1GZTA

Pseudomonas aeruginosa lectin ii (pa-iil) together with fucose
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
114
structure length
114
Chain Sequence
b'ATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNETAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILTNELNFALVGSEDGTDNDYNDAVVVINWPLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FUCOSE-SPECIFIC LECTIN
molecule tags Lectin
publication title Structural Basis for Oligosaccharide-Mediated Adhesion of Pseudomonas Aeruginosa in the Lungs of Cystic Fibrosis Patients
pubmed doi rcsb
total genus 21
structure length 114
sequence length 114
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2002-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07472 PA-IIL Fucose-binding lectin II (PA-IIL)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.400 Mainly Beta Sandwich Jelly Rolls Calcium-mediated lectin 1gztA00
2VNVA 1W8FA 2BP6A 2JDMA 2JDNA 2VUDA 5A6QA 1UZVA 5A6YA 2BV4A 2JDHA 1OXCA 1W8HA 4CE8A 2JDKA 2WRAA 4AOCA 2JDYA 5A3OA 1GZTA 4UT5A 5HCHA 2CHHA 3DCQA 2VUCA 2WR9A 2JDUA 3ZDVA 5A70A 2BOIA 1OVSA 5A6XA 5D2AA 2JDPA 1OURA 2BOJA 1OUXA 1OUSA 5A6ZA 2XR4A 1OVPA 1UQXA
chains in the Genus database with same CATH superfamily
2D5FA 1SFYA 3MIEA 3SMHA 1OOPA 1OQDA 4LO6B 1R083 1RTVA 5LASA 3ZPOA 4RQPB 2DCKA 4XCBA 4A6OA 3SCHA 3TEXA 3WSOA 3AXEA 3ASIA 3P3NA 4KMQA 1JYIA 2G9GA 4BK5A 3M3IA 2ZACA 4Y33A 4C0BA 2VMHA 5IW0A 2IXKA 2LTNA 2LM3A 2EVXA 2JDAA 2JIJA 3IAPA 5F5CA 3MF6A 1V9U3 4CDXC 1WLWA 1JZ4A 4BOWA 1O3RA 2Y33A 4NRQA 1AX2A 1LCLA 1XU2A 3KB5A 4WM8A 2HEYF 1AR73 1VBE1 1W90A 4K20A 2JG9B 2Q8OA 1UZYA 2QUOA 1DGRA 1ENRA 3VBSC 3VKLA 3WOGA 2R043 2QQJA 2E33A 4YVSC 4YSFA 5CFCC 1HW5A 1HJGA 1HRV3 1TE1B 3CHXA 4UOJA 2C6SA 3VDBA 3NQHA 3BTZA 1C8M1 2OIIA 1O3TA 3NJZA 4COUA 4AG4A 3WQ7A 5TSWA 5JPMB 4N43C 4D7TA 3H1MA 2CTVA 2DTYA 5EJZB 2A70A 2W5FA 3O0WA 4QDRA 4XIOA 2IFWA 5F3CA 2E51A 1WLTA 3I2JA 5IYYA 1UOGA 5A6ZA 3FWEA 4LUMA 1JZ8A 5ABJB 1SLCA 1GUIA 4IE5A 3O14A 3APBA 2NLRA 2W9XA 4YW5A 4CRQA 3JB8A 1O8PA 1HRI2 1ZVFA 2HEVF 2UWBA 3LF7A 3N4MA 2Q1MA 5A7WB 4IUGA 5FWJA 2PQQA 3GZTB 4XETA 5JVVA 2OKXA 4DUWA 5IK5A 1UMHA 2ZGUA 4IEXA 3OY8B 4GWJA 2R072 1JI6A 1CAXA 4J25A 4L11A 4WM7A 3ZSKA 2EALA 3OGRA 4UI9L 1AR71 1K5MB 1ZA4A 1SPPB 3SXWA 4Y4RA 1W03A 4AEKA 4LLOA 5GLVA 4QXKA 4LLFA 4HPKA 1KEXA 1PIV3 3ECQA 1W99A 2ZHMA 4CCNA 1AX1A 3DYOA 3MO4A 5FMDA 4S2HA 2WBKA 5SV8A 3NNGA 1JOJA 2WFF3 4YVSB 4FFIA 2AZ5A 5FZ7A 1A8MA 3B00A 1H8TC 1QQP2 1ND3A 3NNMA 3OD4A 4E27A 1EP0A 4GA9A 3WR0A 3NL1A 2TNFA 5C8WA 2PAKA 1CZSA 2WO2A 4OUEA 4R52A 5C3OA 2FDJA 3URFA 3LB9A 2ARBA 4W8JA 4JQTA 1ZBA2 5FMOL 3JD73 2D3RA 2HWC2 4GMP3 4IL7A 4Q5OA 5EYYA 4AFAA 2XBO1 1W9SA 2R32A 3VN4A 1KFXL 3EB7A 4UW3A 2QQPA 2V5DA 4FPJA 4KG0A 3ZXJA 4E8CA 3IMMA 4WM8C 2VJXA 4AAPA 4RQPC 1FPN3 2WA3A 3N7KA 1R092 1XNTA 2PLV1 1LECA 4ATEA 2K46A 2VTXJ 5JOXA 3VLBB 1JODA 5IJRA 4Q0UA 4FVVA 3RFRA 1OD5A 1I9RA 4XTPA 2VPVA 1UY1A 4E4SA 4M0HA 4ONUA 1JH5A 4HT1T 2XQRA 1W6OA 5GM0A 4QGNA 2YMZA 2W1QA 1H4GA 1NCQA 3BB6A 3RS6A 2QKDA 3JCIA 4IE0A 5KXDA 5KXBA 4HVOA 3M70A 1OQEA 5FRAA 1QDCA 2WYSA 3VZJA 4QQOA 4DB5A 2B8MA 2ZMNA 3NV1A 4LA2A 3OGSA 3D0SA 4ZPIA 4CVUA 1W9WA 1V6OA 3NSTA 1KD7A 2ARXA 5BNOC 3VBFA 4BK4A 1U5IA 4QM8A 1TEIA 1VJ2A 2X5IB 4EN6B 2WNOA 1H1AA 4LBLA 1LOFC 3M2MA 1OPOA 5A3UA 4P9IA 1NCRA 4IEVA 2VBPA 1UXXX 2HEWF 1XYNA 3POGA 1RGSA 2BBVA 3ACGA 4QB2A 1L3JA 5L9RA 1I3HA 1VBD1 5KXEA 2QJVA 3VBRB 5HCBA 4QPYA 1H2NA 2BW8A 1VBE2 4EQVA 5HCFA 1MEC1 3C7FA 3LIGA 4M3CA 4QXHA 2EXIA 4QQHA 1R081 2CGPA 1ZBE2 3BOWA 4XQ4A 1YQ5A 3H7YA 2XL9A 4PIZA 5LK5A 3UGFA 4IEOA 3H3ZA 1JUHA 2CAVA 1J58A 4O65A 1OC1A 3WW1A 4NMIA 4CP2A 2JG8B 3M3EA 4BH9A 5L7OB 2XJVA 3RJRA 1HB3A 5C71A 2VW2A 1ENSA 3NJVA 5IVCA 4CEWA 2I74A 2LROA 2BFUS 2YPJA 4E2SA 1YIPA 3T2PA 4LKEA 1F8VA 3BOPA 3T3YA 2PAMA 4QPIB 1AJOA 5FK8A 5T54A 4B7KA 1QOOA 4BXFA 4LBQB 3RWKX 2QQNA 3NO8A 4JGYA 4BLIA 1ZBA3 1YFUA 2XJQA 3WINE 3UJQA 4UFLA 2CYFA 5FY5A 1AJKA 5FZOB 4HFSA 3IIIA 4LMFA 3WT3A 1HB4A 1QJFA 2UY8A 2Y6HA 4YZ2A 1E57A 5K0UB 3Q8CA 5F3GA 5I0SA 4FFGA 4RS5A 3KCCA 3NNJA 1RMU2 5FLIA 4Z82A 4JGZB 4CCCA 5CFCA 1LOFA 2JE9A 2WWJA 4XUOA 1GZTA 5ABJA 4LO7A 4D0QA 3JBG3 5HCHA 3HBKA 2ZGRA 1CONA 3R4DB 3ZM8A 1HRI1 1KXGA 4AF9A 2FD8A 2WZEA 2R1DA 1D7PM 3NAPB 1UPSA 5ERLA 1CIYA 1SCRA 1YNAA 2W87A 5DUWA 5C8CA 4JHTA 4MGQA 3RGBA 4QB6A 1NXD1 5FZEA 1DG6A 4LORA 3AYAA 5A3LA 1O5UA 1AZDA 1ENXA 2ZHKA 2E26A 1US3A 2O0OA 2ZKNA 3J8F3 2ZKLA 4A44A 1MVEA 3R4UA 2Y60A 1QU0A 2RDRA 4Y4YA 2D40A 5AC91 1ALYA 1J1LA 1JUIA 5BY5A 3W20A 2RDQA 2P3KA 1VLNA 2D6KA 3GM8A 2EA7A 3J9SA 3B7MA 1W9FA 3SH4A 5DG2A 4KI5M 2ILMA 4PDWA 4AZZA 1W04A 1YYNA 1NT0A 5LB6A 3RVHA 1HB1A 3MF9A 2W1WA 1S55A 2ERFA 3VKFC 2P34A 2QTWB 2PHWA 2BGPA 3TN92 1W39A 3FN9A 4I0AA 4UBGA 4GZ9A 2FZ1A 4B3NA 3F95A 3WDYA 5HPOA 2ZTNA 1S0DA 2VZTA 4MYEA 1LOCA 2RHPA 4UYBA 4Y26A 3WF3A 5CNAA 2EXKA 4Q8KA 1V9U2 5FOBB 2XWJB 3VZNA 2WINB 4HOOA 4FCAA 4ZXKA 3M4FA 5JSRA 5LEKA 3T0DA 2R1BA 1SLIA 4AR2A 4AQSA 1AR72 3ZXAC 4K3UA 3IDBB 2VQUA 4KG8A 3U75A 1QXPA 3AZWA 1RJ7A 3GBGA 1TVGA 3G6JB 4OLLA 1PVXA 4LR4A 4Y1XA 2MEV2 4UFIA 4MVTA 4Y20A 1KDKA 5FJKA 1FPN1 1C4RA 1SLTA 2YGLA 3I4IA 4HL0A 4FPHA 4QX0A 3UNPA 3IIAA 1I5ZA 1I1EA 5DMYA 2NYYA 2HWC3 5C8CB 3S0MA 3S7EA 4BWOA 1SACA 1M4WA 2PHFA 4MHRA 3VD5A 1LHNA 2Q0AA 1TNRA 3RWNA 1EUTA 3BVCA 1LESA 1RUC2 4GWMA 5CU1A 2XHNA 3TOJA 1UY3A 3VB9A 3ZSEA 5BUVA 1A8DA 1RINA 4H3WA 4L8QA 4LTAA 3ZSLA 1VBB3 4TN7A 5CAZA 1GWKA 5C3QA 1AR62 4QDQA 4QPIC 2ET1A 1O3QA 1PHMA 4XF0A 1W8ZA 4FPOB 3LA2A 4Q0QA 2VECA 3DL3A 5FJHA 1W6PB 1W8TA 2RDSA 2VCBA 1ND3B 3O7OA 3JZVA 3OY8A 2D97A 1FNZA 1VBC2 1RUD3 4WM7B 3MUZ1 1NE4A 3CQOA 2RS52 4D6RA 1O4ZA 4EN0A 4CP9B 5A6YA 5FQ0A 3BI3A 5LBBA 4Q4V3 2VMEA 2UYAA 2VZRA 3N7MA 1XBFA 2R30A 3DYMA 3ZSJA 2E7QA 2P17A 5G04L 3JB4C 4HG6B 1XRUA 4CEYB 5CISA 1DLCA 3OUJA 1PO23 2XJRA 2KM2A 2YBPA 3GYDA 3N3HA 4AK3A 2D6MA 4RSUA 2QZ3A 1AXZA 2WT0A 4HANA 2JDUA 4AI3A 2Y0OA 5FR3A 1OF3A 2QQUA 3AP7A 3GXUA 1QHDA 1VMFA 2PN5A 3POJA 2X53S 4Q4X1 1RUJ2 4HVQA 4R8HA 5KR7A 4OUMA 1CGPA 1ULDA 1YJKA 2BP6A 3J7LA 3UETA 1OF4A 2QQVA 3VDAA 1FMD3 2F6BA 2Y26A 5J98B 5GLZA 5I8TA 3ORJA 2WS91 3PURA 3W5MA 3GDBA 2V4AA 3DKWA 1W8WA 2GC0A 2E6VA 1EV13 1NLRA 1VAMA 4MHUA 4H55A 5F6LB 5IAVA 4CU6A 4MH0E 3VBSA 1ZBE1 4L2NA 1LU2A 4LBQD 1BBT3 1OD3A 3FZ3A 3KQRA 4INDA 1WKYA 1TME3 2FMDA 4V2VA 1REFA 5EFUA 2WZ8A 3B93A 3I59B 2YXSA 4GMP1 2W39A 3VDDA 3M7AA 2DUQA 1PGL1 1JHNA 1UF2C 4AVVA 4X6QB 1F9KA 1MZFA 3VDCA 4IEWA 1KJRA 1KRIA 4XDQA 2PELA 1SBFA 2CNAA 2RR13 4GD4A 4PF1A 3WW4A 4ES9A 1HQLA 4NIIA 4ASMB 2W1SA 1SPPA 1FV2A 2HLEA 3K48A 4GB33 3WP5A 5IVFA 2UURA 1MZEA 4IV3B 3VD9A 4JC1A 3B69A 1AR91 4JKMA 3AYCA 4IV1B 4FBFA 2CHHA 4QU1A 5JIAA 4NWWA 4U2AA 2VZPA 3T08A 3POEA 3VZKA 5IFTA 1DFQA 2VVDA 1LHUA 2YGMA 3PNAA 1NOVA 1FYUA 1RYYA 2OUHA 4OMDA 2F4LA 2WS93 3CL1A 3NW4A 5FCCA 3ZXKA 1RUJ1 4FFFA 2Y8KA 2JDZA 2XR4A 2VC9A 3MIFA 1BK1A 3VZMA 5A3NA 1VPHA 1OVPA 5E1RA 1W9TA 1QEXA 4YM1A 1EPWA 2IXHA 1VAKA 1NE6A 1OSGA 2BU9A 3KMHA 3KT4A 2PLV2 5I0RA 2W47A 1Y43B 5F5IA 2C9KA 4NIGA 3UL2A 2OPKA 5T5LA 3FLPA 4DUXA 5FO9B 1W28A 2A3WA 1GWMA 3BTXA 2V5YA 3P5BA 3T4VA 4HZFA 1HXS1 1OLMA 1JHJA 1UCXA 1YEWA 3ES4A 4FPYA 4WVZA 3VD7A 1G9AA 1E5HA 1NQDA 4E4HA 5BYNA 5FZMA 4CYDA 1H6YA 5L73A 5JDBA 1NQJA 5FMBA 4E2GA 3ACHA 5KHHA 5CIRA 2B9UA 4CTEA 4CZSA 2QNKA 4ITCA 5EV7A 1D2SA 1PNGA 2ZABA 1SLBA 1LGNA 4XAEA 4K8FA 1DQ6A 1XC6A 3IN9A 1DZTA 4YG3A 3PVNA 3QCWA 4AHWA 2MPFA 1IS3A 1N1YA 1J59A 1D2QA 1OQ1A 1ULCA 4EN9B 3ZLIA 3USUB 1HIXA 4BU2A 1S2KA 3ALQA 3OYWA 3MIHA 3T2TA 2E63A 1W9YA 1WLDA 2K2SA 1QXRA 4P00B 4AL9A 1VMHA 1S2EA 1WA6X 1LHVA 1DIWA 2OPWA 3V65A 4IGOA 4XZPA 2R071 2VUCA 4M01A 4LBKA 5CVRA 4AVAA 1LODA 3R0RA 1EV12 3VV1A 4BA6A 5DPNA 1WMXA 5DAQA 1O7FA 2D6OX 3LZZA 5DUVA 4AVCA 4FXGB 3EHKA 1BKZA 5JXIA 5FQ0B 3DECA 2GN7A 3BYWA 5CADA 2DCZA 5FV3A 4KGQA 1RMU3 3FUOA 2YU1A 4JRAA 4PF5A 4AI1A 3MBWA 1G8WA 1LEMA 2VOWA 1QJU3 2B46X 2GC2A 4FOVA 4FO9A 4MOAA 4QU2A 1PVC1 5FYYA 3VBRA 1IPJA 4KNCA 3M3OA 4NOTA 2UY9A 4S2DA 4CCEA 1UZZA 5HXVA 4Y1YA 4OI1A 4FXKB 4OHVA 2GH8A 4CPBA 1TMF3 4H14A 3WW3A 3VBOA 1QWRA 2O8OA 5JI7A 3SEPA 2IVIB 2GNTA 3J4UH 4D7SA 5JUVA 3GBWA 5AC93 4GJZA 2VQTA 3P6BA 1W2TA 3DXTA 5FUPA 4K8RB 5D2AA 2JDPA 2ZAAA 1QOSA 1TG7A 2J1SA 5JPNB 2JKXA 1I5PA 1PO21 1CN1A 1OOPC 1UQXA 1XPWA 3ABZA 2D98A 3KD4A 5FMCA 1VBD2 3DKQA 5FYSA 4XVHA 1ODMA 2P6CA 3J7HA 4Z2AA 4LBJA 4NIAA 1QGLA 4QXBA 3P1IA 1YI9A 2Y0IA 3D6EA 2BUKA 3LEGA 4JTNA 4Y1VA 5CB7A 4QB1A 3WCSA 4FAHA 1OFNA 1G9FA 2PHTA 1X7NA 2YV8A 3DCQA 1K3IA 3JU9A 4OQ8A 2W91A 3MV11 4AVBA 2LW8A 