3CJIA

Structure of seneca valley virus-001
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
258
structure length
258
Chain Sequence
STDNAETGVIEAGNTDTDFSGELAAPGSNHTNVKFLFDRSRLLNVIKVLEKDAVFPRPFPTQEGAQQDDGYFCLLTPRPTVASRPATRFGLYANPSGSGVLANTSLDFNFYSLACFTYFRSDLEVTVVSLEPDLEFAVGWFPSGSEYQASSFVYDQLHVPFHFTGRTPRAFASKGGKVSFVLPWNSVSSVLPVRWGGASKLSSATRGLPAHADWGTIYAFVPRPNEKKSTAVKHVAVYIRYKNARAWCPSMLPFRSYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords Polyprotein
publication title Structure of Seneca Valley Virus-001: an oncolytic picornavirus representing a new genus
pubmed doi rcsb
total genus 48
structure length 258
sequence length 258
ec nomenclature
pdb deposition date 2008-03-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3cjiA00
1K5MC 4IV1C 1VB2A 1IHMA 4JGYA 3FBMA 2PLV2 2HWF1 4LLFA 2BFUL 1HRI3 2RM21 2DF7A 1EV13 4YVWA 1RMU2 1ASJ1 2HWE1 1COV2 1SMVA 2HWD3 1R1A1 3ZFFB 2WWSA 4CEYC 5LK7B 1HXS1 1RUD3 2RS13 2WS92 4CDQB 1MEC1 4GMP3 1VBB2 4FTBA 4RQPC 3ZFFA 1HRV1 5BNOB 3CJIC 3ZFEB 4CDQA 1EV12 1AR71 1FOD3 4Q4V3 3NAPB 1VBD2 1X36A 2HWD2 4QPIC 5BNOA 2XBO1 1AR93 1K5MB 4IV1B 1AYN3 3ZFEA 1RUD2 1POV1 1PGL2 4CEWC 1VBE1 2RMU3 5D8AC 1RHI1 3NAPA 5ABJC 1FMD1 4SBVA 1K5MA 4IV1A 5A32B 4Q4X3 1OHFA 4CEYB 5K0UC 1Z7S1 1FOD2 4Q4V2 4RHV3 5C8CC 3ZFGC 1QJY2 2X5IB 1AR92 1RUJ3 5A32A 1EAH1 1AR81 1AYN2 2WFF3 1NCRC 1VBC2 2Y26A 4CEYA 3CJIB 2R043 3VBUC 4FSJA 1ZBA3 1QQP3 1PGW1 1PO13 2X5IA 1BMV2 1PVC1 1RUH1 4Q4X2 4QPIB 1TMF3 1QJU3 3CJIA 2HWB3 1FPN3 5BNNC 2IZWA 4FTSA 4IV3C 5CFCC 1AUYA 1H8TC 4CEWB 5BNPC 1AR61 5D8AB 5J96B 5ABJB 1RUC1 1RUJ2 2R063 4QPIA 2RS53 1BBT1 3TN93 2BFUS 2R042 3LOBA 4CEWA 5ACA3 1QQP2 5D8AA 5L7OC 5ABJA 4JGZC 1PO12 1ZBE1 5C8CB 1TMF2 1QJU2 3ZFGB 2HWF3 2HWB2 5AC91 3VBOB 1RUI1 1NCRB 2RM23 1HX6A 1DDLA 1ASJ3 5C8CA 2HWE3 3VBUB 2R062 2RR11 1R1A3 3ZFGA 2FZ2A 1R081 2RS52 4Q4Y1 1AL22 1NY71 3TN92 3VBOA 1PO21 1NCRA 5FOJB 1HXS3 3JBG2 5ACA2 1MEC3 1A6CA 1QJZA 3VBFC 5BNNB 4Q4W1 3VBUA 4IV3B 5CFCB 1H8TB 5BNPB 1R091 1HRV3 2HWF2 5DDJ1 4CDXC 4NWWA 1RMU1 2RM22 2WZR3 1AYM3 1AR73 1COV1 1ASJ2 5BNNA 4IV3A 2HWE2 5CFCA 3M8LA 1H8TA 5BNPA 2X5IC 1R1A2 3JB4C 5L7OB 4JGZB 2XBO3 2WS91 1HXS2 1HRI2 1MEC2 1POV3 1VBE3 1RHI3 4AEDC 1FMD3 3VBRB 4CDUC 5L7OA 4JGZA 4N43C 1CJDA 1RUF1 4YVSC 5C4WC 2WZR2 4GMP0 2RS12 1AYM2 1AR72 1VBD1 1Z7S3 3VBRA 1D4M3 3VBFB 2XBO2 1RUD1 1C8NA 3VBSC 1PGL1 1EAH3 4GMP1 1RVF1 4CDXB 1VBE2 1WCDJ 1PIV1 4Y5Z0 1FMD2 1GFF2 2R071 3VBFA 1C8M1 2FZ1A 1RUH3 1BEV3 1FOD1 3VBOC 4CDXA 1Z7S2 1VAKA 1M06G 2RMU2 2GH8A 1QJY1 1D4M2 1AR91 2XPJA 1RUC3 1TME1 4AEDB 1VBC1 4BCUA 4CDUB 4EJRA 1RUG1 1B35C 2MEV1 4N43B 1V9U1 1BBT3 3J8F3 1QJX1 1VBA1 4YVSB 5C4WB 4RHV2 1BMV1 4NWVA 4Q4X1 1PGW2 4AEDA 2VQ0A 1RUH2 4CDUA 2RS33 1BEV2 4N43A 1RUE3 2WFF2 1VRH1 1NG0A 4GB31 4CDWC 3VBSB 5AC93 4YVSA 1RUI3 5C4WA 1ZBA2 2HWC1 2RR13 1R083 2GSYA 4Q4Y3 1BBT2 3VBSA 3J8F2 1FPN2 4QPGC 1PO23 1QQP1 5CFDC 3VBRC 1TMF1 4Q4W3 1OOPC 2RS32 4Z92B 2HWB1 3DPRC 1CD3G 1NCQC 1RUE2 1R093 5DDJ3 5AC92 4WM8C 1RUI2 1B35B 2ZZQA 4RR3C 3JD71 1COV3 3S6PA 1MQTC 2ZAHA 2PLV1 1AL21 2RR12 4Q4Y2 1NY72 2WS93 3JBG1 1B35A 1PO22 3HAGA 5JZGC 1HQNA 4N53C 4CDWB 1NA1C 4Q4W2 1R092 2ZTNA 5FMOS 5DDJ2 1RUF3 3VDDC 5C9AC 4CDWA 1VBB1 1VBD3 4QPGB 5CFDB 2TBVA 1F2NA 3VBHC 3ZXAC 1HRV2 1OOPB 4RS5C 1HRI1 3DPRB 1EV11 4WM7C 1NCQB 1RVF3 1W39A 4QPGA 4WM8B 4GH4C 4RR3B 2HWD1 1PIV3 5CFDA 1VB4A 2R073 1C8M3 1OOPA 1MQTB 4PDWC 2WZR1 5FMOL 2RS11 3DPRA 1AYM1 1NCQA 1RUF2 1POV0 1AR83 1ND3C 1NOVA 4WM8A 4RR3A 5JZGB 1RHI2 4N53B 1QJY3 1NA1B 1MQTA 1TME3 1VBC3 2QQPA 1PVC3 1RUG3 1RVF2 2MEV3 4Q4V1 1V9U3 1QJX3 1VBA3 5JZGA 3VDDB 1PIV2 5C9AB 4N53A 1NA1A 2R072 1C8M2 1ND2C 1AR63 1AYN1 1EAH2 1AR82 3VBHB 5GKAC 2RMU1 1VRH3 4RS5B 1AL0G 4GB33 1D4M1 3VDDA 4WM7B 2BPA2 5C9AA 2WLPA 2BUKA 4JGYC 4RQPB 4GH4B 2HWC3 1TME2 1PVC2 1ZBE3 1RUG2 2MEV2 4YVWC 3VBHA 4RS5A 4PDWB 4FTEA 1V9U2 4RHV1 1QJX2 1VBA2 4WM7A 4RQPA 1ND3B 1RUJ1 4GH4A 1BEV1 3IDEA 1AR62 3JB8A 1RUC2 2WFF1 5A33B 1VRH2 4PDWA 1OPOA 4GB32 2R041 1ZBA1 3JD73 3ZFFC 1ND3A 1PO11 2HWC2 1QJU1 1ZBE2 1F8VA 2PLV3 1AL23 4CDQC 3J8F1 5A33A 1ND2B 1FPN1 2BBVA 5K0UB 3JBG3 1X33A 1RMU3 5BNOC 2RS31 2R061 1RUE1 4JGYB 3ZFEC 2RS51 5J98B 1ND2A 4Y4YA 3TN91 1R082 5K0UA 3NAPC 1E57A 5ACA1 4YVWB 1RB8G 3JD72 4RFT0 1VBB3
chains in the Genus database with same CATH superfamily
2PQSA 1K5MC 1YQ8A 4IV1C 2LM3A 3I3BA 4QXKA 4LLFA 4S2DA 3L2HA 1LTEA 3L2YA 3Q8FA 2WBKA 4EYUA 1JUHA 4IEQA 4MGKE 1XRUA 5EHDA 3HOBA 2Y6JA 4QKFA 2IXHA 4IEWA 3PMEA 3UKNA 2JE8A 2CTVA 4BWOA 4ITCA 1COV2 4YSFA 2GC0A 3NWKA 3RYPA 3OUJA 3ZSMA 3SCFA 1C5HA 4DPNA 4MGTA 3RGBA 1ZZ9A 3BB6A 1LKNA 1WA4A 4NAMA 4UF0A 3ITQA 3LZZA 2IXKA 2RS13 3OGJA 5CKMA 4B29A 4WVVA 4BDVB 1PZ7A 4XE9A 1WMDA 4COUA 4FTBA 2R7EB 1GNHA 3VD9A 4QWNA 4WZCA 3WW1A 1E5HA 3CO2A 2ADEA 4FFFA 1ULCA 1PVXA 2EIEA 2EXIA 1PZ9A 4EN8B 2W68A 1WUVA 1EV12 3PTRB 1AR71 1DIWA 5HXVA 3N7MA 4JX0A 4CPBD 1SQ4A 4PLMA 2VMGA 3C7GA 3NAPB 1VBD2 4BM8A 4HVOA 1X36A 2HWD2 5EWSA 1MS0A 1OSGA 2MPFA 2QDNA 4M00A 4QPIC 4L8QA 3SKJE 3UYJA 2JKXA 3CU7A 1C5IA 1DZQA 1R1ZA 2P4EA 1V6OA 5FZ9A 3E6CC 5A3NA 4A7YA 2FDKA 3CJXA 3VLBB 1T6GC 4XAEA 4CEWC 2MHFA 