2WKKA

Identification of the glycan target of the nematotoxic fungal galectin cgl2 in caenorhabditis elegans
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
150
structure length
150
Chain Sequence
MLYHLFVNNQVKLQNDFKPESVAAIRSSAFNSKGGTTVFNFLSAGENILLHISIRPGENVIVFNSRLKNGAWGPEERIPYAEKFRPPNPSITVIDHGDRFQIRFDYGTSIYYNKRIKENAAAIAYNAENSLFSSPVTVDVHGLLPPLPPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GALECTIN-2
publication title Caenorhabditis Elegans N-Glycan Core Beta-Galactoside Confers Sensitivity Towards Nematotoxic Fungal Galectin Cgl2.
pubmed doi rcsb
source organism Coprinopsis cinerea
molecule tags Sugar binding protein
total genus 34
structure length 150
sequence length 150
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2wkkA00
1CONA 2GN3A 2ZMNA 1AX2A 2ZGKA 3GALA 2ZGLA 4FPHA 4GXLA 3V0AA 2NP0A 3A0NA 1HKDA 2P3KA 2A75A 4C1XA 1JOJA 1WUVA 2ZGPA 4YZ5A 2DUPA 1GKBA 4M3CB 3AYDA 3O0XA 3RRDA 5JLVA 2PHXA 2EXHA 4GKXA 2YMZA 1Z78A 3PJQA 1LGBA 5GJ6A 4YZ2A 1LU1A 3RSJA 1SLLA 3A4UA 3A0KA 1CPMA 4FQ4A 4XMIA 2R1DA 5GLZA 1MR5A 3WHTA 4DRRA 3AZZA 1FX5A 1LECA 1O4ZA 2VW0A 3ILNA 2JE7A 1LGNA 5KXDA 2WT1A 4Y24A 3OYWA 1JXNA 1V6OA 5GZFA 1DYKA 1MS0A 3PVNA 5CBLA 1AF9A 1YXWA 2R0HA 1HLCA 2ZA9A 1V6IA 2SBAA 3N3HA 4M3CE 2A6YA 4Y1UA 1QKQA 5DUVA 5DUXA 1QMJA 1AJKA 3N7KA 5IK8A 4XBQA 1X50A 3MW4A 4WV8A 2DYCA 1LEMA 1DLLA 1MZ6A 1YI7A 3BODA 4Y1VA 1JUIA 5AVAA 3SITA 1W6OB 5CB7A 1MS8A 4XJ8A 3WG3A 1LOBA 5EYXA 3SH5A 1YIFA 1MVEA 4FOQA 4BQ1A 1LOGA 4XTMA 1G9DA 3IMNA 1ENRA 4Q27A 2OUHA 1LU2A 1S0FA 4Q8KA 2EALA 1H30A 2JJ6A 1S0IA 1V6NA 2AYHA 2OVUA 1QOOA 2W52A 3LSEA 4JCKA 4Y1YA 3BTAA 4XZPA 2ZGMA 1W6MA 4PBOA 1VLNA 2JECA 4PF5A 4YGEA 1F5FA 1S0JA 4FP3A 1JN2P 1G7YA 4DFSA 1TEIA 2WSUA 4XILA 4Q8LA 1JYIA 3N36A 4XMAA 1W6NA 5FRAA 1DQ2A 5GZDA 5L73A 3IPVA 3AZXA 4I30A 1GZWB 1FNZA 1CVNA 1KQRA 1OFSA 5HCAA 2DWRA 1LOEA 1GYKA 3MW3A 1QOTA 1WW6A 1V6JA 4GWMA 2P3JA 2C9AA 3AX4A 1CN1A 2GMPA 3WG4A 2KM2A 3B69A 4YGDA 3ZSJA 4AVTA 4L8QA 1QF3A 3RMXA 4YW1A 1LENA 3BIWE 4IQPA 2DVBA 4CZSA 1SBFA 3FLTA 1V6LA 1C4RA 2PHWA 3BOPA 3R05A 1SBDA 2CWMA 1URXA 3M3QA 1N1SA 2LTNA 1AZDA 3PVEA 3AXDA 2EXKA 3KQRA 4Q2FA 1MS5A 2JE9A 4SLIA 3T2TA 3UK9A 3SH3A 4LBJA 4RL7A 3AZVA 1QNWA 1HQLA 4YW2A 5FREA 3PVOA 3RS6A 1MVQA 4KBBA 4LBNA 2R49A 3POSA 4JRAA 2EIGA 2WT2A 1F9KA 1HDKA 2NM1A 1FAYA 2RHPA 5E89A 1UAIA 1LOCA 3SNMA 2PHRA 3ILFA 4ISQA 4Y1ZA 1A3KA 2ZHLA 3I4IA 1SFYA 1SCSA 2LALA 1PZ9A 2XG3A 4R9BA 4Y26A 4YW5A 2D44A 5EYYA 2ZZJA 3WVJA 2A3XA 1AX0A 3WDYA 2WLQA 1CJPA 1SBEA 3DUIA 2ZGQA 4ASMB 3IN9A 1MS9A 3WUDA 1F31A 1KDMA 3AP7A 3M1HA 2VXRA 4XJWA 3WDXA 1RINA 2CNAA 3ZSLA 2ES3A 1DQ4A 2WT0A 2ZMKA 3FFZA 3AYCA 2NZ9A 1FV3A 3B01A 2D6NA 5DZEA 3ZXLA 4XYXA 2DTYA 1I3HA 1IS4A 2YROA 2GN7A 2YY1A 3QCWA 3U4XA 2W39A 1IKQA 5LK5A 2EXIA 1Y7BA 3R4UA 3POYA 3AYEA 4Y22B 2GALA 3N35A 1PZ8A 3PMEA 5GZCA 1G9AA 1G9CA 1FNYA 1DQ0A 4XIOA 5H9PA 1CPNA 1FATA 4YGCA 4YZ1A 1SLTA 2UWCA 3AK0A 3OBRA 2A70A 3UJQA 1GANA 4XHBA 1UN1A 3R4SA 1MS3A 4K21A 1H9PA 2ZGNA 1Z0HA 2AENA 3WDWA 1FV2A 1PZ7A 1GICA 4YFWA 1A78A 2E51A 3AP4A 4Y20B 5KXCA 2D6PA 2P34A 3ATGA 2A6XA 3AXEA 1W6QA 1KRIA 4FOVA 1WD4A 1MS4A 4YW3A 4ZKTB 3WV6A 1I1EA 4GALA 5KXEA 2ZGOA 1DQ6A 3AYAA 2ZABA 3HN1A 1O4YA 2VW2A 5F5QA 1CESA 1DFQA 1ZM1A 1UKGA 1DQ5A 2PHFA 2VH9A 3O0WA 1N1TA 3GNEA 1JHNA 4HANA 2CY6A 2D6OX 1OKQA 4XXPA 3MEPA 2PHUA 1GZWA 1VIWB 4F83A 4ZXKA 5T52A 2VY0A 4BM8A 3FLRA 4OZXA 1EPWA 5H9SA 2D6KA 2TEPA 3SISA 1D0HA 1QU0A 2A7AA 5T55A 4FPGA 1IS3A 1AXKA 2C5DA 5DXDA 3ZPYA 5DG1A 1Q8PA 2OW4A 3M2MA 4ISRA 1BKZA 1G8WA 2D43A 2ZHNA 3L2YA 3N7LA 2W68A 3FUOA 2A3WA 4XIKA 1Q8QA 3ZXKA 2WQZC 2ENRA 4NOTA 3WDVA 4UW5A 3N7MA 4K1ZA 3SH4A 2ERFA 4FPLA 5EXOA 2EXJA 3ZXFA 1DHKB 4FOWA 1D2SA 5JOXA 5GZGA 2DTWA 5JMCA 5JOZA 3WDUA 4YM3A 2ZHKA 3WZ1A 2AUYA 3T1MA 3DGTA 2CTVA 2ARBA 1V6KA 1DGLA 3WOGA 1CR7A 3O0VA 1V6MA 2E7TA 4LBQA 1LHOA 4AVSA 2W08A 5CNAA 3AP9A 1DZQA 3AZYA 5GM0A 1FYUA 2DURA 2FHRA 2DUQA 2NMOA 5GZEA 2XB6C 1G9BA 1WLCA 1B09A 3OPZA 3ZXEA 1LHWA 3WCRA 2A6VA 1JBCA 3USUA 4AVVA 1CQ9A 3Q9OA 4YFZA 3D4KA 4YG0A 2AGSA 1YRZA 3INAA 1WLDA 2GDFA 1DBNA 2Q5TA 3TAYA 4RA0A 4TZDA 5IK5A 5T5PA 2D3PA 2GMMA 2NN8A 5T5OA 1VAMA 3JU9A 2B7YA 1WLWA 3B00A 1N1VA 2HYKA 3B9CA 3D5OA 4P14A 3UJOA 1N3OA 2DVGA 1AJOA 4FOYA 4K20A 3M3CA 2R16A 2VW1A 4DQAA 2R0FA 1AXZA 4XDQA 1KDKA 1ULCA 3V0BB 1W0OA 2CYFA 2NYYA 3TB0A 4M3CA 3WHUA 4M01A 2R1BA 3UL2A 1BXHA 3VKNA 3RQ0A 3VKOA 1SACA 3N7JA 3VKFC 1QDCA 1SLCA 2DVFA 1WW4A 4CTEA 5JOYA 4YZ3A 1QDOA 1W6MB 2GNMA 3NV3A 4Y20A 1LESA 4BLJA 1LGCA 2I2SA 1W6PB 1W6NB 2GNDA 2D3RA 3NWKA 4MYEA 2WSVA 2H0BA 3LSDA 4FPJA 1Q8SA 2G4IA 1HQWA 4YG6A 5GLUA 1LOFC 1WD3A 3IKWA 1BJQA 1LOFA 5HCBA 4AGRA 1G9FA 4P9XA 5SV8A 5DZGA 1Q56A 1W0PA 1LULA 2D7FA 1SLBA 2E6VA 3ENRA 5JVVA 2YXSA 3RMYA 1LOAA 2AR6A 4ITCA 2ARXA 1GNHA 5IK4A 2UU8A 2AREA 4D69A 5IT6A 1W6OA 5CAZA 1VALA 1ENQA 1APNA 1LCLA 1R1ZA 4LBQD 5H9RA 4FQZA 2Z42A 1S0EA 1MS1A 4XJ9A 1SLIA 2EAKA 1QNYA 4AGGA 4BPZA 4DS0A 2ZKNA 5DG2A 3WLUA 4FP2A 1S0BA 1LHUA 5H9QA 3WDTA 1S0GA 4FPKA 1UX6A 2DVAA 3NV4A 4YLZA 3WCSA 5BYNA 1ULEA 5DZFA 4LBLA 1LHVA 3HR9A 1N47A 1YYNA 5IUQA 5T5JA 3W58A 3OY8B 3W59A 2V5YA 4Q1RA 