5C3RA

Crystal structure of the full-length neurospora crassa t7h in complex with alpha-kg and 5-hydroxymethyluracil (5hmu)
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
333
structure length
333
Chain Sequence
MEKAAVNEDGLVIPLIDFSKFLEGDETLKLETAKAILHGFQTAGFIYLKNIPIQPDFREHVFNTSAKFFKLPKEKKLEVGWTTPEANRGYSAPGREKVTQLTDPAEIEKIRSAAPDIKESYEIGREDEPGHPNPWPAEQDDLVGFKSTMNNFFDQCKALHIEVMRAIAVGMGIDANYFDSFVDVGDNILRLLHYPAVKSEVFKINPGQVRAGEHTDYGSITLLFQDSRGGLQVKSPNGQFIDATPIENTVVVNAGDLLARWSNDTIKSTVHRVVEPPKQEDVHPPRYSIAYFCNPNHKSYIEAIPGTYAAESERKYEGINSGKYLVQRLAATY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymine dioxygenase
publication title Molecular basis for the substrate specificity and catalytic mechanism of thymine-7-hydroxylase in fungi
pubmed doi rcsb
source organism Neurospora crassa
molecule tags Oxidoreductase
total genus 98
structure length 333
sequence length 333
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03171 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily
A PF14226 DIOX_N non-haem dioxygenase in morphine synthesis N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.330 Mainly Beta Sandwich Jelly Rolls B-lactam Antibiotic, Isopenicillin N Synthase; Chain 5c3rA00
1ODNA 1W2OA 5C3SA 1QJFA 1GP5A 2CSGA 2VBDA 1GP4A 1W2NA 1UOFA 1BK0A 2BU9A 1OC1A 4BB3A 1RXGA 2JB4A 3ON7A 1GP6A 1W9YA 1UOGA 2BRTA 2BJSA 1W06A 1QIQA 5C3OA 1OBNA 1ODMA 3ZKUA 1W05A 1E5SA 5APAA 1UZWA 3ZOIA 1HB1A 2VE1A 1W3XA 1E5HA 1WA6X 1W3VA 4RGKA 2DBNA 1IPSA 5C3QA 2VCMA 2DBIA 1QJEA 1BLZA 1E5RA 2VBBA 2IVJA 2Y6FA 1W2AX 5C3PA 1UNBA 2Y60A 2VAUA 5C3RA 3ZKYA 1HB3A 1UOBA 1W03A 1HB2A 1UO9A 1RXFA 2WO7A 3OOXA 1HJGA 2JB8A 1W04A 2IVIB 1HB4A 4XAEA 1DCSA 2VBPA 1HJFA 1W28A 1E5IA
chains in the Genus database with same CATH superfamily
4YGBA 1UF2C 3PJYA 4URAA 5A3NA 4YFZA 1WLWA 3KVBA 4Z07A 3ZR6A 4YW2A 3WP5A 3TEYA 4YM0A 5IK4A 4FQ4A 4XFAA 2XJTA 5A3OA 4H7LA 1ASJ1 2E33A 1AYM1 5GLVA 2VZ1A 1UQXA 1PVC2 4QMAA 4CP2A 1CIYA 4Q0VA 1TNRA 3LPGA 2G1MA 2D6MA 2W08A 1EV12 3ENRA 4OHYA 2W0XA 1W9FA 1GOFA 4AI1A 3D82A 3Q9OA 3UJQA 5ACA3 2D6LX 1RUH3 1S2EA 2HEYF 5IVEA 1H2MA 1RUJ3 3AKQA 3MHZA 4XOGA 1JH5A 2BRTA 2FDKA 2RR13 2P6CA 4CUBA 2BDRA 1KJRA 1ZBE3 2KD7A 4LPLA 1AYN2 5FZOA 3WCRA 1PO23 2P17A 4N7IA 1WCKA 3VZMA 3B01A 3FZ3A 3T1LA 2P5BA 2VTXA 3MIGA 1NA1C 3R0RA 3MICA 3WNNA 2RE9A 4CEWB 1JU4A 2WZR1 5IVBA 3UKVA 3LOBA 4LO7A 5CA6A 2UURA 1E5SA 4EWDA 1Q8PA 2ZHNA 1UZWA 2X53S 2XONA 3AXDA 4ORFA 4Y33A 3SHRA 5A7QA 1X7NA 3WP4A 3FJSA 3MLLA 1D2QA 1XU1A 4QX3A 2AUYA 2FCVA 1H8TB 3T1MA 5DZEA 1GLHA 3I97A 3SKJE 1Y9QA 4NUBA 2V4AA 4XZUG 5FY8A 1X8MA 1UXZA 1CAUA 3JB4C 1RUNA 4CCEA 5A6QA 2VC9A 4JGYC 3NO8A 4WVMB 3NNFA 1HKDA 4MGQA 2VMCA 3N3HA 2E31A 4FPEA 4BIFA 1OFSA 4EN8B 1NQDA 1ENSA 1CN1A 5C33A 1W8UA 3RNSA 3BPZA 5C8WA 4GMP3 4QQOA 2FDHA 4KG8A 1RITA 1CPMA 1VBE3 2GALA 3NSTA 4JZRA 2OQ7A 2JG8B 3C7FA 3C8XA 4O65A 2K9ZA 2QQNA 2CGOA 1OVSA 5FCCA 3CBNA 2RS11 1AJKA 1PMHX 3N7MA 3NNGA 1AR93 3ACLA 1NE6A 4CCJA 5HXMA 3VDAA 2J1SA 1HV1A 2W68A 5FZ7A 2PMWB 1FOD3 5FYTA 5A1LA 3U0ZA 1ZRFA 4K20A 2JDYA 1W03A 5CFCA 1V6OA 1CAWA 1WCSA 5LY2A 2KA3A 1ZRCA 2FDGA 3I2OA 1V9U3 5K8SA 4ZZ5A 2C4XA 3RDIA 2D6OX 2GMEA 3OTFA 4GH4C 1LNSA 1NCRA 2UU8A 3AYCA 2VQ0A 1JS9A 2B5HA 1OSGA 4K6BA 3CZJA 2GC2A 1LKNA 4K1YA 3OY8A 1XC6A 4LKEA 1WWYA 4ISRA 4Q29A 4KH9A 1PIV1 1C4RA 4EE2A 1WLDA 2WFF1 2MEV3 2ZZJA 2IZWA 3RVHA 5EHDA 4YWAA 5F37A 4CXWA 2BW8A 3AB0A 1GZWA 4QPYA 3CJIB 1C8M2 1UY0A 2OW4A 4HKWA 1LESA 3IM0A 1CD3G 2E26A 4GD4A 5I8SA 3R4UA 2WR9A 3VBRA 1UOFA 2WA3A 1W8FA 3BTXA 1C5HA 3EQEA 3V65A 3BTZA 1PGL1 2JG9B 4RS5B 1A34A 1I5PA 3POJA 2XBO3 3OG2A 4UBGA 1RXGA 3T0BA 4HVQA 2PHTA 4LLFA 1PGW1 2JE9A 5F5CA 4WM7C 4IEYA 4QHBA 5ACA2 2Y0OA 1IKQA 1RUH2 5B4XA 2PFWA 1RUJ2 5DAQA 2FZ1A 1D4M1 1W2TA 3QBQA 1M4WA 1WW5A 1XU2A 2D40A 3J7LA 3MIEA 2VZPA 1ZBE2 5CEHA 2C1FA 2W39A 4XCBA 1PO22 4XUNA 3VBHC 2VZRA 2O1QA 2ZGUA 5FMOS 4PIZA 5K0UC 3WF2A 2EXIA 5FP9A 1TME1 4MO3M 3ZKUA 3QLQA 4IV3A 4MHRA 2WBKA 5ABJC 1PMIA 1B09A 2SLIA 2YROA 3ZMNA 4ONUA 4AHXA 1GR3A 1VMJA 4K8FA 2WZ8A 5FWEA 5A3WA 1LHOA 3WHTA 1GWKA 3P3NA 4C1XA 5CB7A 4GJZA 3VBOC 2UWBA 3BIWE 3ZVXA 4MGTA 2EAKA 4NHLA 1CIWA 5DG2A 4NIIA 3ZM8A 1DZRA 3E97A 4MLOA 5BNOC 1RUI1 1DYKA 1RJ8A 3APBA 4XBQA 1VE0A 5FYBA 1FPN1 4JC1A 2VMFA 4UFLA 1O3SA 5EXOA 3T4HB 4CRQA 1RB8G 4PLMA 4LO4B 3PIGA 4RGKA 4RR3A 1NA1B 4BLIA 3IDCB 3W21A 4AFAA 4AVBA 1OLME 4D7YA 1G9DA 4M4RA 2Q8CA 2A70A 5KHGA 2XXZA 4D3WA 1XRUA 5JR7B 1W9SA 1JZ4A 1UU6A 3N4MA 2JDPA 1V6KA 2JKXA 3A0KA 1BZWA 3GJAA 1YFWA 1YI9A 3I3EA 3VDDC 1JYWA 4NIDA 2JXAA 3WG1A 1WBLA 1BJQA 1ZBA1 3A0NA 1VBE2 3OUHA 5HCAA 4MHUA 3TB0A 1TMF3 1DQ1A 3B00A 3H1MA 2OYZA 1DIWA 3KV5A 2F17A 3H1YA 1LOFC 1J1TA 2YFUA 4AE2A 5F5QA 1FV2A 1SFPA 2ZACA 4LJHA 3V64A 5GLZA 1AR92 4JGYB 4A7ZA 4CDXC 2B9UA 3CNAA 4FPKA 1SPPA 1FOD2 4M3CF 1OF3A 3VZJA 1HB3A 1ENRA 2YC2A 2GC1A 2OA2A 3D0JA 2BNOA 5EYXA 3VB9A 3WW1A 4EYUA 1V9U2 2OX0A 4GALA 1FX5A 1YRZA 2Z79A 1CAVA 1HJGA 2WAOA 4W4ZA 1V6MA 2VNGA 3ES4A 3I59A 4LIVA 4BCUA 4QGLA 5FPVA 5FQ0A 3K51A 4XAEA 1LB2A 3MPPG 2QCSB 3MUY1 3AYEA 3HAGA 5D8AA 1BVP1 3HQXA 4YVSA 3RI8A 2FMDA 2ET7A 4QPIC 4JCKA 2IWGB 4XEZA 5SV8A 4YARA 3DXUA 1BKZA 3NRUA 1VR3A 5GLWA 5C9AC 4JTOA 4P9YA 3OGVA 4E4ZA 3FHIB 4FPJA 5BY5A 4FTBA 3AL6A 5FYSA 2P6HA 1HIXA 4IV1C 4XF9A 1VMHA 4CDQA 3RFRA 3A22A 3O12A 3JQXA 2ZHKA 1ZZCA 4Q8KA 4GH4B 4HN0A 4IDZA 3SQOA 3HQUA 2XDVA 4E4HA 2GNMA 1VRBA 1Z78A 2WINB 3SCFA 3VBUA 3MIFA 1I9RA 1OUXA 4HK9A 1SG3A 1GFF2 2BU9A 4YVWA 1XNBA 2ZX0A 4PLOA 4CDUA 1MEC3 3SCGA 5JPMB 1CESA 2XBO2 2VXJA 2BTVC 3KVAA 4WM8C 3LEIA 4K9SA 3I2HA 4QM8A 1AL21 1OQDA 1W0NA 3NKTA 1PVXA 1EY2A 1UOGA 3HBKA 1UY3A 4GB32 1QF3A 3ZMOA 4QM9A 2WT1A 1R083 1YWKA 2WSVA 4OUSA 5LZ6A 1YQ6A 1SBFA 1RL3A 2ARBA 4RD7A 4AAPA 3LA2A 4ATFA 4A2UA 1GBGA 2DUPA 1V70A 2NM1A 4JTNA 4YGEA 4YZ4A 4EWEA 1K5MA 4D6QA 4Z1VA 2A3XA 5C7GA 5IVYA 5LK7B 1J3QA 1OXCA 1AR71 4O61A 2DCKA 4H7MA 4JRAA 4UXAA 5A7WA 4AGGA 4AEKA 2DF7A 4PT6A 1AHSA 2WT0A 4F83A 2V5YA 4WM7B 5F2SA 3WZ1A 4BOWA 3H7JA 1H1AA 4E2QA 4NWWA 1S55A 1HRV1 1SACA 3H3ZA 2Q1ZB 5E89A 3H0OA 4A6SA 4BHPA 4CUGA 3URFA 1NQJA 2ZGNA 2FDIA 2XQRA 5L7OC 4ZHNA 2PTMA 1NLQA 4CP1A 1ND2C 3JU9A 1RMU3 5K0UB 3VHOA 5FXXA 4UF0A 2KR2A 2IXCA 3Q8FA 4GXLA 1GQHA 4TXWA 5ABJB 3VD3A 5I93A 1HLCA 4BISA 4Q5OA 2B8MA 3E6BA 5LBBA 1DYPA 5CFDA 4J1WA 4A44A 4AHYA 1Q8QA 3AZWA 3VBOB 3VL9A 5C3PA 4IEZA 2CAUA 5IFTA 1TMF2 5BNOB 3GHMA 4K21A 2RS31 2ZAAA 1M06G 1OVPA 2X29A 4COUA 1VBD1 2I07B 4IL7A 4RSUA 4OI1A 5FY4A 4KMQA 3OB8A 4N53C 4CCMA 4HG6B 2VJXA 4IERA 2W46A 1QJU1 3UK9A 2BP6A 3VDCA 1W9TA 3ZKYA 2ARCA 2VUJA 4K40A 4GWNA 4W50A 3PJQA 4B1MA 1W6PA 5T5JA 3T30A 2XH6A 3AVSA 3LDRA 4ES8A 4XPVA 5F7UA 3VDDB 1ZVFA 3IAPA 2R32A 3H8OA 4DUXA 1STMA 5FZ3A 1WCDJ 2XHKA 5D21A 3AMHA 1UZYA 3C3VA 1H30A 5T5OA 1VMFA 2J1RA 2P3YA 1BXHA 3AMQA 3GCXA 2AC1A 3SNMA 1VALA 4FP3A 3M3IA 1OQEA 2AH2A 5IK5A 4P9IA 4YG0A 1ZZBA 2B9VA 4JQTA 1QJFA 3VZKA 4AHZA 1S0IA 1KJLA 3WQ1A 1KS5A 2Y6LA 5J3UA 3ZX7A 1Z0HA 3ACHA 1ULFA 1O6UA 4Q4X3 5KHIA 4D6RA 1X9TA 2GP5A 4DO0A 1DDLA 1PMJX 3PUAA 1VBB1 4LEJA 5FREA 4UT5A 4CCDA 3R6SA 1MEC2 4QPIB 2JDUA 5T5PA 4DPNA 1QJZA 1W8HA 1UW8A 4SLIA 4QU2A 4XDPA 5C9AB 4Q4V2 4XETA 1V6LA 1W9YA 1OOPC 3ZR5A 3DPRB 1POV3 3O7OA 3VBSB 5FPAA 3VKLA 5G05L 4META 4IV1B 1R082 1R093 3B02A 4YW6A 3WG3A 1XPWA 2D6KA 5A7OA 2Y6HA 3E6CC 5LW9A 1F8VA 4FTEA 2DUQA 2DV9A 3AKTA 3B94A 3MLJA 2UY9A 3NVCA 3Q8AA 2F4LA 2VCAA 5FKCA 2QNKA 3BI3A 3BGAA 4ZXKA 4ISQA 4Y1VA 3TWIA 5BV6A 3LA7A 1OHFA 2W52A 1OLMA 4WM8B 3R05A 3ZOIA 4FBFA 5FZ8A 1VBC3 4Q4Y3 3RYRA 1I1EA 4Z82A 3OGRA 4CXYA 2LALA 4B4RA 5FY1A 2YY1A 4LUKA 4QPGA 4AF9A 3GZTB 3HEIA 3SC7X 4XFHA 5J48A 5A33B 2ZGRA 3QOPA 3CHXA 3MV01 4LLOA 4ZU5A 2NPIA 1RMU2 5ANNA 3WP3A 2LS6A 3H8RA 4RA0A 2ARAA 2BYVE 3JD71 3G6JB 3WOGA 3NAPC 5L9VA 3M2MA 2JDKA 3VZOA 1DGWX 1RUD1 1UZZA 4BQ1A 1T6BX 5F5IA 3W9AA 4QWNA 4R9BA 4A6OA 4LBQA 5IVFA 3T0DA 1JZ7A 5A7SA 5I91A 2DYCA 5DDJ1 1QH7A 3GNEA 3J8F1 1QNYA 5A1AA 2XKPA 4XMAA 5L7OB 2WS93 4NE9A 4HK8A 5C4WC 1CGPA 5C5TA 1ND2B 3GCWA 4YPJA 5F3CA 4S2GA 1VRH3 1BQPA 4TLFA 4XHXA 4BMBA 5BNNA 1U12A 1NKGA 4URTA 4RFT0 1IZ3A 1PNFA 5F3EA 3H8XA 4FTSA 4Y5Z0 4X8PA 1QJX1 3AMMA 3AP7A 1UD1A 5GZFA 2A5ZA 3AKSA 3BOWA 3ILNA 2X8KA 4EJRA 2HWF1 2VMGA 3ZYRA 3PL0A 2HEVF 5FO7B 4CCCA 3O5SA 3WNOA 4AI8A 5KHKA 2JB8A 4FOYA 5LRRA 2X5IA 5FUPA 5IVJA 1RHI2 3KV9A 1DCSA 4JDOA 2I2SA 1Q8VA 4N53B 4I0BA 5FZKA 2QE3A 3L2HA 1QQP3 1R1A2 3TNPB 4BIOA 4KQ7A 2VM9A 2WJSA 3QCWA 2X05A 1K3IA 4AVTA 1DQ5A 1QXRA 4NMIA 2A6WA 3DV8A 1DGLA 3CKHA 4LBQD 1TQ5A 1ULEA 1OQ1A 1W8TA 4TN7A 1QDCA 4UW3A 1QJY3 4XQDA 3OBTA 2JX9A 3TAYA 3KCYA 1YI7A 4GKYA 1W2NA 1EAH3 4AXOA 3B5LB 1EPWA 4Q4X2 5JSOA 3O0XA 2WFPA 3QD6A 1MS0A 2YV8A 1OA2A 3IIAA 4OHXA 3DF0A 4CDWC 1LOCA 3MW3A 2HYKA 