2WKKA

Identification of the glycan target of the nematotoxic fungal galectin cgl2 in caenorhabditis elegans
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
150
structure length
150
Chain Sequence
MLYHLFVNNQVKLQNDFKPESVAAIRSSAFNSKGGTTVFNFLSAGENILLHISIRPGENVIVFNSRLKNGAWGPEERIPYAEKFRPPNPSITVIDHGDRFQIRFDYGTSIYYNKRIKENAAAIAYNAENSLFSSPVTVDVHGLLPPLPPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords GALECTIN-2
publication title Caenorhabditis Elegans N-Glycan Core Beta-Galactoside Confers Sensitivity Towards Nematotoxic Fungal Galectin Cgl2.
pubmed doi rcsb
source organism Coprinopsis cinerea
total genus 34
structure length 150
sequence length 150
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2wkkA00
2ZGPA 1JYCA 5IUQA 2WQZC 5F9TA 1JBCA 3M3OA 4MYEA 2PHFA 1S0FA 2DWRA 2WT1A 1W0PA 1O4YA 1UL9A 4YZ5A 1IS3A 4C1WA 5JDBA 1JOJA 2ZHMA 2PHWA 3N35A 1WW7A 2GMMA 3WV6A 1UMZA 1FV3A 1W6PA 5T50A 4UW6A 2A3WA 5T52A 2A71A 1WLCA 5GZDA 1OFSA 1LGBA 1YRZA 3PVOA 3NV2A 4Y1YA 2NP0A 1AXKA 5T55A 5DUUA 3NV1A 4YZ2A 1DZQA 1YYNA 1DFQA 1DQ1A 3FUOA 1LJ7A 3IM0A 3L2YA 4GXLA 2VY0A 3AZWA 2Z42A 4YW5A 5GM0A 2A70A 1MS1A 1GICA 2C9AA 2CYFA 5JOWA 1BJQA 2AR6A 1R1ZA 1QOOA 4Y1ZA 1BKZA 4LBQA 2HYKA 2P2KA 3LSDA 2AUYA 2DU1A 3AZVA 5GLUA 3OYWB 1S0JA 2V73A 4BLJA 4R9CA 4XILA 3WG3A 4I30A 1G9CA 3U4XA 3B69A 2SLIA 5IK5A 3SISA 5HCFA 4KBBA 2DURA 2VW2A 2R0FA 5DG2A 4XDQA 5T5JA 1CVNA 2R0HA 1ENSA 2R1DA 1DYKA 1G9FA 3O0VA 4YM0A 4H55A 3WCSA 4BOWA 3WDXA 4BMBA 3WG1A 1Q8VA 2NZ9A 3AFKA 5H9QA 1QOSA 2JE7A 4YG0A 3IPVB 4GWNA 3ZXKA 2A3YA 1BZWA 3ZYPA 4YG3A 4NO4A 4AVSA 3RRDA 2VW1A 4Q1PA 2V5YA 1AXYA 3WNXA 4ISQA 4XTPA 1PZ7A 3BOPA 5H9RA 3W58A 1NLSA 2XG3A 3AZZA 1B09A 3D4KA 1GSLA 4LBNA 4C1XA 1W6NB 3WVJA 5DUWA 5AVAA 3W59A 3AXEA 3OBRA 3R4UA 5HCBA 1UZYA 5JOXA 1DQ2A 3V65A 4FPHA 4XJZA 1H9PA 4CZSA 1HQLA 3B00A 1APNA 2A6VA 2DTYA 1H9WA 3M3QA 4FOVA 4FPEA 2ZACA 4HANA 4YGBA 1N3QA 3ZXJA 4Y1XA 3Q9OA 3IN9A 2JJ6A 4FVVA 1DBNA 4LBQD 4PF5A 1OKQA 3B9CA 3LSEA 2E51A 4WVVA 2GMEA 1S1AA 1MZ5A 1HDKA 3N3HA 2E7QA 4XTMA 1SLTA 1VLNA 3D5OA 5EXOA 4BPZA 2I2SA 3AZYA 3PMEA 2VW0A 2D3RA 4GWMA 3ILFA 5EYYA 3VKFC 2YV8A 3WDTA 4LBKA 1CESA 5GJ6A 2DTWA 3POYA 2ZKNA 2DUOA 3USUB 4DPNA 1AJOA 1ULGA 1DHKB 2A6ZA 3ZSLA 4Y1UA 2OVUA 5L73A 1VIWB 1F5FA 1LU2A 1GNZA 1ULEA 1SLAA 2UU8A 2GALA 4BMEA 4W65A 1SLIA 5GZFA 1Q8PA 1GLHA 1LEDA 1BQPA 3M1HA 2ZGUA 4DRRA 3ASIA 1LHVA 2EXHA 2CWSA 1I1EA 4FP2A 4P9YA 3AP9A 2E53A 2ES3A 4XBNA 4XBQA 2GN3A 2VXRA 1MVEA 4HL0A 3VKOA 5CA6A 1DQ6A 3OYWA 2ZHKA 5EWSA 1FX5A 1KITA 3AP7A 3AP6A 2JD4A 1UN1A 3FLPA 2ZABA 1WCSA 2D6NA 1LCLA 1SCRA 1MS5A 1WW4A 4XIOA 4XIKA 4FOYA 1WBFA 1IS4A 4AVTA 4Y1VA 1V6KA 5H9PA 2YZ4A 1LTEA 2FHRA 3V0AB 2UWAA 3SH4A 3IPVA 1W6MB 3V0BB 2WJSA 5DUXA 1LULA 2ZMKA 4P9XA 3UK9A 5JOYA 3OY8A 1N3OA 3M3CA 3VKNA 1AXZA 5GALA 3WCRA 1SBDA 1HQWA 3OBTA 1RIRA 2A6YA 1W6NA 2UURA 3SLIA 4TZDA 1MR5A 4FP3A 5DZFA 2PELA 2DVGA 4JRAA 4XHBA 1LHWA 1F9KA 1DQ0A 1CQ9A 4K20A 4GKYA 3AZXA 1ULDA 3ZYRA 4OZXA 1C4RA 1FV2A 4BQ1A 4K1ZA 3MW4A 1N3PA 2ZGQA 1V00A 2E7TA 3FUQA 1G86A 1N47A 1WD3A 4K21A 1AX0A 1W6QB 3V64A 3VV1A 3SNMA 4FQZA 1U0AA 1LOFC 1X50A 5IK8A 1VAMA 5KXCA 3ENRA 3FLTA 4XJWA 1EPWA 2PHRA 4CTEA 1LGNA 5E8AA 1GBGA 4JC1A 5KXBA 2OUHA 1Y7BA 1MS9A 3USUA 2ERFA 4AGVA 1LECA 1KDKA 2GNMA 1DQ5A 1N1YA 4P9WA 1J1TA 1FAYA 5DUVA 2DYCA 4XXPA 5JMCA 1IS5A 1ENQA 1KJRA 3ZXFA 3QCWA 2D43A 4SLIA 1LHNA 1ULFA 4U36A 1GKBA 4YW3A 1YO8A 1I3HA 1Q8QA 2D6OX 2YXSA 3ATGA 1XQNA 3RS6A 1VAVA 3WZ1A 4YFZA 2EXIA 2LALA 2P34A 3MW3A 5T5PA 1LOCA 3POWA 3UJQA 1HLCA 4WZFA 2NMOA 1LU1A 1GZCA 1A78A 2EAKA 3M3EA 4FOWA 5GLVA 2W68A 4ZKTB 3N36A 4PCRA 1IS6A 2PHTA 3OGGA 2ZGKA 1CR7A 2DVFA 2R16A 2H0BA 4M00A 2NN8A 1JUIA 3AXDA 3GALA 1Q56A 1QOTA 2Q5TA 2SBAA 2ZA9A 5DG1A 2ZAAA 3ILRA 4XJ8A 2R1BA 1MVQA 4BLIA 1QNWA 4YM3A 1V6LA 1JXNA 1SLLA 1VALA 2GN7A 3B01A 2CL2A 1QNYA 1S0GA 2NM1A 3N7LA 1FNYA 4FOQA 4AVVA 2ZGOA 5JVVA 2D44A 1MZ6A 3V0AA 1W6MA 2PHXA 3V0BA 3AYAA 2YY1A 3ILNA 4IQPA 2ZMLA 1CONA 1N1VA 4NOTA 1AX2A 2DVDA 2ZZJA 1Z78A 1LENA 4Y22B 3RMXA 3T1MA 4UW5A 3WUCA 1WUVA 1V6MA 1GYKA 3GNEA 2KM2A 1UPSA 1V6NA 3VUOA 2RHPA 2PHUA 5IK4A 1WLDA 4XHXA 4YM2A 3SH5A 5IK7A 1CPNA 3DGTA 4TYSA 3T1LA 4YZ3A 1W6PB 4FPOB 2W08A 3AYDA 4XMAA 2P3KA 3N7KA 3AX4A 3ZSMA 3WDVA 3I8TA 1WW5A 2ZHLA 3AP5A 1GZ9A 2ZGMA 4YW2A 2ENRA 4GA9A 2ZGTA 1W6QA 4YW4A 1DGLA 1A8DA 1GNHA 2AGSA 1RITA 4YFWA 3T2TA 3WLUA 2A6WA 3NV4A 3INAA 3ZXLA 1G9AA 2UWBA 2FMDA 2GDFA 1G7YA 1AVBA 2GNBA 1SBEA 3UL2A 4YW1A 4F83A 5GZGA 4Q1RA 2D7FA 5JOZA 3BTAA 1LOEA 1MS3A 1UZZA 3RMYA 4DS0A 3I4IA 1JN2P 1QDOA 2DU0A 1ONAA 4DRVA 2WNEA 4ISRA 3DUIA 3WOGA 1NXD1 3SITA 2P37A 5CBLA 4DFSA 1WD4A 1GZWB 1DQ4A 1G8WA 1CJPA 1LOBA 5E88A 5KXDA 3FBYA 2D6KA 1LHUA 4BM8A 2CY6A 1S0BA 1D2SA 4PBOA 4XBLA 2XB6C 4ITCA 2EALA 1V6JA 4FPCA 4FPYA 4JCKA 3ZSJA 3FFZA 1AZDA 1AJKA 5CNAA 2C5DA 1N1TA 2UWCA 3JUUA 2AENA 3KQRA 4R9AA 2NMNA 1FATA 1QKQA 1V6OA 5GLZA 4LBLA 1SACA 1O4ZA 1KJLA 2JDZA 4M3CF 1S0EA 4Y20B 2ZHNA 4XJUA 4GKXA 4XE9A 3ZXEA 2D3SA 4FPFA 3VKMA 5FREA 5JLVA 4XXAA 2VU9A 1IKPA 2BQPA 2D6PA 1AF9A 1TEIA 2W52A 3FLRA 4R9BA 4FQ4A 1QDCA 2EIGA 3RSJA 4RA0A 3A4UA 2DV9A 4LBOA 3M2MA 