2G9ZA

Thiamin pyrophosphokinase from candida albicans
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
322
structure length
297
Chain Sequence
SELIEQVIEQPDSLIISPPSYNHIQPFVYLHNVLLILNQKITIDLISLWKKCEIIVCADGGANSLYEYFNLQRSDYIPDYIVGDFDSISPDVKTYYESHGSKIIRQSSQYYNDFTKSIHCIQLHYQLNHTKENWFESIDEVDGLAKLWNGLNNSSDVVVDIDITIYVLNAIGGRFDQTVQSINQLYIMNEDYPKVTVFFITTNDIIFLLKKGVNYISYKNRLMFHKDNGSSPTPTCGLLPLSNKTPIILNSYGLKYDMRNWKTEMLGQVSSSNRISGETGFIVECSDDIVMNIEIDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords thiamine pyrophosphokinase
publication title Structural characterization of CA1462, the Candida albicans thiamine pyrophosphokinase.
pubmed doi rcsb
source organism Candida albicans
total genus 95
structure length 297
sequence length 322
chains with identical sequence B
ec nomenclature ec 2.7.6.2: Thiamine diphosphokinase.
pdb deposition date 2006-03-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.320 Mainly Beta Sandwich Jelly Rolls Thiamin pyrophosphokinase, thiamin-binding domain 2g9zA01
3.40.50.10240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Thiamin pyrophosphokinase, catalytic domain 2g9zA02
2OMKA 2G9ZA 3S4YA 1IG0A 3K94A 3MELA 1IG3A 3LM8A 3IHKA 2F17A 3CQ9A 2HH9A 3L8MA
chains in the Genus database with same CATH superfamily
1PX0A 4YMSA 4ND6A 5EIWA 3ZIAD 5IVEA 1F2TB 2PX5A 4NEHB 3UOGA 5B30A 1CR4A 1OUSA 4HXCA 2NTNA 4JXJA 4XB6B 5EP2A 3RAPR 5JIUA 1BK0A 4R3NA 2Q4TA 3FLTA 4HYTA 2BJWA 1KEZA 1WXQA 4HUJA 2DKOA 1JZSA 3A6ZA 3SBXA 2NZJA 5JG7A 4WA8A 4D9EA 4DY4A 4OQDA 1PNGA 3NAGA 1VHWA 3MOIA 2W3JA 4RK4A 1RBQA 3X2FA 1EHIA 2A5ZA 3BA1A 2FLVA 2ET7A 3OEWA 5F4BA 1JB1A 4E88A 4M01A 1DDLA 1XPJA 4JENA 2YQ5A 3QHPA 3VA7A 1GL9B 2IOFA 2XQXA 1VE6A 4GB32 3AJAA 1D3AA 3DCJA 2JIGA 1LPAB 1EVLA 4HUQA 4BBZA 3MI8A 2A88A 3FI0A 4FW8A 4JDOA 1ODCA 1C7IA 2I4LA 2J5KA 3FGZA 3URKA 3CZ9A 3N35A 1XJQA 1A9RA 1ITZA 2EL9A 4DUPA 2XRZA 2JGNA 1H9PA 3CLPA 4H2DA 1FVOA 4PHFA 3N74A 1W59A 3BT7A 1N9ZA 5LQDA 5CMLA 3R7FA 2YJ5A 1DELA 3ROTA 2WUVA 3ZV5A 1NIPA 3O0TA 2HA5A 3JB4C 3AYCA 5GZFA 3AEKB 1DQZA 2CHHA 3PFWO 1OKQA 1EPUA 1Y6QA 2VZ3A 3R6SA 3F74A 4YUVA 1T5LA 1I7SB 3LC0A 3IDEA 1RUNA 3GMDA 4G0ZA 1CONA 3UJOA 1LK0A 3ZGZA 4XQEA 4HGYA 5JWPA 2D6MA 5K0NA 3TW4A 5K6TA 2C8LA 3FYUC 4XLZA 4E51A 1RW4A 1W2UA 3KWMA 3ICEA 4GWIA 2J9FA 1R4NB 1IWOA 2HFKA 1C0PA 2YS6A 4X7BA 1H69A 3T9BA 3TW8A 4X1YB 4UULA 1T1RA 4JYPA 1IIBA 4C20A 3D7SA 2FDFA 5FMCA 2EBHX 3WXMA 4YAOA 4RD1A 4N7IA 1VKNA 1GV9A 1Z39A 1PS9A 1J24A 5IVKA 1R083 3EIOA 3CZJA 3L77A 3GCWA 3IAM6 1TJYA 1O96B 1ZESA 1XRQA 1GZSA 1UPCA 2FJUA 5BOVA 1T8UA 3SYKA 1KY5A 2YVLA 3R05A 3EEYA 1S9DA 4HWPA 1ZRFA 2NZWA 4JQYA 4V39A 2I7TA 1CS0B 3HRHA 1MW9X 3LW7A 4KSYA 5D5QA 3I6YA 4WFIA 2YC4A 2OVFA 1RUC1 4KFRA 2CWMA 4ARIA 1VJ0A 3RU7A 4ZXKA 1N9GA 4QKNA 4D6YA 2PXAA 3BB6A 1JLHA 1X1BA 2DHDA 4UOJA 4IZ6A 4QASA 4KGGA 3FHAA 5E6RB 5FTTC 5BSFA 3NSTA 4WCFB 4PIVA 3COSA 4OUSA 5T3UA 1A0OA 1SDDB 4BXFA 1NC1A 4MS4A 3A9RA 5AXAA 1MQTA 2RCYA 2ZIVB 3U3OA 1EVQA 1L8LA 2X42A 2WFPA 1UZNA 5HZHA 1U7TA 1Y42X 5CB4F 5JY6A 1CAXA 4UM7A 3B6JA 3QH6A 4ZYWA 1SBNE 1ZD2P 3BIJA 3KCNA 1TGYA 3IDSA 5FH9A 1R9MA 4NBVA 5ILQA 2RR12 4FP3A 4FE4A 4NPAA 5KX5B 1BOOA 1QS0B 4I9UA 3L7BA 2BCGY 2I3AA 4C14A 2ODWA 3ITQA 1NW4A 2FQ1A 2FWRA 1M2KA 2O2EA 4P4SB 5EV7A 2D40A 2UYCA 1IS4A 4B3NA 4RX1A 3MIZA 3AP7A 4WESB 1CUGA 4CM1A 1SHKA 2HO5A 2FKAA 1RUJ3 2JZNA 1OX6A 4GQBA 4KWJA 3F49S 2VYVA 3AWDA 1PMIA 2I4TA 2NZYA 4TKLA 2NO6A 5J9FA 1NBAA 1OI6A 2VLBA 3HBJA 2JZOA 3UT6A 5FV3A 1CAWA 2EBFX 1WMBA 4DXDA 5KQLA 1GLVA 4K0RA 4AEDA 2PBFA 4L6CA 2SLIA 1ZA4A 1XOYA 5ALGA 3UTCA 4P0TA 1DIWA 3SIWA 3KTDA 2IODA 3P0JA 3N2GB 2WZBA 4O2AB 1ENSA 2QU8A 4LEJA 4Y7DA 3UJPA 1X19A 3AV0B 1R9NA 1QPZA 4IDHA 4B6EA 3B00A 2FN7A 3REOA 3QELA 4CG0A 1TIBA 4CQMA 4YXFA 4TMXA 4LHEA 1XCLA 5EJ7A 2VWPA 4OCZA 2JAQA 3FMFA 3HCOA 4RGBA 4B71A 2XMBA 1L4FA 4QU2A 1BHO1 4FP2A 2YHIA 2QQ5A 3ZJYA 3OZTA 2YIVX 4LBLA 2VTBA 3TQIA 1YFJA 4FXPA 5HHTA 5B3KA 3BSFA 5LA2A 1J70A 4KQKA 2VCCA 5C3SA 4QEDA 3IJRA 3GLVA 1YFYA 2V7EA 4AI2A 1ULHA 2W2LD 1GXSA 3GPCA 4KGXA 2OBMA 3BICA 1EAMA 1CULC 4TL7A 4JCCA 4JQZA 1E1YA 1W8OA 1GO2A 2IPAB 3TOZA 1P8AA 3N9PA 2C2OA 5A7HA 2JFWA 3AF4A 1MIHA 1O6CA 5B12A 2R6JA 3A1DA 4M4SA 1OVMA 2ZYUX 3LSTA 2IXAA 3EVNA 5AI6A 3S28A 1NCQC 1H5UA 4U2GA 4D43A 3GRKA 4IS2A 1VP9A 4PZCA 1CTQA 2XRMA 4MS1B 1BKDR 3AZQA 3RS9A 1C30A 1RQLA 1XEWY 2Q6LA 4O63O 1L5RA 4D4MA 5F7UA 3K8ZA 1YJQA 1YZNA 1AQ6A 1UEJA 3PX7A 2DPYA 2CUZA 3OZFA 1R1A1 5JO0A 5HBRA 1EGMB 1ODLA 3VHQA 5HYVA 4BX0A 1EFVA 3BL6A 2BJHA 1J2EA 4DEVA 1NJ1A 1YTLA 1OLOA 1UWVA 5DCWA 2UKDA 3F3SA 3ROGA 2VMEA 3KHTA 2QRLA 4NOTA 3GR6A 4AUKA 2ZACA 1QONA 1PZFA 1VBD2 5D8AB 3ZY2A 4DV7B 3AM4A 4J2OA 1BE6A 1SZCA 5BNQA 3H16A 2VC9A 1J42A 1YVRA 3DPIA 4RWZA 4KITB 1BYUA 4WZ6A 2XOEA 3FOFC 4MDFA 1REQB 2FQWA 1MEC1 4MV7A 4RFRB 1R6VA 3UJ7A 4PYOA 1MS3A 1Y1TA 2AIRA 3APBA 4OYYA 3A6KA 1ASJ1 2W1QA 2I3BA 3WO0A 1H2RS 2Q8PA 3SSOA 5IJ0B 1ORRA 2QUHA 1QH9A 2AZXA 5JC1A 2X8WA 5IHXA 4UHJA 3AR7A 4QPIB 3E22B 5J2UB 3RZJA 4MXVA 3QKSA 3DMDA 4GZ3A 4EHHA 4RNCA 1XZPA 3Q87B 5HEKA 2VOJA 2VP0A 1LEMA 1T6ZA 5E0KB 3R3ZA 1NQDA 1VSBA 3C5EA 3QXXA 3GWZA 2EWVA 1O2DA 3ZW7A 4B80A 1II9A 