3SISA 4DQAA 3GBWA 3FLPA 2V09A 1A3KA 3NW4A 2QQUA 3I2DA 1UIKA 3T0AA 1ASJ3 1AYM3 4Y1YA 5FYHA 4LQRA 1DZQA 1FMD2 3FLRA 4TYSA 2BBVA 2TUNA 1DGWA 1XSRA 3AP4A 3M4FA 4FPGA 2MPFA 2IXHA 1YNAA 3NMBA 5C3OA 5JOWA 2PHFA 3THPA 3ROUA 2W2IA 2GNTA 1C1LA 3H7YA 3HNBM 3WG4A 1UCXA 3GYDA 4YFWA 2R1BA 2EICA 4AG4A 3Q8CA 1OLRA 1V0AA 3E1F1 3GDBA 5FYZA 5JXHA 1XNKA 3N9QA 2OS2A 2E63A 4P08A 3ZO0B 4FFIA 5FJHA 5DN2A 1O4ZA 1OI6A 3VD7A 4EN0A 1YJKA 3CF6E 1UMIA 3W20A 3PURA 1VBC2 1NZCA 1HB1A 1RUC3 4Q4Y2 1OOPB 4CCKA 5AFEA 3BUCA 5JSPA 1S0CA 3P6BA 1O3QA 3D3AA 3PUQA 4PDWA 2WZR3 2CV6A 5FYMA 1EUTA 3BKZA 1YHFA 3LZZA 1LGNA 2BQPA 4NRQA 1W0PA 3K4ZA 1W3VA 4I0WB 4QDQA 4M3CB 4Q2FA 2BGCA 4M4PA 3LCPA 1FATA 5LEJA 5LWBA 2QJVA 5FZ1A 3VN4A 3CEWA 5FP7A 1VBA1 3EMRA 1ENXA 3ZFEC 3GZAA 4QHZA 3THDA 3MF9A 2RDSA 3S0MA 4MVTA 1NT0A 2J1VA 4FXGB 2X10A 3OBZA 5BYNA 1COV1 1W8WA 1WUVA 3N36A 4BQ2A 2JICA 2FCUA 2WS92 3GBGA 3MFCA 4JV4A 4NRPA 3I2GA 1KGYA 2R061 4NPMA 3POSA 1NY72 1VRH2 4DXRA 3WDVA 1YLLA 1ZNPA 2O14A 2HWC1 2HJIA 4HVOA 5E6HA 5LA1A 3AP5A 4LE4A 1SLAA 3NAPB 4IQPA 5B4NA 1JU3A 3FE5A 3ZIWA 3W5NA 4QKBA 3VD9A 3WNMA 2VW0A 3I8TA 5FZIA 2CHHA 1UO9A 5FBZA 1DQ2A 4LBMA 3VKNA 3OGGA 3OOXA 2VCBA 4CEYA 1XE8A 2JD4A 5A32A 5LA2A 5KHHA 3DGTA 4Y26A 2IVIB 4AQTA 3TN91 5C4WB 1LECA 4YSFA 4NRMA 1MACA 1QOOA 4NR1A 3HVDA 4Q4W1 1AZDA 3QACA 2QKDA 2VBPA 1HJFA 1QQP2 2HBTA 3SH3A 1SQ4A 1CX1A 2QTWB 1PM7A 5C8CA 3LIHA 3FBMA 3UGFA 4DMIA 4KWJA 1DLCA 1HXS1 1SDWA 3KHBA 2CWSA 1W6NB 1ZZ8A 4J1XA 1PIV3 1UMZA 3LOIA 2WFF3 1UXXX 2LUWA 3O14A 4L8QA 1TNFA 1CZVA 5CAZA 1EAH2 4DXSA 3HN3A 2RS51 3P5BA 3FBYA 5IFPA 4LHNA 5DMYA 1OC1A 1IG0A 4CCOA 2BFUS 1JHNA 2BWAA 2JB4A 2HWD1 2P3KA 4GZ9A 2RM23 4R8HA 1I5ZA 4B7EA 2OKXA 3RSJA 3ZN6B 3POFA 4IEPA 4DRRA 4I09A 3FHQA 4OQ9A 2IXIA 1ASJ2 1AYM2 2CU5A 5AVAA 1RVF2 3K77A 2F6BA 3J26N 4CEWA 4D69A 2R7EB 3O1PA 5EPAA 3BVCA 3MZHA 5IVCA 1NE4A 1W6MB 4FVVA 2CWMA 4H14A 2J22A 4BH9A 4LUMA 5FOJB 2OPWA 4ZU7A 5F39A 5JSRA 3LQCA 2QQJA 1H8TA 1O8SA 2Y8KA 4MSVA 5LASA 1GU3A 4CDWB 1JYIA 4XJAA 2ES3A 2CDOA 2D97A 4LE3A 3VBFA 2BBAA 1J59A 1Q43A 2ZEZA 3KV4A 1H0BA 1SLBA 2Y0IA 2ZKLA 4FPHA 1TME3 1URXA 2ZGQA 1RUC2 4I3GA 1CJDA 2DCJA 4WVMA 4YRDA 3S6PA 5CFCC 4XIKA 4NJ4A 2WZR2 1AX0A 3OPTA 3C7EA 4J6GA 1C5IA 4KWUA 4AWDA 1UU4A 4OI2A 3UKNA 1W99A 4QXCA 4JVAA 1N1SA 4P00B 4E2GA 4E4SA 3AP9A 3PIJA 3WG2A 2DBIA 3GZUC 2JG8A 4Q26A 5A3LA 4GWMA 4CXXA 1CAXB 1RUI3 4XABA 3RZMA 1V6JA 5AC91 3TEXA 1FPN3 4UYBA 1DZTA 3PU8A 5FYYA 5F1RA 1DQ6A 2HBUA 2JKBA 1JUHA 3KCXA 4Y4YA 2RG4A 1JYXA 3OF1A 4LT5A 1UMHA 1QMJA 1W6QB 4CP9A 4IGQA 1IPJA 3MV11 1GICA 1REEA 1S4CA 2Y34A 1JOPA 2BEOA 1JOJA 1VAKA 4MOAA 1RUG1 5BXXA 3U10A 5A7PA 4CPBA 5GJ6A 3BOPA 1H1MA 4AGRA 3ZLIA 3AKRA 2FD8A 1VJ2A 4G9SB 2W9XA 2R041 2OQ6A 1ZBA3 5CU1A 3VBRC 1PVC1 3FFQA 1XE7A 1VLNA 2RMU3 4KGGA 4TWTA 3WXPA 1I3HA 2W1UA 1ULPA 3GZEA 1EUUA 4N43C 4Y5TA 2Q8OA 2WZPP 2D7FA 1HB2A 5EV7A 3IDBB 4RHV1 3ZFEB 3HNMA 4PQ9A 1Y9MA 3AMPA 4NN0A 1DP0A 2E7TA 1ZA7A 4QGMA 5FZGA 3V0BB 2Z5WA 2ZABA 4QT6A 2KM2A 3RYPA 1AJOA 2PELA 5BUVA 4CCLA 4KWKA 1XNTA 5JOXA 2WAAA 3CJIA 4AZZA 4XF0A 4NHXA 3ZYHA 2Y33A 2NQYA 3ZXGA 4J25A 2YU1A 2R0HA 3PUHA 1ODNA 2EIBA 2NZ9A 3HQRA 2JDNA 1H9WA 1KXGA 2JG9A 4N8MA 5A1FA 1MS9A 1GP5A 3NKGA 5B2GB 2VL4A 4GIQA 2D93A 4LTAA 4Q8LA 1PX4A 2WFF2 3PMSA 3GGLA 4HVRA 4BZ4A 1YO8A 3UV9A 5HPOA 1UY1A 3DL3A 4Q27A 4CPBD 1VP6A 2WNUC 1BK0A 4CZSA 3CU7A 4GJYA 3W59A 3MO4A 1H8VA 3JQWA 5KBFA 2OUHA 1LULA 4RR3C 4DY3A 5J7MA 3S57A 3LWCA 4HN1A 1GQPA 1ZZ6A 2RDRA 2RM22 4COZA 2IXJA 2WO2A 3FN9A 2XLAA 1QXJA 1LHWA 2CYFA 2ZOEB 3FFZA 4Q1RA 1FV3A 2XPJA 2XUEA 1OH4A 2YBKA 3ACGA 3K4DA 3LEKA 4LOTA 2E9QA 2Q8EA 3AJYA 1SLIA 2ADEA 4UW4A 4YM2A 5F6KA 4JHZA 1G9CA 1W8OA 1PGW2 2NLRA 4HPKB 4JKLA 3N9LA 4BQ5A 5CVRA 1N3OA 2CL2A 2VOWA 2Z4FA 1C8NA 3D5OA 3VKMA 1ULDA 2J1UA 3O1OA 4LKFA 4C90A 4MV2A 4XJZA 2G9FA 3POBA 1OF4A 1W0OA 4IE0A 5FY0A 4D8MA 1GOGA 4A42A 4R52A 1TME2 1A8DA 3I3BA 4QB2A 5EIYB 1AR73 2BZDA 3F95A 1CQ9A 5T5LA 4XUTA 3VD5A 2RJLA 4FQZA 5FLHA 1H1IA 1WW4A 3ACIA 3KZ4C 2RR12 4I02A 4XQWA 3A21A 4BM8A 2JIJA 2WL1A 4OUEA 1GSLA 4HSJA 4ATEA 2DWRA 3OEAA 1LHVA 1YFXA 1LEMA 4A7YA 2DVAA 3JBG1 2VTXJ 4PI0A 5JDBA 4EQVA 3O1TA 1XJAA 3WF1A 4DZGA 4YVSC 4I2OA 1CZTA 1RUI2 1LRHA 4C1WA 5FYIA 1FPN2 3O1SA 3DYMA 1LCLA 3LIGA 4MADA 2DU0A 1NYWA 2Y6FA 3AZVA 5FZDA 2PLV1 1C28A 1OH3A 4JGYA 2DDUA 5KR7A 3RZKA 1UNBA 1CAWB 2ZZQA 2PHRA 2VGDA 2KXLA 4QQ2A 1OD5A 5DXDA 2JDZA 4OHZA 4CDQC 4IW3A 5FWJA 1C8M1 2WIIB 1DFQA 5FXZA 3N7KA 1LR5A 1SLLA 2VH9A 1ZBA2 4YVWC 1KFXL 2RMU2 4XJWA 5TSWA 1UOBA 1O7FA 2RS33 1R1ZA 2ORZA 3H9AA 3ZYIB 2HWB1 2VUDA 3FLTA 3WVJA 1ZRDA 1VBD3 3VLBB 2LW8A 3VKFC 4AQ2A 3AVRA 2ZMLA 1RUH1 1QJU3 3AP6A 3ES1A 3MYXA 3WCSA 3SMHA 5CZKA 1GZWB 2ZAHA 3J9SA 5L36A 1HB4A 4XUQA 2RHPA 5E88A 3VUOA 1PZ7A 2AEZA 4QX0A 1CR7A 5D2AA 2AYHA 2D3PA 3AM2A 3POGA 4MGIE 2PAEA 1BCXA 4XBLA 4LITA 3RZZA 3S5AA 4DXZA 1W28A 3A23A 4N43B 2CTVA 2W94A 2VCCA 3MIBA 2XQXA 4EN7B 1DQ4A 2JDMA 1W2OA 5J98B 4BK4A 5HBAA 1PX3A 5I0UA 5F2WA 4OHVA 2GAUA 4EN6B 1APNA 2XLGA 1TG7A 3PVOA 5EJ1B 5C71A 1WZXA 3FHAA 5I0RA 1LOBA 2D3SA 5JWPA 3I3DA 5HV4A 3MBWA 5JXJA 4JGZC 2ZS6B 3NL1A 1LOGA 2PHDA 1MPXA 4BJ0A 4BQYA 2JDAA 4XYXA 3V56A 5KHJA 5KXCA 4RYDA 1VBB3 3J7HA 3AKPA 5CFDC 3NJXA 1HDKA 2MEV2 3HBZA 1Y3TA 3R4SA 3M7AA 4CU7A 2K0GA 4W65A 1IS4A 4WM7A 2R071 4LKSA 4QX2A 3USSA 1W2UA 2GNDA 4XFIA 2WNUB 3DKWA 2P3JA 1AXZA 2BV4A 1MVQA 4RR3B 4Z8BA 4FPYA 5I0TA 1U5IA 3WDWA 1FOD1 1OD3A 2W92A 2ZMNA 2PQQA 4ZS3A 3UGHA 4P5HA 1G9BA 1JTZX 3AZZA 4NAMA 2ZPXA 4YG6A 1V9U1 4LNVA 2GH2A 2NMOA 4MUVA 5ABJA 2VPVA 4IUGA 5SV5A 4FI9A 2Q30A 1QU0A 1YUDA 2DBNA 2ZXQA 1J84A 3VBOA 5CYYA 1PO11 4BXSV 4M3CE 2OPKA 4IE6A 2DUOA 3KT1A 1BLZA 5BNOA 1QH6A 2VBBA 1WCUA 3HT1A 5FK7A 2VOVA 1X33A 2XJVA 2WN2A 3LF7A 4FOWA 5FFOC 2QQVA 1DBNA 4RQPC 3RMXA 1SCSA 4N9HA 2VG9A 5F3GA 3NNJA 3JD73 4Y3OA 5JR2A 3KHCA 4QB1A 3PDQA 3LD8A 3RWNA 4IEVA 1CAVB 1RUD3 5JMCA 1HX6A 5ISLA 2AZ5A 3DECA 3VDDA 5A3UA 4H3WA 4UW5A 3BTAA 2WRAA 3VBHB 3J8F3 2PHUA 2QZ3A 5FUNA 2VMHA 4DOUA 1HRI3 2RS32 1FAYA 1LOFA 5GZDA 4C8DA 5G04L 2PA7A 2W1SA 1VBD2 2VQUA 5GM0A 4QX5A 1MQTC 4NAOA 5T55A 1XBFA 5FY9A 4GB31 4TZDA 1W9WA 3PVBB 3OBRA 4LKDA 4XILA 5FPZA 1NCQC 1F35A 2P3IA 4CDQB 1QJX3 2H6CA 4P14A 1G9AA 3ZXFA 4BLJA 4N90A 1AR63 5IHRA 1H4GA 1Q5OA 3MW2A 2HWF3 3UYJA 2BNMA 4R9DA 1D7PM 4ZPIA 2XVKA 3ECQA 4YVWB 4XJ9A 3WUDA 4B3NA 1DHKB 3KCCA 2Q4SA 4JAAA 4BYYA 2ZEYA 4NWVA 5FPBA 4WVZA 2YPJA 5T3NA 4QPIA 4KNCA 3ZIXA 1RUE1 1IQDC 4RL7A 4E8DA 2A6XA 1F4AA 5A80A 5FTTC 2XG3A 3DPRA 5JLVA 3NJVA 3VBSA 3VHNA 5F9TA 2HWE1 4IV1A 4BB3A 1QHDA 1VIWB 3AZYA 3MIHA 1MR5A 1MS8A 1GP6A 1DG6A 5IWFA 1TZOA 3G7DA 3KWVA 2AENA 2P37A 4COYA 3UKTA 4CDXB 1WW6A 2FCTA 3PUSA 2FHRA 4JHTA 1VBB2 2TEPA 3UL2A 2QUOA 4OCTA 1UIJA 2B45X 4NHKA 1QIQA 1QY4A 1Q56A 5DAWA 4R4ZA 4WM8A 4BDVB 5JXIA 4FPFA 1TMF1 3UT0A 1J83A 3BALA 2XJQA 4BA6A 3SXWA 2A71A 1K5JA 2CDPA 2AEYA 1F4HA 5FO9B 1A78A 1BEV1 4H55A 1UPIA 3N9NA 2WNVC 1O91A 4JGZB 4ASLA 1HN0A 1O5UA 5BNNC 2J7MA 2I45A 5T52A 4P5YA 2YB7A 3C7HA 1K45A 4PIYA 3UETA 1K12A 4LULA 4XACA 2XKOA 3PVEA 1CJPA 3FMGA 1ND3A 1ULOA 1IGOA 2AREA 1WMXA 4YW1A 5HXVA 3IB3A 4YYOA 3LKJA 1OUSA 3OPZA 4EWAA 4MXVA 4WVWA 5FZ9A 4UFHA 2A1XA 4DIQA 2DVFA 5CKMA 3RJRA 1CPNA 1L3JA 2RJ2A 1SHWB 4OQ8A 3ZSJA 2X5IC 4JX0A 1J58A 3SEEA 5HCHA 4I30A 3OYWA 3SLIA 3WF3A 5L7OA 3M3CA 5BNPC 3LFIA 1GZCA 2PHXA 3HR9A 5L9RA 3W5MA 1ND2A 3J7NA 3D4KA 4XC9A 4Y20A 4XURA 5FJKA 1JMUB 5FO8B 1LU2A 4LBOA 2HH9A 5F32A 4YLZA 3FC0A 3JD72 5FMDA 4FFFA 5K4LA 3VZNA 5I0DA 3I3QA 1SMVA 2QFEA 4MGSA 1RUD2 5FYCA 1SBEA 1VBA3 5C3RA 3KF3A 4QX1A 2BFUL 2ERFA 4IEXA 2VXRA 4QX7A 4GWIA 5FV3A 1COV3 1HRI2 1MEC1 3BU0A 5IYYA 2XWBB 3NV2A 2R063 2XL7A 4PQQA 4UI9L 1DQ0A 4Q4V1 5IJRA 4AEDA 4ZONA 1DLLA 4RQPB 3FX3A 5IW0A 5CBLA 1FT9A 1YQ2A 2WO7A 1MS4A 1NLSA 2Y64A 1RYYA 2EIDA 3BODA 5FIXA 1W04A 3E6DA 4AEMA 4CP0A 5IT6A 1FXZA 3D0SA 5H9PA 4ASMB 1AR62 2VUAA 4YNIA 1Z7S3 2HWF2 4YW7A 3ZFGA 2CGPA 1AR81 3IIIA 3WW2A 2XB6C 3L2YA 3IZOA 4LO5B 1YQ5A 2V73A 3IDAA 2VVDA 1HN1A 4MGKE 3MIDA 2RJKA 2NN8A 3TN93 1REDA 4Q4W3 4M01A 3F2ZA 3WINE 4AI3A 3QH7A 3KT4A 2C24A 1MQTB 1W8ZA 1JW6A 4ZY9A 1PNGA 1FNYA 2ZBJA 4KL1A 3T2OA 2E51A 4PDWC 2QQOA 1NCQB 1QNWA 1MZFA 3ELNA 3N9PA 1XYPA 4YZ5A 2YPDA 1US3A 2VW1A 4PCRA 5FZ0A 4CCNA 3OGSA 4Q1PA 2ZA9A 1WW7A 3ON7A 4L11A 4HONA 3CZUA 2QQLA 5IAVA 1JZ6A 2FMYA 2C0ZA 2Z69A 1IKPA 4Y22B 5ERLA 5JZGC 2RS53 3CIHA 4YM3A 5K7PA 3HD8B 2OXBA 3VV1A 2Q1FA 2YC0A 1EPZA 2HWD3 4MZUA 5FRAA 2UWAA 4A45A 3UNPA 4P9LA 2ZGLA 4BXFA 3VD4A 1UYZA 3K2OA 4QQPA 1RUOA 2GH8A 1OOPA 1JHJA 1S2BA 2W3JA 3N9OA 2PHWA 2V4VA 4XDQA 4XJ8A 1G9FA 2JENA 1IG3A 2ATFA 4C0BA 1B35C 2HKXA 3HIFA 4FAHA 2JIGA 1S0GA 4M3CA 5FP8A 4XFGA 5JIAA 5FLIA 2E6VA 4BQXA 3ZN4A 1SZBA 3USUB 1NOVA 3A4UA 1POQA 1BBT1 1R64A 4JQRA 5FUIA 3LPFA 1GNZA 3EB7A 1QOSA 1E5HA 