1GZTA

Pseudomonas aeruginosa lectin ii (pa-iil) together with fucose
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
114
structure length
114
Chain Sequence
ATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNETAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILTNELNFALVGSEDGTDNDYNDAVVVINWPLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FUCOSE-SPECIFIC LECTIN
publication title Structural Basis for Oligosaccharide-Mediated Adhesion of Pseudomonas Aeruginosa in the Lungs of Cystic Fibrosis Patients
pubmed doi rcsb
molecule tags Lectin
total genus 21
structure length 114
sequence length 114
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2002-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07472 PA-IIL Fucose-binding lectin II (PA-IIL)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.400 Mainly Beta Sandwich Jelly Rolls Calcium-mediated lectin 1gztA00
1GZTA 1OURA 2BP6A 3DCQA 2VUCA 2JDKA 2JDPA 2WR9A 4UT5A 5D2AA 2JDHA 2WRAA 4CE8A 2CHHA 2JDNA 1UZVA 2JDUA 2VUDA 1UQXA 5A6YA 1OXCA 1W8HA 5A6QA 5A70A 2JDMA 2BOJA 1W8FA 2BOIA 4AOCA 2BV4A 1OUXA 1OUSA 5A3OA 2XR4A 2VNVA 2JDYA 1OVSA 3ZDVA 5HCHA 5A6XA 1OVPA 5A6ZA
chains in the Genus database with same CATH superfamily
2VZTA 5F3CA 2B45X 2D5HA 3QH6A 2QQLA 1TG7A 1UXZA 1NXD1 4I02A 4LR4A 2BDRA 4IE5A 4XILA 1XSQA 4D6RA 1VBC1 3I2KA 5IW0A 2BVBA 2WT2A 3S30A 4DMIA 2G4IA 2PLV3 1UYYA 1ZZBA 2XVGA 1J84A 3WT3A 1OPMA 3IB3A 2IXIA 1JYIA 1HN0A 5HPOA 4V2WA 3T09A 3CDZB 2ZX4A 2QQKA 1K5MC 3JZVA 3USUA 4INDA 3WNPA 2ILMA 5FPBA 5HXVA 4I09A 2Z5WA 4K40A 1LHUA 5HXMA 4N8MA 1OVPA 2L9LA 1WCQA 2JKBA 1AR73 3WF0A 2E6VA 4LITA 4QKBA 4BE3A 1CAVB 1GP4A 3ABZA 2ERFA 3KT4A 2R042 4XFHA 3TWIA 4AGVA 1WW6A 1L7RA 1N1VA 1XB9A 2AC1A 2BYVE 1GWMA 3E6BA 5GM0A 2DVGA 3HWJA 4LO8A 1KFUL 1I9RA 4QQOA 1KFXL 4GMP0 5KC6A 5JIUA 1W90A 2GAUA 2ZA9A 4LBQD 5C9AB 2DU0A 5KXDA 2PXJA 3HBKA 5FMDA 3A23A 3LSDA 5ACA1 3RGBA 2D6MA 1V70A 1ZREA 3KSCA 3MW4A 1W03A 2Q1FA 4CU6A 1UNBA 1PVC3 3SHRA 1N3PA 1QDCA 5T52A 4EQVA 2R7EB 4GH4C 1K5MA 4CDWB 4BQ3A 1VALA 1CONA 2VUDA 4LMFA 3AZZA 2F17A 3DUIA 4MVTA 1CAUB 1ZBE2 2VW2A 1CVNA 1OXCA 2BNOA 5FY9A 5C8CC 2CNAA 2P3KA 3VDDB 1BEV2 1DQ0A 4AVVA 1HRV2 3Q8BA 4D3WA 3GBGA 3KV6A 3B3QE 1URXA 2ZX0A 3FHQA 2XJVA 4ZS2A 4HK9A 1FT9A 3KS7A 3UGFA 2DFCA 2H6BA 5JOYA 3GF6A 3ROUA 1OLRA 4CU9A 5APAA 2RS11 4BISA 2A3XA 5AVAA 4AVAA 2JWPA 1L7LA 1HV0A 5IAXA 2FBEA 1LRHA 1SQ4A 2ZGQA 4Q4X1 1GR3A 3RI8A 4YFWA 5EIYB 4JAAA 4BCUA 4P08A 4QKNA 3HJRA 3PLQA 4AGGA 5BNOA 2QBXA 5CNAA 1A6CA 2AYHA 1W2TA 4L2NA 5E16A 3E6CC 2V5YA 4W6WA 5D21A 3RMXA 2JD4A 3P3PA 5A70A 3OYWB 5AC91 4GZ9A 2D44A 1N3OA 1FPN1 4OMCA 4PI0A 4DY5A 4GH4A 1BK0A 4YRDA 1BVVA 4LA2A 5DDJ2 3KB5A 4B7EA 1Q56A 2VZUA 2PHTA 1C8M3 3CO2A 4XF9A 5FY5A 5I8SA 4DZGA 4EWAA 2WT1A 5HBAA 2UY9A 2W1UA 3N9OA 4FPKA 3AZVA 4UW4A 5FZBA 3SNMA 4V1PA 3VBRC 3LEGA 1W2OA 2HWD2 3ATGA 2R043 2P3IA 2JE8A 5K0UB 3NJZA 4D6SA 3HT2A 4GWMA 2XJQA 4YNIA 3WP4A 1BBT2 3Q8AA 4N43C 5A6YA 5FZMA 3I3DA 4XUPA 4XC9A 1H4HA 5FZIA 4IEVA 1VBD3 5GLWA 1V6OA 2ZGSA 5DAVA 2QQUA 3C3VA 2W52A 1W06A 2R16A 5FYBA 4FTSA 3NMBA 1EUUA 1BLZA 2O14A 3VBSC 2YB7A 3LDRA 2FD8A 5B4NA 3ZFFC 2WABA 2WA3A 2VCCA 3T2TA 2GC3A 4HBNA 5AFEA 3VBHC 3H42B 1YLLA 1SEFA 4URAA 4NRPA 3H3LA 2FZ1A 3PTYA 5H9RA 1PMHX 1WD3A 1ZBE3 4UAPA 2XJUA 4TLGA 2CHHA 1SDWA 4XBNA 1LCLA 1VBE1 2Q8OA 1CIYA 5A3UA 2UY8A 2RS52 4QX3A 5FBJA 1KJRA 4PT6A 4BIOA 4ES9A 3VBRA 3WW2A 5B2GB 2CYFA 2F4PA 2P5BA 5FV3A 2XXZA 4YG6A 2EXHA 4UOJA 4GQ7A 1PM4A 2RJ2A 3EBRA 5T5JA 5FYMA 4N43A 3FFQA 4D8MA 4CCEA 3I2IA 4XXAA 4AWDA 3BU0A 5IVJA 1PIV2 4CP0A 2MHFA 1H8VA 2VGDA 3I54A 4XFAA 3THPA 1S2BA 3NNLA 1MS8A 1ND2A 2E33A 1S0JA 2SLIA 3MPBA 1RHI2 4Y20B 3IAQA 1LGNA 4D7YA 1UW8A 4P9GA 5F3GA 1UOFA 2G1MA 1QXJA 2XBO2 3AYCA 3T1LA 3VBSA 1O8PA 4XETA 4Z07A 4AI1A 4R9DA 2JB8A 4IEXA 5EFUA 5C3SA 2MEV2 1LOFC 2RJLA 3SEPA 3A0NA 5DQ0A 2W3JA 3VBHA 2VECA 2WN2A 5FZHA 1WW5A 5DDJ3 4AI9A 5BUVA 3UGGA 1DP0A 5IYYA 3LFIA 2RS33 4MGZE 1Z7S1 2NPIA 3E6DA 3VBFB 1OD5A 3MBWA 1VRH1 1DLCA 3POJA 2HWD3 1ENRA 1V9U2 2VVDA 3OOXA 3GCXA 4NO4A 3RVHA 4OHYA 2ZGTA 2VPVA 3J8F2 3K3OA 2BZDA 1BBT3 3IIAA 4QU1A 5KHKA 4CPBD 2PTMA 1F8VA 4C1XA 2Y64A 2CSGA 3UGHA 5CAZA 1W8NA 3ILNA 1O3QA 1AR82 1R093 4BXFA 3HQRA 3GZAA 4CSWA 4FFHA 3NKTA 4NRQA 4CPBA 1CJDA 1I5ZA 3O14A 4LHNA 3HN3A 4MGSA 1EAH1 3RZLA 4YVWB 3ZXGA 1FI2A 2A1XA 1SLLA 3WQ7A 1OVSA 3OCPA 4BDVB 2A3YA 3LQCA 1QNWA 4OHXA 4Q1RA 3V0BA 1XOYA 3ELNA 1LOFA 4QHOA 5FY1A 5LA2A 3KV9A 3RNSA 2HWF2 1U5XA 2PHUA 5FO7B 1TE1B 1OA4A 2RVAA 2I2SA 2Z4FA 3KGLA 5F39A 2GALA 1BHGA 3VBUC 2WUHA 4BMBA 5F3EA 3H8XA 3HIFA 2RS53 1UZYA 3KQRA 1LOEA 4KQ7A 4OVEA 1PO21 3MF6A 5FYHA 4DY3A 1RC6A 1SFNA 4GXLA 1AX1A 4OHZA 4BK4A 5CKNA 4HFSA 4DS0A 1N3QA 1W9FA 5KHHA 1NE4A 1OQDA 1TZOA 2J42A 4XE9A 1ZRFA 1C3HA 1XE8A 1AYM1 1QJX3 3KF5A 4Q27A 2HWC3 3HBZA 3RYPA 1U5YA 3ZSMA 4C8DA 1DQ5A 3GJAA 3LDBA 1RHI3 4DEQA 2Y6FA 2WS91 2JICA 4IE0A 1RMU1 2XBO3 2WSVA 4IEOA 4K7JA 2ZGKA 1YRZA 3CBNA 4E4DX 3DPRC 2VZOA 3AM2A 4QPGC 1JYXA 2ZX3A 4HL0A 3J7LA 1NLRA 2MEV3 4LBJA 4HN1A 1QHDA 2DFBA 4AHXA 1F2NA 3S0MA 4HSLA 1VBA2 4CZSA 1H1MA 3KZ4C 2ZGUA 4MOAA 3U37A 4ZU7A 3POSA 1UMIA 1ZRDA 3KCYA 4MGIE 4Y22B 4UFLA 2GDFA 2FQPA 1W2UA 4QX1A 3VKNA 3WG1A 2ZMNA 3NAPC 1RUH3 3MPPG 4NAMA 5C8CB 3OUJA 4UFHA 1GFF2 1VBB2 2XB6C 3JD72 5HCHA 5DUXA 2HWB1 4XDOA 1RUJ1 3WDVA 2C9AA 3J8F3 4HZFA 1IG3A 4LIUA 3S6PA 4CXXA 5JUVA 1J1LA 2QZ3A 1HV1A 5CU1A 5D1IA 3OGGA 3UV9A 1W3VA 2VMCA 4QPWA 4DPNA 4P02B 1R081 3DGTA 1AR83 3AMNA 1W9WA 5FKBA 1A78A 1XYPA 4A42A 2AGSA 1GANA 3AZXA 3ZXKA 2C24A 1UY3A 4AEKA 2XVLA 2HLEA 3EB7A 4R8HA 5F9TA 3O1TA 5FZOB 2B7YA 2JDMA 1IS3A 4P5HA 2Y6GA 4XJ9A 5JOXA 3EYPA 1H2NA 4DXTA 2WFF2 3A7QA 5JSOA 3M7AA 4JHZA 1VMFA 4Q4W2 2D93A 1K12A 1LHNA 3DPRA 5A33A 2RS12 1LU2A 2PLV1 4BM8A 2CGPA 3LA7A 2NM1A 2ZOEB 1ASJ2 2GMPA 1DQ6A 1UN1A 1W0NA 1Y9GA 4HKWA 3HEIA 5C3PA 4S2FA 2FDGA 4OHVA 3SQOA 5BNNC 4HKOA 5FRAA 3VL8A 5BPXA 1H2MA 3KGZA 4J1XA 1JZ5A 4IEYA 4PLOA 3PIGA 4L92A 3HN1A 3NAPA 3CU7A 4MADA 2QNKA 5LCWL 1HLCA 1VJ2A 5ANNA 2FDHA 1FPN2 1QIQA 4DQAA 1COV2 1AR71 4Q0VA 1S0DA 3ZFGB 5FZ7A 1U5ZA 5EXOA 3ZSKA 1WBLA 1W9SA 4YW7A 3ZLIA 5CFCC 5JZGC 1AX2A 2QUOA 3RFRA 1WMDA 1ND3B 3H3UA 4A45A 3TEWA 3VZJA 1B35C 4E4ZA 5C33A 2CAVA 3T0DA 1LOAA 4Q5OA 2B42B 4DNYA 2WAOA 1HXS2 4OI4A 5GJ6A 5A6ZA 5CG9A 1BMV1 2VTFA 4MX3A 3OGJA 4FPEA 4ZPIA 5LEKA 1EV13 1W0PA 2XQXA 1YIPA 1MZ6A 2Y6HA 3IKWA 3QBQA 3ZFFB 4EROA 2E9QA 2E63A 5DUUA 4R9BA 2P6HA 1VBA3 3M3CA 4HN0A 1JYCA 1US3A 1C28A 3AJZA 4LO5B 2RMU1 3RJ2X 1UYXA 2VO5A 1PVC1 2ADDA 4XMIA 1NY71 3FX3A 2VCBA 3U75A 4L0PA 4QDRA 4LULA 4Y4YA 2A71A 1DGRN 3JD73 1VBB3 4ARXA 2VMDA 4RYDA 3RZZA 4CUGA 4LK6A 2JX9A 3TNQA 1FV2A 2R072 5FP3A 3HOBA 4FXKB 3H0OA 2TUNA 1XU1A 3HQXA 4UI9L 5JOWA 4YYOA 2OX0A 1FNZA 1XNBA 1LESA 1PO11 1QEXA 4W50A 2QFEA 3VBOC 2CU5A 4EWEA 4NIDA 1G6NA 4Q29A 1B35A 2E51A 3WW3A 1RL3A 5DZGA 1JOPA 1FAYA 1E5IA 1K45A 1AF9A 2VVFA 4JQTA 3WINE 4AFCA 2NYYA 3FBMA 3KVBA 3OUIA 1IHMA 3QOPA 4IDZA 4R4XA 4XIOA 4AK3A 2WFF3 4Q4W3 3IM0A 4YGDA 3PVBB 2RR12 4HETA 4ET7A 3ST7A 4M00A 4XJAA 4B29A 2Q0AA 4F3JA 2CWSA 4ZZ8A 1QMJA 3R4DB 4DEVA 1XNDA 4D7SA 3RZHA 3IBMA 4ASKA 1RVF2 4FOYA 4K3UA 1WKYA 4BYYA 3U1XA 3AKRA 4PIYA 4QM9A 4QQLA 2XL9A 1OD3A 4HOOA 1DHKB 1L3JA 1PVXA 2AH2A 5FQ0B 1HJGA 3MIHA 4BZ4A 5LEJA 2Q30A 4P14A 3VD3A 4AFBA 4C0HA 1F5JA 1DQ2A 1SZBA 3OF1A 1Q8PA 1COV3 4NPLA 4RGAA 1LOGA 3BPSA 3O1RA 1XNCA 4E9KA 1E5RA 2RJKA 4IV1B 2VUAA 2PHFA 1OFNA 2EAAA 2AZ5A 3JB8A 3ACLA 5EYYA 3U10A 5G04L 2PHWA 4TWTA 1DU3D 2R041 2UWBA 4ES8A 2I74A 1IKQA 4B7KA 3VBOA 1V0AA 1OOPB 4AI8A 2EAKA 2R6QA 1K3IA 3P5BA 3VZNA 1LGCA 4L11A 2KD7A 1ZA7A 1TNRA 1QJEA 1VBD1 2QCSB 2ZGRA 5FZ3A 2WQZC 4UXAA 1BXHA 2D40A 3WQBA 3MFAA 4S2HA 4DRVA 1X8EA 1DQ4A 3LE0A 5FY7A 1F4HA 3VBUB 4XUTA 4A7KA 3W58A 5E8AA 5C9AC 1W8UA 4URTA 1NX9A 2J1SA 4DB5A 2Q8DA 3BPZA 2O8QA 1ZBE1 2R073 2P2KA 2ID4A 2RM22 1OF3A 4Q4Y3 1WWYA 1BEV1 2Y26A 4D69A 5JR2A 1HRV1 4NWVA 1S0IA 3RZKA 5IVVA 4YW2A 2FCVA 4LORA 4IXLA 4WM8B 1DCSA 2V5DA 1HN1A 4LKEA 4Q0QA 4F7ZA 2YU2A 1R64A 3T1MA 4EE2A 5J37A 4Y4RA 4CP2A 2XHNA 3C7GA 1DF0A 3DF0A 2YUEA 2ZKLA 2Q1MA 1E57A 1VB2A 1W6OB 4HVQA 1CAVA 4N53B 2RR13 5A33B 1CIWA 2ZGMA 3WF4A 3DPRB 4LKSA 5IJRA 4QPGB 2H0VA 4XHBA 3QH7A 4NAOA 4WBBA 1D4M2 1RVF3 5FMCA 3AFKA 4LLFA 4QHZA 4TTGA 2WZR2 4BQ5A 4YW5A 3W9AA 4DFSA 2UWAA 2WWJA 1SACA 3K2OA 5FYTA 1REFA 1XC6A 4LO7A 4A41A 1C5HA 1OURA 4UW3A 4UW5A 2G9ZA 5DDJ1 5FMBA 1X82A 4RHV2 1W0OA 2JDKA 4LK7A 5C9AA 2JG9B 1S1AA 2ZABA 3AKTA 2OIIA 4L97A 3KCCA 3ZSEA 1WA4A 5A3TA 5E6HA 3V56A 1SLIA 2HWD1 1GNHA 4AI2A 2DVBA 5FMOS 