1NOVA 5GJWC 4EW2A 5J37A 5CIQA 4BVHA 4LHLA 3FWNA 1N1VA 3O0DA 2JAUA 1DOZA 4B45A 1LWOA 4FPCA 2K2WA 3FDZA 1AGYA 2E89A 4MGEA 2WLQA 2Q27A 4J0JA 2ZUFA 1KR2A 1A8PA 5E3HA 3E35A 5J3UA 3K6SB 3B94A 2R7NA 1G3MA 5JXIA 1JIVA 3BALA 4IQ4A 5T4EA 4OAPA 2JEOA 4CDQB 3SIXA 3WBKA 5FFMA 4F06A 1XJ5A 3PFFA 3Q15C 1I3HA 1RXSA 4Z0NA 2HLHA 2QM8A 2PJZA 3WB0A 1UN1A 1ZZ9A 1DVRA 2VJAA 5CXQA 4FO9A 1Q0ZA 1BX1A 3T1YB 1WUIS 2E4VA 1P1HA 4PICA 2ZAYA 4FMCB 4ICIA 2PUGA 3O21A 3QVVA 1KI9A 5GV7A 1YK1A 2IUEA 1US8A 1HB2A 3E97A 4C7BA 4ID3A 1MQ8B 5EINA 4CTOA 1DIAA 4D6SA 2O1SA 4NR0A 5JCOC 3DVAA 4Y20B 4X00A 2DUOA 1QGZA 3A36A 4A7KA 2O5EA 3HU2A 4AECA 3BWYA 4NZPA 4QKFA 4G63A 1QJY1 4WZCA 4CF4A 3D0OA 1P7YA 3PMEA 2ZRPA 3GLHB 3I45A 3VDMA 4BKUA 3DBLA 5HFAA 2ZBEA 3UAZA 4IE4A 3NUGA 1NX9A 3T06B 1G8PA 2J0EA 1PJTA 3AF5A 3CZQA 2QUKA 3JVDA 3CHXA 2PKWA 3AR8A 2XA2A 1DF0A 3SQMA 4NCAA 5JRDS 3U1BA 1XMJA 2B25A 1XD2A 1EUTA 4MRMA 3WV4A 2Q1FA 1OXMA 4YMVA 3C3DA 6CHYA 4WL0A 2XKBA 3K0KA 5C52B 1HETA 4PLHA 1IVYA 1O1YA 5KTOA 5BV7A 4IGFA 4KH9A 4JL8A 3PGJA 4A42A 1EG7A 2SBTA 3PV0A 3H5WA 5C70A 3ZDRA 3SX4A 4H77A 4LECA 1JIUA 4JX8A 4P7BA 3VKFC 2CAUA 2FQYA 4NHMA 3VBFC 1VXRA 4FOVA 4RNDB 4YRIA 3RFRA 5HKAA 1XVUA 3CO0S 4CW7A 5FY1A 2WTXA 4E9KA 3OSUA 1UPAA 4ARZB 2PLV2 5CNKA 4AJ2A 5JEEA 5FWXB 4K6MA 3JV7A 5M34A 3QXSA 1RWNA 4RYDA 1JN0A 2WC2A 2H5IA 1Y3FE 3GEEA 1YVUA 2QT1A 1VSVA 5FJIA 2FPPB 4YMLA 3V2IA 3C3AA 1PFWA 1CUBA 2BKXA 4B8EA 1UXHA 4FD3A 3WRXC 3GDBA 4FU0A 3NTQA 2ISQA 3LEMA 3PT5A 4B3RB 4Z8XA 2O3TA 2XNDA 4BWGA 1Z0FA 1YL6A 2F3UA 5EWLA 4U0KA 1CG6A 1Y7PA 2DFCA 4MV0A 5BRNA 2WQ4A 2PZLA 3R3UA 1DARA 1S2OA 1JYFA 1R8SA 1P33A 1PO13 1F0NA 3PEEA 1Q92A 3LUHA 1BG6A 4DZGA 4BE4A 5FNVB 3OE4A 4G1VA 3NX4A 4BNGA 5ERXA 3DHVA 1IBKB 4Q48A 2CHQA 1C8M1 1SUCA 3KVBA 3M5DA 3E8SA 5JLVA 4PR3A 3ZHQA 3GGJA 5C8CB 4MR8A 2VRNA 3L9WA 5M29A 2WM8A 3WNPA 3GZ4A 5ACA1 2ZRHA 5FYBA 1ZUD1 2WV9A 3QKRA 1OCEA 1ZDMA 3EPLA 1PFUA 2JI4A 1BBT1 3WUDA 4NZZA 5FLEX 4P14A 5FZGA 4G3XA 3OCWA 3UKDA 1WVIA 2VQAA 4UBNA 3W0LB 4FFOA 4RD2A 5FP3A 1BGWA 1SHTX 3A31A 3NALA 4C7JA 5HM8A 1US2A 1S6YA 3CNBA 1OF4A 4KB5A 4CEJA 4CM4A 1RUE3 2ZJ7A 2PHRA 1ZZEA 4ZKEA 3E9YA 3ASVA 5DMXA 2DWCA 3L3BA 5K9ZA 1B6TA 1OHFA 5KNBD 1UOFA 2AOWA 4PF5A 2QV7A 2I76A 3KVNA 2YV1A 2JL1A 4R3WA 3CF6E 2WB2A 1JECA 4Q4X1 2CSUA 3E03A 1E6LA 3HK2A 3GAAA 1QZ3A 5D5HA 1WKBA 1EMDA 1N2CB 4PZLA 3LCPA 2GF0A 1BKZA 3GUYA 3JU9A 2MR6A 3ZWCA 4HEA1 1D2AA 2QRGA 1SKMA 5DMYA 2YRXA 4QXHA 5JI9A 2DCTA 4ECEA 2OHHA 1JV2B 3EIWA 4YUAA 3DTTA 4GX0A 3TTUA 3DWGA 4MZXA 1ZMXA 1V6AA 4YPOA 2X8LA 2QN6A 3DLAA 4KBFA 3S29A 3AU8A 4NICA 3VZMA 4Q4Y3 4JGYA 2W95A 4PPQA 2VCEA 4NXMB 2QQ0A 1T8WA 2IXEA 3GAFA 4CPBD 1EVZA 3H3LA 2GA9A 5EZ5A 4KBBA 3ZU6A 5G4KA 1N6HA 4RVNA 3ZWWA 4B4KA 1GV1A 2XF8A 3U1TA 4W5HA 3RUAA 3QVLA 2AYZA 4JYAB 4BMVA 1QPBA 4MW0A 3STXA 1H1MA 5FOWA 4YMTA 4X8PA 4HDSB 1GG8A 2QNBA 3MXTA 4YHHB 2HPAA 1IWBB 5IBQA 3CFYA 5DM0A 1ISFA 4E5UA 1E89A 3JQ9A 1IG3A 2XVLA 4H6XA 3HXLA 4M22A 1G20B 3NFRA 3OF2A 4KXWA 5FL7D 2C24A 1HWYA 1TTTA 3RODA 4HKLA 3R7DA 1N1EA 1JKFA 1BVUA 1CJPA 2HWC3 1UPBA 2FPMA 2OA2A 1NUUA 4GH4A 2YNMA 5SYAA 2OV2A 1PUXA 4DA4A 2P9GA 2XNJA 2Q41A 3IQIX 4A6OA 3PIDA 2R79A 1GARA 3HVRA 3KT8A 1ECLA 1DRKA 2Q5QA 1I80A 1MJ5A 1J5XA 4AXBA 1Y4WA 1UXXX 2G28A 1ZOPA 3LKDA 4LUCA 5CITA 1FNSA 1MVQA 1PZ9A 1RQRA 4CQLA 2JFYA 4F9FA 5FMOL 4H1TA 3L8EA 1ECFA 3RKUA 3W9UA 3OIGA 4U39A 2FCAA 3FHCB 1CIWA 1GZ4A 4D5GA 3LT0A 1YUDA 5FLHA 1B1AA 2WEKA 4YMIA 1Z4KA 4N5IX 3WIVA 4BX3A 4XBLA 4MQ5A 1E61A 1W2TA 1H2HA 1WUYA 1RWPA 4Q6WA 3FFQA 1VCMA 3MJHA 1PWYE 3FY4A 4W6XA 4ENSA 1X38A 4LE0A 3P0HA 2PANA 3HPRA 5TVKA 4TTAA 3F6EX 3NHWA 4OLFA 3T6KA 2QHXA 4FQ7A 3HKEB 4HBZA 5E0OA 4M0UA 4JJKA 3RUCA 3EA0A 1WCV1 2Z57A 5EZWA 2BBAA 2VW2A 3OKPA 2D54A 4J49A 4LPKA 3MWGA 3KQUA 2Y1LA 1NNLA 4GLJA 1HMPA 2PN5A 4FFVA 1FFCA 1DAKA 1DUVG 1FJ2A 3QA9A 4D7YA 1S8NA 1NJSA 3H19A 3WG4A 4JT8A 1X0XA 4OB6A 1NUAA 2OOSA 2HCTA 5HZMA 1TKRA 4AMBA 3HL0A 1BXGB 3MTJA 4NE2A 4AUMA 1QF6A 4ITUA 1OI3A 3UF0A 1I14A 4XJ9A 2OQVA 1ETUA 1UOEA 3ELWA 3WG2A 1PV2A 5C3UA 4OXQA 1DEAA 2VK8A 3TL2A 1U4OA 3WBFA 1KQNA 5JAZA 3DTVA 4RKYA 2AVDA 1Z62A 3HA7A 3H0KA 1ZHOA 3FKJA 1V39A 4XD7D 3RNOA 3KX2A 1USUA 3IKLA 3PNQA 3AXEA 2GVDC 5TSWA 4A0RA 4N54A 1D2EA 4FOTA 3RC9A 3RU2A 1H4SA 3MRSA 4B4DA 4WLFA 4PRKA 3C4QA 1BRTA 4MVJD 1RUC3 2CDRA 1ADCA 1EWQA 4LRQA 1DC4A 1U2DC 1VMAA 4BGUA 1LHOA 4BJ0A 4B32A 4TXMA 1U7UA 2F43A 3T7RA 4ZYTA 2QQIA 5D3KA 1REEA 1SUIA 2X5IA 1LRHA 3NJVA 4BZXA 1TVMA 5K0UC 3LRXA 4ZVOA 3V64A 3V0BA 2OXFA 2EF6A 2IYLD 1T2DA 2SBAA 2GETA 3ZCRA 2HADA 4DDHA 4XYLA 1T29A 4V0MA 5CM8B 4BFCA 3KWLA 3EVCA 4G3YC 1PTJC 4HZGA 1PK7A 3UPDA 5DXJA 3RWOA 5MN5A 4C03A 2D8MA 2VF7A 3PQEA 4DLKA 3PUSA 2CN1A 4EJ2A 4CF6A 1OA2A 1LSSA 2FFAA 1PWXA 5F12A 2C78A 2ID7A 5D8DA 2B8MA 1OH6A 1B74A 4YGCA 4CRQA 2VCMA 3N1UA 2RCNA 1UEXC 3WQQA 4RADA 3UG6A 2EL7A 4KL8S 2FDRA 3WWYA 1LODA 2B42B 3MDPA 4O1HA 4X71A 1JYIA 3ENRA 3CCBA 3UL2A 2FY8A 5HF5A 5DM2A 3OLQA 1KE2A 4Y22A 4OXKA 5K8JB 2DBVO 4E2FA 2DCZA 5UKDA 1CY4A 1FFWA 1KPHA 4GI1A 2DSTA 2TS1A 3KZMA 3UC5A 2JGDA 1YL5A 3SI7A 4DFSA 2JLXA 1UZAA 1J09A 5T52A 4TS9A 4XQ9A 4F3KA 3OFNA 4MUVA 4Y4YA 1Q57A 3C1OA 5HE9A 4NTZA 4RE5A 2WZPP 2BR5A 4CCYA 2PXXA 5CG2A 