4PIZA 3LEGA 2JENA 3O1OA 4R9BA 5D8AC 3VGIA 5JR2A 5B4NA 4E8CA 5A3WA 2XJQA 2XJSA 3CEWA 4NR1A 1QXJA 1UU5A 5FYVA 4NIDA 5DQ0A 2WA4A 5HCFA 5IUQA 1C1LA 1DLLA 2GC1A 1ENSA 4Q4X3 5T3NA 1YFWA 5JSOA 3KD4A 2W1SA 2H6CA 1ZRFA 1O59A 1TVGA 3IIIA 1Z7S1 3BTXA 3ME2A 3EO6A 4Q4V2 5IK7A 3LPGA 3VZNA 4NIGA 4RHV3 1WLTA 4AE2A 1UW8A 5EIYB 5FZLA 2AUYA 3AKPA 4MGIE 1QJY2 1BKZA 1RUJ3 2P37A 3FJSA 1APNA 1AR81 1AYN2 1FX5A 5FZOA 1PM4A 4E4DX 3H3UA 4W6WA 5A3PA 4KH9A 4LHKA 1YFXA 1ZYBA 3MIFA 4IE5A 3WEZA 1QNYA 3WZ1A 4HT1T 3M3OA 4FCAA 2QFEA 1PO13 2WQ8A 2X5IA 2Y60A 3LE0A 4XQWA 1BMV2 4CUAA 1UMIA 4XJ8A 5JI7A 3I2DA 2GMMA 2UURA 3FFQA 1HV1A 1UY3A 4YW1A 1SLTA 2IZWA 2Y6FA 1YUDA 4K1ZA 4IV3C 4W8JA 1JXNA 2W1QA 5BNQA 1RUOA 3ACHA 5ABJB 5GLVA 2V5YA 5LB6A 4BYYA 5I93A 4JTNA 3VZJA 1CZVA 5FZFA 3IDBB 3HNMA 4TSVA 4B7EA 4HXCA 4ET7A 4DIQA 1CX1A 3ST7A 1GNYA 1W8TA 3HBKA 3TN93 4ES8A 2R042 3HWJA 1ULOA 3HNBM 1JZ7A 4EZ4A 3U0ZA 2QDRA 4ZONA 3VHPA 2R49A 3SITA 3AMNA 5FZ8A 4HPKA 1ULDA 4YGBA 1KGYA 2O14A 1QJU2 4OI4A 4IEUA 4CTEA 5DUWA 2HBUA 2K0GA 2HWB2 2VMCA 3T0AA 2VY0A 2JB8A 5SV8A 3VBOB 3KSCA 4FPOB 1UD1A 1WD3A 2RM23 4XFIA 3U14A 3V0AA 4A42A 3NQHA 1HX6A 2ZKLA 1O3SA 1V6KA 2WNUA 1ASJ3 4IESA 5JMCA 1LEMA 2JG9B 4I0AA 3VBUB 4UFIA 3TB0A 3AP4A 2ZX2A 3ZFGA 4Q0VA 4AF9A 4FPLA 1BLZA 2RS52 1EUUA 3ZN4A 1HQWA 2AEYA 3FWEA 4LE3A 2VZVA 1NCRA 2P17A 2VVFA 1HXS3 5IFPA 3EMRA 4YGCA 4QB2A 3K77A 1J3QA 1NXD1 4WVMA 4BPZA 3LIHA 1QOSA 3AKSA 1XOYA 5HI0A 3AKQA 4P9IA 3R4SA 4UWDA 1HRV3 2HWF2 5FO7B 1YI7A 2KD7A 1YYNA 5DDJ1 2D3SA 3TYJA 2JG8B 4HL0A 3F95A 2LALA 4Q0UA 1AYM3 1N1VA 1Y3TA 2D6OX 4P5YA 5BNNA 4UYBA 1YQ5A 2AEZA 4AFAA 4XURA 1DQ2A 1J59A 2DUOA 2X5IC 3QOPA 5DXDA 4XF9A 3RZJA 2QQIA 1KRIA 2W91A 2XBO3 5I91A 1GMMA 2BDRA 2WS91 1W2TA 2Z69A 1US2A 2W3JA 3N9MA 4NIHA 1POV3 1O8SA 3GJBA 3VDCA 4QGNA 3ZMOA 1VBE3 1UZVA 1U0AA 2HEYF 1DLCA 4S2HA 4W50A 4AQSA 3J7MA 2JKBA 2RJLA 1MS9A 1ZZCA 2D6NA 1CIWA 3GCWA 3VZMA 4PI2A 3VHRA 2HKXA 4FFHA 1RUF1 3WF2A 3FUOA 4YYOA 2VZPA 3WOGA 5K7PA 3DXTA 2FMYA 1AXKA 1DBNA 2XJVA 3LAGA 2VTXA 5KC5A 3ZIXA 4BA6A 1VAVA 2XQXA 4CYDA 1AJKA 2IXIA 2ZGKA 1W8OA 1W06A 4GJZA 3VBSC 5JI9A 1EAH3 5D21A 4DNYA 1QHDA 1ODMA 3B93A 4DXTA 1T2XA 2K46A 3K51A 2BGPA 3NKGA 4CU7A 1DGWA 3MGUA 4QHOA 1JH5A 1GFF2 5KHIA 4XHBA 4IGPA 5FY4A 3VBFA 1C8M1 1N47A 2VJXA 5GLWA 3B5LB 3SH5A 2PA7A 4AL9A 2ZGMA 2FZ1A 3U78A 2CAUA 3CL1A 1SBDA 1YIFA 2J1TA 2VMDA 4AHZA 4EQVA 4FVVA 2BERA 1GLHA 2D44A 4CDXA 4HONA 3EJKA 2WDBA 5B2GB 1ZZ8A 2EF6A 5EP9A 2A3XA 3IAPA 1D4M2 1AR91 5HCAA 2ZS6B 4AI9A 2BTVC 3MF9A 1TME1 4AEDB 5JLVA 5KHKA 1PK6C 5KXBA 1CONA 2YBPA 1F15A 4CDUB 4EJRA 1RUG1 4LBQB 1B35C 1SLBA 4ZXEA 4O65A 4YG3A 4Y1YA 2VL4A 1V9U1 3N9OA 5AFBA 4ZHNA 1VBA1 3VD3A 3WUDA 2F4PA 4FPCA 1DF0A 3FLPA 4I02A 1L7LA 1Z0HA 2BEOA 5ANQA 3IB3A 4HKOA 4IE4A 4OMDA 2JD4A 3QBQA 4QQHA 3GM8A 1OFNA 1H9WA 3M70A 1RTVA 4Y5SA 5FXXA 4XFBA 2FMDA 3ZYPA 4N43A 2WO2A 4UFKA 4AHXA 2WFF2 1GNZA 1DZTA 2YG0A 1C4RA 1H4HA 1LU1A 4TWTA 3S30A 4AI1A 5F3CA 3MF6A 1G9AA 3NRUA 5C4WA 1SFPA 1JU3A 4Z1VA 5FIXA 4LK6A 2W52A 2ZGQA 5CIRA 4OFGA 2WWJA 3AC0A 2UWAA 3NJZA 3OSDA 4FQZA 3PIGA 1JYXA 2RR13 4XMIA 4NROA 2VUJA 1SDWA 4AG4A 4Q4Y3 2EIBA 1OH4A 3J8F2 3KCCA 5GM0A 5FPUA 1FPN2 2DDUA 1QQP1 3AZXA 2BVVA 4XFCA 2FQPA 1DYKA 2PHTA 3U4XA 4UW6A 4Z2AA 1DYPA 1TMF1 4IXLA 4Q4W3 5JVVA 1ZA7A 4QQ2A 1S0GA 2RS32 2F17A 4Z92B 3TEZA 2OPWA 4DS0A 2FBEA 4XW3A 1LHWA 1NAEA 1GZWA 1UYXA 3H42B 5DABA 2I45A 2AZ5A 4P5HA 5AC92 2AC1A 3C7HA 3QLQA 1RUI2 3I3EA 4WM8C 3KWVA 2ZZQA 1X50A 3JD71 4RR3C 2WO7A 1N3QA 2LW8A 3AP7A 1HW5A 1COV3 3KT4A 2ZAHA 1UYPA 4XFAA 2R0HA 4CE8A 4Q0QA 2CAVA 3PU3A 2XVGA 4DZGA 1G9FA 4XUTA 4EROA 1V6NA 4PI0A 4XAAA 2ZMLA 3JBG1 5LBBA 1JZ8A 4H14A 5JZGC 1HN0A 1PX3A 3E97A 3ETQA 4L99A 2B9VA 4N53C 4LNVA 4RGGA 5FLIA 4DRVA 4GZ9A 5A3OA 4UAPA 2ZTNA 3DUIA 1RXFA 4AEKA 2QUOA 1VBD3 1KDMA 3NMBA 1NX9A 4QPGB 2AGSA 3I8TA 3KV4A 2JE7A 5CFDB 3PUAA 4E4SA 1Q8SA 3I4IA 4BQWA 2D98A 3ZXAC 1I5ZA 1BK1A 2VQUA 3U4SA 5JIAA 1LHVA 5FZKA 3DPRB 1UQXA 3I3QA 4GWNA 1SPPA 1NCQB 3D3AA 1RVF3 2YUEA 2V72A 3WW2A 3HPNA 2HYXA 4QD2A 3MLLA 2QQKA 3ES4A 3H8UA 1PIV3 1XB9A 2VCBA 4QMAA 2BJSA 2CYFA 2Q1FA 1QH6A 3ON7A 1VP6A 5FYBA 5LBFA 5JXJA 4AEDA 2RJ2A 4H2AA 1OOPA 2BP6A 5LY1A 3OEBA 4JTOA 4PDWC 5FMOL 3FN9A 2RS11 3SEPA 1CAXB 4KG8A 1A8DA 3LDBA 1AR83 3U37A 4LKDA 4BXSV 3PHMA 1UIJA 4NRQA 5FOBB 2VZUA 5BUVA 1RHI2 3N4MA 2NYYA 3WQBA 1QJY3 3URFA 2JE9A 1NA1B 5FZEA 2CDOA 4J25A 4QHZA 5FXVA 2HH9A 1Q3EA 5JWPA 1ST8A 3WQ0A 1QH7A 2MEV3 3CKHA 2ZBJA 2ZJCA 2OX0A 5FKCA 1BXHA 1SBFA 4CCNA 1QJX3 4K3UA 1V6MA 2WN2A 5LASA 1W9YA 3DYMA 3D0SA 2R072 4HK9A 2QNKA 2ZPXA 4XXAA 3KGLA 3PJYA 1UU6A 3WP3A 1J3PA 2RDQA 3N9QA 4JKLA 1YWKA 5I0TA 3LGRA 2VZTA 4ZZ5A 1C1FA 5GKAC 5F39A 3KVAA 5EV7A 1JHNA 2RVAA 1YC61 4K1YA 4OUMA 4WM7B 5C9AA 1VALA 1XXNA 3AMPA 3AYAA 2DCZA 5FK8A 4K9SA 1Q56A 2JB4A 1W0OA 2HWC3 5IJRA 5ANNA 3ZN6B 3H3LA 3ZPOA 2WNEA 1PVC2 3O1VA 4GWIA 4JQTA 5FTTC 5ISLA 2WINB 4YVWC 1LODA 3WNMA 4RS5A 4V2VA 4DFSA 5CISA 1U12A 4L97A 4RHV1 3OD0A 3UT0A 1IQDC 1GANA 2DCKA 4LMFA 1LULA 3S0MA 1OUSA 1KJRA 2IWGB 4WZFA 2GH2A 1ALYA 1RUJ1 1BEV1 2X10A 4GH4A 4W6YA 1AZDA 1RUC2 1QDCA 1REDA 2VUAA 3MO4A 1O3TA 4MH0E 1VRH2 2ORZA 5F5IA 1W04A 3WP4A 