3M1HA 4GMP0 4FPFA 1PGSA 2AYHA 1REEA 2RS53 3IWZA 3LA7A 4JDMA 4CUAA 2VOTA 3ELNA 3RI9A 3WHUA 4EWAA 1Q8QA 4Q1RA 5A33B 2A3XA 4GIQA 5C5TA 1W06A 2QDNA 5FPUA 1NA1C 1XSQA 2QDRA 5I8YA 5FLJA 2KA3A 2Z2SB 1PO22 1F31A 2PHUA 1OA2A 2DTWA 3H42B 4NRPA 4PLMA 5I0UA 2AR6A 3VBFC 4CU9A 1QIQA 4I2OA 3O1TA 2HBUA 1NY71 4Y5Z0 4IE4A 1OPMA 3VL9A 3A22A 3N35A 3O1OA 1AUYA 2WDBA 2WNVC 2WO1A 2OW4A 2F17A 2WWUA 3IAQA 3VBHA 2EIEA 4UBHA 5FZGA 4TTGA 2XJUA 4L99A 3WDUA 4KU8A 3M8LA 4ATFA 1VBA2 2AREA 4OHYA 4RS5C 1WBLA 3ENRA 4RFRB 4RR3B 1ULEA 3MW4A 1PZ8A 3VBOB 1CQ9A 1JU4A 3QLQA 4R9CA 3ZX7A 3FBMA 1V6IA 3CJIB 5FYCA 1VIWB 4B4RA 4Q0PA 2ZJCA 5FY0A 4EYUA 1RC6A 3KLSA 1V70A 2JKBA 2RG4A 5IHRA 4JDNA 3T1LA 1RUI3 3WNOA 1UYPA 3WXPA 4YFZA 1AL0G 3ZXDA 1YFWA 1LJ7A 3ATGA 2Q4SA 2C5DA 4Q4W3 4WM8B 4B29A 2VOVA 3K51A 1HXS2 2WNUB 4ARXA 1POV3 4OQ9A 4RN5A 1NA1A 1MZ5A 5FO8B 4LBMA 3UK9A 3RPQA 3AKSA 3WG4A 4IV1C 3RMXA 5EZWA 1BMV1 3V0AA 3SHRA 1VB2A 2YY1A 3LCPA 4I0WB 4UFMA 1K5JA 4DQAA 1MEC2 2CGNA 2W08A 5AC92 4XAAA 5FY4A 4M00A 3DPRA 5B4XA 5A7OA 4ZS2A 2BWAA 2VVFA 3A21A 1KS4A 2RJ2A 1OKOA 4EJRA 1XNCA 1UX7A 1UZVA 2YYOA 3KV6A 3C7GA 4UF0B 5E88A 1AYM1 4D69A 5C6CA 1PMJX 2ZGPA 3LOIA 4UXAA 4C91A 4Q29A 2XUMA 4A6SA 1RMU1 1ZRDA 4MGTA 3KHBA 2IWGB 5ACA1 3IDCB 3SITA 3U37A 1NCRC 4CCJA 3ME2A 3S57A 5HV0A 3H8RA 3PMSA 4H7LA 4LE3A 1W6OB 1IS6A 4GJYA 2PLV3 3X29B 5DUXA 3WZ1A 4LK6A 4PIXA 3VZLA 4P9YA 2R073 4SLIA 3LE0A 3LDKA 1RVF1 2V73A 2VZ1A 1YUDA 3SH3A 1DQ2A 2WQ4A 1JZ3A 1MVQA 1W6NA 2H0BA 1Y3TA 4B4PA 4TYSA 5HI0A 5LZ6A 3AX4A 1GQGA 3HWJA 1FX5A 4XUNA 2V72A 1E5RA 2W92A 5ABJC 4O7XA 5A80A 4NE9A 3WV6A 2GC3A 2GAUA 1AXKA 1POV0 3VUOA 2ARAA 3O1MA 4PDWB 5C9AA 4FOQA 4JHZA 4Z2WA 1IQDC 3T4HB 2FQPA 3RZZA 1COV2 3OGGA 4N53C 4XUTA 4CDUA 3K2OA 1OURA 3AFGA 4P5YA 4R9DA 4Y24A 1UU4A 3GALA 4P9GA 5LY2A 3WDWA 2J1EA 4M3CB 4XHXA 2B4KA 1RITA 3V0AB 4AQ2A 4IV1A 1ZBA1 5FYMA 4GXLA 4TLFA 5EJ3A 2SBAA 1NAEA 1BJQA 5DZEA 3C7OA 3MICA 4XXPA 1ULGA 4GB31 2ZMLA 4TLGA 4IEYA 1GNYA 3H8XA 1CX1A 1K42A 2I45A 2VY0A 2Y6KA 3FHQA 5EQUA 4NO4A 3AZVA 4XUQA 4BQYA 3T1MA 3MLLA 1OBNA 3VDDB 5GZGA 1DQ5A 2OS2A 4COVA 1P8JA 2DFCA 3AKPA 4D8MA 5DZFA 4CA9A 2RMU2 1EPZA 2J1RA 4FOWA 1WCDJ 1JW6A 3PU8A 5FYIA 1DYKA 1C8M3 1FXZA 3MPBA 4URAA 1IOAA 1JXNA 1DHKB 1RXFA 1MS3A 2UWAA 2N7GA 2W2IA 3KF5A 1G6NA 4A7KA 1X36A 3AP9A 2JE8A 2ZCWA 4LT5A 1NXMA 4QDSA 4DRVA 2BGCA 2IVJA 4AOCA 2RS33 3HNYM 2W95A 2UU8A 2HWE3 3IPVA 2OXBA 4QM9A 3ZIWA 3TEWA 3VD4A 3POBA 4QPGB 3BCWA 1AL22 2D7FA 2JWPA 4TSVA 5GJ6A 2ZAHA 2VUAA 3CO2A 4JRLA 2VQ0A 4AW7A 3PLQA 1RUF1 1AR61 4XMIA 3JQXA 2JX9A 2NMNA 3MIDA 3NV4A 1YWKA 4URTA 4Q26A 3ZYGA 3HJRA 2VNRA 5DXDA 1T6GC 3EBRA 4XUPA 1H8TB 1BZWA 4LO8A 3G7DA 5B4NA 1KS5A 1WW7A 2VUDA 5T55A 3QH6A 3ZYRA 4Q4V1 4UW5A 1RUH3 1C8NA 1JYCA 2BRTA 1BYHA 3MIGA 1LKNA 5F32A 4HSLA 2FMYA 2KR2A 4X8PA 4XFAA 2WFF2 3AP6A 4Y5TA 1RUC1 3DPRC 5I8SA 1DP0A 5T5PA 5LCWL 3TEYA 3O12A 5CYYA 5A3WA 3H1YA 2R0HA 4FPLA 2W94A 4GAZA 4MSVA 3U1XA 1DQ4A 2FZ2A 1N3QA 4XQDA 3GCWA 2RDNA 1MR5A 3EQEA 5K9YA 3J8F1 1Y7BA 1Q8OA 5FYVA 3ZKYA 2GALA 1QH6A 5F2SA 1X82A 1XYPA 2YROA 4NPMA 3LQCA 3THDA 4ZHNA 1GLHA 1VR3A 5FAXA 5FKCA 1QJY1 1CPMA 4K1ZA 4BQ5A 1F5FA 2J42A 3WNPA 3ZFGA 2Q8DA 2A5ZA 2AH2A 2JDHA 4P9XA 3JD71 2ZGKA 4XURA 3PUSA 1WW6A 4OYUA 4JVAA 5HXMA 4PLOA 1S0BA 2VTXA 4HBNA 4TXWA 4FAGA 1DGRN 4J1WA 3PMEA 1RUE3 1UIJA 3UKVA 3ZYHA 2VZOA 4LO4B 4O9GA 1Q43A 2B39A 3OBRA 1KGYA 4KWLA 4DXRA 1CAWA 1R093 1AYM3 3HOBA 4ASLA 5EYXA 1OVSA 2ADEA 4M4PA 2ZGOA 2VOKA 4UF0A 4JGZA 4UW6A 1C1LA 1DBNA 2GC1A 2ZHLA 1HXS3 5D8AC 1D4VB 4LPLA 1ASJ3 1W8FA 3Q8AA 4ARYA 1O3SA 4LEJA 5FOJB 1MS9A 5HV4A 2VW0A 1S1AA 1PO13 2RM23 4LBNA 4QHZA 2WAOA 1UPIA 2PHLA 4ZXEA 5K4LA 2CV6A 3FFQA 3ZMNA 3KCXA 3RZLA 3U14A 2GN3A 3DGTA 4AE2A 2WO7A 2ORXA 1JN2P 3J8F2 2B42B 4YG6A 2BDRA 2JIGA 2FCTA 5L7OC 1LGBA 1DGWX 3IDEA 4KU7A 1PM4A 4AGGA 1TMF1 3POIA 4DO0A 1X8EA 1QF3A 2BNMA 2GNBA 2VZ3A 2P3IA 2ZXQA 5FZLA 1EAH2 4CXWA 2ZZJA 5FZ9A 1GP5A 1RUH1 4ZY9A 5FYUA 4KWJA 4BJ0A 1FMD1 5JCTA 4LOSA 3AZZA 4U36A 4RR3A 4AGRA 4EE2A 4YZ1A 4ASKA 1RVF2 4N90A 5D8AA 3O1PA 4I0BA 4AWDA 1Y9QA 1AR93 1QDOA 1NG0A 3ZFGC 1GZWA 4G4FA 5GLWA 4WVMB 1RUG3 3WF4A 2GMMA 3MLJA 1YQ8A 2A73B 2DUOA 3AYEA 2VZSA 3DPRB 2X5IC 3LDRA 1LAJA 3ZXGA 4PBPA 3B5LB 4CDUC 5EJ1B 2YZ4A 4Q4Y3 4IERA 4CUGA 3OUHA 1JZ6A 4RGAA 1EV11 3RZMA 3RZJA 2DBIA 4K1YA 5FK7A 2CDOA 1Z7S3 4XFGA 5F5AA 4COZA 3TAYA 4DRRA 4DXSA 3WX5A 4XF3A 5J48A 1J3RA 2MNGA 1F5JA 4X8NA 3PVEA 2WUHA 2VMDA 1O6UA 1X8MA 2WNVA 2IXIA 2WRAA 2Y6GA 4CDWA 1F4HA 2OVUA 2WFF1 2Q8CA 1ULFA 2DVFA 4I3GA 2ORZA 4GH4B 1ZA7A 1SDDB 5FUIA 1A3KA 1U0AA 3IT8A 4JKLA 5GLTA 5LRRA 5L9VA 3J7MA 4LK7A 4RHV2 4S2GA 3CNAA 2WLPA 3E1F1 5F37A 3B9CA 3N9OA 1URXA 1RUE2 3DYPA 1Z7S1 2NP0A 1D4M2 1W8NA 2CSGA 5JOWA 3BN6A 3JBG2 1RHI1 5DAWA 2UWCA 5FXZA 1C5HA 1W6NB 1NX9A 4HXCA 5AVPA 3FE5A 1G9BA 4YVWA 1ZREA 2WC2A 1AR63 5BV6A 2XBO3 4XDPA 4P14A 2FCVA 1CZTA 5M0TA 1V9U1 4ZONA 4R9AA 3A23A 3CBNA 1R1A1 4XFFA 3ZKUA 3VBUC 2BFUL 1HB2A 3O5SA 2OT7A 1VP6A 1PK6A 2EAAA 2EIBA 1ENQA 3VL8A 4CU7A 3AVRA 5FP8A 5FZCA 3H9AA 3TN93 1KJLA 5A70A 5AFEA 1COV1 3ACFA 2BPA2 1CPNA 3PUHA 4NR1A 2QQIA 4E2QA 3OJBA 4CEYA 3RMYA 2XHKA 2RMU1 1GV9A 5T3NA 2RS13 1IS5A 3EJKA 3KV9A 5GLUA 4RD7A 2A1XA 3H0OA 3O1SA 5IK4A 5DDJ1 5KHIA 3PVBB 4XF9A 4OZOA 5FY1A 4KQ7A 2BERA 4B7EA 3BPZA 1OLRA 3ZO0B 1ZRRA 4XIKA 2VXJA 4CDUB 4IEQA 3ZXLA 1HQWA 5IVBA 5ACA2 5FO7B 3I3EA 4AVTA 1R64A 4LHLA 4AXOA 5HBAA 4FOYA 3RYKA 4QQPA 4FFHA 2JJ6A 1HLCA 4YZ4A 2FDHA 3ZFGB 3BIWE 4LNVA 4EN8B 2WZR3 5A32A 1Z78A 3GF6A 5GZEA 1E5IA 1N1TA 2GP3A 4NUBA 5DG1A 1UZWA 1AR92 2JICA 1FOD1 1PZ9A 4XFBA 1WZXA 1PX3A 2BGOA 4R9BA 2VNVA 1R1A3 2A7AA 3B94A 5IFPA 1VRH3 2ZX2A 1SBDA 2W3JA 3PHMA 5F3EA 1FATA 3JQWA 4CXYA 1IQAA 2ZA9A 1PGW2 3M3QA 1PMHX 3MUY1 4BQWA 3VBHB 4I09A 3WNXA 1GP6A 1WWYA 4RQPA 1JTZX 5G05L 4META 3BIEA 1I6XA 3PTYA 3IM0A 5FZ1A 5IVJA 1RJ8A 2IXJA 1UMIA 2Z4FA 3OPTA 4A41A 2VCMA 4I30A 2DF7A 1GR3A 2NQYA 3AFKA 2LS6A 1O4TA 3TEZA 3FHAA 3HN1A 5LA1A 2Z5WA 4F7ZA 2D43A 5FP3A 4AVSA 2VULA 5F39A 1LHWA 4AQTA 3GGLA 1F2NA 1YHFA 1N47A 1BLZA 2JDMA 1UXZA 1LULA 4CCMA 4QX8A 5C4WC 3E5QA 2O14A 4I01A 1S0GA 4CU8A 1CX4A 1Z0HA 2CAUA 2NPIA 2XDVA 4V2WA 1OLME 1RUD1 3SCGA 4BISA 5F1RA 2RJLA 2R042 2X5IA 3GJBA 1OMIA 4HKWA 1CIWA 1WUVA 4OI2A 3HPNA 4RGKA 5E6HA 2SLIA 4CDXB 1ASJ2 1J83A 4LKFA 1HV0A 2WNEA 1AHSA 4LE4A 5JSPA 1GOGA 4GWIA 1HQNA 4FSJA 2VGDA 1HRV1 3AJYA 1G9CA 4Z92B 5FP7A 2EIDA 1UX6A 1FMD2 3HT2A 1SLAA 1RUNA 3ROUA 1OUSA 2ZMKA 2P1BA 3ZYIB 4MGYE 2D6PA 2EXJA 1VALA 1XOYA 4FTSA 4EZHA 2WKKA 4IQPA 3V0BB 1S0EA 2WQZC 1B35A 4BB3A 1YFXA 5JLVA 2HH9A 2ZHNA 1JMUB 2DBNA 3AC0A 3N7JA 2RS12 4OHZA 3ZFFA 3USSA 5KHKA 1RUF2 2YB7A 1OH4A 3VBOC 4Y3OA 3OF1A 3I59A 3CJXA 1YC61 4FQ4A 3KGZA 1QNYA 4A45A 3AP5A 3QACA 3N9NA 3RYRA 5BNPA 4PJYA 4XBNA 4ISRA 1LOEA 1EUUA 2XB6C 3CZJA 4ORFA 5B2GB 3RZKA 1CAXB 4MGIE 1GNHA 4P08A 3R4SA 1IHMA 3MLKA 2WNVB 4K9SA 1YLLA 1YXWA 3C7HA 2VZQA 5FZ0A 1W05A 3I7DA 3TBDA 4UFJA 5CFCB 1CESA 4NVPA 3MZHA 3KV4A 2J1VA 4AHZA 4S2FA 1WCQA 1UU6A 1PIV1 1RUG2 2Z69A 3NMBA 1CAVA 4IE7A 1CZVA 1Q56A 5FIXA 4H7MA 3DF0A 2YDEA 1CJPA 3FL7A 4NIHA 3FBYA 1WMFA 4QHBA 5BNQA 1RHI2 5C9AB 1W6MA 2OQ7A 4Q4Y2 1GNZA 2YC4A 3SEEA 2R6QA 1U5ZA 2XUEA 4NAMA 2HWB1 3ZXEA 1SFPA 2XKOA 5JSOA 4UFHA 1H30A 1UOFA 5FYZA 1PVC2 5J09A 3ACLA 1LNSA 4LBOA 2D5HA 5DQ0A 4QGLA 3JD72 5JXHA 4XILA 1MS0A 4IDZA 2BWCA 2YC0A 1OLQA 2YU2A 3AKTA 3OBZA 5FBJA 1SHWB 1S4CA 1JS9A 1XJAA 1GZ9A 1CJDA 1VE0A 1A34A 5FYTA 1UY4A 1ND2C 1N1SA 2VBBA 4CDWC 2DUPA 2ZX0A 1W3XA 4NJ4A 5FY8A 5I91A 4BMEA 3VHRA 4FPCA 3W58A 3FHIB 2AUYA 3D3AA 5EIYB 2HWF1 3PUAA 4RA0A 4YW7A 4Q1PA 3HNBM 3I2OA 3J26N 5DDJ2 4AI2A 2FDKA 4GALA 1QMJA 2OA2A 5A6XA 2NN8A 4N9HA 5HCAA 2ZGMA 5BNNB 2PHDA 1O59A 3ZSMA 1H8VA 3ST7A 2XOMA 1MS5A 5H9PA 3OYWB 1KDMA 1AL21 2P4EA 4J1XA 3ZN5A 4Q27A 5D8AB 2VMGA 1XNBA 5K8SA 3AB0A 5KHJA 5T5JA 3NWKA 1WLCA 2WSUA 3IPVB 1AYN3 4DS0A 2NMOA 2JB4A 2YBKA 1Q3EA 4JZRA 5A1AA 1YQCA 2BEOA 4QPGA 1Q8PA 1ZBE3 1UYYA 4ET7A 1H1MA 1O4YA 2BJSA 4NPLA 5BNOA 1JYTA 2CDPA 1RUF3 2A6XA 3MIBA 1W8UA 5CFDC 4JCKA 4YM0A 3HMYA 2ZGQA 4YW6A 4DY3A 2DURA 4LO5B 3AVSA 3RI8A 1BCXA 1CAUA 1WW4A 2AACA 4LJHA 1AXYA 1VBE3 5JI9A 3BGAA 3UJOA 3H1WA 5FXXA 3HR9A 1RUI1 2VOXA 4BQ4A 3WQ1A 1QY4A 4IEPA 1YFYA 4ZS3A 3I97A 2EAKA 1GOHA 1ND2A 1LU1A 1X33A 2VCCA 4XZUG 5DAXA 1ASJ1 5FZIA 1UIKA 4FPKA 4W6WA 3S5AA 1FPN2 2DVGA 4MXVA 5FYBA 3KF3A 5CFDA 4CEWB 4LULA 3MI8A 2YBSA 5EPAA 1LOGA 4XC9A 4GWNA 4P5HA 5L36A 3U4SA 2YUEA 5BXXA 3ON7A 1RXGA 3B9IA 5JR7B 2BVBA 4IEZA 4BM8A 2VL4A 5A6QA 2PYTA 2OUJA 2WAAA 5ANQA 2OZJA 3LFMA 1MQTC 3WG1A 4CDQC 4DFSA 2EXHA 5J7MA 4RHV1 2H6CA 2BYVE 