3VDAA 3KQ4B 4LPLA 1H30A 4EN7B 1BBT1 1KS5A 2OS2A 4KI5M 3THTA 2IC1A 1CAUA 4FVVA 1VR3A 1WA6X 2Y38A 3BCWA 3I3EA 1YEWA 3VDDA 3OBZA 3ZYFA 1XQNA 3OBAA 3CZJA 2XG3A 4AYUA 1HQLA 4NROA 1RXGA 1ULEA 1YFWA 1LHWA 3CZUA 2JIJA 1AVBA 4Q0SA 5FY0A 5L9RA 1GWLA 4UF0B 4DRRA 4SBVA 2VW1A 4HT1T 5BNNB 2VUJA 4YM3A 2J1EA 4XFFA 5FZAA 2LUWA 5IATA 1H4GA 1MS5A 4CP9A 4KG8A 4QMAA 5K7PA 2EICA 1ZM1A 2Q5TA 1CN1A 3QD6A 2RM23 4RFT0 4CP1A 5F7UA 3TRSB 1HW5A 2IXHA 2YZ4A 3NW4A 4O9GA 4AVCA 2RS51 1W6PA 2PMWB 3OYWA 4XAEA 5JZGB 3VHRA 2Q8CA 4D6QA 2IXCA 4EYUA 1OLME 2P6CA 2ZBJA 5JXJA 2WYSA 4FPCA 4YSFA 2XQRA 2ES3A 1IPSA 5D8AB 2ZHNA 3JBG3 2YYOA 5LASA 1PIV1 2I45A 1UF2C 1XE0A 2PQQA 4KBZA 4GD4A 3LPFA 3NNMA 4PJYA 1J58A 2J7MA 4CUCA 4DUVA 3AYDA 3WF3A 5FOJB 1QJU3 2KA3A 1RHI1 1Y3TA 1BKZA 3B9CA 4MV2A 3ZIWA 4AR2A 4EN0A 1RUF2 1JYWA 4DIQA 1JZ3A 2XBO1 4XFCA 1JZ7A 1IZ3A 3J7MA 2WZR3 3B7MA 1M4WA 2WQ8A 1JTZX 2QQWA 3ZKYA 4M3CB 3D4KA 1WLWA 1HB2A 4Q8LA 2MEV1 5JXIA 1T6BX 2WSUA 3P3NA 4CCKA 5I91A 3PIJA 4RHV3 2PN5A 2VNGA 3RS6A 3H8RA 1S0GA 4D7TA 1ACCA 5FUNA 3MV01 3H1YA 4LQRA 1O91A 2ENRA 3BOWA 3DV8A 1MZFA 2P3JA 1P8JA 1V9U1 5L73A 4MXWB 5EPAA 4OFGA 4N7IA 2CDPA 2VTXA 1UPSA 2Q1ZB 3JXSA 3J8F1 2GC2A 2OZ6A 4XF0A 4YWAA 4JRAA 4OI0A 1NUKA 5FTTC 3QLQA 2XWJB 3VBFC 4TZDA 1H0BA 1QY4A 4P9LA 5C5TA 1AR81 3WNOA 5IVCA 3GGLA 1E5SA 2Z2SB 3RWKX 4B1MA 2K0GA 3HVDA 4XBQA 2WO1A 1PMJX 2XJTA 5IHRA 1ULOA 1GOHA 2OUHA 1NZIA 4QD2A 1QKQA 1G9BA 2QJVA 4A7ZA 5FXWA 3O1MA 4X8PA 4ZU5A 3VHNA 1MVEA 3D0SA 1WZXA 2JB4A 2JDUA 3CHXA 3SKJE 1CR7A 2WNVB 5AFBA 1D0GA 2HWF1 3GNEA 3KT1A 5I93A 3I2OA 3U07A 2GNMA 4Y20A 4EZHA 3BKZA 3OY8B 1CZSA 2VD7A 4MHRA 4YVWC 3UT0A 1YQ5A 3JB4C 3LOBA 1MZ5A 1W6QA 3RJRA 1D2SA 3K75B 4IGOA 3ZYHA 3BOPA 5FPZA 2XH6A 1GZCA 4RL7A 4KWKA 4QGNA 1LOBA 1O8SA 4GMP3 3H8OA 3ASIA 3MDPA 3HNBM 3LWCA 4UBHA 4BPZA 3VBFA 1C8M2 1YWKA 4X6QB 4OZXA 1HDKA 1FMD3 1MQTB 2VXJA 3I97A 4CVUA 2ATFA 1IGOA 2EALA 1NLSA 4QB1A 1WLDA 4GIQA 4HXCA 1RUF3 5F8PA 4FT8A 5LBFA 1VRBA 4CCMA 4AI3A 2WC2A 1MACA 1RJ8A 1HRI3 4LHLA 1J3RA 3D82A 1JYVA 2ZEYA 3L2HA 4F8AA 1LGBA 1HJFA 1QNYA 4NUBA 4H55A 4NHXA 3AX4A 3WCRA 3NVCA 1W39A 3WNKA 2XKPA 2BWCA 2R0FA 3MIFA 1NG0A 3PUIA 1VBA1 4KWLA 5FDBA 2YPJA 1VBD2 1Y9MA 4I0AA 1GKBA 2PELA 4RR3B 4XIKA 3MIDA 2HBTA 4HMZA 3S5QA 1QXPA 2XLGA 3PUQA 3TN92 3HD8B 4Y5Z0 4YVWA 2OT7A 2V4AA 4C91A 3S57A 2YPDA 1VBB1 3C7EA 2WT0A 3JD71 3CLPA 4E8DA 1AR63 3KF3A 5J3UA 3M70A 1R1A3 1T6GC 2J1RA 4OMDA 2QKDA 2G9GA 3OTFA 2ZGNA 1ZZ7A 1D4VB 4W65A 4A3ZA 1W99A 2VW0A 2ZZQA 2BQPA 2D6PA 4AZZA 2CTVA 3E5UA 3N35A 4CDUB 3FMGA 5FP4A 2W95A 4P00B 1DGWX 2WWSA 3F2ZA 1H2LA 5ABJB 2ET7A 1VAKA 2D6NA 3N9QA 2MNGA 4K9SA 5L9BA 3ZDVA 4N90A 4OI1A 1NA1C 2HH9A 2VOXA 1QJFA 1VMHA 2HEVF 2WFF1 4Q4W1 1CGPA 4YZ1A 1LHVA 1JXNA 2IXKA 3T08A 1SLCA 1ASJ1 1QGLA 1RYYA 3LPGA 4CP9B 3NV2A 1UO9A 4J25A 4YGEA 2V09A 3MYXA 2RE9A 3M4FA 4CCOA 2NN8A 4PI2A 2VZ3A 3KT7A 1SPPB 3N9LA 3R05A 5FZCA 1WMXA 1DDLA 5DMYA 3K46A 1W6PB 3CKHA 5CVRA 5FPXA 4PLMA 3T30A 2N7GA 1COV1 1JBCA 1WBFA 1O3SA 2A5ZA 2CGNA 3ALQA 2GNDA 3RSJA 4CA9A 1G9CA 4QXKA 3ZFEC 3E5XA 2AUYA 4Y22A 2RS32 1JH5A 4Y1VA 3KHCA 4PLNA 3DCQA 1WMFA 1F5FA 4I3GA 2ZHLA 2WAAA 2VR4A 3KM5A 3LKJA 3D8CA 5C8CA 1W9TA 2W94A 5FREA 5CG8A 1MS1A 1KRIA 1HXS1 1REDA 3VZLA 2B8MA 3UYJA 5LA1A 4MGTA 1GU3A 3ZFGC 1H9PA 5FK7A 3EQEA 4IGQA 4FPGA 1ST8A 2WFPA 1NA1A 3USSA 2PYTA 1ND3C 3G7DA 1I1EA 2BNNA 2VJXA 2UWCA 1ALYA 1I5PA 1R092 2Z69A 3ETPA 3HQUA 4W6XA 5EZWA 5F3IA 4YZ4A 3RPQA 1ZZ8A 5FZOA 4OZOA 2RG4A 2P17A 3WHTA 1V00A 4XAAA 3PTRB 4U36A 5FY4A 3OEAA 4CCJA 1POV0 1Q8VA 3EHKA 1A8MA 5D2AA 4QX7A 2E31A 2R071 3GCWA 4ZY9A 5T50A 4AHYA 5LBEA 3ZXEA 3MIGA 4OULA 4B1LA 4YGCA 2Y6LA 2YC2A 1OKQA 5C8WA 3ZFEA 3V0AB 4Y5SA 1QOOA 1VE0A 3P1IA 1VAMA 4R4ZA 3SH3A 1DGRA 2B39A 2PHLA 2WZ8A 1X50A 4XJUA 1SCSA 3M2MA 1SHWB 5DAPA 5FZ6A 3Q9OA 3PVEA 4BQ2A 3BALA 1H9WA 3DKQA 5SV5A 2X05A 4MH0E 1STMA 2FDJA 2W68A 2LROA 1EYBA 4L9BA 3ZFGA 1DLLA 1O5LA 2RR11 3J7HA 1LULA 4H7LA 2P1BA 5DXDA 5FUPA 2ZEWA 3FN9A 5JVVA 1ND3A 2PHXA 2ZHMA 1QJX2 3LIHA 2HWC2 5K8SA 3WDUA 2WR9A 1RVF1 2YFUA 4QGLA 5KR7A 2WLQA 2A6WA 3AZYA 1TQ5A 3O12A 1SFYA 3K3NA 3AMPA 5HI0A 2VBBA 1A3KA 1IS6A 2PAKA 2ZHKA 3W21A 5A7NA 1KDMA 4HG6B 1XYNA 5TSWA 3WLUA 1W6QB 3ZIXA 5IK7A 3ZFFA 4K8RB 3WW4A 5H9QA 3AXDA 2BOIA 4E2SA 1PK6C 1UPIA 1GP5A 4CRQA 3WVJA 2GP5A 5L36A 2G19A 2QTWB 2YBSA 4M3CF 4NHYA 5A1AA 4TSVA 1GICA 1JZ4A 1RUH2 2FZ2A 4Y26A 2D6LX 3AP5A 3PMSA 2ZX2A 3DN7A 2DBIA 4CCLA 1WD4A 3SKVA 4IV1C 2DCKA 2W1WA 1FXZA 4CU8A 3H50A 1QH7A 4B4QA 3ES1A 4QDSA 4OLLA 2GP3A 5FBZA 3UNPA 3WUCA 1DFQA 4BMEA 5EJ1B 3ZYPA 5GZGA 2BU9A 4RSUA 2FCUA 1J1TA 4RFRB 1OOPC 2ZZJA 3SH4A 1ZX5A 5FZ4A 2TBVA 3C7HA 3THCA 3O0VA 1ZA4A 1LEMA 4AQ2A 2WZPP 4E4HA 4GWIA 4XJWA 4LOTA 3I49A 2RDNA 4FPJA 2K9ZA 1QXRA 4JKKA 4D94A 3LOIA 2RM21 1ZBA3 3HR9A 1H6XA 5FFOC 1PMIA 1AR92 3DL3A 3AC0A 1GOGA 1PK6A 2EIGA 4K6BA 4Z92B 4Q1PA 2ZEXA 4GWJA 1XU2A 3NJXA 1UCXA 1KDKA 3GYDA 5C4WB 3DYOA 3NJYA 1UIJA 5CIRA 3J9SA 4FXGB 3CIHA 5FCCA 5FQ0A 1Q8SA 1DYKA 2BGPA 5C3RA 1W28A 4ZXKA 4QU2A 4FPHA 4IV1A 4NHKA 1GOFA 3I2FA 2YC0A 3B9IA 5C5UA 4Y33A 1XNTA 4IE4A 3AYAA 3IWZA 4WM8C 4QKDA 4QXHA 1YI9A 1MZEA 1UY1A 3I2JA 4ASLA 1D4M1 3U78A 3AB0A 3W5MA 4ONUA 1OOPA 4CDQC 2WZR1 2VL4A 2YBPA 4XACA 4MG2A 5I0RA 1V6LA 3NWKA 4N53C 5GLVA 1HQWA 4DXRA 3C8XA 4RHV1 1EV12 1UQXA 1OA2A 3UJQA 3CJXA 4EN9B 1DZQA 2YC4A 4MGQA 3EXUA 2C9KA 5F5AA 3BYWA 4BJ0A 4JKMA 3D5OA 2C1FA 3MW3A 4YGBA 5FP9A 4W4ZA 2PHRA 4Z2WA 5I8TA 4CTEA 3RQ0A 5FYZA 1KEXA 2LRPA 1N1TA 3VZOA 5KXEA 4DOUA 5LA0A 2W46A 4ZHNA 4CXWA 3PUAA 2UURA 3VBUA 1JU4A 3W20A 2A6YA 4G9SB 4IE6A 2JG9C 4FBFA 3APBA 4MGYE 2VULA 4M4RA 4PF1A 2IFRA 3MEPA 1OH4A 3LA3A 2ZS6B 4FPOB 4HK8A 4M3CE 3OGRA 4AF9A 1A34A 1NA1B 1WLTA 4AE2A 5L7OC 4GKYA 4YW4A 2VQTA 3OEBA 4QGMA 5ISLA 1YJLA 4WM8A 4MHUA 3ETQA 4MO3M 4ZS3A 3SCFA 1RJ7A 2C26A 4GWNA 4AQSA 2PHDA 4E2QA 3VD9A 3ZYBA 2WJSA 3RG0A 2BOJA 3HT1A 4LBOA 4CDQA 3BIEA 2UYBA 1MPXA 1X33A 1W6OA 2P34A 3UKVA 3IPVA 3BTYA 4N53A 1XRUA 2HKXA 2XHKA 4YG3A 1BVP1 2D6OX 4QPGA 5C3QA 4RQPB 5E88A 3N3HA 1AR93 1CX1A 1AX0A 1JUHA 4WZFA 5I8YA 1CX4A 4AVSA 3D6EA 1QH6A 5DG1A 3GBWA 5GALA 3AKSA 1JYNA 2AEZA 2BJSA 3ZFEB 4QX0A 1Q5OA 3K51A 3L9JT 3I3QA 3MFCA 4NJ4A 5IFTA 3UESA 4RS5C 4GMP1 5JMCA 2JG9A 3LB9A 3VHPA 4M0NA 5A6QA 4GB32 3GHNA 4A6OA 2BTVC 1LODA 3PU8A 3I7DA 1FMD1 3TBDA 2PAMA 3EMRA 1LR5A 1L7QA 5L7OA 1VBC3 3NRUA 3WCSA 1BYHA 1O7FA 2X5IC 1RUF1 4S2GA 1VAVA 2JDYA 2GNBA 5D8AC 1UWWA 5BNQA 1HRI1 3H8UA 4UWDA 1OC1A 3OGSA 4P5YA 3MW2A 1FOD2 2VM9A 1GQHA 2NZ9A 3WSOA 2X8KA 4H3WA 1LTEA 1ODMA 2JDHA 4UFJA 5L19A 2JDAA 4HKLA 2HBUA 4ISRA 1H1AA 2YXSA 3SCGA 5FZFA 3GXUA 3CQOA 3E5QA 5A32B 4H14A 2JG8B 2QDNA 1LHOA 5IVBA 2VH9A 2A75A 3IDCB 1AHSA 5FYCA 1QJY2 4AOCA 4UF0A 5GZEA 1JYTA 3ILFA 2QZ2A 5BNNA 1AR61 2DCZA 5IFPA 5ERLA 1N1YA 3FHAA 3ACIA 3CEWA 5CBLA 1RGSA 4MSVA 2ZX1A 4QX5A 5FYYA 3LDKA 4RS5A 1MS4A 5JIAA 2Y33A 2E53A 2NMNA 2PA7A 5FAXA 3H3ZA 2BP6A 3ES4A 4FOVA 4K8FA 4Q4Y2 3W59A 3WZ1A 1JZ2A 3U0ZA 4XURA 3VN4A 1NYWA 3O1PA 1UMZA 5A1FA 2X5IA 3MUY1 5FUIA 4PDWB 1CESA 2EXJA 2Y6KA 5DUVA 1GNYA 5D8AA 3PHMA 4XABA 1UYZA 5LBBA 1JW6A 4S2DA 1TMF3 2EIDA 4G3YC 3C2UA 1UY4A 1AUYA 1NE6A 2F4LA 1OUXA 4IESA 1OPOA 5A7WB 1QQP2 5EJ3A 2R1DA 2QQIA 3NV4A 1T2XA 4FI9A 4BQWA 1PK6B 4MGKE 4NPMA 3UETA 5GZCA 4UFKA 1XJAA 1MR5A 2DWRA 3CNAA 4JZRA 4M3CA 5GLZA 3ZN6B 4O61A 2P37A 4LKDA 1Y43B 4COWA 2WNVC 2QQOA 5JSRA 4PIXA 2OVUA 5IWFA 5F5CA 4BOWA 2HJIA 1MVQA 3GBFA 1F35A 4NR1A 4GB33 1C8M1 1JOJA 5FP8A 5FWEA 3RDIA 4CCCA 5CEHA 2DTWA 1RINA 1AYN2 4NN0A 4RA0A 1IG0A 2WKKA 2BW8A 1S0CA 3LA2A 4M0HA 5SV8A 4Z2AA 5A1LA 1Q8OA 4MXWA 5KHJA 1JZ8A 1WCKA 4IV3B 1YCIA 4KWUA 3IMMA 5IAVA 4IQPA 2XONA 2DURA 3UL2A 1FOD3 1MQTC 4DO0A 3AFGA 4PBPA 1OH3A 2VOVA 2ET1A 1M06G 5FMOL 3WY6A 1UD1A 1UMHA 2W5FA 4COZA 4AQTA 1W2AX 4SLIA 2WINB 1QJY3 5HCFA 3BIWE 3WG3A 4I2OA 4Q8KA 4IERA 2XL7A 5JWPA 1RUC2 1FATA 1S2EA 1Z78A 2WNVA 4RR3C 5FZ8A 4K21A 4AFDA 3OY8A 3N9NA 2P4EA 4AXOA 1H8TC 2DCJA 3UKNA 1VLNA 5JXHA 1C4RA 2GU9A 5AVPA 4LO4B 3R6SA 3MUZ1 3ZYGA 2XLFA 1W6NB 1YHFA 5F1RA 1RUNA 2VZ1A 3FZ3A 4XDQA 5CFDB 2BNMA 4AFMA 4CDQB 3JBG2 3POFA 2VZVA 2DF7A 4LHSA 3KV5A 2J22A 4CDUC 1EP0A 1UU6A 1MQTA 3IPVB 4AHWA 4D0QA 5ABJC 2BEOA 3AL5A 1QQP3 2WNUC 4FPYA 4FP3A 2YG0A 1QJU2 1YFXA 3LEIA 5FIXA 1OUSA 3ZX7A 4TLFA 4MYEA 1SBEA 5I0SA 4ATFA 3I2DA 4CCDA 2JECA 1VIWB 5IVFA 1PNGA 3FL7A 1CAWB 3FLRA 1VBE3 1JHNA 2V73A 3WDXA 1G9FA 1NCQB 4QQ2A 3B02A 1NT0A 2ZCWA 4QPIB 4DXSA 3IDEA 3B94A 2TEPA 2Y8KA 4HANA 4WM7C 5LB6A 2HWE2 3AK0A 3AMQA 4CEWB 5J98B 2Q4SA 2RS31 3H1WA 4RR3A 3SC7X 4JGZC 5FLIA 1AYN3 1O4TA 3NV3A 1UZVA 2NLRA 3N9MA 5FPAA 3GHMA 1GZ9A 