3NWKA 4Y22A 2ZGNA 1KRIA 3LCPA 3PVNA 4UW3A 3O0WA 1CIWA 2EXJA 3R4SA 2WT2A 4YM1A 5E89A 4XJ9A 4D69A 1IOAA 2AREA 3A0KA 5HCAA 1UKGA 2VUAA 3AK0A 5IT6A 1CN1A 3O12A 1FNZA 3IKWA 4YGEA 2WSUA 4Q2FA 4Y26A 1S0CA 1UAIA 2GNDA 4WVWA 4ATEA 4U2AA 2D3PA 3B3QE 3JU9A 1ULCA 1GV9A 1QGLA 1DLLA 4AGGA 1W0OA 1QMJA 4FPLA 4R9DA 4WV8A 3MPPG 4YGCA 1URXA 1MS8A 1SCSA 1Z0HA 3R05A 3NV3A 1G9BA 2TEPA 1OQ1A 5SV8A 3PVEA 3WUDA 4Y24A 5GLWA 2EF6A 1MACA 5H9SA 4CRQA 4YG6A 2JE9A 4FPJA 2ARBA 4XJAA 4XYXA 3N7MA 2E6VA 5T5OA 4LBMA 2W39A 1QF3A 2AYHA 2WSVA 4YZ4A 1W6OB 5GLTA 3WHTA 1GZWA 5DXDA 5FRAA 1BXHA 3POSA 3C2UA 4YZ1A 4Q27A 1C57A 1ZM1A 4M01A 3MW2A 2YROA 1YI7A 2AH2A 2OW4A 2DUPA 3BODA 1SBFA 3OY8B 1YIFA 4P14A 1SLCA 2A75A 2ZMNA 4M3CB 1V6IA 2DVBA 2ZBJA 1N1SA 2DVAA 3TAYA 3WDWA 5CAZA 3PJQA 3N7JA 1KDMA 1ENRA 1RINA 1FYUA 2ZGRA 2OUJA 4XMIA 2NYYA 4M3CE 2D6MA 1Q8SA 5KXEA 4Y20A 1AX1A 1LOAA 1DYPA 3H0OA 1MS0A 3TB0A 5F5QA 3KM5A 1QU0A 2P3JA 1JHNA 4Z8BA 5DZEA 4XOGA 1JYIA 3AJZA 1CPMA 5CB7A 3VKLA 1S0IA 3ZVXA 3APBA 4L8QA 2A6XA 1WLWA 2LTNA 3WG4A 3BIWE 2CNAA 2EXKA 1C1LA 2A3XA 4LBQB 1F31A 3RG0A 3QLQA 2WT0A 1Q8OA 1UX6A 4Q8LA 5LK5A 1KQRA 2ARXA 3UJOA 3MEPA 1LEMA 4ASMB 5BYNA 1G9DA 3A0NA 3WDUA 5T5LA 4FPKA 1LODA 1LHOA 2A5ZA 4AWDA 1GANA 3OJBA 2CTVA 2YMZA 1SFYA 2R49A 3OPZA 3AP4A 1LESA 4PBPA 4PQ9A 3ZPYA 1WW6A 1LGCA 5EYXA 2WKKA 1H30A 1IKQA 5GZEA 1PZ9A 2D6LX 1YXWA 2ZGLA 4AGRA 4Q26A 2ZGSA 3HN1A 2JKBA 4GALA 2VH9A 3HR9A 3WG2A 3O0XA 4FPGA 4K1YA 1MS4A 4Q8KA 1D0HA 4LBJA 1ZA4A 1BYHA 2GMPA 4XZPA 2GNTA 3RQ0A 2B7YA 3SH3A 3WHUA 1JW6A 1C1FA 4YLZA 4UW4A 5DZGA 3WDYA 3IMNA 1S0DA 4YGDA 4AYUA 3AYEA 1W6OA 2WLQA 5T54A 5GZCA 1LOFA 3AYCA 3ZSKA 1LOGA 2G4IA 4RL7A 2JECA 1A3KA 1PZ8A 3D6EA 2CWMA 2A7AA 4DQAA 4ATFA 1DIWA 3HMYA 4ZXKA 3CNAA 1SLBA 2P3IA 4M3CA 1HKDA 2DUQA 3O5SA 1WBLA 3AJYA
chains in the Genus database with same CATH superfamily
3AL6A 5I93A 1AR93 1JBCA 4N53B 4IGPA 3M3OA 2PQSA 1PK6C 3ZYBA 1TNFA 2ZX4A 1W0PA 1ST8A 1O4YA 1UL9A 5I0UA 1IS3A 2JDPA 5FZOB 2I07B 1JOJA 2IZWA 3OSDA 4C1WA 1WW7A 2GMMA 1UMZA 1D0GA 1FV3A 5EP9A 1OLMA 2WYFA 3I2HA 4L97A 2PA7A 1YRZA 3NV2A 5F5AA 4V1PA 3KCXA 1RUJ3 5T55A 5DUUA 2R061 5F6KA 4CDUA 3BVCA 1UZ0A 3AZWA 2NLRA 1AYM1 3KV6A 3VBUB 4IERA 1MS1A 1GICA 2GP5A 2WFF3 4D8MA 5C9AC 5LA1A 2XUMA 3L9JT 2VMDA 3Q8EA 4PLOA 1W2UA 2PAEA 2WNOA 5FZ1A 1BKZA 3CU7A 3CHXA 1HN1A 4B7EA 3OYWB 4QX5A 3O1TA 2V73A 4R9CA 4ZU7A 2D97A 1G9CA 3HAGA 3B69A 4UBHA 3WT3A 4HXCA 4W6YA 5JMOA 4NHXA 1AR71 1PM7A 2HWB1 4KBBA 5F2WA 3D3AA 4GQ7A 2BV4A 2MEV1 1DYKA 3O0VA 1S2BA 4JQTA 4B29A 3AVRA 4CVUA 3WG1A 2QQUA 4LO6B 5C3OA 4FTBA 4NRPA 3WW4A 1QOSA 1BLZA 2JE7A 4V2VA 1OOPC 2JDHA 3ROUA 5FPXA 4BCUA 5I8TA 3ZXKA 4ZU5A 4XFHA 3B5LB 2JEMA 4QPGB 4NO4A 4ASKA 3FZ3A 5DAWA 4W6XA 1UYYA 4LHLA 3RRDA 1ZZ6A 2WQ4A 4Q1PA 4UFJA 3VN4A 1AXYA 1BBT2 1WCUA 3ETPA 2HBTA 4ISQA 4XTPA 1PZ7A 5J96B 1EPZA 1PO23 1UIJA 3IAPA 2VMFA 4LBNA 3PL0A 3TBDA 1C8M3 4C1XA 3KT4A 3WVJA 4MOAA 5DUWA 3AXEA 4QXCA 3R4UA 1ZRDA 1UZYA 2OS2A 1CAVB 3ALQA 5TSWA 3GCXA 3V65A 1H9PA 3I2IA 4CZSA 3M3QA 2DTYA 4YGBA 1OI6A 4FPEA 4TSVA 3VB9A 4AHXA 5BNNC 2PMWB 3Q9OA 3FHAA 1H8TC 3B9CA 2K46A 1H4GA 4LEJA 4WBBA 1ZBA1 3LSEA 3IBMA 2E51A 2Y6KA 3QH7A 4QX8A 3T09A 4KBZA 4JHTA 4QB2A 4CXXA 1HDKA 3AMHA 5JWPA 3N3HA 4XTMA 1F2NA 1YI9A 3D5OA 3E6CC 1W8WA 1RTVA 4N53A 1RUD1 3PMEA 3VKFC 4L92A 3RI9A 3ZXGA 3EQEA 2EVXA 2YV8A 4LBKA 2H6BA 2Q8CA 3ES1A 2DUOA 5FZOA 2R062 2XMLA 3ON7A 4QPIC 3T2QA 3BCWA 4GH4C 4Y1UA 2VCCA 4FFFA 3ZN6B 1AYM2 1CGPA 2FQPA 1TMF1 1UXZA 1F5FA 5LWBA 4CXWA 1VBD1 3CF6E 4IEVA 1SLAA 2UU8A 2FMYA 2TNFA 2VVFA 4H7LA 1IPSA 3LPFA 4H2AA 5LA9A 5JR2A 2MPFA 1Q8PA 1GLHA 5CFDB 2ZXQA 1YIPA 3M1HA 3B7MA 3OGJA 4M4RA 3RNSA 3VBUA 4BQ2A 1QHDA 2CWSA 2WS91 3KS7A 1H6YA 3SEEA 2HWB2 4XBNA 4XBQA 4HL0A 2XJUA 4PLMA 4IE5A 2JDKA 1YFXA 2MEV2 3OYWA 1MQTB 4XFGA 4E2SA 1HX6A 4OYUA 1KITA 3RJRA 1XJAA 5A6QA 1O3TA 1WMFA 1NT0A 1SCRA 1J83A 1T6BX 4P08A 2XL9A 3KWVA 4QMAA 1WW4A 4XIOA 1WBFA 1PMJX 2X53S 1IS4A 4Y1VA 5LA0A 4EYUA 4I0BA 1DYOA 1W6MB 3V0BB 3HEIA 4GB33 5DUXA 5JOYA 3O1MA 4QPGA 2XLAA 1O3RA 3M3CA 1K5MC 1W99A 5K0UA 3N9PA 3OGVA 3U4SA 1AXZA 5ISLA 3RI8A 2XH6A 4N90A 3WCRA 3OBTA 1RIRA 1JZ3A 2UURA 2UYBA 3K3NA 1GP6A 3VBOB 5A7OA 5I0RA 2JIJA 1LHWA 1DQ0A 4K20A 4XACA 5BXXA 4CDXC 2A1XA 4ES8A 1BBT3 1FXZA 1NCQB 1DLCA 4RN5A 4OUSA 2JDYA 3MIEA 4CU8A 2ZGQA 1RUD2 2E7TA 5FPLA 2ADEA 1G86A 3K48A 4FFGA 3V64A 4W4ZA 3ZO0B 2FZ1A 3KD4A 3J7NA 1X50A 4FQZA 5FY8A 5KXCA 3ENRA 1D2QA 4XJWA 1TMF2 3ZXAC 1BEV1 1LGNA 4PDWB 4JC1A 4CP9B 5J98B 4YVSB 5L7OC 1MS9A 1UU6A 2ERFA 3GDBA 3JCIA 3AMMA 4J1WA 4XF0A 4Q4X1 1XSRA 2XUEA 1KDKA 4P9WA 1QQP1 1XB9A 3ZN6A 4XXPA 4RR3B 1ENQA 1JU3A 4HSJA 1CAWB 2XQXA 4Q4W1 5CZKA 3MO4A 1ULFA 4E4SA 4U36A 2WNVB 1HRV1 1XQNA 3JD71 4ASLA 2FZ2A 4MX3A 1B35A 3MW3A 2R063 1OURA 5CEHA 3LGRA 2Q0AA 1HLCA 3OPWA 5F32A 3JB4C 1AYM3 3OF1A 4AHYA 2ETEA 5FKCA 4FAHA 1A78A 1GMMA 3M3EA 4FOWA 4CEYB 5C8CC 3WINE 4AOCA 1ODNA 1MQTA 2QDNA 5FKBA 3NJXA 2ZOEB 3KLSA 3SEPA 4DXZA 3TEWA 1IS6A 2XVLA 2WYSA 2WLPA 3QACA 4IE4A 2RG4A 2DVFA 1TNRA 3O1PA 4NRQA 4AI2A 4N43B 4S2GA 1SZBA 2SBAA 3SH4A 2ZA9A 4QT6A 4QHZA 1R081 1AR73 3WP4A 1GU3A 4S2FA 2HWB3 3E6DA 3JBG1 5ACA1 4LUMA 