3CJIA

Structure of seneca valley virus-001
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
258
structure length
258
Chain Sequence
STDNAETGVIEAGNTDTDFSGELAAPGSNHTNVKFLFDRSRLLNVIKVLEKDAVFPRPFPTQEGAQQDDGYFCLLTPRPTVASRPATRFGLYANPSGSGVLANTSLDFNFYSLACFTYFRSDLEVTVVSLEPDLEFAVGWFPSGSEYQASSFVYDQLHVPFHFTGRTPRAFASKGGKVSFVLPWNSVSSVLPVRWGGASKLSSATRGLPAHADWGTIYAFVPRPNEKKSTAVKHVAVYIRYKNARAWCPSMLPFRSYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polyprotein
publication title Structure of Seneca Valley Virus-001: an oncolytic picornavirus representing a new genus
pubmed doi rcsb
molecule tags Virus
total genus 48
structure length 258
sequence length 258
ec nomenclature
pdb deposition date 2008-03-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3cjiA00
1AYM3 4Q4V1 5FMOL 5D8AA 2XPJA 1RUC2 1H8TB 5JZGA 1F2NA 5DDJ3 1BBT1 4RS5A 5BNPB 1VBC2 1VAKA 2RMU1 5CFDC 3JBG3 4IV3C 1HRI1 2WFF1 4Q4Y3 4PDWC 1VBA1 1OOPB 1VBE1 1Z7S3 3ZFFB 1BEV2 1PO23 3ZFEB 1BMV1 1RUG2 3VBHA 3VBFC 3NAPB 1AL21 4Q4X2 2WZR3 1VBD2 1R083 4N43C 3DPRB 1EV12 1VBB1 1AYN2 3S6PA 5CFCA 1MEC1 1NCQC 2PLV2 4GMP0 2RR12 1PO13 1QQP1 4N53B 1AR71 1RUC1 1F8VA 2ZAHA 2HWC1 1X36A 3VBSB 4GMP1 2FZ1A 2HWF2 4GH4A 4JGYB 1RVF3 1H8TC 3JB4C 1RUD1 1RHI1 1RMU3 5BNPC 1QJU2 3VBUA 1K5MB 4CDUB 3VBOB 5BNNA 1COV3 1QJZA 1ND2B 5J98B 1RUG1 1RUH1 1X33A 5K0UB 4Q4V3 1OOPC 2XBO2 3ZFFC 1GFF2 1FOD2 3ZFEC 1BBT3 1VBD1 4AEDB 3NAPC 2HWE2 2RS33 1QJX2 4CDQA 2HWD2 2RS53 1NY72 1TMF1 2RMU3 4RHV2 1HRI3 3DPRC 2WFF3 1RUE2 1RUI2 1VRH3 1VBA3 1VBE3 4BCUA 1HRV1 4FTBA 5A33A 4EJRA 4JGZA 1D4M1 4N53C 2GH8A 4CEYA 4FSJA 2HWB2 1AL23 1HXS1 2WS91 5C9AB 1AUYA 3VBSC 5LK7B 4JGYC 5AC92 1ZBA1 2R072 1NCRA 4PDWB 1VBB3 1MEC3 1NA1B 1W39A 1K5MC 3VBFB 3VBOC 4CDUC 1QQP3 4QPGA 1AR81 1AR73 1PGL1 1FMD3 3ZFGA 1ASJ2 1ND2C 2HWC3 4WM8A 5K0UC 4IV1B 4GMP3 4GB32 3TN93 1AR61 1QJX1 2DF7A 1RUD3 1RHI3 1FPN1 4AEDC 1MQTA 1R092 1EAH2 3J8F2 1AL0G 1C8NA 4FTEA 1B35B 1RUJ1 1ZBE1 3ZXAC 1RUG3 1RUH3 4Q4W1 1TME2 2BPA2 1VBD3 3M8LA 2RM22 3CJIA 1TMF3 4WM7B 5C9AC 1QJY2 2MEV1 1RUF1 5A32A 1AR91 2X5IA 1ND3B 1SMVA 1NA1C 5A33B 1HRV3 3JB8A 1PVC2 4YVWA 2R042 5ACA3 3VBRA 1D4M3 4RR3B 1C8M2 4GB31 4CDXA 5C4WA 5C8CA 5FMOS 2WS93 1HXS3 1V9U2 1PIV2 2R062 5L7OA 4IV1C 1ZBA3 2RS13 1RB8G 3VBUC 1R1A3 1B35C 1NOVA 1AYM2 3VDDB 1AR83 1CD3G 5DDJ2 5CFDA 4IV3A 4Y4YA 1VBC1 2RM21 4RQPB 1AR63 3JBG2 5BNOB 1FPN3 1QJY1 1POV1 4Q4Y2 4QPIA 5GKAC 4WM7C 1RUJ3 1BEV1 1Z7S2 2ZTNA 1PO22 1ZBE3 1PVC1 5D8AB 5JZGB 1ND3C 4RS5B 4Q4X1 4Q4W3 1PIV1 2WZR2 1EV11 1R082 4RFT0 4RR3C 1AYN1 1PGW2 2PLV1 4SBVA 3JD72 2BFUL 2RR11 2MEV3 1PO12 1RUF3 1AR93 1H8TA 3VBHB 4Z92B 2HWF1 4QPGC 3VDDC 1RVF2 5C4WB 1QJU1 1NG0A 1RMU2 4CEWA 4WM8C 5CFCB 4RQPC 5BNOC 1MQTC 1OOPA 3ZFFA 1HX6A 3ZFEA 1RUC3 4Q4V2 3NAPA 2XBO1 1FOD1 1BBT2 3IDEA 4GH4B 5D8AC 2HWE1 5JZGC 1VBC3 2HWD1 3DPRA 2RM23 1NY71 2RS32 4RS5C 2RS52 4RHV1 2IZWA 3VBUB 2RMU2 3JD71 1RUE1 1HRI2 5BNNB 2WFF2 4QPIB 1RUI1 4N53A 1VRH2 1VBA2 1VBE2 1BEV3 4CDWA 1PVC3 1BMV2 3VBSA 4JGYA 1OHFA 2HWB1 4Q4X3 1AL22 3VBHC 5ABJA 5AC91 3VBRC 1EV13 2R071 1CJDA 4CDQB 5C4WC 1AYN3 1K5MA 1VBB2 4CDUA 5FOJB 4YVSA 2PLV3 1MEC2 2RR13 1ND2A 5CFCC 1QQP2 2ZZQA 5K0UA 1AR72 1ASJ1 4FTSA 1FMD2 2VQ0A 4JGZB 2HWC2 2HWF3 4AEDA 4CEYB 3TN92 2RS31 2RS51 1RUD2 1RHI2 1R091 1EAH1 1QJU3 3J8F1 4GH4C 4CEWB 1NCRB 1VRH1 5BNNC 4QPGB 4QPIC 1OPOA 1POV0 2FZ2A 1RUH2 3ZFGB 4NWWA 1TME1 2XBO3 2BUKA 1FOD3 4WM8B 5C9AA 1VB2A 2HWE3 1QJX3 2HWD3 1MQTB 4PDWA 4RHV3 1TMF2 3JD73 1NA1A 1RUE3 4CDQC 3VBFA 1RUI3 1FMD1 1M06G 2R041 1HRV2 4CDWB 5ACA2 1C8M1 4N43A 5J96B 1D4M2 4NWVA 4IV1A 3TN91 2HWB3 1HQNA 1V9U1 2R061 1NCQA 5ABJB 4JGZC 2WS92 1HXS2 3HAGA 5AC93 4CEYC 2R073 2WWSA 3CJIB 1ZBA2 2RS12 1B35A 4YVSB 4CEWC 1R1A2 1NCRC 1AYM1 5A32B 2QQPA 2X5IB 1AR82 5DDJ1 1ASJ3 1PGL2 4YVWB 3VBRB 5BNPA 4CDXB 4GB33 3ZFGC 5C8CB 3JBG1 1AR62 5L7OB 2TBVA 1R093 1FPN2 4Q4Y1 1EAH3 3J8F3 4WM7A 4LLFA 1COV2 1RUJ2 1Z7S1 1DDLA 1PO21 1ND3A 1ZBE2 2BFUS 5ACA1 1E57A 4RR3A 1TME3 5CFDB 2WZR1 4IV3B 4Q4W2 1R081 1VB4A 4CDWC 1PGW1 2RS11 1IHMA 2WLPA 5ABJC 1QJY3 1POV3 2Y26A 1R1A1 1PO11 3CJIC 2MEV2 4YVSC 1RUF2 3VDDA 1AR92 2R043 2GSYA 4N43B 2X5IC 1RVF1 1A6CA 1C8M3 1WCDJ 2BBVA 4Y5Z0 1RMU1 4YVWC 1NCQB 4RQPA 1V9U3 1PIV3 2R063 5BNOA 4CDXC 5C8CC 3VBOA 1COV1 5L7OC 3LOBA 3FBMA
chains in the Genus database with same CATH superfamily
2QDNA 1UPSA 3SCGA 5A1LA 5D8AA 2ZGOA 4YZ5A 5IVJA 3TEWA 5EPAA 3O14A 5CZKA 5J7MA 1F2NA 1PX3A 4KU8A 2I07B 1AZDA 5BNPB 4JQTA 3FJSA 1EPZA 4RGAA 1N3PA 1LGBA 1FV2A 3MI8A 3FZ3A 4G9SB 2CSGA 4BQYA 2CAVA 2LS6A 1W8UA 3OCPA 4JDOA 4JDNA 2WFF1 4Q4Y3 4P5YA 1SHWB 2VD7A 3PVNA 3D6EA 1WA6X 1MS8A 1O6UA 1W6QB 4XUOA 2JENA 4AQ6A 1I5ZA 1XQNA 2ZPXA 5FZHA 1BMV1 2VZRA 1RUG2 4W8JA 5IT6A 1OD5A 5KHJA 4RYDA 1AVBA 2EXIA 2DFBA 3QLQA 4CP9A 2Y34A 4NIGA 3B93A 4MUVA 1XE7A 3SEPA 2Y6KA 1FYUA 4QXBA 4E8DA 4Q4X2 4XHBA 1R083 2VMGA 3VD5A 5FY4A 3DPRB 4FVVA 4OHVA 3V56A 2FDHA 1VBB1 1MZ5A 1AYN2 2PHTA 2QZ3A 4HK9A 3RWKX 4XFIA 1MEC1 1W8NA 2YFUA 5JXIA 4H2AA 3ALQA 1ENQA 2C0ZA 3KV6A 2RHPA 1H6YA 5GZGA 4N53B 3OPWA 1MR5A 4DIQA 1RUC1 5C7GA 3AJZA 4XJZA 3IMNA 1SFYA 4IDZA 1XE8A 2HWC1 2PAKA 3B5LB 3POBA 