1IS5A 4XJUA 3H0OA 4BMBA 5T50A 2DU0A 3KM5A 1AXYA 2D6MA 3WG2A 2WNEA 2A6WA 5F9TA 1C1LA 1MZ5A 3FUQA 3M3EA 4LBKA 3VKMA 5JDBA 2DV9A 4FPEA 1NXD1 4M3CF 4FPCA 1ZA4A 1DIWA 1GNZA 3HMYA 3M3OA 3AP6A 5E8AA 4WVVA 4FVVA 4LBMA 4XBLA 2BQPA 1RITA 4W65A 4XOGA 2VUAA 3AFKA 4BLIA 3ZSMA 1U0AA 2UWAA 1VAVA 3AZWA 1GBGA 4JC1A 4UW4A 2P2KA 4CRQA 1MACA 5GLWA 4YGBA 4C1WA 2FMDA 2A3YA 3O12A 3ZYRA 3V0AB 2PHTA 3AP5A 3ILRA 1N1YA 4WZFA 3VUOA 5T5LA 2A5ZA 4Q26A 2GNTA 3WG1A 1UMZA 3I8TA 1CIWA 1IOAA 1DQ1A 3C2UA 1RIRA 1H9WA 3O5SA 4GA9A 3WUCA 3ZSKA 1GV9A 1Q8OA 1OQ1A 4BMEA 1ENSA 3APBA 5CA6A 2AH2A 1UZZA 1S0CA 3NV1A 4PCRA 4HL0A 4LBOA 5GLTA 5JOWA 1ULDA 4ATEA 1Q8VA 3V0BA 1WW7A 2GMEA 2V73A 4Y1XA 2DU1A 1AVBA 4YM1A 1W6QB 5HCFA 3V64A 3OYWB 2JDZA 3WNXA 1AX1A 1UL9A 2OUJA 4FPFA 1WW5A 3FLPA 2GNBA 4YM2A 2ZMLA 1WBLA 3MPPG 1JYCA 1LHNA 2A71A 2PELA 2WJSA 3D6EA 3FBYA 4H55A 4XE9A 4YW4A 1BZWA 2ZGRA 4AWDA 3SLIA 2UWBA 1UZYA 2D6LX 4XBNA 1LJ7A 1W6PA 4R9DA 4R9AA 2YV8A 4XTPA 3ASIA 1BYHA 1GZCA 3AJYA 3POWA 4YM0A 1V00A 1C1FA 2E53A 2NMNA 4XJZA 1ULFA 1QGLA 3V65A 2DVDA 4GWNA 4WVWA 4R9CA 1ONAA 4U36A 4TYSA 4K1YA 4NO4A 4Y22A 1S0DA 2ZGTA 1IS6A 3OGGA 1WCSA 5EWSA 4YG3A 4P9YA 2DUOA 2YZ4A 3AJZA 1GSLA 1YO8A 3QLQA 3IM0A 1G86A 3LCPA 4FPYA 2E7QA 1KJRA 2UURA 4ATFA 2JD4A 2P3IA 3CNAA 1QOSA 1GLHA 4Q1PA 5GALA 2WKKA 4U2AA 3ZXJA 4XJAA 1IKPA 4AGVA 1UPSA 5DUWA 1DYPA 2CL2A 2ZACA 3B3QE 4UW3A 4DPNA 5E88A 2ZHMA 4PBPA 2ZAAA 1C57A 3IPVB 1LTEA 1SCRA 2JKBA 1KITA 1N3PA 3OY8A 2CWSA 3JUUA 4LBQB 4FPOB 1LEDA 4M00A 5DUUA 1J1TA 2D3SA 3MW2A 3T1LA 2SLIA 1XQNA 2EF6A 1WBFA 1BQPA 2A6ZA 3NV2A 5IK7A 4PQ9A 4BOWA 2ZGSA 1JW6A 1LODA 2P37A 1S1AA 5T54A 4XHXA 3VV1A 1SLAA 1KJLA 4XXAA 4GKYA 4UW6A 4DRVA 1NLSA 1A8DA 3USUB 3OBTA 4Z8BA 4AYUA 3VKLA 3RG0A 4P9WA 5KXBA 4YZ4A 2ZBJA 3ZYPA 2ZGUA 5GLVA 2VU9A 3OJBA 3ZVXA 1N3QA 1GZ9A 1ULGA
chains in the Genus database with same CATH superfamily
1Z7S1 2ZGKA 4LKSA 2NLRA 3V0AA 3BKZA 1JYVA 1IG0A 1GQHA 4ES8A 4Q4V3 4LUMA 3SCHA 2P3KA 2A75A 3VZOA 2DUPA 4BZ4A 1GKBA 3ETPA 4WM7B 3LPGA 4G4FA 1XU2A 3UETA 3THCA 2XBO3 5JZGC 4NIGA 3G7DA 3RVHA 2YBSA 4HK9A 3VHNA 4META 1I5PA 4LK7A 1PVC3 3KT4A 4YZ2A 1XYOA 4KG0A 1FT9A 3RSJA 5ANNA 1OVSA 1WGPA 4HETA 3WHTA 4DRRA 1HRI1 4RFT0 4K8FA 1LECA 1O4ZA 2VW0A 3GF6A 2LM3A 2JE7A 1LB2A 3TYJA 3ECQA 2WT1A 1FOD2 2ADEA 5FQ0B 1CGPA 3ES4A 5AVPA 5GZFA 1V6OA 1S55A 1QJX2 1D4M2 3MIHA 3ZFGC 2W0XA 4NRPA 4FFHA 2HEVF 3DV8A 4R4ZA 1F8VA 2SBAA 2QBXA 4Y1UA 1R64A 2NQYA 4Z2AA 4C0HA 3OSDA 3VBHA 1J1LA 4XBQA 5FZ4A 4WV8A 5I0UA 5IVEA 3PVBB 2K2SA 3DYOA 5EZWA 1W2OA 1X9TA 3O1RA 1MZ6A 3BODA 1SZBA 2DFBA 4CCOA 5FMBA 1KFUL 4JVAA 4Q4W3 2ET7A 5FBZA 4HXCA 1WKYA 4XQ4A 3WG3A 4COYA 3G6JB 3POGA 5KHGA 5C4WC 2FDHA 3DL3A 3T0AA 4RS5A 3I3DA 4NIHA 5G05L 1ENRA 1COV3 5FY7A 1WLTA 3SKJE 4AXOA 3BTYA 2EALA 2VUDA 1HXS3 3UGHA 2HEYF 2ET1A 3O1TA 1W8WA 2W52A 1XNBA 4YW7A 2EAAA 3BTAA 2WZR1 3J7NA 4XEZA 2IVJA 3WQ1A 1G7YA 2B45X 2WSUA 3LWCA 3JXSA 2XGXA 3JBG2 1XRUA 3MDPA 3QOPA 4HG6B 3WNPA 1GOGA 5C6CA 3N36A 4GMP0 5GZDA 4JHZA 5FZEA 5JXHA 3VZMA 3GBFA 3AL5A 3DPRA 1NQDA 4XUQA 2ZS6B 3U10A 5FR3A 4A7KA 1OFSA 1AYN3 5HCAA 4CEYC 4UFHA 1GWMA 4XABA 1AL21 1JOBA 1AR63 1WW6A 2RDRA 1UYYA 1V6JA 2RR11 3AKSA 2C9AA 3ZSJA 1H8TA 3WG4A 3N9LA 4YGDA 3OGRA 5FXZA 1RVF1 4Q4X2 3RZGA 2JE8A 3WNNA 5A3NA 4CZSA 2VAUA 3R05A 3VBSC 1C4RA 4UFIA 1UU5A 2W9XA 5JI7A 4CP0A 3DN7A 4L97A 4JTOA 5J09A 3KHCA 4MGTA 4HZFA 4EE2A 1ZBA3 3UK9A 1DF0A 5F7UA 4OUEA 1JZ8A 1MVQA 2W47A 4LBNA 4XQDA 4Q4V2 2IFRA 5I8YA 4QPIC 1F9KA 1QQP3 1RUJ3 1HDKA 3I49A 3KGLA 2GAUA 1DGWA 1EPZA 2XBO2 1HV1A 1VBC1 3O1MA 4Y1ZA 4WM7A 4K8RB 1PVC2 1QH6A 1AR71 1W9WA 2B5HA 2PTMA 2XG3A 4R9BA 4S2FA 3CEWA 4YW5A 1VBD1 2ZZJA 4GH4C 3WVJA 5F2SA 2C24A 5FKBA 4AFMA 2YFZA 1IPKA 3MIDA 1CJPA 3WDYA 1SBEA 3DUIA 4OCTA 5A7QA 3IN9A 4RHV3 5FZDA 4DO0A 1KDMA 2HJIA 2VXRA 3UESA 4BQXA 4QKDA 5F32A 1JYNA 2NZ9A 2FMYA 3FWEA 1CZVA 3WW3A 3NNLA 2WRAA 3ZXLA 1TG7A 5FPLA 4BXSV 2DTYA 1NZCA 4LNVA 3MFAA 4DINB 4TWTA 2JB4A 3POYA 4QQHA 2GSYA 4Y22B 2GALA 1FXZA 5GZCA 3WSOA 1ZZ9A 5KWRA 1RTVA 3P5BA 4Q4W2 2UWCA 4NAMA 3PURA 4XETA 4XHBA 3TEXA 4XAAA 4CYDA 4W6YA 4E4ZA 1MS3A 2B9UA 3BVCA 5C71A 3RPQA 4K21A 2BGOA 2XJTA 2VR4A 2ZGNA 1XNKA 2AENA 1O91A 1W05A 2E51A 2VO5A 5FY8A 3AP4A 1COV2 4CDWC 1SPPB 1NCRC 1HXS2 3SQOA 5KXCA 3A23A 3FX3A 3AXEA 5FZFA 3ZDVA 4YVSC 3IIAA 5IFPA 4AHWA 5FZ6A 5HV4A 4I2OA 1RL3A 4YVWC 3ZFGA 3GYDA 1SFPA 3QD6A 1TZOA 2HWE3 2QQVA 5LWBA 2VH9A 1DQ5A 1JZ7A 1N1TA 4BYYA 5FZ9A 4BIFA 2VOKA 2V09A 2D6OX 4LO6B 1AYN2 3VBFB 4D8MA 3GZEA 3ZKUA 4B7KA 4ZXKA 5T52A 3TEZA 2XJQA 3IDCB 4WM8C 4RFRB 1D0HA 4ZU5A 2JDYA 3HBKA 1Q8PA 1REEA 2OW4A 5DAXA 1MEC1 4M0HA 3WW2A 3T0BA 5JAXA 1PO23 1BKZA 1NCQC 1ZBA2 2D43A 2E31A 1ZREA 3FUOA 5FZ8A 2PYTA 3NJXA 2XWJB 5EFUA 1CAWB 3GHMA 2WYSA 4LHLA 4UW5A 3N7MA 5FYVA 1BCXA 5CKQA 4ASKA 4AVBA 1RUJ2 1QQP2 2EXJA 3MF9A 1D2SA 2HLEA 2DTWA 3N9MA 1QJY3 1W9YA 1CD3G 4N53A 4OHXA 4JGZB 1RB8G 1V6KA 3WOGA 1CR7A 4CE8A 1V6MA 1R1A3 3IIIA 4DXSA 2W08A 2DBNA 5CNAA 3ACIA 4KGGA 5FZ3A 4CU8A 5I91A 2RM23 1WWYA 2TUNA 3AP9A 1OOPB 4AFDA 4BH9A 2VMFA 4RHV2 4DOUA 3RNSA 2Y6KA 2IXKA 2MEV1 2WDBA 2YUEA 5GZEA 2XB6C 3HEIA 4IE4A 4CCMA 5FO7B 3OGVA 2JG9B 1AR92 3OPZA 