5C3RA

Crystal structure of the full-length neurospora crassa t7h in complex with alpha-kg and 5-hydroxymethyluracil (5hmu)
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
333
structure length
333
Chain Sequence
b'MEKAAVNEDGLVIPLIDFSKFLEGDETLKLETAKAILHGFQTAGFIYLKNIPIQPDFREHVFNTSAKFFKLPKEKKLEVGWTTPEANRGYSAPGREKVTQLTDPAEIEKIRSAAPDIKESYEIGREDEPGHPNPWPAEQDDLVGFKSTMNNFFDQCKALHIEVMRAIAVGMGIDANYFDSFVDVGDNILRLLHYPAVKSEVFKINPGQVRAGEHTDYGSITLLFQDSRGGLQVKSPNGQFIDATPIENTVVVNAGDLLARWSNDTIKSTVHRVVEPPKQEDVHPPRYSIAYFCNPNHKSYIEAIPGTYAAESERKYEGINSGKYLVQRLAATY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymine dioxygenase
publication title Molecular basis for the substrate specificity and catalytic mechanism of thymine-7-hydroxylase in fungi
pubmed doi rcsb
source organism Neurospora crassa
molecule tags Oxidoreductase
total genus 98
structure length 333
sequence length 333
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03171 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily
A PF14226 DIOX_N non-haem dioxygenase in morphine synthesis N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.330 Mainly Beta Sandwich Jelly Rolls B-lactam Antibiotic, Isopenicillin N Synthase; Chain 5c3rA00
1RXFA 1UNBA 1HJGA 3ON7A 1WA6X 2VBBA 1UOFA 2VBDA 1E5HA 1W28A 2VAUA 5C3RA 2Y60A 2BRTA 1ODMA 1BK0A 5C3PA 1W06A 1W05A 1QJFA 1HB1A 1OC1A 2VBPA 3ZOIA 1IPSA 2IVIB 1HB3A 3ZKYA 2WO7A 1DCSA 1W04A 1W3XA 5APAA 1GP6A 2JB8A 1ODNA 4XAEA 2CSGA 1OBNA 1HJFA 1W2NA 2BU9A 5C3OA 1W2AX 1W9YA 3OOXA 1E5IA 2DBIA 1RXGA 1HB2A 1HB4A 2BJSA 5C3SA 1UZWA 1QJEA 4RGKA 1UOGA 3ZKUA 1W3VA 2VE1A 1BLZA 2DBNA 1E5SA 1GP4A 2JB4A 2Y6FA 1QIQA 1UOBA 2IVJA 1W2OA 1E5RA 1W03A 2VCMA 1GP5A 4BB3A 1UO9A 5C3QA
chains in the Genus database with same CATH superfamily
3HQXA 5FBJA 3ME2A 1AX1A 1QEXA 4AW7A 2D7FA 4CCCA 2C5DA 1SPPB 2VMGA 1LNSA 1IS6A 4QKBA 4LQRA 5E8AA 3LIGA 2YV8A 1PGL1 2R072 3I59A 1W6QA 4A41A 1W2TA 3JZVA 5HI0A 5A7SA 1NCQC 1Q8VA 3A4UA 3JQWA 4QPIC 4S2HA 3T3YA 4YZ1A 2Z2SB 1WW4A 2BBAA 2AC1A 2P17A 4HT1T 3WNLA 1W28A 2I74A 4XFCA 4C0HA 4I3PA 4BXSV 3UK9A 3LA7A 1I5ZA 1LENA 2VCCA 4QGNA 4B8EA 2KD7A 1C8M1 3T2PA 1REFA 3Q8FA 3O12A 3W5MA 3S5AA 1YHFA 1ZM1A 1RVF2 2PYTA 3HNBM 3ZFGC 2G9GA 5K0UC 2HKXA 4FTEA 1C1LA 1GWLA 4DPNA 3AB0A 1VMHA 1HQLA 4L11A 4Q4V1 4GWIA 3I97A 4MGIE 4AG4A 1S0GA 1HRV2 1ULPA 3HQUA 5BV6A 1W04A 4UAPA 3JBG1 3JQXA 3NV3A 1N1TA 5DAPA 4GIQA 4C8DA 5EQUA 5FUIA 2XOMA 5LWBA 2GC0A 4FFGA 1W99A 5EJ3A 2BVBA 1QQP2 3UJOA 2BGCA 4L97A 1JYXA 4LBQD 1QDCA 1LB2A 3WCRA 2PLV2 3SQOA 5IW0A 2AEZA 2HYXA 2XXZA 1AYM2 2R1BA 5DQ0A 4RHV2 3LDRA 1RHI3 4YG0A 3DEMA 3P5BA 1ZBA3 4E9KA 1W2NA 5T55A 5ACA3 1EUTA 1QKQA 4HKWA 1KQRA 1VIWB 4LHLA 3SMHA 3NNMA 3V56A 1DZTA 1Q8PA 4P00B 3CJIC 4IESA 3VD5A 4AI1A 5A6YA 1JYVA 4LTAA 4AE2A 3RMYA 1R092 1WBFA 4NE9A 1LOFA 4RA0A 4YYOA 4YW5A 1J83A 1L7QA 1W0NA 4XF4A 3ZDVA 1E5IA 3ZFFC 5J37A 4COWA 3S7EA 3MIHA 2WS93 3ZR6A 3ETPA 1JH5A 4XTMA 4IGQA 4EQVA 1YLLA 4JGZA 1OFSA 1RJ8A 1TQ5A 3WDYA 5CFCC 1LTEA 1AR62 4FCAA 2BJSA 4MGSA 2VCAA 5I0RA 3JD71 3R4UA 3VBSA 3BIEA 3O1SA 1UZWA 1IZ3A 1RUJ3 4GB33 5EWSA 5FY7A 4FAHA 5FZMA 3KMHA 2VU9A 1WGPA 3KT4A 1LCLA 2NMNA 1OKQA 4YM2A 4UFHA 3ZYPA 1YQ6A 1T6GC 4A3ZA 2WC2A 3V64A 2WNVB 1DG6A 1E5SA 3KCXA 4PLNA 2YC2A 4QQPA 4FOWA 4J6GA 1Y9QA 4BQ5A 4LT5A 1G9AA 1FXZA 1ONAA 2PN5A 5T5OA 4BMBA 3H0OA 1O3RA 3KV9A 2J1AA 2ZGMA 4QX7A 3WEZA 1ULGA 3GALA 1IQAA 1ZBE1 3H9AA 4GWNA 4YG6A 1O6UA 4AVSA 3UT0A 2D93A 4CUAA 3PUAA 1KJRA 4XXAA 3MGUA 3UNPA 3J4UH 2WL1A 5FZOA 5IFTA 3DCQA 1YFXA 1JOPA 2A6VA 3ZFEB 1YQ5A 2W47A 5I0UA 1VBD3 3ECQA 5HCFA 2GU9A 4ZS2A 3B94A 3NL1A 4DFSA 1XC6A 2D43A 1DQ6A 3J7NA 4L8QA 4LKDA 1WMDA 2GMPA 2ZCWA 2JE9A 1BZWA 2YBPA 3JB8A 5A70A 1SCSA 2K0GA 3BU0A 5CB7A 5JOYA 1GSLA 5CFDA 1JZ5A 2V4AA 4CEYA 1LULA 1UY4A 2ZHKA 4IEPA 4WVVA 3AFKA 4P9JA 2VZOA 4CRQA 1Z7S2 1W8ZA 5I8SA 4D3WA 1AXZA 4XJZA 2RV9A 1UCXA 5FZHA 2QFEA 1QJY2 2VNRA 1TNRA 1KFXL 3ILNA 4S2DA 4CEWA 5KR7A 3RFRA 3VD4A 1BBT2 4NRMA 4OUMA 5T5JA 3N9QA 5JIUA 5JR2A 3I59B 1W6QB 1NXMA 3S0MA 1SCRA 1VRH2 2CGOA 5HCHA 3OPTA 1B35C 2HWD2 1QGLA 3AX4A 4PF1A 4XBLA 2Y33A 4XAAA 3T0AA 3ZX7A 4QHZA 3UESA 4LKSA 4CDXA 5CKQA 5FFOC 1XE0A 3DXUA 5JI9A 2EXKA 1ODNA 1SLBA 2ARAA 4E2QA 1QQP3 4XJ8A 1W8TA 3M8LA 2G1MA 3BPZA 2PLV3 5IK4A 1GZCA 2BOIA 2QZ3A 3WDXA 2QDNA 1MZ5A 3PLQA 1XOYA 3ZR5A 1V6KA 3OD4A 3OUIA 4KWUA 4RS5C 2VL4A 1GNYA 4JDNA 3ZDSA 3MW4A 3IN9A 3M70A 2ZMNA 4M4RA 3R4SA 2E7QA 4XF3A 4ARXA 4X6QB 2YB7A 1NLRA 1R093 3PUIA 4QPGC 1OH3A 4X8NA 1EPZA 4L2NA 4RR3A 3N9NA 4TSVA 4QGMA 3MF6A 3WOGA 5F39A 1ULCA 3WLUA 5J1XA 1LGCA 2MNGA 1D2QA 3S30A 1DP0A 3I3EA 4RQPA 2VW1A 2QQIA 1AR63 2Y38A 1SLCA 3A7QA 5C6CA 2E51A 3WHUA 3J8F2 5L19A 2PHDA 1QJEA 4DXTA 2GP3A 4IEZA 3KVBA 1HXS1 4Y1UA 4YFWA 5FQ0B 1LEDA 5LATA 5HV0A 3IM0A 5F2SA 5C9AC 4YGCA 1PM7A 4Q4W3 3NAPA 4GWMA 5LBFA 1X8EA 3FC0A 3NRUA 3AKTA 4XHXA 1R1A2 5FR3A 3THDA 3ZLIA 3RZLA 3AZVA 3BTZA 4CU9A 1WCQA 1GANA 5IHRA 5DAWA 2HWE1 2ZGPA 1VMJA 4GAZA 1QJU3 5L73A 1O8PA 1PO11 3MIBA 4JGZB 2RHPA 1VPHA 4AI0A 3LOIA 1RXFA 1CVNA 1PVC2 1WA4A 4OCTA 2DCJA 2ZGLA 1OLQA 1ENQA 5FP8A 3H1WA 1UNBA 5H9QA 1ND3A 3VBSB 5CFCA 1JU4A 2CDOA 3CZJA 1G6NA 1PGW2 3UGFA 2XVLA 4XJ9A 3H3LA 4AGVA 4LHSA 5BNNA 5KXCA 1POV3 1TVGA 2WFF3 3DKWA 5FMOL 4Z2WA 2UY8A 1H2MA 2XQXA 1WLDA 4HK8A 1MS0A 3AKSA 3LSEA 1Y3TA 2AGSA 1O4TA 5DDJ1 4E8CA 3NWKA 5EIYB 4ASKA 3K51A 2FZ1A 3ZYHA 2JG9A 2P6CA 5C7GA 4E4SA 1Q8OA 4OI4A 2ZGNA 4HG6B 1AHSA 2OT7A 4NAMA 1AUYA 4JQTA 5A3OA 2UWBA 4D8MA 5CKNA 1I1EA 1W05A 1O5UA 2RM23 3EBRA 1I6XA 4CZSA 3URFA 3C3VA 3D3AA 4JV4A 1Z7S3 4YGEA 1NLSA 3K3NA 4RFT0 1NA1C 1RMU1 5GKAC 3KT7A 2IXJA 3FFZA 5F3EA 1PZ7A 1XNDA 3PVEA 5F7UA 3DYPA 3MFCA 4QU2A 2WO3A 3M3OA 3WF1A 4NN0A 1UZVA 3IDAA 1AR72 3ASIA 1WCUA 1ND2C 1VRH3 2ZMLA 2YC4A 1XJAA 2WBKA 5FJKA 3T4VA 5LB6A 2VOTA 5GALA 4YZ2A 3CDZB 5A7QA 4FXGB 1UN1A 1OF3A 3K4ZA 3M7AA 3N7JA 2DYCA 2W91A 5DABA 5CFDB 3MI8A 1X9TA 1OLME 4XAEA 3FBYA 4XXPA 1PMJX 4RL7A 1GQHA 2Y0IA 1XNTA 4COUA 4DXSA 1HJFA 4LBOA 4FPJA 4XTPA 4R8HA 4META 2C9AA 2C26A 1IGOA 3WX5A 5IK8A 3S7IA 3OBZA 3ZXFA 4DRRA 3EMRA 4BQ1A 2C6SA 5F37A 3ZYBA 3WG2A 1W6PA 5KC5A 4O9EA 4XBQA 1PGSA 2Z4FA 3B01A 3D8CA 1OSGA 5J48A 4UW6A 3CKHA 3DL3A 2D40A 1F9KA 1HB2A 4LJHA 2ET1A 4PDWA 1MEC1 5A33A 4BA6A 3BB6A 1NCQB 5LW9A 3KS7A 4UBGA 4GH4A 1RUH1 2YFZA 4PIZA 5FMBA 3OBTA 4BHPA 4EZHA 5L7OC 4XFIA 3MIFA 4P5HA 2CHHA 1JZ3A 4CXYA 2ZGQA 3AXEA 1GQGA 3J8F3 4AF9A 4NIHA 2JX9A 3EO6A 5JUVA 2V09A 1D4M1 2VQ0A 1YUDA 1SLTA 2QZ2A 2ZX0A 3H7JA 1WLCA 4RS5A 5K0UB 5FO7B 3USSA 2X29A 2Y6FA 1D4VB 2O8OA 2W2IA 3K46A 1UU4A 4GKYA 1U5XA 3CU7A 1YJKA 4IXLA 4WV8A 4H3WA 4QPGA 1PMIA 4RR3B 1ULEA 2YFUA 3JB4C 5FP7A 1KFUL 1QXJA 1GNHA 4FFIA 2C9KA 1BQPA 1LECA 2ERFA 1EUUA 2CL2A 4RQPB 1PVC3 1YWKA 3HBZA 2JDMA 4FXKB 4UW4A 4BYYA 1CZSA 3FLTA 3M3IA 4O7XA 4OFGA 4N53A 2HEWF 3TEYA 3OCPA 1BEV2 2P34A 3AL6A 4P14A 2WAAA 2QQMA 3AYAA 1J1TA 4FSJA 3AKPA 4K20A 3WQ7A 4CU7A 5CBLA 1BK1A 4M0NA 3H8OA 5C9AA 2FDFA 3CJIB 2W1QA 1G9DA 3B02A 1UF2C 1FX5A 3H50A 1VBC1 1AR93 1C8NA 4CDQC 3C7FA 5C8CC 1AXYA 4HK9A 2PHTA 3P3PA 5FXZA 3E1F1 1KDMA 4QU1A 3VBHC 5DUUA 3ZFFB 1WWYA 2ADDA 4AEJA 3RI8A 2ADEA 3EXUA 4FPYA 3WNOA 2RR12 4Y1YA 1HIXA 2E9QA 2R16A 4L9BA 3HBKA 5EZWA 4JRLA 4AXOA 3QH6A 3LPGA 3VKOA 1G7YA 5CFCB 1W0PA 4GULA 2HH9A 3BN6A 3C7GA 3ZKYA 3POFA 3AKRA 2VXRA 2WZPP 4K21A 4COZA 3ROUA 4ZZ8A 1AR73 1GR3A 3I2GA 5FV3A 2AR6A 2B9UA 1VBE3 3IMNA 3BU7A 4QMAA 3F95A 5FDBA 4LA2A 2ZACA 2O1QA 1K5MC 5ABJC 3U1XA 1Q8SA 2BUKA 3FJSA 5FZCA 3IDBB 2EIGA 3DECA 2WFPA 3WV6A 2WNVC 3B9IA 1ACCA 2QNKA 2HEVF 4LHNA 4LLOA 4QM8A 1OOPC 3TYJA 3TEWA 3I2IA 5F5QA 4JZRA 3USUA 4A6SA 4OHWA 2X53S 1ZVFA 3RYPA 2BGPA 1FI2A 1X50A 1QJX3 3VBUA 1PO22 4CTEA 2ZAHA 4MOAA 2WQ4A 2BVVA 1DQ2A 4FO9A 2EAAA 1UY1A 1JYCA 4EWDA 5T50A 2WNUC 3A23A 5IVBA 4YZ3A 2HWB2 2ID4A 4GKXA 1ENSA 4OZXA 5CISA 3OGRA 3ZSJA 1QH6A 3ZFEC 1W2UA 2SBAA 2VULA 2ZGSA 3N9OA 2A3XA 1AL21 2JDPA 4HXCA 5GLTA 4FFFA 4DEQA 1AX0A 2EF6A 1OA4A 4BU2A 2ZHNA 2D6MA 2RDRA 3NMBA 4HBNA 3IAQA 2PXJA 3OBRA 2WZEA 1RINA 1DGRN 4YW7A 1LOAA 2VZUA 3E97A 4W6WA 4XPVA 5J96B 5LA9A 4CCJA 4CCOA 1YYNA 2BQPA 1C8M2 1W0OA 2JB4A 1OUSA 1IPJA 3Q8BA 4FP3A 4M0HA 1W6PB 4QXHA 4AEDA 1UAIA 3ZN5A 2WUHA 4NIIA 2EALA 2IVJA 3I2HA 2QCSB 1V6NA 4TWTA 4AVBA 4KWLA 2V4VA 4YLZA 2NM1A 4PDWB 1PNFA 5LA2A 5F5AA 1UO9A 2LM3A 4AVVA 5A33B 3W58A 1QOOA 4Q4V2 5A3NA 4GH4B 4GMP1 3U78A 1SBFA 4YW3A 3ZXAC 1N1VA 4NAOA 3ZPYA 1YFUA 2TNFA 3OD0A 3JBG2 4DZGA 2BWAA 2HWF3 3K3OA 1Y4WA 4CDWA 4U36A 3VLBB 5L7OA 2BYVE 4Q4X2 3WQ1A 4DY3A 3K4DA 5B4NA 1Q3EA 3ZVXA 1HX6A 2A73B 2C4XA 5CADA 3LFMA 2D3RA 4ZXKA 2E26A 1AR81 4OI2A 1POV0 4Q2FA 4XFFA 4W6YA 4AAPA 1BEV3 4A7YA 3ZYJB 4LMFA 3HT1A 4RS5B 5FZLA 5A80A 1YI9A 1J58A 2RJ2A 1DYOA 1NG0A 1KS4A 5DUWA 4QPGB 4ZHNA 