1W3XA 3IWZA 4PBOA 4QKNA 5KXEA 5LCWL 5EZWA 4CEYC 1LODA 1R092 2C9AA 4PBPA 1RHI1 2ZJCA 3HPNA 2QDNA 1NXMA 2GMPA 4QXKA 4KI5M 5IATA 4Y5SA 1E5RA 2WNVB 3M1HA 1R1A1 3ETPA 5BNNB 1UOJA 2QQPA 4QDSA 2EALA 1S0BA 2WLPA 4FPOB 4L97A 4C91A 5C8CC 2GZWA 4MH0E 1V00A 2D3RA 2WO3A 4OZXA 4YW4A 2PQSA 3NV4A 2FDJA 1YEWA 4ASKA 5AC93 3ZPOA 4ZU4A 1F5FA 2W1QA 1ULGA 4G3YC 1NAEA 2LRPA 4K8RB 1BMV2 1YJLA 3CQOA 1OA4A 2RDNA 1QWRA 2X5IB 4HANA 1GNYA 3THCA 3RZJA 5JI7A 1QDOA 3RZGA 1FYUA 1S0JA 2VNRA 5DAXA 5BNPB 4DUVA 1RUG3 3GHNA 1WLCA 5C4WA 3ZFFC 5A3MA 1IS6A 4MG2A 4EV0A 2CAVA 2R062 2WQ4A 5CNAA 1VAMA 2R043 3EYPA 2XHNA 5L19A 1RUF1 3ASIA 2YFZA 4XCAA 3ST7A 1FMD1 2B46X 1POV1 2P1BA 1V6NA 5FBJA 4DINB 4CU6A 2HLEA 1VAVA 2WT2A 4IEQA 4Y1XA 2BGOA 2W95A 1JZ2A 3O1RA 1PK6A 2EVXA 4LBJA 1ST8A 4IESA 4RHV3 3NWKA 3AL5A 2VTFA 4PI2A 1W6NA 2YXSA 3FUQA 5FK8A 2OT7A 2QQIA 1Z7S2 4GA9A 1H8TC 1SCRA 1Y4WA 4IGPA 4ET7A 3I3MA 5GLTA 1LJ7A 2NP0A 3M3QA 5KWRA 2YZ4A 2RV9A 3VBFC 4Q4W2 4GWJA 1F5JA 3IBMA 2O0OA 4I3PA 4DEQA 4LHLA 4QU1A 3HJRA 4EZHA 5JAXA 3HMYA 2IXKA 1GZTA 5K9YA 2LROA 2RS13 2ZX4A 3ABZA 2W47A 2A3WA 1TE1B 2ORXA 3MLKA 4KBZA 3ZSEA 4XZPA 4NPRA 1XE0A 2YGLA 3LA3A 2Y38A 3QH6A 3ZSLA 2W1WA 3WD5A 1IOAA 1IHMA 3M3EA 1BYHA 1W6MA 3AK0A 3E5UA 1OMIA 3PUIA 2VECA 5LB6A 2DU1A 3KQRA 1XXNA 2RS52 3EO6A 2GMMA 4LO8A 4Q0QA 3DEMA 3O0VA 4I01A 3WQ7A 3N9MA 4W6WA 5JVVA 2ZGOA 2HWD2 4OMDA 4PDWB 1H4HA 2A6VA 2DCYA 4TTGA 1JOBA 1GWLA 2HYXA 5DUVA 5DZGA 1QJY2 1UYXA 1OKOA 5JUVA 4YZ3A 1VRH1 2ZEWA 3IN9A 4CU9A 3V0AB 4NIHA 3AC0A 4Y4RA 4AVCA 5DUXA 5JZGB 4GAZA 1UKRA 2VE1A 2WQZC 3I2FA 1ZX5A 1YFYA 4B4PA 4CTEA 2RVAA 4EN9B 3RGBA 4UFJA 3KGZA 4UOJA 4DXTA 2XL9A 1ZRRA 3DKQA 4FPLA 1ZYBA 1WA6X 4PLNA 3WNPA 1XNAA 3LSDA 2UYBA 4FP2A 5HI0A 1OT5A 1RTVA 2ZHMA 1W6QA 4WV8A 4EZ4A 4FOVA 1LGBA 2IFWA 4W8JA 4LO6B 3L9JT 1QXPA 3U37A 1QQP1 3KQ4B 1D4M3 1B35B 1LHNA 3KLSA 3POWA 4B29A 2BOIA 2VNOA 3OSDA 3POEA 4B7KA 2O8QA 5F8PA 3P3PA 4Y1ZA 4PHZA 1GZ9A 2WWJA 3O1VA 3JBG3 4A4AA 1KRIA 1IS3A 1F31A 1W6OB 1KQRA 3ITQA 5AC92 2QVSB 2VAUA 3DN7A 3RRDA 4V1PA 5GZEA 3ZFEA 1EAH1 1UY2A 2PLV3 3KV6A 4IGOA 4CEYB 5A32B 3VDBA 4HL0A 2A6ZA 4OMCA 4R9CA 4XQ4A 3WDYA 4QQHA 1WGPA 1NCRC 2EXHA 4MX3A 3WNKA 4GKXA 1JYVA 3V0BA 5C6CA 3TEWA 1C8M3 2D6NA 1RUG2 3AZXA 4AFCA 3D6EA 2IFRA 5C8CB 1RXFA 3B7MA 2R042 2N7GA 4XTMA 2D43A 1S2KA 1RVF1 1T6GC 5HCBA 2HWB3 2GDFA 3CDZB 1KDMA 1ZM1A 1RINA 2ZCWA 3KM5A 3POIA 5FPUA 5FOBB 2DTWA 4RHV2 1W8NA 2QBXA 3KMHA 5CG8A 2QDRA 4A3XA 1ULCA 3DUIA 2WDBA 1ENQA 3MGUA 5FY7A 2Q5TA 3AYAA 4MXWB 3S30A 3O1UA 1OPMA 1KD7A 2GU9A 4HSLA 4K1ZA 3ZXAC 4KG0A 3IPVB 3LDBA 3ZFFB 1U5XA 4MGZE 4N9IA 1XYNA 2P4EA 3EJKA 4A7KA 3MEPA 4H2AA 2R49A 2GNBA 1EV11 3BU7A 1RUC1 1XQNA 3AFGA 2EF6A 3WEZA 3ZDSA 3ZXEA 2OZJA 3BPSA 4K3UA 1Q3EA 2RS12 5I0SA 1AL0G 2XJPA 2QQWA 1G6NA 4R4XA 2GN3A 1O3RA 2J1TA 2WYFA 4X6RB 4AVVA 1WMEA 2XJRA 4GULA 1AYN1 2XJSA 1WKYA 4XXAA 3RMYA 5FZ4A 4CE8A 4XFBA 4HPKA 4IXLA 2QQKA 1Y9GA 4V2WA 1GOHA 4E2SA 3NQHA 1ZZ7A 2IXLA 3FWEA 3WR0A 1AX1A 2WYSA 3KD4A 1QOTA 3VBFB 3N7JA 1OPOA 2JE8A 4IV3C 4ARXA 3AYDA 2RDQA 4BPZA 1Q8OA 2ZKNA 4U36A 5FXWA 5GZGA 1GNHA 4RS5A 2V72A 5FP3A 5DZFA 1D0HA 3Q8BA 1OFNA 2V5DA 1PIV2 3MW4A 1HQNA 4XMIA 5FZCA 4B4QA 5FZOB 2EIEA 5FYVA 1HQLA 4DEVA 2BPA2 2R073 3B69A 1AXYA 4NOTA 1NXD1 2VZ3A 1L7LA 4Q0SA 3POYA 4Z92B 1OKQA 5A6XA 3ZYFA 2ILMA 1O8PA 1LOAA 4CP9B 1UYYA 5JMOA 1PGL2 4AFDA 3AXEA 5JCTA 1N1YA 3VHRA 4NO4A 5BPXA 2LM3A 2TBVA 3ETQA 5DQ0A 5IK8A 3RZHA 1C3HA 1QJEA 3EXUA 4ZS2A 1JUIA 1AL23 3OGJA 1L7QA 3AX4A 3CMGA 1H6XA 1UYPA 3IAQA 5A3PA 1D4M2 5LK5A 4S2HA 2B39A 1CAUB 1LENA 2C9KA 3E5QA 4LHKA 4Z2AA 5J09A 2VOTA 1IPKA 1TEIA 1HW5A 1PO13 3H3UA 3JBG2 4FT8A 5FZMA 5E16A 5FY5A 3CL1A 4Y24A 1NA1A 1BHGA 5FZBA 3WF4A 2YU2A 4HBNA 3I4IA 5LBFA 1T2XA 3ZXKA 2YBSA 3PVNA 3WP6A 2PLV2 4OLLA 3ATGA 4KWLA 3ZSMA 4BWOA 1A6CA 4XBNA 3U4XA 1REFA 2Q8DA 3THTA 3JZVA 5JI9A 4WZFA 1HQWA 2ZGTA 1HRV3 2VZUA 4INDA 2VMIA 2XJUA 2RM21 4M00A 4UW6A 4XDOA 5E8AA 4IEOA 1UY4A 4JDMA 5D8AC 5FKBA 2GC0A 2DFBA 2R1DA 2X09A 1FI2A 4YGCA 4AQ6A 2YG0A 5IVVA 1J3PA 2DVBA 4E27A 2YYOA 2P34A 4LIUA 5EJ3A 5FLJA 5JPNB 1LAJA 4N43A 5EWSA 3U1XA 5CFCB 1JBCA 1O59A 2HWB2 4HKLA 4CVUA 2PN5A 2D6PA 3LAGA 2VR4A 3WDUA 1X8EA 2ZGPA 1O3TA 3OCPA 5A6YA 4GB33 3IMMA 4NPLA 4XHBA 3U75A 2MNGA 4D7TA 1NCRB 3VGIA 1WCQA 1UAIA 4XJUA 3VBUC 4F3JA 2R30A 3OY8B 1D0GA 4PF1A 5I8YA 4OI0A 1UZ0A 2VU9A 3WNLA 4CDUC 2A75A 5F3IA 1YQCA 1SLCA 2NMNA 1GP4A 3DYOA 2Y6KA 2B42B 3PU3A 4MGYE 4YGDA 3IMNA 3S7EA 3ZYBA 4AFMA 5ACA1 4FFHA 1RUJ1 3VZLA 1K42A 5CKQA 2RR11 2WUHA 4ES9A 5F5AA 4LA2A 2R16A 1ZBE1 2ADDA 1ZREA 1X36A 1PO21 2BUKA 2GN7A 3LSEA 1O5LA 2D98A 1RUE3 4HXCA 1A8MA 1KFUL 3PTYA 1G7YA 1K5MC 1ALYA 1XNDA 3ZN5A 2JEMA 2WNUA 3PTRB 4QHOA 3VBRB 4B1LA 2F4PA 1W06A 1UU5A 3HN1A 3LB9A 4GH4A 2E7QA 4JRLA 2Z2SB 1N47A 1NLRA 2EXKA 2HWE3 2QZ2A 4XIOA 5GZCA 1WMDA 3BN6A 2AGSA 4Z2WA 4BK5A 5LBCA 4AFBA 4W6YA 2DCZA 2ID4A 5A70A 4OZOA 1WMFA 1NZIA 4QPWA 2ZX1A 1DGRA 1TVGA 5DUUA 1CONA 4DUWA 1MZEA 3ZYJB 4C0HA 4GMP0 2P2KA 2PAKA 2RMU1 4KU7A 2R072 5DUWA 5JOYA 2DCTA 2UY8A 5GKAC 2G9GA 2DURA 4JDNA 4AVAA 2EXJA 1YC61 1BEV3 5H9RA 2VOKA 3KT7A 4IV3B 4U2AA 5AVPA 3RYKA 1AF9A 1PZ8A 1UWWA 2PYTA 4QAWA 2YDEA 1WBFA 4QKFA 4GMP1 4RGAA 5C70A 3ZYPA 1UZVA 2VMDA 4XVHA 2BVVA 1VBE1 3W58A 5C3QA 1JXNA 4F8AA 4O7XA 3S5QA 4OVEA 3ZPYA 1AL22 2A6YA 1LOEA 3BYWA 1XNCA 1AR91 3C7OA 4FO9A 2EIGA 2AR6A 2OUJA 2DVDA 3JUUA 5DG1A 3VBHA 2VD7A 1DYOA 1PO12 3MI8A 2C6SA 2Y60A 3I49A 2J1EA 3CO2A 4FXKB 5K0UA 3O1MA 3O0WA 4N7UA 4OUMA 4ZXEA 1RC6A 2BNNA 2CY6A 5KC5A 2WSUA 1AR72 1O4TA 1XB9A 3WW4A 3WF0A 1X82A 4L0PA 3UJOA 1JI6A 3CLPA 3DPRC 5FR3A 3VBSC 2VVEA 2LTNA 1AVBA 2SBAA 2WNOA 3SKVA 1N1VA 4AK3A 1F2NA 1JZ8A 2XWJB 1HRV2 4PJYA 3NV1A 4NHMA 4ZKTB 1P8JA 2BWCA 3I2KA 2IUWA 4DB5A 4LMFA 4XFFA 4QGNA 1YYNA 4HLTA 2O8OA 1SPPB 2MEV1 2EAAA 1YFUA 3E5XA 4F7ZA 3IKWA 3WT3A 5LY1A 3SITA 3D8CA 4Q4V3 3ME2A 4YZ2A 3JCIA 4XF3A 3IT8A 2W5FA 2ARXA 2WA4A 3M3OA 4XAAA 5FPXA 3I59B 3K46A 2B7YA 3WDTA 5FYUA 5FQ0B 4YW5A 2H0BA 3T2TA 1GQGA 4AYUA 5DDJ3 2D5HA 2VZOA 4AL9A 5D8AB 4RGGA 4YVSB 2XBO1 1AR83 1CWPA 1HV0A 1ND3C 4MYEA 2W87A 4I0AA 2WC2A 5HCFA 4E4DX 3WQBA 2WWSA 4CDXA 2D5FA 4QB6A 4G4FA 1QJU2 4HMZA 5DPNA 3EHKA 5J96B 3H1WA 4L92A 4Q0PA 4WBBA 2L9LA 3AMNA 1XYOA 4IE5A 2XVLA 3J7MA 4LOSA 3ZYGA 4WZCA 1D2SA 4X6QB 2VMEA 1C1FA 1RUE2 2YMZA 3WX5A 4BE3A 1Q8SA 3K75B 2VULA 5E1RA 2VZVA 2JE7A 3HT2A 3VBUB 2BGPA 2HEWF 4E8CA 2BJSA 4QXHA 3N7LA 4S2FA 2HWE2 3JXSA 4CDUB 4JGZA 5FMCA 3MF6A 3RPQA 4BU2A 3ZSKA 4NROA 3RWKX 3OPWA 2G19A 4XF4A 3PLQA 4CUAA 4JKMA 1S0DA 5CKNA 1GWMA 2WQ8A 5L9BA 3T09A 1SDDB 3WHUA 5C9AA 4ZZ8A 4QPGC 4P9JA 5FDBA 1LHUA 4HOOA 4L2NA 3T2PA 2XMLA 3OEBA 4XFCA 1PZ9A 1QEXA 2C5DA 4AI9A 1S1AA 1K5MB 5F6LB 1GMMA 2VZSA 5D1IA 1ONAA 4CYDA 1NG0A 4O9GA 1KITA 1OLQA 4QDRA 5LBEA 3ZDVA 4D7SA 2FDFA 3LDKA 4AEDC 1BEV2 4UFKA 5FPLA 5A7WB 3B3QE 3NJZA 4EROA 4HKOA 2XGXA 2XUMA 4IE4A 2J1AA 3K3OA 3KS7A 4Y1UA 2VO5A 1IPSA 1F15A 4LR4A 5KXDA 1EP0A 3HOBA 1YQ8A 3TNQA 1BBT3 3N35A 4AEJA 4S2DA 3MUZ1 3ZFGC 4O9EA 2XOMA 5DAPA 1GV9A 2R6QA 2OVUA 4HETA 1RHI3 5A33A 4UF0B 5ANQA 2R0FA 3T3YA 2GP3A 1BVVA 1R1A3 5GALA 3WSOA 1MS5A 1PM4A 3LEMA 3PMEA 3RZLA 5CFDB 1UL9A 3TBDA 3ZXLA 3KGLA 4UAPA 4RQPA 2OZ6A 1RIRA 4XXPA 3VL8A 1UX7A 1JZ3A 4RFRB 2WN3A 1QGLA 3WNXA 1JN2P 2CNAA 5LA0A 3DCQA 3WDXA 4DY5A 1IQAA 4K7JA 5JIUA 4UFMA 1O4YA 1YIPA 2E7AA 1JYCA 2WLQA 4CA9A 1WD4A 3DXTA 4GQ7A 1W6PB 3WW3A 1FNZA 4FAGA 1RGSA 4LBNA 4TLGA 3BIEA 4W6XA 2IC1A 2C26A 4D94A 1MQTA 1MZ5A 1VPHA 5JXGA 4L99A 1RUF3 1XSQA 4FPCA 3WUCA 1J1LA 1GYKA 1FMD3 1ZRIA 4QX8A 4AAXA 4CUCA 4YM1A 3B93A 4LK6A 1NCQA 1E5IA 3WY6A 1JYTA 2JECA 5DDJ2 3J8F2 1S0FA 3VKOA 1W90A 3TRSB 1QKQA 4LXLA 3RI9A 2VBDA 5T54A 1AR82 3I7DA 4AW7A 2CGNA 4N53A 4V2VA 4SBVA 4NIGA 4Y22A 4YZ1A 1NUKA 4XE9A 3I54A 5GLUA 2HWC3 4BQ3A 4XUOA 1R081 5LEKA 2G4IA 3GBFA 3T2QA 1H2NA 1QJX2 2NYYA 4OI4A 3ACFA 5CIRA 4DS0A 5L73A 4BMEA 2G9ZA 2EA7A 4HZFA 3RQ0A 4DFSA 5FZLA 1UN1A 4HT1T 3GALA 5DAVA 2WZEA 3U07A 5CG9A 5KXBA 1OA3A 1JZ5A 1D4VB 1ND3B 1OBNA 2H0VA 1SFYA 3OUJA 4AQSA 5BNQA 5IAXA 1XOYA 2K46A 4CSWA 1KDKA 5IK7A 3USUA 3U11A 1W05A 4B8EA 3TEZA 1G86A 3GXUA 1EYBA 5H9QA 5FZFA 1LU1A 3ILFA 5APAA 1HXS3 3ALQA 1GKBA 3S7IA 2YC4A 5CADA 1RMU1 1MS1A 3OYWB 1HRI1 4BQWA 5FZEA 2ZX2A 2ZGMA 3SEPA 1L7RA 2GSYA 4LA3A 3UESA 2JD9A 4D0QA 4P9GA 4FSJA 2WNVA 4Y20B 4COWA 4NIAA 3SH5A 3GM8A 3JB8A 4P9WA 1U0AA 3K4AA 1PK6C 2VCMA 1AXKA 1BK1A 1MZ6A 3T08A 2DVGA 1DF0A 4QPGB 4RN5A 1AR61 1BBT2 4OHWA 4AHWA 5J1XA 4BQ4A 2YGMA 4R9AA 3UGGA 2IVJA 2YHJA 2WABA 4YG3A 3B9CA 1W2AX 2A7AA 4UBHA 4KU8A 2J42A 1WA4A 1ZA4A 2Y6GA 3M8LA 2FQPA 4AEDB 1UKGA 2H6BA 4LK7A 5BNPA 5FMBA 3A7QA 1CX4A 1LEDA 2GC3A 3VHPA 2DTYA 5LA9A 4XF1A 5FZAA 2W91A 4QXBA 5EP9A 1E57A 2B4KA 4LBQB 4QD2A 4LHSA 1F9KA 3BCWA 3IDEA 4KBBA 4LBLA 1LTEA 3FUOA 2ZEXA 3ZFGB 