5C3RA

Crystal structure of the full-length neurospora crassa t7h in complex with alpha-kg and 5-hydroxymethyluracil (5hmu)
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
333
structure length
333
Chain Sequence
MEKAAVNEDGLVIPLIDFSKFLEGDETLKLETAKAILHGFQTAGFIYLKNIPIQPDFREHVFNTSAKFFKLPKEKKLEVGWTTPEANRGYSAPGREKVTQLTDPAEIEKIRSAAPDIKESYEIGREDEPGHPNPWPAEQDDLVGFKSTMNNFFDQCKALHIEVMRAIAVGMGIDANYFDSFVDVGDNILRLLHYPAVKSEVFKINPGQVRAGEHTDYGSITLLFQDSRGGLQVKSPNGQFIDATPIENTVVVNAGDLLARWSNDTIKSTVHRVVEPPKQEDVHPPRYSIAYFCNPNHKSYIEAIPGTYAAESERKYEGINSGKYLVQRLAATY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Thymine dioxygenase
publication title Molecular basis for the substrate specificity and catalytic mechanism of thymine-7-hydroxylase in fungi
pubmed doi rcsb
source organism Neurospora crassa
total genus 98
structure length 333
sequence length 333
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03171 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily
A PF14226 DIOX_N non-haem dioxygenase in morphine synthesis N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.330 Mainly Beta Sandwich Jelly Rolls B-lactam Antibiotic, Isopenicillin N Synthase; Chain 5c3rA00
1W05A 2BJSA 1E5RA 1W9YA 2WO7A 2Y6FA 1ODNA 1E5SA 1W2NA 1W3XA 1UZWA 3ON7A 3OOXA 1QJEA 1E5IA 1W2AX 3ZKYA 2DBIA 1GP4A 2JB4A 1OC1A 1HB3A 1GP6A 1QJFA 1HB4A 5C3QA 1WA6X 5C3RA 1W06A 4RGKA 5C3PA 1W03A 2VBPA 1HB2A 4XAEA 2JB8A 2IVIB 5APAA 1UOGA 1RXFA 1UOBA 3ZOIA 5C3SA 1RXGA 2DBNA 1E5HA 1QIQA 2Y60A 2BU9A 1W3VA 3ZKUA 1UOFA 5C3OA 1ODMA 2IVJA 2VAUA 1HJFA 1HB1A 2VBDA 1W2OA 1UNBA 1OBNA 2VE1A 2BRTA 1BLZA 1HJGA 1UO9A 2VBBA 2VCMA 1IPSA 1W28A 1W04A 1GP5A 1DCSA 2CSGA 1BK0A 4BB3A
chains in the Genus database with same CATH superfamily
4RFRB 4MZUA 2XVLA 2D6NA 3NNLA 4QB1A 3NSTA 5DZFA 3VBSC 5IJRA 4W50A 2E63A 1V6IA 1J3PA 1HRI1 1LKNA 3OGJA 2JG9A 1W0PA 1IS4A 1VB4A 5IAVA 5K8SA 1JN2P 2VTFA 1F31A 3E97A 3NO8A 4W6XA 3SCGA 2W95A 2PYTA 1JYTA 1O8SA 3H42B 2JDZA 3VBUA 4EWAA 3D0SA 4ITCA 1DQ0A 5LEJA 2IWGB 5FUNA 4CDXB 3ZR6A 3VDBA 4COYA 1COV2 1OFSA 1QY4A 2VUCA 1IQAA 2ZA9A 3IAPA 1V6OA 4UF0B 4XILA 4MHUA 5FZEA 2ERFA 1YQ5A 2YU2A 4TLFA 3OSDA 1CAUA 1HXS2 3D3AA 3TEWA 2HWF1 4ZKTB 1UAIA 1QJFA 4DMIA 3AP4A 5KHKA 1ZX5A 1WA6X 3GBGA 1OH4A 4CE8A 3JBG3 1LOFC 3K46A 1NLRA 3F95A 5H9RA 4XFBA 1G9CA 3O1OA 3PIJA 1LOAA 4QPWA 4XXAA 4QQ2A 4XDPA 4AW7A 4E4ZA 3IPVB 4IV3C 4AEDB 1LU2A 2VMHA 3ZFEA 4LBQB 1AR73 4A44A 2H0BA 2J1RA 4BWOA 3ZMNA 4AOCA 3A7QA 4P9YA 1AR93 3LSDA 4MYEA 4NHXA 1M06G 4BE3A 3PUHA 1ASJ3 3U0ZA 1D0HA 1UZZA 3B01A 1TNRA 1ULOA 4I2OA 2B5HA 4FPOB 4BIFA 5LRSA 4RHV3 3FLTA 4KG8A 3FHQA 4IEYA 5CKQA 4XPVA 1J1TA 1RUI1 4V1PA 4WBBA 4OUSA 3VKLA 5GLTA 5CB7A 5CEHA 2NN8A 2BOJA 2QQIA 4QX3A 5F7UA 2XJRA 1VAMA 4QU2A 1GANA 2IVJA 4NN0A 2Y8KA 1LECA 1RL3A 2JG9B 4OYUA 1UYPA 3TEZA 3MV01 3DPRC 4YGCA 2EICA 4YZ5A 2V72A 3ST7A 3T2OA 3OY8B 5HPOA 1RUOA 1ZNPA 3SITA 3K77A 3RSJA 1ZBA2 3BTXA 4D94A 2BFUL 3ZXGA 4QKDA 2BWCA 3NWKA 5DAXA 2ZEYA 4AQ2A 4QDRA 1PVC1 4GXLA 3B69A 4KL1A 2VE1A 4S2HA 4ZXEA 1PM7A 4TTGA 1BLZA 3MZHA 2HYXA 3T3YA 2RM22 2WZR3 1SLIA 3M8LA 1UY4A 2K2SA 5IFPA 3JUUA 4G9SB 1CAUB 3W58A 4Y33A 2GH2A 3GALA 4NRMA 1KFXL 2TUNA 4MGQA 5AVPA 3SISA 1Q43A 3TNPB 2LTNA 4J1XA 1DCSA 2VMDA 2RMU1 1UN1A 4AL9A 3V0AB 4CP0A 5JI9A 4XEZA 4GH4A 5FREA 4DQAA 3LE0A 4LR4A 3ENRA 3JZVA 2QQUA 4A7YA 1O3TA 4Y1ZA 5KHHA 4CDWA 3ZFEB 2EF6A 4PBPA 5EV7A 4OHYA 2JG8A 3FHIB 1WLDA 3MLJA 1BEV2 2A70A 4FFGA 5FRAA 2KD7A 2QBXA 1CN1A 1QGLA 5FPBA 1H1MA 2JDHA 5KC5A 1SQ4A 1XSRA 4DS0A 1MR5A 3T30A 3THCA 1CGPA 5CVRA 1SFNA 2D6MA 4XF1A 2WT2A 2B9VA 1Y9QA 1MVEA 3HQRA 1ZRDA 3HVDA 1S1AA 1N1SA 1W3XA 2R1DA 5LA9A 2MNGA 4A6OA 3ZYRA 1ZZ8A 3DYOA 1KXGA 3AJZA 2EIBA 1IS6A 1LR5A 4JKMA 5F5CA 2G19A 4ZU5A 5ABJA 4DEQA 4JTNA 2GNMA 3U1XA 4B29A 1DQ2A 1UY3A 2VZRA 5I91A 3KQRA 5L7OB 2WNUC 4Y4YA 2WSVA 3WG3A 5IFTA 2J1AA 2BGCA 2VMFA 5JVVA 1O4YA 1YQ2A 2G9GA 1XNTA 4DNYA 4LHKA 4B4QA 3LPGA 1GQPA 3HR9A 3RMXA 4CP2A 4EROA 5K0UC 3S30A 3TN92 3ZXFA 4NAOA 4AHXA 4XF4A 2Y6HA 3FMGA 5H9PA 1LHNA 4XQWA 5JCTA 2D3SA 4LHSA 4WM8C 4BM8A 4BISA 4IEVA 3FE5A 3KWVA 4COWA 4FO9A 2W3JA 1URXA 1W8FA 4FPKA 4AGVA 4B7KA 1JYIA 2VCAA 5LA0A 1I3HA 3HBKA 5F9TA 2YBSA 2P3IA 3WG1A 2NP0A 3I97A 3AKRA 4K21A 5A7OA 3VDDC 4NHLA 4GH4B 1TZOA 4HL0A 1CPNA 2ETEA 5KWRA 5IW0A 3VKNA 5T52A 4LTAA 3U78A 2V4AA 3MUZ1 1C28A 2JG8B 1HQLA 1YC61 4RFT0 5FY7A 5BXXA 1NG0A 3KVAA 1VBB3 2GU9A 4QB6A 1XE7A 1IKQA 2X5IA 3A0NA 2XH6A 3HNYM 2C4XA 3AZWA 2D7FA 3CZJA 1FOD3 3PUAA 4QDQA 1LB2A 2MEV3 2EXJA 4B3NA 4D6QA 2A71A 2RJLA 1QJU1 1TMF3 5BY5A 4JHZA 4YW5A 5C8CC 1HJFA 4FFHA 1WKYA 1S0CA 5JZGA 2VTXA 2PMWB 1TME2 3U10A 2WNEA 3SQOA 3RZLA 2VMIA 5ISLA 3NAPA 5BNPC 1APNA 1LJ7A 1QOOA 1W2OA 2E31A 1V6MA 5FOBB 4BPZA 1HRV3 5FPZA 4Z2AA 2YC0A 4XHXA 1LENA 4B4RA 2VVDA 3BPZA 2XLGA 3PDQA 5DUVA 2ZGTA 4IV1C 1PGW1 2UYAA 2AH2A 4KH9A 3GYDA 3ES4A 4MGSA 2VNGA 2WWUA 2XQXA 4LKSA 1KJLA 2OUHA 3QH7A 3S0MA 5IYYA 1UYYA 3MYXA 3POWA 1NA1C 5LBFA 4A3XA 5TSWA 4XFFA 3JD71 2QQJA 3HT2A 1LHWA 1AYM1 5FZ0A 5IK8A 3RI8A 1FYUA 3O1PA 3ACGA 3LPFA 1X36A 3CLPA 1YLLA 5FP8A 1LNSA 3VBSA 2C6SA 4JGYC 2VOKA 1RMU2 4IEUA 4DUXA 4QM8A 4DXRA 1JZ8A 2OVUA 1OF4A 2NM1A 4O65A 3OGSA 5FO8B 4N90A 4YG3A 5FYUA 3B93A 4IXLA 1BBT3 3KV4A 2ZXQA 1AX1A 3PJQA 1Z7S3 4KGGA 2NYYA 1BKZA 2C1FA 3ZXKA 2A73B 3BOPA 4O9EA 4F83A 2YFUA 2X10A 2Q1MA 3ZXAC 3FX3A 4HKWA 4I02A 2VNRA 2X5IB 4AF9A 2CAUA 3PHMA 5F39A 5JOYA 5I0TA 1EV12 1IS3A 2QQKA 2ZEZA 4HANA 3RJRA 1CIWA 4WVVA 3T09A 1UQXA 2XJPA 5DMYA 1NCRC 3AXDA 5E6HA 3WQ1A 4XJZA 4CEWA 5C5TA 4HG6B 1JUHA 4AFCA 2DVAA 4LO4B 3IKWA 1LGCA 5G05L 2OW4A 5JZGB 4CYDA 1RHI1 1R091 2ZAHA 3NAPB 1XSQA 5D21A 3EB7A 1I1EA 3NNJA 2RMU2 3PU3A 2JKBA 3GGLA 1RVF2 2V09A 4Q4X2 5ACA2 3O12A 1RUG3 2WIIB 1I9RA 2E26A 2XQRA 3LQCA 4Q4W3 4QX8A 5I8TA 3N35A 2VZUA 4Y1XA 2VZPA 2HBTA 5F3EA 5IVFA 1WW4A 2KM2A 1QJY2 2WA4A 3I2DA 4LUMA 3MIDA 4LKDA 1XRUA 2YDEA 4CDQA 4JDOA 5JMOA 4Y22A 2ARBA 3NNMA 5APAA 5DAQA 2QDRA 5K7PA 1U12A 3ZFFB 2HWC3 3B9CA 1HIXA 4C1WA 2WDBA 4GKYA 4GJYA 4Q0SA 5EPAA 1DYPA 2VY0A 2WT1A 2R071 3URFA 3VBSB 5J1XA 2A6WA 2P17A 2OYZA 1SLCA 1VBA1 5DUWA 3ZMOA 1R1A1 5CFCC 3IMMA 2C26A 1GU3A 3F2ZA 1JW6A 1IG3A 1AL21 1RJ8A 3DPRA 1TQ5A 4Q4Y3 1HV1A 4XOGA 1ENQA 1W3VA 3ZSKA 1PGL1 4Y20A 1PZ7A 5FXWA 4QT6A 5EYYA 2W92A 2WBKA 4DUVA 4DXTA 3KGZA 2FDKA 3ZYJB 4V2VA 1L7LA 1Y4WA 4AQ6A 1UYXA 1W6QA 2GAUA 3I3EA 2A6ZA 5FYMA 1FMD3 1O4ZA 5GLVA 3ZN4A 4E4DX 4A42A 1RUE1 4QXCA 4JGZC 1W6OB 4B1LA 1AXZA 1MQTC 1KDMA 1YJLA 1YUDA 4P9GA 5A6ZA 5AC92 5KHJA 2FBEA 3RZGA 2NLRA 1UYZA 2BZDA 5HXMA 1YFUA 1MZ6A 2OPWA 2WL1A 4MO3M 4B4PA 5F3GA 1ZBE1 4XUOA 3RZJA 1K3IA 1UU5A 1CJDA 1PZ8A 2DCJA 3CMGA 1SDDB 1PNGA 4AVVA 3O0XA 1FI2A 1X50A 2X09A 3I4IA 3AMMA 2BV4A 4IE6A 1CPMA 2RS31 4TZDA 2ZX1A 3VL8A 1OVSA 3B00A 2RE9A 2XXZA 3NRUA 4L97A 3SCHA 3WF0A 4Y22B 3ILNA 3IT8A 3RVHA 4CDXC 4K3UA 4RR3A 4DXZA 3WW1A 4AI8A 1C5HA 2QZ2A 2EA7A 1WMEA 3W20A 2BNNA 1WUVA 3C7OA 4LOSA 4AI0A 2PA7A 1G8WA 4UFMA 1ND3A 2Y6FA 1YYNA 3I2JA 3JBG2 5FZ8A 5GLWA 2QVSB 3RYKA 3DPRB 1UZWA 2WNUA 5DDJ1 4ZS2A 1FXZA 3LA2A 2JX9A 3HJRA 2HWB3 1Y9MA 2ZHNA 3JU9A 4R4ZA 4CU9A 4ES8A 2HEWF 2OS2A 4Y20B 4DO0A 4W65A 5FJHA 4ARYA 3O5SA 2Z2SB 4O61A 1SBEA 2PXJA 1AR92 2EXIA 1W6QB 1CAVA 3USUA 3TB0A 1F5FA 1A78A 5FZCA 1IHMA 1RITA 1FPN3 1QJX1 1UU4A 3AKQA 3OYWA 2HBUA 1ASJ2 4AVSA 1ST8A 2GC2A 1QOSA 4XE9A 1OC1A 4NHKA 2RG4A 5F37A 3P3PA 4AEKA 4RHV2 4CCDA 4N7UA 4W6YA 4YVSC 5LBBA 2GP3A 1ZZCA 4MXVA 5C3RA 4UYBA 1YNAA 3KT1A 3JCIA 2WT0A 4NWVA 5EJ3A 4OVEA 5HV4A 3ZFGA 4P00B 1RUF1 3SKJE 1C3HA 2VM9A 2G4IA 2JG9C 4YW2A 3AX4A 4P14A 4BQ5A 2I2SA 4QU1A 5C5UA 1STMA 1BJQA 3O0VA 3RS6A 5KC6A 1BMV1 3CHXA 1Y43B 2PHUA 3AFKA 5D1IA 5JR7B 3VBUC 4CP1A 1VPHA 4OUMA 3CEWA 4XFHA 2WZR2 2VQAA 1MS0A 3G7DA 4RR3B 3WDYA 4H14A 4AEMA 3J7NA 3E5UA 1I6XA 1QQP2 4HKOA 1RHI2 5LATA 2QQWA 4Y24A 4PLOA 5BNQA 1RUC1 3AL5A 2CDPA 4Q4V1 3FLRA 1LTEA 4URTA 2W5FA 1W6NA 2AR6A 5J09A 3R4SA 4N8MA 2WNUB 2VTXJ 4L8QA 2Q1FA 3M3EA 1IGOA 3B94A 2FCTA 1W6PA 1Z0HA 3INAA 1O6UA 5LW9A 4XBQA 3ZFEC 4AE2A 2WO2A 1N1VA 1J59A 3H8RA 2B9UA 1MPXA 3ALQA 1OA3A 1CAVB 1PGSA 1LGNA 2XMLA 2W08A 4ZY9A 3OD4A 3USUB 4E4HA 1LAJA 1XC6A 4Y4RA 3OYWB 2CGPA 3HEIA 4UFIA 4IGOA 1PMJX 4EWDA 1UO9A 3BUCA 1FT9A 4HSJA 4YARA 4QQPA 4M0NA 5A6QA 2RS13 1VBD1 1YQ6A 2O8OA 2RS51 4LO6B 5DPNA 3VN4A 2TNFA 2WAAA 4NRPA 3ZIXA 5HBAA 1A34A 2BPA2 4M01A 4PLMA 1BCXA 4I3GA 2CSGA 4LOTA 1RUH1 4XVHA 4RD7A 2RJKA 3AJYA 3HD8B 2KXLA 4BDVB 3JXSA 3U11A 1HRI3 2ZZQA 1F8VA 3UKVA 3O1SA 5IVYA 3LOBA 3I3QA 4QKFA 4HETA 5FZIA 1F4AA 4D6RA 2BUKA 2ADDA 3LWCA 5EQUA 3WOGA 3SMHA 1YI7A 1H2MA 2ARXA 1KD7A 1EPWA 4JTOA 4FBFA 4QPGA 2YV8A 1HQWA 3PU8A 3CIHA 1OA2A 5C8CB 4E4SA 4FPHA 1QF3A 4QB2A 1GWKA 2WRAA 3WDUA 3QLQA 5CIRA 1ONAA 5FYIA 5JPMB 1NZIA 