2E33A 3TNQA 4IDZA 1OLMA 3RJRA 1XXNA 2RVAA 4D7TA 5A32A 2ZPXA 4PQ9A 4LO8A 2P1BA 4PLOA 4Z1VA 1LOGA 3BGAA 4Z2AA 4OMDA 3V0BA 1PIV3 2DCTA 1IS3A 2XG3A 5HPOA 1MZ6A 3K2OA 1NAEA 4WVMB 2HWC1 3WG3A 4ZZ5A 1TG7A 3UKTA 5FTTC 3LGRA 5CG8A 3KQ4B 2UWAA 3BTYA 1GP6A 1QF3A 4LK6A 1W6NA 3ZPOA 5C9AB 1W6MA 1YFWA 2VVEA 1CX1A 2W95A 1PZ8A 1D0GA 3WNKA 1C4RA 1PM4A 2OQ7A 1W90A 3RSJA 3LPFA 4ATEA 5C8CA 1K42A 4CDQA 2ZX3A 4FTBA 2BNMA 1O5LA 3KV5A 1LOFC 3OGVA 2YPDA 4KH9A 2X5IC 5LBCA 3VBHA 4LBJA 2LUWA 3M2MA 2XL7A 4N90A 4CCMA 1RTVA 4NR1A 4NIAA 1T2XA 3VKLA 3J9SA 5D8AA 4KBZA 3RWNA 1PX3A 3HQRA 1PO23 4B1LA 2DWRA 1XYOA 1FV3A 2E7AA 5LRRA 3TRSB 1H2NA 2DURA 2WLPA 4OHVA 4E2SA 4IEVA 4COVA 4IE5A 4P9YA 5IVYA 3VV1A 3WCSA 3WP3A 4Q0UA 4AHYA 3KF3A 4DOUA 2R041 4ZPIA 1JOBA 5DAQA 3WDVA 3HPNA 3AVRA 1ZBA2 2X10A 1ULDA 5ACA2 3VUOA 3ZN4A 1O91A 4LO6B 4RGKA 1NY72 1WCKA 3HMYA 3I49A 1JBCA 2VZTA 2KM2A 3ZXDA 4FQZA 1XQNA 4WM7A 4M3CF 2ZA9A 2VVDA 2JDAA 2IWGB 2XJVA 2XVKA 3L9JT 3LWCA 1OOPA 3O0XA 3SXWA 5K8SA 4V2WA 4HLTA 2A6YA 1WMFA 1JHNA 1G9CA 2JENA 2B39A 5DZFA 4L92A 3SCGA 2VTXA 4E4DX 2J42A 1C8M3 4JC1A 4UFMA 3VBUB 1NA1B 1OLRA 1UOBA 4LO7A 4Z82A 2WS92 2W1UA 1TZOA 1GFF2 5FZ7A 3RYKA 4DMIA 1XYPA 4O9GA 1UYYA 1F8VA 3KGLA 1W03A 3NNGA 1CAVA 5LASA 4N9HA 3IPVA 1VE0A 2ETEA 4W6XA 5I0SA 3UGGA 1XNCA 2WNUA 4Q4V3 4GB32 2VNVA 1RUJ2 1RUE1 1UXZA 4YSFA 5JIAA 3AZWA 2RMU1 4PT6A 4QHBA 4LEJA 1BJQA 5DG2A 3W21A 4DUVA 2QQJA 4RD7A 3WXPA 3JBG3 5FY5A 5L9BA 3VD3A 1OQ1A 3HAGA 3WUDA 5JVVA 2AEYA 4CEYC 3K48A 2DCKA 2ZTNA 1R081 2PELA 3HT2A 3B69A 4LBMA 5FAXA 3M3EA 5AVAA 2D6PA 4MVTA 2ATFA 4AZZA 4ARYA 2RS51 3VBFC 1QJFA 5BNPC 4M4PA 3S57A 3ZYRA 2FD8A 4CEWC 2VBPA 3CEWA 2JXAA 3ZSMA 1JYWA 3ZXKA 3HVDA 1EAH1 1LHUA 4XQ4A 3MDPA 5GZCA 4B1MA 3NNFA 3A0KA 3LEMA 1DHKB 1VBD2 1GUIA 3MEPA 3PDQA 3PTRB 5D1IA 3GF6A 4AVAA 3MLJA 4LA3A 3ZSLA 4CDXC 4CDWB 2CWSA 5L7OB 3ORJA 1PNGA 2UU8A 4KWKA 4P9XA 4BK5A 4KU7A 4BE3A 1AYN1 3R6SA 3ACLA 4OI0A 1JU3A 1UMIA 1S1AA 1VLNA 1MS1A 4YRDA 4FPEA 5TSWA 5FO9B 4EN6B 5T54A 2ZZJA 3POYA 3AMQA 1OD3A 3JD73 5CAZA 2DVDA 3E5XA 2HBTA 2J1TA 3PHMA 3THPA 4C1WA 4C90A 2I45A 1HXS2 1W9SA 2D6KA 4PF5A 3VKFC 5F3GA 4HONA 1H0BA 2AZ5A 1GYKA 4R9AA 3QH7A 4XF9A 4XZUG 2D97A 3AYCA 3B00A 1A6CA 5C3OA 5F8PA 1FPN1 1OPOA 5A32B 4A45A 5A3PA 5JI7A 3O7OA 3VZLA 1OUXA 4A42A 4OQ8A 4RR3C 2P3JA 5EFUA 4CCEA 3V0BB 4DXRA 5BXXA 2WWJA 3FX3A 5F3IA 4FPKA 5J7MA 3W59A 5FYTA 3I3MA 1TME1 1ZBE3 1XE7A 4AQ6A 2YMZA 4MZUA 4RQPC 2W1WA 4CVUA 2WYSA 3GHMA 4XUPA 5BPXA 1RUF1 2UURA 1JUHA 3AZYA 3N9LA 2XWBB 1G9BA 3LDKA 5JLVA 1O3SA 4QPWA 2V5YA 3MICA 3X29B 1UIJA 1QWRA 5JZGA 3ZN6A 4IETA 2QQNA 2LW8A 3LEKA 4QXBA 4UWDA 4OLLA 5C8CB 4J25A 2PA7A 4PBOA 4CDQB 3WQ0A 3NVCA 4RYDA 4ZS3A 2XJTA 3NAPC 1QJZA 3ZKUA 3DPRA 1W3VA 4LBKA 5AC91 1KGYA 2YG0A 1OVSA 3KZ4C 4UFKA 3VBHB 1AJOA 1URXA 3WG4A 3M3CA 2GP5A 1GP4A 3POIA 2X5IA 2P5BA 2NZ9A 2ZGUA 3LD8A 5FZ4A 5JOXA 5CIRA 2IXHA 5JXIA 2NP0A 4DQAA 1QIQA 1DF0A 3QD6A 4HOOA 4UFLA 5G05L 3KV4A 4XETA 5FZDA 2HEYF 2FDGA 1COV1 2BV4A 5FZEA 5KHIA 1V00A 4L0PA 3WF3A 4DUWA 1E5RA 1OF4A 2AH2A 1OKOA 3M3QA 3SC7X 1RMU2 3SEPA 5BNQA 4LBNA 3GYDA 1ND3C 2OZJA 4XURA 2E53A 3WHTA 3TB0A 4CU8A 4HSJA 3ABZA 5C4WC 5BNNC 1MACA 4LE4A 3AK0A 4YGBA 1G86A 2E63A 2QKDA 1HJGA 1K5MB 1KJLA 4DO0A 5ABJB 1WA6X 2YBSA 4XCBA 2R0HA 1UOFA 4YGDA 3D5OA 5FYHA 1NUKA 3CNAA 3J7MA 4Q4W2 1GZ9A 2JG9C 3A0NA 5FZ0A 5A7WA 2PFWA 2VZ3A 4Y5TA 1XE8A 2J1EA 1E5HA 1OOPB 3LKJA 5F6LB 2Q8OA 2VQAA 1JZ8A 1F35A 3VBRA 3ZM8A 4LPLA 3HR9A 4X6RB 1QXPA 1W9TA 4A2UA 1ODMA 1QJU2 2JKBA 3CJXA 4N7UA 5C3PA 3KCCA 3HNMA 1A8MA 1CAVB 2A75A 3IPVB 2UYAA 3O1RA 1LHWA 1C57A 3NO8A 2WNUB 2WR9A 5IATA 4AHXA 3MIEA 3OYWA 2C1FA 4QX8A 3CZUA 2JICA 4WVWA 3WNPA 3LA3A 2WFF2 1RUC1 2B7YA 2OQ6A 4XILA 5FPXA 1FMD1 1MEC2 1ZZBA 4YVSC 3RZHA 3WSOA 1W3XA 2NMOA 2ZX4A 4PCRA 2EIBA 3UJQA 4AEMA 3LSDA 3ZXLA 3AP9A 3VN4A 3WW1A 3WDTA 1S2EA 1I9RA 2ORXA 2R32A 3K77A 3POJA 1CPMA 3DGTA 2BGOA 3JUUA 2EAKA 3OGGA 3OB8A 4XE9A 1FATA 5LA1A 4P9LA 1PHMA 1H8TA 2RM22 4LORA 3VHRA 4AEDB 5CA6A 2HBUA 4IEOA 5FOBB 1D4M2 1T6BX 1HXS3 4UXAA 3WT3A 2J7MA 1XU1A 2Q0AA 1ST8A 2VUDA 5IWFA 3VGIA 1CX4A 1H1MA 4YPJA 3MW3A 3J7HA 4UYBA 3VBFA 4C91A 5BNPA 4J1WA 1PZ9A 4Q0QA 2H0BA 4XQDA 5CU1A 1W9YA 2A6ZA 4D6QA 3AC0A 1O4YA 1UKRA 3T2QA 1WBLA 2MPFA 3R05A 4PDWC 5JR7B 4ISRA 1STMA 2HYKA 3AM2A 1Q5OA 2HWE3 2JDHA 2V5DA 4GH4C 1HV1A 1PO13 3ENRA 1WW6A 2QQLA 2DCYA 2Y6KA 5KWRA 1V70A 5FYCA 4LIVA 2D98A 3HN3A 1F15A 4FQ4A 5A7OA 1QDOA 4D6RA 1LOBA 3MIDA 4KGQA 1CJPA 2DDUA 1O3TA 3PIGA 4PHZA 1WMXA 1KITA 4L99A 5DPNA 1SHWB 1I5PA 1S0CA 5DDJ3 2VE1A 4BZ4A 3NKTA 1Q56A 2X8KA 3H3UA 1H9WA 3CHXA 3KF5A 3NNJA 1OURA 4JKMA 4Q29A 1YO8A 3N36A 2MEV1 3OEBA 1JZ7A 1V6JA 5FREA 1REEA 1UYZA 2PHUA 1XB9A 2W39A 1TEIA 2ZXQA 4IE7A 1UYPA 3BYWA 3MF9A 3FE5A 5K7PA 5JMCA 1GP5A 2DUPA 3OSDA 5FYZA 2A5ZA 1OQEA 1CAWA 1RMU3 4OVEA 4QGLA 3AJZA 2ZAAA 3ATGA 4N53C 3C7EA 1O59A 1ZZCA 5JZGB 3KCYA 5LA0A 3ZN6B 4HMZA 2WAOA 2YHJA 2CWMA 4TLGA 2VZVA 2GC2A 3ES1A 3NJVA 1UX7A 4ES9A 3NW4A 3PL0A 5F1RA 4GA9A 2R071 3T1MA 2X5IB 5J09A 1H30A 2VAUA 5IAVA 5C3RA 1NCRA 1NOVA 4TN7A 1O7FA 1VRBA 4QXKA 4MXWA 3UETA 2R6QA 4CUGA 4EN9B 4EROA 3RZKA 1K5JA 1X8MA 4XJUA 1VALA 3VDBA 3O1PA 4BIOA 1CESA 2NN8A 3ZOIA 4A7KA 1RB8G 3WF0A 1H8VA 1U5YA 5FY1A 2TUNA 4YZ4A 2VR4A 5EJZB 1RVF1 2GSYA 4FOVA 3FWEA 2PHXA 1AXKA 4LKFA 1SQ4A 2O0OA 2QBXA 2VGDA 4JDOA 4YW6A 5C4WA 4OUSA 2BFUS 4NMIA 2Q8EA 2XVGA 3U0ZA 2ZBJA 5C4WB 1C1FA 1MEC3 4G9SB 1MS5A 1GBGA 3GBWA 5A7WB 4LITA 4E2GA 1W8HA 1TMF1 1AL22 1MVEA 1RUH3 2XUEA 2PHLA 3Q8EA 4G3YC 1HRV1 1AR92 1V6LA 2XJUA 1MS9A 1S0IA 3ACHA 4XMIA 3J7LA 3VBRB 1JMUB 2JWPA 2A71A 2Y6JA 3I54A 4URTA 2QQWA 5DUVA 3BUCA 4AFAA 2Y26A 5A6QA 1VP6A 4NRQA 5FZIA 2GN3A 5KHHA 2DVGA 4JQRA 1J3PA 2F6BA 2PAEA 2WWUA 4QHOA 1WKYA 1CAUA 4QX2A 1D4M3 1QMJA 4Q1PA 3POSA 2GMMA 1RITA 1AYM1 1WZXA 2UY9A 3VBUC 4Y5Z0 3UYJA 4Q8KA 2JE7A 4RHV1 3MBWA 5FZOB 5IAXA 3OYWB 1VR3A 2Y6GA 3BVCA 5CZKA 3AFGA 4IERA 1PVXA 2A3YA 1HV0A 3BPSA 1VBE2 2DBIA 4LR4A 4PIYA 2D6LX 1VMFA 4Y1VA 3GJAA 4YVSA 3GGLA 5E16A 2LS6A 1HB4A 2HLEA 3RMXA 1CGPA 2IFWA 2XLAA 2ZX2A 2XJSA 3RG0A 3GZUC 3I3QA 2WA3A 4CEYB 5GZFA 4LO4B 1F4HA 4D69A 5IVCA 3T09A 1AR82 3N3HA 4FPGA 1H4HA 4I2OA 4D94A 4XJWA 4RFRB 1Q8QA 4DUXA 4AEDC 4QD2A 1P8JA 1RL3A 3VBFB 1JS9A 5BNPB 1Y9MA 2R061 1LAJA 1QJX2 2YXSA 4CEWB 4I3GA 4ONUA 2J1SA 1SLLA 1VBC3 2J1UA 5HXVA 5A1LA 1LESA 5HBAA 1F2NA 5FPBA 4ES8A 2Y0OA 2A3WA 4MHUA 4CDXB 1S0BA 3H8UA 4IL7A 3C8XA 3DYOA 2X05A 1W6OA 1ULFA 1PMHX 1MQTA 5C3QA 2AACA 3MV11 4BPZA 4R9BA 3KHCA 4AR2A 4CDWC 4OULA 2HWC2 1FOD1 5GLWA 4JVAA 2H6CA 5F3CA 5GLUA 3GBFA 3FLPA 2IUWA 1L3JA 3LAGA 4KU8A 4W65A 3LF7A 1IHMA 2GZWA 2AENA 4FTSA 2A7AA 4Y1ZA 2YDEA 3WDWA 2OX0A 3IB3A 5EJ1B 4IV1A 3JXSA 4JTOA 1IS4A 5EV7A 4HVOA 2W68A 3HD8B 2CNAA 1HKDA 2DU1A 3WD5A 2Y60A 4EN0A 3ZO0B 1EY2A 5FZBA 3U75A 2VUJA 2XQRA 2WO1A 5GLZA 3IBMA 5F2WA 1DQ0A 3D0JA 4FOYA 3LFIA 1ZNPA 4AQSA 3PU3A 1CAWB 5FPZA 1RUOA 2WNOA 4K9SA 2H6BA 2CDPA 5ANNA 1US3A 2HWF2 2ZJCA 3PVNA 4XFGA 4XFBA 4EWEA 3ES4A 4ZY9A 4NWWA 2G9FA 5IJRA 3N7LA 1DCSA 3OBAA 2OW4A 1C28A 1QJY1 4MGZE 5FZ6A 4LUMA 1BBT1 2VUAA 2R49A 4LIUA 3TEXA 2R042 2AREA 5AVPA 4OI1A 2PQQA 3NAPB 1YQ8A 5DUXA 1AL23 2XKOA 2HWD1 3ACFA 4XABA 2XMLA 4K8FA 1NT0A 4MYEA 4XUTA 1J3QA 1UPIA 2V73A 5LBBA 3I8TA 3WQBA 3VKNA 4CP9A 4B4PA 1BVP1 4UT5A 4UBHA 4CP0A 4YFZA 2QQOA 4KI5M 4RGAA 3TAYA 2VVFA 4KMQA 1JOJA 3VZJA 1LRHA 3HIFA 1RUI1 2YUEA 3SLIA 4UF0A 5D8AC 1PIV2 1UY3A 3DXTA 3SH4A 1ND3B 2D44A 3C7OA 3ZSEA 5FXWA 4CCNA 5BNOC 3KD4A 3RPQA 1LJ7A 1UKGA 2FDJA 1YQCA 2IXCA 2W1SA 1CD3G 5IUQA 5I0TA 2EXIA 5BNNB 5IK7A 4NIGA 3DKQA 4CP2A 1DZRA 5DAVA 4MV2A 3KB5A 4GMP3 2RMU2 4JGYA 2JECA 2W94A 1D2SA 4IE4A 4F3JA 5BUVA 5JPNB 3B3QE 2JG9B 4Y26A 3I2OA 4OHYA 5I93A 2PHWA 3GM8A 2RE9A 3WVJA 1HRI1 4WM7C 4YW2A 2VOXA 5JXHA 1ZZ6A 4XQWA 4MADA 4LNVA 4AHWA 1AR83 3HN1A 3NV2A 3V65A 1JYIA 1IG0A 2C24A 4Y33A 1YCIA 5FYUA 2VO5A 4QT6A 2FDIA 3WNXA 4QPYA 4E8DA 1DQ5A 3POEA 5F5CA 5LRSA 3WG1A 2BZDA 3BCWA 3S5QA 4K7JA 4AVTA 2RS52 4TXWA 4NUBA 5DN2A 4N43A 3NQHA 4AI2A 4QQLA 4CCLA 2ARBA 3T4HB 2JEMA 2FDHA 2ZOEB 3H3ZA 1EAH2 5HCBA 4YVSB 3VZOA 1R1A1 2JKXA 3E5QA 3U07A 4A7ZA 3NJXA 1E57A 1PGL2 5FPVA 1NX9A 2Q1FA 2A70A 3ACGA 2HWC3 2A1XA 4AQ2A 1APNA 3HOBA 1PK6A 3ON7A 1OPMA 4QDSA 1AX2A 4XDQA 5FY9A 2GC1A 2KR2A 4Y4RA 2LALA 2Q1MA 3L2YA 1N47A 4LO5B 2OPWA 2Z42A 3OUHA 3BOWA 4G4FA 4Q0SA 2YROA 2WWSA 2RDQA 1F5FA 4I0WB 1JZ6A 4I01A 5DG1A 5FWJA 1VBA1 4AFBA 1HLCA 1BK0A 4MO3M 4N8MA 3GZTB 1BMV1 4NHMA 5AFEA 1FPN2 2Q30A 2EICA 4LBQA 5FZFA 2CU5A 2B8MA 1CWPA 1MQTB 5FY0A 1YC61 1FYUA 2VMDA 3I2KA 4XDPA 4BQXA 4F83A 1UZYA 1KS5A 5FRAA 2DTWA 4D6SA 4XC9A 2LTNA 5GLVA 3PURA 4Y24A 2WDBA 1CPNA 1S0EA 5FKCA 1DYPA 1RUF2 1YI7A 2WZR1 1LHOA 1MVQA 2V72A 4AYUA 3BKZA 1CJDA 3HJRA 4W8JA 4IV1B 2GNMA 2QJVA 2R043 3PUQA 5FZGA 1SLIA 