5FK8A 5I8TA 4BMBA 2TNFA 2WZPP 2JE8A 4DY5A 1N1VA 4D6RA 5IATA 3OPTA 4FOYA 4NHXA 5FZIA 3LE0A 5BNPC 1CX1A 1OQEA 4GJYA 5FPVA 4LK6A 1LHVA 4TTGA 2A1XA 1CJPA 1K5MB 4H7LA 4MXWB 4CDUB 2H0VA 1COV3 1EUTA 5CB7A 1QKQA 2GC1A 3CJXA 1ND2B 1JODA 2W08A 4XFAA 1WLTA 5J98B 1RUH1 5K0UB 3PU3A 4Y20B 3WOGA 1PK6B 2Z69A 3WF1A 1GZWA 1NE6A 4K6BA 1IS6A 4A7KA 1ULEA 2PMWB 2BJSA 1BBT3 4GKYA 4CCEA 4Y22A 4GZ9A 4UFJA 1X50A 2HWE2 5A6ZA 1MS1A 5JLVA 1NY72 5FY0A 2MHFA 1DQ2A 3FE5A 5D21A 4UFMA 3DPRC 2WSUA 1RUE2 1YFWA 1IKPA 2JDZA 2RVAA 4KGGA 1GANA 4UI9L 1DGWX 5HV0A 2I45A 1VBA3 5FYMA 4QM9A 1VBE3 5LCWL 2Z2SB 2ZX0A 3FBYA 4L2NA 4YYOA 4N53C 1D4M1 2D6NA 2YPDA 2GH8A 4GWNA 2ZX4A 4J6GA 4CEYA 3NRUA 3M7AA 4XCAA 4XDPA 1GZCA 4K1YA 4Y5SA 3ZYRA 1AL23 2WS91 3N9LA 5SV5A 1OA3A 4AEKA 3X29B 2YROA 5F3EA 3BYWA 4FXKB 5JXGA 1ZBA1 1PMJX 3I2FA 3I8TA 2C4XA 3MIGA 1GNHA 3P1IA 5FR3A 2E33A 4L11A 4HZFA 1OLMA 3THCA 4YZ4A 1W39A 4LBNA 1K5MC 3VBFB 4BOWA 4CDUC 3D82A 1GNZA 2Q1FA 2WR9A 4P9GA 1PZ9A 3VLBB 4DUVA 5JI7A 4W50A 1ND2C 1W6PB 5L9BA 2D5HA 2Q5TA 2CV6A 5K0UC 5CU1A 1PK6C 1CAVB 4A41A 3TN93 1QJX1 4P00B 5FY5A 5GALA 4QX7A 3NV3A 1HN1A 1RUD3 3F2ZA 2VUAA 1RL3A 3LB9A 2HEYF 2B42B 2Z42A 4XEZA 1R092 5FY7A 3ZYJB 3KT7A 4AE2A 4L97A 2W87A 2E63A 1YWKA 2J1UA 2ZGMA 5FZKA 3WF2A 4LMFA 5FYUA 2HKXA 2P6HA 2QUOA 1G7YA 1RUG3 5HXMA 1JYWA 2BVVA 1UOJA 3ZN5A 4Q0SA 4QM8A 2L9LA 1H4GA 1ZA7A 2YDEA 3LEMA 4Q4W1 2W68A 2ZX1A 1HLCA 4PHZA 2PELA 4NUBA 2OYZA 4HN1A 2W94A 1KJRA 2YC0A 3U07A 1SDWA 1TMF3 4L99A 4WM7B 2VCAA 1QJY2 1TVGA 3V0AB 4KU7A 4QX8A 3A21A 2MEV1 4MGTA 5DAPA 2EA7A 2K0GA 1G8WA 1OKQA 1RUF1 2QQLA 3WCRA 3T09A 4K3UA 3ST7A 1UO9A 4QX2A 1VPHA 1WW7A 4TLGA 3R4UA 5T55A 1C8M2 4GB31 5F5CA 4NPLA 5C4WA 1BJQA 5C8CA 4DEVA 3ACGA 3J7HA 1O91A 4XJ9A 1MZFA 1PIV2 1Q8VA 2R062 3H50A 1OFSA 1VP6A 4KWLA 3SKJE 4BQ2A 4P9WA 3ZM8A 2DVDA 5HBAA 1JZ4A 3WP3A 1AX0A 3IPVB 4AEMA 4SLIA 2D6KA 2FD8A 3OGVA 4AGRA 5FZ3A 5F37A 2DU0A 1CD3G 3J4UH 5DDJ2 3UESA 2DUPA 3NO8A 5IK4A 5I8YA 3O1MA 1STMA 3C7OA 2RM21 5K4LA 4IXLA 4JAAA 4UFLA 2CWMA 4A42A 2KD7A 1AR63 3OUHA 5FZLA 2WN3A 4XJ8A 3PU8A 4WZFA 1POV1 4AHWA 5FAXA 4YW2A 1QGLA 1YHFA 3ZXLA 2F4PA 3WLUA 4QPIA 4ATEA 3GDBA 3AK0A 4LA3A 2EIDA 4WM7C 5FZEA 1EP0A 3PTRB 3SKVA 3SQOA 3VHOA 4BXSV 5IFPA 4MG2A 1S2KA 1PVC1 4UBGA 1S1AA 3JCIA 4W4ZA 5FZOB 4WBBA 3I97A 3UGHA 1S0JA 2EAAA 1CN1A 1ZREA 3BCWA 1O8PA 2V5DA 1H30A 5EJ3A 4BWOA 2ID4A 4KG8A 3ZKUA 4COUA 5GJ6A 1W99A 3MUZ1 5H9QA 4O7XA 3WINE 1WGPA 1QU0A 5FBZA 2BFUL 2RR11 5TSWA 4BA6A 3KZ4C 4HG6B 2ZHNA 1DQ6A 2WINB 4XILA 4QQ2A 4BQ4A 3RWNA 4YW6A 4DEQA 1LB2A 4XHXA 1N3QA 3O1PA 2R1BA 1DQ0A 2Z79A 4ISQA 2FDFA 4QD2A 4UBHA 4K7JA 2ZEWA 2XOMA 4S2HA 4CEWA 4WM8C 1LNSA 4A7YA 4AVTA 5GM0A 1XXNA 1UMZA 1D2QA 2RJLA 2UY8A 2YU1A 3JU9A 4R52A 5F3GA 3KF5A 4TXWA 4ZU7A 1G9DA 4LEJA 3ZXJA 5F6LB 1HIXA 1W6QA 3RDIA 2DUQA 2LRPA 1AX1A 3T3YA 3FL7A 4OVEA 1RUC3 4YGBA 3N35A 4AAPA 2NLRA 3VHNA 2ZEZA 1LOFC 3NJXA 1M4WA 5JMOA 2WJSA 5ANQA 4QKBA 5HI0A 1UXZA 4G3YC 1I6XA 2BQPA 2HWD1 3DPRA 2W1UA 4CP1A 4RHV1 3VBUB 4FBFA 1JOJA 2IXIA 2RMU2 4HSJA 1OBNA 4JZRA 4DNYA 5FPXA 1J1LA 4R4XA 3D3AA 4AR2A 1QDCA 4P08A 1GU3A 2JKBA 3RPQA 1SQ4A 3HR9A 1KFXL 2R16A 4N53A 1VRH2 3C7GA 4U36A 2XHKA 3GZUC 5GLZA 5C33A 1BEV3 1IOAA 1PHMA 4IEYA 4LBQD 5FZFA 3SCHA 1KGYA 4ZXEA 3POGA 4AI1A 2EXKA 5A3OA 2HWB1 1BKZA 1NE4A 5ABJA 4A45A 4FAGA 1O3SA 1EV13 4P9LA 2MNGA 4CDQB 5F9TA 4XQDA 1W3XA 1K5MA 4CDUA 4MXWA 1LENA 1D4VB 4COZA 5A1AA 2PLV3 2VOWA 2HBTA 1W0PA 4UW3A 3TAYA 2WNOA 1IQDC 1HDKA 3M3EA 3MDPA 4B4RA 4NIAA 1ND2A 4XTMA 3AVSA 1G86A 1QQP2 5FLJA 1KJLA 5K0UA 1AR72 1DGLA 4Y20A 1ASJ1 1PK6A 2HJIA 3KT4A 2BOJA 4Q27A 1RJ7A 4D69A 4BIOA 1OXCA 4LUKA 2HWF3 3VD3A 3O5SA 4Y33A 2ZKNA 5EP9A 3M3QA 3MZHA 4DFSA 4XFGA 4XPVA 3HWJA 1QXJA 2VMIA 3I7DA 1RHI2 2YC2A 1QOSA 5F6KA 1QJU3 5LA2A 1Q5OA 1G6NA 3WV6A 2AEYA 1F15A 2KXLA 1SBFA 4K20A 3CLPA 3CL1A 4OUEA 1F9KA 3OD4A 3TBDA 3CQOA 1KS5A 1GZ9A 4FPGA 4B1LA 5GZFA 5LB6A 5JAXA 4FPHA 2VQTA 4OUMA 4ASLA 4HFSA 3WF4A 2XBO3 2BUKA 1JYTA 2P5BA 2A75A 3I2JA 5EWSA 3A23A 4LBQB 1YNAA 4HANA 1QJX3 4FFFA 2BGPA 2ZX3A 3VUOA 2ET1A 1W8FA 3IIIA 1MQTB 5LA9A 1SLTA 2A6VA 2DUOA 4LKDA 4CDQC 3T0DA 3VBFA 1RUI3 4IW3A 3WHTA 1DZTA 2A3YA 1M06G 2VO5A 1W6PA 1HV0A 1HRV2 3NJYA 5DAWA 4N43A 4FXGB 3TRSB 5J96B 1HN0A 4Q1PA 2J22A 5HCHA 1CAVA 2C1FA 4CP0A 1KITA 2FBEA 1HQNA 2FMDA 4XIOA 5E1RA 2YV8A 1W8TA 3GCWA 1XNTA 1W2AX 2K9ZA 1X8MA 1W0NA 3CJIB 1F31A 4F8AA 2JG9B 1JYXA 2WQ4A 2A6XA 1GICA 3LPGA 3C7HA 4IERA 1GOHA 3JZVA 4Q8LA 1SLIA 4YVSB 3WW3A 1W04A 2VOXA 4R4ZA 4C0BA 4OLLA 3EYPA 1YQCA 3K46A 4Q5OA 4D6QA 3UKVA 1SPPB 2WZEA 5C71A 5A32B 5A7OA 1DP0A 2BEOA 1N1YA 2X5IB 5BPXA 2PHFA 5JVVA 3OY8B 1AR82 1PGL2 4GJZA 1PMHX 2VZPA 3CMGA 4R9AA 3T1MA 3VBRB 2VL4A 5EZWA 4GWJA 4CDXB 1KD7A 5BXXA 1D2SA 4GB33 3M4FA 3J7NA 3MV01 2EAKA 1WWYA 3AP9A 5L7OB 2RDNA 5GZCA 1TG7A 2YFZA 2DYCA 4Q4Y1 2BP6A 4WM7A 3OF1A 4QMAA 1YC61 1S2BA 3K48A 3V0AA 1XNCA 1OH4A 1V6KA 3ECQA 2GP3A 2ZMNA 4K1ZA 4LNVA 3N36A 4XF3A 1JUHA 5BYNA 2JX9A 3VDCA 1RUJ2 4QQPA 1NZCA 5FO8B 2QQMA 1ZBE2 3A4UA 3K3NA 5ACA1 2VBPA 5JSOA 4HXCA 1AJOA 5FYCA 1H9WA 3GBWA 1JI6A 1P8JA 1DFQA 3RSJA 1K42A 1R081 4D6SA 4K40A 4CXXA 3WNPA 3ZPYA 3BOWA 3ZYPA 1GKBA 1LODA 4FPLA 