4LBQD

Crystal structure of mouse galectin-1
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
133
structure length
125
Chain Sequence
b'CGLVASNLNLKPGELKVRGEVASDAKSFVLNLGKDSNNLCLHFNPRFNTIVCNTKEDGTWGTEHREPAFPFQPGSITEVCITFDQADLTIKLPDGHEFKFPNRLNMEAINYMAADGDFKIKVAFE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Galectin-1
molecule tags Sugar binding protein
source organism Mus musculus
publication title Crystal structure of mouse galectin-1
rcsb
total genus 25
structure length 125
sequence length 133
ec nomenclature
pdb deposition date 2013-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4lbqD00
1OFSA 1B09A 1LOEA 1YYNA 1AX2A 3POWA 4Q8LA 3V65A 2WSUA 3AJYA 3IPVB 3WG1A 4DQAA 1GICA 1QKQA 4TYSA 4WVVA 5FRAA 4XHBA 4TZDA 5AVAA 1NLSA 1N1SA 3M3OA 2Z42A 1SLCA 2UWBA 1QF3A 2WSVA 2V73A 4BLIA 1FV2A 3H0OA 2VW2A 1C4RA 1ENSA 2ZMNA 1DIWA 2ZGNA 2LALA 1APNA 2ZACA 3BOPA 1IS4A 2G4IA 3WUCA 3V0AB 1G9AA 3V0AA 1S0CA 1LHVA 3RQ0A 4YW2A 1X50A 1WCSA 1DYKA 2A7AA 3JUUA 3SLIA 3M2MA 4ISRA 4XBQA 1DQ5A 1O4YA 2GNDA 4K1YA 1G9FA 1MS0A 4M3CF 2ES3A 1IKQA 2AGSA 2VXRA 1ULGA 2A70A 1QNYA 2ZGOA 1QNWA 4XBLA 1RIRA 2ZA9A 2D6KA 2DYCA 5DUVA 3ZXFA 2OVUA 3ENRA 4FPCA 2DVFA 1RINA 2D3SA 2P34A 3OBRA 5F9TA 3ZPYA 2UWAA 3NV4A 4XIKA 2GMMA 3WDUA 2JDZA 2R1BA 4BMEA 3USUA 4C1WA 3LCPA 1FNYA 2YXSA 4XDQA 2GMEA 2D6MA 3M3CA 2D44A 1N3QA 4YGCA 1BZWA 3ZSMA 5T5JA 1N3OA 2ZMLA 4KBBA 4YZ2A 4FQ4A 2DU1A 4YG6A 3AZYA 4UW3A 1Q8VA 1MS3A 4YW1A 3WLUA 2E53A 3DGTA 3FLPA 1IS6A 4ATEA 1LOAA 1AXKA 4CTEA 1WW6A 1SLTA 5CAZA 1UZYA 2D7FA 4DRVA 1C1FA 3AZXA 1LOBA 1Z78A 3AZVA 4XOGA 3WZ1A 1YO8A 3FUQA 1ULEA 3C2UA 2EXIA 2SLIA 1N1YA 2D6NA 1SFYA 5IUQA 1W6NB 3HMYA 4LBQA 2VH9A 4YZ3A 3SISA 1GZCA 2DVGA 1EPWA 2AUYA 2C5DA 3BIWE 3I8TA 3ILRA 1F31A 1VAVA 4FQZA 2A71A 3BODA 3INAA 4BLJA 4IQPA 4YW5A 3GALA 2PHXA 2ZGLA 4BM8A 3AZZA 4Z8BA 2A6VA 3TAYA 4YZ5A 1WLDA 1WD3A 3WV6A 3N3HA 5IK5A 3B69A 4XXPA 5GM0A 3A0NA 3ZXEA 1AXYA 3OY8A 4YGBA 1G86A 2V5YA 3R4UA 4DRRA 3BTAA 5KXBA 5GZCA 4XXAA 4YZ1A 1MZ5A 2Q5TA 5LK5A 4YW4A 1H9PA 3VUOA 3V0BA 1V6MA 3I4IA 1WUVA 2VW1A 4DPNA 1LESA 3V0BB 3WCRA 1DQ0A 1LTEA 3WHTA 2A5ZA 4CZSA 1Q8PA 1RITA 1QOOA 1GYKA 1OKQA 4U2AA 2UURA 1WW4A 4XMAA 2EALA 4W65A 2ZMKA 1G8WA 1KITA 2DU0A 3POYA 4GKXA 3RSJA 2HYKA 4LBLA 3OYWB 4FOVA 3O12A 4AGVA 3ILNA 3PVEA 3W59A 3A0KA 2E51A 4GXLA 1YXWA 3NV3A 4FPJA 1MS8A 1CONA 1ULCA 3WOGA 2ZGPA 5T5OA 1FATA 1DFQA 1Q56A 1AX0A 1LOCA 2GN7A 4AVVA 5KXCA 1W6MA 2C9AA 1LOFA 2A6ZA 2PHWA 2XG3A 2ZGQA 1HDKA 3AP4A 3D6EA 4FP2A 1V6JA 3SH3A 4M3CA 4Y1VA 3SH4A 1G9DA 3AFKA 3M1HA 4XBNA 3PMEA 3A4UA 1F5FA 4PBOA 5JOYA 2ZGRA 3IM0A 1N47A 1W6QA 3ZXKA 4Y1UA 5JOWA 1PZ9A 5HCFA 4ISQA 1Q8OA 1W6OB 3N7JA 3O0XA 3ZXLA 3R05A 2A6XA 2NMNA 5T5PA 4AVSA 4FPGA 4UW6A 3ATGA 2B7YA 4YG0A 1CVNA 4XTMA 3ILFA 3WG2A 1AXZA 1MS5A 1VLNA 2JE7A 3AYCA 5GZFA 4DFSA 3AK0A 5KXEA 1AX1A 2NYYA 1G9BA 2AH2A 2AR6A 4Q2FA 1URXA 3OGGA 3MEPA 3RS6A 2WQZC 3V64A 2NP0A 1Q8SA 3ZSKA 2I2SA 2ZHKA 3FBYA 3ZYRA 4FP3A 2NMOA 4PBPA 3ASIA 3M3EA 4WZFA 5H9SA 1LU2A 2R16A 4YLZA 3AX4A 1DBNA 2YV8A 2D3PA 5L73A 1S0FA 2OUJA 4Y1ZA 5E89A 2GNTA 1DLLA 2P3JA 2ZHNA 3VKOA 2P3IA 4Y22A 4R9DA 4JRAA 4AWDA 2CWSA 2GN3A 5JVVA 5H9RA 2ZGKA 4XILA 4P9WA 5GZGA 1KRIA 2R0FA 2ENRA 2JJ6A 2SBAA 4FPLA 2CY6A 4XJ9A 3UL2A 2W08A 3IMNA 4FPEA 4ITCA 4P9YA 2ARBA 4FOQA 4WV8A 4YGEA 5CBLA 5DZGA 3AYAA 3FLTA 1KJRA 2WT0A 2D6PA 2ZHMA 3B9CA 1JUIA 4R9BA 1MS9A 2A3YA 1WD4A 1JHNA 2ARXA 2VUAA 2ZZJA 1MR5A 5DG1A 1Z0HA 5E8AA 1UL9A 1S0EA 2FHRA 2WJSA 1FAYA 2A3XA 1LJ7A 1SCRA 3PJQA 4I30A 2P2KA 1KQRA 1JXNA 1GZ9A 1LOFC 5DUUA 3DUIA 3M3QA 5DUXA 1BXHA 4Y1YA 1AJOA 5T50A 5T52A 3QCWA 4WVWA 5GLVA 2ZGMA 3KM5A 2FMDA 1W6PA 2DV9A 5IK8A 1S0BA 2WLQA 2WT2A 1J1TA 1UAIA 1CPMA 1JYCA 3POSA 1F9KA 1MVQA 1FV3A 3APBA 2ZKNA 3AYEA 3T1LA 1SLAA 1MVEA 2GNMA 3OJBA 5IK4A 2GNBA 4FPHA 1Q8QA 4Y22B 4JC1A 4LBQB 1A78A 1KDMA 3WG4A 1UN1A 4FPOB 3N7MA 2DURA 3HN1A 1R1ZA 2VU9A 5IK7A 1SCSA 1S1AA 4FPKA 1LU1A 1LGBA 4YG3A 1GZWB 4NOTA 2GDFA 5GZEA 2EF6A 3WVJA 1DQ2A 1GZWA 4U36A 2ZGTA 3D4KA 4AGRA 1DGLA 4NO4A 4YM1A 5CB7A 1UMZA 3PVNA 3QLQA 1I1EA 4C1XA 1GKBA 1FYUA 1H30A 1SACA 4F83A 3T1MA 2EAKA 1DHKB 1V6NA 2YY1A 4XJAA 5GLWA 2CTVA 1ONAA 1NXD1 5FREA 3AP7A 4FVVA 5EYXA 1LEDA 2W39A 3ZSJA 3VV1A 1W0PA 1SLIA 2PHTA 1QOTA 3RMYA 2NM1A 3FUOA 1BYHA 2OW4A 3NV1A 1SLLA 4HANA 1LECA 4XIOA 1D0HA 3KQRA 4LBOA 1S0DA 1YI7A 4YW3A 4R9AA 2DTWA 1GANA 2H0BA 3AP5A 1W6QB 2EXHA 1V6KA 2ZAAA 1ENQA 5BYNA 1YIFA 1JW6A 1LHUA 1IKPA 2EXJA 3OBTA 1D2SA 1AJKA 3WG3A 4H55A 1LGCA 4YFWA 3O5SA 1W6MB 2CYFA 2UU8A 4K20A 2BQPA 1LHNA 2A6WA 3VKMA 3WDXA 4LBQD 4PQ9A 1LODA 5DG2A 3UJOA 1O4ZA 2XB6C 4BQ1A 1HKDA 1W6PB 1ZM1A 3RRDA 2WNEA 3VKNA 3HR9A 1SBDA 1LHOA 1QMJA 2DVAA 1DYPA 3N35A 1G7YA 5IT6A 3AJZA 5T5LA 1IS5A 3FLRA 4UW5A 2JKBA 4XZPA 2W68A 3CNAA 1LEMA 2RHPA 3SH5A 5JOZA 1GLHA 1UKGA 2D43A 2DUQA 5DZEA 1N3PA 5H9QA 1XQNA 4OZXA 1WW7A 1JYIA 1U0AA 4GALA 1G9CA 1GBGA 1YRZA 3B00A 3LSDA 4YFZA 3U4XA 1CIWA 2YMZA 2D6OX 2E7TA 2PHUA 3B01A 1DQ4A 3L2YA 5EWSA 1VIWB 2GALA 2EXKA 3OY8B 3T2TA 3AP6A 4XJZA 3ZYPA 2PHRA 4L8QA 3FFZA 2OUHA 4BPZA 4LBNA 1WLWA 1IOAA 2EIGA 3D5OA 1WBLA 5GLTA 4P14A 3IN9A 5HCAA 4PCRA 