3J26N 3A4UA 3N7LA 3ALQA 3UKTA 1XBFA 5CKNA 3EYPA 4TZDA 3ZSKA 5C5TA 4B4PA 1PO11 2QQUA 2CHHA 2BQPA 4W65A 3MPPG 5FZCA 1F8VA 1DHKB 1W8HA 3R4DB 1I9RA 4FPEA 4R8HA 3S7EA 3C8XA 2X8KA 2DVFA 4B8EA 1QXPA 1O4ZA 3LCPA 5LA9A 1J83A 3L9JT 3WW3A 2WIIB 4DY3A 3BI3A 1Q8PA 5FFOC 2UY8A 4AVCA 3N9LA 5GZCA 4AEMA 3KLSA 5FY7A 1X8EA 2WNOA 2ZHNA 3ZFEC 3K2OA 4OHWA 3TN91 3JUUA 4XUQA 3U10A 1DQ6A 2XUEA 2JXAA 1E57A 1PMIA 1N1YA 2B8MA 2WYFA 3LSDA 3WP5A 1WCKA 2VQTA 4HZFA 1MS1A 4IGQA 1CR7A 1VB2A 4JGYA 1OA3A 4AI0A 2PLV2 3MW3A 4NHKA 4JRLA 5JOWA 4QQLA 2JDMA 4UF0B 4YZ1A 2RM21 3VL8A 2DF7A 2W1UA 2VOTA 3AVSA 5F5CA 4DINB 5LEKA 1RMU2 2R32A 2W39A 1ASJ1 5DUXA 4CCJA 1XE8A 5BV6A 3ZXDA 1GR3A 4ATFA 1G8WA 3POIA 1DQ1A 3ZKYA 2OS2A 4XMAA 3DGTA 5K8SA 4EWDA 4CEYC 1NQDA 3N35A 1K5JA 1LOFC 1GV9A 3QACA 4XBNA 3ZLIA 4DY5A 4YG6A 4S2FA 3NJXA 1HXS1 1OT5A 2TNFA 2J1AA 1UY4A 3THDA 4CSWA 1VBB2 3QH6A 3BIEA 3W5NA 3ZFFA 3AP5A 4Q2FA 1HRV1 3O1MA 1S0FA 2VMIA 3BVCA 4QHBA 4FP2A 1H6XA 1YFYA 4LEJA 1E5SA 3CJIC 2C0ZA 3D4KA 3OF1A 5E6HA 2PAMA 4QU2A 4CDQA 2PHDA 2XLGA 4MGSA 4XUPA 2D7FA 1AX1A 1NZIA 3W20A 1YQ6A 2C4XA 1ZREA 3VD5A 2Y33A 3FLRA 1N1SA 5FZ0A 5BNOA 1G9BA 1D2SA 2XBO1 2YPJA 4ARXA 2QKDA 1AR93 2XDVA 4UW5A 4V2WA 4JC1A 1RUD2 1POV1 2O8OA 4AI2A 1PGL2 1MS8A 4DXRA 3WDVA 1VBE1 4KBZA 5CKQA 2XQRA 4Y22A 2ZX4A 4M01A 4RA0A 4CPBA 1UZ0A 2RJKA 1K5MA 4MLOA 4NPLA 4IV1A 4JZRA 1OFSA 2Y6HA 5FZOB 4EZHA 5F37A 3BYWA 1V6JA 1SBEA 5M0TA 4PCRA 1FOD2 2BOJA 5I0SA 1DCSA 2G9ZA 4BJ0A 3RSJA 5C8CC 2D6LX 3TNQA 2QVSB 5DG2A 3VZLA 4U2AA 2X5IB 5KR7A 2JDHA 2ZMNA 2TEPA 5A32A 1EAH1 4X8NA 1NLQA 4CVUA 3EBRA 3GGLA 3ORJA 2WFF3 3O0WA 3MV01 4OZOA 3T0BA 4JDOA 2NZ9A 4LOSA 1IKPA 2YYOA 1A34A 1CPNA 3T1MA 4D8MA 2R1BA 2VMEA 1W8WA 4FSJA 5CZKA 1QQP3 1QF3A 2NMOA 3A0NA 1OLMA 4LR4A 2GNMA 3NV4A 3G7DA 2DVBA 1TMF3 4QX2A 3HEIA 3IDCB 1W05A 5FYZA 1F31A 2LROA 1GOFA 1W99A 2A5ZA 2PHUA 5GLZA 2RDNA 1FATA 4BK5A 5A6QA 4FOWA 1FPN3 5FQ0A 2VCCA 3MYXA 1JYWA 5J36A 4OHZA 5CFCC 1UOBA 4PQ9A 2VULA 3B69A 1H8TC 1W3XA 3GZAA 5BNPC 1AR61 2Q4SA 3I2HA 4PT6A 4HPKB 1L3JA 3IDAA 4Y20A 2R063 4QPIA 1MZFA 5A1AA 4Z2WA 1EP0A 2JJ6A 4QB1A 2BFUS 2GZWA 3OGGA 2WT1A 3H8OA 3LOBA 1EPZA 3ACGA 2XWJB 1HLCA 4CEWA 3V0AB 5FO8B 4Y5TA 5D8AA 3W21A 3T4VA 5L7OC 4JGZC 2WNUB 5FZDA 1SZBA 1ZBE1 4JKKA 2VNVA 3WF0A 1CVNA 3WNXA 3MFCA 2A75A 3ZFGB 3W59A 5GZGA 2E32A 4F83A 4AW7A 3QCWA 5FAXA 2WZEA 3CHXA 4HG6B 4LA2A 4E2SA 2ZGLA 1NCRB 2GAUA 5EPAA 5FPZA 2WWUA 2VR4A 5FUPA 3NKTA 2VH9A 2P3IA 4LO6B 1AX2A 4WVMB 4DB5A 3SLIA 2HWE3 2RR11 3T30A 3RWNA 1R1A3 3VZOA 1HKDA 2Q8CA 1D0GA 2A70A 4HBNA 1F9KA 1AL22 4Q4Y1 4QX1A 5A7WA 5IVEA 2E6VA 1QY4A 4Y3OA 2ES3A 3WXPA 4DEVA 5ACA2 1MEC3 1W8NA 1X82A 2WT2A 1A6CA 4Y1VA 5EYYA 5JXIA 5BNNB 1X9TA 2VO5A 4Q4W1 1UXZA 4TN7A 4YRDA 1YCIA 3H7JA 2PQQA 4A4AA 1JTZX 1MS4A 5A3UA 4BH9A 1DU3D 1WW6A 3OPZA 1IG3A 5FP3A 3WD5A 1LGNA 4D0QA 4ASLA 4OQ8A 5IWFA 3HN3A 1ZZ7A 1W6MA 1DGWX 2Z5WA 1H0BA 2ZGNA 3ZXKA 1D2QA 3LPFA 1COV1 5HCBA 4IV3A 4C90A 3JB4C 1PM7A 2W47A 2ZX3A 4NHMA 3B01A 5GZFA 2GMPA 1EY2A 2VZSA 3SC7X 3DF0A 3ZYFA 1GQGA 1KS5A 3O0XA 4CXYA 4YFWA 3SH3A 3CIHA 3LEKA 4YZ4A 3ZN5A 1HRI2 1I5PA 2VC9A 1RHI3 4HMZA 2YPDA 1FMD3 2PAEA 2ZGPA 4R4XA 4OCTA 5IVYA 3PLQA 3J9SA 2W92A 4A45A 1OA2A 1LR5A 4QX8A 2WSUA 1RGSA 1CZSA 3I2OA 2CWSA 4YVSC 3K75B 4MG2A 5JXHA 1WD4A 4BHPA 1VR3A 2WZR2 3M3QA 5JMOA 4ISRA 1AR72 1VBD1 2IFRA 3FHIB 3LA3A 3V56A 2EXKA 3OGRA 3A0KA 3VBRA 3C7FA 2AREA 1SG3A 4NHYA 1UKRA 3WDTA 1OUXA 3VBFB 5AFEA 4W6XA 2OZ6A 1IPSA 1GP6A 1RVF1 3AXEA 5IAXA 1K3IA 3NNGA 4AI3A 4CDXB 4JDNA 4LIUA 1QJFA 5FJHA 3MPBA 1WCDJ 2XKPA 4NAOA 4AFMA 1PIV1 4Y5Z0 1WW4A 5FPXA 3OD4A 3S5QA 2VAUA 1Q43A 1U5ZA 2BNNA 4FXKB 4GALA 5DAWA 2D5FA 3PVBB 3POJA 1RUH3 1BEV3 1H8VA 3OB8A 1AXZA 1HB4A 1Z7S2 1CX4A 1YEWA 1M06G 4ZU5A 3USSA 2RMU2 4YG0A 4LBLA 2GH8A 1QJY1 3B7MA 3MUY1 5DMYA 1KEXA 4COVA 2BV4A 1SCRA 3ECQA 3S5AA 1RUC3 4A3ZA 3OY8A 4XIKA 2YV8A 4YGDA 3PTYA 3LSEA 4LE4A 3FHQA 2MEV1 4N43B 5F3GA 2O8QA 5DN2A 4XIOA 1BBT3 1QJX1 1GWLA 1WBFA 3RI9A 4CUBA 3BOPA 4N7IA 2DVDA 4NMIA 3RMXA 5C4WB 1BMV1 1UOGA 2ZABA 4ZZ8A 2D3RA 1XSRA 3POBA 3C2UA 3KVBA 3I2JA 1QMJA 4TTGA 5DPNA 3ACFA 5FKBA 2H0BA 5LA2A 1HB3A 2XOMA 5BYNA 4UXAA 1V00A 4AQ2A 4CCCA 1NG0A 4DOUA 5DZEA 1JYCA 4CDWC 1ZM1A 5AVPA 1KS4A 3T3YA 1TEIA 1UMHA 4BMEA 1GWKA 4PIYA 1G7YA 2HWC1 4ISQA 5C71A 1AVBA 1UMZA 1Y7BA 3FFZA 3DYPA 4MADA 3TAYA 3FZ3A 1J3RA 1MS5A 2VGDA 4NPRA 4O61A 1POQA 2XLAA 3K48A 4LHSA 4YW5A 4K20A 1GZWB 2GSYA 3OBAA 3VBSA 1CZTA 2OA2A 5C6CA 3Q8CA 2GDFA 3GXUA 1PO23 1IS6A 3GBFA 3NJYA 4BIOA 5IVBA 3NL1A 1J1TA 4YW2A 2NN8A 1XYOA 5A80A 4CXWA 3I59A 3PURA 3VBRC 1OKOA 4JQRA 3Q9OA 2QE3A 2ZEYA 3SH4A 2HWB1 1UPSA 2DTYA 1PMJX 1WKYA 1RUE2 4YW7A 1R093 4NO4A 4BLIA 5JIUA 3POFA 4AVTA 1SACA 2A7AA 1XNAA 2P6HA 4OYUA 1A8MA 3GBGA 5DAXA 1UWWA 3MIDA 4DO0A 1O7FA 1H9PA 3R4UA 4META 1MQTC 1KXGA 2VBBA 4NOTA 3WQ7A 4MXVA 4NVPA 3WX5A 1OF3A 3H7YA 2B39A 3ILFA 5FREA 1PK6A 2QQNA 3WLUA 2QTWB 4IETA 1B35A 2B7YA 3HAGA 2UU8A 3MDPA 5G04L 1UYZA 2VVEA 2YFUA 3KS7A 2NQYA 3HR9A 4MV2A 3ZDVA 4OI2A 1JW6A 2XKOA 3EHKA 2PHRA 3S7IA 4ONUA 1S2KA 4EN6B 4EN7B 4JV4A 5FMOS 3MZHA 5DDJ2 4ORFA 4TYSA 3MIGA 4MOAA 3VDDC 1SPPB 3WNOA 1LECA 3ZR5A 2VOXA 4D3WA 3AL6A 