4UFIA 2NPIA 3RZZA 4E2SA 3U14A 1LESA 2W1SA 2GDFA 2WSVA 2WLPA 5CKQA 1POV3 1JZ7A 3V65A 1XNDA 1SFPA 1ENXA 3UL2A 3ZR5A 3IPVA 5FZ4A 3CJIC 2QBXA 2JG9C 2XJSA 3DKWA 3LKJA 3AC0A 4I02A 3VD7A 4A2UA 4YVSC 1TEIA 3T4HB 3HQUA 3MIDA 3N9MA 3NNMA 1V6OA 3FHQA 2R043 3WDVA 1J1TA 2DWRA 3AKSA 2X5IC 2CY6A 4UW4A 2OUHA 5DAXA 1SCSA 4Y5Z0 1GMMA 3RFRA 3N9PA 1LOEA 1V9U3 1XNKA 2PA7A 3ZYIB 2WQ8A 4CDXC 2VBDA 2XVLA 5I91A 1GBGA 3VZNA 3ES1A 2J1RA 1COV1 1MS4A 1XBFA 5L7OC 4GKXA 3LOBA 1R64A 1C1LA 1VJ2A 2XJRA 2UYAA 3RI9A 5JCTA 5CAZA 3POIA 2OZJA 1LOFA 2D98A 2CHHA 3FBMA 5K9YA 1OLME 2WO2A 2DFCA 3ZYGA 2WA4A 2IVJA 3D0SA 5FMOL 2XPJA 3VKLA 1XNBA 1H8TB 1XSRA 3LA3A 4NRPA 4LIVA 1BBT1 2QCSB 5DG1A 3RMYA 3D8CA 1L7QA 4BZ4A 5FTTC 1VBC2 1GR3A 1VAKA 4LBJA 3VDAA 4AQSA 4MOAA 2AGSA 4Z82A 2E6VA 3JBG3 4HT1T 5FJHA 4UAPA 5CEHA 4MZUA 4DB5A 1GQGA 3O1SA 4X6RB 1ULPA 2Y0IA 4W6XA 3I3MA 4KBBA 2YU2A 4LE4A 4V2VA 4PDWC 1VBA1 1OOPB 1VBE1 5KC6A 4NIHA 1Z7S3 3KF3A 3AYCA 4Q2FA 1PO23 1WA4A 4JKKA 4S2FA 2OS2A 2ZMKA 1W8HA 2DBNA 5JPMB 1S0EA 1T6GC 2TUNA 3M2MA 3HBKA 1UMHA 4B7KA 1JYIA 1AL21 4HVRA 2WZR3 1VBD2 4BIFA 4KH9A 3AFGA 3Q8AA 2VM9A 2W95A 1PZ8A 4DXZA 1AJKA 2JXAA 1W6MB 4FP3A 5DQ0A 1WKYA 1C5IA 4RL7A 1PO13 4BMEA 4CRQA 1V00A 3EXUA 3LSEA 1A8DA 3AMQA 4YG3A 4LA2A 3PIGA 4XE9A 4MGKE 1QWRA 2VZVA 3I2OA 2VOKA 2VCCA 4A6OA 1CZTA 3KLSA 2AUYA 1C4RA 5EYYA 3IKWA 1JOPA 1H8TC 2DURA 2XWBB 4CCNA 1HB4A 1RUD1 2VNVA 1RMU3 3LIGA 1RINA 4PBOA 5CKMA 4FAHA 3VBUA 3WF3A 1Q8OA 1JN2P 4KWUA 3U75A 5CG8A 3VBOB 1IPSA 3EB7A 1U5ZA 1UF2C 2CGPA 1O4YA 1WLCA 4AVCA 4AW7A 3S57A 3QCWA 1RUG1 3ZN6B 1S0CA 3CU7A 5FLIA 4Q4V3 1QJFA 3Q8EA 1OOPC 3IDAA 4Q26A 5FREA 5IAXA 3ZFFC 1O3TA 1FOD2 2YB7A 4OZXA 4BISA 1SCRA 4URAA 2MPFA 2VC9A 1UZ0A 3I2DA 1JYCA 1ENRA 5DZGA 4CDQA 3CEWA 1TMF1 1TQ5A 2WC2A 3WQBA 3AMNA 3WUDA 2W39A 3U1XA 5FPLA 1HRI3 4DXRA 4ET7A 2QQWA 2VG9A 4QXKA 4K21A 4AZZA 3ZSKA 1LEDA 3H8OA 4LBLA 2X8KA 4N90A 2BV4A 2Y6JA 1NXMA 2JDUA 5A33A 3CKHA 4TYSA 3GBGA 4EWDA 5FCCA 2JIJA 5FIXA 4HSLA 5T5LA 1YFUA 5FP9A 1CPNA 4Y4RA 5C9AB 4RN5A 3NL1A 2I74A 5AC92 5LK7B 1YQ2A 2R072 1SBDA 4K8FA 3UYJA 2EIGA 4Q0PA 2JB4A 5FZGA 4AVBA 3HEIA 2D44A 3PJQA 1NA1B 3MIBA 1S55A 2VW1A 3K77A 3VBOC 5JI9A 4D3WA 5C3RA 2BRTA 3W58A 2UWCA 1RUNA 5SV8A 2ZMLA 5A7QA 1GWLA 4IV1B 3W59A 4GMP3 1AR61 2ZXQA 2DF7A 4LBQA 4M01A 2Q8OA 3BTXA 4FPEA 3NV4A 2Y6FA 3L2HA 1DG6A 1MQTA 2VZOA 1YIFA 3OJBA 1ZNPA 1EAH2 3J8F2 3MF9A 1N1TA 4YM3A 1PVXA 3PL0A 4FTEA 2WN2A 1B35B 1JYVA 3IIAA 3KT1A 1PMIA 2W1WA 4E4DX 1FNZA 3DL3A 1RUOA 3S7EA 4ZY9A 2GMEA 3SXWA 1FATA 5C3PA 3UJOA 1L7LA 1UU5A 2SBAA 1J83A 1WW6A 1L3JA 2QNKA 4HN0A 3AP6A 4DPNA 3WDYA 3WW2A 4YG0A 1TME2 4DUWA 4IE7A 5FV3A 4XAAA 5D2AA 4D0QA 1VBD3 2E53A 3CO2A 3TNQA 3M8LA 3RZHA 4CXYA 4OFGA 4DINB 3LD8A 3CJIA 4M0HA 3H1YA 2JG9A 3F95A 5L9RA 5C9AC 3PHMA 2D40A 5HXVA 4FPYA 4OZOA 3B9IA 2ARCA 3VGIA 2PYTA 3KQRA 1F4HA 1SPPA 5A32A 1CGPA 4LBMA 2X5IA 1ND3B 5A3LA 1NA1C 4EN7B 4FCAA 1CAUB 3WP5A 2VMDA 3MYXA 2ZOEB 2LROA 4A6SA 5ACA3 4QKFA 3CBNA 4LBOA 3VBRA 4RR3B 4PI2A 4CDXA 1CZSA 4H55A 4AYUA 2XR4A 4I0BA 4JHTA 2X05A 3VL9A 2E51A 4Y1UA 1HXS3 3TWIA 3AVRA 5L7OA 3B3QE 5FKBA 3UJQA 1C1FA 1OLQA 4C0HA 1Q56A 4IV1C 5FY8A 4OI1A 3IBMA 1NYWA 1I3HA 2EIEA 2XH6A 1J58A 3ES4A 1RB8G 1JHJA 4AI2A 4YFZA 5FZ9A 1ZRIA 1W90A 1ZYBA 1B35C 2A5ZA 1AYM2 1UXXX 5KHHA 3U4SA 2P34A 3I2KA 2WNVB 4EROA 4P9IA 4DRRA 3O1OA 1ULOA 3VHRA 3MGUA 5FP8A 1W2OA 3EO6A 3POEA 1O4ZA 4FPCA 4FPFA 2FMYA 4MGYE 4Y4YA 3U78A 3RS6A 4RQPB 2SLIA 1FPN3 1O7FA 1NQJA 1QJY1 2P4EA 4FFIA 4E2QA 4BHPA 3HNBM 2WNEA 4KG0A 3WG3A 3U0ZA 4LHKA 2LUWA 2X10A 4RGGA 4UT5A 5GKAC 2RV9A 4OI4A 4FQ4A 3JQXA 1Y9MA 1BEV1 2YPJA 4X8PA 4XJUA 1E5IA 4UFKA 1DYOA 1S0IA 2ZTNA 3E5QA 3J26N 3NNGA 3O0WA 5C6CA 2A3WA 1T2XA 1H2KA 1KQRA 2PHXA 2J1SA 3AL5A 1ND3C 4QB2A 2P3IA 4YM0A 1XPWA 4ES8A 1W28A 1PIV1 1QNWA 1EV11 3P6BA 1LAJA 2Q1MA 3HD8B 1RIRA 4RR3C 3GZTB 3L2YA 4LIUA 2ZGPA 4CUCA 2X53S 1PGW2 2CYFA 2YC4A 1BXHA 2J1EA 2PLV1 3JD72 4TSVA 5IAVA 5KXCA 5A3NA 1EYBA 5A7SA 4TWTA 3ZXGA 2XKPA 2Y6HA 5FZAA 1J3RA 1HJFA 2QJVA 3AMPA 4M00A 5DN2A 1AR93 3POFA 3BTZA 1WCKA 2FDJA 1H8TA 1ZM1A 3PVBB 4NJ4A 1YCIA 5A7PA 5B2GB 2HH9A 5DUUA 3VD4A 3TOJA 1IQAA 2HWF1 2IC1A 1AXKA 4GULA 4QPGC 2NP0A 1CX4A 5F2WA 1KDMA 1RVF2 2WAAA 2WNVC 3H8UA 4HMZA 3DXTA 1QJU1 3VKNA 3WX5A 4XF0A 2FCUA 2ORZA 1WZXA 1XE0A 2WRAA 2G4IA 4XJWA 3UKNA 4DQAA 5CFCB 4RQPC 4XJAA 1JS9A 3SCFA 4BQ3A 1WMEA 3MIFA 1REEA 2YMZA 5C3QA 2ARAA 3E5XA 1OOPA 5FXWA 1NXD1 3ZFFA 4B7EA 4TN7A 3HIFA 3PUAA 5GLWA 2CDPA 3G6JB 2XBO1 1QEXA 1E5HA 3THPA 3WZ1A 5FZ0A 4YW5A 1UY1A 1XYOA 4GH4B 2OVUA 4LUMA 2XVKA 5EV7A 1SG3A 4WVVA 1V6LA 2G1MA 3GGLA 5L36A 2RS32 2JG8B 4I30A 5FYBA 2RS52 4YARA 1FT9A 2WZ8A 4DRVA 1QIQA 2FHRA 1AXZA 1W6MA 3VN4A 2WFF2 3D5OA 1URXA 1REFA 4B29A 3NQHA 1RUI1 2XUMA 3OGGA 3T2PA 4BJ0A 4QX1A 1K12A 1PZ7A 2OPKA 1OF4A 2D7FA 3LA7A 1YJLA 2R49A 2VGDA 4N8MA 5J37A 4LHSA 2O14A 2VOTA 4CDWA 1J3PA 1BMV2 1OUXA 3WQ1A 2E32A 2PXJA 1N47A 2YBPA 1OHFA 3O7OA 3UT0A 1VIWB 5FWJA 1W06A 4Q4X3 1H4HA 4MV2A 4IQPA 4YW3A 3VZJA 3OUJA 1CJDA 2AR6A 4QU1A 5IVFA 1Y3TA 1AYN3 2EICA 1XYPA 1VBB2 4NIIA 3OD0A 1WMDA 1HW5A 1U5XA 2GNMA 2BYVE 2HEWF 3ACLA 3K4AA 1MEC2 5FOJB 3BUCA 3C8XA 4LO8A 5LA0A 4QDQA 