3CJIA

Structure of seneca valley virus-001
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
258
structure length
258
Chain Sequence
STDNAETGVIEAGNTDTDFSGELAAPGSNHTNVKFLFDRSRLLNVIKVLEKDAVFPRPFPTQEGAQQDDGYFCLLTPRPTVASRPATRFGLYANPSGSGVLANTSLDFNFYSLACFTYFRSDLEVTVVSLEPDLEFAVGWFPSGSEYQASSFVYDQLHVPFHFTGRTPRAFASKGGKVSFVLPWNSVSSVLPVRWGGASKLSSATRGLPAHADWGTIYAFVPRPNEKKSTAVKHVAVYIRYKNARAWCPSMLPFRSYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Seneca Valley Virus-001: an oncolytic picornavirus representing a new genus
pubmed doi rcsb
molecule tags Virus
molecule keywords Polyprotein
total genus 48
structure length 258
sequence length 258
ec nomenclature
pdb deposition date 2008-03-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3cjiA00
1PO13 1POV1 5C9AA 1PGW2 3NAPA 2HWE3 5C9AC 4IV3B 3JB8A 1ZBA1 1VBB2 5CFDA 1VBC2 5AC92 5J96B 1C8NA 1RUI3 1VBA3 4RS5C 2XBO3 1AYM3 5K0UC 5A33A 1EAH2 1NCRC 1BBT1 1VBE1 5A32B 1MQTC 1ZBA3 2HWE2 5BNOB 1RMU2 1QJY2 4YVSC 3DPRA 3VBOC 2PLV3 4CEWA 1BBT3 1VBE3 1BMV1 1VBB3 2BFUL 1AR92 5LK7B 1RUD2 2RR11 1K5MB 1MEC2 4QPGA 2GH8A 5ACA3 4Q4X3 1RUI1 1QJY1 1RMU1 4Q4Y3 5C4WB 1DDLA 1VBA1 1NY72 4YVWA 2RR13 3JD71 1E57A 4FTSA 4YVWC 3ZFEC 3ZFFB 1FOD3 4N53A 1RVF2 1BBT2 1VBE2 1EAH1 5ACA1 2WZR3 1VBC1 1BMV2 4Q4W1 1ND3B 1QJX3 3VBUA 4GMP3 5BNPC 1VBB1 3JBG3 2R063 1EAH3 3VBUC 4JGZC 1AUYA 4PDWB 1AL22 1RVF1 1TME2 4GMP1 1SMVA 1VRH2 1FOD2 1RUJ1 1QJY3 3JBG1 1MQTA 4JGZA 1AR72 5AC91 1VBD2 1HQNA 1QJZA 1R082 1ZBE2 1PIV3 2RM23 1MEC1 2R071 4JGYA 4WM8A 4FTBA 4QPGC 2RS52 1AYM1 5ACA2 1PGW1 3JB4C 1AR63 1OOPC 4RFT0 4Q4Y2 1NCRB 1RHI2 1RUH1 1PIV1 5BNNA 4QPIB 2ZZQA 1NY71 4SBVA 4QPIA 4CDUC 1VBD3 1RVF3 2WFF2 1OHFA 1AR61 2RM22 1RUH3 1AYN1 1AR91 5D8AB 1ZBA2 1W39A 1RMU3 4GMP0 3VBSB 5JZGC 1AR93 5BNPB 1VB2A 1FPN3 2WZR1 5K0UA 1ZBE3 2HWC3 4Q4W3 1QQP3 4AEDB 1AYN2 2WS93 4IV1A 1PGL2 5C8CA 1PO22 4RR3C 5CFCC 5C9AB 1HRV2 1H8TB 2RMU1 2HWC1 4GB31 2RS32 1A6CA 5CFDB 2PLV1 1RUF2 4RQPC 4FSJA 1CD3G 3VDDA 4EJRA 4NWVA 2RMU3 4WM7A 2WS92 5FMOL 2RM21 1R1A3 1ZBE1 4Z92B 1HRV3 3VBFB 4GH4B 4PDWC 2WS91 3VBFA 1VB4A 1FOD1 1RUJ2 2Y26A 5K0UB 1R1A1 1VBC3 2FZ2A 4CEWB 3VBHC 1QJX1 4CEYA 2RMU2 1V9U3 5D8AC 3ZFGA 4CDUB 1EV12 2HWC2 4CDQB 1R1A2 3NAPB 1PO21 4YVWB 1B35A 3VBSC 2X5IA 4IV3A 1RUJ3 1RUC3 2RS33 1NCRA 3VDDC 1EV13 1RUH2 1MEC3 4RR3B 1FPN1 1ND3A 1BEV2 1NOVA 4GH4A 2RS31 1V9U1 4Y4YA 5L7OC 1TMF2 2HWB2 4YVSA 3CJIB 5CFCA 1NCQB 4PDWA 5ABJA 1R081 5CFCB 1RUC2 5L7OB 1VBD1 1R092 1K5MA 4GB33 4Q4V3 1NCQC 1D4M1 4JGZB 3VBRA 2GSYA 1CJDA 1TME1 1QQP2 3JBG2 1AYN3 1B35B 1RHI1 2BPA2 3VBHA 3TN91 2VQ0A 2HWB3 1D4M3 5FMOS 1HRV1 1TME3 4CEWC 4FTEA 3VBFC 2BBVA 1R093 4Q4V2 5C8CC 4IV1C 1R083 1GFF2 1OOPB 1F2NA 1QQP1 2XPJA 3FBMA 3CJIA 5DDJ3 3J8F2 1ND2C 5L7OA 1FMD2 1MQTB 1RHI3 4CDWA 5JZGB 4GH4C 4JGYB 4WM8B 3VBRB 2HWB1 4RHV1 1ND2A 2BUKA 2HWF3 2R072 4JGYC 4WM8C 3VBRC 3VBHB 1C8M3 1Z7S3 1K5MC 3JD72 4CDQC 4RHV3 4CDXC 4CDUA 1AR81 1COV3 1F8VA 5DDJ1 1M06G 2R043 3ZFEB 3ZFFC 2X5IB 4Q4V1 1FPN2 2ZAHA 2WLPA 4Q4W2 2IZWA 2HWF1 5A32A 3J8F1 5DDJ2 1PO23 4IV3C 5BNOA 4LLFA 1B35C 1AR82 3TN93 3VBSA 5J98B 3CJIC 1POV0 1RB8G 1RUC1 1COV1 1RUE2 2RS12 1R091 5ABJB 1EV11 3ZXAC 5C8CB 5FOJB 3VBOA 1H8TA 4RS5B 3VBOB 4QPGB 2HWD1 1D4M2 2PLV2 2MEV2 3ZFEA 4CDXA 1RUD3 1OPOA 4WM7B 2ZTNA 3M8LA 4Y5Z0 4WM7C 1ASJ2 4Q4X2 5A33B 1V9U2 1HXS2 1HRI2 1RUD1 1TMF1 1PO11 4NWWA 1C8M1 1Z7S1 1FMD1 3NAPC 3ZFGB 1AR83 3TN92 4YVSB 1QJX2 4AEDC 2HWD3 2XBO1 1RUE3 2RS13 2R062 4RS5A 1AL0G 3S6PA 1PVC3 1BEV3 4N43B 1QJU2 1VRH3 5CFDC 4N43A 2FZ1A 1TMF3 1RUG3 1AR73 4N53B 3VBUB 5BNNC 1PVC1 1H8TC 4IV1B 2HWD2 2R042 1BEV1 4GB32 5BNNB 1AYM2 1ND3C 2RS53 4Q4X1 1RUG1 1QJU1 1POV3 1HRI3 1AR62 4QPIC 1RUE1 2RS11 5ABJC 1NCQA 1RUG2 4BCUA 4CDQA 2WFF3 2TBVA 1VRH1 2R041 5BNPA 5C4WA 5GKAC 1ND2B 5C4WC 3ZFFA 4CEYC 1NG0A 2WWSA 2BFUS 3J8F3 1QJU3 1NA1C 1ASJ1 3IDEA 4CEYB 1X33A 1HRI1 2MEV3 4RR3A 1HXS1 1FMD3 1NA1A 5AC93 2DF7A 5BNOC 2WZR2 1NA1B 1X36A 2X5IC 1AL21 2QQPA 1OOPA 1VBA2 2HWF2 2WFF1 3HAGA 5D8AA 2R073 3ZFGC 4CDXB 1ASJ3 4Q4Y1 1HXS3 4CDWB 5JZGA 3VDDB 3JD73 1C8M2 1Z7S2 1AL23 1IHMA 1PO12 4N53C 4RQPA 4RHV2 4CDWC 4RQPB 3DPRC 1COV2 1RUF3 4N43C 3LOBA 1PGL1 1HX6A 1AR71 2HWE1 3DPRB 1WCDJ 2MEV1 1PIV2 1RUI2 2R061 2XBO2 4AEDA 1RUF1 1PVC2 1VAKA 2RS51 2RR12
chains in the Genus database with same CATH superfamily
5C9AA 3I49A 4LEJA 2Z69A 2IXKA 1KITA 2YMZA 4KU7A 4LO7A 1MVQA 4QXHA 4AVSA 2K9ZA 2CAVA 4N9HA 3MEPA 5CFDA 4HL0A 4FPFA 5EYXA 3I8TA 4JKLA 1NUKA 1MR5A 1W6QA 4NPMA 1AYM3 3I2FA 2W1SA 1NCRC 5EWSA 1VBE1 2VW2A 1XNBA 2ZBJA 5T55A 2IXHA 2HLEA 4HBNA 4MGSA 1MQTC 3H3UA 4N7IA 3WQ1A 5L9RA 4QQLA 2HWE2 3VKMA 1DP0A 2JKBA 4LIUA 4UFJA 4BHPA 4E8CA 1QJY2 5E1RA 4P08A 4LBQD 4YVSC 2P37A 3HQRA 3VBOC 1VBE3 4AW7A 3TEWA 4LO4B 1RUD2 3GCWA 4NIGA 1QGLA 5JXJA 5FZAA 1GKBA 5FZDA 2XUEA 1S2EA 2A6VA 4JCKA 5DAQA 5I8SA 2GH8A 3NSTA 3HNYM 4QB6A 3VD4A 1DBNA 1W6PB 3FUQA 3QD6A 4LE3A 1RMU1 4NHMA 4NHKA 4A4AA 5C4WB 1VBA1 2DU1A 1NY72 2RJ2A 2D6LX 4D7TA 3WP3A 1OURA 1E57A 4Q0UA 3LE0A 3ZFFB 5HXMA 5LEKA 1QMJA 1WW6A 3AMPA 3I3DA 4YZ2A 1UOGA 5IK5A 3NO8A 1ZVFA 1OD5A 2XR4A 2CWSA 1D4VB 4DB5A 4B4RA 4A44A 1VBB1 1Z78A 