1QJZA 4A2UA 3BPSA 2WYFA 3R05A 3AKRA 4JKKA 5H9QA 5K0UA 4IGQA 1JZ5A 3ZFEC 4MX3A 2KXLA 2GDFA 3KV5A 4O9EA 4QPGC 1H1IA 5IK7A 1JYWA 4AYUA 1VBA1 4TWTA 4AEDC 2AEZA 2W46A 2PXJA 2WSVA 4BPZA 4N7UA 2LUWA 3S6PA 2P37A 1UKRA 2C0ZA 2H6BA 2FDFA 4LQRA 3LPGA 3AL6A 4Q0VA 1UNBA 3T0BA 2IFRA 3UKNA 2WNUC 1GZCA 2VMCA 2VNOA 4XCAA 4B1LA 2RVAA 4M0NA 5LK7B 5LWBA 1JZ2A 4F3JA 4D7YA 1XU1A 1S0CA 1FOD3 1UL9A 4XF1A 3GCXA 1GU3A 3EXUA 2XLAA 3PJYA 3A0KA 1ZZCA 3QH7A 3AYDA 1W8HA 1NCQB 2C4XA 2ET7A 1CD3G 1VBA3 1XE8A 4K6BA 1ZX5A 1LHOA 3UESA 3WG3A 2P2KA 5EHDA 2FBEA 3MDPA 1J3PA 4AEDA 4PBOA 1O5LA 1YIFA 1BK0A 5JMOA 3IMNA 3UKTA 1UMZA 3LPFA 5JAXA 1GFF2 1VRH2 5A3MA 1DF0A 1DZQA 5FZDA 4N9IA 2JEMA 2HJIA 3CEWA 3LEMA 4XQWA 1JBCA 2WQ8A 1A6CA 3AMMA 5C3PA 1CVNA 3MYXA 5FPXA 1NYWA 1KFUL 1LB2A 3CF6E 1PK6B 3CMGA 3THTA 1ULOA 3FMGA 3AKQA 2JDKA 4N53B 1NA1B 4OUSA 2GH2A 3TNPB 2O1QA 5JZGC 3NNLA 1Y9GA 1X50A 3OD0A 3CKHA 3BTAA 2C24A 2ID4A 4XJ8A 3GHNA 1MS4A 4YM2A 2WL1A 3DXUA 2XJTA 3AJZA 5LA0A 2J1AA 4BQXA 1VBB1 2WN3A 3OGJA 4QT6A 1OUXA 3K4DA 5ANNA 3KHCA 4BE3A 2E9QA 1JYNA 4YW4A 3AMHA 5FPVA 2E7AA 2JXAA 2EF6A 5IVVA 2HWB2 2MEV3 2G4IA 4W50A 3LA3A 5DAVA 3UV9A 2BQPA 5I93A 3WNMA 3KS7A 4CDWB 1YJLA 1H2KA 4XACA 3H3LA 2PHXA 4ZU5A 1ZZ9A 1S0JA 4QX3A 5BNNA 2HWF3 2RMU3 5FDBA 2UYBA 5FYHA 3VZOA 4WVVA 5F2WA 2IZWA 1W2AX 4UWDA 3N9MA 1H2LA 1RUOA 5FPAA 4HMZA 1HX6A 1ODNA 2BOJA 2OYZA 2PA7A 1GWLA 1TQ5A 2J7MA 2HWE2 1UOBA 3ITQA 4XJWA 4B1MA 3QD6A 1NKGA 1US2A 1AF9A 4XDOA 4XJ9A 2NZ9A 4NROA 3KZ4C 3SKJE 3NRUA 3NAPA 4L9BA 2XG3A 2K0GA 2QQWA 1VBC3 3USUA 1FOD2 5AFBA 3I2FA 3VBUA 4BHPA 1IG3A 4D6QA 3PUIA 4C1XA 5GZCA 1IKPA 1XQNA 3ETPA 5LA9A 3T2QA 5FP9A 2JE7A 5L9BA 2A6VA 1W2OA 3GZUC 4YVWC 3V64A 4A42A 4C90A 5LY1A 1DQ0A 5A3PA 2ZEXA 1CAVB 2RS11 2ETEA 3WLUA 2OX0A 2E31A 4AQ6A 5A1LA 2H0VA 4QX2A 2LALA 1H9PA 3CJIC 5EWSA 5C70A 1WCSA 2WABA 1MQTB 4CDQB 4DIQA 1TME2 5FPZA 1LOBA 3HN3A 3T09A 2W1UA 4HKOA 4Q8LA 3VD3A 1MACA 3ES1A 2J22A 2R062 4JTOA 1ZZ7A 5FY7A 5BNPB 3K4AA 1G86A 4Z8BA 4CCLA 1QKQA 2XVGA 5J36A 1E5SA 4XFHA 4WZFA 1GZWB 1W2NA 4OHXA 4WZCA 1RUD2 3C8XA 1BBT2 5FREA 2R041 1JOBA 2C26A 3S7IA 3IZOA 3K3NA 4LUKA 1KQRA 3PDQA 5DUUA 5F7UA 3KWVA 3N36A 4NHXA 2R7EB 1GBGA 1JU3A 1HV1A 1XNAA 4BXSV 5FXWA 4CUCA 4P9JA 1FI2A 4BQ2A 1QOTA 1QJX3 1DYPA 2HYXA 1AL23 5IVEA 1C28A 4YM3A 3ETQA 1V6NA 1MZ6A 2JDYA 1PGW1 4CCDA 1RUE1 3BALA 4MZUA 1V6JA 2GU9A 3DV8A 4NHMA 4PQ9A 4XW3A 3DN7A 5K7PA 1W0PA 1LGCA 4MGKE 3I3MA 1AYN1 1XB9A 4C0HA 2HWD1 1IS4A 1O91A 3KCYA 4E8DA 1DLLA 4QMAA 4QKFA 4IETA 2ZGNA 1WCKA 1MS8A 3PIGA 5H9RA 3DEMA 1WMDA 2CWMA 2ADDA 2E32A 2ZS6B 4OFGA 4WBBA 5KWRA 3K3OA 2VTFA 3L2YA 4CP0A 2WS92 3I3DA 4FT8A 1DCSA 1AYN2 1XNKA 5IUQA 1AR82 1NZIA 1YO8A 3EMRA 2Z79A 1BEV2 1PM7A 2PFWA 3HVDA 3M3CA 5FZ4A 2DU0A 4W65A 4HLTA 3O1RA 4D3WA 5D21A 3TRSB 2ZEZA 5A7WA 4BIFA 2QQMA 3HBZA 1V6LA 4UT5A 1QQP1 1XE0A 3CU7A 1GMMA 2VQAA 1PX4A 2YFZA 4A3ZA 3I3QA 3LIHA 3MGUA 5C7GA 3MW3A 1C5IA 2BVVA 4FI9A 3TYJA 3WEZA 4BZ4A 1W8OA 2CU5A 4YGDA 4YW3A 2VCAA 3B3QE 3IKWA 1STMA 3OEBA 1PMIA 3OB8A 1OA3A 4PLNA 2P6HA 5FMOS 4YFWA 3WP4A 2DVBA 4QQLA 5D1IA 3LDBA 2RV9A 4HONA 4IESA 4Q4Y1 2V4VA 4B8EA 4NRMA 4XABA 1GP4A 2JG8C 3U0ZA 5C3SA 1GKBA 1ZYBA 5JXGA 3I2KA 3ZFFB 3FFZA 4OHWA 1UN1A 1XSRA 3D5OA 3I3BA 3RG0A 3NJYA 3WF2A 1YQ2A 2ARCA 4LHKA 3IDAA 4QKNA 5CBLA 2ZPXA 4P02B 1EYBA 2O8QA 2QZ2A 2X10A 3LWCA 4GB32 4PCRA 4Y22B 3VBRC 2FDIA 1HRV2 1S2BA 1LTEA 2ES3A 4N8MA 5A32B 5JZGB 2FCUA 4CEYC 3B02A 3H3UA 3TB0A 3O1UA 1BVP1 4WVWA 2DV9A 2XL7A 2A3YA 4IW3A 1WD3A 4I3PA 2A6ZA 4XYXA 1SBEA 1GQHA 2VZUA 2D6NA 4PI2A 4TZDA 3BU0A 1AR81 1PK6C 2Y38A 2PQSA 1SQ4A 3B01A 1DDLA 3PIJA 1BMV2 4RL7A 4QX5A 1WBFA 3ZYJB 3SCFA 5KC5A 2LRPA 4HVRA 4ZU4A 1W6MB 1D4M1 5KHGA 1W6QA 5JIUA 1ZZ8A 4GKYA 5EXOA 1UZ0A 4Y20B 5I0DA 4G9SB 4QX7A 5BNPC 5F6KA 3R6SA 2XBO2 3FUQA 2E7TA 3LEIA 3AM2A 1BBT1 2F4PA 5E89A 4L97A 2HWF2 2R16A 3OBAA 2X05A 4AFBA 4LKSA 4MGSA 3IB3A 1X9PA 1QJEA 2ZX4A 4EWDA 1PIV2 4EROA 1GSLA 3ZMOA 3HQRA 2G9ZA 4LOTA 5H9SA 4YWAA 3ZN6B 1VBD3 1LRHA 4YVWB 1V6MA 2ZGLA 1QQP3 1L7LA 5F3IA 3WD5A 4DZGA 2JD9A 2R0FA 2XONA 5LATA 5F9TA 4ZU7A 3W5NA 1NY72 1L7RA 4Z1VA 4YZ5A 1GOFA 4QPWA 3NVCA 4MV2A 3RNSA 5KBFA 5IATA 2RJKA 1UAIA 1LR5A 1OH3A 1DGWA 1H4HA 3OUIA 3WDTA 2DVDA 4A7YA 3TNQA 4EZ4A 2IUWA 1GQPA 3QBQA 4QKBA 4RYDA 1VBC1 2W68A 4AGVA 5C4WA 3V0BA 3A0NA 2E53A 1C3HA 4GKXA 3VHOA 1BHGA 4E4DX 2B7YA 4BIOA 1W3VA 1IKQA 4OI0A 3LKJA 1F15A 4QGMA 4R4XA 3RJ2X 3RZGA 3PVOA 3ZIXA 3GHMA 4YLZA 2WT1A 4LIUA 1OFSA 2PTMA 3ZN4A 1QJX1 3SQOA 4HN0A 4PHZA 2G9FA 4RGGA 3WQ0A 3ZPYA 3N9PA 5J1XA 1SEFA 1F4AA 2HWB3 4J6GA 3O0VA 3VBHC 3VBFB 4BMBA 2YG0A 1J3QA 3E5XA 1YQ6A 3CLPA 3FLRA 3K77A 2JD4A 2CY6A 4MG2A 4RHV3 5FUNA 5JWPA 4IV3A 2GP5A 4COWA 3SNMA 2CL2A 2GMEA 1U5XA 1VB4A 5A7NA 5CG8A 3O1VA 4PIYA 5A33A 1W2UA 3GZAA 2PMWB 4IE6A 4YW1A 5CFDB 1MS1A 2WO3A 2ZOEB 4Q4W2 4W6YA 5GKAC 4N43B 4JV4A 1APNA 2YFUA 2BOIA 5FPBA 1VAVA 5J3UA 2JG9A 1BXHA 2ZBJA 5A1FA 3MV01 1FAYA 3KT7A 3KT1A 3ZFFC 1SZBA 2D6LX 2VE1A 4N7IA 4MXWB 3U11A 2TUNA 2ZX3A 4WM7C 3HD8B 1MQTA 4CDQA 2DWRA 3UGGA 3Q8BA 3WP3A 1OOPB 1JOPA 1CAUB 2BV4A 1Q5OA 3TN91 2JG9C 2R061 1ZZ6A 3WF1A 2XWBB 1QJY3 3C2UA 3L2HA 2Q1FA 1WA4A 4JAAA 4EWEA 5FZHA 4HKLA 3VHPA 1R1ZA 3INAA 1DQ1A 3POFA 2IC1A 4PI0A 3AMQA 3ZDVA 5T50A 1ZRIA 1T2XA 4XOGA 1RUG1 2XKPA 1L7QA 4CSWA 5FLHA 1UWWA 4IXLA 3OCPA 5KXCA 1NCQC 5GZDA 2Y6LA 2QQKA 3OPZA 2CWSA 3HQUA 3PJQA 3W59A 1BQPA 3D4KA 3JXSA 3MW2A 4RFT0 1POV1 1UKGA 3U10A 5ACA3 2DCYA 4MO3M 1CWPA 2Y34A 2R063 4K40A 3E97A 4GQ7A 2VXRA 3V56A 4B4QA 2WZR2 1EAH1 1RIRA 2A6YA 1VRH1 4KGGA 5C3RA 2AC1A 2HYKA 3BTYA 1SLLA 2PAEA 2HBTA 3LSDA 4ZKTB 1YCIA 2AEYA 3QOPA 4IEUA 4LKDA 4AEDB 1PGL2 3AZXA 4P9WA 3SLIA 4HK9A 4MADA 1WW5A 1H2MA 3I2HA 3A7QA 3ZFEB 5FY9A 3L9JT 4M3CE 4QAWA 5JXJA 1N3PA 5A3TA 1OI6A 3T2OA 3WHTA 3VGIA 1V6KA 2I2SA 1AX0A 2FDGA 3THPA 1WCUA 4MGZE 5DABA 2RR11 3D82A 1RHI3 1FT9A 1VMJA 3ILRA 5J37A 3E6CC 1V0AA 5FTTC 2VMIA 4OCTA 1POQA 4Q4X3 1IGOA 3K75B 2HKXA 3PUQA 1BEV1 4N53A 4CDXA 5CKNA 3UYJA 2WA4A 4MXWA 4CE8A 4YNIA 5CEHA 1F35A 5A7SA 3MPPG 3H50A 1H6XA 1QXJA 4XFIA 3WNLA 4CEWC 2D93A 3JBG1 1H8TA 5ISLA 5C33A 3I49A 3WP6A 5IWFA 1BVVA 3AK0A 4UFKA 4KWUA 1H9WA 4QWNA 3VKMA 3RQ0A 3AL5A 1B35C 3DUIA 3LEKA 4DOUA 3KM5A 1QJU1 4LITA 3SH5A 5LW9A 1AR83 4YARA 1VBB2 2G19A 2RS32 4AI0A 4OI4A 2WNUA 4YRDA 4C1WA 4M3CF 4M4RA 5BPXA 4PQQA 1UD1A 5FZFA 1ZM1A 5GZFA 3W9AA 2W0XA 3HNMA 2A6WA 5DDJ3 4JQRA 5LBEA 3BUCA 3Q8EA 3T30A 2DCTA 3A4UA 4KBBA 5DZGA 2Q5TA 2TEPA 1S0IA 2EIGA 4K7JA 4CP1A 5IAXA 2HWE1 3ILNA 1HKDA 2ATFA 4Q4V2 5DN2A 5LEJA 2IXCA 2R49A 3C3VA 4ES8A 4LBQA 4Q4W1 5FZKA 1Q8SA 4QX1A 2VNGA 4JGZC 4E9KA 4IV3C 3ILFA 1JZ7A 2BNNA 2QQOA 2WWSA 3OGVA 4FTBA 4LA3A 5K0UC 3U07A 2Y64A 1DU3D 1RUJ3 5FFOC 4X6RB 5JMCA 2J1UA 1YI7A 1MPXA 3BKZA 2BTVC 1COV3 4XJZA 1ZZBA 2ENRA 4IGPA 5BNNC 4L92A 5T5OA 4JGYC 1RB8G 4DMIA 1U5YA 1V00A 1UYXA 4K21A 1UY0A 1UYZA 3UT0A 4UAPA 2VW1A 3C7EA 2DU1A 2RE9A 2XVLA 3NKTA 3POSA 4XPVA 4GH4A 4XXAA 2VUJA 1WMEA 3LGRA 1C8M2 1LEDA 3LD8A 2L9LA 1ND2B 3CIHA 5KC6A 4CCKA 3WF0A 1T6BX 2X8KA 3D0JA 2GNDA 3J7NA 1RUC3 2ZX1A 1HN0A 4NN0A 5FBZA 5FZBA 3AXDA 3ZYFA 4DEQA 4DINB 1UW8A 2GMPA 4COYA 2WFPA 3Q9OA 5LRSA 2HWD2 1GANA 1PVC3 1ZNPA 2Z42A 4UW4A 2ZEYA 3EO6A 5JOYA 1TME1 1DYOA 1H0BA 1SCSA 4XJAA 5CZKA 4YYOA 2YPDA 3FC0A 3NNFA 2AENA 4HSJA 2OQ6A 3NKGA 2XGXA 5APAA 4AHYA 3K46A 3P3PA 2W52A 1LOAA 3OG2A 5T52A 4E4ZA 5CA6A 1J84A 2A71A 3H7JA 5C9AC 4YW2A 4DXTA 5FP4A 1PO12 2RM22 4JX0A 1J1TA 4HK8A 3WY6A 5A7QA 4HPKB 2XMLA 1REDA 1X9TA 1QNWA 2B45X 3ZN6A 5IK8A 1ST8A 2XLFA 4YGCA 2GNMA 1ND3C 3F2ZA 3KVBA 5AVAA 3ZYBA 1XE7A 4NPRA 3HQXA 3VBSB 4Z07A 5IT6A 3UGHA 5L7OA 1DGLA 1GICA 1HRI3 4QQ2A 4KL1A 4QHOA 1ULPA 2I07B 4Q0SA 3FLTA 4PT6A 4XF4A 5IVYA 4BCUA 1R082 4WV8A 1B09A 2VM9A 4QD2A 2DYCA 1JYXA 3LFIA 4FPEA 2GZWA 1RUH2 4HETA 3HEIA 1NZCA 4YGEA 1EAH3 2RS51 3S30A 2ZGSA 2XVKA 5LBCA 3WUDA 3ZVXA 4AAXA 4L0PA 2ZGTA 3WG2A 4XFCA 2VU9A 3MEPA 5JR2A 4OULA 5C8CC 1QJY2 2ZZQA 1W6QB 3FX3A 3NJXA 4AI9A 3KGLA 3KQ4B 3O0XA 4H2AA 2VVEA 5FZ8A 2B5HA 1TZOA 3ZR5A 3OEAA 3HT1A 4BLJA 5C5UA 5L19A 3GJAA 2BZDA 2A75A 2GSYA 3GBFA 3HAGA 3NV2A 2VD7A 1Y9MA 2QBXA 1NLSA 2X09A 3POYA 2IXLA 5FPLA 2RR12 4QKDA 5F5QA 1KITA 2QVSB 3WDVA 4JDOA 3POWA 1XYOA 3ACIA 4AFMA 1G7YA 3KVAA 1K5MA 3PL0A 4D94A 3I2IA 3N9QA 1QJU2 3WVJA 1UU5A 3VDDC 4GH4C 3AP4A 1PO11 2RM21 3IBMA 3LSEA 1FV3A 1W6PA 2BBAA 2K9ZA 1OT5A 4DUVA 3JUUA 1UO9A 4XHBA 4XJUA 4D6SA 4Y5SA 5C4WB 5FZ6A 1TMF2 2XH6A 1OKQA 1OHFA 4LHNA 4OMCA 4YVSA 4AEMA 2XQXA 1GYKA 2QE3A 3FJSA 2Q30A 1AYM2 4NHLA 3TWIA 1PNFA 4NAOA 2XLGA 3AMPA 3BODA 3OTFA 1YRZA 1JYVA 1Y4WA 1DZRA 3W21A 3SC7X 2XXZA 1ACCA 