1GZTA

Pseudomonas aeruginosa lectin ii (pa-iil) together with fucose
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
114
structure length
114
Chain Sequence
ATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNETAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILTNELNFALVGSEDGTDNDYNDAVVVINWPLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lectin
molecule keywords FUCOSE-SPECIFIC LECTIN
publication title Structural Basis for Oligosaccharide-Mediated Adhesion of Pseudomonas Aeruginosa in the Lungs of Cystic Fibrosis Patients
pubmed doi rcsb
total genus 21
structure length 114
sequence length 114
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2002-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07472 PA-IIL Fucose-binding lectin II (PA-IIL)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.400 Mainly Beta Sandwich Jelly Rolls Calcium-mediated lectin 1gztA00
1OURA 2JDNA 5A6ZA 2JDUA 5A70A 1OUSA 1UZVA 1OXCA 1UQXA 1W8FA 2WRAA 2VUDA 5A6XA 2BV4A 2WR9A 2JDYA 1OVPA 4UT5A 1OVSA 2JDHA 2VNVA 2XR4A 3DCQA 5D2AA 5A3OA 2JDMA 3ZDVA 4CE8A 5A6YA 2JDKA 2JDPA 2BP6A 5HCHA 2BOIA 2CHHA 1W8HA 1GZTA 5A6QA 4AOCA 2BOJA 2VUCA 1OUXA
chains in the Genus database with same CATH superfamily
5LW9A 4TTGA 5AFBA 2D98A 2JG8C 3MO4A 2ZEZA 3N9PA 1PVXA 3OEBA 3VN4A 1POQA 2ZX1A 2XVLA 4FP3A 2RDNA 3NNLA 2R041 4LO8A 3ST7A 3ZFGC 2J1TA 3FLTA 2W95A 3Q8BA 5F9TA 5LCWL 2VMEA 4BQXA 1J1LA 3MPBA 4MHUA 4UXAA 2R043 1KFXL 1XJAA 1H9WA 3IM0A 4CEWB 2IXJA 3VZMA 2X29A 3QBQA 4OUSA 2LUWA 5CKQA 4Y1VA 2RDRA 5EZWA 4IV3B 4BXFA 4Y4RA 1VE0A 4M3CE 2YPDA 3HOBA 4NIIA 3WQ7A 2XJRA 1NQJA 3OOXA 4JGZA 5EHDA 5B4XA 4JDMA 1OURA 4X6QB 1OC1A 3ILNA 3VLBB 4OZXA 1DDLA 2BWCA 4ZKTB 3HJRA 4UBGA 3W58A 5BNQA 1W9TA 5A7NA 2XVKA 4CU9A 5LBCA 5JXGA 3DL3A 5FY1A 2WS91 4BLIA 1QJU2 1SPPA 4UW3A 2K0GA 2Z4FA 5ACA2 4AFCA 4LHLA 1JTZX 2HEYF 4J1XA 4RQPC 3ACHA 1AF9A 1CVNA 4CU6A 2CDPA 2WS93 3DPRA 3MEPA 3RZKA 4XJUA 1ZRIA 4E8CA 1UU6A 4RHV1 4HZFA 1AX2A 1CAWA 1PVC1 3LDKA 2WZ8A 4LIUA 5G04L 4AOCA 1VAMA 4N43A 5C9AB 5F39A 3RMYA 2PTMA 4RHV3 1ZNPA 2HEVF 1PVC3 3KT1A 4P9IA 4PLMA 4H3WA 1ODMA 2R1BA 4XF3A 3NO8A 3TWIA 3O14A 3W59A 2RS51 1AYN1 2DU1A 5A80A 4N8MA 4ZXKA 3LAGA 1OOPA 1H8TA 5FYTA 2RS53 1AYN3 1H4HA 1W8ZA 3VKLA 4OQ9A 2QZ2A 4IEYA 5FZAA 1OQDA 1RUJ2 1XNBA 4PT6A 4A2UA 2FDHA 3WF2A 1O3TA 1GNZA 4HANA 1V6MA 2Q0AA 3WSOA 1M06G 1BBT1 1MQTA 2D6KA 2UY9A 3OPTA 4FT8A 4LOTA 3M3OA 4XJ9A 4FTSA 3LFIA 1QJX1 4MGTA 3KQRA 3PHMA 2WSVA 4FPFA 3U75A 5A6QA 1BBT3 3I2GA 3ILRA 2PHFA 3J26N 3MLJA 1W2TA 1XYOA 2PHWA 3PDQA 1R1ZA 3MZHA 3E6CC 1QJX3 2DVBA 3ORJA 1OLRA 4GWIA 4RR3B 3U1XA 2VNRA 2VH9A 4RGKA 5EYXA 1KJRA 4V1PA 1IS6A 1DP0A 3MV01 1NCQC 3Q8AA 5IAVA 4QXBA 5F3GA 3WG3A 5HBAA 1V70A 1G9CA 1NCRC 5D8AC 4GMP3 1VBC1 4Y20B 2R7EB 3NJVA 4OI2A 4JKMA 3MFCA 5DMYA 1QXRA 2BERA 1GQHA 2LROA 1CZSA 1VBC3 1G9AA 5A3TA 2VOXA 5JI7A 2FCUA 4N9IA 3RQ0A 4UFKA 3PNAA 2E7TA 1JZ6A 2X8KA 3AMQA 5ANQA 1BXHA 4Y5SA 1JYWA 1J83A 5FYVA 1JZ8A 2JJ6A 5LRRA 2EAAA 2YBSA 2BWAA 4FPCA 1XNAA 1UYYA 2ZGSA 4L11A 1W9SA 4FVVA 2D40A 3WZ1A 1CWPA 1VBE2 1W04A 4DQAA 2EIBA 3K4ZA 4IEZA 3WUCA 2W91A 4C1WA 1N47A 2MEV2 4P14A 2EXIA 3I8TA 3ZXFA 3H3ZA 5CG9A 3NV3A 1GMMA 3AJYA 2OA2A 2VVEA 4FPKA 2I74A 2IWGB 4QKFA 2WWUA 1W8UA 1PIV2 1JZ3A 5LY1A 1WMXA 4IV1B 3AZVA 3OBZA 2PN5A 1GWKA 3HQRA 3WG1A 1AR92 3VZOA 2H6BA 4AHYA 4U2AA 3W5MA 1PO22 2GSYA 1W0PA 4FFHA 4EN8B 4ITCA 4MUVA 5F2WA 2ZAHA 4XQ4A 4JTNA 4BQWA 1REFA 4CUBA 1ZBE1 2WNEA 4P5YA 1EAH2 2BNOA 2TUNA 4B3NA 4LULA 2BNNA 2VZQA 3K46A 3KGLA 3WCSA 1UX6A 4Q4X2 4YRDA 1ZBE3 2OX0A 5FXXA 1SZBA 3T08A 1JYCA 2HWE1 1CN1A 2W1SA 3HN3A 1EUUA 2WZEA 4XJWA 1CGPA 2D3RA 1ST8A 3ZXEA 3FN9A 2HWE3 5EJZB 1CR7A 2DCKA 4N53C 3VL9A 1PMIA 2GNBA 1V6JA 1GBGA 2OUJA 1S2EA 3T1LA 1LOFA 5LATA 4QX2A 3PURA 5ABJC 3TB0A 1RUD1 4DUXA 3AFKA 4PQ9A 4CU8A 4MGKE 4EZ4A 5F3CA 1RUE1 1UYXA 1VRH2 1GUIA 3L9JT 3VBSC 1RUD3 3PVOA 4CRQA 1YEWA 2CDOA 2VCAA 2WO7A 3WNMA 2G9FA 4NMIA 5A3WA 2YC2A 1FT9A 5A6XA 2XWBB 2HWB1 4KH9A 4S2DA 4MXWB 1W8NA 2W94A 4OUMA 3WW3A 1YC61 3VZLA 3OUHA 3O1PA 1CX1A 2QE3A 3B9CA 1V9U1 3Q8CA 1IKQA 1AX1A 3CO2A 1SBDA 2BDRA 1J58A 2HWB3 4R9CA 4DPNA 5HV0A 1IS4A 3SCFA 1AR62 1Z78A 1FAYA 1V9U3 1ZZ6A 3ZDSA 4LQRA 5K9YA 3CZUA 2C24A 3VDAA 1QJZA 1AYM2 2YU2A 2K2SA 4B4PA 5C7GA 3TOJA 1DQ0A 3SHRA 1WMDA 2RS11 1KFUL 1CJDA 5F37A 2VZPA 3HNBM 5JOXA 4QMAA 3BU7A 2RS13 1KD7A 5JIAA 5A7SA 1ZZ9A 4K8RB 3AP9A 4Z92B 3LDRA 4GJYA 1K5MA 4AI8A 1O5UA 2ZGQA 1K5JA 5DG1A 1DYKA 2RM21 2XJPA 4BDVB 4J25A 1GNHA 1DZQA 3CQOA 3JB4C 4IDZA 4QPYA 4XBNA 4RS5A 4XDQA 3WP6A 1REDA 2RM23 3JU9A 5CFDC 5I0TA 1UD1A 4UW4A 4C91A 3D5OA 4W65A 3IDBB 5GLTA 5A1LA 2BOJA 5DDJ1 2ZKNA 2RR12 3U07A 4FCAA 5FK7A 1LOEA 2DVDA 1Y7BA 2RE9A 5EQUA 4IESA 1P8JA 1S2KA 2XUEA 3SQOA 5DDJ3 3DEMA 5FRAA 5JVVA 2Y0OA 1YCIA 1OQ1A 2BFUL 4HPKB 3TEZA 2QQNA 2V72A 3ETPA 3VBRC 4NAMA 2VOVA 5FLJA 4R9DA 3C8XA 2DTWA 4E2GA 5LEKA 3BOPA 3R4UA 2FHRA 1JYXA 4ET7A 2E7QA 1FNYA 4XUOA 5BNPC 5ISLA 2O8OA 1HJFA 4K9SA 4AL9A 4ZZ5A 5L7OC 3ES4A 3OY8A 4GD4A 2R32A 3N7JA 3SH5A 1C4RA 1X9PA 4CEYB 5CZKA 1DIWA 3V65A 1WLDA 1DZRA 2JX9A 3RPQA 4LA2A 2DBIA 2EIEA 2R1DA 2ZHNA 1SHWB 2D6NA 2JENA 4QQPA 4IEPA 1IPSA 4FPYA 3RJRA 3I2FA 3NKGA 4GULA 2P4EA 1NA1B 3OGVA 5C4WB 1AXYA 1RJ8A 5DZFA 3THCA 3M2MA 4D7TA 2E33A 4P9XA 1S4CA 4K40A 2X5IC 2YFZA 1H9PA 1HB2A 5T52A 4I02A 4TXWA 3FX3A 3NQHA 4L99A 5BNOC 2AACA 3OF1A 4CEYA 2JKBA 5FY4A 3ETQA 4DNYA 2VZSA 2YGLA 1BMV1 3O0XA 4B8EA 1W6NA 1US3A 1YRZA 2BQPA 2JICA 2XH6A 4IEXA 1NA1A 1ZBA1 4O9GA 3WX5A 1W3VA 1ONAA 1G8WA 1NY71 2XKOA 1ZBA3 4BWOA 2D44A 5J36A 4AW7A 3VBFC 3MF6A 2A3YA 4QU1A 2VMIA 5DAVA 3X29B 3VBUA 1VR3A 3USUB 1WCSA 3FBYA 4XFIA 3EQEA 4AF9A 1G9BA 4YM3A 4JGYB 3H3LA 2D6OX 4L92A 3QH7A 4QQHA 3VZNA 4HBNA 2ADDA 3C3VA 3I3MA 4QGNA 4XC9A 5KXCA 4DXZA 1Q3EA 3KV9A 3HEIA 3ME2A 4QKBA 3GYDA 3N3HA 1LENA 2J7MA 2BVBA 4CCEA 1CPMA 4BQ3A 3ZFEA 2E9QA 2ERFA 1IPJA 4N7UA 4CDQA 3LQCA 5IFPA 1UAIA 2BUKA 3LEGA 3USUA 2D3SA 4AQTA 2EALA 1R081 1G9FA 1H0BA 2RDSA 5IFTA 2CL2A 2VOKA 4M3CB 5BNNB 3ACIA 1RHI1 5IHRA 3WF4A 4GWJA 3I59B 3ZSMA 2WWSA 3E6DA 3C7GA 5C6CA 5C5TA 1RHI3 4AZZA 2SBAA 1NXMA 2IFRA 1RUC1 4ASKA 1HRI2 3WF3A 4TWTA 2KD7A 2GAUA 2YZ4A 2ENRA 3AM2A 3NV4A 4XDOA 3PUQA 1GV9A 4AHZA 3AZZA 4F83A 1STMA 4MH0E 3J7HA 1RUC3 3ZR6A 5BNNA 4JKLA 2W92A 4FAGA 5A6YA 3GZUC 1DFQA 4QX8A 5A3NA 5B4NA 5FZBA 2P3KA 5J7MA 4KWKA 4L9BA 4LITA 3ZN6B 2GALA 1MZEA 2VXJA 3NVCA 2P34A 4QPGC 4DEQA 3AL5A 2ZGTA 1PK6B 1RTVA 4CUGA 2P6CA 1PMHX 5A6ZA 2IXIA 3KSCA 3J7LA 2ARBA 3GHNA 3JQWA 4B4QA 4B7EA 3VZJA 4RFRB 4JRAA 4LO6B 4NRQA 1WWYA 2VO5A 2PXJA 1R091 2BNMA 5A7WB 3EBRA 4FPGA 3AXEA 5FP7A 4KGGA 2E26A 5KXBA 2OS2A 3J7NA 3MUZ1 1HXS3 2OIIA 3ZN6A 4BM8A 1ND3C 3H50A 4YVWC 1R093 4CP1A 5HI0A 4YYOA 2XL7A 3LD8A 4XFBA 1Q8OA 4HG6B 2RV9A 5L9BA 2EIGA 3ITQA 1UW8A 1U5ZA 1ZA4A 3T4VA 4XFGA 4JC1A 1JZ4A 3OUJA 3KT7A 2A70A 1ENSA 3PJYA 3PIJA 1LESA 3WDVA 4FTEA 4M00A 2JDUA 2P2KA 2RS32 1UOBA 3WDTA 1W06A 4F7ZA 5FZCA 4BLJA 2OT7A 1H30A 1H1MA 5J09A 1GZ9A 2UY8A 1WUVA 1YFWA 4XZPA 1H2LA 4A7KA 2WFF1 4IE7A 5KHKA 1Z7S3 3C7HA 3L2HA 1T2XA 4MZUA 1VP6A 4XW3A 4CCMA 1H1IA 2R0HA 4DB5A 5F5AA 1X9TA 1SMVA 2WFF3 3MW2A 4GB31 3VKFC 4LNVA 3OSDA 4I01A 4QB2A 1GSLA 1QNWA 2EA7A 1W8TA 1YJKA 4XJAA 4D0QA 3MYXA 3PUAA 5DAQA 1VBA2 2VQUA 4GB33 4Q4V2 2VMCA 5GALA 2QQUA 3UJOA 3ROUA 3BVCA 2B4KA 3ZXAC 3QD6A 1PO11 1KJLA 4YWAA 1JYNA 2Y33A 1QIQA 1TEIA 1W9YA 5FTTC 3TAYA 5A70A 3BTXA 5E8AA 1HQNA 1PO13 2VUAA 3AKSA 3O12A 4J1WA 1W8OA 4Q4W2 2ZGMA 4P02B 3EHKA 4Y33A 2HYKA 2JB4A 4FOWA 5SV8A 5I0DA 2P3JA 1HRV3 2PHRA 4LHNA 3M70A 1LEDA 4M4PA 4CCCA 2VVDA 5IVJA 2JDMA 4F8AA 4CCJA 2O0OA 3K51A 5KC6A 1DGLA 4YM2A 4YZ5A 1RUH2 1YYNA 4AVVA 5F3IA 3DYPA 2QQVA 3K4DA 1FPN1 1BEV2 3VDDB 5JSPA 3U78A 4AVAA 4BIOA 3O1OA 3THPA 1GZCA 2V4VA 4P08A 4LMFA 1ZVFA 5EJ3A 3CHXA 4RYDA 2BBAA 4WVWA 3VKMA 2BFUS 3LB9A 1BVP1 4N7IA 5A7QA 1RUI1 4JHTA 3BTZA 1WMFA 5CB7A 5ANNA 1S0FA 2A75A 1RUI3 1Y43B 1QJEA 5K0UC 4P00B 4PBPA 5F5IA 1D4M1 3M3IA 4UFMA 1CAUA 3ALQA 4PDWA 4B7KA 2XR4A 5D1IA 5A33B 2P17A 4K21A 1SCSA 2C9KA 4QKDA 3RNSA 4O65A 1N1SA 2GH8A 3T1MA 1D4M3 1LU2A 3KT4A 1NZCA 2GN7A 3VBHA 1HN0A 4CCLA 3U4XA 1XE8A 4L97A 3BUCA 1GQPA 5FZGA 4UFIA 1O4TA 2ZOEB 3VBOC 2W3JA 1ZM1A 1OHFA 3N9MA 1CAVB 4YFWA 3PUIA 5FPVA 3C2UA 4ISQA 4CDXB 5GLUA 1UIKA 5A33A 5JSRA 1OMIA 3IDEA 3J8F1 2WFPA 1J3RA 4JV4A 4QDRA 2W1UA 1UCXA 1GANA 3MLKA 4XJZA 3J8F3 2O8QA 3ZX7A 3ZYBA 3UKVA 2WNUA 1ZA7A 2O14A 3IDAA 1OFNA 2VNVA 4YW5A 3TEXA 4JDNA 1LOBA 4CE8A 5HCAA 4KBZA 4LHKA 3KVBA 2PLV1 2FD8A 1I5ZA 2DWRA 1NG0A 2ILMA 1E5RA 2JD4A 1CZTA 3PIGA 4BQYA 2PLV3 