3MW2A 2DUPA 4XHXA 1ULFA 4XJWA 4ATFA 1CPNA 3N7KA 2P37A 3N36A 4Q1PA 4M00A 4UW4A 1Y7BA 5DZFA 2WKKA 2LTNA 4JCKA 4Q26A 4CRQA 4LBKA 1S0IA 4LBJA 2CL2A 3TB0A 1W6NA 3NV2A 4M3CB 3UK9A 4FPFA 3B3QE 2A3WA 3WDWA 4FOYA 5JLVA 1SLBA 3MW4A 2CNAA 1ENRA 3RG0A 1W6OA 2PELA 1W0OA 1UX6A 2KM2A 4YM2A 3WNXA 2JECA 2DVDA 3OPZA 4Q27A 1AVBA 1MS1A 4YM0A 1MZ6A 2P3KA 1JOJA 2PHFA 4AVTA 1AZDA 4DS0A 2W52A 3RMXA 5GALA 4YZ4A 5KXDA 2ZHLA 1WLCA 4K21A 4YGDA 4R9CA 4XJUA 1KDKA 4AGGA 4XTPA 3AYDA 5GZDA 1DZQA 1MS4A 4Y24A 1HQWA 1S0GA 4XYXA 4ASMB 1KJLA 2AENA 3OYWA 2D3RA 1GNHA 1QOSA 1N1TA 1CQ9A 1WW5A 2D6LX 4FOWA 1UPSA 2ZBJA 5GJ6A 3WDVA 1H9WA 4YM3A 4M3CE 1VALA 1A3KA 5F5QA 2E7QA 5T55A 1PZ7A 1QU0A 1BKZA 2AREA 1HLCA 4BMBA 3USUB 2ZGSA 5CA6A 3AP9A 3AXDA 4PF5A 1FNZA 4Q1RA 4Y1XA 3SNMA 3WCSA 5HCBA 1QGLA 2JD4A 1BJQA 3ZXJA 5DXDA 4D69A 1N1VA 4Q8KA 2A6YA 4FPYA 4LBMA 3SITA 1V00A 5T54A 1ULDA 3IKWA 2A75A 3W58A 2YROA 1CR7A 1LCLA 1CESA 5JMCA 4ZXKA 4BOWA 4GKYA 2TEPA 2NN8A 3VKLA 2E6VA 3PVOA 4K1ZA 4RA0A 2DUOA 1C57A 1S0JA 4ZKTB 3GNEA 2VW0A 4GA9A 4Y20A 1V6OA 1JBCA 4M01A 3AXEA 5E88A 5GLUA 3O0VA 4XJ8A 1A8DA 1LULA 1WBFA 3IPVA 4Y26A 5EYYA 2R1DA 3AZWA 1LOGA 3O0WA 3MPPG 4GWMA 3R4SA 4RL7A 4AYUA 1GNZA 2DWRA 2ERFA 2GMPA 2R0HA 3UJQA 1VAMA 1LHWA 2VY0A 3Q9OA 3MW3A 4SLIA 3LSEA 1GSLA 1I3HA 4XMIA 5EXOA 1MACA 1AF9A 2ZGUA 5SV8A 5JOXA 1DQ6A 1V6IA 1UZZA 3N7LA 4HL0A 1TEIA 1DQ1A 4Y20B 3VKFC 1IS3A 2UWCA 1CN1A 1BQPA 1QDCA 2DTYA 2WT1A 5DUWA 4MYEA 1LGNA 3ZVXA 4P9XA 1JN2P 1ZA4A 1OQ1A 1GV9A 3WUDA 1FX5A 5H9PA 3ZSLA 1V6LA 3WDYA 1SBFA 2JE9A 1LENA 5GLZA 2R49A 2AYHA 2ZABA 3NWKA 4XE9A 4GWNA 1HQLA 1C1LA 2NZ9A 3WHUA 1PZ8A 1QDOA 3WDTA 1CJPA 2DVBA 2CWMA 5CNAA 1SBEA 2YZ4A 3JU9A 5JDBA
chains in the Genus database with same CATH superfamily
3KHCA 1OXCA 4C91A 4ZZ5A 1PGL1 1AX2A 2XLAA 5ACA1 3BTXA 2WSUA 3B5LB 2GH8A 3E97A 1DYOA 4LTAA 4MGZE 3HN3A 5AVAA 1N1SA 3EQEA 2JDYA 2QQKA 5JZGA 2Z42A 2LRPA 1FPN2 3WF2A 2WSVA 2HWF2 1FV2A 3H0OA 1C4RA 3VHNA 1ODMA 2LALA 2ZACA 3JQWA 1IS4A 2B8MA 3AMMA 4QKNA 5IVVA 3V0AA 1LHVA 3SLIA 1X50A 2A7AA 3JUUA 3U0ZA 3M2MA 4XBQA 1O4YA 2WNUA 3T08A 2WBKA 2ES3A 3PNAA 4M0NA 2ZGOA 1RIRA 1NCQB 2D6KA 2ZA9A 1K5MA 4N53B 3FZ3A 2OVUA 3ENRA 2XH6A 1Y43B 5A33A 2QQPA 1W8WA 4CU7A 4C1WA 3USUA 4COVA 3OGJA 4XDQA 4R52A 1X82A 2F4PA 2D44A 5I0DA 1BZWA 4X8PA 1H2KA 5CFCC 2YDEA 2CDPA 3PVBB 3MUY1 1E5SA 1N3OA 2OQ7A 2ZMLA 4NAMA 3U1XA 5FPUA 4LLFA 2BNNA 2JDPA 4NHXA 4DXZA 1JTZX 1FOD3 1FT9A 3UESA 1W0NA 3NO8A 2WYSA 2R071 4PLMA 3DGTA 2GP5A 1BMV2 3FLPA 3ETPA 2WQ4A 2DBIA 1NOVA 5EHDA 3DXUA 2D7FA 5LBFA 2EIDA 2Y6JA 3TBDA 4K8FA 3WZ1A 2VMHA 2CHHA 1REFA 2SLIA 4QB6A 5FJHA 4NRMA 4XDOA 1VBB1 3RI9A 1JYWA 1BVVA 2OIIA 4AL9A 3VDDA 1PVC2 2VH9A 1VBA2 4DO0A 2VNRA 3T2PA 4AEMA 4EROA 4YVWC 2DVGA 1EPWA 4HXCA 4FQZA 3ZKUA 1W2TA 2GSYA 3BODA 4BLJA 4IQPA 5LBBA 1VAKA 3GALA 4AE2A 3IZOA 5DQ0A 5A6ZA 5IATA 3GHMA 4GD4A 2ZGLA 5K4LA 4Z8BA 3O1OA 2JIGA 3SKJE 1WD3A 4BCUA 4UWDA 3B69A 4S2FA 5K9YA 4BQWA 3JBG2 4QWNA 4IE6A 1ZA7A 5GM0A 1O3RA 2WA3A 2Z69A 1WCDJ 2YB7A 3O7OA 1H4HA 5ANNA 5DAXA 5C9AC 4QX5A 3PHMA 3BTAA 2CU5A 3LEMA 5IVCA 5KXBA 4KWLA 4YZ1A 3BTYA 2Q5TA 4WM7C 5LK5A 1QJFA 2QZ2A 4BU2A 4IEQA 3V0BA 1NQJA 3NKGA 4Y4YA 4A7YA 3IMMA 5F5CA 3ZX7A 2G9ZA 1K12A 3KT1A 2QQMA 3WHTA 1UY4A 2FMYA 1H4GA 3LE0A 3H8XA 3NKTA 2J1VA 4U2AA 2WS91 4YVWB 4YSFA 3ZO0B 3TRSB 3WQBA 2ZMKA 2J1EA 1E5IA 2DU0A 4GKXA 1SDDB 2HYKA 3AL6A 2JG9B 3ELNA 3OBZA 2Y0OA 3MF6A 4HN0A 4Y5Z0 1JU4A 3A0KA 4IGPA 3NNGA 1JZ6A 1EAH2 2RS51 4GQ7A 3RNSA 1MS8A 1CONA 1EYBA 2H6CA 3T2OA 4XUQA 4Q4W3 3WOGA 1KFUL 1JZ3A 4PIXA 1RUNA 1OOPA 1W6MA 1LOFA 3NW4A 2WNVC 2ZGQA 3AKRA 4FP2A 2HH9A 5D2AA 3SH3A 4Y1VA 3SH4A 4IUGA 4I2OA 5JIAA 3IT8A 3MIGA 3A4UA 4E2GA 1RUD2 1DU3D 3VDDB 1TMF2 4AOCA 5F6LB 5I0RA 5JOYA 3MZHA 3IM0A 4PLOA 1N47A 1W6QA 5FZ4A 4QQHA 3N7JA 1VRH1 3UGGA 3VBHB 1REEA 5EJ3A 5FPZA 2QJVA 4KWKA 2NMNA 1AR82 1OLQA 5T5PA 4AVSA 3ALQA 4YG0A 4AG4A 1CVNA 4LE3A 1WWYA 3AM2A 2XQRA 4W6YA 3H8RA 1STMA 2K0GA 1AXZA 1VLNA 2JE7A 4DFSA 1Y4WA 2VQUA 1O5UA 2NYYA 5E1RA 1J84A 2AH2A 1PIV1 2AR6A 4OUSA 1VRH3 3FFQA 4Q2FA 4QQOA 1F4AA 2OQ6A 2Q0AA 2PHLA 4GH4A 3PUSA 5JR7B 1XU2A 1RUC2 2I2SA 2YC4A 3MYXA 5JSPA 2VXJA 3ZYRA 3BGAA 3BOWA 1RHI3 2VUJA 3M3EA 5FZMA 5H9SA 2Y6KA 1YJKA 5C9AA 2VVFA 4YLZA 1RUC3 2WNVB 2D3PA 1S0FA 5D8AA 4D94A 2J1RA 1PMJX 3B02A 3DV8A 4QQLA 1VMHA 4Q4W1 3NAPB 1R082 5H9RA 2ZGKA 3RDIA 5LATA 4H2AA 4XILA 2ZEWA 1MEC1 1UZWA 4P9WA 4Y5SA 3WP5A 3ZXGA 1F8VA 2ENRA 1JYNA 1KRIA 4G3YC 5AFBA 4CDXB 1PGW2 4DUVA 2VMIA 3IMNA 1ND3B 4FPEA 4P9YA 2VBDA 1VBD1 3POFA 4AEKA 3B9CA 4YYOA 1EV13 1JUIA 1MS9A 2TNFA 1WD4A 2E31A 3KSCA 2VUAA 4R9BA 3ZN5A 4K8RB 1Z0HA 5E8AA 1UL9A 1S0EA 2IC1A 2WJSA 1BEV1 1BBT2 3RZLA 2EVXA 3RZZA 5T50A 2PYTA 5T52A 4JHTA 1DGWX 5BNOC 5FKBA 5GLVA 3MBWA 1W05A 3USSA 2V4AA 3KF3A 4QD2A 4Q0PA 1W6PA 3WD5A 1S0BA 2XONA 3UGFA 5APAA 4MGKE 1O3SA 1RUD1 3FWEA 4LHKA 1MVQA 3APBA 4NHMA 4P00B 2J1TA 4O7XA 4G4FA 4RHV2 3T1LA 1SLAA 2BERA 2GNMA 3V56A 1F5JA 4BXSV 5I8TA 1R1A1 2QDNA 4Y22B 3CMGA 1A78A 3I2OA 2GC3A 4AI1A 1RJ8A 4FPOB 3I2IA 2VBBA 2FCTA 3NQHA 3ZFGB 3WINE 4OVEA 1AYM1 2A1XA 1ALYA 2XHNA 3DYPA 2HWC2 4FPKA 5IK7A 3GHNA 1LAJA 1OC1A 2JDHA 1U5XA 