3LA3A 4G3YC 3WCRA 3K51A 1JBCA 1ND3C 2JIJA 4RR3C 1CX1A 1CQ9A 5M0TA 3VDBA 5FWJA 2N7GA 4HPKB 4LOTA 2AGSA 1GQGA 1VBB3 3K3OA 1DBNA 4OI2A 2VNRA 4WVZA 2ZX0A 5IK5A 3ZFEC 2NN8A 1VAMA 3JU9A 1W2AX 2X09A 1N1VA 3ZPOA 4P14A 3BALA 1N3OA 2OPKA 2WNVB 4R52A 4A4AA 2XLAA 3M3CA 5FK7A 1Y9GA 2R0FA 4QXBA 3W20A 4P9IA 2NYYA 4D6RA 2VOTA 2ZCWA 2J1VA 2XJUA 1XE7A 5C70A 5LW9A 1LNSA 2KA3A 2XVKA 3N7JA 1QDCA 4XACA 2AEYA 4OZOA 1WW4A 1QDOA 3NV3A 2GNMA 3UGFA 4B8EA 3NNGA 2WR9A 5JSOA 2XL7A 4IGPA 2I2SA 3E97A 4PDWB 4R8HA 2D3RA 2RS33 4KG8A 2HWE2 3LSDA 4FPJA 2G4IA 1HQWA 4URAA 3MI8A 1L7QA 5GLUA 2JKXA 2X5IB 4QGNA 1TMF3 4Y33A 3VHRA 4AGRA 2PA7A 3JD73 4NIIA 2D7FA 1CZTA 1SLBA 2W92A 1OA2A 2VXJA 3KF5A 4QXKA 4IEOA 3VZNA 3VBFA 4ITCA 2X10A 4MGYE 3KCCA 5IK4A 3W5MA 2XPJA 3U1XA 1NAEA 4UF0B 3UYJA 2XXZA 4RGKA 4BK5A 1J83A 2Y6LA 2JWPA 1ENQA 3M3IA 1APNA 4S2HA 1IPJA 1R1ZA 4HMZA 3ABZA 3GCWA 3FMGA 1JHJA 1MQTB 1PO22 3S6PA 1S0EA 1MS1A 1ULPA 1SLIA 1UY1A 2Y34A 5LATA 2B4KA 2XH6A 3WDTA 2IXHA 4FPKA 1HIXA 1QH7A 3WCSA 2A73B 3IAQA 3HR9A 3ZMOA 1O3SA 4NR1A 5FOJB 3OY8B 3W59A 3CJIB 2V5YA 3ZXGA 4OYUA 4XJUA 1QJY2 1NYWA 1UOBA 1JUHA 2DU0A 3KM5A 5T50A 5B2GB 3AM2A 3WG2A 3H1YA 4QX5A 5K7PA 1Q43A 3FUQA 3M3EA 3Q8BA 2VQ0A 4QPGB 1R1A2 2DV9A 5FXWA 4LHKA 5I0RA 3RJ2X 4JGZA 4ZHNA 2VMEA 2RM22 4F3JA 4OHZA 3ZN6B 5C7GA 3WEZA 1GOFA 1OA4A 4LA2A 2VD7A 3VDAA 5C3QA 1ZBE1 1U5XA 5FPZA 2V72A 5FV3A 3AFKA 3VHOA 1OOPA 1S4CA 3ZSMA 4BLIA 2UWAA 3LFMA 2KD7A 1UY3A 2J1SA 4CDUB 1CWPA 4UW4A 4MADA 5FPAA 1MACA 4PLNA 4CRQA 1GZTA 2A3YA 3ACLA 4TSVA 4W4ZA 2PHTA 2XVGA 2JG9A 3AP5A 3E5UA 4QMAA 3SXWA 2WL1A 4WZFA 2PMWB 3VUOA 1NQJA 2A5ZA 3DECA 1VBB2 3I7DA 3WG1A 3DYMA 1UMZA 1CIWA 3C2UA 5FPBA 1W39A 1Y9MA 3IMMA 1H9WA 2W46A 3O5SA 2WUHA 1POV3 4IW3A 2VUJA 4N90A 5IVBA 1KXGA 1J59A 4MGKE 5J48A 2W1UA 2CGNA 1EUTA 1US2A 2Y0OA 5KHIA 5CA6A 5IAXA 2WNVA 1OUXA 1S0CA 1UPIA 1BEV1 3NL1A 4PCRA 5GLTA 4EN7B 1YI9A 2XHKA 4W50A 2RDNA 5AFEA 2RE9A 2GMEA 2V73A 1ZRCA 2OIIA 2Z5WA 5HCFA 3LB9A 5LRSA 3I2DA 3OYWB 5A7PA 2VVDA 3S30A 3LFIA 3VN4A 4LKDA 1RUH2 2QCSB 2WNUB 4KGQA 2ZMLA 3MPPG 1UW8A 3D6EA 3JB8A 1UOGA 3K46A 4XE9A 1E5SA 1BZWA 1RHI1 2ZGRA 5DAPA 4QHZA 4YW4A 2D6LX 4AR2A 1LJ7A 3LEIA 4R9AA 1ND3A 5BV6A 3KLSA 2G9FA 4QX2A 3T30A 1TMF2 3PU8A 1OBNA 2WFF1 4JKKA 1KEXA 4OUSA 1V00A 5FUNA 3ZKYA 3JD72 1ULFA 1QGLA 5F1RA 2X5IA 1LRHA 4GWNA 2C6SA 5EP9A 4DB5A 1WA4A 1XE8A 4MUVA 4U36A 1YC61 1S0DA 1TQ5A 1YCIA 1FMD1 4JKLA 5EWSA 1RUC1 4P9YA 2YZ4A 4FXKB 2FZ1A 3AJZA 1GSLA 1JZ4A 1I5ZA 1G86A 1R091 1BLZA 4LORA 2E7QA 2HWB3 4ATFA 2BEOA 2XJRA 2PHDA 1RMU1 1ZRDA 5FZCA 1QOSA 3FJSA 3CZJA 4ZONA 5L7OB 1GLHA 4PQQA 1QJEA 4IE6A 3GM8A 2WKKA 3UKNA 5FLIA 2K46A 1IKPA 4AGVA 1MQTA 4QX3A 1QJU3 1RYYA 5DUWA 3HD8B 4XFBA 1GP6A 1VBE3 4YW6A 3N9NA 3POEA 3T2OA 4DPNA 2KXLA 5E88A 3E6CC 3S5AA 3VBUB 4PBPA 3U37A 3AMHA 3P6BA 4AG4A 4QXCA 3SEPA 1BK0A 1REFA 3OY8A 4XFFA 2CWSA 4LBQB 3VHPA 3RZLA 5DUUA 1BVP1 4QQPA 3SEEA 3LIHA 3H3UA 5L9BA 3O14A 4B4RA 5IK7A 4PQ9A 1EAH3 1JW6A 2Y0IA 1ZVFA 2P37A 4GB31 1UZ0A 1KJLA 3ZN6A 1X7NA 1WMDA 4CCJA 2Y38A 4UW6A 2R061 1YFXA 1X33A 3ZIWA 3TOJA 5K0UA 4P9WA 1FPN1 4COWA 4YZ4A 2ZBJA 5FO8B 3OJBA 4I3GA 2RS11 2FDFA 2PQSA 3ZVXA 4E9KA 1GZ9A 2WA3A 2GN3A 2ZMNA 2XUEA 3TWIA 4AL9A 4YARA 1HB4A 2YDEA 4K7JA 1TME3 1ASJ3 5FXVA 2QZ2A 4GULA 1GWKA 4FI9A 4C1XA 4OMDA 2R041 5A1AA 5JSRA 4E4HA 3RRDA 5F5AA 3DXUA 1XJAA 4GKXA 2HWC3 4E2SA 3ZYBA 1LGBA 3NVCA 5F37A 1PNGA 1UY4A 4FQ4A 1CPMA 2B8MA 3CJXA 2P6HA 3LA7A 1EV13 1W9FA 5ACA1 3PNAA 1MR5A 2EVXA 5GLZA 3FHIB 5C3RA 1FX5A 3ILNA 1LGNA 2PAMA 2XKPA 4Y24A 2YGLA 3OYWA 1JXNA 1RXGA 4B4PA 3WNLA 2GP3A 1UO9A 2WWUA 1MS0A 5J98B 1AF9A 1VE0A 3TRSB 2R0HA 2WNUA 3K2OA 4LO4B 4CPBD 2BBVA 2ZA9A 4HVRA 4DZGA 2CDOA 2FQPA 3A7QA 2DCJA 2A6YA 3VD9A 1X8EA 2JDAA 3TN93 2GC2A 1AJKA 3N7KA 5IK8A 1AHSA 2L9LA 3ALQA 3MW4A 2DYCA 1CAUB 2IXLA 1LEMA 4ONUA 4DIQA 3VDCA 4K6BA 2YU1A 3SITA 2R073 4JGYB 5IATA 1MS8A 2PLV1 1C28A 4E8DA 5KC6A 4AF9A 1LOBA 3AKRA 4I3PA 1YQ2A 3HNBM 2VZOA 1YIFA 2HWB2 3SH5A 2UYBA 1MVEA 2DCZA 4Q0PA 1NY71 4RS5C 5FZKA 3KD4A 2UY8A 4EZHA 2W5FA 1LU2A 1S0FA 2BWAA 4K40A 1V70A 2Z79A 4Q8KA 3KS7A 2Q30A 5CISA 5L7OA 2OVUA 3J7LA 1QJU2 2ZGMA 1VBE2 1W6MA 1W8FA 3ZR5A 3RYRA 1S0JA 3ZX7A 1JN2P 1PMIA 4HOOA 4XILA 1ZRIA 1GFF2 2WZPP 3ZOIA 3MV11 3B93A 2VQAA 3CO2A 1W6NA 4Q4Y1 3VBUA 4XF3A 3H8UA 5A70A 1C8M3 4ES9A 2FDIA 3DPRC 3AZXA 3T4HB 1FNZA 2J22A 5FY1A 1CVNA 2VG9A 2WIIB 1UIKA 1KQRA 4MG2A 1J3RA 3KB5A 3MW3A 3N4MA 3K4DA 1EAH2 1QOTA 4AQSA 2G19A 4CVUA 1H8TC 4MHRA 5A6QA 4SBVA 1W8UA 4AVTA 3BIWE 2DVBA 1HRV3 1BHGA 1SBFA 3E5QA 3BOPA 3FLTA 3PUSA 4D7SA 1PK6B 4Q5OA 4IDZA 4C91A 5A6YA 5LBFA 2LTNA 1AZDA 2EXKA 4Q2FA 1OT5A 1MS5A 2GH8A 3VZKA 1I9RA 4XF4A 3SH3A 4RL7A 4UOJA 1QNWA 1JU3A 3OB8A 4B29A 5FREA 4N43B 3CKHA 2HKXA 4AI1A 1TME2 1ASJ2 3HQXA 4CXWA 4ZZ8A 3POSA 3KCYA 4JRAA 4XFAA 2EIGA 2YB7A 3BGAA 4HKWA 4OLLA 3WF1A 5HCHA 3ZM8A 5CG9A 1FAYA 2RHPA 3S7IA 2Y26A 1UAIA 2B46X 2B9VA 4NHKA 1O8PA 2HWC2 3MO4A 3U75A 1AR81 1UD1A 4ISQA 4WM7C 2VQUA 3PMSA 1WCUA 3I4IA 2LALA 1PZ9A 3FC0A 2D44A 5EYYA 1EV12 1QXJA 3SCFA 2VTFA 4H3WA 5DDJ3 2C9KA 3WUDA 2VMCA 3AP7A 1R083 4OQ9A 4Z2WA 1RINA 1PIV1 2CNAA 2V4VA 2ES3A 3KZ4C 1OLQA 2RV9A 4WZCA 