1JXNA 4OI2A 1GQPA 2MEV3 1VBB1 4DIQA 2VM9A 3E5XA 1HIXA 2D44A 4MV2A 4QKBA 4XFBA 2BGOA 2CU5A 3H1MA 1RUOA 1W6MA 2PHXA 3DF0A 4KWKA 3V0BA 3ILNA 3S7IA 4BQ5A 1NAEA 1PGSA 1JODA 5FK8A 4DXRA 3I3MA 1VBA3 5A3NA 1AX2A 3U78A 1Z78A 1LENA 3B93A 1POQA 4Y22B 3RMXA 3WUCA 4I2OA 1V6MA 2PTMA 2VZSA 2F6BA 2YPJA 1UPSA 3GCWA 5A3PA 2PHUA 3VBOA 2E32A 2W95A 4NHKA 4XHXA 1DDLA 3ZN4A 1NUKA 3CZJA 1VMHA 4KI5M 4YZ3A 2JB8A 4FPOB 1A6CA 1NCQA 2QTWB 3GHNA 4XMAA 3N7KA 1YNAA 1CAXB 3WDVA 1WW5A 3AL5A 3CLPA 3C7HA 1BEV2 2GP3A 2ENRA 4GA9A 5HXMA 3D8CA 5EJZB 1REDA 3W9AA 2JWPA 1YLLA 1DGLA 1XNDA 1ZBA3 5ANQA 2AGSA 5KC5A 4Q4X2 3WLUA 4CCKA 3I3QA 1QQP2 4I0WB 4H14A 1G9AA 5E1RA 1UF2C 4IEQA 2GDFA 5KXEA 4PDWA 4Q4W2 4CP9A 5GZGA 1X8EA 4FT8A 1RUD3 2EA7A 5JOZA 3BTAA 4YVSA 3O1OA 1MS3A 1UZZA 2VVEA 5CADA 4JGZB 1HRV2 3JD72 2QZ3A 3RZGA 1AUYA 1JN2P 4EN7B 1ONAA 4LIUA 4DRVA 5FZBA 4RR3A 4RFT0 2QBXA 2VZTA 1CAWA 2W94A 4ARXA 3S57A 5J48A 1J3PA 1TQ5A 5KHHA 4N53C 4BK4A 1DU3D 3N9OA 3SITA 1VBD3 1WD4A 1DQ4A 3SCGA 1G8WA 2WNVA 2XKOA 5C5UA 2D6KA 3CMGA 3OBZA 4BM8A 5JI9A 1ND3B 2JXAA 2WWUA 5C4WC 1H2KA 4CCEA 4OI0A 4PBOA 1AL0G 1D2SA 1K42A 2WS93 1OLQA 2IWGB 3ZSJA 1R082 4UAPA 4CEYA 1OD5A 2ZX1A 3P3NA 2UWCA 4ORFA 4AQSA 3U1XA 1VBB2 2NMNA 1V6OA 2XPJA 3VBUC 1E5RA 3B9IA 4N43A 5ABJC 1ZZBA 1S4CA 4Y20B 4N7UA 5HCHA 4XJUA 3VBHB 5FMCA 4XE9A 2D3SA 1O6UA 3DKQA 2Y64A 4FPFA 3VKMA 4UBGA 3G6JB 3JXSA 4FO9A 3BKZA 2WZR1 4FFIA 4XXAA 1NZIA 3NJVA 4BH9A 4Q29A 4EN8B 2KD7A 3FLRA 4R9BA 3VDDB 4OCTA 3A4UA 5DMYA 4LBOA 2IVJA 4Y22A 2HEWF 1HB1A 1KRIA 4EZ4A 4P02B 2RDSA 3QH6A 1ZREA 4OQ8A 2WT2A 5E89A 4XJ9A 4D69A 1KFXL 1IOAA 4QKDA 1WGPA 4QPGC 4OHYA 3WF2A 1UZWA 3O12A 5K0UC 1FNZA 4IDZA 2WSUA 4Y26A 3BN6A 1EUUA 1CAXA 1XOYA 2VZRA 3NKGA 4Z07A 4WVWA 4AEDB 1UZVA 5IJRA 4ATEA 4L9BA 3B3QE 3JU9A 4AGGA 1DLLA 4HK8A 1R092 1WMXA 3MPPG 1PK6B 2LM3A 4COWA 4L99A 3M3IA 1MS8A 5HV4A 1X9PA 1Z0HA 2XJTA 3NV3A 2RS53 1BEV3 1AL22 4B4PA 1ALYA 4XPVA 3OG2A 4JGZA 2AC1A 1MEC3 5GLWA 2P5BA 2WZ8A 5F6LB 4XC9A 4BWOA 3VBFB 4Q4X3 4XYXA 3MIFA 5DN2A 1QQP3 5T5OA 4EWDA 4LBMA 1QF3A 4YZ4A 2VQAA 3SKJE 3WHTA 4KL1A 4C0BA 4XVHA 3WX5A 1HRV3 3JD73 4LITA 1WKYA 1ZM1A 4M01A 4RGAA 5HV0A 1EP0A 5J36A 3LD8A 1YC61 2AH2A 2DUPA 2PLV1 4NHMA 3OY8B 2J1VA 2J1TA 3RZZA 3TNQA 2VG9A 4M3CB 3TAYA 5CAZA 1N1SA 2UY8A 1NXMA 3B02A 4XETA 3VD5A 1W9TA 2VAUA 2QQWA 2VZ3A 4SBVA 5CFDC 1NE4A 2CHHA 4HK9A 1IQAA 1YFYA 1FYUA 2WZR2 4CP0A 5FUNA 1AR61 2GC1A 4PF1A 1RUG1 1Q8SA 2XWJB 2IXIA 4Y20A 5FYUA 4AG4A 1LOAA 1R083 2E9QA 2RS31 3GBWA 3NQHA 3RJ2X 3VBHA 1MQTC 3JBG3 5ACA3 1FOD1 3Q8BA 2XXZA 5DZEA 1VBB3 1LR5A 1ZVFA 3AJZA 2QQKA 3H9AA 2DBNA 1OSGA 3VDDA 3ZVXA 2DCJA 3DCQA 4HG6B 1OLME 3PURA 3MFCA 5HI0A 2BOIA 3K51A 4XDOA 4ZZ5A 3UESA 2ZCWA 2ZKLA 4K7JA 1F31A 3WP5A 1OQDA 2B8MA 1Q8OA 3Q8FA 3DV8A 5BNNB 2ZZQA 2D5FA 1OBNA 3KSCA 4JHZA 3RZHA 3LQCA 5T5LA 4FPKA 1LODA 1QJZA 2BNMA 4CUGA 2A5ZA 1GP4A 3KMHA 4AEDA 1YHFA 3EYPA 2CTVA 2YMZA 3VBOC 1RGSA 3LB9A 1E5IA 1SG3A 1WW6A 3I7DA 4OHWA 4AQ6A 3GHMA 5F1RA 1O3SA 1I5PA 1PK6A 2OX0A 2ZGLA 1VE0A 2ARCA 1NCQC 5HXVA 5AFEA 4YARA 2VECA 4OUEA 4OVEA 4WZCA 2TUNA 3FJSA 1ZBE2 1UXXX 2JKBA 5F3GA 5IAVA 4OQ9A 1NQDA 4GH4B 3HR9A 4CPBA 5C5TA 1SHWB 3VD4A 4LNVA 2VNOA 4MXWB 5KHIA 1ZA4A 4NPRA 2GMPA 3KVAA 4XZPA 3RQ0A 3ZR6A 3SH3A 3VBFA 3WHUA 2JICA 1US2A 3DEMA 4BXSV 1JW6A 1C1FA 4YLZA 5DZGA 1R64A 5LEKA 2OZJA 4QB1A 1S0DA 1YJLA 2W5FA 1H8VA 1ENXA 2PLV2 3J4UH 2WLQA 4NAMA 4PDWC 2K0GA 4I09A 4OI1A 2G4IA 2VCMA 4YVSC 4BK5A 3PUQA 4BIOA 1RUJ1 4AFDA 3DYMA 5LA2A 1JZ8A 2WRAA 2FDIA 2CGOA 2V4VA 4V2WA 4MHUA 5KHKA 1AR62 3AFGA 5I8SA 4YW7A 1MZFA 1RUG2 4M3CA 3O5SA 2BBAA 2OPKA 2OYZA 2WNVC 3CQOA 4AFMA 5IUQA 2QUOA 1HB2A 2WQZC 5F9TA 1FOD2 2VCBA 4GWIA 4MYEA 1S0FA 5FZKA 4EROA 5KWRA 1W2AX 2J1EA 4AL9A 4JDMA 5JDBA 4CEYC 3P3PA 4XUNA 2ZHMA 2Y38A 3N35A 1U5XA 3POEA 5E16A 3RGBA 4QQLA 1W6PA 3PDQA 4MGZE 1SDDB 3MLKA 1WLCA 3BB6A 3KF3A 3WP6A 1Q5OA 1FMD1 2W1UA 4Y1YA 2C26A 3KHCA 2NP0A 1AXKA 3RPQA 4N43C 2YFUA 2WZR3 1DZQA 2RS13 1DFQA 1DQ1A 4Y5Z0 1LJ7A 3ZFFC 1C3HA 2Z42A 2VTXJ 3OD0A 2CYFA 1DGWA 2VVDA 5A32B 4GMP1 4A45A 1QOOA 4QD2A 4B8EA 2R071 4ZXEA 4AHWA 4CDXB 5DPNA 3C7EA 4FFHA 4BLJA 4OZOA 4XILA 5BNNA 3U4XA 3RYPA 1F5JA 3H3ZA 2IXJA 4Z1VA 3F95A 2SLIA 3UKTA 4K3UA 1DG6A 3IT8A 5HCFA 2DURA 2R0FA 1OHFA 2P3YA 2W0XA 1ENSA 2R1DA 1G9FA 4H55A 1UIKA 5FYZA 4IESA 3O1RA 5FO9B 3RZJA 5JSRA 5LK7B 1H6XA 3MIGA 4JRLA 4MVTA 4AVBA 5L7OB 3ZOIA 3IIAA 1GFF2 4ET7A 2A73B 4GH4A 2VQUA 3T2PA 2XDVA 3PU8A 4MXWA 4NR1A 5EPAA 1NLSA 4ZY9A 1NE6A 4RD7A 3KHBA 2CDOA 1RUJ2 1W6NB 3S6PA 5AVAA 3NNFA 3OBRA 5HCBA 3BALA 5JIAA 2XJVA 3MIBA 4XJZA 3J7MA 1WCKA 2VBBA 2WO2A 5A70A 1N3QA 2DFBA 5IVCA 1EUTA 4E8CA 2N7GA 5C8CB 1ZZCA 1JU4A 5L19A 3IN9A 4RYDA 1DBNA 2LROA 3KQ4B 1OKQA 1PX3A 4P00B 4DY5A 5A3MA 1DCSA 2VNRA 1XU1A 4MO3M 1S1AA 4E2QA 2E7QA 2XBO1 1NG0A 1VLNA 3NJYA 4W50A 5FY0A 5KC6A 1O59A 1PVC3 2WO3A 1HXS1 3AZYA 1ND3C 1Z7S1 2JDNA 4UFHA 4FCAA 1FMD2 5A7WB 5HPOA 1VRH1 3RYKA 2DFCA 4BE3A 2JX9A 3DYOA 3USUB 1PMHX 4PT6A 5FFOC 1JI6A 1AR63 1QJY1 1DHKB 1TZOA 2A6ZA 2K9ZA 4EN9B 3ZYIB 1NCRC 3HQUA 2RS33 4PIXA 1VIWB 3WF1A 1ULEA 2LW8A 4XQDA 1K5MA 1OUXA 1FOD3 2R32A 2ZEZA 3GZEA 2R072 2J7MA 4HVOA 1JZ4A 1O4TA 