5F6LB 3UKNA 1AX0A 2HWF3 4L92A 2R6QA 4AGRA 4INDA 2D93A 1ZRFA 3FWEA 3VBFA 3Q8CA 3UK9A 5ANNA 5A3LA 3ZKYA 2BYVE 2J1EA 4GH4C 4DB5A 1JXNA 2D43A 1PMHX 3AP6A 3AYEA 4P9WA 1SEFA 3K75B 1W6PB 2MPFA 2OQ6A 4Q26A 3NKGA 2FDHA 4CDWC 2UWCA 1EAH1 1H0BA 1VBB2 2JG8C 3PURA 4IL7A 3SEPA 4I0AA 5L9RA 1N3PA 3OG2A 4LNVA 2B39A 3ORJA 1W06A 1NA1B 2WNOA 5T5OA 1FOD2 1H2NA 1N1YA 1YHFA 2MEV2 1HB2A 4CEYA 2A75A 2FCUA 2OIIA 4E9KA 3I3BA 1REFA 1JS9A 3I3MA 1TMF2 1UU6A 2D6OX 4CU8A 1DF0A 3SNMA 4AI2A 4KMQA 2EALA 5FYSA 1RUI3 2BW8A 4KWJA 1H9WA 1H4HA 1YFYA 1ULFA 4WVZA 1HRV2 1PO21 4XW3A 4ISQA 4QXKA 5ABJC 4A6SA 2ZGKA 3LB9A 4Y5Z0 2QQOA 5EFUA 4FTBA 1NQDA 1VAKA 2XJVA 5T54A 2BNOA 1C8M1 3D4KA 4JV4A 3ZPOA 4META 5JI7A 4AGGA 3BVCA 4LT5A 4CCKA 1DLCA 2ZACA 3HN3A 4HVRA 1GFF2 1QXPA 2ARAA 3FC0A 4UOJA 4JGZA 1PVC3 4QPGB 1IPJA 4XQ4A 5FY5A 5KR7A 3O1VA 3J8F1 2ZKNA 4LO8A 3WQ7A 4K8FA 2AEZA 5DZEA 3BTYA 2AGSA 2I07B 3WD5A 1K12A 2WWJA 3DYMA 2O8QA 4RS5A 2BRTA 3VBFB 4NIHA 1V6KA 3P6BA 2Y6LA 1ULGA 1QMJA 1JZ4A 2RMU3 1GV9A 1R1ZA 1BBT2 2ZHLA 3Q8FA 4UAPA 3ZXEA 3VD9A 4DIQA 1ND2A 5LBEA 4CU6A 2XVKA 4N9HA 4NPLA 1V9U1 3LKJA 1XB9A 3AYCA 3WP5A 1FATA 2X5IC 1LCLA 3GZEA 5CZKA 2PHLA 4CEYB 3ZO0B 3T1MA 5T5JA 2GMPA 3MEPA 3EYPA 3EJKA 4FQZA 3WEZA 1S2EA 1W8WA 3OPZA 5CNAA 1ALYA 1QDOA 1JH5A 5DG2A 3WUCA 4I0BA 1F2NA 3T0AA 1JZ5A 4D7SA 2VH9A 2V5YA 3HIFA 4ZU4A 5JZGC 5I0UA 3ITQA 4GB31 2YBKA 2ZAAA 2A3WA 2PLV1 3VL9A 2J22A 3NAPC 2XDVA 1DQ1A 2WO1A 3KVBA 4HLTA 5F8PA 4UFJA 2WNVA 4BHPA 1RUG2 2VW2A 4Q4W2 2YXSA 4GULA 4Y1UA 1E5SA 5FMDA 3VV1A 1NY71 3BB6A 1D4M1 3NVCA 3WQBA 1C57A 1K5JA 4RYDA 3VUOA 1KGYA 2XPJA 1VBE1 2ID4A 3S5QA 1IOAA 1MVQA 3X29B 4M3CE 4EQVA 1CONA 3WQ0A 3Q9OA 2R041 1W9FA 4JGZB 3WINE 4DEVA 2BOIA 1JYVA 3TEYA 2WYFA 2BBVA 2HWC2 1DGRA 1U5ZA 1K5MA 3FUOA 3KCYA 4YVSA 1WCDJ 4QKNA 2JB4A 3OPWA 1JZ7A 3RNSA 1LOCA 2E7AA 4Q2FA 5LA2A 4LQRA 3HWJA 2AREA 2PHDA 4LK7A 4RS5B 4UW5A 2ZMNA 2I45A 4QX5A 4RGKA 5L19A 4DRVA 2XJTA 5FZKA 4Q4Y2 3CJIA 2XVGA 2DU0A 4JX0A 5GLUA 1GNYA 1LOEA 2JIJA 3BALA 3EQEA 1WW5A 1AR81 2UWBA 3WP4A 2PAKA 3UT0A 5EJZB 2WQZC 2XJUA 4XQDA 2OPKA 1FMD2 3AXEA 3DEMA 5BNNA 1RXFA 5EIYB 1DQ5A 2BGOA 4URAA 2B42B 4ASMB 2CL2A 3L2HA 5AFBA 4GWMA 4UT5A 1JYNA 1R081 4NAMA 1WLCA 1ZRIA 4HK9A 4UBGA 3MLKA 5L9VA 2KA3A 4XBLA 4CEWC 1QJU3 4QQOA 4EZHA 2ZX0A 5C4WA 2YFZA 3KV5A 2VR4A 4LIVA 3ZXJA 2Y60A 3FFQA 4BQ3A 3NMBA 1H2LA 4K40A 2QQPA 2XWBB 2BU9A 1DZQA 1KS4A 2BDRA 2WNVB 2JDYA 1UW8A 3L9JT 3BU7A 4X8PA 3KT7A 4M3CF 5IVJA 2NMOA 2CWSA 2ARCA 2ZGNA 1UIJA 4RGAA 4AQSA 4MVTA 1MS9A 4K8RB 2W94A 4WZFA 2E32A 4LMFA 1QEXA 1JZ3A 4L0PA 4XJUA 2DVFA 4K6BA 4QXBA 4YNIA 3FZ3A 3AZXA 3J7LA 4QGNA 1T6BX 3ZSMA 4CDQC 4YFZA 1L7QA 1NYWA 1K5MB 3JD73 4YVSB 3TYJA 2HEVF 1FX5A 1AYM3 3FHAA 4D6SA 1KFUL 1Q8SA 5A33A 2IXCA 5B4XA 1W99A 5LEKA 1RUJ1 1UWWA 4F8AA 5LBCA 1BVVA 2J42A 4LE3A 4XXPA 3ZYGA 3GJAA 3UGFA 3A21A 1XNDA 1QJZA 2HWB2 3CJIB 3JQXA 1F15A 2GDFA 4JVAA 1O4TA 3VBHA 3N9PA 1OQDA 1BK0A 4CUCA 4WV8A 1XBFA 4AVBA 1OUXA 2ZHMA 2LM3A 3GM8A 3WR0A 2CV6A 3VBUB 2BVBA 1TE1B 3ZN5A 2ZGUA 1Q3EA 1YXWA 2GH8A 2YGMA 3AVRA 4R9DA 1FPN2 4PQQA 5FKCA 4E8CA 4KBZA 4RQPC 5IVEA 3MPPG 4Z8BA 3SXWA 1DU3D 4MLOA 3J8F2 1NXD1 3V56A 3D82A 1C1FA 2V73A 2RDQA 4HONA 5C4WB 1OKOA 1QQP3 1WMXA 2BBAA 2P5BA 3KCCA 4TN7A 4XACA 4LPLA 1RHI3 3N7LA 4IE0A 3LDKA 4I01A 1R093 4D69A 4CSWA 1A8MA 1QXRA 5CU1A 1ZZ9A 4FPCA 4SBVA 1MS4A 3ON7A 5CBLA 3E6CC 2DF7A 2D5FA 5F3IA 1S2BA 3LAGA 1VRH1 4CUAA 3CF6E 2JE7A 2WINB 4AFMA 5JOXA 3NJYA 3PIGA 1W2AX 3GNEA 3TRSB 4XUNA 4Q27A 2VECA 5DUXA 3KCXA 4L9BA 1CZVA 5FWEA 1FNYA 3ABZA 2P6CA 2Z69A 1MEC1 3M3IA 5C9AA 5IK5A 4AVAA 1HB3A 3AB0A 3I2HA 4N43A 4RSUA 4TWTA 1LOBA 1RUD1 2EIGA 5DQ0A 1QDCA 1W9WA 5FXZA 4AI9A 2XUEA 3FBMA 4RR3C 3DV8A 1GNHA 5A3NA 3AZYA 2ET1A 1G9BA 3KS7A 1VMHA 2K9ZA 4XAEA 1OA4A 1SHWB 2FMDA 2JE8A 4LITA 2R073 3S5AA 2HYKA 1S0EA 4V2WA 1ND3C 1VBA3 2W1QA 5EP9A 1AJOA 1R1A3 4XZPA 4OMCA 4HVOA 1AL23 2JICA 2VVEA 3WG4A 3WNOA 3ZOIA 5JSPA 1S4CA 2ZX2A 3GCWA 4BXFA 3I59A 3W9AA 1SMVA 4DRRA 4H55A 4NPMA 1XE0A 2WFF1 2H6CA 5EXOA 5KXEA 3POIA 4CDUC 1JOJA 5D8AC 2DBNA 2DFCA 3J26N 4Y1YA 4LBQD 4HKLA 2B46X 4AFDA 2P4EA 4EN6B 1RUE3 1DGRN 3R6SA 3POEA 3PVNA 4OI2A 3LZZA 2RS12 4MUVA 2QZ3A 5IWFA 1POQA 3L2YA 2JWPA 2VOVA 1OMIA 1OPOA 3ZLIA 5FO9B 2LW8A 3MW2A 3T4HB 3OJBA 1ZBE3 1DQ4A 1OD3A 1HRI2 3ZFGC 4IDZA 5A70A 1OBNA 2ZOEB 3I2IA 4NO4A 1NXMA 1EPZA 4CDWB 2DVGA 3FN9A 3U14A 4YZ4A 1XXNA 2W52A 3D6EA 1ZA7A 4BMEA 2GC1A 5L36A 2ZABA 1W8NA 5FMOL 1UL9A 2RS33 3LEKA 1EUTA 5C9AB 3QH6A 3DCQA 1H9PA 3B7MA 4C8DA 2BFUS 1VIWB 2QJVA 4OFGA 1NCQC 5DZGA 1MZEA 5HI0A 5AVAA 1V70A 4LJHA 1BK1A 3DECA 4TYSA 3HT1A 1ENSA 2ZTNA 4R52A 1HLCA 4DPNA 2HWF2 2ADEA 1GWLA 2XHNA 5DG1A 1CJPA 1V0AA 5ABJB 1SFPA 1OOPA 4HZFA 4XF3A 1BYHA 1DG6A 5A3TA 2BJSA 1RIRA 5DDJ3 4BQYA 2ZS6B 3ZYPA 3AMHA 2W46A 4F7ZA 3I59B 4MGYE 2R0HA 5CFDA 1PO11 5FY1A 4YG6A 2YB7A 5LY2A 5GZGA 5JSRA 1GZ9A 1O3SA 4EYUA 3MFAA 2MHFA 1GLHA 1NLQA 1QJX3 3ZXLA 3ZM8A 1RTVA 1W6MA 3IMNA 4OLLA 3T2QA 5M0TA 3RG0A 3NNFA 4TXWA 3KB5A 5FBJA 4MADA 1LODA 4N53A 1W9TA 5GZCA 3KLSA 4QX1A 3VZOA 4AHYA 1RUI2 4UFKA 5E1RA 1G86A 2B8MA 1YCIA 1AR71 1OLQA 2K46A 4YZ1A 4KWUA 2IXIA 3POFA 3KHCA 2IZWA 1UMIA 3ZYHA 1RUF3 2GC0A 2OX0A 3BGAA 1GOGA 2P3YA 1I5PA 4Q0PA 1G7YA 5FAXA 1H1AA 4FOWA 2QQMA 2LS6A 4FTSA 5IVVA 2AC1A 1PVC2 3I49A 4YYOA 2ATFA 4QPGC 2YUEA 3WG2A 4YGDA 4ASKA 1UOGA 1AYN1 1PNFA 2J1SA 2EVXA 2XBO1 3O0WA 2IXLA 4XMAA 3ZVXA 4X8NA 3CNAA 5BNOA 4A4AA 3ZYBA 4YZ3A 5LY1A 4NROA 1CWPA 1LEDA 1X9PA 3LIHA 3VDCA 1RUC3 3ILFA 3TWIA 4Q4V3 1U5YA 5J98B 3VBFC 1XOYA 3UESA 5A3OA 2CNAA 4HT1T 3IZOA 3RI9A 5A6XA 1ZZ7A 1GOFA 1VRH2 1PZ9A 3D5OA 4CXXA 4YW1A 4RGGA 1NQJA 3EBRA 3MI8A 4NVPA 4XHBA 5LASA 3RDIA 1UPIA 4Z07A 3WF3A 5H9SA 3APBA 1C4RA 3M70A 3SC7X 3PUIA 4EN9B 2W0XA 1MEC2 1S2KA 3KF3A 1DGWX 2R32A 1PVXA 4CEYC 4XJAA 3MIEA 1W6MB 1OLME 2P3JA 3DYPA 4CXYA 2G1MA 5FYCA 3C8XA 4TLGA 3SHRA 1NX9A 2AEYA 1XYNA 2JDKA 2HH9A 1FAYA 4I3PA 1VBD3 3BIWE 4N53B 2RS53 1XPWA 2VG9A 2W1WA 1X82A 3KZ4C 3EXUA 1DLLA 1RUH3 2J1TA 3H7JA 3TOJA 1HJGA 2ZGRA 4BK4A 5FQ0A 4LLOA 3RWKX 4UWDA 3ZDVA 2YYOA 4BMBA 5A7WA 1PX3A 1IPKA 2E9QA 3IIIA 3NQHA 3AP9A 4PF1A 2GZWA 4PF5A 1W04A 1GP5A 2D44A 2DUOA 4TSVA 3RQ0A 1WLWA 3VBOC 4LHNA 2WYSA 3AP5A 3AVSA 2VMGA 3IN9A 3VGIA 2ET7A 2Y0IA 2VMCA 3FFZA 5A7NA 3NV2A 3LD8A 4FQ4A 4MGKE 4R9AA 4RQPA 4ZXKA 2OA2A 4IQPA 4Q0UA 1GSLA 3NV4A 4CEWB 2JKXA 1WCQA 2WR9A 3C7HA 4FPJA 4PHZA 4S2FA 2JD9A 2DTYA 5A3MA 4GQ7A 4Y1VA 5BNOB 1E5RA 3H3ZA 1KITA 5FOJB 1XU1A 2ZEXA 1Q8QA 3H8XA 2DTWA 4QGMA 3K4ZA 3K2OA 4FFFA 3UYJA 3MF6A 4RS5C 3KF5A 2VZVA 2PN5A 5FZDA 3I2GA 4ZZ5A 5BYNA 3IM0A 1TVGA 2R061 3OUJA 2WSUA 1ND2C 3OOXA 1EAH3 1VRBA 3WLUA 3DXUA 3SH3A 2FZ1A 1QJEA 4FPGA 5T55A 3SKVA 5JOWA 4CDQB 5FYZA 3FUQA 1GWMA 3OEAA 1IS5A 2O1QA 2DU1A 2Y34A 4B7EA 2O0OA 3N9NA 1QJU2 1AR61 5JUVA 5ANQA 2FD8A 4P9JA 1HB4A 2C0ZA 4XDOA 3VZNA 1AXYA 3OGVA 4H2AA 4Z92B 5C3PA 2VCCA 1SZBA 2VBPA 4XCBA 1KEXA 4HK8A 3HN1A 2I74A 5FQ0B 3MIGA 4PT6A 1PO23 3OBRA 5F6KA 2WN2A 5JMCA 4XFIA 5A7WB 2WNVC 2VL4A 3ILRA 2JXAA 2YMZA 3LEGA 4LBJA 3LDBA 4P5YA 2XR4A 4YM0A 2Q8OA 4COZA 1PGW2 3SH5A 3HNMA 5EHDA 5G04L 1C8M3 5DXDA 3ZSLA 4ATFA 3DN7A 5FCCA 1S0GA 3FBYA 4CDUA 1QXJA 5D8AA 2CWMA 4BJ0A 2A6XA 1F35A 1DHKB 2DCTA 2WS91 5LB6A 1RINA 4JCKA 4JQTA 4RQPB 4CUGA 2IXKA 1DYKA 4CZSA 1UY2A 5FK8A 3J7MA 1G9FA 3JD72 2WFPA 3V64A 4R8HA 4QPIA 1AYM2 1K5MC 3J8F3 2EIDA 2OQ7A 2C9KA 1O8PA 2QUOA 2RR11 3CU7A 4O7XA 1UOFA 1C8NA 3AK0A 2WZPP 3TNQA 2Q5TA 3GZUC 4LORA 3N9QA 1ODMA 1SFYA 4WVMA 1G9AA 4AZZA 5C8WA 1AJKA 4Q8KA 3I7DA 4J25A 1UPSA 1WWYA 1H4GA 4IEOA 5J96B 4C0BA 4W8JA 2D6KA 2JDUA 4LO7A 5F5AA 3VHPA 4EWEA 3CJIC 5BV6A 5KXCA 2VD7A 1DGLA 4ZS3A 3ZYFA 2Q4SA 2QKDA 1V9U3 1KJRA 4GMP1 4G4FA 4HXCA 4IEZA 3PVOA 3QOPA 5FXVA 5BNNC 3W5NA 3PUQA 1K42A 2GMMA 5FYBA 1NCQA 2FDJA 2GP5A 1WBFA 3Q8AA 3UJOA 2CYFA 4A2UA 2VU9A 1LULA 3N9MA 5A80A 3DL3A 1OURA 2D5HA 4GZ9A 1O7FA 1KQRA 5C4WC 5GZDA 1CD3G 1NE4A 4YSFA 1AZDA 1GZCA 1ND3B 1R092 2A5ZA 3AZVA 4GB33 4CVUA 2PLV3 3JB4C 4XAAA 5GALA 1QH7A 4P02B 1H6XA 1J58A 3BI3A 4LKFA 3O1MA 4BQWA 2J1VA 4XUQA 2QNKA 3IDCB 1PIV1 5C71A 3VKFC 5HV0A 3UETA 3WP3A 2VW1A 2HJIA 3IWZA 5F32A 2SLIA 1D4M3 1W05A 3AYAA 2C9AA 4CDUB 5D8AB 1VBE3 2VZTA 5HCFA 4F3JA 3U75A 1POV1 4ZU7A 1W0OA 3W5MA 2HWE1 2VNVA 1CIYA 4Q8LA 1X7NA 3O7OA 3RZHA 1W8TA 3VD7A 2DFBA 2R072 2OXBA 3PL0A 4WVMB 4PQ9A 1W8ZA 2QCSB 1SG3A 1GNZA 1VBA2 2ZX3A 3OGGA 2AACA 4IEPA 1ULDA 5KBFA 1R1A2 1O3QA 3ZFGB 4COUA 4DINB 2HWD1 2WWSA 1AL22 1D0GA 1UCXA 2QDNA 5FP4A 4QMAA 2WA3A 3W59A 3ATGA 1AHSA 1PGL2 1JYCA 3VBHC 4EV0A 3E6DA 3AYDA 1AR83 1JTZX 1VJ2A 4NUBA 1CAWA 4XBNA 5FYHA 2ZCWA 4Z82A 3DF0A 5BPXA 4G3YC 2Q1ZB 2QQLA 5SV8A 1UF2C 4K9SA 3N9OA 4LBKA 5F2SA 1RUE2 2F4LA 3PNAA 1NCQB 4UFLA 4OHXA 4A7KA 3J9SA 2Y64A 4UI9L 3S7EA 1MS8A 1K45A 1R083 2AENA 5IUQA 2BEOA 3ZFFC 