4LBQD

Crystal structure of mouse galectin-1
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
133
structure length
125
Chain Sequence
CGLVASNLNLKPGELKVRGEVASDAKSFVLNLGKDSNNLCLHFNPRFNTIVCNTKEDGTWGTEHREPAFPFQPGSITEVCITFDQADLTIKLPDGHEFKFPNRLNMEAINYMAADGDFKIKVAFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Galectin-1
publication title Crystal structure of mouse galectin-1
rcsb
source organism Mus musculus
molecule tags Sugar binding protein
total genus 25
structure length 125
sequence length 133
ec nomenclature
pdb deposition date 2013-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4lbqD00
3UK9A 1DYPA 2OW4A 3ENRA 1JW6A 4FPCA 5DG2A 1VIWB 5KXEA 4AGGA 5KXCA 2A3WA 2ZABA 3R4UA 3M3CA 1QNWA 4BPZA 1KJRA 2LALA 1WBFA 3VUOA 1MR5A 3PVEA 4K21A 2NP0A 1SCRA 4LBLA 2EF6A 1C4RA 4L8QA 3IN9A 3AX4A 3AP7A 4Q8LA 4AGVA 4LBJA 5DZFA 4AVSA 1AXKA 3AZXA 4FPEA 4Y1VA 1ZA4A 3ZSKA 2PHRA 1UZYA 3INAA 2A5ZA 2GN7A 4UW4A 1JYIA 1QNYA 3BOPA 1EPWA 3B3QE 1N47A 2AUYA 4BQ1A 1JOJA 1WCSA 1H30A 3N7JA 1IKPA 1LENA 2GN3A 3FUOA 2EXJA 3WDUA 1AZDA 4RL7A 2D6MA 5JOYA 4C1XA 3MW3A 2ZGTA 1UKGA 1UAIA 1N3QA 3B01A 4WVVA 1W6QA 1N1YA 1FX5A 2ZGQA 1HQLA 4XXAA 1SBFA 2P37A 4Y24A 1IKQA 1I3HA 4YM1A 4DS0A 4YGBA 4DFSA 2CYFA 1QU0A 2ZMNA 3IKWA 3V0BA 2DVAA 1UL9A 3M1HA 1W0PA 4Y20B 1LOAA 1LOFA 2AR6A 2RHPA 3ILNA 1C1LA 2D3PA 5T54A 1KRIA 2V73A 1O4YA 1KJLA 3PMEA 4FQ4A 3WLUA 4PCRA 1G7YA 2FMDA 1DFQA 2DUQA 1RITA 1W6OA 2PHFA 5IT6A 3M3QA 3VKMA 1AF9A 2PHUA 3IPVA 1BQPA 1DHKB 1SLAA 1C57A 2E6VA 2ZGMA 3ZXKA 4XILA 5GLTA 3MEPA 3VKNA 5F9TA 4R9BA 1S0JA 2EALA 4GALA 4BLIA 4P14A 3M2MA 1UMZA 5JOXA 5DZEA 3ZSJA 5GLZA 1H9WA 2DU0A 3AK0A 1PZ7A 1JUIA 3PJQA 1UN1A 1G86A 1G9DA 3WCRA 2ZHNA 3AYAA 4YGCA 1ULEA 2C9AA 2GALA 2A7AA 5EYXA 1ULFA 1SFYA 4LBMA 4XBNA 1VLNA 2WT2A 1LOEA 2D3RA 2VY0A 4FPLA 3JU9A 2V5YA 5T5JA 3WHTA 2YXSA 1VAMA 2CTVA 4K1ZA 1Q8QA 2PHWA 1WUVA 2DVGA 4R9CA 1C1FA 4YG6A 5DUXA 4C1WA 1G9CA 3D6EA 1GZCA 3FLTA 3AFKA 4JC1A 4Q26A 3POSA 3SITA 1TEIA 4ATFA 4YZ2A 3WG1A 2EAKA 4YFZA 5EYYA 2ZGNA 1DQ5A 2JD4A 1UX6A 2XB6C 3AJYA 3POYA 3AYDA 3NWKA 1V6OA 4BLJA 1WD3A 5CB7A 4K1YA 1JYCA 4BMBA 1N3PA 5GLVA 2ARBA 2R49A 4YLZA 1LODA 2ZHLA 1A8DA 1V6KA 5CNAA 3ZSLA 4Y1UA 3FLPA 4YW3A 5GM0A 2EXHA 2JE7A 2A6ZA 4Y20A 3V64A 2D7FA 3OY8B 5IUQA 4AVVA 3I4IA 1D2SA 2YV8A 3A0NA 5GZGA 2A6VA 3OJBA 1B09A 4XE9A 1ULCA 1SBEA 3OYWA 2WSUA 3ILFA 3WG2A 3V0AA 3R05A 2GNTA 2PHXA 4CZSA 4Q1PA 4P9WA 3RS6A 2A70A 4CTEA 5T52A 1IS3A 1MS4A 4P9XA 1G9FA 1CQ9A 2VH9A 1IS6A 2OUHA 2YZ4A 2WNEA 1F31A 1IS5A 5T5PA 1GYKA 5IK8A 1LESA 5FRAA 3SH5A 1JN2P 3RQ0A 1FV2A 3O0WA 4Y1XA 4CRQA 4Y22B 1LOBA 2VUAA 3SLIA 2W08A 2ZGUA 3ZXEA 1LULA 4Y26A 4DQAA 5JMCA 3WDTA 2CY6A 5T55A 3TAYA 2GNDA 2YMZA 4ISQA 2G4IA 1VAVA 3I8TA 1Q8SA 3AZYA 4LBQB 3IMNA 3RSJA 1N1TA 2NZ9A 3RRDA 1KITA 2EXKA 1QDOA 1QF3A 2DVBA 3HMYA 3N36A 1GZWA 4D69A 1WD4A 3B9CA 2AYHA 3GALA 2ZGSA 1J1TA 1CPMA 4KBBA 1V6MA 2ZHKA 3AXDA 4M3CB 3ZVXA 2E53A 1DQ6A 2P3JA 3ZXJA 5DUVA 3ZYPA 4XMAA 1MZ6A 4YZ5A 5KXDA 1NLSA 1H9PA 3RMYA 3W59A 5JOWA 4FPJA 1QKQA 3T1MA 1LGNA 1NXD1 2JDZA 3UJOA 1SLLA 1V6NA 2I2SA 3WVJA 2ZMLA 4WV8A 4XJ9A 1CVNA 2W68A 1WW6A 2HYKA 1A3KA 5H9QA 1HLCA 5H9PA 5IK7A 1CESA 5IK4A 1SLCA 2D3SA 3D5OA 4XZPA 2DUPA 1SBDA 1S0DA 2DVDA 2ZACA 3USUA 2OVUA 1MS0A 1LOCA 2UU8A 4XJAA 1DYKA 3OGGA 2ZMKA 3HN1A 5L73A 2JJ6A 4YM0A 1W6PB 3WNXA 3NV1A 3WZ1A 1IS4A 4W65A 4YZ3A 5CA6A 3DGTA 2GNMA 5CAZA 5DUUA 1AXYA 1HDKA 1D0HA 1MS8A 1SLIA 1W6NB 5FREA 1N1VA 1YRZA 2H0BA 1LEMA 1VALA 1WW7A 4Y1ZA 2JECA 1KQRA 3AJZA 1A78A 4UW6A 5JOZA 4AWDA 1BJQA 1GNZA 2B7YA 1MS5A 4FP3A 5E88A 2C5DA 4GKYA 1DQ1A 3WDVA 1YO8A 2E7QA 5T50A 3ZXFA 2A6WA 1KDMA 3OPZA 4XIOA 3LSDA 1OQ1A 1V6IA 1FNYA 1Q8VA 1HKDA 3AP5A 3MW2A 4YW5A 3VV1A 5GALA 4M3CA 4Q2FA 1V6JA 5AVAA 2Z42A 2UWBA 3C2UA 1AVBA 2NMOA 3ZYRA 2XG3A 2ZHMA 4ATEA 3ATGA 2D43A 1PZ8A 4MYEA 4WVWA 4YW4A 1AJKA 2GDFA 2DWRA 1WW5A 3ILRA 1DQ2A 3ZSMA 1BXHA 4PBPA 4XTMA 5GZCA 4Q1RA 1QMJA 4M3CE 4FPHA 3UL2A 3WHUA 3UJQA 2R1DA 2WLQA 3TB0A 1QDCA 3BIWE 1DQ4A 3FLRA 3DUIA 1AX0A 4YZ1A 2UWAA 1GKBA 2GMMA 1S0CA 3N3HA 4FPGA 1F9KA 1N3OA 2CL2A 1W0OA 3SISA 1LHOA 2R16A 4BM8A 2DYCA 3AP4A 4M00A 2ZA9A 4SLIA 4FP2A 5IK5A 2DTYA 1CJPA 3NV3A 3JUUA 4XTPA 1UPSA 2BQPA 3FBYA 3KM5A 4Y1YA 1GSLA 1FATA 4LBNA 5KXBA 4Q8KA 3PVOA 2WSVA 1ENQA 2NM1A 2D6NA 1QOTA 1V00A 1DIWA 2SLIA 4PBOA 1MACA 1S0BA 3WV6A 4YW1A 4ZXKA 4XJUA 5GLUA 4FPYA 3U4XA 4M3CF 2D44A 1WW4A 1LEDA 1APNA 3A0KA 1FV3A 2D6OX 3O0VA 3O5SA 4P9YA 5DG1A 1FAYA 3N7KA 5GZDA 2ES3A 4WZFA 4TYSA 4DPNA 4DRRA 3AYCA 3O0XA 2NN8A 1F5FA 2WQZC 1YXWA 3H0OA 4K20A 1W6MB 1O4ZA 2A3YA 4YG0A 4YW2A 5JLVA 2DU1A 4XDQA 2VW2A 5JDBA 4XHBA 1LTEA 5H9RA 1ULGA 5EXOA 3MPPG 1W6OB 4FPOB 4GWMA 1MVQA 1QOSA 1N1SA 4R9DA 2NMNA 3IM0A 4TZDA 4YGDA 3KQRA 4ASMB 2VU9A 4BMEA 4XBLA 3QCWA 4XJWA 3T1LA 2ZZJA 5LK5A 2WT0A 2VW1A 3AZWA 2ARXA 3APBA 1CR7A 1S0FA 2PHTA 1XQNA 2DTWA 3B00A 5GLWA 4YFWA 3ASIA 3QLQA 3OY8A 2SBAA 2D6LX 4H55A 1WLCA 1Q8OA 1UZZA 3B69A 1SLTA 3V65A 3OBRA 1GZ9A 5DXDA 4Q27A 3GNEA 1JXNA 1IOAA 2R0FA 1GANA 1YIFA 2D6KA 2DUOA 2W52A 3WG3A 1ULDA 1Q8PA 1ENSA 1DLLA 1SCSA 2DVFA 1GICA 2NYYA 2AGSA 4PQ9A 3AYEA 3OBTA 4GWNA 1WBLA 