3D4KA 2VZPA 1DGLA 1SMVA 3NNMA 4YM1A 1UMZA 4RS5C 4AGRA 4C1XA 1U12A 1RUC1 2HWD1 2ZOEB 3HNYM 3T1MA 2YY1A 1V6NA 2W1SA 5GLWA 2CTVA 4ARXA 4R4ZA 5FREA 2WNVA 2BPA2 4FVVA 2OS2A 4NE9A 2W39A 3ZSJA 4MZUA 3CDZB 3T09A 2QE3A 2WS93 4IXLA 4RGGA 1SLIA 4OMDA 1BCXA 3NV1A 4D6SA 5BNPC 1SLLA 5CU1A 4XIOA 1XSRA 5CFDA 3ZN4A 1GP6A 3VDAA 2RS32 5E16A 2RDRA 5FWJA 1GANA 4XFAA 1W6QB 1X36A 3FJSA 1W3VA 3S7EA 3I3EA 1O6UA 1JW6A 3HQXA 1CAVB 1ZNPA 4L11A 4A7ZA 2BP6A 3NSTA 3OGRA 4BQ2A 2EXJA 1PM4A 1AJKA 5ABJB 4H55A 4AVBA 2R7EB 3C7FA 1OOPB 1W6MB 1UCXA 4YVWA 2EIEA 1BEV3 4ZXEA 2BQPA 4BQ4A 3RWNA 1NCRA 1AL0G 1UY1A 4HN1A 4LBQD 4PQ9A 1LODA 1BEV2 5C4WA 5KC5A 2P5BA 2XB6C 1TQ5A 1HKDA 3LPFA 4NHLA 3O1TA 1YQCA 3UKNA 4P9JA 1SBDA 1H8TC 4LE4A 2OXBA 4AHWA 1HV1A 2IFRA 1IHMA 4XQ4A 5T5LA 3FLRA 2ZX0A 4XZPA 5JOZA 1LEMA 3MHZA 2VQAA 2VCCA 1XNTA 1UKGA 4A41A 2WNUB 1ZRFA 5FO9B 1WW7A 5DPNA 1JZ7A 1CD3G 3PTRB 1G9CA 1GBGA 5AVPA 1I9RA 2JB4A 4LKSA 3MO4A 4NPLA 3U4XA 4CXYA 4EN6B 2IXKA 2XJVA 4LO5B 2YMZA 3B01A 4QDSA 3NAPC 5FY9A 5A3MA 5F1RA 5FP4A 4D7TA 1QJX3 3I3DA 2ZX4A 2YC2A 1GOFA 2DFBA 5JI7A 1HRI2 2VZ3A 3AB0A 4LA3A 5L36A 2PHRA 2Z4FA 2OUHA 3B7MA 3SCHA 4F8AA 3H1MA 3GBWA 2X8KA 2UY9A 3NJYA 4FSJA 2HWF3 1YCIA 5J37A 1SHWB 4NIGA 4Q1PA 1FOD1 3ZOIA 3D82A 4CUGA 2MEV2 5J98B 5FY7A 5FQ0A 1Y7BA 4CVUA 4LBKA 3J8F1 5FAXA 2KXLA 4OMCA 3TB0A 4COYA 4HKLA 5CFCA 3TEZA 1V0AA 3NV2A 3UK9A 1XC6A 3E1F1 1UW8A 4ZPIA 1JH5A 5FUIA 5JXIA 3WDWA 1UYZA 5JLVA 4PDWC 3VZJA 1JZ5A 3MW4A 1ENRA 2Y34A 2VMCA 2G1MA 1OQDA 4CUCA 3OGSA 2PELA 1UX6A 2XVKA 4S2GA 1VR3A 5B4NA 3HVDA 5FUPA 3WNXA 4P9GA 4HK8A 4YM0A 2P3KA 1AR72 1PO13 2PHFA 4ORFA 2BEOA 4B1LA 4E4ZA 5LA1A 4CPBA 3RMXA 4JDNA 2R041 4FFGA 1VBC1 5I0UA 4YZ4A 5IVBA 2ZHLA 5KXDA 4L2NA 4K21A 2IVJA 2VZ1A 4MSVA 4QKBA 4R9CA 4CP2A 4H3WA 3OEBA 1H0BA 2JG8A 3KGZA 1HQWA 1S0GA 2X5IA 4MXWB 3T0DA 2NQYA 1KJLA 3EYPA 1SFPA 4HOOA 2B4KA 5F3GA 1N1TA 4HK9A 5FZHA 3KCCA 3PU3A 1O8SA 2ADEA 1YFYA 2NLRA 3LEIA 5GJ6A 1W8ZA 3RVHA 4N7UA 5IVEA 1PK6C 4AHXA 2QCSB 1A3KA 2OPKA 1J3PA 3DCQA 1QU0A 5T55A 4TTGA 1J83A 4NPMA 5FZCA 1JHJA 1FNZA 1OA2A 1XYOA 4YWAA 1FPN3 3FC0A 3VB9A 3F2ZA 2JD4A 2VMGA 3ST7A 2W47A 2YUEA 3BN6A 1JYVA 4DMIA 5KHGA 3O1UA 2A6YA 4JKMA 4Q0UA 5ABJC 5D8AB 1PO22 3SITA 4HBNA 3SXWA 1WGPA 3IKWA 4XUPA 3K3NA 2YROA 1O3QA 3LA7A 4GKYA 4BHPA 4QDRA 2E6VA 3PVOA 4K1ZA 4RA0A 3VKLA 2ZAHA 1UOBA 4AFBA 3AXEA 2HWB3 1AR93 3O0VA 3UGHA 4AVAA 1LULA 1GFF2 1E5RA 1LOGA 2ZEZA 3OOXA 3R4SA 4FFFA 2RS33 4UBGA 4CDWC 4P08A 1GNZA 3EO6A 1FOD2 3OCPA 3VD3A 3IAQA 4JDMA 4AR2A 4P02B 1T2XA 2HLEA 1FMD2 2VY0A 1AUYA 2XBO1 3VD4A 3IDCB 3MW3A 4XUTA 5SV8A 2Y6LA 4RR3C 2PN5A 4CUAA 4LHLA 3OF1A 1UZZA 1F15A 3VKFC 1TEIA 4I0BA 3WW4A 2UWCA 3TYJA 1GR3A 2WT1A 3GZAA 4Q4Y1 4R4XA 3W5MA 1JU3A 4IEXA 1LGNA 4QX3A 3ZVXA 4P9XA 1JN2P 5LBEA 1CJDA 4B3NA 1V6LA 1U5YA 1PVC3 2EICA 2JE9A 5GLZA 2BUKA 5L9VA 1LB2A 1HQLA 3WHUA 2NZ9A 2FDJA 2B5HA 3WDTA 3ZN6B 2VTXA 5J36A 3ZMOA 5A3LA 4UFJA 1AL21 5CNAA 2R042 2YZ4A 2QDRA 1OFSA 1LOEA 1YYNA 5FFOC 4Q8LA 4AI2A 4PI2A 4LEJA 3IPVB 5BNNA 4DQAA 1WA6X 4EV0A 2XBO3 3BCWA 3CJIB 3VBOA 4DNYA 4IEYA 3KQ4B 3ZM8A 3ZR5A 2RE9A 4E8CA 1ND2A 3CEWA 3JBG1 2UWBA 4CDQC 1XXNA 1COV1 2AEYA 2VMFA 3FL7A 2V73A 4MV2A 1ENSA 2ZMNA 4RR3A 3K48A 2EAAA 3NVCA 2CGPA 5EPAA 3K75B 3OTFA 4JGYA 1DYKA 4P9LA 4ISRA 1O8PA 5J48A 2GNDA 2BFUL 1G9FA 4K1YA 4KGQA 2O0OA 4OZOA 2JICA 1YC61 2MPFA 5FUNA 5HXVA 5F8PA 3LFMA 4HETA 2DYCA 1VBB3 4Q4X1 2HWE2 1H8VA 3HOBA 4FPCA 5FBJA 2DCYA 2DCKA 5EQUA 5F9TA 2UWAA 2X5IB 2ZZQA 3AKSA 3M3IA 1Z7S3 3WDUA 4RGAA 2JDZA 4DUWA 4QAWA 1FNYA 5FMOL 3J9SA 4B4RA 1Q43A 2WFF3 3VBSA 5LY2A 4MGQA 4HKWA 3SQOA 4MHRA 5T5JA 4LR4A 4FAHA 2VTXJ 4KBBA 1NA1C 2BGCA 5LA0A 4CCCA 1DP0A 2VCBA 3AZYA 2B46X 1KS4A 3DF0A 4YG6A 1Q8VA 2QQVA 1CAWB 3LEGA 4OLLA 2E53A 4BIFA 4BK5A 1WZXA 1MZEA 2X05A 3PDQA 4HVQA 1W28A 1YI9A 2JG8B 4CTEA 1WW6A 1SLTA 3Q8FA 1BK0A 3B9IA 2G9FA 3AZXA 2ARCA 4O61A 1W8NA 3G6JB 1ULEA 1WCKA 3C2UA 2EXIA 3H3UA 3E6CC 4AF9A 4FCAA 2RMU2 5FO8B 2D6NA 5FMDA 5HBAA 2X10A 5FK8A 1WCQA 1PK6A 3NL1A 5JIUA 5BY5A 3DL3A 5I8YA 4OHXA 4LXLA 4DUXA 3ILRA 4X8NA 2XPJA 1VAVA 5K0UC 2QBXA 1RVF3 5BNPA 3OEAA 2VOKA 2PHXA 4XZUG 5EIYB 1NG0A 3L9JT 4LUKA 5FO7B 2XJQA 4BE3A 1NYWA 4XFIA 4XFGA 5FOJB 2Y8KA 2VOVA 3WEZA 4QQPA 3ZXEA 1QHDA 4CP1A 4D7SA 5FYYA 4HSLA 5IVYA 4K40A 4YGBA 1G86A 1XOYA 3I3BA 4CYDA 2JB8A 1O4TA 1W03A 4XXAA 1KFXL 2XQXA 1F2NA 5KHHA 5A7OA 1H9PA 4HSJA 4CCEA 4IV1C 3VUOA 2JDKA 4KQ7A 4OQ9A 3SEPA 5C8CA 4PDWB 5F6KA 3VBRB 2C0ZA 2VW1A 2WWUA 4E2SA 3OUIA 2WS92 1EV11 4UF0B 5FY1A 3PMSA 3R4DB 2GP3A 1JOBA 5A1AA 1W9WA 3ABZA 3EMRA 2VMEA 4CZSA 1RITA 4XMAA 1POV3 3M70A 5FLJA 4QB2A 4W65A 1XE7A 3FE5A 3O1VA 1QH6A 1KITA 3TN92 4LBLA 4IERA 3O12A 1ZZBA 3KT4A 3LA2A 4MXWA 2YPDA 2VE1A 2E51A 1FI2A 1GQHA 3VZOA 3NV3A 4KH9A 2CV6A 5F37A 4DZGA 4G9SB 5CADA 4N7IA 5LEKA 2ZGPA 5CYYA 1FATA 1DFQA 2GC0A 3CJIA 5EJ1B 1AX0A 1UD1A 2GN7A 3KWVA 4AVVA 2PHWA 2A6ZA 2XG3A 1WMFA 1O91A 3BPZA 4M3CA 4EWDA 3AFKA 3M1HA 4HMZA 1L3JA 4ZU4A 4RHV3 1X8MA 4PLNA 1ZYBA 3WW3A 5B4XA 5JOWA 5HCFA 2B9VA 1C8M3 1W6OB 1PIV3 2IXCA 5FP7A 2QQNA 5JR2A 3R05A 5FPBA 2A6XA 3HNMA 5AC93 2J42A 1WKYA 1RC6A 4OHVA 4UW6A 2B7YA 2KR2A 3ILFA 1UU5A 