2G9ZA

Thiamin pyrophosphokinase from candida albicans
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
322
structure length
297
Chain Sequence
SELIEQVIEQPDSLIISPPSYNHIQPFVYLHNVLLILNQKITIDLISLWKKCEIIVCADGGANSLYEYFNLQRSDYIPDYIVGDFDSISPDVKTYYESHGSKIIRQSSQYYNDFTKSIHCIQLHYQLNHTKENWFESIDEVDGLAKLWNGLNNSSDVVVDIDITIYVLNAIGGRFDQTVQSINQLYIMNEDYPKVTVFFITTNDIIFLLKKGVNYISYKNRLMFHKDNGSSPTPTCGLLPLSNKTPIILNSYGLKYDMRNWKTEMLGQVSSSNRISGETGFIVECSDDIVMNIEIDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of CA1462, the Candida albicans thiamine pyrophosphokinase.
pubmed doi rcsb
source organism Candida albicans
molecule tags Transferase
molecule keywords thiamine pyrophosphokinase
total genus 95
structure length 297
sequence length 322
chains with identical sequence B
ec nomenclature ec 2.7.6.2: Thiamine diphosphokinase.
pdb deposition date 2006-03-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.320 Mainly Beta Sandwich Jelly Rolls Thiamin pyrophosphokinase, thiamin-binding domain 2g9zA01
3.40.50.10240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Thiamin pyrophosphokinase, catalytic domain 2g9zA02
3L8MA 3K94A 1IG3A 2F17A 2OMKA 1IG0A 3IHKA 3LM8A 3MELA 2G9ZA 3CQ9A 3S4YA 2HH9A
chains in the Genus database with same CATH superfamily
4WDRA 2DKNA 1PLLA 3PCXA 3VDDB 3BTOA 4QBIA 4IXWA 5DHFA 3AXTA 3NIFB 4UOQA 1S1MA 2IFWA 4Q8KA 2HSZA 4N76A 5IW8A 1HNZB 1NDHA 4EQVA 2PKXA 4AKGA 4Z3OA 3WI7A 3LBHA 1I24A 4NFLA 1C9DB 3X43A 5HRCA 4FSHA 1NX9A 5LQAA 3M0EA 1LY1A 1YT5A 2FUCA 4K6HA 1O3TA 5FZ7A 5K2MA 3LF7A 1OPXA 1NAIA 4R7TA 5JPIA 1AGYA 2NMVA 3Q72A 1RRVA 4R2XA 1STMA 3F2IA 3KKQA 2C07A 3NT5A 4AX4A 3E70C 2PS0A 1UJ2A 1KKLA 1E6UA 3VBRC 2O7RA 3EPRA 4RV4A 1SPPA 4W99A 3W78A 3A36A 4W1SA 1B8NA 2P90A 5D21A 4AKHA 4MDFA 1NQXA 2NTEA 3ITNA 4MUGA 5BSWA 2LGJA 1Q1ZA 3R7WA 4BVGA 4DEXA 1N5KA 3GLGE 1ZVMA 5EJ7A 3WAGA 2WI8A 1SB9A 1VSVA 3G02A 3E03A 5IAAA 3T41A 