3NV4A 3O12A 3WDYA 2AH2A 1LHNA 2P3IA 1GLHA 4YM2A 4ISRA 1LCLA 1YYNA 3RMXA 1YI7A 2E51A 2AENA 1S0GA 5E8AA 4AYUA 4Y22A 1KDKA 1S0EA 4GA9A 5E89A 3M3EA 1CIWA 1LJ7A 3AZZA 2PELA 3ZPYA 5HCAA 1QOOA 1JBCA 1MZ5A 1CPNA 1DZQA 3N35A 4FOQA 3W58A 4FOVA 1OFSA 2W39A 4ITCA 1PZ9A 4LBOA 4U2AA 4NO4A 4LBQA 4XBQA 4AVTA 1W6MA 5F5QA 3WG4A 2P3KA 4GXLA 1S1AA 1SACA 4LBKA 5JVVA 4RA0A 2A3XA 3RG0A 1Z0HA 3FUQA 3FFZA 1MS9A 3OYWB 2R1BA 3D4KA 1X50A 1LOFC 2FHRA 3V0AB 2ZGRA 4GKXA 1OKQA 1I1EA 3N7MA 4HANA 2P2KA 5EWSA 1GBGA 4XYXA 5DZGA 1AJOA 3PVNA 2ZBJA 3M3OA 4U36A 3VKFC 2ZKNA 1G9AA 1QGLA 4Z8BA 3WCSA 2CWMA 4FOYA 4IQPA 4NOTA 2AREA 4JCKA 1JHNA 2ZGLA 3NV2A 4XOGA 1SLBA 1MS1A 2R0HA 2ZGPA 2JKBA 3SNMA 5SV8A 3VKLA 2A71A 3AP6A 3MW4A 3ZXLA 1R1ZA 2CWSA 4JRAA 1ZM1A 1ONAA 2LTNA 3N7LA 4XHXA 3WDWA 1FNZA 1GV9A 1V6LA 1LU2A 2KM2A 4I30A 1Q56A 1RINA 4M01A 1GZWB 1BYHA 4FVVA 1LU1A 4LBQD 5CBLA 4YGEA 1W6PA 2E7TA 2TEPA 4FOWA 4XIKA 4OZXA 2JE9A 4XXPA 3R4SA 1CN1A 1MS3A 3VKOA 4AGRA 2VW0A 2OUJA 3BTAA 1CONA 1W6NA 3LSEA 1Y7BA 1FYUA 5DUWA 2VXRA 1HQWA 2CNAA 2WT1A 2WKKA 4UW3A 5HCBA 1LHVA 1BKZA 2DV9A 1U0AA 4YZ4A 4YG3A 3WUCA 2D6PA 2A75A 2WJSA 2ENRA 1S0IA 2EIGA 3BODA 1GNHA 3WDXA 1LHUA 1AXZA 2UURA 3A4UA 5GZEA 1URXA 1WLWA 4PF5A 5T5OA 1RIRA 2GMEA 4HL0A 3AZVA 3L2YA 5GZFA 1WLDA 1ENRA 4FPFA 1DQ0A 1W6QB 1DGLA 3AXEA 5GJ6A 2P34A 2ZGOA 1AX2A 4XJZA 3USUB 4BOWA 3LCPA 1LGCA 4FQZA 5BYNA 4ZKTB 2ERFA 3V0BB 2YROA 1G9BA 2DURA 4XMIA 2GMPA 3SH4A 3WUDA 5H9SA 5T5LA 3HR9A 3AP9A 3POWA 1MVEA 3CNAA 5HCFA 3T2TA 4UW5A 4F83A 1LHWA 1LOGA 4R9AA 1DBNA 2GNBA 1LGBA 1G8WA 1Z78A 1LECA 1AX1A 2YY1A 4XJ8A 2Q5TA 4YM3A 2UWCA 3IPVB 2ZAAA 2ZGKA 4DRVA 2EXIA 2A6YA 1BZWA 3Q9OA 4FPKA 3WOGA 2A6XA 3SH3A
chains in the Genus database with same CATH superfamily
3UK9A 5A7SA 5ISLA 4R52A 3ENRA 4MGIE 5DG2A 4AGGA 2XGXA 4LO7A 5CFDC 4A7ZA 5FKCA 3NMBA 5FXWA 1X33A 1KJRA 5ACA3 3AKSA 3SEEA 1UYPA 1SDWA 2ZCWA 3NAPB 3PVEA 4D7YA 2EF6A 1C4RA 4L8QA 2R063 3W9AA 4HPKB 4KWJA 5DZFA 2C4XA 1AXKA 3MIGA 4COWA 1IPSA 4FPEA 3RFRA 1ENXA 1OVPA 3INAA 1C8NA 3POEA 4UW4A 1FMD1 1HX6A 3H9AA 1VBC1 2Y64A 3B3QE 2AUYA 4BQ1A 3H50A 3N7JA 1H30A 5JZGC 1IKPA 3FUOA 4XAAA 3KSCA 4EE2A 4QXHA 2EAAA 2ZGTA 1L7LA 3B01A 4WVVA 3VBHC 1W6QA 5JOXA 1FX5A 1XBFA 4OCTA 5IK7A 4AEDB 1IKQA 2WYFA 1C28A 1AR82 1PM7A 1UCXA 3NQHA 3RPQA 5CKQA 2R6QA 1JZ5A 5A3NA 3NJYA 4BCUA 2E26A 1AYM1 1H1IA 5FZAA 3CU7A 4Y20B 1QIQA 2V5DA 2KA3A 2PAKA 3FHIB 5FMOS 5EJ3A 2QUOA 1VMJA 3U10A 4F3JA 5T54A 1I5PA 4FQ4A 1O4YA 3PMEA 3UKVA 4QM8A 1O8SA 2XQXA 1W9YA 2QQWA 2RE9A 4PCRA 3QOPA 4NPRA 4CP2A 1H8VA 3VKMA 5J96B 2Q8OA 1OHFA 4UFHA 2ZGMA 4WM8C 3ZXKA 2IC1A 3VBOB 4GB31 5GLTA 4CEWC 2JG8A 4R9BA 1S0JA 1XSRA 3BPSA 4GALA 3U1XA 1HXS1 4QX3A 2C26A 1OQEA 5LA1A 1C5IA 1W90A 1UMZA 1Y9GA 4N8MA 4EN8B 4CDXA 3JZVA 3T08A 3WEZA 1H9WA 2DU0A 2ZAHA 3AK0A 4YVWC 4OHZA 3RI8A 3BCWA 3T2QA 5F39A 4Q4Y2 5D8AC 4AFAA 4JGYA 4AFDA 5IW0A 2C9AA 4Q4W2 3KV9A 4IEYA 4RQPB 3SXWA 2WT2A 1ACCA 3GBFA 2D3RA 2E33A 1UPIA 1IG3A 2XVKA 1V9U2 1UIJA 1Q3EA 2GAUA 4RSUA 5T5JA 4ZU7A 5A70A 3PUIA 1VAMA 2CTVA 2YFUA 3BIEA 1AYN2 1VBE3 4YG6A 1C1FA 4SBVA 5LEJA 3D6EA 3GJBA 3AFKA 1IHMA 1VJ2A 1TEIA 4ATFA 4IGOA 1VBB2 2X10A 3BI3A 1NY72 1QY4A 2W1WA 3I3MA 1XE8A 1DQ5A 3FHQA 3ZDSA 3WQ0A 1UU5A 2X29A 2AACA 2GC3A 2YG0A 4K1YA 5C5UA 3ACFA 3T2PA 4IV3B 4AE2A 1RUI2 3IBMA 5I0RA 1SG3A 2QDRA 2ZHLA 5HXVA 4A3ZA 2LROA 2CDPA 5CNAA 5FPAA 3HIFA 1HB3A 2A6ZA 5I0UA 5IUQA 3I4IA 3U78A 2JX9A 3I2IA 1D2SA 4AZZA 2A6VA 3OJBA 5GZGA 1C8M3 1R1A1 1ULCA 1YQ2A 2BW8A 5FJKA 5C9AA 3OYWA 3I3EA 1I5ZA 1PNFA 3ILFA 4P9GA 5F3EA 5FOBB 5J37A 2XKOA 3R05A 3V0AA 4CZSA 1F15A 3ROUA 2A70A 3FZ3A 4OFGA 1CAXA 2MEV1 2BWCA 2E7AA 2VBBA 5EQUA 2OUHA 2YZ4A 4JHTA 2WNEA 4QX5A 5JSOA 3VHNA 1JN2P 3RQ0A 1FV2A 3OPWA 4XFCA 3U11A 4WM7A 2ARCA 4CRQA 3ZYHA 4QQHA 2ZGUA 2VVEA 4Y26A 3PLQA 1AR83 3WF4A 4DQAA 5JMCA 3MLLA 3ZO0B 2GNDA 2YMZA 4O61A 4N43B 5FCCA 1O5LA 2RS11 2JDNA 3OD4A 3IMNA 4LBQB 2BP6A 3OEBA 1WWYA 2DBNA 1KITA 4NHYA 4AW7A 1UOGA 3N36A 2V4VA 3H8XA 2CAVA 4DUXA 3TEWA 3B9CA 3NO8A 1JU3A 5FO7B 2AYHA 3UKNA 3DPRA 4B1LA 3GALA 4YARA 3DXTA 3VDDA 4BJ0A 5LB6A 2YC4A 1SPPB 2ZHKA 3AXDA 4M3CB 4UFKA 1BHGA 1JYXA 2P3JA 3T0AA 5B2GB 2XLGA 3VGIA 2ZKLA 4ZHNA 4CE8A 4XACA 1TMF1 2FDFA 1W0NA 2GZWA 3CMGA 3LB9A 5JOWA 2BGOA 5FP9A 1GOFA 3LEGA 4Q4Y3 3T1MA 1JU4A 2PQSA 3UJOA 3AKRA 4Q4W3 3WF0A 2ZMLA 4WVMB 5L19A 4ZS3A 1DZRA 1YWKA 3PVBB 1SFNA 1V9U3 4L99A 3UGHA 4B29A 1NT0A 2WNVB 4Z2WA 3HWJA 5FZ7A 1AYN3 3TNQA 2OVUA 1UKRA 1UF2C 3POFA 4XJAA 2QVSB 2QJVA 5C4WA 1VBB3 3I2JA 1W99A 4NHXA 3WP3A 2JJ6A 1WA6X 3WF3A 4W6YA 1J83A 4YM0A 3WZ1A 1QXPA 3DGTA 2GNMA 1YJLA 1VMFA 2JG9B 3J4UH 1D0HA 1MZFA 5JXJA 3THTA 1MS8A 1UX7A 1W6NB 2VECA 2XJSA 5FREA 1HJFA 5I0DA 1HRI2 1LEMA 5FYBA 1RUI3 4E2SA 1OI6A 1OLMA 2FZ1A 3MFAA 4I02A 1QJX2 2LM3A 2YB7A 4ZXEA 3UGFA 3ZKUA 4AWDA 5JOZA 1EAH2 3G7DA 4CA9A 1RHI1 2B7YA 4FP3A 5E88A 5BNNC 2C5DA 3SMHA 4Q4V2 2E7QA 2BFUL 4P9LA 4IV1A 2VQTA 2A6WA 4GIQA 5FPZA 1KDMA 5T50A 5HCHA 1BLZA 3ZFEB 2GP3A 3LF7A 3TYJA 4YW5A 4AI3A 3SQOA 5AVAA 2VJXA 1NQJA 3C2UA 5I91A 3H1WA 4CU8A 4QX7A 4F7ZA 2B4KA 2D43A 3AKPA 3MPBA 2Y8KA 3PUQA 2RS31 3CJIC 4YW4A 2D93A 5FZOA 2G19A 3WNNA 5L9VA 