3N9MA 1LEDA 1PO22 2E26A 3TRSB 3VHOA 4AFAA 2EXHA 4GB31 4XF9A 2LUWA 3LA7A 5A32A 4P9YA 5I0TA 3AP9A 3LOIA 2GN3A 4DUWA 3VKOA 4I0AA 4IGQA 4CDXA 5CA6A 2DF7A 4QHBA 2ZHKA 4IE6A 3AP7A 4RGGA 3VDDC 1O7FA 3BI3A 3UNPA 3FLPA 3H3UA 1Y9MA 3I2FA 3KV5A 1WCSA 2D6NA 2P1BA 1J58A 4N7IA 2BYVE 1XSQA 3B94A 3RVHA 3LAGA 4Z2AA 2XLFA 4I3PA 3VZMA 1Y43B 2VO5A 1V6KA 4MLOA 4QAWA 3VHRA 4I01A 1DGWX 2YZ4A 1AYN3 2E31A 2FHRA 2VMIA 4OUMA 4E4ZA 3MV01 1V9U3 2YPDA 3DYPA 4GULA 5L7OA 1LULA 4XDPA 2ZMKA 4P9XA 2GAUA 3MLLA 5D2AA 1UOBA 3BOWA 4GMP0 4AEDC 1UYXA 5LEJA 1NX9A 2VZQA 1WLTA 4DO0A 4CA9A 4NWVA 3UV9A 1W39A 5CG8A 3K4AA 2W46A 3LDRA 2A6YA 2O0OA 4A7KA 1W6NA 3SLIA 4QX7A 4C0HA 2PELA 4XHBA 1W9FA 1OH3A 1H0BA 1F9KA 4XCBA 3VZLA 5LY1A 4OMCA 1ULDA 5LBEA 2C4XA 3ZYRA 5C4WB 1C4RA 2Z2SB 3NNLA 2Q8OA 3WR0A 3AKPA 3DL3A 3MW4A 4K1ZA 4XABA 5C8CA 1N3PA 3WP3A 4QXBA 3VBFC 3HT1A 2EIDA 1Z7S2 1GUIA 3PLQA 1N47A 4NRMA 5L9VA 1VRH2 2Q1ZB 4OMDA 4F7ZA 2Z4FA 3VV1A 1NY71 1QJY2 1U0AA 4EN0A 5IK8A 2HYXA 2VMHA 5ABJB 5J37A 3WNKA 3A21A 3ZSEA 4ES9A 2PHRA 5LY2A 4FAGA 2FD8A 5A7WA 2E63A 4BQYA 5KXBA 2ATFA 1Y7BA 4AAXA 3USUA 2BP6A 5CU1A 1RHI1 1JZ6A 4QQOA 2B5HA 4IE7A 2QJVA 1NYWA 5DUVA 5DAPA 4GB32 5JMCA 2KA3A 4QDQA 3KT7A 2BBVA 2XHNA 1LHNA 4O7XA 1NZCA 4XFAA 1FMD3 1I3HA 2D6OX 4MADA 4QWNA 4YFZA 1VAVA 2P34A 3POWA 5AFBA 2XLGA 5F8PA 3GM8A 4WZFA 4LTAA 2Y6JA 3RZKA 5FZ4A 4L2NA 2NMOA 3PHMA 4NHYA 1YQ2A 1VBA1 3NW4A 3LA2A 4GMP3 5FP4A 4XF4A 2VNVA 2G9ZA 3DXUA 2R073 1VMJA 2HLEA 3OGGA 4R8HA 4EZHA 4H3WA 1JUIA 2RDRA 3SCHA 3GALA 4PI2A 1XNCA 2Y26A 2ZAAA 4IEWA 1W8NA 3ZLIA 2R1BA 4DEVA 4TLGA 1MVQA 3GGLA 3HBKA 1QNWA 4QPWA 4CUBA 5E6HA 5FO8B 1OQEA 3B01A 4GJYA 1S0GA 4KWJA 1UNBA 2W1WA 4XURA 4LR4A 4AVVA 4CXYA 1F35A 1F4AA 4MGKE 2YY1A 2XJQA 4QM8A 1CONA 2J22A 2Q1FA 4FI9A 2JDMA 1QJEA 1T6GC 2DVDA 5CFCC 1ZZ9A 1YWKA 3H42B 4JVAA 4LUKA 2YGMA 2Q8DA 2KM2A 5FJHA 3ST7A 5C3SA 4CE8A 1H2NA 2IXLA 3K3OA 5D1IA 5FDBA 1GQGA 3SH5A 3OEAA 4AXOA 5A6ZA 3I49A 3Q8AA 3DGTA 5C4WA 1NY72 2VOVA 1TVGA 4Q4Y1 3AX4A 4IL7A 3MF9A 3ZSMA 4FBFA 2ZHLA 4XEZA 2YFZA 2VMEA 5A7PA 4YW2A 5FR3A 2EICA 3A7QA 5FZ0A 2ZGTA 5FXVA 1CZVA 4YW4A 5CVRA 1RHI2 4NIIA 4KWUA 2A6WA 2VL4A 5ABJA 4C91A 1CZSA 1SEFA 3INAA 3ZXLA 5A3LA 1AR72 2XBO3 1EV11 2UWBA 3RYRA 4A41A 1AVBA 1W2TA 4LXLA 4NE9A 1HXS3 2J1AA 1Z7S3 4AVCA 3RMYA 1VMFA 4LJHA 4UFIA 1VRH3 5LASA 1COV1 4FTEA 4QKNA 5JXGA 5FZ7A 3WQ0A 5LRRA 5FZ3A 1QDOA 1F15A 1NLQA 2DU0A 1QJY3 1POV0 3HQRA 4Y4RA 4GWJA 1QJX1 2I74A 5C33A 1QEXA 2Q30A 5ANNA 1RUF1 3WOGA 5IYYA 3MUY1 1VBA2 4D7SA 4AI0A 1W9YA 1YFUA 4QDRA 1LAJA 1UU5A 3WNNA 4D6QA 3ZIXA 4Q4V1 3H50A 2VOTA 5FY9A 1C5IA 1S0BA 3D82A 4CCJA 4ITCA 1SDWA 4QQHA 4LO4B 4FPYA 5FP9A 3MGUA 1AZDA 5IAXA 1UPIA 2VQTA 4DEQA 3GZUC 5CNAA 2C5DA 5CKQA 3R6SA 3LFIA 4NIDA 1WMEA 2VCAA 2X29A 2ORXA 3KQRA 3OGRA 3H8RA 1V70A 3I3EA 2GC3A 4Y5SA 1IG3A 1SACA 2XOMA 3ZKYA 1KJLA 1CAVA 4M3CF 2F4LA 3N9LA 1ZBA2 2ZHNA 5F7UA 3CJIB 3VHNA 4QHOA 3BPSA 4HKWA 2Y0IA 1VBC1 1IG0A 1W90A 2Y60A 2BQPA 1ULOA 3KGLA 1OVPA 1TEIA 2Y6FA 5K7PA 1QDCA 5FP7A 4COYA 3BTXA 4RA0A 1GR3A 1J1LA 2DV9A 4Y33A 5BNPC 1P8JA 3M2MA 3NWKA 2XJRA 1GQHA 4LHKA 3PVNA 4UW3A 1U5IA 3R4SA 2RS51 1JZ5A 4Q4Y2 1WMDA 5FWJA 1VBD2 4LA3A 1Y9QA 5FPZA 2AREA 1MEC1 1XE0A 3ACIA 5D8AB 5HCAA 2VUAA 3AK0A 4MG2A 2HWF3 1CN1A 3T4HB 4AQTA 1E5SA 1K5JA 2YU2A 2WS92 3QBQA 3I2OA 3VBSB 3FWEA 5DAVA 1UAIA 1EV12 2FCUA 3ACLA 1R1A1 1ULCA 1QGLA 3PTYA 5CFDA 5DQ0A 3UKNA 1COV2 2XR4A 1JYWA 1EYBA 2VD7A 1VJ2A 3P1IA 4DZGA 5JXIA 1J59A 4JZRA 1QJX2 4LQRA 2CSGA 1G9BA 1RUF2 2BVBA 2TEPA 1OQ1A 5SV8A 1D7PM 4KU7A 3AKRA 1W8TA 4QQPA 4CRQA 4QDSA 1MACA 3WNPA 2ID4A 4YG6A 2JE9A 4Q4V2 1RHI3 3E5QA 1ZRCA 2WC2A 2AYHA 2WSVA 3ZFFB 3CO2A 3K77A 5C3RA 5FOBB 5FRAA 1BXHA 2OIIA 3C2UA 4YZ1A 2B46X 4E4DX 2KXLA 2Z69A 4X8NA 3MW2A 1SFPA 2XWBB 1UO9A 2BU9A 2YROA 3BODA 4JV4A 4CCDA 4P14A 1DGRN 2ZMNA 5CBLA 4GD4A 4P5YA 2WO1A 3SC7X 1SFNA 5EIYB 4YYOA 4QXHA 3WNMA 3U10A 3O1VA 4W6WA 4GAZA 2YC2A 3LEMA 2ZGRA 5FPAA 2OUJA 4M3CE 3NRUA 1OF4A 3IDCB 2P6HA 5FP8A 2D6MA 2E7AA 1RMU1 4PJYA 3CJIA 3H0OA 2FCVA 4G9SB 3TB0A 5FYHA 4Z8BA 1QXRA 1T2XA 4Q0PA 1JS9A 2PQQA 2RS52 2V72A 2XVGA 1CPMA 5CB7A 3VKLA 2FDHA 3KCCA 4NIGA 1MEC2 2A6XA 3I2KA 3IMMA 5C6CA 4O65A 5FUPA 5BPXA 2LTNA 3LEGA 5LBBA 1E5HA 2CNAA 1RYYA 4PQQA 1C1LA 4NROA 1PNGA 5FXXA 3KZ4C 3L2HA 4JKKA 4LBQB 4CU9A 1PGW1 3ZYHA 1UX6A 1Q43A 4Q8LA 4A42A 1KQRA 2ARXA 5D8AA 1RUNA 2CGPA 1R1A2 1XE7A 3MEPA 3BIEA 2QKDA 3I2GA 5BYNA 4JDOA 2BFUS 3FL7A 3ZN5A 1H2LA 4MHRA 2WR9A 2WIIB 2FDJA 5EHDA 3VBSA 4AWDA 3VDBA 1PIV1 4Q4Y3 2JG8B 3OJBA 2D40A 5F5IA 3SMHA 3OPZA 4IEUA 3K46A 4PQ9A 5EYXA 2PAKA 3FC0A 2WKKA 2CV6A 3AC0A 1IKQA 4KQ7A 3S7EA 3T2OA 4E4HA 1GOGA 1PZ9A 3FN9A 4QX2A 4UOJA 4AGRA 3CBNA 2YBPA 1L7QA 4HZFA 4GALA 1EV13 2VH9A 1NCRB 3WG2A 2UY9A 4Q8KA 3JBG2 5ACA2 4TN7A 4LBJA 2GNTA 1UQXA 4KMQA 2ZEYA 1COV3 2BFUL 4XCAA 3IMNA 4AYUA 1QJX3 4P5HA 3ZFFA 5T54A 5GZCA 5JAXA 2HEYF 1RUF3 3LEKA 2JECA 1A3KA 3DKWA 3JB8A 2VXJA 1O8PA 2PXJA 4A3XA 4CU6A 3GBGA 4IEPA 2RS11 4Q4V3 3PTRB 3OB8A 1ACCA 5A6XA 1H1IA 2WUHA 1DIWA 2PYTA 3M70A 4N9IA 1SLBA 2P3IA 3THCA 5JPMB 2VPVA 2ET1A 3AJYA 2ZGPA 1OVSA 3OEBA 4IE0A 5A3OA 4S2DA 5A7NA 4DXTA 3PU3A 3WQ7A 2PHFA 2WT1A 1OC1A 