3PTYA 1YQCA 2XB6C 1AXKA 3JBG3 4LITA 5FP7A 4ZKTB 4QQ2A 3O1UA 4CTEA 3SEPA 3QLQA 1JYXA 1C5HA 1CPNA 1AL22 3A0KA 2RG4A 4XXPA 1TME2 3AKPA 1CX4A 2ZEWA 4HONA 4QT6A 4CCKA 3JBG1 4XIKA 1AR72 4AQSA 5AC91 2XL7A 1YWKA 4AI9A 1IG0A 1LB2A 4CCCA 1PIV3 4HFSA 2RM23 2JWPA 3WDXA 1V6NA 2R071 2VUAA 3WW4A 2RS52 3ZN4A 3JB4C 3WNXA 1KD7A 1S0DA 4OYUA 4RFT0 3SC7X 3LCPA 1NCRB 2VCMA 1PIV1 5IWFA 2J1UA 3UL2A 4CVUA 3UGGA 2YY1A 4AVAA 2XJTA 1CIWA 3BPSA 1VBD3 2R1DA 1RVF3 2WBKA 5DG1A 3ZPYA 4ARXA 1G6NA 5BPXA 5JXHA 3O5SA 4P9XA 1GICA 4RGGA 3BB6A 1MS5A 2JJ6A 4OUEA 1W6OB 1W8TA 2DWRA 3FZ3A 1UCXA 5C7GA 1W39A 4I0AA 4PBPA 1A34A 1OQDA 3VDAA 1WUVA 1XU2A 4K6BA 2VOWA 1YFWA 1LOFC 1I6XA 4A3XA 5A6XA 1Y7BA 1W3VA 4KQ7A 4XFHA 2KD7A 4Q8LA 5HCFA 3H8XA 4CYDA 2AC1A 5IK8A 5BNPB 4EV0A 3B94A 5FMCA 3P6BA 1JZ4A 4QDQA 3ZXKA 3IBMA 3O14A 2VW1A 3C7HA 4RGAA 4YM2A 4IGOA 2HWC3 5D2AA 4DY5A 1QQP3 5DN2A 3K51A 4Q5OA 1APNA 2WS93 4IV1A 3AZVA 4M3CA 1HRV2 1KRIA 4WVMA 4PBOA 4UW6A 1H8TB 2RMU1 1W06A 2VVDA 2HWC1 1UXXX 4JTNA 3TWIA 4NMIA 5FJKA 3OB8A 1A6CA 2XDVA 3OPWA 1LRHA 1AX0A 2WQZC 3CBNA 2CGNA 1CD3G 4MV2A 3ZYPA 1S2KA 2H0BA 4BPZA 4G3YC 4IEUA 2RMU3 3WP4A 4WM7A 1K3IA 2R16A 1NE6A 3WG1A 5FZ7A 4IEQA 1W8UA 3JUUA 5IFPA 5JPMB 1R1A3 1X9TA 3O1OA 2GMMA 2YROA 4AAPA 3O1RA 4M3CE 1VLNA 3DXUA 2VMCA 4NR1A 4P9LA 3VBFB 2GNTA 5LY2A 2GC0A 1UIKA 4GH4B 1SZBA 2GU9A 1RYYA 1XU1A 5DAVA 2BVVA 3VDBA 2BP6A 1QNYA 2A6ZA 4DRRA 4XJUA 2VQAA 5FPBA 2ZCWA 4C0BA 1R1A1 3K77A 4C8DA 1VBC3 3NJYA 2G4IA 4CEWB 5A6YA 1WLWA 5B4NA 2ZS6B 1QJX1 2XJRA 5LRRA 5D8AC 3ZFGA 4CDUB 1EV12 1X82A 3RYKA 5FZMA 2DFCA 3O1VA 5I0TA 1S0BA 3LKJA 5IVFA 5I8YA 1SLTA 1H1IA 2GN7A 2EXHA 3J9SA 1X7NA 1B35A 2B8MA 3ECQA 5ABJB 2X5IA 1LAJA 1JOBA 5E89A 4XF4A 1RUJ3 1W8WA 5J36A 4HN1A 3NMBA 1RUC3 3ACLA 2RS33 3E5XA 1NCRA 5C5TA 3KM5A 1NXD1 4IEXA 3WDTA 4NIIA 4K3UA 2AEYA 1FPN1 1N1SA 1GNYA 3FN9A 1KS5A 3I2IA 2A3XA 3K4ZA 2BERA 2RS31 2X29A 3OOXA 1UZ0A 3GXUA 4V2VA 1FV2A 3D0SA 4LORA 4A7ZA 1GNZA 5FYHA 1FI2A 1UWWA 5AVPA 2W87A 3RZZA 2C9AA 3I3EA 5CISA 4AFDA 2WT1A 5FXWA 4B29A 4WBBA 2E7TA 1HIXA 3SMHA 3LPFA 1JOJA 3LFIA 1D4M1 3PVNA 4XYXA 4JGZB 5F6KA 1JUHA 3V65A 1HV1A 1KGYA 5DAPA 4EWEA 1OD3A 3LSDA 4KG0A 4MXWA 5FZBA 5AFEA 1QQP2 2PAEA 3I3QA 4KWUA 4XZUG 4ZZ8A 5F1RA 3WP6A 5FZ3A 5F5IA 1RHI1 2VXJA 2JIJA 1O3QA 3OGGA 3VBHA 3DYPA 2B45X 2VQ0A 1V6KA 1R1ZA 2OPKA 2P4EA 2WNEA 2HWB3 5A7WA 5FQ0A 1D4M3 1QJEA 4UW3A 5FMOS 5FZIA 3ZIXA 1FV3A 4H7MA 3POSA 4W8JA 4MLOA 1NZIA 4XZPA 2XONA 3SEEA 4DS0A 4M3CB 2ZGLA 2BBVA 1Q8SA 3WNLA 1SQ4A 3ZXEA 3WCSA 3OCPA 3ACIA 2D6OX 3HIFA 5FYBA 5A7SA 1U5ZA 2BW8A 3FBMA 5CU1A 3THDA 3WF1A 2E53A 1GZWB 3MIDA 4X6RB 1W2OA 3RYPA 1O4TA 2X10A 5LZ6A 5F3IA 2Q0AA 2VOKA 5A3TA 5L7OA 4ASLA 1YQ6A 2ZMNA 4GWIA 1LODA 3T2TA 2OUHA 5L9VA 4NIAA 2C5DA 3WX5A 2F4PA 2DUQA 3VBRB 4BA6A 4YG3A 4CSWA 1K45A 3UKVA 1D2SA 3VBRC 2Z2SB 5FZ0A 1PVXA 4MO3M 3ZMNA 4AR2A 3POEA 3P3PA 3ILNA 4UF0A 4QKNA 1H4HA 3E1F1 3H3ZA 3N7LA 3WF3A 4BK5A 4CDUA 3AK0A 1U0AA 2P6HA 1DZRA 4CP0A 2VD7A 4COYA 4ZXEA 4EYUA 5GALA 4TZDA 4J25A 2D3PA 4JQTA 1XYPA 2K46A 3GGLA 1M06G 3PVEA 1W03A 4DUVA 4QX3A 3MFAA 3ZFEB 4I2OA 1GZ9A 2X5IB 3F95A 2BV4A 2JB4A 3NNJA 3NV4A 4Q4V1 5JR7B 1PHMA 1HB1A 1ZRFA 2ZAHA 2BU9A 4Q4W2 4TLFA 3RG0A 1JYTA 1ACCA 3ST7A 1OFNA 3TNQA 4YZ3A 2VCAA 3IDAA 5FK7A 1ALYA 4QGNA 5A3WA 3OGSA 4E2GA 5DDJ2 4B1LA 2B9UA 3THTA 5KHIA 4LLFA 5DAXA 3TN93 5H9QA 1D0HA 3D5OA 3VZOA 1NX9A 2VY0A 2VMFA 1BJQA 2A5ZA 2HBUA 5F6LB 5F9TA 1N3QA 1AX2A 2BQPA 1W6NA 2W47A 1W2UA 3A23A 3IIIA 3N9LA 3NRUA 1O7FA 4PLOA 4AVTA 1UY1A 1F15A 1R091 4HKOA 3MIEA 4NUBA 4F3JA 4XCBA 5HBAA 2R49A 4OI4A 5FZ8A 5FY0A 1EV11 2A6WA 3E97A 4AVCA 2ZX2A 5FK8A 2J22A 4LBNA 1C57A 1H8TA 1ONAA 3HJRA 1NLSA 4MX3A 3V64A 1TZOA 3J7LA 4QPGB 3EYPA 1BXHA 1C1LA 1D4M2 1SG3A 2MEV2 5FY8A 5CG8A 3INAA 1H9WA 5I91A 3OPTA 1OPOA 4YW1A 5FBZA 2VVFA 5G05L 2ZTNA 5A7WB 2XWBB 3M8LA 5JR2A 4IQPA 1JYCA 2V5YA 3R6SA 1QDCA 4FCAA 2YFZA 3B9IA 3K46A 2DCTA 1ASJ2 4MGKE 4QGMA 1GMMA 5F2WA 4EN8B 4Q4X2 4N9IA 1W8NA 1V9U2 1UD1A 1HXS2 4P9IA 1Y9QA 5JAXA 3HWJA 2BVBA 2WWJA 4YW3A 3U37A 2H0VA 3VDCA 5HCBA 3UETA 3HQUA 2I45A 4OI1A 4HANA 1GUIA 3RS6A 3BALA 5K8SA 2I2SA 1AR83 3T0AA 3M3CA 2GMPA 5B4XA 1AZDA 3R4DB 5A1LA 1JYVA 2WNVA 4YVSB 4KG8A 1D0GA 1PX4A 5T54A 2DUPA 2JDHA 3I4IA 3I97A 4MHRA 3T09A 3MV01 4H7LA 5FIXA 2RDNA 2YC0A 1RUE3 2RS13 2G9FA 2NN8A 2TNFA 3O0XA 4X6QB 3VUOA 3C7EA 4QGLA 2I74A 3IPVB 1E5IA 1UOFA 2OQ6A 4ITCA 1BEV3 4DIQA 3BI3A 1V6JA 1UY0A 4BB3A 3M3IA 2JKXA 2A71A 1ULPA 1H6YA 1TMF3 1S1AA 5EXOA 5BNNC 2UWBA 4UF0B 5JDBA 3RZHA 5A6QA 1SEFA 5FZ9A 5LRSA 3H9AA 1BEV1 1LHWA 5CG9A 5EQUA 1UQXA 1AJKA 2QQNA 3WG2A 1YI7A 1ZNPA 4Q4X1 4E4HA 1PNFA 3W58A 1QJU1 1HQLA 1I5ZA 2Z4FA 4XW3A 5DUXA 1K12A 1ZX5A 3NV1A 1HRI3 3I3BA 3T2QA 3IM0A 3RZLA 3FLRA 3ZSEA 4G4FA 4A42A 3DYOA 5ABJC 2WO7A 1QXPA 1QXRA 4XF3A 5LASA 5JXIA 5JXGA 3K48A 2ZX3A 1GP5A 5H9SA 4DZGA 5IVVA 1RUG2 2JX9A 3MIFA 4NHYA 3WW2A 5CNAA 4CDQA 2DBIA 4OZXA 1YI9A 2JENA 3RGBA 4CU9A 1WW4A 2D5FA 1LGCA 1NLQA 3WHTA 4UOJA 4ZXKA 2ZX4A 2Y38A 4JKMA 5C4WC 2ENRA 2JDKA 4X8NA 2WWSA 2IUWA 4FPJA 4CEYC 4BQ4A 3EJKA 3O1TA 2HEWF 3QH7A 2ZGSA 4RD7A 3ETQA 2IWGB 3AZZA 4YW4A 2FDKA 1UY4A 1ASJ1 3IDEA 3MF6A 4DXRA 5JOZA 3AKQA 2MEV3 