1HDKA 3AZYA 4AEJA 5A7PA 1U12A 1TNFA 2WLQA 4XTMA 4Y1ZA 3WCRA 1EY2A 2WR9A 1K5MC 3ZYPA 4AFDA 3MHZA 2D3PA 2V09A 2VMFA 4R4ZA 1D0HA 4F8AA 4V1PA 3RDIA 4PDWC 4YGBA 2QQLA 4CPBD 4DPNA 3U4XA 3KSCA 2G1MA 1PZ7A 2DCJA 3WUCA 4NHYA 3LOBA 3THCA 3PTRB 1SFNA 4SBVA 4NIDA 3ZDSA 1WGPA 3OBTA 2P3YA 1W0NA 2DDUA 3GNEA 3D8CA 4C8DA 3I2DA 4WVMA 3NAPC 2WJSA 1K12A 1N3OA 2C9AA 4XBQA 4BYYA 1HN1A 1SDWA 1M06G 2VH9A 3ZFEA 4BQ1A 4EV0A 1VRBA 4YPJA 2VAUA 1IG0A 4LIVA 4QPIA 5SV5A 1NCRB 3LAGA 3RRDA 1S0FA 1IPSA 1Z7S2 1RL3A 2VO5A 3N7LA 3WDXA 5FXVA 2WZPP 3SKVA 3WNKA 4FP3A 3H8OA 3OSDA 1SG3A 4JGYB 1RVF3 5JZGA 2RS31 1WD4A 3SISA 5JOZA 1AVBA 5FZ3A 4F83A 5J96B 1ZRFA 4BDVB 5FZOA 2XJSA 3GZEA 4LXLA 5CKQA 1D0GA 2C1FA 2MHFA 3RSJA 2BNOA 2DVAA 5E8AA 3RYPA 1CR7A 1NLQA 3NV3A 3PU3A 3E6DA 5A3OA 2JB8A 4FQZA 3I54A 4LHSA 3WQBA 2WIIB 2XJPA 4NHKA 4AI8A 4EN7B 1IZ3A 2JG8A 1OA4A 2VG9A 5GALA 4FTEA 1D4M3 2Q8EA 3VBUB 2JENA 5CG9A 2WN2A 3S5QA 1XNDA 4I02A 1RUI2 2Y6FA 5EP9A 4P9LA 3VKOA 4KBZA 4ZZ5A 4XEZA 3E5UA 4MLOA 4BQ3A 4Q4X2 3ZR6A 3VKNA 4FP2A 1C57A 3CZUA 3N9LA 4ISQA 4A4AA 4O61A 3RZHA 2J1TA 2JDNA 2Y6JA 4ZZ8A 5LA2A 3MFAA 3CJIA 2OZ6A 2WZR1 1IPKA 1W0OA 1OXCA 1Q8VA 1R1A2 4CP9A 4W4ZA 1ONAA 2P5BA 2X29A 4Q2FA 1O8SA 2QFEA 3AMNA 3I8TA 1HJFA 4GULA 4Y1UA 3T0AA 4RR3C 3EYPA 4NWVA 5E16A 4CUBA 3ZOIA 4AHXA 1UY2A 1CAWB 3MFCA 4QXCA 1B35B 2FHRA 3BU7A 4RS5B 3ZXFA 2WT2A 4DEVA 4A3XA 5F8PA 2VZVA 3Q8FA 3VHNA 2EICA 2HWD3 2YHJA 1UOJA 3OOXA 4Y22A 2QCSB 2CGOA 2HWC1 4YG0A 5CKMA 1QJX2 4OZXA 3OPWA 2VR4A 4FPGA 2D44A 4CCOA 2NM1A 4OVEA 3WW2A 2DFBA 3E6BA 4W6XA 5BNOB 1SMVA 4KWKA 1G9DA 1FNYA 1MEC3 2D3SA 4YZ3A 2KD7A 4DNYA 5LBFA 4KH9A 1NUKA 1QH7A 5FKBA 1N1VA 1R091 3HIFA 3WNNA 2VBDA 3CDZB 5DAPA 5I0TA 4A7ZA 1ZRCA 4HN1A 3K4ZA 2B9VA 4XE9A 3U78A 4N43A 4DY5A 4XMAA 2AGSA 1XXNA 2JECA 4MUVA 1K45A 2PHRA 2TBVA 2YC2A 2ZEWA 1LENA 4AFCA 4CXXA 2XPJA 1BEV3 2Q1ZB 4XBLA 2P3JA 1C1FA 2MEV1 5FZAA 4G3YC 5FWEA 1A78A 3H8UA 4DXZA 3I2GA
chains in the Genus database with same CATH topology
2VNVA 1W8FA 2BP6A 2JDMA 2JDNA 2VUDA 5A6QA 1UZVA 5A6YA 2BV4A 2JDHA 1OXCA 1W8HA 4CE8A 2JDKA 2WRAA 4AOCA 2JDYA 5A3OA 1GZTA 4UT5A 5HCHA 2CHHA 3DCQA 2VUCA 2WR9A 2JDUA 3ZDVA 5A70A 2BOIA 1OVSA 5A6XA 5D2AA 2JDPA 1OURA 2BOJA 1OUXA 1OUSA 5A6ZA 2XR4A 1OVPA 1UQXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VNV A;  1W8F A;  2BP6 A;  2JDM A;  2JDN A;  2VUD A;  5A6Q A;  1UZV A;  5A6Y A;  2BV4 A;  2JDH A;  1OXC A;  1W8H A;  4CE8 A;  2JDK A;  2WRA A;  4AOC A;  2JDY A;  5A3O A;  1GZT A;  4UT5 A;  5HCH A;  2CHH A;  3DCQ A;  2VUC A;  2WR9 A;  2JDU A;  3ZDV A;  5A70 A;  2BOI A;  1OVS A;  5A6X A;  5D2A A;  2JDP A;  1OUR A;  2BOJ A;  1OUX A;  1OUS A;  5A6Z A;  2XR4 A;  1OVP A;  1UQX A; 
#chains in the Genus database with same CATH topology
 2D5F A;  1SFY A;  3MIE A;  3SMH A;  1OOP A;  1OQD A;  4LO6 B;  1R08 3;  1RTV A;  5LAS A;  3ZPO A;  4RQP B;  2DCK A;  4XCB A;  4A6O A;  3SCH A;  3TEX A;  3WSO A;  3AXE A;  3ASI A;  3P3N A;  4KMQ A;  1JYI A;  2G9G A;  4BK5 A;  3M3I A;  2ZAC A;  4Y33 A;  4C0B A;  2VMH A;  5IW0 A;  2IXK A;  2LTN A;  2LM3 A;  2EVX A;  2JDA A;  2JIJ A;  3IAP A;  5F5C A;  3MF6 A;  1V9U 3;  4CDX C;  1WLW A;  1JZ4 A;  4BOW A;  1O3R A;  2Y33 A;  4NRQ A;  1AX2 A;  1LCL A;  1XU2 A;  3KB5 A;  4WM8 A;  2HEY F;  1AR7 3;  1VBE 1;  1W90 A;  4K20 A;  2JG9 B;  2Q8O A;  1UZY A;  2QUO A;  1DGR A;  1ENR A;  3VBS C;  3VKL A;  3WOG A;  2R04 3;  2QQJ A;  2E33 A;  4YVS C;  4YSF A;  5CFC C;  1HW5 A;  1HJG A;  1HRV 3;  1TE1 B;  3CHX A;  4UOJ A;  2C6S A;  3VDB A;  3NQH A;  3BTZ A;  1C8M 1;  2OII A;  1O3T A;  3NJZ A;  4COU A;  4AG4 A;  3WQ7 A;  5TSW A;  5JPM B;  4N43 C;  4D7T A;  3H1M A;  2CTV A;  2DTY A;  5EJZ B;  2A70 A;  2W5F A;  3O0W A;  4QDR A;  4XIO A;  2IFW A;  5F3C A;  2E51 A;  1WLT A;  3I2J A;  5IYY A;  1UOG A;  5A6Z A;  3FWE A;  4LUM A;  1JZ8 A;  5ABJ B;  1SLC A;  1GUI A;  4IE5 A;  3O14 A;  3APB A;  2NLR A;  2W9X A;  4YW5 A;  4CRQ A;  3JB8 A;  1O8P A;  1HRI 2;  1ZVF A;  2HEV F;  2UWB A;  3LF7 A;  3N4M A;  2Q1M A;  5A7W B;  4IUG A;  5FWJ A;  2PQQ A;  3GZT B;  4XET A;  5JVV A;  2OKX A;  4DUW A;  5IK5 A;  1UMH A;  2ZGU A;  4IEX A;  3OY8 B;  4GWJ A;  2R07 2;  1JI6 A;  1CAX A;  4J25 A;  4L11 A;  4WM7 A;  3ZSK A;  2EAL A;  3OGR A;  4UI9 L;  1AR7 1;  1K5M B;  1ZA4 A;  1SPP B;  3SXW A;  4Y4R A;  1W03 A;  4AEK A;  4LLO A;  5GLV A;  4QXK A;  4LLF A;  4HPK A;  1KEX A;  1PIV 3;  3ECQ A;  1W99 A;  2ZHM A;  4CCN A;  1AX1 A;  3DYO A;  3MO4 A;  5FMD A;  4S2H A;  2WBK A;  5SV8 A;  3NNG A;  1JOJ A;  2WFF 3;  4YVS B;  4FFI A;  2AZ5 A;  5FZ7 A;  1A8M A;  3B00 A;  1H8T C;  1QQP 2;  1ND3 A;  3NNM A;  3OD4 A;  4E27 A;  1EP0 A;  4GA9 A;  3WR0 A;  3NL1 A;  2TNF A;  5C8W A;  2PAK A;  1CZS A;  2WO2 A;  4OUE A;  4R52 A;  5C3O A;  2FDJ A;  3URF A;  3LB9 A;  2ARB A;  4W8J A;  4JQT A;  1ZBA 2;  5FMO L;  3JD7 3;  2D3R A;  2HWC 2;  4GMP 3;  4IL7 A;  4Q5O A;  5EYY A;  4AFA A;  2XBO 1;  1W9S A;  2R32 A;  3VN4 A;  1KFX L;  3EB7 A;  4UW3 A;  2QQP A;  2V5D A;  4FPJ A;  4KG0 A;  3ZXJ A;  4E8C A;  3IMM A;  4WM8 C;  2VJX A;  4AAP A;  4RQP C;  1FPN 3;  2WA3 A;  3N7K A;  1R09 2;  1XNT A;  2PLV 1;  1LEC A;  4ATE A;  2K46 A;  2VTX J;  5JOX A;  3VLB B;  1JOD A;  5IJR A;  4Q0U A;  4FVV A;  3RFR A;  1OD5 A;  1I9R A;  4XTP A;  2VPV A;  1UY1 A;  4E4S A;  4M0H A;  4ONU A;  1JH5 A;  4HT1 T;  2XQR A;  1W6O A;  5GM0 A;  4QGN A;  2YMZ A;  2W1Q A;  1H4G A;  1NCQ A;  3BB6 A;  3RS6 A;  2QKD A;  3JCI A;  4IE0 A;  5KXD A;  5KXB A;  4HVO A;  3M70 A;  1OQE A;  5FRA A;  1QDC A;  2WYS A;  3VZJ A;  4QQO A;  4DB5 A;  2B8M A;  2ZMN A;  3NV1 A;  4LA2 A;  3OGS A;  3D0S A;  4ZPI A;  4CVU A;  1W9W A;  1V6O A;  3NST A;  1KD7 A;  2ARX A;  5BNO C;  3VBF A;  4BK4 A;  1U5I A;  4QM8 A;  1TEI A;  1VJ2 A;  2X5I B;  4EN6 B;  2WNO A;  1H1A A;  4LBL A;  1LOF C;  3M2M A;  1OPO A;  5A3U A;  4P9I A;  1NCR A;  4IEV A;  2VBP A;  1UXX X;  2HEW F;  1XYN A;  3POG A;  1RGS A;  2BBV A;  3ACG A;  4QB2 A;  1L3J A;  5L9R A;  1I3H A;  1VBD 1;  5KXE A;  2QJV A;  3VBR B;  5HCB A;  4QPY A;  1H2N A;  2BW8 A;  1VBE 2;  4EQV A;  5HCF A;  1MEC 1;  3C7F A;  3LIG A;  4M3C A;  4QXH A;  2EXI A;  4QQH A;  1R08 1;  2CGP A;  1ZBE 2;  3BOW A;  4XQ4 A;  1YQ5 A;  3H7Y A;  2XL9 A;  4PIZ A;  5LK5 A;  3UGF A;  4IEO A;  3H3Z A;  1JUH A;  2CAV A;  1J58 A;  4O65 A;  1OC1 A;  3WW1 A;  4NMI A;  4CP2 A;  2JG8 B;  3M3E A;  4BH9 A;  5L7O B;  2XJV A;  3RJR A;  1HB3 A;  5C71 A;  2VW2 A;  1ENS A;  3NJV A;  5IVC A;  4CEW A;  2I74 A;  2LRO A;  2BFU S;  2YPJ A;  4E2S A;  1YIP A;  3T2P A;  4LKE A;  1F8V A;  3BOP A;  3T3Y A;  2PAM A;  4QPI B;  1AJO A;  5FK8 A;  5T54 A;  4B7K A;  1QOO A;  4BXF A;  4LBQ B;  3RWK X;  2QQN A;  3NO8 A;  4JGY A;  4BLI A;  1ZBA 3;  1YFU A;  2XJQ A;  3WIN E;  3UJQ A;  4UFL A;  2CYF A;  5FY5 A;  1AJK A;  5FZO B;  4HFS A;  3III A;  4LMF A;  3WT3 A;  1HB4 A;  1QJF A;  2UY8 A;  2Y6H A;  4YZ2 A;  1E57 A;  5K0U B;  3Q8C A;  5F3G A;  5I0S A;  4FFG A;  4RS5 A;  3KCC A;  3NNJ A;  1RMU 2;  5FLI A;  4Z82 A;  4JGZ B;  4CCC A;  5CFC A;  1LOF A;  2JE9 A;  2WWJ A;  4XUO A;  1GZT A;  5ABJ A;  4LO7 A;  4D0Q A;  3JBG 3;  5HCH A;  3HBK A;  2ZGR A;  1CON A;  3R4D B;  3ZM8 A;  1HRI 1;  1KXG A;  4AF9 A;  2FD8 A;  2WZE A;  2R1D A;  1D7P M;  3NAP B;  1UPS A;  5ERL A;  1CIY A;  1SCR A;  1YNA A;  2W87 A;  5DUW A;  5C8C A;  4JHT A;  4MGQ A;  3RGB A;  4QB6 A;  1NXD 1;  5FZE A;  1DG6 A;  4LOR A;  3AYA A;  5A3L A;  1O5U A;  1AZD A;  1ENX A;  2ZHK A;  2E26 A;  1US3 A;  2O0O A;  2ZKN A;  3J8F 3;  2ZKL A;  4A44 A;  1MVE A;  3R4U A;  2Y60 A;  1QU0 A;  2RDR A;  4Y4Y A;  2D40 A;  5AC9 1;  1ALY A;  1J1L A;  1JUI A;  5BY5 A;  3W20 A;  2RDQ A;  2P3K A;  1VLN A;  2D6K A;  3GM8 A;  2EA7 A;  3J9S A;  3B7M A;  1W9F A;  3SH4 A;  5DG2 A;  4KI5 M;  2ILM A;  4PDW A;  4AZZ A;  1W04 A;  1YYN A;  1NT0 A;  5LB6 A;  3RVH A;  1HB1 A;  3MF9 A;  2W1W A;  1S55 A;  2ERF A;  3VKF C;  2P34 A;  2QTW B;  2PHW A;  2BGP A;  3TN9 2;  1W39 A;  3FN9 A;  4I0A A;  4UBG A;  4GZ9 A;  2FZ1 A;  4B3N A;  3F95 A;  3WDY A;  5HPO A;  2ZTN A;  1S0D A;  2VZT A;  4MYE A;  1LOC A;  2RHP A;  4UYB A;  4Y26 A;  3WF3 A;  5CNA A;  2EXK A;  4Q8K A;  1V9U 2;  5FOB B;  2XWJ B;  3VZN A;  2WIN B;  4HOO A;  4FCA A;  4ZXK A;  3M4F A;  5JSR A;  5LEK A;  3T0D A;  2R1B A;  1SLI A;  4AR2 A;  4AQS A;  1AR7 2;  3ZXA C;  4K3U A;  3IDB B;  2VQU A;  4KG8 A;  3U75 A;  1QXP A;  3AZW A;  1RJ7 A;  3GBG A;  1TVG A;  3G6J B;  4OLL A;  1PVX A;  4LR4 A;  4Y1X A;  2MEV 2;  4UFI A;  4MVT A;  