1PMIA 1Y9MA 2OPWA 3M4FA 4V2WA 4JKKA 4QKFA 3E5QA 4PBPA 4XTMA 4DIQA 1FT9A 4LNVA 5CISA 1W2OA 3K2OA 4AL9A 1H6YA 2PLV2 2VBDA 5LRSA 3WHUA 1R082 4LLOA 4GQ7A 2ZOEB 1QDCA 3DUIA 1GKBA 1S0CA 2Y6KA 3MF9A 4GJZA 4QDRA 4URTA 1OA3A 3BU0A 1W0OA 4LOSA 2R16A 2NLRA 2DCYA 4XQ4A 4M00A 4SLIA 4BQXA 1UY4A 3DV8A 1GP4A 3GBWA 3NV3A 4XC9A 3JUUA 1NZIA 3OBAA 2Y33A 1L3JA 4BYYA 4ONUA 2JB8A 1HB2A 1GSLA 4LBNA 4AQTA 3T09A 4Q8KA 3JB4C 4J25A 4IE5A 2HEWF 1ENQA 4OMCA 3IT8A 1QOTA 5FY5A 1UZVA 4P9IA 1AR92 4D3WA 3UYJA 4XJUA 2DDUA 3U4XA 3ZYIB 2PHDA 3VDAA 4QQ2A 3WD5A 1WW4A 4P9YA 1LR5A 4FO9A 4AFMA 4P02B 1AUYA 1BVVA 1POV3 3N7KA 5GZDA 5FYSA 3K4AA 3K77A 4JX0A 2R30A 4DRRA 1K5MC 1UZ0A 1YLLA 2QQKA 1F5FA 2WQZC 1YXWA 3H0OA 1W6MB 2A3YA 4YG0A 2CDOA 4XUQA 4YW2A 4JAAA 2O8QA 5HPOA 1ZRIA 2B42B 5IAXA 3G6JB 4Z92B 3DF0A 3D3AA 4RHV2 1CD3G 5H9RA 4RFT0 5EXOA 3MPPG 1REDA 4FPOB 4GWMA 4PDWC 4Q4X1 4UBGA 2QQUA 4R9DA 2NMNA 4TZDA 4YGDA 4ASMB 1QJX3 1UMHA 2P6CA 3QCWA 4CU7A 1EAH3 2JG8B 2QQJA 4WZCA 4XJWA 4LPLA 2ZZJA 5C3PA 5LK5A 2JICA 3EXUA 4LULA 3UGGA 3TN91 3D0JA 3B94A 4Q4V3 4CDXB 2PHTA 4W8JA 5GLWA 3ASIA 1E5SA 3U75A 4NMIA 2D6LX 3ZM8A 4JGYB 1UZZA 1QJU2 3HVDA 4ES9A 5LA0A 3GJAA 4MGQA 4Q0QA 3PTYA 5HBAA 4N9HA 1NE6A 4UF0A 2PTMA 4FAGA 2VMFA 4QB1A 3VZOA 3THCA 3RG0A 3WW1A 1ENSA 1DLLA 2FDJA 2RJLA 3K51A 1NCQA 2WFF2 2R041 4I3GA 1RXFA 3DYPA 3H42B 1RMU1 5ANNA 3QACA 4N53B 1WBLA 1LHNA 2BJSA 1GLHA 4JRLA 2HLEA 4ISRA 4UT5A 4YM2A 1E57A 2XBO2 4QPYA 2F6BA 1YI7A 2G9FA 3CIHA 5EP9A 2E51A 3VZKA 4CSWA 1QJZA 2PLV3 4AYUA 5HV4A 5E89A 4YSFA 3M3EA 1LJ7A 3CZUA 1QJEA 3AZZA 4FXKB 2PELA 3W21A 1R083 5HCAA 3VBFC 1D4M1 3IDAA 3N35A 4FOQA 1TZOA 2W39A 4FOVA 4ITCA 4LBOA 4META 2W47A 4MH0E 4U2AA 3TEZA 1J58A 1T2XA 1QHDA 1RVF1 4N7UA 5F5QA 3SCGA 2P3KA 3WG4A 2ORZA 4LHSA 4QHZA 2A3XA 4IGQA 4QDQA 1LNSA 2WNOA 1DF0A 2LW8A 4XQWA 2X05A 3EO6A 1OPMA 1MS9A 3OYWB 3D4KA 4EN9B 4JDNA 3IAQA 1LOFC 3THDA 4A3XA 2ZGRA 5FZIA 2J1TA 4GKXA 4AHWA 1SFPA 3HQXA 1W2NA 2HWE1 4CDUA 1I1EA 3PNAA 3VZJA 4ARXA 2YPDA 3OUJA 1SHWB 4XYXA 4GWIA 5BNQA 5BNPC 3VHRA 3PVNA 4FI9A 4PT6A 4AHZA 4Y5Z0 4U36A 5FKBA 1CAXB 2XJTA 5KHKA 3O1SA 1QGLA 1AR93 5A6ZA 3WCSA 2WO1A 4NOTA 2VGDA 4EWDA 4QT6A 4JCKA 1EYBA 3ZFFC 4BH9A 4MX3A 2ZEXA 3BUCA 2UYAA 2W92A 4ZU5A 1RUD1 1SLBA 2X5IA 1CJDA 2B39A 3K4DA 4FFHA 4HKOA 5AC91 2RMU2 2ZGPA 2W1UA 1EV12 2JKBA 1PO11 3ZFGB 2VULA 2A71A 3AVRA 4M4RA 4PLMA 5D21A 5AFBA 1AR72 2EIEA 2FZ2A 4JRAA 1NCRB 1ZM1A 3ZIWA 1NOVA 4R4XA 3FJSA 3KQ4B 5C8CA 3RZJA 3WDWA 3NAPC 4RR3C 1FNZA 2KM2A 3VN4A 4GMP1 4CCEA 1BYHA 4LK6A 1LU1A 4CDQA 2ZXQA 2XOMA 4YGEA 1W6PA 2E7TA 3LEIA 2WBKA 2WNUB 4P9JA 1W8UA 3VKOA 4XF3A 5LY1A 1O5UA 1YIPA 4QHOA 4DMIA 5FZHA 3VBUA 1K42A 2WKKA 1WMFA 2XMLA 4YG3A 5EIYB 2A75A 2ENRA 2EIGA 1GNHA 4CXYA 1SQ4A 3ZR5A 1ZRDA 2IXLA 2K46A 4AEDC 5FY7A 5BXXA 3VDCA 1RIRA 1QJU3 2R32A 3BB6A 5FOJB 4AR2A 5C8WA 4XFHA 1XNAA 1R091 2D98A 4OUMA 5GJ6A 1FMD2 3AMMA 2ZGOA 2WFF3 1AX2A 4XJZA 4BOWA 4JGZC 3LCPA 1GQGA 2VNRA 4LE4A 5BYNA 2YDEA 4AGRA 4XMIA 2GMPA 3J7LA 3QBQA 5C4WB 5JSRA 5JSPA 5T5LA 3AL5A 2XBO3 2XWBB 3AP9A 4ORFA 5HCFA 1FOD2 3CNAA 4A4AA 4ZY9A 1LOGA 4E2QA 1PO22 4KNCA 5AVPA 3VBOC 3SHRA 2GNBA 4LO8A 1G8WA 1XB9A 2G9ZA 2HYXA 1LECA 4JTNA 3N9NA 1AYM2 1H8TC 1ZBA1 2Q5TA 2UWCA 4DRVA 2ZGKA 2C6SA 1BZWA 4XJ9A 5GZCA 2VC9A 1JYNA 2I74A 2OW4A 5FLHA 3DCQA 3ZXDA 5HV0A 1VIWB 3I2DA 1GMMA 4L9BA 1PGW1 1W9SA 2VQAA 4QM9A 5A1FA 5ABJA 1QNWA 1WBFA 3POIA 3J8F2 4QQPA 1VB2A 2NP0A 1SCRA 4QPIA 1S2EA 3AX4A 4LBJA 4W6WA 5FXZA 2FDHA 4G9SB 1IQAA 4HVQA 1RUH1 4JTOA 4GH4A 2GN7A 3CEWA 5FZOB 3E5XA 3ZOIA 4JKLA 1N47A 1XSQA 3X29B 2QZ3A 1UY2A 4BIFA 3GCWA 2RMU3 4IV3C 4Q29A 1EV13 2EXJA 3WDUA 2ADDA 3S7EA 4CCCA 2D6MA 3MHZA 4KWKA 4FCAA 4C1XA 3MW3A 1GFF2 1UKGA 1AR73 1N3QA 1PHMA 1VBA1 1N1YA 3DEMA 3DN7A 1HQLA 1PMJX 2ET7A 2P37A 1W05A 1PVXA 1I3HA 3EHKA 4P5HA 2JDPA 1WKYA 2ZX4A 1GZTA 4G4FA 2XLFA 3IKWA 1QU0A 4ET7A 1L7QA 4Z07A 1HB1A 3V0BA 1UL9A 1AL21 4CXWA 5SV5A 1BMV2 2VZRA 4BK5A 4GAZA 3VD3A 3MI8A 2D3PA 3ORJA 3LWCA 1KRIA 5A3WA 1KJLA 1HV1A 4Z82A 3HPNA 3PURA 2VOWA 4GULA 1X8MA 2FMDA 1RITA 3H1YA 4DEQA 5DQ0A 5IT6A 3M3QA 1V70A 3PDQA 4AI8A 4EROA 3IPVA 1DHKB 1SLAA 1Y3TA 4JKMA 2W1SA 2HWD2 4XILA 2W95A 3KD4A 4MOAA 1I6XA 5LASA 3NSTA 4PQQA 2F4PA 3QD6A 3JBG1 2VMIA 1W3XA 3JD71 4RGGA 3UESA 3ZSJA 2VM9A 5GLZA 2BDRA 4BQ3A 1POV0 1JUIA 1BK1A 2IFRA 4KL1A 5A7OA 5TSWA 1UN1A 1DP0A 4AI0A 1J59A 1FMD3 3Q8BA 2ZHNA 3AYAA 5FZ1A 2BZDA 3WCRA 1FPN1 1ULEA 1G9DA 3MIEA 4IEZA 4K40A 4AEKA 1ULFA 5DAXA 2XLAA 2MEV2 1VLNA 1LOEA 4FPLA 1KEXA 3JQXA 2V5YA 1H4HA 2YXSA 5FZFA 3D82A 1Q8QA 1SMVA 1K3IA 4C1WA 5LWBA 1FOD3 4L11A 1GZCA 2J1SA 5CZKA 5L36A 1PO23 3POSA 4LHNA 1J84A 5F5IA 2VBPA 5F8PA 1RUF1 4DUVA 3K48A 2HKXA 2EAKA 1NYWA 4HN0A 1AYM3 2JD4A 1UX6A 4NUBA 4IETA 3TOJA 1QJY1 2XB6C 4LR4A 1RUC2 3AJYA 5FY8A 1V6OA 5EZWA 5CB7A 3OPTA 2Y38A 1JYCA 3RWKX 5IVVA 1NZCA 1N3PA 4BMBA 2MPFA 5EPAA 1LODA 5G04L 2WZR1 4Y1UA 2QE3A 3EBRA 2XL7A 3QH7A 4LO5B 2WNVC 2JE7A 2W2IA 4UFLA 1UOFA 2D7FA 3J8F3 3V64A 2Y6GA 5BNOA 3MIHA 2YV8A 4GB33 5IVYA 3A0NA 1B09A 4XE9A 3WNPA 3KVAA 4HVOA 4CEYB 1PMHX 2WSUA 1TMF2 1X82A 3AB0A 4UF0B 4OUSA 5F32A 1UY3A 3H1MA 4XF4A 2PHXA 5FZEA 3RNSA 1CX4A 1NCQB 