1NKGA 1ZZ6A 2CAUA 1BK1A 5BNPB 5L7OB 1S0EA 1MEC2 4YW1A 4RN5A 4WV8A 1CJPA 1YO8A 3OPWA 1BQPA 3RYKA 4LIVA 3KD4A 2OA2A 2R0HA 1WCUA 2W92A 4IEWA 4META 4OCTA 4YW6A 1HX6A 4KBBA 2J1TA 4KGQA 1UY0A 4LLOA 1J3QA 3IZOA 1R091 2QVSB 2CWMA 4CDUA 3R4UA 1EY2A 2Q8EA 1PGL1 1GNZA 1SLTA 2Y0IA 5ABJA 1DIWA 4XUNA 4YM1A 1GWKA 5FYIA 4QAWA 4E27A 5FZKA 1GV9A 1KJLA 4LO6B 3ZR6A 4BWOA 1Z7S3 2GN7A 1CZTA 3B00A 4EWDA 3I2GA 4UYBA 3FWEA 5DG2A 4W8JA 1RUC3 4XUQA 3VHOA 1DGLA 1O3TA 4RD7A 5M0TA 1RUD2 1RUI2 3Q8CA 1NZCA 2VNRA 3FE5A 3AMMA 4RS5B 3URFA 1SPPA 2ZTNA 4KL1A 4ORFA 4JGZA 3C7OA 1UIKA 3OBTA 1TEIA 4IETA 4HSJA 3ZMOA 1AXKA 5JZGA 5JPNB 1ZRCA 2VUCA 2X5IB 5CA6A 1ODNA 5C71A 1QJX1 4K1YA 4BLIA 2KM2A 2XPJA 2HWC1 1LEDA 3ACGA 1C1FA 1FMD2 2VMEA 4YZ5A 2E7QA 4R9CA 3WEZA 4LBMA 4G4FA 2ZGPA 2ZKNA 2XJPA 4HLTA 4AEMA 1EUTA 2FHRA 3LZZA 4BLJA 1S55A 2ZGOA 2B46X 4YPJA 2EA7A 1YFYA 2CDOA 1HRI2 3OD4A 5CKQA 2OXBA 4NHMA 4WVVA 2AEYA 3AJYA 2YMZA 3MICA 1ULPA 3MV11 1PO23 2HWE3 2PQSA 3KLSA 3POBA 3KHBA 4Q26A 5FWJA 2EXIA 5F6LB 1ENSA 2OPKA 4DUWA 3ACFA 1XXNA 5LY1A 3PURA 4XCAA 4DUXA 5LK7B 1I3HA 1YQCA 1RUH1 3TAYA 1OA3A 2J1UA 4TYSA 5FXXA 3T4VA 3BTAA 1G9DA 4CYDA 1MEC3 5E1RA 3HNMA 4AVTA 4YM2A 1V6MA 1AR62 3LF7A 1R1A2 1JN2P 4P9IA 1W8FA 4X8NA 4OQ9A 4AVBA 3AVRA 2WO3A 4FTEA 4FPLA 1OF4A 2O1QA 1ZRIA 5A3WA 5ANQA 3POGA 3V0AA 1IOAA 5T5LA 5LRSA 2DYCA 4JGYB 3UK9A 5CKMA 4Y5TA 4FFFA 2OQ7A 4IEPA 4QHBA 4N9HA 1VP6A 1KS4A 2VMGA 5A7OA 3VKLA 1CPNA 1I6XA 4MXVA 3GJBA 3NSTA 1W2NA 4COVA 2BGCA 5J36A 2E7AA 3KVAA 1LOCA 5IVYA 2RDRA 3INAA 1GUIA 4XQ4A 1KD7A 1JUIA 4FO9A 2K46A 1AR91 3P6BA 1BJQA 1RUD3 1RUI3 3CJIC 5B4XA 1W8HA 3LD8A 3POYA 4COUA 5FYVA 1SLBA 4QXCA 1S0BA 3ZMNA 1SLAA 4M4PA 5DZEA 2PFWA 1SFPA 1XNAA 3A21A 4KGGA 3Q8FA 1NQDA 4B8EA 3VD4A 1O4ZA 4X6RB 3NNFA 3AL6A 5A80A 1ULCA 2ZAAA 3VGIA 2ZMLA 3ZN4A 5FO9B 5KC5A 4NIGA 1RXFA 3I59A 5LY2A 5GKAC 2OW4A 1O3RA 1J59A 2VCMA 3CF6E 2DU1A 2XKOA 4UT5A 5FPLA 3C7FA 4XQWA 5C4WC 5J7MA 2A7AA 4KG0A 2AENA 5DZFA 2VBDA 3M3OA 3G6JB 3DECA 4FAHA 3RZMA 2RHPA 1IS5A 2VOWA 1YNAA 3JCIA 1JU3A 5I0TA 3WX5A 5FYSA 2FCTA 1SCRA 1UKGA 5FZDA 2HEWF 1CQ9A 1Q43A 1EV11 2D98A 1REEA 3J4UH 2W9XA 3WG2A 2QQVA 4L8QA 4EN8B 1U0AA 2DVDA 3AP6A 5A3NA 1OLMA 2BRTA 2KXLA 3DKWA 1ONAA 2IVJA 1YIFA 3CJIA 4I3PA 2A73B 4OHWA 1IPKA 3MO4A 5A7QA 3BVCA 3DEMA 1H8TB 1OT5A 3PUSA 4I01A 5JPMB 4IUGA 3OD0A 2FDIA 1MS0A 5FYUA 5F37A 2DVFA 2GC1A 4K1ZA 1UY2A 1AXZA 4RGGA 2IUWA 2EXKA 4AG4A 1UX7A 2W39A 4XDPA 3V65A 3BTXA 3MZHA 1S0FA 4PQQA 5F5QA 5GLTA 4HVRA 4HPKB 5C4WA 3ME2A 1KQRA 3N7KA 5EHDA 4XTMA 5BNOC 1YUDA 2ZPXA 3LEMA 2OPWA 2XJRA 4AEJA 4AAXA 2VVEA 4LEJA 1WLCA 2WNUB 4ARYA 5BY5A 1MS9A 1TMF1 2ETEA 2RMU3 3PNAA 1IQDC 1TME2 3MLLA 4IE7A 4XJ8A 3LFMA 4JV4A 4A4AA 2XVKA 1FYUA 3ZXLA 1LJ7A 4BQ1A 2WRAA 4LBQB 2WN3A 3ITQA 2WDBA 1UKRA 1J3PA 3PVNA 1V6KA 4WM7B 2XLAA 2K2SA 1ZNPA 3D0JA 3MLKA 2BUKA 3OBRA 4JVAA 1UZWA 4C90A 4YZ2A 3W5NA 5GLUA 4JGZB 3TN93 4A7YA 1RITA 1C1LA 2R062 1YI7A 2VE1A 1NCRB 1PO13 2C0ZA 3RI9A 4RQPC 5JSPA 4GB31 4A6SA 1DBNA 3T0BA 4ZONA 5JR7B 3SISA 2LS6A 1JOBA 5CFCA 5EQUA 1FX5A 1U12A 2QQPA 4Q4V2 1UAIA 5DABA 1FOD1 1H6YA 3BGAA 1POV3 1SMVA 2E7TA 4JTOA 4CEYC 4UBGA 3A22A 3K4DA 1LECA 1UL9A 1APNA 5A7PA 1NAEA 4QB6A 5FP7A 2XWBB 5H9SA 3U4SA 2JKXA 2CGOA 4YM0A 1PGL2 2SBAA 3AKPA 3SXWA 4CUAA 2X29A 1C8NA 3GDBA 4O65A 4QWNA 3I3MA 1Y7BA 1QJY1 1W8WA 4RGKA 3ZKUA 5LBCA 1GZWA 2VMFA 5A6XA 2G9FA 1GZTA 4YFZA 4OUEA 5HCAA 2W91A 2P3YA 5CISA 3AP7A 4ATEA 4GAZA 4KMQA 2JG8C 4RQPA 5JLVA 3VZMA 1AL22 1ZBA2 3KV4A 2B4KA 4IEUA 4Q4Y1 3WR0A 4AL9A 3VZKA 1ULGA 2JDNA 1RUE2 4R52A 5IVEA 3WNLA 2YU1A 3ZOIA 2OKXA 5FZ0A 1PZ8A 4AEDB 1ND2C 1QOSA 2X10A 2XMLA 3OB8A 4XZPA 3TOJA 3N7JA 4O9EA 4Y1YA 1QWRA 5I0UA 1AZDA 2ARXA 2PAEA 3WF1A 3ZVXA 5A3PA 3M3IA 3WXPA 1RUG2 4CDXC 1BCXA 1TME3 1O4YA 2WLPA 3LEKA 3ZYIB 4CEYA 4JTNA 3LIGA 1US2A 5F2SA 1PGW2 1QQP1 4UFMA 4IEQA 1OLQA 3FLPA 4PDWC 4NE9A 4QB2A 1X8MA 4LJHA 5FZ9A 5GZDA 4B3NA 3S7IA 3NQHA 1OBNA 1ULFA 3T2PA 4XCBA 5F2WA 1B09A 1W3XA 3B93A 3MLJA 4QX2A 4WVMB 1BEV3 3RRDA 3S7EA 1HRV3 1KGYA 3K77A 4QXBA 2R063 3WNNA 5LW9A 4XYXA 2GNTA 3FHIB 1SG3A 5EYXA 5A32A 5FXZA 3HMYA 2IFWA 5C70A 4LA3A 3I59B 2JG8A 1AYN1 1U5IA 5T5PA 3ZR5A 3N9PA 2XGXA 5LRRA 1UZ0A 1JMUB 4Q4V3 2BBVA 2Z42A 3VL9A 1K5JA 2YY1A 4FFGA 1UOBA 4CDXA 1DYPA 4BB3A 4BU2A 2CL2A 4Y1ZA 2DUOA 5T55A 3O1SA 2FDKA 4IV3C 2XDVA 3USUB 4NWWA 1IS4A 2ZGLA 4LE4A 3ZDSA 2YFZA 2BVVA 3SLIA 4PDWA 5HCBA 4NIHA 3U14A 5FR3A 4J1WA 3CJIB 1IQAA 1GSLA 3VLBB 2V72A 4ISQA 2D7FA 5HV0A 3VKOA 1RUC1 1XNKA 1OQ1A 2LM3A 4FFIA 3LGRA 3NJVA 4GKXA 4UFIA 4YZ3A 4EV0A 4E8CA 5A7WA 1AL23 4PIZA 4Y24A 1C57A 5DN2A 1RUE3 4V2VA 2ADEA 3M3QA 1O6UA 2VOTA 3BODA 3SEEA 3MGUA 3ZN6A 1JZ6A 4BA6A 1PNFA 1W8TA 2DUQA 2KR2A 5JMOA 2D3PA 2NP0A 2EIEA 3A4UA 1CWPA 2DCYA 3JBG1 1RUG3 4XFIA 1HB4A 4NPRA 3VD5A 2VMHA 5DAQA 5DUWA 3DYMA 2J1VA 3J26N 2UYAA 2QDRA 3BTZA 3TB0A 1K5MB 1QJU1 1VBC2 4IV3A 1LU1A 4YLZA 1N47A 5CFDC 2GSYA 2ARBA 2IXLA 2JDPA 3ZN5A 1GMMA 3ZSJA 3PJYA 3WQ1A 4H2AA 2JDZA 3ZXFA 4QPYA 2HWE1 3E97A 3FUOA 4MLOA 1D7PM 2C4XA 1K42A 3PL0A 5J1XA 2JJ6A 3THDA 4F83A 4HONA 4JKLA 1EPZA 1F4AA 1OKOA 3E1F1 2W47A 1V6JA 1QOTA 2LW8A 4BHPA 2A6ZA 5FZGA 2WNEA 1NCQC 1PIV3 1WW7A 1MEC1 2A6VA 2DUPA 2VNVA 2VAUA 3O7OA 4OI2A 4QPIC 3WNXA 1YQ6A 3I2HA 4CEWC 3FJSA 2JEMA 4FQ4A 3OSDA 4QX8A 1WMEA 3ZYJB 4FOWA 4XFBA 3PJQA 5BNOB 1DGWA 2B9UA 2VQ0A 4J6GA 1IPJA 3BU7A 2DTYA 3F95A 1WGPA 1X9TA 4ZU4A 5BNPC 4FP2A 2DV9A 2BPA2 4FQZA 4XQDA 1LKNA 3ZXAC 4GH4B 1S4CA 1W6NA 2YV8A 4GULA 3GALA 3ZXDA 1PGSA 2GN3A 2WO7A 3SCHA 2QQJA 5CFDA 3QACA 1RIRA 1Z0HA 4I0WB 4Z8BA 5H9PA 1VPHA 2R30A 1XPWA 2CV6A 1GZWB 1FV3A 3K4ZA 4XZUG 3PDQA 3T3YA 1TMF2 3WQ0A 1CAXA 4AHZA 5ACA2 1RUOA 1V9U3 1LENA 1ZRRA 2YBKA 3MIEA 4Y1XA 1VB4A 2VQUA 2V4VA 2AREA 3U11A 1RUD1 2R1BA 1RUI1 4JHTA 5KXBA 3WHUA 3LSEA 3WG4A 1O5UA 3AP4A 3M8LA 4I0BA 3IDAA 5L9VA 4KNCA 4QQPA 4AQ6A 5EV7A 1CAWA 1WW4A 1O59A 2NMOA 4NHLA 3VDCA 2YGLA 4ASMB 2VTXJ 1YFUA 1NCQA 3B69A 3MF9A 4QPIA 3WF2A 2J1AA 1E5HA 4YVSC 4CEWA 3V64A 2VXRA 5JAXA 1A8DA 1J83A 1W8OA 2QE3A 5LA9A 4CEYB 4DXZA 5KWRA 4JC1A 1NXMA 1ZZCA 2HEYF 2W87A 5T3NA 4XJZA 5BNPA 1PM7A 3OPZA 1VMJA 1H2KA 2X09A 1GLHA 2IWGB 3PMEA 3WUDA 4Q4X2 5BV6A 2HWF3 4CU7A 4P9WA 2XUEA 3ORJA 3WP5A 1TNFA 1NOVA 1OQEA 3ZO0B 3A0KA 4P9JA 2LALA 3EO6A 1F31A 1POQA 1ZZ9A 2JD9A 4JDMA 5GZFA 2F6BA 5K9YA 3VBRB 5AC92 1CD3G 5I0DA 3ZM8A 3O1VA 1X7NA 3ACHA 2D97A 1GQPA 2RDSA 5IK4A 5C3OA 3AYEA 4KU8A 4N43B 1UZZA 2EIBA 4LBKA 3WP6A 2FDFA 3AZWA 5JDBA 3FUQA 4XFGA 4PHZA 1XE7A 1R1A1 1G86A 1ND2B 1W6MA 3UJOA 3ZYRA 2WIIB 2VU9A 4R9AA 4YVSA 2GZWA 5F6KA 3H1MA 1W8ZA 4L99A 4CDXB 3U4XA 3FFZA 3T4HB 3VBSB 2DBNA 3VKMA 5A7SA 4FTBA 1SBFA 2FMDA 3JQWA 3FLTA 4I30A 2EVXA 4LUMA 3O1UA 1OFSA 1TVGA 3VBHB 5KHIA 1ULDA 4JDOA 1HKDA 4XUOA 2VMIA 2WL1A 3O0WA 5C7GA 1QJZA 3IAPA 2ARCA 5ACA3 4QDQA 4FAGA 4JGYC 5IT6A 3NKGA 3TEXA 3DYPA 1OMIA 4EN6B 4UW6A 1ENXA 4JDNA 4YW3A 1UXXX 2ZXQA 2WBKA 1SBDA 3RMYA 4ZKTB 1Y9QA 3PUHA 1QF3A 5FLJA 3GM8A 3VKFC 3TN91 3N4MA 1X9PA 3M3EA 2BERA 2VY0A 3SH5A 1PX3A 1VBE2 4XF1A 1QU0A 1XBFA 4CE8A 2BGOA 2YROA 3FBYA 1KXGA 4YG0A 4EZ4A 3ON7A 1ZVFA 3HPNA 3OGVA 2VOKA 2NQYA 3K48A 4JCKA 2BFUL 3BN6A 3S5AA 4LE3A 4BK5A 1G8WA 2RS13 1JI6A 4H7MA 4JX0A 2QQMA 3V0BB 4XOGA 3VUOA 2H0BA 1ASJ3 3GZTB 2VCAA 2WQ4A 4IEZA 4Q4X3 1POV1 2TNFA 3RWNA 3VB9A 4LBLA 2EF6A 2JE7A 3IT8A 5BYNA 2YDEA 1ZYBA 5FJKA 5JXGA 2JIGA 1H1IA 2GH2A 2YHJA 3HAGA 3TNPB 3WDTA 3RZGA 3VV1A 1GP6A 2OZJA 4JGYA 3D3AA 5AC93 2R49A 2WNOA 4C1WA 1FPN3 4FOQA 2Z79A 2HYKA 1KITA 5DAXA 3SMHA 2B5HA 2CY6A 4A2UA 4FPFA 1GYKA 3WDYA 4NOTA 2JENA 3PVOA 1NLQA 5FXVA 3WOGA 5KBFA 1Z7S2 2WYFA 4XVHA 5FPUA 3BI3A 1IKPA 2O0OA 5IK5A 3ZPOA 1VRH2 4DINB 5KHGA 4Z82A 3ZPYA 2YGMA 4Y1UA 1HB1A 1HXS3 3I8TA 4BH9A 4WVZA 3UKTA 3IN9A 4LUKA 2MPFA 4FCAA 1UOGA 4Z1VA 1PHMA 4P9XA 1D2QA 1DZTA 2A3WA 5F5IA 4LTAA 4GALA 2IZWA 2O8OA 1MS3A 3NV1A 2DDUA 1WUVA 2ZJCA 3I4IA 4C0BA 2W1SA 4XF4A 4XBLA 2E32A 3T2OA 1YYNA 1JHJA 5FK8A 4E2GA 1TME1 3I3BA 5A3LA 3MIBA 4QKFA 1YC61 4BIFA 2R32A 5CYYA 4BQXA 4LOSA 1BZWA 1CAXB 1EAH2 2VBPA 2VG9A 4QT6A 2IVIB 3POIA 2W0XA 5JCTA 5IK8A 4OUSA 4GJZA 3O5SA 4TN7A 2BV4A 3POWA 5DAWA 3NNJA 2XR4A 4B4PA 3DXTA 4KH9A 2BFUS 2OUJA 2ZMKA 5EJZB 2R061 3CMGA 2B9VA 4IL7A 1XSRA 2GC0A 5EP9A 3KMHA 2JXAA 4CDWC 5LWBA 3NNGA 1UU4A 4XF3A 5JI7A 2RDQA 3JQXA 1PO22 1Y4WA 3ZSLA 4AFAA 3VDBA 1UX6A 2DVAA 4Y3OA 3VDDC 4PBOA 2VZSA 3X29B 3B5LB 1H8TA 3AXEA 2A70A 1NCRC 2W08A 3O0XA 5G05L 5DPNA 1JS9A 2GH8A 1AL0G 1AYM2 2ZEZA 2OQ6A 4PQ9A 1GBGA 4Q4V1 4ZZ5A 4AGRA 2VC9A 5KXCA 3OG2A 2I07B 1JODA 1S2KA 3K4AA 2X53S 3OJBA 3MHZA 2VNOA 4U2AA 4N7UA 2WS92 3J7NA 3KWVA 1AXYA 4N9IA 