1H9PA 1ACCA 1DU3D 4IE7A 2UYAA 3OD0A 4DRVA 4LORA 2BOJA 4OULA 4OFGA 2MHFA 2VZTA 4WVVA 1MVEA 5T50A 3J4UH 1N1TA 3ZXDA 3U4SA 5C5UA 3TYJA 3I2IA 4M0NA 3X29B 4NVPA 3K48A 2A3YA 3LE0A 3TOJA 4AVSA 4P02B 2Q0AA 4XW3A 5J36A 5EFUA 3NAPA 2WKKA 4IETA 4HFSA 4AI2A 4M0HA 5JOZA 1I6XA 1RUF2 4AGVA 1IS5A 4IEUA 1RVF3 3T4VA 2JJ6A 1VBA2 4Q4X1 3HNYM 4PIXA 1POV0 3M70A 3ZXJA 4YW3A 5A6ZA 5C3SA 4FCAA 2D44A 4XUPA 1COV2 4IEWA 1KS4A 2CSGA 1C57A 5M0TA 2Q1MA 3C7GA 3MDPA 4XTPA 2VOXA 1PVC3 1H2LA 3NNLA 1SEFA 1YXWA 3MPBA 1CVNA 2HWC2 2VQTA 1PHMA 5FZ6A 1H2KA 4CEWC 1EV13 1R091 3LFMA 5FP4A 5H9SA 4ARYA 3ILRA 2TNFA 2VQAA 4A3ZA 3H8UA 5HV0A 5IUQA 3PNAA 3WLUA 1SFNA 5FAXA 3OD4A 1US2A 1X9PA 1AYN3 2ZHLA 2VVFA 3H3LA 4UFIA 5FZHA 4D6SA 3ORJA 2UWCA 2VW2A 3OBAA 3V0AA 2I74A 5EJZB 2AACA 3TN92 3U14A 4AR2A 4E9KA 1DGRN 3KB5A 2ZMKA 1VBC1 4Q4Y1 5JZGA 1LGCA 1ODMA 1RJ7A 3GF6A 2YBPA 4TSVA 3ZN6A 1UPSA 2ET1A 2VNVA 1BMV1 3FL7A 3WQ0A 2FZ2A 2XLFA 4DNYA 5KC6A 1HXS2 3I2JA 1S0EA 2ETEA 3WV6A 1YCIA 1Y7BA 4FFGA 2JG8C 3KSCA 1GUIA 2BERA 1SLTA 3LGRA 1X50A 3AFKA 3OJBA 2ENRA 1W39A 3OUIA 4OYUA 3PHMA 1B35A 1JYNA 4CDWA 5LATA 3RJ2X 1GANA 2DFCA 1CZSA 3HWJA 4UWDA 3P1IA 2XVGA 5A3TA 2FBEA 3RG0A 2PHLA 2ZTNA 2E32A 2WO1A 5EYYA 1W6OA 4COVA 1YIFA 2WS91 5J37A 5EQUA 1Z7S1 3NNMA 4PF5A 2WNEA 2WWUA 3BB6A 5FXVA 1MS3A 1H6YA 1NY71 1AUYA 2ZGKA 5FMOL 4KGQA 1OURA 3CJXA 3GJBA 2E53A 1VB4A 3K3NA 2Y26A 1AX2A 3INAA 2K2SA 3MFAA 5CISA 2JWPA 4CU8A 3U78A 4A41A 4Q0UA 1CAXA 4QQLA 3B9IA 4FOQA 2VZQA 1PK6B 3LEGA 3BTYA 1VB2A 1N3QA 5AFBA 4LBKA 2BVBA 1SBDA 3H50A 3NJYA 4P9XA 2XR4A 1G8WA 3EBRA 5DABA 1WLTA 2VY0A 3NV3A 1WD3A 3CJIC 1UX6A 2ZX3A 3SH4A 4AI0A 4MXWA 1J3RA 5LRSA 1V6IA 2YUEA 3KF5A 3AJZA 2OIIA 4JKKA 2PXJA 1JODA 3DYPA 1Y43B 3R4DB 4ITCA 3IPVA 4QKDA 3ZFFA 2VUCA 1U5YA 2A73B 1NX9A 5A7NA 1KEXA 2Y6JA 1PGSA 4L9BA 5I8TA 3H42B 2JG9C 1U5ZA 2ZGSA 4RS5C 4X8NA 3C2UA 2PAMA 4AOCA 4NHYA 1QJY1 1ZZ9A 3Q8EA 3SCHA 3RS6A 2QQMA 2Z42A 1N3PA 2JDHA
chains in the Genus database with same CATH topology
1ODNA 1W2OA 5C3SA 1QJFA 1GP5A 2CSGA 2VBDA 1GP4A 1W2NA 1UOFA 1BK0A 2BU9A 1OC1A 4BB3A 1RXGA 2JB4A 3ON7A 1GP6A 1W9YA 1UOGA 2BRTA 2BJSA 1W06A 1QIQA 5C3OA 1OBNA 1ODMA 3ZKUA 1W05A 1E5SA 5APAA 1UZWA 3ZOIA 1HB1A 2VE1A 1W3XA 1E5HA 1WA6X 1W3VA 4RGKA 2DBNA 1IPSA 5C3QA 2VCMA 2DBIA 1QJEA 1BLZA 1E5RA 2VBBA 2IVJA 2Y6FA 1W2AX 5C3PA 1UNBA 2Y60A 2VAUA 5C3RA 3ZKYA 1HB3A 1UOBA 1W03A 1HB2A 1UO9A 1RXFA 2WO7A 3OOXA 1HJGA 2JB8A 1W04A 2IVIB 1HB4A 4XAEA 1DCSA 2VBPA 1HJFA 1W28A 1E5IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ODN A;  1W2O A;  5C3S A;  1QJF A;  1GP5 A;  2CSG A;  2VBD A;  1GP4 A;  1W2N A;  1UOF A;  1BK0 A;  2BU9 A;  1OC1 A;  4BB3 A;  1RXG A;  2JB4 A;  3ON7 A;  1GP6 A;  1W9Y A;  1UOG A;  2BRT A;  2BJS A;  1W06 A;  1QIQ A;  5C3O A;  1OBN A;  1ODM A;  3ZKU A;  1W05 A;  1E5S A;  5APA A;  1UZW A;  3ZOI A;  1HB1 A;  2VE1 A;  1W3X A;  1E5H A;  1WA6 X;  1W3V A;  4RGK A;  2DBN A;  1IPS A;  5C3Q A;  2VCM A;  2DBI A;  1QJE A;  1BLZ A;  1E5R A;  2VBB A;  2IVJ A;  2Y6F A;  1W2A X;  5C3P A;  1UNB A;  2Y60 A;  2VAU A;  5C3R A;  3ZKY A;  1HB3 A;  1UOB A;  1W03 A;  1HB2 A;  1UO9 A;  1RXF A;  2WO7 A;  3OOX A;  1HJG A;  2JB8 A;  1W04 A;  2IVI B;  1HB4 A;  4XAE A;  1DCS A;  2VBP A;  1HJF A;  1W28 A;  1E5I A; 
#chains in the Genus database with same CATH topology
 4YGB A;  1UF2 C;  3PJY A;  4URA A;  5A3N A;  4YFZ A;  1WLW A;  3KVB A;  4Z07 A;  3ZR6 A;  4YW2 A;  3WP5 A;  3TEY A;  4YM0 A;  5IK4 A;  4FQ4 A;  4XFA A;  2XJT A;  5A3O A;  4H7L A;  1ASJ 1;  2E33 A;  1AYM 1;  5GLV A;  2VZ1 A;  1UQX A;  1PVC 2;  4QMA A;  4CP2 A;  1CIY A;  4Q0V A;  1TNR A;  3LPG A;  2G1M A;  2D6M A;  2W08 A;  1EV1 2;  3ENR A;  4OHY A;  2W0X A;  1W9F A;  1GOF A;  4AI1 A;  3D82 A;  3Q9O A;  3UJQ A;  5ACA 3;  2D6L X;  1RUH 3;  1S2E A;  2HEY F;  5IVE A;  1H2M A;  1RUJ 3;  3AKQ A;  3MHZ A;  4XOG A;  1JH5 A;  2BRT A;  2FDK A;  2RR1 3;  2P6C A;  4CUB A;  2BDR A;  1KJR A;  1ZBE 3;  2KD7 A;  4LPL A;  1AYN 2;  5FZO A;  3WCR A;  1PO2 3;  2P17 A;  4N7I A;  1WCK A;  3VZM A;  3B01 A;  3FZ3 A;  3T1L A;  2P5B A;  2VTX A;  3MIG A;  1NA1 C;  3R0R A;  3MIC A;  3WNN A;  2RE9 A;  4CEW B;  1JU4 A;  2WZR 1;  5IVB A;  3UKV A;  3LOB A;  4LO7 A;  5CA6 A;  2UUR A;  1E5S A;  4EWD A;  1Q8P A;  2ZHN A;  1UZW A;  2X53 S;  2XON A;  3AXD A;  4ORF A;  4Y33 A;  3SHR A;  5A7Q A;  1X7N A;  3WP4 A;  3FJS A;  3MLL A;  1D2Q A;  1XU1 A;  4QX3 A;  2AUY A;  2FCV A;  1H8T B;  3T1M A;  5DZE A;  1GLH A;  3I97 A;  3SKJ E;  1Y9Q A;  4NUB A;  2V4A A;  4XZU G;  5FY8 A;  1X8M A;  1UXZ A;  1CAU A;  3JB4 C;  1RUN A;  4CCE A;  5A6Q A;  2VC9 A;  4JGY C;  3NO8 A;  4WVM B;  3NNF A;  1HKD A;  4MGQ A;  2VMC A;  3N3H A;  2E31 A;  4FPE A;  4BIF A;  1OFS A;  4EN8 B;  1NQD A;  1ENS A;  1CN1 A;  5C33 A;  1W8U A;  3RNS A;  3BPZ A;  5C8W A;  4GMP 3;  4QQO A;  2FDH A;  4KG8 A;  1RIT A;  1CPM A;  1VBE 3;  2GAL A;  3NST A;  4JZR A;  2OQ7 A;  2JG8 B;  3C7F A;  3C8X A;  4O65 A;  2K9Z A;  2QQN A;  2CGO A;  1OVS A;  5FCC A;  3CBN A;  2RS1 1;  1AJK A;  1PMH X;  3N7M A;  3NNG A;  1AR9 3;  3ACL A;  1NE6 A;  4CCJ A;  5HXM A;  3VDA A;  2J1S A;  1HV1 A;  2W68 A;  5FZ7 A;  2PMW B;  1FOD 3;  5FYT A;  5A1L A;  3U0Z A;  1ZRF A;  4K20 A;  2JDY A;  1W03 A;  5CFC A;  1V6O A;  1CAW A;  1WCS A;  5LY2 A;  2KA3 A;  1ZRC A;  2FDG A;  3I2O A;  1V9U 3;  5K8S A;  4ZZ5 A;  2C4X A;  3RDI A;  2D6O X;  2GME A;  3OTF A;  4GH4 C;  1LNS A;  1NCR A;  2UU8 A;  3AYC A;  2VQ0 A;  1JS9 A;  2B5H A;  1OSG A;  4K6B A;  3CZJ A;  2GC2 A;  1LKN A;  4K1Y A;  3OY8 A;  1XC6 A;  4LKE A;  1WWY A;  4ISR A;  4Q29 A;  4KH9 A;  1PIV 1;  1C4R A;  4EE2 A;  1WLD A;  2WFF 1;  2MEV 3;  2ZZJ A;  2IZW A;  3RVH A;  5EHD A;  4YWA A;  5F37 A;  4CXW A;  2BW8 A;  3AB0 A;  1GZW A;  4QPY A;  3CJI B;  1C8M 2;  1UY0 A;  2OW4 A;  4HKW A;  1LES A;  3IM0 A;  1CD3 G;  2E26 A;  4GD4 A;  5I8S A;  3R4U A;  2WR9 A;  3VBR A;  1UOF A;  2WA3 A;  1W8F A;  3BTX A;  1C5H A;  3EQE A;  3V65 A;  3BTZ A;  1PGL 1;  2JG9 B;  4RS5 B;  1A34 A;  1I5P A;  3POJ A;  2XBO 3;  3OG2 A;  4UBG A;  1RXG A;  3T0B A;  4HVQ A;  2PHT A;  4LLF A;  1PGW 1;  2JE9 A;  5F5C A;  4WM7 C;  4IEY A;  4QHB A;  5ACA 2;  2Y0O A;  1IKQ A;  1RUH 2;  5B4X A;  2PFW A;  1RUJ 2;  5DAQ A;  2FZ1 A;  1D4M 1;  1W2T A;  3QBQ A;  1M4W A;  1WW5 A;  1XU2 A;  2D40 A;  3J7L A;  3MIE A;  2VZP A;  1ZBE 2;  5CEH A;  2C1F A;  2W39 A;  4XCB A;  1PO2 2;  4XUN A;  3VBH C;  2VZR A;  2O1Q A;  2ZGU A;  5FMO S;  4PIZ A;  5K0U C;  3WF2 A;  2EXI A;  5FP9 A;  1TME 1;  4MO3 M;  3ZKU A;  3QLQ A;  4IV3 A;  4MHR A;  2WBK A;  5ABJ C;  1PMI A;  1B09 A;  2SLI A;  2YRO A;  3ZMN A;  4ONU A;  4AHX A;  1GR3 A;  1VMJ A;  4K8F A;  2WZ8 A;  5FWE A;  5A3W A;  1LHO A;  3WHT A;  1GWK A;  3P3N A;  4C1X A;  5CB7 A;  4GJZ A;  3VBO C;  2UWB A;  3BIW E;  3ZVX A;  4MGT A;  2EAK A;  4NHL A;  1CIW A;  5DG2 A;  4NII A;  3ZM8 A;  1DZR A;  3E97 A;  4MLO A;  5BNO C;  1RUI 1;  1DYK A;  1RJ8 A;  3APB A;  4XBQ A;  1VE0 A;  5FYB A;  1FPN 1;  4JC1 A;  2VMF A;  4UFL A;  1O3S A;  5EXO A;  3T4H B;  4CRQ A;  1RB8 G;  4PLM A;  4LO4 B;  3PIG A;  4RGK A;  4RR3 A;  1NA1 B;  4BLI A;  3IDC B;  3W21 A;  4AFA A;  4AVB A;  1OLM E;  4D7Y A;  1G9D A;  4M4R A;  2Q8C A;  2A70 A;  5KHG A;  2XXZ A;  4D3W A;  1XRU A;  5JR7 B;  1W9S A;  1JZ4 A;  1UU6 A;  3N4M A;  2JDP A;  1V6K A;  2JKX A;  3A0K A;  1BZW A;  3GJA A;  1YFW A;  1YI9 A;  3I3E A;  3VDD C;  1JYW A;  4NID A;  2JXA A;  3WG1 A;  1WBL A;  1BJQ A;  1ZBA 1;  3A0N A;  1VBE 2;  3OUH A;  5HCA A;  4MHU A;  3TB0 A;  1TMF 3;  1DQ1 A;  3B00 A;  3H1M A;  2OYZ A;  1DIW A;  3KV5 A;  2F17 A;  3H1Y A;  1LOF C;  1J1T A;  2YFU A;  4AE2 A;  5F5Q A;  1FV2 A;  1SFP A;  2ZAC A;  4LJH A;  3V64 A;  5GLZ A;  1AR9 2;  4JGY B;  4A7Z A;  4CDX C;  2B9U A;  3CNA A;  4FPK A;  1SPP A;  1FOD 2;  4M3C F;  1OF3 A;  3VZJ A;  1HB3 A;  1ENR A;  2YC2 A;  2GC1 A;  2OA2 A;  3D0J A;  2BNO A;  5EYX A;  3VB9 A;  3WW1 A;  4EYU A;  1V9U 2;  2OX0 A;  4GAL A;  1FX5 A;  1YRZ A;  2Z79 A;  1CAV A;  1HJG A;  2WAO A;  4W4Z A;  1V6M A;  2VNG A;  3ES4 A;  3I59 A;  4LIV A;  4BCU A;  4QGL A;  5FPV A;  5FQ0 A;  3K51 A;  4XAE A;  1LB2 A;  3MPP G;  2QCS B;  3MUY 1;  3AYE A;  3HAG A;  5D8A A;  1BVP 1;  3HQX A;  4YVS A;  3RI8 A;  2FMD A;  2ET7 A;  4QPI C;  4JCK A;  2IWG B;  4XEZ A;  5SV8 A;  4YAR A;  3DXU A;  1BKZ A;  3NRU A;  1VR3 A;  5GLW A;  5C9A C;  4JTO A;  4P9Y A;  3OGV A;  4E4Z A;  3FHI B;  4FPJ A;  5BY5 A;  4FTB A;  3AL6 A;  5FYS A;  2P6H A;  1HIX A;  4IV1 C;  4XF9 A;  1VMH A;  4CDQ A;  3RFR A;  3A22 A;  3O12 A;  3JQX A;  2ZHK A;  1ZZC A;  4Q8K A;  4GH4 B;  4HN0 A;  4IDZ A;  3SQO A;  3HQU A;  2XDV A;  4E4H A;  2GNM A;  1VRB A;  1Z78 