1PNGA 2HJIA 5LBCA 5FY8A 4CCMA 4KQ7A 3CBNA 5C3PA 2YROA 2XVKA 1V6IA 3AZWA 4P9LA 5C8WA 5JOXA 3VBHC 3CMGA 5LZ6A 1OOPB 5JR7B 2WZPP 1GZTA 2DWRA 1JZ6A 4HKWA 3A7QA 4YNIA 2Y34A 5FYCA 5GJ6A 2FD8A 3MUZ1 1WLDA 3UK9A 2VNRA 5C7GA 2C5DA 2OVUA 2YGLA 3RFRA 3ELNA 3HJRA 1EPWA 1NLRA 3GNEA 1LNSA 1AF9A 2VBDA 1XNTA 4MSVA 3ZKUA 4XOGA 5JXGA 1JZ5A 5LY2A 3GZUC 2XXZA 3X29B 3K4AA 5F3EA 3ZVXA 3DV8A 4N8MA 1S0BA 3WNKA 4N7UA 4BIFA 2CL2A 1BVVA 1RUF2 2ZOEB 4BQYA 3ILNA 4KGGA 1UIKA 3PUQA 1ND3C 4YW4A 4AFDA 4QX3A 4WM8A 3MIEA 3JZVA 4RR3A 2XONA 3BUCA 3AZYA 3KZ4C 3M3CA 3TEWA 3UV9A 3UGFA 2PHLA 1W2UA 1XJAA 2B4KA 4JVAA 2QQJA 1D0HA 5EYXA 3AX4A 5H9RA 2F4LA 1ODNA 4O9GA 1CJPA 5JDBA 3U07A 4XCBA 2XG3A 3KF5A 4CP0A 2R6QA 4AXOA 2VE1A 3MIHA 4CA9A 2F6BA 3ACIA 4B4QA 5JZGA 1CAUA 5C9AB 4N53A 4CCKA 3NNJA 5A7QA 4C8DA 4QKNA 5G05L 1C8M2 1ND2C 5LA0A 1AR63 1SCSA 2ZGSA 4XQ4A 2FDFA 1W9SA 3JCIA 3J7HA 2UWCA 1OI6A 2WNVC 2W2IA 4RS5B 2W95A 4GB33 3HD8B 5J7MA 1D4M1 1XNBA 1VLNA 1T6BX 4ATEA 5A7PA 1WA6X 4AVVA 1F4AA 2JDAA 4HN0A 1F35A 3AMHA 4LA3A 1GP4A 2BUKA 2J1UA 3E6BA 3J4UH 4ASMB 4GH4B 3ZSEA 2VTXJ 1TME2 3AXDA 4QXCA 4B1LA 1ZBE3 3FMGA 1RUG2 1BQPA 4FOVA 1V9U2 3IT8A 3FLTA 1VBA2 3OEAA 5KHJA 2D6MA 4CP9A 2BNMA 4LBOA 2Y8KA 3I2FA 4QDQA 4RQPA 1QGLA 2QZ2A 3K4DA 1YLLA 5FZGA 5FWJA 3JB8A 2E63A 3VKMA 2WFF1 2ZEWA 4LIVA 4LORA 4BU2A 1W9TA 2XH6A 4QM8A 3UKVA 5IVCA 3BU0A 5FJKA 4PDWA 3OUHA 2E26A 1WW5A 2IXCA 4K7JA 4AI8A 5L9RA 1OURA 4INDA 4IEOA 3KV5A 2YU1A 1QU0A 1OXCA 3ZX7A 1I3HA 4OUSA 1URXA 5IVJA 2V4AA 4QQOA 3UGGA 1DGRN 3OGVA 4OZXA 4QX7A 1JYVA 5KXDA 4AVAA 1AL23 1XNCA 3H1MA 3J8F1 4WVWA 3D5OA 3POWA 1LU2A 1FPN1 4R52A 5FZBA 3J7NA 4FXGB 5A33A 5IT6A 2A73B 3LDKA 1DYOA 1K45A 4XETA 2DFBA 5CVRA 5J09A 2UY9A 5IK5A 2RS31 4M3CA 4PLNA 3H8RA 1GOHA 1XPWA 2R061 4JHTA 1OVSA 2PMWB 2VUDA 1ULPA 3LF7A 4JGYB 3GALA 4IQPA 5J98B 4AR2A 3IKWA 1WMEA 1ULFA 3AVRA 3AYEA 3OPWA 3AP9A 3OYWA 5C3SA 3O1RA 1R082 1XC6A 4JHZA 5K0UA 3NAPC 1BZWA 4XABA 2Y0OA 5BPXA 3I49A 3WR0A 1ENQA 3JD72 3T2QA 4GJYA 2GNTA 2V5DA 4RFT0 5L9VA 3M7AA 1NQJA 5FXWA 2C24A 3FHAA 4QDSA 2OKXA 1E5RA 2ZGRA 2P3JA 1Y4WA 4XF1A 4MZUA 2GC3A 4KWLA 1CGPA 2O1QA 4A3XA 3P6BA 1JZ3A 1HRI3 3KCXA 4KGQA 1EV13 4YVWA 5L73A 4I0BA 2OW4A 1OH3A 1WCUA 2L9LA 3AK0A 2DBNA 4OHVA 4E8DA 2HWE1 2YB7A 4XACA 2V73A 2BNOA 2ETEA 3OBTA 2ET7A 1MZEA 1R1A1 2HWD3 3ES1A 4P9WA 3VDAA 3ZFFB 3RZLA 3IBMA 4U36A 4AWDA 1ONAA 4AAXA 4I3PA 4CDQB 4H55A 4BZ4A 1MEC1 1HJFA 3A22A 3ZYBA 5T5PA 4RQPC 2GALA 2A6YA 4M4RA 5LBEA 2HYKA 4XVHA 5F3IA 4OUEA 2KXLA 5BNOB 4HKLA 1JU4A 1RUNA 5A6YA 3G6JB 2GMEA 2JIJA 4LJHA 3H1WA 4I01A 4L11A 4SLIA 3MBWA 4UFJA 2DV9A 2Q30A 3LEIA 3MLJA 5LEJA 2ZX1A 4Q4V3 4A41A 1Y9QA 1UF2C 4P9JA 5IAVA 4UW4A 4Y22B 3NJVA 1VMFA 1CPMA 1WW7A 1DGRA 2ZA9A 1DG6A 1K5MB 4QQPA 5A7SA 1H2KA 4IV1B 1AYN3 1XNKA 3ZFEA 5C33A 3KCYA 1N1TA 3HQUA 3PNAA 2EALA 3UL2A 3PUSA 1MR5A 2RMU3 4CUGA 1RHI1 5ABJC 2J1RA 3OJBA 1FMD1 1X7NA 4N9IA 4BQ4A 4QX0A 5FP8A 3CF6E 1DQ5A 1SLIA 5FPAA 5HV0A 1LHNA 2Y38A 3BGAA 4YM1A 5FP9A 5A32B 5DZFA 2DUQA 1OHFA 1NZCA 2BBAA 4AZZA 4CP1A 3EQEA 4LBKA 4LBNA 1PMHX 4AGVA 4B3NA 3B9CA 4IDZA 1LEDA 4XQDA 3WUCA 5K0UC 2Z79A 3OTFA 4G3YC 3K3NA 3C7EA 5CYYA 5FLJA 5FPLA 4URTA 1U5XA 1W2AX 2UWBA 3RMYA 3RVHA 4YFZA 4IERA 5DAPA 4FPJA 1KQRA 4BB3A 2P3YA 4RN5A 3Q8AA 1RINA 4P14A 4H7LA 1VBC2 3BODA 2ENRA 2Y26A 4CEYA 2A6WA 1LOFA 4M0HA 1CQ9A 4O9EA 3T2OA 4ARYA 4CU8A 5FQ0B 2A6VA 2R043 2FCUA 2JG9C 5DUUA 3T2TA 3VBUC 4AHYA 5IYYA 1PZ8A 1JS9A 2ZEXA 4NJ4A 5LRSA 1PGW1 1PVC1 2LUWA 1RUH1 3BU7A 4Q4X2 4QU1A 4Y20B 1W8UA 4QPIB 1XNDA 2ZGOA 2JWPA 3AFGA 3BCWA 4CZSA 1QJU3 2G4IA 3CJIA 5CEHA 5GALA 2HWB3 1U5YA 2GP3A 3RS6A 5SV5A 5IK4A 4OLLA 4PBOA 4FTSA 4PJYA 1W9WA 4MUVA 1AUYA 1Q8QA 4N90A 4P02B 4CEWB 4FAHA 2WAOA 3POSA 5EJ1B 5D8AB 5F6LB 1RUC1 4NIAA 1RUJ2 4XTMA 5I0RA 3T09A 1YQ2A 4DRRA 1FNZA 3IAQA 2JG8C 2ZGTA 5C3RA 2RS53 1BBT1 1H1IA 3IZOA 4XILA 5F1RA 5CU1A 2TUNA 1L7RA 3T4HB 3MW4A 1OA4A 3E1F1 3T2PA 1PO12 5F32A 3BKZA 5T54A 3RRDA 4Z07A 4EN0A 4PF5A 4Y1UA 4WVZA 2VZQA 2HWF3 4CP2A 5A7WB 1RYYA 3I2GA 5T5LA 4BE3A 2OZJA 3PUHA 4J1WA 5BXXA 3ZXEA 1STMA 2EIGA 1QKQA 4QXHA 5K4LA 5LRRA 3VD7A 2N7GA 1DDLA 2NM1A 2Q8OA 2DFCA 1LOGA 3KHCA 2E53A 5C8CA 3FX3A 2JDUA 1YO8A 3QD6A 2FZ2A 4JDMA 4UW3A 4UFMA 3O0VA 1NT0A 1NY71 2GN7A 3HN1A 5T5OA 3TN92 4AGGA 3O5SA 1PO21 1S4CA 3PL0A 3PIJA 1S2EA 2QQVA 3LDRA 1W6MB 5I8YA 5FZHA 5EJ3A 4B7KA 4QXBA 4IV3B 3J7LA 4X6QB 1ZRIA 5HXMA 2X29A 1R091 1GUIA 1GKBA 2YGMA 4A2UA 1X9PA 2X53S 3NO8A 1UCXA 3Q8EA 4NWWA 4XFGA 3W58A 3VUOA 1RMU1 4XYXA 3AMQA 2RM22 1F4HA 3ZSJA 3V0BA 4LTAA 4A6SA 1ASJ2 4P00B 2JECA 5CFCA 2CV6A 1H8TA 5BNPA 2SBAA 2E7QA 3BTYA 2WAAA 4QPWA 2W0XA 1LRHA 3W9AA 4LHNA 3U1XA 3O1UA 1ZRCA 1HXS2 1KFXL 2JX9A 5T5JA 4XJAA 2DCYA 4IW3A 5FY0A 2EXJA 2NPIA 3ZMNA 5A6ZA 1ZVFA 3HQXA 4AFBA 1H1AA 3KF3A 4AEDC 4DQAA 3VBRB 4CDUC 1OLME 5L7OA 4JGZA 3OG2A 3BPZA 4TLFA 1CJDA 3ZYIB 4HANA 2G1MA 4V1PA 3ZIWA 3SCGA 4GMP0 5KHHA 3I3DA 1AYM2 3WINE 1S0CA 5F2WA 3VDBA 2LTNA 1IS4A 3AZZA 2ZXQA 3GHMA 2R1DA 1S55A 1D4M3 2WA3A 1OBNA 1TQ5A 3CNAA 3LKJA 4HOOA 3NV1A 1YJKA 2XBO2 3WDUA 5GZDA 1RUD1 4XDOA 4BLJA 4BISA 3H8XA 3AYDA 5FMCA 2JIGA 4FPFA 4UOJA 1PGL1 4GMP1 2V09A 1BJQA 4MHRA 3AJZA 4GXLA 1JZ4A 