3CZUA 3LEIA 3S30A 4QGLA 3UT0A 2D98A 2QQVA 3DPRB 3WV6A 4UW6A 2ZX0A 1GP5A 1W8OA 2QVSB 2VUCA 1OA3A 1OFSA 5GZDA 5JIUA 3PVOA 5JXHA 2ZX3A 5FZLA 1VBC3 1IQDC 4BZ4A 1YYNA 4YZ2A 1PGW2 3VDCA 3IM0A 3L2YA 3TN91 2VY0A 4HN1A 4YW5A 5GM0A 5JOWA 3VZJA 1BJQA 4HLTA 3HBZA 1ZZ8A 1X8MA 2AR6A 1HJGA 1R1ZA 4LKDA 4A4AA 2B9VA 2X5IB 4LBQA 4BQWA 3TWIA 2DU1A 3FHIB 5GLUA 1S0JA 4XF1A 3AKQA 3A22A 5FZEA 1KD7A 5FPUA 3BGAA 1NLRA 3I2JA 3SISA 2VQ0A 1W0NA 2VW2A 5DG2A 4XDQA 3LOBA 2GH8A 3VLBB 1CVNA 2R0HA 4EWAA 1REFA 2JG8A 1X82A 1S2EA 2CDPA 4ZONA 4YM0A 3WQBA 4BOWA 1BK0A 3WCSA 4BU2A 3KT1A 1KS4A 1L7LA 1R1A3 4D7TA 4YG0A 3RZLA 1ND3A 1L3JA 4GWNA 3H8OA 2A3YA 4ZPIA 1BZWA 1X33A 4YG3A 1UMIA 4AVSA 2RR13 5A7QA 2H0VA 1NCRA 2Q4SA 4B4RA 3KB5A 3GF6A 4C90A 5K0UB 1PVC1 1H2MA 2MNGA 3BOPA 3QD6A 2VBPA 3W58A 3ES4A 3AZZA 1B09A 3D4KA 1GSLA 4LHNA 3GZAA 3IDAA 1J3QA 2C24A 3W59A 2RS12 5CYYA 3I54A 3W20A 1X36A 2J1RA 2W92A 4INDA 3X29B 2Z79A 4FPHA 5IVYA 4ARYA 1SPPB 4FOVA 5FYIA 1YCIA 2A6VA 1H9WA 5J7MA 4HANA 3LDBA 5FYCA 2XQRA 4Y1XA 1NKGA 1SMVA 3WW3A 2FDKA 2JJ6A 4LBQD 2ZEXA 5AVPA 1W9WA 1VR3A 3WF3A 4CEWC 4D94A 1RVF1 2GMEA 3WEZA 1HV0A 2BUKA 2JD9A 3TEYA 5AC91 4E27A 3E97A 3OUIA 2PFWA 3LE0A 4BPZA 1LKNA 3I2DA 4HT1T 3HPNA 2V09A 3ILFA 4XUPA 1CESA 5GJ6A 2DTWA 3POYA 1HRI1 1PHMA 2ZKNA 3H7JA 1AJOA 2VMCA 2XL7A 4LMFA 4CSWA 4DPNA 3ME2A 3ORJA 3NJZA 1RMU3 3HQXA 2HWC1 3DPRA 1Q3EA 1EAH1 5FCCA 2R6QA 3TN92 1LU2A 2WN3A 3F2ZA 4Q0SA 4RHV1 3M7AA 4BMEA 1BVP1 1BMV1 3HIFA 5CFCB 1FI2A 3H7YA 1AYN1 1JOBA 1BQPA 2ZGUA 4DRRA 3ASIA 1V9U1 1LHVA 3CJIC 2J1SA 2DCKA 5FO7B 1UY0A 2XGXA 1JMUB 4RQPB 5FYBA 1QH6A 1MVEA 4QU1A 1OT5A 1BHGA 4LE4A 2R041 5I0SA 1DQ6A 1YUDA 1U5YA 5EWSA 4XFIA 3AP6A 3UGGA 2JD4A 5A6YA 3O1UA 4HPKB 3LZZA 5F39A 5FBZA 2V4AA 2YYOA 3ZYGA 4BQXA 4CYDA 2Y6HA 1KFUL 1MS5A 4FOYA 1PIV3 2FCTA 3BPZA 5D8AC 1PVC2 3HN3A 2VUJA 1LTEA 3V0AB 2VZ1A 4YNIA 2J1UA 4Z82A 5DAXA 3UK9A 4IEYA 2JDUA 3K75B 3OY8A 3VBSC 2ZS6B 3GBFA 1UU4A 1OPMA 3VL8A 3WQ1A 3VKNA 4DXSA 2I45A 5GALA 2RS32 5A1LA 3Q8CA 1SBDA 2O14A 5L9BA 4OHVA 2WFPA 3EJKA 4X8PA 2QQNA 4TZDA 2WQ8A 4FP3A 2DVGA 4JRAA 4BXFA 2DCTA 1CQ9A 1X7NA 3PUHA 4GKYA 1SPPA 1OF3A 2W2IA 5AC92 4BQ1A 1I9RA 2PAMA 1O3QA 3THTA 3TYJA 4ZZ8A 5B4XA 2QQLA 4P9GA 3KGZA 4K21A 3WD5A 3SNMA 5F3CA 5JCTA 5IVFA 5FBJA 3ZM8A 2HWC2 4RS5C 1EAH2 2EIBA 4LKSA 4RHV2 5FJKA 4CTEA 4MH0E 4UT5A 5E8AA 4HETA 2BVVA 2AEYA 1WWYA 4WM7B 4AEMA 1BMV2 1LB2A 3RDIA 5L9RA 1AYN2 1DQ5A 1N1YA 3VL9A 1J1TA 1RUC3 1V9U2 2DYCA 3U37A 1PO13 3ZXFA 3PNAA 2RJKA 1OH4A 4QKFA 1J3RA 5BNPB 2LRPA 1YO8A 5CFCA 2YXSA 2R042 2BNNA 1RJ8A 5CG9A 3OBAA 1M4WA 4UF0B 3LF7A 3FMGA 3UJQA 1UOFA 3D0JA 3TN93 4R4ZA 1LU1A 1W04A 4RQPA 5GLVA 2W68A 2BW8A 3J9SA 2YU1A 5IVBA 2VE1A 4IV3C 2ZGKA 1CR7A 2R16A 2H0BA 4M00A 4HPKA 4JGYB 4JKMA 5FZ9A 4G4FA 4A44A 1RUH3 2RM21 3BYWA 3NO8A 4YM3A 1VALA 2GN7A 1CIYA 2RV9A 1QNYA 3N7LA 4K40A 1FNYA 4FOQA 4LLOA 1QJFA 1OFNA 3POGA 4QX1A 1MZ6A 5JVVA 4LKFA 3V0AA 4KWLA 3QOPA 2BOJA 4AW7A 2JENA 4HSLA 4FSJA 1MZEA 2ZMLA 4IQPA 3VDAA 4LORA 2JG8C 4NOTA 4E2GA 2ZZJA 3CEWA 4K9SA 1WUVA 4L11A 1XBFA 3IWZA 3HNBM 1V6NA 3VUOA 2L9LA 5BNOB 3EBRA 3THPA 5IK4A 3N9NA 1WLDA 4YM2A 2Y33A 5IK7A 2ZJCA 1W8UA 3EHKA 4TYSA 5LBCA 1YJKA 3LIHA 5A3UA 5IVVA 1UOJA 1M06G 3I8TA 4K6BA 1UYPA 1W2OA 5EFUA 3AVSA 1GZ9A 2ZGMA 4RSUA 4BHPA 5B2GB 3VHPA 1JUHA 3T2TA 1GNHA 4YFWA 1RITA 1RVF3 4EQVA 4KGQA 3NV4A 2XVKA 4A6SA 5AC93 3CKHA 2FMDA 2GNBA 1G7YA 2XJSA 3UL2A 3NSTA 4F83A 4Q1RA 2D7FA 4WM7A 3RFRA 1LOEA 4DS0A 3M4FA 5LCWL 4F8AA 1OA4A 1FPN3 1HRI3 1LRHA 1UX7A 4HKLA 3IDEA 4AI3A 5FYTA 1A8MA 4FXKB 4ZS2A 2HWC3 4M0HA 1EAH3 2BTVC 4RHV3 2P37A 5BNPA 1GZWB 3ACFA 4W8JA 3VD9A 4Z2WA 5E88A 1LOBA 5KXDA 3FBYA 1O5LA 1LHUA 2HH9A 2W47A 2V5DA 3T0BA 4UF0A 2CY6A 1IPJA 3NMBA 5FY4A 3DPRC 4XBLA 4BQ4A 4WVMB 2W3JA 1TME1 3T30A 5KHGA 4JCKA 3FFZA 1AJKA 2RM22 4NMIA 5FV3A 1N1TA 4UFLA 4MXVA 3JUUA 2R043 3AMQA 4AR2A 2QNKA 4R9AA 4AEKA 4JGYA 4XQ4A 1O4ZA 1XU2A 2IFWA 5A3WA 2HWF1 1BVVA 1S0EA 2TBVA 2X5IC 1POV1 1XYPA 4AI1A 2D5HA 1QIQA 4GKXA 4KGGA 3U75A 1K45A 4D0QA 2XBO2 2BGPA 5FREA 1GWLA 4MSVA 5JLVA 2VU9A 4K8RB 4ZS3A 1HXS2 4LULA 4LK7A 1QY4A 4TWTA 5DAQA 2EIGA 1WA4A 4AQ2A 4RGKA 5IW0A 3LCPA 2Y34A 4PHZA 4WM8C 3O0WA 3S5QA 4COZA 1CIWA 2EXJA 3ZFEB 4YM1A 2C0ZA 4IEXA 3OTFA 4UFKA 5BNOA 5FOJB 3A0KA 4J1XA 1UKGA 2YBSA 1HQNA 2W1QA 5IT6A 3CIHA 1NA1B 3P6BA 3IKWA 3T0DA 5FZCA 4ONUA 4IW3A 1W05A 4KNCA 4AAPA 4AEJA 2GNDA 3HT2A 3MHZA 2ET7A 4MGQA 5FUIA 4XAAA 4U2AA 3VGIA 1W9SA 2K2SA 1W0OA 3NNGA 1UOGA 3JQWA 5D21A 1QMJA 5IATA 4R9DA 4H7MA 1O91A 4WV8A 4YGCA 4BISA 2WN2A 1UY4A 1W8FA 1H1MA 1KXGA 2VGDA 4QM9A 3PIJA 5JZGB 1W06A 2P17A 3PVEA 3FHQA 3PIGA 4Y24A 2EF6A 3WNOA 5LZ6A 3EO6A 1D4M3 1GWMA 4KG8A 4URTA 5LB6A 3OCPA 2VOWA 2WNUB 2QDRA 3N7MA 2E6VA 3NVCA 4Q0QA 4A2UA 2VULA 4R4XA 1TME2 1W6OB 1K3IA 3BU7A 4PLNA 5GLTA 4YSFA 1GZWA 5DXDA 3ACHA 2VMGA 3GJAA 4QX0A 1GOFA 3AKTA 4Q27A 3LDKA 3UETA 1CX1A 2X8KA 3ABZA 2BRTA 4IETA 3ZDVA 4A3ZA 1UWWA 1DP0A 4XUTA 1YI7A 4WVMA 3PUSA 5T3NA 1YIFA 1AHSA 1SLCA 2A75A 1CJDA 1V6IA 2HWF2 4JTNA 3WDWA 2DVAA 5CKNA 3URFA 1RB8G 2B39A 5FXZA 1WCDJ 1KDMA 1RUE1 3UYJA 5FY7A 2BERA 2QQOA 5K4LA 5C70A 2NYYA 3ZYJB 1W8ZA 4RQPC 5IFTA 1AX1A 2RE9A 