1G9AA 2D3SA 1GQGA 3GZUC 3PU3A 1RMU2 3NAPB 4HPKA 1QDOA 3VD7A 4NIIA 3O1OA 4M01A 2WWUA 5J48A 4NMIA 4AAPA 3H7JA 3R4SA 5JOZA 1LAJA 1EPWA 5IUQA 5LATA 5FZ1A 2WNUA 1PZ9A 4PF5A 5FZEA 3TEZA 4CXYA 2LTNA 1Q3EA 2Y34A 4KU7A 1NQJA 3WW1A 5HV4A 1OI6A 5FJHA 1VRH3 5FLHA 2W1QA 4AI0A 4LBQA 4CDWA 4WZCA 2VQAA 1AL21 1V6IA 1ZBA1 3OUHA 5FKCA 2WZEA 1W6MB 2WA4A 1OHFA 1RUE1 3BB6A 2VZQA 4WM7A 3ENRA 2HWB2 3NO8A 1RUJ2 4KWJA 4YVSB 3HNYM 4NRMA 1AJOA 1UOJA 2AACA 4LBNA 1CZVA 2HYXA 1DG6A 4GJYA 5LK5A 4A44A 5K0UC 3M1HA 5FO8B 1LB2A 1NCRA 3OPTA 3JUUA 1R082 1YJKA 3DXUA 1RUG1 1XYOA 2FMYA 3AVSA 3R0RA 1RTVA 2XOMA 3RYRA 4XW3A 3Q8EA 1HIXA 3IMNA 4CCNA 4LNVA 5FZLA 5CZKA 3ECQA 1PGW1 3WV6A 4AEDC 1EAH3 4Q0PA 3N7LA 5T5OA 3NL1A 2UU8A 4IGPA 4NIAA 1UU5A 2D3RA 5JI9A 2GMEA 4BQYA 4JRLA 2PLV2 3WDWA 1W04A 2BWAA 2D5FA 3H9AA 2Y6JA 5J96B 1ENQA 4E4SA 3IDBB 4YARA 4XMAA 1DQ1A 2GMMA 4GA9A 5K4LA 4MZUA 5CFCB 2ORXA 1YXWA 1LNSA 2VZRA 4TXWA 5FOBB 1AJKA 4JQRA 1B35B 2H6CA 2WO2A 3L2YA 4OQ8A 1X36A 2DCTA 2D6KA 4XHXA 1UYPA 3ZXJA 4A3XA 3FC0A 1PX4A 1AR72 3AMHA 4XTPA 1OSGA 4B4RA 2AR6A 2QQNA 3AKQA 5J09A 3TEYA 3BUCA 1DYOA 2D43A 1AYM3 2Y60A 2OYZA 5K0UA 5C6CA 5CADA 4WVWA 4FSJA 1DZRA 1D4M3 3LAGA 4CUBA 4OUMA 5CB7A 1YQ2A 3H7YA 5F32A 4OYUA 4ZXEA 3TYJA 1RB8G 1Q8QA 1F15A 2WS93 1CPMA 1SDDB 2JE9A 5A3MA 5A3OA 4Q0UA 4AW7A 5EWSA 1RMU3 3RZJA 2C5DA 1BMV2 3POEA 2RV9A 2Y0OA 2VZPA 4AEDA 3N7MA 5T54A 1G7YA 2A6XA 5LZ6A 3ILRA 4BQ4A 4LHKA 4HVOA 1C5IA 1N1SA 3IIIA 1D0HA 3WNMA 5BXXA 4LT5A 5FPVA 2XJSA 1PZ7A 2RMU2 3QCWA 3B01A 4ITCA 3WD5A 3T2QA 3T0AA 1W9YA 2BBAA 3EJKA 1PVC2 4MUVA 4XEZA 2IXJA 4LKFA 3SITA 3AP9A 1NY72 1YQ8A 3CL1A 3JU9A 1WCSA 1F9KA 3VBOB 2XUMA 3WP3A 1HQNA 4COYA 4NVPA 2C6SA 4QM8A 1FNYA 2HWB3 3KCXA 1RUJ3 3LCPA 4IW3A 4K20A 4QQHA 4XPVA 4PCRA 4O7XA 4WVMA 2ZAHA 4BXSV 4EJRA 3MI8A 4Q2FA 4LXLA 2ARAA 1R1ZA 2E26A 2ORZA 1HB3A 2ZACA 1R083 4XXPA 1WCDJ 4W6YA 1PO12 2W2IA 1V6NA 3N36A 4P9YA 5E89A 5FY8A 1W05A 3GZEA
chains in the Genus database with same CATH topology
1GZTA 1OURA 2BP6A 3DCQA 2VUCA 2JDKA 2JDPA 2WR9A 4UT5A 5D2AA 2JDHA 2WRAA 4CE8A 2CHHA 2JDNA 1UZVA 2JDUA 2VUDA 1UQXA 5A6YA 1OXCA 1W8HA 5A6QA 5A70A 2JDMA 2BOJA 1W8FA 2BOIA 4AOCA 2BV4A 1OUXA 1OUSA 5A3OA 2XR4A 2VNVA 2JDYA 1OVSA 3ZDVA 5HCHA 5A6XA 1OVPA 5A6ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GZT A;  1OUR A;  2BP6 A;  3DCQ A;  2VUC A;  2JDK A;  2JDP A;  2WR9 A;  4UT5 A;  5D2A A;  2JDH A;  2WRA A;  4CE8 A;  2CHH A;  2JDN A;  1UZV A;  2JDU A;  2VUD A;  1UQX A;  5A6Y A;  1OXC A;  1W8H A;  5A6Q A;  5A70 A;  2JDM A;  2BOJ A;  1W8F A;  2BOI A;  4AOC A;  2BV4 A;  1OUX A;  1OUS A;  5A3O A;  2XR4 A;  2VNV A;  2JDY A;  1OVS A;  3ZDV A;  5HCH A;  5A6X A;  1OVP A;  5A6Z A; 
#chains in the Genus database with same CATH topology
 2VZT A;  5F3C A;  2B45 X;  2D5H A;  3QH6 A;  2QQL A;  1TG7 A;  1UXZ A;  1NXD 1;  4I02 A;  4LR4 A;  2BDR A;  4IE5 A;  4XIL A;  1XSQ A;  4D6R A;  1VBC 1;  3I2K A;  5IW0 A;  2BVB A;  2WT2 A;  3S30 A;  4DMI A;  2G4I A;  2PLV 3;  1UYY A;  1ZZB A;  2XVG A;  1J84 A;  3WT3 A;  1OPM A;  3IB3 A;  2IXI A;  1JYI A;  1HN0 A;  5HPO A;  4V2W A;  3T09 A;  3CDZ B;  2ZX4 A;  2QQK A;  1K5M C;  3JZV A;  3USU A;  4IND A;  3WNP A;  2ILM A;  5FPB A;  5HXV A;  4I09 A;  2Z5W A;  4K40 A;  1LHU A;  5HXM A;  4N8M A;  1OVP A;  2L9L A;  1WCQ A;  2JKB A;  1AR7 3;  3WF0 A;  2E6V A;  4LIT A;  4QKB A;  4BE3 A;  1CAV B;  1GP4 A;  3ABZ A;  2ERF A;  3KT4 A;  2R04 2;  4XFH A;  3TWI A;  4AGV A;  1WW6 A;  1L7R A;  1N1V A;  1XB9 A;  2AC1 A;  2BYV E;  1GWM A;  3E6B A;  5GM0 A;  2DVG A;  3HWJ A;  4LO8 A;  1KFU L;  1I9R A;  4QQO A;  1KFX L;  4GMP 0;  5KC6 A;  5JIU A;  1W90 A;  2GAU A;  2ZA9 A;  4LBQ D;  5C9A B;  2DU0 A;  5KXD A;  2PXJ A;  3HBK A;  5FMD A;  3A23 A;  3LSD A;  5ACA 1;  3RGB A;  2D6M A;  1V70 A;  1ZRE A;  3KSC A;  3MW4 A;  1W03 A;  2Q1F A;  4CU6 A;  1UNB A;  1PVC 3;  3SHR A;  1N3P A;  1QDC A;  5T52 A;  4EQV A;  2R7E B;  4GH4 C;  1K5M A;  4CDW B;  4BQ3 A;  1VAL A;  1CON A;  2VUD A;  4LMF A;  3AZZ A;  2F17 A;  3DUI A;  4MVT A;  1CAU B;  1ZBE 2;  2VW2 A;  1CVN A;  1OXC A;  2BNO A;  5FY9 A;  5C8C C;  2CNA A;  2P3K A;  3VDD B;  1BEV 2;  1DQ0 A;  4AVV A;  1HRV 2;  3Q8B A;  4D3W A;  3GBG A;  3KV6 A;  3B3Q E;  1URX A;  2ZX0 A;  3FHQ A;  2XJV A;  4ZS2 A;  4HK9 A;  1FT9 A;  3KS7 A;  3UGF A;  2DFC A;  2H6B A;  5JOY A;  3GF6 A;  3ROU A;  1OLR A;  4CU9 A;  5APA A;  2RS1 1;  4BIS A;  2A3X A;  5AVA A;  4AVA A;  2JWP A;  1L7L A;  1HV0 A;  5IAX A;  2FBE A;  1LRH A;  1SQ4 A;  2ZGQ A;  4Q4X 1;  1GR3 A;  3RI8 A;  4YFW A;  5EIY B;  4JAA A;  4BCU A;  4P08 A;  4QKN A;  3HJR A;  3PLQ A;  4AGG A;  5BNO A;  2QBX A;  5CNA A;  1A6C A;  2AYH A;  1W2T A;  4L2N A;  5E16 A;  3E6C C;  2V5Y A;  4W6W A;  5D21 A;  3RMX A;  2JD4 A;  3P3P A;  5A70 A;  3OYW B;  5AC9 1;  4GZ9 A;  2D44 A;  1N3O A;  1FPN 1;  4OMC A;  4PI0 A;  4DY5 A;  4GH4 A;  1BK0 A;  4YRD A;  1BVV A;  4LA2 A;  5DDJ 2;  3KB5 A;  4B7E A;  1Q56 A;  2VZU A;  2PHT A;  1C8M 3;  3CO2 A;  4XF9 A;  5FY5 A;  5I8S A;  4DZG A;  4EWA A;  2WT1 A;  5HBA A;  2UY9 A;  2W1U A;  3N9O A;  4FPK A;  3AZV A;  4UW4 A;  5FZB A;  3SNM A;  4V1P A;  3VBR C;  3LEG A;  1W2O A;  2HWD 2;  3ATG A;  2R04 3;  2P3I A;  2JE8 A;  5K0U B;  3NJZ A;  4D6S A;  3HT2 A;  4GWM A;  2XJQ A;  4YNI A;  3WP4 A;  1BBT 2;  3Q8A A;  4N43 C;  5A6Y A;  5FZM A;  3I3D A;  4XUP A;  4XC9 A;  1H4H A;  5FZI A;  4IEV A;  1VBD 3;  5GLW A;  1V6O A;  2ZGS A;  5DAV A;  2QQU A;  3C3V A;  2W52 A;  1W06 A;  2R16 A;  5FYB A;  4FTS A;  3NMB A;  1EUU A;  1BLZ A;  2O14 A;  3VBS C;  2YB7 A;  3LDR A;  2FD8 A;  5B4N A;  3ZFF C;  2WAB A;  2WA3 A;  2VCC A;  3T2T A;  2GC3 A;  4HBN A;  5AFE A;  3VBH C;  3H42 B;  1YLL A;  1SEF A;  4URA A;  4NRP A;  3H3L A;  2FZ1 A;  3PTY A;  5H9R A;  1PMH X;  1WD3 A;  1ZBE 3;  4UAP A;  2XJU A;  4TLG A;  2CHH A;  1SDW A;  4XBN A;  1LCL A;  1VBE 1;  2Q8O A;  1CIY A;  5A3U A;  2UY8 A;  2RS5 2;  4QX3 A;  5FBJ A;  1KJR A;  4PT6 A;  4BIO A;  4ES9 A;  3VBR A;  3WW2 A;  5B2G B;  2CYF A;  2F4P A;  2P5B A;  5FV3 A;  2XXZ A;  4YG6 A;  2EXH A;  4UOJ A;  4GQ7 A;  1PM4 A;  2RJ2 A;  3EBR A;  5T5J A;  5FYM A;  4N43 A;  3FFQ A;  4D8M A;  4CCE A;  3I2I A;  4XXA A;  4AWD A;  3BU0 A;  5IVJ A;  1PIV 2;  4CP0 A;  2MHF A;  1H8V A;  2VGD A;  3I54 A;  4XFA A;  3THP A;  1S2B A;  3NNL A;  1MS8 A;  1ND2 A;  2E33 A;  1S0J A;  2SLI A;  3MPB A;  1RHI 2;  4Y20 B;  3IAQ A;  1LGN A;  4D7Y A;  1UW8 A;  4P9G A;  5F3G A;  1UOF A;  2G1M A;  1QXJ A;  2XBO 2;  3AYC A;  3T1L A;  3VBS A;  1O8P A;  4XET A;  4Z07 A;  4AI1 A;  4R9D A;  2JB8 A;  4IEX A;  5EFU A;  5C3S A;  2MEV 2;  1LOF C;  2RJL A;  3SEP A;  3A0N A;  5DQ0 A;  2W3J A;  3VBH A;  2VEC A;  2WN2 A;  5FZH A;  1WW5 A;  5DDJ 3;  4AI9 A;  5BUV A;  3UGG A;  1DP0 A;  5IYY A;  3LFI A;  2RS3 3;  4MGZ E;  1Z7S 1;  2NPI A;  3E6D A;  3VBF B;  1OD5 A;  3MBW A;  1VRH 1;  1DLC A;  3POJ A;  2HWD 3;  1ENR A;  1V9U 2;  2VVD A;  3OOX A;  3GCX A;  4NO4 A;  3RVH A;  4OHY A;  2ZGT A;  2VPV A;  3J8F 2;  3K3O A;  2BZD A;  1BBT 3;  3IIA A;  4QU1 A;  5KHK A;  4CPB D;  2PTM A;  1F8V A;  4C1X A;  2Y64 A;  2CSG A;  3UGH A;  5CAZ A;  1W8N A;  3ILN A;  1O3Q A;  1AR8 2;  1R09 3;  4BXF A;  3HQR A;  3GZA A;  4CSW A;  4FFH A;  3NKT A;  4NRQ A;  4CPB A;  1CJD A;  1I5Z A;  3O14 A;  4LHN A;  3HN3 A;  4MGS A;  1EAH 1;  3RZL A;  4YVW B;  3ZXG A;  1FI2 A;  2A1X A;  1SLL A;  3WQ7 A;  1OVS A;  3OCP A;  4BDV B;  2A3Y A;  3LQC A;  1QNW A;  4OHX A;  4Q1R A;  3V0B A;  1XOY A;  3ELN A;  1LOF A;  4QHO A;  5FY1 A;  5LA2 A;  3KV9 A;  3RNS A;  2HWF 2;  1U5X A;  2PHU A;  5FO7 B;  1TE1 B;  1OA4 A;  2RVA A;  2I2S A;  2Z4F A;  3KGL A;  5F39 A;  2GAL A;  1BHG A;  3VBU C;  2WUH A;  4BMB A;  5F3E A;  3H8X A;  3HIF A;  2RS5 3;  1UZY A;  3KQR A;  1LOE A;  4KQ7 A;  4OVE A;  1PO2 1;  3MF6 A;  5FYH A;  4DY3 A;  1RC6 A;  1SFN A;  4GXL A;  1AX1 A;  4OHZ A;  4BK4 A;  5CKN A;  4HFS A;  4DS0 A;  1N3Q A;  1W9F A;  5KHH A;  1NE4 A;  1OQD A;  1TZO A;  2J42 A;  4XE9 A;  1ZRF A;  1C3H A;  1XE8 A;  1AYM 1;  1QJX 3;  3KF5 A;  4Q27 A;  2HWC 3;  3HBZ A;  3RYP A;  1U5Y A;  3ZSM A;  4C8D A;  1DQ5 A;  3GJA A;  3LDB A;  1RHI 3;  4DEQ A;  2Y6F A;  2WS9 1;  2JIC A;  4IE0 A;  1RMU 1;  2XBO 3;  2WSV A;  4IEO A;  4K7J A;  2ZGK A;  1YRZ A;  3CBN A;  4E4D X;  3DPR C;  2VZO A;  3AM2 A;  4QPG C;  1JYX A;  2ZX3 A;  4HL0 A;  3J7L A;  1NLR A;  2MEV 3;  4LBJ A;  4HN1 A;  1QHD A;  2DFB A;  4AHX A;  1F2N A;  3S0M A;  4HSL A;  1VBA 2;  4CZS A;  1H1M A;  3KZ4 C;  2ZGU A;  4MOA