4IE6A 4AHZA 2JD9A 5FBZA 3SH5A 3J26N 5FYYA 2J1VA 3PNAA 2BERA 4YM1A 1GV9A 5FYVA 4AAXA 4CXXA 2VZQA 3PMSA 3O1MA 1J59A 5FYBA 4B7KA 1GWKA 1TNFA 1M06G 2D6OX 4XUQA 1GICA 4QXCA 2Y6LA 5H9PA 4UFJA 2DFBA 2RS11 3LQCA 1JYNA 4N53B 4GXLA 5JXJA 4M3CE 2NPIA 4R4ZA 1YRZA 3KWVA 2JJ6A 3O14A 4Y4YA 2XONA 2IXLA 3GXUA 1H4GA 1KEXA 3JD72 3U11A 4RN5A 4YM3A 5JZGC 5GJ6A 3UKVA 1RUE3 4MH0E 1OMIA 2RMU3 1JW6A 3FUQA 4OHXA 4MHRA 4QX1A 3WP5A 3U4XA 4DS0A 4BIFA 3QOPA 4EN8B 3DPRC 4ORFA 3D0SA 3AP5A 4B4QA 2RJLA 1N3PA 5FKBA 3TN91 3LEIA 3Q8AA 4CCDA 4FP2A 3TBDA 3FN9A 2OUHA 4UF0B 4M00A 3APBA 2VXJA 2DBNA 1F31A 1R083 1MS8A 4WM8A 5JSPA 5IK5A 5J36A 3R4DB 3WNMA 2YU1A 1GKBA 2XKPA 1ENRA 3RVHA 1UWWA 1ZBE2 3VZNA 2FDKA 2RS53 5FY8A 1XU2A 2VMCA 5BNOA 1SLAA 1VAVA 5M0TA 5IFPA 2UYBA 2JG8A 1Z78A 3E6CC 1EAH3 1HQNA 4IV3A 3AL5A 1UY2A 3IT8A 4JGYB 3MHZA 4H55A 5LZ6A 4ZKTB 2QTWB 1RUC2 2GH2A 5GM0A 3N35A 5FOJB 4PJYA 1QOSA 2VUCA 1K45A 1OD5A 3EYPA 4TYSA 2B9VA 1F4AA 1SFNA 2VZ1A 2YYOA 5FK8A 1AYN3 5FPLA 5SV8A 3K4AA 4MSVA 3ZMNA 1EV11 1LHNA 2O14A 3OPZA 2XDVA 3SH3A 3VBRC 4XUNA 3SHRA 1DFQA 3USUB 1RUD1 4A44A 1EYBA 2VBDA 4LULA 4XCAA 2G19A 1ASJ1 1RJ7A 2P37A 1Q43A 2WYFA 4I09A 2PAMA 5KHJA 2ZKLA 3RZZA 2VM9A 1SZBA 4QDRA 1N1YA 1ZYBA 3A22A 4LUKA 3RWKX 3S6PA 4EZ4A 1JHJA 1W06A 4BWOA 1FPN3 3NV4A 4MG2A 1W9WA 2EIDA 1U5IA 4IEXA 1IPSA 3SITA 4Z8BA 5FPUA 2A6WA 4V2VA 5KBFA 2AUYA 2WQ8A 5FZ3A 2QQVA 1PK6B 2JDNA 4NRPA 3O1VA 2R0FA 2RR11 1TME3 2W87A 3KVAA 4LOTA 1DYKA 4GJZA 3AP4A 5FYSA 3HWJA 1RUF3 2FCTA 4PQQA 1SBEA 1V9U1 4K1ZA 3O0VA 1H8TC 5FYMA 1R64A 4Q4Y1 4XJAA 4PLMA 4BK4A 4CE8A 1AL0G 1Z0HA 3T1LA 3H8XA 3OUJA 3MUY1 1IS5A 4FOQA 2IFRA 5CYYA 2DF7A 2ZEWA 4UW5A 3MW2A 1L7LA 4YW4A 3WP4A 3O5SA 3NJYA 5AC93 2WT0A 2ZGOA 4LBQB 4NWVA 4UFIA 2BU9A 1O3QA 5C8WA 1RUNA 1LEMA 4XYXA 4GWJA 3F2ZA 2A6XA 5KHGA 4P9GA 3FHIB 1UY0A 4IQPA 4Q8LA 1COV3 3PUHA 3QACA 5FZAA 3E5UA 2W92A 2XLGA 1X33A 2PMWB 4AFCA 1SFPA 2G9ZA 4NO4A 1LGNA 1I3HA 1X9PA 4QDQA 5BYNA 3P1IA 4GMP0 4X8PA 1J84A 2VMEA 1DLLA 1UMHA 5EHDA 1GOFA 3AXDA 3THCA 2HWB1 3VHOA 5C3SA 2OA2A 3M1HA 3PJYA 1X82A 3PUSA 4XFAA 2IXIA 4C0BA 4Y1XA 2YU2A 5AFBA 3FZ3A 2B42B 4BH9A 4S2GA 1VBB1 2D3PA 2DVFA 2VQTA 2Z79A 1X7NA 1OVPA 4D0QA 5FZ9A 3W9AA 2HWE2 2RS31 3FMGA 2BP6A 2R30A 1HDKA 1PO12 4A3XA 1ZZ7A 2R1DA 1LHVA 1RUG1 1WLTA 3AMPA 3PTYA 2H0VA 2RJKA 2VG9A 2Q5TA 2XBO1 4O61A 1VB2A 1DGRA 5FCCA 4BB3A 1ZX5A 2E31A 2Y6HA 3AMMA 3V0AA 1YXWA 3RNSA 1W6NB 1F5JA 1W6MB 2VY0A 4TLFA 5A3LA 4K3UA 2B45X 5KHKA 1UOJA 4R9DA 3IDCB 1RUC3 1LGBA 1QHDA 3AP6A 1FMD3 4LXLA 4MUVA 3VHPA 1FAYA 3VZKA 1TMF2 5DDJ2 4E27A 1XYNA 2XHKA 4E4ZA 4NIDA 1YEWA 3CLPA 4XIOA 2WNEA 1KDKA 4OUEA 5A1AA 1NCRC 4H7MA 3CO2A 3H8RA 4Q4X1 5DXDA 3UL2A 1MS4A 4WM8B 4KNCA 2ZGRA 5D8AB 3GHNA 3LDBA 1IQDC 3B93A 3VBOC 1IOAA 4YW1A 3ZXGA 3ZXJA 4GZ9A 5FP9A 3MO4A 4GD4A 1LR5A 5BNOB 3B5LB 5FUNA 1PX4A 2DVBA 1W39A 1ALYA 3MIGA 2JG8B 2ENRA 1OT5A 4IV3B 1UQXA 1WCSA 2F4LA 1RIRA 2IVIB 2DFCA 5CNAA 2P3KA 4QQOA 3GZAA 5EPAA 2ES3A 4AWDA 2OZ6A 1DQ1A 2GNDA 2W9XA 3L2HA 1A34A 4WM7B 3DUIA 5E88A 4AI9A 3IMMA 4TTGA 1MZEA 3VDAA 4M3CA 1NKGA 4Y22A 4BMEA 1AJKA 2VOKA 1LOEA 1NZIA 4AI8A 1XBFA 4JKLA 3U4SA 1G9FA 4FBFA 4ISQA 1N1SA 3T2OA 1LOCA 4AL9A 4DXZA 5HCAA 1VB4A 3ZMOA 1CZVA 1W8UA 2W5FA 3AVSA 3CBNA 4BDVB 2UWCA 3ELNA 1BYHA 3FBMA 4I0BA 5FUPA 4MLOA 2R062 4EN7B 3WZ1A 4COYA 3OGJA 1NLQA 4HVQA 4OZOA 4PIXA 5FY4A 1OH4A 2MEV3 1DQ4A 1JUIA 1QY4A 4HETA 5JDBA 3MPBA 1QH7A 1WD3A 1WLWA 1NYWA 1QXRA 2D5FA 2VCBA 2L9LA 2W46A 2WIIB 3FUOA 5L36A 3RZJA 4IEYA 2RDNA 5G04L 4TZDA 1RUH2 1JI6A 1DZQA 3NSTA 4QKDA 5A1FA 5EYXA 4NPMA 5IYYA 4BQ4A 2Q8DA 4NPRA 4F8AA 3TWIA 1FOD2 3G6JB 3CF6E 3CIHA 5H9RA 1U0AA 2VZRA 5BY5A 2BEOA 2ET7A 4KG0A 1CAXA 3W5NA 4JX0A 2VQUA 2VC9A 3VDDC 5C5UA 2CTVA 4OYUA 2OIIA 4K40A 1HW5A 1FT9A 3TEZA 5LK5A 5C33A 5KXDA 2R073 4HKLA 1RHI1 1Y9GA 5A3TA 1ZBA1 3SNMA 1BLZA 1H1IA 3T0BA 2BNNA 2FQPA 5ACA1 2LRPA 2VECA 3N7MA 2WN3A 1NY71 5DZEA 5A3WA 5LY1A 1G8WA 3K75B 2CGPA 4BQYA 4CDUC 1AZDA 3T30A 2GH8A 4RGGA 2ZEXA 4DB5A 1MQTC 3RZMA 2Z5WA 2Y8KA 3ZSKA 2OYZA 1S4CA 3LB9A 1GZTA 2OXBA 2D6NA 4QB1A 1NE4A 2WS91 1RYYA 3SISA 1RVF3 3O1OA 3C7HA 5FXVA 3IIAA 5F32A 2ZHMA 1HN0A 3TNPB 3I7DA 5IVEA 3H1YA 2JD4A 4D7YA 3GCXA 2IZWA 4IV1C 4AFDA 4GB31 4HZFA 1RUJ1 4AQTA 2LROA 1TMF3 1R1ZA 1NQJA 1SEFA 4D7SA 1HRV3 1VBC2 3WW4A 1UL9A 3D82A 2XPJA 3DN7A 2OS2A 1VAMA 1NCQA 3CQOA 4P5YA 4QPIA 3E6BA 4YVWC 1L7RA 3RS6A 2X09A 1RUI2 1YJLA 2FCVA 4Y20A 1N3QA 4FPHA 4I30A 3H1MA 4U2AA 2Y34A 4W4ZA 1AYM3 4OMCA 3V0AB 5J3UA 1OFNA 3I2FA 4RHV3 4Z92B 2BPA2 2EXJA 2CYFA 4RSUA 3RRDA 4Q26A 1ZRFA 5A3UA 3ZFGA 5K0UA 3LE0A 2CAVA 2YC0A 1MS3A 1MZFA 4ASLA 3VDCA 4YWAA 2WT2A 3T2TA 4V1PA 4CPBD 4INDA 5KXEA 4NHYA 3DPRB 5FLJA 4BXFA 4WBBA 1GWMA 1VBD1 1WMEA 1WW5A 2GNBA 5APAA 4FPFA 3PJQA 4OHZA 2VTXJ 4R52A 1C3HA 4HPKA 1HRI2 4Q27A 2JB8A 4CP1A 2ORZA 4AGGA 1CN1A 2VW0A 3MLLA 4CUCA 3RDIA 2I2SA 3N9PA 1ZRIA 1AF9A 1UD1A 3NJZA 5A7NA 4AK3A 3GJBA 2ZX1A 4ATFA 3BIWE 4CA9A 1MR5A 2CSGA 2WT1A 1NQDA 3EHKA 1UPSA 3OPWA 4FPOB 3G7DA 3VBOA 3WR0A 4EYUA 3LA2A 2R063 1H9PA 2CY6A 1FV2A 3CL1A 3ILRA 4Y3OA 5FK7A 2Q8CA 4DIQA 2VPVA 5ISLA 1IKPA 2YPJA 4K8RB 1JXNA 2XJRA 4N7IA 1EPWA 1O4ZA 4AVCA 5LEKA 3CJIA 3N4MA 3UGHA 3OOXA 3Q8CA 4JCKA 1EP0A 3MLKA 4JGYC 2QQPA 4BLIA 3SCFA 4ZXEA 1ZZ8A 4M3CB 3M4FA 4Y22B 3ZFFA 1GOGA 5I8YA 2BTVC 4CUBA 1FOD3 4R4XA 2E7TA 1CR7A 3VB9A 3ZYFA 5EXOA 2ILMA 1OQDA 1GLHA 4IW3A 4IUGA 2WJSA 1QQP1 2VMHA 3KLSA 2FMYA 4CYDA 2PLV1 1M4WA 1N3OA 3HNYM 4XHBA 2YZ4A 3FFQA 1S55A 2I07B 1DBNA 3PU8A 4PBPA 2BOJA 5FZKA 4UOJA 5FLHA 4N43C 4LLFA 1VBA2 1CIYA 2QQUA 3BOPA 3RQ0A 3SEEA 3I2JA 5KXBA 2GNTA 1BMV2 5A3MA 1JN2P 4Z07A 1R091 4Q5OA 5FMDA 1BXHA 1GNZA 5C70A 4P9WA 4DNYA 4XBNA 5I91A 3ST7A 2E32A 4JHTA 1OA2A 3ALQA 4C1XA 1LKNA 2CAUA 4H14A 5JSRA 4MXVA 5CEHA 5JSOA 2XUMA 1PK6C 3IKWA 2EVXA 1CAXB 4XF1A 1H8TB 1KRIA 1S2KA 1FNZA 2WZR2 1RC6A 1RGSA 4QWNA 1QJY3 1AR61 2DTYA 1HQWA 4ZU5A 2XGXA 4DEVA 3MZHA 1BBT3 4XW3A 1JTZX 3VDDA 4YM0A 3H42B 4FAGA 1UZZA 4ZU7A 2DV9A 2ARCA 2QQKA 5CVRA 3R0RA 2E6VA 5L9RA 1B09A 2HWD3 3O1TA 3AZZA 3BI3A 2Y64A 2D3SA 4NHXA 4XUOA 4Y5SA 4Q4W1 5CKMA 3WF2A 4BQ2A 5IVVA 1GQPA 2WKKA 1POQA 4CDUA 5LCWL 1ZREA 4CSWA 1HB1A 1RUI3 1WCDJ 1OC1A 2OPKA 3IWZA 3P3NA 1YIPA 5JMOA 5F5IA 5H9SA 5B4XA 1QJU1 2RS12 1V6IA 1UU5A 1W8WA 1ULOA 1SFYA 3AMNA 3AYDA 2B46X 2W0XA 1SG3A 4LHKA 5JOZA 1JYTA 4QX3A 4IE0A 2DCZA 3AYEA 2WO7A 1BVVA 4MGTA 4EE2A 4H2AA 4BJ0A 3I3BA 1MPXA 4WZCA 2XL9A 1UU6A 2GC3A 1POV1 2CV6A 2WFF1 3IIIA 3LEGA 3POWA 4KBBA 3KSCA 3LZZA 3POGA 1B35A 4YNIA 4QPIB 1HRI3 3I4IA 2CGNA 5ANQA 1VAKA 4QAWA 4BCUA 4EWAA 4URAA 4MGKE 4YG3A 3TN92 1CQ9A 3GBGA 4YVWA 5FYIA 3VL9A 3WW3A 3DYMA 2VZPA 2DVAA 4Y20B 1D0HA 1V6OA 4PI2A 2RM21 4A4AA 2AYHA 1LU2A 2Q4SA 3ZIWA 2J1RA 3ACIA 1Z7S1 4HL0A 5FMCA 3ZFGB 4FFHA 1XSRA 2XHNA 3E6DA 1XNAA 4EV0A 4FPCA 3GDBA 1ZA4A 4HKOA 3IZOA 4K1YA 4GJYA 2ZABA 3D6EA 3NKGA 2WSVA 4JAAA 2VD7A 1R1A3 3GZEA 3DF0A 2NQYA 5J98B 3ZYIB 2MHFA 2ZMKA 4GALA 5IVFA 3KGZA 4IGPA 3FHQA 1VRH1 2QUOA 3POBA 4HPKB 5JCTA 3NNLA 3KHBA 1XNKA 4A6OA 1H2KA 3VKMA 1NCRB 1REDA 4LK7A 3AZXA 5JAXA 4MXWB 4ASMB 5JPMB 1EV12 1UMZA 5FZ8A 4ZU4A 3VBOB 1QU0A 3THTA 1RUD2 4I0AA 4WVMA 1OI6A 4WM8C 5HXMA 1ASJ2 2K46A 3KV6A 5LY2A 2XJPA 2F4PA 2PHRA 5EP9A 2ZS6B 3RZGA 3U14A 4B29A 2WN2A 1SACA 4KQ7A 1VBA3 4MGQA 1WD4A 2ZKNA 2BDRA 2JG8C 1AVBA 2XB6C 5GZGA 3WUCA 4IV3C 1YQ2A 2BNOA 5FLIA 5JOWA 1H6YA 1OXCA 4FPLA 4MX3A 4HANA 2ZEZA 1RUE2 2VCMA 3EQEA 3EB7A 2WINB 2Z69A 2WO2A 4OQ9A 1SBDA 4XMAA 5D21A 2FCUA 4K6BA 4HN0A 4KG8A 4PI0A 3TOJA 1DGLA 2YGLA 4I02A 3VL8A 3BTXA 4JDMA 1CAUB 4P02B 2PQSA 1V9U2 2WZR3 3VHNA 2VNGA 2R7EB 4Q4Y2 1R082 3AMHA 4AI3A 3J8F1 4AGRA 2YBKA 4N9IA 4IEUA 2VMFA 2PTMA 3KM5A 3WDUA 3KT1A 3WP6A 4NOTA 3ZXEA 4XDOA 5LK7B 5CG9A 1SDWA 4JKKA 3SCHA 1H2LA 3N7KA 2QVSB 3OEAA 3I2DA 1BKZA 2BRTA 3T08A 2EXHA 4F7ZA 1GZWA 4JHZA 3BALA 4AOCA 1SMVA 2G4IA 4IGOA 1YIFA 2WLQA 4NVPA 1WW7A 2JE8A 2EA7A 4HN1A 2KA3A 4XFHA 2VJXA 2DUOA 3GCWA 5DAXA 1IG3A 2RS13 3C2UA 2WZ8A 1AYN2 4Q0PA 1HB3A 4QQ2A 3LCPA 1XSQA 4E4HA 5ERLA 1KD7A 1PVC1 1S0JA 2WABA 3AP7A 1NA1A 2PHFA 2ZZQA 4KWJA 3VDDB 3FLRA 2HJIA 2VMIA 2XLFA 5T5LA 4B4RA 1PGW1 4LKEA 4ZONA 2W08A 4WVZA 1BHGA 5KC6A 2P4EA 4BQ3A 5I0DA 1IKQA 2KXLA 1ND2A 2P2KA 2XH6A 1W9FA 3VD7A 4CU6A 3OY8A 3O0WA 4DY5A 3B9CA 2VW2A 1Y43B 3IAPA 3TN93 1AR91 3CMGA 1OA3A 3GNEA 1OBNA 1UYXA 1W6OB 1VBB2 3N9MA 4CDUB 3WF4A 4YZ5A 3OGSA 4NROA 5FP4A 2IC1A 5GZEA 5SV5A 1W8OA 2RS32 2NLRA 5LBEA 1W2AX 4W50A 1RUG2 1TME2 2FHRA 2N7GA 2XBO2 1JZ2A 3IDEA 1K12A 4BM8A 2F17A 2WRAA 3Q9OA 2B5HA 2C0ZA 4XACA 5FPAA 1UW8A 3UKNA 1ZRRA 3A21A 5FXXA 1DGWA 1OHFA 1QNYA 4O65A 3MV01 3RGBA 3WY6A 1AR71 4NPLA 5FQ0A 2WQZC 1B35B 1SDDB 1CIWA 1VBE1 1YFYA 5A7PA 2O8QA 2WSUA 3PMEA 2GDFA 5F6KA 1LU1A 1SPPA 3MPPG 4IEWA 3LOBA 5AC92 4YVWB 3HEIA 3KQRA 3DV8A 5FMOS 1EV13 1K3IA 