3AXDA 4LE4A 2VZ1A 1HXS1 4HOOA 1NA1A 4RR3A 5BNOC 1PNGA 2OXBA 2ATFA 4AL9A 4CXYA 2ARXA 5D21A 1DGWA 5JI9A 5FFOC 2J1RA 3J7HA 3HAGA 1LNSA 5EV7A 4FQ4A 1W9WA 1ASJ3 4P02B 5BUVA 4YSFA 3PU8A 4Q4Y1 3ZN6A 1KS4A 1HXS3 4R4XA 1D7PM 4CDWB 3UV9A 1I1EA 1ZZ7A 1C8M2 2J1EA 4R9CA 1IGOA 3KSCA 3PUHA 5AFBA 4YNIA 4NAOA 4RQPA 4XJ8A 4RHV2 3PHMA 3WF4A 2WNOA 1CIYA 4CDWC 4DNYA 3MZHA 2G9GA 1KFUL 1XB9A 4TYSA 2QQMA 4IE4A 5IT6A 5FP3A 3UKNA 4GXLA 2EIDA 1AR71 1PK6C 4UYBA 2HWE1 4NHXA 3NW4A 3OEAA 4BQ2A 2VVEA 3W20A 1W0PA 2VMEA 4AEDA 3UGFA 1URXA 4AQTA 4IW3A 1AXZA 1WD3A 2VTXA 4K9SA 4XTMA 3WDUA 4CP9B 1S0GA 1XC6A 2RS51 2QBXA 1PO13 1POV1 1UY3A 3NAPA 3T3YA 2HWE3 4B3NA 1POQA 4Z2WA 1CGPA 5LBFA 2C26A 1UYZA 3HMYA 1CAUA 1J84A 3A4UA 5JSOA 1ZYBA 2PMWB 3JB8A 3KQ4B 1JXNA 4YWAA 5AC92 2QUOA 3W9AA 5KXCA 3PUIA 2VZTA 5JOYA 4YW2A 3LGRA 4JDOA 4D69A 1VBA3 1WKYA 2FHRA 2XBO3 4QDSA 2GMEA 2WQ8A 1IOAA 5A33A 5K0UC 1JYIA 1N47A 4PQQA 2VM9A 3M7AA 3PUQA 2K2SA 5H9RA 2WO1A 5J09A 3IN9A 4XDOA 2ZAAA 5DG2A 1FYUA 3EO6A 3WV6A 3ZXLA 2CL2A 3DPRA 2PLV3 4CEWA 1W6NB 2VE1A 1VBB3 3VD7A 2BFUL 5SV8A 4PI0A 1K42A 3GJAA 3E5UA 2W39A 2UYAA 4IEVA 1OLME 5IAXA 3KMHA 3POJA 3K4AA 4XJAA 1QIQA 2NMNA 1OC1A 3LAGA 2FMYA 4CUGA 4QQHA 2OA2A 2OPWA 5LW9A 2QE3A 5ACA3 5CKMA 1RUI1 1ULEA 3AYEA 3EMRA 1DDLA 5T52A 1A78A 1LHNA 2PN5A 5FV3A 2UYBA 3JD71 3NNFA 5CBLA 4YVWC 1XNTA 2C6SA 2CY6A 3KV6A 4N53A 1BBT2 1JN2P 1EAH1 4LPLA 1FT9A 1H2KA 3B69A 2XLFA 5ACA1 5C70A 3C7GA 1M4WA 5KBFA 2O1QA 4Q4W1 5IYYA 3GYDA 5A70A 2RDRA 1N3PA 4GMP3 1JZ7A 1VPHA 5E6HA 1ZRCA 4MSVA 1WBLA 2ZMKA 1O4YA 3GBFA 2R063 4BQ3A 4HPKA 1EAH3 2A73B 3VBUC 3N7MA 1AUYA 2AH2A 1YHFA 3HN3A 1RVF1 2VH9A 4A6SA 1UX7A 2Y8KA 2A6XA 4Q26A 4GMP1 2HJIA 3W5MA 1VRH2 2D97A 3GHNA 1FOD2 5FOBB 4DEQA 3PURA 1I5PA 1MQTA 4JGZA 4OHXA 4EQVA 1VBD2 1VIWB 3OGRA 4D0QA 3KD4A 1YLLA 3WQ7A 4K21A 3SCFA 1QJZA 1R082 1ZBE2 3DXTA 4IEPA 1O3TA 1UKGA 1EYBA 1CAVA 1Z0HA 4JGYA 3U78A 3WINE 1BK1A 2ZJCA 4Y24A 3LEGA 4GALA 2V09A 4LQRA 4Y5TA 5JSRA 5M0TA 1PGW1 3Q8AA 1EUUA 5T5LA 4LO5B 3RPQA 3AMQA 4Q4Y2 2BGPA 3B02A 3PIJA 4BQWA 4AFAA 4AFCA 2WDBA 3LA7A 4SBVA 5FZEA 5LBBA 3WNNA 1XNKA 1DGRA 1QU0A 1OLMA 1QHDA 1W99A 2WFF2 2VMIA 2YU1A 3AKRA 1RINA 3PUAA 4FPCA 4CCJA 4YGDA 5JMCA 4LHLA 5JMOA 2OZJA 5FLJA 4H2AA 4YM0A 3WP5A 5FYZA 4HMZA 3WVJA 3K2OA 2OW4A 4YW6A 3PVBB 3POBA 2EIBA 3M1HA 4IETA 3SQOA 4XFCA 3POYA 4XETA 4EE2A 5IVJA 4E9KA 2VZQA 4KNCA 4XFFA 3GNEA 3VKNA 4MUVA 2W95A 2D98A 2K0GA 1XSRA 3JZVA 1PZ8A 3C7OA 3KF3A 5F8PA 4XIOA 2B46X 2PQQA 4CPBA 3V0BB 4QM9A 1RB8G 1GBGA 4O7XA 4CUAA 2WT0A 3UNPA 2ARAA 3J7MA 3TNPB 1OKQA 2IXCA 2VOVA 2Y0OA 4WVWA 1VB2A 2VZOA 2WSVA 5SV5A 1NQJA 1GZCA 4BIOA 4D94A 3ZSLA 1W6MB 2WZR1 2BRTA 3URFA 4QMAA 4J6GA 2AEZA 3S30A 1CZVA 4OI2A 1GOHA 1SFNA 4P9WA 4YM1A 2Y6LA 3BIWE 1PO22 5C9AB 3AZXA 1O91A 3OJBA 5KHGA 2QNKA 3LDBA 2WINB 3MFCA 3N9MA 3P3NA 3H1YA 4GJYA 4OLLA 1YIPA 2JG9B 4WVMB 3RZKA 3OUIA 1JZ6A 5EHDA 5CFDB 1AJOA 4CE8A 3GCXA 4AI2A 2YC2A 1W6QB 1WA4A 3A0NA 3PVOA 4FPKA 2ETEA 5DPNA 4EJRA 1GWLA 2EF6A 3V0AB 3RI8A 4GKYA 1CAWA 1Y4WA 3M4FA 1EY2A 2VJXA 5GM0A 5IHRA 4COVA 3CDZB 2P3JA 2NM1A 3AVSA 2NLRA 4E2SA 4O9GA 1C4RA 5FZHA 3VBFA 1N1YA 1YJLA 4B4PA 2WJSA 1RUJ2 1KJRA 4YZ5A 5K0UB 3MV11 1SACA 4E2QA 4ORFA 2ORXA 5EYYA 4HETA 4CEYA 1EPWA 1WMXA 1US2A 4EZHA 3O1MA 3BTYA 5C71A 2Y33A 4BMEA 5EIYB 3BOWA 3FE5A 1DLCA 3NAPB 4FBFA 1PO21 4YLZA 4I0WB 1ODNA 2BOIA 2Y6HA 3VBSC 1HJFA 2OQ7A 3KF5A 5DQ0A 4ZS2A 4AE2A 2CSGA 3D4KA 5A7QA 3W5NA 1SFPA 1N1VA 1ZZ6A 3P1IA 4L11A 4Y5SA 1WZXA 1LENA 5IVBA 3KZ4C 4M4PA 4W4ZA 5CKQA 2YZ4A 5F37A 4MOAA 4MG2A 4XQDA 5DAWA 3PUSA 2XWJB 1ND3A 1O4ZA 2JIGA 2AREA 2FDFA 1GLHA 1NOVA 2VTFA 2CNAA 1PM7A 2RDQA 3PU3A 1JTZX 3DF0A 1F4HA 4XUQA 5CEHA 1UU4A 4JHZA 4Y4YA 2SLIA 2ZGPA 1JOPA 2HWB2 2WNVB 4W65A 4YVSA 3QBQA 1GOGA 1OPMA 4XEZA 1SLLA 4PDWA 2O8OA 5DMYA 1DU3D 1IG3A 4LMFA 4NPLA 4UW4A 1VBD1 4GB33 4S2GA 4FXKB 4RGKA 1WLCA 3OF1A 4YZ4A 3U4SA 3UKTA 2GSYA 1TME1 2VUCA 4NJ4A 2P6CA 1IKQA 4XF9A 3T30A 2YDEA 3JBG2 2DCKA 4QXKA 1OBNA 3I2JA 4MXWB 3RNSA 4M0NA 3MLJA 3TB0A 4Q29A 5EZWA 2JDPA 4XFGA 3AMNA 2ZXQA 4Y20B 5EPAA 1ODMA 4QQOA 1HRV1 1TME3 1JU4A 2VCCA 5FUIA 4CEWC 1V6LA 4M4RA 5FP9A 2Q8CA 3VBFC 1CN1A 2PHDA 1ENXA 1K5JA 4Q4V2 1OLQA 3VZKA 4CU7A 5C8CC 5JLVA 3FHQA 2QCSB 2WZPP 3U11A 2Z42A 1XNAA 2G9ZA 4PI2A 2ZKNA 1XRUA 5FY4A 2CYFA 1OF3A 2JXAA 1F2NA 3IAQA 4NN0A 1QQP1 2IXJA 5FYTA 4WV8A 1TE1B 3NNMA 3GALA 3C2UA 3CJIA 4PLMA 2D5HA 1ZZ9A 1ND2C 3J26N 1KDMA 1MQTB 3JU9A 5JZGB 2WNUC 4L0PA 1OH3A 4WM8B 1W6PA 4LKEA 1ST8A 2RJLA 3AL5A 1S0IA 3MW2A 2D93A 1OUXA 2R072 4N90A 2WN2A 1OQEA 5BNQA 4WM8C 1Q8VA 2PAKA 1KDKA 4GKXA 3ZXFA 1Z7S3 2XUMA 1K5MC 3JD72 1WW5A 2QQUA 2BYVE 4FOVA 5E8AA 2R30A 4BH9A 4QHOA 5FYUA 4JX0A 2BOJA 1GR3A 1F8VA 2SBAA 3DEMA 4I0BA 5DDJ1 2DVFA 5L19A 4XJWA 4J1XA 4NRQA 2WO3A 3NV2A 2WWUA 2XQRA 5DUVA 1XE8A 1SLBA 3ZFFC 4LHSA 4LUMA 1H0BA 2BTVC 3OGJA 5C3OA 5JOXA 5K7PA 1VMJA 4OUSA 3AFKA 4EN9B 4XQWA 2VOTA 3KVAA 3OBRA 2NMOA 3GHMA 1KEXA 3QH6A 1ULOA 2WLPA 1I9RA 2IZWA 2HWF1 4PLNA 3KV5A 5CVRA 4QX8A 2EXKA 2V4AA 2FDHA 3FLTA 1U12A 4IV3C 5B2GB 3O1SA 4ES9A 5BNOA 2IFRA 2E26A 4A45A 1MS8A 4Y1VA 5FXZA 2CGPA 2OVUA 3D3AA 3OPZA 1POV0 4M3CF 5DXDA 3ZKYA 1RUC1 4MH0E 