2JDKA 5F3GA 3WQBA 3MLJA 4AAPA 4AW7A 2ZTNA 3AYCA 3EYPA 4FTSA 3SHRA 4XYXA 1RUF1 4PHZA 3BU0A 1I3HA 4Q29A 3JBG1 1IS4A 2YY1A 2GN7A 5FMOL 3TN92 4NMIA 2K0GA 3R4UA 3ZLIA 4LKFA 2CHHA 1I6XA 5A1LA 5A3TA 2VC9A 3N35A 1PZ8A 1XBFA 3OOXA 3QH6A 4Q0QA 4RSUA 1FNYA 4XIOA 4CEWB 4Y4YA 4YGCA 2R072 2ORZA 2A70A 2YBPA 4XFCA 3FL7A 2P3YA 2I07B 4JGYA 3POJA 2QQIA 1Y4WA 4AHXA 3CHXA 1GICA 4DEQA 4Q4X1 4DXRA 4QX8A 4FXGB 4Y20B 4FTEA 3C3VA 4XAEA 2D6PA 1DGWX 3I3EA 3ATGA 2A6XA 4HSJA 5JPNB 2O14A 2BUKA 1KRIA 4LLFA 1CAXB 1WD4A 4LO5B 4IERA 1DLCA 2WAAA 1OPOA 2HEWF 4GALA 1H6YA 4AFCA 4IE5A 2ZABA 2VW2A 1PGL1 5F5QA 2PHFA 1DFQA 4NUBA 5A7SA 1C8M2 1H2LA 4P9LA 2BGCA 3KWVA 2XBO1 4XXPA 1OKQA 3WP4A 5FP4A 2PHUA 3FE5A 4DNYA 1PVC1 3CF6E 2EA7A 1VIWB 2DDUA 3LEGA 5ANQA 4HFSA 2VY0A 3MPBA 4QB1A 1EPWA 4H14A 4XFGA 4AI3A 3BTZA 2TEPA 1HRV2 2RMU1 1IS3A 5DPNA 2C5DA 5DXDA 2H6BA 3T08A 5DG1A 1DU3D 1WCDJ 2YC2A 4ISRA 4CCCA 1PK6A 3CDZB 2W68A 2EICA 1U5IA 4XIKA 1Q8QA 2XMLA 2Q1ZB 2WQZC 4JV4A 5LA9A 3WDVA 4Q0SA 4X6RB 2E33A 4AZZA 1BK1A 2ERFA 3KMHA 4N43A 5EXOA 4WVMB 3ZXFA 1DHKB 4FOWA 4D3WA 3NNFA 3OBZA 2NPIA 5JOZA 4LUKA 3WDUA 1GU3A 4N53C 4RGGA 2AUYA 2B42B 2DCKA 3DGTA 2CTVA 2ARBA 1YQ8A 2Y8KA 3URFA 1AL23 4AEDB 5F3CA 5DDJ2 1COV1 4IEVA 1UQXA 1H4GA 5GM0A 1FYUA 1W9SA 1R082 3VBRB 3FN9A 4L2NA 2DUQA 2NMOA 5FP9A 1J3QA 1A6CA 4CUBA 3RYPA 4D6SA 4YPJA 1B09A 1W8OA 5A3UA 4HSLA 5I8SA 4J1WA 3USUA 3GZTB 2UY9A 2VVFA 4YFZA 2GH2A 3GGLA 4TZDA 1YRZA 3TAYA 5FMDA 4BB3A 2Q5TA 3HNYM 3R6SA 2EIEA 5A33B 2GMMA 5IWFA 5LA2A 4QHBA 1OVPA 1AYN1 1WLWA 2B7YA 3B00A 3UJOA 4CEWA 5CG8A 2H6CA 4A45A 1AR61 3HT1A 5I93A 1NLQA 4CCDA 1AR73 4XDQA 1KDKA 3V0BB 2GC3A 1W0OA 4D7YA 1VRBA 4M01A 3KVBA 1BXHA 5A32B 3I2HA 1RUNA 3AMQA 1SACA 4DMIA 1SLCA 4Q0VA 4C0BA 1OFNA 1XSRA 2VL4A 2VCCA 3DKWA 3H3ZA 2W1QA 4YZ3A 1OF4A 3ZIXA 4Y20A 4JTNA 4XF9A 2QTWB 3VD4A 4A42A 5EJZB 1LGCA 3WP6A 3UKVA 4AI8A 5FXXA 2E32A 3NWKA 2VZ1A 5FQ0A 1RUD3 3LF7A 2IXCA 1CAXA 1AR93 2RS53 2VZSA 3WF3A 2P4EA 3OPTA 4I09A 4QM9A 1DDLA 2QNKA 2VJXA 2JDMA 3GJAA 1ST8A 5HCBA 1SEFA 4P9XA 2EIDA 2O0OA 1LULA 2W91A 1EP0A 3NKGA 3Q8EA 3WY6A 4PJYA 2XLFA 3B94A 2BJSA 3VBFC 2AR6A 2IXIA 4AFBA 2UU8A 2AREA 2PFWA 3Q8AA 4IV1B 4D69A 5IT6A 1JOPA 4RHV1 3VL8A 1C5IA 5KHKA 4FTBA 3MLKA 2VMHA 2AC1A 3ACGA 3J26N 4CXYA 3MIFA 1ND2B 4FQZA 2P17A 3EMRA 3VB9A 2Z42A 4DS0A 3MYXA 5LCWL 1QNYA 5CIRA 3I3MA 4QQOA 4MGQA 5KBFA 3P1IA 3RWKX 4BHPA 2QQOA 2DVAA 4QT6A 2CSGA 3MZHA 2OS2A 1ULEA 4LBLA 1N47A 5T5JA 3BN6A 4Z07A 1PMJX 1IPSA 3KV4A 1VBA1 4BDVB 2ARAA 4UYBA 3D0SA 1IS5A 4NHXA 4E4SA 5K8SA 4WVMA 3PUIA 2D6MA 4XUNA 4Q0UA 2WNEA 4IETA 4XDOA 1H2MA 1C1LA 1W0NA 2XR4A 1VPHA 4LBKA 2F4LA 1AL22 2CV6A 2R30A 4IEYA 4RQPB 4QD2A 3VKMA 4HVOA 2XVLA 4JGZC 3THPA 4K9SA 2VVEA 4M3CF 4QU1A 4FPCA 1S2BA 1GNZA 3M3OA 5E8AA 4AEDA 4EN9B 4FVVA 3IAPA 2BQPA 1RITA 3LIGA 3J7HA 1W2UA 1OOPC 2J1AA 2I45A 4TN7A 4XF1A 2R6QA 4PI0A 1NUKA 3VBRA 1MEC3 1RJ7A 1SG3A 3RI8A 2D5HA 1M06G 2HWD3 4YGBA 1K5MB 2Q4SA 1HX6A 1W8HA 3IZOA 5F3IA 3V56A 3ZYRA 2JG9C 2HWE1 4RN5A 3ME2A 3B7MA 5C3OA 1SFNA 3A21A 1KD7A 3IDBB 4Q26A 2GNTA 3MF6A 3LOIA 4RD7A 1HQNA 3I8TA 1YWKA 1DQ1A 1O7FA 5HPOA 4GQ7A 5IVYA 1ZA7A 1GV9A 3K3NA 5IAVA 1JMUB 3ES1A 1AR72 3APBA 1GP5A 2WNVC 1VBD2 1YQ5A 2BNMA 4H2AA 5BXXA 3CBNA 3KSCA 4ATEA 1Q8VA 5FAXA 3LD8A 4KMQA 4Y1XA 3T4VA 3V0BA 2WS93 4YM1A 1W6QB 3V64A 5A32A 3NAPB 3AMPA 3NNMA 1PO21 1AX1A 1UL9A 4NPRA 5F3EA 1XSQA 4M4PA 4FPFA 3W21A 1ODNA 1W8TA 2F17A 1F15A 1RUE1 2A71A 2QKDA 5JPMB 3ST7A 1RUD2 3ZFFB 3UKTA 3SLIA 1QEXA 2UWBA 1UZYA 2RS52 2VBPA 3BPSA 4XBNA 2H0VA 3ROUA 4E2QA 4YYOA 2GC1A 4XTPA 1H2NA 1BYHA 3POWA 4YM0A 3HAGA 4J1XA 1YFWA 2XL9A 1U12A 4XJZA 2X5IC 4LQRA 4R9CA 5CFDB 1ONAA 1SMVA 4Y22A 4GJZA 2ZPXA 1DGRA 1OF3A 2XHNA 1WCSA 4MXWB 4YG3A 1D7PM 5KXBA 2VBDA 1YO8A 1OH4A 3IM0A 4FT8A 4FPYA 4OHWA 5AFBA 2VBBA 4IV1A 5JWPA 2JG8B 1WCQA 1O5LA 3I59B 3QACA 4Q1PA 4X8PA 3WQ7A 4PLOA 5A3WA 4CDQB 5FPUA 1CZSA 1ND2A 1MQTC 1SPPA 1UPSA 4IV3B 3ACHA 4EQVA 1RUH3 3VD5A 1DYPA 4UW3A 1F2NA 4UFMA 1YEWA 1MZEA 2RDSA 3IPVB 1UU4A 2JKBA 1H1MA 2W1WA 4LEJA 1W99A 3CJIC 3JUUA 5KHJA 4ET7A 4FPOB 4M00A 4C90A 3ON7A 5I8TA 3O1OA 3ZYHA 1B35B 3VZJA 3ACFA 4A44A 1RUOA 3H7JA 5TSWA 2XDVA 4QPGC 2A6ZA 4RQPA 4QKBA 1GNYA 4EZ4A 2ZGSA 2W3JA 1AL0G 1LODA 2WN2A 5SV5A 1W9TA 4XHXA 1SLAA 5C33A 1JS9A 5FJHA 1MEC2 2GP5A 1QY4A 5C5UA 5K0UC 2HWD2 5J96B 3VLBB 3C7OA 3LA2A 4CDUC 4ZS3A 2RS31 4GD4A 2TNFA 2ZOEB 4CCKA 2WAOA 1DYOA 4LHNA 5LBCA 4OI1A 3ZYPA 2VU9A 2J1EA 4XF0A 1CONA 4OI0A 1AX2A 3AB0A 2ZGLA 1CAVB 3GALA 4PIYA 1P8JA 4QKNA 5ABJB 2NP0A 3WR0A 1AYM3 2BFUL 3A0NA 2ZEWA 4MGIE 1HKDA 1RUG1 3TNQA 1CAWA 3JB4C 1C8NA 2ZGPA 5JIUA 1BBT1 4E4DX 4CU7A 4M3CB 3AYDA 2PHXA 3C8XA 1RXFA 2P5BA 4XW3A 4QWNA 3OEBA 2Q8DA 1Z78A 3OCPA 5C8CB 1W8NA 3J7MA 2RJKA 1LU1A 1XPWA 4NPMA 1SLLA 4QDRA 3A0KA 4XMIA 2WS92 4X8NA 1OQDA 5F8PA 3H8RA 5D2AA 1ZBE3 1VRH1 3PUHA 4A7ZA 3OGJA 1IGOA 2MEV2 4LE4A 2PQQA 5KXDA 3C7GA 1C5HA 5HXMA 3NAPA 4P08A 5K4LA 2Y6FA 3PVNA 5CBLA 1YXWA 3GHNA 2WNUC 3SMHA 5LA0A 3POBA 4NE9A 1V6IA 3N3HA 4M3CE 3ZFFA 4BIOA 4BQYA 1EY2A 1QKQA 5DUVA 1ZZ6A 1QMJA 1UYXA 1X50A 1NLRA 1K45A 4KU7A 4QU2A 5LB6A 5D8AB 2Q8OA 2WZ8A 1DLLA 1XE0A 5FYBA 4HPKA 4Y1VA 3MLLA 