3POYA 3WY6A 4FXKB 4Y5TA 2BNMA 1KS5A 1YIFA 1ZBE2 3A23A 2B4KA 2BQPA 2TEPA 5C70A 1W6NB 5FPVA 3ELNA 4GA9A 4MH0E 1UY0A 3AKTA 4W6WA 3VDAA 2XLFA 4AAPA 3ZN6A 1PK6C 3H9AA 3RFRA 1DFQA 2Q0AA 2PQQA 1E5HA 2RS32 1COV1 1SBFA 5FY8A 2HKXA 2JDAA 4MOAA 5AFEA 5L9BA 1JHJA 3DUIA 4IEXA 2YHJA 5C3OA 4QHOA 5C9AC 3HMYA 1VB2A 1HXS1 2GNBA 4MHRA 4MGZE 1F9KA 1W2UA 4PLNA 4N43C 2VAUA 4LBMA 4ATEA 1VP6A 2ZGOA 4CXWA 3WT3A 4BH9A 1XQNA 3UGHA 1JU4A 1TNFA 2E6VA 2FDFA 1RUJ3 4UW6A 1CZSA 4IGQA 5EZWA 3WP6A 4QXHA 3LGRA 4XUPA 3ZDSA 3G6JB 5DDJ2 4P9XA 3MF9A 3VBOA 1LEMA 3CZUA 4J6GA 1CAWB 4M0HA 4K1ZA 5FZOA 3T2PA 1CVNA 3OUIA 4QDSA 4YM2A 2QQNA 2YPJA 3T0BA 1QJX2 4HOOA 1V6NA 5B2GB 4Q0VA 2O14A 1REDA 1LESA 4COVA 2CY6A 4BXSV 2EIEA 1SCRA 3MIBA 3M4FA 1CESA 2OZ6A 1J84A 4KGQA 2E7QA 4QPYA 4OQ8A 2CDOA 1U5XA 3AMQA 5BUVA 5A1AA 5CA6A 5JWPA 1ZBA1 1Q8PA 2Q8CA 4AVTA 1RUF2 1BQPA 4FCAA 4CU7A 4LE4A 3ZN6B 2WO7A 3ZR5A 1ODNA 1VRH3 1S0DA 4IESA 4AAXA 4CPBA 4S2DA 1T2XA 3WDXA 1BMV2 1U5IA 2RM21 2WAOA 3MICA 4WM7A 4AEJA 3RYRA 1UKRA 3RWNA 3VHNA 5LWBA 2FCVA 1W39A 2GNDA 1W8HA 1MEC3 5FZMA 2D6PA 2ES3A 2K0GA 1YQ8A 5HCAA 3H8OA 3GZTB 3HBZA 5FLIA 1KDKA 4ZZ8A 2DURA 4PI2A 4C0HA 5FPXA 2Z4FA 4NRQA 1OT5A 2ORXA 1UOJA 1OF3A 5L73A 2WLQA 1JBCA 2XHKA 5LRRA 2E33A 4AVCA 4GWNA 1RUC2 1JOPA 5J3UA 3AP7A 4AR2A 4Q4V2 1UXXX 1S0JA 2ZPXA 2YGLA 1WW7A 3E5XA 2R0FA 4XYXA 1BEV1 1OOPC 3ROUA 1SLTA 1JZ2A 5I0RA 1W03A 1H8TA 1ZYBA 2W39A 1W8OA 3MPBA 3WF1A 2AUYA 3ZYIB 3NW4A 3VBOB 1HKDA 2Y6KA 3FLPA 2VMEA 2JB8A 3OEBA 1UZVA 5CFDC 5FZOB 4KNCA 1GQHA 2WFF3 4UF0A 3WX5A 1AL0G 2WKKA 4R9BA 3LDRA 1BHGA 3POGA 4BA6A 5DN2A 3B3QE 2P2KA 4AQTA 5I8YA 3NL1A 5E8AA 5F5QA 1J83A 4QGLA 5GZEA 4PBOA 2F6BA 1VBD2 3MIHA 2RS52 4FI9A 3I2OA 4NR1A 1Q8OA 1OKQA 2A7AA 4FPEA 4CA9A 4N53C 1IQDC 5JIUA 1PM4A 2Y26A 1VALA 4XF9A 2FMYA 1RUH2 5FZAA 3IPVA 3UGGA 4HFSA 4AEDA 1Q8VA 4I09A 4XMIA 3SH4A 5I0DA 2D40A 3PTRB 3V0BA 5CG9A 4X6QB 4M4RA 1OPMA 1VE0A 2HWD2 3POSA 3WF2A 4D7YA 2RDSA 5FZ1A 3VHOA 1J1LA 3TN91 4E2GA 5EJ1B 2IC1A 1ND2B 2KR2A 5J36A 4NOTA 3OUHA 1UMZA 1A3KA 1RJ7A 2RDNA 4D8MA 4KG0A 1W0NA 3VHRA 2XUMA 5A7PA 1LHOA 1YFWA 4I30A 3WHUA 1I5ZA 1M4WA 4YG0A 1ACCA 3WSOA 1PHMA 4UBHA 3E5QA 3UJQA 4AI3A 5BNOC 5JSOA 4LEJA 1NZCA 2P6HA 2VQTA 2VUAA 4H7LA 3WCRA 2EAKA 4IW3A 3TAYA 4XCAA 3OY8A 1UX6A 3N7MA 3WNKA 2W1UA 1IPSA 2VUDA 2XOMA 3UL2A 4NWWA 1WW6A 3BIEA 3ME2A 4EN8B 1YEWA 3LIGA 1H8TB 3QCWA 4KWLA 1LHVA 3WNXA 2YU1A 4SLIA 1EYBA 1W9SA 2HLEA 1EAH2 1PO13 2H0VA 3WCSA 4Z2WA 2FHRA 2IUWA 1ULEA 3SEEA 4CCJA 1JUIA 1LRHA 3ACFA 3THTA 5FZGA 1VMJA 1TME1 2LROA 2GNTA 3AM2A 5FYTA 5CAZA 4B8EA 4Y5SA 5KXDA 4ORFA 2XG3A 3N3HA 4QAWA 2CAVA 1NLSA 1D7PM 3M7AA 4FOYA 5GZFA 3V0AA 1JMUB 4U2AA 2W2IA 4AYUA 4YRDA 4AG4A 4RN5A 4BLJA 2XGXA 1PO22 3WNMA 3V0BB 2A3XA 5E88A 3NNGA 1JYXA 4FVVA 4XZUG 4AHWA 5FZFA 3WV6A 5HXVA 4NHMA 1C8M2 1S0FA 2NMNA 3IDAA 1E5IA 2LRPA 2XL9A 5FV3A 5ACA3 1DZTA 5BNNB 2ZHKA 3BPSA 3CKHA 2P37A 4KI5M 4XF0A 3MW3A 2DCZA 4Y3OA 5CKMA 5A3UA 2FZ2A 1WD4A 2VULA 4NMIA 5GLZA 3BN6A 3LEIA 2B7YA 2VZQA 5T5PA 1CX4A 4DZGA 2Y6JA 4Q1PA 1RMU1 1Q56A 5CG8A 1AYN3 1B35A 2XBO3 3EMRA 2DYCA 4JKKA 3ZXDA 4FOQA 5B4NA 4QX7A 3ETQA 1XNAA 1Y7BA 4NPRA 5L7OA 2WABA 5FMBA 4D0QA 4ONUA 2DVBA 3P1IA 1XNKA 4YGBA 4C1XA 2JENA 3TBDA 1PK6A 2WJSA 3AMPA 3DGTA 2WZ8A 3M3CA 3PMEA 3WNNA 1EV11 4AHZA 1GR3A 2QTWB 2PAEA 5SV5A 3OBAA 5DAPA 4XURA 3FL7A 2VC9A 3I2FA 4OHVA 1V9U2 3U07A 4CPBD 5JXGA 1RC6A 1X9TA 2WO3A 1DGWA 4AFBA 4CUBA 2XJQA 4OZXA 3KT4A 1HX6A 4LIUA 5CISA 3ZKUA 3PUSA 3QD6A 3JQWA 4OULA 3R4DB 1EP0A 4QWNA 4YW6A 1VBC1 4Q1RA 3NV3A 2N7GA 4BU2A 5A33B 1HB1A 1RVF1 2JECA 4Q4X1 5ACA1 4GB32 4Q0QA 4IE7A 2PLV2 4BCUA 4K20A 2PTMA 1VMFA 3MW4A 3KV6A 5GKAC 3PMSA 3UKTA 3PJYA 4YM3A 3RZKA 2FDIA 1UNBA 2VOTA 4BQ2A 1FNZA 2YG0A 1S0BA 3VBRA 1QJY1 2BGPA 2QE3A 2XLAA 4UFHA 4LBNA 3VBHB 1NY72 1WCKA 1D4M2 1ENXA 1GYKA 1WMDA 4M00A 4XC9A 2UWAA 3U37A 4QKBA 3VD3A 3H0OA 3CDZB 3BTAA 1VBE2 3NJVA 3WF4A 1OSGA 3VZLA 1LGBA 2RV9A 4CP9A 2R042 4IEQA 4JRLA 3KQ4B 4NIAA 2JDNA 2VBBA 5IK7A 4DFSA 4BOWA 4Z1VA 1JYWA 4M3CA 5DAVA 1W28A 5CKNA 1SACA 1B35B 1ULCA 4QPIC 1DZRA 4HN1A 5FP3A 1GUIA 5FYYA 5FZ4A 5GJ6A 4Q5OA 1HW5A 3HPNA 2J7MA 1Z78A 4DY5A 2X29A 1ZRCA 3LF7A 4GKXA 1PK6B 4N7IA 5DUUA 2D6LX 1SDWA 3M3QA 1OD5A 1AR82 2VVFA 2R063 3WDVA 1XNBA 4DOUA 1ZREA 4OI4A 1NKGA 5AC91 2YC4A 4PIYA 4IUGA 4QHBA 1XYOA 5I0SA 2E51A 3ETPA 4N43B 1BVP1 3K4AA 4FP2A 2ENRA 2VOWA 1R082 1LHUA 1AR63 3MDPA 2VXRA 3E6BA 2YROA 5IT6A 5JXIA 4BYYA 4D3WA 4FAGA 3GF6A 4LUKA 3RZZA 3U4SA 4NIIA 2ZBJA 3VBRB 3BKZA 3OBZA 1GP6A 3VKOA 3DKQA 5T3NA 5FUPA 2JD4A 5FKBA 2Y38A 3PVBB 5F2WA 4IETA 4IE5A 2QQVA 3LA3A 3MUY1 2Q30A 3GZAA 3A0KA 3H3UA 4CP9B 3BTZA 3WW3A 2NQYA 1SCSA 4O9GA 4NIGA 1X33A 2IFRA 2WS93 2R49A 3W21A 1CX1A 5FR3A 4JAAA 4BQ4A 1N1TA 4AFAA 3LA7A 3VD4A 4M3CB 3AFGA 3MV11 4JDNA 1MS5A 2CU5A 5CADA 3JBG1 2P3KA 2ORZA 2PHFA 3KGLA 3P3NA 1ENRA 2RR13 4NIDA 3KM5A 2PELA 1RUJ2 5FJKA 2JJ6A 3OD0A 3AL6A 1D2SA 3Q8BA 3PVEA 3LSEA 3EO6A 2YY1A 1G9DA 3H50A 3ZIWA 1OQEA 1AR91 4A7ZA 1QU0A 4EN7B 4J1WA 1US2A 2A6VA 5FZ6A 2H6BA 4D7TA 5KXBA 1UMHA 5FWJA 4NE9A 1ASJ1 4HBNA 4ISRA 3ZFFA 4FTEA 3O14A 2XKPA 1OUSA 3CO2A 4GMP3 1A8DA 4RHV1 5FIXA 4YM1A 2R16A 2FQPA 3K3OA 4XTMA 3GBFA 3SCFA 4XFCA 1DDLA 2A3YA 3VZMA 2XONA 1AX2A 1C1LA 3IB3A 1V00A 5F3CA 1SLLA 2ZGSA 2DUPA 4GJZA 4MGTA 2BP6A 2PHTA 3CL1A 4YVWC 2WZEA 4IERA 2IXJA 5FLJA 3OTFA 1UZYA 1QOTA 1OOPB 2D98A 2PAMA 3BU0A 1NUKA 2UYBA 1H8VA 1PIV3 1UXZA 5HCBA 1C5IA 1QWRA 2YBPA 5CFDB 4QX2A 2WZR1 5HCHA 1W6OA 5K4LA 1XJAA 4FXGB 1AUYA 1UKGA 2PFWA 1NAEA 4XETA 3RYPA 1QQP1 4JDMA 5FMOS 4EE2A 1POV3 1RUD2 3OF1A 5FYVA 1WBLA 3O1RA 2HWE3 2OT7A 2ZEWA 2A6YA 5JXHA 2Y0OA 1LOFA 4JC1A 1GZWA 4JZRA 1B09A 1VBC2 4OMDA 1VR3A 1WCUA 4IE4A 4LA2A 4A45A 4QD2A 4PDWC 2RJ2A 4IV3A 1QNWA 4FPFA 1DIWA 1JODA 3ACIA 4L2NA 1X8EA 3WZ1A 5LK7B 1Y3TA 3N7JA 1W2NA 2HWD3 5FO7B 3WNPA 1EUUA 3LFMA 4GWIA 1FV3A 2VZOA 4S2GA 1MZ5A 2BWAA 1AVBA 4CCCA 1SPPA 2L9LA 2WFF2 2ZMKA 5JIAA 5E89A 3RPQA 5IK4A 1S55A 3MO4A 4XJ9A 2VZ1A 2DBIA 5A7SA 4DY3A 4KU7A 1GP4A 4XTPA 3T2TA 4H7MA 2WUHA 5A1LA 2X53S 1KRIA 2E7TA 4PI0A 5FZBA 5A3PA 5EWSA 4JKLA 2EXHA 3IIAA 5F5IA 5IATA 2LUWA 4PIZA 2EXKA 4LHLA 3MGUA 4QM9A 1QKQA 5JAXA 1VLNA 2RVAA 2W68A 4PIXA 3PLQA 3WHTA 1SBDA 4YFWA 4E2SA 1JHNA 4B1MA 2SBAA 1F4HA 4QHZA 3C7FA 4E2QA 5EYXA 4MXWA 3C3VA 3M1HA 4LULA 2PHXA 3A22A 1UOBA 3DXTA 4WM7C 1COV3 1O5UA 4AK3A 5C3SA 3T0DA 1OH3A 1ZM1A 5J48A 4R4XA 4K1YA 1HXS3 1Y9GA 3H1YA 3LEMA 3IBMA 3R05A 3H1WA 4LK6A 2DVDA 5A3WA 3RRDA 2VQUA 4FP3A 2V5DA 1XE8A 3C7GA 3GXUA 1QIQA 1GZWB 5T50A 4P08A 1MZFA 2PHWA 2GC3A 4XABA 1VAVA 4A41A 4IV3B 1O59A 1YI9A 2XKOA 3HOBA 4EJRA 4EZ4A 4LO5B 2W47A 4YGEA 2NZ9A 2D3PA 4GWJA 1VBB1 5FXXA 2GSYA 3LOIA 1DP0A 3JB8A 5K9YA 3TEXA 3T4VA 3B5LB 1H8TC 1JU3A 1WGPA 1FOD1 4W4ZA 3ACHA 4E27A 2MEV1 3GCXA 4UW3A 5C33A 2QFEA 1PO12 1RUNA 1IZ3A 1SPPB 1TMF1 2DUQA 2HEYF 4YZ2A 4AXOA 1XNCA 4MSVA 1JOBA 5FK7A 1UZ0A 3KV9A 3CJXA 3MLLA 5FFOC 1GBGA 3I8TA 1QH6A 5FMCA 4NJ4A 5LZ6A 1HRV1 1CAXA 3ECQA 2RDRA 2C5DA 1GZTA 1SLAA 4HVQA 3R4UA 2TBVA 5FDBA 2WC2A 2YPDA 3KD4A 3VLBB 4BK5A 1AR72 4YW3A 3LCPA 3N36A 3GDBA 4FOVA 4AEDC 1YJKA 2YZ4A 4YPJA 1ZBA3 2W9XA 1REEA 2CGNA 1UD1A 2VO5A 5K0UA 4QQLA 3UNPA 3NV1A 1U0AA 3ZSJA 2WLPA 1HN1A 3MBWA 1OLRA 4LXLA 3GHMA 3HAGA 4MXWB 3ZPYA 3I54A 4FPLA 3BODA 1DQ6A 4WM8A 4DUWA 2RM23 2G9FA 5IVBA 3K3NA 3THDA 4OI1A 3AC0A 2F17A 1PX4A 3P5BA 2ZJCA 4FPYA 2ZMLA 5DAWA 4XIKA 1W9YA 4UXAA 3C7EA 3H3LA 2P34A 5GM0A 2XWJB 1AYN2 5I93A 2XBO2 3VDDA 3WXPA 1XYPA 3HNBM 4FT8A 5FPLA 4AI1A 2X05A 4MX3A 1W2TA 1BBT1 5JLVA 2IFWA 3R0RA 1Z7S1 3K48A 3PTYA 3O1UA 5IAXA 1ULPA 4AWDA 5JXJA 3H7YA 2E53A 1NE6A 1TEIA 1TG7A 2PHRA 1BEV3 1JI6A 3D0JA 2XJSA 3MIFA 4QQHA 4ZPIA 3RJ2X 3NKTA 3HQXA 3Q8EA 1N47A 2ZGPA 1GKBA 3N7KA 3C2UA 3M2MA 3S6PA 5C8CA 2VZSA 3AKSA 2VUJA 1ZZBA 2VNOA 4P5HA 4EN0A 4ES9A 5C3QA 2Y33A 4NHYA 1UY1A 2F4PA 4JHTA 2R043 4HPKA 2P1BA 4YW4A 5BNPA 1BXHA 2GMEA 2Z42A 3GJBA 2BVVA 5E16A 4C91A 4QPIB 3OPTA 4BQ1A 4LKEA 1CAXB 3POJA 5D2AA 3U4XA 1OI6A 2VXJA 3IDBB 1BZWA 1OLMA 1RUG1 1HQNA 1ZVFA 2DWRA 2EAAA 2Z79A 4IV1A 4JRAA 4Q4W1 5FBZA 4C90A 1RB8G 2R7EB 4IGPA 1W90A 2ZGMA 1DYOA 5FP9A 1WZXA 1YRZA 2ZGQA 5FPUA 1RXGA 5K0UB 1YO8A 3O1TA 3WVJA 1UIKA 1CZTA 4CCLA 1RGSA 2IXHA 1WCSA 1NA1A 4XFGA 2JE9A 3TN93 2BERA 5JOZA 5A32A 3S7IA 1P8JA 1D4VB 2ILMA 2NPIA 4GD4A 4WM8B 1H6YA 2HWC1 4XIOA 4ASLA 3CQOA 1WA4A 2A1XA 4L99A 2LALA 2UU8A 4CCOA 3WW2A 4OUEA 4DXSA 1XU2A 4JGYA 1W8UA 3WW4A 2R30A 2VW0A 3VDDB 1YQCA 4KBBA 1B35C 3J7HA 2VBDA 2CGOA 4Q4Y1 5LK5A 2B45X 4YVWA 4BIOA 2Q8DA 2ZGLA 3WDWA 5L7OC 4LBLA 2D97A 2VPVA 3AMNA 3B02A 3T1LA 5KHGA 4ARXA 1A6CA 2UURA 5FY9A 4P9LA 1FMD1 3D8CA 2OUJA 1O3RA 1HN0A 1NCRA 1V6JA 2R062 1FV2A 4K7JA 3ZX7A 4MG2A 1PMIA 3J4UH 2R1BA 1QHDA 4HN0A 4ET7A 4OI0A 1MS3A 2Z5WA 3POBA 2OKXA 4HPKB 1TME3 5BNPB 3RZMA 