1COV1 1VJ2A 5T5OA 2VQUA 1QOTA 1YFXA 2P2KA 3KS7A 1V6MA 4JDMA 4YFWA 4QAWA 2RE9A 3AP4A 5IUQA 2BGCA 4Z82A 3H7YA 3BUCA 2R1BA 4UFLA 2O14A 3UK9A 1JYNA 4YGBA 4JV4A 1YCIA 3S0MA 2C1FA 1RJ8A 1IZ3A 2I07B 3CLPA 3LSEA 4RS5B 5DZGA 5C6CA 4JRAA 3WDVA 3ZYFA 5IFTA 3LEIA 3KHCA 4CPBD 1Q8OA 3ZDSA 2YXSA 3KLSA 3ACGA 2PAMA 1REFA 3V0AA 5T5JA 4D6SA 4QX2A 2LS6A 4XF1A 4WVVA 2YHJA 1JMUB 5FZCA 4R52A 5FYMA 4L2NA 2Q5TA 3LIHA 5A1AA 1HLCA 1ZREA 2BDRA 1TMF1 2Q1ZB 4NWWA 4IGPA 1C8M1 1FMD1 2JB8A 2DUOA 3NAPC 1W9FA 4EN0A 3T2PA 1AX1A 4DINB 2HEYF 2MNGA 1QXJA 2QDRA 2HH9A 3PNAA 3MPPG 2WA4A 1CAXB 1QJX2 1LULA 2XHKA 1F5JA 4Z07A 1UYPA 3ILFA 3T0BA 1EP0A 3WNOA 5FPAA 3W21A 4XAEA 4RFRB 3ATGA 4KWJA 2DVAA 4FQZA 3SH3A 4WZCA 3FUOA 1H4GA 1NYWA 4E4SA 1H1AA 1SPPA 1SBFA 4KI5M 3SXWA 1QJU2 1X9PA 1W0NA 1OH4A 3GF6A 3JXSA 2E7QA 1J59A 4R4ZA 4M01A 5GZCA 4AGGA 1LEMA 1GNHA 1RUG3 4XUOA 2EVXA 4C0HA 4XUTA 3ZR6A 5GZGA 2B39A 3B5LB 2HWD2 3OY8A 4AQ6A 4F8AA 4XVHA 1WCSA 1JZ5A 3H8UA 4NAMA 1RUG1 1WMEA 4CU6A 1LHVA 1AR62 1GWKA 4QPIC 2HYKA 5FTTC 3NKGA 3Q8CA 3N3HA 1QOOA 3PMSA 2WYSA 2JDMA 4QHBA 3DKWA 1HV0A 1LHOA 2H6BA 3HT2A 3HPNA 3K3NA 3MPBA 2GNBA 3O0VA 4XDQA 2W91A 2WL1A 4MADA 4B7EA 2F17A 4NIHA 1WMDA 4FOQA 4K1ZA 5GKAC 4HVRA 1L7LA 3OBAA 5KR7A 3OD0A 4UT5A 1XNCA 1ND2B 3ES1A 5GZDA 3MUZ1 4G9SB 5FZOB 3AMHA 5JWPA 1PMIA 4JQRA 4LOSA 5EJ1B 3LEKA 4Z8BA 3L2HA 4AI3A 1XSQA 5LWBA 5L73A 3M70A 4UW5A 2VR4A 3C7FA 2Q1MA 3QACA 2Q8DA 3JQWA 4OMCA 5FZKA 3ZOIA 3KB5A 2J1AA 3ACFA 2WAOA 1V6IA 1LGBA 4OCTA 1PM4A 1NA1B 3UYJA 1UN1A 5A7OA 2QQPA 2VZSA 2H6CA 3IIAA 3VN4A 1W0OA 4JAAA 2YU2A 1PMJX 4P5HA 5KWRA 2VBBA 3NV3A 5JPNB 3BYWA 4HSLA 3R4SA 1JYWA 2HEVF 3PLQA 2CAUA 1RITA 4C1XA 2WN3A 1PO12 2VNVA 4FFGA 3DL3A 4N53C 4CCDA 2D40A 4RQPB 1WW7A 1LOGA 3AVRA 1RUF3 1FNYA 2EXJA 1PGL1 3LQCA 4GIQA 2ZA9A 1J3QA 1CESA 4Y1YA 1WCDJ 4LXLA 4XF0A 5FYIA 4HG6B 1KJLA 2QFEA 2XBO2 2QJVA 2QVSB 4CCLA 5I0UA 1FATA 5CAZA 1RUF1 2J1TA 2GNDA 2B4KA 3IT8A 4D7SA 4HKWA 5FREA 3FHIB 1PGW2 4BQYA 3OSDA 4CZSA 3RZMA 1AF9A 1TVGA 5C9AC 2ZEXA 3BCWA 4LO6B 1UL9A 3DN7A 1ZBA1 1VBB2 5IAVA 4CRQA 5KXDA 1T6GC 4UFKA 1G9FA 1RUI3 3SKVA 4DQAA 4U36A 2V72A 1JODA 4RS5C 1H6XA 4MYEA 3KCYA 2RDSA 4Q27A 4CCOA 1BBT1 1H8VA 5FLIA 3FMGA 2AGSA 4HK8A 1ZBA3 1MZ6A 1Y43B 2YC4A 2W1WA 2C9KA 5BNOB 3FL7A 3KHBA 1RMU2 4LTAA 2YBPA 5CA6A 1YIFA 5ERLA 5F2SA 1BZWA 3Q9OA 5IJRA 3FHAA 5G04L 1RL3A 1LOBA 1BBT3 1LTEA 3SITA 5EP9A 1AR92 2UWAA 1A8MA 1OLRA 1WCKA 1UXZA 2RR11 2XHNA 4FVVA 4C90A 4OHYA 3VB9A 2D44A 3E5QA 3RSJA 1MEC2 1G86A 2XLAA 4CCMA 1O59A 2V73A 3POWA 3WT3A 4CP1A 2PHUA 1J3PA 3D0JA 4XUNA 5D1IA 2EXIA 2Y6KA 4Q4X3 5IVYA 2XQXA 3OG2A 1DGRN 1VR3A 1XYOA 3KT1A 3HOBA 4FPHA 3W59A 5HV4A 4AVBA 4E27A 3R4UA 4YVWA 1GOFA 2RR13 1DGWX 4IE5A 4P9GA 3AKSA 4IERA 1DFQA 2W5FA 1FOD3 2YBKA 1RVF2 4W50A 3WOGA 4IEZA 3S5AA 1Y3TA 2BGOA 3IKWA 3BVCA 3ZYGA 4ASKA 4S2HA 1ND3B 2VNRA 5CADA 5BNPC 4AGRA 2A6YA 1DIWA 2Q8OA 4BOWA 5BV6A 1G7YA 3ACHA 1YO8A 3VL8A 1DHKB 1PMHX 4M0HA 4CUCA 1UMIA 2IC1A 2W3JA 3I2KA 4PDWB 1DYPA 1V0AA 3O0WA 1BKZA 4AHZA 1KXGA 3RI9A 1XPWA 1SMVA 4EZ4A 1QJY3 1CR7A 1IS5A 1GZWA 3KVBA 1XQNA 4YFZA 1BVP1 5FPLA 3X29B 4ZZ5A 4Y1ZA 1YRZA 1HQNA 1O5LA 2A3WA 3MI8A 4IGQA 2Z5WA 3B7MA 3Q8BA 1MEC1 2HBTA 3EB7A 4A7YA 4KH9A 2YBSA 1LCLA 2VZUA 4RYDA 1B09A 2XJPA 1AYM1 1RXFA 1JU3A 3SCGA 1JH5A 3LEMA 2GC1A 3AYDA 1OOPC 3KCCA 1IPKA 2VBPA 1RHI2 1RUH1 4I3PA 2JEMA 4LKDA 4QPIB 5BNNA 5HPOA 4ONUA 2GC2A 2WA3A 4QXBA 3OY8B 3CU7A 4KGGA 1Q5OA 4YG6A 2E31A 1DQ0A 4LBQB 1AHSA 2LUWA 4MGQA 1FX5A 4AEKA 3UJOA 3OUJA 4KMQA 1RUH3 4IXLA 1AYN1 5FXVA 2HKXA 2BNOA 1AR91 1YFYA 2DCZA 3SNMA 1ZBA2 1BK0A 2ILMA 1PZ7A 4RL7A 5FO8B 2VZRA 1RMU3 3SHRA 3BU0A 2E6VA 2ZGMA 3AZWA 4MGTA 4GMP0 3TYJA 2ZGTA 1UZWA 2YPDA 1N1TA 2OS2A 1O8PA 1AR93 3DUIA 1A8DA 5JIUA 1QWRA 4MXVA 4PF1A 2P17A 1BLZA 5A6ZA 1FPN3 1HKDA 1UKRA 2GP5A 5FZOA 4AEDB 1W6MA 1YJKA 5F5CA 3UT0A 2XG3A 1PZ9A 2WYFA 3AKTA 3BN6A 5C8CA 3WNMA 4E4DX 4RR3C 5CFCC 4XACA 4OFGA 4LHNA 3AJYA 3D6EA 4Y4RA 3VGIA 4EROA 5BY5A 3TEZA 1CX1A 5FZGA 2P3IA 2VNGA 3RRDA 3RZGA 1BVVA 1MS0A 2N7GA 4XFAA 2YYOA 3PJQA 2W52A 2RS32 5FBJA 3ZPOA 2PLV1 4CXXA 3T1LA 4HKLA 1JW6A 1VP6A 4A2UA 3I2HA 3VDDA 1Q8PA 2DTYA 2QKDA 4SLIA 4NWVA 4KL1A 5LY1A 3SLIA 1PK6B 2PHFA 4Q0PA 1OKOA 2ZABA 4FP3A 4YM3A 4IE7A 3I59B 2RM21 4AWDA 3WLUA 4DRVA 2D3SA 4RN5A 4DUWA 1OXCA 4AOCA 1ZBE1 3LD8A 2W08A 4Q0SA 4XCAA 4Z92B 1CONA 1SBEA 1ZZBA 2BWCA 4LBMA 4OMDA 3RYRA 5JSPA 1U5IA 4FPLA 4PDWC 4BXFA 2YB7A 2D6NA 2VMDA 3ZYHA 5KC5A 3KWVA 4GULA 5LATA 4E4ZA 3H7JA 2Y26A 4INDA 1S0JA 2FD8A 4I01A 4YW5A 2TEPA 1SDDB 4PJYA 2XKOA 1CPMA 3J7NA 5CYYA 1OUSA 5F39A 3UJQA 3VBHC 3MF9A 3AP9A 4UAPA 4AFBA 4LULA 1MPXA 4EWAA 2HWC2 2XJQA 1XXNA 1TNFA 3E6BA 5ANNA 4D6RA 4OQ8A 4BK4A 2WQ4A 2XOMA 4OHVA 2X09A 3R05A 4OHWA 2D3RA 5T3NA 4ARYA 4BJ0A 2GH2A 4URAA 5J37A 3WNKA 3NKTA 2XH6A 4QX5A 1VAMA 4FPYA 4Y1XA 3AFGA 4BMBA 1LOEA 3ZN6B 5A7PA 1RXGA 4BWOA 4ATFA 3IMNA 1H9PA 3N9NA 5JIAA 4D8MA 3L9JT 1O3SA 1LJ7A 5C3QA 3LF7A 1XE0A 5IW0A 3VDDC 2DFBA 4MVTA 2BEOA 1RUH2 3TBDA 1IPSA 5A3PA 2ADDA 3H3LA 2WNVC 4YRDA 4GH4A 1G8WA 5DZFA 5E16A 5IVCA 4GZ9A 4QPWA 1RIRA 1V9U1 2Y6JA 1E5RA 4N7UA 4XAAA 4LBLA 3AP7A 1YC61 5CFCA 4FOYA 4PIZA 1NCQB 1NKGA 4FP2A 2OX0A 