A;  3U37 A;  4ZU7 A;  3POS A;  1UMI A;  1ZRD A;  3KCY A;  4MGI E;  4Y22 B;  4UFL A;  2GDF A;  2FQP A;  1W2U A;  4QX1 A;  3VKN A;  3WG1 A;  2ZMN A;  3NAP C;  1RUH 3;  3MPP G;  4NAM A;  5C8C B;  3OUJ A;  4UFH A;  1GFF 2;  1VBB 2;  2XB6 C;  3JD7 2;  5HCH A;  5DUX A;  2HWB 1;  4XDO A;  1RUJ 1;  3WDV A;  2C9A A;  3J8F 3;  4HZF A;  1IG3 A;  4LIU A;  3S6P A;  4CXX A;  5JUV A;  1J1L A;  2QZ3 A;  1HV1 A;  5CU1 A;  5D1I A;  3OGG A;  3UV9 A;  1W3V A;  2VMC A;  4QPW A;  4DPN A;  4P02 B;  1R08 1;  3DGT A;  1AR8 3;  3AMN A;  1W9W A;  5FKB A;  1A78 A;  1XYP A;  4A42 A;  2AGS A;  1GAN A;  3AZX A;  3ZXK A;  2C24 A;  1UY3 A;  4AEK A;  2XVL A;  2HLE A;  3EB7 A;  4R8H A;  5F9T A;  3O1T A;  5FZO B;  2B7Y A;  2JDM A;  1IS3 A;  4P5H A;  2Y6G A;  4XJ9 A;  5JOX A;  3EYP A;  1H2N A;  4DXT A;  2WFF 2;  3A7Q A;  5JSO A;  3M7A A;  4JHZ A;  1VMF A;  4Q4W 2;  2D93 A;  1K12 A;  1LHN A;  3DPR A;  5A33 A;  2RS1 2;  1LU2 A;  2PLV 1;  4BM8 A;  2CGP A;  3LA7 A;  2NM1 A;  2ZOE B;  1ASJ 2;  2GMP A;  1DQ6 A;  1UN1 A;  1W0N A;  1Y9G A;  4HKW A;  3HEI A;  5C3P A;  4S2F A;  2FDG A;  4OHV A;  3SQO A;  5BNN C;  4HKO A;  5FRA A;  3VL8 A;  5BPX A;  1H2M A;  3KGZ A;  4J1X A;  1JZ5 A;  4IEY A;  4PLO A;  3PIG A;  4L92 A;  3HN1 A;  3NAP A;  3CU7 A;  4MAD A;  2QNK A;  5LCW L;  1HLC A;  1VJ2 A;  5ANN A;  2FDH A;  1FPN 2;  1QIQ A;  4DQA A;  1COV 2;  1AR7 1;  4Q0V A;  1S0D A;  3ZFG B;  5FZ7 A;  1U5Z A;  5EXO A;  3ZSK A;  1WBL A;  1W9S A;  4YW7 A;  3ZLI A;  5CFC C;  5JZG C;  1AX2 A;  2QUO A;  3RFR A;  1WMD A;  1ND3 B;  3H3U A;  4A45 A;  3TEW A;  3VZJ A;  1B35 C;  4E4Z A;  5C33 A;  2CAV A;  3T0D A;  1LOA A;  4Q5O A;  2B42 B;  4DNY A;  2WAO A;  1HXS 2;  4OI4 A;  5GJ6 A;  5A6Z A;  5CG9 A;  1BMV 1;  2VTF A;  4MX3 A;  3OGJ A;  4FPE A;  4ZPI A;  5LEK A;  1EV1 3;  1W0P A;  2XQX A;  1YIP A;  1MZ6 A;  2Y6H A;  3IKW A;  3QBQ A;  3ZFF B;  4ERO A;  2E9Q A;  2E63 A;  5DUU A;  4R9B A;  2P6H A;  1VBA 3;  3M3C A;  4HN0 A;  1JYC A;  1US3 A;  1C28 A;  3AJZ A;  4LO5 B;  2RMU 1;  3RJ2 X;  1UYX A;  2VO5 A;  1PVC 1;  2ADD A;  4XMI A;  1NY7 1;  3FX3 A;  2VCB A;  3U75 A;  4L0P A;  4QDR A;  4LUL A;  4Y4Y A;  2A71 A;  1DGR N;  3JD7 3;  1VBB 3;  4ARX A;  2VMD A;  4RYD A;  3RZZ A;  4CUG A;  4LK6 A;  2JX9 A;  3TNQ A;  1FV2 A;  2R07 2;  5FP3 A;  3HOB A;  4FXK B;  3H0O A;  2TUN A;  1XU1 A;  3HQX A;  4UI9 L;  5JOW A;  4YYO A;  2OX0 A;  1FNZ A;  1XNB A;  1LES A;  1PO1 1;  1QEX A;  4W50 A;  2QFE A;  3VBO C;  2CU5 A;  4EWE A;  4NID A;  1G6N A;  4Q29 A;  1B35 A;  2E51 A;  3WW3 A;  1RL3 A;  5DZG A;  1JOP A;  1FAY A;  1E5I A;  1K45 A;  1AF9 A;  2VVF A;  4JQT A;  3WIN E;  4AFC A;  2NYY A;  3FBM A;  3KVB A;  3OUI A;  1IHM A;  3QOP A;  4IDZ A;  4R4X A;  4XIO A;  4AK3 A;  2WFF 3;  4Q4W 3;  3IM0 A;  4YGD A;  3PVB B;  2RR1 2;  4HET A;  4ET7 A;  3ST7 A;  4M00 A;  4XJA A;  4B29 A;  2Q0A A;  4F3J A;  2CWS A;  4ZZ8 A;  1QMJ A;  3R4D B;  4DEV A;  1XND A;  4D7S A;  3RZH A;  3IBM A;  4ASK A;  1RVF 2;  4FOY A;  4K3U A;  1WKY A;  4BYY A;  3U1X A;  3AKR A;  4PIY A;  4QM9 A;  4QQL A;  2XL9 A;  1OD3 A;  4HOO A;  1DHK B;  1L3J A;  1PVX A;  2AH2 A;  5FQ0 B;  1HJG A;  3MIH A;  4BZ4 A;  5LEJ A;  2Q30 A;  4P14 A;  3VD3 A;  4AFB A;  4C0H A;  1F5J A;  1DQ2 A;  1SZB A;  3OF1 A;  1Q8P A;  1COV 3;  4NPL A;  4RGA A;  1LOG A;  3BPS A;  3O1R A;  1XNC A;  4E9K A;  1E5R A;  2RJK A;  4IV1 B;  2VUA A;  2PHF A;  1OFN A;  2EAA A;  2AZ5 A;  3JB8 A;  3ACL A;  5EYY A;  3U10 A;  5G04 L;  2PHW A;  4TWT A;  1DU3 D;  2R04 1;  2UWB A;  4ES8 A;  2I74 A;  1IKQ A;  4B7K A;  3VBO A;  1V0A A;  1OOP B;  4AI8 A;  2EAK A;  2R6Q A;  1K3I A;  3P5B A;  3VZN A;  1LGC A;  4L11 A;  2KD7 A;  1ZA7 A;  1TNR A;  1QJE A;  1VBD 1;  2QCS B;  2ZGR A;  5FZ3 A;  2WQZ C;  4UXA A;  1BXH A;  2D40 A;  3WQB A;  3MFA A;  4S2H A;  4DRV A;  1X8E A;  1DQ4 A;  3LE0 A;  5FY7 A;  1F4H A;  3VBU B;  4XUT A;  4A7K A;  3W58 A;  5E8A A;  5C9A C;  1W8U A;  4URT A;  1NX9 A;  2J1S A;  4DB5 A;  2Q8D A;  3BPZ A;  2O8Q A;  1ZBE 1;  2R07 3;  2P2K A;  2ID4 A;  2RM2 2;  1OF3 A;  4Q4Y 3;  1WWY A;  1BEV 1;  2Y26 A;  4D69 A;  5JR2 A;  1HRV 1;  4NWV A;  1S0I A;  3RZK A;  5IVV A;  4YW2 A;  2FCV A;  4LOR A;  4IXL A;  4WM8 B;  1DCS A;  2V5D A;  1HN1 A;  4LKE A;  4Q0Q A;  4F7Z A;  2YU2 A;  1R64 A;  3T1M A;  4EE2 A;  5J37 A;  4Y4R A;  4CP2 A;  2XHN A;  3C7G A;  1DF0 A;  3DF0 A;  2YUE A;  2ZKL A;  2Q1M A;  1E57 A;  1VB2 A;  1W6O B;  4HVQ A;  1CAV A;  4N53 B;  2RR1 3;  5A33 B;  1CIW A;  2ZGM A;  3WF4 A;  3DPR B;  4LKS A;  5IJR A;  4QPG B;  2H0V A;  4XHB A;  3QH7 A;  4NAO A;  4WBB A;  1D4M 2;  1RVF 3;  5FMC A;  3AFK A;  4LLF A;  4QHZ A;  4TTG A;  2WZR 2;  4BQ5 A;  4YW5 A;  3W9A A;  4DFS A;  2UWA A;  2WWJ A;  1SAC A;  3K2O A;  5FYT A;  1REF A;  1XC6 A;  4LO7 A;  4A41 A;  1C5H A;  1OUR A;  4UW3 A;  4UW5 A;  2G9Z A;  5DDJ 1;  5FMB A;  1X82 A;  4RHV 2;  1W0O A;  2JDK A;  4LK7 A;  5C9A A;  2JG9 B;  1S1A A;  2ZAB A;  3AKT A;  2OII A;  4L97 A;  3KCC A;  3ZSE A;  1WA4 A;  5A3T A;  5E6H A;  3V56 A;  1SLI A;  2HWD 1;  1GNH A;  4AI2 A;  2DVB A;  5FMO S;  3VDA A;  3KQ4 B;  4LPL A;  1H30 A;  4EN7 B;  1BBT 1;  1KS5 A;  2OS2 A;  4KI5 M;  3THT A;  2IC1 A;  1CAU A;  4FVV A;  1VR3 A;  1WA6 X;  2Y38 A;  3BCW A;  3I3E A;  1YEW A;  3VDD A;  3OBZ A;  3ZYF A;  1XQN A;  3OBA A;  3CZJ A;  2XG3 A;  4AYU A;  1HQL A;  4NRO A;  1RXG A;  1ULE A;  1YFW A;  1LHW A;  3CZU A;  2JIJ A;  1AVB A;  4Q0S A;  5FY0 A;  5L9R A;  1GWL A;  4UF0 B;  4DRR A;  4SBV A;  2VW1 A;  4HT1 T;  5BNN B;  2VUJ A;  4YM3 A;  2J1E A;  4XFF A;  5FZA A;  2LUW A;  5IAT A;  1H4G A;  1MS5 A;  4CP9 A;  4KG8 A;  4QMA A;  5K7P A;  2EIC A;  1ZM1 A;  2Q5T A;  1CN1 A;  3QD6 A;  2RM2 3;  4RFT 0;  4CP1 A;  5F7U A;  3TRS B;  1HW5 A;  2IXH A;  2YZ4 A;  3NW4 A;  4O9G A;  4AVC A;  2RS5 1;  1W6P A;  2PMW B;  3OYW A;  4XAE A;  5JZG B;  3VHR A;  2Q8C A;  4D6Q A;  2IXC A;  4EYU A;  1OLM E;  2P6C A;  2ZBJ A;  5JXJ A;  2WYS A;  4FPC A;  4YSF A;  2XQR A;  2ES3 A;  1IPS A;  5D8A B;  2ZHN A;  3JBG 3;  2YYO A;  5LAS A;  1PIV 1;  2I45 A;  1UF2 C;  1XE0 A;  2PQQ A;  4KBZ A;  4GD4 A;  3LPF A;  3NNM A;  4PJY A;  1J58 A;  2J7M A;  4CUC A;  4DUV A;  3AYD A;  3WF3 A;  5FOJ B;  1QJU 3;  2KA3 A;  1RHI 1;  1Y3T A;  1BKZ A;  3B9C A;  4MV2 A;  3ZIW A;  4AR2 A;  4EN0 A;  1RUF 2;  1JYW A;  4DIQ A;  1JZ3 A;  2XBO 1;  4XFC A;  1JZ7 A;  1IZ3 A;  3J7M A;  2WZR 3;  3B7M A;  1M4W A;  2WQ8 A;  1JTZ X;  2QQW A;  3ZKY A;  4M3C B;  3D4K A;  1WLW A;  1HB2 A;  4Q8L A;  2MEV 1;  5JXI A;  1T6B X;  2WSU A;  3P3N A;  4CCK A;  5I91 A;  3PIJ A;  4RHV 3;  2PN5 A;  2VNG A;  3RS6 A;  3H8R A;  1S0G A;  4D7T A;  1ACC A;  5FUN A;  3MV0 1;  3H1Y A;  4LQR A;  1O91 A;  2ENR A;  3BOW A;  3DV8 A;  1MZF A;  2P3J A;  1P8J A;  1V9U 1;  5L73 A;  4MXW B;  5EPA A;  4OFG A;  4N7I A;  2CDP A;  2VTX A;  1UPS A;  2Q1Z B;  3JXS A;  3J8F 1;  2GC2 A;  2OZ6 A;  4XF0 A;  4YWA A;  4JRA A;  4OI0 A;  1NUK A;  5FTT C;  3QLQ A;  2XWJ B;  3VBF C;  4TZD A;  1H0B A;  1QY4 A;  4P9L A;  5C5T A;  1AR8 1;  3WNO A;  5IVC A;  3GGL A;  1E5S A;  2Z2S B;  3RWK X;  4B1M A;  2K0G A;  3HVD A;  4XBQ A;  2WO1 A;  1PMJ X;  2XJT A;  5IHR A;  1ULO A;  1GOH A;  2OUH A;  1NZI A;  4QD2 A;  1QKQ A;  1G9B A;  2QJV A;  4A7Z A;  5FXW A;  3O1M A;  4X8P A;  4ZU5 A;  3VHN A;  1MVE A;  3D0S A;  1WZX A;  2JB4 A;  2JDU A;  3CHX A;  3SKJ E;  1CR7 A;  2WNV B;  5AFB A;  1D0G A;  2HWF 1;  3GNE A;  3KT1 A;  5I93 A;  3I2O A;  3U07 A;  2GNM A;  4Y20 A;  4EZH A;  3BKZ A;  3OY8 B;  1CZS A;  2VD7 A;  4MHR A;  4YVW C;  3UT0 A;  1YQ5 A;  3JB4 C;  3LOB A;  1MZ5 A;  1W6Q A;  3RJR A;  1D2S A;  3K75 B;  4IGO A;  3ZYH A;  3BOP A;  5FPZ A;  2XH6 A;  1GZC A;  4RL7 A;  4KWK A;  4QGN A;  1LOB A;  1O8S A;  4GMP 3;  3H8O A;  3ASI A;  3MDP A;  3HNB M;  3LWC A;  4UBH A;  4BPZ A;  3VBF A;  1C8M 2;  1YWK A;  4X6Q B;  4OZX A;  1HDK A;  1FMD 3;  1MQT B;  2VXJ A;  3I97 A;  4CVU A;  2ATF A;  1IGO A;  2EAL A;  1NLS A;  4QB1 A;  1WLD A;  4GIQ A;  4HXC A;  1RUF 3;  5F8P A;  4FT8 A;  5LBF A;  1VRB A;  4CCM A;  4AI3 A;  2WC2 A;  1MAC A;  1RJ8 A;  1HRI 3;  4LHL A;  1J3R A;  3D82 A;  1JYV A;  2ZEY A;  3L2H A;  4F8A A;  1LGB A;  1HJF A;  1QNY A;  4NUB A;  4H55 A;  4NHX A;  3AX4 A;  3WCR A;  3NVC A;  1W39 A;  3WNK A;  2XKP A;  2BWC A;  2R0F A;  3MIF A;  1NG0 A;  3PUI A;  1VBA 1;  4KWL A;  5FDB A;  2YPJ A;  1VBD 2;  1Y9M A;  4I0A A;  1GKB A;  2PEL A;  4RR3 B;  4XIK A;  3MID A;  2HBT A;  4HMZ A;  3S5Q A;  1QXP A;  2XLG A;  