4K88A 1G3QA 5DIFA 4EJSC 5JOXA 1Z4MA 2QM7A 1MOSA 5H3LA 1CAVA 1KTIA 3MPBA 2FCUA 1BE8A 1VLQA 2WJGA 2NU8B 1E64A 2WE7A 2VK8A 1FX0B 2LKDA 4DO0A 4ND1A 5A2QA 4KWTA 4O2AA 1SACA 4XMAA 3RYCA 2R6AA 2Y68A 1Y5IA 4GWLA 3TJMA 4MVTA 3OJXA 3HDVA 4ZU3A 1EHCA 5EP9A 4UM9B 1N0IA 2R7AA 3Q2KA 4YRJA 3STHA 4BLOA 1XE0A 1NW8A 1FTYA 5ERGB 4AS3A 4QPIB 3JTEA 1DG1G 2EP7A 5CUQA 3S1AB 4TKVA 4YZ4A 1LESA 1DIBA 1UXOA 2VJKA 3UYKA 2BKUA 1M2OB 3U4QB 2GCEA 3D4NA 2Y2UA 4CEJA 1JDSA 2HHAA 2AR7A 1OLQA 2B46X 1BZYA 2PXCA 1YJKA 2V6JA 3GRUA 1P5FA 4CIXA 2Q8DA 1YZYA 2J9XB 3NGXA 2DWOA 2A0UA 3MWGA 1FXWF 5HCNA 3TW8B 1XRQA 3QMMA 4D79A 2H7XA 4NHLA 1KH2A 4EX7A 1LX7A 3OEAA 3RAGA 4CEWC 3H0EA 1K2WA 3T1OA 1R3UA 2RM23 5KQRA 4ENRA 3KL4A 2ARCA 2B82A 1H9PA 2O8DB 4YGCA 3IHTA 3PIJA 2Y71A 4BUCA 3RRYA 1W9SA 2YXDA 1X1CA 1QQP3 2NO4A 5FPPA 1UBMS 5F3EA 1E63A 2C31A 3BK7A 2PKCA 1E2HA 1IM5A 1O87A 1T2NA 3WVNA 3T7SA 3ZY6A 3AP3A 2GNBA 8AT1A 2O8EB 5SY4A 2I3GA 5DTEA 3DVRX 2AOVA 1CUBA 1ATZA 4PLHA 5CHEA 2XNCA 3O4FA 3UK0A 4I5DA 5CVCA 4DYVA 4YMLA 4CT5A 5AI6A 1W2WB 3ENRA 3EUFA 4OMFG 1KITA 2IITA 1E1YA 5DSTA 1E8MA 1RB8G 5GJVC 1K8QA 4BN5A 1T2EA 3WADA 4TYMA 4TRNA 4O5OA 3T3GA 1BDHA 4ZO9A 2VUUA 1B43A 3AVOA 3TL3A 4RHCA 1EXNA 3ACBA 1CXZA 4QXCA 3R4CA 2GUGA 2PGJA 1CNMA 1GZUA 4IE4A 4G5FA 1GOHA 3A9UA 3T08A 3OZEA 4A36A 1GUBA 3UMVA 1EPWA 5AVQA 1JYIA 1NVAA 2HU8A 1X7YB 1NU6A 1U80A 3SXPA 1NBWB 3U7JA 4QU2A 1Z68A 1SHWB 1U0NA 3JZMA 4CMGA 1X92A 3T61A 4UYBA 2FZVA 3I6QA 3JUUA 1NA1C 4C0LA 1O91A 5K1ZA 1MQ9A 3NHPA 1RHI2 3Q88A 4L75A 3BGDA 4B43A 4WBSA 3SZUA 4YNBA 1O95D 1EX9A 4ML3A 2O2JA 1YE8A 5HUJA 3SS9X 2OS2A 4EKEA 3EMKA 4FJ1A 4CV2A 3LNTA 2CXTA 3VNBA 5A0TA 3CONA 1H3NA 3SZ3A 1GZ6A 3CIFA 4XQ0A 4COVA 1QG6A 3RFUA 4Q4CA 4HDAA 3WNPA 2BEJA 4ITVA 3VR6H 2BFDA 4C43A 5K3OA 1PW7A 2YUIA 3CBNA 3GZAA 2PDAA 2IYNA 4HT1T 1G9DA 3MWEA 2E0IA 1R092 3TAXA 3J8F2 1IFXA 5I7VA 2CNBA 2DFVA 3DT6A 4OUKX 3LDHA 1HDEA 2G67A 4KWEA 3GFRA 4DM3A 2X77A 