1SBFA

Soybean agglutinin
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
234
structure length
234
Chain Sequence
b'AETVSFSWNKFVPKQPNMILQGDAIVTSSGKLQLNKVDENGTPKPSSLGRALYSTPIHIWDKETGSVASFAASFNFTFYAPDTKRLADGLAFFLAPIDTKPQTHAGYLGLFNENESGDQVVAVEFDTFRNSWDPPNPHIGINVNSIRSIKTTSWDLANNKVAKVLITYDASTSLLVASLVYPSQRTSNILSDVVDLKTSLPEWVRIGFSAATGLDIPGESHDVLSWSFASNLPH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SOYBEAN AGGLUTININ
publication title X-ray crystallographic studies of unique cross-linked lattices between four isomeric biantennary oligosaccharides and soybean agglutinin.
pubmed doi rcsb
molecule tags Lectin
total genus 47
structure length 234
sequence length 234
ec nomenclature
pdb deposition date 1997-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1sbfA00
4FPJA 3WUCA 2W52A 1DQ0A 1ULFA 4Y22A 1QOTA 1Z0HA 1GYKA 3IM0A 2DUOA 4YFWA 4DFSA 1IS3A 2CL2A 1DYPA 5JVVA 3ZXEA 4ZKTB 5T5OA 5T5LA 1A78A 1W6NB 1LESA 1W6QB 2W39A 3D4KA 5T54A 1G9AA 3AZXA 3RG0A 3TB0A 1GZWA 1LENA 4FPKA 3HN1A 2D3RA 1URXA 2VW1A 5GALA 4BMEA 2HYKA 1QU0A 1MVQA 3W59A 2DYCA 3O5SA 5DUWA 4XBNA 2ZHLA 4ASMB 1LOGA 2OUHA 2ZGMA 3N3HA 2EXKA 3BODA 1LOFC 4YW2A 1LGNA 1PZ9A 5H9QA 5JOYA 4YZ3A 1UPSA 3ILRA 1RIRA 4FQ4A 2WT0A 2NMOA 3GNEA 1WW6A 1SCRA 3NV1A 1G9BA 1QF3A 1QMJA 3DGTA 4BMBA 2YV8A 1S0FA 3AX4A 1O4ZA 3PMEA 1Q8OA 2D3PA 2ZAAA 4D69A 3SNMA 3RMXA 4YZ2A 4K21A 3OYWB 1IKPA 3CNAA 2AH2A 2R1DA 5DUXA 2AUYA 4K1YA 1JYCA 1QNYA 3ZSLA 1LGBA 2D6LX 4WVWA 5GZGA 1UMZA 3A0KA 2A3XA 2PHWA 3ATGA 1QOSA 3OGGA 1G9CA 1W0PA 1DQ2A 3ZYRA 2ZBJA 1HKDA 1PZ7A 1CN1A 2RHPA 1QKQA 5GJ6A 1S0BA 1MACA 1EPWA 4GKYA 1DQ6A 5T5PA 4YM0A 3V0BB 3AP4A 3O0WA 1SFYA 2A5ZA 3SLIA 3I4IA 3M3OA 4IQPA 1N47A 5DG1A 2NYYA 1GNZA 2Q5TA 4H55A 4OZXA 1MS0A 4UW5A 1G86A 3B3QE 3FUOA 4XMIA 4DRVA 2GALA 3AJYA 2B7YA 3MW4A 4FOQA 2ARXA 3WV6A 4R9CA 5AVAA 2D6NA 3I8TA 1G9FA 1CIWA 4TYSA 4ISQA 3FLTA 4XHXA 2PHTA 2UWCA 4Y20A 2DTWA 5HCBA 5L73A 4YGEA 1ONAA 5GLVA 3L2YA 2E51A 4Y1XA 4RL7A 2GMPA 2AYHA 1OKQA 1I3HA 4M3CA 4YW1A 4YGBA 4TZDA 3O0VA 2VH9A 1WLDA 1DQ5A 4P14A 2D3SA 1CR7A 2EXJA 4XDQA 1LODA 3D6EA 4XJ9A 3AZVA 5DUVA 3WCRA 3AFKA 3IPVA 2FHRA 2BQPA 1KDMA 1Q8PA 2ZHNA 3R4UA 1YYNA 1UL9A 4ITCA 3W58A 1NLSA 4ATEA 3QCWA 2YY1A 2XG3A 4GWNA 3WG3A 1MS4A 2P37A 3VV1A 4LBMA 1MS5A 1QDCA 1BJQA 1MZ5A 4Y24A 1RINA 2OVUA 2WLQA 1BZWA 1SCSA 4Y1UA 1DQ1A 3V0AB 2G4IA 5EWSA 2DVAA 3WG1A 4Y26A 4YLZA 4UW4A 2EXHA 3FLRA 2A6XA 1N1YA 3AP9A 3AYAA 2PELA 1WW4A 1BYHA 2ZGNA 4CRQA 1CQ9A 2P2KA 1AVBA 1FV2A 4Y1YA 1WD3A 4GA9A 2CWMA 3OBRA 1MZ6A 3SITA 3IN9A 4BOWA 3MW2A 1LHVA 4Z8BA 1LULA 2JDZA 5GLUA 3VKFC 1GZ9A 2GNBA 1N1VA 4YM2A 4YZ1A 1YO8A 1N3QA 3N36A 1QNWA 1ULDA 1X50A 1JXNA 1DLLA 3TAYA 3WDVA 2GN7A 3AYDA 4M3CF 3AXEA 4FPGA 4FOVA 4PF5A 4XOGA 5EYYA 1C1FA 1FX5A 2VW2A 2WT1A 4XTPA 5E8AA 2P3KA 1FNZA 4FPEA 3AYEA 4Y1VA 5IT6A 4M01A 4GALA 3D5OA 4P9YA 2DV9A 4XZPA 3A4UA 3SH5A 1AX1A 1S0CA 4PBOA 4AGVA 4LBQB 1KQRA 2NM1A 3WNXA 3KM5A 3WUDA 1DFQA 2R49A 4ATFA 4FOYA 1W6NA 3RMYA 5BYNA 2WJSA 3N7MA 2P3JA 2GN3A 5IK5A 4Y22B 1GV9A 2GMMA 2PHUA 4YG0A 1A8DA 2JECA 1W6PA 2PHXA 4SLIA 1ENRA 4YG6A 1C4RA 5DXDA 3USUB 1S0IA 1HLCA 2ZGSA 2E53A 3WZ1A 1CESA 3RRDA 2E7TA 1SBEA 2ARBA 2DURA 1AX2A 4XMAA 3NV4A 3WDYA 5KXCA 2ZGUA 4CTEA 4F83A 4YM3A 4YGCA 3WOGA 1D2SA 4Q2FA 1BXHA 1N1SA 1UKGA 2Z42A 5T50A 4XIOA 1GLHA 2A6YA 2ZHMA 5IUQA 3N35A 5EXOA 3WVJA 1C1LA 2C5DA 2D6KA 1CPNA 4FPOB 2EXIA 2EIGA 4XJ8A 3AZYA 2V5YA 1WLCA 3ZYPA 2JD4A 3AYCA 1APNA 3B01A 3AP5A 4BLIA 3OYWA 1QDOA 3GALA 4Y1ZA 2ZGTA 3MW3A 5F9TA 2UURA 4XJWA 2SLIA 1Q8VA 5GLZA 4FP2A 2WKKA 1ULEA 4R9DA 3HR9A 4C1XA 2R0HA 2GDFA 1W6OA 1Z78A 3RS6A 2A6ZA 5HCAA 1QGLA 2E7QA 4XE9A 4AVSA 1AJKA 1XQNA 1LOEA 3B00A 2YMZA 3MPPG 1GKBA 1ULGA 2YZ4A 4UW6A 4FPFA 4K20A 3Q9OA 2DWRA 4DS0A 2FMDA 1WBLA 4XXPA 1OQ1A 2D7FA 1KITA 4FPYA 5T52A 5GZDA 2WQZC 1H9PA 4Q8KA 2KM2A 5CAZA 3ENRA 4XBQA 1F31A 3BOPA 3B69A 3SISA 3FUQA 1SACA 4Q1RA 1V6NA 1N1TA 3FBYA 1YI7A 2ZGKA 4YFZA 5SV8A 3NV3A 5DG2A 4GWMA 4CZSA 4M00A 5EYXA 2A6VA 4R9AA 2GNTA 1SLBA 3H0OA 1WBFA 4BPZA 1LU2A 1SLCA 1ULCA 1LHUA 1LHWA 2PHFA 3ZSKA 3WHUA 2ERFA 4FOWA 1V6MA 5JOXA 3OJBA 1JYIA 2ZACA 5H9PA 1WW7A 3BTAA 2WT2A 4M3CB 1N3OA 1GSLA 3ZXFA 3M3CA 1DZQA 1WUVA 2W08A 3IKWA 1S0GA 4YZ5A 2E6VA 1UZYA 2YXSA 1GBGA 2DTYA 3OBTA 3UL2A 4ZXKA 1V6LA 4C1WA 3IPVB 1GANA 5JDBA 1LHNA 1LOBA 4XBLA 5GZEA 3WDXA 3JUUA 1KDKA 1JN2P 4YM1A 3ILNA 2UU8A 1LU1A 1NXD1 1Y7BA 2VU9A 1MS1A 2WSVA 2PHRA 2A6WA 3INAA 4AVTA 2ZGRA 4PCRA 5CNAA 3T1LA 3VKNA 2VUAA 3ZXJA 3SH4A 2WSUA 5T55A 3ZSJA 1F5FA 3ILFA 1W6MA 1W0OA 3M3EA 4GXLA 1WLWA 4NOTA 1JW6A 1Q56A 3PVNA 4XIKA 3HMYA 1J1TA 1FAYA 3N7JA 2DUQA 2JJ6A 2UWAA 1Q8QA 2EAKA 5KXBA 4KBBA 3WHTA 4M3CE 5H9SA 4W65A 1B09A 2H0BA 1AXZA 1ZA4A 3ZPYA 2ZMNA 3WDWA 2EF6A 3PVEA 1FATA 1YRZA 4U2AA 3APBA 1PZ8A 4LBOA 4R9BA 1DHKB 3OY8A 2ES3A 3T1MA 5FRAA 1IS4A 2ZZJA 3RQ0A 1V6OA 3FFZA 2R0FA 5T5JA 2XB6C 2OUJA 2ZABA 2ZKNA 5JLVA 1BQPA 5DUUA 1MVEA 1LTEA 1DIWA 4BM8A 3R4SA 3KQRA 5LK5A 1LEMA 1W6QA 2ZGLA 2A70A 1UZZA 5CA6A 1AF9A 1CONA 5DZEA 4AVVA 1MS9A 2NP0A 1GNHA 3SH3A 5KXDA 3JU9A 1VLNA 4HANA 5GLTA 5HCFA 1LJ7A 2VW0A 1H30A 3USUA 1CJPA 1GZWB 4L8QA 3VKLA 1LEDA 3LCPA 3O0XA 