4Y20 A;  1KDK A;  5FJK A;  1FPN 1;  1C4R A;  1SLT A;  2YGL A;  3I4I A;  4HL0 A;  4FPH A;  4QX0 A;  3UNP A;  3IIA A;  1I5Z A;  1I1E A;  5DMY A;  2NYY A;  2HWC 3;  5C8C B;  3S0M A;  3S7E A;  4BWO A;  1SAC A;  1M4W A;  2PHF A;  4MHR A;  3VD5 A;  1LHN A;  2Q0A A;  1TNR A;  3RWN A;  1EUT A;  3BVC A;  1LES A;  1RUC 2;  4GWM A;  5CU1 A;  2XHN A;  3TOJ A;  1UY3 A;  3VB9 A;  3ZSE A;  5BUV A;  1A8D A;  1RIN A;  4H3W A;  4L8Q A;  4LTA A;  3ZSL A;  1VBB 3;  4TN7 A;  5CAZ A;  1GWK A;  5C3Q A;  1AR6 2;  4QDQ A;  4QPI C;  2ET1 A;  1O3Q A;  1PHM A;  4XF0 A;  1W8Z A;  4FPO B;  3LA2 A;  4Q0Q A;  2VEC A;  3DL3 A;  5FJH A;  1W6P B;  1W8T A;  2RDS A;  2VCB A;  1ND3 B;  3O7O A;  3JZV A;  3OY8 A;  2D97 A;  1FNZ A;  1VBC 2;  1RUD 3;  4WM7 B;  3MUZ 1;  1NE4 A;  3CQO A;  2RS5 2;  4D6R A;  1O4Z A;  4EN0 A;  4CP9 B;  5A6Y A;  5FQ0 A;  3BI3 A;  5LBB A;  4Q4V 3;  2VME A;  2UYA A;  2VZR A;  3N7M A;  1XBF A;  2R30 A;  3DYM A;  3ZSJ A;  2E7Q A;  2P17 A;  5G04 L;  3JB4 C;  4HG6 B;  1XRU A;  4CEY B;  5CIS A;  1DLC A;  3OUJ A;  1PO2 3;  2XJR A;  2KM2 A;  2YBP A;  3GYD A;  3N3H A;  4AK3 A;  2D6M A;  4RSU A;  2QZ3 A;  1AXZ A;  2WT0 A;  4HAN A;  2JDU A;  4AI3 A;  2Y0O A;  5FR3 A;  1OF3 A;  2QQU A;  3AP7 A;  3GXU A;  1QHD A;  1VMF A;  2PN5 A;  3POJ A;  2X53 S;  4Q4X 1;  1RUJ 2;  4HVQ A;  4R8H A;  5KR7 A;  4OUM A;  1CGP A;  1ULD A;  1YJK A;  2BP6 A;  3J7L A;  3UET A;  1OF4 A;  2QQV A;  3VDA A;  1FMD 3;  2F6B A;  2Y26 A;  5J98 B;  5GLZ A;  5I8T A;  3ORJ A;  2WS9 1;  3PUR A;  3W5M A;  3GDB A;  2V4A A;  3DKW A;  1W8W A;  2GC0 A;  2E6V A;  1EV1 3;  1NLR A;  1VAM A;  4MHU A;  4H55 A;  5F6L B;  5IAV A;  4CU6 A;  4MH0 E;  3VBS A;  1ZBE 1;  4L2N A;  1LU2 A;  4LBQ D;  1BBT 3;  1OD3 A;  3FZ3 A;  3KQR A;  4IND A;  1WKY A;  1TME 3;  2FMD A;  4V2V A;  1REF A;  5EFU A;  2WZ8 A;  3B93 A;  3I59 B;  2YXS A;  4GMP 1;  2W39 A;  3VDD A;  3M7A A;  2DUQ A;  1PGL 1;  1JHN A;  1UF2 C;  4AVV A;  4X6Q B;  1F9K A;  1MZF A;  3VDC A;  4IEW A;  1KJR A;  1KRI A;  4XDQ A;  2PEL A;  1SBF A;  2CNA A;  2RR1 3;  4GD4 A;  4PF1 A;  3WW4 A;  4ES9 A;  1HQL A;  4NII A;  4ASM B;  2W1S A;  1SPP A;  1FV2 A;  2HLE A;  3K48 A;  4GB3 3;  3WP5 A;  5IVF A;  2UUR A;  1MZE A;  4IV3 B;  3VD9 A;  4JC1 A;  3B69 A;  1AR9 1;  4JKM A;  3AYC A;  4IV1 B;  4FBF A;  2CHH A;  4QU1 A;  5JIA A;  4NWW A;  4U2A A;  2VZP A;  3T08 A;  3POE A;  3VZK A;  5IFT A;  1DFQ A;  2VVD A;  1LHU A;  2YGM A;  3PNA A;  1NOV A;  1FYU A;  1RYY A;  2OUH A;  4OMD A;  2F4L A;  2WS9 3;  3CL1 A;  3NW4 A;  5FCC A;  3ZXK A;  1RUJ 1;  4FFF A;  2Y8K A;  2JDZ A;  2XR4 A;  2VC9 A;  3MIF A;  1BK1 A;  3VZM A;  5A3N A;  1VPH A;  1OVP A;  5E1R A;  1W9T A;  1QEX A;  4YM1 A;  1EPW A;  2IXH A;  1VAK A;  1NE6 A;  1OSG A;  2BU9 A;  3KMH A;  3KT4 A;  2PLV 2;  5I0R A;  2W47 A;  1Y43 B;  5F5I A;  2C9K A;  4NIG A;  3UL2 A;  2OPK A;  5T5L A;  3FLP A;  4DUX A;  5FO9 B;  1W28 A;  2A3W A;  1GWM A;  3BTX A;  2V5Y A;  3P5B A;  3T4V A;  4HZF A;  1HXS 1;  1OLM A;  1JHJ A;  1UCX A;  1YEW A;  3ES4 A;  4FPY A;  4WVZ A;  3VD7 A;  1G9A A;  1E5H A;  1NQD A;  4E4H A;  5BYN A;  5FZM A;  4CYD A;  1H6Y A;  5L73 A;  5JDB A;  1NQJ A;  5FMB A;  4E2G A;  3ACH A;  5KHH A;  5CIR A;  2B9U A;  4CTE A;  4CZS A;  2QNK A;  4ITC A;  5EV7 A;  1D2S A;  1PNG A;  2ZAB A;  1SLB A;  1LGN A;  4XAE A;  4K8F A;  1DQ6 A;  1XC6 A;  3IN9 A;  1DZT A;  4YG3 A;  3PVN A;  3QCW A;  4AHW A;  2MPF A;  1IS3 A;  1N1Y A;  1J59 A;  1D2Q A;  1OQ1 A;  1ULC A;  4EN9 B;  3ZLI A;  3USU B;  1HIX A;  4BU2 A;  1S2K A;  3ALQ A;  3OYW A;  3MIH A;  3T2T A;  2E63 A;  1W9Y A;  1WLD A;  2K2S A;  1QXR A;  4P00 B;  4AL9 A;  1VMH A;  1S2E A;  1WA6 X;  1LHV A;  1DIW A;  2OPW A;  3V65 A;  4IGO A;  4XZP A;  2R07 1;  2VUC A;  4M01 A;  4LBK A;  5CVR A;  4AVA A;  1LOD A;  3R0R A;  1EV1 2;  3VV1 A;  4BA6 A;  5DPN A;  1WMX A;  5DAQ A;  1O7F A;  2D6O X;  3LZZ A;  5DUV A;  4AVC A;  4FXG B;  3EHK A;  1BKZ A;  5JXI A;  5FQ0 B;  3DEC A;  2GN7 A;  3BYW A;  5CAD A;  2DCZ A;  5FV3 A;  4KGQ A;  1RMU 3;  3FUO A;  2YU1 A;  4JRA A;  4PF5 A;  4AI1 A;  3MBW A;  1G8W A;  1LEM A;  2VOW A;  1QJU 3;  2B46 X;  2GC2 A;  4FOV A;  4FO9 A;  4MOA A;  4QU2 A;  1PVC 1;  5FYY A;  3VBR A;  1IPJ A;  4KNC A;  3M3O A;  4NOT A;  2UY9 A;  4S2D A;  4CCE A;  1UZZ A;  5HXV A;  4Y1Y A;  4OI1 A;  4FXK B;  4OHV A;  2GH8 A;  4CPB A;  1TMF 3;  4H14 A;  3WW3 A;  3VBO A;  1QWR A;  2O8O A;  5JI7 A;  3SEP A;  2IVI B;  2GNT A;  3J4U H;  4D7S A;  5JUV A;  3GBW A;  5AC9 3;  4GJZ A;  2VQT A;  3P6B A;  1W2T A;  3DXT A;  5FUP A;  4K8R B;  5D2A A;  2JDP A;  2ZAA A;  1QOS A;  1TG7 A;  2J1S A;  5JPN B;  2JKX A;  1I5P A;  1PO2 1;  1CN1 A;  1OOP C;  1UQX A;  1XPW A;  3ABZ A;  2D98 A;  3KD4 A;  5FMC A;  1VBD 2;  3DKQ A;  5FYS A;  4XVH A;  1ODM A;  2P6C A;  3J7H A;  4Z2A A;  4LBJ A;  4NIA A;  1QGL A;  4QXB A;  3P1I A;  1YI9 A;  2Y0I A;  3D6E A;  2BUK A;  3LEG A;  4JTN A;  4Y1V A;  5CB7 A;  4QB1 A;  3WCS A;  4FAH A;  1OFN A;  1G9F A;  2PHT A;  1X7N A;  2YV8 A;  3DCQ A;  1K3I A;  3JU9 A;  4OQ8 A;  2W91 A;  3MV1 1;  4AVB A;  2LW8 A;  3M1H A;  4GMP 0;  4FPF A;  1PGS A;  2AYH A;  1REE A;  2RS5 3;  3IWZ A;  3LA7 A;  4JDM A;  4CUA A;  2VOT A;  3ELN A;  3RI9 A;  3WHU A;  4EWA A;  1Q8Q A;  4Q1R A;  5A33 B;  2A3X A;  4GIQ A;  5C5T A;  1W06 A;  2QDN A;  5FPU A;  1NA1 C;  1XSQ A;  2QDR A;  5I8Y A;  5FLJ A;  2KA3 A;  2Z2S B;  1PO2 2;  1F31 A;  2PHU A;  1OA2 A;  2DTW A;  3H42 B;  4NRP A;  4PLM A;  5I0U A;  2AR6 A;  3VBF C;  4CU9 A;  1QIQ A;  4I2O A;  3O1T A;  2HBU A;  1NY7 1;  4Y5Z 0;  4IE4 A;  1OPM A;  3VL9 A;  3A22 A;  3N35 A;  3O1O A;  1AUY A;  2WDB A;  2WNV C;  2WO1 A;  2OW4 A;  2F17 A;  2WWU A;  3IAQ A;  3VBH A;  2EIE A;  4UBH A;  5FZG A;  4TTG A;  2XJU A;  4L99 A;  3WDU A;  4KU8 A;  3M8L A;  4ATF A;  1VBA 2;  2ARE A;  4OHY A;  4RS5 C;  1WBL A;  3ENR A;  4RFR B;  4RR3 B;  1ULE A;  3MW4 A;  1PZ8 A;  3VBO B;  1CQ9 A;  1JU4 A;  3QLQ A;  4R9C A;  3ZX7 A;  3FBM A;  1V6I A;  3CJI B;  5FYC A;  1VIW B;  4B4R A;  4Q0P A;  2ZJC A;  5FY0 A;  4EYU A;  1RC6 A;  3KLS A;  1V70 A;  2JKB A;  2RG4 A;  5IHR A;  4JDN A;  3T1L A;  1RUI 3;  3WNO A;  1UYP A;  3WXP A;  4YFZ A;  1AL0 G;  3ZXD A;  1YFW A;  1LJ7 A;  3ATG A;  2Q4S A;  2C5D A;  4Q4W 3;  4WM8 B;  4B29 A;  2VOV A;  3K51 A;  1HXS 2;  2WNU B;  4ARX A;  1POV 3;  4OQ9 A;  4RN5 A;  1NA1 A;  1MZ5 A;  5FO8 B;  4LBM A;  3UK9 A;  3RPQ A;  3AKS A;  3WG4 A;  4IV1 C;  3RMX A;  5EZW A;  1BMV 1;  3V0A A;  3SHR A;  1VB2 A;  2YY1 A;  3LCP A;  4I0W B;  4UFM A;  1K5J A;  4DQA A;  1MEC 2;  2CGN A;  2W08 A;  5AC9 2;  4XAA A;  5FY4 A;  4M00 A;  3DPR A;  5B4X A;  5A7O A;  4ZS2 A;  2BWA A;  2VVF A;  3A21 A;  1KS4 A;  2RJ2 A;  1OKO A;  4EJR A;  1XNC A;  1UX7 A;  1UZV A;  2YYO A;  3KV6 A;  3C7G A;  4UF0 B;  5E88 A;  1AYM 1;  4D69 A;  5C6C A;  1PMJ X;  2ZGP A;  3LOI A;  4UXA A;  4C91 A;  4Q29 A;  2XUM A;  4A6S A;  1RMU 1;  1ZRD A;  4MGT A;  3KHB A;  2IWG B;  5ACA 1;  3IDC B;  3SIT A;  3U37 A;  1NCR C;  4CCJ A;  3ME2 A;  3S57 A;  5HV0 A;  3H8R A;  3PMS A;  4H7L A;  4LE3 A;  1W6O B;  1IS6 A;  4GJY A;  2PLV 3;  3X29 B;  5DUX A;  3WZ1 A;  4LK6 A;  4PIX A;  3VZL A;  4P9Y A;  2R07 3;  4SLI A;  3LE0 A;  3LDK A;  1RVF 1;  2V73 A;  2VZ1 A;  1YUD A;  3SH3 A;  1DQ2 A;  2WQ4 A;  1JZ3 A;  1MVQ A;  1W6N A;  2H0B A;  1Y3T A;  4B4P A;  4TYS A;  5HI0 A;  5LZ6 A;  3AX4 A;  1GQG A;  3HWJ A;  1FX5 A;  4XUN A;  2V72 A;  1E5R A;  2W92 A;  5ABJ C;  4O7X A;  5A80 A;  4NE9 A;  3WV6 A;  2GC3 A;  2GAU A;  1AXK A;  1POV 0;  3VUO A;  2ARA A;  3O1M A;  4PDW B;  5C9A A;  4FOQ A;  4JHZ A;  4Z2W A;  1IQD C;  3T4H B;  2FQP A;  3RZZ A;  1COV 2;  3OGG A;  4N53 C;  4XUT A;  4CDU A;  3K2O A;  1OUR A;  3AFG A;  4P5Y A;  4R9D A;  4Y24 A;  1UU4 A;  3GAL A;  4P9G A;  5LY2 A;  3WDW A;  2J1E A;  4M3C B;  4XHX A;  2B4K A;  1RIT A;  3V0A B;  4AQ2 A;  4IV1 A;  1ZBA 1;  5FYM A;  4GXL A;  4TLF A;  5EJ3 A;  2SBA A;  1NAE A;  1BJQ A;  5DZE A;  3C7O A;  3MIC A;  4XXP A;  1ULG A;  4GB3 1;  2ZML A;  4TLG A;  4IEY A;  1GNY A;  3H8X A;  1CX1 A;  1K42 A;  2I45 A;  2VY0 A;  2Y6K A;  3FHQ A;  5EQU A;  4NO4 A;  3AZV A;  4XUQ A;  4BQY A;  3T1M A;  3MLL A;  1OBN A;  3VDD B;  5GZG A;  1DQ5 A;  2OS2 A;  4COV A;  1P8J A;  2DFC A;  3AKP A;  4D8M A;  5DZF A;  4CA9 A;  2RMU 2;  1EPZ A;  2J1R A;  4FOW A;  1WCD J;  1JW6 A;  3PU8 A;  5FYI A;  1DYK A;  1C8M 3;  1FXZ A;  3MPB A;  4URA A;  1IOA A;  1JXN A;  1DHK B;  1RXF A;  1MS3 A;  2UWA A;  2N7G A;  2W2I A;  