3FLRA 4HFSA 2B45X 1DGWX 3BPZA 5DUXA 3BPSA 2WQ4A 4RGAA 2YY1A 4BQ1A 3LSEA 3S7IA 1YQ2A 1HQWA 4QAWA 1ENXA 3O5SA 4A4AA 3I49A 3ZLIA 3NL1A 1TMF2 2WNVC 1X82A 3ZVXA 2Q8EA 5A3UA 1K45A 4DFSA 5JMOA 2N7GA 1JYVA 3W5NA 1HV0A 3GGLA 4Y4YA 1W90A 4R52A 2W1QA 2Y0IA 5LA9A 5CFCB 1QQP1 3F95A 3S30A 1A3KA 2AZ5A 2YDEA 2OVUA 4GH4C 2DUPA 3JBG2 1RUF1 4IGQA 2HWD2 4CP9B 1XQNA 2BTVC 2FBEA 1RUF3 4CXYA 4DRRA 4HT1T 1C8M1 1O8SA 3CKHA 3RZHA 1U5YA 5FPLA 4E4ZA 2VJXA 5FZ4A 3NNFA 3FE5A 4Y1YA 1LAJA 1UMIA 1O3SA 4BB3A 1C8M3 1YQ5A 3BODA 3ZKUA 4UW5A 5BY5A 5KWRA 3POEA 2ORZA 1ZZ8A 5FY9A 4RL7A 4EWEA 1RVF2 3FHIB 2GNTA 3KCCA 1VB2A 2WR9A 3K77A 3P3PA 5L9VA 1QH7A 4WM8C 2JG8A 4E8DA 3WY6A 3ON7A 4CDUB 1AZDA 4Q8LA 4CZSA 3UNPA 2R16A 1GWMA 3LIHA 2NZ9A 1OT5A 2JD9A 3FUOA 3APBA 5IVBA 1B09A 3UKNA 1CPNA 1UU5A 4H55A 2B42B 4LTAA 3ZFGA 5DABA 1EV12 3QACA 4H2AA 2AEZA 5F3EA 5CG8A 3D8CA 5FPBA 4MGYE 1CZVA 5GZDA 2H6CA 1SBFA 4Q0UA 5FZ9A 1BYHA 2RMU1 3HN1A 4YVSB 5G05L 4GXLA 3GCXA 2XBO1 3IWZA 3OBRA 4MLOA 2VZRA 4C0BA 5LRSA 2A71A 2RMU3 3POWA 4IXLA 1QOOA 4NE9A 1IG0A 3MW3A 4CDWC 2XBO3 3UESA 3WNOA 1QJFA 5AFEA 1W6MA 3AK0A 4ATFA 5JIUA 1ZYBA 1HX6A 1EPZA 2A3WA 2WSUA 4S2FA 4TLFA 1H6YA 3RVHA 1MS9A 4AG4A 4XOGA 4LKFA 2LS6A 3E1F1 1JOPA 1OLQA 2DFBA 5A32A 2Q1ZB 4XTPA 1SDWA 5FP4A 1MZFA 3OD4A 4GQ7A 4OVEA 4QPIC 1NLSA 2Y38A 4XMIA 5CVRA 3RJ2X 3OBTA 1J3QA 4HK8A 3EB7A 1CQ9A 4YZ4A 1UY3A 2IVJA 2WT0A 1B35C 1COV1 2H0BA 4P9YA 4Z07A 1OPOA 3KGZA 4MGZE 1OVPA 3H1MA 4I2OA 3UGHA 5J37A 1O3QA 3T4HB 1COV3 3CJXA 3D82A 2R071 4LKSA 1XNCA 4XIOA 4AR2A 4I3GA 4EJRA 2Q1MA 2R49A 5JOYA 3MGUA 4LKDA 3RGBA 4I09A 5LBEA 2PHDA 3WDYA 2PA7A 2Y8KA 1JI6A 2GP3A 1LULA 5GM0A 1UX7A 3LPFA 4BQ5A 1JHNA 4YG0A 1SFYA 3ELNA 1CAXA 1NCRB 3H7JA 1HXS2 2IVIB 2HWC1 1QEXA 4H7LA 1KRIA 1AR72 1Q43A 1POV1 4CCNA 1GFF2 1TZOA 5FLHA 4H7MA 4KBBA 4A7ZA 3UGGA 5DUVA 2HWC3 1YQCA 4OYUA 2BGPA 1POV3 2DTYA 4JGZB 2D6MA 1GYKA 2VVFA 1PM7A 4W6WA 1AJKA 2WZPP 3H8OA 3T0BA 2VCBA 1NCQA 1BJQA 1NCRA 3OPZA 5D8AA 4C8DA 4NOTA 1DF0A 1SPPB 2DVFA 3URFA 1LGBA 2F6BA 1V0AA 4FPLA 3QOPA 3U0ZA 3PTRB 3DPRB 4XF0A 2DV9A 1UIJA 1Z7S2 1FMD2 3KV4A 2P1BA 1CAWB 1DLCA 2NYYA 4HVQA 5KC5A 1O4YA 3AKQA 4N43B 2A6WA 2W46A 2Z79A 4TN7A 2VU9A 4YZ2A 2K46A 3RZLA 5C70A 3AZXA 1DQ1A 2RJKA 4BU2A 4IERA 3FJSA 2PFWA 4LBMA 2DF7A 3NAPB 4K1ZA 1MZ6A 1OOPB 1H8TB 1A8DA 3TBDA 1PHMA 5DPNA 1F35A 5FY5A 1DHKB 2KXLA 1UN1A 2ZPXA 1RUG2 1KS4A 3B93A 4B1LA 5E6HA 3WR0A 4HVRA 3H3UA 4QXKA 2QQWA 2VUCA 5A3LA 4EWAA 2DUQA 4XF1A 5EXOA 1ASJ1 1MQTB 1W6QB 1LU1A 2J1RA 2XQRA 1HRV2 3POJA 1YUDA 3WW4A 3FZ3A 4KL1A 1MVEA 3NAPA 4NHMA 4LLOA 1ASJ3 4IQPA 3QH6A 4NJ4A 1RINA 4HETA 3I54A 4XBLA 4LT5A 3H1YA 1WMEA 3ZO0B 3C7FA 5C8CC 1RB8G 1MEC1 2YYOA 4COYA 1OFSA 5IVVA 1W6QA 5KXDA 1W6OA 4QU2A 4P9JA 3DYMA 5C3QA 2WQZC 1AVBA 3VV1A 5GLVA 4GAZA 5KXEA 3AMHA 4QXHA 5J48A 4D6SA 1FNZA 1MS5A 1TME2 4C0HA 1KDKA 3U11A 3RS6A 4DMIA 1TNRA 2G9ZA 3CBNA 1S55A 3I3BA 1I9RA 3MIHA 3N9OA 1XNKA 4B4RA 1SQ4A 5ABJA 2W52A 1SEFA 2EXHA 2VNOA 4XDPA 4DY3A 4QX7A 3CJIC 3CLPA 3DKWA 4G3YC 4NHLA 4WZFA 4A6OA 1H2KA 3AYCA 1VBB1 2YMZA 4NPMA 5F6LB 1PZ7A 2BJSA 1XYPA 1JOJA 4XXPA 4LA3A 1S0EA 1VBB3 1APNA 1ULOA 1QNYA 1JHJA 1WLTA 1QJY1 5FUNA 4EN9B 2Q30A 3WXPA 4YFZA 4HONA 5GLZA 3RSJA 3RMXA 3A21A 2RVAA 1L7QA 1MS0A 5I91A 2C6SA 1W03A 3KV6A 4OFGA 1YFYA 4X8NA 1QOSA 3H8RA 1QJY3 3VKOA 1IS5A 5CKMA 3W20A 5FYYA 2CV6A 3UGFA 3H8XA 2VCCA 1UMZA 3OGGA 3V0BA 3NJXA 4LBKA 4XUQA 4LXLA 2I2SA 4JTOA 4Q29A 2AH2A 3KWVA 4NIGA 3SMHA 2D5HA 4LO5B 3LEMA 3TN91 3MUY1 4UFHA 4CP2A 3EO6A 1AR81 3R4SA 1HDKA 1N1VA 2UYAA 3TN93 5DAPA 1W8HA 1AR83 4IV3C 4ZZ8A 3ZYPA 5M0TA 1PGW1 4YM1A 1JS9A 5FMBA 1AL21 3GHMA 2WZR2 4YG3A 4CYDA 1KQRA 1PGL2 5FYBA 2VECA 4NR1A 1AL23 2EICA 2XUMA 4QM9A 2Z5WA 3JXSA 5CFDA 1YI9A 1ZRCA 1LHNA 1MS4A 4FQZA 2ZMKA 1W0OA 2JDYA 3A4UA 4KWLA 5L7OB 5I93A 3JCIA 4ASLA 5FPZA 5C33A 4XURA 4Y3OA 3ACLA 3WVJA 1LODA 2QNKA 3VBRA 3E6BA 2BZDA 1NE6A 3UL2A 5C3OA 1DG6A 2XJSA 5FP8A 5C9AC 4XUPA 1V6OA 4LBQD 3N35A 1VPHA 1D4VB 1VBD2 2ES3A 2ORXA 2ZEXA 5DAXA 2WT1A 3CDZB 5T50A 4AFMA 3DYOA 3MIFA 5FK8A 5L7OA 5BPXA 2X5IB 1K12A 1RUE3 1FOD1 2QQJA 4TLGA 2JWPA 5FO8B 3AZYA 3DXTA 2A5ZA 5C3SA 3PUSA 1FOD3 5FZ3A 5J3UA 1GU3A 1MR5A 4AFDA 1R64A 3WG2A 5FZ1A 2BU9A 3I2HA 3ZFFB 2Y26A 1O8PA 4FSJA 3AP4A 4Q26A 4XE9A 3KHBA 1N1TA 3R05A 3LWCA 3JB8A 4IEUA 4KGQA 2X5IA 2ATFA 1K5MB 1Q56A 1UY2A 3KZ4C 5JR7B 2QUOA 5FY7A 5BNOA 4QX1A 1R1A1 4RR3C 4C90A 2R061 2Q8CA 4DIQA 4RS5B 4DY5A 3OYWB 3O0VA 2J22A 3ZFFA 1R1A3 1SLIA 1VMHA 2CSGA 2R063 1YNAA 5LBBA 1EPWA 4DUWA 2V09A 1JZ5A 4LUKA 2RJLA 5FBJA 4ZU7A 1RMU2 5FAXA 4AVTA 4AHXA 3OB8A 4ZU5A 1Q8QA 5IK5A 1LHWA 3OYWA 2ZBJA 1Z0HA 1OF3A 1LOGA 3I2JA 2YBPA 1KDMA 3HMYA 5HCFA 3RG0A 4GKYA 1DLLA 2AREA 1VMJA 2JB8A 4DEVA 4E4SA 4Q5OA 5I8YA 3OY8B 1HB4A 3PTYA 5HPOA 4PLNA 3BYWA 2B7YA 4WVMB 4BXSV 1LHOA 2TNFA 3OG2A 2HH9A 3ZSJA 3ZSLA 4XFFA 1GOHA 2XOMA 4IE0A 3H7YA 4PJYA 1IOAA 1XU2A 5FZDA 4GMP0 3VKNA 1OVSA 3KV5A 4FPJA 4AAPA 1L3JA 2MHFA 1KXGA 1NQDA 3BGAA 2VZOA 1ACCA 4IV1C 3A0NA 1NOVA 4GWNA 4NWWA 5FREA 5FJHA 5LASA 4CTEA 5JWPA 3V0AA 3POSA 4BQ4A 2X09A 3AC0A 4WVMA 2VTXA 4AWDA 4A45A 4WV8A 4TZDA 1J84A 4EZHA 2XXZA 2KM2A 3ZR5A 5LEJA 1SCRA 1W6NB 2VZUA 1OD5A 3SISA 4YSFA 3DN7A 3IAPA 3K2OA 5EWSA 3WINE 2R042 3GDBA 5FR3A 4QX5A 1XNTA 3SLIA 1FX5A 1PZ9A 4KI5M 1QU0A 2OQ6A 3UK9A 1FATA 4UT5A 4OQ8A 4JHZA 3VBUB 3AP6A 4LR4A 4K6BA 1WD3A 2J1VA 2FDGA 3GZEA 2VC9A 3RI8A 4LO4B 3BTAA 1LHVA 4P9WA 3BALA 4M0HA 4EE2A 4XF9A 2EAKA 1W6PB 3A0KA 3ZIWA 2DU0A 3WOGA 1ND3A 4N9HA 4FAHA 2MNGA 4YVWA 3AYDA 4ZXEA 4YGBA 2G4IA 3ZFEB 3I3EA 4FI9A 2WQ8A 3ZYIB 4CDQB 5BUVA 2JG9B 3NKTA 1OXCA 2WS92 2XL9A 5SV5A 2AUYA 2NMNA 4LJHA 4IEVA 4MGQA 2NLRA 1QH6A 3AP5A 4UWDA 1C28A 4QM8A 3WDWA 1W6PA 1X36A 4RHV2 1JH5A 1RITA 1PVC2 3RYPA 1E5SA 4BIFA 3N36A 1LOCA 1H6XA 2BOIA 1ZZBA 4DXRA 4EN0A 2DUOA 2QBXA 2JG9A 4KU8A 2QDNA 4ES9A 1S0IA 4Y1XA 4LBLA 2VZ1A 5LBFA 4FO9A 3INAA 2RS52 1AYN2 2WDBA 4PIZA 2XHNA 2ZMLA 2VM9A 2OPWA 3Q8FA 1R083 1PM4A 3D0JA 3I2KA 2VMHA 1YFUA 1DGRA 3Q9OA 4IUGA 4PBOA 3TRSB 2Z69A 1UO9A 1ND2C 5IAXA 3P3NA 3JD71 2QQLA 1AL0G 4IE4A 5IJRA 1EY2A 1O4ZA 1WW4A 3CL1A 1JYIA 3AKRA 1HJGA 4UW6A 3R6SA 2FZ1A 1BBT2 4QDQA 3JD73 4IGOA 2VNGA 1GICA 4F3JA 5JI9A 1MS1A 1QJX2 3DUIA 1AJOA 1S0CA 4MHRA 3T2OA 3SNMA 4HKLA 2A6XA 5FZIA 1N3QA 1N3OA 3J4UH 4AFAA 3S7EA 1W9WA 1Y9QA 1ODNA 1YFXA 4K7JA 4A3ZA 4QB6A 4OHYA 1KITA 5BXXA 2Z42A 4EYUA 1W2OA 3SEEA 4YW4A 3DF0A 1IPKA 2OZJA 3S6PA 1QWRA 4CCDA 1U5IA 4BYYA 5F5CA 2VR4A 1VBC2 2WNOA 3FBMA 3HNYM 3LZZA 3LCPA 1XC6A 1WD4A 3GM8A 3PVBB 2ZHMA 2B9UA 2I45A 1OD3A 2WBKA 1LNSA 4HLTA 4NHKA 5JUVA 1CIWA 1V6NA 3ZDVA 1HB1A 5AC91 2VW1A 3MIBA 3U37A 1MZ5A 2VTXJ 4D3WA 1ULDA 2W08A 5E88A 5E89A 4CEYC 2LTNA 3HT2A 4GALA 1QOTA 5IYYA 2WAAA 2XJUA 1L7RA 4IEQA 4XHBA 3WT3A 4TSVA 1NA1C 5C4WC 1RXFA 2IZWA 3SKJE 3I4IA 4HOOA 2NN8A 5KHIA 1DCSA 4LHSA 3SKVA 2YPJA 4XBQA 3E5XA 4J6GA 5IK7A 2Z2SB 3VBOA 5FKBA 1XRUA 2XQXA 3PU3A 2B5HA 2LALA 4BOWA 2SLIA 2Q5TA 3FHQA 4AEKA 1YHFA 3OGRA 5IK4A 1QMJA 5TSWA 2GC1A 4XXAA 2ZX2A 5FZ8A 1FXZA 1OLMA 1UL9A 1ULCA 3I97A 3V64A 3GBWA 3SH3A 1VAVA 3T0AA 2NP0A 1ZBE2 4MXVA 4XFCA 2FMDA 4LBNA 1SFNA 3ZYRA 4AEJA 1YO8A 5GZCA 4N90A 4FOVA 2B8MA 2VBBA 4WZCA 2HWE2 4XAEA 1S1AA 3I2IA 3O1SA 4AEDB 1FI2A 5ACA1 3AMNA 3SCGA 1QJU1 4JGYC 3ZMNA 1SLCA 1CJPA 1F9KA 2VQAA 4MVTA 1J59A 1ULGA 4Q0QA 3A7QA 5H9RA 3M8LA 1HV1A 4I0BA 2WNVA 4XF4A 2OQ7A 5ACA3 5JDBA 4Q0PA 1QJU3 5FWEA 2WLQA 1O59A 3WD5A 1RUD2 4H14A 1RUE2 3KF5A 1I1EA 1XE0A 3IIIA 3VD5A 3R4DB 2YU1A 4XACA 4CEWC 1OA2A 1S0GA 1CAUB 4PDWB 4AQSA 3WW1A 4AEDA 5BNNC 2ZGPA 3HR9A 2K9ZA 1SLTA 2PHUA 4GH4A 1FPN3 4LBOA 1UOFA 1VJ2A 3HVDA 4KG8A 2WJSA 4UAPA 4HL0A 2Q1FA 2XGXA 4Y1UA 3VBHB 2HWB2 1C3HA 2KA3A 1TE1B 2WIIB 2W1WA 4JDOA 4NVPA 5FXZA 5FXWA 2Q8DA 4A42A 5CISA 1HLCA 4DUVA 1V9U2 2L9LA 4O7XA 3RFRA 3VHNA 1RUJ1 4V2WA 4D8MA 5A7PA 4DXTA 1JZ2A 4GKXA 3WHUA 2YG0A 4KNCA 4RA0A 3LE0A 2Y6JA 1UNBA 4OHVA 2B46X 1RUJ3 5I0UA 3IPVA 1UPSA 1TNFA 1LB2A 4D69A 2UWCA 1UZZA 1W2NA 1O5LA 3B69A 3FWEA 3GZAA 2YUEA 5D21A 1JXNA 2WNUB 4P9GA 3WQBA 2NQYA 5FZ6A 2RS12 5IVYA 2ZKLA 3ZKYA 2D7FA 1PK6C 4ZS2A 4AI3A 4IEOA 5L9RA 4LO7A 3OCPA 3BOWA 4E9KA 4ZHNA 5CYYA 2PAMA 4U36A 5FP3A 1C8NA 2NM1A 2WO2A 4LBQB 4RN5A 4X8PA 4UFLA 1N3PA 4YGCA 5JOZA 3IT8A 3HNMA 2VY0A 4CCOA 2RM22 3OUIA 2WLPA 5JCTA 4YW7A 3E97A 4EN6B 5FWJA 2ZAAA 2GC3A 1ZREA 1LRHA 4BMEA 5FQ0A 5BYNA 3O1UA 3H0OA 4OMDA 1WCKA 1UOGA 4DRVA 2AGSA 4XAAA 2GNDA 2P3IA 4WM7B 5F1RA 4XIKA 5DDJ2 4CUCA 5FZOB 2Y34A 4QHZA 3J9SA 4TYSA 5LWBA 4FFIA 2PMWB 3OJBA 4LBQA 4PIYA 4CDWA 2FDFA 2D93A 3PVNA 3OTFA 1OQEA 4EV0A 3B94A 3NW4A 4NO4A 1VBE1 4W8JA 1UZYA 3EJKA 4NN0A 4HKWA 