A;  1UF2 C;  2OZ6 A;  2FMD A;  3DYP A;  1ALY A;  4AI2 A;  4XDO A;  2G9G A;  5FBZ A;  4OI0 A;  3RSJ A;  2QBX A;  2X10 A;  3MPP G;  1AJK A;  2RV9 A;  4I3P A;  5FUI A;  3D5O A;  1U5X A;  4ZU7 A;  2WLP A;  3PJY A;  4JQR A;  2C0Z A;  4JDM A;  5C8W A;  3H7Y A;  4PDW A;  3CJX A;  3KT1 A;  3G7D A;  4MSV A;  4F7Z A;  2VL4 A;  1QJX 2;  4GB3 1;  4JCK A;  2VUC A;  2G1M A;  1RUF 3;  2JD9 A;  4GH4 B;  4MXV A;  4RHV 1;  4KG8 A;  1UY4 A;  2QZ2 A;  2ZGQ A;  4FPF A;  4ZHN A;  2DCZ A;  3ZSJ A;  1BCX A;  4ZXK A;  4CPB A;  1OA4 A;  3ACG A;  3AMQ A;  4QMA A;  5FXZ A;  3H8X A;  4P02 B;  2JEC A;  2E32 A;  4FOY A;  1UKR A;  3O12 A;  4FXK B;  4XZU G;  2Q0A A;  4ONU A;  5FZ7 A;  5CKN A;  1V9U 3;  4N43 B;  3GCX A;  3FHI B;  4MLO A;  1NY7 1;  2R16 A;  2UWC A;  3KZ4 C;  3GBG A;  3NW4 A;  3M3E A;  1GLH A;  1CZS A;  3C7H A;  5A3W A;  1VBA 1;  1J1L A;  3ZFE A;  2JB8 A;  1I9R A;  4L2N A;  2CSG A;  1OFS A;  2WO3 A;  1CZV A;  2G9Z A;  3MYX A;  4Y22 B;  4E8C A;  3ZFG B;  3TN9 2;  1WBF A;  1ZVF A;  4CXX A;  2ZKL A;  4LHL A;  1UOG A;  4YG3 A;  1QNW A;  5DAX A;  4BPZ A;  2WFF 2;  4EN9 B;  1Z0H A;  3O7O A;  3M3C A;  4K9S A;  2ZAA A;  1DCS A;  3ZR6 A;  5FOB B;  2JDH A;  2VCB A;  2CYF A;  3AKS A;  3PIJ A;  4PT6 A;  1U12 A;  4LR4 A;  3LEK A;  4Q4W 1;  5L7O C;  5A3N A;  5FYV A;  1LAJ A;  1WME A;  1V6L A;  4XCB A;  4L92 A;  3N7L A;  5A6Q A;  2UYA A;  2MEV 1;  1YQC A;  1WZX A;  5F5I A;  4Y5Z 0;  3THD A;  3VBR B;  4EN0 A;  3Q8E A;  3VBS A;  5IVE A;  1H2N A;  4C0B A;  1RUG 1;  1APN A;  3I2I A;  4W65 A;  1XJA A;  4QGM A;  2PEL A;  2WWJ A;  3FUO A;  4DIQ A;  3BTZ A;  1LHW A;  2Y6J A;  5SV5 A;  3RZK A;  3VL8 A;  3M2M A;  4HZF A;  3AKT A;  4CCJ A;  2P3K A;  4GB3 3;  3BAL A;  2AR6 A;  2H6C A;  3AMH A;  5J96 B;  5LAT A;  2VMD A;  1REF A;  3NV2 A;  4IEO A;  1WMD A;  4RHV 3;  3LEI A;  3UT0 A;  3QD6 A;  4RYD A;  4RN5 A;  4A3X A;  1IGO A;  2ZGM A;  2ARE A;  5FV3 A;  5G05 L;  3RYK A;  2GZW A;  4CCC A;  1AL2 3;  1KGY A;  3VBF A;  5JXG A;  3K3O A;  1R08 1;  1WD3 A;  1CN1 A;  1JOJ A;  1HB3 A;  4LKE A;  4OHZ A;  2D5H A;  3U0Z A;  4E2Q A;  2G19 A;  4N9I A;  1MEC 1;  4QKD A;  1SG3 A;  2VW0 A;  4QXC A;  1VBA 3;  2BQP A;  5LA2 A;  1C8M 1;  3WUD A;  1R09 2;  4GAL A;  3R4D B;  4ORF A;  3BPZ A;  4TWT A;  1NLS A;  5F8P A;  3N7M A;  2A5Z A;  3HN3 A;  2VOV A;  4QKF A;  4CYD A;  2WZE A;  2X5I A;  1S2E A;  3FLP A;  1F9K A;  3ZX7 A;  5JOZ A;  1HV0 A;  4JDO A;  2R06 1;  3AMN A;  1DQ5 A;  2YHJ A;  1SPP A;  5CEH A;  1ULO A;  4FTB A;  1Y3T A;  1IKQ A;  5HXV A;  1F31 A;  2VO5 A;  2K46 A;  3IMM A;  5KC6 A;  4XFC A;  2E7Q A;  3CNA A;  4Q4Y 1;  3VBO A;  4Y5S A;  