4UXAA 4IE0A 1MS5A 4NMIA 4EZ4A 1PHMA 2DCZA 1R083 2ZTNA 1G9BA 5FYCA 4BK4A 5KC6A 3O1PA 3LKJA 5JMCA 4YVSB 4JZRA 2WQZC 2PQQA 3RZHA 1Q8SA 1XB9A 4D6RA 3ZYIB 1W3XA 5FR3A 1X8EA 2W1WA 3NRUA 4L9BA 2HWC3 3FBYA 4LJHA 2OA2A 5LW9A 1LNSA 5BUVA 1RXFA 2R16A 3WR0A 3LAGA 3ZDVA 5C8CC 2YV8A 2BWCA 1IPKA 2OUJA 2RS53 3BIEA 2WL1A 2GNTA 2P3JA 2ZHNA 4YARA 5C70A 1UU6A 3VBSB 3S0MA 4Z92B 2BBVA 1PGW1 5FZGA 3CQOA 4AWDA 4CCNA 2GN3A 2BNMA 3I3MA 2R043 2W1QA 2C26A 4N9IA 2BW8A 4NHKA 4XC9A 3CL1A 5GZGA 4Y5TA 2JJ6A 3C7HA 2QQUA 4H7MA 5M0TA 4OQ8A 1VB2A 2W08A 2GAUA 4ITCA 1W2AX 4FOQA 1RUJ2 4P9IA 5FPXA 1RUF2 3N9OA 3AYAA 1CAUB 1RUJ3 4ET7A 5FZ0A 4BA6A 1UXXX 3NMBA 1JHNA 2ARXA 1GWKA 2ZZJA 3PUAA 1MR5A 1EY2A 2Y38A 5DG1A 5H9PA 1SZBA 3PJQA 1FAYA 1I5PA 1QY4A 4B7KA 5F3EA 1L7RA 4PJYA 5DUUA 1LOFC 3MDPA 3RJRA 5DUXA 1DG6A 4CXXA 2VUCA 4XUOA 3VZMA 4IV3A 4E27A 5IFPA 1W2NA 2Q8EA 1ND2B 2FMDA 2LS6A 3LDBA 5HCHA 1J1TA 4GMP3 3HIFA 3N9PA 3POSA 5CFDB 5FLIA 2WFF1 1TMF3 2BVBA 4BQYA 3VGIA 1XPWA 4Z07A 1O59A 5JZGC 3E5XA 1C3HA 1MVEA 5FPLA 2QQIA 1RUE3 4HFSA 2ZJCA 4FFIA 5FYSA 2RJLA 4CDQB 3MLKA 1KDMA 4JQRA 3V0AB 2KA3A 3ZLIA 2DURA 4M4RA 3BU0A 4Y3OA 3K4ZA 1R1ZA 1ACCA 2AEZA 3JB8A 5FCCA 1VBA1 4CDXA 2ZX1A 2DCJA 1LGBA 2PAKA 2ZS6B 4YG3A 3WVJA 4U36A 1GZWA 1RVF2 3I2DA 3MIEA 2VECA 1UOFA 5CB7A 1UYYA 2R063 3PVNA 3QLQA 1JYXA 1H30A 5BNOA 4NRQA 4GB31 4F83A 1US2A 2EAKA 4LNVA 4AFDA 5A32A 3AP7A 1RUI3 1YUDA 2QTWB 3H8UA 1FXZA 5EFUA 3RYKA 4QKDA 3WY6A 4DXSA 5AFEA 1XSQA 3VV1A 3BTZA 3MIBA 4ZHNA 5FYBA 2H6BA 1TNFA 2R32A 3GXUA 4B4QA 5IAXA 5FZLA 3LOIA 4RD7A 3RMYA 3RPQA 2NM1A 1M4WA 1BYHA 2K46A 5LA9A 3CZJA 3ZFGA 2J7MA 2VC9A 2YYOA 2DTWA 3BYWA 2CAVA 2EXHA 1ZZ9A 1IG3A 4P5YA 1IKPA 1OBNA 2QQOA 2R30A 3JB4C 4QXCA 3TN93 2BVVA 4XFHA 4FTEA 1D2SA 2RM22 1LGCA 4W50A 3LPGA 2JWPA 1NE4A 1UX7A 2UU8A 4Q4W2 4K20A 4Q5OA 3VBFA 2A6WA 4I09A 5FZKA 3WDXA 1NZCA 3ACIA 4QXHA 4Q4Y3 5C3SA 2WRAA 1MEC2 4UFHA 1O4ZA 2X09A 1QJZA 2JKXA 2E32A 3ACHA 3HR9A 1WCUA 2WDBA 3H3ZA 1W8TA 4O9GA 4GH4C 3X29B 4O9EA 1PMIA 4GJZA 4OCTA 3KHBA 2JKBA 3J26N 2RHPA 1J1LA 4QX8A 3SH5A 2BJSA 1GLHA 5E6HA 1N3PA 5H9QA 1UYPA 4CA9A 1XQNA 4OZXA 2GU9A 1JYIA 2BGPA 3M4FA 5C8CB 2RDNA 2OYZA 2QNKA 5FPAA 2MEV3 3N4MA 5J1XA 4CP9A 3FBMA 3L2YA 3H7JA 2VVEA 4ES9A 4JRLA 1CAVA 5A3PA 1OD3A 3UYJA 1O5LA 1VIWB 2GALA 3AKQA 3KGLA 2WZR1 3UKTA 4EN8B 4JDOA 2XLGA 2JXAA 1Z7S1 3AP6A 4N43C 4QX2A 2FDHA 1LRHA 2ADDA 4NIAA 1I6XA 1IOAA 2EIGA 5C5UA 1V9U2 5FPVA 2AC1A 2YHJA 5GLTA 4BJ0A 4DIQA 4IEOA 3IN9A 3T0BA 4WBBA 2DUPA 1QEXA 1UWWA 2P17A 1C5HA 3ETQA 4XJWA 4ATFA 5J96B 3VBOC 2JDNA 4QU2A 3OUHA 2ARAA 2OPWA 3ZYHA 3J8F2 3N36A 3VBHA 3WNKA 1A34A 1G6NA 4KNCA 3T4HB 4GWJA 1ASJ1 3W9AA 4UW4A 4Q26A 2F6BA 3FX3A 1UY3A 1LKNA 4NROA 3DYOA 3GDBA 4LBJA 2YFZA 1HW5A 3DPRA 5CEHA 1WLTA 4M3CB 4WM8C 2WO3A 5FZOB 4OFGA 3JD72 1A6CA 2P3YA 3AC0A 1SLBA 3WNOA 1HXS3 1K3IA 3RG0A 1W6OA 2WN2A 2XVLA 3KT7A 4LKEA 2XBO2 3VD5A 1TVGA 1ULPA 4YM2A 2JECA 2DVDA 3ORJA 5A7WB 4A42A 3AKPA 1AVBA 2D97A 1AR92 1QWRA 3VBUC 1OLMA 1RMU3 2VTFA 2YGLA 4IEVA 4DS0A 1IG0A 5JWPA 2PA7A 3HPNA 4N43B 4Y4RA 3THPA 5GALA 5J3UA 3RFRA 4AI0A 4BZ4A 1TNRA 3RZKA 4ASKA 3I3QA 4BQ5A 4CUBA 3BUCA 4XTPA 3AYDA 5GZDA 2O8OA 1WA4A 1ND3A 2BRTA 3HJRA 4XYXA 4XCBA 1OPOA 2D3RA 1GNHA 1JI6A 4IESA 2XKPA 1WW5A 2D6LX 3PL0A 5FZ7A 2BBAA 2V72A 4FOWA 4CU8A 2FZ2A 4TLGA 3RZGA 3WDVA 1H9WA 2OX0A 1SEFA 5HI0A 4YM3A 1H6YA 1H2MA 1VALA 2E7QA 5KBFA 1O3TA 1GP4A 1BKZA 2AREA 1HLCA 3IDAA 1H6XA 5CA6A 3AP9A 3AXDA 4Q1RA 2WQ8A 4OUMA 1CGPA 2FCVA 4TLFA 4K7JA 3K2OA 3ZFEA 5A3WA 1PO21 2B39A 1BJQA 3CKHA 4AAXA 1QXPA 3GBFA 1N1VA 3ROUA 1RUH3 4E4SA 1B35C 1R64A 4LBMA 4JTNA 3VBUB 4DY3A 4B4PA 2XKOA 4XF1A 4J1WA 3VL8A 5T54A 2J1AA 1KS5A 1D4VB 1LCLA 2QQWA 4UAPA 5FWEA 5FXWA 2WZPP 4BOWA 2TEPA 2VZUA 4FXKB 5HPOA 1RTVA 4COUA 2VW0A 4GA9A 4XDPA 1JBCA 1VB4A 2YU2A 2VCAA 3KS7A 5GLUA 4GMP0 4XJ8A 4LOTA 1WBFA 2XL9A 3IPVA 3ME2A 1HXS1 4K9SA 4XURA 3O0WA 4D0QA 4NWWA 4DEQA 4AYUA 2DWRA 2YU1A 2X53S 3DXTA 2R0HA 4CDUA 3UJQA 4HLTA 3GBGA 2R062 2D40A 1D7PM 1ENXA 1YJLA 2I07B 1CZVA 1XNAA 1OQEA 2WFPA 3S7IA 3TEYA 2VM9A 3LSEA 2QUOA 1MACA 5JOXA 5F2WA 1DQ6A 4XQDA 1IQDC 1BQPA 5L7OB 4V2WA 1J59A 5CG8A 2RM23 3H8OA 5J7MA 4Q4V3 3RJ2X 4PQQA 3CZUA 3ZSLA 1DGRA 1K5JA 4GIQA 1OD5A 4OI2A 4AQTA 3WDYA 4DXRA 5FMOS 3FHAA 2ZABA 5FMBA 1UY0A 1J3RA 5ACA2 1C8M2 3C7EA 1CIYA 1UPIA 2W1UA 1VBC2 3JU9A 5JDBA 1CZTA 2UY8A 2PLV1 3POWA 4YW6A 3V65A 4HKOA 1QJX2 4QQ2A 1RUG1 1GICA 2VULA 1HRV3 4JX0A 4QPGA 4A4AA 5FRAA 5FY8A 1NLSA 2P1BA 4CP9B 4WM8B 1SLCA 5FDBA 5FY5A 2W0XA 3Q8CA 1ASJ3 1Y3TA 4BLIA 1YLLA 1DIWA 2ZGNA 3BOPA 1APNA 3VBHC 4KWUA 1RL3A 1AYN1 2HEYF 1R081 3E6DA 1RUG3 3ZFGC 5K7PA 1S0CA 3CBNA 3KVBA 4YW2A 2Y0IA 1WCSA 3RQ0A 1YQ6A 1K5MB 2LUWA 3NJXA 1DQ5A 1UOGA 4N53A 1EUTA 1IKQA 2AGSA 2VXRA 1ULGA 2A70A 1QQP3 2VZQA 1QNWA 1RUH1 1VJ2A 2BWAA 2DDUA 3AVSA 3H3LA 1DLCA 4ZONA 5A7QA 3ZXFA 4QT6A 2WZR3 1RINA 3R0RA 3URFA 1X7NA 3ZPYA 2PQSA 4XIKA 5A7WA 4AFMA 4CEYB 4BMEA 2R1BA 4K6BA 3LCPA 1MQTC 2DF7A 3GCXA 2GMEA 1HXS2 2D6MA 1N3QA 2XOMA 3GGLA 3M3CA 5FZ8A 5JXGA 2ORZA 4QX0A 4FI9A 4FQ4A 2DU1A 1NY71 2HJIA 3FMGA 3O1SA 1RB8G 4UW3A 4YW1A 1MS3A 3THTA 3WLUA 1IPJA 3I2JA 3RI8A 3QOPA 1NUKA 3H9AA 