1ZX5A 2EXHA 4CCMA 4Z1VA 5CFCC 4E4SA 4LT5A 1YLLA 2ZZQA 3DYOA 3ZMOA 4Y1YA 3USUB 4GAZA 1C5HA 4S2DA 5D1IA 3ZN6A 5LBCA 4BH9A 4OMDA 1FMD2 3H42B 3OG2A 1MACA 2VQ0A 3TEYA 4JGZB 5LRSA 4KQ7A 1O8SA 2HWC2 3H3ZA 2GNBA 4XOGA 3WR0A 2C9AA 1YO8A 4IUGA 4XF9A 2BU9A 1RC6A 4BQXA 1JZ5A 3BB6A 2DV9A 2CGOA 2QQUA 3G7DA 1IZ3A 4DZGA 4QQLA 4NOTA 5K7PA 4GH4C 1KFUL 4PLMA 1YQ5A 3RZJA 5JDBA 5IVYA 2H6BA 1O4TA 2JG8C 5JIUA 1GP6A 1VRH1 4AFDA 2WIIB 2VR4A 1OPOA 2HBUA 2FZ2A 3NV1A 1RUH2 3LA2A 4KBZA 5J48A 3VHPA 1G9BA 3KMHA 3T2OA 4WM8B 3EQEA 5A3TA 1HJGA 5C9AA 3MPBA 1WD3A 2HWE3 3ILRA 4XFHA 5H9PA 2KA3A 3CZJA 1ST8A 3GF6A 4NE9A 3JD73 3C3VA 5C70A 3HT1A 5I0DA 1NA1A 1RUE3 5FMCA 2C24A 5A70A 1O3RA 4QX3A 3TNPB 2JDPA 2YYOA 4CUAA 5A3PA 2D6OX 5IVBA 1CPMA 3KV4A 3ZXEA 3H8RA 2GNTA 2Q8CA 3P3NA 1OA4A 5DPNA 4E4HA 2R041 2VY0A 1WLWA 1O5UA 5A6XA 5E16A 2Z5WA 3ZYHA 1D4M2 4LLOA 5FZ1A 4DXSA 4IV1A 4JC1A 1V9U1 2BERA 2A70A 3MBWA 4JGZC 3H7YA 2WS92 1RJ8A 2W52A 4IEPA 4NN0A 5FMDA 1VRBA 1JU3A 5T54A 4AFCA 1H2MA 4PQQA 1ZBA2 2AYHA 4X6QB 2JJ6A 2RS12 1JXNA 1B35A 1DGRN 4CYDA 4XMAA 3PTYA 1R1A2 1W6OB 3AZWA 4K9SA 2NQYA 2QFEA 3I3QA 5F5IA 4QX5A 1RTVA 1D0GA 3BTYA 3N9OA 5E89A 3MLJA 1X82A 2W91A 3MFCA 2VAUA 4ZU5A 1EPWA 2OQ6A 4Q8KA 5FYYA 5BNPA 3J7LA 1H8VA 3Q9OA 4UFHA 5EJ1B 4XF4A 1ZZ9A 4QPYA 3JBG1 1J59A 1H1AA 1OMIA 2TBVA 1R093 4PQ9A 3CZUA 3AKRA 2VTXA 4J25A 3LZZA 3BI3A 5J1XA 4Y5TA 1H1IA 4LLFA 5CADA 3ZIXA 2LW8A 2WT0A 2WLQA 4XUQA 3UV9A 5FK7A 4OHYA 4Y1ZA 1WCQA 1Z7S1 3ENRA 4XDOA 1PO21 5HCBA 1ND3A 4I3PA 1OI6A 4B1MA 1CAUA 2JWPA 2VNOA 3E6BA 4PLOA 4AEJA 1JH5A 5IYYA 4GD4A 3U4XA 1RXFA 5ISLA 2YZ4A 3PVOA 2ZCWA 4RR3A 2VCMA 1CAWB 4F7ZA 2WZR1 3GJAA 4Q4W2 4AFBA 3O12A 4JCKA 2XUEA 1YFXA 3FC0A 1JUIA 2XVGA 4AHXA 2V4VA 4AL9A 1LEMA 1QJY3 4FPOB 1Y43B 1SLCA 3INAA 2RDQA 1LOCA 3LEKA 3IMMA 4LO5B 5I0TA 1OF3A 1LECA 1F5JA 2C6SA 1BK0A 1PO11 1UY4A 2MEV2 4QAWA 3RYKA 4O61A 2XLAA 1APNA 3BALA 1RUF2 1LOGA 2A3XA 4GXLA 2WNVA 2DCYA 4MHRA 1UY0A 2ZAAA 3ACFA 4LR4A 1YFYA 3M3CA 1UCXA 3SISA 1OD3A 2CDOA 3KB5A 1A6CA 1C8M3 1UD1A 1CVNA 3DYMA 4PBPA 2GC3A 2BWCA 5ANNA 3R4SA 1RMU1 4DUXA 1NCQB 4RQPA 1PIV3 2DCJA 2IFWA 2R063 1LCLA 2GMMA 3OYWB 5FOBB 2WO1A 2ZS6B 3A22A 5FXZA 4HKWA 2YG0A 3HMYA 2QQVA 1W9YA 3CDZB 4V1PA 4G4FA 4Q29A 4M3CB 1XSQA 4Q4V1 5IFTA 5E6HA 1CZVA 5IWFA 2VUDA 5IUQA 3IZOA 1H1MA 4MXVA 5DDJ3 5JMCA 2UWBA 4AFAA 2XLGA 1PNFA 1LHWA 2P3KA 2Y60A 1S0DA 1OSGA 4NPRA 1FV3A 5E88A 1MZ6A 1WW4A 5CVRA 3HT2A 1O3QA 2WAOA 1HRI1 2GALA 4QHBA 2D3SA 5EQUA 3H1MA 2JDHA 3RJRA 2H6CA 4EE2A 1CONA 2HEVF 3AYEA 3K3OA 4LE3A 2BNOA 1W2NA 5CNAA 3ZIWA 1CIYA 4C1WA 5F1RA 2V73A 5DABA 3IM0A 4PCRA 1S0BA 4R8HA 5C5TA 4QHOA 4BLJA 5CFCA 3I59B 1NCQC 2JDNA 2VNRA 5F5AA 4GWMA 3BODA 1GYKA 1ODMA 4ZHNA 3BTAA 4IGQA 2RR12 3AZVA 3H0OA 1S4CA 2R7EB 3EJKA 3LWCA 3ZYFA 2Y33A 4AG4A 1YI9A 2VOVA 4BK4A 3E6CC 3FN9A 3PUIA 2Y8KA 4MGIE 5HCFA 2ZAHA 2YY1A 3AFKA 4XDQA 3OEAA 4NVPA 1OURA 2E7AA 2BZDA 2W92A 2XQXA 2FZ1A 4GH4A 1DQ4A 4GMP1 4P5HA 4Y3OA 3VBSB 3U11A 4HL0A 2Q4SA 2JG8A 3LDRA 4FPKA 3UKTA 5A6YA 3WQ7A 2E7TA 1VMJA 1QJEA 4C90A 3FUQA 5CA6A 1YQ8A 2W46A 3VDBA 1QJZA 1F35A 1K3IA 4XZPA 5FO7B 3W5NA 5LW9A 3PJYA 1DU3D 4ISRA 1VAMA 2P3YA 2VVDA 1SLAA 3WNXA 3TYJA 1X33A 2UURA 1IS5A 2WUHA 2NMNA 4J1XA 1CAXB 3HQRA 3O1VA 1GFF2 1H0BA 3VL8A 4H3WA 4EZHA 1VBD1 4AEDB 4JX0A 1H2LA 2YGMA 3ZSEA 4BQ5A 1YJKA 3KD4A 3I3DA 1JMUB 1UYXA 2WKKA 4NROA 2HWD2 3KHBA 3SH5A 2B45X 2RMU3 4RHV2 3KGZA 4CZSA 4HKLA 1IPJA 2AEZA 2P37A 5FKCA 2ZZJA 5GZEA 1VRH3 4HONA 1UL9A 2XJPA 3QH6A 3RG0A 3USUA 5JOXA 4BCUA 1W05A 3AX4A 4LK7A 1JU4A 2R32A 5FUPA 4FTBA 4JGZA 5FBJA 2ZACA 2G19A 3APBA 1NT0A 3AM2A 5AVAA 5FPAA 3WF0A 3RZMA 4FSJA 2HWB2 4IESA 1HXS1 4P14A 3OOXA 1AUYA 4ITCA 3VBSC 4QHZA 1G9AA 3ETQA 4YPJA 4OUSA 3T2QA 1TNFA 2J1VA 4PDWB 5BV6A 4QQHA 4DXTA 3POYA 1TNRA 4QKDA 3J9SA 2OKXA 2JDYA 1DCSA 1QQP3 2ATFA 1VR3A 4HK8A 1QXPA 1ACCA 1AR73 3VD9A 2UY9A 3ZO0B 4XCBA 4META 1ASJ2 3FFQA 4D7TA 2G9GA 5BNQA 4WM8A 1HB2A 3LEGA 3Q8FA 3WG4A 1DYPA 2VZSA 2IXHA 4V2WA 1YEWA 2G9FA 1RHI3 1FPN1 3BVCA 2GAUA 4IL7A 4NHMA 3SITA 1DZRA 4AEDC 3ZFFB 5FLHA 2HYKA 4I0WB 4CCDA 4CXWA 4Z8BA 1I1EA 1C8NA 1RITA 3KWVA 4ZS2A 2R30A 3THDA 4YW4A 1JHNA 4KNCA 2GN7A 4QDRA 4O9GA 1LOBA 5GLVA 2OA2A 1GUIA 4HETA 4AF9A 4C1XA 2N7GA 5IVVA 5KR7A 1UW8A 5FZOA 2OIIA 5FPUA 2VE1A 3WSOA 3HQXA 4CSWA 3ZSLA 4DMIA 4R9CA 5G05L 3DECA 3I49A 1GP5A 2VXJA 5AFBA 3PVEA 4PI0A 1SFNA 3WDXA 1W6OA 2XB6C 4CU6A 2GU9A 2OUJA 3EBRA 2YBKA 1AR91 5KXDA 1US3A 3AKPA 1HRV3 2WT2A 3KVBA 1UX7A 4PF1A 4XXAA 4HLTA 5H9RA 1A8MA 2P2KA 2VZ3A 3QD6A 1RGSA 2B46X 5BUVA 4XABA 1HQWA 2ENRA 4MHUA 1SZBA 3WUCA 4CU8A 1IG3A 1KXGA 2XQRA 3U37A 2B39A 3O1TA 5DUXA 4WV8A 1MPXA 2VW2A 3NMBA 3BKZA 5APAA 3RJ2X 4YZ3A 1NOVA 3HN1A 3OGSA 4J1WA 3VDDB 1AR83 4YWAA 4XFCA 3DEMA 3BOPA 1OKOA 1CAWA 2GH2A 4BU2A 4NR1A 3ZSJA 1MVEA 5FYZA 5E8AA 2WBKA 3NNJA 5DG2A 1H9PA 1NQDA 2QQJA 1QOTA 1KDKA 5FPZA 4OQ9A 3SHRA 1W9SA 4CCJA 5BNOB 3I2GA 3KM5A 3VB9A 2VH9A 5T5PA 4Q4Y2 2ZHLA 4A44A 4YM1A 2FDGA 1I9RA 1O5LA 2W9XA 3WP4A 3I3BA 1RUJ3 4NMIA 5IVCA 5B4XA 2ORXA 1X9PA 2XL9A 2JDMA 2QDRA 1BVVA 4ZU4A 1AXYA 1ZBE3 5DZEA 3W21A 1OT5A 4N7IA 3ZLIA 3UNPA 2NN8A 2PQSA 5JZGB 2XG3A 1DZQA 3USSA 1ALYA 2VNGA 1C57A 2H0BA 