1SOWA 3EC7A 1AR81 4EN7B 1V8PA 3SHWA 4ONUA 3D8RA 1P31A 4WM7A 3R9WA 3FOEC 1Z56C 1ZGZA 3JALB 4YP1A 5LP1A 3VO1A 4W6ZA 1HTWA 1DBRA 1YAJA 3N2YA 1FRFS 3VSAA 4JJ6A 3AM5A 3HN6A 2F8LA 3Q88A 1F48A 1Q12A 3SHOA 4NG5A 1TMF3 1CR0A 4NBSA 2PH3A 3IKMB 2P77A 1IN7A 4ARUA 4OIMA 3S2GA 2QIPA 3WSVA 2JFXA 3FX3A 3SQNA 3SXJA 2XUPA 5C80A 3HXMA 3AI7A 4PYLA 1HDRA 1I5RA 1C3VA 2HLDD 1O4TA 2RHGB 1TVKB 3GA5A 3T5MA 2G8NA 1QTNA 3WSOA 1TC2A 3D7MA 3I30X 4BQPA 4TXNA 3VX4A 2POQX 4IOLA 5FTJA 1LH0A 5B55A 1GP5A 4N53C 4PG6A 3HFRA 3NNJA 3CMMA 5A33A 4DF3A 4K03A 4TSVA 1MJGA 2ORED 4FNGA 3NL1A 1MU0A 4QBIA 2O5VA 3QLUA 3VYVA 5M7EA 2YUIA 3HIFA 4GMP0 4ZIRA 4G9EA 2X0FA 5TIIA 2H63A 3PITA 2ZK7A 2Z3VA 1W4BA 5TMDA 3KUCA 1QRDA 2DBIA 3A1UA 2X05A 2ZMKA 1ULZA 4BWFB 4WTOA 4QX8A 4ILEA 2A84A 3VZLA 1AKMA 2PA0A 1EUYA 2L42A 3AT1A 2HEWF 4CYDA 5G0UA 3UYKA 2RDRA 4L5IA 1DCFA 1Z5GA 4P9NA 4GLBA 3IAEA 2WWFA 1P9NA 4DC1A 2C9KA 3X29B 5CW1A 3V1LA 4B74A 1KL7A 4HY3A 1QBKC 2WJZB 3W4JA 3SHFA 1L5YA 3JS5A 3HNPA 1FXWA 1T3LA 2FEPA 4K9LA 1FJHA 1KI6B 3ABZA 1YZVA 1EFUA 3ZN5A 3WGYA 5FQNA 3CMCO 1TYDE 4ZMSA 5F2KA 4RPKA 4ITRC 1K6XA 1SG9A 4JZYA 4B4PA 4B6JA 1SBFA 1YXMA 3OZWA 3LUJA 4ALLA 4TWTA 3HRKA 4RJJA 4MKHA 5F2WA 1S0DA 4RIHA 5AESA 2Y93A 4C0XA 5JD4A 2XGGA 2O8VA 3D6MA 1UJNA 3JZAA 2JKZA 1E3TA 5F3GA 4ZCMA 4ZN6A 4YRTA 2X4IA 4U7GA 4CUKA 3ZR5A 4WOPA 3RTCA 1ZOOA 4HT1T 3IP3A 4OP2A 2RONA 3WGKA 5GJBA 1GQ2A 1M8GA 4C5BA 2JIOA 2R87A 3UV9A 4F8AA 2HR1A 1XG5A 4OZOA 2VG8A 3FCUB 5ALOA 2X3UA 4JOSA 4TV8F 4WXPA 1VLJA 2EP7A 2WAXA 3WMXA 3E70C 3N0VA 1II8A 3ZLUA 4D74A 1FMCA 3IAXA 1ZHHA 2VDVE 3NOQA 1PBNA 1A9YA 3GVCA 4M0DA 4OVEA 2NSDA 1XNQB 4MCIA 5HA5A 3U40A 2AI1A 4PRLA 1WSBA 3BJEA 4GWGA 4YRSA 1Y3CE 4QGMA 4UHHA 3OT1A 3VKLA 1GCOA 4CLEA 1FXSA 1A6CA 2QD4A 4IYJA 1DSSG 5BSUA 2EKLA 4QECA 5HQTA 4XIGS 2CJXA 1WW8A 2QY6A 4UPEA 1RYNA 1MX5A 3ELUA 5EA2A 2ZI3A 3IMFA 3H8VA 4RK7A 2ZT7A 2PQQA 2G5CA 4XF4A 2DP4E 2R0HA 1HSOA 4AZSA 2PX2A 1XJCA 4XF1A 1KOLA 2GAOA 3FPGA 1QJCA 1RJDA 2BFCA 4EYSA 2ZDGA 2FSVA 4ALKA 2ZX2A 2PV7A 2ZPUA 1JQBA 1UZLA 4BAGA 4CEYC 2Z2KA 3O4FA 3OOSA 4RTKA 2A5DA 2YL2A 3IIEA 4Z9BA 3TQHA 2AC1A 3SFZA 2WN2A 5B2ZA 1IJEA 1QJY3 1TU0A 4OHKA 2DCJA 3I01A 4Q1EA 2GP5A 3LIHA 3L4KA 2NLRA 1M6VA 3GFQA 4X3PA 1I7PA 2VVFA 4QPGB 1XHEA 5DG1A 4YCDA 3OPZA 1QJFA 4J7CA 3CY6A 3UGKA 4IEWA 3I28A 3GBPA 2QVYX 1TD1A 4KTTE 3WD5A 2ODAA 2AT1A 2PUDA 2VPTA 4C87A 3I04M 3KD2A 2X5XA 3TFOA 5ABJC 1TZKA 1E2FA 2Q2WA 2FEOA 5K3FA 3Q7PA 5CCBA 2ZB3A 5DI3B 2NN8A 4UXJA 4IV0A 4DDMA 3IBTA 4B4WA 1OMOA 3LCRA 5AJYA 5F3RA 1RLOA 1L9KA 2ZR9A 3OEHD 3ZD6A 1EVKA 2PHLA 4EFKA 1JQKA 1ZI6A 3L2YA 2WLPA 5C8YB 4LI3X 3EZ6A 3H9EO 2F64A 1AR62 1VL5A 4Q12A 3RT1A 5I4KA 2NO7A 1TF7A 5IDYA 3TEFA 4OBBA 4P3OA 1MS4A 3KOZA 1Q2XA 1Y9JA 4AQ6A 2OP0A 1LVHA 2MMGA 3IMGA 3FFZA 4D4HA 4RTPA 5AI4A 3LP5A 1HFJA 3PVBB 5FIXA 1BKYA 2FAXA 1HI9A 5DNDA 1VHDA 4D4IA 4EG3A 2P3LA 2ZZQA 4NOMA 3QV2A 3P4YA 1G9FA 1E3EA 4K1YA 2ZE5A 1C8M3 1KYXA 2JE7A 2P5TB 1EFRD 1H94A 4ACAA 4XVHA 4HLUA 1CX9B 5ACA3 3DE6X 4RJLA 4M83A 3RR2A 4B5KA 4UEWA 3DTNA 3HO6A 3DCNA 1FSSA 5LASA 2CNLA 2WIKA 4D26A 4L51A 1SC6A 1B35A 1BBT3 2COKA 4AI0A 1H5NA 1KYTA 5K0TA 3WGUA 4C3OB 3EVAA 4ZVVA 2JCSA 2C5LA 4TS3A 1C9JA 9ABPA 4XZ3A 5JT1A 1KSJA 4RS3A 3LB9A 2VZRA 1GV0A 1GKBA 2IHVA 3TSYA 3RTBA 2CKDA 2Z6AA 1HA3A 1JHDA 1JHJA 4I01A 1HRKA 3RD5A 1RVF2 4A03A 1HLPA 5DLEA 4JGBA 4I4LA 3Q8EA 4Y9DA 3MFAA 3Q8CA 1G3IA 4LULA 2VNJA 1GZUA 1PG2A 4LJ9A 4B8YA 4LZJA 3GO4A 2V5UA 1KFJB 1YJBA 4COYA 4B43A 4BRSA 3OCXA 2MR5A 5JAOA 1NKSA 4QHBA 4QRDA 3OTQA 2HYXA 5DAQA 3TAUA 1QVZA 5DPNA 3K9QO 4AMVA 1VPHA 3EZGA 1MRSA 4FE7A 1DE0A 3QPAA 4CU2A 4KAAA 4MQMA 1IN6A 3A2MA 3IVRA 5P21A 2D0DA 3T3DA 3K4PA 3ZXAC 4LHVA 4PIZA 4U6SA 4HSLA 4XWKA 1SM4A 5LVAA 2YWRA 1T3GA 1QH1B 3UMBA 1GA6A 4H6PA 4FEYA 4LJHA 4FZ5A 4X91A 4I3FA 4IV8A 4W6QA 2IYPA 3DV0B 3RJZA 2YXNA 4CWAA 3AU9A 1PK6A 2FE1A 2RHWA 3QK7A 3R8XA 3ADKA 3QUQA 2OUKA 5IJWA 2WHXA 1M6YA 4META 1HG0A 1UBMS 4TYWA 2X0NA 2XHNA 3DDZX 2VZTA 1DIGA 4G97A 5FF9A 1Y7LA 1O6ZA 4HPKB 2O2HA 3L6UA 1SA0A 1REDA 1NMQA 2VUIB 1SULA 5KSWB 1U0SY 2QTNA 1IM5A 1QG6A 4YR7A 3DAHA 1CU1A 1TO6A 3TD6A 4NHLA 2R6FA 3BHJA 1ZX5A 1DCSA 1MGPA 4S04A 4XX0A 3W5DA 5IU6A 2JVIA 2VJMB 1FUKA 3GBSA 1XSEA 5FWYA 4HQFA 1JU3A 3T5TA 4HADA 5DZEA 4IWNA 4BQXA 1DRUA 4IEFB 4FZ3A 2QRKA 5HRCA 4D8WA 3LUDA 2ZHMA 2X58A 4CCWA 1HL3A 2FSHA 1RQGA 2QCSB 1G3RA 4ARCA 3C7EA 1N2EA 3FWYA 1L3BA 1JI6A 1V7QA 3DP9A 5FUIA 4OATA 2GI4A 1JHAA 1UBFA 3BREA 2FRXA 5C9AC 5GM2A 2J6BA 1KU0A 2Q28A 2ZIXA 2XAUA 1L5KA 3C3WA 3A4VA 4YAUA 4BLQA 3IMCA 1A9XB 1EZ1A 1Y9MA 4HWKA 1EU1A 1ZN7A 1VG8A 4YLEA 4PPNA 3G0CA 3OBBA 4J1TC 3OHPA 3H8RA 1O59A 2DBNA 3QSGA 3UNXA 3MPPG 4HAZA 4TKVB 1JHUA 4JJ7A 4AGVA 4KZKA 3CT6A 4N0DA 1E60A 4JK3A 5CTJA 5JAMA 3W5CA 2Y6VA 1I0LA 3DZDA 3H5AA 1XNDA 2R6QA 4LKSA 1UY1A 2WZR2 2WSIA 2YVKA 5DTQA 2ZMNA 4RZ3A 1UK7A 3ZY5A 1RXWA 5LYYA 4L2IA 4QOFA 1DBVO 3S1SA 3USCS 2N3ZA 3BULA 1FDRA 2CVQA 3J7AC 4HVOA 5FZAA 1NV9A 1JWBB 2OCDA 1Z73A 1GGNA 2VZ8A 3LA7A 2Y27A 4AJNA 1UPFA 2QT9A 1RMU2 2Z04A 1PT5A 1I2DA 2C29D 1NG1A 1K12A 1PAUA 4YW6A 2BMFA 2CF6A 2VHUA 3FZNA 2QVXX 2HF9A 1W35A 2VVTA 2AEFA 1JYXA 1N77A 4P35A 1SK8A 3WNXA 2WSMA 1FXUA 1YZFA 1U0JA 1RC8A 4CCJA 1ODMA 2G5TA 