3S7I A;  1ND2 A;  5F3G A;  4Q4W 3;  2WNV C;  4LLF A;  3ILR A;  4K8R B;  2MEV 3;  1DQ6 A;  1V6M A;  4AXO A;  5JMO A;  5KXB A;  2CWS A;  3WQ0 A;  4DIN B;  3KV9 A;  1DGL A;  1MPX A;  3GBW A;  2W08 A;  3VB9 A;  3WXP A;  5FZ6 A;  2ZCW A;  3SLI A;  3WZ1 A;  2W46 A;  2BWC A;  2RM2 2;  4RS5 A;  2IZW A;  4WBB A;  1SHW B;  1VBE 2;  2DU1 A;  3BCW A;  3DPR C;  4N9H A;  2GND A;  3T0B A;  4PDW B;  1VE0 A;  2IXL A;  2V5D A;  4XTP A;  4C0H A;  2Q1Z B;  5FFO C;  5IFP A;  4KWJ A;  2NM1 A;  1PNG A;  2JG9 A;  2C6S A;  3D3A A;  4S2D A;  3OBZ A;  2W92 A;  3PU3 A;  1Q8O A;  5FYS A;  4FPJ A;  2UY9 A;  3CJI A;  2AYH A;  1AYN 2;  4YW6 A;  2OW4 A;  4B4R A;  5J36 A;  2ARA A;  3F95 A;  2HWC 2;  3IIA A;  3CL1 A;  1GBG A;  1R08 3;  4LK7 A;  3A0N A;  4PLO A;  4ZXE A;  4CUG A;  3MIH A;  2VZQ A;  1IHM A;  5JR2 A;  5F32 A;  4I3G A;  4RL7 A;  1RUN A;  1QJU 1;  4JGY A;  4XQW A;  2XPJ A;  3VBU B;  5HCH A;  2ZOE B;  1Z78 A;  1C8M 3;  5CG9 A;  1X8M A;  2Q1M A;  2YBS A;  4E4D X;  2I74 A;  2ZGN A;  2P4E A;  4Z82 A;  4UI9 L;  4QX8 A;  5FZA A;  3ZFE B;  4GD4 A;  2GC3 A;  2A73 B;  3NKT A;  4XVH A;  1MQT C;  3FLT A;  4MVT A;  1NZC A;  2R06 3;  4YVS C;  4Y3O A;  4I0A A;  3ZYJ B;  2JDU A;  5FOJ B;  5FWJ A;  3N9M A;  1ENS A;  1ZYB A;  4JGZ A;  2JDZ A;  1UPI A;  1F5J A;  2EIE A;  2RS5 1;  3NNM A;  5BNQ A;  3OD0 A;  5FZG A;  1DQ2 A;  1NCR C;  4Q4Y 3;  5FY1 A;  3U14 A;  2A6V A;  2EIC A;  5BNP C;  1S55 A;  4QDR A;  4Q0V A;  5FMB A;  2Z5W A;  3THP A;  1QOS A;  3N4M A;  4M01 A;  1OOP C;  2RDR A;  2ET1 A;  1RUH 1;  2P2K A;  3ZKY A;  1RED A;  3P6B A;  4MET A;  1CAV A;  3FN9 A;  1XSQ A;  3HOB A;  5FY7 A;  4XW3 A;  5JXH A;  3ALQ A;  2VZS A;  1SAC A;  1VLN A;  5T5O A;  3OBR A;  2QQN A;  3VBS B;  3HQR A;  5LBB A;  4DQA A;  5JCT A;  5HCA A;  1TNF A;  4E8D A;  4J1X A;  2FDK A;  4QB6 A;  4AI9 A;  2R0F A;  2VOW A;  1PIV 2;  2DVF A;  1ODM A;  5H9R A;  3V65 A;  4HVQ A;  1KQR A;  4CCN A;  3FWE A;  2Z69 A;  4QPW A;  1GWM A;  1CJP A;  1O7F A;  3ZR5 A;  5GZC A;  4H2A A;  4FQ4 A;  1UZ0 A;  3C2U A;  1W6O A;  4YGC A;  2IC1 A;  3ZPO A;  1UU6 A;  2MHF A;  1ND3 C;  1N3Q A;  2XLG A;  4QHO A;  4DXR A;  4Z2A A;  2B39 A;  1FNZ A;  5K0U C;  3TWI A;  1HX6 A;  2A1X A;  2E9Q A;  3FUQ A;  1QJU 3;  3CZJ A;  4J25 A;  3VBF B;  3N9Q A;  4YW5 A;  2R07 2;  4IEX A;  2YRO A;  3AZV A;  1XSR A;  4I0W B;  4LBL A;  2WDB A;  4O9G A;  1OQE A;  4D7S A;  2V4A A;  3R05 A;  5J48 A;  5JOX A;  1TEI A;  1V6O A;  2TUN A;  4AGV A;  5F37 A;  1V6N A;  1G86 A;  4DY5 A;  4DXS A;  2I2S A;  2X5I B;  1GOG A;  4Y26 A;  1PVX A;  1UMH A;  4HOO A;  4LKS A;  1AHS A;  2VVE A;  4GWM A;  1UX7 A;  