2MEV1 2WAOA 3W9AA 1I3HA 1OF4A 2Y6FA 3BKZA 1VBE3 4LK6A 3MICA 4WM7A 2GU9A 1WW7A 2XKPA 2Y64A 1AXKA 4XUNA 5FZOA 2DVAA 2MEV3 5A3OA 1PIV1 2WKKA 2VPVA 2ETEA 1QQP3 1C57A 1CESA 5IWFA 1UY0A 3O1VA 3TEWA 5LA1A 1PIV3 4CU7A 1AR91 3N7LA 2WO3A 1WKYA 1B35A 1PO21 3P5BA 4PIXA 5CU1A 4AQ6A 3LOBA 5A1AA 2JG8B 2WN3A 5JPMB 1AR93 3HQXA 3LA3A 4OULA 1GP5A 1EAH1 1GZWA 2AYHA 5FUIA 3SH4A 1PO23 4A41A 2RG4A 2QQKA 2JEMA 2UURA 2WA3A 4Q4X1 4LBJA 3ZFGB 3ACGA 1EAH3 4Y5TA 3VL8A 4Q8KA 1BMV2 1IS3A 4W4ZA 2D5FA 5FMCA 4Q4X3 2A6ZA 4XJ8A 2XG3A 4V2VA 1EUTA 1NXD1 1WGPA 3PLQA 2CGOA 2ZGUA 4YM0A 2ZJCA 2VOTA 2PELA 5K8SA 5FZFA 1ZBA2 2D97A 1UU4A 1F4HA 1JUIA 3NNMA 2X05A 1MS8A 3VDDC 1NY72 1F2NA 3L2YA 1K42A 3TNPB 1LGNA 1VRH1 1SLLA 1VRBA 1W6MB 4NROA 1Q8VA 5EP9A 5EV7A 4FPEA 4AI1A 3RRDA 1VB4A 1VRH3 2R30A 3M3EA 1PZ8A 4QGMA 4LK7A 1NZIA 1S0JA 3VUOA 3ZSEA 1D2QA 2J1AA 2V5YA 3E5QA 1YIPA 1MPXA 4RQPB 5A32B 2WT2A 1DZTA 2P37A 1LR5A 4BCUA 4YLZA 1PNFA 1UMHA 1JN2P 1F5FA 4Q1RA 2B39A 3LA2A 2ZZJA 2G9GA 3RYKA 1WLCA 1NKGA 3WP5A 4JAAA 1AR61 4BK5A 3NSTA 1R082 1V6LA 5DUWA 5B2GB 5I8SA 2F17A 3U14A 1AYM1 2D3PA 1RHI2 1RL3A 4I3PA 4B29A 1Q8PA 1V00A 4RQPA 2VG9A 3MHZA 3WNKA 2HEWF 3O1TA 5GZFA 2VD7A 3RYRA 1LTEA 5E1RA 1WCQA 3GXUA 3HBZA 4FXGB 4CDXC 3H1WA 1WW6A 4ZPIA 1REEA 1RUC2 4CXWA 4XZUG 2EXKA 1TG7A 4PF1A 2PHXA 5FPXA 1FYUA 1CAXB 4LPLA 4XHXA 5I0SA 3OPWA 1CIYA 4XCAA 1ZZ7A 4GIQA 4EROA 2R6QA 3KS7A 3RZJA 1XU1A 4Y24A 2YBKA 4FBFA 3POFA 1JOBA 1NLRA 4META 3FMGA 4KWUA 2R073 4FOQA 4IE6A 5FBZA 2XVGA 3POIA 1NX9A 3ZXGA 4MGSA 2RR11 2GZWA 3K3NA 1EP0A 4OI4A 4MYEA 4Y22B 1NCQB 2FMYA 3T2QA 3I3QA 3AXDA 2CYFA 4S2GA 3ZYHA 4XYXA 5D8AB 3ZPYA 4NAOA 2CAUA 5JZGC 1A34A 3M4FA 1TQ5A 1RC6A 1R092 1E5HA 4HN0A 3AZWA 4HVOA 3GF6A 2GMEA 2JDZA 3B5LB 2V4AA 3OGJA 4BE3A 4DINB 5CFCC 2XPJA 2XLAA 2CGPA 2R0FA 1RJ7A 1GKBA 2QJVA 3ZXDA 2ARXA 5FZHA 4GZ9A 4AFBA 1C5HA 3IAQA 1MS3A 2VZTA 2E31A 2HLEA 3AKTA 3AL6A 4QQ2A 4Y1ZA 5LB6A 2PAEA 5LY2A 1UF2C 2ZZQA 4Y22A 3SCHA 4AE2A 2BYVE 3ZYJB 2XDVA 2KR2A 3MIGA 1GR3A 4M01A 2UYBA 4ZS3A 5FJKA 3ZSKA 5C71A 5GZGA 1ZRDA 4JKKA 1HN1A 4KU7A 2JXAA 3GJAA 4COZA 3CJIA 5FYIA 3N7MA 1J3PA 1MACA 4OUEA 3G6JB 4XFAA 2A7AA 2IXHA 5JXIA 5FZKA 2WFF2 3THTA 2HKXA 3M1HA 4BMBA 3FUQA 2ZHKA 1ULFA 3D4KA 1K3IA 2ZS6B 4GB32 3LFMA 4KQ7A 1H2NA 3HD8B 5JLVA 4AI9A 2YXSA 2QQMA 3CMGA 2WINB 4UFJA 1YQ8A 2JDKA 3I2DA 4CDUC 5FIXA 2BP6A 5GJ6A 2CHHA 4K3UA 4ZONA 1DQ5A 4NRPA 3LF7A 1UKRA 5CADA 2HBUA 5HV4A 1PO12 1QGLA 1U5XA 3KCXA 2PHLA 1LKNA 5A7OA 3MLLA 5JMCA 3ZOIA 1DQ4A 5APAA 1GOFA 2JE9A 1W6OB 1O91A 1W8FA 4P5HA 3T3YA 4CP0A 4YVSC 1LECA 4IV3A 5KBFA 2C1FA 1JW6A 3IMNA 3VD9A 3HIFA 4ZU4A 2HYXA 2LM3A 2WUHA 2E63A 5A3MA 1GWLA 3NV2A 4N53B 5FZ7A 2PAKA 4COVA 5C3PA 5EPAA 2GNMA 2V73A 3KQ4B 1FPN2 4XVHA 5FMOS 3U10A 2WA4A 1XSQA 4MV2A 5DXDA 5ABJB 4XCBA 3I2OA 3GBGA 4Y26A 1MEC3 1WBFA 3VBSB 1W3XA 2QFEA 3S0MA 3FFZA 1I5PA 4O61A 3GJBA 5L73A 5JR2A 1OLME 3AJZA 1RUI2 4N53A 2I07B 2H0VA 1UZVA 2P3YA 3PVEA 3RZZA 4YNIA 2E32A 3DGTA 2CNAA 5FZ0A 5FO9B 4YW3A 1D4M2 1HRI1 5C9AA 1ZRFA 2BEOA 4NIHA 2J42A 3VBSA 1HRI3 1SG3A 2VBPA 5C8CA 2ID4A 4L2NA 4FP2A 3AVRA 1BKZA 3OEAA 5JOWA 3V0BB 4NPRA 3EMRA 2QQPA 2ET1A 4I30A 1CD3G 1WA4A 4NUBA 4YZ1A 4FTBA 2VZVA 1QY4A 4M4RA 1VALA 2GMPA 2WN2A 3BB6A 3H8UA 3IDCB 3KMHA 4GMP1 4GWMA 5FCCA 5IUQA 3VZKA 3LOIA 4AI2A 1WLWA 1QKQA 3J8F2 4AHWA 5C8WA 2OXBA 3FLPA 4Q4Y1 5AVPA 1XBFA 2G1MA 1XXNA 1WCUA 2VQTA 4OMCA 4YZ3A 4AK3A 4ATEA 2YB7A 4Q4Y3 2Y6KA 2BGOA 1DU3D 2OUHA 3AYEA 4YW2A 1J1TA 4JGZC 5FKCA 4XILA 2VGDA 1JU4A 3VD4A 4RR3A 2PLV2 1JU3A 2HBTA 2YC4A 3KD4A 1F5JA 1PX4A 3MBWA 4X6RB 5CFDB 4AI0A 5HXMA 3W21A 2A6VA 1WBLA 1IQDC 4NWVA 3C7OA 1VIWB 1UOJA 2P5BA 1UPIA 3KF3A 2YFUA 3U4SA 3ACFA 4Y20A 1GP4A 1OBNA 5T54A 4NPLA 4PI0A 5FZEA 1XOYA 4AYUA 3DPRC 1XE7A 1SBEA 1PNGA 1OSGA 2RS31 1AXZA 1H4GA 4JVAA 3VBRB 2OKXA 3UT0A 2C9AA 4QWNA 4GJZA 2FDIA 4N43C 1QQP2 4RGGA 2RS33 3PUHA 4AVSA 4G4FA 2BV4A 2WYFA 1RUF2 3S5QA 5EFUA 2J1UA 4KMQA 3DXUA 5BNPB 5CAZA 3R0RA 1US2A 4E27A 1POV0 3O0WA 4ORFA 4XUTA 3NAPC 2A1XA 2JE7A 4UI9L 1OOPC 1H8TC 1C8M2 3AVSA 3NRUA 1LCLA 1WZXA 3GBFA 1VBA1 4Q4V1 2Q4SA 5FZLA 5C3RA 2GDFA 1OUXA 2FDKA 4UF0B 1NLQA 2FCVA 3KB5A 1JODA 1VBA3 4Q4V3 4A6SA 1MQTC 4UYBA 3TYJA 4IV1A 4O9EA 3IIAA 4XQWA 5BNPA 3CEWA 5HCBA 1DGWA 3NJZA 3PU8A 4Q4W1 3ZMOA 3SITA 4AGVA 4QKNA 5BNOB 5LK7B 1H8VA 1SFPA 2GH2A 4Q4W3 2DBNA 1W0NA 2DCTA 2VMGA 5F2SA 2WYSA 4I0WB 4UF0A 3RWKX 2C26A 2RDQA 1HB3A 4AVBA 3ATGA 3ILFA 3NNGA 1RUH1 4L8QA 1W8WA 4CPBD 3H9AA 1W2UA 4Q1PA 1BVVA 2ET7A 1CX4A 3QCWA 4ONUA 1BEV1 4HSLA 3LA7A 2VQ0A 1W05A 1RUH3 3Q8EA 1X33A 3VBFB 2CGNA 3BI3A 4BA6A 1RGSA 2VMDA 1BK1A 5IW0A 1BEV3 3WUDA 3AYAA 3OBAA 1RXGA 2PHTA 2RMU2 4JRLA 4R4XA 2LRPA 2XBO2 2ZX0A 2QQIA 4OI1A 2VUDA 2ZX4A 3POYA 5F32A 1LEMA 5BV6A 5A1FA 3K75B 2VCMA 3HPNA 4YARA 5EYYA 4CVUA 4K8FA 4LIVA 1JUHA 2BW8A 2ARAA 2ZHLA 5GZEA 4IGPA 4PI2A 3VHPA 4R9AA 1DYOA 3NWKA 3N7KA 3VBFA 4KWJA 1OKQA 1Q8SA 2W39A 4M3CF 1T6GC 4MXWA 2JECA 1GLHA 3B7MA 3BN6A 3WEZA 2VULA 2YROA 3DV8A 4NHXA 1UZWA 3JUUA 5FZMA 5EIYB 1OH3A 4OHXA 3HBKA 3V0AB 2ARCA 1ND2B 5F6KA 4LE4A 1UXZA 5LA0A 4JQTA 3HAGA 1UQXA 1OA4A 1WA6X 4LE3A 1COV2 1URXA 2CY6A 5FYSA 3BTYA 3BU0A 4Z2WA 3NNJA 2GC2A 2VOWA 3NV1A 4XETA 4EWDA 3VD7A 4CSWA 2FCTA 2R072 4QX0A 3CIHA 3ZIXA 2C4XA 5IVCA 3EYPA 1O7FA 3CU7A 2TEPA 4Z1VA 1ND2A 1YXWA 2XJTA 4QPGB 3MI8A 4FXKB 5FFOC 4QT6A 3VDCA 4NHYA 5KR7A 2JDNA 2HWC2 2IXLA 3LKJA 2QDRA 1OUSA 1TMF1 4BPZA 2UWAA 4HXCA 5CA6A 5J1XA 3VD3A 1LOFC 4AEMA 2YHJA 5FOBB 2HWF1 5JAXA 1UY1A 2CWMA 2P6HA 1TMF3 4XTMA 2A3XA 3IBMA 1ND3B 4QPGA 2HWF3 5DZGA 4YVWB 5CBLA 3O1MA 1A78A 2VXRA 2VW2A 3JBG1 2HWD1 2XHKA 2NPIA 4C1XA 4MOAA 4HPKA 1F31A 3B9IA 1DBNA 3JBG3 2HWD3 3WNPA 3K4AA 2B9VA 3P1IA 1HQLA 1IKPA 1NUKA 5T3NA 1CONA 4W6XA 3D6EA 1FV2A 2A6YA 4CUAA 4E2QA 5F7UA 3GZTB 1GOGA 2IXKA 1JBCA 4QHBA 2JE8A 2FQPA 4E4HA 3WQ1A 4D7SA 1GP6A 1H2MA 3F2ZA 4ARXA 2W47A 4EN7B 1W2AX 1RVF1 2E6VA 4PLOA 5KHJA 4R4ZA 1LJ7A 2DVGA 1SLBA 4AQ2A 5CIRA 3GNEA 5T5PA 5AVAA 4BISA 1RVF3 3ZFFC 1QHDA 5T5LA 2VE1A 5C4WA 1NE4A 3GCWA 2DCYA 3K48A 2QKDA 4QDSA 4COWA 2E51A 4LORA 1K5MC 1BK0A 4E2SA 5FY8A 2ZGOA 1Q5OA 1ASJ2 2VBDA 1EV11 1AUYA 4D6QA 2YC0A 3JZVA 5H9SA 5IVEA 1Y3TA 3KM5A 4FFGA 4K1YA 3B01A 2BVVA 3D3AA 4RS5C 5CKNA 4JX0A 3VHRA 2CAVA 1D0HA 1EV13 3DECA 2TBVA 4RSUA 1VAKA 1GQGA 1FV3A 3WNLA 4AXOA 2PQQA 1EYBA 3FC0A 5FPAA 1XSRA 3HWJA 4COUA 3ZPOA 1QF3A 1MEC2 2FZ2A 5K4LA 2X10A 2W2IA 3KHCA 1L7LA 4G9SB 4BQ2A 4K20A 4Z82A 2XB6C 1S2BA 4HN1A 4I0AA 4DZGA 4LOSA 4BJ0A 3EXUA 5HXVA 3ENRA 3UKTA 2PYTA 4DXSA 3T30A 4DS0A 4JGYA 5FPUA 2RJ2A 1W39A 2VZ3A 4IW3A 3WNNA 4BK4A 2LW8A 4MADA 2V5DA 2EXJA 1IHMA 3ASIA 4R9BA 1Y9MA 3POBA 3MIEA 2JIJA 1YIFA 1UKGA 1JZ7A 3ZN4A 4CEWA 5K0UB 5DG2A 1O6UA 2VMFA 5C5UA 1UYPA 4M3CA 1XYNA 3VGIA 4IE5A 2BGCA 3AP7A 4LLFA 1XPWA 1VBB2 4PCRA 3I59A 5GKAC 5FMDA 2W68A 2FDJA 1KS5A 4YW1A 1NAEA 1BHGA 2ZEWA 1E57A 2WWJA 1BQPA 1N1YA 2ZA9A 1QXJA 5EJ1B 3VBOB 3M3QA 5AC93 1QJY2 1QDCA 2Y60A 5T55A 1U12A 3RDIA 3UETA 4Q4Y2 5K0UA 4HMZA 4XABA 4S2HA 3V56A 5JPNB 3LGRA 1DQ2A 1ULEA 3UJQA 1HXS1 4OCTA 1AR71 3IMMA 3M7AA 4UBHA 3JQXA 1V6IA 3M3CA 4D6RA 4FOYA 4FFFA 3KLSA 4ISRA 5FXVA 4MGIE 1LHUA 2WL1A 1AR73 3TN92 3S57A 1AR82 1D7PM 1PK6A 1SACA 3A22A 2QTWB 1RIRA 5FYUA 2BRTA 2HJIA 2OYZA 3VBUC 3WW2A 2ZGKA 4AGGA 2DFCA 2BBVA 2E53A 2D6PA 4XPVA 5IT6A 2IXCA 4BZ4A 3I3DA 5IVFA 1GZTA 4OLLA 1NT0A 1OI6A 3MIDA 1PGW2 3NMBA 4HK9A 3VB9A 3WCRA 1AL22 2ADEA 5A7WA 4JCKA 3PMSA 5LA2A 2IC1A 3N9QA 1W28A 3MFAA 2WNVB 4WBBA 5DZEA 3ZXLA 3ABZA 3WP3A 2EIDA 3WNXA 1Z7S1 2GN3A 1FMD1 3ZFEC 3MV11 1TVGA 4CDQC 5JXJA 2JIGA 2JG9C 1G9DA 4ASMB 3D0SA 5ERLA 2W87A 4FPHA 1FMD3 2YGMA 4LKEA 4BH9A 5IK8A 4GH4B 1H1AA 2O1QA 4YW6A 4WVVA 2AR6A 4PQQA 3I7DA 1UY4A 1F8VA 1V6KA 5J98B 2VAUA 1E5IA 1ZZCA 1XB9A 1JMUB 1YJLA 1IGOA 1QDOA 2XJQA 1RUG1 2WO1A 2ZABA 3AFGA 4ZY9A 4XEZA 4Q0SA 2VTFA 1X8MA 3ZM8A 1RUG3 5FO7B 1FOD2 1T6BX 1YQ6A 3SXWA 3IPVB 1HRV1 1AHSA 5A3PA 1D0GA 2WRAA 4NRMA 4QQLA 2JDAA 3MDPA 2W5FA 2CWSA 2CU5A 5FOJB 4INDA 1X50A 3AMMA 4OZOA 4WM8B 4QXCA 1OA3A 3KCYA 4FPOB 1X7NA 3OD0A 3LSDA 2OPKA 5LZ6A 1IG3A 4MO3M 2MPFA 4QB1A 3MW4A 1OKOA 2XWJB 1R1A2 4UOJA 3VHOA 2GC0A 2R062 4JZRA 1HKDA 2XLFA 1LGCA 2ZTNA 5FQ0B 1WW5A 4WM8A 5JXHA 1TME1 4L0PA 4XFHA 1RUNA 1IZ3A 1UWWA 3O7OA 1U0AA 4RFT0 3FFQA 3P6BA 2Y6LA 1TME3 2QCSB 2Y6HA 3VDDA 4Z8BA 1PX3A 5CNAA 2C5DA 1W99A 4W6YA 3T2PA 3ZYFA 4IL7A 4Y5Z0 4CDWB 1ENRA 5FYMA 2GMMA 1SDDB 3KVAA 3AB0A 3ZXKA 3DCQA 3PMEA 5FYZA 3LPGA 3USSA 1WCDJ 4A3XA 3RZGA 1A6CA 4MX3A 4OHZA 2OW4A 4MSVA 3DKQA 1F15A 5FMOL 4QQOA 4MG2A 2AENA 1PGSA 1UZ0A 1G86A 1A8MA 4XMAA 4QPIB 4ARYA 1UYZA 5F5QA 2IFWA 2A73B 2X53S 