1JUIA 4NVPA 2B39A 4NN0A 3WF0A 1T2XA 1YFYA 1W6OB 5CB7A 5CFDA 4JX0A 4XJ8A 1YQ6A 5FYYA 1PO13 4I0BA 4MXWA 4FOQA 3I2JA 3SCGA 1VB2A 2JDNA 2OXBA 3MGUA 4XTMA 3IMNA 3POIA 3J4UH 2OUHA 1WMFA 4KWJA 4EYUA 4ZY9A 4BE3A 1H30A 2JJ6A 5JXJA 3PU3A 5L7OC 3LPFA 2AYHA 3HWJA 2BBAA 2OX0A 4JCKA 4CDQA 4BQ5A 4Y1YA 2IZWA 3RI9A 3WNMA 4PF5A 1H1AA 4EN0A 4IV3A 4YGEA 4AI9A 4DFSA 5FUIA 1TEIA 2BOJA 3FHAA 4Q8LA 1JYIA 5CYYA 1YQCA 2WFF3 4PDWA 3VBUC 1POV1 1DQ2A 3MBWA 4QKFA 3U07A 2WZEA 1XNCA 3IPVA 2HBUA 1BVVA 3W9AA 4BJ0A 4I30A 4P02B 1GZWB 5J7MA 4BQ2A 2IWGB 4FCAA 4LA3A 4IEUA 2DWRA 1LOEA 2HBTA 1B35A 3U0ZA 1FMD3 2ZX2A 1RUC3 1LKNA 4GWMA 1VMJA 3L9JT 1EYBA 4GMP3 1R093 2VCAA 3AX4A 2GMPA 2KM2A 3TEWA 4HK8A 4L8QA 1UOJA 3RMXA 4P9JA 1XC6A 1RMU3 3Q8CA 4IQPA 4JAAA 4W6WA 4KU8A 4UF0A 1XOYA 3BIEA 1SBDA 2I74A 1URXA 1DZTA 3KV6A 3M3QA 4XFHA 2C1FA 3PVEA 3Q8FA 2C26A 3AXDA 3KQRA 4SLIA 5F6LB 3T2TA 2JE9A 3I54A 1FI2A 4A3ZA 5BNNB 4LBJA 3AZVA 4AQTA 1HQLA 4YW2A 5FMOS 1AYM2 3RS6A 4Y3OA 2FDGA 3IDEA 4N7IA 5ABJA 1XNDA 5E89A 1LOCA 1PGW1 2XKOA 3FHQA 4CP9B 3CJIA 2PHRA 3ILFA 4W6XA 1A3KA 2RJ2A 2F4PA 2W94A 5LY2A 4F8AA 5C8CA 3NW4A 4GB33 1JODA 4QPGA 1ZBE2 2A3XA 2WLQA 1UCXA 2C4XA 3AVRA 3K75B 4MZUA 1K42A 1W3VA 5BNPB 3ZXAC 3VBOB 1X82A 4XJWA 3WDXA 2YBKA 4LKEA 3ZSLA 4JKMA 1DQ4A 2ZMKA 1QJU1 3EB7A 1PGSA 4UFJA 1F35A 1VBE1 1FV3A 3B01A 3J8F1 4P9GA 5DZEA 5K9YA 1KS5A 4CDUA 4AEJA 1UIJA 1RGSA 4GJYA 3HOBA 3W5NA 3HIFA 5JXGA 4QDQA 4MGSA 3O1PA 1L7RA 1NOVA 3AYEA 4IEWA 1WMEA 4CUGA 5J36A 3PMEA 5FP7A 1WZXA 3BYWA 1DQ0A 5HV0A 1QXRA 1CPNA 1FATA 2CDPA 2R043 1KGYA 1SLTA 3OUIA 2D97A 3PUAA 5D8AA 3T3YA 4YZ1A 3TEYA 3AK0A 1XYPA 4CDXB 4MX3A 1GANA 1EAH1 1UN1A 1XNTA 3R4SA 1PO12 2VTXA 1WMXA 4PT6A 3SKVA 4JGYC 5LEKA 4DUWA 1UXZA 4LIVA 2QQPA 2JEMA 2YYOA 1A78A 2DF7A 5A3OA 2WNOA 3CLPA 4MO3M 4LT5A 1X9PA 2P34A 4HT1T 1XYNA 5I0SA 5BY5A 5AC93 4FOVA 1BMV1 5FY5A 5CU1A 4ZKTB 4L9BA 4YW3A 5FLHA 5BNOB 3WV6A 5JR7B 2ZGOA 4NPLA 1DQ6A 2WFF2 3AYAA 5FZBA 1ZM1A 2O8QA 3BI3A 3GNEA 1MPXA 5G04L 3EO6A 2ZAHA 3AKPA 4E8CA 3RZJA 4QGLA 1LAJA 4BK4A 1JZ2A 3MEPA 5DMYA 2XUMA 1GZWA 5IVFA 1FMD2 3KT1A 1RUC2 2PLV3 1KFXL 4Y4RA 3I2GA 4F83A 2QE3A 3VD3A 2HWF3 1R092 4ARYA 1EV11 3WNOA 4LLOA 3I2OA 1RMU2 4NRQA 1QU0A 2A7AA 1JTZX 5T55A 3ZDSA 4FPGA 4KQ7A 3ZR6A 3ZPYA 1OD3A 1TNRA 3GDBA 3M2MA 2BRTA 4XZUG 3ZN4A 5CFCB 3ORJA 3EHKA 1PK6C 3L2YA 3N7LA 2ILMA 1DZRA 1V9U3 3KF3A 2AZ5A 1HJGA 3TN91 5BNNA 3H50A 1PX3A 1H0BA 3KV5A 5FFOC 3JZVA 4FPLA 5C3PA 4LOSA 4N43C 4Q4Y3 4L92A 3FZ3A 4YM3A 5A6ZA 2ZHKA 2ETEA 2VM9A 2R071 4QM8A 3OBAA 4QPWA 1PVXA 5EV7A 3VD7A 1UXXX 5DAQA 4HN1A 4CP9A 5T3NA 2W95A 4LBQA 4TXWA 4AVSA 4GB32 3NSTA 2ADDA 1ZRRA 3VGIA 1UX7A 4H7LA 2R062 1ALYA 1GP4A 1RUI3 2FHRA 4BXFA 5FP8A 3I3QA 4CUAA 2BPA2 5BNPA 4FSJA 2EIBA 1FOD1 4MHUA 3VBOA 1WLCA 4D94A 2RS12 4UFLA 3VBHB 1LHWA 1QJX1 1D4M1 5A3LA 2BVBA 1JYXA 3Q9OA 3D4KA 3M70A 1C3HA 2VE1A 1C8M1 4HONA 1WLDA 5JXIA 4M4RA 2R042 5T5PA 2X8KA 2D3PA 5L9RA 4CEWC 1O6UA 3D5OA 2VMGA 1AR83 1L7LA 1AJOA 2DVGA 1DP0A 4FOYA 3WT3A 4K20A 4X6QB 5DQ0A 2VW1A 4MOAA 4DQAA 1ULCA 2VCMA 4KL1A 4CDXA 3D8CA 3DXTA 3WHUA 3MUY1 4ASLA 5ACA2 3S0MA 3UL2A 3VKNA 4UFKA 5C8WA 3EBRA 4FBFA 1HRV1 1RJ8A 2XOMA 4RGAA 3VKOA 3VKFC 2DVFA 5FMCA 2DCTA 4CTEA 4BLJA 3ZXDA 4DY3A 2QQLA 4N8MA 1E5RA 5E1RA 5AC92 4LO7A 2QUOA 3I3BA 4LR4A 4MYEA 1RUF3 2H0BA 1W04A 4FFFA 1GUIA 1HB2A 1NA1B 2VOVA 4MLOA 5DAVA 5BNOA 1Z7S3 5C9AB 4WBBA 4AQ2A 2J7MA 2E7AA 2F6BA 3AL6A 2OYZA 5C3SA 1BJQA 1LOFA 1GR3A 2WABA 1G9FA 2FDJA 1PNFA 3ETQA 1Q56A 4IE0A 4MH0E 5SV8A 2E6VA 5IW0A 4C8DA 3WF4A 2PLV2 4BQWA 3B5LB 3C7EA 2J1RA 1CAUA 2HWF2 2ARXA 4NROA 1HJFA 4AK3A 2WFPA 5FYTA 2UYAA 1NY72 2OPWA 2WO3A 2A1XA 2VNGA 3H9AA 5CAZA 1ZRFA 1LCLA 3ZO0B 5H9RA 1HRI3 2J42A 3LAGA 2WO1A 2YG0A 2ZX3A 1F5JA 4JQRA 4XJ9A 4BPZA 1V9U2 3B9IA 3EJKA 5DG2A 5CFCA 4FP2A 1S0BA 5H9QA 1CIYA 1UX6A 3NV4A 3T2PA 1D0GA 5IFTA 4LO8A 4KWLA 2VPVA 2ZX1A 3AMMA 4Q4Y2 5IUQA 1T6GC 3W58A 4A2UA 3WD5A 1TVGA 3HBZA 2D93A 3AVSA 4D6QA 4Q4V1 3H0OA 3GCXA 4ZS2A 4OVEA 2WYFA 3U11A 3AMNA 3P3NA 4HLTA 5JDBA 1QIQA 2K9ZA 2YC4A 3OD4A 1QXPA 4AEDC 1HB1A 2ZEXA 3AP6A 3CL1A 4LBMA 1SQ4A 4OUMA 4XBLA 4XOGA 1A34A 2VUAA 2DBIA 5FUPA 2ID4A 2RMU3 1RUI2 5C5TA 1U0AA 4CCEA 5A80A 4P00B 3UNPA 3VBRC 3UT0A 2IXJA 4JC1A 2P2KA 4AHYA 1KS4A 2JD9A 1POV0 5FYSA 3VDDB 4J25A 1OKOA 3O12A 4B7EA 1UF2C 4I0AA 3ILRA 2WZR3 4KH9A 4M0NA 3BB6A 4LULA 3U4SA 2D98A 1US3A 3LKJA 3ZYFA 1QJZA 4AVCA 1H4HA 3WP3A 1RIRA 1JYWA 1HW5A 4PIZA 3K48A 4GA9A 5DABA 5FTTC 2OKXA 4TLGA 3ZSKA 2O1QA 4YRDA 5JZGB 1AR82 4HKOA 3I2IA 4LK6A 2BV4A 3LEKA 4Q4W1 4XC9A 5JMOA 4PF1A 3E1F1 1OQEA 1YHFA 3H8XA 4LBOA 1IQDC 4BQ3A 1SDWA 2IC1A 2RR13 2WINB 4B1MA 1AVBA 1JU4A 4AOCA 3S5QA 4BQ4A 4UT5A 5FDBA 1PIV2 4ZZ5A 1RVF3 2RDQA 5FY0A 2JDZA 3WNXA 1HXS1 2OZJA 3BPZA 1WW5A 3ZFGB 4XDPA 4YM2A 4J6GA 1WBLA 1JYCA 2PELA 3FBYA 4H55A 4XCBA 2PN5A 1ZZCA 1RUF2 5BUVA 1O3TA 2IFWA 1ZZ8A 4AWDA 1K12A 1HN0A 4AI0A 2ZZQA 4IESA 1Z7S2 1OMIA 2VQTA 2YV8A 4O7XA 5FLJA 3ASIA 1F4AA 4GWJA 4ZXEA 1Q5OA 3P3PA 1NA1A 5FPVA 5C9AA 2J1TA 1C1FA 2NMNA 3V65A 4EWAA 3MIGA 4Z82A 3OF1A 4WVWA 4TYSA 5APAA 4K1YA 3AFGA 1UY0A 2XJPA 4KWKA 4XCAA 4LMFA 4COVA 1VBC3 5C4WB 4LPLA 1IS6A 1HB3A 3OGGA 5FP3A 1U5YA 