2JDYA 2W52A 1UOGA 2DU0A 1UX6A 2GAUA 4GQ7A 3WW2A 4BISA 2ZGKA 4IEQA 1RUD3 1U12A 3ITQA 1C5IA 3JCIA 3MUZ1 1V0AA 4XEZA 1ASJ3 2YY1A 1QNWA 1COV2 3BODA 4UI9L 1IPKA 4DINB 2XR4A 4LBLA 1X36A 2JDKA 1W8NA 2VH9A 3EJKA 2QE3A 4XZPA 4CCKA 4HVRA 2TBVA 2W3JA 3MYXA 3SKVA 3T0DA 1QJX1 3VD9A 1W2OA 3NV1A 1J1LA 4QB6A 5JXGA 2PAKA 4QB2A 1TE1B 4NJ4A 4FVVA 1YNAA 5I8TA 4QKFA 5B2GB 2VTFA 4Q1RA 4AFMA 1DIWA 1XNBA 3LIHA 5E89A 2JDUA 4M01A 2RR13 4CP9B 1XPWA 4SBVA 1GMMA 4R9CA 4QX5A 4DRVA 1O8SA 1Y7BA 2JIJA 1A8DA 5DMYA 1V9U3 2VBBA 4LE3A 3WINE 4Q4Y3 5E6HA 3ZIXA 4YARA 5GZDA 4QKNA 1ZZ9A 2GN7A 1A3KA 3QCWA 3VZMA 3MFAA 4XOGA 5T5PA 2P3IA 2K9ZA 2JIGA 1NZCA 1DU3D 1LODA 5JWPA 3PVOA 3I3DA 4P9IA 5FJHA 3RI9A 4WZFA 1C5HA 2FZ2A 3WNNA 4HFSA 2ZHLA 3ZYGA 1DLCA 5LEJA 2OKXA 3U10A 3RYRA 4LOSA 2FBEA 2BW8A 3FL7A 5EYYA 1CONA 1FMD2 4H7LA 3SKJE 1S2BA 5FIXA 2VZSA 4BOWA 3PVBB 2GALA 3H7YA 5T3NA 2Q1ZB 2WA4A 3OJBA 3AJYA 2HWF1 1D7PM 3AKQA 1DGWX 3U37A 4B7EA 2XJQA 4JGZC 4JRAA 2ZGTA 5HV4A 3QBQA 3FHAA 1BEV1 1JODA 3VBSC 3W20A 3OF1A 4EJRA 2HWB3 1KXGA 3O1UA 5F9TA 1QOTA 4N43B 1UXXX 1UIKA 3P6BA 5E1RA 4QM9A 5A6XA 5DZGA 5K4LA 1RHI2 3UV9A 1GZWB 1GU3A 1K5MA 2J22A 5IT6A 2YGMA 2K2SA 5ABJA 1XRUA 1VBB3 4XIKA 2BWCA 4NHKA 5D2AA 2ARXA 5IVJA 2WNVA 1BCXA 1HN1A 4FI9A 4QX0A 2P6HA 2RS33 1S0FA 1W8FA 2VOVA 4HSLA 5T52A 1RUG3 3PIJA 2P3YA 2EIEA 1S0DA 2XBO3 2XWJB 1PIV1 2B4KA 5FP3A 5C5TA 1NXD1 2QDRA 2RG4A 1RXGA 3INAA 3OG2A 3RJ2X 5FZ1A 1DDLA 2VNOA 2TEPA 4NHLA 1VJ2A 1ZRDA 4KGGA 3B7MA 3QLQA 4B3NA 3OTFA 4BLJA 1ND2B 1UZ0A 4XVHA 4JTNA 5FWEA 3OY8B 4FT8A 2ZEYA 3D4KA 2GMEA 1U5ZA 2VOWA 1A78A 4ET7A 2D5HA 2BBVA 4QQHA 2NYYA 3ZFEA 1FNYA 4UW3A 1J3RA 1US2A 1JZ4A 1V6MA 2MEV2 1H6XA 2OUJA 4P08A 2DUQA 4XF0A 1CZTA 3BTAA 2RDSA 4KL1A 4Q4X3 2IXKA 4MGYE 5C71A 2OVUA 4Q0VA 5CFDC 2FMDA 5L9VA 4AEKA 1GOHA 3ETQA 5K9YA 4CPBA 1ENXA 5A6ZA 1H1AA 4J1XA 3JU9A 1ZRCA 4S2FA 1WUVA 2BFUL 4SLIA 4CXWA 1PO21 2SLIA 4ITCA 2JDZA 1NE6A 3ILFA 4BQWA 5FO8B 1ZA7A
chains in the Genus database with same CATH topology
1RXFA 1UNBA 1HJGA 3ON7A 1WA6X 2VBBA 1UOFA 2VBDA 1E5HA 1W28A 2VAUA 5C3RA 2Y60A 2BRTA 1ODMA 1BK0A 5C3PA 1W06A 1W05A 1QJFA 1HB1A 1OC1A 2VBPA 3ZOIA 1IPSA 2IVIB 1HB3A 3ZKYA 2WO7A 1DCSA 1W04A 1W3XA 5APAA 1GP6A 2JB8A 1ODNA 4XAEA 2CSGA 1OBNA 1HJFA 1W2NA 2BU9A 5C3OA 1W2AX 1W9YA 3OOXA 1E5IA 2DBIA 1RXGA 1HB2A 1HB4A 2BJSA 5C3SA 1UZWA 1QJEA 4RGKA 1UOGA 3ZKUA 1W3VA 2VE1A 1BLZA 2DBNA 1E5SA 1GP4A 2JB4A 2Y6FA 1QIQA 1UOBA 2IVJA 1W2OA 1E5RA 1W03A 2VCMA 1GP5A 4BB3A 1UO9A 5C3QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RXF A;  1UNB A;  1HJG A;  3ON7 A;  1WA6 X;  2VBB A;  1UOF A;  2VBD A;  1E5H A;  1W28 A;  2VAU A;  5C3R A;  2Y60 A;  2BRT A;  1ODM A;  1BK0 A;  5C3P A;  1W06 A;  1W05 A;  1QJF A;  1HB1 A;  1OC1 A;  2VBP A;  3ZOI A;  1IPS A;  2IVI B;  1HB3 A;  3ZKY A;  2WO7 A;  1DCS A;  1W04 A;  1W3X A;  5APA A;  1GP6 A;  2JB8 A;  1ODN A;  4XAE A;  2CSG A;  1OBN A;  1HJF A;  1W2N A;  2BU9 A;  5C3O A;  1W2A X;  1W9Y A;  3OOX A;  1E5I A;  2DBI A;  1RXG A;  1HB2 A;  1HB4 A;  2BJS A;  5C3S A;  1UZW A;  1QJE A;  4RGK A;  1UOG A;  3ZKU A;  1W3V A;  2VE1 A;  1BLZ A;  2DBN A;  1E5S A;  1GP4 A;  2JB4 A;  2Y6F A;  1QIQ A;  1UOB A;  2IVJ A;  1W2O A;  1E5R A;  1W03 A;  2VCM A;  1GP5 A;  4BB3 A;  1UO9 A;  5C3Q A; 
#chains in the Genus database with same CATH topology
 3HQX A;  5FBJ A;  3ME2 A;  1AX1 A;  1QEX A;  4AW7 A;  2D7F A;  4CCC A;  2C5D A;  1SPP B;  2VMG A;  1LNS A;  1IS6 A;  4QKB A;  4LQR A;  5E8A A;  3LIG A;  2YV8 A;  1PGL 1;  2R07 2;  3I59 A;  1W6Q A;  4A41 A;  1W2T A;  3JZV A;  5HI0 A;  5A7S A;  1NCQ C;  1Q8V A;  3A4U A;  3JQW A;  4QPI C;  4S2H A;  3T3Y A;  4YZ1 A;  2Z2S B;  1WW4 A;  2BBA A;  2AC1 A;  2P17 A;  4HT1 T;  3WNL A;  1W28 A;  2I74 A;  4XFC A;  4C0H A;  4I3P A;  4BXS V;  3UK9 A;  3LA7 A;  1I5Z A;  1LEN A;  2VCC A;  4QGN A;  4B8E A;  2KD7 A;  1C8M 1;  3T2P A;  1REF A;  3Q8F A;  3O12 A;  3W5M A;  3S5A A;  1YHF A;  1ZM1 A;  1RVF 2;  2PYT A;  3HNB M;  3ZFG C;  2G9G A;  5K0U C;  2HKX A;  4FTE A;  1C1L A;  1GWL A;  4DPN A;  3AB0 A;  1VMH A;  1HQL A;  4L11 A;  4Q4V 1;  4GWI A;  3I97 A;  4MGI E;  4AG4 A;  1S0G A;  1HRV 2;  1ULP A;  3HQU A;  5BV6 A;  1W04 A;  4UAP A;  3JBG 1;  3JQX A;  3NV3 A;  1N1T A;  5DAP A;  4GIQ A;  4C8D A;  5EQU A;  5FUI A;  2XOM A;  5LWB A;  2GC0 A;  4FFG A;  1W99 A;  5EJ3 A;  2BVB A;  1QQP 2;  3UJO A;  2BGC A;  4L97 A;  1JYX A;  4LBQ D;  1QDC A;  1LB2 A;  3WCR A;  2PLV 2;  3SQO A;  5IW0 A;  2AEZ A;  2HYX A;  2XXZ A;  1AYM 2;  2R1B A;  5DQ0 A;  4RHV 2;  3LDR A;  1RHI 3;  4YG0 A;  3DEM A;  3P5B A;  1ZBA 3;  4E9K A;  1W2N A;  5T55 A;  5ACA 3;  1EUT A;  1QKQ A;  4HKW A;  1KQR A;  1VIW B;  4LHL A;  3SMH A;  3NNM A;  3V56 A;  1DZT A;  1Q8P A;  4P00 B;  3CJI C;  4IES A;  3VD5 A;  4AI1 A;  5A6Y A;  1JYV A;  4LTA A;  4AE2 A;  3RMY A;  1R09 2;  1WBF A;  4NE9 A;  1LOF A;  4RA0 A;  4YYO A;  4YW5 A;  1J83 A;  1L7Q A;  1W0N A;  4XF4 A;  3ZDV A;  1E5I A;  3ZFF C;  5J37 A;  4COW A;  3S7E A;  3MIH A;  2WS9 3;  3ZR6 A;  3ETP A;  1JH5 A;  4XTM A;  4IGQ A;  4EQV A;  1YLL A;  4JGZ A;  1OFS A;  1RJ8 A;  1TQ5 A;  3WDY A;  5CFC C;  1LTE A;  1AR6 2;  4FCA A;  2BJS A;  4MGS A;  2VCA A;  5I0R A;  3JD7 1;  3R4U A;  3VBS A;  3BIE A;  3O1S A;  1UZW A;  1IZ3 A;  1RUJ 3;  4GB3 3;  5EWS A;  5FY7 A;  4FAH A;  5FZM A;  3KMH A;  2VU9 A;  1WGP A;  3KT4 A;  1LCL A;  2NMN A;  1OKQ A;  4YM2 A;  4UFH A;  3ZYP A;  1YQ6 A;  1T6G C;  4A3Z A;  2WC2 A;  3V64 A;  2WNV B;  1DG6 A;  1E5S A;  3KCX A;  4PLN A;  2YC2 A;  4QQP A;  4FOW A;  4J6G A;  1Y9Q A;  4BQ5 A;  4LT5 A;  1G9A A;  1FXZ A;  1ONA A;  2PN5 A;  5T5O A;  4BMB A;  3H0O A;  1O3R A;  3KV9 A;  2J1A A;  2ZGM A;  4QX7 A;  3WEZ A;  1ULG A;  3GAL A;  1IQA A;  1ZBE 1;  3H9A A;  4GWN A;  4YG6 A;  1O6U A;  4AVS A;  3UT0 A;  2D93 A;  4CUA A;  3PUA A;  1KJR A;  4XXA A;  3MGU A;  3UNP A;  3J4U H;  2WL1 A;  5FZO A;  5IFT A;  3DCQ A;  1YFX A;  1JOP A;  2A6V A;  3ZFE B;  1YQ5 A;  2W47 A;  5I0U A;  1VBD 3;  3ECQ A;  5HCF A;  2GU9 A;  4ZS2 A;  3B94 A;  3NL1 A;  4DFS A;  1XC6 A;  2D43 A;  1DQ6 A;  3J7N A;  4L8Q A;  4LKD A;  1WMD A;  2GMP A;  2ZCW A;  2JE9 A;  1BZW A;  2YBP A;  3JB8 A;  5A70 A;  1SCS A;  2K0G A;  3BU0 A;  5CB7 A;  5JOY A;  1GSL A;  5CFD A;  1JZ5 A;  2V4A A;  4CEY A;  1LUL A;  1UY4 A;  2ZHK A;  4IEP A;  4WVV A;  3AFK A;  4P9J A;  2VZO A;  4CRQ A;  1Z7S 2;  1W8Z A;  5I8S A;  4D3W A;  1AXZ A;  4XJZ A;  2RV9 A;  1UCX A;  5FZH A;  2QFE A;  1QJY 2;  2VNR A;  1TNR A;  1KFX L;  3ILN A;  4S2D A;  4CEW A;  5KR7 A;  3RFR A;  3VD4 A;  1BBT 2;  4NRM A;  4OUM A;  5T5J A;  3N9Q A;  5JIU A;  5JR2 A;  3I59 B;  1W6Q B;  1NXM A;  3S0M A;  1SCR A;  1VRH 2;  2CGO A;  5HCH A;  3OPT A;  1B35 C;  2HWD 2;  1QGL A;  3AX4 A;  4PF1 A;  4XBL A;  2Y33 A;  4XAA A;  3T0A A;  3ZX7 A;  4QHZ A;  3UES A;  4LKS A;  4CDX A;  5CKQ A;  5FFO C;  1XE0 A;  3DXU A;  5JI9 A;  2EXK A;  1ODN A;  1SLB A;  2ARA A;  4E2Q A;  1QQP 3;  4XJ8 A;  1W8T A;  3M8L A;  2G1M A;  3BPZ A;  2PLV 3;  5IK4 A;  1GZC A;  2BOI A;  2QZ3 A;  3WDX A;  2QDN A;  1MZ5 A;  3PLQ A;  1XOY A;  3ZR5 A;  1V6K A;  3OD4 A;  3OUI A;  4KWU A;  4RS5 C;  2VL4 A;  1GNY A;  4JDN A;  3ZDS A;  3MW4 A;  3IN9 A;  3M70 A;  2ZMN A;  4M4R A;  3R4S A;  2E7Q A;  4XF3 A;  4ARX A;  4X6Q B;  2YB7 A;  1NLR A;  1R09 3;  3PUI A;  4QPG C;  1OH3 A;  4X8N A;  1EPZ A;  4L2N A;  4RR3 A;  3N9N A;  4TSV A;  4QGM A;  3MF6 A;  3WOG A;  5F39 A;  1ULC A;  3WLU A;  5J1X A;  1LGC A;  2MNG A;  1D2Q A;  3S30 A;  1DP0 A;  3I3E A;  4RQP A;  2VW1 A;  2QQI A;  1AR6 3;  2Y38 A;  1SLC A;  3A7Q A;  5C6C A;  2E51 A;  3WHU A;  3J8F 2;  5L19 A;  2PHD A;  1QJE A;  4DXT A;  2GP3 A;  4IEZ A;  3KVB A;  1HXS 1;  4Y1U A;  4YFW A;  5FQ0 B;  1LED A;  5LAT A;  5HV0 A;  3IM0 A;  5F2S A;  5C9A C;  4YGC A;  1PM7 A;  4Q4W 3;  3NAP A;  4GWM A;  5LBF A;  1X8E A;  3FC0 A;  3NRU A;  3AKT A;  4XHX A;  1R1A 2;  5FR3 A;  3THD A;  3ZLI A;  3RZL A;  3AZV A;  3BTZ A;  4CU9 A;  1WCQ A;  1GAN A;  5IHR A;  5DAW A;  2HWE 1;  2ZGP A;  1VMJ A;  4GAZ A;  1QJU 3;  5L73 A;  1O8P A;  1PO1 1;  3MIB A;  4JGZ B;  2RHP A;  1VPH A;  4AI0 A;  3LOI A;  1RXF A;  1CVN A;  1PVC 2;  1WA4 A;  4OCT A;  2DCJ A;  2ZGL A;  1OLQ A;  1ENQ A;  5FP8 A;  3H1W A;  1UNB A;  5H9Q A;  1ND3 A;  3VBS B;  5CFC A;  1JU4 A;  2CDO A;  3CZJ A;  1G6N A;  1PGW 2;  3UGF A;  2XVL A;  4XJ9 A;  3H3L A;  4AGV A;  4LHS A;  5BNN A;  5KXC A;  1POV 3;  1TVG A;  2WFF 3;  3DKW A;  5FMO L;  4Z2W A;  2UY8 A;  1H2M A;  2XQX A;  1WLD A;  4HK8 A;  1MS0 A;  3AKS A;  3LSE A;  1Y3T A;  2AGS A;  1O4T A;  5DDJ 1;  4E8C A;  3NWK A;  5EIY B;  4ASK A;  3K51 A;  2FZ1 A;  3ZYH A;  2JG9 A;  2P6C A;  5C7G A;  4E4S A;  1Q8O