4Q4X1 4RS5B 5FZCA 5LASA 4BLIA 4WVZA 3DGTA 3DV8A 1R082 2WFPA 3IDBB 3NJVA 4KMQA 1AYN1 3GJBA 5F32A 3VZMA 4PIXA 3OYWA 3ETPA 1RYYA 4QX0A 2XJVA 4K8RB 3IWZA 2CWSA 1NX9A 4Q0QA 4YM2A 5LBEA 4CCLA 3NJZA 3NNFA 2JDAA 4M3CA 4AQTA 1QHDA 3CF6E 1A34A 3KGLA 1OA2A 2IFRA 2JD4A 2DDUA 3MO4A 3VBHB 1DLCA 4CPBA 3VDDC 2QQNA 2QTWB 4ZS3A 2J1AA 3BU7A 5FYHA 5JR7B 5C4WB 3M1HA 2PHWA 3ZKYA 4M3CF 1NG0A 2O8OA 3LFIA 3RQ0A 3WDUA 2ARBA 1DLLA 2HLEA 1XNAA 2D3PA 1UYPA 4Z2WA 3T30A 1YYNA 4YFWA 4D8MA 5LBFA 1Z0HA 3POJA 4X8NA 4LO4B 2ZGKA 5BNOC 1S0GA 3AL6A 1R1ZA 3GM8A 1Z78A 2IXKA 4GWIA 2W2IA 3HNYM 1HX6A 4OI2A 4D7YA 3O0VA 3B9CA 1MS3A 4WVMB 2X09A 5L19A 3S0MA 3U10A 4O65A 1LGCA 3QH7A 3T0BA 5H9SA 4LKFA 1HB1A 2O1QA 1BBT2 3WW4A 3POSA 5CIRA 2WA3A 1UPIA 2XWJB 4S2GA 1UZZA 2HWE1 5JZGC 3V0BB 1UY2A 1VBC3 2D3RA 1NY71 1BVP1 2VTXJ 3NV2A 4Q0UA 4QQOA 4RS5C 2XLFA 3ABZA 1UU6A 2IZWA 5ERLA 1UAIA 3AXEA 3E97A 3GZEA 3I59A 3JD71 4AI8A 4AOCA 1RUE1 2QQOA 4L92A 5LATA 5IJRA 5BNNB 2PAEA 3HJRA 4QPIB 4DOUA 1OFNA 2ADEA 1VBA2 4QGLA 2XJQA 1VBE2 2WO7A 1ZA4A 4XXPA 4COVA 4XMIA 3SMHA 4CUBA 3UETA 1O59A 3ITQA 3KV5A 1UZVA 3VBSA 3WD5A 4YW7A 1VMHA 2RE9A 4FOWA 4IE4A 1AL22 3DXUA 3VBHC 4XFBA 4IGOA 2ARXA 3NVCA 4CU7A 1LR5A 1W2UA 2OZ6A 1US2A 5C4WC 1KS4A 2GZWA 3ZXFA 2DCTA 5KXEA 2QKDA 1ZZBA 4YVSA 1HKDA 2JIGA 3I54A 4UF0B 1LU1A 1OPMA 4ONUA 4MO3M 2BBAA 4W6YA 4IE0A 1MS0A 1IG0A 1W8OA 3BPZA 4RGKA 4UWDA 4XIKA 3UK9A 5A1FA 3OY8A 3B69A 1N3OA 2Y6GA 1YI7A 5FQ0B 4FTSA 2W3JA 1UKRA 3LPFA 1CAXA 4HPKB 1OUSA 3N3HA 1SEFA 2WWUA 4AEDA 2R6QA 4FFGA 2FDIA 2P1BA 2ZKLA 3TN92 2CNAA 2RS31 4LO6B 1NAEA 4QXCA 1U5IA 2RS51 4Y1VA 1RUD2 1V6NA 1R091 3WCSA 3ZXDA 4CEWB 4OHWA 4ARXA 1PM4A 3H8XA 2BTVC 3LGRA 1NCRB 3WT3A 3WG1A 3O1RA 1Y4WA 4HOOA 5JOZA 1VMFA 2PQQA 3M70A 1CESA 4JDMA 2WO3A 3I2IA 4NAMA 2JB8A 1ULGA 5BNNC 5EHDA 4QPGB 4QPIC 5J36A 3WP6A 1POV0 2JEMA 4FPJA 4BXFA 2BVBA 3GCXA 3ZFGB 3OEBA 4NWWA 2ET7A 4MGSA 5LRRA 3TB0A 1J3QA 1FOD3 4ZXKA 2LALA 2W47A 2PHUA 3NWKA 3MV11 5A7WB 4NRQA 2UWAA 2VBBA 4AFMA 1U12A 4XBQA 2XXZA 4JKLA 4PDWA 1MS5A 1IS4A 1TMF2 4JRLA 5JXHA 1XOYA 4JQRA 1WLDA 4LITA 1GV9A 1KRIA 3KCXA 2K46A 2RDSA 4N7UA 4XACA 3ORJA 2ZEYA 1QXRA 5A80A 2VMFA 5FYSA 4TZDA 2VVFA 5J09A 1FMD1 3A0NA 2FDKA 5DAQA 1GNYA 1OLRA 4P9JA 4COYA 3AYDA 2AZ5A 1C8M1 4LOSA 1PNGA 4RA0A 4RFRB 5EIYB 1BHGA 3P3PA 1BCXA 4CE8A 4AK3A 1CR7A 3KHCA 5AVPA 3ZDVA 4YGEA 2R061 5ABJB 5HPOA 1LHNA 3E1F1 5EFUA 4GQ7A 5AC93 3URFA 5AFEA 1C3HA 2R073 2WWSA 3GHNA 4I3GA 1PM7A 2WL1A 1UZWA 1U0AA 4OHZA 1W9FA 4CEWC 2ADDA 3UGFA 5IK8A 1UMIA 2F4LA 1NCRC 5CKNA 3VZOA 4JHZA 4KI5M 5DDJ1 4YVWB 1QF3A 2ETEA 5GZDA 5CYYA 5FFOC 1VAVA 2VZQA 3RYRA 3ZFGC 5M0TA 4KGQA 1AR62 3FLTA 2DVFA 2FQPA 2BW8A 4BQ1A 1EAH3 3J8F3 3AKTA 4IEOA 4UW6A 3GXUA 3T08A 5EJZB 2AACA 5C3SA 1ZZ6A 2NM1A 4L0PA 5A3UA 4AGGA 3FLPA 1HB3A 1K5JA 5FP7A 1ZVFA 1QH7A 4MVTA 4XBNA 2BFUS 2VMHA 3B94A 4LULA 3LQCA 4NAOA 4XURA 2Y38A 5FY1A 4JRAA 1DQ1A 1D0HA 2VQUA 4AVSA 4DY3A 2XJUA 2Q8DA 1TME3 1UIJA 3GYDA 4XUTA 4IV3B 4YNIA 3WY6A 3ZMNA 5CFDB 4XFFA 5IVEA 4LORA 1VB4A 2IVIB 3FX3A 3GBFA 2VTFA 4MLOA 5T3NA 5LWBA 1UOBA 3H9AA 4IGPA 2R1DA 1POQA 2Y0OA 2V09A 3D4KA 4UOJA 2RS11 3AP4A 1IHMA 3GALA 3K4DA 4N9IA 3THTA 4EZ4A 5ABJC 2VMCA 2Y26A 2RJKA 1R1A1 4HBNA 4JV4A 1I5PA 1L7RA 4PJYA 2DVGA 2B7YA 1XU2A 1UN1A 1BLZA 1PX4A 1NUKA 3VDDA 1UYZA 3J7MA 4AHYA 1QOOA 2ILMA 2O8QA 3CNAA 2GSYA 4N43B 2I2SA 1WCDJ 3R0RA 2BBVA 5FMBA 3V64A 3M3OA 2W5FA 1DBNA 1Y9GA 2D6LX 4YVWC 3TEXA 2ZGUA 5BNOA 5JR2A 5CBLA 3KSCA 1LJ7A 3VBOA 1GSLA 4EQVA 3MLLA 2YUEA 2YXSA 3C7FA 4E27A 2EALA 2B8MA 2CU5A 2GMPA 3MUY1 2YGLA 3H7JA 5FYIA 4CTEA 1AYM3 1UWWA 2V4AA 2WYFA 5DUVA 5HV4A 4OQ8A 1RUC2 2CGNA 2PAMA 5JZGA 2AH2A 4RS5A 1LULA 1N1SA 1WCUA 2VPVA 1SBEA 2V5YA 4RD7A 3O0XA 2RMU1 5CFDC 5I0SA 4IV3C 1WW5A 3WNMA 2ZEXA 1V6MA 4MX3A 4DS0A 4EN6B 2ZBJA 4HVOA 3BN6A 1ULDA 1OQDA 4XYXA 1LGNA 3LCPA 3OBAA 3N9NA 2W0XA 4AI9A 2G9ZA 2GN3A 3FHIB 1XRUA 1BEV2 5L73A 1AF9A 3ZFEB 3Q8CA 1W8WA 3OBZA 3VBHA 2ZABA 3VBFC 1W3VA 1UYYA 1BK1A 3NAPB 2B5HA 1Q8PA 4R9DA 4EN0A 4R9BA 1FAYA 3RRDA 2DTWA 5FXXA 2WT1A 2GP5A 4ZZ5A 2XJTA 3EMRA 4N43C 1EV12 3GHMA 3ILFA 1Y7BA 3LF7A 2XHNA 2QE3A 3S6PA 3I4IA 3LSDA 2J7MA 5C5UA 2E7QA 2PLV2 4OI0A 1IKQA 1JOBA 4GMP0 4BYYA 1LKNA 4NPMA 2PHLA 3RYPA 1A78A 1QQP1 1NLRA 3LOIA 1S0FA 1JTZX 1AR71 4FOQA 4WVMA 1VE0A 3ZOIA 1F8VA 4JTOA 4AXOA 3KV9A 2B9UA 2VULA 5FUNA 1X36A 3K75B 1YUDA 4JGYB 2HWF2 4P9YA 3UGGA 1RVF3 3WDTA 3JB4C 3V0BA 5A7NA 1RHI1 1EUUA 2WYSA 3QBQA 5FP4A 3ZPOA 4KL1A 3ME2A 1QJU2 4FP2A 4HKOA 4YW1A 1BQPA 5FPBA 5BNNA 1ZZ7A 1ZZ8A 3D0JA 3ON7A 4XVHA 3BIEA 2JDKA 3Q8BA 4UW5A 1ZRRA 3RVHA 1WMXA 5F8PA 4AI0A 1W6NB 1YRZA 1ZRCA 5KWRA 3VKOA 1NLSA 3HVDA 1W9WA 2OQ7A 4QXHA 2XBO2 3BU0A 3AXDA 3ZFEC 2D6MA 4E2GA 1XC6A 5FJKA 1SACA 2WNUB 1DF0A 3NAPC 2D97A 4P02B 3O1UA 1MZEA 2VZ1A 5FYTA 2RS33 1QJX2 4M4RA 1XB9A 2RS53 1XYNA 3OB8A 2OW4A 4IEVA 4XUPA 5DUWA 2ZGTA 3T2TA 4YSFA 2R0FA 4Y1XA 4UF0A 2WFF3 5IK7A 2BNMA 4CPBD 3IN9A 3PUQA 1RUI2 3WNNA 2YBSA 4C91A 5FQ0A 3PMSA 3HBZA 1HRV1 4EJRA 1D7PM 4HPKA 5LA1A 2JICA 5JXJA 4YGDA 3S5AA 5C8WA 1G9CA 4E4ZA 4LJHA 1UZYA 4PIYA 2BDRA 4JGYC 4XTPA 5F5QA 1NCRA 1VBB3 5FZBA 2UYBA 1QNYA 2VZTA 5F3CA 4KWKA 1MEC3 4U2AA 1CQ9A 2Y64A 