2R0FA 3VKLA 1OPMA 3KQRA 3ZM8A 3F2ZA 1CAWA 1VBE2 1WWYA 3R05A 4GD4A 1YNAA 4BK4A 3PUIA 2J1SA 5FP7A 1HJGA 4KWJA 1W6OA 2J22A 2VW0A 4RYDA 2PFWA 3OY8B 1UXXX 4LO7A 3THTA 1L7QA 1KJLA 1IOAA 3POYA 1GZCA 1FOD1 4Y4RA 5T52A 4FOYA 2PYTA 3AKTA 1VAKA 4FBFA 2JDYA 2E7TA 2OUJA 4X6RB 3SMHA 3M3EA 2OUHA 3BN6A 4NRMA 3A23A 2VZ3A 3H9AA 2P3KA 4LBQD 2WFPA 4EN9B 3WT3A 1NE4A 5FMDA 1YJLA 3OPTA 1DQ0A 4BCUA 3PJQA 3PVOA 5FZAA 3M3IA 3T1LA 2QQMA 3J8F3 2KM2A 2VMHA 2CNAA 2EXHA 3GZTB 4LUKA 5KXCA 3DECA 4AAPA 5FY1A 3HBZA 2GNDA 4NWVA 4G4FA 4BQ1A 3ZXGA 5E88A 1O5LA 3INAA 2A6XA 2ZAAA 3M4FA 1UNBA 2RS33 4A7ZA 3IPVA 1IGOA 3WDXA 1Z78A 4JCKA 4AQTA 4C0BA 4GB31 3RWKX 2ADDA 2E33A 2GN3A 4XF3A 3TEXA 3VBSB 3WG1A 4R9AA 4YVSA 5AC93 1RUI3 1UY0A 1ACCA 4XC9A 1GQHA 4I3GA 1ZBA2 3I59B 3K46A 1J58A 1XE0A 2FDJA 1UX7A 5FZ4A 3WCSA 2VNGA 4XBQA 1CAVA 2DU0A 4IE7A 5JUVA 3ZPYA 1GP5A 1V70A 3LFIA 1R083 2ID4A 3ZXLA 3OCPA 3APBA 3I2KA 4QPGC 1CWPA 4CCOA 2B42B 5CFDC 4P9XA 2XHNA 2ZZJA 1N3OA 1W0PA 3AL5A 4XDQA 3DPRC 1CD3G 1JYTA 3CLPA 1NCQC 2P5BA 2W87A 4ZS2A 5FRAA 5FZ1A 3HT2A 4Q27A 1PK6B 4K40A 2IVJA 4MXWA 5FXZA 1B35B 5B4XA 5FR3A 2ATFA 3USUA 3DKQA 4FOQA 4C1XA 1ULEA 4QDRA 2WT0A 3E5XA 2CWMA 3HMYA 1O4TA 1H2NA 5L36A 3S6PA 5JPNB 1AL21 2RR12 5A7OA 1MACA 3RJRA 1LOCA 1O8PA 1GWMA 3N7JA 3NV2A 2A6ZA 4AYUA 1RXGA 4J1XA 4Q4Y2 1VAMA 1VRBA 1SHWB 4Q0SA 1XE7A 3P3PA 1TE1B 4Z82A 4D7TA 4LKEA 3E5UA 3GBWA 3EXUA 1OLRA 1NA1C 4QGMA 2WZ8A 2WABA 4KL1A 4Q4W2 1G6NA 2V4VA 1GICA 3HVDA 2YC2A 1NYWA 3UNPA 2EVXA 4FPGA 2OQ7A 3KGZA 3E6DA 4GKYA 3HIFA 2VZOA 3OUIA 1FNYA 4CDWA 1W6NA 3NW4A 4ZY9A 2GU9A 3SISA 4WV8A 5HPOA 4UFHA 1UO9A 3JU9A 3RZZA 2XJUA 4KI5M 5D1IA 1JODA 3RZHA 3PMSA 3ZR6A 3IWZA 4JAAA 3AMMA 1CIYA 2QZ3A 1HRI1 4KG0A 1EV11 1UY2A 4WM7C 1DP0A 1AXYA 2QQOA 1W39A 3EB7A 3MICA 1VE0A 4HK8A 4K21A 4LITA 5FYIA 3RDIA 4AK3A 1LENA 4NIIA 5IFTA 3THCA 4WM8B 3E5QA 4RR3B 2HWD1 1V6LA 1N3PA 1VB4A 2VCMA 1KD7A 3WF3A 2R073 1Y43B 1QNWA 2WZR1 2D43A 3AM2A 4FFIA 3ZYGA 2HLEA 2LS6A 4Y26A 3ZXFA 4L92A 2WUHA 3WSOA 1B09A 5FYYA 1JUIA 4YM3A 1W9FA 4AQ6A 4IEZA 5JZGB 1CAUB 4N53B 3MV11 2Y6LA 3QH7A 1KITA 1RJ8A 1S1AA 5H9QA 1MQTA 4CCLA 4BQ3A 2E31A 1VBC3 1O6UA 1OKQA 1PVC3 2D97A 1W8ZA 4KWUA 2CSGA 4Q29A 1RVF2 5LA1A 4Q8KA 2YBSA 4Q4V1 3UETA 4AGRA 1XU2A 1LAJA 3VB9A 1LOBA 4XUNA 3DL3A 4YLZA 3WDWA 1PIV2 4F3JA 1UZZA 4HLTA 2LRPA 2I74A 1O4YA 1AYN1 1JOPA 5KC6A 5F5AA 3S57A 2VBPA 1YI9A 1AR82 1RL3A 4GAZA 4ASKA 2D93A 2RMU1 1VRH3 2WN3A 1AL0G 4RD7A 2BGOA 1MZ6A 5A3TA 2WQ4A 4TLGA 3VDDA 2G19A 4D7YA 4OMCA 3LIGA 4AHWA 4XJUA 4CP9B 1K12A 4RQPB 5HBAA 4HVQA 4IEXA 2HEWF 2WLQA 3AKRA 1DQ4A 3LA7A 4HFSA 1W2NA 2IXJA 4I09A 2B46X 3WDYA 3D6EA 2MEV2 4XUOA 3VBHA 2UYBA 4PDWB 2VECA 4MGQA 4NPMA 2ARCA 4FTEA 5JCTA 1QJX2 3RG0A 1P8JA 3KV6A 1WCSA 3B9IA 1ENXA 4ZPIA 1YHFA 2Y0IA 3WF4A 1ZZBA 5FK7A 1LESA 1GYKA 1W28A 1FV3A 1UOFA 1HDKA 2WKKA 4KU8A 4KBBA 1PNFA 2WO1A 3KB5A 1TNRA 5A33B 3KV9A 5F7UA 3CQOA 2CY6A 2R041 1AX0A 2JDNA 1G9CA 2YDEA 3WW4A 3MLKA 1IPJA 1HIXA 3NNFA 5FDBA 1GSLA 4LHLA 4BQ2A 1ND3A 1W6PA 2ORXA 4LO8A 4M3CB 2HWC2 1SLAA 4Q0PA 1QJEA 1JMUB 2VZRA 3A21A 3RZMA 1QJU1 2W08A 4ZU4A 2PLV3 5CG8A 2EAAA 2E51A 4QKDA 5FY5A 2BBVA 1LGCA 3OYWB 2ZEZA 1SLCA 2EA7A 4D6SA 4E4ZA 3NVCA 4BMBA 5K0UB 4Q1PA 1VJ2A 2XGXA 1X33A 2Y64A 1RMU3 4IUGA 5FUIA 4JRAA 1BCXA 2AYHA 2FCTA 1O3RA 1RUE1 4W4ZA 4OVEA 3N9PA 4FO9A 1W8FA 5FYMA 2D6KA 2RS51 3ACLA 1ND2A 4Y4YA 4DXZA 2HBTA 5IATA 3AJYA 4YZ3A 2D40A 1XYPA 5IW0A 3ZSLA 4M3CF 2E7AA 2WNVA 5T55A 3NNMA 3FE5A 4YVWB 5A7NA 4EWEA 3WV6A 1RB8G 4E27A 1W6QA 2DYCA 4Q8LA 2QBXA 1VBB3 5A3LA 3WG2A 1WCQA 2CU5A 2XL9A 2ZHMA 3AZVA 2FDIA 5FPVA 1IHMA 4DMIA 3FBMA 2HWF1 3AYCA 3H50A 5F5QA 2BFUL 4QGLA 2G9GA 4E9KA 1ENRA 4P9YA 5FYSA 4A6OA 4MHUA 1H6YA 3VZKA 5CADA 1PX4A 2GNBA 2K9ZA 5H9PA 2Q8DA 3ZN6A 4AEJA 2DTWA 1O91A 3GZEA 5DG1A 1SMVA 4J6GA 2WWSA 3B02A 4LQRA 5C5UA 1DGLA 4RL7A 5LK7B 5LK5A 1HQLA 2PELA 1RUD3 2WS92 4GWMA 4XJZA 3ZXJA 2KA3A 4LOTA 4ES9A 3KHBA 4GMP3 1SFYA 2AR6A 4C91A 4QPYA 2XR4A 2P1BA 3N9NA 5JOZA 4OHYA 2XMLA 4NUBA 4LO4B 5I8SA 3BOWA 1WMXA 4LK7A 4LULA 3SQOA 3ZFEB 1W0NA 2VOWA 2Z2SB 5J37A 1C28A 1H1MA 3Q8BA 1FOD3 3NV3A 1Y9MA 1LJ7A 2R30A 4HSLA 1R64A 2VW2A 4PHZA 5FBJA 4E2QA 1HV0A 3KT1A 4Y1XA 5LCWL 2WJSA 4IGOA 2A3WA 2A71A 3HT1A 4QKBA 3NSTA 5KWRA 2PHXA 2D3PA 2Z4FA 3UGHA 2WQZC 2OT7A 4QAWA 2FDGA 3LWCA 3NAPA 1CESA 1IS3A 4SBVA 1S0JA 1EUTA 1IKQA 4XBLA 3ABZA 4DEQA 3U11A 3WY6A 4UT5A 1H2MA 2VM9A 3SHRA 4NE9A 3C7OA 4R9DA 2CGPA 2OIIA 5FZMA 2ILMA 1CN1A 5ERLA 2WSVA 4CEYB 1QOOA 1VMHA 4GA9A 2XWBB 4MO3M 5FYHA 1QWRA 1I6XA 2WNUC 4GIQA 3WNLA 2J1EA 4XEZA 2FHRA 5BY5A 1E5IA 2GC2A 4Y33A 5C70A 2P2KA 4M3CE 3ROUA 5CA6A 2W1WA 3VL9A 2I2SA 4K8FA 3ZFGC 1JZ2A 1AR92 1FI2A 5JPMB 5H9SA 3B3QE 1NLSA 1ZNPA 2DVAA 2Q0AA 2RHPA 1NCRC 4YM0A 1S0DA 5E8AA 1C3HA 1XYNA 4IE0A 3CJIB 3THPA 4FFGA 1NKGA 2VUCA 4RGKA 5T50A 3P5BA 2YC0A 4Y24A 3DN7A 1ZBA3 2VZ1A 3BIWE 4FI9A 3M1HA 3D82A 1UN1A 1MVQA 2BVBA 2HEVF 4E2GA 4EE2A 3AFKA 1J1LA 3WCRA 1UAIA 5J48A 3D0JA 1Q8OA 4XZUG 1A78A 4AVSA 5FYUA 1US3A 5BNNC 2G9FA 4D69A 2JDZA 1YFUA 4GWJA 3ZYJB 1XU1A 2I07B 3WQ1A 1QOTA 3V64A 1HB2A 4K6BA 1LCLA 3PVNA 5J96B 3FBYA 1I1EA 2PAKA 4H3WA 2YC4A 2VD7A 2BU9A 4IE6A 3SXWA 5HV4A 