3A23A 4OHWA 2UU8A 1HW5A 4R8HA 5FP9A 2ZEYA 2CTVA 2ZMNA 2XLGA 4AGRA 1B35B 1M4WA 4YPJA 3MF9A 4IETA 4D94A 2ZCWA 2QZ3A 5DN2A 1PMJX 1G6NA 1GZWB 2EVXA 5D2AA 1S0BA 1CAVA 1LOAA 1G7YA 2WC2A 4QD2A 1VMFA 5LK5A 1SLAA 3WLUA 2QVSB 4DOUA 1Y4WA 1ULPA 4QPIA 4CDXA 2EF6A 1Y9GA 3POGA 4YGEA 5KHHA 5HCHA 2DCJA 3LEIA 4CPBA 2OZ6A 2E7AA 2XONA 2ZGLA 4URTA 3WDXA 1C1FA 2ZACA 4A7YA 1QXPA 2WZR1 3PL0A 1HIXA 1PGL1 5JZGB 3CF6E 2HWF2 4HSJA 3UYJA 5FYCA 3T2TA 3SC7X 4A44A 2WZR3 1YI7A 2AEYA 3WHTA 1AX0A 2JKXA 1DYPA 2D43A 4AEDC 1ALYA 5L36A 2W0XA 5DUUA 1MVQA 1KEXA 3B3QE 3TNQA 3G7DA 4AAXA 2ZGRA 3B00A 5DQ0A 4CXXA 5E16A 4ES8A 5JZGA 1UXXX 2G19A 1X8EA 3ECQA 1ENQA 3SEPA 4SLIA 1C5IA 5CFCA 2J1SA 3RI9A 2QQOA 2GP5A 2UWBA 4LUMA 4CCKA 3RWNA 4PDWC 3MPPG 3VDBA 2DCZA 4LEJA 1BLZA 3ZXJA 1VBD1 2RHPA 1RYYA 3CNAA 3THDA 4CP9A 5FDBA 5JSOA 3IB3A 4AVCA 1YLLA 3WF0A 3ES1A 4D7YA 3VBHC 3WP4A 1KGYA 1RUOA 1VBD3 3C7EA 1OPMA 4CA9A 4EQVA 2Y6GA 5FUPA 2VW0A 3WG4A 4BHPA 2BPA2 5F8PA 2Q8OA 1ZRRA 1DQ6A 2F4PA 4PF5A 3WDUA 3K3OA 5K7PA 3IKWA 4KG0A 4M0NA 2JDPA 4RD7A 3AX4A 3B02A 3E5UA 3N4MA 1NYWA 3HQUA 4Q0VA 2F4LA 1I6XA 3QLQA 4IEWA 4QPWA 4YGDA 3LEKA 3NJYA 1IQAA 2WNUC 5I8TA 5L19A 1AR63 3GALA 4DO0A 1O3RA 3OGSA 5I0RA 4URAA 4Z2AA 5FLIA 2J1EA 4SBVA 1XNDA 4FQ4A 4CDUA 1F4AA 1AYM3 3BCWA 4JQRA 3JD72 3WQ0A 2XJVA 2WABA 3H42B 1ZX5A 2C0ZA 4WVZA 3T0DA 2NMOA 2XMLA 3IZOA 3LIGA 4OI0A 5J96B 5C8CB 3UV9A 1DGRN 2IUWA 4QX3A 5KHGA 1RMU1 3BIWE 4XQDA 4B1MA 3S5AA 5FY0A 2DURA 3TEYA 2DYCA 1RMU3 4W50A 4YVSA 4HKOA 4WM7C 3N9NA 3BIEA 3O1RA 4Q2FA 2D6LX 4NIAA 1YWKA 4Q27A 3HT1A 1S0DA 4PHZA 3RZMA 5FYHA 3ZN5A 3AMPA 3FL7A 1C1LA 2VUJA 3PJQA 3CZJA 3T09A 4P9LA 2PQSA 5IATA 1BZWA 2RR13 2YV8A 1OH4A 5T5OA 3LDBA 3FHAA 4QGLA 5H9QA 2DDUA 3CJIB 3ZYGA 2W9XA 4GA9A 4QHOA 2JDHA 5FV3A 5AC92 5CEHA 4E4DX 2AC1A 1BCXA 2ZX3A 1VLNA 3WV6A 1JYTA 4NIDA 3AKPA 1D2SA 2ZGNA 2ZXQA 3IN9A 4YG6A 5DAWA 5GLWA 3J7MA 2VL4A 1W9FA 1GNYA 3WF1A 3N9LA 5T5JA 5H9PA
chains in the Genus database with same CATH topology
1OURA 2JDNA 5A6ZA 2JDUA 5A70A 1OUSA 1UZVA 1OXCA 1UQXA 1W8FA 2WRAA 2VUDA 5A6XA 2BV4A 2WR9A 2JDYA 1OVPA 4UT5A 1OVSA 2JDHA 2VNVA 2XR4A 3DCQA 5D2AA 5A3OA 2JDMA 3ZDVA 4CE8A 5A6YA 2JDKA 2JDPA 2BP6A 5HCHA 2BOIA 2CHHA 1W8HA 1GZTA 5A6QA 4AOCA 2BOJA 2VUCA 1OUXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OUR A;  2JDN A;  5A6Z A;  2JDU A;  5A70 A;  1OUS A;  1UZV A;  1OXC A;  1UQX A;  1W8F A;  2WRA A;  2VUD A;  5A6X A;  2BV4 A;  2WR9 A;  2JDY A;  1OVP A;  4UT5 A;  1OVS A;  2JDH A;  2VNV A;  2XR4 A;  3DCQ A;  5D2A A;  5A3O A;  2JDM A;  3ZDV A;  4CE8 A;  5A6Y A;  2JDK A;  2JDP A;  2BP6 A;  5HCH A;  2BOI A;  2CHH A;  1W8H A;  1GZT A;  5A6Q A;  4AOC A;  2BOJ A;  2VUC A;  1OUX A; 
#chains in the Genus database with same CATH topology
 5LW9 A;  4TTG A;  5AFB A;  2D98 A;  2JG8 C;  3MO4 A;  2ZEZ A;  3N9P A;  1PVX A;  3OEB A;  3VN4 A;  1POQ A;  2ZX1 A;  2XVL A;  4FP3 A;  2RDN A;  3NNL A;  2R04 1;  4LO8 A;  3ST7 A;  3ZFG C;  2J1T A;  3FLT A;  2W95 A;  3Q8B A;  5F9T A;  5LCW L;  2VME A;  4BQX A;  1J1L A;  3MPB A;  4MHU A;  4UXA A;  2R04 3;  1KFX L;  1XJA A;  1H9W A;  3IM0 A;  4CEW B;  2IXJ A;  3VZM A;  2X29 A;  3QBQ A;  4OUS A;  2LUW A;  5CKQ A;  4Y1V A;  2RDR A;  5EZW A;  4IV3 B;  4BXF A;  4Y4R A;  1VE0 A;  4M3C E;  2YPD A;  3HOB A;  4NII A;  3WQ7 A;  2XJR A;  1NQJ A;  3OOX A;  4JGZ A;  5EHD A;  5B4X A;  4JDM A;  1OUR A;  4X6Q B;  1OC1 A;  3ILN A;  3VLB B;  4OZX A;  1DDL A;  2BWC A;  4ZKT B;  3HJR A;  4UBG A;  3W58 A;  5BNQ A;  1W9T A;  5A7N A;  2XVK A;  4CU9 A;  5LBC A;  5JXG A;  3DL3 A;  5FY1 A;  2WS9 1;  4BLI A;  1QJU 2;  1SPP A;  4UW3 A;  2K0G A;  2Z4F A;  5ACA 2;  4AFC A;  4LHL A;  1JTZ X;  2HEY F;  4J1X A;  4RQP C;  3ACH A;  1AF9 A;  1CVN A;  4CU6 A;  2CDP A;  2WS9 3;  3DPR A;  3MEP A;  3RZK A;  4XJU A;  1ZRI A;  4E8C A;  1UU6 A;  4RHV 1;  4HZF A;  1AX2 A;  1CAW A;  1PVC 1;  3LDK A;  2WZ8 A;  4LIU A;  5G04 L;  4AOC A;  1VAM A;  4N43 A;  5C9A B;  5F39 A;  3RMY A;  2PTM A;  4RHV 3;  1ZNP A;  2HEV F;  1PVC 3;  3KT1 A;  4P9I A;  4PLM A;  4H3W A;  1ODM A;  2R1B A;  4XF3 A;  3NO8 A;  3TWI A;  3O14 A;  3W59 A;  2RS5 1;  1AYN 1;  2DU1 A;  5A80 A;  4N8M A;  4ZXK A;  3LAG A;  1OOP A;  1H8T A;  5FYT A;  2RS5 3;  1AYN 3;  1H4H A;  1W8Z A;  3VKL A;  4OQ9 A;  2QZ2 A;  4IEY A;  5FZA A;  1OQD A;  1RUJ 2;  1XNB A;  4PT6 A;  4A2U A;  2FDH A;  3WF2 A;  1O3T A;  1GNZ A;  4HAN A;  1V6M A;  2Q0A A;  3WSO A;  1M06 G;  1BBT 1;  1MQT A;  2D6K A;  2UY9 A;  3OPT A;  4FT8 A;  4LOT A;  3M3O A;  4XJ9 A;  4FTS A;  3LFI A;  1QJX 1;  4MGT A;  3KQR A;  3PHM A;  2WSV A;  4FPF A;  3U75 A;  5A6Q A;  1BBT 3;  3I2G A;  3ILR A;  2PHF A;  3J26 N;  3MLJ A;  1W2T A;  1XYO A;  2PHW A;  3PDQ A;  1R1Z A;  3MZH A;  3E6C C;  1QJX 3;  2DVB A;  3ORJ A;  1OLR A;  4GWI A;  4RR3 B;  3U1X A;  2VNR A;  2VH9 A;  4RGK A;  5EYX A;  1KJR A;  4V1P A;  1IS6 A;  1DP0 A;  3MV0 1;  1NCQ C;  3Q8A A;  5IAV A;  4QXB A;  5F3G A;  3WG3 A;  5HBA A;  1V70 A;  1G9C A;  1NCR C;  5D8A C;  4GMP 3;  1VBC 1;  4Y20 B;  2R7E B;  3NJV A;  4OI2 A;  4JKM A;  3MFC A;  5DMY A;  1QXR A;  2BER A;  1GQH A;  2LRO A;  1CZS A;  1VBC 3;  1G9A A;  5A3T A;  2VOX A;  5JI7 A;  2FCU A;  4N9I A;  3RQ0 A;  4UFK A;  3PNA A;  2E7T A;  1JZ6 A;  2X8K A;  3AMQ A;  5ANQ A;  1BXH A;  4Y5S A;  1JYW A;  1J83 A;  5FYV A;  1JZ8 A;  2JJ6 A;  5LRR A;  2EAA A;  2YBS A;  2BWA A;  4FPC A;  1XNA A;  1UYY A;  2ZGS A;  4L11 A;  1W9S A;  4FVV A;  2D40 A;  3WZ1 A;  1CWP A;  1VBE 2;  1W04 A;  4DQA A;  2EIB A;  3K4Z A;  4IEZ A;  3WUC A;  2W91 A;  4C1W A;  1N47 A;  2MEV 2;  4P14 A;  2EXI A;  3I8T A;  3ZXF A;  3H3Z A;  5CG9 A;  3NV3 A;  1GMM A;  3AJY A;  2OA2 A;  2VVE A;  4FPK A;  2I74 A;  2IWG B;  4QKF A;  2WWU A;  1W8U A;  1PIV 2;  1JZ3 A;  5LY1 A;  1WMX A;  4IV1 B;  3AZV A;  3OBZ A;  2PN5 A;  1GWK A;  3HQR A;  3WG1 A;  1AR9 2;  3VZO A;  2H6B A;  4AHY A;  4U2A A;  3W5M A;  1PO2 2;  2GSY A;  1W0P A;  4FFH A;  4EN8 B;  4ITC A;  4MUV A;  5F2W A;  2ZAH A;  4XQ4 A;  4JTN A;  4BQW A;  1REF A;  4CUB A;  1ZBE 1;  2WNE A;  4P5Y A;  1EAH 2;  2BNO A;  2TUN A;  4B3N A;  4LUL A;  2BNN A;  2VZQ A;  3K46 A;  3KGL A;  3WCS A;  1UX6 A;  4Q4X 2;  4YRD A;  1ZBE 3;  2OX0 A;  5FXX A;  1SZB A;  3T08 A;  1JYC A;  2HWE 1;  1CN1 A;  2W1S A;  3HN3 A;  1EUU A;  2WZE A;  4XJW A;  1CGP A;  2D3R A;  1ST8 A;  3ZXE A;  3FN9 A;  2HWE 3;  5EJZ B;  1CR7 A;  2DCK A;  4N53 C;  3VL9 A;  1PMI A;  2GNB A;  1V6J A;  1GBG A;  2OUJ A;  1S2E A;  3T1L A;  1LOF A;  5LAT A;  4QX2 A;  3PUR A;  5ABJ C;  3TB0 A;  1RUD 1;  4DUX A;  3AFK A;  4PQ9 A;  4CU8 A;  4MGK E;  4EZ4 A;  5F3C A;  1RUE 1;  1UYX A;  1VRH 2;  1GUI A;  3L9J T;  3VBS C;  1RUD 3;  3PVO A;  4CRQ A;  1YEW A;  2CDO A;  2VCA A;  2WO7 A;  3WNM A;  2G9F A;  4NMI A;  5A3W A;  2YC2 A;  1FT9 A;  5A6X A;  2XWB B;  2HWB 1;  4KH9 A;  4S2D A;  4MXW B;  1W8N A;  2W94 A;  4OUM A;  3WW3 A;  1YC6 1;  3VZL A;  3OUH A;  3O1P A;  1CX1 A;  2QE3 A;  3B9C A;  1V9U 1;  3Q8C A;  1IKQ A;  1AX1 A;  3CO2 A;  1SBD A;  2BDR A;  1J58 A;  2HWB 3;  4R9C A;  4DPN A;  5HV0 A;  1IS4 A;  3SCF A;  1AR6 2;  1Z78 A;  1FAY A;  1V9U 3;  1ZZ6 A;  3ZDS A;  4LQR A;  5K9Y A;  3CZU A;  2C24 A;  3VDA A;  1QJZ A;  1AYM 2;  2YU2 A;  2K2S A;  4B4P A;  5C7G A;  3TOJ A;  1DQ0 A;  3SHR A;  1WMD A;  2RS1 1;  1KFU L;  1CJD A;  5F37 A;  2VZP A;  3HNB M;  5JOX A;  4QMA A;  3BU7 A;  2RS1 3;  1KD7 A;  5JIA A;  5A7S A;  1ZZ9 A;  4K8R B;  3AP9 A;  4Z92 B;  3LDR A;  4GJY A;  1K5M A;  4AI8 A;  1O5U A;  2ZGQ A;  1K5J A;  5DG1 A;  1DYK A;  2RM2 1;  2XJP A;  4BDV B;  4J25 A;  1GNH A;  1DZQ A;  3CQO A;  3JB4 C;  4IDZ A;  4QPY A;  4XBN A;  4RS5 A;  4XDQ A;  3WP6 A;  1RED A;  2RM2 3;  3JU9 A;  5CFD C;  5I0T A;  1UD1 A;  4UW4 A;  4C91 A;  3D5O A;  4W65 A;  3IDB B;  5GLT A;  5A1L A;  2BOJ A;  5DDJ 1;  2ZKN A;  2RR1 2;  3U07 A;  4FCA A;  5FK7 A;  1LOE A;  2DVD A;  1Y7B A;  2RE9 A;  5EQU A;  4IES A;  1P8J A;  1S2K A;  2XUE A;  3SQO A;  5DDJ 3;  3DEM A;  5FRA A;  5JVV A;  2Y0O A;  1YCI A;  1OQ1 A;  2BFU L;  4HPK B;  3TEZ A;  2QQN A;  2V72 A;  3ETP A;  3VBR C;  4NAM A;  2VOV A;  5FLJ A;  4R9D A;  3C8X A;  2DTW A;  4E2G A;  5LEK A;  3BOP A;  3R4U A;  2FHR A;  1JYX A;  4ET7 A;  2E7Q A;  1FNY A;  4XUO A;  5BNP C;  5ISL A;  2O8O A;  1HJF A;  4K9S A;  4AL9 A;  4ZZ5 A;  5L7O C;  3ES4 A;  3OY8 A;  4GD4 A;  2R32 A;  3N7J A;  3SH5 A;  1C4R A;  1X9P A;  4CEY B;  5CZK A;  1DIW A;  3V65 A;  1WLD A;  1DZR A;  2JX9 A;  3RPQ A;  4LA2 A;  2DBI A;  2EIE A;  2R1D A;  