4O9EA 5FZMA 2ZEWA 1DYPA 3KV9A 3VD7A 4BYYA 4MGIE 2RM23 4QX3A 5FPBA 2GC2A 3LA3A 2AACA 3M8LA 4NJ4A 1VPHA 4XFFA 5EJ1B 2P3JA 5F5QA 3OUJA 4XOGA 4OLLA 4FXGB 4OHXA 4AF9A 1JYIA 5A3TA 3K4DA 4QU2A 1S0IA 1V0AA 4N8MA 3TOJA 3APBA 4L8QA 2BWAA 1W3VA 5FZIA 2FDGA 1CAUB 3DECA 4CP2A 1DZRA 3MUZ1 2C1FA 2J42A 3WG4A 5FK7A 1OD3A 3LFMA 3K4ZA 4NAOA 3ZFEA 4EV0A 1TE1B 1RUI3 1HV1A 3RG0A 4NVPA 3UJOA 2ARAA 3RZMA 3DN7A 2ADDA 4DOUA 1LEMA 5F37A 3U07A 1NA1A 4LE3A 2HWE3 3WDUA 4NHLA 1UD1A 1YQ5A 4DNYA 3H8XA 2R7EB 3MDPA 2YDEA 2QE3A 4P9IA 4CEWB 2BJSA 1GANA 2ZX2A 2VZVA 4IEZA 5FZFA 3WNLA 4MZUA 4CDQC 1WA6X 1KGYA 1SFYA 2R49A 4AHZA 3AP4A 3ZPYA 1B35B 2IFRA 1I5ZA 5FZDA 5B4NA 1ZX5A 5BY5A 1H30A 3ZR5A 5GZEA 3S0MA 1YXWA 4IV1C 2F17A 5A1AA 4KU8A 2BEOA 3PJYA 2ZGSA 4Q26A 1IPKA 2G19A 4BJ0A 3HN1A 5JZGA 2QQMA 1U12A 4D6RA 5JSOA 3O0XA 4FPGA 1GZTA 1YQCA 4I3GA 3MYXA 2WNUA 5APAA 4UW4A 3T0AA 4AK3A 2XONA 3WY6A 3H1WA 2NQYA 3AYEA 1W6OA 2XKPA 1LOFA 3AYCA 3GJBA 1LOGA 3ZSKA 4WM7C 4MGTA 1PZ8A 4N9HA 1QH7A 1QXJA 5C3QA 2CWMA 2P4EA 4XF3A 3ZKUA 1RUE2 2A7AA 1GNYA 5FMDA 4CDWC 4DQAA 1NOVA 4P9LA 3HMYA 1XNTA 4HONA 5FLIA 4ZXKA 3CNAA 2YB7A 1TME3 3POIA 2DUQA 1EY2A 2NPIA 1I6XA 3VD3A 1JYCA 5I91A 4PI0A 2QCSB 3J7LA 2WA4A 1KS5A 3OUHA 3U0ZA 4XQWA 2DWRA 5FYVA 5JSPA 3NNJA 4YZ5A 2PHWA 2EIEA 5T50A 4LO7A 3T08A 2A3WA 1POV3 5T52A 2A71A 4LO8A 1HB3A 1LGBA 4PIYA 4M0NA 1ODMA 5GKAC 1ASJ1 5G05L 1IZ3A 3NV1A 1VB2A 3MLJA 4JGYC 2JIGA 1X9TA 3FUOA 4GXLA 3R0RA 4JKLA 1BCXA 1CAUA 2A70A 2C9AA 5FIXA 4EWEA 1XRUA 4LLFA 2RR11 4IEOA 3MF6A 4Y1ZA 2HYKA 2P2KA 3LSDA 2AUYA 3AZVA 4NPMA 5EZWA 4UFMA 4FTSA 3WG3A 3LKJA 4I30A 4HFSA 4K8FA 5IK5A 3K2OA 1H4HA 2VTFA 5T5JA 4CEWA 3ZFGB 2AZ5A 3IIIA 4LKEA 3MICA 4LOTA 1E57A 5JXJA 5BNOC 3WDXA 4YW6A 4BMBA 1Q8VA 2NZ9A 2OA2A 3AFKA 4RS5B 5FP3A 3C7OA 5H9QA 3THDA 1UCXA 3WW1A 2HWD1 1W2NA 2Y6LA 3IPVB 5IWFA 2VNGA 2QQJA 3ZYPA 4B3NA 1WCQA 4BDVB 2VW1A 3BTZA 2V5YA 1YQ6A 1XE8A 2OXBA 3WNXA 3J8F1 4CDUC 5H9RA 2XG3A 2IXCA 3VBRB 5J1XA 2BWCA 2KR2A 5J09A 2Q8EA 3OGSA 1VBC2 3KCYA 5JOXA 3CDZB 4XW3A 1DQ2A 4X6QB 4NIHA 1HQLA 3B00A 1APNA 3SHRA 3ZXJA 2ZACA 1QXPA 3HOBA 2BZDA 2CAVA 3KF5A 3ZMOA 5FLHA 3FFQA 4QB6A 2IVIB 2JB4A 2OZ6A 4I02A 2OKXA 4FVVA 4PF5A 2JKXA 2PHLA 2WA3A 4CCMA 2Q1MA 4URAA 4WVVA 4IV3B 3VZKA 1W28A 3C8XA 1MZ5A 1JYVA 2B42B 1PNFA 1SLTA 5FPVA 5EXOA 2I2SA 4HMZA 4O9GA 5JR7B 2DCZA 2D3RA 2VW0A 2XHKA 4GWMA 5EYYA 1RUE3 2RJ2A 4B1LA 3VZOA 3WDTA 4DUXA 5LW9A 1RXGA 1ASJ2 2ORZA 1ULGA 2OPWA 2QFEA 3ZSLA 4Y3OA 5L36A 2OVUA 5L73A 1UW8A 4HVQA 3HNMA 1GNZA 1XNKA 1F4HA 5JUVA 3BU0A 2GALA 2HKXA 1XPWA 2RR12 2QQPA 1A34A 4W65A 1SLIA 4GJZA 5GZFA 3R4DB 1DF0A 5FAXA 2JE8A 1WBLA 3PUIA 4BA6A 1I1EA 4LT5A 4FP2A 3WXPA 3I3BA 2E53A 1DZTA 2ES3A 2YG0A 4YWAA 2VXRA 4ZHNA 2VUDA 4JX0A 1R091 1PGL1 1W03A 4JTOA 1JYXA 1FX5A 4J6GA 1IGOA 1UN1A 2AEZA 2ZABA 2F4PA 4B4QA 1JYNA 2HWD2 2JG9B 1LCLA 3ITQA 3ZX7A 1TMF3 2VJXA 4LA2A 3ZFGA 3H8UA 3POJA 4YVWB 1AL21 1ND2B 3OD4A 3ZFEC 3BTYA 4XIKA 5FY1A 5FYMA 1S55A 2BDRA 1OXCA 4AVAA 4AVTA 4RS5A 3J8F2 5H9PA 1AR81 1SQ4A 2UWAA 3NNMA 1YQ8A 3IPVA 1NA1C 2WJSA 4Q0UA 2X10A 1Y9GA 1N3OA 2Y0OA 3RWKX 2BNOA 1RMU2 3O14A 2OT7A 3MFAA 4AFBA 1S2KA 2XJPA 3I3DA 1OLRA 3GZTB 3AB0A 1REEA 1HQWA 1GOHA 3C7FA 4JDNA 3VBRA 3WW2A 2VC9A 5BNQA 3FE5A 1MR5A 1VBE1 2HEVF 3IB3A 4PIZA 5DZFA 3MIDA 5A7SA 1RUC1 3AZXA 4F3JA 2Z5WA 5JZGC 5KR7A 1HW5A 1PO11 1HN0A 4OZXA 4ZU4A 2DDUA 4IUGA 2C9KA 1FV2A 2G9GA 4G3YC 3TNPB 5M0TA 1V00A 3FUQA 3J7HA 2WNUC 3EXUA 3ZYFA 4A7ZA 1WD3A 2B9UA 1AX0A 1W6QB 5EJ3A 5BV6A 4IV3A 3W5NA 1CZTA 3E1F1 4LO5B 4LIVA 1LOFC 1VAMA 1ZA7A 3FLTA 4XZUG 4LOSA 1EPWA 1WZXA 3POFA 3I97A 1GBGA 3KV4A 4NPLA 1PIV2 2OUHA 1PVXA 3AM2A 2EAAA 4BQ3A 3SXWA 2RJLA 3IZOA 1LECA 2GNMA 3NAPB 3TEXA 2RVAA 4JAAA 4AGVA 1FAYA 1ULPA 2W91A 1RUH1 5JPNB 1IS5A 1KJRA 3ZPOA 3QCWA 2D43A 4HKOA 4SLIA 4YW3A 1GKBA 3PUAA 3RS6A 1Q8QA 3ATGA 3WZ1A 3HD8B 4MGYE 1ASJ3 4UXAA 1ZRIA 2EXIA 2LALA 4WM8B 5T5PA 5BUVA 1PGL2 1LOCA 4CCNA 1DGRA 2WABA 4AI9A 1VRBA 1XC6A 3HWJA 5F3EA 2EAKA 1FT9A 1GZCA 5FZGA 4QGMA 4ZKTB 1Y3TA 3N36A 4PCRA 2FBEA 1C28A 2DBIA 3NL1A 1RL3A 2PHTA 4DY3A 1OA2A 1STMA 4E8DA 5IVEA 1AR82 1ZZ7A 1H1AA 2NN8A 1W3XA 2JG9A 3AXDA 5CISA 1Q56A 1QOTA 2Q5TA 1ZBE1 4UWDA 5DG1A 4QXKA 3ILRA 4XJ8A 4EJRA 4YVWA 2G9FA 1ND2A 3ACGA 4BLIA 4Q4W3 4DUVA 1V6LA 1IHMA 1SLLA 2CL2A 5C9AB 1QWRA 2NM1A 1UY1A 3ZDSA 2O8OA 2E33A 2ZGOA 3U14A 2ZTNA 2HWD3 3A23A 3AYAA 1VBE2 4XFCA 2WBKA 3KVBA 2WAOA 4MGSA 1N1VA 1RUC2 2P6CA 3T1MA 3W21A 5F5CA 1C8NA 2GH2A 4UW5A 1PO12 3ZMNA 1B35C 1GYKA 3J8F3 2VZUA 3GNEA 4QGNA 2Y6GA 2RHPA 4Q0VA 4HN0A 5KHJA 1FPN1 5DDJ1 4CU7A 3VZNA 3O1SA 1KEXA 1OOPB 1QJU1 5FZ8A 4LK6A 1CPNA 4J25A 3T1LA 1W6PB 4QPYA 2OQ6A 2W08A 3AYDA 2P3KA 5C7GA 3MIHA 3MV11 4AFCA 3H1YA 3AP5A 3MZHA 3O7OA 4BB3A 1W6QA 4C8DA 1A8DA 5IFPA 1MPXA 1L7RA 5DABA 1RUH2 2WL1A 5FMOS 3S5AA 4A6OA 1SBEA 2X5IA 4YW1A 2B45X 3T3YA 2ZAHA 3GXUA 3ETQA 1Y4WA 1RXFA 2W1SA 3NAPA 3POBA 3E6BA 1H8TB 3I4IA 4UYBA 5EQUA 2MHFA 2WNEA 3MBWA 4ISRA 3DUIA 1NXD1 1XYNA 3T4VA 1HB4A 4DFSA 1JYTA 1ZYBA 2WWJA 1CJPA 2W87A 4WM8A 4KG0A 4TLFA 4Z92B 1JHJA 3N9QA 4B1MA 4MUVA 4CUAA 2XB6C 1F8VA 2EALA 2VOXA 5JI7A 1V6JA 2RMU1 4FPCA 5FLJA 4QPIB 3PMSA 5FMOL 2O1QA 