2FCUA 2VXRA 5L7OB 4AF9A 3P5BA 1DG6A 4Q4V3 1Y9MA 4Y26A 4XBNA 4PCRA 5H9PA 1NCQC 3F2ZA 3RQ0A 1JS9A 5FXXA 2JG9C 5GLZA 1FNZA 1JUIA 4BISA 3WDWA 2KXLA 3LDKA 3VBRA 1A3KA 3AMMA 2RJKA 1CJDA 4R9BA 3NL1A 2JICA 2J1SA 4M00A 1B35B 1BYHA 4MGYE 1SLIA 1W2TA 4FSJA 2AENA 2AYHA 3IMMA 5FLHA 3ZXJA 3EBRA 3TN91 2DVDA 1LOFA 1YXWA 2GAUA 2LTNA 2VBDA 2J1VA 1CQ9A 2DTWA 3DCQA 4BXSV 5FO9B 2WZ8A 3TEYA 3LWCA 4BQ1A 3ZYBA 1U5XA 1H2LA 3EQEA 4I30A 4Q1RA 5FYSA 4B8EA 4LLOA 5GLWA 2LROA 4FTEA 1R093 3GZEA 3THCA 2ZEYA 2RVAA 1CZSA 2QDNA 3NJXA 1UZYA 1R083 4CXWA 5J48A 2VU9A 3NWKA 1ZA4A 1LU2A 2W92A 2WRAA 4BIFA 5ANQA 3VZMA 2XPJA 4ZS3A 4XMAA 3VZJA 2P3YA 1ULGA 3DGTA 3NNLA 4HT1T 5DDJ3 3J8F2 2JD9A 3LIGA 3H50A 5DUWA 3U75A 5FYYA 2RV9A 1FMD2 2JECA 3FWEA 4CDWA 3ENRA 4V2WA 4DO0A 3CIHA 5FY5A 4DOUA 1UYXA 2EA7A 4JHTA 1ND2A 2B5HA 3WUDA 2BUKA 4YG0A 2HWF3 2ZX1A 3RFRA 2LALA 2VCBA 1Q56A 4F7ZA 1REEA 1O6UA 2UURA 3CJXA 2W9XA 3USUB 5A1FA 3H8RA 3VBHB 1DGLA 3WD5A 2VUDA 5FPVA 2FMDA 5LCWL 1J1LA 1XYNA 4XMIA 5A3LA 3ZSMA 5FZ1A 4FO9A 4JC1A 4PIYA 4CDXC 3H8OA 3I7DA 2QTWB 1AR81 1COV3 3B01A 4CP9A 4Z1VA 1UZZA 1HN1A 4P9YA 2EICA 3GJBA 2AUYA 2LRPA 2R043 3ELNA 4A3ZA 4BLIA 2VUJA 4QB1A 1UO9A 5FP8A 1X50A 1DYOA 4FI9A 5C3RA 4Q0QA 3HNMA 2C4XA 3BPZA 3VKOA 4ISQA 4O65A 4BDVB 3ZO0B 1VRBA 1HW5A 1I3HA 2J7MA 5FR3A 1HB2A 5FMDA 5FY7A 2ZGNA 5A32A 3J8F1 3A7QA 1PO23 3MIHA 4GA9A 4XBQA 5J1XA 1PX3A 1B35C 1AR82 1UMZA 2C24A 2VZ3A 3D8CA 4ASMB 5J98B 2AACA 4CCEA 4EWDA 4AFMA 5IK7A 1YEWA 2KA3A 2QZ3A 4N8MA 4OULA 1SCSA 1LECA 3MLKA 2GNMA 4RSUA 2EALA 3ZXDA 4B4QA 1RUE2 2E51A 2EIEA 2RS12 2ZHNA 4XHXA 2VG9A 5FDBA 1UZVA 2XJUA 4KBZA 2NQYA 4NE9A 3U0ZA 3WY6A 1NLRA 2JD4A 4L8QA 3ZXAC 5C8CB 5FOJB 5FUNA 3CHXA 3VBOA 1OVSA 4K8FA 1REDA 3WHUA 3ZYJB 4IEOA 5IK4A 2ET7A 3AL6A 3GBGA 4HK9A 3WW1A 3WF2A 4L9BA 3N9PA 1UAIA 1GP4A 1W8HA 3MICA 4ES8A 3ZFEA 2ORZA 1RUD3 4WM7B 5GLTA 5I93A 4Y5Z0 4FXGB 4ZPIA 3WUCA 3FFQA 4WM7C 1ZRRA 3LA3A 3VKFC 1XJAA 3GZUC 4HN0A 3MO4A 1HRI2 2WUHA 4QD2A 4A6OA 1RUD1 2DYCA 1PGSA 3OYWA 2QQOA 2Q1FA 4J1WA 1IS3A 1DF0A 3G6JB 2BNNA 1OT5A 3IZOA 4IEYA 4NOTA 4PHZA 4FFHA 2CWMA 3AYCA 1MZEA 1WCQA 3V56A 3ZFGB 3A21A 3TN92 5JCTA 4NRPA 2HWD3 5ISLA 1O3RA 1ULCA 4K20A 3D82A 4A41A 4Q8KA 2PFWA 5T5PA 2IVIB 1JZ3A 1SDWA 2NZ9A 4XC9A 1AL0G 2W1UA 1PVC3 1GWMA 1GU3A 4O61A 5C8WA 4XFBA 4N43B 1LOCA 4R9DA 1YQ5A 2D6PA 5HXVA 3K75B 4Y22B 5C5UA 2FZ1A 5CKNA 1ULFA 4Y3OA 5HCAA 5KXBA 3ZN5A 1AR73 1VE0A 5HI0A 2CHHA 4WZFA 4PQ9A 1PVC1 1H8TC 2XJVA 1UU5A 4IV1B 5I0RA 1O5UA 2R042 5C3PA 2W68A 1FAYA 2ZGKA 3PL0A 4GB32 3POFA 5FZLA 4LHKA 3H0OA 3U10A 3K4DA 1ND3C 4JDNA 5FPUA 5L36A 2RS53 1SFYA 1NXMA 4YZ1A 2WC2A 1POV3 4UWDA 3VV1A 3I2GA 2TUNA 4HVQA 5I8TA 1T6BX 2JDUA 2FDIA 4XPVA 2D43A 4BZ4A 2WZEA 1NCQA 3GZTB 1C1FA 2E7AA 1VAVA 4PF5A 2X05A 4HXCA 1F9KA 2CTVA 2ET1A 3FJSA 2O0OA 4LT5A 2TBVA 1MS4A 1VRH1 3ES4A 3GM8A 5F5QA 4QKDA 3EXUA 5FMBA 5BYNA 3N36A 4IL7A 3S57A 1W05A 1EPZA 2CV6A 3BKZA 3RMXA 3ZYIB 4HZFA 3B9CA 3BTAA 4P00B 5T50A 1NG0A 3HVDA 3KT4A 4DEVA 4IE0A 3CZUA 4BE3A 3ZLIA 2CGOA 4O9EA 1JZ8A 1G9DA 1UOJA 2Q8EA 1NA1C 1QJFA 1ZA7A 4LBQA 1JHNA 5KXEA 1X33A 4COZA 3ZMOA 4QXCA 1GSLA 5AC93 2D6MA 2WAAA 2WZR2 1W8OA 3KGLA 1X36A 2X5IC 1VMFA 2A75A 1VBA2 3VLBB 5JI7A 2WFF1 5F32A 2R073 2OKXA 1JI6A 4QX7A 1HQWA 5LA9A 1W6OA 3RZJA 2D6KA 2X53S 1Z7S2 2QQJA 3JD73 3AM2A 4AVVA 3HEIA 1WLTA 1IHMA 3I3MA 4KWKA 3T1MA 3ZX7A 4K1YA 4Q2FA 4LK6A 1UIJA 4QQPA 5FCCA 1MACA 5FKCA 3N4MA 2JDAA 4H3WA 3SKJE 2JDNA 1Q3EA 3AP5A 3WG3A 1N3OA 1G9BA 4N43C 4V1PA 4WVZA 5FKBA 1HX6A 2R0HA 3POIA 3DPRB 4XURA 1GP6A 4IEWA 1RUI2 2R061 1ZZ8A 4UBHA 3S5QA 5LA1A 4XABA 3I2DA 1HDKA 2XMLA 3AJZA 3NQHA 4META 1GQGA 1PVC2 4ZU7A 3RWKX 1OA2A 1VAKA 2Q30A 2VAUA 2Y64A 5TSWA 4CA9A 4B7KA 1H2NA 4COWA 1OVPA 1WCUA 1S55A 4P5YA 1ENRA 2A70A 4LBOA 4AG4A 2VL4A 5FZ4A 5LBCA 2Y60A 4DXSA 3CKHA 4LA2A 3OBZA 4TSVA 4EN6B 4IV3B 4AGVA 2OUJA 2ZPXA 1VBC2 5J96B 3DECA 1C8NA 1CWPA 4DFSA 1P8JA 4OHZA 4TWTA 3N9QA 2UY9A 4HVOA 2FQPA 1EAH2 1VALA 2GALA 4UFHA 3O1PA 3IAPA 1WD4A 5A32B 3USSA 1GQHA 1L7RA 2PELA 3E6CC 1S4CA 3POGA 3CZJA 1VMHA 4KWLA 4CU8A 3HR9A 1W9SA 3CL1A 4NRMA 4DY3A 2BBAA 2JE8A 2Y34A 4OVEA 3RJRA 1UPSA 4W6YA 1DZTA 2WLQA 5C3SA 4C1WA 1BMV1 5LK7B 2JG8B 2XGXA 4K40A 1HB3A 2WO2A 4KU8A 1K5MB 4LNVA 4KBBA 2P5BA 3ROUA 1C5IA 4QPGA 5EJZB 4FFIA 1DZQA 1KQRA 2VNOA 2ZACA 4Y1UA 1QJY1 2PHLA 2E33A 3FFZA 1SPPB 4Q4Y3 1YFUA 2E9QA 2PQSA 2ARCA 2WR9A 4BM8A 2JE7A 2PHXA 3C3VA 5FP4A 5LB6A 3ZFEC 4FTSA 3M3OA 1VBE2 4OQ9A 1OA3A 3ZSKA 3MIGA 4LBJA 2WZR3 1VBC1 3LDRA 1BMV2 2PXJA 2YG0A 3KGZA 4Y20A 2XXZA 2DU0A 1QJX3 3HD8B 3HT1A 3OD4A 3VBUA 4XDPA 4R9AA 2R32A 4OZOA 4AZZA 1H30A 1UF2C 5LK5A 4IUGA 1ULDA 1RJ7A 4LBKA 1D2QA 4JGZC 3RWNA 5A3MA 3Q8EA 4XJZA 2VC9A 3AX4A 4GWMA 1AXYA 4LKSA 1JBCA 1RUJ1 4QKFA 4XUPA 4B1MA 2YFUA 1BCXA 3IB3A 3UESA 5FJHA 2XJSA 1DQ4A 4LO8A 4MHUA 1LGNA 2LW8A 2VMHA 5F7UA 2YGLA 1G9AA 2NP0A 2B9VA 3GDBA 4GWJA 3VD3A 5A80A 3WSOA 1Q43A 2Y6GA 3IWZA 2XLGA 4WM8A 3ZM8A 4FTBA 4QPGC 4AQ2A 1YQ2A 3SH4A 5ACA2 1F4AA 2G1MA 2DVGA 2GZWA 3BTXA 2HYXA 3HQXA 2JDZA 1AR63 3ASIA 2OT7A 2C0ZA 2WSUA 3ZXGA 2WNUA 5FQ0B 4DUXA 2XVLA 1TG7A 4FOWA 3VZNA 4P9JA 1RGSA 2ZZQA 3KV9A 4YW7A 2FDGA 1NY71 2ZHLA 4IESA 3NJZA 4K8RB 