3QWHA 4F04A 1X8JA 2Z98A 4BNDA 1TAQA 4HLDA 2GZAA 4BQ1A 5DH9A 2KBEA 1GGJA 1WSWA 4W1PA 1Q3TA 3EFEA 2HREA 2F1JA 3ZXKA 5JZGB 3UXMA 2FCTA 4TUYA 2ZUSA 2AR7A 4K88A 2YIJA 2RM21 1I30A 1A5SB 1OWMA 1J8FA 4D8MA 3CVJA 1WNTA 1GQQA 2VTDA 2ZI4A 5JHGB 4LY3A 3H2GA 1G66A 5E6HA 3GNTA 2I4OA 1WDMA 2IYSA 4WUVA 2DHCA 4HDRA 1T0UA 3IULA 2IV2X 4WXRA 3GDOA 1XZCA 1BSVA 1PIV3 1FS6A 1AR91 1NQXA 3J8F1 3VU0A 5CA0F 2ZM6B 5T5JA 3IUBA 4LRXA 4R5HA 4DCPA 4LA3A 3TSAA 3GMSA 2SCUB 2GPJA 3TEJA 1R0SA 5C1DA 5CLIA 1ZGCA 4RHV1 1VKOA 3NG1A 2GEDA 2APJA 2ZWOA 1W93A 4Y2UA 4RVOA 3N58A 1KNXA 2IVFA 4A8JB 2RD2A 1R1DA 3F95A 1V3QE 4JXXA 4C0KA 1BNCA 1ZCBA 3E7WA 3AZWA 4UM9D 3NTVA 1P75A 3JU3A 3RS0A 5T50A 4XJ8A 3PKJA 4R9AA 4FBMA 4RORA 3POSA 3H1FA 2O2IA 1SVOA 2RS11 3ZLBA 4PCUA 4JGZA 3AUSA 3CWQA 3WJ1A 3VD9A 1ZCJA 2B9VA 4QQLA 2WG0A 4ZP1A 3IUYA 3WKEA 2AUMA 1DQ2A 4OHZA 3M4YA 2G1PA 3P32A 5FPPA 2H9AA 2ZTSA 3HUTA 3OSDA 4RPLA 2QVLA 3NTRA 1PJSA 5DEOA 5DABA 1RUD2 3G5MA 1IY8A 2QPTA 3EGDB 1JHRA 2X8JA 3USUA 5B2EA 3ZLJA 2ZXFA 3IHKA 3NYIA 4EN0A 3L93A 3NAPA 1XXHE 2EIBA 3NR2A 2W2NA 4YC7A 1OILA 1DC8A 2OHIA 5T6BA 1L2TA 4M54A 3T5CA 3LTNC 5CVDA 4R9DA 4Y6PA 2ZREA 3VNBA 3F4KA 2X2EA 4BX2A 5IK2D 3HA3A 4XUDA 3ACLA 1HG1A 2PUTA 3GALA 3EEQA 1SB9A 1U6KA 1FW6A 4IICA 1HB3A 5JCJD 4JBXA 4OXNA 3LCCA 4RGKA 4GDMA 3SLIA 3AKCA 3WICA 1DTWA 1G9CA 1B73A 1HE5A 3OQOA 1E6UA 3J7LA 4OYUA 5EJ3A 3AVUA 5BOSB 4II2A 3P4UA 3ZHRA 3C2QA 2HJWA 5C4WC 5A0FA 9LDBA 2NQ8A 3V0AA 3LQRA 1KJQA 1I4OA 4R0MA 2VT7A 3HNOA 1P4GA 1Y3IA 4F84A 3JWEA 3O73A 2HPVA 1SBQA 4TMZA 4GDFA 5CB7A 2XDVA 2Q8QA 4LOKA 5C2JB 4RJ2A 4ESEA 3T5AA 1ABEA 4UU7A 4UAVA 2YH2A 1S2LA 2ZSIA 4MPDA 4R8KA 1NLQA 2Y0IA 2F1OA 4LXXA 5A2QA 3FBTA 1KFXL 4TMYA 5K0SA 5LQCA 5IAJA 3MBKA 4XUTA 3GD7A 3ED5A 1MR5A 1QVVA 4PX9A 1Q84A 2E5LB 4TXHA 1WEKA 521PA 2HGZA 1XQYA 4GZ9A 4EPRA 3LPCA 4XGIA 3BRCA 4Q7MB 4QDJA 2WHRA 4EFMA 1JFTA 4I5IA 3W4KA 4FAGA 121PA 4IJUA 1Z29A 4OBEA 4QDKA 1CWUA 2XTJA 4F5ZA 1H85A 2ZJCA 3VM6A 1XTTA 5EMLA 3M6MD 4JXZA 2MYNA 1RE0A 5B1YA 5HIMA 1VE3A 1YFUA 3N3BC 1OH3A 4N5DA 2VXOA 1WB5A 3QVTA 1KMIY 5F9HA 1BO6A 3ZMNA 1SHZA 3ZCPA 1JLRA 4Q2FA 1O95C 3CTPA 4PAGA 1PYDA 1XPRA 2JCVA 2ZIFA 2OCXA 4GJZA 1QP0A 1G5FA 1PI3A 4BJHB 1MFZA 4BO0A 3U4MA 2FEWB 2PMEA 4D9MA 2ZROA 2REBA 4FI3F 1W76A 2G9QA 5BQ5A 4F8YA 2PHWA 5EZSA 1UDBA 3EY9A 2J1UA 2WJHA 5CNIA 4HN2A 5JWOA 3R6DA 2GAJA 5ECDA 5TMBA 1FYVA 2V6FA 4L3VA 2OCKA 4EI9A 3NJ8A 3FZ3A 4TS4A 4F7WA 2O8DA 1DYPA 4TL8A 5I91A 1VIWB 4QM7A 1O3SA 3D43A 4WV3A 3ZC3A 1NQAO 1UKRA 4FKZA 4Z4FA 1Y37A 4L6IA 5CCXA 1XZBA 4ND5A 5CT4A 1QGOA 4XD2A 4ZAFA 3WQ0A 3R5SA 3CH4B 4ZZ0A 4FDTA 2DFDA 4G37A 1CBUA 3GD5A 1M5RA 4R9RA 3MS2A 4D2IA 3GEIA 2ZI6A 4KXFB 5CU7A 6ADHA 1KZGB 1R50A 3K73O 1YE5A 3CV3A 1JSLA 1NG0A 3AO0B 2XJRA 1UYPA 5E1BA 1R9GA 3CJXA 3FYDA 4O7XA 4ZVSA 4Z92B 2II6A 4EX6A 1E9RA 4WN9A 5GPBA 4F93B 1F4HA 2WJGA 3CIFA 2PX0A 4BZPA 2HWE1 3UJNA 2WTNA 2QENA 3QBQA 4LMPA 4A0HA 3NNFA 3ZHZA 4NPMA 2WINI 2SHKA 1EWRA 4BVLA 1Z5VA 3F3KA 3H0CA 2HA4A 2H0AA 4O4IB 5HUHA 3HQ4O 2EERA 3LOIA 1GU7A 1J2UA 1UPTA 2BFMA 4DUGA 1TUBB 3WHKA 4ATFA 5JYDA 4YGYA 4O5OA 5BWLA 1A8SA 2GS9A 3M4ZA 1CF2O 1ZNYA 4MGIE 4CDNA 3AM1A 4MEAA 1SAYA 5T8KA 5EQFA 2IWHA 4MCJA 4LIPD 3RHFA 3GLFB 2YW9A 1MP0A 4EP1A 4K9SA 4KQGA 1C8KA 4GICA 4TMWA 3R1IA 2EW1A 3ZWAA 4BMSA 2WS91 3OX1A 5J59A 3S2YA 1Q3HA 2W92A 1ZRMA 4G1MB 3F1KA 2QGFA 2WE7A 1D09A 1PVC1 4C6SA 2QVCA 3MCUA 5K6RA 1EK6A 1N4AA 3KAKA 3KXDA 4KIWA 2I9PA 3E1KA 4ZICA 2WT9A 3OM1A 4Q18A 4YRFA 4CL3A 3KPVA 3LGXA 1O57A 4IWYA 4IAOA 2V5VA 1U02A 3SC6A 4MRNA 5A2GA 1DJQA 2P6MA 2Y99A 4KO2S 1XD8A 5KJEA 5KTKA 3NHZA 1CQJB 1NNI1 2LW7A 4FPLA 1JEDA 1ENQA 4RL6A 3ALQA 2J87A 5BY2A 4B4VA 1XMOB 2QE7D 4ESHA 3ZN2A 3GUZA 2C4MA 3VR5H 3T9AA 1NW3A 3MYXA 1LB1B 3BMQA 2QRZA 3UMGA 2PUVA 1JU4A 3DE1X 2CHVA 2A0XA 3F0TA 3SDZA 2BWJA 1PL8A 2C26A 2BEWA 5DWDA 4DMFA 4C4AA 4CCOA 1LSJA 2F59A 4FFIA 5IAOA 1UMDA 3GDWA 2RMKA 1MB3A 1CZTA 1XK6A 2FW9A 1HE1C 5T4BA 3MMZA 4A3ZA 4R7TA 4BN0A 1EZ4A 1YC5A 3PE6A 1R8QA 3OCZA 2C4NA 2AREA 3ZTYA 2F8MA 4WK0B 4C1NA 4C90A 2FX3A 4U6QA 1NATA 4LBYA 1Q44A 2Q29A 4KUGA 1PJBA 4HVQA 4L85A 4LJ6A 5AT1A 2H52A 2QM3A 5BR4A 1TADA 1ENRA 1NA1A 3RSSA 4JBIA 1ZNQO 5F33A 2ZGSA 2JIZA 4ZDJA 2QEQA 3ROUA 3B70A 3VU1A 2W0MA 4RV4A 4AVCA 5IAVA 4RTRA 1AS0A 3DVSX 3FUQA 1O5TA 5JR2A 1ZQ1A 5BSMA 3C6KA 2HV8A 3OJEA 5DXFA 5CG9A 1MLDA 1N5JA 4FN5A 4RSUA 4FFDA 1EFTA 1ZN8A 4QTZA 5FV4A 1JTZX 3L7KA 3T1MA 2Q1ZB 4IHQA 2ODNA 3ZVLA 3PDIB 3QG5A 2HV9A 3MAJA 4DARA 2H16A 3IV9A 3TN93 3A70A 1QU2A 1EXVA 3UICA 5IT6A 5FZBA 1ODSA 1VMKA 4IEQA 5JAXA 1OTXA 2PIAA 2OAP1 4CIAA 3HI6A 3NWKA 3MQ4A 3AUFA 2AS0A 3OPMA 2XJSA 2DY1A 2V9PA 4P4LA 4Q4AA 1ZA1A 3REQA 4LF8B 4AVBA 4EB6B 3AHFA 5C8WA 2OGSA 1ZR4A 2C9AA 4CUBA 5FMBA 4Z3OA 4WZFA 5F78A 1MX3A 4NNOA 5JYEA 2E1RA 2W1UA 1M6EX 4NBKA 5LYJF 4MSUA 2NW6A 1AB5A 4JDNA 4Q9IA 3KEOA 4D3DA 3IKJA 2OFOA 5IF3A 3C1TA 3H99A 2P9TA 1OWLA 2E87A 1NHGA 2CW5A 2X1LA 1OIVA 2GSDA 3WMWA 1TME1 5KWVA 4JC8A 4UTVA 2HZBA 4EB8A 1V6SA 1OLRA 3VHXB 3D3QA 1V5EA 5FUYA 1I6XA 5IK7A 3O1SA 4CZ2A 2Y6LA 1NW9B 5A3RA 1CDEA 2EV9A 2AN9A 1EV11 1B26A 2EFHB 3LDBA 3FPBA 4TZTA 1QRUA 3DEYX 3HVUA 4G9SB 4YAIA 2QDXA 1QQ7A 4LWOA 1FPMA 3O8BA 1JDVA 3KU1A 4R1TA 3SKVA 1WTAA 