2ZHN A;  1SHW B;  2D6N A;  2JEN A;  4QQP A;  4IEP A;  1IPS A;  4FPY A;  3RJR A;  3I2F A;  3NKG A;  4GUL A;  2P4E A;  1NA1 B;  3OGV A;  5C4W B;  1AXY A;  1RJ8 A;  5DZF A;  3THC A;  3M2M A;  4D7T A;  2E33 A;  4P9X A;  1S4C A;  4K40 A;  2X5I C;  2YFZ A;  1H9P A;  1HB2 A;  5T52 A;  4I02 A;  4TXW A;  3FX3 A;  3NQH A;  4L99 A;  5BNO C;  2AAC A;  3OF1 A;  4CEY A;  2JKB A;  5FY4 A;  3ETQ A;  4DNY A;  2VZS A;  2YGL A;  1BMV 1;  3O0X A;  4B8E A;  1W6N A;  1US3 A;  1YRZ A;  2BQP A;  2JIC A;  2XH6 A;  4IEX A;  1NA1 A;  1ZBA 1;  4O9G A;  3WX5 A;  1W3V A;  1ONA A;  1G8W A;  1NY7 1;  2XKO A;  1ZBA 3;  4BWO A;  2D44 A;  5J36 A;  4AW7 A;  3VBF C;  3MF6 A;  2A3Y A;  4QU1 A;  2VMI A;  5DAV A;  3X29 B;  3VBU A;  1VR3 A;  3USU B;  1WCS A;  3FBY A;  4XFI A;  3EQE A;  4AF9 A;  1G9B A;  4YM3 A;  4JGY B;  3H3L A;  2D6O X;  4L92 A;  3QH7 A;  4QQH A;  3VZN A;  4HBN A;  2ADD A;  3C3V A;  3I3M A;  4QGN A;  4XC9 A;  5KXC A;  4DXZ A;  1Q3E A;  3KV9 A;  3HEI A;  3ME2 A;  4QKB A;  3GYD A;  3N3H A;  1LEN A;  2J7M A;  2BVB A;  4CCE A;  1CPM A;  4BQ3 A;  3ZFE A;  2E9Q A;  2ERF A;  1IPJ A;  4N7U A;  4CDQ A;  3LQC A;  5IFP A;  1UAI A;  2BUK A;  3LEG A;  3USU A;  2D3S A;  4AQT A;  2EAL A;  1R08 1;  1G9F A;  1H0B A;  2RDS A;  5IFT A;  2CL2 A;  2VOK A;  4M3C B;  5BNN B;  3ACI A;  1RHI 1;  5IHR A;  3WF4 A;  4GWJ A;  3I59 B;  3ZSM A;  2WWS A;  3E6D A;  3C7G A;  5C6C A;  5C5T A;  1RHI 3;  4AZZ A;  2SBA A;  1NXM A;  2IFR A;  1RUC 1;  4ASK A;  1HRI 2;  3WF3 A;  4TWT A;  2KD7 A;  2GAU A;  2YZ4 A;  2ENR A;  3AM2 A;  3NV4 A;  4XDO A;  3PUQ A;  1GV9 A;  4AHZ A;  3AZZ A;  4F83 A;  1STM A;  4MH0 E;  3J7H A;  1RUC 3;  3ZR6 A;  5BNN A;  4JKL A;  2W92 A;  4FAG A;  5A6Y A;  3GZU C;  1DFQ A;  4QX8 A;  5A3N A;  5B4N A;  5FZB A;  2P3K A;  5J7M A;  4KWK A;  4L9B A;  4LIT A;  3ZN6 B;  2GAL A;  1MZE A;  2VXJ A;  3NVC A;  2P34 A;  4QPG C;  4DEQ A;  3AL5 A;  2ZGT A;  1PK6 B;  1RTV A;  4CUG A;  2P6C A;  1PMH X;  5A6Z A;  2IXI A;  3KSC A;  3J7L A;  2ARB A;  3GHN A;  3JQW A;  4B4Q A;  4B7E A;  3VZJ A;  4RFR B;  4JRA A;  4LO6 B;  4NRQ A;  1WWY A;  2VO5 A;  2PXJ A;  1R09 1;  2BNM A;  5A7W B;  3EBR A;  4FPG A;  3AXE A;  5FP7 A;  4KGG A;  2E26 A;  5KXB A;  2OS2 A;  3J7N A;  3MUZ 1;  1HXS 3;  2OII A;  3ZN6 A;  4BM8 A;  1ND3 C;  3H50 A;  4YVW C;  1R09 3;  4CP1 A;  5HI0 A;  4YYO A;  2XL7 A;  3LD8 A;  4XFB A;  1Q8O A;  4HG6 B;  2RV9 A;  5L9B A;  2EIG A;  3ITQ A;  1UW8 A;  1U5Z A;  1ZA4 A;  3T4V A;  4XFG A;  4JC1 A;  1JZ4 A;  3OUJ A;  3KT7 A;  2A70 A;  1ENS A;  3PJY A;  3PIJ A;  1LES A;  3WDV A;  4FTE A;  4M00 A;  2JDU A;  2P2K A;  2RS3 2;  1UOB A;  3WDT A;  1W06 A;  4F7Z A;  5FZC A;  4BLJ A;  2OT7 A;  1H30 A;  1H1M A;  5J09 A;  1GZ9 A;  2UY8 A;  1WUV A;  1YFW A;  4XZP A;  1H2L A;  4A7K A;  2WFF 1;  4IE7 A;  5KHK A;  1Z7S 3;  3C7H A;  3L2H A;  1T2X A;  4MZU A;  1VP6 A;  4XW3 A;  4CCM A;  1H1I A;  2R0H A;  4DB5 A;  5F5A A;  1X9T A;  1SMV A;  2WFF 3;  3MW2 A;  4GB3 1;  3VKF C;  4LNV A;  3OSD A;  4I01 A;  4QB2 A;  1GSL A;  1QNW A;  2EA7 A;  1W8T A;  1YJK A;  4XJA A;  4D0Q A;  3MYX A;  3PUA A;  5DAQ A;  1VBA 2;  2VQU A;  4GB3 3;  4Q4V 2;  2VMC A;  5GAL A;  2QQU A;  3UJO A;  3ROU A;  3BVC A;  2B4K A;  3ZXA C;  3QD6 A;  1PO1 1;  1KJL A;  4YWA A;  1JYN A;  2Y33 A;  1QIQ A;  1TEI A;  1W9Y A;  5FTT C;  3TAY A;  5A70 A;  3BTX A;  5E8A A;  1HQN A;  1PO1 3;  2VUA A;  3AKS A;  3O12 A;  4J1W A;  1W8O A;  4Q4W 2;  2ZGM A;  4P02 B;  3EHK A;  4Y33 A;  2HYK A;  2JB4 A;  4FOW A;  5SV8 A;  5I0D A;  2P3J A;  1HRV 3;  2PHR A;  4LHN A;  3M70 A;  1LED A;  4M4P A;  4CCC A;  2VVD A;  5IVJ A;  2JDM A;  4F8A A;  4CCJ A;  2O0O A;  3K51 A;  5KC6 A;  1DGL A;  4YM2 A;  4YZ5 A;  1RUH 2;  1YYN A;  4AVV A;  5F3I A;  3DYP A;  2QQV A;  3K4D A;  1FPN 1;  1BEV 2;  3VDD B;  5JSP A;  3U78 A;  4AVA A;  4BIO A;  3O1O A;  3THP A;  1GZC A;  2V4V A;  4P08 A;  4LMF A;  1ZVF A;  5EJ3 A;  3CHX A;  4RYD A;  2BBA A;  4WVW A;  3VKM A;  2BFU S;  3LB9 A;  1BVP 1;  4N7I A;  5A7Q A;  1RUI 1;  4JHT A;  3BTZ A;  1WMF A;  5CB7 A;  5ANN A;  1S0F A;  2A75 A;  1RUI 3;  1Y43 B;  1QJE A;  5K0U C;  4P00 B;  4PBP A;  5F5I A;  1D4M 1;  3M3I A;  4UFM A;  1CAU A;  3ALQ A;  4PDW A;  4B7K A;  2XR4 A;  5D1I A;  5A33 B;  2P17 A;  4K21 A;  1SCS A;  2C9K A;  4QKD A;  3RNS A;  4O65 A;  1N1S A;  2GH8 A;  3T1M A;  1D4M 3;  1LU2 A;  3KT4 A;  1NZC A;  2GN7 A;  3VBH A;  1HN0 A;  4CCL A;  3U4X A;  1XE8 A;  4L97 A;  3BUC A;  1GQP A;  5FZG A;  4UFI A;  1O4T A;  2ZOE B;  3VBO C;  2W3J A;  1ZM1 A;  1OHF A;  3N9M A;  1CAV B;  4YFW A;  3PUI A;  5FPV A;  3C2U A;  4ISQ A;  4CDX B;  5GLU A;  1UIK A;  5A33 A;  5JSR A;  1OMI A;  3IDE A;  3J8F 1;  2WFP A;  1J3R A;  4JV4 A;  4QDR A;  2W1U A;  1UCX A;  1GAN A;  3MLK A;  4XJZ A;  3J8F 3;  2O8Q A;  3ZX7 A;  3ZYB A;  3UKV A;  2WNU A;  1ZA7 A;  2O14 A;  3IDA A;  1OFN A;  2VNV A;  4YW5 A;  3TEX A;  4JDN A;  1LOB A;  4CE8 A;  5HCA A;  4KBZ A;  4LHK A;  3KVB A;  2PLV 1;  2FD8 A;  1I5Z A;  2DWR A;  1NG0 A;  2ILM A;  1E5R A;  2JD4 A;  1CZT A;  3PIG A;  4BQY A;  2PLV 3;  3FLR A;  4HFS A;  2B45 X;  1DGW X;  3BPZ A;  5DUX A;  3BPS A;  2WQ4 A;  4RGA A;  2YY1 A;  4BQ1 A;  3LSE A;  3S7I A;  1YQ2 A;  1HQW A;  4QAW A;  1ENX A;  3O5S A;  4A4A A;  3I49 A;  3ZLI A;  3NL1 A;  1TMF 2;  2WNV C;  1X82 A;  3ZVX A;  2Q8E A;  5A3U A;  1K45 A;  4DFS A;  5JMO A;  2N7G A;  1JYV A;  3W5N A;  1HV0 A;  3GGL A;  4Y4Y A;  1W90 A;  4R52 A;  2W1Q A;  2Y0I A;  5LA9 A;  5CFC B;  1QQP 1;  3F95 A;  3S30 A;  1A3K A;  2AZ5 A;  2YDE A;  2OVU A;  4GH4 C;  2DUP A;  3JBG 2;  1RUF 1;  4IGQ A;  2HWD 2;  4CP9 B;  1XQN A;  2BTV C;  2FBE A;  1RUF 3;  4CXY A;  4DRR A;  4HT1 T;  1C8M 1;  1O8S A;  3CKH A;  3RZH A;  1U5Y A;  5FPL A;  4E4Z A;  2VJX A;  5FZ4 A;  3NNF A;  3FE5 A;  4Y1Y A;  1LAJ A;  1UMI A;  1O3S A;  4BB3 A;  1C8M 3;  1YQ5 A;  3BOD A;  3ZKU A;  4UW5 A;  5BY5 A;  5KWR A;  3POE A;  2ORZ A;  1ZZ8 A;  5FY9 A;  4RL7 A;  4EWE A;  1RVF 2;  3FHI B;  2GNT A;  3KCC A;  1VB2 A;  2WR9 A;  3K77 A;  3P3P A;  5L9V A;  1QH7 A;  4WM8 C;  2JG8 A;  4E8D A;  3WY6 A;  3ON7 A;  4CDU B;  1AZD A;  4Q8L A;  4CZS A;  3UNP A;  2R16 A;  1GWM A;  3LIH A;  2NZ9 A;  1OT5 A;  2JD9 A;  3FUO A;  3APB A;  5IVB A;  1B09 A;  3UKN A;  1CPN A;  1UU5 A;  4H55 A;  2B42 B;  4LTA A;  3ZFG A;  5DAB A;  1EV1 2;  3QAC A;  4H2A A;  2AEZ A;  5F3E A;  5CG8 A;  3D8C A;  5FPB A;  4MGY E;  1CZV A;  5GZD A;  2H6C A;  1SBF A;  4Q0U A;  5FZ9 A;  1BYH A;  2RMU 1;  3HN1 A;  4YVS B;  5G05 L;  4GXL A;  3GCX A;  2XBO 1;  3IWZ A;  3OBR A;  4MLO A;  2VZR A;  4C0B A;  5LRS A;  2A71 A;  2RMU 3;  3POW A;  4IXL A;  1QOO A;  4NE9 A;  1IG0 A;  3MW3 A;  4CDW C;  2XBO 3;  3UES A;  3WNO A;  1QJF A;  5AFE A;  1W6M A;  3AK0 A;  4ATF A;  5JIU A;  1ZYB A;  1HX6 A;  1EPZ A;  2A3W A;  2WSU A;  4S2F A;  4TLF A;  1H6Y A;  3RVH A;  1MS9 A;  4AG4 A;  4XOG A;  4LKF A;  2LS6 A;  3E1F 1;  1JOP A;  1OLQ A;  2DFB A;  5A32 A;  2Q1Z B;  4XTP A;  1SDW A;  5FP4 A;  1MZF A;  3OD4 A;  4GQ7 A;  4OVE A;  4QPI C;  1NLS A;  2Y38 A;  4XMI A;  5CVR A;  3RJ2 X;  3OBT A;  1J3Q A;  4HK8 A;  3EB7 A;  1CQ9 A;  4YZ4 A;  1UY3 A;  2IVJ A;  2WT0 A;  1B35 C;  1COV 1;  2H0B A;  4P9Y A;  4Z07 A;  1OPO A;  3KGZ A;  4MGZ E;  1OVP A;  3H1M A;  4I2O A;  3UGH A;  5J37 A;  1O3Q A;  3T4H B;  1COV 3;  3CJX A;  3D82 A;  2R07 1;  4LKS A;  1XNC A;  4XIO A;  4AR2 A;  4I3G A;  4EJR A;  2Q1M A;  2R49 A;  5JOY A;  3MGU A;  4LKD A;  3RGB A;  4I09 A;  5LBE A;  2PHD A;  3WDY A;  2PA7 A;  2Y8K A;  1JI6 A;  2GP3 A;  1LUL A;  5GM0 A;  1UX7 A;  3LPF A;  4BQ5 A;  1JHN A;  4YG0 A;  1SFY A;  3ELN A;  1CAX A;  1NCR B;  3H7J A;  1HXS 2;  2IVI B;  2HWC 1;  1QEX A;  4H7L A;  1KRI A;  1AR7 2;  1Q43 A;  1POV 1;  4CCN A;  1GFF 2;  1TZO A;  5FLH A;  4H7M A;  4KBB A;  4A7Z A;  3UGG A;  5DUV A;  2HWC 3;  1YQC A;  4OYU A;  2BGP A;  1POV 3;  2DTY A;  4JGZ B;  2D6M A;  1GYK A;  2VVF A;  1PM7 A;  4W6W A;  1AJK A;  2WZP P;  3H8O A;  3T0B A;  2VCB A;  1NCQ A;  1BJQ A;  1NCR A;  3OPZ A;  5D8A A;  4C8D A;  4NOT A;  1DF0 A;  1SPP B;  2DVF A;  3URF A;  1LGB A;  2F6B A;  1V0A A;  4FPL A;  3QOP A;  3U0Z A;  3PTR B;  3DPR B;  4XF0 A;  2DV9 A;  1UIJ A;  1Z7S 2;  1FMD 2;  3KV4 A;  2P1B A;  1CAW B;  1DLC A;  2NYY A;  4HVQ A;  5KC5 A;  1O4Y A;  3AKQ A;  4N43 B;  2A6W A;  2W46 A;  2Z79 A;  4TN7 A;  2VU9 A;  4YZ2 A;  2K46 A;  3RZL A;  5C70 A;  3AZX A;  1DQ1 A;  2RJK A;  4BU2 A;  4IER A;  3FJS A;  2PFW A;  4LBM A;  2DF7 A;  3NAP B;  