1UY2A 2BWCA 3QLQA 3LCPA 3H1WA 2GZWA 1ZX5A 1VBD3 4IV1C 1KJRA 3PL0A 4Z1VA 4PI2A 2JD4A 2P3IA 2YPDA 1HRI2 3CNAA 4AQ6A 5A1FA 3ZN5A 2JX9A 5GALA 1ND2C 4U2AA 4IXLA 2AACA 3ZXJA 3KQ4B 3THTA 3D0JA 1K3IA 5HXVA 1ZBA1 3ZSEA 3OPWA 4KNCA 3I2FA 1M4WA 2VZQA 1PGL2 2XWBB 2MNGA 1NZIA 2TBVA 4P5HA 4EROA 4CCLA 4N53B 4OHVA 2ZAAA 1C57A 2BFUS 1LTEA 3WINE 1SCRA 1RUJ1 1QQP1 1KITA 1A8MA 1W3XA 4I02A 5FK8A 1UYZA 3HT2A 3LDRA 4O65A 3UGGA 3MW2A 4CEYB 2SLIA 3RJRA 1XQNA 4XQWA 4Y5Z0 2EF6A 5DN2A 1U5ZA 2VGDA 5JI9A 4B1LA 3GZUC 3RGBA 2IVIB 3MV01 4RQPC 3NV2A 2IUWA 4BOWA 1E57A 3JCIA 3KVAA 2WLPA 4ZU7A 4QHOA 1S1AA 2LUWA 3EXUA 5FYHA 4R4XA 4UAPA 2RMU2 1J3PA 5JIAA 4MVTA 4XXAA 3VV1A 3VBSB 4DRVA 2CU5A 1NLSA 1A8DA 4BA6A 3IBMA 4DXTA 3H42B 4AYUA 3VKLA 4TLFA 2VOXA 1RUD1 4GWIA 5KC5A 4LTAA 1W90A 2GC0A 2ZGUA 4IE7A 1AR91 1K5MC 2RS51 2WZR2 5GLVA 3VDDA 1N3QA 4A6SA 2VZUA 2VTXJ 4FPHA 4GXLA 2WN3A 4QB6A 1PM4A 4QPIB 4XVHA 1VBA3 3H3LA 5FZMA 4COZA 4UXAA 4AAXA 1JOJA 1WUVA 4YZ5A 4QX7A 4FAHA 1OC1A 5JLVA 3O0XA 1JI6A 2EXHA 5JZGA 1CX4A 2YMZA 3PJQA 2QQNA 5EPAA 5GJ6A 3MIBA 4GH4B 4CXXA 4S2GA 2Q0AA 2RR12 3A4UA 2HYXA 3L2HA 1ACCA 3K4AA 2VZPA 2R1DA 2XONA 2Q8CA 3DCQA 3AZZA 1RVF2 2VZTA 3K77A 5EJ1B 3NAPC 2BU9A 5A7WB 4DUVA 2Z4FA 1D4VB 1DYKA 3NNJA 1OH3A 1PX4A 2Y60A 3KGZA 1HLCA 4QAWA 3M8LA 4YWAA 3ZFFC 3PLQA 1X8MA 1WCKA 4V2WA 4XUOA 1JH5A 5DUXA 3U78A 4IL7A 4V1PA 1W28A 3AKQA 4LITA 1OLME 4HN0A 3QH7A 5FYCA 2AEZA 2Y64A 3TBDA 1JZ6A 4HKLA 5EJ3A 1YI7A 1AR62 1TE1B 3RZMA 1O3RA 1VBC2 5AVAA 5F6KA 5CFDC 5ERLA 4NIDA 4N7UA 5A33A 4IGQA 4I0WB 4LE3A 4GZ9A 2OA2A 4LXLA 2PHLA 2WO2A 5EYXA 4ZU4A 5FZ0A 5C4WA 2QJVA 4B3NA 3USSA 4CDWB 4LHSA 4BQ1A 1LOGA 5CKNA 1NXMA 1NCRB 1VAKA 4QX0A 1G9DA 4QQ2A 4NHMA 1L3JA 4Q27A 4OMCA 2JB8A 3H7YA 4G9SB 4BISA 3KCXA 2HWD1 5FOBB 1S0IA 4JZRA 4NIAA 4IEPA 1V6NA 2JG8C 4YVSB 4CDQC 1QOOA 1RUE3 1OI6A 2MEV3 2ORXA 2X53S 1POQA 2JDUA 3GBGA 3LSEA 3PIJA 4XZPA 5CVRA 3VZLA 4MXVA 2JIGA 2QDRA 4PBOA 4YVWB 1VLNA 2JECA 4IV3C 3PHMA 1F5FA 4FP3A 4KBZA 4IEZA 4AE2A 1UYPA 4PDWC 4A3XA 4XMAA 5FRAA 4Z92B 3C7FA 5IVVA 4A7YA 1E5HA 4JHTA 5L73A 1UWWA 1ZZBA 2WBKA 3NJYA 4CP2A 1D2QA 1QJY1 2VNVA 5D21A 2QQKA 2VCBA 4QX1A 2OT7A 3K4ZA 3ZMNA 1B35C 4BWOA 1GYKA 4CEYA 4DXZA 1R1A1 4L0PA 4AEMA 1RC6A 2P3JA 2WS91 4WM8B 2VULA 4JQTA 3IDAA 1CN1A 4CU9A 2RM21 3B69A 2Q8EA 5JSPA 5FZOB 2QFEA 1ZNPA 1QF3A 2V5DA 2ZXQA 5FPXA 4YW1A 1LENA 3ITQA 2XLGA 1W03A 5IHRA 1V6LA 2PHWA 3LGRA 3VBSA 5JCTA 1NCQB 1NT0A 2CWMA 1H6XA 1PMHX 2D40A 1YFUA 1N1SA 4E27A 3AC0A 3LE0A 4KI5M 5FYZA 4CCNA 3PVOA 1VBA2 4KBBA 1NE6A 2ZEYA 2JENA 2R49A 1VBB1 2WT2A 5ABJC 4QPIA 2WQ8A 2NM1A 1IG3A 5IVJA 2XJVA 2CGPA 2FZ2A 1W2NA 3PJYA 4UI9L 5BNQA 3SNMA 5FY9A 2BDRA 1S2KA 2WWJA 3LQCA 3TNPB 2ZHLA 5LBEA 1SFYA 5C8CC 1SCSA 3PDQA 4Y26A 5A6XA 2QDNA 1OLMA 3J9SA 2VZ3A 1O59A 4GH4A 1ODMA 4ORFA 1AX0A 4DUXA 2QVSB 1VR3A 5LRRA 3T2QA 2ZGQA 4ASMB 1MS9A 4XUPA 3OEAA 4Y5SA 1F31A 3M1HA 2BGPA 2ZX4A 3WX5A 4L11A 1UZWA 3BUCA 2QQWA 2WT0A 3WW1A 3FFZA 1RUH1 5A7WA 4MSVA 1ND3B 2D6NA 2BNNA 4RR3B 1V0AA 3QBQA 2JICA 3CMGA 5FYMA 4INDA 2YROA 3QCWA 3U4XA 5F5CA 1K5MA 2W39A 1IKQA 5LK5A 2EXIA 1Y7BA 3CZUA 4AEKA 3O1SA 3RWNA 1RUG3 3HQUA 1TMF1 1UZVA 2X05A 3ZFEB 1G9AA 1G9CA 1ENXA 1JYTA 3PUQA 1BBT3 2VECA 3JD71 1PHMA 3OG2A 5H9PA 5D8AC 1JZ5A 3RDIA 5I0DA 2P1BA 3OBRA 3UJQA 3E6DA 2JDPA 5ISLA 1QWRA 4CSWA 1W8ZA 4QXHA 1H9PA 5EIYB 2X29A 1Z0HA 5FZGA 2DFCA 4OFGA 4KWUA 1FV2A 3WDWA 1PZ7A 4NHYA 4ARXA 1YLLA 2BOIA 4YFWA 1VRH3 3OGSA 1O8SA 4CDWA 3C7HA 3EQEA 1NCRA 4UWDA 4EJRA 2RJLA 4JDNA 4QGMA 5EHDA 1RUE2 3VL9A 1W6QA 4NAOA 4YVSA 4BU2A 1MS4A 2MHFA 2WWSA 3HJRA 1DGRN 3B02A 4IEXA 1I1EA 5KXEA 1AYM1 4YVWA 1OURA 4FO9A 4AVAA 3HN1A 3E6BA 1O4YA 1SHWB 1CESA 3O0WA 1UKGA 2YU2A 4OQ8A 1JHNA 1NKGA 3DF0A 3BTXA 4HANA 1NE4A 2C0ZA 2CY6A 1VMFA 3JQWA 5D1IA 4XFIA 4QB2A 4BM8A 1NG0A 3FLRA 4OZXA 4CA9A 1VMHA 2OQ6A 1YUDA 5H9SA 2D6KA 3S57A 3PTYA 1BEV3 3SISA 3IWZA 4WM8A 5K0UB 4S2DA 2RG4A 4JDMA 2FCTA 2LROA 1AXKA 2E26A 4NWWA 5FZOA 5FCCA 4H7MA 3H1MA 3R4DB 1XB9A 3HPNA 4IEQA 5BPXA 1EUUA 4DEVA 1G8WA 2ZHNA 1NCQA 4LIUA 5KHHA 3RYKA 3F95A 4EWDA 2A3WA 2WQ4A 3ZXKA 2JG8A 3I59A 2ENRA 4NOTA 5BNNC 2J1UA 3OTFA 1RHI3 5LZ6A 1K5JA 4K1ZA 3SH4A 1J84A 1TNFA 2BZDA 3RZHA 5CADA 2W1SA 2V4AA 3IB3A 5JOXA 2D5FA 4BCUA 5GZGA 2LW8A 4UBHA 5JMCA 5LK7B 4EN8B 3WZ1A 1OPMA 3T1MA 4COUA 4O9EA 4JRLA 1LR5A 5L36A 1DGLA 1PO11 1QJFA 2VMDA 2MPFA 2E7TA 3O0VA 4N9IA 1LHOA 4P5YA 4CUCA 1ZYBA 5FYIA 2O8OA 1OSGA 3IT8A 4QQLA 2W2IA 3MICA 1GOHA 4EN6B 2VUCA 4F7ZA 1DZQA 3AZYA 4GAZA 4Y5TA 3KHBA 3GZAA 1SDDB 2DURA 4UBGA 2Y33A 3N9QA 2FDKA 4FFIA 5BNPC 4YNIA 3RFRA 2RS32 3VBOC 1O5UA 5IJRA 1G9BA 5J37A 2BYVE 5FZAA 1JZ3A 3OUJA 3ZXEA 4LJHA 2A6VA 4AVVA 2QQJA 2ZKLA 1ULOA 4RR3A 4NRMA 1OA3A 2BVVA 1UOFA 4DY5A 4AFAA 1RUG2 1S2EA 4YG0A 3INAA 2GDFA 4RA0A 3MUZ1 3POFA 1BBT2 3I2KA 1CAVA 5T5OA 2BNOA 3ZFEA 1G6NA 3B9CA 2HYKA 1Y9QA 2Q1FA 1O4TA 2E9QA 3BOWA 2R16A 4GMP1 2ZEZA 4CDXC 1AXZA 3WF2A 2CYFA 2WC2A 3TB0A 4M3CA 4K3UA 2R1BA 1YJLA 1VRH2 1Y3TA 4L99A 2HWB1 1OXCA 3RQ0A 4AHZA 3AKTA 2JDHA 5E6HA 5JOYA 1WA6X 1W6MB 3S7EA 1LESA 4URTA 1VP6A 2R063 3M4FA 4FFGA 5GKAC 3J8F3 1W6PB 1IZ3A 1W6NB 2GNDA 2LRPA 3HN3A 3OD0A 1Q3EA 1FPN3 2WSVA 3OUHA 