1IG0A 1US3A 4L11A 1OQ1A 3VD5A 5IVCA 1AR62 4FSJA 5JPNB 2PQSA 2VOXA 4XJ8A 1UX7A 1L7RA 4CCEA 2YC2A 4PDWA 1GQGA 4X6RB 4IV1B 4XDQA 1YFXA 2VZ3A 1WLTA 4N9IA 5I8SA 5A7QA 3UV9A 3HQUA 3VZJA 1GICA 3MFCA 5A1FA 1T6GC 2XB6C 3I3DA 3GHNA 1WD3A 4XFAA 2GN3A 5IHRA 5LCWL 3VBRC 2GALA 3M3OA 3B9IA 4WZCA 3A4UA 4BQXA 5A32B 2C24A 1GOHA 2OZJA 2FDGA 1OVPA 2JDMA 2W87A 3MHZA 5C7GA 5FY0A 2WS92 1SLBA 4RL7A 4CRQA 1EY2A 4GAZA 2CTVA 3AZZA 3OBTA 2ZZJA 4JGYB 3QBQA 2Y6GA 1QNYA 2Q8EA 4FAHA 1MACA 5F1RA 3BYWA 5CFCA 3THPA 4M4PA 1YIPA 1RMU3 1JZ6A 5FP7A 3ACLA 3OCPA 2RR12 1N3OA 2DV9A 4XUTA 4CTEA 2HWB1 2VJXA 4YVWB 3S57A 2WN3A 4I0WB 3IAQA 1S0IA 5CYYA 5A6YA 2UY9A 2VGDA 3N9LA 5C6CA 4Q29A 1D2QA 4ZONA 1FPN1 1LOGA 4P9IA 1EV13 1NCRB 4HSLA 3CBNA 4MGIE 4CCNA 1MQTA 4MV2A 4OHWA 3IDEA 1MS1A 2WQ4A 2CHHA 4KWKA 3OGRA 2AYHA 3RGBA 4E8DA 4FFIA 1YWKA 2IVIB 1H30A 4JQRA 4LBOA 4KU8A 5H9QA 5J37A 1F5JA 2VCBA 1RUD3 2W1SA 2V4VA 2ZKLA 3WDTA 3LFIA 4ZHNA 4WVWA 1R64A 1HDKA 4BZ4A 5J7MA 1RYYA 2JIGA 3BCWA 4UW4A 4PDWB 5FPAA 1VBC3 2D3RA 1OHFA 1RVF3 1Z7S2 4Q4X3 2W91A 4U36A 5DABA 4XJWA 1IKPA 2BTVC 4YLZA 4YW7A 5FTTC 3BOWA 3WNLA 4GALA 1AF9A 4RA0A 3K51A 4R9CA 1J3QA 1ZRRA 3USSA 2VQ0A 3T08A 1PIV2 4GMP0 5FUIA 3I2KA 1QJY3 2JEMA 2UY8A 4YWAA 5ERLA 3VB9A 1X8MA 5KHIA 2G9ZA 5FZHA 4CDXA 1CR7A 4PCRA 2GN7A 2J1UA 1V6LA 1DBNA 3KHBA 1G6NA 4KQ7A 3NJXA 1OXCA 5T5LA 3ZSEA 3ASIA 4PJYA 3WUDA 2ZX4A 5FZ7A 4CCMA 5FZ3A 1NT0A 4Y26A 4OHZA 3V65A 1O5LA 3NJZA 4LLFA 5JDBA 2HWE2 3ES1A 3KSCA 3K4DA 2DCKA 1AXKA 5FLHA 5CFCB 1Q5OA 3H1MA 4GIQA 4OZOA 5JR2A 4BLIA 3EHKA 4OCTA 1O91A 3AKPA 1OFNA 3KMHA 1HV0A 3SLIA 2RHPA 3QACA 2JDPA 4IEWA 4LBQA 2VCMA 1ZZ6A 5FZ9A 1ZA4A 1N3QA 4H3WA 2XL7A 1H1IA 1J3RA 1L3JA 5FZLA 3VZKA 3N4MA 2DDUA 3FJSA 4LA3A 5LA1A 4A3ZA 3DKWA 1H2KA 1POV0 1GMMA 1LU1A 1MQTB 1E57A 2AZ5A 4HMZA 1NOVA 2X8KA 3GBWA 4QX0A 4WM7B 3RMYA 3VKMA 1CQ9A 1WMFA 3E1F1 2RS11 4BB3A 5AC93 2WQ8A 2DCYA 3H8UA 3OB8A 4OQ9A 5FY4A
chains in the Genus database with same CATH topology
1W05A 2BJSA 1E5RA 1W9YA 2WO7A 2Y6FA 1ODNA 1E5SA 1W2NA 1W3XA 1UZWA 3ON7A 3OOXA 1QJEA 1E5IA 1W2AX 3ZKYA 2DBIA 1GP4A 2JB4A 1OC1A 1HB3A 1GP6A 1QJFA 1HB4A 5C3QA 1WA6X 5C3RA 1W06A 4RGKA 5C3PA 1W03A 2VBPA 1HB2A 4XAEA 2JB8A 2IVIB 5APAA 1UOGA 1RXFA 1UOBA 3ZOIA 5C3SA 1RXGA 2DBNA 1E5HA 1QIQA 2Y60A 2BU9A 1W3VA 3ZKUA 1UOFA 5C3OA 1ODMA 2IVJA 2VAUA 1HJFA 1HB1A 2VBDA 1W2OA 1UNBA 1OBNA 2VE1A 2BRTA 1BLZA 1HJGA 1UO9A 2VBBA 2VCMA 1IPSA 1W28A 1W04A 1GP5A 1DCSA 2CSGA 1BK0A 4BB3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W05 A;  2BJS A;  1E5R A;  1W9Y A;  2WO7 A;  2Y6F A;  1ODN A;  1E5S A;  1W2N A;  1W3X A;  1UZW A;  3ON7 A;  3OOX A;  1QJE A;  1E5I A;  1W2A X;  3ZKY A;  2DBI A;  1GP4 A;  2JB4 A;  1OC1 A;  1HB3 A;  1GP6 A;  1QJF A;  1HB4 A;  5C3Q A;  1WA6 X;  5C3R A;  1W06 A;  4RGK A;  5C3P A;  1W03 A;  2VBP A;  1HB2 A;  4XAE A;  2JB8 A;  2IVI B;  5APA A;  1UOG A;  1RXF A;  1UOB A;  3ZOI A;  5C3S A;  1RXG A;  2DBN A;  1E5H A;  1QIQ A;  2Y60 A;  2BU9 A;  1W3V A;  3ZKU A;  1UOF A;  5C3O A;  1ODM A;  2IVJ A;  2VAU A;  1HJF A;  1HB1 A;  2VBD A;  1W2O A;  1UNB A;  1OBN A;  2VE1 A;  2BRT A;  1BLZ A;  1HJG A;  1UO9 A;  2VBB A;  2VCM A;  1IPS A;  1W28 A;  1W04 A;  1GP5 A;  1DCS A;  2CSG A;  1BK0 A;  4BB3 A; 
#chains in the Genus database with same CATH topology
 4RFR B;  4MZU A;  2XVL A;  2D6N A;  3NNL A;  4QB1 A;  3NST A;  5DZF A;  3VBS C;  5IJR A;  4W50 A;  2E63 A;  1V6I A;  1J3P A;  1HRI 1;  1LKN A;  3OGJ A;  2JG9 A;  1W0P A;  1IS4 A;  1VB4 A;  5IAV A;  5K8S A;  1JN2 P;  2VTF A;  1F31 A;  3E97 A;  3NO8 A;  4W6X A;  3SCG A;  2W95 A;  2PYT A;  1JYT A;  1O8S A;  3H42 B;  2JDZ A;  3VBU A;  4EWA A;  3D0S A;  4ITC A;  1DQ0 A;  5LEJ A;  2IWG B;  5FUN A;  4CDX B;  3ZR6 A;  3VDB A;  4COY A;  1COV 2;  1OFS A;  1QY4 A;  2VUC A;  1IQA A;  2ZA9 A;  3IAP A;  1V6O A;  4UF0 B;  4XIL A;  4MHU A;  5FZE A;  2ERF A;  1YQ5 A;  2YU2 A;  4TLF A;  3OSD A;  1CAU A;  1HXS 2;  3D3A A;  3TEW A;  2HWF 1;  4ZKT B;  1UAI A;  1QJF A;  4DMI A;  3AP4 A;  5KHK A;  1ZX5 A;  1WA6 X;  3GBG A;  1OH4 A;  4CE8 A;  3JBG 3;  1LOF C;  3K46 A;  1NLR A;  3F95 A;  5H9R A;  4XFB A;  1G9C A;  3O1O A;  3PIJ A;  1LOA A;  4QPW A;  4XXA A;  4QQ2 A;  4XDP A;  4AW7 A;  4E4Z A;  3IPV B;  4IV3 C;  4AED B;  1LU2 A;  2VMH A;  3ZFE A;  4LBQ B;  1AR7 3;  4A44 A;  2H0B A;  2J1R A;  4BWO A;  3ZMN A;  4AOC A;  3A7Q A;  4P9Y A;  1AR9 3;  3LSD A;  4MYE A;  4NHX A;  1M06 G;  4BE3 A;  3PUH A;  1ASJ 3;  3U0Z A;  1D0H A;  1UZZ A;  3B01 A;  1TNR A;  1ULO A;  4I2O A;  2B5H A;  4FPO B;  4BIF A;  5LRS A;  4RHV 3;  3FLT A;  4KG8 A;  3FHQ A;  4IEY A;  5CKQ A;  4XPV A;  1J1T A;  1RUI 1;  4V1P A;  4WBB A;  4OUS A;  3VKL A;  5GLT A;  5CB7 A;  5CEH A;  2NN8 A;  2BOJ A;  2QQI A;  4QX3 A;  5F7U A;  2XJR A;  1VAM A;  4QU2 A;  1GAN A;  2IVJ A;  4NN0 A;  2Y8K A;  1LEC A;  1RL3 A;  2JG9 B;  4OYU A;  1UYP A;  3TEZ A;  3MV0 1;  3DPR C;  4YGC A;  2EIC A;  4YZ5 A;  2V72 A;  3ST7 A;  3T2O A;  3OY8 B;  5HPO A;  1RUO A;  1ZNP A;  3SIT A;  3K77 A;  3RSJ A;  1ZBA 2;  3BTX A;  4D94 A;  2BFU L;  3ZXG A;  4QKD A;  2BWC A;  3NWK A;  5DAX A;  2ZEY A;  4AQ2 A;  4QDR A;  1PVC 1;  4GXL A;  3B69 A;  4KL1 A;  2VE1 A;  4S2H A;  4ZXE A;  1PM7 A;  4TTG A;  1BLZ A;  3MZH A;  2HYX A;  3T3Y A;  2RM2 2;  2WZR 3;  1SLI A;  3M8L A;  1UY4 A;  2K2S A;  5IFP A;  3JUU A;  4G9S B;  1CAU B;  3W58 A;  4Y33 A;  2GH2 A;  3GAL A;  4NRM A;  1KFX L;  2TUN A;  4MGQ A;  5AVP A;  3SIS A;  1Q43 A;  3TNP B;  2LTN A;  4J1X A;  1DCS A;  2VMD A;  2RMU 1;  1UN1 A;  4AL9 A;  3V0A B;  4CP0 A;  5JI9 A;  4XEZ A;  4GH4 A;  5FRE A;  4DQA A;  3LE0 A;  4LR4 A;  3ENR A;  3JZV A;  2QQU A;  4A7Y A;  1O3T A;  4Y1Z A;  5KHH A;  4CDW A;  3ZFE B;  2EF6 A;  4PBP A;  5EV7 A;  4OHY A;  2JG8 A;  3FHI B;  1WLD A;  3MLJ A;  1BEV 2;  2A70 A;  4FFG A;  5FRA A;  2KD7 A;  2QBX A;  1CN1 A;  1QGL A;  5FPB A;  1H1M A;  2JDH A;  5KC5 A;  1SQ4 A;  1XSR A;  4DS0 A;  1MR5 A;  3T30 A;  3THC A;  1CGP A;  5CVR A;  1SFN A;  2D6M A;  4XF1 A;  2WT2 A;  2B9V A;  1Y9Q A;  1MVE A;  3HQR A;  1ZRD A;  3HVD A;  1S1A A;  1N1S A;  1W3X A;  2R1D A;  5LA9 A;  2MNG A;  4A6O A;  3ZYR A;  1ZZ8 A;  3DYO A;  1KXG A;  3AJZ A;  2EIB A;  1IS6 A;  1LR5 A;  4JKM A;  5F5C A;  2G19 A;  4ZU5 A;  5ABJ A;  4DEQ A;  4JTN A;  2GNM A;  3U1X A;  4B29 A;  1DQ2 A;  1UY3 A;  2VZR A;  5I91 A;  3KQR A;  5L7O B;  2WNU C;  4Y4Y A;  2WSV A;  3WG3 A;  5IFT A;  2J1A A;  2BGC A;  2VMF A;  5JVV A;  1O4Y A;  1YQ2 A;  2G9G A;  1XNT A;  4DNY A;  4LHK A;  4B4Q A;  3LPG A;  1GQP A;  3HR9 A;  3RMX A;  4CP2 A;  4ERO A;  5K0U C;  3S30 A;  3TN9 2;  3ZXF A;  4NAO A;  4AHX A;  4XF4 A;  2Y6H A;  3FMG A;  5H9P A;  1LHN A;  4XQW A;  5JCT A;  2D3S A;  4LHS A;  4WM8 C;  4BM8 A;  4BIS A;  4IEV A;  3FE5 A;  3KWV A;  4COW A;  4FO9 A;  2W3J A;  1URX A;  1W8F A;  4FPK A;  4AGV A;  4B7K A;  1JYI A;  2VCA A;  5LA0 A;  1I3H A;  3HBK A;  5F9T A;  2YBS A;  2P3I A;  3WG1 A;  2NP0 A;  3I97 A;  3AKR A;  4K21 A;  5A7O A;  3VDD C;  4NHL A;  4GH4 B;  1TZO A;  4HL0 A;  1CPN A;  2ETE A;  5KWR A;  5IW0 A;  3VKN A;  5T52 A;  4LTA A;  3U78 A;  2V4A A;  3MUZ 1;  1C28 A;  2JG8 B;  1HQL A;  1YC6 1;  4RFT 0;  5FY7 A;  5BXX A;  1NG0 A;  3KVA A;  1VBB 3;  2GU9 A;  4QB6 A;  1XE7 A;  1IKQ A;  2X5I A;  3A0N A;  2XH6 A;  3HNY M;  2C4X A;  3AZW A;  2D7F A;  3CZJ A;  1FOD 3;  3PUA A;  4QDQ A;  1LB2 A;  2MEV 3;  2EXJ A;  4B3N A;  4D6Q A;  2A71 A;  2RJL A;  1QJU 1;  1TMF 3;  5BY5 A;  4JHZ A;  4YW5 A;  5C8C C;  1HJF A;  4FFH A;  1WKY A;  1S0C A;  5JZG A;  2VTX A;  2PMW B;  1TME 2;  3U10 A;  2WNE A;  3SQO A;  3RZL A;  2VMI A;  5ISL A;  3NAP A;  5BNP C;  1APN A;  1LJ7 A;  1QOO A;  1W2O A;  2E31 A;  1V6M A;  5FOB B;  4BPZ A;  1HRV 3;  5FPZ A;  4Z2A A;  2YC0 A;  4XHX A;  1LEN A;  4B4R A;  2VVD A;  3BPZ A;  2XLG A;  3PDQ A;  5DUV A;  2ZGT A;  4IV1 C;  1PGW 1;  2UYA A;  2AH2 A;  4KH9 A;  3GYD A;  3ES4 A;  4MGS A;  2VNG A;  2WWU A;  2XQX A;  4LKS A;  1KJL A;  2OUH A;  3QH7 A;  3S0M A;  5IYY A;  1UYY A;  3MYX A;  3POW A;  1NA1 C;  5LBF A;  4A3X A;  5TSW A;  4XFF A;  3JD7 1;  2QQJ A;  3HT2 A;  1LHW A;  1AYM 1;  5FZ0 A;  5IK8 A;  3RI8 A;  1FYU A;  3O1P A;  3ACG A;  3LPF A;  1X36 A;  3CLP A;  1YLL A;  5FP8 A;  1LNS A;  3VBS A;  2C6S A;  4JGY C;  2VOK A;  1RMU 2;  4IEU A;  4DUX A;  4QM8 A;  4DXR A;  1JZ8 A;  2OVU A;  1OF4 A;  2NM1 A;  4O65 A;  3OGS A;  5FO8 B;  4N90 A;  4YG3 A;  5FYU A;  3B93 A;  4IXL A;  1BBT 3;  3KV4 A;  2ZXQ A;  1AX1 A;  3PJQ A;  1Z7S 3;  4KGG A;  2NYY A;  1BKZ A;  2C1F A;  3ZXK A;  2A73 B;  3BOP A;  4O9E A;  4F83 A;  2YFU A;  2X10 A;  2Q1M A;  3ZXA C;  3FX3 A;  4HKW A;  4I02 A;  2VNR A;  2X5I B;  4AF9 A;  