4AGR A;  2RS5 3;  3FFZ A;  1SPP B;  1YQ6 A;  2A75 A;  4MOA A;  5FYZ A;  2XBO 3;  3EB7 A;  1TZO A;  1VBB 3;  3LD8 A;  5FYC A;  5C5U A;  3WQB A;  2YGM A;  1JYV A;  2NMN A;  4EN8 B;  1VBD 2;  3VBO B;  2WSV A;  3Q8C A;  4FFF A;  3C7F A;  1A8D A;  1V00 A;  1Y7B A;  1O8P A;  1RUH 3;  4OHV A;  3PVO A;  3AJY A;  5C33 A;  3VUO A;  4XDQ A;  1BQP A;  1LCL A;  4ES8 A;  3BUC A;  1RUJ 2;  5CAZ A;  4AW7 A;  2D3S A;  4WM8 A;  4XQD A;  1MS0 A;  1ASJ 1;  3ZO0 B;  5A1F A;  2WN2 A;  2WNO A;  3B5L B;  1ACC A;  3I2J A;  2UWA A;  1I5P A;  4RS5 B;  4TN7 A;  4ISQ A;  5EJZ B;  1XE7 A;  3T09 A;  1PO1 2;  3H1Y A;  1BMV 2;  4EN6 B;  3N9N A;  1DQ1 A;  3UYJ A;  3FHA A;  2YGL A;  2JG9 B;  3RFR A;  4YPJ A;  4AI3 A;  3IM0 A;  1DGW A;  3VZM A;  4HKW A;  3AYC A;  2XHN A;  5FJH A;  5FPV A;  4HLT A;  5IK8 A;  1FMD 1;  2CWM A;  1Q3E A;  2Z42 A;  4OZX A;  1W99 A;  1XND A;  4YM2 A;  3ZXJ A;  2F4L A;  2UWB A;  1POV 0;  3IPV A;  1C5I A;  4XF9 A;  4ZU5 A;  4XAC A;  1Q8S A;  3LDK A;  1JYW A;  4HPK A;  1EAH 2;  4IGQ A;  2E31 A;  4RSU A;  4JGY B;  3VHO A;  5KHH A;  2VH9 A;  4QXH A;  1PM7 A;  1HLC A;  5KXC A;  1XYN A;  3OJB A;  2VY0 A;  4MGT A;  1ZA7 A;  5FJK A;  2WAO A;  1DZQ A;  4OYU A;  4Y33 A;  3VDA A;  3WW3 A;  3SCG A;  2WNU C;  3ILN A;  4CU8 A;  4GJZ A;  4FOV A;  4I09 A;  3J7H A;  3KVA A;  2JKB A;  1TE1 B;  3MF6 A;  4JGZ B;  1ZBE 1;  3U11 A;  3KCX A;  3LA7 A;  5E89 A;  3W20 A;  1SLA A;  3SH5 A;  2A3W A;  1W28 A;  1OA2 A;  4XJ8 A;  1JUI A;  3HN1 A;  1D4M 2;  4ZZ5 A;  5HV4 A;  2JDP A;  3KSC A;  4OUS A;  1IPJ A;  5BNN B;  2KD7 A;  2YY1 A;  4XUR A;  4ATE A;  1BVP 1;  3S0M A;  2WR9 A;  2GH2 A;  4UFL A;  3H9A A;  1CAV B;  1KIT A;  1RMU 1;  4RD7 A;  3WF2 A;  1ASJ 3;  4IV3 C;  4K7J A;  3U78 A;  4AHY A;  1DBN A;  5F7U A;  2Y64 A;  4AG4 A;  1PZ8 A;  5ABJ A;  1JZ3 A;  1S0G A;  3M3Q A;  2K2S A;  4OI4 A;  4MGK E;  4CDX A;  4BQ5 A;  5I93 A;  2EIB A;  2WNV A;  5IVC A;  4XJW A;  1SEF A;  2GNT A;  1W6Q A;  2LS6 A;  2VW2 A;  4R9C A;  1FMD 3;  2EF6 A;  2GN7 A;  4QQP A;  1RIR A;  4ZZ8 A;  3WP4 A;  5HPO A;  4GKX A;  1QMJ A;  1W8F A;  1PGL 2;  4AFD A;  3J8F 1;  4LTA A;  2VBB A;  3KHC A;  5JZG B;  3ZM8 A;  5GLV A;  2ERF A;  1EV1 1;  5FZC A;  3O1V A;  2P34 A;  4NPL A;  4QQL A;  2ZEW A;  5CZK A;  1H30 A;  2HWD 2;  5FZ1 A;  5JIA A;  3R4U A;  3UKN A;  4NHK A;  3WF0 A;  2ZAH A;  2Q8E A;  3NKG A;  1FAY A;  3CZU A;  1W9W A;  4GXL A;  4GWJ A;  4IGP A;  1BBT 1;  3Q8B A;  1PK6 A;  3R0R A;  4K1Z A;  1OFN A;  5ANQ A;  4NHM A;  4NUB A;  2AZ5 A;  4BH9 A;  3OGR A;  1K45 A;  1OXC A;  3N7K A;  4X6Q B;  1QOO A;  1HRI 2;  2W94 A;  3HD8 B;  2NLR A;  2Q4S A;  3RI9 