3KF5 A;  1G6N A;  4A7K A;  1X36 A;  3AP9 A;  2JE8 A;  2ZCW A;  4LT5 A;  1NXM A;  4QDS A;  4DRV A;  2BGC A;  2IVJ A;  4AOC A;  2RS3 3;  3HNY M;  2W95 A;  2UU8 A;  2HWE 3;  3IPV A;  2OXB A;  4QM9 A;  3ZIW A;  3TEW A;  3VD4 A;  3POB A;  4QPG B;  3BCW A;  1AL2 2;  2D7F A;  2JWP A;  4TSV A;  5GJ6 A;  2ZAH A;  2VUA A;  3CO2 A;  4JRL A;  2VQ0 A;  4AW7 A;  3PLQ A;  1RUF 1;  1AR6 1;  4XMI A;  3JQX A;  2JX9 A;  2NMN A;  3MID A;  3NV4 A;  1YWK A;  4URT A;  4Q26 A;  3ZYG A;  3HJR A;  2VNR A;  5DXD A;  1T6G C;  3EBR A;  4XUP A;  1H8T B;  1BZW A;  4LO8 A;  3G7D A;  5B4N A;  1KS5 A;  1WW7 A;  2VUD A;  5T55 A;  3QH6 A;  3ZYR A;  4Q4V 1;  4UW5 A;  1RUH 3;  1C8N A;  1JYC A;  2BRT A;  1BYH A;  3MIG A;  1LKN A;  5F32 A;  4HSL A;  2FMY A;  2KR2 A;  4X8P A;  4XFA A;  2WFF 2;  3AP6 A;  4Y5T A;  1RUC 1;  3DPR C;  5I8S A;  1DP0 A;  5T5P A;  5LCW L;  3TEY A;  3O12 A;  5CYY A;  5A3W A;  3H1Y A;  2R0H A;  4FPL A;  2W94 A;  4GAZ A;  4MSV A;  3U1X A;  1DQ4 A;  2FZ2 A;  1N3Q A;  4XQD A;  3GCW A;  2RDN A;  1MR5 A;  3EQE A;  5K9Y A;  3J8F 1;  1Y7B A;  1Q8O A;  5FYV A;  3ZKY A;  2GAL A;  1QH6 A;  5F2S A;  1X82 A;  1XYP A;  2YRO A;  4NPM A;  3LQC A;  3THD A;  4ZHN A;  1GLH A;  1VR3 A;  5FAX A;  5FKC A;  1QJY 1;  1CPM A;  4K1Z A;  4BQ5 A;  1F5F A;  2J42 A;  3WNP A;  3ZFG A;  2Q8D A;  2A5Z A;  2AH2 A;  2JDH A;  4P9X A;  3JD7 1;  2ZGK A;  4XUR A;  3PUS A;  1WW6 A;  4OYU A;  4JVA A;  5HXM A;  4PLO A;  1S0B A;  2VTX A;  4HBN A;  4TXW A;  4FAG A;  1DGR N;  4J1W A;  3PME A;  1RUE 3;  1UIJ A;  3UKV A;  3ZYH A;  2VZO A;  4LO4 B;  4O9G A;  1Q43 A;  2B39 A;  3OBR A;  1KGY A;  4KWL A;  4DXR A;  1CAW A;  1R09 3;  1AYM 3;  3HOB A;  4ASL A;  5EYX A;  1OVS A;  2ADE A;  4M4P A;  2ZGO A;  2VOK A;  4UF0 A;  4JGZ A;  4UW6 A;  1C1L A;  1DBN A;  2GC1 A;  2ZHL A;  1HXS 3;  5D8A C;  1D4V B;  4LPL A;  1ASJ 3;  1W8F A;  3Q8A A;  4ARY A;  1O3S A;  4LEJ A;  5FOJ B;  1MS9 A;  5HV4 A;  2VW0 A;  1S1A A;  1PO1 3;  2RM2 3;  4LBN A;  4QHZ A;  2WAO A;  1UPI A;  2PHL A;  4ZXE A;  5K4L A;  2CV6 A;  3FFQ A;  3ZMN A;  3KCX A;  3RZL A;  3U14 A;  2GN3 A;  3DGT A;  4AE2 A;  2WO7 A;  2ORX A;  1JN2 P;  3J8F 2;  2B42 B;  4YG6 A;  2BDR A;  2JIG A;  2FCT A;  5L7O C;  1LGB A;  1DGW X;  3IDE A;  4KU7 A;  1PM4 A;  4AGG A;  1TMF 1;  3POI A;  4DO0 A;  1X8E A;  1QF3 A;  2BNM A;  2GNB A;  2VZ3 A;  2P3I A;  2ZXQ A;  5FZL A;  1EAH 2;  4CXW A;  2ZZJ A;  5FZ9 A;  1GP5 A;  1RUH 1;  4ZY9 A;  5FYU A;  4KWJ A;  4BJ0 A;  1FMD 1;  5JCT A;  4LOS A;  3AZZ A;  4U36 A;  4RR3 A;  4AGR A;  4EE2 A;  4YZ1 A;  4ASK A;  1RVF 2;  4N90 A;  5D8A A;  3O1P A;  4I0B A;  4AWD A;  1Y9Q A;  1AR9 3;  1QDO A;  1NG0 A;  3ZFG C;  1GZW A;  4G4F A;  5GLW A;  4WVM B;  1RUG 3;  3WF4 A;  2GMM A;  3MLJ A;  1YQ8 A;  2A73 B;  2DUO A;  3AYE A;  2VZS A;  3DPR B;  2X5I C;  3LDR A;  1LAJ A;  3ZXG A;  4PBP A;  3B5L B;  4CDU C;  5EJ1 B;  2YZ4 A;  4Q4Y 3;  4IER A;  4CUG A;  3OUH A;  1JZ6 A;  4RGA A;  1EV1 1;  3RZM A;  3RZJ A;  2DBI A;  4K1Y A;  5FK7 A;  2CDO A;  1Z7S 3;  4XFG A;  5F5A A;  4COZ A;  3TAY A;  4DRR A;  4DXS A;  3WX5 A;  4XF3 A;  5J48 A;  1J3R A;  2MNG A;  1F5J A;  4X8N A;  3PVE A;  2WUH A;  2VMD A;  1O6U A;  1X8M A;  2WNV A;  2IXI A;  2WRA A;  2Y6G A;  4CDW A;  1F4H A;  2OVU A;  2WFF 1;  2Q8C A;  1ULF A;  2DVF A;  4I3G A;  2ORZ A;  4GH4 B;  1ZA7 A;  1SDD B;  5FUI A;  1A3K A;  1U0A A;  3IT8 A;  4JKL A;  5GLT A;  5LRR A;  5L9V A;  3J7M A;  4LK7 A;  4RHV 2;  4S2G A;  3CNA A;  2WLP A;  3E1F 1;  5F37 A;  3B9C A;  3N9O A;  1URX A;  1RUE 2;  3DYP A;  1Z7S 1;  2NP0 A;  1D4M 2;  1W8N A;  2CSG A;  5JOW A;  3BN6 A;  3JBG 2;  1RHI 1;  5DAW A;  2UWC A;  5FXZ A;  1C5H A;  1W6N B;  1NX9 A;  4HXC A;  5AVP A;  3FE5 A;  1G9B A;  4YVW A;  1ZRE A;  2WC2 A;  1AR6 3;  5BV6 A;  2XBO 3;  4XDP A;  4P14 A;  2FCV A;  1CZT A;  5M0T A;  1V9U 1;  4ZON A;  4R9A A;  3A23 A;  3CBN A;  1R1A 1;  4XFF A;  3ZKU A;  3VBU C;  2BFU L;  1HB2 A;  3O5S A;  2OT7 A;  1VP6 A;  1PK6 A;  2EAA A;  2EIB A;  1ENQ A;  3VL8 A;  4CU7 A;  3AVR A;  5FP8 A;  5FZC A;  3H9A A;  3TN9 3;  1KJL A;  5A70 A;  5AFE A;  1COV 1;  3ACF A;  2BPA 2;  1CPN A;  3PUH A;  4NR1 A;  2QQI A;  4E2Q A;  3OJB A;  4CEY A;  3RMY A;  2XHK A;  2RMU 1;  1GV9 A;  5T3N A;  2RS1 3;  1IS5 A;  3EJK A;  3KV9 A;  5GLU A;  4RD7 A;  2A1X A;  3H0O A;  3O1S A;  5IK4 A;  5DDJ 1;  5KHI A;  3PVB B;  4XF9 A;  4OZO A;  5FY1 A;  4KQ7 A;  2BER A;  4B7E A;  3BPZ A;  1OLR A;  3ZO0 B;  1ZRR A;  4XIK A;  2VXJ A;  4CDU B;  4IEQ A;  3ZXL A;  1HQW A;  5IVB A;  5ACA 2;  5FO7 B;  3I3E A;  4AVT A;  1R64 A;  4LHL A;  4AXO A;  5HBA A;  4FOY A;  3RYK A;  4QQP A;  4FFH A;  2JJ6 A;  1HLC A;  4YZ4 A;  2FDH A;  3ZFG B;  3BIW E;  4LNV A;  4EN8 B;  2WZR 3;  5A32 A;  1Z78 A;  3GF6 A;  5GZE A;  1E5I A;  1N1T A;  2GP3 A;  4NUB A;  5DG1 A;  1UZW A;  1AR9 2;  2JIC A;  1FOD 1;  1PZ9 A;  4XFB A;  1WZX A;  1PX3 A;  2BGO A;  4R9B A;  2VNV A;  1R1A 3;  2A7A A;  3B94 A;  5IFP A;  1VRH 3;  2ZX2 A;  1SBD A;  2W3J A;  3PHM A;  5F3E A;  1FAT A;  3JQW A;  4CXY A;  1IQA A;  2ZA9 A;  1PGW 2;  3M3Q A;  1PMH X;  3MUY 1;  4BQW A;  3VBH B;  4I09 A;  3WNX A;  1GP6 A;  1WWY A;  4RQP A;  1JTZ X;  5G05 L;  4MET A;  3BIE A;  1I6X A;  3PTY A;  3IM0 A;  5FZ1 A;  5IVJ A;  1RJ8 A;  2IXJ A;  1UMI A;  2Z4F A;  3OPT A;  4A41 A;  2VCM A;  4I30 A;  2DF7 A;  1GR3 A;  2NQY A;  3AFK A;  2LS6 A;  1O4T A;  3TEZ A;  3FHA A;  3HN1 A;  5LA1 A;  2Z5W A;  4F7Z A;  2D43 A;  5FP3 A;  4AVS A;  2VUL A;  5F39 A;  1LHW A;  4AQT A;  3GGL A;  1F2N A;  1YHF A;  1N47 A;  1BLZ A;  2JDM A;  1UXZ A;  1LUL A;  4CCM A;  4QX8 A;  5C4W C;  3E5Q A;  2O14 A;  4I01 A;  1S0G A;  4CU8 A;  1CX4 A;  1Z0H A;  2CAU A;  2NPI A;  2XDV A;  4V2W A;  1OLM E;  1RUD 1;  3SCG A;  4BIS A;  5F1R A;  2RJL A;  2R04 2;  2X5I A;  3GJB A;  1OMI A;  4HKW A;  1CIW A;  1WUV A;  4OI2 A;  3HPN A;  4RGK A;  5E6H A;  2SLI A;  4CDX B;  1ASJ 2;  1J83 A;  4LKF A;  1HV0 A;  2WNE A;  1AHS A;  4LE4 A;  5JSP A;  1GOG A;  4GWI A;  1HQN A;  4FSJ A;  2VGD A;  1HRV 1;  3AJY A;  1G9C A;  4Z92 B;  5FP7 A;  2EID A;  1UX6 A;  1FMD 2;  3HT2 A;  1SLA A;  1RUN A;  3ROU A;  1OUS A;  2ZMK A;  2P1B A;  3ZYI B;  4MGY E;  2D6P A;  2EXJ A;  1VAL A;  1XOY A;  4FTS A;  4EZH A;  2WKK A;  4IQP A;  3V0B B;  1S0E A;  2WQZ C;  1B35 A;  4BB3 A;  1YFX A;  5JLV A;  2HH9 A;  2ZHN A;  1JMU B;  2DBN A;  3AC0 A;  3N7J A;  2RS1 2;  4OHZ A;  3ZFF A;  3USS A;  5KHK A;  1RUF 2;  2YB7 A;  1OH4 A;  3VBO C;  4Y3O A;  3OF1 A;  3I59 A;  3CJX A;  1YC6 1;  4FQ4 A;  3KGZ A;  1QNY A;  4A45 A;  3AP5 A;  3QAC A;  3N9N A;  3RYR A;  5BNP A;  4PJY A;  4XBN A;  4ISR A;  1LOE A;  1EUU A;  2XB6 C;  3CZJ A;  4ORF A;  5B2G B;  3RZK A;  1CAX B;  4MGI E;  1GNH A;  4P08 A;  3R4S A;  1IHM A;  3MLK A;  2WNV B;  4K9S A;  1YLL A;  1YXW A;  3C7H A;  2VZQ A;  5FZ0 A;  1W05 A;  3I7D A;  3TBD A;  4UFJ A;  5CFC B;  1CES A;  4NVP A;  3MZH A;  3KV4 A;  2J1V A;  4AHZ A;  4S2F A;  1WCQ A;  1UU6 A;  1PIV 1;  1RUG 2;  2Z69 A;  3NMB A;  1CAV A;  4IE7 A;  1CZV A;  1Q56 A;  5FIX A;  4H7M A;  3DF0 A;  2YDE A;  1CJP A;  3FL7 A;  4NIH A;  3FBY A;  1WMF A;  4QHB A;  5BNQ A;  1RHI 2;  5C9A B;  1W6M A;  2OQ7 A;  4Q4Y 2;  1GNZ A;  2YC4 A;  3SEE A;  2R6Q A;  1U5Z A;  2XUE A;  4NAM A;  2HWB 1;  3ZXE A;  1SFP A;  2XKO A;  5JSO A;  4UFH A;  1H30 A;  1UOF A;  5FYZ A;  1PVC 2;  5J09 A;  3ACL A;  1LNS A;  4LBO A;  2D5H A;  5DQ0 A;  4QGL A;  3JD7 2;  5JXH A;  4XIL A;  1MS0 A;  4IDZ A;  2BWC A;  2YC0 A;  1OLQ A;  2YU2 A;  3AKT A;  3OBZ A;  5FBJ A;  1SHW B;  1S4C A;  1JS9 A;  1XJA A;  1GZ9 A;  1CJD A;  1VE0 A;  1A34 A;  5FYT A;  1UY4 A;  1ND2 C;  1N1S A;  2VBB A;  4CDW C;  2DUP A;  2ZX0 A;  1W3X A;  4NJ4 A;  5FY8 A;  5I91 A;  4BME A;  3VHR A;  4FPC A;  3W58 A;  3FHI B;  2AUY A;  3D3A A;  5EIY B;  2HWF 1;  3PUA A;  4RA0 A;  4YW7 A;  4Q1P A;  3HNB M;  3I2O A;  3J26 N;  5DDJ 2;  4AI2 A;  2FDK A;  4GAL A;  1QMJ A;  2OA2 A;  5A6X A;  2NN8 A;  4N9H A;  5HCA A;  2ZGM A;  5BNN B;  2PHD A;  1O59 A;  3ZSM A;  1H8V A;  3ST7 A;  2XOM A;  1MS5 A;  5H9P A;  3OYW B;  1KDM A;  1AL2 1;  2P4E A;  4J1X A;  3ZN5 A;  4Q27 A;  5D8A B;  2VMG A;  1XNB A;  5K8S A;  3AB0 A;  5KHJ A;  5T5J A;  3NWK A;  1WLC A;  2WSU A;  3IPV B;  1AYN 3;  4DS0 A;  2NMO A;  2JB4 A;  2YBK A;  1Q3E A;  4JZR A;  5A1A A;  1YQC A;  2BEO A;  4QPG A;  1Q8P A;  1ZBE 3;  1UYY A;  4ET7 A;  1H1M A;  1O4Y A;  2BJS A;  4NPL A;  5BNO A;  1JYT A;  2CDP A;  1RUF 3;  2A6X A;  3MIB A;  1W8U A;  5CFD C;  