2CAU A;  3PHM A;  5F39 A;  5JOY A;  5I0T A;  1EV1 2;  1IS3 A;  2QQK A;  2ZEZ A;  4HAN A;  3RJR A;  1CIW A;  4WVV A;  3T09 A;  1UQX A;  2XJP A;  5DMY A;  1NCR C;  3AXD A;  5E6H A;  3WQ1 A;  4XJZ A;  4CEW A;  5C5T A;  4HG6 B;  1JUH A;  4AFC A;  2DVA A;  4LO4 B;  3IKW A;  1LGC A;  5G05 L;  2OW4 A;  5JZG B;  4CYD A;  1RHI 1;  1R09 1;  2ZAH A;  3NAP B;  1XSQ A;  5D21 A;  3EB7 A;  1I1E A;  3NNJ A;  2RMU 2;  3PU3 A;  2JKB A;  3GGL A;  1RVF 2;  2V09 A;  4Q4X 2;  5ACA 2;  3O12 A;  1RUG 3;  2WII B;  1I9R A;  2E26 A;  2XQR A;  3LQC A;  4Q4W 3;  4QX8 A;  5I8T A;  3N35 A;  2VZU A;  4Y1X A;  2VZP A;  2HBT A;  5F3E A;  5IVF A;  1WW4 A;  2KM2 A;  1QJY 2;  2WA4 A;  3I2D A;  4LUM A;  3MID A;  4LKD A;  1XRU A;  2YDE A;  4CDQ A;  4JDO A;  5JMO A;  4Y22 A;  2ARB A;  3NNM A;  5APA A;  5DAQ A;  2QDR A;  5K7P A;  1U12 A;  3ZFF B;  2HWC 3;  3B9C A;  1HIX A;  4C1W A;  2WDB A;  4GKY A;  4GJY A;  4Q0S A;  5EPA A;  1DYP A;  2VY0 A;  2WT1 A;  2R07 1;  3URF A;  3VBS B;  5J1X A;  2A6W A;  2P17 A;  2OYZ A;  1SLC A;  1VBA 1;  5DUW A;  3ZMO A;  1R1A 1;  5CFC C;  3IMM A;  2C26 A;  1GU3 A;  3F2Z A;  1JW6 A;  1IG3 A;  1AL2 1;  1RJ8 A;  3DPR A;  1TQ5 A;  4Q4Y 3;  1HV1 A;  4XOG A;  1ENQ A;  1W3V A;  3ZSK A;  1PGL 1;  4Y20 A;  1PZ7 A;  5FXW A;  4QT6 A;  5EYY A;  2W92 A;  2WBK A;  4DUV A;  4DXT A;  3KGZ A;  2FDK A;  3ZYJ B;  4V2V A;  1L7L A;  1Y4W A;  4AQ6 A;  1UYX A;  1W6Q A;  2GAU A;  3I3E A;  2A6Z A;  5FYM A;  1FMD 3;  1O4Z A;  5GLV A;  3ZN4 A;  4E4D X;  4A42 A;  1RUE 1;  4QXC A;  4JGZ C;  1W6O B;  4B1L A;  1AXZ A;  1MQT C;  1KDM A;  1YJL A;  1YUD A;  4P9G A;  5A6Z A;  5AC9 2;  5KHJ A;  2FBE A;  3RZG A;  2NLR A;  1UYZ A;  2BZD A;  5HXM A;  1YFU A;  1MZ6 A;  2OPW A;  2WL1 A;  4MO3 M;  4B4P A;  5F3G A;  1ZBE 1;  4XUO A;  3RZJ A;  1K3I A;  1UU5 A;  1CJD A;  1PZ8 A;  2DCJ A;  3CMG A;  1SDD B;  1PNG A;  4AVV A;  3O0X A;  1FI2 A;  1X50 A;  2X09 A;  3I4I A;  3AMM A;  2BV4 A;  4IE6 A;  1CPM A;  2RS3 1;  4TZD A;  2ZX1 A;  3VL8 A;  1OVS A;  3B00 A;  2RE9 A;  2XXZ A;  3NRU A;  4L97 A;  3SCH A;  3WF0 A;  4Y22 B;  3ILN A;  3IT8 A;  3RVH A;  4CDX C;  4K3U A;  4RR3 A;  4DXZ A;  3WW1 A;  4AI8 A;  1C5H A;  2QZ2 A;  2EA7 A;  1WME A;  3W20 A;  2BNN A;  1WUV A;  3C7O A;  4LOS A;  4AI0 A;  2PA7 A;  1G8W A;  4UFM A;  1ND3 A;  2Y6F A;  1YYN A;  3I2J A;  3JBG 2;  5FZ8 A;  5GLW A;  2QVS B;  3RYK A;  3DPR B;  1UZW A;  2WNU A;  5DDJ 1;  4ZS2 A;  1FXZ A;  3LA2 A;  2JX9 A;  3HJR A;  2HWB 3;  1Y9M A;  2ZHN A;  3JU9 A;  4R4Z A;  4CU9 A;  4ES8 A;  2HEW F;  2OS2 A;  4Y20 B;  4DO0 A;  4W65 A;  5FJH A;  4ARY A;  3O5S A;  2Z2S B;  4O61 A;  1SBE A;  2PXJ A;  1AR9 2;  2EXI A;  1W6Q B;  1CAV A;  3USU A;  3TB0 A;  1F5F A;  1A78 A;  5FZC A;  1IHM A;  1RIT A;  1FPN 3;  1QJX 1;  1UU4 A;  3AKQ A;  3OYW A;  2HBU A;  1ASJ 2;  4AVS A;  1ST8 A;  2GC2 A;  1QOS A;  4XE9 A;  1OC1 A;  4NHK A;  2RG4 A;  5F37 A;  3P3P A;  4AEK A;  4RHV 2;  4CCD A;  4N7U A;  4W6Y A;  4YVS C;  5LBB A;  2GP3 A;  1ZZC A;  4MXV A;  5C3R A;  4UYB A;  1YNA A;  3KT1 A;  3JCI A;  2WT0 A;  4NWV A;  5EJ3 A;  4OVE A;  5HV4 A;  3ZFG A;  4P00 B;  1RUF 1;  3SKJ E;  1C3H A;  2VM9 A;  2G4I A;  2JG9 C;  4YW2 A;  3AX4 A;  4P14 A;  4BQ5 A;  2I2S A;  4QU1 A;  5C5U A;  1STM A;  1BJQ A;  3O0V A;  3RS6 A;  5KC6 A;  1BMV 1;  3CHX A;  1Y43 B;  2PHU A;  3AFK A;  5D1I A;  5JR7 B;  3VBU C;  4CP1 A;  1VPH A;  4OUM A;  3CEW A;  4XFH A;  2WZR 2;  2VQA A;  1MS0 A;  3G7D A;  4RR3 B;  3WDY A;  4H14 A;  4AEM A;  3J7N A;  3E5U A;  1I6X A;  1QQP 2;  4HKO A;  1RHI 2;  5LAT A;  2QQW A;  4Y24 A;  4PLO A;  5BNQ A;  1RUC 1;  3AL5 A;  2CDP A;  4Q4V 1;  3FLR A;  1LTE A;  4URT A;  2W5F A;  1W6N A;  2AR6 A;  5J09 A;  3R4S A;  4N8M A;  2WNU B;  2VTX J;  4L8Q A;  2Q1F A;  3M3E A;  1IGO A;  3B94 A;  2FCT A;  1W6P A;  1Z0H A;  3INA A;  1O6U A;  5LW9 A;  4XBQ A;  3ZFE C;  4AE2 A;  2WO2 A;  1N1V A;  1J59 A;  3H8R A;  2B9U A;  1MPX A;  3ALQ A;  1OA3 A;  1CAV B;  1PGS A;  1LGN A;  2XML A;  2W08 A;  4ZY9 A;  3OD4 A;  3USU B;  4E4H A;  1LAJ A;  1XC6 A;  4Y4R A;  3OYW B;  2CGP A;  3HEI A;  4UFI A;  4IGO A;  1PMJ X;  4EWD A;  1UO9 A;  3BUC A;  1FT9 A;  4HSJ A;  4YAR A;  4QQP A;  4M0N A;  5A6Q A;  2RS1 3;  1VBD 1;  1YQ6 A;  2O8O A;  2RS5 1;  4LO6 B;  5DPN A;  3VN4 A;  2TNF A;  2WAA A;  4NRP A;  3ZIX A;  5HBA A;  1A34 A;  2BPA 2;  4M01 A;  4PLM A;  1BCX A;  4I3G A;  2CSG A;  4LOT A;  1RUH 1;  4XVH A;  4RD7 A;  2RJK A;  3AJY A;  3HD8 B;  2KXL A;  4BDV B;  3JXS A;  3U11 A;  1HRI 3;  2ZZQ A;  1F8V A;  3UKV A;  3O1S A;  5IVY A;  3LOB A;  3I3Q A;  4QKF A;  4HET A;  5FZI A;  1F4A A;  4D6R A;  2BUK A;  2ADD A;  3LWC A;  5EQU A;  3WOG A;  3SMH A;  1YI7 A;  1H2M A;  2ARX A;  1KD7 A;  1EPW A;  4JTO A;  4FBF A;  4QPG A;  2YV8 A;  1HQW A;  3PU8 A;  3CIH A;  1OA2 A;  5C8C B;  4E4S A;  4FPH A;  1QF3 A;  4QB2 A;  1GWK A;  2WRA A;  3WDU A;  3QLQ A;  5CIR A;  1ONA A;  5FYI A;  5JPM B;  1NZI A;  5F6L B;  3UKN A;  1AX0 A;  2HWF 3;  4L92 A;  2R6Q A;  4AGR A;  4IND A;  2D93 A;  1ZRF A;  3FWE A;  3VBF A;  3Q8C A;  3UK9 A;  5ANN A;  5A3L A;  3ZKY A;  2BYV E;  2J1E A;  4GH4 C;  4DB5 A;  1JXN A;  2D43 A;  1PMH X;  3AP6 A;  3AYE A;  4P9W A;  1SEF A;  3K75 B;  1W6P B;  2MPF A;  2OQ6 A;  4Q26 A;  3NKG A;  2FDH A;  4CDW C;  2UWC A;  1EAH 1;  1H0B A;  1VBB 2;  2JG8 C;  3PUR A;  4IL7 A;  3SEP A;  4I0A A;  5L9R A;  1N3P A;  3OG2 A;  4LNV A;  2B39 A;  3ORJ A;  1W06 A;  1NA1 B;  2WNO A;  5T5O A;  1FOD 2;  1H2N A;  1N1Y A;  1YHF A;  2MEV 2;  1HB2 A;  4CEY A;  2A75 A;  2FCU A;  2OII A;  4E9K A;  3I3B A;  1REF A;  1JS9 A;  3I3M A;  1TMF 2;  1UU6 A;  2D6O X;  4CU8 A;  1DF0 A;  3SNM A;  4AI2 A;  4KMQ A;  2EAL A;  5FYS A;  1RUI 3;  2BW8 A;  4KWJ A;  1H9W A;  1H4H A;  1YFY A;  1ULF A;  4WVZ A;  1HRV 2;  1PO2 1;  4XW3 A;  4ISQ A;  4QXK A;  5ABJ C;  4A6S A;  2ZGK A;  3LB9 A;  4Y5Z 0;  2QQO A;  5EFU A;  4FTB A;  1NQD A;  1VAK A;  2XJV A;  5T54 A;  2BNO A;  1C8M 1;  3D4K A;  4JV4 A;  3ZPO A;  4MET A;  5JI7 A;  4AGG A;  3BVC A;  4LT5 A;  4CCK A;  1DLC A;  2ZAC A;  3HN3 A;  4HVR A;  1GFF 2;  1QXP A;  2ARA A;  3FC0 A;  4UOJ A;  4JGZ A;  1PVC 3;  4QPG B;  1IPJ A;  4XQ4 A;  5FY5 A;  5KR7 A;  3O1V A;  3J8F 1;  2ZKN A;  4LO8 A;  3WQ7 A;  4K8F A;  2AEZ A;  5DZE A;  3BTY A;  2AGS A;  2I07 B;  3WD5 A;  1K12 A;  2WWJ A;  3DYM A;  2O8Q A;  4RS5 A;  2BRT A;  3VBF B;  4NIH A;  1V6K A;  3P6B A;  2Y6L A;  1ULG A;  1QMJ A;  1JZ4 A;  2RMU 3;  1GV9 A;  1R1Z A;  1BBT 2;  2ZHL A;  3Q8F A;  4UAP A;  3ZXE A;  3VD9 A;  4DIQ A;  1ND2 A;  5LBE A;  4CU6 A;  2XVK A;  4N9H A;  4NPL A;  1V9U 1;  3LKJ A;  1XB9 A;  3AYC A;  3WP5 A;  1FAT A;  2X5I C;  1LCL A;  3GZE A;  5CZK A;  2PHL A;  4CEY B;  3ZO0 B;  3T1M A;  5T5J A;  2GMP A;  3MEP A;  3EYP A;  3EJK A;  4FQZ A;  3WEZ A;  1S2E A;  1W8W A;  3OPZ A;  5CNA A;  1ALY A;  1QDO A;  1JH5 A;  5DG2 A;  3WUC A;  4I0B A;  1F2N A;  3T0A A;  1JZ5 A;  4D7S A;  2VH9 A;  2V5Y A;  3HIF A;  4ZU4 A;  5JZG C;  5I0U A;  3ITQ A;  4GB3 1;  2YBK A;  2ZAA A;  2A3W A;  2PLV 1;  3VL9 A;  2J22 A;  3NAP C;  2XDV A;  1DQ1 A;  2WO1 A;  3KVB A;  4HLT A;  5F8P A;  4UFJ A;  2WNV A;  4BHP A;  1RUG 2;  2VW2 A;  4Q4W 2;  2YXS A;  4GUL A;  4Y1U A;  1E5S A;  5FMD A;  3VV1 A;  1NY7 1;  3BB6 A;  1D4M 1;  3NVC A;  3WQB A;  1C57 A;  1K5J A;  4RYD A;  3VUO A;  1KGY A;  2XPJ A;  1VBE 1;  2ID4 A;  3S5Q A;  1IOA A;  1MVQ A;  3X29 B;  4M3C E;  4EQV A;  1CON A;  3WQ0 A;  3Q9O A;  2R04 1;  1W9F A;  4JGZ B;  3WIN E;  4DEV A;  2BOI A;  1JYV A;  3TEY A;  2WYF A;  2BBV A;  2HWC 2;  1DGR A;  1U5Z A;  1K5M A;  3FUO A;  3KCY A;  4YVS A;  1WCD J;  4QKN A;  2JB4 A;  3OPW A;  1JZ7 A;  3RNS A;  1LOC A;  2E7A A;  4Q2F A;  5LA2 A;  4LQR A;  3HWJ A;  2ARE A;  2PHD A;  4LK7 A;  4RS5 B;  4UW5 A;  2ZMN A;  2I45 A;  4QX5 A;  4RGK A;  5L19 A;  4DRV A;  2XJT A;  5FZK A;  4Q4Y 2;  3CJI A;  2XVG A;  2DU0 A;  4JX0 A;  5GLU A;  1GNY A;  1LOE A;  2JIJ A;  3BAL A;  3EQE A;  1WW5 A;  1AR8 1;  2UWB A;  3WP4 A;  2PAK A;  3UT0 A;  5EJZ B;  2WQZ C;  2XJU A;  4XQD A;  2OPK A;  1FMD 2;  3AXE A;  3DEM A;  5BNN A;  1RXF A;  5EIY B;  1DQ5 A;  2BGO A;  4URA A;  2B42 B;  4ASM B;  2CL2 A;  3L2H A;  5AFB A;  4GWM A;  4UT5 A;  1JYN A;  1R08 1;  4NAM A;  1WLC A;  1ZRI A;  4HK9 A;  4UBG A;  3MLK A;  5L9V A;  2KA3 A;  4XBL A;  4CEW C;  1QJU 3;  4QQO A;  4EZH A;  2ZX0 A;  5C4W A;  2YFZ A;  3KV5 A;  2VR4 A;  4LIV A;  3ZXJ A;  2Y60 A;  3FFQ A;  4BQ3 A;  3NMB A;  1H2L A;  4K40 A;  2QQP A;  2XWB B;  2BU9 A;  1DZQ A;  1KS4 A;  2BDR A;  2WNV B;  2JDY A;  1UW8 A;  3L9J T;  3BU7 A;  4X8P A;  3KT7 A;  4M3C F;  5IVJ A;  2NMO A;  2CWS A;  2ARC A;  2ZGN A;  1UIJ A;  4RGA