4D94A 1O3SA 2JG9C 3LA2A 1Q5OA 1WA4A 3N9LA 4LA2A 3KGZA 5E1RA 3ZPOA 4CDWA 4C90A 1YQ6A 1CQ9A 5L7OB 4PI2A 3RZKA 1VBE2 4MGZE 1IS6A 1XU1A 2F4LA 1F31A 1IS5A 5T5PA 1RUG1 1W03A 3GYDA 4UFMA 5FRAA 5L9RA 4Y1XA 2XONA 2VUAA 3NNJA 3SLIA 3H3LA 3F2ZA 3WDTA 2XXZA 2CY6A 2HWC1 2J1UA 2VUJA 3GZEA 3MBWA 3PL0A 2D5HA 2VMCA 4ISQA 4K3UA 4OLLA 5FBZA 5CFDA 2WS91 2G4IA 3ABZA 1VAVA 4KGQA 5JWPA 5FMDA 1Q8SA 3AZYA 4NIGA 3ZFEC 4TWTA 1GOGA 1JH5A 1IZ3A 3OD0A 3VZMA 1ULPA 5F2WA 5J09A 1PIV2 3F95A 4S2DA 1QDOA 1PM4A 3ETQA 3WR0A 4D69A 1GZWA 1WMXA 3A23A 5JXHA 2HJIA 3I59B 5F6KA 1J1TA 1CPMA 1V6MA 1EY2A 2O14A 1U5IA 1RUE1 1C8M2 3ZVXA 1DLCA 2HWD3 1DQ6A 1RHI2 2XJUA 2VMHA 3ZXJA 3GZUC 4XMAA 4C8DA 4ZONA 4QGNA 5JZGA 4FTEA 1Y9QA 3R0RA 4ZU4A 4CCLA 4BQ2A 4YZ5A 1H9PA 3KMHA 3RMYA 5A3LA 2JIJA 5C3RA 3VBHA 1QKQA 4QPGA 3ZYFA 1JOPA 1OD5A 4MUVA 4JV4A 2IUWA 5FMCA 1NXD1 1COV2 2JDZA 4XCAA 2X5IB 1UYXA 3IZOA 4A7KA 1NE4A 2Y6HA 4XF1A 2BOIA 2MEV3 2HYKA 2W68A 2VR4A 5JUVA 1O3QA 3VD9A 1HLCA 1WMDA 2QDNA 4PHZA 1VRH2 3HQRA 1CAVA 2Z79A 5IK4A 1ZX5A 2RS32 4C0HA 2B8MA 2D3SA 3HT2A 2A73B 3RZLA 5JR2A 5DAWA 3W5NA 1S0DA 2DVDA 1H4GA 5D1IA 5C8CB 3MIBA 4XEZA 2QKDA 1TNRA 2ZMKA 3NJZA 4CDQB 4YVSC 4LHLA 3AVSA 2PAMA 1W6PB 3WNXA 4ARYA 3LFIA 1IS4A 3OGRA 4W65A 5CA6A 1A6CA 4LKFA 5CAZA 1OBNA 1DU3D 5EHDA 3PHMA 1RUC3 3ECQA 4O9GA 4ASLA 5A7WA 4CEWA 3WINE 3AKTA 1WW7A 1M06G 4PIXA 5DN2A 2VOKA 2ZJCA 4YVWA 2BEOA 5FZ6A 2C0ZA 5D8AA 1BJQA 1GNZA 3WDVA 1OPOA 1YO8A 2F17A 3ZXFA 1WLTA 2OA2A 1TMF3 3OPZA 4X6RB 4XIOA 1O3RA 2HWF1 4TTGA 1V6IA 1FNYA 1QH7A 3K3OA 1ZRCA 3GBGA 2KXLA 4QGLA 5JXGA 1OLME 4O9EA 2Z42A 2UWBA 2VCAA 1B35B 4KGGA 4RD7A 3ZYRA 2XG3A 1RYYA 1QWRA 5JPNB 5A7NA 1FI2A 2MHFA 4COYA 4MYEA 4NHLA 1O7FA 4GZ9A 2GDFA 4NIIA 2DWRA 2GH8A 1CZVA 2B9UA 4IERA 1BXHA 2JG8C 3I3DA 1LRHA 3L9JT 4Q1RA 4FBFA 5JIUA 4NRPA 4AQ6A 3KS7A 5A80A 3ZN6A 3NKTA 3TEYA 2V4AA 1CGPA 5IAVA 4JDOA 3UJQA 2WLQA 5A3UA 1XU2A 5F3GA 4AAPA 1PIV3 1DQ4A 3IB3A 5LY2A 3OBZA 2IXKA 2BFUS 2ZTNA 4Q4X2 5KWRA 4FPGA 1F9KA 1N3OA 1LB2A 1H2KA 4QX8A 1AHSA 2CL2A 3N9QA 1RB8G 3LEKA 1U5ZA 2PHLA 4QPIB 5FR3A 2C1FA 5LBBA 1RHI3 1CJPA 1UYYA 1WCDJ 2WYSA 4N53C 3ZIXA 3ZYJB 3P5BA 5A6QA 3TN92 3RJRA 5J3UA 3J7HA 4GH4B 4NN0A 1PK6A 2GC0A 2W9XA 4EQVA 2WWJA 2CGPA 5ACA1 4BQYA 3T30A 2D6NA 1COV3 2SLIA 4PBOA 3WV6A 4K8RB 2VZVA 4ZXKA 4EJRA 5JCTA 3WW2A 1Y4WA 4M3CF 2IXHA 1VRH3 1APNA 2XHNA 5DG1A 3O0VA 3O5SA 3ZXAC 2RS33 3ZN5A 2JDKA 4PJYA 5BV6A 1RMU2 3KF3A 4FAHA 4DPNA 5FYYA 4B4RA 3O0XA 3ZDVA 2OPKA 1WCUA 3ON7A 2WFPA 3B9IA 2ZPXA 1W8ZA 2BTVC 2DF7A 4XDQA 4EZ4A 5FO9B 1UZWA 3AFGA 2VW2A 4XF0A 2WRAA 1LTEA 3TEXA 3MFCA 1D4M2 2C9KA 3IWZA 3H8UA 1VAKA 2WO7A 1OVSA 2A1XA 3U14A 5FQ0A 1QOSA 1IPJA 2TUNA 3T3YA 4BMEA 3V0AB 1RVF2 2VU9A 3T4HB 1W28A 4CPBA 3E97A 5I8YA 4EWEA 1MPXA 3C7OA 4QX2A 2BNMA 5LW9A 3NNFA 1XOYA 1UU4A 4L97A 4UWDA 4OI1A 3APBA 3ZFGC 1W06A 1ODMA 3B00A 3SKVA 4YFWA 4MXVA 4M0NA 2PQQA 5IATA 4AQSA 1V0AA 1NCRC 3W20A 4H7LA 3VBRB 4H55A 1WLCA 2J1AA 4YWAA 1FXZA 3B69A 3SCHA 3V65A 3I2HA 3WP4A 1YJKA 4HFSA 4NAOA 2RJ2A 1JXNA 2R0FA 2TNFA 1GANA 2W52A 2DUOA 4CCKA 2BOJA 2WNUC 4AG4A 4D7SA 1BEV1 3N9PA 1RUD2 1XE7A 3IDCB 1EPZA 4EN7B 3OBTA 4DXRA 2WAOA 5F3IA 3EB7A 3KV4A 2P3IA 5FYIA 3WDYA 2B5HA 4LO6B 2Q1MA 4CCMA 5JXIA 1YYNA 2ZS6B 4UI9L 3RMXA 1UIKA 5FPVA 1XNKA 5DDJ1 4KWUA 2ORXA 1S0GA 4XDOA 4Y22A 1KDKA 1S0EA 5A32B 1J3PA 1QQP2 4NPMA 4AF9A 1CPNA 3U37A 3W58A 4CCJA 1BBT1 1OFSA 2XUMA 3EQEA 5FYHA 5JIAA 4Q4X3 1PVC2 3OGSA 5IVFA 4AVBA 3H3UA 4AVTA 2J1VA 5K7PA 4AFCA 1DGWX 4V2VA 3JQWA 1AR61 4LEJA 2HWB1 5IWFA 5BNOB 3FUQA 2P17A 3GCXA 2E63A 2EVXA 3TN93 1X50A 2FHRA 3I54A 1OKQA 1ULOA 4BQ5A 3CJIA 1WMEA 5EWSA 1UYZA 1AJOA 4CDWB 2JDMA 2ZBJA 2WDBA 5K0UC 2DFCA 1G9AA 1YC61 3VD7A 3P1IA 5F6LB 4HK9A 4HZFA 4IQPA 3QH6A 1R092 3TNPB 3HT1A 3VHPA 4I0WB 4XQDA 4RGAA 2WL1A 2JD9A 4XOGA 5FP4A 3B5LB 1MS1A 5B4NA 4LIVA 1RMU3 3OUHA 3LZZA 2OYZA 2LRPA 2R0HA 5IJRA 5KC6A 2OX0A 3IIIA 3VKLA 2YBSA 3AP6A 4KG8A 3USSA 3ZXLA 4MO3M 1VRBA 2LTNA 3N7LA 2VO5A 1VB4A 4XHXA 4AHXA 3FBMA 1GV9A 1XNBA 2OT7A 3MV01 4I30A 3POGA 5JI7A 2AEZA 4A44A 1GZWB 4LBQD 1D4M3 1ND3A 4M0HA 4AQ2A 5C7GA 4PIZA 5CFCC 4OHVA 4LT5A 1ZBA2 2TEPA 2JDYA 4XIKA 4COZA 3MYXA 4OZXA 2JWPA 3R4SA 2CAUA 3IDBB 2N7GA 1W9WA 3VZNA 2OUJA 1RVF3 3LSEA 1GOHA 1Y7BA 1FYUA 5DUWA 2VXRA 2WT1A 4IEXA 4UW3A 5HCBA 1JZ7A 3WW4A 1U0AA 3V56A 2WJSA 1S0IA 2EICA 2B45X 2BBAA 1LHUA 4ZPIA 1VBD1 2UURA 3VBHB 1JYWA 1YQCA 4QPGB 5GZEA 1URXA 1WLWA 1WCKA 3CLPA 3AZVA 3L2YA 2RM22 5IFTA 2W5FA 1K5MA 5K9YA 1RUH2 5L9BA 1W6QB 4LORA 4PLOA 3E1F1 2DBIA 3DKWA 1U5XA 4MHUA 2WZEA 2Y6FA 4XUTA 1UU6A 1RUD3 3KVBA 5G05L 4BZ4A 1PGL2 1K12A 3KWVA 4ZKTB 3C3VA 3MLJA 4Q4W1 2OQ6A 3GDBA 3WW3A 3WUDA 1KS5A 2EIBA 2IVJA 1V9U1 2Y0OA 4FT8A 1VBA2 3POWA 2GSYA 2GP5A 3J26N 2H0VA 4E8DA 1AYN1 1LKNA 4D7TA 2VOVA 4HK8A 5A7WB 1LGBA 4GMP3 4I09A 1QQP3 5FY4A 4KMQA 3WQ7A 4HMZA 1PX4A 3Q9OA 3WNLA 2P1BA 1CZSA 4YVWB 1PVC3 2VY0A 4NIAA 4N9IA 1DYPA 1Q43A 1VE0A 3R4DB 3KT1A 1JW6A 4FPCA 5D8AB 2IXJA 1UXXX 1YFWA 4NWVA 2IXCA 2UY8A 3IIAA 5KXCA 2J7MA 3R4UA 1H1MA 3M3CA 5FZCA 3VBSC 2LALA 3LGRA 3VUOA 5T3NA 1MR5A 2ZX1A 3HNYM 4BHPA 4H2AA 1OFNA 1HQNA 1D0GA 4E4DX 1ASJ2 1I9RA 4RS5C 3S6PA 