A;  4CE8 A;  3WG3 A;  1RUD 2;  3PUS A;  1ZBE 3;  1D2Q A;  2P3J A;  1B35 B;  1Y43 B;  3OB8 A;  4PCR A;  4B7K A;  1GUI A;  1JMU B;  1AR7 2;  2W95 A;  1RHI 2;  3BVC A;  2QKD A;  1OQ1 A;  2WJS A;  3I2K A;  2PQS A;  4UF0 A;  4JVA A;  2YFU A;  3WHU A;  3SKV A;  3E6B A;  3NMB A;  2FDH A;  4YVS A;  3FFQ A;  4XZP A;  1DYK A;  2XKO A;  4PLM A;  1RMU 3;  3MIB A;  1OC1 A;  1OT5 A;  1UZW A;  4JZR A;  2CGO A;  3JD7 1;  3AZX A;  2VNV A;  5DAB A;  2E53 A;  2X8K A;  5ACA 1;  4WM8 B;  4R9A A;  3RYR A;  3HR9 A;  5I8T A;  5GZE A;  4OHW A;  4TSV A;  1WLD A;  2RJL A;  2H6B A;  2PYT A;  1PGW 2;  2DUP A;  2P3Y A;  1SQ4 A;  1FPN 3;  2Y0I A;  1AXZ A;  2YC2 A;  2ZZJ A;  4M4P A;  5IJR A;  5FXV A;  3UJO A;  4COV A;  5BNP A;  5L19 A;  3HT2 A;  3HNM A;  1KFU L;  3RZL A;  5KC5 A;  4FTS A;  1OKO A;  1OOP A;  1SLC A;  2PHX A;  2AH2 A;  1HB1 A;  1LJ7 A;  2Y26 A;  3LFM A;  3DEC A;  3I97 A;  4LLO A;  4Q8L A;  2UU8 A;  2YC4 A;  4UFM A;  4W4Z A;  4UT5 A;  1NCQ C;  1UY2 A;  5I8S A;  1GQH A;  1UU5 A;  1Y4W A;  2RJ2 A;  3I8T A;  3OCP A;  3J8F 3;  4J6G A;  3VBH C;  3WG2 A;  4LIV A;  1DGR A;  1VRB A;  4K1Y A;  4YWA A;  3ITQ A;  1YFY A;  5F2W A;  3ZYH A;  5C8C C;  4B8E A;  1EV1 3;  3AKR A;  3IPV B;  5F9T A;  2GNM A;  3WIN E;  3CEW A;  1QF3 A;  1QY4 A;  3H3L A;  1GYK A;  4HPK B;  2J22 A;  2W1Q A;  3D0S A;  1BBT 3;  1DQ0 A;  4IEZ A;  4OQ8 A;  1YYN A;  2EIG A;  4JTO A;  4A44 A;  4Q5O A;  2DTY A;  1G9D A;  3EYP A;  5JSR A;  3NAP C;  1JTZ X;  3IB3 A;  1BK1 A;  1GZC A;  2D6P A;  5BXX A;  3L2H A;  5C71 A;  4HVO A;  3AYE A;  5K0U A;  1C5H A;  3WW4 A;  5F5A A;  2K9Z A;  4S2F A;  4LO5 B;  1CX4 A;  3ABZ A;  5FYH A;  2WT2 A;  1RC6 A;  2YBK A;  2RVA A;  4LBN A;  3WT3 A;  1PHM A;  4AWD A;  5J7M A;  2XUM A;  4LKD A;  5JWP A;  2PHF A;  2R30 A;  5E6H A;  2I45 A;  2BVB A;  3AYD A;  3HJR A;  2P37 A;  3LIH A;  3RI8 A;  4NPM A;  4LHS A;  3VGI A;  3BI3 A;  1HKD A;  4EWD A;  3GBF A;  5FPU A;  5IVY A;  4UOJ A;  5ACA 3;  3JD7 3;  1W2O A;  4CUA A;  4CEY A;  5FP4 A;  5AFB A;  4FI9 A;  2VCC A;  3DYO A;  1QQP 2;  4QX7 A;  1RXF A;  4ZS3 A;  5FUN A;  3FC0 A;  3UET A;  4BQ4 A;  1UOF A;  5ABJ B;  3PTR B;  1LOC A;  3N9P A;  2I07 B;  2PHU A;  4KBB A;  3VHP A;  4BOW A;  1IPK A;  2ZEZ A;  1Y9Q A;  4GWI A;  5DXD A;  4AVB A;  4CDX B;  1O91 A;  5A7P A;  2WNV B;  1OD5 A;  3MFC A;  4IW3 A;  1TVG A;  1V6J A;  1AX2 A;  1WA6 X;  2PHR A;  4XYX A;  1W6Q B;  5ANN A;  4L0P A;  4XF0 A;  4EYU A;  5IFT A;  1W6N A;  3MLJ A;  4QM9 A;  4OQ9 A;  2P6C A;  2GC2 A;  3PUQ A;  1BEV 1;  4QWN A;  2BOI A;  1NOV A;  1O3T A;  1RUC 1;  1A34 A;  1F8V A;  2ZS6 B;  4JAA A;  3UGG A;  1UYP