A;  4AQS A;  4MVT A;  1MS9 A;  4K8R B;  2W94 A;  4WZF A;  2E32 A;  4LMF A;  1QEX A;  1JZ3 A;  4L0P A;  4XJU A;  2DVF A;  4K6B A;  4QXB A;  4YNI A;  3FZ3 A;  3AZX A;  3J7L A;  4QGN A;  1T6B X;  3ZSM A;  4CDQ C;  4YFZ A;  1L7Q A;  1NYW A;  1K5M B;  3JD7 3;  4YVS B;  3TYJ A;  2HEV F;  1FX5 A;  1AYM 3;  3FHA A;  4D6S A;  1KFU L;  1Q8S A;  5A33 A;  2IXC A;  5B4X A;  1W99 A;  5LEK A;  1RUJ 1;  1UWW A;  4F8A A;  5LBC A;  1BVV A;  2J42 A;  4LE3 A;  4XXP A;  3ZYG A;  3GJA A;  3UGF A;  3A21 A;  1XND A;  1QJZ A;  2HWB 2;  3CJI B;  3JQX A;  1F15 A;  2GDF A;  4JVA A;  1O4T A;  3VBH A;  3N9P A;  1OQD A;  1BK0 A;  4CUC A;  4WV8 A;  1XBF A;  4AVB A;  1OUX A;  2ZHM A;  2LM3 A;  3GM8 A;  3WR0 A;  2CV6 A;  3VBU B;  2BVB A;  1TE1 B;  3ZN5 A;  2ZGU A;  1Q3E A;  1YXW A;  2GH8 A;  2YGM A;  3AVR A;  4R9D A;  1FPN 2;  4PQQ A;  5FKC A;  4E8C A;  4KBZ A;  4RQP C;  5IVE A;  3MPP G;  4Z8B A;  3SXW A;  1DU3 D;  4MLO A;  3J8F 2;  1NXD 1;  3V56 A;  3D82 A;  1C1F A;  2V73 A;  2RDQ A;  4HON A;  5C4W B;  1OKO A;  1QQP 3;  1WMX A;  2BBA A;  2P5B A;  3KCC A;  4TN7 A;  4XAC A;  4LPL A;  1RHI 3;  3N7L A;  4IE0 A;  3LDK A;  4I01 A;  1R09 3;  4D69 A;  4CSW A;  1A8M A;  1QXR A;  5CU1 A;  1ZZ9 A;  4FPC A;  4SBV A;  1MS4 A;  3ON7 A;  5CBL A;  3E6C C;  2DF7 A;  2D5F A;  5F3I A;  1S2B A;  3LAG A;  1VRH 1;  4CUA A;  3CF6 E;  2JE7 A;  2WIN B;  4AFM A;  5JOX A;  3NJY A;  3PIG A;  1W2A X;  3GNE A;  3TRS B;  4XUN A;  4Q27 A;  2VEC A;  5DUX A;  3KCX A;  4L9B A;  1CZV A;  5FWE A;  1FNY A;  3ABZ A;  2P6C A;  2Z69 A;  1MEC 1;  3M3I A;  5C9A A;  5IK5 A;  4AVA A;  1HB3 A;  3AB0 A;  3I2H A;  4N43 A;  4RSU A;  4TWT A;  1LOB A;  1RUD 1;  2EIG A;  5DQ0 A;  1QDC A;  1W9W A;  5FXZ A;  4AI9 A;  2XUE A;  3FBM A;  4RR3 C;  3DV8 A;  1GNH A;  5A3N A;  3AZY A;  2ET1 A;  1G9B A;  3KS7 A;  1VMH A;  2K9Z A;  4XAE A;  1OA4 A;  1SHW B;  2FMD A;  2JE8 A;  4LIT A;  2R07 3;  3S5A A;  2HYK A;  1S0E A;  4V2W A;  1ND3 C;  1VBA 3;  2W1Q A;  5EP9 A;  1AJO A;  1R1A 3;  4XZP A;  4OMC A;  4HVO A;  1AL2 3;  2JIC A;  2VVE A;  3WG4 A;  3WNO A;  3ZOI A;  5JSP A;  1S4C A;  2ZX2 A;  3GCW A;  4BXF A;  3I59 A;  3W9A A;  1SMV A;  4DRR A;  4H55 A;  4NPM A;  1XE0 A;  2WFF 1;  2H6C A;  5EXO A;  5KXE A;  3POI A;  4CDU C;  1JOJ A;  5D8A C;  2DBN A;  2DFC A;  3J26 N;  4Y1Y A;  4LBQ D;  4HKL A;  2B46 X;  4AFD A;  2P4E A;  4EN6 B;  1RUE 3;  1DGR N;  3R6S A;  3POE A;  3PVN A;  4OI2 A;  3LZZ A;  2RS1 2;  4MUV A;  2QZ3 A;  5IWF A;  1POQ A;  3L2Y A;  2JWP A;  2VOV A;  1OMI A;  1OPO A;  3ZLI A;  5FO9 B;  2LW8 A;  3MW2 A;  3T4H B;  3OJB A;  1ZBE 3;  1DQ4 A;  1OD3 A;  1HRI 2;  3ZFG C;  4IDZ A;  5A70 A;  1OBN A;  2ZOE B;  3I2I A;  4NO4 A;  1NXM A;  1EPZ A;  4CDW B;  2DVG A;  3FN9 A;  3U14 A;  4YZ4 A;  1XXN A;  2W52 A;  3D6E A;  1ZA7 A;  4BME A;  2GC1 A;  5L36 A;  2ZAB A;  1W8N A;  5FMO L;  1UL9 A;  2RS3 3;  3LEK A;  1EUT A;  5C9A B;  3QH6 A;  3DCQ A;  1H9P A;  3B7M A;  4C8D A;  2BFU S;  1VIW B;  2QJV A;  4OFG A;  1NCQ C;  5DZG A;  1MZE A;  5HI0 A;  5AVA A;  1V70 A;  4LJH A;  1BK1 A;  3DEC A;  4TYS A;  3HT1 A;  1ENS A;  2ZTN A;  4R52 A;  1HLC A;  4DPN A;  2HWF 2;  2ADE A;  1GWL A;  2XHN A;  5DG1 A;  1CJP A;  1V0A A;  5ABJ B;  1SFP A;  1OOP A;  4HZF A;  4XF3 A;  1BYH A;  1DG6 A;  5A3T A;  2BJS A;  1RIR A;  5DDJ 3;  4BQY A;  2ZS6 B;  3ZYP A;  3AMH A;  2W46 A;  4F7Z A;  3I59 B;  4MGY E;  2R0H A;  5CFD A;  1PO1 1;  5FY1 A;  4YG6 A;  2YB7 A;  5LY2 A;  5GZG A;  5JSR A;  1GZ9 A;  1O3S A;  4EYU A;  3MFA A;  2MHF A;  1GLH A;  1NLQ A;  1QJX 3;  3ZXL A;  3ZM8 A;  1RTV A;  1W6M A;  3IMN A;  4OLL A;  3T2Q A;  5M0T A;  3RG0 A;  3NNF A;  4TXW A;  3KB5 A;  5FBJ A;  4MAD A;  1LOD A;  4N53 A;  1W9T A;  5GZC A;  3KLS A;  4QX1 A;  3VZO A;  4AHY A;  1RUI 2;  4UFK A;  5E1R A;  1G86 A;  2B8M A;  1YCI A;  1AR7 1;  1OLQ A;  2K46 A;  4YZ1 A;  4KWU A;  2IXI A;  3POF A;  3KHC A;  2IZW A;  1UMI A;  3ZYH A;  1RUF 3;  2GC0 A;  2OX0 A;  3BGA A;  1GOG A;  2P3Y A;  1I5P A;  4Q0P A;  1G7Y A;  5FAX A;  1H1A A;  4FOW A;  2QQM A;  2LS6 A;  4FTS A;  5IVV A;  2AC1 A;  1PVC 2;  3I49 A;  4YYO A;  2ATF A;  4QPG C;  2YUE A;  3WG2 A;  4YGD A;  4ASK A;  1UOG A;  1AYN 1;  1PNF A;  2J1S A;  2EVX A;  2XBO 1;  3O0W A;  2IXL A;  4XMA A;  3ZVX A;  4X8N A;  3CNA A;  5BNO A;  4A4A A;  3ZYB A;  4YZ3 A;  5LY1 A;  4NRO A;  1CWP A;  1LED A;  1X9P A;  3LIH A;  3VDC A;  1RUC 3;  3ILF A;  3TWI A;  4Q4V 3;  1U5Y A;  5J98 B;  3VBF C;  1XOY A;  3UES A;  5A3O A;  2CNA A;  4HT1 T;  3IZO A;  3RI9 A;  5A6X A;  1ZZ7 A;  1GOF A;  1VRH 2;  1PZ9 A;  3D5O A;  4CXX A;  4YW1 A;  4RGG A;  1NQJ A;  3EBR A;  3MI8 A;  4NVP A;  4XHB A;  5LAS A;  3RDI A;  1UPI A;  4Z07 A;  3WF3 A;  5H9S A;  3APB A;  1C4R A;  3M70 A;  3SC7 X;  3PUI A;  4EN9 B;  2W0X A;  1MEC 2;  1S2K A;  3KF3 A;  1DGW X;  2R32 A;  1PVX A;  4CEY C;  4XJA A;  3MIE A;  1W6M B;  1OLM E;  2P3J A;  3DYP A;  4CXY A;  2G1M A;  5FYC A;  3C8X A;  4TLG A;  3SHR A;  1NX9 A;  2AEY A;  1XYN A;  2JDK A;  2HH9 A;  1FAY A;  4I3P A;  1VBD 3;  3BIW E;  4N53 B;  2RS5 3;  1XPW A;  2VG9 A;  2W1W A;  1X82 A;  3KZ4 C;  3EXU A;  1DLL A;  1RUH 3;  2J1T A;  3H7J A;  3TOJ A;  1HJG A;  2ZGR A;  4BK4 A;  5FQ0 A;  4LLO A;  3RWK X;  4UWD A;  3ZDV A;  2YYO A;  4BMB A;  5A7W A;  1PX3 A;  1IPK A;  2E9Q A;  3III A;  3NQH A;  3AP9 A;  4PF1 A;  2GZW A;  4PF5 A;  1W04 A;  1GP5 A;  2D44 A;  2DUO A;  4TSV A;  3RQ0 A;  1WLW A;  3VBO C;  4LHN A;  2WYS A;  3AP5 A;  3AVS A;  2VMG A;  3IN9 A;  3VGI A;  2ET7 A;  2Y0I A;  2VMC A;  3FFZ A;  5A7N A;  3NV2 A;  3LD8 A;  4FQ4 A;  4MGK E;  4R9A A;  4RQP A;  4ZXK A;  2OA2 A;  4IQP A;  4Q0U A;  1GSL A;  3NV4 A;  4CEW B;  2JKX A;  1WCQ A;  2WR9 A;  3C7H A;  4FPJ A;  4PHZ A;  4S2F A;  2JD9 A;  2DTY A;  5A3M A;  4GQ7 A;  4Y1V A;  5BNO B;  1E5R A;  3H3Z A;  1KIT A;  5FOJ B;  1XU1 A;  2ZEX A;  1Q8Q A;  3H8X A;  2DTW A;  4QGM A;  3K4Z A;  3K2O A;  4FFF A;  3UYJ A;  3MF6 A;  4RS5 C;  3KF5 A;  2VZV A;  2PN5 A;  5FZD A;  3I2G A;  4ZZ5 A;  5BYN A;  3IM0 A;  1TVG A;  2R06 1;  3OUJ A;  2WSU A;  1ND2 C;  3OOX A;  1EAH 3;  1VRB A;  3WLU A;  3DXU A;  3SH3 A;  2FZ1 A;  1QJE A;  4FPG A;  5T55 A;  3SKV A;  5JOW A;  4CDQ B;  5FYZ A;  3FUQ A;  1GWM A;  3OEA A;  1IS5 A;  2O1Q A;  2DU1 A;  2Y34 A;  4B7E A;  2O0O A;  3N9N A;  1QJU 2;  1AR6 1;  5JUV A;  5ANQ A;  2FD8 A;  4P9J A;  1HB4 A;  2C0Z A;  4XDO A;  3VZN A;  1AXY A;  3OGV A;  4H2A A;  4Z92 B;  5C3P A;  2VCC A;  1SZB A;  2VBP A;  4XCB A;  1KEX A;  4HK8 A;  3HN1 A;  2I74 A;  5FQ0 B;  3MIG A;  4PT6 A;  1PO2 3;  3OBR A;  5F6K A;  2WN2 A;  5JMC A;  4XFI A;  5A7W B;  2WNV C;  2VL4 A;  3ILR A;  2JXA A;  2YMZ A;  3LEG A;  4LBJ A;  3LDB A;  4P5Y A;  2XR4 A;  4YM0 A;  2Q8O A;  4COZ A;  1PGW 2;  3SH5 A;  3HNM A;  5EHD A;  5G04 L;  1C8M 3;  5DXD A;  3ZSL A;  4ATF A;  3DN7 A;  5FCC A;  1S0G A;  3FBY A;  4CDU A;  1QXJ A;  5D8A A;  2CWM A;  4BJ0 A;  2A6X A;  1F35 A;  1DHK B;  2DCT A;  2WS9 1;  5LB6 A;  1RIN A;  4JCK A;  4JQT A;  4RQP B;  4CUG A;  2IXK A;  1DYK A;  4CZS A;  1UY2 A;  5FK8 A;  3J7M A;  1G9F A;  3JD7 2;  2WFP A;  3V64 A;  4R8H A;  4QPI A;  1AYM 2;  1K5M C;  3J8F 3;  2EID A;  2OQ7 A;  2C9K A;  1O8P A;  2QUO A;  2RR1 1;  3CU7 A;  4O7X A;  1UOF A;  1C8N A;  3AK0 A;  2WZP P;  3TNQ A;  2Q5T A;  3GZU C;  4LOR A;  3N9Q A;  1ODM A;  1SFY A;  4WVM A;  1G9A A;  4AZZ A;  5C8W A;  1AJK A;  4Q8K A;  3I7D A;  4J25 A;  1UPS A;  1WWY A;  1H4G A;  4IEO A;  5J96 B;  4C0B A;  4W8J A;  2D6K A;  2JDU A;  4LO7 A;  5F5A A;  3VHP A;  4EWE A;  3CJI C;  5BV6 A;  5KXC A;  2VD7 A;  1DGL A;  4ZS3 A;  3ZYF A;  2Q4S A;  2QKD A;  1V9U 3;  1KJR A;  4GMP 1;  4G4F A;  4HXC A;  4IEZ A;  3PVO A;  3QOP A;  5FXV A;  5BNN C;  3W5N A;  3PUQ A;  1K42 A;  2GMM A;  5FYB A;  1NCQ A;  2FDJ A;  2GP5 A;  1WBF A;  3Q8A A;  3UJO A;  2CYF A;  4A2U A;  2VU9 A;  1LUL A;  3N9M A;  5A80 A;  3DL3 A;  1OUR A;  2D5H A;  4GZ9 A;  1O7F A;  1KQR A;  5C4W C;  5GZD A;  1CD3 G;  1NE4 A;  4YSF A;  1AZD A;  1GZC A;  1ND3 B;  1R09 2;  2A5Z A;  3AZV A;  4GB3 3;  4CVU A;  2PLV 3;  3JB4 C;  4XAA A;  5GAL A;  1QH7 A;  4P02 B;  1H6X A;  1J58 A;  3BI3 A;  4LKF A;  3O1M A;  4BQW A;  2J1V A;  4XUQ A;  2QNK A;  3IDC B;  1PIV 1;  5C71 A;  3VKF C;  5HV0 A;  3UET A;  3WP3 A;  2VW1 A;  2HJI A;  3IWZ A;  5F32 A;  2SLI A;  1D4M 3;  1W05 A;  3AYA A;  2C9A A;  4CDU B;  5D8A B;  1VBE 3;  2VZT A;  5HCF A;  4F3J A;  3U75 A;  1POV 1;  4ZU7 A;  1W0O A;  3W5M A;  2HWE 1;  2VNV A;  1CIY A;  4Q8L A;  1X7N A;  3O7O A;  3RZH A;  1W8T A;  3VD7 A;  2DFB A;  2R07 2;  2OXB A;  3PL0 A;  4WVM B;  4PQ9 A;  1W8Z A;  2QCS B;  1SG3 A;  1GNZ A;  1VBA 2;  2ZX3 A;  3OGG A;  