4Q8LA 4AVSA 1QH6A 4OUEA 3JD72 4IE6A 4Y1VA 3ZSKA 4LA3A 1UZYA 1R093 3S5AA 1STMA 3Q8EA 1JYIA 4XW3A 1OD3A 3CL1A 1JOJA 1OUSA 1WCSA 3J7MA 4HONA 4QHBA 3VBFA 4CUCA 2ILMA 2VVDA 4IE0A 4IW3A 4D6SA 5JOYA 1ZZ8A 4JDMA 1R64A 3L2HA 1CWPA 1UAIA 2ZGQA 3ZN6B 4DS0A 4YM1A 1SBFA 2RV9A 4FSJA 3LKJA 3E6BA 4YGBA 4OI0A 2CYFA 4KBZA 3J9SA 1RUF2 1MQTC 2DVAA 2RDQA 1Z7S1 2VTXJ 2XH6A 3M1HA 4CEYC 1ZBA3 2J1RA 3MF6A 5J1XA 3RZGA 1LOAA 1LOFA 2RHPA 3ILNA 1QJY2 3MGUA 4BXFA 1CAWA 3AC0A 2VUCA 4BU2A 1NCQC 3HBKA 1YNAA 4LIUA 5C9AB 2V73A 4INDA 3WLUA 4IXLA 1DFQA 5L7OC 2XQRA 1W6OA 3I2FA 2WZR2 1PK6B 1AF9A 2PHUA 3ZFFA 2R071 2XR4A 1C57A 2E6VA 1DGRA 5F9TA 4QPWA 3VKNA 3TRSB 1X36A 4K8FA 4BLIA 3M2MA 5M0TA 2RM23 1S2BA 1RUH3 1PZ7A 3PJQA 4WM7B 5F37A 4OQ8A 1G86A 2CSGA 3BN6A 2GC1A 1GNYA 2GALA 2A7AA 2JEMA 3NAPA 4LBMA 1SFYA 4RR3A 4XBNA 4Y33A 5IVEA 5IFPA 4IDZA 4DB5A 4K6BA 1RL3A 2YUEA 1J3RA 3KT4A 4HPKA 1OH3A 4CP0A 3O1PA 2Z4FA 2X09A 4K1ZA 5DUXA 4R9CA 1WUVA 1L7RA 1JODA 5DAPA 1VBA3 1GQHA 4M4PA 3FLTA 1ZNPA 4JC1A 2RVAA 4LKSA 4Q26A 3SITA 3DPRB 4I0AA 4AFBA 4TSVA 3VDDB 1VP6A 1S2KA 5FZKA 1W8OA 1OF4A 3UT0A 1AL23 1ZBE2 2WS92 2RS51 3WF1A 3WNOA 4UAPA 5FMBA 1LAJA 1A8MA 4FFGA 1JS9A 3DYMA 3AYDA 3POYA 4XAEA 5CYYA 1NA1A 4AVAA 1WD3A 3O1OA 3GZAA 3I2OA 2X5IC 5GLVA 2VMEA 2R49A 2FDKA 4YLZA 3WQBA 1HRI1 1V6KA 3ZSLA 4YW3A 5GM0A 3PMSA 4AI1A 4QB2A 4Y20A 5FTTC 5D2AA 2QZ2A 4NVPA 4UFIA 2YFZA 1QJX1 4W50A 2QCSB 3T4VA 1ASJ3 1UOBA 2IZWA 4JGZA 1SBEA 4CUAA 2YYOA 1JI6A 4XFFA 3JD73 1H2LA 4CDQC 4QX0A 1OT5A 1VBC2 1WCQA 2GNTA 2YU1A 3H7JA 3BVCA 4MGKE 4Q1PA 4Q4V1 1ZZCA 1OQDA 1UOJA 1IS3A 4DEVA 1MS4A 2E9QA 4P9XA 1G9FA 2VH9A 1QXJA 2BERA 5FYZA 1RJ8A 5F5CA 1H8TA 4NWWA 5IK8A 1LESA 1XE0A 3VL9A 3O0WA 3WP6A 4F8AA 4Y22B 3AMQA 1LOBA 4B8EA 4OI2A 4HN1A 5FAXA 5T55A 1UD1A 3I97A 1RUF3 2XUEA 1UY0A 1IG0A 3LA3A 3NKGA 3ELNA 5C33A 1JHJA 1IGOA 2WN2A 4L92A 3I8TA 2Z5WA 1JYVA 1OSGA 1HW5A 2DCJA 4QU1A 2QQLA 4OHYA 3LIGA 1QJY3 1ZA7A 2NZ9A 2XJRA 3OF1A 4RQPC 3RRDA 5JMOA 4NAMA 5APAA 2EXKA 2K0GA 1O8PA 2WA4A 4IV1B 1J3QA 1R081 1WD4A 1HRV1 1B35C 2HEYF 4AEJA 5FLIA 4KBBA 2WZR3 4GB32 3E6CC 4MXWA 1HXS2 2OZJA 1DYOA 1JTZX 2E53A 4B4QA 4R8HA 2WIIB 1YQ5A 1RJ7A 1REFA 4XPVA 1SZBA 2OQ7A 4HT1T 1HB4A 2BYVE 3D8CA 2RR11 4BIOA 5A33A 2HWF2 1H0BA 4FPJA 1VMHA 4MZUA 5CG8A 2UY9A 5DABA 1SLLA 1V6NA 2I2SA 2X8KA 3WVJA 4WV8A 3KGLA 2LUWA 2VAUA 1ODNA 1W04A 2QQVA 2Q8DA 3D5OA 1TNFA 4XFAA 1UQXA 2VZOA 2VVFA 5C5TA 2DUPA 1SBDA 3USUA 4CYDA 4LMFA 3URFA 2XJPA 1MS0A 1LOCA 2UU8A 4H3WA 1XYOA 4RFRB 4NIHA 1DYKA 1ND2A 4N90A 3HN1A 1A34A 1ND3B 3UKTA 2Q1FA 1ZBE3 2WS93 3NV1A 4GH4C 4YZ3A 3I2KA 3RDIA 2JB4A 1AXYA 4OQ9A 5IHRA 2PMWB 4YW7A 4W4ZA 1OOPA 2GU9A 4NHMA 2H0BA 4DXZA 1W9FA 1TQ5A 4A41A 1GWMA 2OZ6A 4RHV1 3S0MA 3T0BA 5I0SA 3AJZA 1YI9A 1A78A 2RG4A 2J1EA 4BK4A 3C8XA 4UBHA 1R1A2 5KHIA 3D0SA 1KFUL 1MS5A 4XFIA 3BALA 1DQ1A 4N43C 5FO8B 3VLBB 3FN9A 5E6HA 4GD4A 1VBC3 5JI9A 1E5IA 3H8RA 3MW2A 1Q8VA 5LA9A 3VV1A 5GALA 4M3CA 1MEC1 4B1MA 1QJU1 2ZHMA 4D8MA 1XXNA 2FDGA 4FTSA 3CO2A 1ZZBA 4WVWA 3KF5A 4GMP0 5LBCA 4BDVB 1AJKA 3MIDA 1NXMA 3JXSA 5FZ4A 3OG2A 5I8SA 1H1AA 4E9KA 2WFF1 3ZSMA 3JB8A 5A7QA 1XYNA 2RS12 2VCMA 5LRRA 4WVMA 2FBEA 3O14A 3OUIA 3C7HA 5IVBA 3KV5A 4IEUA 5EJ1B 1F2NA 2WNVA 2XBO1 1TG7A 5FPBA 4ZS2A 4AI2A 2VQUA 3VBRC 1DGRN 5DAQA 1H2MA 3TB0A 3BIWE 3LA7A 1Y43B 4HLTA 4XUNA 3WNMA 4YZ1A 2UWAA 1OA4A 2HBUA 3CZJA 2YGLA 3N3HA 3CHXA 4Y5SA 1OXCA 1WGPA 2VUDA 1CX1A 1VR3A 3SISA 1HXS3 4BM8A 2DYCA 3AP4A 5HXMA 1US2A 2ZA9A 3FHAA 3KV6A 1HN1A 3T2OA 2BV4A 5FWJA 5C3SA 5E16A 1UPSA 2BQPA 2JXAA 1RGSA 2OS2A 3FBYA 3KM5A 3LIHA 5FV3A 1WZXA 2E32A 2WWUA 3HNBM 4E4HA 4Y4YA 2JDUA 1FATA 2HWF3 1W2AX 5EFUA 4Z2AA 2NM1A 1OA2A 3CKHA 1V00A 2CHHA 4H7MA 1MACA 1S0BA 4YW1A 5A3MA 3POJA 3VBFB 5GLUA 3BTYA 2D44A 5A6XA 3A0KA 1IQDC 2D6OX 3TWIA 3I3BA 3GHNA 4D6QA 2ES3A 4AHYA 4WZFA 2HBTA 2IWGB 4LOTA 2I07B 1ZVFA 4CCNA 1D2QA 5I93A 2NN8A 3ACLA 1POQA 2WO3A 3AMNA 2RMU1 1EV11 4JZRA 1O4ZA 4DNYA 4CVUA 3WF2A 2JDHA 2DCKA 3GXUA 1XNDA 2WUHA 2YC0A 5JDBA 1ULGA 4XETA 1OURA 3A7QA 1BBT2 1W6OB 5DMYA 2Q4SA 4CDUB 2XJVA 3IM0A 3MUY1 3VZLA 1JOBA 4XBLA 2ZX0A 2QNKA 4TN7A 1R1A3 4BE3A 2O0OA 1AR62 3P3PA 2HWB2 5F5AA 3T1LA 2VW1A 4EN0A 2QTWB 1CR7A 1S0FA 4I2OA 1GP6A 2DTWA 3H3ZA 3QLQA 3OY8A 2SBAA 3FL7A 1Q8OA 4DY5A 2RJKA 3M3IA 5J36A 3IDEA 2C24A 3OBRA 4RR3B 4QXKA 4XFGA 5DXDA 5J48A 4Q27A 3GNEA 2HEVF 2D6KA 1YIFA 3WG3A 1HIXA 4YVSA 4FFIA 1YFXA 4CU9A 3HJRA 1SCSA 4HSJA 4HOOA 1GICA 3NNLA 2NYYA 2AGSA 3AYEA 4TXWA 2CU5A 2WO2A 3NV4A 3O12A 4V1PA 3RZZA 1O3TA 2QQOA 1W2TA 2RS13 4Q0VA 2BWAA 5FJHA 3RVHA 2WQ8A 3A21A 4WM8A 4UXAA 5E8AA 3VBUB 4GA9A 4AEMA 1CIWA 3B02A 4QPGC 1FOD1 1NA1B 1PNGA 1JYTA 3WY6A 1QOOA 1PO21 4IGPA 5C70A 3RJ2X 1PZ9A 3S57A 5A3PA 2X53S 4XFBA 3AMPA 1W6MA 1JZ3A 2R7EB 2Y0IA 2W1QA 1S1AA 1W3VA 4GXLA 4LBKA 4RA0A 3HBZA 4C0BA 1JZ4A 2PFWA 4JGZB 3FFZA 3NNMA 3I7DA 4A6OA 3RGBA 4URAA 1GU3A 3VDBA 2XPJA 4LK7A 2WN3A 4OMDA 4QXCA 4WBBA 1VBD2 3N7MA 4HANA 2Q1ZB 5DZGA 3Q8CA 3J8F1 3M3OA 3C7FA 1U12A 2VG9A 2ZKNA 3VKFC 4JHZA 4NRQA 2CWMA 1D4VB 4AOCA 4KG0A 2QQPA 5FZMA 3HAGA 1H8TB 4IUGA 2D40A 1TME1 1BEV3 2VZUA 3GF6A 1XRUA 5J7MA 4FTBA 3NNGA 4CDXC 2BBVA 3B93A 4LHKA 