4K1Z A;  1MZ6 A;  1OOP B;  1H8T B;  1A8D A;  3TBD A;  1PHM A;  5DPN A;  1F35 A;  5FY5 A;  1DHK B;  2KXL A;  1UN1 A;  2ZPX A;  1RUG 2;  1KS4 A;  3B93 A;  4B1L A;  5E6H A;  3WR0 A;  4HVR A;  3H3U A;  4QXK A;  2QQW A;  2VUC A;  5A3L A;  4EWA A;  2DUQ A;  4XF1 A;  5EXO A;  1ASJ 1;  1MQT B;  1W6Q B;  1LU1 A;  2J1R A;  2XQR A;  1HRV 2;  3POJ A;  1YUD A;  3WW4 A;  3FZ3 A;  4KL1 A;  1MVE A;  3NAP A;  4NHM A;  4LLO A;  1ASJ 3;  4IQP A;  3QH6 A;  4NJ4 A;  1RIN A;  4HET A;  3I54 A;  4XBL A;  4LT5 A;  3H1Y A;  1WME A;  3ZO0 B;  3C7F A;  5C8C C;  1RB8 G;  1MEC 1;  2YYO A;  4COY A;  1OFS A;  5IVV A;  1W6Q A;  5KXD A;  1W6O A;  4QU2 A;  4P9J A;  3DYM A;  5C3Q A;  2WQZ C;  1AVB A;  3VV1 A;  5GLV A;  4GAZ A;  5KXE A;  3AMH A;  4QXH A;  5J48 A;  4D6S A;  1FNZ A;  1MS5 A;  1TME 2;  4C0H A;  1KDK A;  3U11 A;  3RS6 A;  4DMI A;  1TNR A;  2G9Z A;  3CBN A;  1S55 A;  3I3B A;  1I9R A;  3MIH A;  3N9O A;  1XNK A;  4B4R A;  1SQ4 A;  5ABJ A;  2W52 A;  1SEF A;  2EXH A;  2VNO A;  4XDP A;  4DY3 A;  4QX7 A;  3CJI C;  3CLP A;  3DKW A;  4G3Y C;  4NHL A;  4WZF A;  4A6O A;  1H2K A;  3AYC A;  1VBB 1;  2YMZ A;  4NPM A;  5F6L B;  1PZ7 A;  2BJS A;  1XYP A;  1JOJ A;  4XXP A;  4LA3 A;  1S0E A;  1VBB 3;  1APN A;  1ULO A;  1QNY A;  1JHJ A;  1WLT A;  1QJY 1;  5FUN A;  4EN9 B;  2Q30 A;  3WXP A;  4YFZ A;  4HON A;  5GLZ A;  3RSJ A;  3RMX A;  3A21 A;  2RVA A;  1L7Q A;  1MS0 A;  5I91 A;  2C6S A;  1W03 A;  3KV6 A;  4OFG A;  1YFY A;  4X8N A;  1QOS A;  3H8R A;  1QJY 3;  3VKO A;  1IS5 A;  5CKM A;  3W20 A;  5FYY A;  2CV6 A;  3UGF A;  3H8X A;  2VCC A;  1UMZ A;  3OGG A;  3V0B A;  3NJX A;  4LBK A;  4XUQ A;  4LXL A;  2I2S A;  4JTO A;  4Q29 A;  2AH2 A;  3KWV A;  4NIG A;  3SMH A;  2D5H A;  4LO5 B;  3LEM A;  3TN9 1;  3MUY 1;  4UFH A;  4CP2 A;  3EO6 A;  1AR8 1;  3R4S A;  1HDK A;  1N1V A;  2UYA A;  3TN9 3;  5DAP A;  1W8H A;  1AR8 3;  4IV3 C;  4ZZ8 A;  3ZYP A;  5M0T A;  1PGW 1;  4YM1 A;  1JS9 A;  5FMB A;  1AL2 1;  3GHM A;  2WZR 2;  4YG3 A;  4CYD A;  1KQR A;  1PGL 2;  5FYB A;  2VEC A;  4NR1 A;  1AL2 3;  2EIC A;  2XUM A;  4QM9 A;  2Z5W A;  3JXS A;  5CFD A;  1YI9 A;  1ZRC A;  1LHN A;  1MS4 A;  4FQZ A;  2ZMK A;  1W0O A;  2JDY A;  3A4U A;  4KWL A;  5L7O B;  5I93 A;  3JCI A;  4ASL A;  5FPZ A;  5C33 A;  4XUR A;  4Y3O A;  3ACL A;  3WVJ A;  1LOD A;  2QNK A;  3VBR A;  3E6B A;  2BZD A;  1NE6 A;  3UL2 A;  5C3O A;  1DG6 A;  2XJS A;  5FP8 A;  5C9A C;  4XUP A;  1V6O A;  4LBQ D;  3N35 A;  1VPH A;  1D4V B;  1VBD 2;  2ES3 A;  2ORX A;  2ZEX A;  5DAX A;  2WT1 A;  3CDZ B;  5T50 A;  4AFM A;  3DYO A;  3MIF A;  5FK8 A;  5L7O A;  5BPX A;  2X5I B;  1K12 A;  1RUE 3;  1FOD 1;  2QQJ A;  4TLG A;  2JWP A;  5FO8 B;  3AZY A;  3DXT A;  2A5Z A;  5C3S A;  3PUS A;  1FOD 3;  5FZ3 A;  5J3U A;  1GU3 A;  1MR5 A;  4AFD A;  1R64 A;  3WG2 A;  5FZ1 A;  2BU9 A;  3I2H A;  3ZFF B;  2Y26 A;  1O8P A;  4FSJ A;  3AP4 A;  4Q26 A;  4XE9 A;  3KHB A;  1N1T A;  3R05 A;  3LWC A;  3JB8 A;  4IEU A;  4KGQ A;  2X5I A;  2ATF A;  1K5M B;  1Q56 A;  1UY2 A;  3KZ4 C;  5JR7 B;  2QUO A;  5FY7 A;  5BNO A;  4QX1 A;  1R1A 1;  4RR3 C;  4C90 A;  2R06 1;  2Q8C A;  4DIQ A;  4RS5 B;  4DY5 A;  3OYW B;  3O0V A;  2J22 A;  3ZFF A;  1R1A 3;  1SLI A;  1VMH A;  2CSG A;  2R06 3;  1YNA A;  5LBB A;  1EPW A;  4DUW A;  2V09 A;  1JZ5 A;  4LUK A;  2RJL A;  5FBJ A;  4ZU7 A;  1RMU 2;  5FAX A;  4AVT A;  4AHX A;  3OB8 A;  4ZU5 A;  1Q8Q A;  5IK5 A;  1LHW A;  3OYW A;  2ZBJ A;  1Z0H A;  1OF3 A;  1LOG A;  3I2J A;  2YBP A;  1KDM A;  3HMY A;  5HCF A;  3RG0 A;  4GKY A;  1DLL A;  2ARE A;  1VMJ A;  2JB8 A;  4DEV A;  4E4S A;  4Q5O A;  5I8Y A;  3OY8 B;  1HB4 A;  3PTY A;  5HPO A;  4PLN A;  3BYW A;  2B7Y A;  4WVM B;  4BXS V;  1LHO A;  2TNF A;  3OG2 A;  2HH9 A;  3ZSJ A;  3ZSL A;  4XFF A;  1GOH A;  2XOM A;  4IE0 A;  3H7Y A;  4PJY A;  1IOA A;  1XU2 A;  5FZD A;  4GMP 0;  3VKN A;  1OVS A;  3KV5 A;  4FPJ A;  4AAP A;  1L3J A;  2MHF A;  1KXG A;  1NQD A;  3BGA A;  2VZO A;  1ACC A;  4IV1 C;  3A0N A;  1NOV A;  4GWN A;  4NWW A;  5FRE A;  5FJH A;  5LAS A;  4CTE A;  5JWP A;  3V0A A;  3POS A;  4BQ4 A;  2X09 A;  3AC0 A;  4WVM A;  2VTX A;  4AWD A;  4A45 A;  4WV8 A;  4TZD A;  1J84 A;  4EZH A;  2XXZ A;  2KM2 A;  3ZR5 A;  5LEJ A;  1SCR A;  1W6N B;  2VZU A;  1OD5 A;  3SIS A;  4YSF A;  3DN7 A;  3IAP A;  3K2O A;  5EWS A;  3WIN E;  2R04 2;  3GDB A;  5FR3 A;  4QX5 A;  1XNT A;  3SLI A;  1FX5 A;  1PZ9 A;  4KI5 M;  1QU0 A;  2OQ6 A;  3UK9 A;  1FAT A;  4UT5 A;  4OQ8 A;  4JHZ A;  3VBU B;  3AP6 A;  4LR4 A;  4K6B A;  1WD3 A;  2J1V A;  2FDG A;  3GZE A;  2VC9 A;  3RI8 A;  4LO4 B;  3BTA A;  1LHV A;  4P9W A;  3BAL A;  4M0H A;  4EE2 A;  4XF9 A;  2EAK A;  1W6P B;  3A0K A;  3ZIW A;  2DU0 A;  3WOG A;  1ND3 A;  4N9H A;  4FAH A;  2MNG A;  4YVW A;  3AYD A;  4ZXE A;  4YGB A;  2G4I A;  3ZFE B;  3I3E A;  4FI9 A;  2WQ8 A;  3ZYI B;  4CDQ B;  5BUV A;  2JG9 B;  3NKT A;  1OXC A;  2WS9 2;  2XL9 A;  5SV5 A;  2AUY A;  2NMN A;  4LJH A;  4IEV A;  4MGQ A;  2NLR A;  1QH6 A;  3AP5 A;  4UWD A;  1C28 A;  4QM8 A;  3WDW A;  1W6P A;  1X36 A;  4RHV 2;  1JH5 A;  1RIT A;  1PVC 2;  3RYP A;  1E5S A;  4BIF A;  3N36 A;  1LOC A;  1H6X A;  2BOI A;  1ZZB A;  4DXR A;  4EN0 A;  2DUO A;  2QBX A;  2JG9 A;  4KU8 A;  2QDN A;  4ES9 A;  1S0I A;  4Y1X A;  4LBL A;  2VZ1 A;  5LBF A;  4FO9 A;  3INA A;  2RS5 2;  1AYN 2;  2WDB A;  4PIZ A;  2XHN A;  2ZML A;  2VM9 A;  2OPW A;  3Q8F A;  1R08 3;  1PM4 A;  3D0J A;  3I2K A;  2VMH A;  1YFU A;  1DGR A;  3Q9O A;  4IUG A;  4PBO A;  3TRS B;  2Z69 A;  1UO9 A;  1ND2 C;  5IAX A;  3P3N A;  3JD7 1;  2QQL A;  1AL0 G;  4IE4 A;  5IJR A;  1EY2 A;  1O4Z A;  1WW4 A;  3CL1 A;  1JYI A;  3AKR A;  1HJG A;  4UW6 A;  3R6S A;  2FZ1 A;  1BBT 2;  4QDQ A;  3JD7 3;  4IGO A;  2VNG A;  1GIC A;  4F3J A;  5JI9 A;  1MS1 A;  1QJX 2;  3DUI A;  1AJO A;  1S0C A;  4MHR A;  3T2O A;  3SNM A;  4HKL A;  2A6X A;  5FZI A;  1N3Q A;  1N3O A;  3J4U H;  4AFA A;  3S7E A;  1W9W A;  1Y9Q A;  1ODN A;  1YFX A;  4K7J A;  4A3Z A;  4QB6 A;  4OHY A;  1KIT A;  5BXX A;  2Z42 A;  4EYU A;  1W2O A;  3SEE A;  4YW4 A;  3DF0 A;  1IPK A;  2OZJ A;  3S6P A;  1QWR A;  4CCD A;  1U5I A;  4BYY A;  5F5C A;  2VR4 A;  1VBC 2;  2WNO A;  3FBM A;  3HNY M;  3LZZ A;  3LCP A;  1XC6 A;  1WD4 A;  3GM8 A;  3PVB B;  2ZHM A;  2B9U A;  2I45 A;  1OD3 A;  2WBK A;  1LNS A;  4HLT A;  4NHK A;  5JUV A;  1CIW A;  1V6N A;  3ZDV A;  1HB1 A;  5AC9 1;  2VW1 A;  3MIB A;  3U37 A;  1MZ5 A;  2VTX J;  4D3W A;  1ULD A;  2W08 A;  5E88 A;  5E89 A;  4CEY C;  2LTN A;  3HT2 A;  4GAL A;  1QOT A;  5IYY A;  2WAA A;  2XJU A;  1L7R A;  4IEQ A;  4XHB A;  3WT3 A;  4TSV A;  1NA1 C;  5C4W C;  1RXF A;  2IZW A;  3SKJ E;  3I4I A;  4HOO A;  2NN8 A;  5KHI A;  1DCS A;  4LHS A;  3SKV A;  2YPJ A;  4XBQ A;  3E5X A;  4J6G A;  5IK7 A;  2Z2S B;  3VBO A;  5FKB A;  1XRU A;  2XQX A;  3PU3 A;  2B5H A;  2LAL A;  4BOW A;  2SLI A;  2Q5T A;  3FHQ A;  4AEK A;  1YHF A;  3OGR A;  5IK4 A;  1QMJ A;  5TSW A;  2GC1 A;  4XXA A;  2ZX2 A;  5FZ8 A;  1FXZ A;  1OLM A;  1UL9 A;  1ULC A;  3I97 A;  3V64 A;  3GBW A;  3SH3 A;  1VAV A;  3T0A A;  2NP0 A;  1ZBE 2;  4MXV A;  4XFC A;  2FMD A;  4LBN A;  1SFN A;  3ZYR A;  4AEJ A;  1YO8 A;  5GZC A;  4N90 A;  4FOV A;  2B8M A;  2VBB A;  4WZC A;  2HWE 2;  4XAE A;  1S1A A;  3I2I A;  3O1S A;  4AED B;  1FI2 A;  5ACA 1;  3AMN A;  3SCG A;  1QJU 1;  4JGY C;  3ZMN A;  1SLC A;  1CJP A;  1F9K A;  2VQA A;  4MVT A;  1J59 A;  1ULG A;  4Q0Q A;  3A7Q A;  5H9R A;  3M8L A;  1HV1 A;  4I0B A;  2WNV A;  4XF4 A;  2OQ7 A;  5ACA 3;  5JDB A;  4Q0P A;  1QJU 3;  5FWE A;  2WLQ A;  1O59 A;  3WD5 A;  1RUD 2;  4H14 A;  1RUE 2;  3KF5 A;  1I1E A;  1XE0 A;  3III A;  3VD5 A;  3R4D B;  2YU1 A;  4XAC A;  4CEW C;  1OA2 A;  1S0G A;  1CAU B;  4PDW B;  4AQS A;  3WW1 A;  4AED A;  5BNN C;  2ZGP A;  3HR9 A;  2K9Z A;  1SLT A;  2PHU A;  4GH4 A;  1FPN 3;  4LBO A;  1UOF A;  1VJ2 A;  3HVD A;  4KG8 A;  2WJS A;  4UAP A;  4HL0 A;  2Q1F A;  2XGX A;  4Y1U A;  3VBH B;  2HWB 2;  1C3H A;  2KA3 A;  1TE1 B;  2WII B;  2W1W A;  4JDO A;  4NVP A;  5FXZ A;  5FXW A;  2Q8D A;  4A42 A;  5CIS A;  1HLC A;  4DUV A;  1V9U 2;  2L9L A;  4O7X A;  3RFR A;  3VHN A;  1RUJ 1;  4V2W A;  4D8M A;  5A7P A;  4DXT A;  1JZ2 A;  4GKX A;  3WHU A;  2YG0 A;  4KNC A;  4RA0 A;  3LE0 A;  2Y6J A;  1UNB A;  4OHV A;  2B46 X;  1RUJ 3;  5I0U A;  3IPV A;  1UPS A;  1TNF A;  1LB2 A;  4D69 A;  2UWC A;  1UZZ A;  1W2N A;  1O5L A;  3B69 A;  3FWE A;  3GZA A;  2YUE A;  5D21 A;  1JXN A;  2WNU B;  4P9G A;  3WQB A;  2NQY A;  5FZ6 A;  2RS1 2;  