A;  2WIN B;  3SCF A;  3VBU A;  3MIF A;  1I9R A;  1OUX A;  4HK9 A;  1SG3 A;  1GFF 2;  2BU9 A;  4YVW A;  1XNB A;  2ZX0 A;  4PLO A;  4CDU A;  1MEC 3;  3SCG A;  5JPM B;  1CES A;  2XBO 2;  2VXJ A;  2BTV C;  3KVA A;  4WM8 C;  3LEI A;  4K9S A;  3I2H A;  4QM8 A;  1AL2 1;  1OQD A;  1W0N A;  3NKT A;  1PVX A;  1EY2 A;  1UOG A;  3HBK A;  1UY3 A;  4GB3 2;  1QF3 A;  3ZMO A;  4QM9 A;  2WT1 A;  1R08 3;  1YWK A;  2WSV A;  4OUS A;  5LZ6 A;  1YQ6 A;  1SBF A;  1RL3 A;  2ARB A;  4RD7 A;  4AAP A;  3LA2 A;  4ATF A;  4A2U A;  1GBG A;  2DUP A;  1V70 A;  2NM1 A;  4JTN A;  4YGE A;  4YZ4 A;  4EWE A;  1K5M A;  4D6Q A;  4Z1V A;  2A3X A;  5C7G A;  5IVY A;  5LK7 B;  1J3Q A;  1OXC A;  1AR7 1;  4O61 A;  2DCK A;  4H7M A;  4JRA A;  4UXA A;  5A7W A;  4AGG A;  4AEK A;  2DF7 A;  4PT6 A;  1AHS A;  2WT0 A;  4F83 A;  2V5Y A;  4WM7 B;  5F2S A;  3WZ1 A;  4BOW A;  3H7J A;  1H1A A;  4E2Q A;  4NWW A;  1S55 A;  1HRV 1;  1SAC A;  3H3Z A;  2Q1Z B;  5E89 A;  3H0O A;  4A6S A;  4BHP A;  4CUG A;  3URF A;  1NQJ A;  2ZGN A;  2FDI A;  2XQR A;  5L7O C;  4ZHN A;  2PTM A;  1NLQ A;  4CP1 A;  1ND2 C;  3JU9 A;  1RMU 3;  5K0U B;  3VHO A;  5FXX A;  4UF0 A;  2KR2 A;  2IXC A;  3Q8F A;  4GXL A;  1GQH A;  4TXW A;  5ABJ B;  3VD3 A;  5I93 A;  1HLC A;  4BIS A;  4Q5O A;  2B8M A;  3E6B A;  5LBB A;  1DYP A;  5CFD A;  4J1W A;  4A44 A;  4AHY A;  1Q8Q A;  3AZW A;  3VBO B;  3VL9 A;  5C3P A;  4IEZ A;  2CAU A;  5IFT A;  1TMF 2;  5BNO B;  3GHM A;  4K21 A;  2RS3 1;  2ZAA A;  1M06 G;  1OVP A;  2X29 A;  4COU A;  1VBD 1;  2I07 B;  4IL7 A;  4RSU A;  4OI1 A;  5FY4 A;  4KMQ A;  3OB8 A;  4N53 C;  4CCM A;  4HG6 B;  2VJX A;  4IER A;  2W46 A;  1QJU 1;  3UK9 A;  2BP6 A;  3VDC A;  1W9T A;  3ZKY A;  2ARC A;  2VUJ A;  4K40 A;  4GWN A;  4W50 A;  3PJQ A;  4B1M A;  1W6P A;  5T5J A;  3T30 A;  2XH6 A;  3AVS A;  3LDR A;  4ES8 A;  4XPV A;  5F7U A;  3VDD B;  1ZVF A;  3IAP A;  2R32 A;  3H8O A;  4DUX A;  1STM A;  5FZ3 A;  1WCD J;  2XHK A;  5D21 A;  3AMH A;  1UZY A;  3C3V A;  1H30 A;  5T5O A;  1VMF A;  2J1R A;  2P3Y A;  1BXH A;  3AMQ A;  3GCX A;  2AC1 A;  3SNM A;  1VAL A;  4FP3 A;  3M3I A;  1OQE A;  2AH2 A;  5IK5 A;  4P9I A;  4YG0 A;  1ZZB A;  2B9V A;  4JQT A;  1QJF A;  3VZK A;  4AHZ A;  1S0I A;  1KJL A;  3WQ1 A;  1KS5 A;  2Y6L A;  5J3U A;  3ZX7 A;  1Z0H A;  3ACH A;  1ULF A;  1O6U A;  4Q4X 3;  5KHI A;  4D6R A;  1X9T A;  2GP5 A;  4DO0 A;  1DDL A;  1PMJ X;  3PUA A;  1VBB 1;  4LEJ A;  5FRE A;  4UT5 A;  4CCD A;  3R6S A;  1MEC 2;  4QPI B;  2JDU A;  5T5P A;  4DPN A;  1QJZ A;  1W8H A;  1UW8 A;  4SLI A;  4QU2 A;  4XDP A;  5C9A B;  4Q4V 2;  4XET A;  1V6L A;  1W9Y A;  1OOP C;  3ZR5 A;  3DPR B;  1POV 3;  3O7O A;  3VBS B;  5FPA A;  3VKL A;  5G05 L;  4MET A;  4IV1 B;  1R08 2;  1R09 3;  3B02 A;  4YW6 A;  3WG3 A;  1XPW A;  2D6K A;  5A7O A;  2Y6H A;  3E6C C;  5LW9 A;  1F8V A;  4FTE A;  2DUQ A;  2DV9 A;  3AKT A;  3B94 A;  3MLJ A;  2UY9 A;  3NVC A;  3Q8A A;  2F4L A;  2VCA A;  5FKC A;  2QNK A;  3BI3 A;  3BGA A;  4ZXK A;  4ISQ A;  4Y1V A;  3TWI A;  5BV6 A;  3LA7 A;  1OHF A;  2W52 A;  1OLM A;  4WM8 B;  3R05 A;  3ZOI A;  4FBF A;  5FZ8 A;  1VBC 3;  4Q4Y 3;  3RYR A;  1I1E A;  4Z82 A;  3OGR A;  4CXY A;  2LAL A;  4B4R A;  5FY1 A;  2YY1 A;  4LUK A;  4QPG A;  4AF9 A;  3GZT B;  3HEI A;  3SC7 X;  4XFH A;  5J48 A;  5A33 B;  2ZGR A;  3QOP A;  3CHX A;  3MV0 1;  4LLO A;  4ZU5 A;  2NPI A;  1RMU 2;  5ANN A;  3WP3 A;  2LS6 A;  3H8R A;  4RA0 A;  2ARA A;  2BYV E;  3JD7 1;  3G6J B;  3WOG A;  3NAP C;  5L9V A;  3M2M A;  2JDK A;  3VZO A;  1DGW X;  1RUD 1;  1UZZ A;  4BQ1 A;  1T6B X;  5F5I A;  3W9A A;  4QWN A;  4R9B A;  4A6O A;  4LBQ A;  5IVF A;  3T0D A;  1JZ7 A;  5A7S A;  5I91 A;  2DYC A;  5DDJ 1;  1QH7 A;  3GNE A;  3J8F 1;  1QNY A;  5A1A A;  2XKP A;  4XMA A;  5L7O B;  2WS9 3;  4NE9 A;  4HK8 A;  5C4W C;  1CGP A;  5C5T A;  1ND2 B;  3GCW A;  4YPJ A;  5F3C A;  4S2G A;  1VRH 3;  1BQP A;  4TLF A;  4XHX A;  4BMB A;  5BNN A;  1U12 A;  1NKG A;  4URT A;  4RFT 0;  1IZ3 A;  1PNF A;  5F3E A;  3H8X A;  4FTS A;  4Y5Z 0;  4X8P A;  1QJX 1;  3AMM A;  3AP7 A;  1UD1 A;  5GZF A;  2A5Z A;  3AKS A;  3BOW A;  3ILN A;  2X8K A;  4EJR A;  2HWF 1;  2VMG A;  3ZYR A;  3PL0 A;  2HEV F;  5FO7 B;  4CCC A;  3O5S A;  3WNO A;  4AI8 A;  5KHK A;  2JB8 A;  4FOY A;  5LRR A;  2X5I A;  5FUP A;  5IVJ A;  1RHI 2;  3KV9 A;  1DCS A;  4JDO A;  2I2S A;  1Q8V A;  4N53 B;  4I0B A;  5FZK A;  2QE3 A;  3L2H A;  1QQP 3;  1R1A 2;  3TNP B;  4BIO A;  4KQ7 A;  2VM9 A;  2WJS A;  3QCW A;  2X05 A;  1K3I A;  4AVT A;  1DQ5 A;  1QXR A;  4NMI A;  2A6W A;  3DV8 A;  1DGL A;  3CKH A;  4LBQ D;  1TQ5 A;  1ULE A;  1OQ1 A;  1W8T A;  4TN7 A;  1QDC A;  4UW3 A;  1QJY 3;  4XQD A;  3OBT A;  2JX9 A;  3TAY A;  3KCY A;  1YI7 A;  4GKY A;  1W2N A;  1EAH 3;  4AXO A;  3B5L B;  1EPW A;  4Q4X 2;  5JSO A;  3O0X A;  2WFP A;  3QD6 A;  1MS0 A;  2YV8 A;  1OA2 A;  3IIA A;  4OHX A;  3DF0 A;  4CDW C;  1LOC A;  3MW3 A;  2HYK A;  3SIS A;  4DQA A;  3GBW A;  3FLP A;  2V09 A;  1A3K A;  3NW4 A;  2QQU A;  3I2D A;  1UIK A;  3T0A A;  1ASJ 3;  1AYM 3;  4Y1Y A;  5FYH A;  4LQR A;  1DZQ A;  1FMD 2;  3FLR A;  4TYS A;  2BBV A;  2TUN A;  1DGW A;  1XSR A;  3AP4 A;  3M4F A;  4FPG A;  2MPF A;  2IXH A;  1YNA A;  3NMB A;  5C3O A;  5JOW A;  2PHF A;  3THP A;  3ROU A;  2W2I A;  2GNT A;  1C1L A;  3H7Y A;  3HNB M;  3WG4 A;  1UCX A;  3GYD A;  4YFW A;  2R1B A;  2EIC A;  4AG4 A;  3Q8C A;  1OLR A;  1V0A A;  3E1F 1;  3GDB A;  5FYZ A;  5JXH A;  1XNK A;  3N9Q A;  2OS2 A;  2E63 A;  4P08 A;  3ZO0 B;  4FFI A;  5FJH A;  5DN2 A;  1O4Z A;  1OI6 A;  3VD7 A;  4EN0 A;  1YJK A;  3CF6 E;  1UMI A;  3W20 A;  3PUR A;  1VBC 2;  1NZC A;  1HB1 A;  1RUC 3;  4Q4Y 2;  1OOP B;  4CCK A;  5AFE A;  3BUC A;  5JSP A;  1S0C A;  3P6B A;  1O3Q A;  3D3A A;  3PUQ A;  4PDW A;  2WZR 3;  2CV6 A;  5FYM A;  1EUT A;  3BKZ A;  1YHF A;  3LZZ A;  1LGN A;  2BQP A;  4NRQ A;  1W0P A;  3K4Z A;  1W3V A;  4I0W B;  4QDQ A;  4M3C B;  4Q2F A;  2BGC A;  4M4P A;  3LCP A;  1FAT A;  5LEJ A;  5LWB A;  2QJV A;  5FZ1 A;  3VN4 A;  3CEW A;  5FP7 A;  1VBA 1;  3EMR A;  1ENX A;  3ZFE C;  3GZA A;  4QHZ A;  3THD A;  3MF9 A;  2RDS A;  3S0M A;  4MVT A;  1NT0 A;  2J1V A;  4FXG B;  2X10 A;  3OBZ A;  5BYN A;  1COV 1;  1W8W A;  1WUV A;  3N36 A;  4BQ2 A;  2JIC A;  2FCU A;  2WS9 2;  3GBG A;  3MFC A;  4JV4 A;  4NRP A;  3I2G A;  1KGY A;  2R06 1;  4NPM A;  3POS A;  1NY7 2;  1VRH 2;  4DXR A;  3WDV A;  1YLL A;  1ZNP A;  2O14 A;  2HWC 1;  2HJI A;  4HVO A;  5E6H A;  5LA1 A;  3AP5 A;  4LE4 A;  1SLA A;  3NAP B;  4IQP A;  5B4N A;  1JU3 A;  3FE5 A;  3ZIW A;  3W5N A;  4QKB A;  3VD9 A;  3WNM A;  2VW0 A;  3I8T A;  5FZI A;  2CHH A;  1UO9 A;  5FBZ A;  1DQ2 A;  4LBM A;  3VKN A;  3OGG A;  3OOX A;  2VCB A;  4CEY A;  1XE8 A;  2JD4 A;  5A32 A;  5LA2 A;  5KHH A;  3DGT A;  4Y26 A;  2IVI B;  4AQT A;  3TN9 1;  5C4W B;  1LEC A;  4YSF A;  4NRM A;  1MAC A;  1QOO A;  4NR1 A;  3HVD A;  4Q4W 1;  1AZD A;  3QAC A;  2QKD A;  2VBP A;  1HJF A;  1QQP 2;  2HBT A;  3SH3 A;  1SQ4 A;  1CX1 A;  2QTW B;  1PM7 A;  5C8C A;  3LIH A;  3FBM A;  3UGF A;  4DMI A;  4KWJ A;  1DLC A;  1HXS 1;  1SDW A;  3KHB A;  2CWS A;  1W6N B;  1ZZ8 A;  4J1X A;  1PIV 3;  1UMZ A;  3LOI A;  2WFF 3;  1UXX X;  2LUW A;  3O14 A;  4L8Q A;  1TNF A;  1CZV A;  5CAZ A;  1EAH 2;  4DXS A;  3HN3 A;  2RS5 1;  3P5B A;  3FBY A;  5IFP A;  4LHN A;  5DMY A;  1OC1 A;  1IG0 A;  4CCO A;  2BFU S;  1JHN A;  2BWA A;  2JB4 A;  2HWD 1;  2P3K A;  4GZ9 A;  2RM2 3;  4R8H A;  1I5Z A;  4B7E A;  2OKX A;  3RSJ A;  3ZN6 B;  3POF A;  4IEP A;  4DRR A;  4I09 A;  3FHQ A;  4OQ9 A;  2IXI A;  1ASJ 2;  1AYM 2;  2CU5 A;  5AVA A;  1RVF 2;  3K77 A;  2F6B A;  3J26 N;  4CEW A;  4D69 A;  2R7E B;  3O1P A;  5EPA A;  3BVC A;  3MZH A;  5IVC A;  1NE4 A;  1W6M B;  4FVV A;  2CWM A;  4H14 A;  2J22 A;  4BH9 A;  4LUM A;  5FOJ B;  2OPW A;  4ZU7 A;  5F39 A;  5JSR A;  3LQC A;  2QQJ A;  1H8T A;  1O8S A;  2Y8K A;  4MSV A;  5LAS A;  1GU3 A;  4CDW B;  1JYI A;  4XJA A;  2ES3 A;  2CDO A;  2D97 A;  4LE3 A;  3VBF A;  2BBA A;  1J59 A;  1Q43 A;  2ZEZ A;  3KV4 A;  1H0B A;  1SLB A;  2Y0I A;  2ZKL A;  4FPH A;  1TME 3;  1URX A;  2ZGQ A;  1RUC 2;  4I3G A;  1CJD A;  2DCJ A;  4WVM A;  4YRD A;  3S6P A;  5CFC C;  4XIK A;  4NJ4 A;  2WZR 2;  1AX0 A;  3OPT A;  3C7E A;  4J6G A;  1C5I A;  4KWU A;  4AWD A;  1UU4 A;  4OI2 A;  3UKN A;  1W99 A;  4QXC A;  4JVA A;  1N1S A;  4P00 B;  4E2G A;  4E4S A;  3AP9 A;  3PIJ A;  3WG2 A;  2DBI A;  3GZU C;  2JG8 A;  4Q26 A;  5A3L A;  4GWM A;  4CXX A;  1CAX B;  1RUI 3;  4XAB A;  3RZM A;  1V6J A;  5AC9 1;  3TEX A;  1FPN 3;  4UYB A;  1DZT A;  3PU8 A;  5FYY A;  5F1R A;  1DQ6 A;  2HBU A;  2JKB A;  1JUH A;  3KCX A;  4Y4Y A;  2RG4 A;  1JYX A;  3OF1 