4CP9A 3SNMA 4KU8A 5SV8A 4BISA 3FFQA 1RUNA 3MW4A 1R1ZA 3ZN4A 4Y3OA 5DDJ3 1ONAA 4JGYC 4BWOA 2ETEA 3BOWA 5HI0A 4Y5TA 3ETPA 2NPIA 2ZEYA 3IAPA 1F4AA 1V6LA 1LU2A 5KHHA 1Q56A 4H14A 1RUJ1 4ES8A 2MNGA 1W8NA 4M01A 5CBLA 5ABJB 4N53A 4CCDA 3O1RA 4DUWA 4FOWA 1BBT3 2JE9A 5FPXA 4EYUA 4COUA 2VXJA 4QB6A 1BMV1 4MXWB 2VW0A 1YFUA 3A22A 4JVAA 5LA2A 1X8EA 1S55A 1AR63 2DCTA 2HWB3 4QMAA 1ZZ9A 1VPHA 1BKZA 3WUCA 5A3OA 4IL7A 5K4LA 2D6PA 5J98B 3LFMA 4HVRA 4A45A 4CU6A 5A33B 1CAUA 2R061 4PF5A 3W5MA 4HL0A 4NHKA 1J1LA 2HWD1 2CV6A 3AL6A 5GZFA 5CU1A 1ENRA 1E5RA 4FPFA 3VHOA 3S30A 2R042 3ZKYA 1DGLA 4A7YA 2QQNA 3Q8AA 4LKEA 2P34A 1F8VA 3OOXA 4OULA 4QDSA 4XF9A 3R6SA 3USUB 4O65A 2GC2A 5C9AC 3V0BB 2I45A 1G9BA 1ND2B 5A6YA 1ZRFA 3SH4A 2FQPA 3FE5A 3OEAA 5FUIA 5H9SA 5I8TA 1DDLA 4QGMA 2FDIA 2G1MA 4EWAA 1MVEA 1PK6C 3T2TA 3K75B 4GJYA 1LHWA 4UW5A 3KB5A 4FXGB 1DBNA 1OOPB 2VE1A 1OC1A 1Z78A 5FYMA 1AX1A 2XKPA 2NQYA 2YY1A 2FCVA 4DXSA 1Z7S2 2ATFA 2JIGA 1UNBA 1YHFA 2ZAAA 3IPVB 4S2FA 1UW8A 2EXIA 3ZFGA 3ZMOA 2BPA2 2A6XA 4WM7C 1ALYA 3ALQA 3NJVA 3WXPA 1NCRA 3ACIA 4MV2A 3ZYGA 3GM8A 1C3HA 1DCSA 5FPLA 4A6SA 1RUC1 2K2SA 5KXEA 2P5BA 4XUOA 4DOUA 1EP0A 3OGVA 1QEXA 2A3WA 2HWE2 2ZABA 4AXOA 1GUIA 5FMOL 4BPZA 1RUOA 5ERLA 4FFFA 2R072 5FPUA 4K21A 1VBD3 2WNUA 4LBLA 4S2HA 4EZHA 4MGTA 3IN9A 2YC2A 3AP7A 2YU2A 4AGVA 2B46X 3K4ZA 3CDZB 2WWSA 3AZXA 3DPRC 2KR2A 2O8OA 4NIDA 3VDDC 1ZA4A 2PHRA 4E2GA 2A5ZA 3WT3A 3MUZ1 5DPNA 5AC92 5CKMA 1QNYA 3BOPA 1EPWA 1PO12 3NRUA 1DG6A 1T6GC 4E27A 5A3TA 4LO4B 5B4XA 3PIJA 1LENA 1K5JA 2GN3A 4AVCA 1AZDA 2H6CA 4RL7A 1KXGA 1VBE1 2PYTA 4Y24A 4DO0A 4P00B 5BNNA 4DY3A 3BTZA 4DFSA 2ZMNA 3OGJA 1JZ6A 1W0PA 1US3A 2RS52 2WABA 2AR6A 2VMGA 1C1LA 4COVA 2BVBA 1NUKA 1SDDB 3M7AA 4DINB 5C4WC 2JDAA 1G7YA 4D0QA 1PIV1 4G3YC 2DUQA 5K0UA 2PHFA 4DZGA 5JPMB 3MIFA 3DYOA 5CG9A 1H2NA 1BQPA 4RN5A 1E5HA 3LAGA 3MEPA 2D5FA 3HN3A 3PUHA 5BPXA 3ZX7A 2EALA 1C8M1 4P14A 3O1MA 5DZEA 4B7EA 3N9MA 2R043 4YYOA 2OXBA 4P5YA 4YGCA 4A2UA 3MV11 5FDBA 5EYXA 5KR7A 1X9PA 5FZGA 5CFDB 3N4MA 1COV1 1W39A 4IV1C 5C3OA 5IVCA 3JU9A 5FIXA 3WHTA 4NPLA 5CFCA 1X7NA 4E4SA 2W91A 2PHWA 1C5HA 2DVGA 1G9CA 1VRH1 2XWJB 2BUKA 3BKZA 4IEOA 1AR81 5F1RA 5AFEA 4IEWA 4YZ2A 1TVGA 5C71A 4PIYA 3KCXA 3WG1A 3RI9A 5EYYA 4MGYE 3ZR6A 4YFZA 2VQ0A 2ZGNA 1Z7S3 3GHMA 2Q8EA 1OKOA 4QQLA 1G6NA 2DCZA 3GGLA 3NWKA 1UMIA 1YUDA 4JQTA 1PGW2 5FK8A 2TBVA 4BLJA 5BY5A 4EN6B 5JZGB 4HKWA 2WLPA 3T0DA 1AL0G 2ARBA 1HRV2 2BU9A 3NJXA 2JE8A 1A8DA 2HWE3 3FLPA 1GWLA 4HETA 2EXHA 4J1XA 5BUVA 3MLKA 3OY8B 5LK7B 2R073 4AVVA 5FZ0A 1O4TA 1RC6A 5FK7A 2BRTA 3DECA 1ZZ7A 2VZPA 3LDBA 1CAVB 3M8LA 4Q0PA 5CIRA 1OMIA 1ND3C 4Q5OA 2RR12 3WG2A 2W87A 5F7UA 4YVSB 5LCWL 2VZQA 4Q4Y1 1O91A 4P9WA 3RS6A 4BQ4A 5AC93 4CTEA 5T52A 4MLOA 1PO13 2PA7A 4QWNA 5FP3A 3H7YA 5LATA 4PDWA 5LBFA 1M4WA 2W94A 3K46A 1GYKA 4WM8B 4OHWA 3SH5A 4CEWB 5FFOC 4AAXA 4HSLA 2ET1A 2W08A 3ZXEA 1GR3A 2B9VA 1AL22 1LULA 2QQIA 3EJKA 3VB9A 4E4ZA 4IEPA 1VBB1 4UFJA 3DKQA 5FZ9A 5FP7A 3TAYA 1W2UA 1NY71 5LZ6A 3VD4A 5A1LA 5FYUA 1XNTA 2RDRA 4HBNA 2RS53 3WP5A 3VBSA 3NVCA 2J22A 3RSJA 4CUBA 1N1TA 3KCYA 4XDPA 2DVBA 1QF3A 3ST7A 3HMYA 3MDPA 4RS5A 2JKXA 1RUI1 4LITA 4XZUG 5KHJA 3RZMA 2KD7A 2VD7A 1DGWA 5CKNA 5K8SA 5KC5A 5FZBA 2ZGSA 5FZ3A 1HRI3 3EMRA 3RYRA 2XJQA 4OHXA 4BB3A 3OB8A 3I49A 4HKLA 1REEA 3AMHA 2FCTA 2CGOA 3JBG2 4LUMA 5DUVA 3ZYPA 3NL1A 5F3CA 4MHRA 5I0TA 4QX1A 1MZ6A 4KU7A 1IPKA 5KXDA 1NLSA 5FWEA 3W59A 1FPN2 2BGCA 2AC1A 3RZHA 4IE4A 1LGNA 1P8JA 3MZHA 4A42A 1MEC2 3M70A 2GH2A 1CVNA 2AEYA 5LEKA 1WW6A 5FY9A 1A3KA 5H9QA 3LPFA 4CP9B 4KWLA 5H9PA 1MQTA 1CESA 4CEYA 2ADEA 3JCIA 5IYYA 3HNMA 1SLCA 4CUGA 2YBKA 4XZPA 2ZX3A 3U07A 2ZACA 1UY1A 4I3PA 4YRDA 3MICA 5FYCA 4XXAA 2V09A 2YGMA 3OGGA 3S5QA 5L73A 3UNPA 2HH9A 2BNOA 5FXXA 2DFBA 4ZZ8A 5L7OA 5C3QA 1QXRA 2WQ4A 1JMUB 2EA7A 3OSDA 1EUTA 5DUUA 1HDKA 5BNPA 2WZ8A 1SLIA 5A7PA 1CZTA 4TLGA 1N1VA 3GZTB 1YRZA 4LTAA 3CBNA 1ZYBA 4P08A 1VALA 1F35A 1XNCA 2Y26A 1HRV3 4Y1ZA 2VZ1A 2JECA 4BXSV 1KQRA 1NLRA 3ACGA 4L2NA 4XABA 4UW6A 1X9TA 5GKAC 4B4PA 1CAUB 2P4EA 3LOIA 2JENA 3ZXGA 2ARAA 4GKYA 4IE7A 4NR1A 2D97A 2WR9A 2IFWA 2RR13 3I59A 3LSDA 3POBA 4RYDA 3WX5A 3KHCA 1OQ1A 1BCXA 3AP5A 1HKDA 2YPJA 2IVIB 4Q2FA 1S4CA 1V6JA 3TBDA 5FZDA 1AVBA 2NMOA 4XCBA 3K3NA 3BTXA 1RUG2 4ATEA 3ATGA 3SCFA 3KCCA 1NAEA 2RDNA 5FUPA 1KFXL 1PZ8A 2Q0AA 5FY1A 1ST8A 4CDUC 1POV1 2EIDA 1WW5A 2HWC2 5CEHA 3ILRA 1DQ2A 4NROA 1YCIA 3FWEA 2BVVA 4OI4A 3IMMA 1QMJA 1O6UA 5FQ0B 4D6RA 5C6CA 2WA3A 4M3CE 4FPHA 4MVTA 4LE3A 4K9SA 2FCUA 2VPVA 2ZEWA 3UL2A 4AEDA 2R1DA 3FC0A 4PLNA 2BNNA 3PU3A 4KQ7A 4WVZA 3FLRA 2Y34A 1AX0A 2LS6A 4XVHA 2GMMA 1QQP1 1RUE2 4QKDA 3EYPA 4RHV3 1RTVA 4MADA 4MSVA 5C8CC 3O1VA 1LHOA 1EUUA 1EAH1 1PVC1 3JBG3 5IK5A 4FP2A 2DTYA 1W8HA 2VOXA 4XTPA 1YFYA 4LXLA 4QKNA 1HV0A 3BPZA 1W9TA 4Z1VA 1GP5A 2VCCA 2WAAA 3ACHA 3CF6E 4Y1YA 4CXXA 1FPN3 1PX3A 4JQRA 3VBOA 5KXBA 1K45A 3PVOA 2WSVA 3VBUC 1MZEA 1TE1B 2ZZQA 1DIWA 1NA1C 1MEC3 3LD8A 4FPYA 1ZZ6A 1LEDA 1FV3A 1XYPA 1O59A 3HOBA 3B7MA 1FAYA 2WC2A 3BU7A 3P3NA 3SC7X 2QQMA 4B7KA 5BNNB 1OH4A 4RQPA 1UXZA 3VL8A 4TYSA 4S2GA 3AYCA 4Y4RA 1OUXA 2PAEA 1B35A 2PXJA 5FYTA 3U4SA 2J42A 