3PUQ A;  3TN9 2;  3HD8 B;  4Y5Z 0;  4YVW A;  2OT7 A;  2V4A A;  4C91 A;  3S57 A;  2YPD A;  1VBB 1;  3C7E A;  2WT0 A;  3JD7 1;  3CLP A;  4E8D A;  1AR6 3;  3KF3 A;  5J3U A;  3M70 A;  1R1A 3;  1T6G C;  2J1R A;  4OMD A;  2QKD A;  2G9G A;  3OTF A;  2ZGN A;  1ZZ7 A;  1D4V B;  4W65 A;  4A3Z A;  1W99 A;  2VW0 A;  2ZZQ A;  2BQP A;  2D6P A;  4AZZ A;  2CTV A;  3E5U A;  3N35 A;  4CDU B;  3FMG A;  5FP4 A;  2W95 A;  4P00 B;  1DGW X;  2WWS A;  3F2Z A;  1H2L A;  5ABJ B;  2ET7 A;  1VAK A;  2D6N A;  3N9Q A;  2MNG A;  4K9S A;  5L9B A;  3ZDV A;  4N90 A;  4OI1 A;  1NA1 C;  2HH9 A;  2VOX A;  1QJF A;  1VMH A;  2HEV F;  2WFF 1;  4Q4W 1;  1CGP A;  4YZ1 A;  1LHV A;  1JXN A;  2IXK A;  3T08 A;  1SLC A;  1ASJ 1;  1QGL A;  1RYY A;  3LPG A;  4CP9 B;  3NV2 A;  1UO9 A;  4J25 A;  4YGE A;  2V09 A;  3MYX A;  2RE9 A;  3M4F A;  4CCO A;  2NN8 A;  4PI2 A;  2VZ3 A;  3KT7 A;  1SPP B;  3N9L A;  3R05 A;  5FZC A;  1WMX A;  1DDL A;  5DMY A;  3K46 A;  1W6P B;  3CKH A;  5CVR A;  5FPX A;  4PLM A;  3T30 A;  2N7G A;  1COV 1;  1JBC A;  1WBF A;  1O3S A;  2A5Z A;  2CGN A;  3ALQ A;  2GND A;  3RSJ A;  4CA9 A;  1G9C A;  4QXK A;  3ZFE C;  3E5X A;  2AUY A;  4Y22 A;  2RS3 2;  1JH5 A;  4Y1V A;  3KHC A;  4PLN A;  3DCQ A;  1WMF A;  1F5F A;  4I3G A;  2ZHL A;  2WAA A;  2VR4 A;  3KM5 A;  3LKJ A;  3D8C A;  5C8C A;  1W9T A;  2W94 A;  5FRE A;  5CG8 A;  1MS1 A;  1KRI A;  1HXS 1;  1RED A;  3VZL A;  2B8M A;  3UYJ A;  5LA1 A;  4MGT A;  1GU3 A;  3ZFG C;  1H9P A;  5FK7 A;  3EQE A;  4IGQ A;  4FPG A;  1ST8 A;  2WFP A;  1NA1 A;  3USS A;  2PYT A;  1ND3 C;  3G7D A;  1I1E A;  2BNN A;  2VJX A;  2UWC A;  1ALY A;  1I5P A;  1R09 2;  2Z69 A;  3ETP A;  3HQU A;  4W6X A;  5EZW A;  5F3I A;  4YZ4 A;  3RPQ A;  1ZZ8 A;  5FZO A;  4OZO A;  2RG4 A;  2P17 A;  3WHT A;  1V00 A;  4XAA A;  3PTR B;  4U36 A;  5FY4 A;  3OEA A;  4CCJ A;  1POV 0;  1Q8V A;  3EHK A;  1A8M A;  5D2A A;  4QX7 A;  2E31 A;  2R07 1;  3GCW A;  4ZY9 A;  5T50 A;  4AHY A;  5LBE A;  3ZXE A;  3MIG A;  4OUL A;  4B1L A;  4YGC A;  2Y6L A;  2YC2 A;  1OKQ A;  5C8W A;  3ZFE A;  3V0A B;  4Y5S A;  1QOO A;  1VE0 A;  3P1I A;  1VAM A;  4R4Z A;  3SH3 A;  1DGR A;  2B39 A;  2PHL A;  2WZ8 A;  1X50 A;  4XJU A;  1SCS A;  3M2M A;  1SHW B;  5DAP A;  5FZ6 A;  3Q9O A;  3PVE A;  4BQ2 A;  3BAL A;  1H9W A;  3DKQ A;  5SV5 A;  2X05 A;  4MH0 E;  1STM A;  2FDJ A;  2W68 A;  2LRO A;  1EYB A;  4L9B A;  3ZFG A;  1DLL A;  1O5L A;  2RR1 1;  3J7H A;  1LUL A;  4H7L A;  2P1B A;  5DXD A;  5FUP A;  2ZEW A;  3FN9 A;  5JVV A;  1ND3 A;  2PHX A;  2ZHM A;  1QJX 2;  3LIH A;  2HWC 2;  5K8S A;  3WDU A;  2WR9 A;  1RVF 1;  2YFU A;  4QGL A;  5KR7 A;  2WLQ A;  2A6W A;  3AZY A;  1TQ5 A;  3O12 A;  1SFY A;  3K3N A;  3AMP A;  5HI0 A;  2VBB A;  1A3K A;  1IS6 A;  2PAK A;  2ZHK A;  3W21 A;  5A7N A;  1KDM A;  4HG6 B;  1XYN A;  5TSW A;  3WLU A;  1W6Q B;  3ZIX A;  5IK7 A;  3ZFF A;  4K8R B;  3WW4 A;  5H9Q A;  3AXD A;  2BOI A;  4E2S A;  1PK6 C;  1UPI A;  1GP5 A;  4CRQ A;  3WVJ A;  2GP5 A;  5L36 A;  2G19 A;  2QTW B;  2YBS A;  4M3C F;  4NHY A;  5A1A A;  4TSV A;  1GIC A;  1JZ4 A;  1RUH 2;  2FZ2 A;  4Y26 A;  2D6L X;  3AP5 A;  3PMS A;  2ZX2 A;  3DN7 A;  2DBI A;  4CCL A;  1WD4 A;  3SKV A;  4IV1 C;  2DCK A;  2W1W A;  1FXZ A;  4CU8 A;  3H50 A;  1QH7 A;  4B4Q A;  3ES1 A;  4QDS A;  4OLL A;  2GP3 A;  5FBZ A;  3UNP A;  3WUC A;  1DFQ A;  4BME A;  5EJ1 B;  3ZYP A;  5GZG A;  2BU9 A;  4RSU A;  2FCU A;  1J1T A;  4RFR B;  1OOP C;  2ZZJ A;  3SH4 A;  1ZX5 A;  5FZ4 A;  2TBV A;  3C7H A;  3THC A;  3O0V A;  1ZA4 A;  1LEM A;  4AQ2 A;  2WZP P;  4E4H A;  4GWI A;  4XJW A;  4LOT A;  3I49 A;  2RDN A;  4FPJ A;  2K9Z A;  1QXR A;  4JKK A;  4D94 A;  3LOI A;  2RM2 1;  1ZBA 3;  3HR9 A;  1H6X A;  5FFO C;  1PMI A;  1AR9 2;  3DL3 A;  3AC0 A;  1GOG A;  1PK6 A;  2EIG A;  4K6B A;  4Z92 B;  4Q1P A;  2ZEX A;  4GWJ A;  1XU2 A;  3NJX A;  1UCX A;  1KDK A;  3GYD A;  5C4W B;  3DYO A;  3NJY A;  1UIJ A;  5CIR A;  3J9S A;  4FXG B;  3CIH A;  5FCC A;  5FQ0 A;  1Q8S A;  1DYK A;  2BGP A;  5C3R A;  1W28 A;  4ZXK A;  4QU2 A;  4FPH A;  4IV1 A;  4NHK A;  1GOF A;  3I2F A;  2YC0 A;  3B9I A;  5C5U A;  4Y33 A;  1XNT A;  4IE4 A;  3AYA A;  3IWZ A;  4WM8 C;  4QKD A;  4QXH A;  1YI9 A;  1MZE A;  1UY1 A;  3I2J A;  4ASL A;  1D4M 1;  3U78 A;  3AB0 A;  3W5M A;  4ONU A;  1OOP A;  4CDQ C;  2WZR 1;  2VL4 A;  2YBP A;  4XAC A;  4MG2 A;  5I0R A;  1V6L A;  3NWK A;  4N53 C;  5GLV A;  1HQW A;  4DXR A;  3C8X A;  4RHV 1;  1EV1 2;  1UQX A;  1OA2 A;  3UJQ A;  3CJX A;  4EN9 B;  1DZQ A;  2YC4 A;  4MGQ A;  3EXU A;  2C9K A;  5F5A A;  3BYW A;  4BJ0 A;  4JKM A;  3D5O A;  2C1F A;  3MW3 A;  4YGB A;  5FP9 A;  4W4Z A;  2PHR A;  4Z2W A;  5I8T A;  4CTE A;  3RQ0 A;  5FYZ A;  1KEX A;  2LRP A;  1N1T A;  3VZO A;  5KXE A;  4DOU A;  5LA0 A;  2W46 A;  4ZHN A;  4CXW A;  3PUA A;  2UUR A;  3VBU A;  1JU4 A;  3W20 A;  2A6Y A;  4G9S B;  4IE6 A;  2JG9 C;  4FBF A;  3APB A;  4MGY E;  2VUL A;  4M4R A;  4PF1 A;  2IFR A;  3MEP A;  1OH4 A;  3LA3 A;  2ZS6 B;  4FPO B;  4HK8 A;  4M3C E;  3OGR A;  4AF9 A;  1A34 A;  1NA1 B;  1WLT A;  4AE2 A;  5L7O C;  4GKY A;  4YW4 A;  2VQT A;  3OEB A;  4QGM A;  5ISL A;  1YJL A;  4WM8 A;  4MHU A;  3ETQ A;  4MO3 M;  4ZS3 A;  3SCF A;  1RJ7 A;  2C26 A;  4GWN A;  4AQS A;  2PHD A;  4E2Q A;  3VD9 A;  3ZYB A;  2WJS A;  3RG0 A;  2BOJ A;  3HT1 A;  4LBO A;  4CDQ A;  3BIE A;  2UYB A;  1MPX A;  1X33 A;  1W6O A;  2P34 A;  3UKV A;  3IPV A;  3BTY A;  4N53 A;  1XRU A;  2HKX A;  2XHK A;  4YG3 A;  1BVP 1;  2D6O X;  4QPG A;  5C3Q A;  4RQP B;  5E88 A;  3N3H A;  1AR9 3;  1CX1 A;  1AX0 A;  1JUH A;  4WZF A;  5I8Y A;  1CX4 A;  4AVS A;  3D6E A;  1QH6 A;  5DG1 A;  3GBW A;  5GAL A;  3AKS A;  1JYN A;  2AEZ A;  2BJS A;  3ZFE B;  4QX0 A;  1Q5O A;  3K51 A;  3L9J T;  3I3Q A;  3MFC A;  4NJ4 A;  5IFT A;  3UES A;  4RS5 C;  4GMP 1;  5JMC A;  2JG9 A;  3LB9 A;  3VHP A;  4M0N A;  5A6Q A;  4GB3 2;  3GHN A;  4A6O A;  2BTV C;  1LOD A;  3PU8 A;  3I7D A;  1FMD 1;  3TBD A;  2PAM A;  3EMR A;  1LR5 A;  1L7Q A;  5L7O A;  1VBC 3;  3NRU A;  3WCS A;  1BYH A;  1O7F A;  2X5I C;  1RUF 1;  4S2G A;  1VAV A;  2JDY A;  2GNB A;  5D8A C;  1UWW A;  5BNQ A;  1HRI 1;  3H8U A;  4UWD A;  1OC1 A;  3OGS A;  4P5Y A;  3MW2 A;  1FOD 2;  2VM9 A;  1GQH A;  2NZ9 A;  3WSO A;  2X8K A;  4H3W A;  1LTE A;  1ODM A;  2JDH A;  4UFJ A;  5L19 A;  2JDA A;  4HKL A;  2HBU A;  4ISR A;  1H1A A;  2YXS A;  3SCG A;  5FZF A;  3GXU A;  3CQO A;  3E5Q A;  5A32 B;  4H14 A;  2JG8 B;  2QDN A;  1LHO A;  5IVB A;  2VH9 A;  2A75 A;  3IDC B;  1AHS A;  5FYC A;  1QJY 2;  4AOC A;  4UF0 A;  5GZE A;  1JYT A;  3ILF A;  2QZ2 A;  5BNN A;  1AR6 1;  2DCZ A;  5IFP A;  5ERL A;  1N1Y A;  3FHA A;  3ACI A;  3CEW A;  5CBL A;  1RGS A;  4MSV A;  2ZX1 A;  4QX5 A;  5FYY A;  3LDK A;  4RS5 A;  1MS4 A;  5JIA A;  2Y33 A;  2E53 A;  2NMN A;  2PA7 A;  5FAX A;  3H3Z A;  2BP6 A;  3ES4 A;  4FOV A;  4K8F A;  4Q4Y 2;  3W59 A;  3WZ1 A;  1JZ2 A;  3U0Z A;  4XUR A;  3VN4 A;  1NYW A;  3O1P A;  1UMZ A;  5A1F A;  2X5I A;  3MUY 1;  5FUI A;  4PDW B;  1CES A;  2EXJ A;  2Y6K A;  5DUV A;  1GNY A;  5D8A A;  3PHM A;  4XAB A;  1UYZ A;  5LBB A;  1JW6 A;  4S2D A;  1TMF 3;  2EID A;  4G3Y C;  3C2U A;  1UY4 A;  1AUY A;  1NE6 A;  2F4L A;  1OUX A;  4IES A;  1OPO A;  5A7W B;  1QQP 2;  5EJ3 A;  2R1D A;  2QQI A;  3NV4 A;  1T2X A;  4FI9 A;  4BQW A;  1PK6 B;  4MGK E;  4NPM A;  3UET A;  5GZC A;  4UFK A;  1XJA A;  1MR5 A;  2DWR A;  3CNA A;  4JZR A;  4M3C A;  5GLZ A;  3ZN6 B;  4O61 A;  2P37 A;  4LKD A;  1Y43 B;  4COW A;  2WNV C;  2QQO A;  5JSR A;  4PIX A;  2OVU A;  5IWF A;  5F5C A;  4BOW A;  2HJI A;  1MVQ A;  3GBF A;  1F35 A;  4NR1 A;  4GB3 3;  1C8M 1;  1JOJ A;  5FP8 A;  5FWE A;  3RDI A;  4CCC A;  5CEH A;  2DTW A;  1RIN A;  1AYN 2;  4NN0 A;  4RA0 A;  1IG0 A;  2WKK A;  2BW8 A;  1S0C A;  3LA2 A;  4M0H A;  5SV8 A;  4Z2A A;  5A1L A;  1Q8O A;  4MXW A;  5KHJ A;  1JZ8 A;  1WCK A;  4IV3 B;  1YCI A;  4KWU A;  3IMM A;  5IAV A;  4IQP A;  2XON A;  2DUR A;  3UL2 A;  1FOD 3;  1MQT C;  4DO0 A;  3AFG A;  4PBP A;  1OH3 A;  2VOV A;  2ET1 A;  1M06 G;  5FMO L;  3WY6 A;  1UD1 A;  1UMH A;  2W5F A;  4COZ A;  4AQT A;  1W2A X;  4SLI A;  2WIN B;  1QJY 3;  5HCF A;  3BIW E;  3WG3 A;  4I2O A;  4Q8K A;  4IER A;  2XL7 A;  5JWP A;  1RUC 2;  1FAT A;  1S2E A;  1Z78 A;  2WNV A;  4RR3 C;  5FZ8 A;  4K21 A;  4AFD A;  3OY8 A;  3N9N A;  2P4E A;  4AXO A;  1H8T C;  2DCJ A;  3UKN A;  1VLN A;  5JXH A;  1C4R A;  2GU9 A;  5AVP A;  4LO4 B;  3R6S A;  3MUZ 1;  3ZYG A;  2XLF A;  1W6N B;  1YHF A;  5F1R A;  