5I8YA 2BPA2 4R52A 5FWEA 1PMIA 2CAUA 1LNSA 1AR91 4XUQA 2AENA 5A33B 1W8HA 1XNBA 2VZPA 1R093 1FATA 1QKQA 4O61A 2WWSA 1C5HA 3AMNA 4LBLA 5GLZA 4CDQB 4TTGA 1ZRRA 2JDZA 2QZ2A 1O8SA 3FX3A 4WVZA 5F3IA 3UKVA 3HJRA 3SKVA 1RVF2 1RC6A 3I59B 1AL23 3OOXA 2G1MA 4IV1B 3ZXEA 1G6NA 5C9AA 1XNAA 1UY3A 2WZEA 1AR83 3C7GA 1OPOA 1IKPA 4NUBA 4OI4A 2VBDA 4QQ2A 2D6PA 2LS6A 1AF9A 2GZWA 4RR3C 2W52A 5F2SA 4FQ4A 3RSJA 3ZFGC 2WFF1 1FPN2 1HRI2 1VB4A 2D93A 2GC0A 5DDJ2 4HVRA 1QJU2 2ZGNA 4NIAA 3JZVA 4YRDA 5C3PA 1UYZA 5G04L 4D6SA 4CUCA 1PX4A 3C3VA 1D4M1 1K12A 1VBE3 3OPTA 4HBNA 4YPJA 1OOPA 2PHDA 2WZPP 3HNYM 4AI8A 5FMBA 2WO7A 2PN5A 2VTXA 4YGEA 4L0PA 5EV7A 3WF4A 4META 4Q2FA 4CDWB 5J3UA 1S0CA 4OULA 5IHRA 1K5MB 3VBRC 4CPBD 3JQXA 4COUA 1OKOA 2D3PA 2WDBA 1GV9A 2VOKA 2BGCA 4FPLA 3IAQA 2YC0A 1CX4A 1URXA 2YC4A 2GSYA 2W9XA 3ELNA 1SCSA 4P9JA 2YGLA 3R05A 2YUEA 2B4KA 4LHSA 5FZ6A 3WF0A 4JQRA 1PO21 3WUDA 3CJXA 1C8M1 5FQ0B 5K8SA 5H9SA 2H6CA 1H8TA 3RWNA 3G7DA 4FPJA 2ARBA 4AE2A 4XJAA 4RFRB 1HJFA 4EN6B 3MPBA 4S2HA 4NN0A 1NQJA 2W39A 2Y8KA 2RMU2 3V56A 4IGOA 1JTZX 3ECQA 2ZPXA 3POSA 2IXKA 2IXHA 2HBUA 1AR92 3FBMA 1C57A 4OHZA 5LATA 3HVDA 4GZ9A 1JH5A 1UKRA 4XUOA 1O5UA 1OUSA 2OW4A 1BK1A 1SBFA 3AKSA 4Q5OA 4QPIA 4CCCA 2OQ7A 2DVBA 2UYAA 2ZBJA 1J84A 2X05A 5SV5A 5IVJA 3IDBB 1VP6A 3PJQA 4KH9A 4UI9L 2WINB 5FTTC 2VR4A 5A33A 3N7JA 1YEWA 1RUI1 1ENRA 1CD3G 3LWCA 1PM4A 1RINA 2RDQA 5C71A 4BIFA 4CDQA 1UMHA 4XMIA 5A80A 2JDAA 1ZBE3 1US3A 2HWE1 2RDNA 4GIQA 2WFF2 4D3WA 1MS0A 3I59A 4IV1A 2IUWA 4A7YA 3P5BA 3KM5A 4JGZC 1QU0A 1JHNA 3LIGA 1YFWA 5LBFA 3E5UA 2JG9C 4CDUB 4DMIA 5HBAA 5FZHA 2GU9A 3N4MA 1ZRFA 2PLV3 2VZOA 3UGHA 1D4M2 1TG7A 1ND2C 4YVWC 1U5ZA 4D7YA 4DB5A 5FXWA 3BUCA 5C8WA 1WLWA 2FDFA 3BIWE 2EXKA 4XAEA 3LPGA 2YBKA 2C6SA 5CIRA 1RJ7A 5ERLA 1CWPA 1UY2A 1XXNA 2A3XA 3EB7A 3MI8A 3QLQA 2WT0A 5FYYA 5K9YA 2WAAA 5LK5A 4EE2A 4E9KA 1GWKA 1OMIA 1RUG3 4ASMB 5A1FA 5DDJ3 4COVA 1G9DA 2R30A 3A0NA 3SQOA 4CDWA 1QJU3 4M4PA 1LHOA 3D0SA 2X09A 1VAKA 2CGNA 3USSA 3ZXDA 3EMRA 4B7KA 4PBPA 1LESA 4CCOA 1LGCA 1D4VB 1C8M2 4HOOA 4CCLA 3VBHC 2D6LX 4LPLA 3W5MA 1JOPA 2DCYA 2HJIA 1JZ7A 4IXLA 4AZZA 5KBFA 1JZ2A 4K1YA 1MS4A 4TXWA 2QQIA 4DINB 1D0HA 5FQ0A 2YHJA 1BYHA 5FYSA 4X6RB 2O8QA 3ZIWA 2B7YA 4OFGA 3TEZA 2ILMA 3GYDA 3WDYA 5LRSA 4YGDA 3WSOA 1BBT1 3AMPA 1XYOA 4RL7A 3NKTA 4Y5TA 3UGFA 3U11A 3J26N 3DXTA 3D6EA 5FY5A 3SCFA 3CL1A 3NAPC 1RUI2 4NWWA 5FZAA 1ZNPA 3PVBB 4CP1A 4ATFA 2IC1A 4Y4YA 5CKMA 2RMU3 1HKDA 5I0DA 3H3LA 2HWE2
chains in the Genus database with same CATH topology
5I93A 1AR93 1JBCA 4N53B 3M3OA 1PK6C 1TNFA 2ZX4A 1W0PA 1O4YA 1UL9A 5I0UA 1IS3A 4C1WA 2I07B 1JOJA 2IZWA 1WW7A 2GMMA 1UMZA 1D0GA 1FV3A 4L97A 2PA7A 1YRZA 3NV2A 4V1PA 3KCXA 1RUJ3 5T55A 5DUUA 2R061 5F6KA 4CDUA 3AZWA 2NLRA 1AYM1 3VBUB 4IERA 1MS1A 1GICA 2WFF3 5C9AC 2XUMA 3L9JT 4PLOA 1W2UA 2PAEA 1BKZA 3CU7A 4B7EA 3OYWB 4QX5A 2V73A 4R9CA 4ZU7A 2D97A 1G9CA 3HAGA 3B69A 4UBHA 3WT3A 4W6YA 1AR71 1PM7A 2HWB1 4KBBA 4GQ7A 2MEV1 1DYKA 3O0VA 1S2BA 4B29A 3WG1A 4LO6B 4FTBA 3WW4A 1QOSA 2JE7A 1OOPC 3ROUA 5FPXA 4BCUA 5I8TA 3ZXKA 4ZU5A 4XFHA 3B5LB 2JEMA 4QPGB 4NO4A 3FZ3A 4W6XA 3RRDA 4LHLA 3VN4A 1ZZ6A 2WQ4A 4Q1PA 5K0UB 1AXYA 1BBT2 4ISQA 4XTPA 1PZ7A 5J96B 1EPZA 1PO23 1UIJA 4LBNA 3TBDA 1C8M3 4C1XA 3KT4A 3WVJA 5DUWA 3AXEA 3R4UA 1ZRDA 1UZYA 3ALQA 1CAVB 5TSWA 3V65A 1H9PA 4CZSA 3M3QA 2DTYA 4YGBA 1OI6A 4FPEA 4TSVA 4AHXA 5BNNC 3Q9OA 1H8TC 3B9CA 4LEJA 1H4GA 4WBBA 1ZBA1 3LSEA 3IBMA 2E51A 3QH7A 5JWPA 1HDKA 3AMHA 3N3HA 4XTMA 1F2NA 1YI9A 3D5OA 3E6CC 1RTVA 4N53A 1RUD1 3PMEA 3VKFC 4L92A 3RI9A 3ZXGA 3EQEA 2EVXA 2YV8A 4LBKA 2H6BA 3ES1A 2DUOA 2R062 4QPIC 3BCWA 4GH4C 4Y1UA 3ZN6B 1AYM2 1CGPA 2FQPA 1TMF1 1F5FA 1VBD1 3CF6E 4IEVA 1SLAA 2UU8A 2FMYA 2TNFA 2VVFA 4H7LA 2MPFA 1Q8PA 1GLHA 5CFDB 3M1HA 1YIPA 3B7MA 3OGJA 3RNSA 3VBUA 1QHDA 2CWSA 2WS91 3KS7A 2HWB2 4XBNA 4XBQA 4HL0A 2XJUA 4PLMA 1YFXA 2MEV2 3OYWA 1MQTB 4XFGA 4E2SA 1HX6A 1KITA 3RJRA 1O3TA 1WMFA 1SCRA 2XL9A 4QMAA 1WW4A 4XIOA 1WBFA 2X53S 1IS4A 4Y1VA 4I0BA 1W6MB 3V0BB 4GB33 5DUXA 5JOYA 4QPGA 2XLAA 1O3RA 3M3CA 1K5MC 5K0UA 1AXZA 3RI8A 2XH6A 4N90A 3WCRA 3OBTA 1RIRA 2UURA 2UYBA 3VBOB 5I0RA 1LHWA 1DQ0A 4K20A 5BXXA 4CDXC 4ES8A 1BBT3 1FXZA 1NCQB 4OUSA 3MIEA 2ZGQA 1RUD2 2E7TA 1G86A 3K48A 3V64A 3ZO0B 2FZ1A 3KD4A 4FQZA 1X50A 5KXCA 3ENRA 1D2QA 4XJWA 1TMF2 3ZXAC 1BEV1 1LGNA 4PDWB 4JC1A 5J98B 4YVSB 5L7OC 1MS9A 1UU6A 2ERFA 3JCIA 3AMMA 4J1WA 4XF0A 4Q4X1 4P9WA 1KDKA 1QQP1 3ZN6A 4XXPA 4RR3B 1ENQA 4HSJA 1CAWB 4Q4W1 1ULFA 4E4SA 4U36A 2WNVB 1HRV1 1XQNA 3JD71 4ASLA 2FZ2A 4MX3A 1B35A 3MW3A 2R063 3LGRA 2Q0AA 1HLCA 3JB4C 1AYM3 3OF1A 4AHYA 2ETEA 4FAHA 1A78A 3M3EA 4FOWA 4CEYB 5C8CC 3WINE 1MQTA 2QDNA 2ZOEB 3KLSA 4DXZA 1IS6A 2XVLA 2WLPA 3QACA 2DVFA 1TNRA 4AI2A 4N43B 4S2GA 3SH4A 2SBAA 2ZA9A 4QT6A 1R081 1AR73 3WP4A 4S2FA 2HWB3 3E6DA 3JBG1 5ACA1 4LUMA 1JXNA 4OI2A 2MEV3 1VBB1 3E5XA 1HIXA 2D44A 4MV2A 4XFBA 3H1MA 1RUOA 1W6MA 2PHXA 3DF0A 4KWKA 3V0BA 3ILNA 3S7IA 1PGSA 1VBA3 1AX2A 1Z78A 1LENA 3B93A 4Y22B 3RMXA 3WUCA 4I2OA 1V6MA 2PTMA 2F6BA 2YPJA 1UPSA 2PHUA 3VBOA 4NHKA 4XHXA 1DDLA 3ZN4A 4YZ3A 4FPOB 1A6CA 1NCQA 3GHNA 4XMAA 3N7KA 1YNAA 1CAXB 3WDVA 