4QPIA 4CDUC 2QQWA 1OHFA 2P3KA 3GBWA 1U5YA 3KV4A 4X8PA 4URTA 1AR61 2D7FA 4JRLA 4UBGA 2RM22 4NROA 1W8ZA 1L3JA 3FLPA 4FAHA 3U07A 4MGIE 4AHWA 2PA7A 2ZKLA 2X8KA 2QQKA 4AI1A 5D8AB 4TN7A 2VPVA 4IE6A 5CB7A 3MW4A 1SHWB 5KHHA 3ITQA 1QEXA 2EAAA 3PIGA 3ZYRA 2XKPA 3NVCA 2V4VA 3MW3A 1XNDA 4BYYA 3VBSB 2VGDA 3TEXA 3USUA 5JZGC 4HLTA 1XOYA 4BQXA 1CAVB 2DCJA 1DQ6A 1X8MA 3VZLA 2ZGUA 4TXWA 3APBA 4ATEA 2WABA 2OIIA 1OI6A 5K0UA 1TEIA 4JKKA 1ZBE3 2ERFA 4EN7B 1OFSA 4Q4W3 2ZEZA 1AYN2 1IKPA 4R8HA 1PGL2 1UU6A 5K4LA 1LHUA 2DURA 1GZTA 4FPOB 3AZYA 4GAZA 2A1XA 1ZZCA 2XVGA 1SLCA 5FWEA 4GB31 4OUMA 4MGZE 4K7JA 1RUF2 3LB9A 4Q1PA 4RQPC 5E88A 3Q8FA 1S0CA 4AHYA 3OTFA 1F35A 1LKNA 2PYTA 3M3QA 1RTVA 2WKKA 3SISA 4I02A 4QWNA 2WS92 1PK6A 5FMOL 3K3OA 5HV0A 1QDOA 3V0BA 1OF4A 1US3A 2J42A 2R6QA 3I59A 3KQRA 1HRV3 3WZ1A 4AI8A 1UMHA 1IS4A 1J1TA 1CVNA 3N9OA 4LJHA 2WS91 4DXZA 1HJGA 4DMIA 1EUTA 1VB4A 3BGAA 1YYNA 1E5SA 1FOD1 3BU7A 3HBZA 3QOPA 2O8QA 1CJPA 4ZU4A 3WG4A 1KFXL 2F6BA 2IFWA 5FRAA 1ZRIA 3AXEA 1HB4A 2FZ2A 2B42B 1X8EA 3LOIA 1RC6A 2RMU2 1IPJA 1V9U3 1O8SA 2FCTA 3M3EA 5FZFA 3OEBA 3LZZA 5LA2A 4CDQB 3M2MA 1CAXA 1S0FA 3VL9A 1R1A2 2NYYA 3R0RA 3ORJA 1NZCA 2W46A 4NHLA 5FPZA 4YVWB 2JE9A 2A3YA 3GZAA 4FPGA 1NAEA 4IV3A 4AEJA 1S0EA 2ZMLA 2GC3A 2P34A 4AHXA 1XBFA 1UX6A 3S7IA 4A7KA 2BZDA 2A7AA 2WNUB 2ZX0A 4XHBA 4YARA 2VW0A 1YNAA 2JDYA 3OYWB 2E32A 2Y6FA 4XBLA 1J83A 1EV13 4QU1A 2DCYA 2UU8A 5JVVA 2XL9A 1MEC3 3VD5A 4RR3B 1BEV2 4FAGA 5LBEA 1OQ1A 1OSGA 5APAA 4U2AA 4AAXA 5HCHA 3RVHA 2VTXJ 4D7YA 5EJ3A 3N35A 5L7OC 1TMF2 3MUY1 3B00A 3AC0A 3ZIWA 3CJIB 2L9LA 4JVAA 5ABJA 1R081 2E63A 2JG8A 5CFCB 1RUC2 5FO7B 4XILA 3C8XA 1R092 1K5MA 1Q8QA 3T4HB 5L9BA 4ET7A 2ZGRA 2YUEA 3MHZA 5FUPA 2VOXA 5BXXA 1J58A 5A3OA 4H14A 2Q4SA 4QU2A 1ENQA 4CCNA 1AYN3 2AR6A 5FY9A 2BPA2 3IPVA 5A3NA 4D6QA 1GANA 2VO5A 2ZGOA 4XJ9A 4LOTA 3T0DA 3LFMA 1WLDA 3CO2A 2DV9A 2DBNA 2GN3A 3LPGA 4AYUA 3U4XA 1LESA 3WXPA 5J3UA 4HPKB 3PDQA 1UY2A 4KGQA 1DCSA 3MYXA 4IV1C 1WA6X 3RMYA 3CQOA 3JQXA 1GFF2 4YGCA 1OOPB 1LOAA 3I54A 4CUBA 1CAUB 2OZ6A 2W94A 2YGMA 1SLAA 3ME2A 3VHNA 1C28A 1SCRA 3HN1A 3TRSB 2CDPA 2QZ2A 5A3UA 1NT0A 3BTZA 3CNAA 3SH5A 4LA3A 2WFPA 3ETPA 1R64A 1RHI3 3H1WA 5JUVA 4GH4C 4W6XA 4I09A 2UWCA 1DQ2A 4JGYB 5F3CA 2IXLA 3ALQA 1YQ8A 2HWB1 2MHFA 4RHV1 4GQ7A 4TTGA 2Z79A 4IDZA 4JGYC 5I0SA 4I3GA 1W2NA 4Q0VA 3FBYA 2YPJA 2QQVA 4LUKA 1C8M3 3MDPA 4LR4A 1RUOA 1QH7A 1ENSA 3OUHA 1CZTA 4CDQC 4RHV3 4QHZA 1J3RA 2VMGA 1QNWA 3ILRA 1IQDC 1QKQA 2DVBA 2OYZA 4JTOA 4FFFA 5LA0A 4JZRA 3T4VA 2PHTA 3WDYA 1WMFA 5DABA 4NO4A 5JOWA 1HN0A 2AZ5A 4H55A 1T2XA 2NPIA 5DZEA 3WW3A 4GWNA 3FX3A 1UYYA 1FPN2 2Y0IA 4BLJA 1H2MA 2ZGQA 2EIGA 1IS6A 2ADEA 4Y33A 3ZKUA 3VHRA 5KC6A 1JZ2A 2CDOA 3BIEA 4BQ5A 4GD4A 3ZDVA 1V6OA 1W9YA 1GV9A 2BWAA 4S2FA 4YYOA 4L92A 3I2OA 1F31A 3AP6A 1F5FA 1AVBA 3VBSA 4FT8A 2FCVA 2W0XA 5C33A 3CJIC 4GJZA 4QB2A 4AEMA 5A7NA 3B93A 2ZOEB 1BQPA 3E6DA 1GQPA 3BOPA 4F83A 1Y9GA 4QKBA 4XOGA 1RUNA 5F3EA 1L7QA 5F5AA 1H1MA 2XVKA 1MS1A 1V70A 3AB0A 2EAKA 4RA0A 4TLGA 5GLVA 2V5DA 5EFUA 4COUA 3EHKA 3THPA 2BJSA 3O12A 5GZEA 1S2BA 5K9YA 3FC0A 1DQ5A 1WWYA 3KCXA 3VBOB 2B7YA 4YPJA 2HWD1 2PLV2 5AVAA 1E5HA 3N7KA 4NPRA 4QDRA 1DQ1A 3WNPA 4CDXA 3MGUA 4CP2A 4BU2A 1TQ5A 3DV8A 2KM2A 4NIDA 2PHWA 5KHKA 2VULA 3MLLA 4S2DA 2FBEA 5IVEA 2YV8A 4W6WA 3WCRA 5A33B 2IVJA 2FDJA 2MPFA 1PO11 1TNRA 1Z7S1 3CMGA 1LU1A 1UW8A 2ES3A 2ZHMA 3ZSJA 1UPIA 5IATA 3KT7A 1FXZA 3NNGA 3ABZA 3LA2A 3RJ2X 4UXAA 2WT2A 1C3HA 3O7OA 4XQ4A 4E8DA 1DYKA 4AEDC 2RHPA 5FAXA 3TAYA 3VD9A 4ISRA 1JHJA 2F4LA 2W2IA 2XBO1 4XE9A 2ARBA 2R062 1ZRDA 1QF3A 2KR2A 1QH6A 4P14A 4RS5A 1W2AX 3S6PA 1OMIA 2G19A 4L97A 3H1MA 3WF0A 3VHOA 4QX0A 5KHJA 4ZHNA 3RDIA 1VRH3 5CFDC 4N43A 2GDFA 1W90A 3U1XA 4QX1A 4Y22A 2ID4A 4N53B 5GZFA 5F3GA 3VBUB 1SBDA 3PMEA 1W28A 3IDCB 1YUDA 2W1QA 4NVPA 2VZPA 5BNNB 4AK3A 3HBKA 5FYCA 1AYM2 3MBWA 2UY8A 5FYVA 5GJ6A 3T2OA 2PHRA 4ZU5A 2VECA 2JG9A 4AI0A 5FWJA 3A22A 3G7DA 1MS9A 1UNBA 3DKQA 4Z2AA 3JCIA 1RUE1 2RS11 4ZONA 1QY4A 4DPNA 4PT6A 3CEWA 1MVEA 1CAWB 2P1BA 3PJYA 4BCUA 1NE4A 3UGHA 2JG8C 2WFF3 5LEJA 2QQIA 4D3WA 3WQ0A 1UOBA 2DDUA 4XXAA 3SCHA 5FPXA 2R041 3OBTA 5BNPA 5C4WA 5CZKA 3PTRB 3ZVXA 1DLLA 4XFIA 3HNBM 4MZUA 5GLUA 5FY1A 1ZM1A 3VKLA 3ZR5A 3ZFFA 5CIRA 4AXOA 5J7MA 2BFUS 3J8F3 3VHPA 1QJU3 3BODA 1GYKA 3OGVA 4CEYB 3TOJA 1IQAA 1HRI1 1LEDA 2ZHKA 2GP3A 1FMD3 1MZ5A 2DF7A 1MS3A 1W8FA 2CU5A 3AYAA 5DUUA 2PTMA 1OA4A 3DYMA 1AL21 3B3QE 4UFIA 4ZY9A 1W3XA 2VQTA 4LKFA 2WIIB 3MIBA 1OOPA 3N7JA 4QM8A 2HWF2 5D8AA 3ZFGC 4C91A 4CDXB 3U14A 3CF6E 3QCWA 1WBFA 4L99A 4QPYA 5FZ6A 2BNMA 2ZZJA 3IDBB 4PIXA 3WQBA 4DXTA 4UFMA 5JZGA 1G9CA 4OI0A 3VDDB 4HSJA 1AL23 2IXIA 4LIVA 2R0FA 3ON7A 5I0DA 3WR0A 4LK7A 1WGPA 1MZFA 3DPRC 3NJVA 1COV2 1QOSA 3WEZA 2VZVA 2QQLA 3LOBA 1STMA 4UI9L 4YGEA 4FPEA 4XTPA 1XE7A 3J4UH 2MEV1 3T08A 1PIV2 1W9TA 3L2YA 1LR5A 1W04A 2LM3A 1BHGA 3H42B 2R7EB 3S7EA 1NQDA 2RR12 1V00A
chains in the Genus database with same CATH topology