4JCK A;  4YM0 A;  3HMY A;  2ZGQ A;  4YW6 A;  4DY3 A;  2DUR A;  4LO5 B;  3AVS A;  3RI8 A;  1BCX A;  1CAU A;  1WW4 A;  2AAC A;  4LJH A;  1AXY A;  1VBE 3;  5JI9 A;  3BGA A;  3UJO A;  3H1W A;  5FXX A;  3HR9 A;  1RUI 1;  2VOX A;  4BQ4 A;  3WQ1 A;  1QY4 A;  4IEP A;  1YFY A;  4ZS3 A;  3I97 A;  2EAK A;  1GOH A;  1ND2 A;  1LU1 A;  1X33 A;  2VCC A;  4XZU G;  5DAX A;  1ASJ 1;  5FZI A;  1UIK A;  4FPK A;  4W6W A;  3S5A A;  1FPN 2;  2DVG A;  4MXV A;  5FYB A;  3KF3 A;  5CFD A;  4CEW B;  4LUL A;  3MI8 A;  2YBS A;  5EPA A;  1LOG A;  4XC9 A;  4GWN A;  4P5H A;  5L36 A;  3U4S A;  2YUE A;  5BXX A;  3ON7 A;  1RXG A;  3B9I A;  5JR7 B;  2BVB A;  4IEZ A;  4BM8 A;  2VL4 A;  5A6Q A;  2PYT A;  2OUJ A;  2WAA A;  5ANQ A;  2OZJ A;  3LFM A;  1MQT C;  3WG1 A;  4CDQ C;  4DFS A;  2EXH A;  5J7M A;  4RHV 1;  2H6C A;  2BYV E;  1QJZ A;  4A2U A;  3BPS A;  2WYF A;  3R05 A;  3AKR A;  4JKK A;  5H9Q A;  5K0U A;  4IGQ A;  1JZ5 A;  3ZFE C;  4MX3 A;  2KXL A;  2GDF A;  3KV5 A;  4O9E A;  4QPG C;  1H1I A;  5IK7 A;  1JYW A;  4AYU A;  1VBA 1;  4TWT A;  4AED C;  2AEZ A;  2W46 A;  2PXJ A;  2WSV A;  4BPZ A;  4N7U A;  2LUW A;  3S6P A;  2P37 A;  1UKR A;  2C0Z A;  2H6B A;  2FDF A;  4LQR A;  3LPG A;  3AL6 A;  4Q0V A;  1UNB A;  3T0B A;  2IFR A;  3UKN A;  2WNU C;  1GZC A;  2VMC A;  2VNO A;  4XCA A;  4B1L A;  2RVA A;  4M0N A;  5LK7 B;  5LWB A;  1JZ2 A;  4F3J A;  4D7Y A;  1XU1 A;  1S0C A;  1FOD 3;  1UL9 A;  4XF1 A;  3GCX A;  1GU3 A;  3EXU A;  2XLA A;  3PJY A;  3A0K A;  1ZZC A;  3QH7 A;  3AYD A;  1W8H A;  1NCQ B;  2C4X A;  2ET7 A;  1CD3 G;  1VBA 3;  1XE8 A;  4K6B A;  1ZX5 A;  1LHO A;  3UES A;  3WG3 A;  2P2K A;  5EHD A;  2FBE A;  3MDP A;  1J3P A;  4AED A;  4PBO A;  1O5L A;  1YIF A;  1BK0 A;  5JMO A;  3IMN A;  3UKT A;  1UMZ A;  3LPF A;  5JAX A;  1GFF 2;  1VRH 2;  5A3M A;  1DF0 A;  1DZQ A;  5FZD A;  4N9I A;  2JEM A;  2HJI A;  3CEW A;  3LEM A;  4XQW A;  1JBC A;  2WQ8 A;  1A6C A;  3AMM A;  5C3P A;  1CVN A;  3MYX A;  5FPX A;  1NYW A;  1KFU L;  1LB2 A;  3CF6 E;  1PK6 B;  3CMG A;  3THT A;  1ULO A;  3FMG A;  3AKQ A;  2JDK A;  4N53 B;  1NA1 B;  4OUS A;  2GH2 A;  3TNP B;  2O1Q A;  5JZG C;  3NNL A;  1Y9G A;  1X50 A;  3OD0 A;  3CKH A;  3BTA A;  2C24 A;  2ID4 A;  4XJ8 A;  3GHN A;  1MS4 A;  4YM2 A;  2WL1 A;  3DXU A;  2XJT A;  3AJZ A;  5LA0 A;  2J1A A;  4BQX A;  1VBB 1;  2WN3 A;  3OGJ A;  4QT6 A;  1OUX A;  3K4D A;  5ANN A;  3KHC A;  4BE3 A;  2E9Q A;  1JYN A;  4YW4 A;  3AMH A;  5FPV A;  2E7A A;  2JXA A;  2EF6 A;  5IVV A;  2HWB 2;  2MEV 3;  2G4I A;  4W50 A;  3LA3 A;  5DAV A;  3UV9 A;  2BQP A;  5I93 A;  3WNM A;  3KS7 A;  4CDW B;  1YJL A;  1H2K A;  4XAC A;  3H3L A;  2PHX A;  4ZU5 A;  1ZZ9 A;  1S0J A;  4QX3 A;  5BNN A;  2HWF 3;  2RMU 3;  5FDB A;  2UYB A;  5FYH A;  3VZO A;  4WVV A;  5F2W A;  2IZW A;  1W2A X;  4UWD A;  3N9M A;  1H2L A;  1RUO A;  5FPA A;  4HMZ A;  1HX6 A;  1ODN A;  2BOJ A;  2OYZ A;  2PA7 A;  1GWL A;  1TQ5 A;  2J7M A;  2HWE 2;  1UOB A;  3ITQ A;  4XJW A;  4B1M A;  3QD6 A;  1NKG A;  1US2 A;  1AF9 A;  4XDO A;  4XJ9 A;  2NZ9 A;  4NRO A;  3KZ4 C;  3SKJ E;  3NRU A;  3NAP A;  4L9B A;  2XG3 A;  2K0G A;  2QQW A;  1VBC 3;  3USU A;  1FOD 2;  5AFB A;  3I2F A;  3VBU A;  4BHP A;  1IG3 A;  4D6Q A;  3PUI A;  4C1X A;  5GZC A;  1IKP A;  1XQN A;  3ETP A;  5LA9 A;  3T2Q A;  5FP9 A;  2JE7 A;  5L9B A;  2A6V A;  1W2O A;  3GZU C;  4YVW C;  3V64 A;  4A42 A;  4C90 A;  5LY1 A;  1DQ0 A;  5A3P A;  2ZEX A;  1CAV B;  2RS1 1;  2ETE A;  3WLU A;  2OX0 A;  2E31 A;  4AQ6 A;  5A1L A;  2H0V A;  4QX2 A;  2LAL A;  1H9P A;  3CJI C;  5EWS A;  5C70 A;  1WCS A;  2WAB A;  1MQT B;  4CDQ B;  4DIQ A;  1TME 2;  5FPZ A;  1LOB A;  3HN3 A;  3T09 A;  2W1U A;  4HKO A;  4Q8L A;  3VD3 A;  1MAC A;  3ES1 A;  2J22 A;  2R06 2;  4JTO A;  1ZZ7 A;  5FY7 A;  5BNP B;  3K4A A;  1G86 A;  4Z8B A;  4CCL A;  1QKQ A;  2XVG A;  5J36 A;  1E5S A;  4XFH A;  4WZF A;  1GZW B;  1W2N A;  4OHX A;  4WZC A;  1RUD 2;  3C8X A;  1BBT 2;  5FRE A;  2R04 1;  1JOB A;  2C26 A;  3S7I A;  3IZO A;  3K3N A;  4LUK A;  1KQR A;  3PDQ A;  5DUU A;  5F7U A;  3KWV A;  3N36 A;  4NHX A;  2R7E B;  1GBG A;  1JU3 A;  1HV1 A;  1XNA A;  4BXS V;  5FXW A;  4CUC A;  4P9J A;  1FI2 A;  4BQ2 A;  1QOT A;  1QJX 3;  1DYP A;  2HYX A;  1AL2 3;  5IVE A;  1C28 A;  4YM3 A;  3ETQ A;  1V6N A;  1MZ6 A;  2JDY A;  1PGW 1;  4CCD A;  1RUE 1;  3BAL A;  4MZU A;  1V6J A;  2GU9 A;  3DV8 A;  4NHM A;  4PQ9 A;  4XW3 A;  3DN7 A;  5K7P A;  1W0P A;  1LGC A;  4MGK E;  3I3M A;  1AYN 1;  1XB9 A;  4C0H A;  2HWD 1;  1IS4 A;  1O91 A;  3KCY A;  4E8D A;  1DLL A;  4QMA A;  4QKF A;  4IET A;  2ZGN A;  1WCK A;  1MS8 A;  3PIG A;  5H9R A;  3DEM A;  1WMD A;  2CWM A;  2ADD A;  2E32 A;  2ZS6 B;  4OFG A;  4WBB A;  5KWR A;  3K3O A;  2VTF A;  3L2Y A;  4CP0 A;  2WS9 2;  3I3D A;  4FT8 A;  1DCS A;  1AYN 2;  1XNK A;  5IUQ A;  1AR8 2;  1NZI A;  1YO8 A;  3EMR A;  2Z79 A;  1BEV 2;  1PM7 A;  2PFW A;  3HVD A;  3M3C A;  5FZ4 A;  2DU0 A;  4W65 A;  4HLT A;  3O1R A;  4D3W A;  5D21 A;  3TRS B;  2ZEZ A;  5A7W A;  4BIF A;  2QQM A;  3HBZ A;  1V6L A;  4UT5 A;  1QQP 1;  1XE0 A;  3CU7 A;  1GMM A;  2VQA A;  1PX4 A;  2YFZ A;  4A3Z A;  3I3Q A;  3LIH A;  3MGU A;  5C7G A;  3MW3 A;  1C5I A;  2BVV A;  4FI9 A;  3TYJ A;  3WEZ A;  4BZ4 A;  1W8O A;  2CU5 A;  4YGD A;  4YW3 A;  2VCA A;  3B3Q E;  3IKW A;  1STM A;  3OEB A;  1PMI A;  3OB8 A;  1OA3 A;  4PLN A;  2P6H A;  5FMO S;  4YFW A;  3WP4 A;  2DVB A;  4QQL A;  5D1I A;  3LDB A;  2RV9 A;  4HON A;  4IES A;  4Q4Y 1;  2V4V A;  4B8E A;  4NRM A;  4XAB A;  1GP4 A;  2JG8 C;  3U0Z A;  5C3S A;  1GKB A;  1ZYB A;  5JXG A;  3I2K A;  3ZFF B;  3FFZ A;  4OHW A;  1UN1 A;  1XSR A;  3D5O A;  3I3B A;  3RG0 A;  3NJY A;  3WF2 A;  1YQ2 A;  2ARC A;  4LHK A;  3IDA A;  4QKN A;  5CBL A;  2ZPX A;  4P02 B;  1EYB A;  2O8Q A;  2QZ2 A;  2X10 A;  3LWC A;  4GB3 2;  4PCR A;  4Y22 B;  3VBR C;  2FDI A;  1HRV 2;  1S2B A;  1LTE A;  2ES3 A;  4N8M A;  5A32 B;  5JZG B;  2FCU A;  4CEY C;  3B02 A;  3H3U A;  3TB0 A;  3O1U A;  1BVP 1;  4WVW A;  2DV9 A;  2XL7 A;  2A3Y A;  4IW3 A;  1WD3 A;  4I3P A;  2A6Z A;  4XYX A;  1SBE A;  1GQH A;  2VZU A;  2D6N A;  4PI2 A;  4TZD A;  3BU0 A;  1AR8 1;  1PK6 C;  2Y38 A;  2PQS A;  1SQ4 A;  3B01 A;  1DDL A;  3PIJ A;  1BMV 2;  4RL7 A;  4QX5 A;  1WBF A;  3ZYJ B;  3SCF A;  5KC5 A;  2LRP A;  4HVR A;  4ZU4 A;  1W6M B;  1D4M 1;  5KHG A;  1W6Q A;  5JIU A;  1ZZ8 A;  4GKY A;  5EXO A;  1UZ0 A;  4Y20 B;  5I0D A;  4G9S B;  4QX7 A;  5BNP C;  5F6K A;  3R6S A;  2XBO 2;  3FUQ A;  2E7T A;  3LEI A;  3AM2 A;  1BBT 1;  2F4P A;  5E89 A;  4L97 A;  2HWF 2;  2R16 A;  3OBA A;  2X05 A;  4AFB A;  4LKS A;  4MGS A;  3IB3 A;  1X9P A;  1QJE A;  2ZX4 A;  4EWD A;  1PIV 2;  4ERO A;  1GSL A;  3ZMO A;  3HQR A;  2G9Z A;  4LOT A;  5H9S A;  4YWA A;  3ZN6 B;  1VBD 3;  1LRH A;  4YVW B;  1V6M A;  2ZGL A;  1QQP 3;  1L7L A;  5F3I A;  3WD5 A;  4DZG A;  2JD9 A;  2R0F A;  2XON A;  5LAT A;  5F9T A;  4ZU7 A;  3W5N A;  1NY7 2;  1L7R A;  4Z1V A;  4YZ5 A;  1GOF A;  4QPW A;  3NVC A;  4MV2 A;  3RNS A;  5KBF A;  5IAT A;  2RJK A;  1UAI A;  1LR5 A;  1OH3 A;  1DGW A;  1H4H A;  3OUI A;  3WDT A;  2DVD A;  4A7Y A;  3TNQ A;  4EZ4 A;  2IUW A;  1GQP A;  3QBQ A;  4QKB A;  4RYD A;  1VBC 1;  2W68 A;  4AGV A;  5C4W A;  3V0B A;  3A0N A;  2E53 A;  1C3H A;  4GKX A;  3VHO A;  1BHG A;  4E4D X;  2B7Y A;  4BIO A;  1W3V A;  1IKQ A;  4OI0 A;  3LKJ A;  1F15 A;  4QGM A;  4R4X A;  3RJ2 X;  3RZG A;  3PVO A;  3ZIX A;  3GHM A;  4YLZ A;  2WT1 A;  4LIU A;  1OFS A;  2PTM A;  3ZN4 A;  1QJX 1;  3SQO A;  4HN0 A;  4PHZ A;  2G9F A;  4RGG A;  3WQ0 A;  3ZPY A;  3N9P A;  5J1X A;  1SEF A;  1F4A A;  2HWB 3;  4J6G A;  3O0V A;  3VBH C;  3VBF B;  4BMB A;  2YG0 A;  1J3Q A;  3E5X A;  1YQ6 A;  3CLP A;  3FLR A;  3K77 A;  2JD4 A;  2CY6 A;  4MG2 A;  4RHV 3;  5FUN A;  5JWP A;  4IV3 A;  2GP5 A;  4COW A;  3SNM A;  2CL2 A;  2GME A;  1U5X A;  1VB4 A;  5A7N A;  5CG8 A;  3O1V A;  4PIY A;  5A33 A;  1W2U A;  3GZA A;  2PMW B;  4IE6 A;  4YW1 A;  5CFD B;  1MS1 A;  2WO3 A;  2ZOE B;  4Q4W 2;  4W6Y A;  5GKA C;  4N43 B;  4JV4 A;  1APN A;  2YFU A;  2BOI A;  5FPB A;  1VAV A;  5J3U A;  2JG9 A;  1BXH A;  2ZBJ A;  5A1F A;  3MV0 1;  1FAY A;  3KT7 A;  3KT1 A;  3ZFF C;  1SZB A;  2D6L X;  2VE1 A;  4N7I A;  4MXW B;  3U11 A;  2TUN A;  2ZX3 A;  4WM7 C;  3HD8 B;  1MQT A;  4CDQ A;  2DWR A;  3UGG A;  3Q8B A;  3WP3 A;  1OOP B;  1JOP A;  1CAU B;  2BV4 A;  1Q5O A;  3TN9 1;  2JG9 C;  2R06 1;  1ZZ6 A;  3WF1 A;  2XWB B;  1QJY 3;  3C2U A;  3L2H A;  2Q1F A;  1WA4 A;  4JAA A;  