5T52A 5DZFA 2QZ2A 4FOVA 3HNMA 4YG6A 2F6BA 3OTFA 4H14A 3W5MA 4QPGA 1IS3A 1ULFA 1AR81 4B4PA 3BPSA 4BPZA 1JZ3A 1J84A 3MW2A 1FMD3 5FUIA 4Q0VA 4M3CE 3ZFGA 1PGL1 2D6PA 2ZX2A 2D93A 4F3JA 2HWC3 4NO4A 4EN8B 2ES3A 2VJXA 3R05A 1QDOA 1S2EA 2JD9A 2ZGLA 4GB32 2O0OA 4I0AA 4IETA 4PLNA 4LKEA 5A7WA 5A3MA 1HQLA 1V6IA 4LQRA 2VMEA 1VALA 3IAPA 4LBKA 4I09A 4BB3A 5DMYA 3R4DB 2BGCA 4CVUA 2IWGB 2WNUC 1AL0G 4CP2A 2XMLA 3NKTA 5FP3A 5T50A 2Q30A 4CA9A 2QQIA 5DAVA 4COWA 1DYKA 4XQWA 3ZSMA 1RUJ1 3ZVXA 2Q1ZB 5C3OA 3HPNA 4LKSA 2AENA 3AZXA 1ZBE1 1V0AA 2R0HA 4EN9B 2QVSB 4FI9A 2VCBA 2DTYA 3ZXAC 1RUH3 1DQ5A 1UOFA 4INDA 3PLQA 1GP4A 5KHGA 2BNNA 1ZZCA 4QB6A 3L9JT 4GIQA 4UYBA 5F39A 2BPA2 2ZGNA 1AX2A 4MH0E 4GA9A 2RM22 3RZGA 2DCKA 3AP5A 4Y24A 2WWJA 5L9VA 3POWA 1W0OA 1K45A 1PGSA 1YIPA 2E26A 4EWEA 1OH3A 5F3IA 2EXJA 5I0RA 3DN7A 3R6SA 1DHKB 2VECA 4YZ1A 4IE6A 1JW6A 3SNMA 3RZLA 1SMVA 4N9HA 4Z07A 3A7QA 1U5YA 1NKGA 2LM3A 3AB0A 5A33B 3JB8A 1PVC2 4YVWA 2R042 2XONA 3GNEA 1D4M3 3SH4A 2OXBA 4JTNA 4QPWA 2BOIA 2CAUA 2DVBA 5FMOS 3DKQA 2WS93 1V9U2 5JOWA 4L8QA 2KR2A 3ASIA 2J42A 2J1TA 5LY2A 5JSRA 1ZBA3 4LO7A 3WNKA 1VLNA 2RS13 4W6WA 2ZHKA 1OVSA 1Y9QA 2PN5A 3VBUC 3EHKA 3ZR6A 1R1A3 3MW4A 4BK5A 5J3UA 3LIHA 3QOPA 3S30A 3T1LA 3N7LA 1G9FA 1MS9A 4IEZA 2IUWA 1SLBA 3A0KA 2VXRA 2DCZA 2NMOA 3KQ4B 2Y6LA 5CFDA 2C26A 4IV3A 3WVJA 1VBC1 4A3XA 3MICA 3DF0A 2PTMA 4NHYA 1UNBA 5FZ7A 3MIEA 3JBG2 4AVVA 5A6QA 2X29A 2HYXA 4E8CA 2C9KA 5KHKA 3OBTA 3VV1A 2JKXA 1JZ8A 2PHDA 3MIHA 5FZ8A 1ONAA 4FFHA 2XDVA 5KXBA 2E9QA 3QACA 2W1QA 1WD4A 3MW3A 4FO9A 1RXGA 1Z7S2 1PO22 1ENSA 5D8AB 3DCQA 3E6DA 4XUNA 3PDQA 2ZA9A 3OPZA 1UIKA 4JVAA 4FQZA 4I2OA 4IEXA 2QQKA 2ZJCA 3ROUA 4EYUA 4Q4W3 4ORFA 2VU9A 2WZR2 3K51A 3NNLA 1YQ6A 4CU9A 1NLQA 2B9VA 4RFT0 3IAQA 5LZ6A 4B3NA 4SBVA 3HN3A 2OT7A 2IXLA 1Q3EA 3ELNA 5I8SA 1GWKA 2MEV3 1PO12 1JZ6A 3RI8A 1FI2A 1RUF3 3NSTA 3W20A 1W8ZA 4TLFA 1UKGA 2EVXA 5I93A 1JYNA 4BM8A 1F4AA 1DIWA 2Z4FA 4CP9B 4PT6A 1GWMA 4Z92B 1AHSA 3BIWE 1UY3A 2FCTA 4LOTA 4MGQA 4CCCA 3MPPG 4LHLA 1FNYA 3S5QA 3FMGA 4P9XA 5FZMA 1RMU2 2K2SA 4A7ZA 5FYVA 5A3WA 2ZGSA 5JOYA 2YHJA 4XAEA 3CIHA 4QKNA 4ARYA 5IHRA 3IDCB 2A7AA 1SDDB 1MQTC 2A6ZA 1LHUA 2A73B 5HCAA 4C8DA 3JUUA 4JKMA 4OMCA 5JUVA 3WNOA 4QB1A 3ZFEA 4B4QA 1B09A 2P6CA 1WCSA 1LTEA 3OGJA 4Q4V2 3NAPA 1E5RA 3B00A 3PNAA 1QY4A 4EWAA 1FOD1 3PIJA 4QT6A 3LEIA 4ZPIA 1GOFA 4UXAA 2OX0A 3IDEA 5D8AC 3JQWA 3P5BA 4O9EA 1IPKA 5FDBA 2RM23 4A3ZA 2Q8EA 3VKFC 2BGOA 4CUGA 4XF1A 4Q1RA 1HRI2 1GQPA 4B8EA 1BYHA 3WW1A 3ZN4A 4ES9A 4BDVB 5FZ6A 1SLLA 2RJ2A 4MSVA 4OCTA 2D43A 2IXJA 3I2HA 3KCCA 3PUHA 3ACHA 1PVC3 3C7EA 1GZWB 3ZXKA 2XL7A 1UX6A 4JGYA 1GZTA 3H3UA 2ZGRA 4NRMA 1Q43A 4Y22B 5AC91 1LHOA 1OQ1A 3GZAA 3BGAA 2R071 4LXLA 3VBRC 4E9KA 4IEWA 3ACIA 5BY5A 2P3JA 5LBBA 3WXPA 3SEEA 3N7KA 1X8EA 3OBRA 2WQZC 2RR13 3FHAA 1LRHA 2ZHMA 4PF5A 5T5OA 3N9QA 4YLZA 5LK5A 1W6NA 5JSPA 1NZIA 4ZZ8A 1ULCA 3WNLA 3TEZA 5B4NA 5LEJA 3RGBA 1E5SA 4XZUG 3ZYBA 2PHRA 4LPLA 4CEYB 4AAXA 5KBFA 4XQ4A 2WNUA 1JBCA 1H6XA 1FX5A 4Y26A 1GQHA 2TEPA 1H2NA 1EAH1 3J8F1 3FWEA 4XW3A 4GALA 1JZ2A 3VKMA 5F7UA 2EIBA 3FUOA 3HOBA 1W2TA 4OULA 1EY2A 2E31A 3B02A 3I3EA 3LAGA 5CG9A 4W65A 2AC1A 1TME1 1OC1A 3AZZA 3PURA 5JIAA 4CCKA 2Q0AA 4EV0A 2A6YA 1FXZA 3OUIA 1T6BX 5DXDA 3SH3A 4F83A 1V6JA 3AZYA 1XU1A 1VB2A 4NIDA 2HWD3 2VVEA 1ZRFA 3LDBA 4PIZA 5FZDA 3T0AA 4RHV3 5CISA 5FRAA 2JE9A 5GLTA 3N7MA 5IK5A 3S7IA 3AYAA 2VUJA 2BWAA 4M4PA 2VQAA 4WVWA 3T4VA 3DUIA 4YZ2A 3C2UA 4ZKTB 2B4KA 4AGVA 3E5UA 4QGNA 2GC0A 3B7MA 4CDWB 5ACA2 1OVPA 2DVAA 4NHKA 1A3KA 5G04L 3NW4A 4M0NA 3KS7A 3KCYA 4NWVA 3ZX7A 4Z2AA 2WABA 4QU2A 2HWB3 3TN91 1F5FA 4AHZA 5KHIA 2A6WA 5JWPA 1NCQA 5LY1A 1C28A 3RNSA 1HXS2 3SC7X 5FXVA 3HAGA 4CEYC 4AWDA 5JPNB 2V72A 4XETA 1YXWA 4L9BA 3N7JA 5KC5A 1BZWA 2AREA 1WUVA 2JE7A 2PFWA 4IEUA 3MLKA 2IXCA 2XGXA 5GLUA 3DYPA 3VZKA 3LDKA 3IT8A 1REDA 1AYM1 2WDBA 4LHNA 4NHLA 2QQPA 2FCVA 3LFMA 4MYEA 1DGRA 3NKGA 1ASJ3 4LTAA 3AKQA 3N4MA 4ASKA 4CCOA 4ZONA 1UU4A 1UQXA 3H1WA 3VZLA 4ASMB 1TZOA 5C8CB 4FT8A 1DGWA 4YGCA 5K8SA 3RZKA 1FPN2 1GOGA 3OGRA 2VUCA 1XJAA 3RMXA 4ATFA 2P17A 4YRDA 1W9TA 3WHUA 2VZUA 5EXOA 3MF6A 1COV2 3JXSA 4OYUA 1Q8SA 3AMMA 5F2SA 2C5DA 3ATGA 2KM2A 1DDLA 3MFAA 3AJYA 1CIWA 4BQWA 4XBLA 3ZDSA 3AMHA 3SLIA 3WQ0A 4BE3A 2A71A 3WEZA 1E57A 1V70A 2CTVA 3K4ZA 3OSDA 2NYYA 1QH6A 1ZRDA 1W03A 5FWEA 4CDWC 2OPWA 4D7SA 5I0UA 1PGW1 4MGZE 5IW0A 4AI3A 3MHZA 1MVQA 2DBIA 2RDRA 3AP7A 4HVQA 2UU8A 4QGMA 3KVAA 3B01A 4AVAA 4H7MA 4RSUA 2GNDA 1UOGA 5FY9A 4KWJA 2D5FA 5FO9B 1IGOA 5LEKA 1ODNA 3WG2A 1Q8QA 1AR92 1GLHA 3K2OA 3MEPA 1TE1B 4OHXA 4QWNA 4WZCA 2LTNA 1WMFA 1RVF1 1HV1A 1QMJA 3CHXA 3ILNA 1LOAA 2VW0A 2EF6A 2F17A 2CL2A 4I01A 2NZ9A 4A4AA 4QDSA 4D94A 4IE5A 3W9AA 5T5JA 3PUSA 1CWPA 3FFZA 1LU2A 2XKOA 2ZGQA 4DO0A 1WBLA 5C8CC 2DU1A 4IEQA 2RG4A 5EYXA 2ERFA 3M3IA 4AQ2A 2JECA 3IB3A 1X7NA 4URTA 1X9TA 1WBFA 3H3LA 1KEXA 4XC9A 3WDWA 3FLRA 3PMEA 4MADA 2GC2A
chains in the Genus database with same CATH topology