4EWEA 4DRVA 4LPLA 4JGZA 1Z78A 2P6HA 2ZEYA 3AZVA 5DDJ3 1D4M1 1YO8A 2W87A 3GZEA 3FUQA 4QPIC 5SV5A 4RFRB 1POV1 4N43A 1AR71 4NWVA 4A44A 2BTVC 5FP3A 3POIA 3HMYA 1E5HA 4LBQA 4AHZA 4AQSA 4FTSA 1SFNA 4XF9A 4L99A 2KD7A 4YZ3A 4IEZA 3ES4A 2XWJB 4JV4A 3SISA 1GZCA 3TNQA 3U78A 3I8TA 4XUNA 1NT0A 4QXKA 2TUNA 1RJ7A 3INAA 4YW5A 3WNLA 1RUF3 1OMIA 2AACA 5FXXA 4BM8A 3AZZA 2A6VA 1OSGA 3TAYA 5F39A 4YZ5A 3WV6A 1NLRA 1OF3A 1W8OA 5BV6A 1TZOA 3LIGA 3GYDA 2E9QA 1SPPA 3LA3A 1AXYA 2Y60A 3E5UA 1NCQA 4A6SA 3R4UA 5HV4A 1JZ2A 1IGOA 5GZCA 1MZ5A 1HV0A 5D8AC 2IUWA 4XF0A 4YW4A 1ULOA 4XPVA 2JG9A 5CVRA 5A33B 5LRSA 3MFAA 4IDZA 3VBFC 1LESA 5LB6A 3VL9A 3V0BB 1LTEA 3MF9A 2A5ZA 1QJY1 4UFMA 3Q8EA 2ATFA 4CP0A 3RZJA 4QGMA 4RQPB 1Q8PA 1IPSA 4Q4V2 1OKQA 1QOOA 4L97A 1UF2C 3S5QA 2XJRA 2EALA 4ZS3A 2B45X 1OPMA 1RUF1 5FTTC 5BNNB 3AMQA 1G8WA 2RDSA 3POYA 3RSJA 2OZJA 3WNNA 1E57A 4I3PA 1RUH2 4LUMA 2FD8A 3PVEA 3W59A 4AAPA 2VPVA 3ZFFC 1AHSA 4F3JA 4AEDA 1YXWA 5FP9A 4OI4A 1ULCA 2K9ZA 5IWFA 1GOGA 5IVJA 2ID4A 1ZZCA 2G9GA 5T5OA 5BNPB 1PNFA 1Q56A 3N9QA 2XVGA 2PXJA 1W9SA 1EAH1 5DAVA 3AP4A 1H1MA 1U5ZA 3D6EA 1G9DA 1V6JA 1D4M3 2DFCA 1RXGA 1VRH2 2B9UA 3PMEA 1F5FA 1D4M2 2BNOA 3ZDSA 1VMFA 4LMFA 5L7OA 4WM7B 2WFF2 4JGYC 4Y1UA 2A73B 3D3AA 3WF4A 4ISQA 1Q8OA 4CCKA 3O0XA 4B7EA 1OOPC 4QGLA 2LM3A 2CSGA 2VGDA 4LT5A 2C9KA 4KBZA 3ATGA 3WG2A 4DXTA 4XTMA 1ZBE1 2HEWF 2HYXA 4W6XA 3AYCA 5GZFA 4TN7A 1BBT3 1GMMA 1AX1A 2QKDA 2E63A 3NNFA 3PUIA 4MX3A 5KXEA 2J22A 1URXA 4YNIA 4ASLA 4FXGB 3MEPA 3RS6A 4E8DA 1KEXA 4QMAA 4BDVB 4CU9A 2JG9C 1OI6A 1XBFA 3QH6A 4XQWA 1K45A 5C7GA 2VOTA 2WAAA 4HVRA 3C7OA 2ETEA 3VN4A 2NMOA 3H7YA 3HD8B 3ASIA 4UT5A 4W6WA 4A2UA 3P3PA 4IV3C 5FZ6A 4CEYA 4CSWA 4MGYE 1DBNA 5FZAA 5L73A 5E89A 2YBPA 1W39A 3P5BA 2HWE3 2P3IA 1PGSA 2PTMA 2ZPXA 4JRAA 4R9DA 1PM7A 2YBSA 3UETA 4CCJA 4YPJA 5C3QA 3MI8A 5BPXA 5JVVA 3ZKYA 1CZSA 1ODNA 5I0SA 3KD4A 3WNMA 3OUJA 4BXFA 1UZVA 2JDAA 2R0FA 4XJ9A 5KHJA 3KB5A 1GNYA 2HBTA 5LY1A 2ARBA 5LBCA 4WV8A 1QJU2 4YGEA 5DZGA 1DDLA 4XFBA 4LO8A 1KJRA 2D6PA 2ZHMA 2Y6FA 3IIIA 3MUZ1 1W99A 1YWKA 4GJYA 2RR11 2Z79A 4I30A 2A3XA 2FCUA 1LJ7A 1SCRA 2UYBA 2P2KA 1JXNA 1GZ9A 5JCTA 1JS9A 3M3QA 3QACA 4XFCA 4Y1YA 5F7UA 4WVWA 3I7DA 2C24A 3SMHA 3THDA 4AK3A 1BBT1 2XMLA 3B93A 2BU9A 3POGA 3S30A 1FMD3 1RGSA 5A1LA 4ZZ8A 4UBHA 1TME3 2DV9A 3E5QA 4XCAA 2WLQA 1BHGA 3SKVA 4Q0VA 4Z2WA 1UAIA 1BMV1 4EJRA 2FZ1A 3M8LA 1HN0A 3N9MA 3M7AA 5FYHA 1FV3A 2WN3A 2W94A 3AYEA 5A3TA 3MGUA 4FO9A 2PAEA 1UKRA 1UU4A 2GNBA 3J7MA 1Q8QA 3PJYA 4FPHA 4JC1A 4LBQB 3JBG3 3K46A 1UZ0A 3PU8A 4V2VA 1I5ZA 1UN1A 1SPPB 1JOPA 4NHYA 4YW7A 5A3NA 3EBRA 3HN1A 2I45A 5BXXA 4PHZA 5G05L 4NPRA 1RUI1 1SCSA 1S1AA 1RYYA 3H42B 1LU1A 1HB3A 3Q8BA 4IEWA 3NJVA 4CEWA 1DQ2A 2IXLA 5A6XA 1XJAA 2ZGTA 4JTOA 1H2LA 2WUHA 3VHPA 1I1EA 5C5TA 2HWC1 1GKBA 1FYUA 4D8MA 2FDFA 4N53C 3SEEA 2VR4A 4XJAA 3A22A 1ONAA 1QQP2 1RUOA 1OHFA 1ZVFA 2BV4A 4HVOA 2Y33A 4E4HA 1J3QA 4DB5A 5A6QA 4MG2A 1MQTB 5C3OA 2WO7A 2PHTA 5D1IA 1HIXA 5IVFA 2WO2A 2VAUA 2ZX3A 3FUOA 3KCYA 4HANA 1LECA 1QXRA 1D0HA 3MV01 1S0DA 3VBRC 3LEKA 5GZEA 4A7KA 4LULA 2QVSB 2RM21 3AP5A 1TME1 2Q8CA 1FMD1 5DAWA 4CDUC 1Y9QA 2ZAAA 5BYNA 3PUHA 1ZRRA 3VDDC 5JXJA 3OBTA 3WG3A 3ES1A 4MADA 3T2QA 2CDOA 1XNCA 3PTYA 4YFWA 4COZA 3I54A 2CYFA 3HT1A 3K77A 3HWJA 5L9RA 1W2OA 4LOSA 4QM8A 2RVAA 5DG2A 5DDJ2 1QJEA 4IE5A 3MLLA 5IAVA 4BQ1A 1W6PB 1ZM1A 5A3UA 4S2DA 4GZ9A 2JDUA 4I0WB 2RJ2A 2I74A 3MIFA 1QMJA 2WZ8A 2XHKA 1DYPA 3KF5A 1QJU1 4AQ6A 5IT6A 1G7YA 2VL4A 2RG4A 4I01A 3AJZA 1IS5A 5LK7B 3BPSA 1ZBA3 4FFHA 2RR12 2WAOA 2VG9A 2W68A 3CNAA 4LLOA 2XL7A 1OFNA 5FJKA 5FYIA 4E2QA 2DUQA 5L9BA 5DZEA 5LCWL 4IE7A 3BKZA 1WMEA 2RS11 3KVAA 1YRZA 2E33A 4JKKA 1HRV1 3B00A 3LSDA 4PI0A 3P1IA 1YFUA 5JAXA 4YFZA 5B2GB 1CIWA 1W8HA 2E7TA 1F35A 1HRI1 1DQ4A 5EWSA 4FBFA 3D8CA 4RQPA 4UFLA 3W20A 5FBZA 1AR62 3S57A 2EXKA 1EPZA 1EUUA 3ZIXA 2YBKA 1Y9MA 2ZCWA 4XJZA 3T2TA 3ZYPA 2IXHA 4L8QA 4BPZA 1CX4A 1ND3C 3VBFB 1EP0A 1V70A 4FAGA 1CAXB 2RJKA 2P4EA 4P14A 3WXPA 5HCAA 1ASJ2 3MW2A 1B35A 4AEDC 4EN7B 1CX1A 3MICA 3N7KA 1H1AA 1ZBE3 2HEVF 2P37A 1MZFA 3POBA 3OD0A 1O7FA 1PX3A 5FQ0B 1MPXA 1Q3EA 1XNDA 4CDQA 3AFGA 5DZFA 1ZREA 3WP6A 5A80A 3WT3A 4GB32 4CRQA 1S0IA 2CL2A 4D7YA 2Y6HA 3GM8A 4PIZA 1ZRCA 4QPGC 4FPFA 1TME2 5CFCB 3DEMA 1SDWA 2E7AA 4NRPA 2A3WA 3VD9A 3ZPOA 5FOBB 1IZ3A 4TWTA 1JMUB 2VZTA 4XABA 5I0TA 3VD7A 4WVZA 2KM2A 3H1YA 4MUVA 4XAAA 4A3ZA 1VBD2 4W8JA 3A7QA 5DDJ1 1ZZ8A 1MZ6A 1VBB2 1JOJA 3KMHA 3TEXA 4AVTA 1AZDA 3K51A 1QJU3 4QPIB 2X5IC 1VP6A 5K8SA 5ANQA 1WLCA 3WF0A 3HBZA 4YGDA 1H2NA 4XJUA 1KDKA 5FIXA 1DZQA 1MS4A 1ND2C 4EN9B 4HT1T 4RS5B 4Y24A 4J6GA 4MGTA 4HPKA 2YC0A 4ASMB 3HEIA 3I2GA 2AENA 1RUE2 3OYWA 4X6QB 1ZRIA 2QQJA 1CQ9A 1YHFA 3BALA 2X29A 4TXWA 5JZGB 2ZBJA 1XE0A 5FKCA 2F17A 3W5NA 4KGGA 3QBQA 3BB6A 4CCOA 1PZ7A 3B94A 4BMBA 3USUB 2ZGSA 4IEUA 4IV3B 3SNMA 2Y6GA 4QM9A 4Y1XA 1UMIA 3KCXA 4CCLA 1AR61 4JGZC 1HX6A 1PMHX 2ZKLA 2RS12 1NZIA 2C1FA 4XFFA 1Q5OA 1HRV2 1AYM2 4FPYA 5T3NA 5FY0A 3KV4A 4QXBA 3ZYJB 4PIYA 3HT2A 3LOBA 1VMJA 2WA4A 4AZZA 1BVP1 1EV12 2VZRA 4FTBA 4IGOA 1T6GC 2Z2SB 1J58A 3MV11 2A75A 2VNVA 2JENA 3W58A 2VD7A 1CESA 3ACLA 4ZXKA 5K0UB 