2AREA 1QOOA 2AR6A 4FQZA 1IOAA 4BLJA 2EALA 1YIFA 4P9XA 2CTVA 1IS5A 1WW5A 2NMNA 1DBNA 1W6PB 2CY6A 1V6KA 2A3YA 5DZGA 1RITA 4JRAA 5JOZA 3PVOA 3WG4A 2R16A 2GMEA 2DVBA 2WNEA 2VY0A 4XJUA 3VUOA 5H9RA 3OPZA 1SLIA 4DQAA 4FPHA 4AWDA 3WLUA 1G8WA 4YW4A 2A71A 1AZDA 1VIWB 2GNMA 2ZGQA 4XTMA 3WG2A 3ZVXA 4XJZA 3NV2A 1Q8SA 3ZXLA 3AZWA 4LBQD 4YZ4A 1S0DA 3UK9A 2AGSA 1BKZA 5IK8A 1HQWA 1LOCA 3FLPA 1KJLA 1UX6A 3QLQA 2D6PA 1VALA 4NO4A 4AGGA 1MS3A 2V73A 2ENRA 2R1BA 4MYEA 4BQ1A 4JCKA 5GZCA 1KJRA 2JE7A 1DGLA 3ASIA 3BIWE 2YROA 4HL0A 3V65A 2DVFA 3V0BA 2A75A 1DYKA 2D6MA 1MR5A 4XJAA 3LSEA 3M1HA 4LBKA 3RSJA 3NWKA 1D0HA 1W6OB 3VKMA 1AJOA 4XXAA 2D43A 3AZZA 3C2UA 1A3KA 2CYFA 3A0NA 1O4YA 1DQ4A 1ZM1A 1MS8A 2D6OX 4PBPA 4ISRA 5JOWA 3IMNA 3DUIA 1GICA 3MEPA 5E88A 1U0AA 1CPMA 4I30A 2P34A 3N7KA 2TEPA 1CVNA 2ZMKA 3AXDA 1LCLA 2A3WA 1AX0A 2P3IA 1IS6A 1N3PA 3AK0A 2CWSA 2JE9A 4YW5A 5GM0A 2A7AA 3PJQA 4Y20B 1UN1A 4GKXA 4PQ9A 3V64A 4Q1PA 4FVVA 4LBJA 2LALA 3O12A 1VAVA 3AJZA 1HDKA 1FV3A 2CNAA 2UWBA 1ENSA 1R1ZA 1WD4A 3T2TA 4JC1A 3ZXKA 1LECA 2DUPA 4Q27A 3R05A 4YG3A 4Q8LA 3M3QA 2D44A 3POSA 3VKOA 2DU1A 2C9AA 1SLTA 3V0AA 3POYA 4YW3A 5FREA 1JHNA 2ZGOA 2JKBA 1IKQA 2W68A 5CBLA 1KRIA 3ZSMA 1HQLA 5DZFA 1TEIA 1JBCA 2ZA9A 4Q26A 5JMCA 1I1EA 2AENA 4YGDA 1SBDA 1F9KA 4AYUA 4FP3A 4K1ZA 1V6JA 5E89A 4DPNA 1SLLA 1V00A 3M2MA 3B9CA 1ENQA 5KXEA 2SBAA 3WCSA 4RA0A 2DVGA 1SLAA 2DVDA 4XYXA 4U36A 1LGCA 5F5QA 3UJQA 1LOAA 4LBLA 1VAMA 4XHBA 3WDTA 5GLWA 4FPCA 2I2SA 1AXKA 1OFSA 4XILA 1WCSA 1C57A 2NZ9A 3N7LA 2ZMLA 1JUIA 3POWA 4WVVA 4DRRA 3AP6A 1W6MB 1H9WA 2DU0A 1V6IA 2OW4A 1S0EA 4AGRA 1UAIA 4LBNA 1LHOA 1GZCA 5IK4A 1LOFA 3UJOA 2LTNA 1AXYA 2NN8A 2VXRA 1S1AA 4LBQA 2ZGPA 1YXWA 5CB7A 5GZFA 3WDUA 1G9DA 3U4XA 4FPLA 3AP7A 3LSDA 1JOJA 2GNDA 4WZFA 4WV8A 2ZHKA 1SBFA 1FNYA 1S0JA 3OY8B 4UW3A 4P9WA 1FYUA 5IK7A 1G7YA
chains in the Genus database with same CATH superfamily
2PAMA 3KCXA 4FPJA 1VE0A 2W52A 2FZ1A 5ABJC 1Z0HA 3IM0A 3ZFEB 2DUOA 5CEHA 5JMOA 5A7NA 2GP3A 3SCFA 2DF7A 2W1SA 4RQPC 5A6XA 5LEKA 1YJLA 2ZTNA 2WAOA 5T5OA 5FZKA 1A78A 4NE9A 3BTYA 2XL9A 1LESA 1W6QB 2XJSA 3N9MA 1R093 1CAUA 4AVBA 2HWB1 3AZXA 3I2IA 3J7LA 1RUG1 2D3RA 3KGLA 1URXA 4YRDA 1E5RA 5F5AA 2HYKA 1JODA 5JCTA 3W59A 1QXRA 3VBOC 5DPNA 2ZHLA 1PO13 4AR2A 1LOGA 2ZGMA 2VNOA 4CEYA 2EXKA 1RXGA 4YW2A 3EJKA 2J1RA 2Y38A 4AEDC 3HJRA 3ACHA 4I0BA 5FZ0A 5H9QA 4BU2A 4YZ3A 1CX4A 5FDBA 1X8MA 1RIRA 1R64A 2WWSA 3LPFA 2WT0A 4CUBA 5JXIA 5FYMA 1POV3 3AFGA 3OUIA 3LOBA 2R041 4BMBA 2WFF3 5FYZA 4B7EA 4L9BA 4BYYA 1X8EA 4E4HA 2F4LA 2WS92 5IVBA 2AEYA 1Q8OA 1GR3A 3SNMA 1PK6B 2BTVC 4QB2A 4NHKA 3I2KA 3E6BA 2PMWB 3OUHA 4XF3A 4DUWA 3ZSLA 4K1YA 1JYCA 1QNYA 4YYOA 4L11A 1X9PA 4META 3OGGA 1W0PA 3PUQA 4BK5A 4OVEA 1UY0A 2DBIA 5JR7B 5IVJA 1RTVA 1YUDA 2RHPA 1W9WA 1DQ6A 3VDAA 1O3QA 4PI0A 3NNMA 2RE9A 3DYPA 4LKFA 4QX2A 3KWVA 1BBT3 2QQNA 4R8HA 3ZPOA 3I59A 3O1MA 4J6GA 1N47A 1UZVA 3ZFGC 2YFZA 1BHGA 4PLNA 1L7LA 1R1A3 2NYYA 3ZYHA 4UW5A 1XYPA 1DZRA 4DRVA 3FUOA 1T6GC 4N9IA 5FWEA 3ZYGA 4LHLA 5E6HA 2JB4A 1BEV2 2ARXA 5FYSA 2BU9A 1FXZA 2BUKA 2D6NA 2D5FA 5F6KA 5AVAA 5FIXA 4CCKA 1CIWA 4XHXA 4LHKA 4IEVA 4D7TA 5HCBA 4YGEA 2D5HA 3KV6A 4Y1XA 3AMHA 4RL7A 3S7IA 3KT4A 2X53S 4UBGA 4QXBA 1WCUA 5BY5A 1RUI3 4I01A 2WO3A 3B9IA 4OULA 4RHV2 5LW9A 1W8UA 4COUA 4YPJA 2HWE2 3VL9A 3MLJA 1QJX2 4UFMA 3HAGA 4BJ0A 4TZDA 2HBUA 1VBB3 1DQ5A 2YBKA 1CR7A 2EXJA 2W5FA 2X09A 4N53A 2BW8A 3IT8A 4AI2A 3PVBB 3AMQA 4GJYA 4XQ4A 3OG2A 3W58A 1K3IA 1VBD3 1NLSA 2J42A 4FTSA 1OQEA 1UF2C 1H8TB 3W20A 4RGKA 4GH4C 3MF9A 2K9ZA 1B35B 1MZ5A 2LUWA 1RINA 3PU3A 1RMU3 3VBSC 1H4HA 1SCSA 3GHMA 3UGHA 4EN8B 3VB9A 3KHCA 2OXBA 4BE3A 2E26A 4NWWA 4OZOA 1X33A 4UW4A 2QZ3A 2WZR1 3VHPA 4HKWA 1R081 1N1YA 3CDZB 5BNOA 1DGRN 1BYHA 5ABJB 3MPBA 4JRLA 1WD3A 4Y1YA 3IN9A 3LPGA 4DXZA 4RQPB 5K0UC 1LHVA 3VBUA 5ISLA 1ZRIA 3N9OA 4S2HA 2VOXA 4BQ5A 5FMCA 3TNQA 3GM8A 4B1LA 5ACA3 1PM7A 3N36A 5IVCA 3MDPA 1AR72 1AL23 1JXNA 1DLLA 3I3QA 3TAYA 3JD72 3WDVA 2GN7A 2RM23 3JBG3 4KMQA 3KT7A 1RL3A 4FOVA 1WCDJ 4WM8A 2QQKA 3LEMA 2XKPA 4M0HA 4EZ4A 5L19A 4MADA 3WF2A 3I2JA 1D4M3 2HWD1 3IB3A 5IT6A 3ZR5A 4N90A 3GZAA 2DV9A 3A4UA 2VM9A 1AX1A 4AEDB 3WF4A 1S0CA 4PBOA 1VBC1 1EV12 1O91A 2NM1A 4PDWA 3WNXA 5FZ3A 5K9YA 1ZBE1 1DFQA 2E33A 2GC2A 3TEXA 2XVKA 4QB1A 4HLTA 3IIAA 2P3JA 2DBNA 2VD7A 4W8JA 1GV9A 4A44A 3VDDB 2JECA 1W6PA 3POFA 2PHXA 1AYN3 2BVVA 1FPN1 5A7QA 4MV2A 3VZLA 3WZ1A 3ORJA 4RFT0 4CSWA 2PLV2 1J1LA 1V70A 3ROUA 3NV4A 2JE8A 5G04L 4E4SA 3WDYA 2ZGUA 3SQOA 1NY71 1O4TA 4YM3A 1OD3A 5FY5A 3WNOA 1NT0A 2JIJA 3SXWA 3GZUC 1MZFA 1N1SA 2W2IA 1GLHA 2V4AA 4QHBA 3SKJE 5IUQA 3ZMNA 4ZPIA 2IVJA 4OHZA 1VBE3 2VTXA 4ARXA 2D6KA 2V5YA 1WLCA 1US2A 1XNDA 2JD4A 3AYCA 3BU0A 1C5HA 3I2DA 4BLIA 3OYWA 1CAXA 5C3OA 4LK7A 1UY4A 4XJWA 4AEJA 4XETA 4QQPA 5IFTA 3DL3A 1W9TA 1WGPA 1YQCA 3P5BA 3IDBB 3HN3A 4AVSA 3QH6A 2GSYA 3DCQA 3LZZA 1GKBA 4QX0A 1RUD1 4UW6A 4K20A 2VE1A 3T0BA 2XHKA 1OVPA 2DWRA 1VRH1 2GC3A 2RS53 3HT2A 3Q9OA 4LLOA 4AEKA 2FMDA 4COVA 1CAWB 1WBLA 1BVP1 4UFJA 4LITA 5T52A 5J3UA 1LB2A 3BKZA 2CGNA 3MFAA 2ILMA 1PNFA 1FOD1 1CIYA 5I0DA 1GP4A 3KT1A 3SISA 1SACA 3EB7A 4DINB 3AVRA 2XVLA 2WQ8A 3VBSB 2PXJA 