3E15A 2ZIWB 5ITVA 4QD2A 4YFWA 5F77A 5FQ0B 1E2DA 2ZTVA 3RSCA 4AWAA 2WNHA 1OURA 4QLOA 4NYMR 4Y9TA 1TM4E 5IAKA 4DQXA 2WJPA 3K2QA 3LVFO 4JITA 3WBBA 3EVBA 4IEUA 2QXTA 1RRKA 4HMZA 1E6MA 3HJUA 2ACEA 3GLTA 2REXB 2NX2A 1ZCAA 4ZI7B 1V1RA 1DQSA 4Y2HA 4JB2A 3ZBTA 1AQUA 2QL7A 3ZFFC 4RQPB 1U0HC 2XPJA 2A6YA 2YFQA 1Z5UA 5IYZB 1XNKA 2RKOA 1NAIA 1IHOA 3A9CA 3VH2A 2JC3A 2ATCA 1ODFA 8ATCA 3N2KA 1EDOA 3T7DA 1LPOA 3OFKA 2VJCA 5FUQA 5LQMA 5AXDA 3FTCA 5JI3E 3AZXA 5EZYA 4NNPA 2DPHA 4V03A 3BXHA 2NMVA 4XWOA 5EP9A 1VGRA 2YHBA 4GBJA 1OQEA 2VAWA 2EBWA 4GMKA 1XE8A 1BEEA 2PMBA 5LJIA 4KUEA 4I1YA 4LTDA 4TMVA 1DWQA 1D4VB 2NUPB 2Z9DA 1FV3A 2AMFA 1VRCA 2F1HA 5ALXA 2FN3A 3DL0A 3BTVA 3MRTA 4QDUA 1NCRA 1NG9A 5FYMA 5EESA 3EOAI 3LFMA 1X9GA 2OX0A 3F3MA 3B13B 2PQSA 2YHUA 4XDYA 5DHPA 1HZJA 2OGTA 3OZ7A 4G0NA 4EZ4A 3ZV6A 1X50A 4AMGA 2D3TA 1ZJJA 4NIIA 1I24A 5EY5B 5JBQA 1AUVA 5GONB 1VG1A 1PX4A 3LPGA 1PUIA 1CJKC 2Q3EA 2D3PA 1XEXA 4MV6A 2TECE 1D6SA 3VBSC 2EFGA 3DYBA 2WKPA 1QF7A 5E9AA 1FP1D 1YJAA 1RJ7A 3FHJA 3UT5A 5L7OC 3AX4A 3D3EA 3HVKA 4D9JA 1XU2A 5KVQA 3BDVA 3KYDB 1IKPA 1CZHA 4A92A 4D41A 4D81A 1XU4A 2W22A 4C4XA 5L9BA 1J2YA 4DJTA 3ZQJA 1OWOA 3ROFA 3LDHA 3SIPA 3QPWA 4I1SA 5B4TA 1K7CA 5FKJA 2ZVQX 2GNBA 4HQ6A 4LC1A 3GBVA 1W1UA 4LYAA 2ZGMA 4O4HF 2X0EA 1QR6A 1YAHA 4OMCA 1TM7E 3ODGA 5JAQA 4B6FA 5AQEA 2ACKA 3TNJA 3SCZA 2DWOA 3B20A 2QRPA 3TZKA 4MAAA 1BCSB 4OI0A 4D9HA 5TJ9A 1SCQA 4PLPA 3WNBA 4MI1A 2QJRA 2HBUA 1MZFA 3SEPA 3COJA 1AR93 3J8F3 4U2KA 2ZJOA 5LQNA 3MWFA 2AC4A 2G72A 1IZ8A 4TKUA 3IV6A 1E2LA 1A7AA 5D7BA 4C7KA 4OUKX 2HBTA 4R4XA 4EA6A 2ZBUA 5ALFA 4N4AA 3NBYC 3NHBA 3RFCA 5JMOA 5LW9A 3C3BA 5KJ1A 1UWCA 4HDQB 1C5IA 3L43A 1CLUA 4J0IA 3FGNA 4XM1A 4FGUA 4P92A 4FMDB 2ORIA 3VC7A 1G19A 2NO9A 4F2HA 2CD9A 4O59O 3N36A 1U3CA 2UUBB 4GKVA 1R5BA 3FFTA 1IPKA 3Q8AA 4D9GA 4FTSA 1EVJA 1CAVB 1EINA 2A14A 3V33A 4GE0A 1LDYA 1NY71 4MQ4A 3EMRA 5THXA 3QNMA 2FW8A 4X92A 3H9CA 4FEAA 2W2KB 5HTOA 3TEXA 3G2MA 2IDMA 4EYGA 1QH6A 5EPUA 2JG9C 1I1OA 3LUAA 2BGJA 4H7HA 4U8GA 3U6KA 5GJVC 5BVHA 4KIFA 3OD1A 1ISIA 3R8FA 1V1MB 2DWRA 2A4KA 2Z8ZA 3P0RA 2XMRA 5EQTA 1OOEA 3QJGA 3SEFA 1OOPC 4KDCA 5BWMA 2O57A 1HJFA 2FMDA 1F6BA 4KAXA 1N0VC 5BXYA 1UQUA 2FJ0A 1SXPA 3DE2X 1RM0A 3E9QA 1LK7A 4MI9A 3ZSMA 3W7VA 3KSAC 3RBAA 1PP4A 2DT8A 4U0JA 2WR8A 1GZ9A 4PSVA 3NC1C 1GTVA 4D0SA 1OXSC 4O2BF 4CR8A 3UB2A 2NM1A 2HWD1 2WWRA 5A5VA 1ZK0A 4MW9A 3EODA 4A6PA 1GKUB 3CNNA 1JDSA 4N7JA 2O8BA 2H07A 3X1WA 1SBTA 1P4SA 1KK3A 4A15A 4B4OA 2H6BA 1NR5A 8OHMA 2YQZA 1V37A 4JMPA 4LXTA 3B1WA 1CUWA 5LBEA 5FYHA 3DAPA 4ARBA 3AVWA 3W58A 1MA0A 3KJZA 4LGMA 1P2SA 4DQUA 4OGLA 1QXJA 1JOBA 1KFBB 1XC7A 1BHSA 3W8NA 1JBKA 1Y80A 4C08A 5A32A 3GZUC 2XWPA 1DG6A 5CBLA 2C98A 3WA7A 1AM4D 2JLSA 2EJVA 4ZGWA 1SKAA 2O0JA 1A8QA 1CVNA 2I6SA 1H0SA 4YQFA 4CMKA 1FATA 1NVEA 4GA9A 4FTWA 1PGPA 3RYTC 1N7JA 3H13A 1Y1QA 3B9CA 4L8WB 1WXEA 3LQ2A 1VR3A 4TQGA 3TOJA 5LOVA 2DRIA 3SMQA 2XUDA 3HCFA 4E4DX 1VZ2A 3S1AA 3I6IA 1NDQA 4OHXA 1TX4B 1X1EA 1YJCA 1Z6AA 3EX7C 3UHPA 1XROA 3LXRA 3WL5A 2VK1A 2C3MA 1CT9A 3NBQA 3QMVA 5JDCA 3N6RA 1UZMA 3JQDA 1SCBA 5BSWA 4RIEA 3WP3A 5DNWA 4MVJE 5BSHA 1L6IA 2XZPA 3BRQA 2JH9A 3Q12A 4ISRA 4WZBA 5ES3A 4YP6A 1PRYA 1Z17A 2VDQB 1SXJB 2QPLA 5CFCC 3U4XA 3S2EA 1DRVA 4WVZA 4MULA 4FOLA 1X39A 4CEHB 4LVOA 4I14A 3BPZA 3RWBA 3MYRA 5EGSA 3U49A 3SC7X 1VLQA 1WF3A 2EGUA 1IHDA 5FULA 5BMVA 5LMNB 5D3MB 4ZU5A 4Q7EA 4P3XA 3IXMA 5CYYA 2ZSAA 1HB1A 3V65A 1ZC4A 5AQ1A 2XE7A 4KQIA 3HLTA 3GP5A 1B1CA 5HXMA 4UHDA 2O2GA 4RFSA 4WE3A 1P7PA 2P9EA 1GWNA 4Z1VA 1G38A 3IVGA 4YVSC 3TO5A 2P5SA 2PFGA 5ALWA 3NJ4A 4NEGA 2RHLA 2IIQA 3CJIA 1NZFA 3P26A 4E46A 3N0TA 5F5LA 3TMAA 3ICWA 1ACCA 1VJ2A 2OKCA 4IL5A 2X2FA 2HRRA 4LOLA 4HWRA 4O2RA 4LJKA 4PQQA 5FOSA 3HCAA 3ZN6A 1U8FO 5DTEA 3E5RA 3BWEA 1UBTS 3ND6A 3W34A 3SSMA 1JR2A 2ZM5A 2C7PA 2XUEA 1AN9A 3D2CA 2WFLB 1V6JA 5LQJA 1M3SA 1Q77A 2LDXA 1UFOA 4MEBA 5BVGA 1X9TA 3W5MA 1NXPA 1NONA 1H2NA 2HJIA 3ORYA 3TYXA 1D0GA 3I58A 2EQAA 2MU1A 4IGOA 1AZSC 4Q24A 1C80A 2XVYA 4ZU1X 5GLZA 1P0CA 4N65A 3WR5A 1IN1A 2BEOA 4YREA 3KQOA 5JXWA 3IL2A 4J1XA 3VXKA 1W03A 2WA2A 1WW6A 3DL2A 3CE9A 3P27A 3ZDYB 3CL1A 5IVIA 4L92A 4PLWA 4LE3A 5T41A 3X1MA 3FKSD 1TQ4A 3FR7A 1E3WB 2Q1UA 2ZIEA 5F1PA 5REQA 1ND2B 3SC2A 5FJKA 3GCXA 2FD8A 1ZMRA 1NLYA 2QN7A 1OX4A 3FUTA 1RWOA 3JQFC 3QPDA 2PO5A 4H17A 1ZVKA 1FYXA 3ISJA 4XXHA 2KM1A 4MGTA 4BTLA 1PVC3 2QZZA 3D64A 2A7XA 3CBGA 1UAIA 2G67A 3WGHA 1QIHA 5EWMA 1G7SA 2YB7A 5AHOA 1Z3IX 2OYZA 3NTLA 2P1ZA 3WHUA 2LP4Y 1W29A 3LCVB 4WPGA 2CV0A 3BGOS 2V97A 4UUAA 1CZKA 2AACA 2ZB4A 3GT3A 1ZIYA 4C22A 3IDAA 3PPXA 1EWYA 3GCZA 2I5PO 4MADA 5JE8A 2NUAB 1DLJA 1X7YA 1QHDA 2GCNA 5FZLA 3QU4A 2YVAA 3GV0A 4NCJA 3RIEA 1JEYB 1RTTA 1GYQA 5AKXA 3DFKA 3ZFGA 2PRZA 3DLHA 1DBPA 4ER7A 4IJKA 3ZSJA 4UC0A 4YY3B 4AQTA 1RYEA 1A98A 3PUIA 1W05A 2H54A 5AK4A 3IQGX 4FPEA 1W8UA 3FHIB 4JODA 1Z37A 3PCXA 5HIAA 4I2NA 3E9RA 1PO12 5B58C 3MZ0A 2WL1A 3R09A 3PI7A 2C2WA 2WUWE 3SISA 4O61A 1F1JA 5JTUA 2P4SA 3N7TA 4LJRA 4Z51A 5KYWA 2RVAA 2A3XA 3AY3A 3E3OA 2UU9B 5JSQA 3GI1A 1RLUA 1CNMA 1J7JA 2BTQB 2XB6C 5BSKA 1ZR2A 4YP5A 3P9NA 5GIPE 1JMVA 3WDKA 1W73A 3ZLTA 4JEUA 1KH3A 2R5NA 4MA4A 5JXGA 2BR4A 1UMBB 1JYWA 4CMBA 2GBPA 2J4FA 