4M4PA 2NN8A 1HN1A 5FZIA 1YEWA 2D93A 5LA2A 3J7LA 1C57A 1S0JA 2AZ5A 2IZWA 3D0JA 3PUQA 4L0PA 4MHUA 5JMOA 4RQPC 4Y20A 1MQTA 3T3YA 3KV6A 2W9XA 2XGXA 3GCWA 4M01A 5JUVA 4CDWA 4QX7A 5E88A 4JVAA 4XETA 2RS52 4EWAA 2R1DA 3AZWA 4GWMA 3MPPG 1UIJA 3D0SA 4RL7A 5BNOB 2GMPA 4JAAA 1NQDA 3LIHA 5CIRA 5CKMA 3P3NA 2BOJA 3Q9OA 4LITA 1L7LA 3MLJA 3MFCA 1GSLA 4RFT0 4INDA 5EXOA 1AF9A 2ZGUA 1PVC1 4E9KA 3OSDA 4CXWA 1V6IA 4MGSA 3UKVA 3N7LA 1DQ1A 4TSVA 1CN1A 1HJFA 2XJUA 1QDCA 1R093 2DTYA 3J4UH 1AR63 4MYEA 1GU3A 1ZA4A 1W8UA 1OQ1A 2PHDA 2W92A 4P5HA 3WUDA 4CEWB 1FX5A 1PO23 3ZMNA 1VBE3 3OD4A 4URTA 4GULA 4LKDA 5DAQA 2IVIB 3VBUA 2R49A 1R092 2AYHA 4XE9A 1H8TA 1C1LA 2GC2A 1QDOA 1PIV2 3ZSEA 1DCSA 4N9HA 1CJPA 4XACA 4A6OA 2CWMA 4AI9A 1CAXA 1SBEA 2QFEA 2VBPA 2W91A 2YPJA 3AKTA 4AFCA 4QPWA 4AW7A 1X9PA 1W2UA 1B09A 2Y26A 4QKFA 3AJYA 3WG1A 2RR13 1AL22 3AMPA 1HJGA 1QKQA 4TYSA 4WVVA 4C0BA 1H1IA 2VZVA 3EHKA 4XHBA 3GF6A 3DKQA 1RUE1 2VNOA 3N9NA 5HXMA 4TZDA 1AYN2 4A3XA 3M3OA 2JG8C 2RV9A 2VNGA 1QF3A 4KU8A 5A7PA 2VW2A 3MIHA 2R073 2PLV3 3L2HA 5F32A 4ZS2A 1OLME 2K2SA 3I97A 2G4IA 3WUCA 2WNOA 2YGMA 5A6YA 1DZTA 4RR3B 1G9AA 4OHYA 3BVCA 4CCMA 2JIJA 5C71A 2HWE1 4M3CF 1Z7S2 2WO1A 1MS0A 2BZDA 2Y64A 2Q30A 4XBLA 1QNYA 3VBOB 3F95A 1NXMA 5DUVA 4CEWC 5IFTA 1AR73 2GC1A 5TSWA 2R6QA 4CDXC 5EV7A 2DVFA 2D3SA 1AR83 2P34A 3GZUC 3OBRA 4PDWA 2JD9A 1TG7A 2VMDA 3NV4A 2GMMA 4LK6A 4Q4V1 4KWJA 4Y33A 3ITQA 1M06G 2CGNA 2YXSA 1DZRA 4Q4X2 4WM8A 4YGCA 3DPRC 4GWIA 4QU1A 5FZ9A 3ZSMA 2VVDA 1KXGA 3C3VA 3DYMA 4Q29A 4YZ2A 1COV3 4PF1A 5C8WA 4HPKB 1CAWA 1S2KA 2VQTA 1IS6A 2XDVA 1LOAA 1AXKA 5FYMA 4ATEA 5A1FA 2EA7A 5CAZA 1UZYA 1C1FA 1EAH3 3ZN6A 1LOBA 4YRDA 1XYPA 4XOGA 1VBC3 2FDKA 3AMNA 3EB7A 3VDCA 5EJZB 2R061 2D5HA 1GWMA 5FYVA 1N1YA 2Q4SA 2XWBB 4GB33 1SFYA 3WP4A 5IUQA 1W6NB 3WNPA 3LF7A 3OPTA 4JKLA 5IHRA 3ACGA 4QHBA 3TWIA 4QDQA 5BNQA 2AUYA 3BIWE 2C5DA 1ZBE2 2VO5A 1F31A 2BGOA 5JSOA 1AYM3 2A71A 1KD7A 3R6SA 3I2FA 1WLDA 4C0HA 1KGYA 3N3HA 5IJRA 5IK5A 4V1PA 1OA4A 4DEVA 4O65A 1OLRA 4LKFA 4XXPA 5CFDC 4NIDA 3I59B 3HQRA 1X33A 3HNBM 3A0NA 4NAOA 3OY8A 5FK7A 3KV5A 2H0VA 1HB2A 4AFAA 1UYXA 2V5YA 4DRRA 2DBNA 5EP9A 2LROA 4QPGB 1QJX1 2F4LA 2VJXA 2XLFA 4XVHA 5CKNA 2CAUA 4KU7A 3T0AA 2VUDA 5C4WC 3LZZA 1V6MA 3I4IA 2ILMA 2W5FA 1OA3A 1WUVA 4RYDA 2HWD3 5FLHA 4LHNA 3SCFA 3WQ1A 4DPNA 3NNLA 3LD8A 4QX1A 3UT0A 1REDA 3A23A 4MGIE 1DQ0A 4UYBA 3SCGA 3WCRA 5CISA 5JI9A 4B29A 1JODA 2WR9A 5FZFA 1GYKA 2UURA 1WW4A 2OZ6A 3ON7A 4XAEA 3S6PA 1VBD3 3ZFEB 4YVSC 4QPYA 4ZU5A 1SG3A 2XJSA 3POEA 3OYWB 4FOVA 2VQ0A 4IGQA 4AGVA 3ILNA 2B42B 2BDRA 4I02A 4NUBA 4GXLA 2VCMA 4FPJA 5AC92 1OURA 4K3UA 1H8TB 3ZXDA 1C28A 4AQ2A 2WABA 2J1SA 4L92A 3J7HA 1LOCA 5KXCA 5G04L 3VDBA 2FDGA 1SQ4A 5DAPA 2C9AA 1HDKA 4C8DA 5J09A 4J1XA 4LO6B 3CJIC 4XBNA 1PK6B 2WNUC 5FYUA 4RS5A 2NPIA 4PBOA 2ZGRA 4HZFA 2BOIA 2IXJA 3HAGA 3ZFFA 4XF4A 1DGRN 1PZ9A 3ZXKA 3J8F3 4IV1B 4AHYA 1ZX5A 3ZXLA 4BYYA 5C3PA 1TMF1 4JGZB 2BYVE 2HWD2 4B8EA 4FPGA 3PLQA 3OPWA 5FXVA 2YFUA 3OB8A 1IQAA 4IETA 1W04A 5FMCA 1CWPA 1US3A 2WIIB 3AK0A 2IFWA 5K0UA 5IW0A 1V9U1 4YVSA 3OGGA 3PURA 3MIDA 3V64A 2NP0A 3J7NA 3CHXA 4ZY9A 3ZSKA 3NJZA 4Q0SA 1XU1A 2PLV2 2V09A 5FZ3A 4MVTA 2ZHKA 2MEV1 5FZ1A 2HBUA 4AEDB 2CGOA 1YNAA 3BU7A 2G19A 4PBPA 2W46A 5FYTA 3OG2A 1AYN3 1L7QA 4WZFA 1LU2A 3IIAA 2WWSA 2ZX2A 3JD73 4KG0A 4NIIA 3AX4A 1NA1B 3P6BA 4ZU7A 1COV2 4NN0A 4Y1ZA 5F5IA 3VLBB 1DLLA 3VKOA 2MNGA 4WVMA 1C8NA 4Y22A 5ERLA 2IXIA 4CDWB 3U07A 3I2KA 2CWSA 4PT6A 1XNBA 5EZWA 1VBA3 3VZLA 3O1MA 2SBAA 2WZEA 3PIGA 2CY6A 2WYFA 4FPLA 4LORA 3UL2A 3VBRA 5LASA 3RZMA 5FZEA 5CBLA 1VBE2 1V9U3 3FLTA 4D6QA 2GH2A 2WT0A 1S4CA 1RMU2 3LDRA 4OULA 2A3YA 4XW3A 4QGNA 1GP5A 4QHZA 2Q8OA 2QQLA 3JXSA 3VHRA 4CU6A 4IL7A 3RYPA 2FHRA 4Z1VA 3RWKX 3WW1A 3ZYBA 1NE6A 3O14A 1POQA 4W4ZA 1KQRA 4LK7A 3DUIA 1GQPA 1BXHA 1JYTA 2ORXA 1AJOA 5KHIA 4LHSA 3QCWA 2PFWA 1WMXA 2ZGMA 2JEMA 4S2HA 4QB1A 3KM5A 5DN2A 1DGWA 3KZ4C 3CIHA 5IK8A 4GAZA 2WT2A 1CPMA 1JYCA 2O14A 3HBKA 5C6CA 3KV9A 1F9KA 4XF3A 4I3GA 5AC91 2MHFA 2ZKNA 5ABJA 1VPHA 1W9TA 1OF4A 1OVSA 4OI0A 1W8FA 2OKXA 3VBSC 3OJBA 5IK4A 1RUI2 3QD6A 4BIOA 1AR81 3WG4A 3CJXA 4RHV1 3GZTB 3N7MA 5A7NA 5C4WB 5ISLA 3I59A 1RVF1 1VE0A 1D2QA 1NCRB 2QZ3A 1GQGA 2VU9A 3CF6E 3NNJA 4MH0E 1LR5A 4QHOA 3QH7A 1NX9A 1GZWB 1MEC3 1HRI3 2GDFA 2HWB1 2V4VA 2EF6A 3DECA 4N8MA 4NOTA 3ECQA 4RSUA 4Z82A 2XUEA 3MPBA 3U14A 2WC2A 4NO4A 4EZHA 5IYYA 2UYAA 4LQRA 3I2HA 1SACA 4Z2AA 1DHKB 1TE1B 1OT5A 1NXD1 1OKOA 2RS13 5A32B 5EYXA 4WM7A 1LEDA 3GJBA 4CE8A 2OT7A 1W0PA 1K42A 3BI3A 1S55A 3Q8AA 3OBAA 2XJPA 1QOTA 1ZBA1 4AVCA 3K4DA 2OW4A 4LBOA 3KQRA 3ZR6A 1YI7A 1F4HA 2Q1FA 4J25A 4R9AA 4YW3A 5KHKA 4IE4A 5FZBA 2VZSA 2H0BA 4DOUA 3PIJA 3OGVA 1QIQA 1V6KA 4GMP1 1QJY3 1ENQA 1PVXA 1YIFA 4UFKA 2GZWA 1LHUA 2ET1A 3GJAA 2EIBA 2RS31 3VZNA 4OYUA 4KMQA 5LZ6A 4IW3A 4CPBD 3K3OA 1VBE1 5FXZA 2E26A 4DY5A 3HQUA 5CG9A 5JSRA 3O5SA 4Q4Y2 1LHNA 4MXVA 3VKMA 4AI8A 2IWGB 4CEYC 3I49A 5A70A 4LIUA 3UJOA 2TBVA 1CAUA 3ZFFB 3RRDA 2WNEA 3VKNA 2ET7A 3TN91 1LHOA 1UMHA 4MLOA 2DVAA 4OHWA 5CZKA 4EQVA 5DABA 4JQTA 3N35A 2XXZA 5KWRA 1WMDA 4COWA 1RMU1 3TEWA 2Q8DA 1W9YA 1NLQA 4UW5A 3RGBA 3W21A 