A;  4OI4 A;  2ZGN A;  4HG6 B;  1AHS A;  2OT7 A;  4NAM A;  1AUY A;  4JQT A;  5A3O A;  2UWB A;  4D8M A;  5CKN A;  1I1E A;  1W05 A;  1O5U A;  2RM2 3;  3EBR A;  1I6X A;  4CZS A;  3URF A;  3C3V A;  3D3A A;  4JV4 A;  1Z7S 3;  4YGE A;  1NLS A;  3K3N A;  4RFT 0;  1NA1 C;  1RMU 1;  5GKA C;  3KT7 A;  2IXJ A;  3FFZ A;  5F3E A;  1PZ7 A;  1XND A;  3PVE A;  5F7U A;  3DYP A;  3MFC A;  4QU2 A;  2WO3 A;  3M3O A;  3WF1 A;  4NN0 A;  1UZV A;  3IDA A;  1AR7 2;  3ASI A;  1WCU A;  1ND2 C;  1VRH 3;  2ZML A;  2YC4 A;  1XJA A;  2WBK A;  5FJK A;  3T4V A;  5LB6 A;  2VOT A;  5GAL A;  4YZ2 A;  3CDZ B;  5A7Q A;  4FXG B;  1UN1 A;  1OF3 A;  3K4Z A;  3M7A A;  3N7J A;  2DYC A;  2W91 A;  5DAB A;  5CFD B;  3MI8 A;  1X9T A;  1OLM E;  4XAE A;  3FBY A;  4XXP A;  1PMJ X;  4RL7 A;  1GQH A;  2Y0I A;  1XNT A;  4COU A;  4DXS A;  1HJF A;  4LBO A;  4FPJ A;  4XTP A;  4R8H A;  4MET A;  2C9A A;  2C26 A;  1IGO A;  3WX5 A;  5IK8 A;  3S7I A;  3OBZ A;  3ZXF A;  4DRR A;  3EMR A;  4BQ1 A;  2C6S A;  5F37 A;  3ZYB A;  3WG2 A;  1W6P A;  5KC5 A;  4O9E A;  4XBQ A;  1PGS A;  2Z4F A;  3B01 A;  3D8C A;  1OSG A;  5J48 A;  4UW6 A;  3CKH A;  3DL3 A;  2D40 A;  1F9K A;  1HB2 A;  4LJH A;  2ET1 A;  4PDW A;  1MEC 1;  5A33 A;  4BA6 A;  3BB6 A;  1NCQ B;  5LW9 A;  3KS7 A;  4UBG A;  4GH4 A;  1RUH 1;  2YFZ A;  4PIZ A;  5FMB A;  3OBT A;  4BHP A;  4EZH A;  5L7O C;  4XFI A;  3MIF A;  4P5H A;  2CHH A;  1JZ3 A;  4CXY A;  2ZGQ A;  3AXE A;  1GQG A;  3J8F 3;  4AF9 A;  4NIH A;  2JX9 A;  3EO6 A;  5JUV A;  2V09 A;  1D4M 1;  2VQ0 A;  1YUD A;  1SLT A;  2QZ2 A;  2ZX0 A;  3H7J A;  1WLC A;  4RS5 A;  5K0U B;  5FO7 B;  3USS A;  2X29 A;  2Y6F A;  1D4V B;  2O8O A;  2W2I A;  3K46 A;  1UU4 A;  4GKY A;  1U5X A;  3CU7 A;  1YJK A;  4IXL A;  4WV8 A;  4H3W A;  4QPG A;  1PMI A;  4RR3 B;  1ULE A;  2YFU A;  3JB4 C;  5FP7 A;  1KFU L;  1QXJ A;  1GNH A;  4FFI A;  2C9K A;  1BQP A;  1LEC A;  2ERF A;  1EUU A;  2CL2 A;  4RQP B;  1PVC 3;  1YWK A;  3HBZ A;  2JDM A;  4FXK B;  4UW4 A;  4BYY A;  1CZS A;  3FLT A;  3M3I A;  4O7X A;  4OFG A;  4N53 A;  2HEW F;  3TEY A;  3OCP A;  1BEV 2;  2P34 A;  3AL6 A;  4P14 A;  2WAA A;  2QQM A;  3AYA A;  1J1T A;  4FSJ A;  3AKP A;  4K20 A;  3WQ7 A;  4CU7 A;  5CBL A;  1BK1 A;  4M0N A;  3H8O A;  5C9A A;  2FDF A;  3CJI B;  2W1Q A;  1G9D A;  3B02 A;  1UF2 C;  1FX5 A;  3H50 A;  1VBC 1;  1AR9 3;  1C8N A;  4CDQ C;  3C7F A;  5C8C C;  1AXY A;  4HK9 A;  2PHT A;  3P3P A;  5FXZ A;  3E1F 1;  1KDM A;  4QU1 A;  3VBH C;  5DUU A;  3ZFF B;  1WWY A;  2ADD A;  4AEJ A;  3RI8 A;  2ADE A;  3EXU A;  4FPY A;  3WNO A;  2RR1 2;  4Y1Y A;  1HIX A;  2E9Q A;  2R16 A;  4L9B A;  3HBK A;  5EZW A;  4JRL A;  4AXO A;  3QH6 A;  3LPG A;  3VKO A;  1G7Y A;  5CFC B;  1W0P A;  4GUL A;  2HH9 A;  3BN6 A;  3C7G A;  3ZKY A;  3POF A;  3AKR A;  2VXR A;  2WZP P;  4K21 A;  4COZ A;  3ROU A;  4ZZ8 A;  1AR7 3;  1GR3 A;  3I2G A;  5FV3 A;  2AR6 A;  2B9U A;  1VBE 3;  3IMN A;  3BU7 A;  4QMA A;  3F95 A;  5FDB A;  4LA2 A;  2ZAC A;  2O1Q A;  1K5M C;  5ABJ C;  3U1X A;  1Q8S A;  2BUK A;  3FJS A;  5FZC A;  3IDB B;  2EIG A;  3DEC A;  2WFP A;  3WV6 A;  2WNV C;  3B9I A;  1ACC A;  2QNK A;  2HEV F;  4LHN A;  4LLO A;  4QM8 A;  1OOP C;  3TYJ A;  3TEW A;  3I2I A;  5F5Q A;  4JZR A;  3USU A;  4A6S A;  4OHW A;  2X53 S;  1ZVF A;  3RYP A;  2BGP A;  1FI2 A;  1X50 A;  1QJX 3;  3VBU A;  1PO2 2;  4CTE A;  2ZAH A;  4MOA A;  2WQ4 A;  2BVV A;  1DQ2 A;  4FO9 A;  2EAA A;  1UY1 A;  1JYC A;  4EWD A;  5T50 A;  2WNU C;  3A23 A;  5IVB A;  4YZ3 A;  2HWB 2;  2ID4 A;  4GKX A;  1ENS A;  4OZX A;  5CIS A;  3OGR A;  3ZSJ A;  1QH6 A;  3ZFE C;  1W2U A;  2SBA A;  2VUL A;  2ZGS A;  3N9O A;  2A3X A;  1AL2 1;  2JDP A;  4HXC A;  5GLT A;  4FFF A;  4DEQ A;  1AX0 A;  2EF6 A;  1OA4 A;  4BU2 A;  2ZHN A;  2D6M A;  2RDR A;  3NMB A;  4HBN A;  3IAQ A;  2PXJ A;  3OBR A;  2WZE A;  1RIN A;  1DGR N;  4YW7 A;  1LOA A;  2VZU A;  3E97 A;  4W6W A;  4XPV A;  5J96 B;  5LA9 A;  4CCJ A;  4CCO A;  1YYN A;  2BQP A;  1C8M 2;  1W0O A;  2JB4 A;  1OUS A;  1IPJ A;  3Q8B A;  4FP3 A;  4M0H A;  1W6P B;  4QXH A;  4AED A;  1UAI A;  3ZN5 A;  2WUH A;  4NII A;  2EAL A;  2IVJ A;  3I2H A;  2QCS B;  1V6N A;  4TWT A;  4AVB A;  4KWL A;  2V4V A;  4YLZ A;  2NM1 A;  4PDW B;  1PNF A;  5LA2 A;  5F5A A;  1UO9 A;  2LM3 A;  4AVV A;  5A33 B;  3W58 A;  1QOO A;  4Q4V 2;  5A3N A;  4GH4 B;  4GMP 1;  3U78 A;  1SBF A;  4YW3 A;  3ZXA C;  1N1V A;  4NAO A;  3ZPY A;  1YFU A;  2TNF A;  3OD0 A;  3JBG 2;  4DZG A;  2BWA A;  2HWF 3;  3K3O A;  1Y4W A;  4CDW A;  4U36 A;  3VLB B;  5L7O A;  2BYV E;  4Q4X 2;  3WQ1 A;  4DY3 A;  3K4D A;  5B4N A;  1Q3E A;  3ZVX A;  1HX6 A;  2A73 B;  2C4X A;  5CAD A;  3LFM A;  2D3R A;  4ZXK A;  2E26 A;  1AR8 1;  4OI2 A;  1POV 0;  4Q2F A;  4XFF A;  4W6Y A;  4AAP A;  1BEV 3;  4A7Y A;  3ZYJ B;  4LMF A;  3HT1 A;  4RS5 B;  5FZL A;  5A80 A;  1YI9 A;  1J58 A;  2RJ2 A;  1DYO A;  1NG0 A;  1KS4 A;  5DUW A;  4QPG B;  4ZHN A;  2E33 A;  3TNQ A;  4IDZ A;  1OLM A;  3RJR A;  1XXN A;  2RVA A;  4D7T A;  5A32 A;  2ZPX A;  4PQ9 A;  4LO8 A;  2P1B A;  4PLO A;  4Z1V A;  1LOG A;  3BGA A;  4Z2A A;  4OMD A;  3V0B A;  1PIV 3;  2DCT A;  1IS3 A;  2XG3 A;  5HPO A;  1MZ6 A;  3K2O A;  1NAE A;  4WVM B;  2HWC 1;  3WG3 A;  4ZZ5 A;  1TG7 A;  3UKT A;  5FTT C;  3LGR A;  5CG8 A;  3KQ4 B;  2UWA A;  3BTY A;  1GP6 A;  1QF3 A;  4LK6 A;  1W6N A;  3ZPO A;  5C9A B;  1W6M A;  1YFW A;  2VVE A;  1CX1 A;  2W95 A;  1PZ8 A;  1D0G A;  3WNK A;  1C4R A;  1PM4 A;  2OQ7 A;  1W90 A;  3RSJ A;  3LPF A;  4ATE A;  5C8C A;  1K42 A;  4CDQ A;  2ZX3 A;  4FTB A;  2BNM A;  1O5L A;  3KV5 A;  1LOF C;  3OGV A;  2YPD A;  4KH9 A;  2X5I C;  5LBC A;  3VBH A;  4LBJ A;  2LUW A;  3M2M A;  2XL7 A;  4N90 A;  4CCM A;  1RTV A;  4NR1 A;  4NIA A;  1T2X A;  3VKL A;  3J9S A;  5D8A A;  4KBZ A;  3RWN A;  1PX3 A;  3HQR A;  1PO2 3;  4B1L A;  2DWR A;  1XYO A;  1FV3 A;  2E7A A;  5LRR A;  3TRS B;  1H2N A;  2DUR A;  2WLP A;  4OHV A;  4E2S A;  4IEV A;  4COV A;  4IE5 A;  4P9Y A;  5IVY A;  3VV1 A;  3WCS A;  3WP3 A;  4Q0U A;  4AHY A;  3KF3 A;  4DOU A;  2R04 1;  4ZPI A;  1JOB A;  5DAQ A;  3WDV A;  3HPN A;  3AVR A;  1ZBA 2;  2X10 A;  1ULD A;  5ACA 2;  3VUO A;  3ZN4 A;  1O91 A;  4LO6 B;  4RGK A;  1NY7 2;  1WCK A;  3HMY A;  3I49 A;  1JBC A;  2VZT A;  2KM2 A;  3ZXD A;  4FQZ A;  1XQN A;  4WM7 A;  4M3C F;  2ZA9 A;  2VVD A;  2JDA A;  2IWG B;  2XJV A;  2XVK A;  3L9J T;  3LWC A;  1OOP A;  3O0X A;  3SXW A;  5K8S A;  4V2W A;  4HLT A;  2A6Y A;  1WMF A;  1JHN A;  1G9C A;  2JEN A;  2B39 A;  5DZF A;  4L92 A;  3SCG A;  2VTX A;  4E4D X;  2J42 A;  1C8M 3;  4JC1 A;  4UFM A;  3VBU B;  1NA1 B;  1OLR A;  1UOB A;  4LO7 A;  4Z82 A;  2WS9 2;  2W1U A;  1TZO A;  1GFF 2;  5FZ7 A;  3RYK A;  4DMI A;  1XYP A;  4O9G A;  1UYY A;  1F8V A;  3KGL A;  1W03 A;  3NNG A;  1CAV A;  5LAS A;  4N9H A;  3IPV A;  1VE0 A;  2ETE A;  4W6X A;  5I0S A;  3UGG A;  1XNC A;  2WNU A;  4Q4V 3;  4GB3 2;  2VNV A;  1RUJ 2;  1RUE 1;  1UXZ A;  4YSF A;  5JIA A;  3AZW A;  2RMU 1;  4PT6 A;  4QHB A;  4LEJ A;  1BJQ A;  5DG2 A;  3W21 A;  4DUV A;  2QQJ A;  4RD7 A;  3WXP A;  3JBG 3;  5FY5 A;  5L9B A;  3VD3 A;  1OQ1 A;  3HAG A;  3WUD A;  5JVV A;  2AEY A;  4CEY C;  3K48 A;  2DCK A;  2ZTN A;  1R08 1;  2PEL A;  3HT2 A;  3B69 A;  4LBM A;  5FAX A;  3M3E A;  5AVA A;  2D6P A;  4MVT A;  2ATF A;  4AZZ A;  4ARY A;  2RS5 1;  3VBF C;  1QJF A;  5BNP C;  4M4P A;  3S57 A;  3ZYR A;  2FD8 A;  4CEW C;  2VBP A;  3CEW A;  2JXA A;  3ZSM A;  1JYW A;  3ZXK A;  3HVD A;  1EAH 1;  1LHU A;  4XQ4 A;  3MDP A;  5GZC A;  4B1M A;  3NNF A;  3A0K A;  3LEM A;  1DHK B;  1VBD 2;  1GUI A;  3MEP A;  3PDQ A;  3PTR B;  5D1I A;  3GF6 A;  4AVA A;  3MLJ A;  4LA3 A;  3ZSL A;  4CDX C;  4CDW B;  2CWS A;  5L7O B;  3ORJ A;  1PNG A;  2UU8 A;  4KWK A;  4P9X A;  4BK5 A;  4KU7 A;  4BE3 A;  1AYN 1;  3R6S A;  3ACL A;  4OI0 A;  1JU3 A;  1UMI A;  1S1A A;  1VLN A;  1MS1 A;  4YRD A;  4FPE A;  5TSW A;  5FO9 B;  4EN6 B;  5T54 A;  2ZZJ A;  3POY A;  3AMQ A;  1OD3 A;  3JD7 3;  5CAZ A;  2DVD A;  3E5X A;  2HBT A;  2J1T A;  3PHM A;  3THP A;  4C1W A;  4C90 A;  2I45 A;  1HXS 2;  1W9S A;  2D6K A;  4PF5 A;  3VKF C;  5F3G A;  4HON A;  1H0B A;  2AZ5 A;  1GYK A;  4R9A A;  3QH7 A;  4XF9 A;  4XZU G;  2D97 A;  3AYC A;  3B00 A;  1A6C A;  5C3O A;  5F8P A;  1FPN 1;  1OPO A;  5A32 B;  4A45 A;  5A3P A;  5JI7 A;  3O7O A;  3VZL A;  1OUX A;  4A42 A;  4OQ8 A;  4RR3 C;  2P3J A;  5EFU A;  4CCE A;  3V0B B;  4DXR A;  5BXX A;  2WWJ A;  3FX3 A;  5F3I A;  4FPK A;  5J7M A;  3W59 A;  5FYT A;  3I3M A;  1TME 1;  1ZBE 3;  1XE7 A;  4AQ6 A;  2YMZ A;  4MZU A;  4RQP C;  2W1W A;  4CVU A;  2WYS A;  3GHM A;  4XUP A;  5BPX A;  1RUF 1;  2UUR A;  1JUH A;  3AZY A;  3N9L A;  2XWB