2AAC A;  4IEP A;  1ULD A;  5KBF A;  1R1A 2;  1O3Q A;  3ZFG B;  4COU A;  4DIN B;  2HWD 1;  2WWS A;  1AL2 2;  1D0G A;  1UCX A;  2QDN A;  5FP4 A;  4QMA A;  2WA3 A;  3W59 A;  3ATG A;  1AHS A;  1PGL 2;  1JYC A;  3VBH C;  4EV0 A;  3E6D A;  3AYD A;  1AR8 3;  1JTZ X;  1VJ2 A;  4NUB A;  1CAW A;  4XBN A;  5FYH A;  2ZCW A;  4Z82 A;  3DF0 A;  5BPX A;  4G3Y C;  2Q1Z B;  2QQL A;  5SV8 A;  1UF2 C;  4K9S A;  3N9O A;  4LBK A;  5F2S A;  1RUE 2;  2F4L A;  3PNA A;  1NCQ B;  4UFL A;  4OHX A;  4A7K A;  3J9S A;  2Y64 A;  4UI9 L;  3S7E A;  1MS8 A;  1K45 A;  1R08 3;  2AEN A;  5IUQ A;  2BEO A;  3ZFF C;  3POY A;  3WY6 A;  4FXK B;  4Y5T A;  2BNM A;  1KS5 A;  1YIF A;  1ZBE 2;  3A23 A;  2B4K A;  2BQP A;  2TEP A;  5C70 A;  1W6N B;  5FPV A;  3ELN A;  4GA9 A;  4MH0 E;  1UY0 A;  3AKT A;  4W6W A;  3VDA A;  2XLF A;  4AAP A;  3ZN6 A;  1PK6 C;  3H9A A;  3RFR A;  1DFQ A;  2Q0A A;  2PQQ A;  1E5H A;  2RS3 2;  1COV 1;  1SBF A;  5FY8 A;  2HKX A;  2JDA A;  4MOA A;  5AFE A;  5L9B A;  1JHJ A;  3DUI A;  4IEX A;  2YHJ A;  5C3O A;  4QHO A;  5C9A C;  3HMY A;  1VB2 A;  1HXS 1;  2GNB A;  4MHR A;  4MGZ E;  1F9K A;  1W2U A;  4PLN A;  4N43 C;  2VAU A;  4LBM A;  4ATE A;  1VP6 A;  2ZGO A;  4CXW A;  3WT3 A;  4BH9 A;  1XQN A;  3UGH A;  1JU4 A;  1TNF A;  2E6V A;  2FDF A;  1RUJ 3;  4UW6 A;  1CZS A;  4IGQ A;  5EZW A;  3WP6 A;  4QXH A;  3LGR A;  4XUP A;  3ZDS A;  3G6J B;  5DDJ 2;  4P9X A;  3MF9 A;  3VBO A;  1LEM A;  3CZU A;  4J6G A;  1CAW B;  4M0H A;  4K1Z A;  5FZO A;  3T2P A;  1CVN A;  3OUI A;  4QDS A;  4YM2 A;  2QQN A;  2YPJ A;  3T0B A;  1QJX 2;  4HOO A;  1V6N A;  5B2G B;  4Q0V A;  2O14 A;  1RED A;  1LES A;  4COV A;  2CY6 A;  4BXS V;  2EIE A;  1SCR A;  3MIB A;  3M4F A;  1CES A;  2OZ6 A;  1J84 A;  4KGQ A;  2E7Q A;  4QPY A;  4OQ8 A;  2CDO A;  1U5X A;  3AMQ A;  5BUV A;  5A1A A;  5CA6 A;  5JWP A;  1ZBA 1;  1Q8P A;  2Q8C A;  4AVT A;  1RUF 2;  1BQP A;  4FCA A;  4CU7 A;  4LE4 A;  3ZN6 B;  2WO7 A;  3ZR5 A;  1ODN A;  1VRH 3;  1S0D A;  4IES A;  4AAX A;  4CPB A;  4S2D A;  1T2X A;  3WDX A;  1BMV 2;  1U5I A;  2RM2 1;  2WAO A;  3MIC A;  4WM7 A;  4AEJ A;  3RYR A;  1UKR A;  3RWN A;  3VHN A;  5LWB A;  2FCV A;  1W39 A;  2GND A;  1W8H A;  1MEC 3;  5FZM A;  2D6P A;  2ES3 A;  2K0G A;  1YQ8 A;  5HCA A;  3H8O A;  3GZT B;  3HBZ A;  5FLI A;  1KDK A;  4ZZ8 A;  2DUR A;  4PI2 A;  4C0H A;  5FPX A;  2Z4F A;  4NRQ A;  1OT5 A;  2ORX A;  1UOJ A;  1OF3 A;  5L73 A;  2WLQ A;  1JBC A;  2XHK A;  5LRR A;  2E33 A;  4AVC A;  4GWN A;  1RUC 2;  1JOP A;  5J3U A;  3AP7 A;  4AR2 A;  4Q4V 2;  1UXX X;  1S0J A;  2ZPX A;  2YGL A;  1WW7 A;  3E5X A;  2R0F A;  4XYX A;  1BEV 1;  1OOP C;  3ROU A;  1SLT A;  1JZ2 A;  5I0R A;  1W03 A;  1H8T A;  1ZYB A;  2W39 A;  1W8O A;  3MPB A;  3WF1 A;  2AUY A;  3ZYI B;  3NW4 A;  3VBO B;  1HKD A;  2Y6K A;  3FLP A;  2VME A;  2JB8 A;  3OEB A;  1UZV A;  5CFD C;  5FZO B;  4KNC A;  1GQH A;  2WFF 3;  4UF0 A;  3WX5 A;  1AL0 G;  2WKK A;  4R9B A;  3LDR A;  1BHG A;  3POG A;  4BA6 A;  5DN2 A;  3B3Q E;  2P2K A;  4AQT A;  5I8Y A;  3NL1 A;  5E8A A;  5F5Q A;  1J83 A;  4QGL A;  5GZE A;  4PBO A;  2F6B A;  1VBD 2;  3MIH A;  2RS5 2;  4FI9 A;  3I2O A;  4NR1 A;  1Q8O A;  1OKQ A;  2A7A A;  4FPE A;  4CA9 A;  4N53 C;  1IQD C;  5JIU A;  1PM4 A;  2Y26 A;  1VAL A;  4XF9 A;  2FMY A;  1RUH 2;  5FZA A;  3IPV A;  3UGG A;  4HFS A;  4AED A;  1Q8V A;  4I09 A;  4XMI A;  3SH4 A;  5I0D A;  2D40 A;  3PTR B;  3V0B A;  5CG9 A;  4X6Q B;  4M4R A;  1OPM A;  1VE0 A;  2HWD 2;  3POS A;  3WF2 A;  4D7Y A;  2RDS A;  5FZ1 A;  3VHO A;  1J1L A;  3TN9 1;  4E2G A;  5EJ1 B;  2IC1 A;  1ND2 B;  2KR2 A;  5J36 A;  4NOT A;  3OUH A;  1UMZ A;  1A3K A;  1RJ7 A;  2RDN A;  4D8M A;  4KG0 A;  1W0N A;  3VHR A;  2XUM A;  5A7P A;  1LHO A;  1YFW A;  4I30 A;  3WHU A;  1I5Z A;  1M4W A;  4YG0 A;  1ACC A;  3WSO A;  1PHM A;  4UBH A;  3E5Q A;  3UJQ A;  4AI3 A;  5BNO C;  5JSO A;  4LEJ A;  1NZC A;  2P6H A;  2VQT A;  2VUA A;  4H7L A;  3WCR A;  2EAK A;  4IW3 A;  3TAY A;  4XCA A;  3OY8 A;  1UX6 A;  3N7M A;  3WNK A;  2W1U A;  1IPS A;  2VUD A;  2XOM A;  3UL2 A;  4NWW A;  1WW6 A;  3BIE A;  3ME2 A;  4EN8 B;  1YEW A;  3LIG A;  1H8T B;  3QCW A;  4KWL A;  1LHV A;  3WNX A;  2YU1 A;  4SLI A;  1EYB A;  1W9S A;  2HLE A;  1EAH 2;  1PO1 3;  2H0V A;  3WCS A;  4Z2W A;  2FHR A;  2IUW A;  1ULE A;  3SEE A;  4CCJ A;  1JUI A;  1LRH A;  3ACF A;  3THT A;  5FZG A;  1VMJ A;  1TME 1;  2LRO A;  2GNT A;  3AM2 A;  5FYT A;  5CAZ A;  4B8E A;  4Y5S A;  5KXD A;  4ORF A;  2XG3 A;  3N3H A;  4QAW A;  2CAV A;  1NLS A;  1D7P M;  3M7A A;  4FOY A;  5GZF A;  3V0A A;  1JMU B;  4U2A A;  2W2I A;  4AYU A;  4YRD A;  4AG4 A;  4RN5 A;  4BLJ A;  2XGX A;  1PO2 2;  3WNM A;  3V0B B;  2A3X A;  5E88 A;  3NNG A;  1JYX A;  4FVV A;  4XZU G;  4AHW A;  5FZF A;  3WV6 A;  5HXV A;  4NHM A;  1C8M 2;  1S0F A;  2NMN A;  3IDA A;  1E5I A;  2LRP A;  2XL9 A;  5FV3 A;  5ACA 3;  1DZT A;  5BNN B;  2ZHK A;  3BPS A;  3CKH A;  2P37 A;  4KI5 M;  4XF0 A;  3MW3 A;  2DCZ A;  4Y3O A;  5CKM A;  5A3U A;  2FZ2 A;  1WD4 A;  2VUL A;  4NMI A;  5GLZ A;  3BN6 A;  3LEI A;  2B7Y A;  2VZQ A;  5T5P A;  1CX4 A;  4DZG A;  2Y6J A;  4Q1P A;  1RMU 1;  1Q56 A;  5CG8 A;  1AYN 3;  1B35 A;  2XBO 3;  3EMR A;  2DYC A;  4JKK A;  3ZXD A;  4FOQ A;  5B4N A;  4QX7 A;  3ETQ A;  1XNA A;  1Y7B A;  4NPR A;  5L7O A;  2WAB A;  5FMB A;  4D0Q A;  4ONU A;  2DVB A;  3P1I A;  1XNK A;  4YGB A;  4C1X A;  2JEN A;  3TBD A;  1PK6 A;  2WJS A;  3AMP A;  3DGT A;  2WZ8 A;  3M3C A;  3PME A;  3WNN A;  1EV1 1;  4AHZ A;  1GR3 A;  2QTW B;  2PAE A;  5SV5 A;  3OBA A;  5DAP A;  4XUR A;  3FL7 A;  2VC9 A;  3I2F A;  4OHV A;  1V9U 2;  3U07 A;  4CPB D;  5JXG A;  1RC6 A;  1X9T A;  2WO3 A;  1DGW A;  4AFB A;  4CUB A;  2XJQ A;  4OZX A;  3KT4 A;  1HX6 A;  4LIU A;  5CIS A;  3ZKU A;  3PUS A;  3QD6 A;  3JQW A;  4OUL A;  3R4D B;  1EP0 A;  4QWN A;  4YW6 A;  1VBC 1;  4Q1R A;  3NV3 A;  2N7G A;  4BU2 A;  5A33 B;  1HB1 A;  1RVF 1;  2JEC A;  4Q4X 1;  5ACA 1;  4GB3 2;  4Q0Q A;  4IE7 A;  2PLV 2;  4BCU A;  4K20 A;  2PTM A;  1VMF A;  3MW4 A;  3KV6 A;  5GKA C;  3PMS A;  3UKT A;  3PJY A;  4YM3 A;  3RZK A;  2FDI A;  1UNB A;  2VOT A;  4BQ2 A;  1FNZ A;  2YG0 A;  1S0B A;  3VBR A;  1QJY 1;  2BGP A;  2QE3 A;  2XLA A;  4UFH A;  4LBN A;  3VBH B;  1NY7 2;  1WCK A;  1D4M 2;  1ENX A;  1GYK A;  1WMD A;  4M00 A;  4XC9 A;  2UWA A;  3U37 A;  4QKB A;  3VD3 A;  3H0O A;  3CDZ B;  3BTA A;  1VBE 2;  3NJV A;  3WF4 A;  1OSG A;  3VZL A;  1LGB A;  2RV9 A;  4CP9 A;  2R04 2;  4IEQ A;  4JRL A;  3KQ4 B;  4NIA A;  2JDN A;  2VBB A;  5IK7 A;  4DFS A;  4BOW A;  4Z1V A;  1JYW A;  4M3C A;  5DAV A;  1W28 A;  5CKN A;  1SAC A;  1B35 B;  1ULC A;  4QPI C;  1DZR A;  4HN1 A;  5FP3 A;  1GUI A;  5FYY A;  5FZ4 A;  5GJ6 A;  4Q5O A;  1HW5 A;  3HPN A;  2J7M A;  1Z78 A;  4DY5 A;  2X29 A;  1ZRC A;  3LF7 A;  4GKX A;  1PK6 B;  4N7I A;  5DUU A;  2D6L X;  1SDW A;  3M3Q A;  1OD5 A;  1AR8 2;  2VVF A;  2R06 3;  3WDV A;  1XNB A;  4DOU A;  1ZRE A;  4OI4 A;  1NKG A;  5AC9 1;  2YC4 A;  4PIY A;  4IUG A;  4QHB A;  1XYO A;  5I0S A;  2E51 A;  3ETP A;  4N43 B;  1BVP 1;  3K4A A;  4FP2 A;  2ENR A;  2VOW A;  1R08 2;  1LHU A;  1AR6 3;  3MDP A;  2VXR A;  3E6B A;  2YRO A;  5IT6 A;  5JXI A;  4BYY A;  4D3W A;  4FAG A;  3GF6 A;  4LUK A;  3RZZ A;  3U4S A;  4NII A;  2ZBJ A;  3VBR B;  3BKZ A;  3OBZ A;  1GP6 A;  3VKO A;  3DKQ A;  5T3N A;  5FUP A;  2JD4 A;  5FKB A;  2Y38 A;  3PVB B;  5F2W A;  4IET A;  4IE5 A;  2QQV A;  3LA3 A;  3MUY 1;  2Q30 A;  3GZA A;  3A0K A;  3H3U A;  4CP9 B;  3BTZ A;  3WW3 A;  2NQY A;  1SCS A;  4O9G A;  4NIG A;  1X33 A;  2IFR A;  2WS9 3;  2R49 A;  3W21 A;  1CX1 A;  5FR3 A;  4JAA A;  4BQ4 A;  1N1T A;  4AFA A;  3LA7 A;  3VD4 A;  4M3C B;  3AFG A;  3MV1 1;  4JDN A;  1MS5 A;  2CU5 A;  5CAD A;  3JBG 1;  2P3K A;  2ORZ A;  2PHF A;  3KGL A;  3P3N A;  1ENR A;  2RR1 3;  4NID A;  3KM5 A;  2PEL A;  1RUJ 2;  5FJK A;  2JJ6 A;  3OD0 A;  3AL6 A;  1D2S A;  3Q8B A;  3PVE A;  3LSE A;  3EO6 A;  2YY1 A;  1G9D A;  3H50 A;  3ZIW A;  1OQE A;  1AR9 1;  4A7Z A;  1QU0 A;  4EN7 B;  4J1W A;  1US2 A;  2A6V A;  5FZ6 A;  2H6B A;  4D7T A;  5KXB A;  1UMH A;  5FWJ A;  4NE9 A;  1ASJ 1;  4HBN A;  4ISR A;  3ZFF A;  4FTE A;  3O14 A;  2XKP A;  1OUS A;  3CO2 A;  4GMP 3;  1A8D A;  4RHV 1;  5FIX A;  4YM1 A;  2R16 A;  2FQP A;  3K3O A;  4XTM A;  3GBF A;  3SCF A;  4XFC A;  1DDL A;  2A3Y A;  3VZM A;  2XON A;  1AX2 A;  1C1L A;  3IB3 A;  1V00 A;  5F3C A;  1SLL A;  2ZGS A;  2DUP A;  4GJZ A;  4MGT A;  2BP6 A;  2PHT A;  3CL1 A;  4YVW C;  2WZE A;  4IER A;  2IXJ A;  5FLJ A;  3OTF A;  1UZY A;  1QOT A;  1OOP B;  2D98 A;  2PAM A;  3BU0 A;  1NUK A;  2UYB A;  1H8V A;  1PIV 3;  1UXZ A;  5HCB A;  1C5I A;  1QWR