1QJEA 2RJLA 1TVGA 4Q29A 2VNRA 2R043 1ZNPA 2ZGKA 5C9AA 3PLQA 2EAAA 5IAVA 5EYXA 1UXXX 1RUE2 1TE1B 3DPRA 2FCUA 3MIGA 3N9PA 1TME1 4CPBA 4BPZA 1OOPA 1LU2A 1TMF1 1XE0A 2PHFA 1LHWA 4NPMA 3RFRA 1LRHA 2WN3A 3TBDA 3WHUA 1ZBA1 4CDWA 4CXYA 5JOXA 4KWLA 2IXIA 4IGQA 1OURA 2ZACA 5K0UB 1JYIA 4IEQA 3LA7A 3RNSA 3GCWA 3BTAA 4XFAA 4O7XA 1SZBA 4W6YA 2G19A 1GOGA 1DZQA 5JZGA 1X82A 4N43C 4YZ5A 3UL2A 1UZYA 4C0HA 4W50A 4HVRA 2RMU2 3OSDA 4OHVA 4A6SA 1F35A 1RUJ2 2QQJA 4OQ8A 4LEJA 1JYVA 1LHNA 1LOBA 5GZEA 4E2GA 5LBEA 3ILNA 3ZKYA 4DXSA 3THTA 1NZIA 1DLCA 1LU1A 1YQ2A 1F4HA 2UU8A 4CU7A 4F7ZA 2QUOA 1MS1A 2E7AA 2PHRA 2LRPA 3QOPA 2A6WA 4PI2A 5CFCB 5FFOC 3VD5A 3T2PA 4PCRA 1E5SA 4LE3A 5CIRA 5FUPA 3VKNA 4QX8A 3VD3A 4CYDA 3ZSJA 3SHRA 2R061 4IEOA 4Q4X2 5L36A 2J7MA 3OF1A 3TEYA 2VQTA 1J1TA 2RDSA 2PN5A 2DUQA 3HMYA 3KVBA 1Q8QA 4PLMA 3TRSB 5IVFA 2RJKA 2FDGA 3J8F1 4M3CE 5DAVA 3ZPYA 1AXZA 2DDUA 3PVEA 4IE7A 3ACGA 1NA1C 2JWPA 2Q0AA 5JI9A 3VZMA 1XB9A 2EIBA 4GB33 3ACIA 1V6OA 2D98A 4UOJA 3ZFEA 4QKFA 2OUJA 1QQP3 4TSVA 5I8TA 2ZKNA 3C7OA 3S57A 3PDQA 3R4SA 1UZWA 4LTAA 5LK5A 4ES8A 5BNQA 1W6QA 2OZJA 2A70A 1UZZA 2O14A 3AMPA 3NNFA 5FZ1A 2YYOA 2J1EA 5FMOL 4NROA 2WZR3 1GZTA 2VBPA 3OGJA 3KD4A 3POGA 3RYRA 4JHTA 2RDNA 2ZEYA 1CAUB 1H0BA 1H30A 3USUA 5JPMB 3OD0A 1LEDA 3H1MA 2VULA 4DZGA 3O0XA 1COV1 1UU4A 2JDHA 5EPAA 2XJTA 4A3ZA 3AB0A 4QM9A 2EALA 5LATA 5C8CC 1IS5A 2GH8A 3MZHA 4MXVA 2CY6A 1V6KA 2F4PA 1OF3A 3KHBA 3WG4A 3NAPC 1CWPA 2GMEA 2XKOA 1K5MC 5FMBA 5F2SA 5JXGA 1XE7A 2ZCWA 3H8OA 2FDJA 3O7OA 3BCWA 1X36A 3DEMA 4MUVA 1SLIA 4MO3M 4XFCA 4DQAA 4XCBA 4AWDA 1JH5A 4XURA 4XTMA 3I2OA 2Y33A 1VR3A 2VVEA 2C1FA 2RR11 4MVTA 3ZFFC 4OUEA 4X6RB 4WBBA 3AKQA 3R0RA 3GJBA 1J3RA 5FZ4A 4QPIC 2O8QA 1HQWA 3FLPA 1DF0A 2BEOA 1OA4A 3QLQA 4NO4A 2N7GA 4A2UA 4AFAA 2XVGA 4BQ1A 2RS12 3VBFA 4EYUA 1BVVA 3WR0A 1KJRA 3ASIA 3BIWE 4E8DA 2GAUA 4W6WA 2DVFA 4FFHA 2XBO3 3LSEA 1W0NA 2YC0A 3M1HA 2C4XA 1D0HA 3N9LA 1UZ0A 5L9BA 4IEWA 3LFMA 2HBTA 3LD8A 1UQXA 4H7LA 5A3MA 1Q5OA 1PGW2 1YLLA 4MGYE 3VBHA 3C2UA 1NCRA 3A0NA 1DQ4A 3I59B 2GC1A 2V72A 1VBE2 2LM3A 2WYSA 1ND3C 1HRV1 3DUIA 3DYMA 5FY7A 3WP3A 5BNNC 1CPMA 5LRSA 2K0GA 2PAKA 2P34A 4I30A 1L7QA 3J26N 1C8NA 3K4DA 2XWJB 2XUEA 1RJ8A 3D0JA 2BWCA 5EFUA 1IS6A 4JGZC 4QM8A 4A45A 1N3PA 2VCCA 5FJHA 4YW5A 2ET1A 3WF0A 3PUAA 2OA2A 4LBJA 1VJ2A 4UYBA 3AJZA 4CUAA 3LA3A 4FSJA 2HWB2 4A7KA 3E5UA 1H8TA 1RUG2 2RS33 4HFSA 1OQDA 1QXJA 5FZLA 2DCTA 4AFDA 1RHI3 2NLRA 1WA4A 3VKOA 1SLTA 1NA1B 1RUD3 2JDKA 2RG4A 5FREA 5LCWL 5CBLA 4Y5Z0 5DZFA 1TEIA 3B5LB 3GGLA 4CCDA 4NJ4A 1JBCA 3I2HA 3LIHA 4Q26A 5F32A 1WMDA 4EN6B 1I1EA 5ABJA 1FOD3 1R091 2R042 4ASLA 4FP3A 1V6JA 3AKPA 4RQPA 3O1OA 1V00A 4ORFA 1ENQA 1XYOA 2SBAA 4I3PA 2BPA2 2FCVA 2ZKLA 4JKMA 2DVGA 2DVDA 3CO2A 4XYXA 1UPIA 3UJQA 1NG0A 1O5LA 4IGPA 5FLJA 3M7AA 4P5YA 1PO11 5GLWA 3HIFA 3LEKA 1AXKA 1GQHA 4FPCA 3ZKUA 1XPWA 3ES1A 3FWEA 4CDXC 1OH3A 1JUIA 2FMYA 2C26A 3MIBA 1GFF2 4DRRA 5A32A 3MIHA 2BFUS 3VBOA 1U5YA 3I3DA 3IDCB 1S0EA 4AGRA 4LBNA 5FP8A 4JDMA 1POV1 1GZCA 5I0SA 2JG8C 2VZ3A 4QB6A 4AW7A 2WFF1 5C8CB 1UNBA 2YDEA 4QGMA 1H1IA 2NN8A 4JVAA 4AEDA 1S1AA 1W03A 2J1SA 3H42B 2ZGPA 1YXWA 3WDUA 4DOUA 3NAPB 1OFNA 2ZEXA 4OYUA 1K5MB 5BXXA 1GQGA 1S4CA 4UW3A 4P9WA 4KBZA 3A7QA 1G7YA 2WWUA 4EWDA 1JZ3A 5FZAA 1Q43A 2IVIB 3WUCA 4A3XA 4DFSA 4PDWB 5FK8A 1IS3A 1XSRA 4D6QA 2CL2A 1W8ZA 5JVVA 5J1XA 1XBFA 1V0AA 5FZHA 2LW8A 2LROA 3AC0A 2W39A 3D4KA 4LJHA 3RG0A 2FDIA 1BBT1 1SEFA 4QQOA 4AI8A 2JIGA 1J59A 1NQDA 5HV0A 2VW1A 2JDPA 1VBA3 5GALA 4BMEA 1JZ6A 4R52A 2D97A 4PQQA 1UOBA 3IDAA 5D8AC 4HVQA 3O5SA 3OGVA 5FBZA 4XFGA 4E4ZA 1Y43B 5G05L 5F5CA 3ZFGA 1O7FA 1RGSA 1LGNA 2NQYA 4LULA 4N7UA 5I8SA 1UPSA 3MHZA 4XUNA 2GC0A 4S2FA 1JS9A 2NMOA 4QGLA 3GJAA 5DQ0A 1SCRA 3OBZA 2IWGB 1RUI1 4X8PA 1G9BA 4OCTA 3T3YA 2E63A 2ADDA 5IHRA 1PVC1 1ND3B 2X8KA 1AR63 3AX4A 1O4ZA 2WZR2 3UESA 1R082 1VBB1 2D3PA 2ZAAA 4D69A 4XFIA 5JR2A 1HIXA 1AL0G 3OYWB 4SBVA 2VBDA 1H4GA 5A1AA 4J25A 2VXJA 1DZTA 3BOWA 1VBD1 1UYPA 1UKRA 2D6LX 5LZ6A 4WVWA 2A3XA 1RUF3 2PHWA 3AKSA 1QOSA 4KNCA 1CAWA 2QNKA 2ZBJA 1RMU1 3NVCA 4XUPA 4V2VA 1PZ7A 2VQUA 4IEUA 5GJ6A 1QKQA 1S0BA 5F5IA 4BQYA 2D40A 5T5PA 1U12A 3K4AA 4GH4A 4XUOA 4XPVA 2VMIA 2CHHA 1SFYA 3O0WA 3RI9A 4MGSA 1QJU3 5JUVA 1YQ5A 2WNUC 4B4QA 3VBSA 1GP5A 2JDYA 4H55A 5AVPA 2HWD2 2QCSB 3B3QE 4XMIA 1EY2A 2GALA 2FQPA 2XWBB 4CEWC 2Q4SA 2W95A 3LB9A 4QPYA 1UXZA 3GBFA 1VBC2 3RVHA 4Z92B 3WV6A 2X29A 2VBBA 1ZBE2 3U0ZA 5ACA1 1RVF3 3B94A 2PHTA 3DECA 4Y20A 3WQBA 1YCIA 2OX0A 2PQQA 2W91A 3DKWA 5C9AB 2E51A 4D0QA 5K0UA 4Q4W2 4FCAA 3OGSA 2AYHA 4BA6A 3DPRB 2RM21 1QWRA 1ULOA 1C28A 5ANNA 3AM2A 5EZWA 4YW1A 3L9JT 4LIUA 4NPLA 1FPN2 2QKDA 4CDXB 1LODA 4EWAA 2FHRA 3CJIC 3KCCA 3R4UA 4BWOA 1DYOA 5JZGB 3MICA 4ITCA 3SEEA 1NY72 3SEPA 1E5IA 4JQTA 4JKLA 4BCUA 1XC6A 3WG3A 5F37A 2R073 4KQ7A 3VV1A 3ACFA 1VMHA 2JG8B 2Q1FA 1MS5A 1QDCA 1CJDA 4QHOA 1BJQA 5CKMA 1RUC1 5C6CA 1ASJ3 1OXCA 3I7DA 3BGAA 4QXCA 5B4XA 1OPOA 4QDSA 1LNSA 1ODMA 4RFRB 5FYVA 2EXHA 4GZ9A 3DF0A 1AYN1 3FLRA 2VZ1A 3AP9A 1SDWA 3IBMA 3WQ7A 2VMEA 2ZGNA 4HVOA 1CQ9A 1W06A 2VZRA 2ZOEB 1FV2A 2MHFA 1OD5A 2ZXQA 2R30A 2WZEA 4GA9A 2CWMA 3OBRA 3VD7A 5DDJ1 3PUHA 4HONA 