A;  1VIW B;  2WUH A;  2SLI A;  1VR3 A;  3K3N A;  3OTF A;  4YM3 A;  3LFI A;  1G8W A;  1COV 1;  2FCV A;  2E26 A;  2XWJ B;  3AZZ A;  1HXS 1;  4CUB A;  2O1Q A;  4PQQ A;  2OVU A;  3WG1 A;  3UNP A;  2GNB A;  3U37 A;  4BCU A;  5LCW L;  1DU3 D;  1PK6 B;  3POB A;  5FZF A;  2X05 A;  3OG2 A;  5FY9 A;  3MDP A;  3GHN A;  4XFH A;  3MV0 1;  2D97 A;  2DYC A;  1RIN A;  1YFX A;  4W50 A;  4AFA A;  4D7Y A;  1ONA A;  2G4I A;  5FPB A;  1QH7 A;  4QGN A;  2B45 X;  1W8W A;  2XVL A;  1W8N A;  1ZRI A;  3FL7 A;  4X8N A;  3LEG A;  3PJQ A;  5T5P A;  5JXJ A;  1JZ7 A;  2HWB 2;  2JDK A;  2A6Y A;  3CDZ B;  3OYW A;  3RZM A;  3CLP A;  1S2K A;  4UBH A;  1XNK A;  2JEN A;  1W2U A;  3I2G A;  1QJY 2;  2P17 A;  2ZML A;  2WYF A;  3DYM A;  3NV4 A;  5FMO L;  4MO3 M;  5CIR A;  2WS9 1;  2A7A A;  4UF0 B;  4NRQ A;  4CPB D;  1NXM A;  1GU3 A;  1KFX L;  2VNG A;  3B9I A;  5T52 A;  1K12 A;  4XXA A;  2ORZ A;  2WNU A;  3DF0 A;  2ZGR A;  4AHX A;  5FR3 A;  2D40 A;  3T08 A;  4WV8 A;  4L99 A;  2WYS A;  3ZKU A;  2DVD A;  2KXL A;  1JHJ A;  1D4V B;  5DN2 A;  4KBZ A;  3GZU C;  1RL3 A;  2ARC A;  1QJE A;  2DVG A;  4MZU A;  4KU7 A;  1FOD 2;  2XLA A;  2ZHL A;  1Y9G A;  3O0W A;  5FQ0 A;  2FD8 A;  4AED A;  5DMY A;  1POQ A;  3LWC A;  2PXJ A;  3P1I A;  5F3I A;  4XFB A;  4LE3 A;  1OOP B;  3AL5 A;  4XFF A;  5ISL A;  1K5M C;  4QX2 A;  1N1T A;  3KLS A;  1BEV 3;  1RUC 3;  3MPB A;  1PX3 A;  4LXL A;  1GZ9 A;  4OI1 A;  1CAU A;  4IE7 A;  2D44 A;  4FPC A;  1UOJ A;  4RGK A;  1J3R A;  4P9L A;  5CB7 A;  1COV 3;  2BER A;  4PHZ A;  1F15 A;  3F2Z A;  3UES A;  1D2S A;  3TEZ A;  3TB0 A;  4XDP A;  1HXS 3;  4MGQ A;  3OPT A;  5FDB A;  3ZIW A;  2CNA A;  4LBQ A;  1BZW A;  3GAL A;  4B4Q A;  4L11 A;  5EPA A;  2YU1 A;  1AR8 2;  3CHX A;  4FPH A;  1VP6 A;  1VMF A;  2DWR A;  4P08 A;  3ELN A;  5D8A C;  5IK7 A;  2IXI A;  1OH4 A;  3C8X A;  2XJT A;  3P3P A;  1JN2 P;  1KS4 A;  1W9F A;  2QQI A;  2RS1 1;  4LBO A;  5EFU A;  4QQH A;  5FKB A;  2VTX J;  3KM5 A;  2QQU A;  1FV2 A;  3SKJ E;  4Q4X 1;  4DMI A;  3V0B A;  4N7I A;  2KA3 A;  4Z8B A;  5LW9 A;  1ZRF A;  2DCK A;  2VUJ A;  1MS4 A;  1TME 1;  4AI0 A;  2WS9 3;  5AC9 1;  1H2L A;  4HSL A;  4XBQ A;  1H8T A;  4FCA A;  1QOT A;  4W6Y A;  2ZAC A;  1R1A 2;  2JWP A;  2QFE A;  4CZS A;  3SH4 A;  1NLQ A;  4MV2 A;  2C26 A;  4AEK A;  4F8A A;  3GZE A;  4CEY B;  2XG3 A;  3JQW A;  1QJF A;  3FJS A;  1LB2 A;  1P8J A;  4AOC A;  5G04 L;  4RQP A;  5GJ6 A;  1M06 G;  4CP0 A;  1JUH A;  3RNS A;  3NV3 A;  4Q1R A;  4UFH A;  5JOW A;  3APB A;  1V70 A;  4XAE A;  3H1M A;  4FPG A;  4OUE A;  1Q8P A;  4OUL A;  2VZU A;  2P1B A;  3MO4 A;  4CDW B;  5K4L A;  1UY1 A;  4PI2 A;  