5IVY A;  2ZKL A;  3ZKY A;  2D7F A;  1PK6 C;  4ZS2 A;  4AI3 A;  4IEO A;  5L9R A;  4LO7 A;  3OCP A;  3BOW A;  4E9K A;  4ZHN A;  5CYY A;  2PAM A;  4U36 A;  5FP3 A;  1C8N A;  2NM1 A;  2WO2 A;  4LBQ B;  4RN5 A;  4X8P A;  4UFL A;  1N3P A;  4YGC A;  5JOZ A;  3IT8 A;  3HNM A;  2VY0 A;  4CCO A;  2RM2 2;  3OUI A;  2WLP A;  5JCT A;  4YW7 A;  3E97 A;  4EN6 B;  5FWJ A;  2ZAA A;  2GC3 A;  1ZRE A;  1LRH A;  4BME A;  5FQ0 A;  5BYN A;  3O1U A;  3H0O A;  4OMD A;  1WCK A;  1UOG A;  4DRV A;  2AGS A;  4XAA A;  2GND A;  2P3I A;  4WM7 B;  5F1R A;  4XIK A;  5DDJ 2;  4CUC A;  5FZO B;  2Y34 A;  4QHZ A;  3J9S A;  4TYS A;  5LWB A;  4FFI A;  2PMW B;  3OJB A;  4LBQ A;  4PIY A;  4CDW A;  2FDF A;  2D93 A;  3PVN A;  3OTF A;  1OQE A;  4EV0 A;  3B94 A;  3NW4 A;  4NO4 A;  1VBE 1;  4W8J A;  1UZY A;  3EJK A;  4NN0 A;  4HKW A;  2MEV 1;  2WAO A;  3W9A A;  1I3H A;  1OF4 A;  2Y6F A;  3BKZ A;  1VBE 3;  4LK6 A;  3MIC A;  4WM7 A;  2GU9 A;  1WW7 A;  2XKP A;  2Y64 A;  1AXK A;  4XUN A;  5FZO A;  2DVA A;  2MEV 3;  5A3O A;  1PIV 1;  2WKK A;  2VPV A;  2ETE A;  1QQP 3;  1C57 A;  1CES A;  5IWF A;  1UY0 A;  3O1V A;  3TEW A;  5LA1 A;  1PIV 3;  4CU7 A;  1AR9 1;  3N7L A;  2WO3 A;  1WKY A;  1B35 A;  1PO2 1;  3P5B A;  4PIX A;  5CU1 A;  4AQ6 A;  3LOB A;  5A1A A;  2JG8 B;  2WN3 A;  5JPM B;  1AR9 3;  3HQX A;  3LA3 A;  4OUL A;  1GP5 A;  1EAH 1;  1GZW A;  2AYH A;  5FUI A;  3SH4 A;  1PO2 3;  4A41 A;  2RG4 A;  2QQK A;  2JEM A;  2UUR A;  2WA3 A;  4Q4X 1;  4LBJ A;  3ZFG B;  3ACG A;  1EAH 3;  4Y5T A;  3VL8 A;  4Q8K A;  1BMV 2;  1IS3 A;  4W4Z A;  2D5F A;  5FMC A;  4Q4X 3;  2A6Z A;  4XJ8 A;  2XG3 A;  4V2V A;  1EUT A;  1NXD 1;  1WGP A;  3PLQ A;  2CGO A;  2ZGU A;  4YM0 A;  2ZJC A;  2VOT A;  2PEL A;  5K8S A;  5FZF A;  1ZBA 2;  2D97 A;  1UU4 A;  1F4H A;  1JUI A;  3NNM A;  2X05 A;  1MS8 A;  3VDD C;  1NY7 2;  1F2N A;  3L2Y A;  1K42 A;  3TNP B;  1LGN A;  1VRH 1;  1SLL A;  1VRB A;  1W6M B;  4NRO A;  1Q8V A;  5EP9 A;  5EV7 A;  4FPE A;  4AI1 A;  3RRD A;  1VB4 A;  1VRH 3;  2R30 A;  3M3E A;  1PZ8 A;  4QGM A;  4LK7 A;  1NZI A;  1S0J A;  3VUO A;  3ZSE A;  1D2Q A;  2J1A A;  2V5Y A;  3E5Q A;  1YIP A;  1MPX A;  4RQP B;  5A32 B;  2WT2 A;  1DZT A;  2P37 A;  1LR5 A;  4BCU A;  4YLZ A;  1PNF A;  1UMH A;  1JN2 P;  1F5F A;  4Q1R A;  2B39 A;  3LA2 A;  2ZZJ A;  2G9G A;  3RYK A;  1WLC A;  1NKG A;  3WP5 A;  4JAA A;  1AR6 1;  4BK5 A;  3NST A;  1R08 2;  1V6L A;  5DUW A;  5B2G B;  5I8S A;  2F17 A;  3U14 A;  1AYM 1;  2D3P A;  1RHI 2;  1RL3 A;  4I3P A;  4B29 A;  1Q8P A;  1V00 A;  4RQP A;  2VG9 A;  3MHZ A;  3WNK A;  2HEW F;  3O1T A;  5GZF A;  2VD7 A;  3RYR A;  1LTE A;  5E1R A;  1WCQ A;  3GXU A;  3HBZ A;  4FXG B;  4CDX C;  3H1W A;  1WW6 A;  4ZPI A;  1REE A;  1RUC 2;  4CXW A;  4XZU G;  2EXK A;  1TG7 A;  4PF1 A;  2PHX A;  5FPX A;  1FYU A;  1CAX B;  4LPL A;  4XHX A;  5I0S A;  3OPW A;  1CIY A;  4XCA A;  1ZZ7 A;  4GIQ A;  4ERO A;  2R6Q A;  3KS7 A;  3RZJ A;  1XU1 A;  4Y24 A;  2YBK A;  4FBF A;  3POF A;  1JOB A;  1NLR A;  4MET A;  3FMG A;  4KWU A;  2R07 3;  4FOQ A;  4IE6 A;  5FBZ A;  2XVG A;  3POI A;  1NX9 A;  3ZXG A;  4MGS A;  2RR1 1;  2GZW A;  3K3N A;  1EP0 A;  4OI4 A;  4MYE A;  4Y22 B;  1NCQ B;  2FMY A;  3T2Q A;  3I3Q A;  3AXD A;  2CYF A;  4S2G A;  3ZYH A;  4XYX A;  5D8A B;  3ZPY A;  4NAO A;  2CAU A;  5JZG C;  1A34 A;  3M4F A;  1TQ5 A;  1RC6 A;  1R09 2;  1E5H A;  4HN0 A;  3AZW A;  4HVO A;  3GF6 A;  2GME A;  2JDZ A;  3B5L B;  2V4A A;  3OGJ A;  4BE3 A;  4DIN B;  5CFC C;  2XPJ A;  2XLA A;  2CGP A;  2R0F A;  1RJ7 A;  1GKB A;  2QJV A;  3ZXD A;  2ARX A;  5FZH A;  4GZ9 A;  4AFB A;  1C5H A;  3IAQ A;  1MS3 A;  2VZT A;  2E31 A;  2HLE A;  3AKT A;  3AL6 A;  4QQ2 A;  4Y1Z A;  5LB6 A;  2PAE A;  5LY2 A;  1UF2 C;  2ZZQ A;  4Y22 A;  3SCH A;  4AE2 A;  2BYV E;  3ZYJ B;  2XDV A;  2KR2 A;  3MIG A;  1GR3 A;  4M01 A;  2UYB A;  4ZS3 A;  5FJK A;  3ZSK A;  5C71 A;  5GZG A;  1ZRD A;  4JKK A;  1HN1 A;  4KU7 A;  2JXA A;  3GJA A;  4COZ A;  3CJI A;  5FYI A;  3N7M A;  1J3P A;  1MAC A;  4OUE A;  3G6J B;  4XFA A;  2A7A A;  2IXH A;  5JXI A;  5FZK A;  2WFF 2;  3THT A;  2HKX A;  3M1H A;  4BMB A;  3FUQ A;  2ZHK A;  1ULF A;  3D4K A;  1K3I A;  2ZS6 B;  4GB3 2;  3LFM A;  4KQ7 A;  1H2N A;  3HD8 B;  5JLV A;  4AI9 A;  2YXS A;  2QQM A;  3CMG A;  2WIN B;  4UFJ A;  1YQ8 A;  2JDK A;  3I2D A;  4CDU C;  5FIX A;  2BP6 A;  5GJ6 A;  2CHH A;  4K3U A;  4ZON A;  1DQ5 A;  4NRP A;  3LF7 A;  1UKR A;  5CAD A;  2HBU A;  5HV4 A;  1PO1 2;  1QGL A;  1U5X A;  3KCX A;  2PHL A;  1LKN A;  5A7O A;  3MLL A;  5JMC A;  3ZOI A;  1DQ4 A;  5APA A;  1GOF A;  2JE9 A;  1W6O B;  1O91 A;  1W8F A;  4P5H A;  3T3Y A;  4CP0 A;  4YVS C;  1LEC A;  4IV3 A;  5KBF A;  2C1F A;  1JW6 A;  3IMN A;  3VD9 A;  3HIF A;  4ZU4 A;  2HYX A;  2LM3 A;  2WUH A;  2E63 A;  5A3M A;  1GWL A;  3NV2 A;  4N53 B;  5FZ7 A;  2PAK A;  4COV A;  5C3P A;  5EPA A;  2GNM A;  2V73 A;  3KQ4 B;  1FPN 2;  4XVH A;  5FMO S;  3U10 A;  2WA4 A;  1XSQ A;  4MV2 A;  5DXD A;  5ABJ B;  4XCB A;  3I2O A;  3GBG A;  4Y26 A;  1MEC 3;  1WBF A;  3VBS B;  1W3X A;  2QFE A;  3S0M A;  3FFZ A;  1I5P A;  4O61 A;  3GJB A;  5L73 A;  5JR2 A;  1OLM E;  3AJZ A;  1RUI 2;  4N53 A;  2I07 B;  2H0V A;  1UZV A;  2P3Y A;  3PVE A;  3RZZ A;  4YNI A;  2E32 A;  3DGT A;  2CNA A;  5FZ0 A;  5FO9 B;  4YW3 A;  1D4M 2;  1HRI 1;  5C9A A;  1ZRF A;  2BEO A;  4NIH A;  2J42 A;  3VBS A;  1HRI 3;  1SG3 A;  2VBP A;  5C8C A;  2ID4 A;  4L2N A;  4FP2 A;  3AVR A;  1BKZ A;  3OEA A;  5JOW A;  3V0B B;  4NPR A;  3EMR A;  2QQP A;  2ET1 A;  4I30 A;  1CD3 G;  1WA4 A;  4NUB A;  4YZ1 A;  4FTB A;  2VZV A;  1QY4 A;  4M4R A;  1VAL A;  2GMP A;  2WN2 A;  3BB6 A;  3H8U A;  3IDC B;  3KMH A;  4GMP 1;  4GWM A;  5FCC A;  5IUQ A;  3VZK A;  3LOI A;  4AI2 A;  1WLW A;  1QKQ A;  3J8F 2;  4AHW A;  5C8W A;  2OXB A;  3FLP A;  4Q4Y 1;  5AVP A;  1XBF A;  2G1M A;  1XXN A;  1WCU A;  2VQT A;  4OMC A;  4YZ3 A;  4AK3 A;  4ATE A;  2YB7 A;  4Q4Y 3;  2Y6K A;  2BGO A;  1DU3 D;  2OUH A;  3AYE A;  4YW2 A;  1J1T A;  4JGZ C;  5FKC A;  4XIL A;  2VGD A;  1JU4 A;  3VD4 A;  4RR3 A;  2PLV 2;  1JU3 A;  2HBT A;  2YC4 A;  3KD4 A;  1F5J A;  1PX4 A;  3MBW A;  4X6R B;  5CFD B;  4AI0 A;  5HXM A;  3W21 A;  2A6V A;  1WBL A;  1IQD C;  4NWV A;  3C7O A;  1VIW B;  1UOJ A;  2P5B A;  1UPI A;  3KF3 A;  2YFU A;  3U4S A;  3ACF A;  4Y20 A;  1GP4 A;  1OBN A;  5T54 A;  4NPL A;  4PI0 A;  5FZE A;  1XOY A;  4AYU A;  3DPR C;  1XE7 A;  1SBE A;  1PNG A;  1OSG A;  2RS3 1;  1AXZ A;  1H4G A;  4JVA A;  3VBR B;  2OKX A;  3UT0 A;  2C9A A;  4QWN A;  4GJZ A;  2FDI A;  4N43 C;  1QQP 2;  4RGG A;  2RS3 3;  3PUH A;  4AVS A;  4G4F A;  2BV4 A;  2WYF A;  1RUF 2;  3S5Q A;  5EFU A;  2J1U A;  4KMQ A;  3DXU A;  5BNP B;  5CAZ A;  3R0R A;  1US2 A;  4E27 A;  1POV 0;  3O0W A;  4ORF A;  4XUT A;  3NAP C;  2A1X A;  2JE7 A;  4UI9 L;  1OOP C;  1H8T C;  1C8M 2;  3AVS A;  3NRU A;  1LCL A;  1WZX A;  3GBF A;  1VBA 1;  4Q4V 1;  2Q4S A;  5FZL A;  5C3R A;  2GDF A;  1OUX A;  2FDK A;  4UF0 B;  1NLQ A;  2FCV A;  3KB5 A;  1JOD A;  1VBA 3;  4Q4V 3;  4A6S A;  1MQT C;  4UYB A;  3TYJ A;  4IV1 A;  4O9E A;  3IIA A;  4XQW A;  5BNP A;  3CEW A;  5HCB A;  1DGW A;  3NJZ A;  3PU8 A;  4Q4W 1;  3ZMO A;  3SIT A;  4AGV A;  4QKN A;  5BNO B;  5LK7 B;  1H8V A;  1SFP A;  2GH2 A;  4Q4W 3;  2DBN A;  1W0N A;  2DCT A;  2VMG A;  5F2S A;  2WYS A;  4I0W B;  4UF0 A;  3RWK X;  2C26 A;  2RDQ A;  1HB3 A;  4AVB A;  3ATG A;  3ILF A;  3NNG A;  1RUH 1;  4L8Q A;  1W8W A;  4CPB D;  3H9A A;  1W2U A;  4Q1P A;  1BVV A;  2ET7 A;  1CX4 A;  3QCW A;  4ONU A;  1BEV 1;  4HSL A;  3LA7 A;  2VQ0 A;  1W05 A;  1RUH 3;  3Q8E A;  1X33 A;  3VBF B;  2CGN A;  3BI3 A;  4BA6 A;  1RGS A;  2VMD A;  1BK1 A;  5IW0 A;  1BEV 3;  3WUD A;  3AYA A;  3OBA A;  1RXG A;  2PHT A;  2RMU 2;  4JRL A;  4R4X A;  2LRP A;  2XBO 2;  2ZX0 A;  2QQI A;  4OI1 A;  2VUD A;  2ZX4 A;  3POY A;  5F32 A;  1LEM A;  5BV6 A;  5A1F A;  3K75 B;  2VCM A;  3HPN A;  4YAR A;  5EYY A;  4CVU A;  4K8F A;  4LIV A;  1JUH A;  2BW8 A;  2ARA A;  2ZHL A;  5GZE A;  4IGP A;  4PI2 A;  3VHP A;  4R9A A;  1DYO A;  3NWK A;  3N7K A;  3VBF A;  4KWJ A;  1OKQ A;  1Q8S A;  2W39 A;  4M3C F;  1T6G C;  4MXW A;  2JEC A;  1GLH A;  3B7M A;  3BN6 A;  3WEZ A;  2VUL A;  2YRO A;  3DV8 A;  4NHX A;  1UZW A;  3JUU A;  5FZM A;  5EIY B;  1OH3 A;  4OHX A;  3HBK A;  3V0A B;  2ARC A;  1ND2 B;  5F6K A;  4LE4 A;  1UXZ A;  5LA0 A;  4JQT A;  3HAG A;  1UQX A;  1OA4 A;  1WA6 X;  4LE3 A;  1COV 2;  1URX A;  2CY6 A;  5FYS A;  3BTY A;  3BU0 A;  4Z2W A;  