4IE4A 4UFIA 2QQOA 2IXHA 3QH7A 4DB5A 3WF3A 5GLUA 3VKFC 1GZ9A 2GNBA 1N1VA 3O1RA 1YO8A 1IQDC 1SDDB 1O6UA 4A7YA 3MV01 5C3RA 1QNWA 5KC6A 2QDNA 1K5JA 3POBA 3UKVA 3KB5A 4EN0A 3U4SA 1RUD2 2MNGA 4E8CA 4M4PA 2RDRA 2Y8KA 1UIKA 2EIDA 3AXEA 1VRH2 5DAQA 4FPGA 5EYYA 3MYXA 2BVBA 2VW2A 5E8AA 2WT1A 3Q8AA 1AR83 4C0BA 5FLHA 3AYEA 3LWCA 1DDLA 2BNMA 4ZS3A 2XL7A 3SH5A 4HXCA 4DXTA 3JB8A 4NUBA 2XMLA 5IJRA 3KM5A 5FOJB 3ZM8A 2BZDA 3POIA 2R49A 2HWC3 1I6XA 2WLPA 4ATFA 1J58A 1NLQA 4FOYA 1ND2C 1W6NA 4QKBA 5FPXA 4IE5A 4Z82A 2WJSA 5FZ8A 5J09A 3NNJA 4Y22B 5C71A 4RD7A 2RS51 1QHDA 1RC6A 1TME2 2GMMA 5F3IA 4ES9A 5A3PA 1TMF2 2VUCA 3HEIA 3KQ4B 4YG6A 1ZBA2 2W92A 1C4RA 3USUB 1HLCA 3OOXA 1CESA 2Y0IA 4D94A 1UYYA 1QJY3 2E7TA 4YARA 2OKXA 1AUYA 3VDBA 2DURA 4DO0A 5FO9B 4XMAA 4O9GA 4ZS2A 4CTEA 4F83A 1BK1A 1CD3G 3J7HA 4KH9A 3DYOA 4FBFA 1UKGA 3IDEA 2Z42A 4XIOA 2A6YA 1OLMA 2ZHMA 5IVEA 1JYNA 3DXTA 4HBNA 4TN7A 1C1LA 5FZBA 4GWIA 4XFFA 4XABA 1D4VB 2WNUB 5C5UA 1CPNA 2EXIA 4HK8A 2EIGA 4QDQA 2H6CA 3LDRA 5E1RA 2HEYF 1DU3D 5FZ9A 4XQWA 2VMGA 4Y1ZA 3H8RA 1F15A 2R062 1JYXA 2SLIA 2VCMA 4FP2A 4R9DA 4QPGC 3UETA 3VBFB 2R0HA 1JZ2A 3JXSA 4MGTA 1JHJA 1QGLA 4OHXA 3J8F2 4XF0A 4XE9A 4Z2WA 1XQNA 3LIGA 1GOFA 3B00A 2YMZA 2J1VA 4MXWB 4N43A 2YZ4A 4LT5A 2ID4A 4FPFA 4XF1A 2XOMA 4ZU4A 3CZJA 2UY9A 2JDMA 1KITA 3EYPA 4FPYA 3VBHB 1ZYBA 2WQZC 1NCRB 4OMCA 2HYXA 3Q8CA 4Q8KA 5CAZA 2A1XA 4LO7A 3U1XA 1PO23 5FYTA 2G9ZA 3B69A 4H14A 4NAOA 4Y4YA 1HN1A 3NRUA 1YI7A 3C7GA 1PVC3 4YFZA 3HOBA 1SMVA 3U14A 4AL9A 1K42A 3RWNA 5FR3A 4CU9A 1SLBA 3H0OA 1MPXA 1WBFA 2JB8A 2LS6A 1ULCA 1SLCA 2QQVA 1LHUA 4KWKA 3ETQA 4YW6A 3ES4A 3ZYBA 4AI1A 4JHZA 4GB31 4XACA 4YNIA 4XW3A 3RYPA 2E31A 3KMHA 1NA1A 3OJBA 1M4WA 1YNAA 1REDA 5H9PA 1COV2 2IC1A 3ZSEA 1JZ5A 1QQP1 4M3CB 2ZX0A 3HNYM 5LA0A 4XUTA 2W08A 3IKWA 2XLFA 2E6VA 4IE0A 4NRQA 1QEXA 4NIHA 3JQXA 3HT1A 3NKGA 1KFXL 2BGCA 4C1WA 2ZJCA 1E5HA 3IPVB 1V9U3 4EZHA 4PF1A 3WDXA 2O1QA 1KDKA 2KXLA 5LY2A 5HV4A 4B7KA 2RR12 1Y7BA 5FYIA 4NRPA 4XF4A 1OC1A 1JZ8A 1GWLA 3INAA 1JZ7A 4NHLA 3UV9A 1MEC3 4DIQA 1W3XA 3ZXJA 5FO8B 4XQDA 2WSUA 2H0VA 3MF6A 5FY1A 1F8VA 1F5FA 3ILFA 4XDOA 2BGPA 3HWJA 2R32A 4ET7A 1JW6A 5EJ3A 1ND2B 2JJ6A 1LKNA 2P6CA 2QBXA 3PTYA 4P00B 5C8CA 5H9SA 4TLFA 4JX0A 5A32B 5FYUA 3VBOB 1FATA 5K7PA 4U2AA 3APBA 3S7EA 1PZ8A 4LBOA 3NAPA 1W04A 2RJ2A 1UOGA 3H9AA 5FXVA 1DGRA 1H1AA 1K5MA 1NZCA 4R9BA 3T1MA 2ZZJA 2ATFA 2OYZA 1PIV3 1HB3A 1REFA 1EAH2 2R0FA 2XJVA 3RGBA 3ZFFA 2ZABA 2YGMA 1HRV2 2UY8A 1DIWA 4BM8A 1H2NA 1W9YA 4EROA 2OQ7A 1RUC3 1LEMA 4QPIA 2IZWA 5I0RA 1HRI3 4UBHA 3ITQA 5DZEA 2J1UA 4NR1A 3U07A 4AI3A 2EIEA 2XBO1 5KXDA 3JU9A 1WCKA 3KV5A 1VLNA 4QX5A 2F17A 4CP2A 2HJIA 4HANA 1REEA 1LJ7A 1HX6A 1O8PA 5DDJ3 3LA2A 3CU7A 3LCPA 1RXFA 2XDVA 2YBPA 2AREA 4FQZA 4IEPA 1IPKA 4JDNA 4QPGB 2WWJA 2EVXA 3Q8EA 4EN9B 2NMNA 1WW5A 1DBNA 5C4WC 1WMEA 5DZGA 5JOZA 1AYM3 4LXLA 3PVOA 2R16A 1HV1A 1H2MA 3ZFGB 2ETEA 2DFBA 4HSLA 1ND3A 1W99A 4D6RA 5BNNA 2FZ2A 2VMFA 4K8FA 4YW4A 2ZGQA 4CDUC 3KSCA 1ZA7A 5FMOS 1A8MA 3LKJA 4BHPA 4H2AA 3NV2A 1W05A 1R092 4GD4A 4JGZA 3UK9A 1S0DA 2VOWA 4COWA 4Q4V3 1SG3A 4QT6A 5IK8A 2RS31 1LOCA 4AG4A 1KJLA 4ZXEA 1RHI1 2D6PA 1KFUL 5CG9A 2C24A 4AGGA 1PGL2 1PO12 2ENRA 4MYEA 5F1RA 1YHFA 1UYZA 2JE7A 1SFNA 2OZ6A 4ZONA 1JOPA 1DYKA 2X05A 3TN93 5J48A 2PHDA 1T2XA 4R4ZA 3NWKA 2Y26A 2VZTA 1W28A 1KGYA 1OT5A 1YC61 5CKNA 5JSRA 4N9HA 1OSGA 2W3JA 1PX4A 2WFF2 3AZZA 4GH4B 1C8M1 1A3KA 4LMFA 2CYFA 1IQAA 2IXLA 4EJRA 2BERA 3S0MA 2V4VA 2WA3A 4AEMA 5E88A 3PIGA 3S30A 3K4ZA 2Y64A 2TEPA 1CVNA 1AR93 1L3JA 2Q8EA 4AFCA 3KV9A 3M4FA 3FE5A 4P9JA 2P3IA 5F2WA 4AHZA 5FZOA 1IPSA 5B4NA 2ZZQA 3AL6A 5DN2A 5HXVA 4UFKA 4Y20B 1UN1A 3T2OA 3IMMA 2YHJA 5FZFA 2R7EB 3LGRA 4GKXA 2CDPA 3V64A 1UWWA 4CDXA 5A6ZA 2LALA 3RZZA 3ZXGA 5APAA 3PNAA 4D3WA 5IFPA 5FUIA 3VD9A 1HDKA 1POQA 3RDIA 1ENSA 1BBT2 5FOBB 1R1ZA 3ZR6A 3ZXKA 1LECA 4C8DA 1R1A2 1DG6A 2ZX2A 1OI6A 2JG8A 4IV1C 5J96B 4YW7A 1KS5A 2P17A 2DU1A 1OUXA 2C9AA 2Z69A 5A3OA 2ZGOA 2VZOA 1IKQA 3OPTA 2YC2A 1OA2A 2VTFA 2VQAA 1HQLA 3OPWA 4AI9A 2ZA9A 3BVCA 3JQWA 4IL7A 4NHYA 4AOCA 2VG9A 2AENA 3M8LA 4YGDA 3DV8A 4PIZA 1RUI2 2QVSB 4K1ZA 1Y3TA 1UMIA 3ZXAC 4DPNA 2CGOA 2HWF1 4NAMA 4ARYA 4A42A 3M2MA 3RZGA 1H6YA 1VBB2 4PT6A 3WCSA 1VBA1 3I49A 4RA0A 1SLAA 1ULPA 4GJZA 1L7RA 2JX9A 1LGCA 2ZEWA 2Q1MA 1VAMA 4EWEA 4IV3C 4XHBA 3WDTA 2I2SA 3WEZA 2HKXA 1VBD2 1PGSA 1C57A 1WCSA 2IFWA 3EMRA 2ZMLA 4JKKA 4MZUA 2WUHA 3BB6A 4AQTA 4GIQA 2QE3A 5D8AA 1W6MB 2WO1A 5FTTC 3K3OA 1RMU2 5A7SA 2ZS6B 3K46A 3FZ3A 2MPFA 2Y60A 4XC9A 1AXYA 2VXRA 3TWIA 1AR61 5C4WB 3KS7A 1SHWB 3THDA 3U4XA 3CKHA 2BBVA 4B29A 1JOJA 4WV8A 2MEV1 5FK7A 1FNYA 1S0JA 3WY6A 2JDAA 4E2QA 2VO5A 4CDUB 1DQ0A 1H2KA 1ULFA 1QOTA 2QQIA 1GYKA 1RUF1 4Y22A 4YFWA 5HPOA 1IPJA 2Q1ZB 3BN6A 3PUIA 5ACA2 4Q0QA 1F4AA 1WMFA 4ZKTB 1QXPA 1AL22 1PNGA 5T5LA 4BQ4A 1W6NB 2NPIA 2RM22 3JBG2 3W5NA 3BIEA 1G9AA 1GOHA 1YQ8A 1O3RA 1QJU1 3ZXDA 3HN1A 4FFFA 4NN0A 3VGIA 2XJPA 1BK0A 2JICA 1D4M2 4RHV1 2B9VA 3M3IA 4XAAA 1EPZA 2G1MA 4XBNA 5DUWA 3N3HA 5IVYA 3BODA 2XHNA 2WNUA 3ZIWA 1RVF1 1TQ5A 2P3YA 4XF9A 2AACA 4QQ2A 1PZ9A 4AF9A 4A7ZA 5JOYA 5J36A 1RUC2 3ILRA 1JOBA 4CEWA 1ACCA 4FQ4A 1LAJA 1HW5A 