B;  1G9B A;  3LDK A;  5JLV A;  1O3S A;  4QPW A;  2V5Y A;  3MIC A;  3X29 B;  1UIJ A;  1QWR A;  5JZG A;  3ZN6 A;  4IET A;  2QQN A;  2LW8 A;  3LEK A;  4QXB A;  4UWD A;  4OLL A;  5C8C B;  4J25 A;  2PA7 A;  4PBO A;  4CDQ B;  3WQ0 A;  3NVC A;  4RYD A;  4ZS3 A;  2XJT A;  3NAP C;  1QJZ A;  3ZKU A;  3DPR A;  1W3V A;  4LBK A;  5AC9 1;  1KGY A;  2YG0 A;  1OVS A;  3KZ4 C;  4UFK A;  3VBH B;  1AJO A;  1URX A;  3WG4 A;  3M3C A;  2GP5 A;  1GP4 A;  3POI A;  2X5I A;  2P5B A;  2NZ9 A;  2ZGU A;  3LD8 A;  5FZ4 A;  5JOX A;  5CIR A;  2IXH A;  5JXI A;  2NP0 A;  4DQA A;  1QIQ A;  1DF0 A;  3QD6 A;  4HOO A;  4UFL A;  5G05 L;  3KV4 A;  4XET A;  5FZD A;  2HEY F;  2FDG A;  1COV 1;  2BV4 A;  5FZE A;  5KHI A;  1V00 A;  4L0P A;  3WF3 A;  4DUW A;  1E5R A;  1OF4 A;  2AH2 A;  1OKO A;  3M3Q A;  3SC7 X;  1RMU 2;  3SEP A;  5BNQ A;  4LBN A;  3GYD A;  1ND3 C;  2OZJ A;  4XUR A;  2E53 A;  3WHT A;  3TB0 A;  4CU8 A;  4HSJ A;  3ABZ A;  5C4W C;  5BNN C;  1MAC A;  4LE4 A;  3AK0 A;  4YGB A;  1G86 A;  2E63 A;  2QKD A;  1HJG A;  1K5M B;  1KJL A;  4DO0 A;  5ABJ B;  1WA6 X;  2YBS A;  4XCB A;  2R0H A;  1UOF A;  4YGD A;  3D5O A;  5FYH A;  1NUK A;  3CNA A;  3J7M A;  4Q4W 2;  1GZ9 A;  2JG9 C;  3A0N A;  5FZ0 A;  5A7W A;  2PFW A;  2VZ3 A;  4Y5T A;  1XE8 A;  2J1E A;  1E5H A;  1OOP B;  3LKJ A;  5F6L B;  2Q8O A;  2VQA A;  1JZ8 A;  1F35 A;  3VBR A;  3ZM8 A;  4LPL A;  3HR9 A;  4X6R B;  1QXP A;  1W9T A;  4A2U A;  1ODM A;  1QJU 2;  2JKB A;  3CJX A;  4N7U A;  5C3P A;  3KCC A;  3HNM A;  1A8M A;  1CAV B;  2A75 A;  3IPV B;  2UYA A;  3O1R A;  1LHW A;  1C57 A;  3NO8 A;  2WNU B;  2WR9 A;  5IAT A;  4AHX A;  3MIE A;  3OYW A;  2C1F A;  4QX8 A;  3CZU A;  2JIC A;  4WVW A;  3WNP A;  3LA3 A;  2WFF 2;  1RUC 1;  2B7Y A;  2OQ6 A;  4XIL A;  5FPX A;  1FMD 1;  1MEC 2;  1ZZB A;  4YVS C;  3RZH A;  3WSO A;  1W3X A;  2NMO A;  2ZX4 A;  4PCR A;  2EIB A;  3UJQ A;  4AEM A;  3LSD A;  3ZXL A;  3AP9 A;  3VN4 A;  3WW1 A;  3WDT A;  1S2E A;  1I9R A;  2ORX A;  2R32 A;  3K77 A;  3POJ A;  1CPM A;  3DGT A;  2BGO A;  3JUU A;  2EAK A;  3OGG A;  3OB8 A;  4XE9 A;  1FAT A;  5LA1 A;  4P9L A;  1PHM A;  1H8T A;  2RM2 2;  4LOR A;  3VHR A;  4AED B;  5CA6 A;  2HBU A;  4IEO A;  5FOB B;  1D4M 2;  1T6B X;  1HXS 3;  4UXA A;  3WT3 A;  2J7M A;  1XU1 A;  2Q0A A;  1ST8 A;  2VUD A;  5IWF A;  3VGI A;  1CX4 A;  1H1M A;  4YPJ A;  3MW3 A;  3J7H A;  4UYB A;  3VBF A;  4C91 A;  5BNP A;  4J1W A;  1PZ9 A;  4Q0Q A;  2H0B A;  4XQD A;  5CU1 A;  1W9Y A;  2A6Z A;  4D6Q A;  3AC0 A;  1O4Y A;  1UKR A;  3T2Q A;  1WBL A;  2MPF A;  3R05 A;  4PDW C;  5JR7 B;  4ISR A;  1STM A;  2HYK A;  3AM2 A;  1Q5O A;  2HWE 3;  2JDH A;  2V5D A;  4GH4 C;  1HV1 A;  1PO1 3;  3ENR A;  1WW6 A;  2QQL A;  2DCY A;  2Y6K A;  5KWR A;  1V70 A;  5FYC A;  4LIV A;  2D98 A;  3HN3 A;  1F15 A;  4FQ4 A;  5A7O A;  1QDO A;  4D6R A;  1LOB A;  3MID A;  4KGQ A;  1CJP A;  2DDU A;  1O3T A;  3PIG A;  4PHZ A;  1WMX A;  1KIT A;  4L99 A;  5DPN A;  1SHW B;  1I5P A;  1S0C A;  5DDJ 3;  2VE1 A;  4BZ4 A;  3NKT A;  1Q56 A;  2X8K A;  3H3U A;  1H9W A;  3CHX A;  3KF5 A;  3NNJ A;  1OUR A;  4JKM A;  4Q29 A;  1YO8 A;  3N36 A;  2MEV 1;  3OEB A;  1JZ7 A;  1V6J A;  5FRE A;  1REE A;  1UYZ A;  2PHU A;  1XB9 A;  2W39 A;  1TEI A;  2ZXQ A;  4IE7 A;  1UYP A;  3BYW A;  3MF9 A;  3FE5 A;  5K7P A;  5JMC A;  1GP5 A;  2DUP A;  3OSD A;  5FYZ A;  2A5Z A;  1OQE A;  1CAW A;  1RMU 3;  4OVE A;  4QGL A;  3AJZ A;  2ZAA A;  3ATG A;  4N53 C;  3C7E A;  1O59 A;  1ZZC A;  5JZG B;  3KCY A;  5LA0 A;  3ZN6 B;  4HMZ A;  2WAO A;  2YHJ A;  2CWM A;  4TLG A;  2VZV A;  2GC2 A;  3ES1 A;  3NJV A;  1UX7 A;  4ES9 A;  3NW4 A;  3PL0 A;  5F1R A;  4GA9 A;  2R07 1;  3T1M A;  2X5I B;  5J09 A;  1H30 A;  2VAU A;  5IAV A;  5C3R A;  1NCR A;  1NOV A;  4TN7 A;  1O7F A;  1VRB A;  4QXK A;  4MXW A;  3UET A;  2R6Q A;  4CUG A;  4EN9 B;  4ERO A;  3RZK A;  1K5J A;  1X8M A;  4XJU A;  1VAL A;  3VDB A;  3O1P A;  4BIO A;  1CES A;  2NN8 A;  3ZOI A;  4A7K A;  1RB8 G;  3WF0 A;  1H8V A;  1U5Y A;  5FY1 A;  2TUN A;  4YZ4 A;  2VR4 A;  5EJZ B;  1RVF 1;  2GSY A;  4FOV A;  3FWE A;  2PHX A;  1AXK A;  4LKF A;  1SQ4 A;  2O0O A;  2QBX A;  2VGD A;  4JDO A;  4YW6 A;  5C4W A;  4OUS A;  2BFU S;  4NMI A;  2Q8E A;  2XVG A;  3U0Z A;  2ZBJ A;  5C4W B;  1C1F A;  1MEC 3;  4G9S B;  1MS5 A;  1GBG A;  3GBW A;  5A7W B;  4LIT A;  4E2G A;  1W8H A;  1TMF 1;  1AL2 2;  1MVE A;  1RUH 3;  2XUE A;  2PHL A;  3Q8E A;  4G3Y C;  1HRV 1;  1AR9 2;  1V6L A;  2XJU A;  1MS9 A;  1S0I A;  3ACH A;  4XMI A;  3J7L A;  3VBR B;  1JMU B;  2JWP A;  2A71 A;  2Y6J A;  3I54 A;  4URT A;  2QQW A;  5DUV A;  3BUC A;  4AFA A;  2Y26 A;  5A6Q A;  1VP6 A;  4NRQ A;  5FZI A;  2GN3 A;  5KHH A;  2DVG A;  4JQR A;  1J3P A;  2F6B A;  2PAE A;  2WWU A;  4QHO A;  1WKY A;  1CAU A;  4QX2 A;  1D4M 3;  1QMJ A;  4Q1P A;  3POS A;  2GMM A;  1RIT A;  1AYM 1;  1WZX A;  2UY9 A;  3VBU C;  4Y5Z 0;  3UYJ A;  4Q8K A;  2JE7 A;  4RHV 1;  3MBW A;  5FZO B;  5IAX A;  3OYW B;  1VR3 A;  2Y6G A;  3BVC A;  5CZK A;  3AFG A;  4IER A;  1PVX A;  2A3Y A;  1HV0 A;  3BPS A;  1VBE 2;  2DBI A;  4LR4 A;  4PIY A;  2D6L X;  1VMF A;  4Y1V A;  3GJA A;  4YVS A;  3GGL A;  5E16 A;  2LS6 A;  1HB4 A;  2HLE A;  3RMX A;  1CGP A;  2IFW A;  2XLA A;  2ZX2 A;  2XJS A;  3RG0 A;  3GZU C;  3I3Q A;  2WA3 A;  4CEY B;  5GZF A;  4LO4 B;  1F4H A;  4D69 A;  5IVC A;  3T09 A;  1AR8 2;  3N3H A;  4FPG A;  1H4H A;  4I2O A;  4D94 A;  4XJW A;  4RFR B;  1Q8Q A;  4DUX A;  4AED C;  4QD2 A;  1P8J A;  1RL3 A;  3VBF B;  1JS9 A;  5BNP B;  1Y9M A;  2R06 1;  1LAJ A;  1QJX 2;  2YXS A;  4CEW B;  4I3G A;  4ONU A;  2J1S A;  1SLL A;  1VBC 3;  2J1U A;  5HXV A;  5A1L A;  1LES A;  5HBA A;  1F2N A;  5FPB A;  4ES8 A;  2Y0O A;  2A3W A;  4MHU A;  4CDX B;  1S0B A;  3H8U A;  4IL7 A;  3C8X A;  3DYO A;  2X05 A;  1W6O A;  1ULF A;  1PMH X;  1MQT A;  5C3Q A;  2AAC A;  3MV1 1;  4BPZ A;  4R9B A;  3KHC A;  4AR2 A;  4CDW C;  4OUL A;  2HWC 2;  1FOD 1;  5GLW A;  4JVA A;  2H6C A;  5F3C A;  5GLU A;  3GBF A;  3FLP A;  2IUW A;  1L3J A;  3LAG A;  4KU8 A;  4W65 A;  3LF7 A;  1IHM A;  2GZW A;  2AEN A;  4FTS A;  2A7A A;  4Y1Z A;  2YDE A;  3WDW A;  2OX0 A;  3IB3 A;  5EJ1 B;  4IV1 A;  3JXS A;  4JTO A;  1IS4 A;  5EV7 A;  4HVO A;  2W68 A;  3HD8 B;  2CNA A;  1HKD A;  2DU1 A;  3WD5 A;  2Y60 A;  4EN0 A;  3ZO0 B;  1EY2 A;  5FZB A;  3U75 A;  2VUJ A;  2XQR A;  2WO1 A;  5GLZ A;  3IBM A;  5F2W A;  1DQ0 A;  3D0J A;  4FOY A;  3LFI A;  1ZNP A;  4AQS A;  3PU3 A;  1CAW B;  5FPZ A;  1RUO A;  2WNO A;  4K9S A;  2H6B A;  2CDP A;  5ANN A;  1US3 A;  2HWF 2;  2ZJC A;  3PVN A;  4XFG A;  4XFB A;  4EWE A;  3ES4 A;  4ZY9 A;  4NWW A;  2G9F A;  5IJR A;  3N7L A;  1DCS A;  3OBA A;  2OW4 A;  1C28 A;  1QJY 1;  4MGZ E;  5FZ6 A;  4LUM A;  1BBT 1;  2VUA A;  2R49 A;  4LIU A;  3TEX A;  2R04 2;  2ARE A;  5AVP A;  4OI1 A;  2PQQ A;  3NAP B;  1YQ8 A;  5DUX A;  1AL2 3;  2XKO A;  2HWD 1;  3ACF A;  4XAB A;  2XML A;  4K8F A;  1NT0 A;  4MYE A;  4XUT A;  1J3Q A;  1UPI A;  2V73 A;  5LBB A;  3I8T A;  3WQB A;  3VKN A;  4CP9 A;  4B4P A;  1BVP 1;  4UT5 A;  4UBH A;  4CP0 A;  4YFZ A;  2QQO A;  4KI5 M;  4RGA A;  3TAY A;  2VVF A;  4KMQ A;  1JOJ A;  3VZJ A;  1LRH A;  3HIF A;  1RUI 1;  2YUE A;  3SLI A;  4UF0 A;  5D8A C;  1PIV 2;  1UY3 A;  3DXT A;  3SH4 A;  1ND3 B;  2D44 A;  3C7O A;  3ZSE A;  5FXW A;  4CCN A;  5BNO C;  3KD4 A;  3RPQ A;  1LJ7 A;  1UKG A;  2FDJ A;  1YQC A;  2IXC A;  2W1S A;  1CD3 G;  5IUQ A;  5I0T A;  2EXI A;  5BNN B;  5IK7 A;  4NIG A;  3DKQ A;  4CP2 A;  1DZR A;  5DAV A;  4MV2 A;  3KB5 A;  4GMP 3;  2RMU 2;  4JGY A;  2JEC A;  2W94 A;  1D2S A;  4IE4 A;  4F3J A;  5BUV A;  5JPN B;  3B3Q E;  2JG9 B;  4Y26 A;  3I2O A;  4OHY A;  5I93 A;  2PHW A;  3GM8 A;  2RE9 A;  3WVJ A;  1HRI 1;  4WM7 C;  4YW2 A;  2VOX A;  5JXH A;  1ZZ6 A;  4XQW A;  4MAD A;  4LNV A;  4AHW A;  1AR8 3;  3HN1 A;  3NV2 A;  3V65 A;  1JYI A;  1IG0 A;  2C24 A;  4Y33 A;  1YCI A;  5FYU A;  2VO5 A;  4QT6 A;  2FDI A;  3WNX A;  4QPY A;  4E8D A;  1DQ5 A;  3POE A;  5F5C A;  5LRS A;  3WG1 A;  2BZD A;  3BCW A;  3S5Q A;  4K7J A;  4AVT A;  2RS5 2;  4TXW A;  4NUB A;  5DN2 A;  4N43 A;  3NQH A;  4AI2 A;  4QQL A;  4CCL A;  2ARB A;  3T4H B;  2JEM A;  2FDH A;  2ZOE B;  3H3Z A;  1EAH 2;  5HCB A;  4YVS B;  3VZO A;  1R1A 1;  2JKX A;  3E5Q A;  3U07 A;  4A7Z A;  3NJX A;  1E57 A;  1PGL 2;  5FPV A;  1NX9 A;  2Q1F A;  2A70 A;  3ACG A;  2HWC 3;  2A1X A;  4AQ2 A;  1APN A;  3HOB A;  1PK6 A;  3ON7 A;  1OPM A;  4QDS A;  1AX2 A;  4XDQ A;  5FY9 A;  2GC1 A;  2KR2 A;  4Y4R A;  2LAL A;  2Q1M A;  3L2Y A;  1N47 A;  4LO5 B;  2OPW A;  2Z42 A;  3OUH A;  3BOW A;  4G4F A;  4Q0S A;  2YRO A;  2WWS A;  2RDQ A;  1F5F A;  4I0W B;  1JZ6 A;  4I01 A;  