3NNJ A;  2GC2 A;  2VOW A;  3NV1 A;  4XET A;  4EWD A;  3VD7 A;  4CSW A;  2FCT A;  2R07 2;  4QX0 A;  3CIH A;  3ZIX A;  2C4X A;  5IVC A;  3EYP A;  1O7F A;  3CU7 A;  2TEP A;  4Z1V A;  1ND2 A;  1YXW A;  2XJT A;  4QPG B;  3MI8 A;  4FXK B;  5FFO C;  4QT6 A;  3VDC A;  4NHY A;  5KR7 A;  2JDN A;  2HWC 2;  2IXL A;  3LKJ A;  2QDR A;  1OUS A;  1TMF 1;  4BPZ A;  2UWA A;  4HXC A;  5CA6 A;  5J1X A;  3VD3 A;  1LOF C;  4AEM A;  2YHJ A;  5FOB B;  2HWF 1;  5JAX A;  1UY1 A;  2CWM A;  2P6H A;  1TMF 3;  4XTM A;  2A3X A;  3IBM A;  1ND3 B;  4QPG A;  2HWF 3;  5DZG A;  4YVW B;  5CBL A;  3O1M A;  1A78 A;  2VXR A;  2VW2 A;  3JBG 1;  2HWD 1;  2XHK A;  2NPI A;  4C1X A;  4MOA A;  4HPK A;  1F31 A;  3B9I A;  1DBN A;  3JBG 3;  2HWD 3;  3WNP A;  3K4A A;  2B9V A;  3P1I A;  1HQL A;  1IKP A;  1NUK A;  5T3N A;  1CON A;  4W6X A;  3D6E A;  1FV2 A;  2A6Y A;  4CUA A;  4E2Q A;  5F7U A;  3GZT B;  1GOG A;  2IXK A;  1JBC A;  4QHB A;  2JE8 A;  2FQP A;  4E4H A;  3WQ1 A;  4D7S A;  1GP6 A;  1H2M A;  3F2Z A;  4ARX A;  2W47 A;  4EN7 B;  1W2A X;  1RVF 1;  2E6V A;  4PLO A;  5KHJ A;  4R4Z A;  1LJ7 A;  2DVG A;  1SLB A;  4AQ2 A;  5CIR A;  3GNE A;  5T5P A;  5AVA A;  4BIS A;  1RVF 3;  3ZFF C;  1QHD A;  5T5L A;  2VE1 A;  5C4W A;  1NE4 A;  3GCW A;  2DCY A;  3K48 A;  2QKD A;  4QDS A;  4COW A;  2E51 A;  4LOR A;  1K5M C;  1BK0 A;  4E2S A;  5FY8 A;  2ZGO A;  1Q5O A;  1ASJ 2;  2VBD A;  1EV1 1;  1AUY A;  4D6Q A;  2YC0 A;  3JZV A;  5H9S A;  5IVE A;  1Y3T A;  3KM5 A;  4FFG A;  4K1Y A;  3B01 A;  2BVV A;  3D3A A;  4RS5 C;  5CKN A;  4JX0 A;  3VHR A;  2CAV A;  1D0H A;  1EV1 3;  3DEC A;  2TBV A;  4RSU A;  1VAK A;  1GQG A;  1FV3 A;  3WNL A;  4AXO A;  2PQQ A;  1EYB A;  3FC0 A;  5FPA A;  1XSR A;  3HWJ A;  4COU A;  3ZPO A;  1QF3 A;  1MEC 2;  2FZ2 A;  5K4L A;  2X10 A;  2W2I A;  3KHC A;  1L7L A;  4G9S B;  4BQ2 A;  4K20 A;  4Z82 A;  2XB6 C;  1S2B A;  4HN1 A;  4I0A A;  4DZG A;  4LOS A;  4BJ0 A;  3EXU A;  5HXV A;  3ENR A;  3UKT A;  2PYT A;  4DXS A;  3T30 A;  4DS0 A;  4JGY A;  5FPU A;  2RJ2 A;  1W39 A;  2VZ3 A;  4IW3 A;  3WNN A;  4BK4 A;  2LW8 A;  4MAD A;  2V5D A;  2EXJ A;  1IHM A;  3ASI A;  4R9B A;  1Y9M A;  3POB A;  3MIE A;  2JIJ A;  1YIF A;  1UKG A;  1JZ7 A;  3ZN4 A;  4CEW A;  5K0U B;  5DG2 A;  1O6U A;  2VMF A;  5C5U A;  1UYP A;  4M3C A;  1XYN A;  3VGI A;  4IE5 A;  2BGC A;  3AP7 A;  4LLF A;  1XPW A;  1VBB 2;  4PCR A;  3I59 A;  5GKA C;  5FMD A;  2W68 A;  2FDJ A;  1KS5 A;  4YW1 A;  1NAE A;  1BHG A;  2ZEW A;  1E57 A;  2WWJ A;  1BQP A;  1N1Y A;  2ZA9 A;  1QXJ A;  5EJ1 B;  3VBO B;  3M3Q A;  5AC9 3;  1QJY 2;  1QDC A;  2Y60 A;  5T55 A;  1U12 A;  3RDI A;  3UET A;  4Q4Y 2;  5K0U A;  4HMZ A;  4XAB A;  4S2H A;  3V56 A;  5JPN B;  3LGR A;  1DQ2 A;  1ULE A;  3UJQ A;  1HXS 1;  4OCT A;  1AR7 1;  3IMM A;  3M7A A;  4UBH A;  3JQX A;  1V6I A;  3M3C A;  4D6R A;  4FOY A;  4FFF A;  3KLS A;  4ISR A;  5FXV A;  4MGI E;  1LHU A;  2WL1 A;  1AR7 3;  3TN9 2;  3S57 A;  1AR8 2;  1D7P M;  1PK6 A;  1SAC A;  3A22 A;  2QTW B;  1RIR A;  5FYU A;  2BRT A;  2HJI A;  2OYZ A;  3VBU C;  3WW2 A;  2ZGK A;  4AGG A;  2DFC A;  2BBV A;  2E53 A;  2D6P A;  4XPV A;  5IT6 A;  2IXC A;  4BZ4 A;  3I3D A;  5IVF A;  1GZT A;  4OLL A;  1NT0 A;  1OI6 A;  3MID A;  1PGW 2;  3NMB A;  4HK9 A;  3VB9 A;  3WCR A;  1AL2 2;  2ADE A;  5A7W A;  4JCK A;  3PMS A;  5LA2 A;  2IC1 A;  3N9Q A;  1W28 A;  3MFA A;  2WNV B;  4WBB A;  5DZE A;  3ZXL A;  3ABZ A;  3WP3 A;  2EID A;  3WNX A;  1Z7S 1;  2GN3 A;  1FMD 1;  3ZFE C;  3MV1 1;  1TVG A;  4CDQ C;  5JXJ A;  2JIG A;  2JG9 C;  1G9D A;  4ASM B;  3D0S A;  5ERL A;  2W87 A;  4FPH A;  1FMD 3;  2YGM A;  4LKE A;  4BH9 A;  5IK8 A;  4GH4 B;  1H1A A;  2O1Q A;  4YW6 A;  4WVV A;  2AR6 A;  4PQQ A;  3I7D A;  1UY4 A;  1F8V A;  1V6K A;  5J98 B;  2VAU A;  1E5I A;  1ZZC A;  1XB9 A;  1JMU B;  1YJL A;  1IGO A;  1QDO A;  2XJQ A;  1RUG 1;  2WO1 A;  2ZAB A;  3AFG A;  4ZY9 A;  4XEZ A;  4Q0S A;  2VTF A;  1X8M A;  3ZM8 A;  1RUG 3;  5FO7 B;  1FOD 2;  1T6B X;  1YQ6 A;  3SXW A;  3IPV B;  1HRV 1;  1AHS A;  5A3P A;  1D0G A;  2WRA A;  4NRM A;  4QQL A;  2JDA A;  3MDP A;  2W5F A;  2CWS A;  2CU5 A;  5FOJ B;  4IND A;  1X50 A;  3AMM A;  4OZO A;  4WM8 B;  4QXC A;  1OA3 A;  3KCY A;  4FPO B;  1X7N A;  3OD0 A;  3LSD A;  2OPK A;  5LZ6 A;  1IG3 A;  4MO3 M;  2MPF A;  4QB1 A;  3MW4 A;  1OKO A;  2XWJ B;  1R1A 2;  4UOJ A;  3VHO A;  2GC0 A;  2R06 2;  4JZR A;  1HKD A;  2XLF A;  1LGC A;  2ZTN A;  5FQ0 B;  1WW5 A;  4WM8 A;  5JXH A;  1TME 1;  4L0P A;  4XFH A;  1RUN A;  1IZ3 A;  1UWW A;  3O7O A;  1U0A A;  4RFT 0;  3FFQ A;  3P6B A;  2Y6L A;  1TME 3;  2QCS B;  2Y6H A;  3VDD A;  4Z8B A;  1PX3 A;  5CNA A;  2C5D A;  1W99 A;  4W6Y A;  3T2P A;  3ZYF A;  4IL7 A;  4Y5Z 0;  4CDW B;  1ENR A;  5FYM A;  2GMM A;  1SDD B;  3KVA A;  3AB0 A;  3ZXK A;  3DCQ A;  3PME A;  5FYZ A;  3LPG A;  3USS A;  1WCD J;  4A3X A;  3RZG A;  1A6C A;  4MX3 A;  4OHZ A;  2OW4 A;  4MSV A;  3DKQ A;  1F15 A;  5FMO L;  4QQO A;  4MG2 A;  2AEN A;  1PGS A;  1UZ0 A;  1G86 A;  1A8M A;  4XMA A;  4QPI B;  4ARY A;  1UYZ A;  5F5Q A;  2IFW A;  2A73 B;  2X53 S;  3A23 A;  4OHW A;  2UU8 A;  1HW5 A;  4R8H A;  5FP9 A;  2ZEY A;  2CTV A;  2ZMN A;  2XLG A;  4AGR A;  1B35 B;  1M4W A;  4YPJ A;  3MF9 A;  4IET A;  4D94 A;  2ZCW A;  2QZ3 A;  5DN2 A;  1PMJ X;  1G6N A;  1GZW B;  2EVX A;  5D2A A;  1S0B A;  1CAV A;  1LOA A;  1G7Y A;  2WC2 A;  4QD2 A;  1VMF A;  5LK5 A;  1SLA A;  3WLU A;  2QVS B;  4DOU A;  1Y4W A;  1ULP A;  4QPI A;  4CDX A;  2EF6 A;  1Y9G A;  3POG A;  4YGE A;  5KHH A;  5HCH A;  2DCJ A;  3LEI A;  4CPB A;  2OZ6 A;  2E7A A;  2XON A;  2ZGL A;  4URT A;  3WDX A;  1C1F A;  2ZAC A;  4A7Y A;  1QXP A;  2WZR 1;  3PL0 A;  1HIX A;  1PGL 1;  5JZG B;  3CF6 E;  2HWF 2;  4HSJ A;  3UYJ A;  5FYC A;  3T2T A;  3SC7 X;  4A44 A;  2WZR 3;  1YI7 A;  2AEY A;  3WHT A;  1AX0 A;  2JKX A;  1DYP A;  2D43 A;  4AED C;  1ALY A;  5L36 A;  2W0X A;  5DUU A;  1MVQ A;  1KEX A;  3B3Q E;  3TNQ A;  3G7D A;  4AAX A;  2ZGR A;  3B00 A;  5DQ0 A;  4CXX A;  5E16 A;  4ES8 A;  5JZG A;  1UXX X;  2G19 A;  1X8E A;  3ECQ A;  1ENQ A;  3SEP A;  4SLI A;  1C5I A;  5CFC A;  2J1S A;  3RI9 A;  2QQO A;  2GP5 A;  2UWB A;  4LUM A;  4CCK A;  3RWN A;  4PDW C;  3MPP G;  3VDB A;  2DCZ A;  4LEJ A;  1BLZ A;  3ZXJ A;  1VBD 1;  2RHP A;  1RYY A;  3CNA A;  3THD A;  4CP9 A;  5FDB A;  5JSO A;  3IB3 A;  4AVC A;  1YLL A;  3WF0 A;  3ES1 A;  4D7Y A;  3VBH C;  3WP4 A;  1KGY A;  1RUO A;  1VBD 3;  3C7E A;  1OPM A;  4CA9 A;  4EQV A;  2Y6G A;  5FUP A;  2VW0 A;  3WG4 A;  4BHP A;  2BPA 2;  5F8P A;  2Q8O A;  1ZRR A;  1DQ6 A;  2F4P A;  4PF5 A;  3WDU A;  3K3O A;  5K7P A;  3IKW A;  4KG0 A;  4M0N A;  2JDP A;  4RD7 A;  3AX4 A;  3B02 A;  3E5U A;  3N4M A;  1NYW A;  3HQU A;  4Q0V A;  2F4L A;  1I6X A;  3QLQ A;  4IEW A;  4QPW A;  4YGD A;  3LEK A;  3NJY A;  1IQA A;  2WNU C;  5I8T A;  5L19 A;  1AR6 3;  3GAL A;  4DO0 A;  1O3R A;  3OGS A;  5I0R A;  4URA A;  4Z2A A;  5FLI A;  2J1E A;  4SBV A;  1XND A;  4FQ4 A;  4CDU A;  1F4A A;  1AYM 3;  3BCW A;  4JQR A;  3JD7 2;  3WQ0 A;  2XJV A;  2WAB A;  3H42 B;  1ZX5 A;  2C0Z A;  4WVZ A;  3T0D A;  2NMO A;  2XML A;  3IZO A;  3LIG A;  4OI0 A;  5J96 B;  5C8C B;  3UV9 A;  1DGR N;  2IUW A;  4QX3 A;  5KHG A;  1RMU 1;  3BIW E;  4XQD A;  4B1M A;  3S5A A;  5FY0 A;  2DUR A;  3TEY A;  2DYC A;  1RMU 3;  4W50 A;  4YVS A;  4HKO A;  4WM7 C;  3N9N A;  3BIE A;  3O1R A;  4Q2F A;  2D6L X;  4NIA A;  1YWK A;  4Q27 A;  3HT1 A;  1S0D A;  4PHZ A;  3RZM A;  5FYH A;  3ZN5 A;  3AMP A;  3FL7 A;  1C1L A;  2VUJ A;  3PJQ A;  3CZJ A;  3T09 A;  4P9L A;  2PQS A;  5IAT A;  1BZW A;  2RR1 3;  2YV8 A;  1OH4 A;  5T5O A;  3LDB A;  3FHA A;  4QGL A;  5H9Q A;  2DDU A;  3CJI B;  3ZYG A;  2W9X A;  4GA9 A;  4QHO A;  2JDH A;  5FV3 A;  5AC9 2;  5CEH A;  4E4D X;  2AC1 A;  1BCX A;  2ZX3 A;  1VLN A;  3WV6 A;  1JYT A;  4NID A;  3AKP A;  1D2S A;  2ZGN A;  2ZXQ A;  3IN9 A;  4YG6 A;  5DAW A;  5GLW A;  3J7M A;  2VL4 A;  1W9F A;  1GNY A;  3WF1 A;  3N9L A;  5T5J A;  5H9P A; 
#chains in the Genus database with same CATH homology
 1OUR A;  2JDN A;  5A6Z A;  2JDU A;  5A70 A;  1OUS A;  1UZV A;  1OXC A;  1UQX A;  1W8F A;  2WRA A;  2VUD A;  5A6X A;  2BV4 A;  2WR9 A;  2JDY A;  1OVP A;  4UT5 A;  1OVS A;  2JDH A;  2VNV A;  2XR4 A;  3DCQ A;  5D2A A;  5A3O A;  2JDM A;  3ZDV A;  4CE8 A;  5A6Y A;  2JDK A;  2JDP A;  2BP6 A;  5HCH A;  2BOI A;  2CHH A;  1W8H A;  1GZT A;  5A6Q A;  4AOC A;  2BOJ A;  2VUC A;  1OUX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...