5A6X A;  1W6N B;  2YXS A;  1HV1 A;  5D1I A;  4IQP A;  4QKB A;  4V1P A;  4W6W A;  2GC1 A;  1CR7 A;  1UZY A;  2LTN A;  3VD5 A;  2EAK A;  4EZH A;  1RTV A;  4RHV 2;  5IAX A;  1W2N A;  3PME A;  3RWN A;  3L2Y A;  1AL2 1;  2HBT A;  1DG6 A;  1O6U A;  4LHN A;  2H0B A;  2RS3 1;  2VPV A;  1WD4 A;  4SLI A;  1QJX 1;  4Z07 A;  3VKF C;  1SLL A;  5EXO A;  2W87 A;  3WF1 A;  1VRH 2;  4O7X A;  1U5Y A;  1YCI A;  4QX5 A;  1GAN A;  1LUL A;  1H4H A;  4P9J A;  3LDR A;  3IDC B;  5HBA A;  5FLJ A;  1W8H A;  3B69 A;  4IE0 A;  4V2W A;  4WZC A;  4COY A;  5C8C A;  1CQ9 A;  1QDO A;  1NG0 A;  2RS1 3;  5C3P A;  3O0X A;  4Y24 A;  5E1R A;  3ZN6 A;  4Q4X 3;  1IG3 A;  3LQC A;  2JG8 C;  2FBE A;  1G7Y A;  4E2G A;  1TME 3;  3OYW B;  5FXX A;  5J37 A;  2ZA9 A;  5J1X A;  5AC9 3;  3TBD A;  3PUH A;  1B09 A;  4HKO A;  5JI9 A;  2OS2 A;  3WP6 A;  1XNC A;  4LEJ A;  4FPY A;  1T6B X;  1RUI 2;  4XJA A;  3WLU A;  2HWE 2;  3QBQ A;  4A3Z A;  1I3H A;  2ZEX A;  1H4G A;  1YO8 A;  3TN9 1;  3JB4 C;  2R04 2;  4H14 A;  4Y1X A;  1JYX A;  3B93 A;  2BEO A;  2WFF 1;  3ZIX A;  4PIX A;  5KHK A;  3QLQ A;  3VN4 A;  1YUD A;  4JKM A;  1UL9 A;  1E5H A;  1S0C A;  2EXH A;  2VMC A;  3HT1 A;  4WVV A;  2ES3 A;  3RQ0 A;  4B29 A;  5CVR A;  4KL1 A;  4UFJ A;  4ET7 A;  4UAP A;  1OUX A;  3KWV A;  5A3L A;  1C4R A;  1N1V A;  1RUG 2;  3GM8 A;  1XU1 A;  5FQ0 B;  2VMF A;  2BVV A;  3ZDS A;  4AED B;  2Y34 A;  2VW1 A;  4FTE A;  4OHY A;  1JZ8 A;  2XWB B;  2GSY A;  2HWF 2;  2NN8 A;  1T2X A;  2QVS B;  5A33 A;  3N9O A;  3RG0 A;  4RR3 B;  1JOD A;  1OI6 A;  4CU6 A;  1O59 A;  4NRP A;  3SHR A;  4C1X A;  1CAU B;  3LIG A;  4WVW A;  5C3O A;  4FOQ A;  1HB4 A;  5EZW A;  5GLU A;  2RS3 3;  1LOB A;  4P00 B;  1QJX 3;  4DRV A;  4HSJ A;  1OPO A;  1YIF A;  3WV6 A;  5LA0 A;  2WL1 A;  3NNL A;  3NWK A;  3NNG A;  1W9Y A;  4MGI E;  1SFP A;  1ULG A;  2EA7 A;  4NII A;  4LIT A;  1MEC 2;  2Q8O A;  1UMZ A;  1O4T A;  4QX3 A;  1NE6 A;  3CQO A;  1HB2 A;  3E97 A;  2QQK A;  4WM7 C;  5CKM A;  1D0H A;  2GAL A;  1A3K A;  1C8M 2;  1ODN A;  3B01 A;  4JHT A;  5FYT A;  4RFR B;  4AE2 A;  1PVC 2;  1RGS A;  4NOT A;  2QQM A;  1PO2 1;  4HN1 A;  3N3H A;  4XFG A;  1S4C A;  2QQW A;  3WVJ A;  4BU2 A;  1FNY A;  1XXN A;  1GZW A;  2BU9 A;  2ETE A;  1W03 A;  1N3P A;  3H8U A;  3ZN5 A;  4A6O A;  4BQ1 A;  1Q43 A;  4IV1 C;  1WCQ A;  1R09 1;  4DOU A;  1XE8 A;  4LBM A;  1IZ3 A;  4PI0 A;  5T5J A;  3MZH A;  1GOF A;  4BIO A;  4QDQ A;  3SXW A;  3NJY A;  4CDQ C;  1J84 A;  4JTN A;  1T6G C;  4EZ4 A;  2FDJ A;  4ZON A;  3TN9 3;  1H8T B;  3E5U A;  1S2B A;  1RVF 2;  4OVE A;  1X36 A;  2WFF 3;  1CPN A;  3LA2 A;  5EIY B;  1ZZ8 A;  2ZHK A;  