1R1A3 1XYNA 2JDMA 4LO4B 2D43A 4OUEA 5LWBA 3IB3A 4UFIA 2P6CA 4BQ3A 4JGYB 5L19A 4MOAA 1NKGA 1U0AA 4GALA 1OUXA 4OI1A 5GKAC 2WINB 2YG0A 3S5AA 3G7DA 1R1A2 4BISA 3POJA 2FBEA 3VHOA 2WZR2 3ACFA 2VOXA 2D6OX 3SC7X 2PHUA 5KR7A 1BLZA 3AL5A 5L7OC 4NR1A 3TOJA 4HG6B 5JXHA 4WVMB 3OY8B 4XEZA 2ZEXA 2O8QA 2HWB2 3JQXA 3AVRA 1S2BA 1JZ8A 3FFZA 2JE8A 3LFIA 1WLWA 4LBNA 3T30A 4META 3D5OA 4URAA 4BWOA 1WBLA 2HKXA 1OH4A 1YIPA 4PCRA 1XE8A 4XHXA 1ULFA 1C5IA 1CPNA 2D5FA 2RDQA 4LA2A 1GWLA 1HB4A 4ONUA 2DCTA 3WF3A 3LDKA 4M00A 5F5AA 3WSOA 3THCA 3ZFEC 5A3OA 3SHRA 3U37A 3WQ0A 3IDEA 1NA1A 4ARYA 5JPMB 2WKKA 2LTNA 3DKWA 4JCKA 1W6NA 3TNPB 2FDIA 3H1WA 4EN0A 1NY72 1P8JA 3EXUA 3ZXAC 3DPRB 3B3QE 3T4VA 1ZZ7A 4WZCA 4C90A 1PO11 2VZOA 1X9TA 4FOYA 3IAPA 1RHI1 3EJKA 2CNAA 3WF1A 1AR91 1ZBA2 4IV1A 4LIVA 4Q4X3 1W0OA 1K5MC 3JD71 4BH9A 1OVPA 3ZYFA 3CO2A 1XNKA 1B35B 2LW8A 3K4AA 3OPZA 2W3JA 1JUHA 1Y9GA 1MS1A 1RUJ1 1ST8A 4Q27A 1NCQC 4UI9L 2RMU1 2BFUS 3U10A 1GZTA 1HQNA 1NAEA 2W52A 3DN7A 4MO3M 3WP3A 2XJTA 1UXZA 3CU7A 4A45A 1PGL2 1ZZ6A 3CLPA 4AGGA 5FV3A 1POV0 3FN9A 3RYRA 1R091 3N9LA 5F3CA 5HV0A 1YFWA 4RN5A 1QOSA 2WLPA 1UNBA 2FQPA 3LWCA 1FPN1 5FZDA 5LEJA 1RUD3 1W06A 4N90A 4AXOA 2HWF1 2D98A 1QH7A 3ZYGA 1UPSA 1S2EA 1BK1A 3LB9A 4KI5M 3KLSA 4HONA 1AL23 1U5IA 4M3CE 3LGRA 1OH3A 5F5QA 1QXJA 4UF0A 4KG8A 4X6RB 4PF5A 3WCSA 4Q0QA 3ZIWA 1UO9A 3H50A 3IBMA 4QPIA 3JZVA 4H14A 4CCDA 5HCBA 1GUIA 1QGLA 4RGKA 4I0AA 3ZXJA 5FYZA 2XUMA 5DXDA 4D69A 1YQ2A 2Q1MA 3UV9A 4FT8A 4EE2A 4Q8KA 1UIKA 1YQ5A 5DMYA 4AI3A 1XRUA 1V00A 3C8XA 5F3IA 1ULDA 2N7GA 1QJY2 3WX5A 1CR7A 1T6BX 3C7GA 1UOJA 4JHZA 5F2SA 5ACA3 2PAMA 3E6BA 4NVPA 5FZOA 3AMHA 3O1RA 1ZRDA 2RMU3 2DUOA 1QQP1 4ZKTB 3GNEA 2O1QA 1V6OA 4BB3A 3NAPA 1OUSA 1YFXA 3FHQA 1D0GA 1UY2A 3VZKA 2R072 5FP8A 4GH4B 4AEJA 3IWZA 3U4SA 3U75A 1A8DA 4KL1A 4Y26A 3WQ7A 5EYYA 2V5DA 4ES8A 4F7ZA 3LQCA 5C9AB 5A7SA 4CDUB 2ERFA 2ZXQA 3WW2A 5JPNB 2WWJA 1A8MA 1RHI2 4UOJA 4NJ4A 2J1UA 5D21A 1VAMA 2W2IA 1LHWA 4E4DX 4EYUA 4SLIA 4NIHA 4D3WA 4XMIA 1I3HA 2W95A 5LRRA 1PNGA 1DF0A 2Z5WA 2C6SA 4HL0A 2PMWB 4Y20B 5I91A 5CKQA 5FY4A 1IS3A 5C3RA 4IEPA 1PO12 4H7LA 5DUWA 2C4XA 2JX9A 4OHZA 1GOHA 5I8SA 4R8HA 1GV9A 4M0HA 4SBVA 1C8M1 4LO7A 2XR4A 5BNNC 1NCRC 2Q1ZB 2L9LA 1SBFA 3IDBB 1LENA 3JCIA 4DINB 2VOWA 1PX4A 3U11A 3NWKA 5C33A 4GWNA 1W9FA 1UQXA 1PZ8A 3A21A 4B1MA 1HB1A 3UNPA 5I93A 1VRBA 2DVBA 3FHIB 1RUG2 1JZ4A 4BQXA 1W90A 1YQ8A 4FP3A
chains in the Genus database with same CATH topology
4C91A 1PGL1 1AX2A 2XLAA 5ACA1 2WSUA 3B5LB 2GH8A 3E97A 4LTAA 4MGZE 5AVAA 1N1SA 3EQEA 5JZGA 2Z42A 1FPN2 2WSVA 2HWF2 1FV2A 3H0OA 1C4RA 3VHNA 2LALA 2ZACA 3JQWA 1IS4A 2B8MA 3AMMA 3V0AA 1LHVA 3SLIA 1X50A 2A7AA 3JUUA 3U0ZA 3M2MA 4XBQA 1O4YA 2WNUA 2ES3A 3PNAA 4M0NA 2ZGOA 1RIRA 1NCQB 2D6KA 2ZA9A 1K5MA 4N53B 3FZ3A 2OVUA 3ENRA 2XH6A 1Y43B 5A33A 2QQPA 4C1WA 3USUA 4COVA 3OGJA 4XDQA 4R52A 1X82A 2F4PA 2D44A 1BZWA 4X8PA 1H2KA 5CFCC 2YDEA 3PVBB 1N3OA 2ZMLA 4LLFA 2BNNA 4DXZA 1JTZX 1FOD3 1FT9A 3NO8A 2R071 4PLMA 3DGTA 1BMV2 3FLPA 2WQ4A 1NOVA 2D7FA 3TBDA 4K8FA 3WZ1A 2VMHA 1REFA 2SLIA 1VBB1 3RI9A 1BVVA 2OIIA 3VDDA 1PVC2 2VH9A 1VBA2 2VNRA 4AEMA 4EROA 4YVWC 2DVGA 1EPWA 4FQZA 2GSYA 3BODA 4BLJA 4IQPA 4AE2A 1VAKA 3GALA 3GHMA 2ZGLA 4Z8BA 1WD3A 4BCUA 3B69A 4S2FA 5K9YA 3JBG2 5GM0A 1O3RA 2WA3A 2Z69A 1WCDJ 3O7OA 5C9AC 1H4HA 4QX5A 3PHMA 3BTAA 5KXBA 4KWLA 4YZ1A 2Q5TA 4WM7C 5LK5A 2QZ2A 4IEQA 3V0BA 1NQJA 3NKGA 4Y4YA 4A7YA 3ZX7A 3KT1A 3WHTA 2FMYA 1H4GA 3NKTA 4U2AA 2WS91 4YVWB 4YSFA 3ZO0B 3TRSB 2ZMKA 4GKXA 2DU0A 2HYKA 2JG9B 3ELNA 4HN0A 2Y0OA 3MF6A 4Y5Z0 3A0KA 1EAH2 2RS51 4GQ7A 3RNSA 1MS8A 1CONA 1EYBA 2H6CA 4Q4W3 3WOGA 1KFUL 4PIXA 1RUNA 1OOPA 1W6MA 1LOFA 3NW4A 2WNVC 2ZGQA 3AKRA 4FP2A 3SH4A 3SH3A 4I2OA 4Y1VA 5JIAA 3IT8A 3MIGA 3A4UA 4E2GA 1RUD2 1DU3D 3VDDB 1TMF2 5F6LB 5I0RA 5JOYA 3MZHA 3IM0A 4PLOA 1N47A 1W6QA 4QQHA 3N7JA 1VRH1 3VBHB 1REEA 5EJ3A 5FPZA 2QJVA 4KWKA 2NMNA 1AR82 1OLQA 5T5PA 4AVSA 3ALQA 4YG0A 4AG4A 1CVNA 4LE3A 3AM2A 4W6YA 2K0GA 1AXZA 1VLNA 2JE7A 4DFSA 1O5UA 2NYYA 5E1RA 2AH2A 1PIV1 2AR6A 4OUSA 1VRH3 3FFQA 4Q2FA 4QQOA 2Q0AA 2PHLA 4GH4A 5JR7B 1XU2A 1RUC2 2I2SA 3MYXA 5JSPA 3ZYRA 3BOWA 1RHI3 2VUJA 3M3EA 5H9SA 1YJKA 5C9AA 2VVFA 4YLZA 1RUC3 2WNVB 2D3PA 1S0FA 5D8AA 4D94A 3B02A 3DV8A 4QQLA 4Q4W1 3NAPB 1R082 5H9RA 2ZGKA 3RDIA 4XILA 4P9WA 1MEC1 1F8VA 3ZXGA 3WP5A 1KRIA 2ENRA 4G3YC 5AFBA 4CDXB 1PGW2 2VMIA 3IMNA 1ND3B 4FPEA 4P9YA 1VBD1 4AEKA 3B9CA 4YYOA 1EV13 1JUIA 1MS9A 2TNFA 1WD4A 3KSCA 4R9BA 2VUAA 3ZN5A 1Z0HA 5E8AA 1UL9A 1S0EA 2IC1A 2WJSA 1BEV1 1BBT2 2EVXA 3RZZA 5T50A 2PYTA 5T52A 1DGWX 5BNOC 5GLVA 3USSA 4QD2A 4Q0PA 1W6PA 3WD5A 1S0BA 4MGKE 1O3SA 1RUD1 3FWEA 4LHKA 1MVQA 3APBA 4NHMA 4RHV2 4G4FA 3T1LA 1SLAA 3V56A 2GNMA 1F5JA 1R1A1 2QDNA 4Y22B 1A78A 2GC3A 4AI1A 1RJ8A 4FPOB 3ZFGB 3WINE 4OVEA 1AYM1 5IK7A 1ALYA 2HWC2 4FPKA 3GHNA 1U5XA 3D4KA 4AGRA 1DGLA 1SMVA 4YM1A 1UMZA 4RS5C 4C1XA 1U12A 1RUC1 2HWD1 2ZOEB 3T1MA 2YY1A 1V6NA 5GLWA 2CTVA 4R4ZA 5FREA 2WNVA 2BPA2 4FVVA 2W39A 3ZSJA 4MZUA 2QE3A 2WS93 4IXLA 4RGGA 1SLIA 1BCXA 3NV1A 5BNPC 1SLLA 5CU1A 4XIOA 3ZN4A 5CFDA 2RS32 5E16A 1GANA 4XFAA 1W6QB 1X36A 3FJSA 3S7EA 1JW6A 