2QDNA 1UPSA 3SCGA 5D8AA 2ZGOA 4YZ5A 3O14A 5J7MA 1F2NA 4KU8A 2I07B 1AZDA 5BNPB 3FJSA 1EPZA 4RGAA 1N3PA 1LGBA 1FV2A 3MI8A 3FZ3A 4G9SB 2CAVA 3OCPA 4JDOA 4JDNA 2WFF1 4Q4Y3 3PVNA 3D6EA 1MS8A 1W6QB 2JENA 4AQ6A 1I5ZA 1XQNA 2ZPXA 1BMV1 1RUG2 5KHJA 5IT6A 1OD5A 1AVBA 2EXIA 2DFBA 3QLQA 3B93A 4MUVA 1XE7A 1FYUA 4Q4X2 4XHBA 1R083 2VMGA 3DPRB 4FVVA 4OHVA 3V56A 1VBB1 1MZ5A 1AYN2 2PHTA 2QZ3A 4HK9A 4XFIA 1MEC1 3ALQA 1ENQA 2C0ZA 2RHPA 5GZGA 4N53B 1MR5A 1RUC1 3AJZA 4XJZA 3IMNA 1SFYA 1XE8A 2HWC1 2PAKA 3B5LB 5I8TA 4BMBA 2TNFA 2WZPP 4DY5A 1N1VA 4FOYA 5BNPC 1OQEA 1LHVA 1CJPA 1K5MB 4H7LA 4MXWB 4CDUB 2H0VA 1COV3 5CB7A 1QKQA 2GC1A 3CJXA 1ND2B 2W08A 4XFAA 5J98B 1WLTA 1RUH1 5K0UB 4Y20B 3WOGA 1PK6B 2Z69A 1GZWA 1NE6A 4K6BA 1IS6A 4A7KA 1ULEA 1BBT3 4GKYA 4Y22A 1X50A 2HWE2 1MS1A 5JLVA 1NY72 2MHFA 1DQ2A 3FE5A 3DPRC 2WSUA 1RUE2 1YFWA 1IKPA 2JDZA 4KGGA 1GANA 1DGWX 2I45A 1VBA3 4QM9A 1VBE3 2Z2SB 2ZX0A 3FBYA 4L2NA 4YYOA 4N53C 1D4M1 2D6NA 4J6GA 2GH8A 4GWNA 2ZX4A 4CEYA 3M7AA 1GZCA 4K1YA 3ZYRA 1AL23 2WS91 5SV5A 1OA3A 4AEKA 3X29B 2YROA 4FXKB 1ZBA1 3I8TA 3MIGA 1GNHA 4L11A 4HZFA 4YZ4A 1W39A 4LBNA 1K5MC 3VBFB 4BOWA 4CDUC 3D82A 1GNZA 3VLBB 4P9GA 1PZ9A 5JI7A 1ND2C 1W6PB 2D5HA 2Q5TA 2CV6A 5K0UC 5CU1A 1PK6C 1CAVB 3TN93 1QJX1 5GALA 3NV3A 1RUD3 2VUAA 1RL3A 3LB9A 2HEYF 2B42B 2Z42A 4XEZA 1R092 3ZYJB 3KT7A 4AE2A 4L97A 2E63A 1YWKA 2ZGMA 2HKXA 2QUOA 1G7YA 1RUG3 2BVVA 3ZN5A 4Q0SA 4QM8A 1H4GA 2YDEA 4Q4W1 2W68A 2ZX1A 1HLCA 2PELA 2OYZA 4HN1A 1KJRA 2YC0A 3U07A 1SDWA 1TMF3 4L99A 4WM7B 1QJY2 3V0AB 4KU7A 2MEV1 2EA7A 2K0GA 1G8WA 1OKQA 1RUF1 3WCRA 4K3UA 3ST7A 1WW7A 3R4UA 5T55A 1C8M2 4GB31 5C4WA 1BJQA 5C8CA 1O91A 4XJ9A 1MZFA 1PIV2 1Q8VA 2R062 3H50A 1OFSA 1VP6A 4KWLA 4P9WA 2DVDA 5HBAA 3WP3A 1AX0A 3IPVB 4AEMA 4SLIA 2D6KA 4AGRA 2DU0A 1CD3G 3J4UH 5DDJ2 2DUPA 3NO8A 5IK4A 5I8YA 2RM21 4IXLA 4JAAA 2CWMA 1AR63 4XJ8A 4WZFA 1POV1 4AHWA 5FAXA 4YW2A 1QGLA 1YHFA 3ZXLA 2F4PA 3WLUA 4QPIA 4ATEA 3AK0A 4LA3A 4WM7C 3VHOA 1EP0A 1S2KA 1PVC1 4UBGA 1S1AA 3JCIA 4WBBA 1S0JA 2EAAA 1CN1A 1ZREA 3BCWA 1H30A 5EJ3A 4BWOA 4KG8A 4COUA 5GJ6A 5H9QA 3WINE 1WGPA 1QU0A 5FBZA 2BFUL 2RR11 5TSWA 4BA6A 3KZ4C 2ZHNA 1DQ6A 2WINB 4XILA 4QQ2A 3RWNA 1LB2A 4XHXA 1N3QA 2R1BA 1DQ0A 2Z79A 4ISQA 4QD2A 4UBHA 4K7JA 4S2HA 4CEWA 4WM8C 4A7YA 4AVTA 5GM0A 1XXNA 1UMZA 1D2QA 2RJLA 2UY8A 3JU9A 4R52A 4ZU7A 1G9DA 4LEJA 3ZXJA 5F6LB 1HIXA 1W6QA 3RDIA 2DUQA 1AX1A 4OVEA 1RUC3 4YGBA 3N35A 2NLRA 3VHNA 1LOFC 1M4WA 2WJSA 5HI0A 4G3YC 1I6XA 2BQPA 2HWD1 3DPRA 4CP1A 4RHV1 3VBUB 4FBFA 1JOJA 2IXIA 2RMU2 4HSJA 4DNYA 5FPXA 1J1LA 4R4XA 1QDCA 3RPQA 2JKBA 1SQ4A 3HR9A 1KFXL 2R16A 4N53A 1VRH2 5C33A 4U36A 2XHKA 3GZUC 5GLZA 1BEV3 1IOAA 1PHMA 4IEYA 4LBQD 3SCHA 4AI1A 2EXKA 2HWB1 1BKZA 1NE4A 5ABJA 1O3SA 1EV13 4P9LA 2MNGA 4CDQB 5F9TA 4XQDA 1K5MA 4CDUA 4MXWA 1LENA 1D4VB 4COZA 2VOWA 2PLV3 4UW3A 1W0PA 3TAYA 1HDKA 3M3EA 3MDPA 4B4RA 1ND2A 4XTMA 1G86A 1QQP2 5FLJA 1KJLA 5K0UA 1AR72 1DGLA 4Y20A 1ASJ1 1PK6A 2HJIA 3KT4A 4Q27A 1RJ7A 4D69A 4BIOA 4LUKA 2HWF3 3O5SA 2ZKNA 3MZHA 3M3QA 4DFSA 4XFGA 4XPVA 3HWJA 1QXJA 2VMIA 3I7DA 1RHI2 5F6KA 1QOSA 1QJU3 1Q5OA 1G6NA 3WV6A 2KXLA 1SBFA 4K20A 3CLPA 3CL1A 1F9KA 3OD4A 3TBDA 1KS5A 1GZ9A 4FPGA 5JAXA 5GZFA 4FPHA 4OUMA 4ASLA 4HFSA 2XBO3 2BUKA 2A75A 5EWSA 4LBQB 1YNAA 4HANA 1QJX3 3VUOA 2ZX3A 2ET1A 1MQTB 1SLTA 2A6VA 2DUOA 4CDQC 3VBFA 1RUI3 3WHTA 1DZTA 2A3YA 1M06G 1W6PA 1HV0A 1HRV2 4N43A 4FXGB 3TRSB 5J96B 4Q1PA 1CAVA 2C1FA 4CP0A 1KITA 1HQNA 2FBEA 2FMDA 4XIOA 5E1RA 2YV8A 2K9ZA 1X8MA 3CJIB 1F31A 4F8AA 2JG9B 2WQ4A 2A6XA 1GICA 4IERA 4YVSB 3WW3A 4Q8LA 3JZVA 4FAGA 1SLIA 4C0BA 4R4ZA 2VOXA 4OLLA 3UKVA 5A32B 2BEOA 5BPXA 1N1YA 2X5IB 5JVVA 2PHFA 3OY8B 1AR82 1PGL2 4R9AA 3VBRB 3T1MA 5EZWA 4CDXB 1KD7A 5BXXA 1D2SA 4GB33 3M4FA 2EAKA 3AP9A 5L7OB 5GZCA 2DYCA 4Q4Y1 4WM7A 3OF1A 4QMAA 1S2BA 3K48A 3V0AA 1XNCA 4LNVA 1V6KA 3ECQA 2ZMNA 4XF3A 4K1ZA 5BYNA 3N36A 1JUHA 2JX9A 1RUJ2 4QQPA 1NZCA 5FO8B 3A4UA 1ZBE2 5ACA1 5JSOA 1AJOA 1H9WA 3GBWA 3RSJA 1DFQA 1R081 4K40A 3ZPYA 3BOWA 3ZYPA 1GKBA 1LODA 4FPLA 2NPIA 3RZZA 4E2SA 1LESA 2GDFA 2WSVA 2WLPA 1POV3 3V65A 1XNDA 1ENXA 3UL2A 3IPVA 3CJIC 2JG9C 2XJSA 3DKWA 3LKJA 4I02A 4A2UA 4YVSC 1TEIA 3MIDA 1V6OA 2R043 3WDVA 1J1TA 2DWRA 3AKSA 2X5IC 2CY6A 4UW4A 2OUHA 1SCSA 4Y5Z0 1LOEA 1V9U3 1XNKA 2PA7A 3ZYIB 4CDXC 2XVLA 5I91A 1GBGA 3VZNA 3ES1A 1COV1 1MS4A 5L7OC 4GKXA 3LOBA 1C1LA 1VJ2A 2XJRA 2UYAA 3RI9A 5JCTA 5CAZA 2OZJA 1LOFA 2D98A 3FBMA 5K9YA 3ZYGA 2DFCA 2WA4A 3D0SA 5FMOL 2XPJA 3VKLA 1XNBA 1H8TB 3LA3A 1BBT1 2QCSB 5DG1A 3RMYA 3D8CA 4BZ4A 5FTTC 1VBC2 1GR3A 1VAKA 4LBJA 4AQSA 2AGSA 4Z82A 2E6VA 3JBG3 4HT1T 4MZUA 4DB5A 1GQGA 4X6RB 2Y0IA 4W6XA 4KBBA 4LE4A 4PDWC 1VBA1 1OOPB 1VBE1 5KC6A 1Z7S3 4Q2FA 3AYCA 4S2FA 1PO23 1WA4A 3ZFFB 4E2GA 2ZMKA 5JPMB 1S0EA 1T6GC 2TUNA 3M2MA 4B7KA 1JYIA 1AL21 4HVRA 2WZR3 1VBD2 4BIFA 4KH9A 3AFGA 1PZ8A 4DXZA 1AJKA 2JXAA 1W6MB 4FP3A 1C5IA 4RL7A 1PO13 4BMEA 4CRQA 1V00A 3EXUA 3LSEA 1A8DA 3AMQA 4YG3A 4LA2A 4XE9A 4MGKE 1QWRA 2VOKA 3KLSA 2AUYA 1C4RA 5EYYA 3IKWA 1H8TC 2DURA 2XWBB 1RUD1 1RMU3 4PBOA 1RINA 4FAHA 3VBUA 1Q8OA 1JN2P 5CG8A 3VBOB 1U5ZA 1UF2C 2CGPA 1O4YA 1WLCA 4AVCA 4AW7A 3QCWA 1RUG1 3ZN6B 1S0CA 3CU7A 5FLIA 4Q4V3 1OOPC 4Q26A 5FREA 3ZFFC 1O3TA 1FOD2 4OZXA 1SCRA 2MPFA 3I2DA 1JYCA 1ENRA 5DZGA 4CDQA 3CEWA 1TMF1 1TQ5A 2WC2A 3AMNA 3WUDA 2W39A 1HRI3 2VG9A 4QXKA 4K21A 3ZSKA 1LEDA 4LBLA 