5FY4A 4EV0A 5BNOC 2RS13 5FIXA 1Q8SA 4HVQA 2YGMA 5FZIA 4YG6A 1YJKA 3UV9A 3FFQA 1LOFC 1WD3A 2Q1MA 3IKWA 4OULA 1UKRA 2G9GA 5DZGA 1W0PA 1W2TA 3ENRA 3NMBA 2QZ3A 5JVVA 4A6OA 2YXSA 1CJDA 3RMYA 2PXJA 3NJZA 1LOAA 1H8VA 1GNHA 5CZKA 1W06A 1BEV2 2FCVA 3SC7X 1UMHA 1W6OA 1VALA 2Y6HA 3PIGA 4LBQD 5ACA3 3F2ZA 2PAKA 2ZJCA 3A22A 5CEHA 5FO9B 5HI0A 5LY1A 3KT7A 4AGGA 2EAKA 3WNKA 2ZKNA 3MFCA 3WLUA 4V2VA 5CFCC 1LHUA 4XPVA 1S0GA 3HNMA 1RHI2 2E63A 4HBNA 4YLZA 5LASA 5BYNA 5DZFA 5F2WA 5FZ1A 1LHVA 1YYNA 5A7NA 3RZKA 3THDA 3H8OA 1TME1 1ASJ1 2XQXA 4Q1RA 3MIEA 3KV9A 3X29B 4BMBA 4PIXA 4TTGA 3O1UA 1AXYA 1O3QA 4YSFA 2WO7A 2A6WA 3GBWA 3MHZA 1MZ5A 1XXNA 4XURA 5F9TA 3LDBA 5FJKA 5KR7A 4FPEA 2GU9A 2HWC1 1NXD1 1HN1A 3LEMA 3NRUA 2ATFA 2Y6GA 2Z2SB 3CQOA 1ZA4A 1STMA 1DIWA 3GXUA 2OQ7A 3HMYA 3JQXA 5FZHA 4WVVA 1X36A 4EWEA 5B4NA 4W65A 4CU6A 4A41A 5FZLA 1YNAA 2VNOA 3NQHA 1NX9A 1VAVA 2YHJA 2VZVA 5AC91 3AZWA 1ZZ7A 1GBGA 4AI2A 5A3MA 2DCYA 5I0TA 5L19A 1OUSA 5GLWA 4C1WA 5JR2A 5FKCA 1PM7A 2FMDA 3BCWA 3V0AB 5F5IA 3VBHC 2CAVA 3WW4A 1N1YA 5T5LA 5FZ7A 5HBAA 5IYYA 3ZYGA 1F4HA 1IOAA 5E16A 3ELNA 4I01A 4JDOA 1PGW2 3WUCA 1Q8OA 1H2KA 4N9HA 1OQ1A 1DCSA 4NWVA 2HWF1 3ZYIB 4BMEA 1ENSA 2BW8A 2Y6JA 2AH2A 1GMMA 1UZZA 2YC0A 3NV1A 4HL0A 5J3UA 5JOWA 3N9PA 1ULDA 5L9VA 4RYDA 1WW7A 1GQPA 2FCUA 3O7OA 4NHLA 2DU1A 3HVDA 3LDKA 5F39A 2QQMA 3WXPA 4GIQA 5A7OA 1OLRA 2CGOA 3BU7A 1VB4A 1IHMA 2BTVC 2OUJA 2CAUA 2QQUA 2YPJA 1FOD3 3FLPA 2GNBA 3J8F2 5IVCA 5JUVA 1V9U1 2XJSA 2YFUA 1LHNA 4XUTA 2WJSA 1QJX3 1D4M3 1FPN2 3NKTA 3T0DA 2RVAA 2BP6A 2ARCA 1W6PA 4O9GA 4R9DA 5J1XA 2G1MA 1QHDA 3CIHA 1GZCA 2OZ6A 3AJYA 1AUYA 2R7EB 3D82A 1NA1C 3FBMA 3NJVA 2W87A 5C9AC 1YIPA 2FD8A 2E53A 4QDSA 2DVDA 2HH9A 2FBEA 3R0RA 1OD5A 1H1IA 1HV0A 1REDA 2VZRA 4NO4A 3M7AA 5DAWA 2JXAA 4D7TA 3N9OA 2ZGTA 4MV2A 3O1VA 3LOBA 4IUGA 3RZZA 3T09A 2DUOA 2R32A 4RS5B 1T6BX 3NO8A 5CKMA 3I97A 2VMIA 2UURA 1RUI1 2VOWA 3E5XA 4CPBA 4ZPIA 3DYPA 1MZFA 5A3PA 4MGZE 1BMV2 4B4QA 4XJAA 1PIV3 1XNAA 4D0QA 4QPYA 2CL2A 2ZACA 3B3QE 2LS6A 4O61A 5FBJA 2ZHMA 5FWEA 1VJ2A 2Z69A 3JBG3 4E2GA 1E5IA 3DPRB 3GJBA 1N3PA 4OI4A 5LEJA 1LEDA 4NJ4A 1J1TA 1GWLA 5FYUA 2D3SA 3T1LA 5LBBA 4W8JA 5B4XA 3DKQA 4PLMA 1J58A 1UNBA 1WBFA 1XU1A 1Y43B 1BQPA 1DG6A 1H8TB 3D3AA 4CP1A 4IGOA 1UU6A 2BERA 3CU7A 3U14A 2KR2A 5T54A 2XQRA 4FAGA 5LA1A 1OHFA 5DDJ1 3LZZA 4GKYA 4Q4X3 5EQUA 2PAEA 1R081 3PTRB 3USUB 1UMIA 3OBTA 3HQRA 3WQ0A 4Z8BA 2P6CA 3RG0A 2G9ZA 4OHYA 3DEMA 3ZYJB 3VDDC 2WA4A 1IQAA 3WP5A 1ULGA
chains in the Genus database with same CATH topology
1Z7S1 2ZGKA 3V0AA 2NLRA 1GQHA 4ES8A 4Q4V3 4LUMA 3SCHA 2P3KA 2A75A 3VZOA 2DUPA 4BZ4A 1GKBA 4WM7B 4G4FA 1XU2A 5JZGC 2XBO3 3G7DA 4HK9A 3VHNA 4META 1PVC3 3KT4A 4YZ2A 1XYOA 4KG0A 1FT9A 3RSJA 1WGPA 4HETA 3WHTA 4DRRA 1HRI1 4RFT0 4K8FA 1LECA 1O4ZA 2VW0A 3GF6A 2LM3A 2JE7A 1LB2A 3TYJA 3ECQA 2WT1A 1FOD2 5FQ0B 1CGPA 3ES4A 5AVPA 5GZFA 1V6OA 1S55A 1QJX2 1D4M2 3MIHA 3ZFGC 2W0XA 2HEVF 3DV8A 4R4ZA 1F8VA 2SBAA 4Y1UA 2NQYA 4C0HA 3VBHA 1J1LA 4XBQA 5I0UA 4WV8A 3PVBB 2K2SA 5EZWA 1MZ6A 3BODA 2DFBA 1KFUL 4JVAA 4Q4W3 2ET7A 5FBZA 4XQ4A 3WG3A 4COYA 3G6JB 5KHGA 5C4WC 3DL3A 4RS5A 1ENRA 1COV3 4AXOA 1WLTA 2EALA 1HXS3 2HEYF 2ET1A 2W52A 1XNBA 2EAAA 3BTAA 2WZR1 4XEZA 3WQ1A 1G7YA 2B45X 2WSUA 3LWCA 3MDPA 2XGXA 3JBG2 1XRUA 3QOPA 5C6CA 3N36A 4GMP0 5GZDA 3VZMA 3GBFA 3DPRA 1NQDA 2ZS6B 3U10A 4A7KA 1OFSA 1AYN3 5HCAA 4CEYC 1AL21 1AR63 1WW6A 2RR11 3AKSA 1V6JA 2C9AA 3ZSJA 1H8TA 3WG4A 4YGDA 1RVF1 4Q4X2 4CZSA 3R05A 3VBSC 1C4RA 1UU5A 5JI7A 4CP0A 3DN7A 4L97A 4JTOA 5J09A 4HZFA 1ZBA3 3UK9A 1DF0A 1MVQA 4LBNA 4XQDA 4Q4V2 2IFRA 5I8YA 4QPIC 1F9KA 1QQP3 1RUJ3 1HDKA 3KGLA 2GAUA 1DGWA 1EPZA 2XBO2 1HV1A 1VBC1 4Y1ZA 4WM7A 1PVC2 1QH6A 1AR71 2B5HA 2PTMA 2XG3A 4R9BA 4S2FA 4YW5A 3CEWA 1VBD1 2ZZJA 4GH4C 3WVJA 4AFMA 3WDYA 1IPKA 3MIDA 1CJPA 1SBEA 3DUIA 3IN9A 4RHV3 1KDMA 2HJIA 2VXRA 2NZ9A 2FMYA 3FWEA 3WW3A 3ZXLA 2DTYA 1NZCA 4LNVA 3MFAA 4DINB 4TWTA 3POYA 4QQHA 2GSYA 4Y22B 2GALA 1FXZA 5GZCA 1ZZ9A 5KWRA 1RTVA 4Q4W2 2UWCA 4XETA 4XHBA 4CYDA 4E4ZA 4W6YA 1MS3A 2B9UA 3RPQA 4K21A 2XJTA 2ZGNA 1XNKA 2AENA 1O91A 2E51A 3AP4A 1COV2 4CDWC 1NCRC 1HXS2 5KXCA 3FX3A 3AXEA 4YVSC 3IIAA 4AHWA 4I2OA 1RL3A 4YVWC 3ZFGA 3GYDA 3QD6A 2HWE3 2VH9A 1DQ5A 1N1TA 4BYYA 4BIFA 2VOKA 2V09A 2D6OX 4LO6B 1AYN2 3VBFB 4B7KA 4ZXKA 5T52A 2XJQA 3IDCB 4WM8C 1D0HA 4ZU5A 1Q8PA 1REEA 2OW4A 1MEC1 4M0HA 3WW2A 5JAXA 1PO23 1BKZA 1NCQC 1ZBA2 2D43A 1ZREA 3FUOA 2PYTA 5EFUA 2XWJB 1CAWB 3GHMA 4LHLA 4UW5A 3N7MA 1BCXA 4AVBA 1RUJ2 1QQP2 2EXJA 3MF9A 1D2SA 2DTWA 1QJY3 1CD3G 4N53A 4OHXA 4JGZB 1RB8G 1V6KA 3WOGA 1CR7A 1V6MA 1R1A3 2W08A 5CNAA 4KGGA 5I91A 2RM23 2TUNA 4AFDA 3AP9A 1OOPB 4BH9A 4DOUA 4RHV2 3RNSA 2IXKA 2MEV1 2YUEA 5GZEA 2XB6C 5FO7B 2JG9B 1AR92 3OPZA 3LA3A 4G3YC 3WCRA 3K51A 1JBCA 1ND3C 4RR3C 1CQ9A 2N7GA 4HPKB 2AGSA 1GQGA 1VBB3 4OI2A 1DBNA 4WVZA 2VNRA 2ZX0A 5IK5A 3ZFEC 2NN8A 1VAMA 3JU9A 1N1VA 4P14A 3BALA 1N3OA 2OPKA 2WNVB 4R52A 2XLAA 3M3CA 2R0FA 4P9IA 2NYYA 2ZCWA 2XJUA 1XE7A 2KA3A 2XVKA 3N7JA 1QDCA 1WW4A 1QDOA 3NV3A 2GNMA 4B8EA 5JSOA 2XL7A 2I2SA 3E97A 4PDWB 4R8HA 2D3RA 2RS33 4KG8A 2HWE2 3LSDA 4FPJA 2G4IA 1HQWA 3MI8A 5GLUA 2X5IB 