1P3JA 4QGFA 5B6IA 4M4SA 3K05A 3DF7A 4IMJB 4MVJM 3L82B 1XDBA 3G7UA 5T3NA 1W2OA 4O0MA 2ECPA 1T3LA 2C4UA 4K0RA 4QBFA 3O94A 1FB5A 4URTA 5CX1B 1FLVA 2WZR2 4DXZA 5K0LA 4BRZA 4EPTA 4RYLA 1E3TA 4OYLA 4MH0E 3LKDA 3LHDA 1TMYA 2PHLA 5ENZA 1YF3A 3LUDA 2CMHA 2PBRA 4YALA 5FWDA 2Q5CA 4LVUA 2O0HA 2CCKA 4B4OA 2I2DA 4PT6A 3I1YA 1LPOA 3IVRA 3RVNA 2DVFA 1VHTA 2I2FA 3NJ4A 5EL0A 4JGZB 3COPA 2PWZA 1IPJA 1PZNA 1XD2A 1AS0A 4D2IA 4OUEA 1CR0A 3TYJA 2D93A 4NJ4A 2YC0A 3ZM8A 4M7RA 4U2BA 4O4IF 4DLZA 5KUTA 3GJ3A 3T2OA 1XZIA 3BHMA 1XR3A 2JG9B 3H8VA 4YSFA 4GL2A 5LL6P 3NEJA 3KUXA 5EQJB 2DKFA 3VDQA 2JD9A 3A22A 1RTKA 3JZFA 1PGL2 2YY5A 2JWPA 3PD7A 4Z1MD 1VKNA 1J00A 2QROA 2IWRA 4M49A 5K3DA 1WA4A 4BDTA 1L7RA 3M3EA 5JSPA 3WGQA 1A3CA 2OQ6A 1NUUA 2Y0DA 4AMBA 4YRNA 1W3XA 1Z7S2 1PJ4A 3KHTA 1B0UA 3DZCA 5DN6A 3T8YA 2VJYA 1FS6A 2ID4A 2DUNA 3ZHZA 4F21A 4WT7A 3UGTA 4AG5A 3UA4A 3KYCA 1AX9A 1GZ5A 3WC4A 4AZTA 3UBMA 2VUSA 1XQYA 5FUWA 2ZBGA 3GDWA 4X1YA 3NWEA 1IRXA 3AI1A 1OFSA 1M1YB 1YFWA 5I9TA 4MHTA 3NZEA 3IKVA 3LYHA 1WCDJ 4UWDA 1YS6A 1U3UA 2GO7A 4ZKEA 1RXVA 4QKDA 5F35A 3PP8A 2I45A 1JLSA 3IDOA 2CJYA 3DZJA 3Q8MA 3DKWA 2ZE8A 3IAQA 2A6PA 2ON6A 4J76A 1KRWA 1MVQA 4I4TA 3LUCA 5B57C 4CP2A 4P2BA 4KBYA 3WV6A 4KI7A 1DC8A 1LQ2A 3KVVA 3NETA 4UE2A 2B1RA 4UM7A 1GKIA 4R8RA 1JEDA 4EFLA 1X9PA 2R85A 2RGCA 3OWXA 5IT6A 2XL7A 3FD8A 2JFYA 4XWAA 2D3PA 4Y4RA 1YBHA 1L4GA 3DW3X 3W8RA 1SCSA 2A7QA 1KDRA 4F2GA 2PYTA 2FQWA 4I30A 1OJ7A 2PFGA 3E3NA 3WE7A 3F5DA 4J0QA 5M3BA 16PKA 2XMDA 3DMYA 2ZBVA 1QDOA 4DR1B 4GKAA 3AMVA 2WZBA 2ZUBA 5GOZA 5CA1A 4Q7EA 5L3ZA 1UP6A 1AGXA 1T6GC 4FCTA 4HVOA 1JXAA 4LYAA 1RUG1 1DDOA 4YRRA 2RE9A 5IVFA 4C3ZA 1JA9A 3G8DA 5H9WA 4OXYA 2FWAA 2Y1XA 3V9AA 1QF7A 3S5UA 4FPCA 5CTAA 2IEDA 2DV9A 2BP7A 2BSXA 1YZFA 3A0NA 3KX2A 4JYAB 1B00A 5FTLA 4Q4V1 2P41A 8LDHA 2QDKA 2Q30A 4Y1UA 2Y0OA 4Y3OA 2XMRA 4E1BA 5CFPA 1KYXA 1UMCA 1IH8A 1RIRA 1Z45A 4DCVA 2JGFA 2YMQA 4HH3C 3L4JA 1PL8A 5BXXA 2J3KA 