2X8KA 4N90A 1NXMA 5A33A 4TYSA 4EWDA 3GBGA 5FCCA 4HSLA 5T5LA 1YFUA 1CPNA 5C9AB 3NL1A 2I74A 5AC92 5LK7B 2R072 4K8FA 1SBDA 2EIGA 4Q0PA 4AVBA 2D44A 3PJQA 1NA1B 3MIBA 1S55A 2VW1A 3VBOC 5JI9A 4D3WA 3W58A 2UWCA 1RUNA 5SV8A 2ZMLA 3W59A 4IV1B 4GMP3 1AR61 4LBQA 2DF7A 4M01A 2Q8OA 4FPEA 3NV4A 3L2HA 1DG6A 1MQTA 4YM3A 1YIFA 3OJBA 1ZNPA 1EAH2 3J8F2 3MF9A 1N1TA 1PVXA 4FTEA 1B35B 3IIAA 3KT1A 1PMIA 4E4DX 1FNZA 3DL3A 1RUOA 3S7EA 2GMEA 3SXWA 1FATA 3UJOA 1UU5A 2SBAA 1WW6A 1L3JA 2QNKA 4HN0A 3AP6A 4DPNA 3WDYA 3WW2A 4YG0A 1TME2 1VBD3 2E53A 3CO2A 3TNQA 3M8LA 4OFGA 4DINB 3CJIA 4M0HA 3H1YA 2JG9A 5C9AC 3PHMA 2D40A 5HXVA 4FPYA 3B9IA 3VGIA 2PYTA 3KQRA 5A32A 1CGPA 4LBMA 2X5IA 1ND3B 5A3LA 1NA1C 4EN7B 4FCAA 1CAUB 3WP5A 3MYXA 2ZOEB 5ACA3 4LBOA 3VBRA 4RR3B 4CDXA 4H55A 4AYUA 4I0BA 3VL9A 2E51A 4Y1UA 1HXS3 3TWIA 5L7OA 3B3QE 3UJQA 1C1FA 1OLQA 4C0HA 1Q56A 4IV1C 4OI1A 3IBMA 1NYWA 1I3HA 2XH6A 1J58A 3ES4A 1RB8G 4AI2A 4YFZA 1ZYBA 1B35C 2A5ZA 1AYM2 5KHHA 2P34A 2WNVB 4EROA 4P9IA 4DRRA 3VHRA 3MGUA 3EO6A 4FPCA 1O4ZA 4MGYE 4FPFA 2FMYA 4Y4YA 3RS6A 4RQPB 2SLIA 1FPN3 1O7FA 1NQJA 1QJY1 4E2QA 4BHPA 4KG0A 2WNEA 3WG3A 3U0ZA 4LHKA 2LUWA 4RGGA 5GKAC 4OI4A 4FQ4A 3JQXA 4X8PA 1BEV1 2YPJA 4XJUA 1S0IA 3E5QA 2ZTNA 3J26N 3O0WA 5C6CA 2A3WA 1H2KA 1KQRA 2PHXA 1ND3C 2P3IA 4YM0A 4ES8A 1PIV1 1QNWA 1EV11 2Q1MA 3HD8B 1RIRA 4RR3C 3GZTB 3L2YA 2ZGPA 2X53S 1PGW2 2CYFA 4TSVA 1BXHA 2PLV1 3JD72 5KXCA 1EYBA 3ZXGA 4TWTA 2XKPA 1J3RA 2QJVA 3AMPA 4M00A 1AR93 1WCKA 5B2GB 1H8TA 1ZM1A 3PVBB 1YCIA 5DUUA 3TOJA 1IQAA 2HWF1 2IC1A 1AXKA 4GULA 4QPGC 2NP0A 1CX4A 1KDMA 1RVF2 2WNVC 3H8UA 4HMZA 1QJU1 3VKNA 3WX5A 4XF0A 2G4IA 4XJWA 3UKNA 4DQAA 5CFCB 4RQPC 4XJAA 3SCFA 1WMEA 3MIFA 1REEA 2YMZA 3E5XA 1OOPA 1NXD1 3ZFFA 4B7EA 3HIFA 5GLWA 3G6JB 2XBO1 3THPA 3WZ1A 4YW5A 1XYOA 4GH4B 2OVUA 4LUMA 2XVKA 5EV7A 4WVVA 1V6LA 5L36A 2RS32 2JG8B 4I30A 2RS52 4YARA 1FT9A 4DRVA 2FHRA 1AXZA 1W6MA 3VN4A 2WFF2 3D5OA 1URXA 1REFA 4B29A 1RUI1 2XUMA 3OGGA 1PZ7A 2OPKA 2D7FA 3LA7A 1YJLA 2R49A 2VGDA 5J37A 4CDWA 1J3PA 1BMV2 3WQ1A 1N47A 1OHFA 3O7OA 1VIWB 4Q4X3 1H4HA 4MV2A 4IQPA 4YW3A 3VZJA 1CJDA 2AR6A 1Y3TA 1AYN3 1XYPA 1VBB2 3OD0A 1WMDA 1HW5A 1U5XA 2GNMA 2BYVE 2HEWF 3ACLA 5FOJB 1MEC2 4LO8A 4LT5A 1ZX5A 2EXHA 4Z1VA 5CFCC 4E4SA 1YLLA 2ZZQA 3ZMOA 3ZN6A 4Y1YA 3USUB 5D1IA 1C5HA 4S2DA 4BH9A 1FMD2 1MACA 2VQ0A 4JGZB 5LRSA 4KQ7A 2HWC2 4XOGA 3H3ZA 2GNBA 3WR0A 2C9AA 1YO8A 4XF9A 1RC6A 3BB6A 2DV9A 2CGOA 3G7DA 1IZ3A 4DZGA 4QQLA 4NOTA 5K7PA 4GH4C 1KFUL 4PLMA 5JDBA 2H6BA 1O4TA 2JG8C 5JIUA 1VRH1 4AFDA 2WIIB 1OPOA 2FZ2A 3NV1A 1RUH2 3LA2A 5J48A 3VHPA 1G9BA 3KMHA 4WM8B 3EQEA 5C9AA 3MPBA 1WD3A 2HWE3 3ILRA 4XFHA 5H9PA 2KA3A 3GF6A 3JD73 3C3VA 3HT1A 1NA1A 1RUE3 1O3RA 3TNPB 2YYOA 2D6OX 1CPMA 3ZXEA 2GNTA 3P3NA 1OA4A 2R041 2VY0A 1WLWA 1O5UA 5E16A 2Z5WA 1D4M2 4LLOA 4IV1A 4JC1A 1V9U1 2A70A 4JGZC 3H7YA 2WS92 1RJ8A 2W52A 4IEPA 4NN0A 5T54A 4AFCA 1H2MA 1ZBA2 2AYHA 4X6QB 2JJ6A 2RS12 1JXNA 1B35A 1DGRN 4CYDA 4XMAA 3PTYA 1R1A2 1W6OB 3AZWA 4K9SA 2NQYA 2QFEA 4QX5A 1RTVA 1D0GA 5E89A 3MLJA 1X82A 3MFCA 4ZU5A 4Q8KA 1EPWA 5BNPA 1H8VA 3Q9OA 4XF4A 1ZZ9A 4QPYA 3JBG1 1J59A 1H1AA 1OMIA 2TBVA 1R093 4PQ9A 3AKRA 3LZZA 1H1IA 4LLFA 5CADA 3ZIXA 2WT0A 2WLQA 3UV9A 4OHYA 4Y1ZA 1Z7S1 3ENRA 5HCBA 1PO21 1ND3A 4I3PA 1OI6A 1CAUA 4PLOA 2VNOA 3E6BA 4AEJA 3U4XA 1JH5A 2YZ4A 3PVOA 2ZCWA 4RR3A 4F7ZA 1CAWB 2WZR1 4Q4W2 4AFBA 3O12A 4JCKA 1YFXA 3FC0A 1JUIA 2XVGA 4AHXA 1LEMA 1QJY3 4FPOB 1Y43B 1SLCA 3INAA 4LO5B 1LOCA 5I0TA 1PO11 1LECA 1F5JA 2MEV2 3RYKA 2XLAA 1APNA 3BALA 1RUF2 1LOGA 2A3XA 4GXLA 2WNVA 2DCYA 2ZAAA 4LR4A 1YFYA 3M3CA 1UCXA 3SISA 3KB5A 1A6CA 1C8M3 1UD1A 1CVNA 4PBPA 2GC3A 2BWCA 3R4SA 1RMU1 1NCQB 4RQPA 1PIV3 2DCJA 2IFWA 2R063 1LCLA 2GMMA 3OYWB 5FOBB 2ZS6B 4HKWA 3HMYA 4V1PA 4G4FA 4Q29A 4M3CB 4Q4V1 5IUQA 1H1MA 4MXVA 5DDJ3 5JMCA 2UWBA 4AFAA 2XLGA 1PNFA 1LHWA 2P3KA 1S0DA 1OSGA 4NPRA 1FV3A 5E88A 1MZ6A 1WW4A 5CVRA 3HT2A 1O3QA 1HRI1 2GALA 4QHBA 2D3SA 3H1MA 3RJRA 2H6CA 1CONA 2HEVF 3AYEA 4LE3A 2BNOA 5CNAA 3ZIWA 4C1WA 5F1RA 2V73A 3IM0A 4PCRA 1S0BA 4R8HA 4BLJA 5CFCA 3I59B 1NCQC 2VNRA 4GWMA 3BODA 1GYKA 3BTAA 2RR12 3AZVA 3H0OA 3EJKA 3LWCA 4AG4A 3E6CC 1YI9A 2VOVA 4MGIE 5HCFA 2ZAHA 2YY1A 3AFKA 4XDQA 4NVPA 2E7AA 4P5HA 3VBSB 4GMP1 2FZ1A 4GH4A 1DQ4A 3U11A 4HL0A 2Q4SA 2JG8A 4FPKA 3UKTA 3WQ7A 2E7TA 4C90A 3FUQA 5CA6A 1QJZA 4XZPA 5FO7B 3PJYA 1DU3D 4ISRA 1VAMA 2VVDA 1SLAA 3WNXA 3TYJA 1X33A 2UURA 1IS5A 2NMNA 4J1XA 1CAXB 1GFF2 1H0BA 3VL8A 4H3WA 1VBD1 4AEDB 1H2LA 2YGMA 3ZSEA 1YJKA 3KD4A 2WKKA 2HWD2 3SH5A 2B45X 2RMU3 4RHV2 3KGZA 4CZSA 4HKLA 1IPJA 2P37A 2ZZJA 5GZEA 1VRH3 1UL9A 2XJPA 3QH6A 3RG0A 3USUA 5JOXA 4BCUA 3AX4A 4FTBA 2R32A 4JGZA 2ZACA 3APBA 3AM2A 5AVAA 4FSJA 2HWB2 4IESA 1HXS1 4P14A 1AUYA 4ITCA 3VBSC 1G9AA 3ETQA 4OUSA 1TNFA 4PDWB 5BV6A 4QQHA 3POYA 1TNRA 3J9SA 1QQP3 2ATFA 1VR3A 4HK8A 1QXPA 1AR73 2UY9A 3ZO0B 4META 1ASJ2 3FFQA 4D7TA 2G9GA 5BNQA 4WM8A 3WG4A 1DYPA 2IXHA 2G9FA 1RHI3 1FPN1 4IL7A 2GAUA 4NHMA 3SITA 1DZRA 4AEDC 4Z8BA 5FLHA 2HYKA 4I0WB 1I1EA 1ZRCA 1C8NA 1RITA 2R30A 4YW4A 1JHNA 4KNCA 2GN7A 4O9GA 1LOBA 5GLVA 2OA2A 4HETA 4AF9A 4C1XA 2N7GA 1UW8A 2OIIA 3HQXA 3ZSLA 4DMIA 4R9CA 5AFBA 3PVE