2WN2A 3E6DA 3JB4C 3MFCA 4IEYA 1QF3A 3DGTA 4WM7C 2KR2A 1JUHA 3H3UA 1CAVB 1AYN2 3OUJA 3PMEA 4N7IA 3N4MA 3QACA 4EV0A 3RMXA 4AHXA 1OHFA 4K21A 3HBKA 2PFWA 3CQOA 4INDA 3B7MA 1IKPA 4MXWA 3AMNA 2AH2A 1XYNA 2R1DA 3HVDA 3WSOA 3TOJA 2V09A 5GZGA 1UMZA 1JYWA 3ATGA 5A7PA 2R071 5I0TA 4IXLA 3GHNA 1G9CA 5SV5A 1U5ZA 3CJIA 3R4DB 1ASJ1 4Q0UA 5IATA 1HKDA 5IVVA 4N43B 1FI2A 1EPWA 4YM0A 4BB3A 3A23A 1GUIA 2A5ZA 4IV1B 5EP9A 3FX3A 5J37A 5D1IA 3SMHA 1VPHA 4BQ3A 2Q5TA 4OZXA 1MS0A 4NIIA 1G86A 3EXUA 3AJYA 2BNNA 4FOQA 3MW4A 2VVDA 1KEXA 1Y9QA 4R4XA 4MGZE 3IAQA 3BU7A 4R9CA 3WNKA 4Z2AA 1AHSA 5HBAA 1G9FA 3CEWA 5A3TA 4ISQA 2QQLA 3IZOA 2UWCA 4NMIA 1ONAA 1QH6A 2DCJA 4N8MA 2ET7A 4DUVA 1I3HA 2RS52 4M3CA 5GKAC 1OVSA 1DCSA 4IW3A 4RSUA 5FZ6A 2W47A 2RVAA 1AR81 1MQTC 1RUH3 1WCQA 2VH9A 1WLDA 3AVSA 4P14A 2A73B 2D3SA 4OFGA 1W8HA 1W9FA 1VB4A 2VMCA 2YFUA 2OIIA 2ZX1A 3AZVA 3HBZA 5I0UA 3IPVA 3WCRA 2ZHNA 2QQPA 2JG9C 3JCIA 5L7OC 3NW4A 1UL9A 4IETA 4NHXA 3QCWA 4GWNA 3I3MA 4OHWA 2HWC1 4LUKA 1C8M3 3H7YA 5LB6A 1WZXA 3RPQA 3MUZ1 1BZWA 4Y1UA 2YPDA 5FXZA 4HN0A 2W87A 4Y26A 1OH4A 4YLZA 3BI3A 2KA3A 1XNKA 1CZVA 5A3WA 1CZTA 4H3WA 3T0DA 1ND2A 2PELA 1WW4A 3AYAA 4JTOA 5LY1A 4CRQA 1QJY1 1CZSA 1AVBA 4CDQC 4QQLA 1UY2A 5HXMA 3SITA 3A21A 2VOVA 4BOWA 4XDPA 3NNGA 1J84A 2VZQA 1LULA 2JDZA 2Y6GA 3ZDSA 1OA3A 4YM2A 4YZ1A 1UW8A 4ZY9A 2GU9A 3FMGA 1JZ4A 3D82A 4QX7A 5FXWA 4EQVA 1LR5A 3AYDA 4M3CF 3E1F1 4O65A 1C1FA 4FI9A 2YU2A 2P3KA 3NKTA 4NWVA 1FNZA 4FPEA 4CCJA 3D8CA 4Y1VA 5J7MA 3BPSA 3D5OA 4GALA 4P9YA 1U5IA 3J4UH 3ZFFB 4XZPA 5FV3A 2X5IC 3KF3A 4LKEA 4OHYA 1W9SA 4LBQB 1KQRA 2PTMA 4RS5C 1HN0A 2QFEA 4CP1A 1PHMA 1TZOA 1YFWA 4QPIB 5FP9A 3RJRA 3B93A 5JAXA 4E27A 5KC5A 4AHWA 4AAXA 5LK7B 4WM7B 4DXRA 2HWF3 1W2TA 2QJVA 3FJSA 3RMYA 3BTXA 1Z7S1 1H1MA 3WQ0A 4QPGA 3BYWA 1RUNA 5FP7A 5KHKA 2PHUA 4UWDA 1A8DA 4J1XA 4QHZA 4YG0A 2VC9A 3ZIXA 1RUOA 2WS93 1PMHX 1ENRA 3MGUA 4SLIA 3VHOA 3RZJA 4GB32 2ARCA 2XH6A 4ONUA 2BRTA 1S0IA 2ZGSA 2E53A 4QXKA 2GZWA 3UKNA 2WZPP 1QQP2 1SBEA 1PO21 2WNVC 3UGFA 2ARBA 1XNBA 3MIDA 1AX2A 4LK6A 4PIXA 3VBRC 3W9AA 2JEMA 5C3SA 5JPNB 5KXCA 2WO7A 3WOGA 2K46A 5T50A 3VLBB 5LBCA 4AXOA 4OI0A 1W8NA 5BNNB 3N35A 5EXOA 4Y5SA 1ZX5A 1STMA 4EN7B 1XU1A 3BTZA 2C5DA 1D0GA 3C3VA 5C8WA 2MEV3 2P6HA 4PJYA 2PA7A 3T4HB 1X7NA 3AZYA 3KLSA 4JGZB 4MGQA 3ZYPA 5FPZA 4BH9A 1ZRDA 2IXJA 3B01A 3AP5A 5DAPA 5F9TA 2ZGTA 2UURA 3C8XA 2YBSA 3FBMA 3A22A 5GLZA 1OKOA 1BEV3 4CU6A 3HR9A 2FBEA 2GDFA 1EYBA 1Z78A 2P5BA 3RS6A 2E7QA 4LHSA 1XNTA 2C6SA 1V9U1 1VMFA 3SCGA 1LOEA 5AFEA 3JZVA 3MPPG 4PIYA 4QGNA 1ULGA 2OPWA 2VJXA 2ZPXA 2Q8OA 1ZRCA 4I0WB 1WKYA 5FZDA 2B39A 4DS0A 4RHV3 2QQUA 2XJUA 4XXPA 3WINE 4W4ZA 2HWE3 1MEC1 5E16A 1QJX3 3J9SA 2JG9B 5FY0A 3O1UA 5GZDA 4KG0A 5L7OB 2GP5A 1H9PA 1UOFA 3GBWA 4FFGA 2JENA 3ENRA 5CFDC 4LR4A 3FUQA 4Q4Y1 3PTRB 3K75B 3C7FA 3LEIA 3ELNA 1W8WA 1V6NA 1N1TA 3KCYA 4K7JA 5FZOB 4ZU7A 1US3A 5SV8A 3NV3A 2XBO2 3ACLA 3BALA 5DG2A 5FPBA 4M00A 2WYFA 4CZSA 4QDRA 2TBVA 1H6XA 4H7MA 1YFXA 3ZOIA 3ZSKA 3I3EA 1V6MA 1SPPB 1PIV1 3B02A 3MO4A 4QD2A 1WA6X 5ERLA 2ORZA 5KBFA 2DCKA 3M70A 2P1BA 3WNNA 5IYYA 3POEA 5KHIA 3M3CA 4Q0SA 1WUVA 4O9EA 2YXSA 3OBTA 2DTYA 1C5IA 1ODNA 4FAHA 4ZXKA 1XNAA 1HRI1 1V6LA 2YU1A 3RJ2X 1GANA 4L99A 1AR73 5JDBA 1O59A 4XBLA 1YJKA 3JUUA 3ZDVA 3JD73 4Z1VA 1DGWA 2G9FA 1D7PM 2VU9A 2YC4A 3PIJA 3WP5A 3WNLA 4B1MA 4AHYA 3T1LA 2RS32 4ASKA 4RS5B 4HG6B 3NJYA 3P1IA 1RHI2 3RZKA 3BUCA 1W6MA 1W0OA 4G9SB 1AYM1 1Q56A 3UKTA 1EV13 4CPBD 4XIKA 1FAYA 2TUNA 2XJRA 4MSVA 2UWAA 3LEGA 4NVPA 4LKSA 5FYYA 4KBBA 3WHTA 2O0OA 4W65A 2H0BA 1ZA4A 4HPKA 5KWRA 2ZMNA 5D8AB 5C4WA 2KD7A 3ETPA 4QAWA 1PX3A 5I91A 5FPAA 2J1TA 4IERA 5AFBA 1DHKB 1FOD2 2ES3A 4GQ7A 1IS4A 3RQ0A 4Q4V1 3GXUA 2VECA 4GWJA 4AE2A 4CDUA 5C3QA 4NRMA 5LA9A 3H8UA 2UYBA 5T5JA 1S2KA 4HKOA 3ZN4A 1B35C 5JLVA 5DUUA 1MVEA 2PLV3 1LTEA 3KZ4C 5T3NA 1QY4A 4AQ6A 3MI8A 5HI0A 2AEZA 1UY3A 2ZGLA 5CA6A 4TXWA 4GULA 3T08A 3MLLA 2FDFA 3PHMA 1RYYA 3P3PA 4HZFA 4QWNA 3TN91 3U75A 2NP0A 3SH3A 1OLRA 4FXGB 5CISA 1IHMA 5GLTA 5FP3A 5HCFA 1NOVA 3MIFA 4JTNA 2VW0A 1HV0A 4L8QA 3D0SA 2I45A 4CUCA 3TNPB 5JI7A 2AR6A 1IOAA 4BLJA 3KV4A 1IG0A 1YIFA 2YGLA 1GU3A 2CTVA 3OEAA 1TNRA 1AR91 1RITA 5FQ0B 2WIIB 3VDCA 5D2AA 4WVZA 1IG3A 3WNMA 2B46X 4XCAA 5A70A 4XJUA 2VY0A 4JV4A 1ZRFA 1ZREA 4FPHA 5EHDA 1CAVA 1AZDA 1VIWB 3IWZA 3WP4A 3RZLA 3T2QA 4CEWB 5BUVA 5F3CA 4YVSC 1O3SA 2WQ4A 5CZKA 5A7OA 3ZXLA 2Y0OA 3AZWA 4PLOA 3H8XA 4AFBA 1S2EA 2HWF2 3WQ1A 1BKZA 2C9KA 5CFDB 2B42B 4YSFA 1YIPA 2HLEA 5B2GB 5HCHA 1VBA2 4KG8A 4GMP0 5C5TA 5TSWA 4QPWA 4MGIE 3PURA 4Y4RA 2R1BA 4XUQA 5ANQA 4CCMA 1Y4WA 3VDDC 1Z7S3 4XFHA 5FZMA 5AC92 4HL0A 3V65A 2F6BA 2A75A 3HQXA 4UF0B 4IV1A 1MR5A 4XJAA 2B5HA 2D93A 3CJIB 4LBKA 1OLQA 2HEWF 2YPJA 5FCCA 1RUE3 5JXHA 4JGYC 1W6OB 3DN7A 4KGQA 3VKMA 5LWBA 4X8NA 3K77A 3E6CC 3J7NA 2W1WA 1AR62 1FMD1 1C3HA 5JXJA 5M0TA 1O4YA 1MS8A 1UOJA 4F3JA 4ISRA 5L9RA 2MEV2 3CMGA 3U10A 3U37A 4LE4A 1EUUA 4UFHA 2A3WA 2RMU3 1AX0A 2XGXA 1RUF2 3GBGA 4TLGA 3T4VA 2I07B 5A3UA 2WL1A 1RUJ3 4V2WA 5F3GA 3C7EA 2A7AA 3PJQA 5GM0A 5I93A 4IV3A 2Y34A 4PQ9A 2W1QA 5AC93 3C7HA 4FVVA 3EO6A 1K12A 2EICA 3O12A 5FPVA 1VAVA 1WMXA 4I02A 1FV3A 2CNAA 2UWBA 