5C9AA 4LEJA 2Z69A 2IXKA 1KITA 2YMZA 4KU7A 4LO7A 1MVQA 4AVSA 2K9ZA 2CAVA 4N9HA 3MEPA 5CFDA 4HL0A 4FPFA 5EYXA 3I8TA 1MR5A 1W6QA 1AYM3 5EWSA 1NCRC 1VBE1 2VW2A 1XNBA 2ZBJA 5T55A 2IXHA 4HBNA 1MQTC 3H3UA 4N7IA 3WQ1A 4QQLA 2HWE2 3VKMA 2JKBA 4BHPA 1QJY2 5E1RA 4LBQD 4YVSC 2P37A 3VBOC 1VBE3 4AW7A 4LO4B 1RUD2 1QGLA 1GKBA 2A6VA 4JCKA 5I8SA 2GH8A 3NSTA 1DBNA 1W6PB 3FUQA 3QD6A 4LE3A 1RMU1 4NHMA 4NHKA 5C4WB 1VBA1 2DU1A 1NY72 2D6LX 4D7TA 3WP3A 1E57A 4Q0UA 3ZFFB 5LEKA 1QMJA 1WW6A 3AMPA 4YZ2A 5IK5A 3NO8A 1ZVFA 1OD5A 2CWSA 1D4VB 4DB5A 4B4RA 1VBB1 1Z78A 3PTYA 2XB6C 3JBG3 1AXKA 4ZKTB 4QQ2A 4CTEA 3QLQA 1C5HA 1CPNA 1AL22 3A0KA 4XXPA 1TME2 3AKPA 1CX4A 4QT6A 3JBG1 4XIKA 1AR72 4AQSA 5AC91 2XL7A 1YWKA 1LB2A 1PIV3 4HFSA 2RM23 3WDXA 1V6NA 2R071 2VUAA 3WW4A 2RS52 3ZN4A 3JB4C 3WNXA 1KD7A 1S0DA 4RFT0 3LCPA 1NCRB 1PIV1 3UL2A 2YY1A 4AVAA 2XJTA 1CIWA 1VBD3 2R1DA 1RVF3 5DG1A 3ZPYA 1G6NA 5BPXA 3O5SA 4P9XA 1GICA 4RGGA 3BB6A 1MS5A 2JJ6A 1W6OB 2DWRA 3FZ3A 1UCXA 1W39A 4I0AA 4PBPA 1OQDA 1WUVA 1XU2A 4K6BA 2VOWA 1YFWA 1LOFC 1I6XA 4A3XA 1Y7BA 4KQ7A 4XFHA 5HCFA 4Q8LA 4CYDA 5IK8A 5BNPB 4EV0A 3B94A 3ZXKA 3IBMA 3O14A 2VW1A 4RGAA 4YM2A 2HWC3 4DY5A 1QQP3 3K51A 1APNA 2WS93 4IV1A 3AZVA 4M3CA 1HRV2 1KRIA 4WVMA 4PBOA 4UW6A 1H8TB 2RMU1 2VVDA 2HWC1 4JTNA 3TWIA 1A6CA 1LRHA 1AX0A 2WQZC 4MV2A 2CGNA 1CD3G 3ZYPA 4BPZA 1S2KA 2H0BA 4FSJA 4G3YC 4IEUA 2RMU3 3WP4A 4WM7A 2R16A 1NE6A 3WG1A 4IEQA 3JUUA 5JPMB 1R1A3 2GMMA 2YROA 4M3CE 1VLNA 4NR1A 4P9LA 3VBFB 2GNTA 2GC0A 1UIKA 4GH4B 2GU9A 1XU1A 2BVVA 1QNYA 2A6ZA 4DRRA 4XJUA 2VQAA 2ZCWA 4C0BA 1R1A1 1VBC3 2G4IA 4CEWB 1WLWA 2ZS6B 1QJX1 2XJRA 5LRRA 5D8AC 3ZFGA 4CDUB 1EV12 1X82A 3RYKA 2DFCA 5I0TA 1S0BA 3LKJA 5I8YA 1SLTA 1H1IA 2GN7A 2EXHA 3J9SA 1X7NA 1B35A 2B8MA 3ECQA 2X5IA 5E89A 4XF4A 1RUJ3 5J36A 4HN1A 1RUC3 3ACLA 2RS33 3E5XA 1NCRA 3KM5A 1NXD1 4IEXA 3WDTA 4K3UA 1FPN1 1N1SA 1KS5A 2A3XA 2RS31 2X29A 1FV2A 3D0SA 4A7ZA 1GNZA 1FI2A 5AVPA 3RZZA 2C9AA 4AFDA 2WT1A 4B29A 4WBBA 2E7TA 1HIXA 3SMHA 1JOJA 3PVNA 1D4M1 4XYXA 5F6KA 4JGZB 3V65A 1JUHA 4EN7B 1HV1A 4EWEA 5AFEA 4KG0A 3LSDA 4MXWA 1QQP2 2PAEA 5F1RA 3WP6A 1RHI1 1O3QA 3OGGA 3VBHA 2B45X 2VQ0A 1V6KA 1R1ZA 2OPKA 2WNEA 2HWB3 5FQ0A 1D4M3 4UW3A 5FMOS 3ZIXA 1FV3A 4H7MA 3POSA 4DS0A 4MLOA 4XZPA 4M3CB 2ZGLA 2BBVA 1Q8SA 3ZXEA 1SQ4A 3WCSA 3OCPA 2D6OX 3HIFA 1U5ZA 2BW8A 3FBMA 5CU1A 2E53A 1GZWB 3MIDA 4X6RB 3RYPA 1O4TA 2Q0AA 2VOKA 5L7OA 4ASLA 2ZMNA 1LODA 3T2TA 2OUHA 2C5DA 3WX5A 2F4PA 2DUQA 3VBRB 4BA6A 4YG3A 3UKVA 1D2SA 3VBRC 2Z2SB 1PVXA 3ZMNA 3P3PA 3ILNA 1H4HA 3H3ZA 3N7LA 4CDUA 3AK0A 1U0AA 4COYA 1DZRA 4CP0A 4TZDA 5GALA 2D3PA 1XYPA 1M06G 3PVEA 3MFAA 3ZFEB 4I2OA 1GZ9A 2X5IB 3NV4A 4Q4V1 5JR7B 1PHMA 1ZRFA 2ZAHA 4Q4W2 4TLFA 3RG0A 3ST7A 3TNQA 1OFNA 4YZ3A 1ALYA 4QGNA 4E2GA 5DDJ2 2B9UA 3THTA 5KHIA 4LLFA 3TN93 5H9QA 1D0HA 3D5OA 3VZOA 2VY0A 1BJQA 2A5ZA 5F6LB 5F9TA 1N3QA 1AX2A 2BQPA 1W6NA 1RB8G 1W2UA 4PLOA 1O7FA 4AVTA 1R091 4HKOA 3MIEA 4F3JA 5HBAA 2R49A 4OI4A 1EV11 2A6WA 3E97A 4AVCA 2ZX2A 4LBNA 1C57A 1H8TA 1ONAA 1NLSA 4MX3A 3V64A 4QPGB 1BXHA 1C1LA 1D4M2 5CG8A 2MEV2 3INAA 1H9WA 5I91A 4YW1A 1OPOA 5FBZA 2VVFA 2ZTNA 2XWBB 3M8LA 4IQPA 1JYCA 2V5YA 3R6SA 1QDCA 4FCAA 3B9IA 4EN8B 2DCTA 1ASJ2 4MGKE 4QGMA 4Q4X2 4N9IA 1V9U2 1UD1A 1HXS2 4P9IA 1Y9QA 5JAXA 3HWJA 2BVBA 4YW3A 2H0VA 5HCBA 2I45A 4OI1A 4HANA 3RS6A 3BALA 5K8SA 2I2SA 1AR83 3M3CA 2GMPA 1AZDA 3R4DB 2WNVA 4YVSB 4KG8A 1D0GA 5T54A 2DUPA 3I4IA 4H7LA 2YC0A 1RUE3 2RS13 2G9FA 2NN8A 2TNFA 3O0XA 4X6QB 3VUOA 4QGLA 2I74A 3IPVB 4ITCA 1BEV3 1V6JA 3M3IA 2A71A 1TMF3 1S1AA 5EXOA 5BNNC 2UWBA 5JDBA 1SEFA 5LRSA 3H9AA 1BEV1 1LHWA 5CG9A 1AJKA 3WG2A 1YI7A 1ZNPA 4Q4X1 1PNFA 3W58A 1QJU1 1HQLA 1I5ZA 4XW3A 5DUXA 1ZX5A 3NV1A 1HRI3 3IM0A 3FLRA 3ZSEA 4G4FA 5ABJC 1QXPA 1QXRA 4XF3A 3K48A 2ZX3A 5H9SA 4DZGA 1RUG2 2JX9A 3MIFA 3WW2A 4CDQA 5CNAA 4OZXA 1YI9A 2JENA 1WW4A 2D5FA 1LGCA 3WHTA 4ZXKA 2ZX4A 2Y38A 5C4WC 2ENRA 4X8NA 4CEYC 2WWSA 4FPJA 3EJKA 2HEWF 3QH7A 2ZGSA 4RD7A 3ETQA 2IWGB 3AZZA 4YW4A 1ASJ1 3IDEA 3MF6A 5JOZA 3AKQA 3AXDA 2MEV3 4LE4A 4RR3A 1HXS1 5BNOC 1NA1A 1PNGA 2ATFA 2ARXA 1DGWA 5JI9A 5FFOC 3HAGA 5EV7A 4FQ4A 5BUVA 1ASJ3 4YSFA 4Q4Y1 3ZN6A 1KS4A 1HXS3 4R4XA 4CDWB 1I1EA 3UV9A 1ZZ7A 1C8M2 4R9CA 1IGOA 3KSCA 5AFBA 4YNIA 4RQPA 4XJ8A 4RHV2 3PHMA 4DNYA 4CDWC 3MZHA 2G9GA 1KFUL 4TYSA 5IT6A 3UKNA 4GXLA 1AR71 1PK6C 2HWE1 3NW4A 2VVEA 1W0PA 4AEDA 1URXA 4AQTA 4XTMA 1AXZA 1WD3A 4K9SA 3WDUA 1S0GA 2RS51 1PO13 1POV1 3NAPA 2HWE3 4B3NA 4Z2WA 1CGPA 3HMYA 1CAUA 5JSOA 3A4UA 1ZYBA 3JB8A 1JXNA 5AC92 5KXCA 2QUOA 3W9AA 5JOYA 4YW2A 3LGRA 4JDOA 4D69A 1VBA3 2FHRA 2XBO3 5K0UC 2GMEA 1JYIA 1IOAA 5A33A 1N47A 3M7AA 2K2SA 5H9RA 5J09A 3IN9A 2ZAAA 5DG2A 1FYUA 3EO6A 3WV6A 3ZXLA 2CL2A 3DPRA 2PLV3 4CEWA 1W6NB 1VBB3 2BFUL 5SV8A 3E5UA 2W39A 2UYAA 4IEVA 3KMHA 4XJAA 2NMNA 3LAGA 2FMYA 4QQHA 2OA2A 2QE3A 5ACA3 1RUI1 1ULEA 3AYEA 1DDLA 5T52A 1A78A 1LHNA 2PN5A 2UYBA 3JD71 5CBLA 4YVWC 2CY6A 4N53A 1BBT2 1JN2P 1EAH1 1FT9A 1H2KA 3B69A 2XLFA 5ACA1 1M4WA 5KBFA 2O1QA 4Q4W1 3GYDA 1N3PA 4GMP3 1ZRCA 4MSVA 1WBLA 2ZMKA 1O4YA 3GBFA 2R063 4HPKA 1EAH3 2A73B 3VBUC 3N7MA 1AUYA 2AH2A 1YHFA 1RVF1 2VH9A 4Q26A 2A6XA 4GMP1 2HJIA 1VRH2 2D97A 3GHNA 1FOD2 5FOBB 1MQTA 4OHXA 4JGZA 1VBD2 1VIWB 3KD4A 1YLLA 3WQ7A 4K21A 3SCFA 1QJZA 1R082 1ZBE2 1O3TA 4IEPA 1UKGA 1EYBA 1CAVA 1Z0HA 4JGYA 3WINE 1BK1A 2ZJCA 4Y24A 4GALA 2V09A 5JSRA 1PGW1 