4QGNA 1TMF3 3VHRA 4AGRA 2PA7A 3JD73 2D7FA 1SLBA 1OA2A 4QXKA 4IEOA 3VZNA 3VBFA 4ITCA 4MGYE 3KCCA 5IK4A 2XPJA 1ENQA 3M3IA 1APNA 4S2HA 1IPJA 1R1ZA 4HMZA 3FMGA 1MQTB 1PO22 3S6PA 1S0EA 1MS1A 1SLIA 2XH6A 3WDTA 2IXHA 4FPKA 1HIXA 1QH7A 3WCSA 2A73B 3HR9A 3ZMOA 1O3SA 4NR1A 5FOJB 3OY8B 3W59A 3CJIB 2V5YA 3ZXGA 4XJUA 5B2GB 1QJY2 1NYWA 1JUHA 2DU0A 3KM5A 5T50A 3AM2A 3WG2A 3H1YA 4QX5A 5K7PA 1Q43A 3FUQA 3M3EA 2VQ0A 4QPGB 1R1A2 2DV9A 5I0RA 4LHKA 3RJ2X 4JGZA 2RM22 4F3JA 4OHZA 3ZN6B 1OA4A 4LA2A 1ZBE1 1U5XA 5FPZA 3VHOA 3AFKA 4BLIA 1OOPA 3ZSMA 2UWAA 4CDUB 4UW4A 4CRQA 1MACA 4PLNA 2A3YA 3ACLA 4TSVA 3SXWA 2PHTA 2XVGA 2JG9A 3AP5A 3E5UA 4QMAA 2WL1A 4WZFA 3VUOA 1NQJA 2A5ZA 1VBB2 3I7DA 3WG1A 1UMZA 1CIWA 3C2UA 1W39A 1H9WA 3O5SA 1POV3 4N90A 2VUJA 1KXGA 1J59A 4MGKE 5J48A 2CGNA 2Y0OA 5KHIA 5CA6A 2WNVA 1S0CA 3NL1A 1UPIA 1BEV1 4PCRA 5GLTA 4EN7B 1YI9A 2XHKA 5AFEA 2RE9A 2GMEA 2V73A 1ZRCA 2OIIA 2Z5WA 5HCFA 3LB9A 5LRSA 3I2DA 3OYWB 2VVDA 3S30A 3VN4A 1RUH2 2QCSB 2WNUB 4KGQA 2ZMLA 3MPPG 1UW8A 3D6EA 3JB8A 4XE9A 4YW4A 1BZWA 1RHI1 2ZGRA 2D6LX 1LJ7A 4R9AA 1ND3A 5BV6A 3KLSA 2G9FA 1TMF2 2WFF1 4OUSA 1V00A 3JD72 1ULFA 1QGLA 5F1RA 2X5IA 1LRHA 4GWNA 4DB5A 1WA4A 1XE8A 4MUVA 4U36A 1S0DA 1TQ5A 1YCIA 1FMD1 5EWSA 1RUC1 4P9YA 2YZ4A 4FXKB 2FZ1A 3AJZA 1GSLA 1I5ZA 1G86A 1R091 2E7QA 2HWB3 4ATFA 2BEOA 2XJRA 2PHDA 1RMU1 1ZRDA 1QOSA 3FJSA 5L7OB 1GLHA 2WKKA 3UKNA 5FLIA 1IKPA 4AGVA 1MQTA 1QJU3 5DUWA 3HD8B 4XFBA 1VBE3 4DPNA 3E6CC 2KXLA 5E88A 3VBUB 4PBPA 3AMHA 4AG4A 1REFA 3OY8A 4XFFA 2CWSA 4LBQB 3VHPA 5DUUA 1BVP1 4QQPA 3H3UA 3O14A 4B4RA 5IK7A 4PQ9A 1EAH3 1JW6A 2Y0IA 1ZVFA 2P37A 4GB31 1KJLA 3ZN6A 1X7NA 1WMDA 2Y38A 4UW6A 2R061 1YFXA 1X33A 3ZIWA 3TOJA 5K0UA 4P9WA 1FPN1 4COWA 4YZ4A 2ZBJA 5FO8B 3OJBA 4I3GA 2RS11 3ZVXA 4E9KA 1GZ9A 2WA3A 2GN3A 2ZMNA 3TWIA 4YARA 2YDEA 4K7JA 1TME3 1ASJ3 2QZ2A 4GULA 4C1XA 2R041 5JSRA 3RRDA 4GKXA 2HWC3 4E2SA 1LGBA 3NVCA 1PNGA 4FQ4A 1CPMA 2B8MA 3CJXA 3LA7A 1EV13 5ACA1 3PNAA 1MR5A 2EVXA 5GLZA 3FHIB 1FX5A 3ILNA 1LGNA 2PAMA 2XKPA 4Y24A 2YGLA 3OYWA 1JXNA 4B4PA 1MS0A 5J98B 1AF9A 3TRSB 2R0HA 2WNUA 4LO4B 2BBVA 2ZA9A 4HVRA 4DZGA 2FQPA 2DCJA 2A6YA 1X8EA 3TN93 2GC2A 1AJKA 3N7KA 5IK8A 1AHSA 3ALQA 3MW4A 2DYCA 1CAUB 2IXLA 1LEMA 4ONUA 4K6BA 3SITA 2R073 4JGYB 1MS8A 2PLV1 1C28A 5KC6A 4AF9A 1LOBA 3AKRA 4I3PA 3SH5A 1YIFA 2HWB2 2UYBA 1MVEA 2DCZA 4Q0PA 1NY71 4RS5C 3KD4A 2UY8A 1LU2A 1S0FA 2BWAA 4K40A 1V70A 2Z79A 4Q8KA 3KS7A 2Q30A 5L7OA 2OVUA 1QJU2 2ZGMA 1VBE2 1W6MA 3RYRA 1S0JA 3ZX7A 1JN2P 1PMIA 4XILA 1GFF2 2WZPP 3B93A 2VQAA 3CO2A 1W6NA 4Q4Y1 3VBUA 4XF3A 3H8UA 1C8M3 4ES9A 3DPRC 3AZXA 1FNZA 1CVNA 2VG9A 2WIIB 1UIKA 1KQRA 1J3RA 3KB5A 3MW3A 3N4MA 1EAH2 1QOTA 4AQSA 1H8TC 4SBVA 4AVTA 3BIWE 2DVBA 1HRV3 1SBFA 3E5QA 3FLTA 3BOPA 4D7SA 1PK6B 4C91A 2LTNA 1AZDA 2EXKA 4Q2FA 1MS5A 2GH8A 3VZKA 1I9RA 4XF4A 3SH3A 4RL7A 1QNWA 4B29A 5FREA 4N43B 4AI1A 2HKXA 1TME2 1ASJ2 3HQXA 3POSA 3KCYA 4JRAA 4XFAA 2EIGA 4HKWA 4OLLA 1FAYA 2RHPA 3S7IA 2Y26A 1UAIA 2B46X 4NHKA 2HWC2 1AR81 1UD1A 4ISQA 4WM7C 3PMSA 3I4IA 2LALA 1PZ9A 3FC0A 2D44A 5EYYA 1EV12 1QXJA 3SCFA 4H3WA 5DDJ3 3WUDA 3AP7A 1R083 4Z2WA 1RINA 1PIV1 2CNAA 3KZ4C 2ES3A 4WZCA 1OLQA 5CG9A 4AW7A 4OHYA 3MLJA 2ZTNA 3AYCA 4FTSA 3SHRA 4XYXA 1RUF1 1I3HA 4Q29A 3JBG1 1IS4A 2YY1A 2GN7A 5FMOL 3TN92 2K0GA 3R4UA 1I6XA 3N35A 1PZ8A 4CEWB 3QH6A 4Q0QA 4RSUA 1FNYA 4XIOA 4Y4YA 4YGCA 2R072 2A70A 4XFCA 2I07B 4JGYA 4AHXA 1GICA 4Q4X1 4Y20B 4FXGB 4FTEA 3C3VA 2D6PA 1DGWX 3ATGA 2A6XA 4HSJA 5JPNB 2BUKA 1KRIA 4LLFA 1CAXB 1WD4A 4LO5B 4IERA 1OPOA 2HEWF 4GALA 4AFCA 2ZABA 2VW2A 1PGL1 5F5QA 2PHFA 1DFQA 1C8M2 1H2LA 4P9LA 2BGCA 2XBO1 4XXPA 1OKQA 3WP4A 2PHUA 3FE5A 4DNYA 1PVC1 3CF6E 2EA7A 1VIWB 4HFSA 2VY0A 3MPBA 4XFGA 1EPWA 4H14A 4AI3A 2TEPA 1HRV2 2RMU1 1IS3A 2C5DA 5DXDA 2H6BA 5DG1A 1DU3D 1WCDJ 4ISRA 1PK6A 2W68A 4XIKA 1U5IA 1Q8QA 2Q1ZB 2WQZC 4JV4A 3WDVA 4Q0SA 4X6RB 1BK1A 2ERFA 3KMHA 4N43A 5EXOA 4WVMB 3ZXFA 1DHKB 4FOWA 4D3WA 2NPIA 5JOZA 4LUKA 3WDUA 4N53C 4RGGA 2AUYA 2B42B 2DCKA 3DGTA 2CTVA 2ARBA 3URFA 1AL23 4AEDB 5DDJ2 1COV1 4IEVA 1H4GA 5GM0A 1FYUA 3VBRB 1R082 4L2NA 2DUQA 2NMOA 1J3QA 1A6CA 3RYPA 1B09A 4HSLA 5I8SA 4J1WA 3USUA 3GZTB 2UY9A 2VVFA 4YFZA 2GH2A 4TZDA 1YRZA 3TAYA 2Q5TA 3R6SA 5A33B 2GMMA 4QHBA 5CG8A 1AYN1 1WLWA 2B7YA 3B00A 3UJOA 4CEWA 2H6CA 1AR61 3HT1A 5I93A 1AR73 4XDQA 1KDKA 3V0BB 2GC3A 1W0OA 4D7YA 4M01A 1BXHA 5A32B 1RUNA 3AMQA 1SACA 4DMIA 1SLCA 4Q0VA 4C0BA 1OFNA 3DKWA 3H3ZA 4YZ3A 3ZIXA 4Y20A 4JTNA 4XF9A 1LGCA 3WP6A 3UKVA 4AI8A 3NWKA 5FQ0A 1RUD3 2IXCA 1CAXA 1AR93 2RS53 4I09A 4QM9A 1DDLA 2QNKA 5HCBA 1SEFA 4P9XA 2O0OA 1LULA 1EP0A 3NKGA 3WY6A 4PJYA 2XLFA 3B94A 3VBFC 2AR6A 2IXIA 4AFBA 2UU8A 2AREA 2PFWA 4IV1B 4D69A 5IT6A 4RHV1 3VL8A 1C5IA 5KHKA 4FTBA 3MLKA 2VMHA 3J26N 3MIFA 1ND2B 4FQZA 2P17A 2Z42A 4DS0A 3MYXA 1QNYA 5CIRA 4QQOA 5KBFA 4BHPA 2DVAA 4QT6A 3MZHA 1ULEA 4LBLA 1N47A 5T5JA 4Z07A 1VBA1 5K8SA 3D0SA 1IS5A 4E4SA 4WVMA 2D6MA 4Q0UA 2WNEA 4IETA 1H2MA 1C1LA 4LBKA 2R30A 1AL22 2CV6A 4IEYA 4RQPB 3VKMA 4QD2A 4HVOA 2XVLA 4JGZC 3THPA 4K9SA 2VVEA 4M3CF 4FPCA 1S2BA 1GNZA 3M3OA 5E8AA 4AEDA 4EN9B 4FVVA 2BQPA 1RITA 1W2UA 1OOPC 2I45A 4XF1A 2R6QA 3VBRA 1MEC3