1XNCA 1U5XA 2WABA 1QJU2 2WINB 2DUPA 4Q27A 3WT3A 3ZMOA 3R05A 4YG3A 4Q4X3 3M3QA 3UGGA 5CG8A 4P02B 5IWFA 2CU5A 2WAAA 3POSA 4RR3A 3USSA 4HN1A 4YW3A 2QZ2A 4XZUG 4IGOA 1KRIA 1RVF2 4YVWC 4CXWA 1W2UA 2FCTA 1P8JA 3GCXA 1ALYA 1UU6A 4KI5M 5CADA 5JSPA 2XLGA 4TTGA 1SBDA 2W46A 4MLOA 1BMV1 1F9KA 3CBNA 4AYUA 1VP6A 2V5DA 2DCYA 3MLKA 5E89A 4D6SA 3E5QA 4I2OA 1SLLA 3LE0A 1NYWA 1NLRA 2B8MA 1Y9GA 1PM4A 1UIJA 3B9CA 4Q4Y3 4WVMB 4DEVA 5KXEA 3O1TA 3CL1A 4B8EA 4LOSA 4KWUA 4URTA 4AQ2A 2WA4A 4U36A 5F5QA 1O5UA 1LOAA 1NX9A 3MIEA 3VBRB 1W2NA 1YWKA 2I74A 1W8OA 2NZ9A 5KHHA 3N7LA 4XEZA 1KD7A 5K8SA 2VZSA 2R072 4M0NA 2BFUL 5A3NA 4L92A 3AP6A 3FHIB 2DU0A 2VNGA 1V6IA 1ASJ2 2TNFA 4BK4A 4KU8A 3WD5A 1LHOA 3UJOA 2LTNA 4RGGA 1HQNA 4L97A 4LBQA 5CB7A 5GZFA 1G9DA 4WZFA 3G7DA 2GNDA 2XJQA 1MZEA 4P9LA 1SBFA 4ZZ5A 2VTXJ 3OY8B 4D8MA 4WM7A 4IEZA 5FYBA 5IK7A 4MH0E 1A6CA 3LFIA 5K4LA 2PHLA 1HXS1 4LKDA 4LHNA 1QJFA 1YQ6A 5CFCC 2FDKA 4UT5A 4YVSB 3UNPA 1DYPA 3ZXEA 5LBBA 2Z79A 3NO8A 3R6SA 3H3ZA 2DCZA 4COZA 4AVCA 3RZMA 4B4PA 5T54A 5J98B 4IUGA 3TB0A 1GZWA 1LENA 2JDNA 2VOKA 3ZYIB 3KGZA 4FPKA 4Q4W1 1AR82 1W8FA 4B3NA 4LA3A 1O3TA 1POV0 1QU0A 4LO4B 1MVQA 1I5ZA 3CJXA 2DYCA 3Q8BA 3WW3A 2XQXA 4Z07A 1NCQC 2ARAA 4ASMB 2RS13 5F8PA 1TG7A 1UD1A 2OUHA 3HPNA 4OI2A 5I8YA 5KHGA 1LOFC 2QTWB 1ZZCA 4NIAA 4A6OA 4IE6A 5BNPC 4JGYB 2HWC2 4HMZA 4DMIA 3MBWA 5DMYA 5FBJA 1VAKA 1CGPA 3GNEA 1WW6A 2RDQA 3NV1A 4HSJA 1QMJA 5A33B 2YV8A 4ZHNA 3PU8A 2BDRA 4Y33A 4DEQA 3FN9A 1S0FA 4BXSV 1RUH1 1RJ7A 1H2LA 3OCPA 5BV6A 4YZ2A 4NHMA 1QJY2 1ZZ9A 5F3EA 3NL1A 4A4AA 5F39A 2Q30A 4JZRA 3CNAA 4QQHA 2AZ5A 4RN5A 5DUXA 2AUYA 4BQXA 3RZHA 1MQTA 1LGBA 4URAA 3Q8FA 3A0KA 5LA1A 5FYCA 1E57A 1DQ2A 2JG9A 2ZEZA 5CKQA 3HNBM 3ZYRA 1NQJA 3K3NA 1JTZX 5FMDA 4BDVB 5JIUA 1CN1A 4FO9A 5L7OA 2O8OA 1MACA 4V1PA 4GKYA 5C33A 3V0BB 2HWB3 2XUMA 3AP4A 3SLIA 1IZ3A 2VZPA 3I4IA 3M3OA 4IQPA 1NE6A 1Q3EA 1ZZ6A 4CEYC 1RUG3 4F8AA 1XU2A 5DG1A 1GNZA 3UYJA 3CLPA 1WLTA 5EJ1B 2B7YA 4YVWB 1J3PA 3GZEA 3OBAA 3FFQA 4K8RB 4J1WA 3I8TA 3MUY1 4TYSA 4CDQA 4DUXA 5L73A 3FLTA 2YUEA 4I0AA 2DTWA 2OQ6A 2WFPA 3CF6E 3PL0A 4KU7A 1SPPA 5GLVA 4CCOA 2B45X 3L2YA 5LRRA 5A1FA 4FTEA 1XRUA 5IW0A 1Z7S2 2GMPA 2WR9A 1GQPA 1OKQA 2WO2A 2WZ8A 5EJZB 3IAPA 4B4RA 4G3YC 2XR4A 4LO6B 3P3NA 5FLIA 4CXXA 2Z4FA 3I54A 3K2OA 3O0VA 3KVAA 4XDQA 3V56A 3D6EA 2PYTA 3H3LA 4XJ9A 2XXZA 5DUVA 4FFIA 4HETA 4AI0A 1GNYA 1PO22 1S55A 3AFKA 2BQPA 1KDMA 1Q8PA 2VUDA 3K51A 5FZGA 1YYNA 2Y6KA 5FZCA 4IDZA 4ATEA 2YY1A 2XG3A 4CUGA 1YI9A 1JYTA 1MS4A 2BOIA 2P37A 1NKGA 4JDOA 4LBMA 2Z2SB 2Q8DA 1PVC2 3CHXA 2X5IA 2WBKA 4Y24A 1FMD3 2W1UA 2OVUA 2WLQA 3GZTB 4QU1A 1YEWA 4RS5A 1DQ1A 1T6BX 5CVRA 3V0AB 2C0ZA 4FT8A 2UYAA 4MHUA 4Y5TA 2G4IA 5EWSA 2DVAA 3LAGA 3WG1A 4CCNA 4OMDA 2WS91 4DY5A 5L9VA 4TWTA 2A6XA 4LIVA 1GWKA 3TEZA 4O61A 2P2KA 1DGWX 3W21A 4CU8A 5A7WB 4D7SA 2WRAA 1MZ6A 4BIOA 2FDHA 3MW2A 3PUSA 4Z8BA 4AK3A 1F2NA 1FT9A 4RGAA 1UYXA 1N3QA 2WNVA 4KGGA 1V9U2 1ULDA 3N9QA 4HPKB 4RR3C 3VBRA 1X50A 1XOYA 1YFUA 4EE2A 4N53C 3ZN6B 2IXKA 4K9SA 4C90A 3LOIA 4FAGA 4XOGA 2IXCA 4PF5A 1SFPA 4A41A 1FX5A 2OPKA 1MEC2 4XTPA 1NCQB 3TYJA 5LA2A 2YB7A 4AAPA 3L2HA 4M01A 2Y6LA 2J1AA 3E97A 5BNPB 3T30A 3MV11 1ZZ8A 2Y6FA 3NMBA 4HOOA 3HNMA 4Q4Y2 1BEV1 4AGVA 5EQUA 1ZVFA 4I3GA 2WC2A 3QBQA 3VZOA 3WUDA 3N9NA 4CP9B 5A3LA 5CU1A 5BNOC 3HQUA 3O14A 5BYNA 3N7MA 5FPUA 1PMJX 2GN3A 2P4EA 5IK5A 1UU5A 2JD9A 4OUMA 3QD6A 3O1PA 2HWE1 3WX5A 3VBUC 1QJX1 5FQ0A 5DXDA 3I97A 1R083 1PIV2 3RYKA 3OTFA 2VCBA 4GMP1 3RRDA 2B4KA 2K2SA 5JWPA 1UX7A 1W8TA 2EA7A 3NQHA 1NAEA 4YGCA 4KWJA 2XLAA 3FHAA 1D2SA 2VOTA 1BXHA 4Q2FA 1HRI2 4HK9A 4Y3OA 5F6LB 1BLZA 4WM8C 1H8VA 4YWAA 4BQ2A 3TEWA 5CFDA 3WVJA 4CCLA 5FUNA 4CEYB 4WZCA 3POJA 4QX3A 3LF7A 5FZIA 4FPOB 4XJ8A 1UY1A 5DDJ2 4ZZ8A 4PDWC 1QJZA 1PK6A 1A34A 4L2NA 1APNA 1NXMA 1HXS3 1UO9A 1QDOA 2HWD3 3GALA 3MW3A 4OLLA 5FP4A 2VZVA 4UF0A 4OQ9A 4CA9A 4K6BA 1AYM2 1Q8VA 3WXPA 2CDOA 2WKKA 1ULEA 1VBC3 4XFBA 4JAAA 4C1XA 3FHQA 2HEVF 1W6OA 1ZBE3 2A6ZA 5HCAA 5C7GA 4GAZA 1AJKA 2VCAA 1AR71 2XPJA 2BGOA 4Q4W3 3JD71 3F2ZA 4PHZA 1ZZBA 2DFCA 2Y6JA 3H1WA 4LLFA 3I3BA 4LUMA 5A80A 1SQ4A 1OQ1A 2D7FA 1NE4A 4Q4V2 3THPA 1FPN3 4FTBA 3THCA 4E4DX 3OB8A 3VZNA 2KM2A 5C70A 3H50A 5D21A 4XBQA 1F31A 2WDBA 3BOPA 5CYYA 1EV11 1EAH1 3ST7A 2VVFA 3AMMA 3ZLIA 5BPXA 4Q1RA 3T09A 2JXAA 2ZX4A 4UI9L 3WW1A 2BYVE 3FBYA 3VHNA 3UT0A 4AZZA 3TN92 4GWMA 3H7JA 2X10A 4OI4A 4KL1A 2A6VA 4IV3B 4R9AA 2GNTA 2VAUA 5FAXA 3WW2A 1XSQA 4UXAA 1OPMA 1YFYA 2ERFA 4FOWA 4QU2A 3NNLA 3GF6A 4CCCA 4JQRA 4DY3A 2W9XA 4LQRA 1WW7A 2YG0A 2ADEA 3ECQA 1NUKA 1D2QA 3DKQA 2WT2A 1IGOA 1N3OA 2PLV1 3VZJA 1GSLA 4S2DA 3ZXFA 4C91A 1JMUB 1ZRRA 4LOTA 2BV4A 1S0GA 1AR92 3I2FA 4RR3B 1GBGA 2QDRA 3AKTA 2B9UA 4N53B 1B35A 4K3UA 3O1VA 1HB2A 4WVMA 4BQWA 2BBAA 1JN2P 2XONA 4YM1A 1EUTA 1QH7A 1NXD1 5JIAA 3HD8B 1VRH3 2WSVA 5IAXA 3LQCA 4M4RA 4AVTA 2ZGRA 3U11A 3P6BA 1HJGA 5CNAA 2VMDA 4MGKE 2VUAA 2BWAA 2BOJA 3SH4A 1I9RA 3VL8A 5T55A 5C9AC 4Q0PA 5FY8A 3X29B 3M3EA 4GXLA 4E9KA 1WLWA 4NOTA 3PVNA 2Z5WA 3DPRC 3URFA 5BNOB 3N7JA 2EAKA 3ZN5A 1OOPC 1JU4A 5FO7B 3LDKA 5KXBA 1W2AX 4AVAA 4AQSA 1B09A 4LORA 2ORXA 1ST8A 2VUJA 5IK4A 3WDWA 2EF6A 5DABA 4CDWC 