4K20A 1BK0A 3PUAA 4PI0A 2PLV1 2UYBA 5JLVA 2DU1A 1D7PM 3THPA 3E6DA 5CVRA 1YQ8A 1OLQA 5IVJA 5KBFA 3HD8B 4XHBA 3KHBA 3S7IA 2W3JA 4L0PA 2VTXA 5K0UB 1MVQA 3CJIB 3C7GA 1N1SA 1F4HA 3KQRA 4I01A 4K7JA 1XJAA 4QKBA 1JUHA 2G9GA 4J6GA 5FLJA 2Z69A 2YBPA 4Q0SA 1DZTA 4IV3A 3O1TA 3LDRA 1W8FA 2WT0A 3AZWA 3FMGA 3LQCA 4YNIA 3RYKA 3LE0A 4B3NA 2ARXA 5FUNA 4O7XA 2VZ3A 1XQNA 2RDSA 2W0XA 3PJYA 4W6XA 3PUSA 1SLTA 1GZ9A 3HQUA 4RGKA 1AR91 1KS4A 4BQWA 3RWNA 4HG6B 1IOAA 3OTFA 1RUG3 5ABJC 2RM21 5ANQA 5FP8A 1ULDA 1Q8PA 5JR7B 5CFCB 2DVFA 3LDKA 2Q30A 1GWKA 4YPJA 4QPIC 4DXTA 1TME2 4KH9A 1NG0A 2YHJA 3FX3A 4LKDA 4PQ9A 2HWC3 4C91A 1NX9A 1XPWA 3ITQA 4GWNA 5FZLA 1HN0A 2AH2A 1F5JA 3CQOA 5FBJA 1LCLA 2VZTA 2FD8A 1PGL1 3WSOA 1UO9A 2ZEZA 2AENA 2Q8CA 2QFEA 4X8PA 2VOTA 2CGNA 3ZPYA 4CP1A 3ES1A 4ZZ5A 1RUJ2 1JBCA 1MZ5A 1DZQA 1XC6A 4GWJA 3J7NA 4N43A 3PTRB 1ZREA 5LBEA 4ASKA 2Z2SB 4LQRA 1RUE3 4NO4A 4LBQA 4CPBD 2AZ5A 4YW6A 4XBQA 1SACA 1KD7A 3NW4A 5JVVA 5KHGA 1ZRRA 1K5MB 1Z0HA 3VD5A 2R1BA 5EV7A 1ND2C 4KI5M 4MG2A 1T6BX 1SEFA 3PU8A 3BYWA 4UYBA 1SPPA 2FMYA 5FY0A 4AK3A 5ACA2 3Q8FA 3OCPA 2P2KA 2R062 1GBGA 1OF3A 3C7EA 4Q0UA 4OYUA 2PN5A 1OOPC 3I2GA 1QJFA 4OVEA 4Z8BA 1ASJ1 4I0BA 4FOYA 4LJHA 4PDWB 2AREA 2WINB 2VNGA 3H8OA 1JHNA 2Y6JA 1RXGA 3ES4A 3KZ4C 3KLSA 3PIGA 1GQPA 2VNVA 2ZGLA 3NV2A 2VTFA 4HXCA 2ID4A 3SKJE 2IXIA 3ZYBA 3KT7A 4BA6A 5F2SA 3VBRA 2Y60A 2K9ZA 2V72A 4UOJA 1PGSA 4LLFA 2CWSA 3DL3A 3VBSB 3E5UA 3MO4A 2OKXA 2XVGA 4MGSA 1RINA 4PF1A 2H6BA 4X8NA 4XURA 5FYVA 4FVVA 4RS5B 4QD2A 3UV9A 3U0ZA 3CJXA 2VMDA 4NE9A 4QAWA 1YEWA 3ZLIA 2XHKA 4XXPA 2WZPP 1CN1A 1MS3A 2JG9A 2P6HA 2L9LA 1HJGA 3HEIA 3BTAA 1OLRA 4IESA 1CONA 1W6NA 2VNOA 4J1WA 2XDVA 4R4ZA 3SEPA 3WNKA 1KGYA 4E8CA 1HQWA 2CNAA 5A32A 1JZ8A 3O1UA 2ZX2A 1LHVA 3AM2A 2DV9A 4YZ4A 5EJZB 5JAXA 3RYPA 1NKGA 1W8TA 3LOBA 3BODA 2VCBA 3WDXA 2QBXA 2BGPA 1AXZA 3A4UA 5T5OA 2GMEA 2XL9A 3O7OA 4TLFA 1U5YA 3AKQA 1WLDA 3P6BA 5FZ8A 1DQ0A 3ZMNA 1BEV2 3LPGA 1MQTB 4XUPA 3ZFEA 3AXEA 2Y6LA 4QQOA 3WQ1A 5BNOC 2P3YA 2VL4A 4IEVA 4QU2A 1TME3 1LGCA 3ME2A 4FQZA 5FXVA 4NJ4A 2E31A 2ERFA 2O1QA 2YROA 5DAVA 1NLQA 5DDJ2 2DURA 1H6XA 4X6QB 4EV0A 3LEMA 1CAWB 1AR71 4N7IA 3HR9A 4LUKA 4CCOA 1NQDA 3I3QA 2OIIA 4F83A 4OZOA 4R9AA 4CDWC 3DXUA 5BNPB 4NRMA 1CIYA 4QXBA 3BGAA 3ZSEA 4AI9A 3UETA 2XVLA 1UWWA 1RUJ3 5CADA 3N9OA 1JZ2A 4XJ8A 3ZFFB 4YM3A 1BVP1 1W8WA 2W46A 2VZSA 5A1AA 4FPKA 2A6YA 4IEQA 3WOGA 3SH3A 1ZBE1
chains in the Genus database with same CATH topology
3UK9A 4R52A 3ENRA 4MGIE 5DG2A 4AGGA 2XGXA 4LO7A 5CFDC 4A7ZA 1X33A 1KJRA 5ACA3 3AKSA 3NAPB 1SDWA 2ZCWA 3PVEA 4D7YA 2EF6A 1C4RA 4L8QA 2R063 3W9AA 4HPKB 4KWJA 5DZFA 1AXKA 3MIGA 4COWA 4FPEA 1ENXA 3INAA 1C8NA 4UW4A 1FMD1 1HX6A 3H9AA 1VBC1 3B3QE 2AUYA 4BQ1A 3H50A 3N7JA 1H30A 5JZGC 1IKPA 3FUOA 3KSCA 2EAAA 2ZGTA 3B01A 4WVVA 3VBHC 1W6QA 5JOXA 1FX5A 5IK7A 4AEDB 1IKQA 1C28A 1AR82 1PM7A 1UCXA 3RPQA 2R6QA 4BCUA 1AYM1 1H1IA 3CU7A 4Y20B 2KA3A 2PAKA 3FHIB 5FMOS 5EJ3A 2QUOA 3U10A 4F3JA 5T54A 4FQ4A 1O4YA 3PMEA 3UKVA 4QM8A 2RE9A 4PCRA 3QOPA 4NPRA 4CP2A 1H8VA 3VKMA 5J96B 2Q8OA 1OHFA 3ZXKA 2ZGMA 4WM8C 2IC1A 3VBOB 4GB31 5GLTA 4CEWC 2JG8A 4R9BA 1S0JA 4AFBA 4GALA 1HXS1 1OQEA 1C5IA 1UMZA 4EN8B 4CDXA 3JZVA 1H9WA 2DU0A 2ZAHA 3AK0A 4YVWC 4OHZA 3RI8A 3BCWA 4Q4Y2 5D8AC 4AFAA 4JGYA 4AFDA 2C9AA 4Q4W2 4IEYA 4RQPB 3SXWA 2WT2A 3GBFA 2D3RA 1UPIA 2XVKA 1V9U2 1UIJA 1Q3EA 2GAUA 4RSUA 5T5JA 4ZU7A 1VAMA 2CTVA 1AYN2 1VBE3 4YG6A 1C1FA 4SBVA 5LEJA 3D6EA 3AFKA 1IHMA 1VJ2A 1TEIA 4ATFA 1VBB2 1NY72 1QY4A 1XE8A 1DQ5A 3ZDSA 3WQ0A 1UU5A 2X29A 2GC3A 4K1YA 4AE2A 4IV3B 1RUI2 3IBMA 5I0RA 2QDRA 2ZHLA 5HXVA 5CNAA 3HIFA 2A6ZA 5I0UA 5IUQA 3I4IA 2JX9A 1D2SA 5GZGA 2A6VA 3OJBA 1C8M3 1R1A1 1ULCA 2BW8A 5C9AA 3OYWA 1I5ZA 1PNFA 3ILFA 4P9GA 5FOBB 5J37A 2XKOA 3R05A 3V0AA 4CZSA 3ROUA 2A70A 3FZ3A 4OFGA 1CAXA 2MEV1 2BWCA 2E7AA 2OUHA 2YZ4A 4QX5A 2WNEA 5JSOA 3VHNA 1JN2P 3RQ0A 1FV2A 3U11A 4XFCA 4CRQA 4WM7A 4QQHA 2ZGUA 2VVEA 4Y26A 3PLQA 1AR83 4DQAA 5JMCA 3MLLA 3ZO0B 2GNDA 2YMZA 4N43B 5FCCA 1O5LA 2RS11 3OD4A 4LBQB 3IMNA 1KITA 4AW7A 3N36A 2CAVA 3B9CA 3NO8A 5FO7B 2AYHA 3UKNA 3DPRA 3GALA 4YARA 3VDDA 2ZHKA 3AXDA 4M3CB 2P3JA 5B2GB 2XLGA 3VGIA 2ZKLA 1TMF1 2GZWA 3LB9A 5JOWA 3T1MA 4Q4Y3 3UJOA 3AKRA 4Q4W3 2ZMLA 4WVMB 5L19A 1DZRA 1YWKA 3PVBB 1SFNA 1V9U3 4L99A 4B29A 2WNVB 4Z2WA 3HWJA 1AYN3 3TNQA 2OVUA 1UKRA 1UF2C 4XJAA 2QVSB 2QJVA 5C4WA 1VBB3 3WP3A 2JJ6A 4W6YA 4YM0A 3WZ1A 1QXPA 3DGTA 2GNMA 1YJLA 3J4UH 2JG9B 1D0HA 1MZFA 3THTA 1MS8A 1W6NB 2VECA 2XJSA 5FREA 1HRI2 1LEMA 1RUI3 4E2SA 1OI6A 2FZ1A 3MFAA 4I02A 1QJX2 2LM3A 5JOZA 4AWDA 1EAH2 3G7DA 1RHI1 2B7YA 4FP3A 5E88A 5BNNC 2C5DA 3SMHA 4Q4V2 2E7QA 2BFUL 4P9LA 4IV1A 5T50A 2A6WA 4GIQA 5FPZA 1KDMA 3ZFEB 3TYJA 4YW5A 4AI3A 5AVAA 1NQJA 3C2UA 5I91A 3H1WA 4F7ZA 2D43A 3AKPA 3MPBA 2RS31 3CJIC 4YW4A 2D93A 1PMIA 3M4FA 3E5QA 4PBPA 4XTMA 1FT9A 4LNVA 2PLV2 5LRSA 3WHUA 1R082 4LLOA 4GQ7A 2ZOEB 1QDCA 3DUIA 1GKBA 1S0CA 3MF9A 4URTA 1OA3A 1W0OA 2R16A 2NLRA 2DCYA 4XQ4A 4M00A 4SLIA 3DV8A 3GBWA 3NV3A 3JUUA 1L3JA 4BYYA 4ONUA 1GSLA 4LBNA 4AQTA 4Q8KA 3JB4C 1ENQA 2HEWF 3IT8A 1QOTA 4P9IA 1AR92 4D3WA 4XJUA 3U4XA 3ZYIB 2PHDA 3WD5A 4QQ2A 