3PVNA 1WMAA 2V3CC 2CFRA 4ZALA 5DDJ2 1JLKA 5IEJA 2H8GA 4XJSA 1F7VA 5JNSA 4K6BA 1GPKA 2VMCA 1BA3A 2Q6IA 3B3GA 3T0GA 3S5QA 4JBGA 4WNIA 1QVAA 1DGWX 4U3JA 3FN9A 2H2GA 1RUE2 1LHNA 1WA4A 1G6OA 4XILA 3E9EA 2VTXJ 1FRVA 1I4DD 4ZXPA 3EQ6A 2H1HA 4R9NA 1QFZA 1VJDA 3NATA 2CBGA 4B7ZA 3VD4A 3DKWA 1JOPA 2AFHA 5J5AA 1TXGA 1R1A3 3FFAA 2ZPTX 3IQZA 1ZK2A 3LPMA 4KI0A 3DPUA 3TVDA 1TKAA 4XFBA 4CCMA 3GJQA 4KQ1A 4QHYA 1Q50A 3X2SA 4QBFA 3AETA 2PKCA 1T9HA 3T3YA 4GC9A 4J0QA 2O8NA 3OPTA 1XQXA 4KWKA 3EIUA 2NAPA 1OTHA 3HA5A 4Q4Y2 3TVTA 3CEHA 3PQ4A 2J9GA 3AONB 3W90A 4ZDWA 2NO0A 4BB9A 1Z33A 4JIGA 2PYIA 4V24A 3GLGE 1MEC3 2IX9A 3WLOA 4HEQA 1KF0A 3I73A 4KU8A 1DFIA 3LEGA 1ASJ3 1HEYA 1EV13 2PLRA 3WG3A 1FFBA 2ZU0C 2VTFA 2VS1A 4NK5A 3BB1A 4F1WA 2JD4A 5L19A 4LZAA 2J48A 3WNNA 2HDWA 1VHLA 3K32A 1JXQA 1MVLA 2WNUC 3QOYA 1SXIA 3TKYA 1QJZA 3CZRA 3TCNA 4YZ2A 4G1UC 1WHTA 4WN3A 2HWC2 3RQ0A 5KSOA 5FRAA 3R77A 3DEMA 1F3OA 2XCQA 2V7UA 3WYCA 2B2NA 1GM5A 4R9CA 3L6BA 3WWOA 1W2WB 4Z1MD 2HWF1 5CVUA 1H2YA 3QEBZ 2IOYA 4N3CA 4X8HA 4OH7A 4K9NA 4K0KB 5LL6P 3H50A 5BR1A 3U7QB 3LUGA 4RKRA 4BRZA 4N3NA 4FK8A 4CUCA 3CLVA 3VR5A 3I34X 5TQVA 1T13A 1MRZA 3OAAA 3OHSX 2OR3A 1TQDA 1OAOC 3HPQA 4J1QA 4UVEA 1ENYA 3DFFA 1Z4QA 1EK2A 2WSLA 2QMYA 3EXFA 4RQAA 1X94A 4EJSA 3T0FA 2UVDA 1T1JA 1W5SA 2NZ9A 1A72A 3K9GA 1KHHA 1GTSA 1BD3A 3JXEA 4DC0A 5HV0A 2LUOA 3HUUA 3LVBA 4DYVA 5CT8A 5BV8A 4WI1A 3E6DA 4N49A 3QE2A 3M34A 1WQ3A 1JODA 4FE3A 1A71A 4L4YA 5DAXA 4D4KA 2V4VA 1H30A 4IWXA 5DHUA 5F9MA 3WP1B 4XC9A 2YCBA 3OOEA 3AL5A 3Q6MA 2IH2A 2OY0A 2ZVPX 3PP8A 4J0GA 4YJ3A 4S2EA 1RWQA 2OHFA 1Y6ZA 1E2JA 1DJNA 3CUYA 2IZWA 4MO3M 3FCEA 2IP4A 1R0WA 4ARYA 2JS7A 4X65B 1P2UA 5JJCA 4AKHA 2V55B 3ZWNA 4TV9A 3RJ5A 3WWZA 3B3QA 4YT2A 1SHJA 2VH5R 3A6HA 4GPIB 3AYXB 1HKUA 5ANQA 1F7UA 3TLGB 1LS6A 1BFDA 3FUWA 3SH3A 3ITEA 3OOJA 3BEOA 3WQSB 2A94A 2AB0A 5A6VA 4SLIA 1TGVA 2ZTLA 2FVXA 3V8EA 4BNUA 3BH6A 2GRJA 3KV6A 4QBKA 3LBYA 3QVUA 4ZI5A 1UFKA 5BWCA 4ASUA 2J59A 3D02A 5IWCA 3BPSA 1JJ7A 2GILA 2BGLA 1VJCA 2VATA 5ABPA 3TSOA 3H5LA 1G1AA 4I6GA 4AJEA 3QKUA 4DUZB 4NX2A 1VAMA 3CU5A 1ZYBA 3RYCB 4AF6A 4EO9A 2OFXA 4YV1A 4KWLA 5IAGA 2HMTA 2JCBA 1NVBA 3FJ1A 3IQWA 4XM2A 2W6OA 3QUBA 5CB6A 2W6IA 1X6VA 3IHLA 5CKNA 4KXQA 2IW3A 4JB3A 4H6WA 5EEGA 3QVKA 3LZDA 3AEQA 3D1LA 4XRRA 3OUJA 1NNSA 4GR9A 4LOAA 1VBA1 2VW1A 4BLJA 1FDTA 1Z22A 1I94B 3TL6A 3FZEA 4ALMA 2XDQA 3KBBA 2HMAA 2C83A 1ZOLA 1F2UA 1MXFA 1J97A 1W8HA 4BK5A 5EZ6B 2CXHA 3HYRA 4DXZA 2QTVA 2NOAA 4PQYA 5KDDA 3NEPX 1P2FA 4PBSA 4BAZA 3BWXA 5CXXA 2H08A 4M1MA 5HKBA 5EIXA 4R2XA 4ZAWA 4DJEC 1CJSA 1T6XA 3BOWA 2OL4A 3E7XA 2PUHA 3DMNA 4LS3A 5KVVA 1TC1A 3FVVA 4DBVO 2GH2A 3KJIA 4ZU3A 5FJJA 3GJ3A 4M1KA 4TRRA 4ITVA 3AY0A 4IR7A 2R042 2Z2IA 3VL8A 3SP1A 3ROZA 1RPNA 2V7BA 2O7VA 1V5IA 4G8BA 3CX8A 2JCYA 3N7AA 3RSFA 2XUGA 1QKIA 1PQWA 5B64A 4QB1A 1CUIA 4QDRA 5T3YA 2QJTA 4JFAA 5FY8A 4I08A 2JDYA 1NF3A 4N43A 5MFPA 4C4YA 1DIOB 5IWFA 4XFHA 2R2GA 4XWGA 1Q15A 2E5FA 1OYVA 2F55A 3BRWD 4I4CA 4Q4X3 3SBDA 1U3VA 4W5WA 5AKHA 4A10A 2G1UA 4CCDA 2VJLA 2E53A 1XQ1A 2H1RA 4II3A 1STMA 4YJGA 5FYCA 5K8LA 2JBAA 4RKFA 1H2LA 4IXDA 3DLCA 2REOA 5G41A 3E5MA 5DG2A 4Z0PA 1WETA 2PTHA 1S8AA 1YZHA 4Y6SA 2H1WA 1HXS1 4JP3A 2I62A 4UFNA 3O4GA 1FDSA 2H31A 1MQTB 1T1EA 3G85A 1TMF2 4RF3A 4MUYA 1UR5A 1W85B 2PBLA 1Z18A 4FGJA 3D6EA 3I8XA 4S24A 3DZKA 1HE2A 4KQXA 3VO9A 5DYYA 3WRYA 4EHBA 1V47A 4I1RA 3THYA 2C7OA 1D7AA 2D6KA 1J5PA 5EG5A 1OH5A 5EHNA 3ZNPA 2YZMA 1E9DA 4N8DA 1K66A 3C7OA 3X1XA 2AEMA 2IEGA 4UCWA 2JI6A 4PLZA 3DE3X 5IH7A 4P9WA 2EZUA 3A4UA 3ND8A 4QQ8A 4R4JA 4HSJA 5KTMA 2OO7A 1JQLB 3FOCA 1CE8A 3LL7A 5J5VA 2DY0A 4AW7A 2YFZA 1N6IA 4NBNA 4EKDA 3C6QA 2ZAAA 1Z75A 2P1BA 5D3QA 4Q3LA 1YFKA 3RSZA 3K1YA 5CYPA 5CNMA 3LP6A 1Y4DE 1E62A 2TYSB 3VNQA 4EG5A 3CEWA 4EMSA 3E5UA 2Y1XA 4UU0A 5LP6A 1VCOA 4LPLA 1CRZA 4URVR 1J5EB 4DB4A 5BNNA 1ZA7A 4IEEA 5D00A 3A1FA 4PHZA 4PU0A 2WF8A 4X1IA 1Y9AA 3DAYA 3JAWA 3ETDA 2JJ1D 5L9RA 4B6QA 1YKSA 4KACA 4PYQA 4LR4A 5BW4A 3JD1A 1KFKB 3BFXA 1XAHA 4YYZA 3QELB 5KJ6A 1YKFA 4UWDA 3TRFA 5IXJA 4P32A 5ICCA 1NMXA 3IVXA 4BUCA 2EXHA 3I4IA 1NJGA 3AFGA 4LBKA 2VR4A 3N7KA 4L9AA 1K5MC 1M2VA 5L3SA 5IK8A 1WABA 1BW9B 4BU2A 3INTA 3B3JA 3D3AA 1YZUA 5CH5A 2OPHA 4JYZA 1NSYA 4W1QA 2G88A 4I9HA 2CL7X 1JIQA 4YAWA 3IOEA 4RH1A 5CFDB 4D98A 3IS3A 1PR0A 2IIBA 1JJFA 4RLQA 3UC9A 3H83A 3NDBB 4RJTA 3BCHA 1H23A 1E32A 1ZM2A 2ANBA 5JADA 2VBDA 3H7IA 3DYVA 3ETQA 5DBHX 3O82A 1HM5A 4K7JA 5AO9A 2XUZA 2ONKA 3KOYA 2PFKA 3T7IA 1MJGM 4NC9A 1AKEA 1FTSA 4PFJA 4XIFA 4NZMA 3AIIA 3ZHVA 4UFPA 3OQMA 3O1HB 4J90A 5F5IA 2G5PA 4YDSA 3VAYA 3HADA 4S2DA 3P9ZA 4D1YA 621PA 1U8AA 3Q3EA 3TAHA 4DR6B 3GXOA 4B1LA 4NV0A 4ENTA 3IERA 1I7QB 3V7NA 2ZE7A 3S2SA 1GFSA 3L8GA 1VBKA 2Z3WA 2UYQA 2XGOA 5JSFA 4DO0A 4XAAA 2B46X 1T6BY 5FK7A 2FMYA 4KODA 1T2VA 4FFPA 1N92A 4AY5A 3H7JA 2P4QA 3L5KA 1DB3A 2ZYWX 3V8PA 1UT5A 3IT1A 4KQ6A 4ZPXA 3O1TA 5FYIA 4ONEA 5A7WB 3T1HB 1W8DA 4DLZA 1Z36A 3GZNA 5BY5A 1OE0A 3VKHA 2UVPB 4ZVPA 4LXUA 1EFVB 2PU5A 2RMU1 4JOBA 4MIEA 3BMCA 3C7AA 4I81A 2A30A 1N7GA 3CF4A 2UWCA 1SGWA 3DUIA 2HWYA 3L6DA 2A70A 1QOOA 3GCGA 2OUIA 3K96A 3EH2A 3EZFA 4M00A 3SQXA 4RK6A 2BHRA 3RFUA 2R6DA 4ZRDA 1RUF2 2UZ1B 3T0DA 5K8UA 1QJY2 