5DG1 A;  5FWJ A;  1VBA 1;  4AFB A;  1HLC A;  1BK0 A;  4MO3 M;  4N8M A;  3GZT B;  1BMV 1;  4NHM A;  5AFE A;  1FPN 2;  2Q30 A;  2EIC A;  4LBQ A;  5FZF A;  2CU5 A;  2B8M A;  1CWP A;  1MQT B;  5FY0 A;  1YC6 1;  1FYU A;  2VMD A;  3I2K A;  4XDP A;  4BQX A;  4F83 A;  1UZY A;  1KS5 A;  5FRA A;  2DTW A;  4D6S A;  4XC9 A;  2LTN A;  5GLV A;  3PUR A;  4Y24 A;  2WDB A;  1CPN A;  1S0E A;  5FKC A;  1DYP A;  1RUF 2;  1YI7 A;  2WZR 1;  1LHO A;  1MVQ A;  2V72 A;  4AYU A;  3BKZ A;  1CJD A;  3HJR A;  4W8J A;  4IV1 B;  2GNM A;  2QJV A;  2R04 3;  3PUQ A;  5FZG A;  1SLI A;  4IE6 A;  4AHZ A;  2JD9 A;  5FBZ A;  3SH5 A;  3J26 N;  5FYY A;  2J1V A;  3PNA A;  2BER A;  4YM1 A;  1GV9 A;  5FYV A;  4AAX A;  4CXX A;  2VZQ A;  3PMS A;  3O1M A;  1J59 A;  5FYB A;  4B7K A;  1GWK A;  1TNF A;  1M06 G;  2D6O X;  4XUQ A;  1GIC A;  4QXC A;  2Y6L A;  5H9P A;  4UFJ A;  2DFB A;  2RS1 1;  3LQC A;  1JYN A;  4N53 B;  4GXL A;  5JXJ A;  4M3C E;  2NPI A;  4R4Z A;  1YRZ A;  3KWV A;  2JJ6 A;  3O14 A;  4Y4Y A;  2XON A;  2IXL A;  3GXU A;  1H4G A;  1KEX A;  3JD7 2;  3U11 A;  4RN5 A;  4YM3 A;  5JZG C;  5GJ6 A;  3UKV A;  1RUE 3;  4MH0 E;  1OMI A;  2RMU 3;  1JW6 A;  3FUQ A;  4OHX A;  4MHR A;  4QX1 A;  3WP5 A;  3U4X A;  4DS0 A;  4BIF A;  3QOP A;  4EN8 B;  3DPR C;  4ORF A;  3D0S A;  3AP5 A;  4B4Q A;  2RJL A;  1N3P A;  5FKB A;  3TN9 1;  3LEI A;  3Q8A A;  4CCD A;  4FP2 A;  3TBD A;  3FN9 A;  2OUH A;  4UF0 B;  4M00 A;  3APB A;  2VXJ A;  2DBN A;  1F31 A;  1R08 3;  1MS8 A;  4WM8 A;  5JSP A;  5IK5 A;  5J36 A;  3R4D B;  3WNM A;  2YU1 A;  1GKB A;  2XKP A;  1ENR A;  3RVH A;  1UWW A;  1ZBE 2;  3VZN A;  2FDK A;  2RS5 3;  5FY8 A;  1XU2 A;  2VMC A;  5BNO A;  1SLA A;  1VAV A;  5M0T A;  5IFP A;  2UYB A;  2JG8 A;  1Z78 A;  3E6C C;  1EAH 3;  1HQN A;  4IV3 A;  3AL5 A;  1UY2 A;  3IT8 A;  4JGY B;  3MHZ A;  4H55 A;  5LZ6 A;  4ZKT B;  2QTW B;  1RUC 2;  2GH2 A;  5GM0 A;  3N35 A;  5FOJ B;  4PJY A;  1QOS A;  2VUC A;  1K45 A;  1OD5 A;  3EYP A;  4TYS A;  2B9V A;  1F4A A;  1SFN A;  2VZ1 A;  2YYO A;  5FK8 A;  1AYN 3;  5FPL A;  5SV8 A;  3K4A A;  4MSV A;  3ZMN A;  1EV1 1;  1LHN A;  2O14 A;  3OPZ A;  2XDV A;  3SH3 A;  3VBR C;  4XUN A;  3SHR A;  1DFQ A;  3USU B;  1RUD 1;  4A44 A;  1EYB A;  2VBD A;  4LUL A;  4XCA A;  2G19 A;  1ASJ 1;  1RJ7 A;  2P37 A;  1Q43 A;  2WYF A;  4I09 A;  2PAM A;  5KHJ A;  2ZKL A;  3RZZ A;  2VM9 A;  1SZB A;  4QDR A;  1N1Y A;  1ZYB A;  3A22 A;  4LUK A;  3RWK X;  3S6P A;  4EZ4 A;  1JHJ A;  1W06 A;  4BWO A;  1FPN 3;  3NV4 A;  4MG2 A;  1W9W A;  2EID A;  1U5I A;  4IEX A;  1IPS A;  3SIT A;  4Z8B A;  5FPU A;  2A6W A;  4V2V A;  5KBF A;  2AUY A;  2WQ8 A;  5FZ3 A;  2QQV A;  1PK6 B;  2JDN A;  4NRP A;  3O1V A;  2R0F A;  2RR1 1;  1TME 3;  2W87 A;  3KVA A;  4LOT A;  1DYK A;  4GJZ A;  3AP4 A;  5FYS A;  3HWJ A;  1RUF 3;  2FCT A;  4PQQ A;  1SBE A;  1V9U 1;  4K1Z A;  3O0V A;  1H8T C;  5FYM A;  1R64 A;  4Q4Y 1;  4XJA A;  4PLM A;  4BK4 A;  4CE8 A;  1AL0 G;  1Z0H A;  3T1L A;  3H8X A;  3OUJ A;  3MUY 1;  1IS5 A;  4FOQ A;  2IFR A;  5CYY A;  2DF7 A;  2ZEW A;  4UW5 A;  3MW2 A;  1L7L A;  4YW4 A;  3WP4 A;  3O5S A;  3NJY A;  5AC9 3;  2WT0 A;  2ZGO A;  4LBQ B;  4NWV A;  4UFI A;  2BU9 A;  1O3Q A;  5C8W A;  1RUN A;  1LEM A;  4XYX A;  4GWJ A;  3F2Z A;  2A6X A;  5KHG A;  4P9G A;  3FHI B;  1UY0 A;  4IQP A;  4Q8L A;  1COV 3;  3PUH A;  3QAC A;  5FZA A;  3E5U A;  2W92 A;  2XLG A;  1X33 A;  2PMW B;  4AFC A;  1SFP A;  2G9Z A;  4NO4 A;  1LGN A;  1I3H A;  1X9P A;  4QDQ A;  5BYN A;  3P1I A;  4GMP 0;  4X8P A;  1J84 A;  2VME A;  1DLL A;  1UMH A;  5EHD A;  1GOF A;  3AXD A;  3THC A;  2HWB 1;  3VHO A;  5C3S A;  2OA2 A;  3M1H A;  3PJY A;  1X82 A;  3PUS A;  4XFA A;  2IXI A;  4C0B A;  4Y1X A;  2YU2 A;  5AFB A;  3FZ3 A;  2B42 B;  4BH9 A;  4S2G A;  1VBB 1;  2D3P A;  2DVF A;  2VQT A;  2Z79 A;  1X7N A;  1OVP A;  4D0Q A;  5FZ9 A;  3W9A A;  2HWE 2;  2RS3 1;  3FMG A;  2BP6 A;  2R30 A;  1HDK A;  1PO1 2;  4A3X A;  1ZZ7 A;  2R1D A;  1LHV A;  1RUG 1;  1WLT A;  3AMP A;  3PTY A;  2H0V A;  2RJK A;  2VG9 A;  2Q5T A;  2XBO 1;  4O61 A;  1VB2 A;  1DGR A;  5FCC A;  4BB3 A;  1ZX5 A;  2E31 A;  2Y6H A;  3AMM A;  3V0A A;  1YXW A;  3RNS A;  1W6N B;  1F5J A;  1W6M B;  2VY0 A;  4TLF A;  5A3L A;  4K3U A;  2B45 X;  5KHK A;  1UOJ A;  4R9D A;  3IDC B;  1RUC 3;  1LGB A;  1QHD A;  3AP6 A;  1FMD 3;  4LXL A;  4MUV A;  3VHP A;  1FAY A;  3VZK A;  1TMF 2;  5DDJ 2;  4E27 A;  1XYN A;  2XHK A;  4E4Z A;  4NID A;  1YEW A;  3CLP A;  4XIO A;  2WNE A;  1KDK A;  4OUE A;  5A1A A;  1NCR C;  4H7M A;  3CO2 A;  3H8R A;  4Q4X 1;  5DXD A;  3UL2 A;  1MS4 A;  4WM8 B;  4KNC A;  2ZGR A;  5D8A B;  3GHN A;  3LDB A;  1IQD C;  3B93 A;  3VBO C;  1IOA A;  4YW1 A;  3ZXG A;  3ZXJ A;  4GZ9 A;  5FP9 A;  3MO4 A;  4GD4 A;  1LR5 A;  5BNO B;  3B5L B;  5FUN A;  1PX4 A;  2DVB A;  1W39 A;  1ALY A;  3MIG A;  2JG8 B;  2ENR A;  1OT5 A;  4IV3 B;  1UQX A;  1WCS A;  2F4L A;  1RIR A;  2IVI B;  2DFC A;  5CNA A;  2P3K A;  4QQO A;  3GZA A;  5EPA A;  2ES3 A;  4AWD A;  2OZ6 A;  1DQ1 A;  2GND A;  2W9X A;  3L2H A;  1A34 A;  4WM7 B;  3DUI A;  5E88 A;  4AI9 A;  3IMM A;  4TTG A;  1MZE A;  3VDA A;  4M3C A;  1NKG A;  4Y22 A;  4BME A;  1AJK A;  2VOK A;  1LOE A;  1NZI A;  4AI8 A;  1XBF A;  4JKL A;  3U4S A;  1G9F A;  4FBF A;  4ISQ A;  1N1S A;  3T2O A;  1LOC A;  4AL9 A;  4DXZ A;  5HCA A;  1VB4 A;  3ZMO A;  1CZV A;  1W8U A;  2W5F A;  3AVS A;  3CBN A;  4BDV B;  2UWC A;  3ELN A;  1BYH A;  3FBM A;  4I0B A;  5FUP A;  4MLO A;  2R06 2;  4EN7 B;  3WZ1 A;  4COY A;  3OGJ A;  1NLQ A;  4HVQ A;  4OZO A;  4PIX A;  5FY4 A;  1OH4 A;  2MEV 3;  1DQ4 A;  1JUI A;  1QY4 A;  4HET A;  5JDB A;  3MPB A;  1QH7 A;  1WD3 A;  1WLW A;  1NYW A;  1QXR A;  2D5F A;  2VCB A;  2L9L A;  2W46 A;  2WII B;  3FUO A;  5L36 A;  3RZJ A;  4IEY A;  2RDN A;  5G04 L;  4TZD A;  1RUH 2;  1JI6 A;  1DZQ A;  3NST A;  4QKD A;  5A1F A;  5EYX A;  4NPM A;  5IYY A;  4BQ4 A;  2Q8D A;  4NPR A;  4F8A A;  3TWI A;  1FOD 2;  3G6J B;  3CF6 E;  3CIH A;  5H9R A;  1U0A A;  2VZR A;  5BY5 A;  2BEO A;  2ET7 A;  4KG0 A;  1CAX A;  3W5N A;  4JX0 A;  2VQU A;  2VC9 A;  3VDD C;  5C5U A;  2CTV A;  4OYU A;  2OII A;  4K40 A;  1HW5 A;  1FT9 A;  3TEZ A;  5LK5 A;  5C33 A;  5KXD A;  2R07 3;  4HKL A;  1RHI 1;  1Y9G A;  5A3T A;  1ZBA 1;  3SNM A;  1BLZ A;  1H1I A;  3T0B A;  2BNN A;  2FQP A;  5ACA 1;  2LRP A;  2VEC A;  3N7M A;  2WN3 A;  1NY7 1;  5DZE A;  5A3W A;  5LY1 A;  1G8W A;  3K75 B;  2CGP A;  4BQY A;  4CDU C;  1AZD A;  3T30 A;  2GH8 A;  4RGG A;  2ZEX A;  4DB5 A;  1MQT C;  3RZM A;  2Z5W A;  2Y8K A;  3ZSK A;  2OYZ A;  1S4C A;  3LB9 A;  1GZT A;  2OXB A;  2D6N A;  4QB1 A;  1NE4 A;  2WS9 1;  1RYY A;  3SIS A;  1RVF 3;  3O1O A;  3C7H A;  5FXV A;  3IIA A;  5F32 A;  2ZHM A;  1HN0 A;  3TNP B;  3I7D A;  5IVE A;  3H1Y A;  2JD4 A;  4D7Y A;  3GCX A;  2IZW A;  4IV1 C;  4AFD A;  4GB3 1;  4HZF A;  1RUJ 1;  4AQT A;  2LRO A;  1TMF 3;  1R1Z A;  1NQJ A;  1SEF A;  4D7S A;  1HRV 3;  1VBC 2;  3WW4 A;  1UL9 A;  3D82 A;  2XPJ A;  3DN7 A;  2OS2 A;  1VAM A;  1NCQ A;  3CQO A;  4P5Y A;  4QPI A;  3E6B A;  4YVW C;  1L7R A;  3RS6 A;  2X09 A;  1RUI 2;  1YJL A;  2FCV A;  4Y20 A;  1N3Q A;  4FPH A;  4I30 A;  3H1M A;  4U2A A;  2Y34 A;  4W4Z A;  1AYM 3;  4OMC A;  3V0A B;  5J3U A;  1OFN A;  3I2F A;  4RHV 3;  4Z92 B;  2BPA 2;  2EXJ A;  2CYF A;  4RSU A;  3RRD A;  4Q26 A;  1ZRF A;  5A3U A;  3ZFG A;  5K0U A;  3LE0 A;  2CAV A;  2YC0 A;  1MS3 A;  1MZF A;  4ASL A;  3VDC A;  4YWA A;  2WT2 A;  3T2T A;  4V1P A;  4CPB D;  4IND A;  5KXE A;  4NHY A;  3DPR B;  5FLJ A;  4BXF A;  4WBB A;  1GWM A;  1VBD 1;  1WME A;  1WW5 A;  2GNB A;  5APA A;  4FPF A;  3PJQ A;  4OHZ A;  2VTX J;  4R52 A;  1C3H A;  4HPK A;  1HRI 2;  4Q27 A;  2JB8 A;  4CP1 A;  2ORZ A;  4AGG A;  1CN1 A;  2VW0 A;  3MLL A;  4CUC A;  3RDI A;  2I2S A;  3N9P A;  1ZRI A;  1AF9 A;  1UD1 A;  3NJZ A;  5A7N A;  4AK3 A;  3GJB A;  2ZX1 A;  4ATF A;  3BIW E;  4CA9 A;  1MR5 A;  2CSG A;  2WT1 A;  1NQD A;  3EHK A;  1UPS A;  3OPW A;  4FPO B;  3G7D A;  3VBO A;  3WR0 A;  4EYU A;  3LA2 A;  2R06 3;  1H9P A;  2CY6 A;  1FV2 A;  3CL1 A;  3ILR A;  4Y3O A;  5FK7 A;  2Q8C A;  4DIQ A;  2VPV A;  5ISL A;  1IKP A;  2YPJ A;  4K8R B;  1JXN A;  2XJR A;  4N7I A;  1EPW A;  1O4Z A;  4AVC A;  5LEK A;  3CJI A;  3N4M A;  3UGH A;  3OOX A;  3Q8C A;  4JCK A;  1EP0 A;  3MLK A;  4JGY C;  2QQP A;  4BLI A;  3SCF A;  4ZXE A;  1ZZ8 A;  4M3C B;  3M4F A;  4Y22 B;  3ZFF A;  1GOG A;  5I8Y A;  2BTV C;  4CUB A;  1FOD 3;  4R4X A;  2E7T A;  1CR7 A;  3VB9 A;  3ZYF A;  5EXO A;  2ILM A;  1OQD A;  1GLH A;  4IW3 A;  4IUG A;  2WJS A;  1QQP 1;  2VMH A;  3KLS A;  2FMY A;  4CYD A;  2PLV 1;  1M4W A;  1N3O A;  3HNY M;  4XHB A;  2YZ4 A;  