3MHZA 1BYHA 1ULGA 1WBLA 2RV9A 3VHNA 2OQ6A 5LWBA 4XFHA 1OQDA 3LOIA 4PIXA 3H0OA 3WG3A 3CZUA 2BOIA 5DUVA 3WF1A 3GF6A 5FCCA 5ACA3 1QQP2 5ABJA 4D94A 3OOXA 1BK0A 2AH2A 4YW3A 3N36A 4I30A 5DZGA 5C8CB 1IG0A 2RDRA 4XF4A 5FV3A 5E1RA 1TMF2 1OF4A 4ZU7A 5A70A 2K2SA 1UKGA 3TWIA 5JSPA 2DU1A 5KHGA 4M4PA 5HCHA 4B4RA 5AC91 1RUI1 4PQQA 4OI1A 2C9KA 3LQCA 1BHGA 1TNFA 2A3YA 1DFQA 1UY1A 3OBZA 1FXZA 3LB9A 3GJAA 2R062 2FDHA 2X09A 3WNNA 1JBCA 2BWCA 3FL7A 5E89A 4NRPA 4D7SA 1R081 1LHUA 3WP6A 5IVFA 3VBOA 4QB6A 1KDKA 4LPLA 3N7KA 2Z42A 1IS5A 3I7DA 5FP4A 5FOJB 3JBG2 3V0BB 1YXWA 1FYUA 4GKXA 1QJZA 3VBFC 2JG9A 3VBUA 5CFCB 1LOEA 1H8TB 5BNPB 3UJQA 1D7PM 4HVRA 4DUVA 4IL7A 1NE6A 4CDXC 5DAVA 3WHTA 4DUWA 5FWEA 2WZR3 5TSWA 1X8MA 1UOJA 2EAKA 1AR73 4FPKA 5FBZA 1K42A 5DAQA 4D6QA 4D6RA 4EWAA 3BTZA 1IZ3A 1ZRRA 3MEPA 2HWE2 4IEYA 3M8LA 3DKWA 3O1TA 1O3QA 1R1A2 1YIPA 3ZO0B 5L7OB 3SCHA 4JGZB 1OVPA 4FPHA 1PHMA 2VXRA 1W03A 2JG8A 4N9HA 5I8TA 2H6BA 5KXEA 5L9BA 1JN2P 1MEC2 4LLOA 2D6PA 1LGBA 1NXMA 2JDKA 2EIDA 3RPQA 4P08A 5F8PA 1IQAA 2J7MA 3IIAA 2JEMA 4FT8A 5K9YA 3W5MA 4H7MA 2XJPA 2CGOA 2VCAA 3P1IA 4N43C 1AJOA 5F9TA 3KM5A 4FP3A 3DXUA 4LBJA 2ZX0A 4XDPA 4FAGA 5FMBA 2UYAA 5C4WC 5I0UA 2Q1ZB 2RS12 2ARAA 2W9XA 5FO9B 4B1MA 1Z7S3 3RJ2X 2GP5A 3K3OA 1CAWB 5E16A 1WLCA 2XB6C 1OD3A 4HN1A 5CNAA 2XL7A 4XZPA 5LATA 1W6OB 2QCSB 2BW8A 4JKMA 4XF0A 1C8NA 4CUCA 1HN1A 2DURA 2VNOA 1H30A 4R9CA 4LT5A 1J84A 2JD9A 4TXWA 2X05A 2B5HA 2OXBA 4I0WB 2DCJA 1XQNA 4KMQA 1FMD2 4HETA 4YZ5A 3KMHA 4RSUA 2B45X 2R071 3DYOA 1MVEA 3ZDSA 2YMZA 5GZEA 4O7XA 1UYYA 2AENA 1OLQA 2IUWA 5CG9A 1SEFA 2BGCA 3ETPA 3M2MA 5FLHA 3VBOC 2SLIA 2QJVA 2Q1MA 3BPSA 1QIQA 4QX5A 4AFCA 4YARA 2YBKA 3TBDA 4C0HA 1ZRDA 2ET1A 4E4HA 4COWA 4IEPA 2XPJA 4UI9L 5CAZA 1VBC1 5JOYA 5IVVA 1FAYA 1UZYA 5J3UA 2OPKA 4LXLA 5EFUA 3IPVB 3VKOA 1M4WA 3VKFC 2XHKA 2WRAA 1MS3A 4LUMA 2VU9A 1H4GA 4YVSB 4XJWA 2VMFA 4RHV2 4DXSA 1WZXA 3IMNA 4S2GA 2VG9A 1OD5A 4Q4X1 2D5HA 3AB0A 4WBBA 4BQ5A 1NUKA 1PGW2 2WR9A 3SEEA 2VQ0A 2VXJA 4IEVA 4ZXKA 4YPJA 4XJ9A 1RUH2 3B00A 1CAVB 4FPYA 1BEV2 4LBQA 4UBGA 4YWAA 4CDUA 1XSQA 3N3HA 1RUE3 1W3VA 1VRH1 2DBIA 1BVP1 4LO5B 3H3ZA 1JI6A 1UZWA 3IN9A 2DUPA 3T0DA 3FC0A 4YW6A 4K8RB 4KWKA 2ZKNA 5C3OA 1GOGA 4Q1RA 2PHWA 3C3VA 3RI8A 2YY1A 5KBFA 3I2IA 4MGYE 4P9GA 5FZ7A 3ZYHA 3H1YA 2XJRA 3GHNA 2DCTA 4XCAA 3O14A 1BBT2 3POEA 4MXWB 3RQ0A 1FT9A 2ERFA 3USUB 4MGZE 3VN4A 4MYEA 4R4ZA 2RG4A 4URAA 5FY9A 1OOPC 5F6KA 2WYSA 2FCVA 3SNMA 1AHSA 5LW9A 3O1SA 1A3KA 4MVTA 2JICA 2ARBA 1JYNA 1W90A 3WVJA 2XJTA 5A1LA 1WGPA 1OMIA 5DDJ3 5APAA 4AVBA 3NNLA 2ZGUA 3LEMA 2NMNA 3PDQA 4PBPA 1TZOA 1VPHA 1MPXA 2H0VA 4XXPA 4RGAA 3WNPA 5A6XA 5CB7A 2Q5TA 4GQ7A 2YFZA 2BZDA 2KR2A 2PLV1 1QDOA 4BQXA 2ARXA 5D2AA 2MNGA 3TOJA 1NY72 1JYIA 2WS93 3LD8A 2IXLA 4Q26A 1PO22 3T08A 1HQNA 2BYVE 2EICA 1Q5OA 2PN5A 2VTFA 3IMMA 3K4ZA 4L2NA 4CDWB 1W6NB 1YRZA 2Y6KA 3ZYRA 2W5FA 2A1XA 2R16A 3ENRA 1R092 1PGSA 3MI8A 2VPVA 4OHXA 4QM9A 1TG7A 4XHXA 4ZKTB 1RUF3 2QQWA 3RYKA 5C9AC 3BTAA 1RIRA 2ZMKA 4CRQA 4ZS3A 1VBB1 1UL9A 1GQPA 3VD4A 2WO3A 3VKNA 3VV1A 4Z8BA 5AVAA 2ZHKA 2TBVA 1IPKA 1F2NA 1LB2A 3ILRA 5IHRA 2WC2A 1REFA 3RZGA 1HRV2 4Y1ZA 4RS5C 1QEXA 1SFNA 5J1XA 4NHXA 3MIBA 4XTPA 4PLOA 3LFMA 4QPGA 2C6SA 3JQXA 4I2OA 2WL1A 4GH4C 1RITA 5GLUA 4EV0A 5CFDA 3KQ4B 1JOJA 2C9AA 2ZHLA 3RZKA 4PF1A 2YHJA 1C8M3 2P34A 2PTMA 4YGEA 1ZZ6A 1MQTB 4AOCA 3P3NA 3DPRA 1AYM1 1NCQA 1POV0 2XVLA 2E9QA 1G9DA 1VMJA 5CBLA 2XLFA 1DZRA 1RC6A 4LKSA 1NOVA 1QXRA 3PVEA 1ZX5A 1S2BA 2B9UA 3ATGA 1KFUL 1ZA4A 2CGNA 4BXFA 3ZOIA 1LOAA 1TME3 1U5IA 4XFFA 1CAXA 1LHOA 3DEMA 4Q5OA 4RFRB 3TEYA 2QQPA 3JQWA 1RUG3 1OQ1A 2OYZA 3UJOA 4X8PA 1FV2A 1V9U3 3GYDA 1VBA3 1UPIA 3VDDB 4CU9A 5FYTA 2C26A 2YU2A 4YM2A 4F7ZA 3JXSA 3O7OA 1NA1A 3IM0A 3TNPB 5I0DA 2PHFA 2VOVA 2VQAA 1EAH2 4A44A 3VBHB 3OBRA 3PU8A 5EXOA 2IFWA 1S0IA 2YZ4A 3RNSA 4BOWA 2BPA2 3MFAA 2QQLA 2WLPA 3D8CA 4LKFA 4OI0A 4JGYC 1GBGA 3LA2A 3GCXA 4LBMA 3R0RA 2Q8EA 1F5FA 4CCEA 1Y9GA 4CCDA 5JAXA 2J1VA 2AACA 5FZIA 1YQCA 2RE9A 1RJ7A 3V65A 3O12A 2IVIB 5EJZB 3UESA 3GDBA 2ZCWA 3FUQA 3MW2A 4MX3A 3WG4A 2JDPA 2VOKA 4NN0A 4A7KA 1GU3A 4WM7A 5FZ6A 1OQEA 3HNYM 1UU4A 3BALA 1ND3B 5F2SA 2Y6GA 1W6PB 3TRSB 5FUNA 3IDEA 1AR62 4C1WA 2BRTA 2RDSA 5GLTA 4XPVA 3VHOA 1W2OA 3CZJA 3WHUA 1JOBA 1JHJA 2P6CA 4KU7A 3R6SA 1OPOA 3OGSA 4G9SB 4GB32 2ZACA 3I97A 4COYA 5C3QA 2NLRA 4NHLA 1Q8VA 1C57A 5IK8A 1ZBA1 4COZA 3JD73 3ZFFC 1WLWA 4DUXA 1V0AA 1SDDB 4CU6A 4OQ9A 4UFLA 5FPBA 2PXJA 3B94A 4HSJA 1H2LA 5EQUA 1MZ5A 1ZBE2 4CDQC 1OC1A 1O5UA 2BWAA 4F8AA 1ND2B 3ASIA 2O0OA 4M0NA 5JSRA 3O1PA 5EZWA 4YZ2A 4OULA 1GZ9A 4GULA 1EYBA 3JBG3 3CDZB 2WNVB 3DCQA 1F5JA 1D4VB 1SLLA 2W46A 1UX6A 1W6QB 2C1FA 1G86A 5BNOC 3RYRA 1S0EA 2CDPA 5A3MA 2VVDA 2W94A 4UBHA 3U75A 4CXXA 3I3MA 1HB1A 3POGA 1VIWB 3AP6A 3KT7A 5A1FA 4KNCA 2J42A 1WMFA 2YXSA 2VW1A 2XUMA 4L0PA 2NP0A 4L9BA 1REEA 3I54A 5ACA1 3HQRA 5L19A 3SKVA 2DVGA 4QT6A 2IC1A 4FQ4A 5FZ3A
chains in the Genus database with same CATH topology