2HD4A 1JQDA 5IBPA 2XSZD 2QGNA 5AVVA 3PR2B 3P3PA 1UKCA 2RGNA 4DCVA 5JLJA 4AN4A 1WBFA 3WZ1A 3FTEA 5FB3A 4ZYLA 4YDRA 1RRVA 1WV1A 5EJ1B 1JFSA 4L5CA 2CLOB 4NAMA 1L4NA 2QE6A 4QFMA 2PY6A 3QKSB 4EA7A 1KJJA 3TRKA 4PTZA 3PUAA 3O8OB 16PKA 2R7MA 3RS2A 2CHUA 4MUGA 4YH1A 4FLFA 5EE9A 2WO7A 4RY9A 1W4AA 3B85A 4GOKA 2Y1EA 3AUKA 4X61A 3EFHA 1W8ZA 1YZTA 2EW8A 4C4PA 1K7EB 3U7GA 1OIXA 5HDBB 4WNYA 2GR9A 2Q0XA 2VHZA 3FHQA 5B3LA 2DCKA 3RRBA 3TSWA 1R37A 4QXBA 1EESA 1ZY2A 2H9IA 4FOSA 2REQA 3SPXA 4INOA 4OZXA 2PHFA 4BMOB 4HANA 3F6SA 3E5QA 4FVTA 2W6JD 2Q3FA 3R0VA 2XTNA 3C1AA 4ZO4A 3UJ3X 2YC2C 4PNEA 5DVZA 1V9U1 4RS4A 2YJNA 3IJPA 2FQQA 1G9SA 2AHRA 4DMGA 2C2YA 1Z2PX 1DO8A 4NU8X 4FB4A 1XKTA 2R1ZA 1KJ8A 1DJMA 2JJ2A 3OQVA 2HGSA 1O4YA 5KKCA 4XVQA 3ROXA 1MEOA 1X9IA 4GEKA 5B1DA 4XEUA 2EFEB 4N6OA 1LDNA 1AR83 4MLDA 1IUKA 1W3XA 3RSHA 5BMOA 1DBQA 4LMAA 2Z08A 3LT2A 2IYTA 5KJCA 1OWNA 3EDMA 1HDOA 4TS1A 2DKNA 5HF8A 1C1HA 3IUSA 1RSZA 1HW5A 4HQ0A 1IEXA 4E5NA 4XM0A 2OMEA 2WYOA 2JDKA 3B5LB 1HV8A 1DXHA 2VHVA 5ENZA 2ZBJA 1WPRA 2P3SA 5I7WA 4L95C 3I01M 5EHDA 1US8B 4I09A 3NOXA 1MG0A 2R071 2AC2A 3EEFA 2BKAA 3BGWA 1Q0PA 3CEPB 4HGZA 1XSRA 4D4LA 4LN1A 3TBFA 3A1EA 2PFSA 3DVAB 1ECJA 1OUMA 2LCFA 4CRWB 4JBYA 5DM1A 3PYXA 1KNQA 1BH6A 2VOXA 3H17A 1ZMOA 3AINA 5BNPA 2HUPA 5K7PA 4HWOA 4IV1A 2CXOA 4GNRA 5CB4A 3F67A 4D7AA 1ST2A 2W0SA 2XT6A 2WUEA 4UMEA 3I9V6 3U4IA 1AQNA 3VBOB 2AQIA 4U7FA 1N8KA 3DC7A 4BAUA 1GYPA 3WNCA 1S0GA 1GSHA 3VBUC 3DA8A 3H3FA 3T2QA 2NU7A 1O3RA 3LUCA 1UAYA 3LY8A 4TQAA 3BKXA 2Q3CA 2VL7A 4YONB 3WAKA 1KJRA 5EJ9A 1WUVA 2IHYA 2QYOA 2NYVA 5CISA 4FEEA 1C1LA 1BE8A 5K6AA 3RBXA 4RL4A 4ME6A 4GW3A 3DDUA 3DVQX 4KVFA 1VLVA 5F8PA 4R2IA 1P3Y1 1PKXA 1QK4A 2VJBA 5E4JA 1SY7A 3FH0A 2O2SA 1NVDA 5K7SA 3D5TA 2PKQO 1LDEA 3B2NA 4L5AA 5ITSA 4UE3S 3K0AA 5LEKA 4AKIA 4R0NA 1X80B 4EK9A 1DEKA 1EUDA 1GQFA 2NO4A 5DSTA 2UUOA 4L9BA 1B3RA 2ARAA 4PYMA 5IVHA 5A4IS 2PZBA 5DISB 3ELYA 3WF0A 1W4RA 1QAQA 3KZVA 1YRLA 3KJGA 5FZHA 4ZCQA 2AR9A 2JARA 3JYHA 3H8WA 2WA3A 4P6VF 3E7PA 3CKYA 1ML3A 2MHFA 3G0HA 4MQEA 3DKPA 3SKJE 4HK8A 5CA6A 1R4MB 5BWBA 3CUKA 2XAAA 3ZQ6A 1U28A 2C84A 2G80A 3VTAA 1FJGB 2MINA 1J83A 3REFA 4MGZR 1MT3A 3QKRB 4HL6A 2W39A 3HT1A 4F1KA 4GPEA 1C0LA 3JRWA 3ON7A 3M82A 3AJRA 4HXGA 1L8AA 2OO5C 4NEQA 3HDHA 4HNVA 1N5MA 1XDZA 4NYIR 4BQQA 4Q3DA 3ZW8A 1Q0UA 3CGWA 3CLHA 3CUEF 3D7KA 3A0KA 4CEJB 4BOWA 1XU9A 5JSOA 3RS7A 3GN1A 1OXCA 3VR2D 2O8EB 1AB6A 4W9NC 3ZE9A 3TZEA 1BU8A 4ZOAA 3MMXA 3ZEAA 4BC1A 2DGDA 1AS3A 2DCUA 4AT1A 2BBSA 1WRBA 4BQEA 4GXQA 2ARBA 2WQ8A 3WGMA 2IBTA 4UTNA 4KH1A 1W6MB 5HPYB 1AGPA 2Q5EA 3SF8B 1FFXA 1YBFA 3VHNA 1H5QA 2CE2X 3RYFA 2DM6A 4DQDA 3N5CA 4K9RA 4EDHA 1GEGA 1UCFA 1LENA 4EE2A 2NZXA 4UDOA 5LDHA 2VCBA 3IE2A 3IPXA 3DE7X 1U2RA 2CHGA 4JBWA 3PENA 1TMYA 2ZRJA 2W5FA 2GZSA 1KQ3A 2HYIC 2WQZC 2B3DA 3P71T 1XTIA 5G4KB 1QYWA 1RZ3A 5EPEA 5DYGA 5BN5B 3NZEA 3A6PC 3DCQA 5I0RA 5TGTA 1LRLA 4AEKA 3PTZA 1FYUA 4NRDA 1TE2A 1TZMA 2CB0A 5I7RA 3DOEA 2OSVA 4N5NA 4MUFA 2ZMLA 1P60A 3T0AA 4LOSA 2XA1A 4AJIA 4G8JA 4MW5A 3UNPA 1NXSA 1USIA 4LIVA 5I9LA 4BQ2A 2M2IA 3GNQA 4OB8A 3TZBA 4CLOB 1N2JA 4LO4B 3FJSA 3KELA 3W7AA 4RDXA 4EZIA 5SYNA 1VLZA 3N86A 5HZKA 3C6BA 1AYM1 3ACBA 2BMEA 1RAFA 4OCTA 1E5XA 3RGBA 1E5HA 4GH4B 1EUZA 3ZXYA 1QXPA 1JBQA 2XCRB 4E2GA 3OYWA 3BL5A 2B4YA 4RF2A 4RN5A 4BCBA 4C76A 3X2EA 3RK1A 3RAFC 4Z6KA 2WPNA 4DA6A 4UDXX 3ZCUA 1T2FA 1N6RA 3KQNA 3O75A 2EFJA 4FOWA 4IH4A 4G4FA 1XLTC 2YN4A 1NPDA 1UINA 4GWLA 3G7UA 2BHNA 3BYZA 1PIV2 3A4NA 2GSWA 4LJ5A 1FBTA 3AIKA 1Z15A 3NO4A 3O26A 4HRVA 3FIUA 2RDQA 2CXPA 4CCNA 1XOIA 3KTAA 3OA2A 4X0EA 3H3ZA 2YN2A 1VBA3 2YFKA 1JH9A 2C5GA 4P33A 1D2MA 4O4JB 5A6SA 5E38A 3RRYA 3LPDA 5EJ2A 3K0BA 2ZEYA 3E5XA 2E2WA 1IAQA 1U0BB 1T8RA 4WY8A 1SPXA 1TECE 2Q49A 2H7XA 3MM4A 1GCGA 4BP9A 2VWHA 2OM6A 3O0XA 2V7QA 2BFBA 1NKTA 3ZWYA 5G3ZA 4PPYA 1KXJA 4OJKA 1GHTA 3AYAA 4HNQA 5BNOA 1IHUA 5LK5A 1P0PA 3KTOA 1VLNA 1NT2A 4A5OA 4NI5A 1PVDA 1EDBA 1OZAA 5A5GA 2LV8A 3GDGA 2JAHA 2PRKA 3HJRA 4YDQA 4PZAA 1VCIA 4X84A 1O54A 4XEHA 2VQFB 1MB9A 1NXQA 3IFSA 3W79A 3WS7A 5JSHA 1JH8A 3MJ4A 3WXBA 1FJXA 5HQ3A 1YA4A 2BNMA 3K35A 4KGZA 3IAUA 5K8CA 1EPWA 5KOHA 3DTVB 3BU0A 4P31A 2GNPA 3S8YA 3RQIA 4B6PA 2H2DA 4BPBA 2BGUA 5JSYA 2B8TA 4WX2B 2NN3C 3AI2A 4PYIA 5ALQA 1OQAA 4N9QA 5CP8A 4Q4CA 2ADMA 2O2XA 1R9JA 1DADA 2NPOA 4QDZA 2Y60A 1GGKA 3H8UA 1A8UA 4G0XA 5F2OA 4LXQA 4B3TB 1H9AA 5KVSA 1G86A 2OKGA 3G6KA 1Q56A 2WHEA 4FIZA 1ZIPA 1NW8A 2BUBA 2HQ1A 2ID9A 4FWIB 1HXS3 5DRYA 3TWOA 2CDPA 3B5IA 2F48A 5AK3A 4XJWA 4UDYX 2VQDA 4OF4A 5C5TA 5E9JA 3CR3C 2BM9A 3MTGA 4MW1A 3UK1A 3UENA 3WFJA 1KARA 1EGVB 1I32A 2Y6JA 4FPYA 4OQMA 3EGVA 4A4DA 4KGDA 1E2HA 2E9QA 1XXLA 5KTTA 4MGYE 2QJWA 4XW3A 3KUXA 5C35A 1UOPA 3M0EA 1QE5A 5C7YA 2VRCD 2F1IA 4NAHA 2VNKA 3MO4A 4KK3A 1C1XA 4BQYA 3GB9A 3F6YA 1K0UA 1OGIA 2IZ0A 5FUNA 3PHBE 3ZXXA 4GXRA 2UYAA 3EQ7A 4UW4A 1JG1A 4JVAA 1RHI1 1AYN1 1DS6A 2A9RA 3LU1A 4OHOA 3DN7A 4TQUS 1CUDA 4IDNA 3CM0A 1A50B 5HCUA 3E6AA 2P6OA 2DTEA 2W1SA 3TIFA 2KHZA 2BP7A 3RZGA 4YUXA 1G8HA 4Q15A 3I4FA 2AK2A 2I45A 4RHUA 1F8GA 1UOGA 4FW9A 2JGDB 4IVPA 4E2YA 4RSGA 2IYXA 2HEGA 4RDHA 3FSGA 3JQAB 1U63A 4QJ4A 1AKUA 3OURA 4KI7A 2EVWX 3BF8A 3ROPA 2JASA 4M9RA 4CCYB 