3HQXA 1CAVB 1ZNPA 4L11A 4A7ZA 3NSTA 2EXJA 5ABJB 1AJKA 4H55A 4AVBA 1OOPB 1W6MB 1UCXA 4YVWA 1BEV3 2BQPA 3RWNA 1NCRA 1AL0G 4HN1A 4LBQD 4PQ9A 1LODA 1BEV2 5C4WA 5KC5A 2XB6C 4NHLA 1TQ5A 1HKDA 3UKNA 4P9JA 1SBDA 1H8TC 4LE4A 4AHWA 1HV1A 2IFRA 1IHMA 4XQ4A 5T5LA 3FLRA 2ZX0A 4XZPA 5JOZA 1LEMA 2VQAA 1UKGA 2WNUB 1ZRFA 5FO9B 1WW7A 1CD3G 1G9CA 1GBGA 5AVPA 1I9RA 3U4XA 4EN6B 2IXKA 2XJVA 4LO5B 2YMZA 3B01A 3NAPC 5A3MA 5F1RA 4D7TA 1QJX3 2ZX4A 2DFBA 5JI7A 1HRI2 4LA3A 3AB0A 5L36A 2PHRA 2OUHA 3B7MA 3SCHA 4F8AA 3H1MA 3GBWA 2X8KA 2UY9A 4FSJA 2HWF3 1YCIA 5J37A 4Q1PA 1FOD1 3D82A 2MEV2 5J98B 5FQ0A 1Y7BA 4LBKA 3J8F1 5FAXA 2KXLA 3TB0A 4COYA 5CFCA 4HKLA 3NV2A 3UK9A 1UW8A 1JH5A 3WDWA 5JLVA 4PDWC 3VZJA 3MW4A 1ENRA 1OQDA 2PELA 1UX6A 2XVKA 4S2GA 1VR3A 3WNXA 4P9GA 4HK8A 4YM0A 2P3KA 1AR72 1PO13 2PHFA 4ORFA 2BEOA 4E4ZA 3RMXA 4JDNA 2R041 1VBC1 5I0UA 4YZ4A 5KXDA 2ZHLA 4L2NA 4K21A 4MSVA 4R9CA 4CP2A 4H3WA 1H0BA 2JG8A 3KGZA 1HQWA 1S0GA 2X5IA 4MXWB 2NQYA 1KJLA 1N1TA 4HK9A 3KCCA 1YFYA 2NLRA 5GJ6A 4N7UA 1PK6C 4AHXA 2QCSB 1A3KA 2OPKA 1J3PA 5T55A 1QU0A 1FNZA 1OA2A 1XYOA 1FPN3 3FC0A 2JD4A 2VMGA 3ST7A 2YUEA 4DMIA 5KHGA 2A6YA 4Q0UA 5ABJC 5D8AB 1PO22 3SITA 4HBNA 3SXWA 1WGPA 3IKWA 2YROA 1O3QA 3LA7A 4GKYA 4BHPA 3VKLA 2E6VA 3PVOA 4K1ZA 4RA0A 2ZAHA 4AFBA 3AXEA 2HWB3 1AR93 3O0VA 4AVAA 1LULA 1GFF2 1LOGA 3R4SA 2RS33 4UBGA 4CDWC 1GNZA 3EO6A 1FOD2 3OCPA 4JDMA 1FMD2 2VY0A 1AUYA 2XBO1 3IDCB 3MW3A 5SV8A 4RR3C 2PN5A 4LHLA 3OF1A 1UZZA 3VKFC 3WW4A 1TEIA 4I0BA 2UWCA 3TYJA 1GR3A 2WT1A 3GZAA 4Q4Y1 4R4XA 4IEXA 1LGNA 3ZVXA 4P9XA 1JN2P 1CJDA 4B3NA 1V6LA 1U5YA 1PVC3 2JE9A 5GLZA 2BUKA 1LB2A 1HQLA 3WHUA 2NZ9A 3ZN6B 2B5HA 3WDTA 5J36A 3ZMOA 5A3LA 1AL21 5CNAA 2R042 2YZ4A 2QDRA 1OFSA 1LOEA 1YYNA 5FFOC 4Q8LA 4AI2A 4LEJA 3IPVB 5BNNA 4DQAA 4EV0A 2XBO3 3BCWA 3CJIB 3VBOA 4DNYA 4IEYA 2RE9A 1ND2A 3CEWA 3JBG1 2UWBA 4CDQC 1XXNA 1COV1 2V73A 4MV2A 1ENSA 2ZMNA 4RR3A 3K48A 2EAAA 3NVCA 2CGPA 3OTFA 4JGYA 1DYKA 4P9LA 4ISRA 5J48A 2GNDA 2BFUL 1G9FA 4K1YA 4KGQA 2O0OA 2JICA 2MPFA 5HXVA 4HETA 2DYCA 1VBB3 4Q4X1 2HWE2 1H8VA 4FPCA 2DCYA 2DCKA 5F9TA 2UWAA 2X5IB 2ZZQA 3AKSA 3M3IA 1Z7S3 3WDUA 4RGAA 2JDZA 1FNYA 5FMOL 3J9SA 4B4RA 1Q43A 2WFF3 3VBSA 4HKWA 4FAHA 5T5JA 4LR4A 4KBBA 1NA1C 2BGCA 4YG6A 3AZYA 2B46X 1KS4A 3DF0A 1Q8VA 4BIFA 1CAWB 4HVQA 4OLLA 2E53A 1MZEA 1YI9A 2JG8B 4CTEA 1WW6A 1SLTA 3B9IA 2G9FA 3AZXA 3G6JB 1ULEA 1WCKA 3C2UA 2EXIA 3H3UA 3E6CC 4AF9A 4FCAA 2RMU2 5FO8B 2D6NA 5HBAA 1PK6A 3NL1A 5JIUA 5BY5A 3DL3A 5I8YA 4OHXA 3ILRA 4X8NA 2XPJA 1VAVA 5K0UC 1RVF3 5BNPA 2VOKA 2PHXA 1NG0A 3L9JT 4LUKA 5FO7B 2XJQA 4BE3A 1NYWA 4XFIA 4XFGA 5FOJB 2VOVA 4QQPA 3ZXEA 1QHDA 4CP1A 4D7SA 4HSLA 4K40A 4YGBA 1G86A 4CYDA 1O4TA 4XXAA 1KFXL 1F2NA 5KHHA 1H9PA 4HSJA 3VUOA 4IV1C 4KQ7A 5C8CA 4PDWB 5F6KA 3VBRB 2C0ZA 2VW1A 4E2SA 2WS92 1EV11 3PMSA 3R4DB 4CZSA 1RITA 4XMAA 1POV3 3M70A 5FLJA 4W65A 1XE7A 3FE5A 1QH6A 1KITA 3TN92 4LBLA 4IERA 3O12A 1ZZBA 3KT4A 3LA2A 4MXWA 2E51A 1FI2A 1GQHA 3VZOA 3NV3A 4KH9A 2CV6A 4DZGA 4G9SB 5CADA 4N7IA 5LEKA 2ZGPA 1FATA 1DFQA 2GC0A 3CJIA 1AX0A 1UD1A 2GN7A 4AVVA 2PHWA 2A6ZA 2XG3A 1WMFA 1O91A 3BPZA 4M3CA 4EWDA 3AFKA 3M1HA 4HMZA 1L3JA 4ZU4A 4RHV3 1X8MA 4PLNA 1ZYBA 3WW3A 5JOWA 5HCFA 1C8M3 1W6OB 1PIV3 2IXCA 3R05A 2A6XA 5AC93 1RC6A 4OHVA 4UW6A 2B7YA 3ILFA 1UU5A 4UXAA 1MS5A 1PHMA 2DCZA 1R083 2ZTNA 1G9BA 5KC6A 3LKJA 4YVSB 2WQZC 2PQQA 1Q8SA 3ZYIB 1X8EA 4L9BA 2HWC3 3FBYA 2OA2A 5BUVA 2R16A 3WR0A 3LAGA 5C8CC 2YV8A 2BWCA 1IPKA 2OUJA 2RS53 2WL1A 2GNTA 2ZHNA 2P3JA 4YARA 1UU6A 3VBSB 3S0MA 4Z92B 2BBVA 1PGW1 4AWDA 2GN3A 2BNMA 2R043 4N9IA 2BW8A 4NHKA 5GZGA 3CL1A 2JJ6A 4H7MA 1VB2A 2W08A 2GAUA 4ITCA 4FOQA 1RUJ2 4P9IA 5FPXA 1RUF2 3AYAA 1CAUB 1RUJ3 4BA6A 1JHNA 2ARXA 2ZZJA 1MR5A 1EY2A 2Y38A 5DG1A 5H9PA 3PJQA 1FAYA 1QY4A 4B7KA 4PJYA 5DUUA 1LOFC 3MDPA 3RJRA 5DUXA 1DG6A 3VZMA 4IV3A 4E27A 1ND2B 2FMDA 1J1TA 4GMP3 3HIFA 3POSA 5CFDB 5FLIA 2WFF1 1TMF3 2BVBA 3VGIA 5JZGC 4Z07A 3E5XA 1C3HA 1MVEA 1RUE3 4HFSA 2ZJCA 3V0AB 2RJLA 4CDQB 3MLKA 1KDMA 4JQRA 2KA3A 2DURA 1R1ZA 3JB8A 5FCCA 1VBA1 4CDXA 2ZX1A 2DCJA 1LGBA 2PAKA 2ZS6B 4YG3A 3WVJA 4U36A 1GZWA 1RVF2 3I2DA 3MIEA 2VECA 5CB7A 2R063 3PVNA 3QLQA 1H30A 5BNOA 4F83A 4GB31 2EAKA 4LNVA 4AFDA 5A32A 3AP7A 1RUI3 1YUDA 3WY6A 3H8UA 1FXZA 5EFUA 3RYKA 5AFEA 3VV1A 3MIBA 2H6BA 1TNFA 2R32A 4B4QA 3LOIA 4RD7A 3RMYA 3RPQA 2NM1A 1M4WA 1BYHA 3ZFGA 2YYOA 2DTWA 2CAVA 2EXHA 1ZZ9A 1IKPA 3JB4C 2R30A 3TN93 4FTEA 2BVVA 4XFHA 1D2SA 2RM22 1LGCA 1NE4A 2UU8A 4Q4W2 3VBFA 4K20A 2A6WA 4I09A 3WDXA 1NZCA 4Q4Y3 1MEC2 1O4ZA 1QJZA 3HR9A 3H3ZA 4O9GA 4GH4C 3X29B 4O9EA 1PMIA 2JKBA 3J26N 2RHPA 1J1LA 3SH5A 1GLHA 1N3PA 5H9QA 1XQNA 4OZXA 2GU9A 1JYIA 3M4FA 5C8CB 2OYZA 2QNKA 2MEV3 3N4MA 3FBMA 3L2YA 3H7JA 2VVEA 4ES9A 4JRLA 1CAVA 4EN8B 1O5LA 1VIWB 2GALA 3AKQA 3KGLA 2WZR1 3UKTA 4JDOA 2XLGA 2JXAA 1Z7S1 3AP6A 4N43C 1LRHA 1IOAA 1I6XA 2EIGA 1V9U2 2YHJA 5GLTA 4IEOA 3IN9A 4WBBA 2DUPA 5J96B 2P17A 1C5HA 3ETQA 4XJWA 4ATFA 3VBOC 4QU2A 3J8F2 3N36A 3VBHA 1G6NA 4KNCA 1ASJ1 3W9AA 4UW4A 4Q26A 2F6BA 3FX3A 1LKNA 4LBJA 1HW5A 3DPRA 1WLTA 4M3CB 4WM8C 4OFGA 3JD72 1A6CA 1SLBA 1HXS3 3RG0A 1W6OA 2XVLA 3KT7A 2XBO2 4YM2A</