1K5MC 4IV1C 2LM3A 4QXKA 4LLFA 4S2DA 3L2HA 1LTEA 3L2YA 1JUHA 4IEQA 4MGKE 1XRUA 2IXHA 4IEWA 3PMEA 3UKNA 2CTVA 4BWOA 4ITCA 1COV2 4YSFA 2GC0A 3NWKA 3RYPA 3ZSMA 3SCFA 1C5HA 4DPNA 1ZZ9A 3BB6A 1LKNA 1WA4A 3OGJA 3LZZA 2IXKA 2RS13 4B29A 4WVVA 1PZ7A 4XE9A 1WMDA 4COUA 4FTBA 1GNHA 4WZCA 3WW1A 3CO2A 1ULCA 1PVXA 2EXIA 1PZ9A 4EN8B 2W68A 1WUVA 1EV12 1AR71 1DIWA 5HXVA 3N7MA 1SQ4A 4PLMA 2VMGA 3NAPB 1VBD2 4BM8A 4HVOA 1X36A 2HWD2 5EWSA 1MS0A 1OSGA 2MPFA 2QDNA 4M00A 4QPIC 4L8QA 3CU7A 1C5IA 1DZQA 1R1ZA 3E6CC 1V6OA 4A7YA 3CJXA 3VLBB 1T6GC 4CEWC 2MHFA 4PIZA 2JENA 4R9BA 5D8AC 3VGIA 2XJQA 2XJSA 3CEWA 4NR1A 1QXJA 1UU5A 2WA4A 5HCFA 5IUQA 1C1LA 1DLLA 2GC1A 1ENSA 4Q4X3 5T3NA 1YFWA 5JSOA 3KD4A 1ZRFA 2H6CA 1Z7S1 3ME2A 3EO6A 4Q4V2 5IK7A 3VZNA 4RHV3 1WLTA 4AE2A 1UW8A 2AUYA 3AKPA 4MGIE 1QJY2 1BKZA 1RUJ3 2P37A 3FJSA 1APNA 1AR81 1AYN2 1FX5A 4E4DX 3H3UA 4W6WA 4KH9A 4LHKA 1YFXA 1ZYBA 3MIFA 1QNYA 3WZ1A 4HT1T 3M3OA 4FCAA 2QFEA 1PO13 2X5IA 4XQWA 1BMV2 4XJ8A 5JI7A 3I2DA 2UURA 2GMMA 3FFQA 1HV1A 4YW1A 1SLTA 2IZWA 1YUDA 4K1ZA 4IV3C 1JXNA 5BNQA 1RUOA 5ABJB 5GLVA 2V5YA 4BYYA 5I93A 4JTNA 3VZJA 3IDBB 4TSVA 4B7EA 3ST7A 3TN93 4ES8A 2R042 3HWJA 3U0ZA 2QDRA 3VHPA 2R49A 3SITA 3AMNA 4HPKA 1ULDA 4YGBA 1QJU2 4OI4A 4IEUA 4CTEA 5DUWA 2K0GA 2HWB2 2VY0A 5SV8A 3VBOB 3KSCA 4FPOB 1UD1A 1WD3A 2RM23 4XFIA 3V0AA 1HX6A 2ZKLA 1O3SA 1V6KA 2WNUA 1ASJ3 4IESA 5JMCA 1LEMA 2JG9B 4I0AA 3VBUB 3TB0A 3AP4A 2ZX2A 3ZFGA 4Q0VA 4AF9A 4FPLA 2RS52 3ZN4A 1HQWA 3FWEA 4LE3A 1NCRA 2P17A 2VVFA 1HXS3 4YGCA 1J3QA 1NXD1 4WVMA 4BPZA 1QOSA 3AKSA 5HI0A 3AKQA 4P9IA 3R4SA 1HRV3 2HWF2 5FO7B 1YI7A 1YYNA 5DDJ1 2D3SA 3TYJA 2JG8B 4HL0A 2LALA 4Q0UA 1AYM3 1N1VA 1Y3TA 2D6OX 5BNNA 4AFAA 1DQ2A 1J59A 2DUOA 2X5IC 3QOPA 5DXDA 4XF9A 1KRIA 2XBO3 5I91A 2WS91 2Z69A 1POV3 3ZMOA 4QGNA 1VBE3 1U0AA 2HEYF 4S2HA 4AQSA 2RJLA 2JKBA 1MS9A 1ZZCA 2D6NA 1CIWA 3VZMA 3VHRA 2HKXA 1RUF1 3FUOA 4YYOA 3WOGA 5K7PA 2FMYA 1AXKA 1DBNA 2XJVA 3LAGA 5KC5A 3ZIXA 4BA6A 1VAVA 4CYDA 1AJKA 2IXIA 2ZGKA 3VBSC 5JI9A 1EAH3 4DNYA 1QHDA 3B93A 3K51A 3NKGA 1DGWA 3MGUA 1JH5A 1GFF2 5KHIA 4XHBA 3VBFA 1C8M1 1N47A 5GLWA 3SH5A 3B5LB 2PA7A 2ZGMA 2FZ1A 2CAUA 3CL1A 1SBDA 1YIFA 4AHZA 4FVVA 1GLHA 2D44A 4CDXA 3EJKA 5B2GB 1ZZ8A 2EF6A 2A3XA 1D4M2 1AR91 5HCAA 2ZS6B 2BTVC 3MF9A 1TME1 4AEDB 5JLVA 5KHKA 1PK6C 5KXBA 1CONA 4CDUB 4EJRA 1RUG1 4LBQB 1B35C 1SLBA 4YG3A 4Y1YA 1V9U1 5AFBA 1VBA1 3WUDA 2F4PA 4FPCA 1DF0A 3FLPA 4I02A 1Z0HA 2BEOA 4HKOA 2JD4A 3QBQA 4QQHA 3M70A 1OFNA 1H9WA 1RTVA 4XFBA 2FMDA 3ZYPA 4N43A 4AHXA 2WFF2 1GNZA 1DZTA 1C4RA 1H4HA 1LU1A 4TWTA 3S30A 4AI1A 3MF6A 1G9AA 5C4WA 4Z1VA 2W52A 2ZGQA 5CIRA 4OFGA 2UWAA 3NJZA 4FQZA 2RR13 4XMIA 2VUJA 1SDWA 4AG4A 4Q4Y3 3KCCA 3J8F2 5GM0A 1FPN2 1QQP1 3AZXA 2BVVA 4XFCA 2FQPA 1DYKA 2PHTA 3U4XA 4UW6A 1DYPA 1TMF1 4IXLA 4Q4W3 5JVVA 4QQ2A 1S0GA 2RS32 4Z92B 4DS0A 2FBEA 4XW3A 1LHWA 1GZWA 2I45A 2AZ5A 4P5HA 5AC92 3QLQA 4WM8C 1RUI2 2ZZQA 1X50A 3JD71 4RR3C 1N3QA 3AP7A 1HW5A 1COV3 3KT4A 2ZAHA 4XFAA 2R0HA 4Q0QA 2CAVA 4DZGA 2XVGA 1G9FA 4EROA 1V6NA 2ZMLA 3JBG1 4H14A 5JZGC 3E97A 3ETQA 4L99A 4N53C 4LNVA 4RGGA 5FLIA 4DRVA 2ZTNA 3DUIA 4AEKA 2QUOA 1VBD3 1KDMA 4QPGB 2AGSA 3I8TA 2JE7A 5CFDB 4E4SA 1Q8SA 3I4IA 2D98A 3ZXAC 1I5ZA 1BK1A 5JIAA 1LHVA 3DPRB 4GWNA 1NCQB 1RVF3 2YUEA 3WW2A 4QD2A 3MLLA 3ES4A 3H8UA 1PIV3 4QMAA 2CYFA 1QH6A 1VP6A 1OOPA 4JTOA 4PDWC 5FMOL 2RS11 1CAXB 4KG8A 1A8DA 1AR83 3PHMA 1UIJA 5FOBB 5BUVA 1RHI2 3N4MA 2NYYA 1QJY3 3URFA 2JE9A 1NA1B 1Q3EA 5JWPA 3WQ0A 1QH7A 2MEV3 2ZBJA 2ZJCA 1BXHA 1SBFA 1QJX3 4K3UA 1V6MA 3D0SA 2R072 4HK9A 2QNKA 2ZPXA 4XXAA 3KGLA 3PJYA 1UU6A 3WP3A 1J3PA 1YWKA 5I0TA 3LGRA 1C1FA 5GKAC 5EV7A 1JHNA 4K1YA 4OUMA 4WM7B 5C9AA 1VALA 1XXNA 3AMPA 3AYAA 2DCZA 4K9SA 1Q56A 3ZN6B 1W0OA 2HWC3 2WNEA 1PVC2 5FTTC 2WINB 4YVWC 1LODA 4RS5A 4DFSA 1U12A 4L97A 4RHV1 3OD0A 1GANA 2DCKA 1LULA 3S0MA 1KJRA 2IWGB 4WZFA 2GH2A 1ALYA 1RUJ1 1BEV1 4GH4A 4W6YA 1AZDA 1RUC2 1QDCA 1REDA 2VUAA 1O3TA 4MH0E 1VRH2 3WP4A 3J26N 3A4UA 3N7LA 3ALQA 3UKTA 4TZDA 3ZSKA 4B4PA 1PO11 2BQPA 4W65A 3MPPG 1F8VA 1DHKB 3R4DB 1I9RA 4FPEA 4R8HA 3S7EA 2X8KA 2DVFA 4B8EA 1QXPA 1O4ZA 3LCPA 3L9JT 3WW3A 2WIIB 4DY3A 1Q8PA 5FFOC 2UY8A 4AVCA 5GZCA 4AEMA 3KLSA 1X8EA 2ZHNA 3ZFEC 4OHWA 3TN91 3JUUA 3U10A 1DQ6A 2JXAA 1E57A 1PMIA 1N1YA 2B8MA 3LSDA 3WP5A 1WCKA 4HZFA 1MS1A 1CR7A 1VB2A 4JGYA 1OA3A 4AI0A 2PLV2 3MW3A 4NHKA 4JRLA 5JOWA 4QQLA 4YZ1A 2RM21 3VL8A 2DF7A 4DINB 5LEKA 1RMU2 2R32A 2W39A 1ASJ1 5DUXA 5BV6A 1XE8A 3ZXDA 1GR3A 4ATFA 1G8WA 1DQ1A 4XMAA 3DGTA 5K8SA 4EWDA 4CEYC 1NQDA 3N35A 1LOFC 1GV9A 3QACA 4XBNA 4DY5A 4YG6A 4S2FA 1HXS1 2TNFA 1VBB2 3QH6A 3ZFFA 3AP5A 4Q2FA 1HRV1 1S0FA 2VMIA 4QHBA 4FP2A 1YFYA 4LEJA 3CJIC 2C0ZA 3D4KA 3OF1A 2PAMA 4QU2A 4CDQA 2PHDA 2XLGA 2D7FA 1AX1A 1ZREA 3FLRA 1N1SA 5BNOA 1G9BA 1D2SA 2XBO1 2YPJA 2QKDA 1AR93 4UW5A 4JC1A 1RUD2 1POV1 2O8OA 4AI2A 1PGL2 1MS8A 3WDVA 1VBE1 4Y22A 2ZX4A 4M01A 4RA0A 2RJKA 1K5MA 4MLOA 4IV1A 1OFSA 1V6JA 1SBEA 4PCRA 1FOD2 5I0SA 5C8CC 3RSJA 2D6LX 3TNQA 2QVSB 5DG2A 3VZLA 4U2AA 2X5IB 2ZMNA 2TEPA 5A32A 1EAH1 4X8NA 3EBRA 2WFF3 3O0WA 4JDOA 2NZ9A 1IKPA 2YYOA 1CPNA 3T1MA 2R1BA 4FSJA 1QQP3 1QF3A 2NMOA 3A0NA 4LR4A 2GNMA 3NV4A 3G7DA 2DVBA 1TMF3 3IDCB 1F31A 2PHUA 2A5ZA 5GLZA 1FATA 4FOWA 1FPN3 5FQ0A 3MYXA 5J36A 4OHZA 5CFCC 4PQ9A 2VULA 3B69A 1H8TC 3GZAA 5BNPC 1AR61 2Q4SA 4HPKB 1L3JA 4Y20A 2R063 4QPIA 1MZFA 4Z2WA 