3FFQ A;  1S55 A;  2I07 B;  1DBN A;  3PU8 A;  4PBP A;  2BOJ A;  5FZK A;  4UOJ A;  5FLH A;  4N43 C;  4LLF A;  1VBA 2;  1CIY A;  2QQU A;  3BOP A;  3RQ0 A;  3SEE A;  3I2J A;  5KXB A;  2GNT A;  1BMV 2;  5A3M A;  1JN2 P;  4Z07 A;  1R09 1;  4Q5O A;  5FMD A;  1BXH A;  1GNZ A;  5C70 A;  4P9W A;  4DNY A;  4XBN A;  5I91 A;  3ST7 A;  2E32 A;  4JHT A;  1OA2 A;  3ALQ A;  4C1X A;  1LKN A;  2CAU A;  4H14 A;  5JSR A;  4MXV A;  5CEH A;  5JSO A;  2XUM A;  1PK6 C;  3IKW A;  2EVX A;  1CAX B;  4XF1 A;  1H8T B;  1KRI A;  1S2K A;  1FNZ A;  2WZR 2;  1RC6 A;  1RGS A;  4QWN A;  1QJY 3;  1AR6 1;  2DTY A;  1HQW A;  4ZU5 A;  2XGX A;  4DEV A;  3MZH A;  1BBT 3;  4XW3 A;  1JTZ X;  3VDD A;  4YM0 A;  3H42 B;  4FAG A;  1UZZ A;  4ZU7 A;  2DV9 A;  2ARC A;  2QQK A;  5CVR A;  3R0R A;  2E6V A;  5L9R A;  1B09 A;  2HWD 3;  3O1T A;  3AZZ A;  3BI3 A;  2Y64 A;  2D3S A;  4NHX A;  4XUO A;  4Y5S A;  4Q4W 1;  5CKM A;  3WF2 A;  4BQ2 A;  5IVV A;  1GQP A;  2WKK A;  1POQ A;  4CDU A;  5LCW L;  1ZRE A;  4CSW A;  1HB1 A;  1RUI 3;  1WCD J;  1OC1 A;  2OPK A;  3IWZ A;  3P3N A;  1YIP A;  5JMO A;  5F5I A;  5H9S A;  5B4X A;  1QJU 1;  2RS1 2;  1V6I A;  1UU5 A;  1W8W A;  1ULO A;  1SFY A;  3AMN A;  3AYD A;  2B46 X;  2W0X A;  1SG3 A;  4LHK A;  5JOZ A;  1JYT A;  4QX3 A;  4IE0 A;  2DCZ A;  3AYE A;  2WO7 A;  1BVV A;  4MGT A;  4EE2 A;  4H2A A;  4BJ0 A;  3I3B A;  1MPX A;  4WZC A;  2XL9 A;  1UU6 A;  2GC3 A;  1POV 1;  2CV6 A;  2WFF 1;  3III A;  3LEG A;  3POW A;  4KBB A;  3KSC A;  3LZZ A;  3POG A;  1B35 A;  4YNI A;  4QPI B;  1HRI 3;  3I4I A;  2CGN A;  5ANQ A;  1VAK A;  4QAW A;  4BCU A;  4EWA A;  4URA A;  4MGK E;  4YG3 A;  3TN9 2;  1CQ9 A;  3GBG A;  4YVW A;  5FYI A;  3VL9 A;  3WW3 A;  3DYM A;  2VZP A;  2DVA A;  4Y20 B;  1D0H A;  1V6O A;  4PI2 A;  2RM2 1;  4A4A A;  2AYH A;  1LU2 A;  2Q4S A;  3ZIW A;  2J1R A;  3ACI A;  1Z7S 1;  4HL0 A;  5FMC A;  3ZFG B;  4FFH A;  1XSR A;  2XHN A;  3E6D A;  1XNA A;  4EV0 A;  4FPC A;  3GDB A;  1ZA4 A;  4HKO A;  3IZO A;  4K1Y A;  4GJY A;  2ZAB A;  3D6E A;  3NKG A;  2WSV A;  4JAA A;  2VD7 A;  1R1A 3;  3GZE A;  3DF0 A;  2NQY A;  5J98 B;  3ZYI B;  2MHF A;  2ZMK A;  4GAL A;  5IVF A;  3KGZ A;  4IGP A;  3FHQ A;  1VRH 1;  2QUO A;  3POB A;  4HPK B;  5JCT A;  3NNL A;  3KHB A;  1XNK A;  4A6O A;  1H2K A;  3VKM A;  1NCR B;  1RED A;  4LK7 A;  3AZX A;  5JAX A;  4MXW B;  4ASM B;  5JPM B;  1EV1 2;  1UMZ A;  5FZ8 A;  4ZU4 A;  3VBO B;  1QU0 A;  3THT A;  1RUD 2;  4I0A A;  4WVM A;  1OI6 A;  4WM8 C;  5HXM A;  1ASJ 2;  2K46 A;  3KV6 A;  5LY2 A;  2XJP A;  2F4P A;  2PHR A;  5EP9 A;  2ZS6 B;  3RZG A;  3U14 A;  4B29 A;  2WN2 A;  1SAC A;  4KQ7 A;  1VBA 3;  4MGQ A;  1WD4 A;  2ZKN A;  2BDR A;  2JG8 C;  1AVB A;  2XB6 C;  5GZG A;  3WUC A;  4IV3 C;  1YQ2 A;  2BNO A;  5FLI A;  5JOW A;  1H6Y A;  1OXC A;  4FPL A;  4MX3 A;  4HAN A;  2ZEZ A;  1RUE 2;  2VCM A;  3EQE A;  3EB7 A;  2WIN B;  2Z69 A;  2WO2 A;  4OQ9 A;  1SBD A;  4XMA A;  5D21 A;  2FCU A;  4K6B A;  4HN0 A;  4KG8 A;  4PI0 A;  3TOJ A;  1DGL A;  2YGL A;  4I02 A;  3VL8 A;  3BTX A;  4JDM A;  1CAU B;  4P02 B;  2PQS A;  1V9U 2;  2WZR 3;  3VHN A;  2VNG A;  2R7E B;  4Q4Y 2;  1R08 2;  3AMH A;  4AI3 A;  3J8F 1;  4AGR A;  2YBK A;  4N9I A;  4IEU A;  2VMF A;  2PTM A;  3KM5 A;  3WDU A;  3KT1 A;  3WP6 A;  4NOT A;  3ZXE A;  4XDO A;  5LK7 B;  5CG9 A;  1SDW A;  4JKK A;  3SCH A;  1H2L A;  3N7K A;  2QVS B;  3OEA A;  3I2D A;  1BKZ A;  2BRT A;  3T08 A;  2EXH A;  4F7Z A;  1GZW A;  4JHZ A;  3BAL A;  4AOC A;  1SMV A;  2G4I A;  4IGO A;  1YIF A;  2WLQ A;  4NVP A;  1WW7 A;  2JE8 A;  2EA7 A;  4HN1 A;  2KA3 A;  4XFH A;  2VJX A;  2DUO A;  3GCW A;  5DAX A;  1IG3 A;  2RS1 3;  3C2U A;  2WZ8 A;  1AYN 2;  4Q0P A;  1HB3 A;  4QQ2 A;  3LCP A;  1XSQ A;  4E4H A;  5ERL A;  1KD7 A;  1PVC 1;  1S0J A;  2WAB A;  3AP7 A;  1NA1 A;  2PHF A;  2ZZQ A;  4KWJ A;  3VDD B;  3FLR A;  2HJI A;  2VMI A;  2XLF A;  5T5L A;  4B4R A;  1PGW 1;  4LKE A;  4ZON A;  2W08 A;  4WVZ A;  1BHG A;  5KC6 A;  2P4E A;  4BQ3 A;  5I0D A;  1IKQ A;  2KXL A;  1ND2 A;  2P2K A;  2XH6 A;  1W9F A;  3VD7 A;  4CU6 A;  3OY8 A;  3O0W A;  4DY5 A;  3B9C A;  2VW2 A;  1Y43 B;  3IAP A;  3TN9 3;  1AR9 1;  3CMG A;  1OA3 A;  3GNE A;  1OBN A;  1UYX A;  1W6O B;  1VBB 2;  3N9M A;  4CDU B;  3WF4 A;  4YZ5 A;  3OGS A;  4NRO A;  5FP4 A;  2IC1 A;  5GZE A;  5SV5 A;  1W8O A;  2RS3 2;  2NLR A;  5LBE A;  1W2A X;  4W50 A;  1RUG 2;  1TME 2;  2FHR A;  2N7G A;  2XBO 2;  1JZ2 A;  3IDE A;  1K12 A;  4BM8 A;  2F17 A;  2WRA A;  3Q9O A;  2B5H A;  2C0Z A;  4XAC A;  5FPA A;  1UW8 A;  3UKN A;  1ZRR A;  3A21 A;  5FXX A;  1DGW A;  1OHF A;  1QNY A;  4O65 A;  3MV0 1;  3RGB A;  3WY6 A;  1AR7 1;  4NPL A;  5FQ0 A;  2WQZ C;  1B35 B;  1SDD B;  1CIW A;  1VBE 1;  1YFY A;  5A7P A;  2O8Q A;  2WSU A;  3PME A;  2GDF A;  5F6K A;  1LU1 A;  1SPP A;  3MPP G;  4IEW A;  3LOB A;  5AC9 2;  4YVW B;  3HEI A;  3KQR A;  3DV8 A;  5FMO S;  1EV1 3;  1K3I A;  2JDY A;  2W52 A;  1UOG A;  2DU0 A;  1UX6 A;  2GAU A;  4GQ7 A;  3WW2 A;  4BIS A;  2ZGK A;  4IEQ A;  1RUD 3;  1U12 A;  3ITQ A;  1C5I A;  3JCI A;  3MUZ 1;  1V0A A;  4XEZ A;  1ASJ 3;  2YY1 A;  1QNW A;  1COV 2;  3BOD A;  4UI9 L;  1IPK A;  4DIN B;  2XR4 A;  4LBL A;  1X36 A;  2JDK A;  1W8N A;  2VH9 A;  3EJK A;  2QE3 A;  4XZP A;  4CCK A;  4HVR A;  2TBV A;  2W3J A;  3MYX A;  3SKV A;  3T0D A;  1QJX 1;  3VD9 A;  1W2O A;  3NV1 A;  1J1L A;  4QB6 A;  5JXG A;  2PAK A;  4QB2 A;  1TE1 B;  4NJ4 A;  4FVV A;  1YNA A;  5I8T A;  4QKF A;  5B2G B;  2VTF A;  4Q1R A;  4AFM A;  1DIW A;  1XNB A;  3LIH A;  5E89 A;  2JDU A;  4M01 A;  2RR1 3;  4CP9 B;  1XPW A;  4SBV A;  1GMM A;  4R9C A;  4QX5 A;  4DRV A;  1O8S A;  1Y7B A;  2JIJ A;  1A8D A;  5DMY A;  1V9U 3;  2VBB A;  4LE3 A;  3WIN E;  4Q4Y 3;  5E6H A;  3ZIX A;  4YAR A;  5GZD A;  4QKN A;  1ZZ9 A;  2GN7 A;  1A3K A;  3QCW A;  3VZM A;  3MFA A;  4XOG A;  5T5P A;  2P3I A;  2K9Z A;  2JIG A;  1NZC A;  1DU3 D;  1LOD A;  5JWP A;  3PVO A;  3I3D A;  4P9I A;  5FJH A;  3RI9 A;  4WZF A;  1C5H A;  2FZ2 A;  3WNN A;  4HFS A;  2ZHL A;  3ZYG A;  1DLC A;  5LEJ A;  2OKX A;  3U10 A;  3RYR A;  4LOS A;  2FBE A;  2BW8 A;  3FL7 A;  5EYY A;  1CON A;  1FMD 2;  4H7L A;  3SKJ E;  1S2B A;  5FIX A;  2VZS A;  4BOW A;  3PVB B;  2GAL A;  3H7Y A;  5T3N A;  2Q1Z B;  2WA4 A;  3OJB A;  3AJY A;  2HWF 1;  1D7P M;  3AKQ A;  1DGW X;  3U37 A;  4B7E A;  2XJQ A;  4JGZ C;  4JRA A;  2ZGT A;  5HV4 A;  3QBQ A;  3FHA A;  1BEV 1;  1JOD A;  3VBS C;  3W20 A;  3OF1 A;  4EJR A;  2HWB 3;  1KXG A;  3O1U A;  5F9T A;  1QOT A;  4N43 B;  1UXX X;  1UIK A;  3P6B A;  5E1R A;  4QM9 A;  5A6X A;  5DZG A;  5K4L A;  1RHI 2;  3UV9 A;  1GZW B;  1GU3 A;  1K5M A;  2J22 A;  5IT6 A;  2YGM A;  2K2S A;  5ABJ A;  1XRU A;  1VBB 3;  4XIK A;  2BWC A;  4NHK A;  5D2A A;  2ARX A;  5IVJ A;  2WNV A;  1BCX A;  1HN1 A;  4FI9 A;  4QX0 A;  2P6H A;  2RS3 3;  1S0F A;  1W8F A;  2VOV A;  4HSL A;  5T52 A;  1RUG 3;  3PIJ A;  2P3Y A;  2EIE A;  1S0D A;  2XBO 3;  2XWJ B;  1PIV 1;  2B4K A;  5FP3 A;  5C5T A;  1NXD 1;  2QDR A;  2RG4 A;  1RXG A;  3INA A;  3OG2 A;  3RJ2 X;  5FZ1 A;  1DDL A;  2VNO A;  2TEP A;  4NHL A;  1VJ2 A;  1ZRD A;  4KGG A;  3B7M A;  3QLQ A;  4B3N A;  3OTF A;  4BLJ A;  1ND2 B;  1UZ0 A;  4XVH A;  4JTN A;  5FWE A;  3OY8 B;  4FT8 A;  2ZEY A;  3D4K A;  2GME A;  1U5Z A;  2VOW A;  1A78 A;  4ET7 A;  2D5H A;  2BBV A;  4QQH A;  2NYY A;  3ZFE A;  1FNY A;  4UW3 A;  1J3R A;  1US2 A;  1JZ4 A;  1V6M A;  2MEV 2;  1H6X A;  2OUJ A;  4P08 A;  2DUQ A;  4XF0 A;  1CZT A;  3BTA A;  2RDS A;  4KL1 A;  4Q4X 3;  2IXK A;  4MGY E;  5C71 A;  2OVU A;  4Q0V A;  5CFD C;  2FMD A;  5L9V A;  4AEK A;  1GOH A;  3ETQ A;  5K9Y A;  4CPB A;  1ENX A;  5A6Z A;  1H1A A;  4J1X A;  3JU9 A;  1ZRC A;  4S2F A;  1WUV A;  2BFU L;  4SLI A;  4CXW A;  1PO2 1;  2SLI A;  4ITC A;  2JDZ A;  1NE6 A;  3ILF A;  4BQW A;  5FO8 B;  1ZA7 A; 
#chains in the Genus database with same CATH homology
 1RXF A;  1UNB A;  1HJG A;  3ON7 A;  1WA6 X;  2VBB A;  1UOF A;  2VBD A;  1E5H A;  1W28 A;  2VAU A;  5C3R A;  2Y60 A;  2BRT A;  1ODM A;  1BK0 A;  5C3P A;  1W06 A;  1W05 A;  1QJF A;  1HB1 A;  1OC1 A;  2VBP A;  3ZOI A;  1IPS A;  2IVI B;  1HB3 A;  3ZKY A;  2WO7 A;  1DCS A;  1W04 A;  1W3X A;  5APA A;  1GP6 A;  2JB8 A;  1ODN A;  4XAE A;  2CSG A;  1OBN A;  1HJF A;  1W2N A;  2BU9 A;  5C3O A;  1W2A X;  1W9Y A;  3OOX A;  1E5I A;  2DBI A;  1RXG A;  1HB2 A;  1HB4 A;  2BJS A;  5C3S A;  1UZW A;  1QJE A;  4RGK A;  1UOG A;  3ZKU A;  1W3V A;  2VE1 A;  1BLZ A;  2DBN A;  1E5S A;  1GP4 A;  2JB4 A;  2Y6F A;  1QIQ A;  1UOB A;  2IVJ A;  1W2O A;  1E5R A;  1W03 A;  2VCM A;  1GP5 A;  4BB3 A;  1UO9 A;  5C3Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...