1RUN A;  2VZ1 A;  3FZ3 A;  4XDQ A;  5CFD B;  2BNM A;  4AFM A;  4CDQ B;  3JBG 2;  3POF A;  2VZV A;  2DF7 A;  4LHS A;  3KV5 A;  2J22 A;  4CDU C;  1EP0 A;  1UU6 A;  1MQT A;  3IPV B;  4AHW A;  4D0Q A;  5ABJ C;  2BEO A;  3AL5 A;  1QQP 3;  2WNU C;  4FPY A;  4FP3 A;  2YG0 A;  1QJU 2;  1YFX A;  3LEI A;  5FIX A;  1OUS A;  3ZX7 A;  4TLF A;  4MYE A;  1SBE A;  5I0S A;  4ATF A;  3I2D A;  4CCD A;  2JEC A;  1VIW B;  5IVF A;  1PNG A;  3FL7 A;  1CAW B;  3FLR A;  1VBE 3;  1JHN A;  2V73 A;  3WDX A;  1G9F A;  1NCQ B;  4QQ2 A;  3B02 A;  1NT0 A;  2ZCW A;  4QPI B;  4DXS A;  3IDE A;  3B94 A;  2TEP A;  2Y8K A;  4HAN A;  4WM7 C;  5LB6 A;  2HWE 2;  3AK0 A;  3AMQ A;  4CEW B;  5J98 B;  2Q4S A;  2RS3 1;  3H1W A;  4RR3 A;  3SC7 X;  4JGZ C;  5FLI A;  1AYN 3;  1O4T A;  3NV3 A;  1UZV A;  2NLR A;  3N9M A;  5FPA A;  3GHM A;  1GZ9 A;  1NKG A;  1ZZ6 A;  2CAU A;  1BK1 A;  5BNP B;  5L7O B;  1S0E A;  1MEC 2;  4YW1 A;  4RN5 A;  4WV8 A;  1CJP A;  1YO8 A;  3OPW A;  1BQP A;  3RYK A;  4LIV A;  3KD4 A;  2OA2 A;  2R0H A;  1WCU A;  2W92 A;  4IEW A;  4MET A;  4OCT A;  4YW6 A;  1HX6 A;  4KBB A;  2J1T A;  4KGQ A;  1UY0 A;  4LLO A;  1J3Q A;  3IZO A;  1R09 1;  2QVS B;  2CWM A;  4CDU A;  3R4U A;  1EY2 A;  2Q8E A;  1PGL 1;  1GNZ A;  1SLT A;  2Y0I A;  5ABJ A;  1DIW A;  4XUN A;  4YM1 A;  1GWK A;  5FYI A;  4QAW A;  4E27 A;  5FZK A;  1GV9 A;  1KJL A;  4LO6 B;  3ZR6 A;  4BWO A;  1Z7S 3;  2GN7 A;  1CZT A;  3B00 A;  4EWD A;  3I2G A;  4UYB A;  3FWE A;  5DG2 A;  4W8J A;  1RUC 3;  4XUQ A;  3VHO A;  1DGL A;  1O3T A;  4RD7 A;  5M0T A;  1RUD 2;  1RUI 2;  3Q8C A;  1NZC A;  2VNR A;  3FE5 A;  3AMM A;  4RS5 B;  3URF A;  1SPP A;  2ZTN A;  4KL1 A;  4ORF A;  4JGZ A;  3C7O A;  1UIK A;  3OBT A;  1TEI A;  4IET A;  4HSJ A;  3ZMO A;  1AXK A;  5JZG A;  5JPN B;  1ZRC A;  2VUC A;  2X5I B;  5CA6 A;  1ODN A;  5C71 A;  1QJX 1;  4K1Y A;  4BLI A;  2KM2 A;  2XPJ A;  2HWC 1;  1LED A;  3ACG A;  1C1F A;  1FMD 2;  2VME A;  4YZ5 A;  2E7Q A;  4R9C A;  3WEZ A;  4LBM A;  4G4F A;  2ZGP A;  2ZKN A;  2XJP A;  4HLT A;  4AEM A;  1EUT A;  2FHR A;  3LZZ A;  4BLJ A;  1S55 A;  2ZGO A;  2B46 X;  4YPJ A;  2EA7 A;  1YFY A;  2CDO A;  1HRI 2;  3OD4 A;  5CKQ A;  2OXB A;  4NHM A;  4WVV A;  2AEY A;  3AJY A;  2YMZ A;  3MIC A;  1ULP A;  3MV1 1;  1PO2 3;  2HWE 3;  2PQS A;  3KLS A;  3POB A;  3KHB A;  4Q26 A;  5FWJ A;  2EXI A;  5F6L B;  1ENS A;  2OPK A;  4DUW A;  3ACF A;  1XXN A;  5LY1 A;  3PUR A;  4XCA A;  4DUX A;  5LK7 B;  1I3H A;  1YQC A;  1RUH 1;  3TAY A;  1OA3 A;  2J1U A;  4TYS A;  5FXX A;  3T4V A;  3BTA A;  1G9D A;  4CYD A;  1MEC 3;  5E1R A;  3HNM A;  4AVT A;  4YM2 A;  1V6M A;  1AR6 2;  3LF7 A;  1R1A 2;  1JN2 P;  4P9I A;  1W8F A;  4X8N A;  4OQ9 A;  4AVB A;  3AVR A;  2WO3 A;  4FTE A;  4FPL A;  1OF4 A;  2O1Q A;  1ZRI A;  5A3W A;  5ANQ A;  3POG A;  3V0A A;  1IOA A;  5T5L A;  5LRS A;  2DYC A;  4JGY B;  3UK9 A;  5CKM A;  4Y5T A;  4FFF A;  2OQ7 A;  4IEP A;  4QHB A;  4N9H A;  1VP6 A;  1KS4 A;  2VMG A;  5A7O A;  3VKL A;  1CPN A;  1I6X A;  4MXV A;  3GJB A;  3NST A;  1W2N A;  4COV A;  2BGC A;  5J36 A;  2E7A A;  3KVA A;  1LOC A;  5IVY A;  2RDR A;  3INA A;  1GUI A;  4XQ4 A;  1KD7 A;  1JUI A;  4FO9 A;  2K46 A;  1AR9 1;  3P6B A;  1BJQ A;  1RUD 3;  1RUI 3;  3CJI C;  5B4X A;  1W8H A;  3LD8 A;  3POY A;  4COU A;  5FYV A;  1SLB A;  4QXC A;  1S0B A;  3ZMN A;  1SLA A;  4M4P A;  5DZE A;  2PFW A;  1SFP A;  1XNA A;  3A21 A;  4KGG A;  3Q8F A;  1NQD A;  4B8E A;  3VD4 A;  1O4Z A;  4X6R B;  3NNF A;  3AL6 A;  5A80 A;  1ULC A;  2ZAA A;  3VGI A;  2ZML A;  3ZN4 A;  5FO9 B;  5KC5 A;  4NIG A;  1RXF A;  3I59 A;  5LY2 A;  5GKA C;  2OW4 A;  1O3R A;  1J59 A;  2VCM A;  3CF6 E;  2DU1 A;  2XKO A;  4UT5 A;  5FPL A;  3C7F A;  4XQW A;  5C4W C;  5J7M A;  2A7A A;  4KG0 A;  2AEN A;  5DZF A;  2VBD A;  3M3O A;  3G6J B;  3DEC A;  4FAH A;  3RZM A;  2RHP A;  1IS5 A;  2VOW A;  1YNA A;  3JCI A;  1JU3 A;  5I0T A;  3WX5 A;  5FYS A;  2FCT A;  1SCR A;  1UKG A;  5FZD A;  2HEW F;  1CQ9 A;  1Q43 A;  1EV1 1;  2D98 A;  1REE A;  3J4U H;  2W9X A;  3WG2 A;  2QQV A;  4L8Q A;  4EN8 B;  1U0A A;  2DVD A;  3AP6 A;  5A3N A;  1OLM A;  2BRT A;  2KXL A;  3DKW A;  1ONA A;  2IVJ A;  1YIF A;  3CJI A;  4I3P A;  2A73 B;  4OHW A;  1IPK A;  3MO4 A;  5A7Q A;  3BVC A;  3DEM A;  1H8T B;  1OT5 A;  3PUS A;  4I01 A;  5JPM B;  4IUG A;  3OD0 A;  2FDI A;  1MS0 A;  5FYU A;  5F37 A;  2DVF A;  2GC1 A;  4K1Z A;  1UY2 A;  1AXZ A;  4RGG A;  2IUW A;  2EXK A;  4AG4 A;  1UX7 A;  2W39 A;  4XDP A;  3V65 A;  3BTX A;  3MZH A;  1S0F A;  4PQQ A;  5F5Q A;  5GLT A;  4HVR A;  4HPK B;  5C4W A;  3ME2 A;  1KQR A;  3N7K A;  5EHD A;  4XTM A;  5BNO C;  1YUD A;  2ZPX A;  3LEM A;  2OPW A;  2XJR A;  4AEJ A;  4AAX A;  2VVE A;  4LEJ A;  1WLC A;  2WNU B;  4ARY A;  5BY5 A;  1MS9 A;  1TMF 1;  2ETE A;  2RMU 3;  3PNA A;  1IQD C;  1TME 2;  3MLL A;  4IE7 A;  4XJ8 A;  3LFM A;  4JV4 A;  4A4A A;  2XVK A;  1FYU A;  3ZXL A;  1LJ7 A;  4BQ1 A;  2WRA A;  4LBQ B;  2WN3 A;  3ITQ A;  2WDB A;  1UKR A;  1J3P A;  3PVN A;  1V6K A;  4WM7 B;  2XLA A;  2K2S A;  1ZNP A;  3D0J A;  3MLK A;  2BUK A;  3OBR A;  4JVA A;  1UZW A;  4C90 A;  4YZ2 A;  3W5N A;  5GLU A;  4JGZ B;  3TN9 3;  4A7Y A;  1RIT A;  1C1L A;  2R06 2;  1YI7 A;  2VE1 A;  1NCR B;  1PO1 3;  2C0Z A;  3RI9 A;  4RQP C;  5JSP A;  4GB3 1;  4A6S A;  1DBN A;  3T0B A;  4ZON A;  5JR7 B;  3SIS A;  2LS6 A;  1JOB A;  5CFC A;  5EQU A;  1FX5 A;  1U12 A;  2QQP A;  4Q4V 2;  1UAI A;  5DAB A;  1FOD 1;  1H6Y A;  3BGA A;  1POV 3;  1SMV A;  2E7T A;  4JTO A;  4CEY C;  4UBG A;  3A22 A;  3K4D A;  1LEC A;  1UL9 A;  1APN A;  5A7P A;  1NAE A;  4QB6 A;  5FP7 A;  2XWB B;  5H9S A;  3U4S A;  2JKX A;  2CGO A;  4YM0 A;  1PGL 2;  2SBA A;  3AKP A;  3SXW A;  4CUA A;  2X29 A;  1C8N A;  3GDB A;  4O65 A;  4QWN A;  3I3M A;  1Y7B A;  1QJY 1;  1W8W A;  4RGK A;  3ZKU A;  5LBC A;  1GZW A;  2VMF A;  5A6X A;  2G9F A;  1GZT A;  4YFZ A;  4OUE A;  5HCA A;  2W91 A;  2P3Y A;  5CIS A;  3AP7 A;  4ATE A;  4GAZ A;  4KMQ A;  2JG8 C;  4RQP A;  5JLV A;  3VZM A;  1AL2 2;  1ZBA 2;  3KV4 A;  2B4K A;  4IEU A;  4Q4Y 1;  3WR0 A;  4AL9 A;  3VZK A;  1ULG A;  2JDN A;  1RUE 2;  4R52 A;  5IVE A;  3WNL A;  2YU1 A;  3ZOI A;  2OKX A;  5FZ0 A;  1PZ8 A;  4AED B;  1ND2 C;  1QOS A;  2X10 A;  2XML A;  3OB8 A;  4XZP A;  3TOJ A;  3N7J A;  4O9E A;  4Y1Y A;  1QWR A;  5I0U A;  1AZD A;  2ARX A;  2PAE A;  3WF1 A;  3ZVX A;  5A3P A;  3M3I A;  3WXP A;  1RUG 2;  4CDX C;  1BCX A;  1TME 3;  1O4Y A;  2WLP A;  3LEK A;  3ZYI B;  4CEY A;  4JTN A;  3LIG A;  1US2 A;  5F2S A;  1PGW 2;  1QQP 1;  4UFM A;  4IEQ A;  1OLQ A;  3FLP A;  4PDW C;  4NE9 A;  4QB2 A;  1X8M A;  4LJH A;  5FZ9 A;  5GZD A;  4B3N A;  3S7I A;  3NQH A;  1OBN A;  1ULF A;  3T2P A;  4XCB A;  5F2W A;  1B09 A;  1W3X A;  3B93 A;  3MLJ A;  4QX2 A;  4WVM B;  1BEV 3;  3RRD A;  3S7E A;  1HRV 3;  1KGY A;  3K77 A;  4QXB A;  2R06 3;  3WNN A;  5LW9 A;  4XYX A;  2GNT A;  3FHI B;  1SG3 A;  5EYX A;  5A32 A;  5FXZ A;  3HMY A;  2IFW A;  5C70 A;  4LA3 A;  3I59 B;  2JG8 A;  1AYN 1;  1U5I A;  5T5P A;  3ZR5 A;  3N9P A;  2XGX A;  5LRR A;  1UZ0 A;  1JMU B;  4Q4V 3;  2BBV A;  2Z42 A;  3VL9 A;  1K5J A;  2YY1 A;  4FFG A;  1UOB A;  4CDX A;  1DYP A;  4BB3 A;  4BU2 A;  2CL2 A;  4Y1Z A;  2DUO A;  5T55 A;  3O1S A;  2FDK A;  4IV3 C;  2XDV A;  3USU B;  4NWW A;  1IS4 A;  2ZGL A;  4LE4 A;  3ZDS A;  2YFZ A;  2BVV A;  3SLI A;  4PDW A;  5HCB A;  4NIH A;  3U14 A;  5FR3 A;  4J1W A;  3CJI B;  1IQA A;  1GSL A;  3VLB B;  2V72 A;  4ISQ A;  2D7F A;  5HV0 A;  3VKO A;  1RUC 1;  1XNK A;  1OQ1 A;  2LM3 A;  4FFI A;  3LGR A;  3NJV A;  4GKX A;  4UFI A;  4YZ3 A;  4EV0 A;  4E8C A;  5A7W A;  1AL2 3;  4PIZ A;  4Y24 A;  1C57 A;  5DN2 A;  1RUE 3;  4V2V A;  2ADE A;  3M3Q A;  1O6U A;  2VOT A;  3BOD A;  3SEE A;  3MGU A;  3ZN6 A;  1JZ6 A;  4BA6 A;  1PNF A;  1W8T A;  2DUQ A;  2KR2 A;  5JMO A;  2D3P A;  2NP0 A;  2EIE A;  3A4U A;  1CWP A;  2DCY A;  3JBG 1;  1RUG 3;  4XFI A;  1HB4 A;  4NPR A;  3VD5 A;  2VMH A;  5DAQ A;  5DUW A;  3DYM A;  2J1V A;  3J26 N;  2UYA A;  2QDR A;  3BTZ A;  3TB0 A;  1K5M B;  1QJU 1;  1VBC 2;  4IV3 A;  1LU1 A;  4YLZ A;  1N47 A;  5CFD C;  2GSY A;  2ARB A;  2IXL A;  2JDP A;  3ZN5 A;  1GMM A;  3ZSJ A;  3PJY A;  3WQ1 A;  4H2A A;  2JDZ A;  3ZXF A;  4QPY A;  2HWE 1;  3E97 A;  3FUO A;  4MLO A;  1D7P M;  2C4X A;  1K42 A;  3PL0 A;  5J1X A;  2JJ6 A;  3THD A;  4F83 A;  4HON A;  4JKL A;  1EPZ A;  1F4A A;  1OKO A;  3E1F 1;  2W47 A;  1V6J A;  1QOT A;  2LW8 A;  4BHP A;  2A6Z A;  5FZG A;  2WNE A;  