A;  4LT5 A;  1UMH A;  1QMJ A;  1W6Q B;  4CP9 A;  4IGQ A;  1IPJ A;  3MV1 1;  1GIC A;  1REE A;  1S4C A;  2Y34 A;  1JOP A;  2BEO A;  1JOJ A;  1VAK A;  4MOA A;  1RUG 1;  5BXX A;  3U10 A;  5A7P A;  4CPB A;  5GJ6 A;  3BOP A;  1H1M A;  4AGR A;  3ZLI A;  3AKR A;  2FD8 A;  1VJ2 A;  4G9S B;  2W9X A;  2R04 1;  2OQ6 A;  1ZBA 3;  5CU1 A;  3VBR C;  1PVC 1;  3FFQ A;  1XE7 A;  1VLN A;  2RMU 3;  4KGG A;  4TWT A;  3WXP A;  1I3H A;  2W1U A;  1ULP A;  3GZE A;  1EUU A;  4N43 C;  4Y5T A;  2Q8O A;  2WZP P;  2D7F A;  1HB2 A;  5EV7 A;  3IDB B;  4RHV 1;  3ZFE B;  3HNM A;  4PQ9 A;  1Y9M A;  3AMP A;  4NN0 A;  1DP0 A;  2E7T A;  1ZA7 A;  4QGM A;  5FZG A;  3V0B B;  2Z5W A;  2ZAB A;  4QT6 A;  2KM2 A;  3RYP A;  1AJO A;  2PEL A;  5BUV A;  4CCL A;  4KWK A;  1XNT A;  5JOX A;  2WAA A;  3CJI A;  4AZZ A;  4XF0 A;  4NHX A;  3ZYH A;  2Y33 A;  2NQY A;  3ZXG A;  4J25 A;  2YU1 A;  2R0H A;  3PUH A;  1ODN A;  2EIB A;  2NZ9 A;  3HQR A;  2JDN A;  1H9W A;  1KXG A;  2JG9 A;  4N8M A;  5A1F A;  1MS9 A;  1GP5 A;  3NKG A;  5B2G B;  2VL4 A;  4GIQ A;  2D93 A;  4LTA A;  4Q8L A;  1PX4 A;  2WFF 2;  3PMS A;  3GGL A;  4HVR A;  4BZ4 A;  1YO8 A;  3UV9 A;  5HPO A;  1UY1 A;  3DL3 A;  4Q27 A;  4CPB D;  1VP6 A;  2WNU C;  1BK0 A;  4CZS A;  3CU7 A;  4GJY A;  3W59 A;  3MO4 A;  1H8V A;  3JQW A;  5KBF A;  2OUH A;  1LUL A;  4RR3 C;  4DY3 A;  5J7M A;  3S57 A;  3LWC A;  4HN1 A;  1GQP A;  1ZZ6 A;  2RDR A;  2RM2 2;  4COZ A;  2IXJ A;  2WO2 A;  3FN9 A;  2XLA A;  1QXJ A;  1LHW A;  2CYF A;  2ZOE B;  3FFZ A;  4Q1R A;  1FV3 A;  2XPJ A;  2XUE A;  1OH4 A;  2YBK A;  3ACG A;  3K4D A;  3LEK A;  4LOT A;  2E9Q A;  2Q8E A;  3AJY A;  1SLI A;  2ADE A;  4UW4 A;  4YM2 A;  5F6K A;  4JHZ A;  1G9C A;  1W8O A;  1PGW 2;  2NLR A;  4HPK B;  4JKL A;  3N9L A;  4BQ5 A;  5CVR A;  1N3O A;  2CL2 A;  2VOW A;  2Z4F A;  1C8N A;  3D5O A;  3VKM A;  1ULD A;  2J1U A;  3O1O A;  4LKF A;  4C90 A;  4MV2 A;  4XJZ A;  2G9F A;  3POB A;  1OF4 A;  1W0O A;  4IE0 A;  5FY0 A;  4D8M A;  1GOG A;  4A42 A;  4R52 A;  1TME 2;  1A8D A;  3I3B A;  4QB2 A;  5EIY B;  1AR7 3;  2BZD A;  3F95 A;  1CQ9 A;  5T5L A;  4XUT A;  3VD5 A;  2RJL A;  4FQZ A;  5FLH A;  1H1I A;  1WW4 A;  3ACI A;  3KZ4 C;  2RR1 2;  4I02 A;  4XQW A;  3A21 A;  4BM8 A;  2JIJ A;  2WL1 A;  4OUE A;  1GSL A;  4HSJ A;  4ATE A;  2DWR A;  3OEA A;  1LHV A;  1YFX A;  1LEM A;  4A7Y A;  2DVA A;  3JBG 1;  2VTX J;  4PI0 A;  5JDB A;  4EQV A;  3O1T A;  1XJA A;  3WF1 A;  4DZG A;  4YVS C;  4I2O A;  1CZT A;  1RUI 2;  1LRH A;  4C1W A;  5FYI A;  1FPN 2;  3O1S A;  3DYM A;  1LCL A;  3LIG A;  4MAD A;  2DU0 A;  1NYW A;  2Y6F A;  3AZV A;  5FZD A;  2PLV 1;  1C28 A;  1OH3 A;  4JGY A;  2DDU A;  5KR7 A;  3RZK A;  1UNB A;  1CAW B;  2ZZQ A;  2PHR A;  2VGD A;  2KXL A;  4QQ2 A;  1OD5 A;  5DXD A;  2JDZ A;  4OHZ A;  4CDQ C;  4IW3 A;  5FWJ A;  1C8M 1;  2WII B;  1DFQ A;  5FXZ A;  3N7K A;  1LR5 A;  1SLL A;  2VH9 A;  1ZBA 2;  4YVW C;  1KFX L;  2RMU 2;  4XJW A;  5TSW A;  1UOB A;  1O7F A;  2RS3 3;  1R1Z A;  2ORZ A;  3H9A A;  3ZYI B;  2HWB 1;  2VUD A;  3FLT A;  3WVJ A;  1ZRD A;  1VBD 3;  3VLB B;  2LW8 A;  3VKF C;  4AQ2 A;  3AVR A;  2ZML A;  1RUH 1;  1QJU 3;  3AP6 A;  3ES1 A;  3MYX A;  3WCS A;  3SMH A;  5CZK A;  1GZW B;  2ZAH A;  3J9S A;  5L36 A;  1HB4 A;  4XUQ A;  2RHP A;  5E88 A;  3VUO A;  1PZ7 A;  2AEZ A;  4QX0 A;  1CR7 A;  5D2A A;  2AYH A;  2D3P A;  3AM2 A;  3POG A;  4MGI E;  2PAE A;  1BCX A;  4XBL A;  4LIT A;  3RZZ A;  3S5A A;  4DXZ A;  1W28 A;  3A23 A;  4N43 B;  2CTV A;  2W94 A;  2VCC A;  3MIB A;  2XQX A;  4EN7 B;  1DQ4 A;  2JDM A;  1W2O A;  5J98 B;  4BK4 A;  5HBA A;  1PX3 A;  5I0U A;  5F2W A;  4OHV A;  2GAU A;  4EN6 B;  1APN A;  2XLG A;  1TG7 A;  3PVO A;  5EJ1 B;  5C71 A;  1WZX A;  3FHA A;  5I0R A;  1LOB A;  2D3S A;  5JWP A;  3I3D A;  5HV4 A;  3MBW A;  5JXJ A;  4JGZ C;  2ZS6 B;  3NL1 A;  1LOG A;  2PHD A;  1MPX A;  4BJ0 A;  4BQY A;  2JDA A;  4XYX A;  3V56 A;  5KHJ A;  5KXC A;  4RYD A;  1VBB 3;  3J7H A;  3AKP A;  5CFD C;  3NJX A;  1HDK A;  2MEV 2;  3HBZ A;  1Y3T A;  3R4S A;  3M7A A;  4CU7 A;  2K0G A;  4W65 A;  1IS4 A;  4WM7 A;  2R07 1;  4LKS A;  4QX2 A;  3USS A;  1W2U A;  2GND A;  4XFI A;  2WNU B;  3DKW A;  2P3J A;  1AXZ A;  2BV4 A;  1MVQ A;  4RR3 B;  4Z8B A;  4FPY A;  5I0T A;  1U5I A;  3WDW A;  1FOD 1;  1OD3 A;  2W92 A;  2ZMN A;  2PQQ A;  4ZS3 A;  3UGH A;  4P5H A;  1G9B A;  1JTZ X;  3AZZ A;  4NAM A;  2ZPX A;  4YG6 A;  1V9U 1;  4LNV A;  2GH2 A;  2NMO A;  4MUV A;  5ABJ A;  2VPV A;  4IUG A;  5SV5 A;  4FI9 A;  2Q30 A;  1QU0 A;  1YUD A;  2DBN A;  2ZXQ A;  1J84 A;  3VBO A;  5CYY A;  1PO1 1;  4BXS V;  4M3C E;  2OPK A;  4IE6 A;  2DUO A;  3KT1 A;  1BLZ A;  5BNO A;  1QH6 A;  2VBB A;  1WCU A;  3HT1 A;  5FK7 A;  2VOV A;  1X33 A;  2XJV A;  2WN2 A;  3LF7 A;  4FOW A;  5FFO C;  2QQV A;  1DBN A;  4RQP C;  3RMX A;  1SCS A;  4N9H A;  2VG9 A;  5F3G A;  3NNJ A;  3JD7 3;  4Y3O A;  5JR2 A;  3KHC A;  4QB1 A;  3PDQ A;  3LD8 A;  3RWN A;  4IEV A;  1CAV B;  1RUD 3;  5JMC A;  1HX6 A;  5ISL A;  2AZ5 A;  3DEC A;  3VDD A;  5A3U A;  4H3W A;  4UW5 A;  3BTA A;  2WRA A;  3VBH B;  3J8F 3;  2PHU A;  2QZ3 A;  5FUN A;  2VMH A;  4DOU A;  1HRI 3;  2RS3 2;  1FAY A;  1LOF A;  5GZD A;  4C8D A;  5G04 L;  2PA7 A;  2W1S A;  1VBD 2;  2VQU A;  5GM0 A;  4QX5 A;  1MQT C;  4NAO A;  5T55 A;  1XBF A;  5FY9 A;  4GB3 1;  4TZD A;  1W9W A;  3PVB B;  3OBR A;  4LKD A;  4XIL A;  5FPZ A;  1NCQ C;  1F35 A;  2P3I A;  4CDQ B;  1QJX 3;  2H6C A;  4P14 A;  1G9A A;  3ZXF A;  4BLJ A;  4N90 A;  1AR6 3;  5IHR A;  1H4G A;  1Q5O A;  3MW2 A;  2HWF 3;  3UYJ A;  2BNM A;  4R9D A;  1D7P M;  4ZPI A;  2XVK A;  3ECQ A;  4YVW B;  4XJ9 A;  3WUD A;  4B3N A;  1DHK B;  3KCC A;  2Q4S A;  4JAA A;  4BYY A;  2ZEY A;  4NWV A;  5FPB A;  4WVZ A;  2YPJ A;  5T3N A;  4QPI A;  4KNC A;  3ZIX A;  1RUE 1;  1IQD C;  4RL7 A;  4E8D A;  2A6X A;  1F4A A;  5A80 A;  5FTT C;  2XG3 A;  3DPR A;  5JLV A;  3NJV A;  3VBS A;  3VHN A;  5F9T A;  2HWE 1;  4IV1 A;  4BB3 A;  1QHD A;  1VIW B;  3AZY A;  3MIH A;  1MR5 A;  1MS8 A;  1GP6 A;  1DG6 A;  5IWF A;  1TZO A;  3G7D A;  3KWV A;  2AEN A;  2P37 A;  4COY A;  3UKT A;  4CDX B;  1WW6 A;  2FCT A;  3PUS A;  2FHR A;  4JHT A;  1VBB 2;  2TEP A;  3UL2 A;  2QUO A;  4OCT A;  1UIJ A;  2B45 X;  4NHK A;  1QIQ A;  1QY4 A;  1Q56 A;  5DAW A;  4R4Z A;  4WM8 A;  4BDV B;  5JXI A;  4FPF A;  1TMF 1;  3UT0 A;  1J83 A;  3BAL A;  2XJQ A;  4BA6 A;  3SXW A;  2A71 A;  1K5J A;  2CDP A;  2AEY A;  1F4H A;  5FO9 B;  1A78 A;  1BEV 1;  4H55 A;  1UPI A;  3N9N A;  2WNV C;  1O91 A;  4JGZ B;  4ASL A;  1HN0 A;  1O5U A;  5BNN C;  2J7M A;  2I45 A;  5T52 A;  4P5Y A;  2YB7 A;  3C7H A;  1K45 A;  4PIY A;  3UET A;  1K12 A;  4LUL A;  4XAC A;  2XKO A;  3PVE A;  1CJP A;  3FMG A;  1ND3 A;  1ULO A;  1IGO A;  2ARE A;  1WMX A;  4YW1 A;  5HXV A;  3IB3 A;  4YYO A;  3LKJ A;  1OUS A;  3OPZ A;  4EWA A;  4MXV A;  4WVW A;  5FZ9 A;  4UFH A;  2A1X A;  4DIQ A;  2DVF A;  5CKM A;  3RJR A;  1CPN A;  1L3J A;  2RJ2 A;  1SHW B;  4OQ8 A;  3ZSJ A;  2X5I C;  4JX0 A;  1J58 A;  3SEE A;  5HCH A;  4I30 A;  3OYW A;  3SLI A;  3WF3 A;  5L7O A;  3M3C A;  5BNP C;  3LFI A;  1GZC A;  2PHX A;  3HR9 A;  5L9R A;  3W5M A;  1ND2 A;  3J7N A;  3D4K A;  4XC9 A;  4Y20 A;  4XUR A;  5FJK A;  1JMU B;  5FO8 B;  1LU2 A;  4LBO A;  2HH9 A;  5F32 A;  4YLZ A;  3FC0 A;  3JD7 2;  5FMD A;  4FFF A;  5K4L A;  3VZN A;  5I0D A;  3I3Q A;  1SMV A;  2QFE A;  4MGS A;  1RUD 2;  5FYC A;  1SBE A;  1VBA 3;  5C3R A;  3KF3 A;  4QX1 A;  2BFU L;  2ERF A;  4IEX A;  2VXR A;  4QX7 A;  4GWI A;  5FV3 A;  1COV 3;  1HRI 2;  1MEC 1;  3BU0 A;  5IYY A;  2XWB B;  3NV2 A;  2R06 3;  2XL7 A;  4PQQ A;  4UI9 L;  1DQ0 A;  4Q4V 1;  5IJR A;  4AED A;  4ZON A;  1DLL A;  4RQP B;  3FX3 A;  5IW0 A;  5CBL A;  1FT9 A;  1YQ2 A;  2WO7 A;  1MS4 A;  1NLS A;  2Y64 A;  1RYY A;  2EID A;  3BOD A;  5FIX A;  1W04 A;  3E6D A;  4AEM A;  4CP0 A;  5IT6 A;  1FXZ A;  3D0S A;  5H9P A;  4ASM B;  1AR6 2;  2VUA A;  4YNI A;  1Z7S 3;  2HWF 2;  4YW7 A;  3ZFG A;  2CGP A;  1AR8 1;  3III A;  3WW2 A;  2XB6 C;  3L2Y A;  3IZO A;  4LO5 B;  1YQ5 A;  2V73 A;  3IDA A;  2VVD A;  1HN1 A;  4MGK E;  3MID A;  2RJK A;  2NN8 A;  3TN9 3;  1RED A;  4Q4W 3;  4M01 A;  3F2Z A;  3WIN E;  4AI3 A;  3QH7 A;  3KT4 A;  2C24 A;  1MQT B;  1W8Z A;  1JW6 A;  4ZY9 A;  1PNG A;  1FNY A;  2ZBJ A;  4KL1 A;  3T2O A;  2E51 A;  4PDW C;  2QQO A;  1NCQ B;  1QNW A;  1MZF A;  3ELN A;  3N9P A;  1XYP A;  4YZ5 A;  2YPD A;  1US3 A;  2VW1 A;  4PCR A;  5FZ0 A;  4CCN A;  3OGS A;  4Q1P A;  2ZA9 A;  1WW7 A;  3ON7 A;  4L11 A;  4HON A;  3CZU A;  2QQL A;  5IAV A;  1JZ6 A;  2FMY A;  2C0Z A;  2Z69 A;  1IKP A;  4Y22 B;  5ERL A;  5JZG C;  2RS5 3;  3CIH A;  4YM3 A;  5K7P A;  