1WW4A 4P9YA 1LR5A 4FO9A 4AFMA 1AUYA 1BVVA 1POV3 3N7KA 5GZDA 4DRRA 2R30A 1K5MC 1YLLA 1F5FA 2WQZC 1YXWA 3H0OA 1W6MB 2A3YA 4YG0A 4YW2A 4JAAA 2O8QA 2B42B 3G6JB 4Z92B 3DF0A 5H9RA 4RHV2 1CD3G 4RFT0 5EXOA 3MPPG 1REDA 4FPOB 4GWMA 4PDWC 4Q4X1 4UBGA 4R9DA 4TZDA 2NMNA 4YGDA 4ASMB 1QJX3 3QCWA 1EAH3 2JG8B 4WZCA 4XJWA 2ZZJA 5LK5A 2JICA 3EXUA 4LULA 3TN91 3D0JA 3B94A 4Q4V3 4CDXB 2PHTA 5GLWA 3ASIA 2D6LX 4JGYB 1UZZA 1QJU2 4ES9A 4Q0QA 3PTYA 5HBAA 4N9HA 1NE6A 2PTMA 4FAGA 3VZOA 3WW1A 1ENSA 1DLLA 2RJLA 3K51A 1NCQA 2WFF2 2R041 4I3GA 1RMU1 3QACA 4N53B 1WBLA 1LHNA 4YM2A 1GLHA 4JRLA 4ISRA 1E57A 2XBO2 4QPYA 2F6BA 1YI7A 2G9FA 2E51A 3VZKA 1QJZA 2PLV3 4AYUA 5E89A 4YSFA 3M3EA 1LJ7A 4FXKB 3AZZA 2PELA 5HCAA 1R083 3VBFC 1D4M1 3N35A 4FOQA 4FOVA 2W39A 4ITCA 4LBOA 4META 4MH0E 4U2AA 1J58A 1QHDA 1RVF1 4N7UA 5F5QA 3SCGA 2P3KA 3WG4A 2A3XA 3RG0A 1DF0A 4XQWA 3EO6A 1OPMA 1MS9A 3OYWB 3D4KA 4EN9B 4JDNA 1LOFC 4A3XA 2ZGRA 4AHWA 3V0AB 4GKXA 3HQXA 4CDUA 2HWE1 1I1EA 3PNAA 3VZJA 5BNQA 4FTBA 4XYXA 5BNPC 3VHRA 3PVNA 4AHZA 4Y5Z0 4U36A 5KHKA 1CAXB 2XJTA 1QGLA 1AR93 3WCSA 4NOTA 2VGDA 4EWDA 4QT6A 4JCKA 1EYBA 3ZFFC 4BH9A 4MX3A 2UYAA 4ZU5A 1RUD1 1SLBA 2X5IA 1CJDA 2B39A 5AC91 4HKOA 2RMU2 2ZGPA 1EV12 2JKBA 1PO11 3ZFGB 2VULA 2A71A 4PLMA 5AFBA 2FZ2A 1AR72 4JRAA 1NCRB 1ZM1A 3ZIWA 1NOVA 4R4XA 3FJSA 5C8CA 3WDWA 3NAPC 4RR3C 1FNZA 2KM2A 3VN4A 4GMP1 1BYHA 1LU1A 4CDQA 4YGEA 1W6PA 2E7TA 2WNUB 4P9JA 3VKOA 4XF3A 1O5UA 1YIPA 4DMIA 3VBUA 2WKKA 1WMFA 4YG3A 2A75A 2ENRA 2EIGA 1GNHA 1SQ4A 1ZRDA 2IXLA 4AEDC 5BXXA 1RIRA 1QJU3 2R32A 3BB6A 5FOJB 5C8WA 4XFHA 1R091 2D98A 4OUMA 5GJ6A 1FMD2 3AMMA 2ZGOA 2WFF3 1AX2A 4XJZA 4BOWA 4JGZC 3LCPA 1GQGA 2VNRA 4LE4A 5BYNA 2YDEA 4XMIA 2GMPA 5C4WB 3QBQA 5JSRA 5JSPA 5T5LA 2XBO3 2XWBB 3AP9A 4ORFA 5HCFA 1FOD2 3CNAA 1LOGA 4E2QA 1PO22 4KNCA 5AVPA 3VBOC 3SHRA 2GNBA 4LO8A 1G8WA 1LECA 4JTNA 1AYM2 1H8TC 1ZBA1 2Q5TA 2UWCA 4DRVA 2ZGKA 1BZWA 4XJ9A 5GZCA 2I74A 2OW4A 5FLHA 3ZXDA 1VIWB 3I2DA 4L9BA 1PGW1 2VQAA 4QM9A 5ABJA 1QNWA 1WBFA 4QQPA 3J8F2 1VB2A 2NP0A 1SCRA 4QPIA 3AX4A 4LBJA 4W6WA 4G9SB 1IQAA 4HVQA 1RUH1 4JTOA 4GH4A 2GN7A 3CEWA 3E5XA 1N47A 3X29B 2QZ3A 4BIFA 2RMU3 4IV3C 4Q29A 1EV13 2EXJA 3WDUA 3S7EA 2D6MA 4KWKA 4FCAA 4C1XA 3MW3A 1GFF2 1UKGA 1AR73 1N3QA 1PHMA 1VBA1 1N1YA 3DN7A 4XXAA 1HQLA 2ET7A 2P37A 4P5HA 3EHKA 1PVXA 1I3HA 2ZX4A 4G4FA 2XLFA 3IKWA 1QU0A 4Z07A 3V0BA 1UL9A 1AL21 5SV5A 1BMV2 3MI8A 2D3PA 3LWCA 1KRIA 1KJLA 1HV1A 4Z82A 2VOWA 4GULA 1X8MA 2FMDA 1RITA 3H1YA 5IT6A 3M3QA 1V70A 4AI8A 4EROA 3IPVA 1DHKB 1SLAA 1Y3TA 4XILA 2HWD2 3KD4A 1I6XA 3NSTA 2F4PA 3QD6A 3JBG1 2VMIA 4RGGA 3JD71 3ZSJA 5GLZA 1POV0 1JUIA 1BK1A 2IFRA 4KL1A 5TSWA 1UN1A 4AI0A 1J59A 1FMD3 3WCRA 2ZHNA 3AYAA 1G9DA 1FPN1 1ULEA 3MIEA 4IEZA 4K40A 4AEKA 1ULFA 2XLAA 2MEV2 1VLNA 1LOEA 4FPLA 3JQXA 2V5YA 1H4HA 2YXSA 3D82A 1Q8QA 1SMVA 4C1WA 1FOD3 4L11A 1GZCA 5L36A 1PO23 3POSA 4LHNA 1RUF1 3K48A 2EAKA 2HKXA 1NYWA 4HN0A 1AYM3 2JD4A 1UX6A 3TOJA 4IETA 1QJY1 2XB6C 4LR4A 1RUC2 3AJYA 1V6OA 5EZWA 5CB7A 2Y38A 1JYCA 1NZCA 1N3PA 4BMBA 2MPFA 1LODA 2WZR1 4Y1UA 2QE3A 3EBRA 2XL7A 3QH7A 4LO5B 2WNVC 2JE7A 3V64A 2D7FA 3J8F3 5BNOA 3MIHA 2YV8A 4GB33 3A0NA 1B09A 4XE9A 4HVOA 4CEYB 2WSUA 1TMF2 1X82A 3AB0A 4OUSA 3H1MA 4XF4A 2PHXA 3RNSA 1CX4A 1NCQB 4D94A 1O3SA 2JG9C 3LA2A 1Q5OA 1WA4A 4LA2A 5E1RA 3KGZA 4CDWA 4C90A 1CQ9A 5L7OB 1VBE2 4MGZE 1IS6A 1XU1A 1F31A 1IS5A 5T5PA 1RUG1 3GYDA 5FRAA 4Y1XA 2VUAA 3SLIA 3WDTA 2CY6A 2HWC1 2VUJA 4ISQA 4OLLA 5FBZA 5J48A 2D5HA 4K3UA 5CFDA 5JWPA 2WS91 2G4IA 4KGQA 1VAVA 1Q8SA 3AZYA 3ZFEC 4TWTA 1JH5A 1IZ3A 3OD0A 3VZMA 5J09A 1PIV2 4S2DA 1QDOA 3WR0A 3ETQA 4D69A 1GZWA 2HJIA 3I59B 5F6KA 1J1TA 1CPMA 1V6MA 1EY2A 1U5IA 1RUE1 1C8M2 3ZVXA 2HWD3 1DQ6A 1RHI2 2XJUA 2VMHA 3ZXJA 3GZUC 4XMAA 4QGNA 5JZGA 4FTEA 1Y9QA 3R0RA 4ZU4A 4YZ5A 1H9PA 3KMHA 3RMYA 5A3LA 3VBHA 1QKQA 4QPGA 1OD5A 4MUVA 4JV4A 1NXD1 1COV2 2JDZA 2X5IB 4A7KA 1NE4A 4XF1A 2MEV3 2W68A 2HYKA 1O3QA 1HLCA 1WMDA 2QDNA 1VRH2 1CAVA 2Z79A 5IK4A 1ZX5A 2RS32 4C0HA 2B8MA 2D3SA 3HT2A 2A73B 1S0DA 2DVDA 1H4GA 5D1IA 5C8CB 3MIBA 4XEZA 2QKDA 1TNRA 2ZMKA 3NJZA 4CDQB 4YVSC 4LHLA 2PAMA 1W6PB 3WNXA 1IS4A 4W65A 5CAZA 5CA6A 1A6CA 1DU3D 3PHMA 1RUC3 3ECQA 4O9GA 4ASLA 4CEWA 3WINE 3AKTA 1WW7A 1M06G 4PIXA 2VOKA 2ZJCA 4YVWA 2BEOA 2C0ZA 5D8AA 1BJQA 1GNZA 3WDVA 1OPOA 1YO8A 3ZXFA 1WLTA 2OA2A 1TMF3 3OPZA 4X6RB 4XIOA 1O3RA 2HWF1 1V6IA 1FNYA 1QH7A 1ZRCA 3GBGA 2KXLA 4QGLA 4O9EA 2Z42A 2UWBA 4KGGA 1B35B 4RD7A 3ZYRA 2XG3A 1QWRA 5JPNB 1FI2A 2MHFA 4COYA 4MYEA 4NHLA 1O7FA 2GDFA 2DWRA 2GH8A 2B9UA 4IERA 1BXHA 2JG8C 4Q1RA 1LRHA 3L9JT 4FBFA 5JIUA 4AQ6A 3KS7A 3ZN6A 3NKTA 1CGPA 4JDOA 3UJQA 2WLQA 1XU2A 1PIV3 1DQ4A 2IXKA 2BFUS 2ZTNA 4Q4X2 5KWRA 4FPGA 1F9KA 1N3OA 1LB2A 1H2KA 1AHSA 2CL2A 1RB8G 1U5ZA 2PHLA 4QPIB 2C1FA 1RHI3 1CJPA 1WCDJ 3ZIXA 4N53C 3ZYJB 3TN92 3RJRA 5J3UA 4GH4B 4NN0A 1PK6A 2GC0A 2CGPA 5ACA1 2D6NA 1COV3 2SLIA 4PBOA 3WV6A 4EJRA 4ZXKA 5JCTA 3WW2A 4M3CF 2IXHA 1VRH3 1APNA 5DG1A 3O0VA 3O5SA 3ZXAC 2RS33 3ZN5A 4PJYA 5BV6A 1RMU2 4FAHA 4DPNA 4B4RA 3O0XA 2OPKA 2WFPA 3B9IA 2ZPXA 2BTVC 2DF7A 4XDQA 5FO9B 3AFGA 2VW2A 4XF0A 1LTEA 3MFCA 1D4M2 3IWZA 3H8UA 1VAKA <