3NVAA 4IQGA 1XYOA 2RJKA 1ZBE1 3ABSB 3PFGA 5I3ZA 5JPIA 4N8MA 1N1GA 3M5CA 4LUKA 2XEDA 2NVOA 1RYDA 2AH2A 1EM8B 1WDKA 4PTYA 4V0RA 2TMYA 1GZHB 4Q0PA 1XRNA 5H3CA 3ACGA 1MNAA 4KV7A 3OEEA 1DPGA 4GALA 2N47A 3IILA 4B81A 2H5LA 5LZ7A 1B76A 3IXQA 1JZ5A 4DANA 3VOAA 5LJLA 2P6HA 1N0IA 1P77A 2GN1A 3Q9SA 2DH6A 3CR7A 4CN9A 2R1VA 4AFNA 2FR0A 4FPHA 1T2EA 1ZBQA 1QGUB 5DCYA 4YJFB 2RGUA 3K5PA 3TZHA 4PZEA 3QLJA 2VECA 3KALA 2ZYSA 1KTIA 3HDGA 1QGYA 4HSGA 2I2DA 3SXUB 1WD5A 2WRZA 1WM1A 1DGLA 1RABA 5A3QA 3ACFA 3FNRA 1R082 4TTQA 3OUHA 3AEUB 2XCOA 1DBIA 4B75A 2QZJA 1NSFA 4DT1A 2WBLC 2HCRA 1GG2A 3BCSA 3EAQA 4ZIRB 3OLXA 3W1VA 2QBYA 3OWXA 4Z4HA 3FG9A 5JMWA 2VSNA 4MG2A 5CDUA 2ZUWA 2E82A 3GLIB 3LKJA 3I9LA 3RYHB 5FYQA 3RBZA 2GB4A 3PG5A 2FR1A 4X20B 3ZWKA 4NIHA 5K5EA 2Q8EA 2RM23 2OQIA 5BV2P 3HYTA 4Y8VA 2QX7A 2EKBA 5CXSA 5CD9A 5GKAC 1VFNA 5A6XA 1TI7A 1U5ZA 3J80A 4YRJA 3BWMA 3WAJA 5EJAA 1NP3A 4RFLA 5AJHA 1V2GA 3FSEA 2BAGA 5CK5A 2WHPA 3G9QA 3HR7A 2W2PA 2YRFA 3RYPA 4WZAB 1X2EA 3I2OA 3FW1A 3IESA 3ZMOA 1SIWA 4WRRA 4CP0A 4OH1A 1OIWA 3SFTA 3TTVA 2HJ9A 3A2LA 1QUEA 2G70A 2RHHA 4PW0A 1G8MA 4I8IA 4DM7A 1G42A 2ZUVA 5DYTA 2A75A 3PBKA 1OKKA 1JHVA 1C9KA 1B0AA 2C4TA 4RHV3 4IDQA 3U16A 5A3TA 5H9PA 2YINC 2YZNA 3QSYA 2QW1A 1IHMA 1G41A 3DPRA 5FPZA 4NE7A 5LA1A 4HN9A 5DK6A 5DTJA 4FHCA 1E0SA 2H0QA 1XNGA 1M2EA 3DNMA 4UFIA 1RJGA 1RUJ2 5CBKA 2I29A 3R9XA 1ZK3A 4WCFC 1NQJA 5F35A 2V74B 3MIGA 1Y9ZA 1IFXA 2NSYA 1RJ8A 5LBIA 1OF3A 1MS0A 1X7WA 1Y5NA 2RS13 1W6UA 1U0OC 1TYEB 2KYRA 4IMIB 3PLNA 2BMWA 5I7OA 1II8B 3LUFA 2NZ8A 3IIKA 2HUNA 1Z63A 1KS2A 1LJ7A 4I50F 1ZXLA 3IP1A 2MSCB 1DMRA 5BSGA 3HMKA 2YU1A 1NJ5A 4HFJA 4KU7A 4TKZA 1Q91A 1W75A 3M3PA 3D8SA 4DIFA 3VU3A 1ZS9A 3EIEA 1YB6A 4M7WA 1H05A 1CD3G 3K2BA 3NHRA 2RB4A 3ROQA 2FZKA 1A96A 2QZPA 1KWKA 2EIDA 4NLLA 1F3LA 1EVYA 2AWOA 5LRSA 1WUJS 1WXFA 4KR2A 2FZEA 3IBSA 4K2AA 3VDNB 3TIVA 1VYUA 4M3CA 2L19A 1WIWA 4DCNA 1ORVA 3DM5A 2A5YB 2VP9A 2ADEA 6AT1A 2WWJA 1Z5ZA 4NIDA 1F4LA 3D4BA 2WU0A 4V3CA 2ZU6A 3L7LA 1CRQA 4GQIA 2X1VA 4F21A 4ASLA 1UFRA 2BFCB 2HMYB 3WP0A 2FFRA 5K0JA 4AICA 4C06A 3A1WA 4QQOA 5DN6D 1KJIA 3GLHE 3BE6A 6NULA 4RR3B 1ZBA1 1NDUA 3CNQS 1NZJA 5F2SA 2BH2A 4D0RA 1V7ZA 3J7HA 4ZAVA 2Q1XA 4DWVA 1NZCA 1YRZA 2IXCA 4YASA 1UY3A 5DT2A 1V16B 3G0BA 3MGCA 1XZNA 1A5AB 2GALA 5BW6B 3ZSLA 2LWIA 4URHA 3RIGA 2WYHA 4KTVE 4DDUA 5BPXA 4CM3A 1Q7RA 1Z7S1 1SFPA 3NHMA 1ISHA 3WLHA 1RYYA 3TN92 5JPMB 1X86B 1VE5A 5LM3A 5TR9A 3W9YA 3ZK8A 3MXOA 1AHNA 3CW2A 4OLLA 1JUDA 2HDOA 4CDXA 4CKBA 4HK4A 4DQLA 1LQUA 3T1OA 4PV7A 1JHOA 4BE7B 3VKUA 1K2VN 1HOTA 3KV3O 2VPWA 5HKOA 3O1PA 3R9KA 3WK8A 1OVSA 2X15A 3VD5A 1P1KA 2KLBA 3W6NA 3HJHA 3E8MA 3CRZA 3ML1A 3V4VB 5FUMA 5JYBA 1KS5A 1U0EA 3F5MA 3UTDA 2KB0A 4ZD6A 1WNFA 4UCXA 4DPNA 4QUKA 1BN7A 1E1NA 3FNQA 1J0CA 3K9BA 4A6SA 2QUAA 2G08A 4OMUA 1CEXA 4W7IA 2P3KA 1ES9A 1MHPA 5F23A 1XNTA 3V4RA 3V80A 3GJXC 5KOIA 1ZD8A 1VJ1A 1GG5A 2C9MA 5K45A 2WJSA 1GL7A 4MKRA 3VFDA 4GD3Q 5GZ3A 3C3MA 3QG1A 2DUPA 1MABA 4EFNA 4UUQA 1SUAA 3SR0A 4ZKDA 2EW2A 4DR5B 2NXNA 5LA6A 4QOIA 4Q4W1 3OGJA 4BH9A 3H1AA 1PSWA 2R8RA 3WGIA 2QMEA 5D8AC 4P81A 4RGVA 3T3GA 3QUCA 1U2SA 1FFHA 5JI7A 1TM5E 2WVGA 4J1WA 3PPIA 1G8SA 2CD7A 2PBZA 2VT2A 3NOOA 2UYOA 1W0KA 2QMUA 3THXA 1V6CA 1DRWA 1CV2A 1AGRA 3QU2A 5JECA 1N2CE 2P79A 5JVDB 3CF4G 4B7CA 2R8EA 5DU2A 3MRXA 3P0FA 2IS4A 4EQVA 1ARZA 2YJ4A 4FAHA 4S3MA 1IS3A 1VXOA 3OT5A 4QPIC 1QDCA 1DKPA 2B3TA 4HGRA 2I03A 2Q3MA 5AJXA 1UXIA 2UY9A 3V48A 3I4LA 4YAGA 3GYBA 1KYYA 1V95A 5DN9A 3SZRA 2HWE3 1IQ0A 2DU8A 3E6BA 1U5CA 1E4YA 1W9TA 3U2QA 4B6RA 2QTAA 1ZN2A 1LU1A 2O0HA 3TZCA 3HBMA 3KV5A 4DR4B 5KMGB 4PRYA 4GO1A 4OU5A 3LIPA 2CGNA 5IEBA 1WB9A 1Z83A 2P2NA 2FDXA 4B7KA 4JRLA 3A06A 3U9LA 3GP3A 4TXJA 1E99A 2O4CA 3WLPA 1R6DA 2Z6VA 4G0UA 2ZUDA 3Q8MA 4NHXA 3R0XA 4X6QB 3V00A 2A3YA 3WDMA 3ER8A 1OREA 1Y1SA 1EBUA 3P9QA 5K03A 1MPTA 3ZFEB 1G20E 3FTFA 3FVWA 4TLCA 2HRQA 2NTYC 1JVSA 4RK0A 2WS93 1GANA 5LRRA 5GGYA 1UPIA 1MC5A 3IVAA 4BNVA 4QX7A 3T3NA 3PQFA 2AI2A 3ZS9A 2IYVA 3K0FB 4WZZA 1ELOA 1YVEI 1GPLA 1F60A 3EOBI 4PFQA 4US2R 2BSXA 3ZCSA 2JI8A 2Y9MB 4Q9HA 5IT5A 3DXTA 2P4HX 4DDKA 3I9NA 3GN2A 1O4VA 2RKBA 1X1RA 4ZT2A 2JFGA 2J3HA 3N2LA 3R24A 3VPGA 5C5IA 2QPAA 4R2WA 4BRWA 1YJKA 3DH0A 2J32A 2RSLA 4JV5B 2H3HA 2O8FB 2ZGLA 5F32A 4FFLA 3V9PA 1CP2A 3K71B 3DQPA 3FR8A 1AR92 4Q47A 1QO0A 4P34A 2ZIXB 4L2NA 3S55A 4YW1A 3UKTA 2KA3A 2OORC 1FEZA 2A3RA 4LSMA 4I2OA 2IU0A 4NN0A 2IHZA 4GRIA 3M6WA 3RLIA 3FPSA 1RHRA 3TKAA 4FJ0A 4XYXA 1VMJA 1DI0A 4H27A 1C14A 4QM8A 4MYHA 3BIOA 4A7ZA 1NKGA 1V8BA 1WCQA 4PF1A 1JYCA 4Z2YA 1GQPA 4BMCA 2NTJA 1CGPA 3MBOA 5JOYA 5T57A 2QQWA 2PBRA 3EG9B 5HK9A 2BP6A 3L0DA 1XI2A 5FI5A 4DLTA 1C5KA 1FX0A 3PLRA 5AW0A 1UPXA 3MSXA 3RV4A 3VZRA 5D84A 3WDSA 4Z4GA 3U3MA 4LVUA 1HYHA 3WL8A 2FSFA 4IV3A 1Q6ZA 4OKSA 4N76A 1U2GC 1J58A 3OBZA 4MDHA 4DM4A 3PWKA 4NWWA 3D1JA 4Y98A 3GAZA 1GOGA 3A2NA 3OQIA 2G1JA 3HDQA 4MIKA 4XFJA 4BJ1A 5I7UA 3DOIA 5EI5A 1XVIA 1UMCA 3IOBA 2VNAA 3SOZA 2PR7A 5E6SA 1XTJA 4REQA 2E32A 3WMRA 4FXOA 2GTPA 4KV9A 1KP9A 1R64A 4JYBA 1F8UA 2A59A 4LAFA 4DIBA 1ZZ7A 3OC0A 3UJDA 2WZQA 1SXJD 5CFOA 5C8CC 3CF2A 1UP4A 1DJLA 2LTAA 5HM6A 1LHUA 2VXRA 1XJAA 2Z2ZA 1K86A 1UC9A 2ILTA 1UDRA 4TUYB 5KXDA