A;  2YBP A;  5CFD B;  4QX2 A;  2WZR 1;  5HCH A;  1W6O A;  5K4L A;  1XJA A;  4FXG B;  1AUY A;  1UKG A;  2PFW A;  1NAE A;  4XET A;  3RYP A;  1QQP 1;  4JDM A;  5FMO S;  4EE2 A;  1POV 3;  1RUD 2;  3OF1 A;  5FYV A;  1WBL A;  3O1R A;  2HWE 3;  2OT7 A;  2ZEW A;  2A6Y A;  5JXH A;  2Y0O A;  1LOF A;  4JC1 A;  1GZW A;  4JZR A;  1B09 A;  1VBC 2;  4OMD A;  1VR3 A;  1WCU A;  4IE4 A;  4LA2 A;  4A45 A;  4QD2 A;  4PDW C;  2RJ2 A;  4IV3 A;  1QNW A;  4FPF A;  1DIW A;  1JOD A;  3ACI A;  4L2N A;  1X8E A;  3WZ1 A;  5LK7 B;  1Y3T A;  3N7J A;  1W2N A;  2HWD 3;  5FO7 B;  3WNP A;  1EUU A;  3LFM A;  4GWI A;  1FV3 A;  2VZO A;  4S2G A;  1MZ5 A;  2BWA A;  1AVB A;  4CCC A;  1SPP A;  2L9L A;  2WFF 2;  2ZMK A;  5JIA A;  5E89 A;  3RPQ A;  5IK4 A;  1S55 A;  3MO4 A;  4XJ9 A;  2VZ1 A;  2DBI A;  5A7S A;  4DY3 A;  4KU7 A;  1GP4 A;  4XTP A;  3T2T A;  4H7M A;  2WUH A;  5A1L A;  2X53 S;  1KRI A;  2E7T A;  4PI0 A;  5FZB A;  5A3P A;  5EWS A;  4JKL A;  2EXH A;  3IIA A;  5F5I A;  5IAT A;  2LUW A;  4PIZ A;  2EXK A;  4LHL A;  3MGU A;  4QM9 A;  1QKQ A;  5JAX A;  1VLN A;  2RVA A;  2W68 A;  4PIX A;  3PLQ A;  3WHT A;  1SBD A;  4YFW A;  4E2S A;  1JHN A;  4B1M A;  2SBA A;  1F4H A;  4QHZ A;  3C7F A;  4E2Q A;  5EYX A;  4MXW A;  3C3V A;  3M1H A;  4LUL A;  2PHX A;  3A22 A;  1UOB A;  3DXT A;  4WM7 C;  1COV 3;  1O5U A;  4AK3 A;  5C3S A;  3T0D A;  1OH3 A;  1ZM1 A;  5J48 A;  4R4X A;  4K1Y A;  1HXS 3;  1Y9G A;  3H1Y A;  3LEM A;  3IBM A;  3R05 A;  3H1W A;  4LK6 A;  2DVD A;  5A3W A;  3RRD A;  2VQU A;  4FP3 A;  2V5D A;  1XE8 A;  3C7G A;  3GXU A;  1QIQ A;  1GZW B;  5T50 A;  4P08 A;  1MZF A;  2PHW A;  2GC3 A;  4XAB A;  1VAV A;  4A41 A;  4IV3 B;  1O59 A;  1YI9 A;  2XKO A;  3HOB A;  4EJR A;  4EZ4 A;  4LO5 B;  2W47 A;  4YGE A;  2NZ9 A;  2D3P A;  4GWJ A;  1VBB 1;  5FXX A;  2GSY A;  3LOI A;  1DP0 A;  3JB8 A;  5K9Y A;  3TEX A;  3T4V A;  3B5L B;  1H8T C;  1JU3 A;  1WGP A;  1FOD 1;  4W4Z A;  3ACH A;  4E27 A;  2MEV 1;  3GCX A;  4UW3 A;  5C33 A;  2QFE A;  1PO1 2;  1RUN A;  1IZ3 A;  1SPP B;  1TMF 1;  2DUQ A;  2HEY F;  4YZ2 A;  4AXO A;  1XNC A;  4MSV A;  1JOB A;  5FK7 A;  1UZ0 A;  3KV9 A;  3CJX A;  3MLL A;  5FFO C;  1GBG A;  3I8T A;  1QH6 A;  5FMC A;  4NJ4 A;  5LZ6 A;  1HRV 1;  1CAX A;  3ECQ A;  2RDR A;  2C5D A;  1GZT A;  1SLA A;  4HVQ A;  3R4U A;  2TBV A;  5FDB A;  2WC2 A;  2YPD A;  3KD4 A;  3VLB B;  4BK5 A;  1AR7 2;  4YW3 A;  3LCP A;  3N36 A;  3GDB A;  4FOV A;  4AED C;  1YJK A;  2YZ4 A;  4YPJ A;  1ZBA 3;  2W9X A;  1REE A;  2CGN A;  1UD1 A;  2VO5 A;  5K0U A;  4QQL A;  3UNP A;  3NV1 A;  1U0A A;  3ZSJ A;  2WLP A;  1HN1 A;  3MBW A;  1OLR A;  4LXL A;  3GHM A;  3HAG A;  4MXW B;  3ZPY A;  3I54 A;  4FPL A;  3BOD A;  1DQ6 A;  4WM8 A;  4DUW A;  2RM2 3;  2G9F A;  5IVB A;  3K3N A;  3THD A;  4OI1 A;  3AC0 A;  2F17 A;  1PX4 A;  3P5B A;  2ZJC A;  4FPY A;  2ZML A;  5DAW A;  4XIK A;  1W9Y A;  4UXA A;  3C7E A;  3H3L A;  2P34 A;  5GM0 A;  2XWJ B;  1AYN 2;  5I93 A;  2XBO 2;  3VDD A;  3WXP A;  1XYP A;  3HNB M;  4FT8 A;  5FPL A;  4AI1 A;  2X05 A;  4MX3 A;  1W2T A;  1BBT 1;  5JLV A;  2IFW A;  3R0R A;  1Z7S 1;  3K48 A;  3PTY A;  3O1U A;  5IAX A;  1ULP A;  4AWD A;  5JXJ A;  3H7Y A;  2E53 A;  1NE6 A;  1TEI A;  1TG7 A;  2PHR A;  1BEV 3;  1JI6 A;  3D0J A;  2XJS A;  3MIF A;  4QQH A;  4ZPI A;  3RJ2 X;  3NKT A;  3HQX A;  3Q8E A;  1N47 A;  2ZGP A;  1GKB A;  3N7K A;  3C2U A;  3M2M A;  3S6P A;  5C8C A;  2VZS A;  3AKS A;  2VUJ A;  1ZZB A;  2VNO A;  4P5H A;  4EN0 A;  4ES9 A;  5C3Q A;  2Y33 A;  4NHY A;  1UY1 A;  2F4P A;  4JHT A;  2R04 3;  4HPK A;  2P1B A;  4YW4 A;  5BNP A;  1BXH A;  2GME A;  2Z42 A;  3GJB A;  2BVV A;  5E16 A;  4C91 A;  4QPI B;  3OPT A;  4BQ1 A;  4LKE A;  1CAX B;  3POJ A;  5D2A A;  3U4X A;  1OI6 A;  2VXJ A;  3IDB B;  1BZW A;  1OLM A;  1RUG 1;  1HQN A;  1ZVF A;  2DWR A;  2EAA A;  2Z79 A;  4IV1 A;  4JRA A;  4Q4W 1;  5FBZ A;  4C90 A;  1RB8 G;  2R7E B;  4IGP A;  1W90 A;  2ZGM A;  1DYO A;  5FP9 A;  1WZX A;  1YRZ A;  2ZGQ A;  5FPU A;  1RXG A;  5K0U B;  1YO8 A;  3O1T A;  3WVJ A;  1UIK A;  1CZT A;  4CCL A;  1RGS A;  2IXH A;  1WCS A;  1NA1 A;  4XFG A;  2JE9 A;  3TN9 3;  2BER A;  5JOZ A;  5A32 A;  3S7I A;  1P8J A;  1D4V B;  2ILM A;  2NPI A;  4GD4 A;  4WM8 B;  1H6Y A;  2HWC 1;  4XIO A;  4ASL A;  3CQO A;  1WA4 A;  2A1X A;  4L99 A;  2LAL A;  2UU8 A;  4CCO A;  3WW2 A;  4OUE A;  4DXS A;  1XU2 A;  4JGY A;  1W8U A;  3WW4 A;  2R30 A;  2VW0 A;  3VDD B;  1YQC A;  4KBB A;  1B35 C;  3J7H A;  2VBD A;  2CGO A;  4Q4Y 1;  5LK5 A;  2B45 X;  4YVW A;  4BIO A;  2Q8D A;  2ZGL A;  3WDW A;  5L7O C;  4LBL A;  2D97 A;  2VPV A;  3AMN A;  3B02 A;  3T1L A;  5KHG A;  4ARX A;  1A6C A;  2UUR A;  5FY9 A;  4P9L A;  1FMD 1;  3D8C A;  2OUJ A;  1O3R A;  1HN0 A;  1NCR A;  1V6J A;  2R06 2;  1FV2 A;  4K7J A;  3ZX7 A;  4MG2 A;  1PMI A;  3J4U H;  2R1B A;  1QHD A;  4HN0 A;  4ET7 A;  4OI0 A;  1MS3 A;  2Z5W A;  3POB A;  2OKX A;  4HPK B;  1TME 3;  5BNP B;  3RZM A;  1IG0 A;  1US3 A;  4L11 A;  1OQ1 A;  3VD5 A;  5IVC A;  1AR6 2;  4FSJ A;  5JPN B;  2PQS A;  2VOX A;  4XJ8 A;  1UX7 A;  1L7R A;  4CCE A;  2YC2 A;  4PDW A;  1GQG A;  4X6R B;  4IV1 B;  4XDQ A;  1YFX A;  2VZ3 A;  1WLT A;  4N9I A;  5I8S A;  5A7Q A;  3UV9 A;  3HQU A;  3VZJ A;  1GIC A;  3MFC A;  5A1F A;  1T6G C;  2XB6 C;  3I3D A;  3GHN A;  1WD3 A;  4XFA A;  2GN3 A;  5IHR A;  5LCW L;  3VBR C;  2GAL A;  3M3O A;  3B9I A;  4WZC A;  3A4U A;  4BQX A;  5A32 B;  2C24 A;  1GOH A;  2OZJ A;  2FDG A;  1OVP A;  2JDM A;  2W87 A;  3MHZ A;  5C7G A;  5FY0 A;  2WS9 2;  1SLB A;  4RL7 A;  4CRQ A;  1EY2 A;  4GAZ A;  2CTV A;  3AZZ A;  3OBT A;  2ZZJ A;  4JGY B;  3QBQ A;  2Y6G A;  1QNY A;  2Q8E A;  4FAH A;  1MAC A;  5F1R A;  3BYW A;  5CFC A;  3THP A;  4M4P A;  1YIP A;  1RMU 3;  1JZ6 A;  5FP7 A;  3ACL A;  3OCP A;  2RR1 2;  1N3O A;  2DV9 A;  4XUT A;  4CTE A;  2HWB 1;  2VJX A;  4YVW B;  3S57 A;  2WN3 A;  4I0W B;  3IAQ A;  1S0I A;  5CYY A;  5A6Y A;  2UY9 A;  2VGD A;  3N9L A;  5C6C A;  4Q29 A;  1D2Q A;  4ZON A;  1FPN 1;  1LOG A;  4P9I A;  1EV1 3;  1NCR B;  4HSL A;  3CBN A;  4MGI E;  4CCN A;  1MQT A;  4MV2 A;  4OHW A;  3IDE A;  1MS1 A;  2WQ4 A;  2CHH A;  4KWK A;  3OGR A;  2AYH A;  3RGB A;  4E8D A;  4FFI A;  1YWK A;  2IVI B;  1H30 A;  4JQR A;  4LBO A;  4KU8 A;  5H9Q A;  5J37 A;  1F5J A;  2VCB A;  1RUD 3;  2W1S A;  2V4V A;  2ZKL A;  3WDT A;  3LFI A;  4ZHN A;  4WVW A;  1R64 A;  1HDK A;  4BZ4 A;  5J7M A;  1RYY A;  2JIG A;  3BCW A;  4UW4 A;  4PDW B;  5FPA A;  1VBC 3;  2D3R A;  1OHF A;  1RVF 3;  1Z7S 2;  4Q4X 3;  2W91 A;  4U36 A;  5DAB A;  4XJW A;  1IKP A;  2BTV C;  4YLZ A;  4YW7 A;  5FTT C;  3BOW A;  3WNL A;  4GAL A;  1AF9 A;  4RA0 A;  3K51 A;  4R9C A;  1J3Q A;  1ZRR A;  3USS A;  2VQ0 A;  3T08 A;  1PIV 2;  4GMP 0;  5FUI A;  3I2K A;  1QJY 3;  2JEM A;  2UY8 A;  4YWA A;  5ERL A;  3VB9 A;  1X8M A;  5KHI A;  2G9Z A;  5FZH A;  4CDX A;  1CR7 A;  4PCR A;  2GN7 A;  2J1U A;  1V6L A;  1DBN A;  3KHB A;  1G6N A;  4KQ7 A;  3NJX A;  1OXC A;  5T5L A;  3ZSE A;  3ASI A;  4PJY A;  3WUD A;  2ZX4 A;  5FZ7 A;  4CCM A;  5FZ3 A;  1NT0 A;  4Y26 A;  4OHZ A;  3V65 A;  1O5L A;  3NJZ A;  4LLF A;  5JDB A;  2HWE 2;  3ES1 A;  3KSC A;  3K4D A;  2DCK A;  1AXK A;  5FLH A;  5CFC B;  1Q5O A;  3H1M A;  4GIQ A;  4OZO A;  5JR2 A;  4BLI A;  3EHK A;  4OCT A;  1O91 A;  3AKP A;  1OFN A;  3KMH A;  1HV0 A;  3SLI A;  2RHP A;  3QAC A;  2JDP A;  4IEW A;  4LBQ A;  2VCM A;  1ZZ6 A;  5FZ9 A;  1ZA4 A;  1N3Q A;  4H3W A;  2XL7 A;  1H1I A;  1J3R A;  1L3J A;  5FZL A;  3VZK A;  3N4M A;  2DDU A;  3FJS A;  4LA3 A;  5LA1 A;  4A3Z A;  3DKW A;  1H2K A;  1POV 0;  1GMM A;  1LU1 A;  1MQT B;  1E57 A;  2AZ5 A;  4HMZ A;  1NOV A;  2X8K A;  3GBW A;  4QX0 A;  4WM7 B;  3RMY A;  3VKM A;  1CQ9 A;  1WMF A;  3E1F 1;  2RS1 1;  4BB3 A;  5AC9 3;  2WQ8 A;  2DCY A;  3H8U A;  3OB8 A;  4OQ9 A;  5FY4 A; 
#chains in the Genus database with same CATH homology
 1W05 A;  2BJS A;  1E5R A;  1W9Y A;  2WO7 A;  2Y6F A;  1ODN A;  1E5S A;  1W2N A;  1W3X A;  1UZW A;  3ON7 A;  3OOX A;  1QJE A;  1E5I A;  1W2A X;  3ZKY A;  2DBI A;  1GP4 A;  2JB4 A;  1OC1 A;  1HB3 A;  1GP6 A;  1QJF A;  1HB4 A;  5C3Q A;  1WA6 X;  5C3R A;  1W06 A;  4RGK A;  5C3P A;  1W03 A;  2VBP A;  1HB2 A;  4XAE A;  2JB8 A;  2IVI B;  5APA A;  1UOG A;  1RXF A;  1UOB A;  3ZOI A;  5C3S A;  1RXG A;  2DBN A;  1E5H A;  1QIQ A;  2Y60 A;  2BU9 A;  1W3V A;  3ZKU A;  1UOF A;  5C3O A;  1ODM A;  2IVJ A;  2VAU A;  1HJF A;  1HB1 A;  2VBD A;  1W2O A;  1UNB A;  1OBN A;  2VE1 A;  2BRT A;  1BLZ A;  1HJG A;  1UO9 A;  2VBB A;  2VCM A;  1IPS A;  1W28 A;  1W04 A;  1GP5 A;  1DCS A;  2CSG A;  1BK0 A;  4BB3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...