3OY8 A;  5JVV A;  5LEK A;  1MZF A;  4GKY A;  2WWU A;  4D0Q A;  1ZRD A;  1DDL A;  1UY3 A;  4RQP B;  3VD3 A;  5BUV A;  2VG9 A;  4ZU4 A;  1ZBA 1;  3A7Q A;  2DF7 A;  1JZ2 A;  3THT A;  3PIG A;  3DUI A;  4FFI A;  3WNL A;  3BIW E;  1NKG A;  4YVW A;  1REE A;  2BGP A;  1LEC A;  3J7L A;  2VOT A;  2XLF A;  1HQN A;  2RR1 2;  2BDR A;  3OOX A;  4QT6 A;  2AUY A;  1WUV A;  3P5B A;  5IK5 A;  5GLT A;  4NAM A;  3M7A A;  3QH7 A;  5C3S A;  2WAB A;  5EV7 A;  3NJZ A;  2B46 X;  1ULE A;  4FP2 A;  3WNP A;  3ZSK A;  2QE3 A;  3KCC A;  5DUV A;  4AYU A;  1I5Z A;  1WMF A;  4QAW A;  4S2H A;  5FO8 B;  4LO4 B;  1YHF A;  3K4Z A;  2R0H A;  1G6N A;  2ZHM A;  3BB6 A;  1M4W A;  4GZ9 A;  1NA1 A;  2J1U A;  3MW2 A;  4MH0 E;  1ULF A;  1AXY A;  1AYN 1;  3AP5 A;  1RUO A;  1NQD A;  1AR6 2;  4JRL A;  1AF9 A;  2HWC 1;  4X8P A;  4XUO A;  5JPM B;  1GFF 2;  2CDP A;  1RJ8 A;  1UYZ A;  4QPG C;  5IW0 A;  1OQD A;  1QHD A;  2DBN A;  3GYD A;  3WW2 A;  1PO2 3;  5C8C B;  1V6K A;  2PN5 A;  1GNY A;  3JBG 2;  1IPS A;  2RMU 2;  3AMP A;  5GLZ A;  3ZN6 B;  3JU9 A;  1WKY A;  1R09 3;  2XBO 1;  4FAH A;  1VBB 1;  4Q27 A;  4PQ9 A;  4GIQ A;  1UNB A;  4MX3 A;  3POS A;  4XEZ A;  1NE4 A;  3HBZ A;  3VHN A;  4AAX A;  1JHN A;  3AZY A;  4HL0 A;  4URT A;  5JIU A;  1MVE A;  1XNB A;  2DV9 A;  4LUL A;  1XNA A;  4X6R B;  5EWS A;  4CEW C;  3VKL A;  2VD7 A;  3JUU A;  3MFA A;  3VHR A;  3ZYB A;  4DFS A;  1OLM A;  2J1V A;  1JOB A;  2BV4 A;  3PU8 A;  5D8A A;  1CGP A;  1UYX A;  1ZM1 A;  3WDT A;  3P3N A;  3HIF A;  4M3C F;  1YEW A;  3AJZ A;  1EP0 A;  2AAC A;  4QQO A;  5KR7 A;  1DP0 A;  1GP4 A;  3RGB A;  1ZBA 3;  2WA3 A;  2WQ4 A;  4QKN A;  1MS8 A;  3POJ A;  1LOE A;  3T1M A;  1DYO A;  3AVS A;  5FMO S;  5GAL A;  5T5L A;  3O1U A;  3B9C A;  1DF0 A;  3EQE A;  4QPI C;  5FBJ A;  1CJD A;  4LUM A;  4CP1 A;  2RE9 A;  3LCP A;  3UKT A;  2VOK A;  4FBF A;  4LOS A;  1CAX A;  4XJU A;  3PVE A;  5DAP A;  5BV6 A;  5A33 B;  2VTX A;  1YRZ A;  2Y6F A;  5JSP A;  1E5I A;  1VBE 3;  2X09 A;  3CMG A;  1ZRC A;  2XKP A;  3WCR A;  5FXW A;  4NR1 A;  1BK0 A;  4XBN A;  1UX6 A;  2HBU A;  1PIV 1;  4NHY A;  1KJR A;  3UK9 A;  5A70 A;  4D6Q A;  2ZMN A;  5CFC C;  3VLB B;  3BPS A;  3W5M A;  3KS7 A;  5AFE A;  1SBF A;  4CCM A;  1AYN 3;  1WMX A;  2OQ6 A;  3KF5 A;  5GZF A;  4CDU C;  1WLW A;  2HWC 3;  4LE4 A;  4D6R A;  3SEE A;  5IAV A;  5TSW A;  2WBK A;  1VB4 A;  1GOH A;  1W0P A;  2BJS A;  2DTW A;  2J1S A;  3DGT A;  5CFD C;  4CCD A;  2OUJ A;  5DQ0 A;  5FMC A;  1HW5 A;  3ZXG A;  5I91 A;  3M4F A;  2R07 1;  1WCS A;  3I4I A;  3K2O A;  1XOY A;  1W2T A;  2NYY A;  4LO6 B;  2BGO A;  3LKJ A;  3T2T A;  1GZW B;  3PTY A;  3UL2 