3HD8 B;  2OXB A;  3VV1 A;  2Q1F A;  2YC0 A;  1EPZ A;  2HWD 3;  4MZU A;  5FRA A;  2UWA A;  4A45 A;  3UNP A;  4P9L A;  2ZGL A;  4BXF A;  3VD4 A;  1UYZ A;  3K2O A;  4QQP A;  1RUO A;  2GH8 A;  1OOP A;  1JHJ A;  1S2B A;  2W3J A;  3N9O A;  2PHW A;  2V4V A;  4XDQ A;  4XJ8 A;  1G9F A;  2JEN A;  1IG3 A;  2ATF A;  4C0B A;  1B35 C;  2HKX A;  3HIF A;  4FAH A;  2JIG A;  1S0G A;  4M3C A;  5FP8 A;  4XFG A;  5JIA A;  5FLI A;  2E6V A;  4BQX A;  3ZN4 A;  1SZB A;  3USU B;  1NOV A;  3A4U A;  1POQ A;  1BBT 1;  1R64 A;  4JQR A;  5FUI A;  3LPF A;  1GNZ A;  3EB7 A;  1QOS A;  1E5H A;  1W3X A;  3IWZ A;  4PBO A;  4QKN A;  5KXE A;  5LCW L;  5EZW A;  4CEY C;  1LOD A;  1R09 2;  2C9A A;  4PBP A;  1RHI 1;  2ZJC A;  3HPN A;  2QDN A;  1NXM A;  2GMP A;  4QXK A;  4KI5 M;  5IAT A;  4Y5S A;  1E5R A;  2WNV B;  3M1H A;  1R1A 1;  3ETP A;  5BNN B;  1UOJ A;  2QQP A;  4QDS A;  2EAL A;  1S0B A;  2WLP A;  4FPO B;  4L97 A;  4C91 A;  5C8C C;  2GZW A;  4MH0 E;  1V00 A;  2D3R A;  2WO3 A;  4OZX A;  4YW4 A;  2PQS A;  3NV4 A;  2FDJ A;  1YEW A;  4ASK A;  5AC9 3;  3ZPO A;  4ZU4 A;  1F5F A;  2W1Q A;  1ULG A;  4G3Y C;  1NAE A;  2LRP A;  4K8R B;  1BMV 2;  1YJL A;  3CQO A;  1OA4 A;  2RDN A;  1QWR A;  2X5I B;  4HAN A;  1GNY A;  3THC A;  3RZJ A;  5JI7 A;  1QDO A;  3RZG A;  1FYU A;  1S0J A;  2VNR A;  5DAX A;  5BNP B;  4DUV A;  1RUG 3;  3GHN A;  1WLC A;  5C4W A;  3ZFF C;  5A3M A;  1IS6 A;  4MG2 A;  4EV0 A;  2CAV A;  2R06 2;  2WQ4 A;  5CNA A;  1VAM A;  2R04 3;  3EYP A;  2XHN A;  5L19 A;  1RUF 1;  3ASI A;  2YFZ A;  4XCA A;  3ST7 A;  1FMD 1;  2B46 X;  1POV 1;  2P1B A;  1V6N A;  5FBJ A;  4DIN B;  4CU6 A;  2HLE A;  1VAV A;  2WT2 A;  4IEQ A;  4Y1X A;  2BGO A;  2W95 A;  1JZ2 A;  3O1R A;  1PK6 A;  2EVX A;  4LBJ A;  1ST8 A;  4IES A;  4RHV 3;  3NWK A;  3AL5 A;  2VTF A;  4PI2 A;  1W6N A;  2YXS A;  3FUQ A;  5FK8 A;  2OT7 A;  2QQI A;  1Z7S 2;  4GA9 A;  1H8T C;  1SCR A;  1Y4W A;  4IGP A;  4ET7 A;  3I3M A;  5GLT A;  1LJ7 A;  2NP0 A;  3M3Q A;  5KWR A;  2YZ4 A;  2RV9 A;  3VBF C;  4Q4W 2;  4GWJ A;  1F5J A;  3IBM A;  2O0O A;  4I3P A;  4DEQ A;  4LHL A;  4QU1 A;  3HJR A;  4EZH A;  5JAX A;  3HMY A;  2IXK A;  1GZT A;  5K9Y A;  2LRO A;  2RS1 3;  2ZX4 A;  3ABZ A;  2W47 A;  2A3W A;  1TE1 B;  2ORX A;  3MLK A;  4KBZ A;  3ZSE A;  4XZP A;  4NPR A;  1XE0 A;  2YGL A;  3LA3 A;  2Y38 A;  3QH6 A;  3ZSL A;  2W1W A;  3WD5 A;  1IOA A;  1IHM A;  3M3E A;  1BYH A;  1W6M A;  3AK0 A;  3E5U A;  1OMI A;  3PUI A;  2VEC A;  5LB6 A;  2DU1 A;  3KQR A;  1XXN A;  2RS5 2;  3EO6 A;  2GMM A;  4LO8 A;  4Q0Q A;  3DEM A;  3O0V A;  4I01 A;  3WQ7 A;  3N9M A;  4W6W A;  5JVV A;  2ZGO A;  2HWD 2;  4OMD A;  4PDW B;  1H4H A;  2A6V A;  2DCY A;  4TTG A;  1JOB A;  1GWL A;  2HYX A;  5DUV A;  5DZG A;  1QJY 2;  1UYX A;  1OKO A;  5JUV A;  4YZ3 A;  1VRH 1;  2ZEW A;  3IN9 A;  4CU9 A;  3V0A B;  4NIH A;  3AC0 A;  4Y4R A;  4AVC A;  5DUX A;  5JZG B;  4GAZ A;  1UKR A;  2VE1 A;  2WQZ C;  3I2F A;  1ZX5 A;  1YFY A;  4B4P A;  4CTE A;  2RVA A;  4EN9 B;  3RGB A;  4UFJ A;  3KGZ A;  4UOJ A;  4DXT A;  2XL9 A;  1ZRR A;  3DKQ A;  4FPL A;  1ZYB A;  1WA6 X;  4PLN A;  3WNP A;  1XNA A;  3LSD A;  2UYB A;  4FP2 A;  5HI0 A;  1OT5 A;  1RTV A;  2ZHM A;  1W6Q A;  4WV8 A;  4EZ4 A;  4FOV A;  1LGB A;  2IFW A;  4W8J A;  4LO6 B;  3L9J T;  1QXP A;  3U37 A;  1QQP 1;  3KQ4 B;  1D4M 3;  1B35 B;  1LHN A;  3KLS A;  3POW A;  4B29 A;  2BOI A;  2VNO A;  3OSD A;  3POE A;  4B7K A;  2O8Q A;  5F8P A;  3P3P A;  4Y1Z A;  4PHZ A;  1GZ9 A;  2WWJ A;  3O1V A;  3JBG 3;  4A4A A;  1KRI A;  1IS3 A;  1F31 A;  1W6O B;  1KQR A;  3ITQ A;  5AC9 2;  2QVS B;  2VAU A;  3DN7 A;  3RRD A;  4V1P A;  5GZE A;  3ZFE A;  1EAH 1;  1UY2 A;  2PLV 3;  3KV6 A;  4IGO A;  4CEY B;  5A32 B;  3VDB A;  4HL0 A;  2A6Z A;  4OMC A;  4R9C A;  4XQ4 A;  3WDY A;  4QQH A;  1WGP A;  1NCR C;  2EXH A;  4MX3 A;  3WNK A;  4GKX A;  1JYV A;  3V0B A;  5C6C A;  3TEW A;  1C8M 3;  2D6N A;  1RUG 2;  3AZX A;  4AFC A;  3D6E A;  2IFR A;  5C8C B;  1RXF A;  3B7M A;  2R04 2;  2N7G A;  4XTM A;  2D43 A;  1S2K A;  1RVF 1;  1T6G C;  5HCB A;  2HWB 3;  2GDF A;  3CDZ B;  1KDM A;  1ZM1 A;  1RIN A;  2ZCW A;  3KM5 A;  3POI A;  5FPU A;  5FOB B;  2DTW A;  4RHV 2;  1W8N A;  2QBX A;  3KMH A;  5CG8 A;  2QDR A;  4A3X A;  1ULC A;  3DUI A;  2WDB A;  1ENQ A;  3MGU A;  5FY7 A;  2Q5T A;  3AYA A;  4MXW B;  3S30 A;  3O1U A;  1OPM A;  1KD7 A;  2GU9 A;  4HSL A;  4K1Z A;  3ZXA C;  4KG0 A;  3IPV B;  3LDB A;  3ZFF B;  1U5X A;  4MGZ E;  4N9I A;  1XYN A;  2P4E A;  3EJK A;  4A7K A;  3MEP A;  4H2A A;  2R49 A;  2GNB A;  1EV1 1;  3BU7 A;  1RUC 1;  1XQN A;  3AFG A;  2EF6 A;  3WEZ A;  3ZDS A;  3ZXE A;  2OZJ A;  3BPS A;  4K3U A;  1Q3E A;  2RS1 2;  5I0S A;  1AL0 G;  2XJP A;  2QQW A;  1G6N A;  4R4X A;  2GN3 A;  1O3R A;  2J1T A;  2WYF A;  4X6R B;  4AVV A;  1WME A;  2XJR A;  4GUL A;  1AYN 1;  2XJS A;  1WKY A;  4XXA A;  3RMY A;  5FZ4 A;  4CE8 A;  4XFB A;  4HPK A;  4IXL A;  2QQK A;  1Y9G A;  4V2W A;  1GOH A;  4E2S A;  3NQH A;  1ZZ7 A;  2IXL A;  3FWE A;  3WR0 A;  1AX1 A;  2WYS A;  3KD4 A;  1QOT A;  3VBF B;  3N7J A;  1OPO A;  2JE8 A;  4IV3 C;  4ARX A;  3AYD A;  2RDQ A;  4BPZ A;  1Q8O A;  2ZKN A;  4U36 A;  5FXW A;  5GZG A;  1GNH A;  4RS5 A;  2V72 A;  5FP3 A;  5DZF A;  1D0H A;  3Q8B A;  1OFN A;  2V5D A;  1PIV 2;  3MW4 A;  1HQN A;  4XMI A;  5FZC A;  4B4Q A;  5FZO B;  2EIE A;  5FYV A;  1HQL A;  4DEV A;  2BPA 2;  2R07 3;  3B69 A;  1AXY A;  4NOT A;  1NXD 1;  2VZ3 A;  1L7L A;  4Q0S A;  3POY A;  4Z92 B;  1OKQ A;  5A6X A;  3ZYF A;  2ILM A;  1O8P A;  1LOA A;  4CP9 B;  1UYY A;  5JMO A;  1PGL 2;  4AFD A;  3AXE A;  5JCT A;  1N1Y A;  3VHR A;  4NO4 A;  5BPX A;  2LM3 A;  2TBV A;  3ETQ A;  5DQ0 A;  5IK8 A;  3RZH A;  1C3H A;  1QJE A;  3EXU A;  4ZS2 A;  1JUI A;  1AL2 3;  3OGJ A;  1L7Q A;  3AX4 A;  3CMG A;  1H6X A;  1UYP A;  3IAQ A;  5A3P A;  1D4M 2;  5LK5 A;  4S2H A;  2B39 A;  1CAU B;  1LEN A;  2C9K A;  3E5Q A;  4LHK A;  4Z2A A;  5J09 A;  2VOT A;  1IPK A;  1TEI A;  1HW5 A;  1PO1 3;  3H3U A;  3JBG 2;  4FT8 A;  5FZM A;  5E16 A;  5FY5 A;  3CL1 A;  4Y24 A;  1NA1 A;  1BHG A;  5FZB A;  3WF4 A;  2YU2 A;  4HBN A;  3I4I A;  5LBF A;  1T2X A;  3ZXK A;  2YBS A;  3PVN A;  3WP6 A;  2PLV 2;  4OLL A;  3ATG A;  4KWL A;  3ZSM A;  4BWO A;  1A6C A;  4XBN A;  3U4X A;  1REF A;  2Q8D A;  3THT A;  3JZV A;  5JI9 A;  4WZF A;  1HQW A;  2ZGT A;  1HRV 3;  2VZU A;  4IND A;  2VMI A;  2XJU A;  2RM2 1;  4M00 A;  4UW6 A;  4XDO A;  5E8A A;  4IEO A;  1UY4 A;  4JDM A;  5D8A C;  5FKB A;  2GC0 A;  2DFB A;  2R1D A;  2X09 A;  1FI2 A;  4YGC A;  4AQ6 A;  2YG0 A;  5IVV A;  1J3P A;  2DVB A;  4E27 A;  2YYO A;  2P34 A;  4LIU A;  5EJ3 A;  5FLJ A;  5JPN B;  1LAJ A;  4N43 A;  5EWS A;  3U1X A;  5CFC B;  1JBC A;  1O59 A;  2HWB 2;  4HKL A;  4CVU A;  2PN5 A;  2D6P A;  3LAG A;  2VR4 A;  3WDU A;  1X8E A;  2ZGP A;  1O3T A;  3OCP A;  5A6Y A;  4GB3 3;  3IMM A;  4NPL A;  4XHB A;  3U75 A;  2MNG A;  4D7T A;  1NCR B;  3VGI A;  1WCQ A;  1UAI A;  4XJU A;  3VBU C;  4F3J A;  2R30 A;  3OY8 B;  1D0G A;  4PF1 A;  5I8Y A;  4OI0 A;  1UZ0 A;  2VU9 A;  3WNL A;  4CDU C;  2A75 A;  5F3I A;  1YQC A;  1SLC A;  2NMN A;  1GP4 A;  3DYO A;  2Y6K A;  2B42 B;  3PU3 A;  4MGY E;  4YGD A;  3IMN A;  3S7E A;  3ZYB A;  4AFM A;  5ACA 1;  4FFH A;  1RUJ 1;  3VZL A;  1K42 A;  5CKQ A;  2RR1 1;  2WUH A;  4ES9 A;  5F5A A;  4LA2 A;  2R16 A;  1ZBE 1;  2ADD A;  1ZRE A;  1X36 A;  1PO2 1;  2BUK A;  2GN7 A;  3LSE A;  1O5L A;  2D98 A;  1RUE 3;  4HXC A;  1A8M A;  1KFU L;  3PTY A;  1G7Y A;  1K5M C;  1ALY A;  1XND A;  3ZN5 A;  2JEM A;  2WNU A;  3PTR B;  4QHO A;  3VBR B;  4B1L A;  2F4P A;  1W06 A;  1UU5 A;  3HN1 A;  3LB9 A;  4GH4 A;  2E7Q A;  4JRL A;  2Z2S B;  1N47 A;  1NLR A;  2EXK A;  2HWE 3;  2QZ2 A;  4XIO A;  5GZC A;  1WMD A;  3BN6 A;  2AGS A;  4Z2W A;  4BK5 A;  5LBC A;  4AFB A;  4W6Y A;  2DCZ A;  2ID4 A;  5A70 A;  4OZO A;  1WMF A;  1NZI A;  4QPW A;  2ZX1 A;  1DGR A;  1TVG A;  5DUU A;  1CON A;  4DUW A;  1MZE A;  3ZYJ B;  4C0H A;  4GMP 0;  2P2K A;  2PAK A;  2RMU 1;  4KU7 A;  2R07 2;  5DUW A;  5JOY A;  2DCT A;  2UY8 A;  5GKA C;  2G9G A;  2DUR A;  4JDN A;  4AVA A;  2EXJ A;  1YC6 1;  1BEV 3;  5H9R A;  2VOK A;  3KT7 A;  4IV3 B;  4U2A A;  5AVP A;  3RYK A;  1AF9 A;  1PZ8 A;  1UWW A;  2PYT A;  4QAW A;  2YDE A;  1WBF A;  4QKF A;  4GMP 1;  4RGA A;  5C70 A;  3ZYP A;  1UZV A;  2VMD A;  4XVH A;  2BVV A;  1VBE 1;  3W58 A;  5C3Q A;  1JXN A;  4F8A A;  4O7X A;  3S5Q A;  4OVE A;  3ZPY A;  1AL2 2;  2A6Y A;  1LOE A;  3BYW A;  1XNC A;  1AR9 1;  3C7O A;  4FO9 A;  2EIG A;  2AR6 A;  2OUJ A;  2DVD A;  3JUU A;  5DG1 A;  3VBH A;  2VD7 A;  1DYO A;  1PO1 2;  3MI8 A;  2C6S A;  2Y60 A;  3I49 A;  2J1E A;  3CO2 A;  