5T5LA 4LO5B 3RPQA 3AMQA 4Q4Y2 3B02A 4AFAA 4AFCA 3LA7A 4SBVA 1XNKA 1DGRA 1QU0A 1QHDA 2WFF2 2VMIA 3AKRA 1RINA 4FPCA 5JMCA 4YGDA 4LHLA 2OZJA 5FLJA 4YM0A 3WP5A 4HMZA 3WVJA 2OW4A 3PVBB 3M1HA 4IETA 4XFCA 3POYA 4XETA 4E9KA 4KNCA 4XFFA 3GNEA 3VKNA 4MUVA 2D98A 2K0GA 3JZVA 1PZ8A 3V0BB 4XIOA 2B46X 2PQQA 4QM9A 1GBGA 2WT0A 3TNPB 2Y0OA 1OKQA 2IXCA 2VOVA 4WVWA 1VB2A 2WSVA 5SV5A 1NQJA 1GZCA 4BIOA 4D94A 3ZSLA 1W6MB 2WZR1 3URFA 4QMAA 4J6GA 3S30A 4OI2A 1SFNA 4P9WA 4YM1A 3BIWE 1PO22 5C9AB 3AZXA 1O91A 3OJBA 5KHGA 2QNKA 3P3NA 2WINB 3MFCA 3H1YA 4OLLA 1YIPA 2JG9B 4WVMB 5CFDB 1AJOA 4AI2A 3PVOA 1W6QB 1WA4A 3A0NA 4FPKA 4EJRA 2ETEA 3V0AB 2EF6A 3RI8A 4GKYA 1CAWA 3M4FA 1EY2A 5GM0A 4COVA 2P3JA 2NM1A 2NLRA 4E2SA 4O9GA 1C4RA 3VBFA 1N1YA 1YJLA 4B4PA 2WJSA 1RUJ2 1KJRA 4YZ5A 5K0UB 1SACA 4E2QA 4ORFA 5EYYA 4HETA 4CEYA 1EPWA 4BMEA 3BOWA 3FE5A 3NAPB 4FBFA 1PO21 4YLZA 4I0WB 3VBSC 4AE2A 3D4KA 1ZZ6A 1N1VA 4L11A 1LENA 3KZ4C 2YZ4A 4XQDA 2XWJB 1ND3A 1O4ZA 2AREA 1GLHA 1NOVA 2CNAA 1PM7A 1JTZX 3DF0A 1UU4A 4Y4YA 2SLIA 2ZGPA 2HWB2 2WNVB 4W65A 4YVSA 3QBQA 1OPMA 4XEZA 1SLLA 4PDWA 2O8OA 1DU3D 4UW4A 1VBD1 4GB33 4S2GA 4FXKB 4YZ4A 1WLCA 3OF1A 3UKTA 2GSYA 1TME1 1IKQA 4XF9A 2YDEA 3JBG2 2DCKA 4QXKA 4MXWB 3RNSA 4M0NA 3MLJA 3TB0A 4Q29A 5EZWA 4XFGA 3AMNA 4Y20B 4QQOA 1HRV1 1TME3 4CEWC 1V6LA 3VBFC 1CN1A 2PHDA 1ENXA 4Q4V2 3VZKA 1OLQA 5JLVA 5C8CC 2QCSB 2WZPP 3U11A 2Z42A 2ZKNA 1XRUA 2CYFA 2JXAA 1F2NA 4NN0A 1QQP1 2IXJA 4WV8A 1TE1B 3GALA 3C2UA 3CJIA 4PLMA 2D5HA 1ZZ9A 1ND2C 3J26N 1KDMA 1MQTB 3JU9A 5JZGB 2WNUC 4WM8B 1W6PA 2RJLA 1S0IA 3MW2A 2D93A 2R072 4N90A 1OQEA 5BNQA 4WM8C 1Q8VA 2PAKA 1KDKA 4GKXA 3ZXFA 1Z7S3 2XUMA 1K5MC 3JD72 1WW5A 2BYVE 4FOVA 5E8AA 2R30A 4BH9A 1GR3A 1F8VA 2SBAA 4I0BA 5DDJ1 2DVFA 5L19A 4XJWA 4J1XA 3NV2A 5DUVA 1XE8A 1SLBA 3ZFFC 4LUMA 1H0BA 2BTVC 3OGJA 5JOXA 5K7PA 4OUSA 3AFKA 4EN9B 4XQWA 3OBRA 2NMOA 3GHMA 3QH6A 2WLPA 1I9RA 2IZWA 2HWF1 4PLNA 5CVRA 2EXKA 3FLTA 1U12A 4IV3C 5B2GB 4ES9A 5BNOA 2IFRA 1MS8A 4Y1VA 2CGPA 2OVUA 3OPZA 1POV0 4M3CF 5DXDA 1RUC1 4MH0E 1COV1 1VJ2A 5T5OA 1QOTA 1YFXA 2P2KA 3KS7A 1V6MA 4JDMA 4YFWA 2RE9A 3AP4A 5IUQA 2BGCA 4Z82A 3H7YA 2R1BA 3UK9A 4YGBA 4JV4A 1YCIA 3S0MA 2C1FA 1RJ8A 1IZ3A 2I07B 3CLPA 3LSEA 4RS5B 5DZGA 5C6CA 4JRAA 3WDVA 1Q8OA 3ZDSA 2YXSA 3KLSA 2PAMA 1REFA 3V0AA 5T5JA 4XF1A 4WVVA 2YHJA 4R52A 4L2NA 2Q5TA 1HLCA 1ZREA 1TMF1 2Q1ZB 4NWWA 1C8M1 1FMD1 2DUOA 3NAPC 4EN0A 1AX1A 4DINB 2HEYF 2MNGA 1QXJA 2QDRA 3PNAA 3MPPG 2WA4A 1CAXB 1QJX2 1LULA 2XHKA 1F5JA 4Z07A 3ILFA 1EP0A 3ATGA 4KWJA 2DVAA 4FQZA 3SH3A 4WZCA 3FUOA 1H4GA 1NYWA 4E4SA 1H1AA 1SBFA 3SXWA 1QJU2 3GF6A 2E7QA 1J59A 4R4ZA 4M01A 5GZCA 4AGGA 1LEMA 1GNHA 1RUG3 2EVXA 4C0HA 5GZGA 2B39A 3B5LB 2HWD2 3OY8A 4AQ6A 4F8AA 1WCSA 3H8UA 1RUG1 1WMEA 1LHVA 1AR62 4QPIC 2HYKA 5FTTC 3NKGA 3N3HA 1QOOA 3PMSA 4QHBA 3DKWA 1HV0A 1LHOA 2H6BA 3HT2A 3MPBA 2GNBA 3O0VA 4XDQA 2WL1A 4B7EA 1WMDA 4FOQA 4K1ZA 5GKAC 4HVRA 3OD0A 1XNCA 1ND2B 3ES1A 5GZDA 4G9SB 3AMHA 5JWPA 1PMIA 4JQRA 4Z8BA 3L2HA 4AI3A 5L73A 3M70A 4UW5A 3QACA 2Q1MA 3JQWA 3KB5A 1V6IA 1LGBA 1NA1B 1UN1A 2QQPA 2H6CA 3IIAA 3VN4A 1W0OA 4JAAA 4P5HA 5KWRA 3NV3A 5JPNB 4HSLA 3R4SA 2HEVF 3PLQA 2CAUA 1RITA 4C1XA 1PO12 4N53C 3DL3A 2D40A 4RQPB 1WW7A 1LOGA 1RUF3 1FNYA 2EXJA 1PGL1 4GIQA 2ZA9A 1J3QA 1CESA 4Y1YA 1WCDJ 4XF0A 1KJLA 2QFEA 2XBO2 2QJVA 2QVSB 5I0UA 1FATA 5CAZA 1RUF1 2GNDA 3IT8A 4D7SA 4HKWA 5FREA 3FHIB 1PGW2 4CZSA 1AF9A 5C9AC 3BCWA 4LO6B 1UL9A 3DN7A 1ZBA1 1VBB2 4CRQA 5KXDA 1T6GC 1G9FA 1RUI3 4DQAA 4U36A 4RS5C 4MYEA 3KCYA 4Q27A 1BBT1 1H8VA 5FLIA 3FMGA 2AGSA 4HK8A 1ZBA3 1MZ6A 1Y43B 5BNOB 1RMU2 4LTAA 5CA6A 1YIFA 1BZWA 3Q9OA 1RL3A 1LOBA 1BBT3 1LTEA 3SITA 1AR92 2UWAA 1A8MA 1OLRA 1WCKA 4FVVA 2RR11 4C90A 4OHYA 2D44A 3E5QA 3RSJA 1MEC2 1G86A 2XLAA 2V73A 3POWA 4CP1A 3WT3A 2PHUA 1J3PA 3D0JA 5D1IA 2EXIA 4Q4X3 4FPHA 1DGRN 1VR3A 1XYOA 3KT1A 3W59A 4AVBA 4E27A 3R4UA 4YVWA 2RR13 1DGWX 4P9GA 3AKSA 4IERA 1DFQA 1FOD3 3WOGA 1RVF2 4IEZA 1Y3TA 3IKWA 3ZYGA 4S2HA 1ND3B 2VNRA 5CADA 5BNPC 4AGRA 2A6YA 1DIWA 2Q8OA 4BOWA 5BV6A 1G7YA 3VL8A 1YO8A 1DHKB 4M0HA 2IC1A 4PDWB 1DYPA 3O0WA 4AHZA 1BKZA 1KXGA 3RI9A 1SMVA 1QJY3 1CR7A 1IS5A 1GZWA 1XQNA 4YFZA 1BVP1 3X29B 4Y1ZA 1YRZA 1HQNA 1O5LA 2A3WA 3MI8A 2Z5WA 3B7MA 1MEC1 4A7YA 4KH9A 1LCLA 1B09A 2XJPA 1AYM1 3SCGA 1JH5A 2GC1A 3AYDA 1OOPC 3KCCA 1IPKA 1RHI2 1RUH1 4I3PA 2JEMA 5BNNA 4QPIB 4ONUA 2GC2A 2WA3A 3OY8B 3CU7A 4KGGA 1Q5OA 4YG6A 4LBQB 1DQ0A 1AHSA 2LUWA 4AEKA 1FX5A 3UJOA 1RUH3 4IXLA 1AYN1 2HKXA 2BNOA 1AR91 1YFYA 2DCZA 3SNMA 1ZBA2 2ILMA 1PZ7A 4RL7A 5FO8B 3SHRA 1RMU3 2E6VA 2ZGMA 3AZWA 4GMP0 3TYJA 2ZGTA 1N1TA 3DUIA 1AR93 1A8DA 5JIUA 1QWRA 4MXVA 2P17A 1FPN3 1HKDA 1UKRA 4AEDB 1W6MA 1YJKA 2XG3A 1PZ9A 3AKTA 5C8CA 4E4DX 4RR3C 5CFCC 4OFGA 4LHNA 3AJYA 3D6EA 5BY5A 3VGIA 4EROA 3RRDA 2P3IA 2VNGA 1BVVA 1MS0A 2N7GA 4XFAA 2YYOA 3PJQA 2W52A 2RS32 2PLV1 3T1LA 4HKLA 1JW6A 1VP6A 4A2UA 3VDDA 1Q8PA 2DTYA 2QKDA 4SLIA 4NWVA 4KL1A 3SLIA 1PK6B 2PHFA 4Q0PA 4FP3A 2ZABA 4YM3A 3I59B 2RM21 4AWDA 3WLUA 4DRVA 2D3SA 1ZBE1 4Q0SA 2W08A 4Z92B 1CONA 1SBEA 1ZZBA 2BWCA 4LBMA 3RYRA 5JSPA 1U5IA 4FPLA 4PDWC 2D6NA 5KC5A 4GULA 4E4ZA 3H7JA 2Y26A 4INDA 1S0JA 4I01A 4YW5A