4EWE A;  5FZH A;  4HKL A;  3VHP A;  1R1Z A;  3INA A;  1DQ1 A;  3POF A;  2IC1 A;  4PI0 A;  3AMQ A;  3ZDV A;  5T50 A;  1ZRI A;  1T2X A;  4XOG A;  1RUG 1;  2XKP A;  1L7Q A;  4CSW A;  5FLH A;  1UWW A;  4IXL A;  3OCP A;  5KXC A;  1NCQ C;  5GZD A;  2Y6L A;  2QQK A;  3OPZ A;  2CWS A;  3HQU A;  3PJQ A;  3W59 A;  1BQP A;  3D4K A;  3JXS A;  3MW2 A;  4RFT 0;  1POV 1;  1UKG A;  3U10 A;  5ACA 3;  2DCY A;  4MO3 M;  1CWP A;  2Y34 A;  2R06 3;  4K40 A;  3E97 A;  4GQ7 A;  2VXR A;  3V56 A;  4B4Q A;  2WZR 2;  1EAH 1;  1RIR A;  2A6Y A;  1VRH 1;  4KGG A;  5C3R A;  2AC1 A;  2HYK A;  3BTY A;  1SLL A;  2PAE A;  2HBT A;  3LSD A;  4ZKT B;  1YCI A;  2AEY A;  3QOP A;  4IEU A;  4LKD A;  4AED B;  1PGL 2;  3AZX A;  4P9W A;  3SLI A;  4HK9 A;  4MAD A;  1WW5 A;  1H2M A;  3I2H A;  3A7Q A;  3ZFE B;  5FY9 A;  3L9J T;  4M3C E;  4QAW A;  5JXJ A;  1N3P A;  5A3T A;  1OI6 A;  3T2O A;  3WHT A;  3VGI A;  1V6K A;  2I2S A;  1AX0 A;  2FDG A;  3THP A;  1WCU A;  4MGZ E;  5DAB A;  2RR1 1;  3D82 A;  1RHI 3;  1FT9 A;  1VMJ A;  3ILR A;  5J37 A;  3E6C C;  1V0A A;  5FTT C;  2VMI A;  4OCT A;  1POQ A;  4Q4X 3;  1IGO A;  3K75 B;  2HKX A;  3PUQ A;  1BEV 1;  4N53 A;  4CDX A;  5CKN A;  3UYJ A;  2WA4 A;  4MXW A;  4CE8 A;  4YNI A;  5CEH A;  1F35 A;  5A7S A;  3MPP G;  3H50 A;  1H6X A;  1QXJ A;  4XFI A;  3WNL A;  4CEW C;  2D93 A;  3JBG 1;  1H8T A;  5ISL A;  5C33 A;  3I49 A;  3WP6 A;  5IWF A;  1BVV A;  3AK0 A;  4UFK A;  4KWU A;  1H9W A;  4QWN A;  3VKM A;  3RQ0 A;  3AL5 A;  1B35 C;  3DUI A;  3LEK A;  4DOU A;  3KM5 A;  1QJU 1;  4LIT A;  3SH5 A;  5LW9 A;  1AR8 3;  4YAR A;  1VBB 2;  2G19 A;  2RS3 2;  4AI0 A;  4OI4 A;  2WNU A;  4YRD A;  4C1W A;  4M3C F;  4M4R A;  5BPX A;  4PQQ A;  1UD1 A;  5FZF A;  1ZM1 A;  5GZF A;  3W9A A;  2W0X A;  3HNM A;  2A6W A;  5DDJ 3;  4JQR A;  5LBE A;  3BUC A;  3Q8E A;  3T30 A;  2DCT A;  3A4U A;  4KBB A;  5DZG A;  2Q5T A;  2TEP A;  1S0I A;  2EIG A;  4K7J A;  4CP1 A;  5IAX A;  2HWE 1;  3ILN A;  1HKD A;  2ATF A;  4Q4V 2;  5DN2 A;  5LEJ A;  2IXC A;  2R49 A;  3C3V A;  4ES8 A;  4LBQ A;  4Q4W 1;  5FZK A;  1Q8S A;  4QX1 A;  2VNG A;  4JGZ C;  4E9K A;  4IV3 C;  3ILF A;  1JZ7 A;  2BNN A;  2QQO A;  2WWS A;  3OGV A;  4FTB A;  4LA3 A;  5K0U C;  3U07 A;  2Y64 A;  1DU3 D;  1RUJ 3;  5FFO C;  4X6R B;  5JMC A;  2J1U A;  1YI7 A;  1MPX A;  3BKZ A;  2BTV C;  1COV 3;  4XJZ A;  1ZZB A;  2ENR A;  4IGP A;  5BNN C;  4L92 A;  5T5O A;  4JGY C;  1RB8 G;  4DMI A;  1U5Y A;  1V00 A;  1UYX A;  4K21 A;  1UY0 A;  1UYZ A;  3UT0 A;  4UAP A;  2VW1 A;  3C7E A;  2DU1 A;  2RE9 A;  2XVL A;  3NKT A;  3POS A;  4XPV A;  4GH4 A;  4XXA A;  2VUJ A;  1WME A;  3LGR A;  1C8M 2;  1LED A;  3LD8 A;  2L9L A;  1ND2 B;  3CIH A;  5KC6 A;  4CCK A;  3WF0 A;  1T6B X;  2X8K A;  3D0J A;  2GND A;  3J7N A;  1RUC 3;  2ZX1 A;  1HN0 A;  4NN0 A;  5FBZ A;  5FZB A;  3AXD A;  3ZYF A;  4DEQ A;  4DIN B;  1UW8 A;  2GMP A;  4COY A;  2WFP A;  3Q9O A;  5LRS A;  2HWD 2;  1GAN A;  1PVC 3;  1ZNP A;  2Z42 A;  4UW4 A;  2ZEY A;  3EO6 A;  5JOY A;  1TME 1;  1DYO A;  1H0B A;  1SCS A;  4XJA A;  5CZK A;  4YYO A;  2YPD A;  3FC0 A;  3NNF A;  2AEN A;  4HSJ A;  2OQ6 A;  3NKG A;  2XGX A;  5APA A;  4AHY A;  3K46 A;  3P3P A;  2W52 A;  1LOA A;  3OG2 A;  5T52 A;  4E4Z A;  5CA6 A;  1J84 A;  2A71 A;  3H7J A;  5C9A C;  4YW2 A;  4DXT A;  5FP4 A;  1PO1 2;  2RM2 2;  4JX0 A;  1J1T A;  4HK8 A;  3WY6 A;  5A7Q A;  4HPK B;  2XML A;  1RED A;  1X9T A;  1QNW A;  2B45 X;  3ZN6 A;  5IK8 A;  1ST8 A;  2XLF A;  4YGC A;  2GNM A;  1ND3 C;  3F2Z A;  3KVB A;  5AVA A;  3ZYB A;  1XE7 A;  4NPR A;  3HQX A;  3VBS B;  4Z07 A;  5IT6 A;  3UGH A;  5L7O A;  1DGL A;  1GIC A;  1HRI 3;  4QQ2 A;  4KL1 A;  4QHO A;  1ULP A;  2I07 B;  4Q0S A;  3FLT A;  4PT6 A;  4XF4 A;  5IVY A;  4BCU A;  1R08 2;  4WV8 A;  1B09 A;  2VM9 A;  4QD2 A;  2DYC A;  1JYX A;  3LFI A;  4FPE A;  2GZW A;  1RUH 2;  4HET A;  3HEI A;  1NZC A;  4YGE A;  1EAH 3;  2RS5 1;  3S30 A;  2ZGS A;  2XVK A;  5LBC A;  3WUD A;  3ZVX A;  4AAX A;  4L0P A;  2ZGT A;  3WG2 A;  4XFC A;  2VU9 A;  3MEP A;  5JR2 A;  4OUL A;  5C8C C;  1QJY 2;  2ZZQ A;  1W6Q B;  3FX3 A;  3NJX A;  4AI9 A;  3KGL A;  3KQ4 B;  3O0X A;  4H2A A;  2VVE A;  5FZ8 A;  2B5H A;  1TZO A;  3ZR5 A;  3OEA A;  3HT1 A;  4BLJ A;  5C5U A;  5L19 A;  3GJA A;  2BZD A;  2A75 A;  2GSY A;  3GBF A;  3HAG A;  3NV2 A;  2VD7 A;  1Y9M A;  2QBX A;  1NLS A;  2X09 A;  3POY A;  2IXL A;  5FPL A;  2RR1 2;  4QKD A;  5F5Q A;  1KIT A;  2QVS B;  3WDV A;  4JDO A;  3POW A;  1XYO A;  3ACI A;  4AFM A;  1G7Y A;  3KVA A;  1K5M A;  3PL0 A;  4D94 A;  3I2I A;  3N9Q A;  1QJU 2;  3WVJ A;  1UU5 A;  3VDD C;  4GH4 C;  3AP4 A;  1PO1 1;  2RM2 1;  3IBM A;  3LSE A;  1FV3 A;  1W6P A;  2BBA A;  2K9Z A;  1OT5 A;  4DUV A;  3JUU A;  1UO9 A;  4XHB A;  4XJU A;  4D6S A;  4Y5S A;  5C4W B;  5FZ6 A;  1TMF 2;  2XH6 A;  1OKQ A;  1OHF A;  4LHN A;  4OMC A;  4YVS A;  4AEM A;  2XQX A;  1GYK A;  2QE3 A;  3FJS A;  2Q30 A;  1AYM 2;  4NHL A;  3TWI A;  1PNF A;  4NAO A;  2XLG A;  3AMP A;  3BOD A;  3OTF A;  1YRZ A;  1JYV A;  1Y4W A;  1DZR A;  3W21 A;  3SC7 X;  2XXZ A;  1ACC A;  1HDK A;  3AZY A;  4AEJ A;  5A7P A;  1U12 A;  1TNF A;  2WLQ A;  4XTM A;  4Y1Z A;  3WCR A;  1EY2 A;  2WR9 A;  1K5M C;  3ZYP A;  4AFD A;  3MHZ A;  2D3P A;  2V09 A;  2VMF A;  4R4Z A;  1D0H A;  4F8A A;  4V1P A;  3RDI A;  4PDW C;  4YGB A;  2QQL A;  4CPB D;  4DPN A;  3U4X A;  3KSC A;  2G1M A;  1PZ7 A;  2DCJ A;  3WUC A;  4NHY A;  3LOB A;  3THC A;  3PTR B;  1SFN A;  4SBV A;  4NID A;  3ZDS A;  1WGP A;  3OBT A;  2P3Y A;  1W0N A;  2DDU A;  3GNE A;  3D8C A;  4C8D A;  3I2D A;  4WVM A;  3NAP C;  2WJS A;  1K12 A;  1N3O A;  2C9A A;  4XBQ A;  4BYY A;  1HN1 A;  1SDW A;  1M06 G;  2VH9 A;  3ZFE A;  4BQ1 A;  4EV0 A;  1VRB A;  4YPJ A;  2VAU A;  1IG0 A;  4LIV A;  4QPI A;  5SV5 A;  1NCR B;  3LAG A;  3RRD A;  1S0F A;  1IPS A;  1Z7S 2;  1RL3 A;  2VO5 A;  3N7L A;  3WDX A;  5FXV A;  2WZP P;  3SKV A;  3WNK A;  4FP3 A;  3H8O A;  3OSD A;  1SG3 A;  4JGY B;  1RVF 3;  5JZG A;  2RS3 1;  1WD4 A;  3SIS A;  5JOZ A;  1AVB A;  5FZ3 A;  4F83 A;  5J96 B;  1ZRF A;  4BDV B;  5FZO A;  2XJS A;  3GZE A;  4LXL A;  5CKQ A;  1D0G A;  2C1F A;  2MHF A;  3RSJ A;  2BNO A;  2DVA A;  5E8A A;  3RYP A;  1CR7 A;  1NLQ A;  3NV3 A;  3PU3 A;  3E6D A;  5A3O A;  2JB8 A;  4FQZ A;  3I54 A;  4LHS A;  3WQB A;  2WII B;  2XJP A;  4NHK A;  4AI8 A;  4EN7 B;  1IZ3 A;  2JG8 A;  1OA4 A;  2VG9 A;  5GAL A;  4FTE A;  1D4M 3;  2Q8E A;  3VBU B;  2JEN A;  5CG9 A;  2WN2 A;  3S5Q A;  1XND A;  4I02 A;  1RUI 2;  2Y6F A;  5EP9 A;  4P9L A;  3VKO A;  4KBZ A;  4ZZ5 A;  4XEZ A;  3E5U A;  4MLO A;  4BQ3 A;  4Q4X 2;  3ZR6 A;  3VKN A;  4FP2 A;  1C57 A;  3CZU A;  3N9L A;  4ISQ A;  4A4A A;  4O61 A;  3RZH A;  2J1T A;  2JDN A;  2Y6J A;  4ZZ8 A;  5LA2 A;  3MFA A;  3CJI A;  2OZ6 A;  2WZR 1;  1IPK A;  1W0O A;  1OXC A;  1Q8V A;  1R1A 2;  4CP9 A;  4W4Z A;  1ONA A;  2P5B A;  2X29 A;  4Q2F A;  1O8S A;  2QFE A;  3AMN A;  3I8T A;  1HJF A;  4GUL A;  4Y1U A;  3T0A A;  4RR3 C;  3EYP A;  4NWV A;  5E16 A;  4CUB A;  3ZOI A;  4AHX A;  1UY2 A;  1CAW B;  3MFC A;  4QXC A;  1B35 B;  2FHR A;  3BU7 A;  4RS5 B;  3ZXF A;  2WT2 A;  4DEV A;  4A3X A;  5F8P A;  2VZV A;  3Q8F A;  3VHN A;  2EIC A;  2HWD 3;  2YHJ A;  1UOJ A;  3OOX A;  4Y22 A;  2QCS B;  2CGO A;  2HWC 1;  4YG0 A;  5CKM A;  1QJX 2;  4OZX A;  3OPW A;  2VR4 A;  4FPG A;  2D44 A;  4CCO A;  2NM1 A;  4OVE A;  3WW2 A;  2DFB A;  3E6B A;  4W6X A;  5BNO B;  1SMV A;  4KWK A;  1G9D A;  1FNY A;  1MEC 3;  2D3S A;  4YZ3 A;  2KD7 A;  4DNY A;  5LBF A;  4KH9 A;  1NUK A;  1QH7 A;  5FKB A;  1N1V A;  1R09 1;  3HIF A;  3WNN A;  2VBD A;  3CDZ B;  5DAP A;  5I0T A;  4A7Z A;  1ZRC A;  4HN1 A;  3K4Z A;  2B9V A;  4XE9 A;  3U78 A;  4N43 A;  4DY5 A;  4XMA A;  2AGS A;  1XXN A;  2JEC A;  4MUV A;  1K45 A;  2PHR A;  2TBV A;  2YC2 A;  2ZEW A;  1LEN A;  4AFC A;  4CXX A;  2XPJ A;  1BEV 3;  2Q1Z B;  4XBL A;  2P3J A;  1C1F A;  2MEV 1;  5FZA A;  4G3Y C;  5FWE A;  1A78 A;  3H8U A;  4DXZ A;  3I2G A; 
#chains in the Genus database with same CATH homology
 2VNV A;  1W8F A;  2BP6 A;  2JDM A;  2JDN A;  2VUD A;  5A6Q A;  1UZV A;  5A6Y A;  2BV4 A;  2JDH A;  1OXC A;  1W8H A;  4CE8 A;  2JDK A;  2WRA A;  4AOC A;  2JDY A;  5A3O A;  1GZT A;  4UT5 A;  5HCH A;  2CHH A;  3DCQ A;  2VUC A;  2WR9 A;  2JDU A;  3ZDV A;  5A70 A;  2BOI A;  1OVS A;  5A6X A;  5D2A A;  2JDP A;  1OUR A;  2BOJ A;  1OUX A;  1OUS A;  5A6Z A;  2XR4 A;  1OVP A;  1UQX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...