1EP0A 2JJ6A 2BFUS 2GZWA 3OGGA 2WT1A 3LOBA 1EPZA 2XWJB 1HLCA 4CEWA 3V0AB 5FO8B 5D8AA 5L7OC 4JGZC 2WNUB 1ZBE1 1CVNA 3WNXA 3MFCA 2A75A 3ZFGB 3W59A 5GZGA 4F83A 4AW7A 3QCWA 5FAXA 4LA2A 4E2SA 2ZGLA 1NCRB 2GAUA 5FPZA 3NKTA 2VH9A 2P3IA 4LO6B 1AX2A 4WVMB 4DB5A 3SLIA 2HWE3 2RR11 3RWNA 1R1A3 3VZOA 1HKDA 1D0GA 2A70A 4HBNA 1F9KA 1AL22 4Q4Y1 2E6VA 1QY4A 2ES3A 3WXPA 5ACA2 1MEC3 1X82A 2WT2A 1A6CA 4Y1VA 5EYYA 5BNNB 4Q4W1 4YRDA 1YCIA 3H7JA 2PQQA 1JTZX 1MS4A 4BH9A 1DU3D 1WW6A 3OPZA 3WD5A 1LGNA 4ASLA 1ZZ7A 1W6MA 1DGWX 2Z5WA 1H0BA 2ZGNA 3ZXKA 1D2QA 5HCBA 1COV1 4IV3A 4C90A 3JB4C 1PM7A 4NHMA 2ZX3A 3B01A 5GZFA 2GMPA 1EY2A 3DF0A 1GQGA 1KS5A 3O0XA 4YFWA 3SH3A 4YZ4A 3ZN5A 1HRI2 1RHI3 4HMZA 1FMD3 2PAEA 2ZGPA 4R4XA 3PLQA 3J9SA 1OA2A 1LR5A 2WSUA 1RGSA 2CWSA 4YVSC 1WD4A 4BHPA 1VR3A 2WZR2 3M3QA 4ISRA 1AR72 1VBD1 2IFRA 3FHIB 3LA3A 3V56A 2EXKA 3A0KA 3VBRA 2AREA 3WDTA 1UKRA 3VBFB 5AFEA 4W6XA 2OZ6A 1RVF1 3AXEA 4AI3A 4CDXB 4JDNA 3MPBA 1WCDJ 2XKPA 4AFMA 1PIV1 4Y5Z0 1WW4A 5FPXA 3OD4A 1Q43A 1U5ZA 2BNNA 4FXKB 4GALA 2D5FA 3PVBB 1RUH3 1BEV3 1H8VA 1AXZA 1Z7S2 1CX4A 1M06G 4ZU5A 3USSA 2RMU2 4YG0A 4LBLA 2GH8A 1QJY1 3B7MA 4COVA 1SCRA 3ECQA 1RUC3 3OY8A 4XIKA 2YV8A 4YGDA 3PTYA 3LSEA 4LE4A 2MEV1 4N43B 2O8QA 4XIOA 1BBT3 1QJX1 1WBFA 3RI9A 3BOPA 4N7IA 2DVDA 3RMXA 5C4WB 1BMV1 2ZABA 2D3RA 3C2UA 1QMJA 2H0BA 5BYNA 4UXAA 1V00A 4AQ2A 1NG0A 4DOUA 5DZEA 1JYCA 4CDWC 1ZM1A 5AVPA 1KS4A 1TEIA 4BMEA 4PIYA 1G7YA 2HWC1 4ISQA 1AVBA 1UMZA 1Y7BA 3FFZA 3TAYA 3FZ3A 1J3RA 1MS5A 2VGDA 4NPRA 2XLAA 4YW5A 3K48A 4K20A 1GZWB 2GSYA 3VBSA 2OA2A 5C6CA 2GDFA 1PO23 1IS6A 3GBFA 4BIOA 3NL1A 1J1TA 4YW2A 2NN8A 1XYOA 3I59A 3VBRC 4JQRA 3Q9OA 2QE3A 3SH4A 2HWB1 1UPSA 2DTYA 1RUE2 1R093 4NO4A 4BLIA 5JIUA 4AVTA 1SACA 2A7AA 1A8MA 3GBGA 3MIDA 1O7FA 1H9PA 3R4UA 4META 1MQTC 1KXGA 4NOTA 3WQ7A 4MXVA 4NVPA 3WX5A 3H7YA 2B39A 3ILFA 5FREA 1PK6A 3WLUA 4IETA 1B35A 2B7YA 3HAGA 2UU8A 3MDPA 2VVEA 3KS7A 2NQYA 3HR9A 4MV2A 4OI2A 1JW6A 2XKOA 3EHKA 2PHRA 3S7IA 4ONUA 1S2KA 4EN6B 4EN7B 4JV4A 5FMOS 3MZHA 5DDJ2 4ORFA 4TYSA 3MIGA 3VDDC 1LECA 2VOXA 4D3WA 1PNGA 2HJIA 4KQ7A 5C8WA 2YROA 2XVKA 1V6IA 3AZWA 4P9LA 5JOXA 3VBHC 1OOPB 5JR7B 2WZPP 2DWRA 4HKWA 4YNIA 5GJ6A 1WLDA 3UK9A 2VNRA 2C5DA 2OVUA 2YGLA 3ELNA 1EPWA 1NLRA 3GNEA 1AF9A 4MSVA 4XOGA 3GZUC 3X29B 3ZVXA 3DV8A 1S0BA 4N7UA 4BIFA 2CL2A 1BVVA 1RUF2 2ZOEB 3ILNA 4KGGA 1UIKA 1ND3C 4YW4A 4AFDA 4WM8A 3MIEA 3JZVA 4RR3A 3AZYA 3KZ4C 3M3CA 3UV9A 2PHLA 1W2UA 4JVAA 1D0HA 5EYXA 3AX4A 5H9RA 4O9GA 1CJPA 5JDBA 3U07A 2XG3A 4CP0A 2R6QA 4AXOA 3MIHA 2F6BA 4B4QA 5JZGA 1CAUA 5C9AB 4N53A 1C8M2 1ND2C 1AR63 1SCSA 2ZGSA 4XQ4A 3JCIA 2UWCA 1OI6A 2WNVC 4RS5B 4GB33 3HD8B 5J7MA 1D4M1 1XNBA 1VLNA 4ATEA 4AVVA 4HN0A 4LA3A 3AMHA 2BUKA 3E6BA 3J4UH 4ASMB 4GH4B 3ZSEA 1TME2 3AXDA 1ZBE3 3FMGA 1RUG2 1BQPA 4FOVA 1V9U2 3IT8A 3FLTA 1VBA2 5KHJA 2D6MA 2BNMA 4LBOA 4RQPA 2QZ2A 1QGLA 1YLLA 3JB8A 2E63A 3VKMA 2WFF1 2XH6A 4QM8A 3UKVA 4PDWA 1WW5A 2IXCA 4K7JA 4AI8A 4INDA 4IEOA 1QU0A 3ZX7A 1I3HA 4OUSA 1URXA 4QQOA 1DGRN 4OZXA 5KXDA 4AVAA 1AL23 1XNCA 3H1MA 3J8F1 4WVWA 3D5OA 3POWA 1LU2A 1FPN1 4R52A 5A33A 5IT6A 4FXGB 2A73B 4XETA 2DFBA 5CVRA 5J09A 2UY9A 5IK5A 2RS31 4M3CA 4PLNA 2R061 4JGYB 3GALA 4IQPA 5J98B 3IKWA 1WMEA 1ULFA 3OYWA 3AYEA 3AP9A 1R082 5K0UA 3NAPC 1BZWA 2Y0OA 5BPXA 3WR0A 1ENQA 3JD72 4RFT0 2GNTA 3M7AA 1NQJA 2ZGRA 2P3JA 4XF1A 4MZUA 2GC3A 4KWLA 1CGPA 2O1QA 4A3XA 1HRI3 3KCXA 4KGQA 1EV13 4YVWA 5L73A 4I0BA 2OW4A 3AK0A 4OHVA 2HWE1 2V73A 2BNOA 2ETEA 3OBTA 2ET7A 1MZEA 1R1A1 2HWD3 3ES1A 4P9WA 3ZFFB 4E27A 3IBMA 4U36A 4AWDA 1ONAA 4I3PA 4CDQB 4H55A 4BZ4A 1MEC1 5T5PA 4RQPC 2GALA 2A6YA 2HYKA 5BNOB 2KXLA 4HKLA 1RUNA 3G6JB 2GMEA 3H1WA 4I01A 4L11A 4SLIA 2DV9A 2Q30A 3MLJA 5LEJA 2ZX1A 4Q4V3 1Y9QA 1UF2C 4P9JA 4UW4A 4Y22B 1CPMA 1WW7A 1DGRA 2ZA9A 1DG6A 1K5MB 4QQPA 1H2KA 4IV1B 1AYN3 1XNKA 3ZFEA 5C33A 3KCYA 1N1TA 3PNAA 2EALA 3UL2A 1MR5A 2RMU3 1RHI1 5ABJC 3OJBA 1FMD1 1X7NA 4N9IA 3CF6E 1DQ5A 1SLIA 1LHNA 2Y38A 4YM1A 5A32B 5DZFA 2DUQA 1OHFA 1NZCA 4CP1A 3EQEA 4LBKA 4LBNA 4AGVA 4B3NA 5K0UC 3B9CA 4XQDA 1LEDA 3WUCA 2Z79A 3OTFA 4G3YC 5FLJA 4URTA 1U5XA 4YFZA 2UWBA 3RMYA 4IERA 4FPJA 1KQRA 1RINA 4P14A 4H7LA 1VBC2 3BODA 2ENRA 2Y26A 4CEYA 2A6WA 1LOFA 4M0HA 1CQ9A 4O9EA 5FQ0B 2A6VA 2R043 5DUUA 2JG9C 3T2TA 3VBUC 4AHYA 1PZ8A 5LRSA 1PGW1 1PVC1 2LUWA 1RUH1 3BU7A 4Q4X2 4Y20B 4QPIB 1XNDA 2ZGOA 3AFGA 3BCWA 4CZSA 1QJU3 2G4IA 3CJIA 5GALA 2HWB3 1U5YA 3RS6A 5SV5A 5IK4A 4OLLA 4PBOA 4FTSA 4PJYA 4MUVA 1AUYA 1Q8QA 4N90A 4CEWB 4FAHA 3POSA 5F6LB 5D8AB 1RUC1 1RUJ2 4XTMA 5I0RA 4DRRA 1FNZA 2JG8C 2ZGTA 2RS53 1BBT1 1H1IA 4XILA 5F1RA 5CU1A 2TUNA 3MW4A 1OA4A 1PO12 5T54A 3RRDA 4Z07A 4EN0A 4PF5A 4Y1UA 4WVZA 2HWF3 4CP2A 5T5LA 4BE3A 2OZJA 4J1WA 5BXXA 3ZXEA 2EIGA 1QKQA 5LRRA 2N7GA 1DDLA 2NM1A 2Q8OA 2DFCA 1LOGA 2E53A 5C8CA 3FX3A 1YO8A 3QD6A 2FZ2A 4JDMA 4UW3A 3O0VA 1NY71 2GN7A 3HN1A 5T5OA 3TN92 4AGGA 3O5SA 1PO21 1W6MB 5I8YA 5EJ3A 4B7KA 4IV3B 4X6QB 2X29A 1R091 1GKBA 2YGMA 4A2UA 2X53S 3NO8A 1UCXA 4NWWA 4XFGA 3VUOA 3W58A 1RMU1 4XYXA 3AMQA 2RM22 3V0BA 3ZSJA 4LTAA 1ASJ2 2JECA 5CFCA 2CV6A 1H8TA 5BNPA 2SBAA 2E7QA 2W0XA 1LRHA 3W9AA 4LHNA 1ZRCA 1HXS2 1KFXL 2JX9A 5T5JA