1WW5A 3CLPA 1BEV2 2ENRA 4GA9A 3D8CA 1REDA 3W9AA 1YLLA 1DGLA 1XNDA 1ZBA3 5KC5A 2AGSA 4Q4X2 3WLUA 4I0WB 1QQP2 4H14A 1G9AA 5E1RA 1UF2C 4IEQA 2GDFA 4PDWA 4Q4W2 5GZGA 1X8EA 4FT8A 1RUD3 2EA7A 5JOZA 3BTAA 4YVSA 1MS3A 1UZZA 2VVEA 5CADA 4JGZB 1HRV2 3JD72 2QZ3A 1AUYA 1JN2P 4EN7B 1ONAA 4DRVA 4RR3A 4RFT0 1CAWA 5J48A 1J3PA 1TQ5A 5KHHA 4N53C 1DU3D 3SITA 1VBD3 1WD4A 1DQ4A 3SCGA 1G8WA 2WNVA 2XKOA 2D6KA 4BM8A 5JI9A 1ND3B 2JXAA 5C4WC 1H2KA 4OI0A 4PBOA 1AL0G 1D2SA 2WS93 1OLQA 2IWGB 3ZSJA 1R082 4CEYA 1OD5A 2ZX1A 3P3NA 2UWCA 4ORFA 4AQSA 1VBB2 2NMNA 1V6OA 2XPJA 3VBUC 4N43A 3B9IA 5ABJC 1ZZBA 4Y20B 4N7UA 4XJUA 3VBHB 4XE9A 2D3SA 4FPFA 3VKMA 4UBGA 3G6JB 4FO9A 2WZR1 4XXAA 4BH9A 4Q29A 4EN8B 3FLRA 4R9BA 3VDDB 3A4UA 4LBOA 4Y22A 2HEWF 1KRIA 3QH6A 1ZREA 2WT2A 5E89A 4XJ9A 4D69A 1KFXL 1IOAA 1WGPA 4QPGC 4OHYA 3O12A 5K0UC 1FNZA 2WSUA 4Y26A 1CAXA 3NKGA 4Z07A 4WVWA 4AEDB 4ATEA 4L9BA 3B3QE 3JU9A 4AGGA 1DLLA 4HK8A 1R092 3MPPG 1PK6B 2LM3A 4COWA 4L99A 3M3IA 1MS8A 1Z0HA 2XJTA 3NV3A 2RS53 1BEV3 1AL22 4B4PA 1ALYA 4XPVA 4JGZA 5GLWA 1MEC3 5F6LB 4BWOA 3VBFB 4Q4X3 4XYXA 3MIFA 1QQP3 5T5OA 4EWDA 4LBMA 1QF3A 4YZ4A 2VQAA 3WHTA 4KL1A 4C0BA 3WX5A 1HRV3 3JD73 1ZM1A 4M01A 4RGAA 1EP0A 5J36A 2AH2A 2DUPA 2PLV1 4NHMA 3OY8B 3RZZA 3TNQA 2VG9A 4M3CB 3TAYA 5CAZA 1N1SA 2UY8A 1NXMA 3B02A 4XETA 5CFDC 4SBVA 1NE4A 4HK9A 1IQAA 1YFYA 1FYUA 2WZR2 4CP0A 1AR61 2GC1A 1RUG1 2XWJB 1Q8SA 2IXIA 4Y20A 4AG4A 5KXEA 1LOAA 1R083 2E9QA 2RS31 3GBWA 3RJ2X 3VBHA 1MQTC 3JBG3 5ACA3 1FOD1 5DZEA 1VBB3 1LR5A 1ZVFA 3AJZA 3H9AA 1OSGA 3VDDA 3ZVXA 2DCJA 3MFCA 5HI0A 3K51A 2ZCWA 2ZKLA 4K7JA 1F31A 3WP5A 1OQDA 2B8MA 1Q8OA 3DV8A 5BNNB 2ZZQA 2D5FA 3KSCA 5T5LA 4FPKA 1LODA 1QJZA 2BNMA 2A5ZA 3KMHA 4AEDA 1YHFA 2CTVA 2YMZA 3VBOC 1RGSA 3LB9A 1WW6A 3I7DA 4OHWA 4AQ6A 3GHMA 5F1RA 1O3SA 1PK6A 2ZGLA 1NCQC 5HXVA 5AFEA 4YARA 2VECA 4OVEA 4WZCA 2TUNA 3FJSA 1ZBE2 2JKBA 1NQDA 4GH4B 3HR9A 4LNVA 2VNOA 4MXWB 5KHIA 1ZA4A 4NPRA 2GMPA 4XZPA 3RQ0A 3SH3A 3VBFA 3WHUA 2JICA 5LEKA 1JW6A 1C1FA 4YLZA 5DZGA 2OZJA 1S0DA 1YJLA 1H8VA 1ENXA 2PLV2 3J4UH 2WLQA 4PDWC 4OI1A 2K0GA 4I09A 2G4IA 4YVSC 4BIOA 1RUJ1 4AFDA 2CGOA 5KHKA 1AR62 3AFGA 5I8SA 1MZFA 1RUG2 4M3CA 3O5SA 2OPKA 2OYZA 2WNVC 4AFMA 5IUQA 2QUOA 2WQZC 5F9TA 1FOD2 4MYEA 1S0FA 4EROA 5KWRA 4JDMA 5JDBA 4CEYC 3P3PA 2ZHMA 2Y38A 3N35A 1U5XA 5E16A 4QQLA 1W6PA 4MGZE 3MLKA 1WLCA 3BB6A 3WP6A 1Q5OA 1FMD1 4Y1YA 2NP0A 1AXKA 3RPQA 4N43C 2WZR3 1DZQA 2RS13 1DFQA 1DQ1A 4Y5Z0 1LJ7A 3ZFFC 1C3HA 2Z42A 3OD0A 2CYFA 1DGWA 2VVDA 5A32B 4GMP1 1QOOA 4QD2A 4B8EA 2R071 4AHWA 4CDXB 4BLJA 4XILA 5BNNA 3U4XA 3RYPA 1F5JA 3H3ZA 2IXJA 2SLIA 3UKTA 4K3UA 1DG6A 3IT8A 5HCFA 2DURA 2R0FA 1OHFA 2W0XA 1ENSA 2R1DA 1G9FA 4H55A 1UIKA 4IESA 5FO9B 5JSRA 5LK7B 3MIGA 4JRLA 4MVTA 4AVBA 5L7OB 3IIAA 1GFF2 2A73B 4GH4A 4MXWA 4NR1A 1NLSA 1NE6A 4RD7A 1RUJ2 1W6NB 3S6PA 5AVAA 3OBRA 5HCBA 5JIAA 3BALA 2XJVA 3MIBA 4XJZA 1WCKA 1N3QA 2DFBA 2N7GA 5C8CB 1ZZCA 5L19A 3IN9A 1DBNA 4DY5A 1OKQA 5A3MA 2VNRA 1XU1A 4E2QA 1S1AA 2E7QA 2XBO1 1NG0A 1VLNA 5KC6A 1PVC3 1HXS1 3AZYA 1ND3C 1Z7S1 4FCAA 1FMD2 1VRH1 3RYKA 2DFCA 4BE3A 2JX9A 3USUB 5FFOC 2K9ZA 1AR63 1QJY1 1DHKB 4EN9B 2A6ZA 3ZYIB 1NCRC 2RS33 4PIXA 1VIWB 1ULEA 4XQDA 1K5MA 2R32A 1FOD3 2R072 4HVOA 1O4TA 1LEDA 1PO22 3TRSB 3VHOA 4AFAA 2EXHA 4GB31 4XF9A 2LUWA 3LA7A 5A32A 4P9YA 5I0TA 3AP9A 3LOIA 2GN3A 3VKOA 4I0AA 4CDXA 5CA6A 2DF7A 4QHBA 2ZHKA 3AP7A 4RGGA 3VDDC 1O7FA 3FLPA 3H3UA 1WCSA 2D6NA 1J58A 4N7IA 2BYVE 3B94A 3LAGA 2XLFA 4I3PA 3VZMA 1Y43B 1V6KA 4MLOA 3VHRA 4I01A 1DGWX 2YZ4A 1AYN3 2FHRA 2VMIA 4OUMA 4E4ZA 1V9U3 4GULA 5L7OA 1LULA 2ZMKA 4P9XA 2GAUA 3MLLA 4GMP0 3BOWA 4AEDC 5LEJA 1WLTA 4NWVA 3UV9A 1W39A 5CG8A 4A7KA 2A6YA 2O0OA 1W6NA 3SLIA 4C0HA 2PELA 4XHBA 3VZLA 1H0BA 1F9KA 1ULDA 3ZYRA 5C4WB 1C4RA 2Z2SB 2Q8OA 3WR0A 3AKPA 3DL3A 3MW4A 4K1ZA 5C8CA 1N3PA 3WP3A 3VBFC 3HT1A 1Z7S2 3PLQA 1N47A 1VRH2 2Q1ZB 4F7ZA 3VV1A 1NY71 1QJY2 1U0AA 4EN0A 5IK8A 2VMHA 5J37A 5ABJB 3ZSEA 4ES9A 2PHRA 4FAGA 2E63A 5KXBA 2ATFA 1Y7BA 3USUA 5CU1A 1RHI1 4QQOA 2B5HA 2QJVA 1NYWA 5DUVA 4GB32 5JMCA 2KA3A 3KT7A 2BBVA 1LHNA 1NZCA 4XFAA 1FMD3 1I3HA 2D6OX 4YFZA 1VAVA 2P34A 3POWA 5AFBA 2XLGA 4WZFA 4LTAA 4L2NA 2NMOA 3PHMA 1VBA1 3NW4A 3LA2A 4GMP3 4XF4A 2R073 3OGGA 4R8HA 4H3WA 1JUIA 3SCHA 3GALA 1XNCA 2Y26A 2ZAAA 4IEWA 2R1BA 1MVQA 1QNWA 5FO8B 1OQEA 3B01A 1S0GA 4KWJA 4AVVA 4LR4A 4MGKE 2YY1A 2XJQA 4QM8A 1CONA 1T6GC 2DVDA 5CFCC 1ZZ9A 1YWKA 4JVAA 4LUKA 2YGMA 2KM2A 3ST7A 1H2NA 2IXLA 5D1IA 5FDBA 1GQGA 3SH5A 4AXOA 3DGTA 5C4WA 1NY72 2VOVA 4Q4Y1 3AX4A 4IL7A 3MF9A 3ZSMA 4FBFA 2ZHLA 4XEZA 4YW2A 2ZGTA 4YW4A 5CVRA 1RHI2 2A6WA 5ABJA 4C91A 1SEFA 3INAA 3ZXLA 5A3LA 1AR72 2XBO3 1EV11 2UWBA 3RYRA 1AVBA 1HXS3 1Z7S3 4AVCA 3RMYA 4FTEA 1VRH3 1COV1 3WQ0A 5LRRA 4Z1VA 1QDOA 2DU0A 1QJY3 1POV0 1QJX1 2I74A 5C33A 2Q30A 1RUF1 3WOGA 4D7SA 1VBA2 4AI0A 1YFUA 1UU5A 3ZIXA 4Q4V1 3H50A 1C5IA 1S0BA 3D82A 4ITCA 1SDWA 4QQHA 4LO4B 4FPYA 3MGUA 1AZDA 1UPIA 3GZUC 5CNAA 2C5DA 3R6SA 1WMEA 2X29A 3KQRA 1V70A 2GC3A 1SACA 1KJLA 1CAVA 4M3CF 1ZBA2 2ZHNA 3CJIB 3VHNA 4HKWA 2Y0IA 1VBC1 2BQPA 3KGLA 1TEIA 5K7PA 1QDCA 4COYA 4RA0A 1GR3A 1J1LA 2DV9A 5BNPC 3M2MA 3NWKA 2XJRA 1GQHA