1NCQ C;  1PIV 3;  1WW7 A;  1MEC 1;  2A6V A;  2DUP A;  2VNV A;  2VAU A;  3O7O A;  4OI2 A;  4QPI C;  3WNX A;  1YQ6 A;  3I2H A;  4CEW C;  3FJS A;  2JEM A;  4FQ4 A;  3OSD A;  4QX8 A;  1WME A;  3ZYJ B;  4FOW A;  4XFB A;  3PJQ A;  5BNO B;  1DGW A;  2B9U A;  2VQ0 A;  4J6G A;  1IPJ A;  3BU7 A;  2DTY A;  3F95 A;  1WGP A;  1X9T A;  4ZU4 A;  5BNP C;  4FP2 A;  2DV9 A;  2BPA 2;  4FQZ A;  4XQD A;  1LKN A;  3ZXA C;  4GH4 B;  1S4C A;  1W6N A;  2YV8 A;  4GUL A;  3GAL A;  3ZXD A;  1PGS A;  2GN3 A;  2WO7 A;  3SCH A;  2QQJ A;  5CFD A;  3QAC A;  1RIR A;  1Z0H A;  4I0W B;  4Z8B A;  5H9P A;  1VPH A;  2R30 A;  1XPW A;  2CV6 A;  1GZW B;  1FV3 A;  3K4Z A;  4XZU G;  3PDQ A;  3T3Y A;  1TMF 2;  3WQ0 A;  1CAX A;  4AHZ A;  5ACA 2;  1RUO A;  1V9U 3;  1LEN A;  1ZRR A;  2YBK A;  3MIE A;  4Y1X A;  1VB4 A;  2VQU A;  2V4V A;  2ARE A;  3U11 A;  1RUD 1;  2R1B A;  1RUI 1;  4JHT A;  5KXB A;  3WHU A;  3LSE A;  3WG4 A;  1O5U A;  3AP4 A;  3M8L A;  4I0B A;  3IDA A;  5L9V A;  4KNC A;  4QQP A;  4AQ6 A;  5EV7 A;  1CAW A;  1WW4 A;  1O59 A;  2NMO A;  4NHL A;  3VDC A;  2YGL A;  4ASM B;  2VTX J;  1YFU A;  1NCQ A;  3B69 A;  3MF9 A;  4QPI A;  3WF2 A;  2J1A A;  1E5H A;  4YVS C;  4CEW A;  3V64 A;  2VXR A;  5JAX A;  1A8D A;  1J83 A;  1W8O A;  2QE3 A;  5LA9 A;  4CEY B;  4DXZ A;  5KWR A;  4JC1 A;  1NXM A;  1ZZC A;  2HEY F;  2W87 A;  5T3N A;  4XJZ A;  5BNP A;  1PM7 A;  3OPZ A;  1VMJ A;  1H2K A;  2X09 A;  1GLH A;  2IWG B;  3PME A;  3WUD A;  4Q4X 2;  5BV6 A;  2HWF 3;  4CU7 A;  4P9W A;  2XUE A;  3ORJ A;  3WP5 A;  1TNF A;  1NOV A;  1OQE A;  3ZO0 B;  3A0K A;  4P9J A;  2LAL A;  3EO6 A;  1F31 A;  1POQ A;  1ZZ9 A;  2JD9 A;  4JDM A;  5GZF A;  2F6B A;  5K9Y A;  3VBR B;  5AC9 2;  1CD3 G;  5I0D A;  3ZM8 A;  3O1V A;  1X7N A;  3ACH A;  2D97 A;  1GQP A;  2RDS A;  5IK4 A;  5C3O A;  3AYE A;  4KU8 A;  4N43 B;  1UZZ A;  2EIB A;  4LBK A;  3WP6 A;  2FDF A;  3AZW A;  5JDB A;  3FUQ A;  4XFG A;  4PHZ A;  1XE7 A;  1R1A 1;  1G86 A;  1ND2 B;  1W6M A;  3UJO A;  3ZYR A;  2WII B;  2VU9 A;  4R9A A;  4YVS A;  2GZW A;  5F6K A;  3H1M A;  1W8Z A;  4L99 A;  4CDX B;  3U4X A;  3FFZ A;  3T4H B;  3VBS B;  2DBN A;  3VKM A;  5A7S A;  4FTB A;  1SBF A;  2FMD A;  3JQW A;  3FLT A;  4I30 A;  2EVX A;  4LUM A;  3O1U A;  1OFS A;  1TVG A;  3VBH B;  5KHI A;  1ULD A;  4JDO A;  1HKD A;  4XUO A;  2VMI A;  2WL1 A;  3O0W A;  5C7G A;  1QJZ A;  3IAP A;  2ARC A;  5ACA 3;  4QDQ A;  4FAG A;  4JGY C;  5IT6 A;  3NKG A;  3TEX A;  3DYP A;  1OMI A;  4EN6 B;  4UW6 A;  1ENX A;  4JDN A;  4YW3 A;  1UXX X;  2ZXQ A;  2WBK A;  1SBD A;  3RMY A;  4ZKT B;  1Y9Q A;  3PUH A;  1QF3 A;  5FLJ A;  3GM8 A;  3VKF C;  3TN9 1;  3N4M A;  1X9P A;  3M3E A;  2BER A;  2VY0 A;  3SH5 A;  1PX3 A;  1VBE 2;  4XF1 A;  1QU0 A;  1XBF A;  4CE8 A;  2BGO A;  2YRO A;  3FBY A;  1KXG A;  4YG0 A;  4EZ4 A;  3ON7 A;  1ZVF A;  3HPN A;  3OGV A;  2VOK A;  2NQY A;  3K48 A;  4JCK A;  2BFU L;  3BN6 A;  3S5A A;  4LE3 A;  4BK5 A;  1G8W A;  2RS1 3;  1JI6 A;  4H7M A;  4JX0 A;  2QQM A;  3V0B B;  4XOG A;  3VUO A;  2H0B A;  1ASJ 3;  3GZT B;  2VCA A;  2WQ4 A;  4IEZ A;  4Q4X 3;  1POV 1;  2TNF A;  3RWN A;  3VB9 A;  4LBL A;  2EF6 A;  2JE7 A;  3IT8 A;  5BYN A;  2YDE A;  1ZYB A;  5FJK A;  5JXG A;  2JIG A;  1H1I A;  2GH2 A;  2YHJ A;  3HAG A;  3TNP B;  3WDT A;  3RZG A;  3VV1 A;  1GP6 A;  2OZJ A;  4JGY A;  3D3A A;  5AC9 3;  2R49 A;  2WNO A;  4C1W A;  1FPN 3;  4FOQ A;  2Z79 A;  2HYK A;  1KIT A;  5DAX A;  3SMH A;  2B5H A;  2CY6 A;  4A2U A;  4FPF A;  1GYK A;  3WDY A;  4NOT A;  2JEN A;  3PVO A;  1NLQ A;  5FXV A;  3WOG A;  5KBF A;  1Z7S 2;  2WYF A;  4XVH A;  5FPU A;  3BI3 A;  1IKP A;  2O0O A;  5IK5 A;  3ZPO A;  1VRH 2;  4DIN B;  5KHG A;  4Z82 A;  3ZPY A;  2YGM A;  4Y1U A;  1HB1 A;  1HXS 3;  3I8T A;  4BH9 A;  4WVZ A;  3UKT A;  3IN9 A;  4LUK A;  2MPF A;  4FCA A;  1UOG A;  4Z1V A;  1PHM A;  4P9X A;  1D2Q A;  1DZT A;  2A3W A;  5F5I A;  4LTA A;  4GAL A;  2IZW A;  2O8O A;  1MS3 A;  3NV1 A;  2DDU A;  1WUV A;  2ZJC A;  3I4I A;  4C0B A;  2W1S A;  4XF4 A;  4XBL A;  2E32 A;  3T2O A;  1YYN A;  1JHJ A;  5FK8 A;  4E2G A;  1TME 1;  3I3B A;  5A3L A;  3MIB A;  4QKF A;  1YC6 1;  4BIF A;  2R32 A;  5CYY A;  4BQX A;  4LOS A;  1BZW A;  1CAX B;  1EAH 2;  2VBP A;  2VG9 A;  4QT6 A;  2IVI B;  3POI A;  2W0X A;  5JCT A;  5IK8 A;  4OUS A;  4GJZ A;  3O5S A;  4TN7 A;  2BV4 A;  3POW A;  5DAW A;  3NNJ A;  2XR4 A;  4B4P A;  3DXT A;  4KH9 A;  2BFU S;  2OUJ A;  2ZMK A;  5EJZ B;  2R06 1;  3CMG A;  2B9V A;  4IL7 A;  1XSR A;  2GC0 A;  5EP9 A;  3KMH A;  2JXA A;  4CDW C;  5LWB A;  3NNG A;  1UU4 A;  4XF3 A;  5JI7 A;  2RDQ A;  3JQX A;  1PO2 2;  1Y4W A;  3ZSL A;  4AFA A;  3VDB A;  1UX6 A;  2DVA A;  4Y3O A;  3VDD C;  4PBO A;  2VZS A;  3X29 B;  3B5L B;  1H8T A;  3AXE A;  2A70 A;  1NCR C;  2W08 A;  3O0X A;  5G05 L;  5DPN A;  1JS9 A;  2GH8 A;  1AL0 G;  1AYM 2;  2ZEZ A;  2OQ6 A;  4PQ9 A;  1GBG A;  4Q4V 1;  4ZZ5 A;  4AGR A;  2VC9 A;  5KXC A;  3OG2 A;  2I07 B;  1JOD A;  1S2K A;  3K4A A;  2X53 S;  3OJB A;  3MHZ A;  2VNO A;  4U2A A;  4N7U A;  2WS9 2;  3J7N A;  3KWV A;  1AXY A;  4N9I A;  1G9A A;  2D3S A;  1GQG A;  3GZU C;  3PU3 A;  1RMU 2;  3NAP B;  4HPK A;  1QDO A;  3VD7 A;  4NII A;  3O1O A;  4M01 A;  2WWU A;  5J48 A;  4NMI A;  4AAP A;  3H7J A;  3R4S A;  5JOZ A;  1LAJ A;  1EPW A;  5IUQ A;  5LAT A;  5FZ1 A;  2WNU A;  1PZ9 A;  4PF5 A;  5FZE A;  3TEZ A;  4CXY A;  2LTN A;  1Q3E A;  2Y34 A;  4KU7 A;  1NQJ A;  3WW1 A;  5HV4 A;  1OI6 A;  5FJH A;  1VRH 3;  5FLH A;  2W1Q A;  4AI0 A;  4LBQ A;  4CDW A;  4WZC A;  2VQA A;  1AL2 1;  1V6I A;  1ZBA 1;  3OUH A;  5FKC A;  2WZE A;  1W6M B;  2WA4 A;  1OHF A;  1RUE 1;  3BB6 A;  2VZQ A;  4WM7 A;  3ENR A;  2HWB 2;  3NO8 A;  1RUJ 2;  4KWJ A;  4YVS B;  3HNY M;  4NRM A;  1AJO A;  1UOJ A;  2AAC A;  4LBN A;  1CZV A;  2HYX A;  1DG6 A;  4GJY A;  5LK5 A;  4A44 A;  5K0U C;  3M1H A;  5FO8 B;  1LB2 A;  1NCR A;  3OPT A;  3JUU A;  1R08 2;  1YJK A;  3DXU A;  1RUG 1;  1XYO A;  2FMY A;  3AVS A;  3R0R A;  1RTV A;  2XOM A;  3RYR A;  4XW3 A;  3Q8E A;  1HIX A;  3IMN A;  4CCN A;  4LNV A;  5FZL A;  5CZK A;  3ECQ A;  1PGW 1;  3WV6 A;  4AED C;  1EAH 3;  4Q0P A;  3N7L A;  5T5O A;  3NL1 A;  2UU8 A;  4IGP A;  4NIA A;  1UU5 A;  2D3R A;  5JI9 A;  2GME A;  4BQY A;  4JRL A;  2PLV 2;  3WDW A;  1W04 A;  2BWA A;  2D5F A;  3H9A A;  2Y6J A;  5J96 B;  1ENQ A;  4E4S A;  3IDB B;  4YAR A;  4XMA A;  1DQ1 A;  2GMM A;  4GA9 A;  5K4L A;  4MZU A;  5CFC B;  2ORX A;  1YXW A;  1LNS A;  2VZR A;  4TXW A;  5FOB B;  1AJK A;  4JQR A;  1B35 B;  2H6C A;  2WO2 A;  3L2Y A;  4OQ8 A;  1X36 A;  2DCT A;  2D6K A;  4XHX A;  1UYP A;  3ZXJ A;  4A3X A;  3FC0 A;  1PX4 A;  1AR7 2;  3AMH A;  4XTP A;  1OSG A;  4B4R A;  2AR6 A;  2QQN A;  3AKQ A;  5J09 A;  3TEY A;  3BUC A;  1DYO A;  2D43 A;  1AYM 3;  2Y60 A;  2OYZ A;  5K0U A;  5C6C A;  5CAD A;  4WVW A;  4FSJ A;  1DZR A;  1D4M 3;  3LAG A;  4CUB A;  4OUM A;  5CB7 A;  1YQ2 A;  3H7Y A;  5F32 A;  4OYU A;  4ZXE A;  3TYJ A;  1RB8 G;  1Q8Q A;  1F15 A;  2WS9 3;  1CPM A;  1SDD B;  2JE9 A;  5A3M A;  5A3O A;  4Q0U A;  4AW7 A;  5EWS A;  1RMU 3;  3RZJ A;  2C5D A;  1BMV 2;  3POE A;  2RV9 A;  2Y0O A;  2VZP A;  4AED A;  3N7M A;  5T54 A;  1G7Y A;  2A6X A;  5LZ6 A;  3ILR A;  4BQ4 A;  4LHK A;  4HVO A;  1C5I A;  1N1S A;  3III A;  1D0H A;  3WNM A;  5BXX A;  4LT5 A;  5FPV A;  2XJS A;  1PZ7 A;  2RMU 2;  3QCW A;  3B01 A;  4ITC A;  3WD5 A;  3T2Q A;  3T0A A;  1W9Y A;  2BBA A;  3EJK A;  1PVC 2;  4MUV A;  4XEZ A;  2IXJ A;  4LKF A;  3SIT A;  3AP9 A;  1NY7 2;  1YQ8 A;  3CL1 A;  3JU9 A;  1WCS A;  1F9K A;  3VBO B;  2XUM A;  3WP3 A;  1HQN A;  4COY A;  4NVP A;  2C6S A;  4QM8 A;  1FNY A;  2HWB 3;  3KCX A;  1RUJ 3;  3LCP A;  4IW3 A;  4K20 A;  4QQH A;  4XPV A;  4PCR A;  4O7X A;  4WVM A;  2ZAH A;  4BXS V;  4EJR A;  3MI8 A;  4Q2F A;  4LXL A;  2ARA A;  1R1Z A;  2E26 A;  2ORZ A;  1HB3 A;  2ZAC A;  1R08 3;  4XXP A;  1WCD J;  4W6Y A;  1PO1 2;  2W2I A;  1V6N A;  3N36 A;  4P9Y A;  5E89 A;  5FY8 A;  1W05 A;  3GZE A; 
#chains in the Genus database with same CATH homology
 1GZT A;  1OUR A;  2BP6 A;  3DCQ A;  2VUC A;  2JDK A;  2JDP A;  2WR9 A;  4UT5 A;  5D2A A;  2JDH A;  2WRA A;  4CE8 A;  2CHH A;  2JDN A;  1UZV A;  2JDU A;  2VUD A;  1UQX A;  5A6Y A;  1OXC A;  1W8H A;  5A6Q A;  5A70 A;  2JDM A;  2BOJ A;  1W8F A;  2BOI A;  4AOC A;  2BV4 A;  1OUX A;  1OUS A;  5A3O A;  2XR4 A;  2VNV A;  2JDY A;  1OVS A;  3ZDV A;  5HCH A;  5A6X A;  1OVP A;  5A6Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...