1PGL1 1YRZA 1QIQA 1GMMA 3VBUB 3EBRA 3K48A 2CSGA 2QQWA 2CAUA 1TME3 4QXHA 3OY8A 1TMF3 3SKVA 5EIYB 5JZGC 2H6BA 5FRAA 1ZBA3 1FMD2 3FFZA 1XE8A 2VL4A 4FXKB 2XB6C 4Q0VA 4BIFA 4YVSA 2IUWA 1BQPA 2VZUA 4X6QB 1PMIA 3G6JB 4QKNA 5LASA 4NIDA 3KQRA 4WM8B 3NSTA 2OS2A 1W2OA 2E9QA 3OEBA 3U78A 1AF9A 1O8SA 4MHRA 1CONA 1J3QA 1W3VA 2VNVA 1MS9A 4AVVA 4DNYA 1GNHA 1PVXA 1RUE1 1CX1A 3VDDA 1X9TA 2CV6A 1RB8G 2AC1A 3PMSA 3WF1A 1XXNA 1CJPA 2BP6A 1GZWB 3VKLA 1UMHA 1QOOA 3VHRA 4JGYA 4P9XA 3WP6A 4G4FA 2R063 5FY9A 1W39A 1W6PB 4IESA 5FZ7A 2A3YA 3NJVA 5FKCA 4JRAA 1OBNA 3EQEA 5DAWA 1R1A1 2RMU1 4MX3A 2DVBA 3ME2A 2WNEA 2ZAHA 1HB1A 5A33A 2BNOA 3VUOA 3J8F3 5H9RA 3OPZA 1RUJ1 4L0PA 3VZKA 3ZO0B 3WLUA 1G8WA 3WG2A 2A71A 1F5JA 2GNMA 3ZVXA 5FJKA 3ZFEC 5AC91 4XAEA 4XJZA 5EV7A 1ZZ7A 4I09A 3O1SA 1Q8SA 3DXUA 2RV9A 2BJSA 1BMV2 4LBQD 4YZ4A 4QX1A 4IEXA 1GP6A 2AGSA 1W90A 2JDUA 2JKXA 4P9IA 3ZX7A 2J22A 3AKRA 1S2BA 2CAVA 1UX6A 2IFRA 4K40A 2PAEA 4Q4X1 1VB2A 1VALA 4LA2A 3SC7X 4LPLA 3FC0A 4W6XA 1MS3A 2V73A 2L9LA 5FPLA 3W5MA 5DAXA 5FZEA 3S6PA 4JCKA 3WW4A 5GZCA 1DGLA 1MQTB 5FY4A 4MG2A 2YROA 1CAXB 3V0BA 3NJXA 1UCXA 2D6MA 1OF4A 4Q5OA 5KR7A 3RSJA 4GMP3 2FD8A 4QMAA 1AJOA 3ZYJB 4XXAA 2D43A 4YVWA 1KXGA 2VPVA 3RI8A 3J7MA 1ZM1A 2D6OX 4PBPA 1COV3 1KS4A 2OT7A 3CZUA 3CIHA 3IMNA 5FWJA 1GICA 3MEPA 2VR4A 1U0AA 4HKLA 4OI1A 5JOWA 1OLME 4NPRA 5LEJA 3N7KA 3OGRA 2ZMKA 4BISA 1GWMA 1PK6C 4CCEA 5KHJA 3AXDA 1HXS2 1LCLA 5A1LA 3ABZA 1TNFA 4LNVA 3AK0A 4CDQB 4S2GA 2CWSA 2JE9A 3I2GA 2VGDA 3EHKA 3LDBA 4OUSA 2QQMA 4COYA 2GH2A 3ZYFA 4Q1PA 2RR13 2W94A 3GYDA 2XQRA 4LO5B 1OUSA 2W0XA 5FKBA 5LBFA 5JSOA 1AL21 5A6YA 4XVHA 3VBFC 2CGPA 1WD4A 2WNOA 3T2TA 4JC1A 2VMHA 3PJYA 3SCHA 3JBG1 1K45A 4Q8LA 3RWKX 1OOPB 3T0AA 1ENXA 1JU3A 2D44A 4P9GA 1VRBA 2G9GA 4MOAA 4CDWB 3KF5A 1M06G 3VN4A 3POYA 1EP0A 1D4M1 3V0AA 1Y9MA 1JHNA 2E32A 3IIIA 2JKBA 2W68A 4AFMA 2HH9A 3ZSMA 3FL7A 5FYHA 3VBHC 4BZ4A 2VQ0A 1NCRC 2X5IB 4D7YA 5JMCA 5A7WA 1WWYA 5CFCA 3S5AA 1BCXA 3ON7A 1JI6A 4BXFA 1RUH2 4LO8A 1EAH3 1VMJA 1XJAA 4UAPA 1HRV3 3GDBA 4UFLA 4LBLA 5FXXA 3BPZA 2Q8CA 2RS11 4QKDA 4ZU5A 1OFSA 1J83A 4XILA 3H1YA 4RYDA 3ZN6A 3POWA 4WVVA 3NJZA 5A6QA 4NIGA 4YGBA 2WNVB 1H9WA 1I5PA 5F7UA 1C8M2 1NCQA 1H8TC 1DP0A 1HJFA 1OMIA 1UAIA 2OW4A 2R6QA 2ZX3A 3AL5A 3HQRA 4P08A 3D3AA 3OD4A 1LOFA 4CP0A 4CVUA 5BNPA 5C3PA 1PGW1 4P5HA 2Y6HA 2PQSA 3S5QA 3VD4A 4HT1T 1HB4A 4CE8A 1VBE1 4FPLA 3ALQA 3AP7A 3LSDA 4CP9A 4E2SA 2ZHKA 3E5XA 3WNPA 1FYUA 1G6NA 3F95A
chains in the Genus database with same CATH topology
2PAMA 3KCXA 4FPJA 2W52A 2FZ1A 5ABJC 1Z0HA 3IM0A 3ZFEB 2DUOA 3SCFA 2DF7A 4RQPC 5LEKA 1YJLA 2ZTNA 5T5OA 1A78A 2XL9A 1LESA 1W6QB 2XJSA 1R093 1CAUA 4AVBA 2HWB1 3AZXA 1RUG1 2D3RA 3KGLA 1URXA 4YRDA 2HYKA 5JCTA 3W59A 1QXRA 3VBOC 2ZHLA 1PO13 1LOGA 2ZGMA 2VNOA 4CEYA 2EXKA 4YW2A 3EJKA 2Y38A 4AEDC 5H9QA 4I0BA 4YZ3A 1CX4A 5FDBA 1X8MA 1RIRA 2WWSA 2WT0A 1POV3 3AFGA 3LOBA 2R041 4BMBA 2WFF3 4B7EA 4L9BA 4BYYA 1X8EA 2WS92 1Q8OA 1GR3A 3SNMA 1PK6B 2BTVC 4NHKA 3E6BA 4XF3A 3ZSLA 4K1YA 1JYCA 1QNYA 4YYOA 4L11A 4META 3OGGA 1W0PA 4OVEA 5JR7B 1RTVA 1YUDA 2RHPA 1DQ6A 1O3QA 2RE9A 1BBT3 4R8HA 3I59A 4J6GA 1N47A 3ZFGC 4PLNA 1R1A3 2NYYA 4UW5A 1XYPA 1DZRA 4DRVA 3FUOA 1T6GC 4N9IA 3ZYGA 4LHLA 1BEV2 2ARXA 1FXZA 2BUKA 2D6NA 2D5FA 5F6KA 5AVAA 1CIWA 4XHXA 4LHKA 4IEVA 4D7TA 5HCBA 4YGEA 2D5HA 4Y1XA 3AMHA 4RL7A 3S7IA 3KT4A 2X53S 4UBGA 5BY5A 1RUI3 4I01A 3B9IA 4RHV2 4OULA 4COUA 3VL9A 2HWE2 3MLJA 1QJX2 3HAGA 4TZDA 1VBB3 1DQ5A 1CR7A 2EXJA 4N53A 2BW8A 3IT8A 4AI2A 3PVBB 3AMQA 4XQ4A 3W58A 1VBD3 1NLSA 4FTSA 1OQEA 1UF2C 1H8TB 4GH4C 3MF9A 2K9ZA 1B35B 1MZ5A 2LUWA 1RINA 1RMU3 3VBSC 1H4HA 1SCSA 3GHMA 4EN8B 4BE3A 4NWWA 1X33A 4UW4A 2QZ3A 2WZR1 3VHPA 4HKWA 1R081 1N1YA 5BNOA 1DGRN 1BYHA 5ABJB 3MPBA 4JRLA 1WD3A 4Y1YA 3IN9A 4DXZA 5K0UC 4RQPB 1LHVA 3VBUA 4S2HA 2VOXA 3TNQA 5ACA3 1PM7A 3N36A 3MDPA 1AR72 1AL23 1JXNA 1DLLA 3TAYA 3JD72 3WDVA 2GN7A 2RM23 3JBG3 3KT7A 1RL3A 4FOVA 1WCDJ 4WM8A 2XKPA 4M0HA 5L19A 1D4M3 2HWD1 5IT6A 4N90A 3GZAA 2DV9A 3A4UA 1AX1A 4AEDB 1S0CA 4PBOA 1VBC1 1EV12 1O91A 2NM1A 4PDWA 3WNXA 5K9YA 1ZBE1 1DFQA 2GC2A 2XVKA 4HLTA 3IIAA 2P3JA 1GV9A 3VDDB 2JECA 1W6PA 2PHXA 1AYN3 2BVVA 1FPN1 4MV2A 3VZLA 3WZ1A 4RFT0 2PLV2 1J1LA 1V70A 3ROUA 3NV4A 4E4SA 3WDYA 2ZGUA 1NY71 1O4TA 4YM3A 3SXWA 3GZUC 1MZFA 1N1SA 1GLHA 4QHBA 5IUQA 3ZMNA 4OHZA 1VBE3 2D6KA 2V5YA 1WLCA 1XNDA 2JD4A 3AYCA 1C5HA 3I2DA 4BLIA 3OYWA 1CAXA 4XJWA 4AEJA 4XETA 4QQPA 3DL3A 1WGPA 3IDBB 4AVSA 3QH6A 2GSYA 3LZZA 1GKBA 1RUD1 4UW6A 4K20A 2XHKA 2DWRA 2RS53 1VRH1 2GC3A 3HT2A 3Q9OA 4LLOA 4AEKA 4COVA 2FMDA 1CAWB 1WBLA 1BVP1 5T52A 5J3UA 1LB2A 2CGNA 3MFAA 2ILMA 1PNFA 1FOD1 3KT1A 3SISA 1SACA 4DINB 2XVLA 3VBSB 2RJLA 4Q29A 2VNRA 2R043 1ZNPA 2ZGKA 5C9AA 3PLQA 2EAAA 5EYXA 1RUE2 1TE1B 3DPRA 3MIGA 1TME1 4BPZA 1OOPA 1LU2A 1TMF1 2PHFA 1LHWA 3TBDA 1LRHA 3WHUA 1ZBA1 4CDWA 5JOXA 4KWLA 2IXIA 5K0UB 2ZACA 1JYIA 4IEQA 3LA7A 3RNSA 4XFAA 3BTAA 4W6YA 1DZQA 5JZGA 1X82A 4N43C 4YZ5A 3UL2A 1UZYA 4C0HA 4HVRA 2RMU2 4OHVA 1RUJ2 4LEJA 1LHNA 1LOBA 5GZEA 4E2GA 3ILNA 5AC92 5KC6A 3THTA 2UU8A 1LU1A 4F7ZA 2QUOA 1MS1A 2E7AA 2PHRA 3QOPA 5CFCB 2A6WA 5FFOC 4PCRA 4LE3A 5CIRA 3VKNA 