4FXK B;  5K0U A;  3O1M A;  3O0W A;  4N7U A;  4OUM A;  4ZXE A;  1RC6 A;  2BNN A;  2CY6 A;  5KC5 A;  2WSU A;  1AR7 2;  1O4T A;  1XB9 A;  3WW4 A;  3WF0 A;  1X82 A;  4L0P A;  3UJO A;  1JI6 A;  3CLP A;  3DPR C;  5FR3 A;  3VBS C;  2VVE A;  2LTN A;  1AVB A;  2SBA A;  2WNO A;  3SKV A;  1N1V A;  4AK3 A;  1F2N A;  1JZ8 A;  2XWJ B;  1HRV 2;  4PJY A;  3NV1 A;  4NHM A;  4ZKT B;  1P8J A;  2BWC A;  3I2K A;  2IUW A;  4DB5 A;  4LMF A;  4XFF A;  4QGN A;  1YYN A;  4HLT A;  2O8O A;  1SPP B;  2MEV 1;  2EAA A;  1YFU A;  3E5X A;  4F7Z A;  3IKW A;  3WT3 A;  5LY1 A;  3SIT A;  3D8C A;  4Q4V 3;  3ME2 A;  4YZ2 A;  3JCI A;  4XF3 A;  3IT8 A;  2W5F A;  2ARX A;  2WA4 A;  3M3O A;  4XAA A;  5FPX A;  3I59 B;  3K46 A;  2B7Y A;  3WDT A;  5FYU A;  5FQ0 B;  4YW5 A;  2H0B A;  3T2T A;  1GQG A;  4AYU A;  5DDJ 3;  2D5H A;  2VZO A;  4AL9 A;  5D8A B;  4RGG A;  4YVS B;  2XBO 1;  1AR8 3;  1CWP A;  1HV0 A;  1ND3 C;  4MYE A;  2W87 A;  4I0A A;  2WC2 A;  5HCF A;  4E4D X;  3WQB A;  2WWS A;  4CDX A;  2D5F A;  4QB6 A;  4G4F A;  1QJU 2;  4HMZ A;  5DPN A;  3EHK A;  5J96 B;  3H1W A;  4L92 A;  4Q0P A;  4WBB A;  2L9L A;  3AMN A;  1XYO A;  4IE5 A;  2XVL A;  3J7M A;  4LOS A;  3ZYG A;  4WZC A;  1D2S A;  4X6Q B;  2VME A;  1C1F A;  1RUE 2;  2YMZ A;  3WX5 A;  4BE3 A;  1Q8S A;  3K75 B;  2VUL A;  5E1R A;  2VZV A;  2JE7 A;  3HT2 A;  3VBU B;  2BGP A;  2HEW F;  4E8C A;  2BJS A;  4QXH A;  3N7L A;  4S2F A;  2HWE 2;  3JXS A;  4CDU B;  4JGZ A;  5FMC A;  3MF6 A;  3RPQ A;  4BU2 A;  3ZSK A;  4NRO A;  3RWK X;  3OPW A;  2G19 A;  4XF4 A;  3PLQ A;  4CUA A;  4JKM A;  1S0D A;  5CKN A;  1GWM A;  2WQ8 A;  5L9B A;  3T09 A;  1SDD B;  3WHU A;  5C9A A;  4ZZ8 A;  4QPG C;  4P9J A;  5FDB A;  1LHU A;  4HOO A;  4L2N A;  3T2P A;  2XML A;  3OEB A;  4XFC A;  1PZ9 A;  1QEX A;  2C5D A;  4AI9 A;  1S1A A;  1K5M B;  5F6L B;  1GMM A;  2VZS A;  5D1I A;  1ONA A;  4CYD A;  1NG0 A;  4O9G A;  1KIT A;  1OLQ A;  4QDR A;  5LBE A;  3ZDV A;  4D7S A;  2FDF A;  3LDK A;  4AED C;  1BEV 2;  4UFK A;  5FPL A;  5A7W B;  3B3Q E;  3NJZ A;  4ERO A;  4HKO A;  2XGX A;  2XUM A;  4IE4 A;  2J1A A;  3K3O A;  3KS7 A;  4Y1U A;  2VO5 A;  1IPS A;  1F15 A;  4LR4 A;  5KXD A;  1EP0 A;  3HOB A;  1YQ8 A;  3TNQ A;  1BBT 3;  3N35 A;  4AEJ A;  4S2D A;  3MUZ 1;  3ZFG C;  4O9E A;  2XOM A;  5DAP A;  1GV9 A;  2R6Q A;  2OVU A;  4HET A;  1RHI 3;  5A33 A;  4UF0 B;  5ANQ A;  2R0F A;  3T3Y A;  2GP3 A;  1BVV A;  1R1A 3;  5GAL A;  3WSO A;  1MS5 A;  1PM4 A;  3LEM A;  3PME A;  3RZL A;  5CFD B;  1UL9 A;  3TBD A;  3ZXL A;  3KGL A;  4UAP A;  4RQP A;  2OZ6 A;  1RIR A;  4XXP A;  3VL8 A;  1UX7 A;  1JZ3 A;  4RFR B;  2WN3 A;  1QGL A;  3WNX A;  1JN2 P;  2CNA A;  5LA0 A;  3DCQ A;  3WDX A;  4DY5 A;  1IQA A;  4K7J A;  5JIU A;  4UFM A;  1O4Y A;  1YIP A;  2E7A A;  1JYC A;  2WLQ A;  4CA9 A;  1WD4 A;  3DXT A;  4GQ7 A;  1W6P B;  3WW3 A;  1FNZ A;  4FAG A;  1RGS A;  4LBN A;  4TLG A;  3BIE A;  4W6X A;  2IC1 A;  2C26 A;  4D94 A;  1MQT A;  1MZ5 A;  1VPH A;  5JXG A;  4L99 A;  1RUF 3;  1XSQ A;  4FPC A;  3WUC A;  1J1L A;  1GYK A;  1FMD 3;  1ZRI A;  4QX8 A;  4AAX A;  4CUC A;  4YM1 A;  3B93 A;  4LK6 A;  1NCQ A;  1E5I A;  3WY6 A;  1JYT A;  2JEC A;  5DDJ 2;  3J8F 2;  1S0F A;  3VKO A;  1W90 A;  3TRS B;  1QKQ A;  4LXL A;  3RI9 A;  2VBD A;  5T54 A;  1AR8 2;  3I7D A;  4AW7 A;  2CGN A;  4N53 A;  4V2V A;  4SBV A;  4NIG A;  4Y22 A;  4YZ1 A;  1NUK A;  4XE9 A;  3I54 A;  5GLU A;  2HWC 3;  4BQ3 A;  4XUO A;  1R08 1;  5LEK A;  2G4I A;  3GBF A;  3T2Q A;  1H2N A;  1QJX 2;  2NYY A;  4OI4 A;  3ACF A;  5CIR A;  4DS0 A;  5L73 A;  4BME A;  2G9Z A;  2EA7 A;  4HZF A;  3RQ0 A;  4DFS A;  5FZL A;  1UN1 A;  4HT1 T;  3GAL A;  5DAV A;  2WZE A;  3U07 A;  5CG9 A;  5KXB A;  1OA3 A;  1JZ5 A;  1D4V B;  1ND3 B;  1OBN A;  2H0V A;  1SFY A;  3OUJ A;  4AQS A;  5BNQ A;  5IAX A;  1XOY A;  2K46 A;  4CSW A;  1KDK A;  5IK7 A;  3USU A;  3U11 A;  1W05 A;  4B8E A;  3TEZ A;  1G86 A;  3GXU A;  1EYB A;  5H9Q A;  5FZF A;  1LU1 A;  3ILF A;  5APA A;  1HXS 3;  3ALQ A;  1GKB A;  3S7I A;  2YC4 A;  5CAD A;  1RMU 1;  1MS1 A;  3OYW B;  1HRI 1;  4BQW A;  5FZE A;  2ZX2 A;  2ZGM A;  3SEP A;  1L7R A;  2GSY A;  4LA3 A;  3UES A;  2JD9 A;  4D0Q A;  4P9G A;  4FSJ A;  2WNV A;  4Y20 B;  4COW A;  4NIA A;  3SH5 A;  3GM8 A;  3JB8 A;  4P9W A;  1U0A A;  3K4A A;  1PK6 C;  2VCM A;  1AXK A;  1BK1 A;  1MZ6 A;  3T08 A;  2DVG A;  1DF0 A;  4QPG B;  4RN5 A;  1AR6 1;  1BBT 2;  4OHW A;  4AHW A;  5J1X A;  4BQ4 A;  2YGM A;  4R9A A;  3UGG A;  2IVJ A;  2YHJ A;  2WAB A;  4YG3 A;  3B9C A;  1W2A X;  2A7A A;  4UBH A;  4KU8 A;  2J42 A;  1WA4 A;  1ZA4 A;  2Y6G A;  3M8L A;  2FQP A;  4AED B;  1UKG A;  2H6B A;  4LK7 A;  5BNP A;  5FMB A;  3A7Q A;  1CX4 A;  1LED A;  2GC3 A;  3VHP A;  2DTY A;  5LA9 A;  4XF1 A;  5FZA A;  2W91 A;  4QXB A;  5EP9 A;  1E57 A;  2B4K A;  4LBQ B;  4QD2 A;  4LHS A;  1F9K A;  3BCW A;  3IDE A;  4KBB A;  4LBL A;  1LTE A;  3FUO A;  2ZEX A;  3ZFG B;  1H9P A;  1ACC A;  1DU3 D;  4IE7 A;  2UYA A;  3OD0 A;  4DRV A;  4LOR A;  2BOJ A;  4OUL A;  4OFG A;  2MHF A;  2VZT A;  4WVV A;  1MVE A;  5T50 A;  3J4U H;  1N1T A;  3ZXD A;  3U4S A;  5C5U A;  3TYJ A;  3I2I A;  4M0N A;  3X29 B;  4NVP A;  3K48 A;  2A3Y A;  3LE0 A;  3TOJ A;  4AVS A;  4P02 B;  2Q0A A;  4XW3 A;  5J36 A;  5EFU A;  3NAP A;  2WKK A;  4IET A;  4HFS A;  4AI2 A;  4M0H A;  5JOZ A;  1I6X A;  1RUF 2;  4AGV A;  1IS5 A;  4IEU A;  1RVF 3;  3T4V A;  2JJ6 A;  1VBA 2;  4Q4X 1;  3HNY M;  4PIX A;  1POV 0;  3M70 A;  3ZXJ A;  4YW3 A;  5A6Z A;  5C3S A;  4FCA A;  2D44 A;  4XUP A;  1COV 2;  4IEW A;  1KS4 A;  2CSG A;  1C57 A;  5M0T A;  2Q1M A;  3C7G A;  3MDP A;  4XTP A;  2VOX A;  1PVC 3;  1H2L A;  3NNL A;  1SEF A;  1YXW A;  3MPB A;  1CVN A;  2HWC 2;  2VQT A;  1PHM A;  5FZ6 A;  1H2K A;  4CEW C;  1EV1 3;  1R09 1;  3LFM A;  5FP4 A;  5H9S A;  4ARY A;  3ILR A;  2TNF A;  2VQA A;  4A3Z A;  3H8U A;  5HV0 A;  5IUQ A;  3PNA A;  3WLU A;  1SFN A;  5FAX A;  3OD4 A;  1US2 A;  1X9P A;  1AYN 3;  2ZHL A;  2VVF A;  3H3L A;  4UFI A;  5FZH A;  4D6S A;  3ORJ A;  2UWC A;  2VW2 A;  3OBA A;  3V0A A;  2I74 A;  5EJZ B;  2AAC A;  3TN9 2;  3U14 A;  4AR2 A;  4E9K A;  1DGR N;  3KB5 A;  2ZMK A;  1VBC 1;  4Q4Y 1;  5JZG A;  1LGC A;  1ODM A;  1RJ7 A;  3GF6 A;  2YBP A;  4TSV A;  3ZN6 A;  1UPS A;  2ET1 A;  2VNV A;  1BMV 1;  3FL7 A;  3WQ0 A;  2FZ2 A;  2XLF A;  4DNY A;  5KC6 A;  1HXS 2;  3I2J A;  1S0E A;  2ETE A;  3WV6 A;  1YCI A;  1Y7B A;  4FFG A;  2JG8 C;  3KSC A;  1GUI A;  2BER A;  1SLT A;  3LGR A;  1X50 A;  3AFK A;  3OJB A;  2ENR A;  1W39 A;  3OUI A;  4OYU A;  3PHM A;  1B35 A;  1JYN A;  4CDW A;  5LAT A;  3RJ2 X;  1GAN A;  2DFC A;  1CZS A;  3HWJ A;  4UWD A;  3P1I A;  2XVG A;  5A3T A;  2FBE A;  3RG0 A;  2PHL A;  2ZTN A;  2E32 A;  2WO1 A;  5EYY A;  1W6O A;  4COV A;  1YIF A;  2WS9 1;  5J37 A;  5EQU A;  1Z7S 1;  3NNM A;  4PF5 A;  2WNE A;  2WWU A;  3BB6 A;  5FXV A;  1MS3 A;  1H6Y A;  1NY7 1;  1AUY A;  2ZGK A;  5FMO L;  4KGQ A;  1OUR A;  3CJX A;  3GJB A;  2E53 A;  1VB4 A;  3K3N A;  2Y26 A;  1AX2 A;  3INA A;  2K2S A;  3MFA A;  5CIS A;  2JWP A;  4CU8 A;  3U78 A;  4A41 A;  4Q0U A;  1CAX A;  4QQL A;  3B9I A;  4FOQ A;  2VZQ A;  1PK6 B;  3LEG A;  3BTY A;  1VB2 A;  1N3Q A;  5AFB A;  4LBK A;  2BVB A;  1SBD A;  3H50 A;  3NJY A;  4P9X A;  2XR4 A;  1G8W A;  3EBR A;  5DAB A;  1WLT A;  2VY0 A;  3NV3 A;  1WD3 A;  3CJI C;  1UX6 A;  2ZX3 A;  3SH4 A;  4AI0 A;  4MXW A;  1J3R A;  5LRS A;  1V6I A;  2YUE A;  3KF5 A;  3AJZ A;  2OII A;  4JKK A;  2PXJ A;  1JOD A;  3DYP A;  1Y43 B;  3R4D B;  4ITC A;  3IPV A;  4QKD A;  3ZFF A;  2VUC A;  1U5Y A;  2A73 B;  1NX9 A;  5A7N A;  1KEX A;  2Y6J A;  1PGS A;  4L9B A;  5I8T A;  3H42 B;  2JG9 C;  1U5Z A;  2ZGS A;  4RS5 C;  4X8N A;  3C2U A;  2PAM A;  4AOC A;  4NHY A;  1QJY 1;  1ZZ9 A;  3Q8E A;  3SCH A;  3RS6 A;  2QQM A;  2Z42 A;  1N3P A;  2JDH A; 
#chains in the Genus database with same CATH homology
 1ODN A;  1W2O A;  5C3S A;  1QJF A;  1GP5 A;  2CSG A;  2VBD A;  1GP4 A;  1W2N A;  1UOF A;  1BK0 A;  2BU9 A;  1OC1 A;  4BB3 A;  1RXG A;  2JB4 A;  3ON7 A;  1GP6 A;  1W9Y A;  1UOG A;  2BRT A;  2BJS A;  1W06 A;  1QIQ A;  5C3O A;  1OBN A;  1ODM A;  3ZKU A;  1W05 A;  1E5S A;  5APA A;  1UZW A;  3ZOI A;  1HB1 A;  2VE1 A;  1W3X A;  1E5H A;  1WA6 X;  1W3V A;  4RGK A;  2DBN A;  1IPS A;  5C3Q A;  2VCM A;  2DBI A;  1QJE A;  1BLZ A;  1E5R A;  2VBB A;  2IVJ A;  2Y6F A;  1W2A X;  5C3P A;  1UNB A;  2Y60 A;  2VAU A;  5C3R A;  3ZKY A;  1HB3 A;  1UOB A;  1W03 A;  1HB2 A;  1UO9 A;  1RXF A;  2WO7 A;  3OOX A;  1HJG A;  2JB8 A;  1W04 A;  2IVI B;  1HB4 A;  4XAE A;  1DCS A;  2VBP A;  1HJF A;  1W28 A;  1E5I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...