A;  2B5H A;  5FPX A;  2JDY A;  2VEC A;  3G6J B;  2VZP A;  1FX5 A;  1ND2 B;  1S1A A;  3THC A;  5CG8 A;  4FO9 A;  4G4F A;  5EP9 A;  1POV 1;  5FRE A;  5F5C A;  3VDD C;  1K5J A;  2BRT A;  1L7Q A;  4DY3 A;  4UW6 A;  2DCY A;  3BGA A;  5J09 A;  1G9A A;  5IYY A;  1WA4 A;  1YJK A;  4LT5 A;  1BJQ A;  2Q1F A;  2Q8D A;  4DB5 A;  4ZKT B;  4C1W A;  1IOA A;  1URX A;  2PFW A;  1TMF 1;  2WC2 A;  3OY8 B;  4LPL A;  4N90 A;  2OKX A;  4DZG A;  3LDB A;  1NT0 A;  5JSO A;  1VBD 1;  2ZGU A;  3ES1 A;  1VBC 2;  1HN0 A;  3HWJ A;  1EYB A;  2C4X A;  3ZLI A;  3J26 N;  5L7O A;  1UN1 A;  5CBL A;  2FDF A;  4IE4 A;  1LED A;  3U4X A;  3V0A A;  2VZO A;  4R4Z A;  4PLN A;  4FPL A;  1QXR A;  4YVW B;  3CJI B;  5EYX A;  4GH4 C;  4CTE A;  5FZ8 A;  3TAY A;  3WY6 A;  2ZGT A;  4AVA A;  2JE7 A;  1PIV 3;  2BTV C;  2EXJ A;  2VQA A;  1PO1 1;  3AK0 A;  4FOW A;  4BYY A;  5JXI A;  2YZ4 A;  3WNO A;  2WRA A;  2DVA A;  4HET A;  4Q0Q A;  1BMV 1;  2V4V A;  5LAS A;  3DXT A;  3MLL A;  1LOF C;  2DUQ A;  3HEI A;  4N43 C;  1NA1 B;  3VZL A;  2XJU A;  4IL7 A;  1ZZC A;  3SNM A;  2XUE A;  2KM2 A;  1V6I A;  3FMG A;  2ARX A;  2OII A;  2UYB A;  1G9C A;  1ZZ7 A;  2EVX A;  4IE6 A;  2IVI B;  4JDN A;  3UJQ A;  1QU0 A;  2JDA A;  5A1A A;  5H9Q A;  5DG2 A;  2HYX A;  5JR7 B;  2R07 3;  2A3Y A;  3T1L A;  1EAH 1;  4XBL A;  3ZFG C;  1UZZ A;  4HBN A;  1LRH A;  4XFI A;  2OUH A;  5IK4 A;  1VB2 A;  3VDB A;  1ENX A;  1LGB A;  4YW3 A;  5KHI A;  2OQ7 A;  2C24 A;  2B8M A;  3GGL A;  1K42 A;  2YUE A;  2NP0 A;  1IQA A;  1POV 3;  1HJG A;  4WM7 A;  3SH3 A;  2PLV 2;  3USU A;  2YV8 A;  4E4S A;  2YBP A;  1HQW A;  5A3M A;  4EWE A;  3H42 B;  3NNJ A;  1VMJ A;  5CU1 A;  1YI9 A;  1TMF 3;  1HIX A;  3VBR C;  1OSG A;  5M0T A;  4FPK A;  3I2O A;  3POY A;  1VBD 3;  4R9B A;  5L9B A;  4DNY A;  1GV9 A;  4IV1 A;  1RB8 G;  2O8O A;  1FPN 1;  2TBV A;  4AI1 A;  4JX0 A;  4BWO A;  2GDF A;  3PUA A;  1W8Z A;  5B4N A;  2AEZ A;  1AZD A;  3ST7 A;  3M8L A;  2C5D A;  2EXK A;  4IND A;  1AYM 1;  2QQO A;  2QUO A;  1I1E A;  4N8M A;  4H7M A;  1JH5 A;  4UFK A;  1XYO A;  4Q4V 1;  3T0A A;  2XOM A;  2JX9 A;  5DDJ 2;  5C7G A;  1W6O B;  1CAX B;  2R6Q A;  4IET A;  5FYM A;  1OVS A;  5BNO C;  5AVA A;  1UXZ A;  4YZ5 A;  4IER A;  4FP3 A;  1PO1 3;  4K40 A;  4NWV A;  5KHG A;  4KMQ A;  2XQX A;  1G9F A;  2LAL A;  5FY0 A;  4A4A A;  3T2Q A;  5JMC A;  5IVV A;  3DPR A;  3TRS B;  2GMP A;  3GHM A;  1VAV A;  2XL9 A;  2E51 A;  1DFQ A;  2LRO A;  3JXS A;  4YZ2 A;  3NV1 A;  4HK8 A;  3MI8 A;  1SLB A; 
#chains in the Genus database with same CATH homology
 1YQ6 A;  1YQ5 A;  1YQ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...