4CYDA 3ZSJA 3SHRA 2R061 4IEOA 4Q4X2 5L36A 3OF1A 3HMYA 1J1TA 2PN5A 2DUQA 4PLMA 3TRSB 1Q8QA 2RJKA 3J8F1 4M3CE 3ZPYA 1AXZA 3PVEA 1NA1C 2Q0AA 5JI9A 3VZMA 4GB33 1V6OA 2D98A 3ZFEA 2OUJA 1QQP3 4TSVA 5I8TA 2ZKNA 3R4SA 4ES8A 4LTAA 5LK5A 5BNQA 1W6QA 2OZJA 2A70A 1UZZA 3AMPA 2YYOA 5FMOL 2WZR3 3OGJA 3KD4A 3RYRA 1CAUB 1H0BA 1H30A 3USUA 5JPMB 3OD0A 1LEDA 3H1MA 2VULA 4DZGA 3O0XA 1COV1 1UU4A 5C8CC 2XJTA 3AB0A 4QM9A 2EALA 1IS5A 2GH8A 3MZHA 4MXVA 2CY6A 1V6KA 2F4PA 3WG4A 3NAPC 2XKOA 2GMEA 1K5MC 1XE7A 2ZCWA 3O7OA 3BCWA 1X36A 4XFCA 4MUVA 1SLIA 4DQAA 4AWDA 1JH5A 4XTMA 1VR3A 2VVEA 2C1FA 2RR11 4MVTA 3ZFFC 4X6RB 4WBBA 3AKQA 3R0RA 1J3RA 4QPIC 2O8QA 1HQWA 3FLPA 1DF0A 2BEOA 1OA4A 3QLQA 4NO4A 2N7GA 4A2UA 4AFAA 2XVGA 4BQ1A 2RS12 3VBFA 1BVVA 3WR0A 1KJRA 3ASIA 3BIWE 2GAUA 4W6WA 2DVFA 2XBO3 3LSEA 2YC0A 3M1HA 1D0HA 4IEWA 4H7LA 5A3MA 1Q5OA 1PGW2 1YLLA 4MGYE 3VBHA 3C2UA 1NCRA 3A0NA 1DQ4A 3I59B 2GC1A 1VBE2 2LM3A 3DUIA 1ND3C 1HRV1 5BNNC 5LRSA 3WP3A 1CPMA 2K0GA 2PAKA 2P34A 4I30A 3J26N 1C8NA 2XWJB 1RJ8A 3D0JA 2BWCA 5EFUA 1IS6A 4JGZC 4QM8A 1N3PA 4YW5A 2ET1A 2OA2A 4LBJA 1VJ2A 3AJZA 4FSJA 3LA3A 2HWB2 4A7KA 3E5UA 1H8TA 1RUG2 2RS33 4HFSA 1OQDA 1QXJA 2DCTA 4AFDA 1RHI3 2NLRA 1WA4A 3VKOA 1SLTA 1NA1B 1RUD3 5FREA 5CBLA 4Y5Z0 5DZFA 1TEIA 3B5LB 1JBCA 4Q26A 1WMDA 4EN6B 1I1EA 5ABJA 1FOD3 1R091 2R042 4ASLA 4FP3A 1V6JA 3AKPA 4RQPA 1V00A 4ORFA 1ENQA 1XYOA 2SBAA 4I3PA 2BPA2 2ZKLA 2DVGA 2DVDA 3CO2A 4XYXA 1UPIA 3UJQA 1NG0A 1O5LA 5FLJA 3M7AA 1PO11 5GLWA 3HIFA 4FPCA 1AXKA 1GQHA 4CDXC 3ES1A 3FWEA 1JUIA 2FMYA 3MIBA 1GFF2 4DRRA 5A32A 3MIHA 2BFUS 3VBOA 1U5YA 3IDCB 1S0EA 4AGRA 4LBNA 4JDMA 1POV1 1GZCA 5I0SA 2JG8C 4AW7A 2WFF1 5C8CB 2YDEA 4QGMA 1H1IA 2NN8A 4JVAA 4AEDA 1S1AA 2ZGPA 1YXWA 3WDUA 4DOUA 3NAPB 1OFNA 5BXXA 1K5MB 1GQGA 4UW3A 4P9WA 1G7YA 4EWDA 1Q43A 3WUCA 4A3XA 4DFSA 4PDWB 1IS3A 2CL2A 5JVVA 2W39A 3D4KA 3RG0A 1BBT1 1SEFA 4QQOA 4AI8A 1J59A 1NQDA 2VW1A 1VBA3 5GALA 4BMEA 4R52A 2D97A 5D8AC 4HVQA 3O5SA 5FBZA 4XFGA 4E4ZA 1Y43B 3ZFGA 1O7FA 1RGSA 1LGNA 2NQYA 4LULA 4N7UA 5I8SA 1UPSA 2GC0A 4S2FA 2NMOA 4QGLA 1G9BA 1SCRA 4X8PA 2IWGB 1RUI1 2E63A 1PVC1 1ND3B 2X8KA 1AR63 3AX4A 1O4ZA 2WZR2 1R082 1VBB1 2D3PA 2ZAAA 4D69A 4XFIA 1HIXA 1AL0G 3OYWB 4SBVA 1H4GA 1DZTA 3BOWA 1VBD1 1UKRA 2D6LX 4WVWA 2A3XA 1RUF3 2PHWA 3AKSA 1QOSA 4KNCA 1CAWA 2QNKA 2ZBJA 1RMU1 3NVCA 1PZ7A 4IEUA 5GJ6A 1QKQA 1S0BA 2D40A 5T5PA 1U12A 4GH4A 4XPVA 2VMIA 3O0WA 1SFYA 3RI9A 1QJU3 2WNUC 4B4QA 3VBSA 4H55A 5AVPA 2HWD2 2QCSB 3B3QE 4XMIA 1EY2A 2GALA 2FQPA 2XWBB 4CEWC 2Q4SA 3LB9A 4QPYA 3GBFA 4Z92B 1VBC2 3WV6A 2X29A 1ZBE2 3U0ZA 5ACA1 1RVF3 3B94A 2PHTA 4Y20A 1YCIA 2PQQA 3DKWA 5C9AB 2E51A 5K0UA 4Q4W2 4FCAA 2AYHA 4BA6A 3DPRB 2RM21 1QWRA 1C28A 3AM2A 5EZWA 4YW1A 3L9JT 1FPN2 2QKDA 4CDXB 1LODA 4EWAA 2FHRA 3CJIC 3KCCA 3R4UA 4BWOA 5JZGB 3MICA 4ITCA 1NY72 4BCUA 3WG3A 2R073 4KQ7A 3VV1A 2JG8B 5C6CA 1MS5A 1QDCA 1CJDA 1BJQA 1RUC1 1ASJ3 3I7DA 1OPOA 2EXHA 3DF0A 1AYN1 3FLRA 3AP9A 1SDWA 3IBMA 3WQ7A 2ZGNA 4HVOA 1CQ9A 2ZOEB 5JWPA 1FV2A 2MHFA 1OD5A 2R30A 4GA9A 2CWMA 3OBRA 5DDJ1 2IXHA 3QH7A 4DB5A 5GLUA 3VKFC 1GZ9A 2GNBA 1N1VA 1YO8A 4A7YA 1QNWA 2QDNA 3UKVA 3KB5A 4EN0A 1RUD2 2MNGA 1UIKA 3AXEA 1VRH2 4FPGA 5EYYA 3MYXA 2BVBA 2VW2A 5E8AA 2WT1A 1AR83 4C0BA 5FLHA 3AYEA 3LWCA 1DDLA 2BNMA 2XL7A 3SH5A 3JB8A 3KM5A 5FOJB 2R49A 2HWC3 1I6XA 2WLPA 4ATFA 1J58A 4FOYA 1ND2C 1W6NA 5FPXA 5J09A 4Z82A 2WJSA 4Y22B 4RD7A 2RS51 1QHDA 1RC6A 1TME2 2GMMA 4ES9A 1TMF2 4YG6A 1ZBA2 1C4RA 3USUB 1HLCA 1CESA 2Y0IA 4D94A 4YARA 1QJY3 2E7TA 1AUYA 2DURA 5FO9B 4XMAA 4O9GA 4CTEA 4F83A 1BK1A 1CD3G 4KH9A 4FBFA 1UKGA 3IDEA 2Z42A 4XIOA 2A6YA 2ZHMA 4HBNA 1C1LA 4XFFA 1D4VB 2WNUB 1CPNA 2EXIA 4HK8A 2EIGA 2H6CA 5E1RA 2HEYF 1DU3D 4XQWA 2VMGA 4Y1ZA 2R062 2SLIA 4FP2A 4R9DA 4QPGC 3VBFB 2R0HA 1QGLA 4OHXA 4XF0A 3J8F2 4XE9A 4Z2WA 1XQNA 3B00A 2YMZA 4MXWB 4N43A 2YZ4A 4FPFA 4XF1A 4ZU4A 2UY9A 1KITA 4FPYA 3VBHB 1ZYBA 2WQZC 1NCRB 4Q8KA 5CAZA 4LO7A 1PO23 3B69A 4H14A 4Y4YA 1YI7A 4YFZA 1PVC3 1SMVA 3RWNA 1SLBA 3H0OA 1WBFA 1ULCA 1SLCA 4KWKA 1LHUA 4AI1A 3ETQA 3ES4A 4GB31 4YNIA 4XW3A 3RYPA 3KMHA 1NA1A 3OJBA 1M4WA 1YNAA 1REDA 5H9PA 1COV2 2IC1A 3ZSEA 1QQP1 4M3CB 2ZX0A 2W08A 3IKWA 2XLFA 2E6VA 3JQXA 3HT1A 3NKGA 1KFXL 2BGCA 4C1WA 2ZJCA 3IPVB 1V9U3 3WDXA 2O1QA 1KDKA 2KXLA 4B7KA 2RR12 1Y7BA 4XF4A 3INAA 4NHLA 3UV9A 1MEC3 3ZXJA 5FO8B 4XQDA 2WSUA 2H0VA 3MF6A 1F8VA 1F5FA 3ILFA 3HWJA 2R32A 1JW6A 5EJ3A 1ND2B 2JJ6A 1LKNA 3PTYA 5C8CA 5H9SA 4TLFA 5A32B 3VBOB 1FATA 5K7PA 4U2AA 3APBA 3S7EA 1PZ8A 4LBOA 3NAPA 3H9AA 1DGRA 1H1AA 1K5MA 1NZCA 4R9BA 3T1MA 2ZZJA 2ATFA 2OYZA 1PIV3 1REFA 1EAH2 2R0FA 2XJVA 3ZFFA 2ZABA 2YGMA 1HRV2 2UY8A 1DIWA 4BM8A 1H2NA 4EROA 1RUC3 1LEMA 4QPIA 2IZWA 5I0RA 1HRI3 4UBHA 5DZEA 4NR1A 3U07A 4AI3A 2XBO1 5KXDA 3JU9A 1WCKA 4QX5A 1VLNA 4CP2A 2HJIA 4HANA 1REEA 1LJ7A 1HX6A 5DDJ3 3LA2A 3CU7A 3LCPA 4IEPA 2AREA 4FQZA 1IPKA 4JDNA 4QPGB 2EVXA 4EN9B 2NMNA 1WW5A 1DBNA 5C4WC 1WMEA 5DZGA 5JOZA 1AYM3 3PVOA 2R16A 1HV1A 1H2MA 3ZFGB 2ETEA 2DFBA 4HSLA 1ND3A 5BNNA 2FZ2A 4K8FA 4YW4A 2ZGQA 4CDUC 3KSCA 1A8MA 3LKJA 4BHPA 3NV2A 1R092 4JGZA 3UK9A 1S0DA 2VOWA 4COWA 4Q4V3 4QT6A 5IK8A 2RS31 1LOCA 4AG4A 1KJLA 1RHI