3T1VA 3KUCA 4UBMA 4BGUA 1TXGA 4LCBA 3FN4A 3LRXA 1EBBA 1BCSA 2GASA 1N5MA 3ITDA 4YT4A 4LJSA 5A6SA 5JCXA 3M83A 4RS5C 2D6OX 2CJWA 2PV7A 3GRPA 3PWZA 4A0GA 3B48A 1H85A 3TLEA 4REQA 4MOWA 3QYAA 2Z57A 4YMTA 2D6NA 4JBHA 5C5EA 5JMCA 2WQZC 2W83A 4RQBA 2NU8A 1KI6A 3L18A 4ZANA 2IV7A 3FUQA 4DMFA 1NIJA 3CVJA 5CVEA 1T6NA 1C5HA 1FP4B 2JIOA 4FT2A 5F4ZA 3PGA1 1JZ2A 2G28A 2BTQA 1GQRA 3JW8A 3E15A 3BU0A 1JAXA 2ZX1A 2YFYA 1FP1D 2DU8A 5LRSA 1RXIA 4QB2A 2PWBA 2FF5A 1SIWA 4XQDA 3BXOA 3N9PA 3P96A 3DLAA 1NE2A 4OP1A 1HE8B 2ZEXA 1AQ6A 3U7HB 4OI2A 5FWNA 2DF7A 3R0XA 4JDOA 1F6WA 2VF5X 2CV6A 3U80A 1AHSA 1UX6A 4RSRA 1KOLA 1OI4A 2ZI6A 1A2OA 4PWZA 4Z0NA 2NP0A 1AURA 5BR1A 4OQXA 4CZSA 3IEIA 1JKJB 2F3QA 2V9PA 3RT9A 4L92A 4M8LA 4GWGA 3NP9A 3N8IA 1CJVC 1B8PA 1GV0A 4GDMA 1T5BA 4Z0TA 1M2VA 4DIOA 4Z9YA 1AR72 4BWVA 4R4XA 1RUOA 5DNEA 4PC2A 3WFIA 2I71A 2BFBB 5AP9A 4EBBA 2G1UA 2QP4A 4C2BA 1EUUA 5GOTA 1T0UA 3HDGA 3P0IA 4L9WA 4RXUA 3HM2A 4OMUA 1B74A 3VGIA 2Q6LA 3Q0TA 2HRZA 3U7EB 3G9XA 3RZHA 2FG7C 4M21A 2YW2A 3K8OE 4GICA 3R05A 5CKNA 3AUXA 2OXTA 4OY3A 4G4SO 2QS9A 1T5OA 3I2DA 5ILGA 4DQUA 4B3MB 2Q4OA 4H0CA 5JECA 3GJYA 3M3IA 3GRZA 1FNYA 4H6VA 2O20A 4LVOA 1EDBA 5FLJA 4Q4X3 1WCKA 2AC1A 2NM1A 2ZRKA 5A1FA 3I2YX 1XZAA 3IVXA 4IIYA 5FBLB 2HBYA 3NHWA 3ZVNA 1DV2A 1EAH1 1PVXA 1PDVA 1JDVA 2OM2A 3UK7A 3CRVA 1PR6A 4M0HA 5ECDA 3C39A 2YV3A 3FSEA 3H1FA 3I76A 3W7AA 2DERA 3ZWNA 2IIQA 3U6BA 2NSDA 3AHHA 1A5TA 5B3JC 4UPEA 4GB33 1X74A 3OJFA 4BQNA 4NONA 1OQ1A 1H0SA 1V7CA 4BJ1A 4UW3A 2NUPB 1OA0A 3GLGA 2HU2A 1H5UA 4GEKA 1NUHA 1LODA 1A4UA 1NVFA 3CSUA 4TKUB 4MHSA 2WJVA 2Y60A 5K45A 1DLLA 3QX8A 2W2LA 2JX9A 4LO7A 4E2FA 2AI3A 2EZ4A 5CVDA 3AP9A 1N6KA 3E3AA 3SU8A 4HTFA 2WJIA 4MKIA 2A5LA 2ZOSA 1QKIA 1QQ6A 4AF8A 2PS1A 5GV7A 4DLTA 3DW1X 4NX2A 3W5DA 4I1OA 1TM7E 5HEKA 5E6UA 1E6CA 1IM2A 3DD1A 4A0SA 1U9IC 1OV4A 4KEAA 5K99A 3VYVA 3G8CA 3JRWA 4Q1VA 1NN0A 1R66A 3Q9SA 3VBOB 3VC3A 1TO1E 2ZZQA 1JI6A 5H9PA 4JCOA 1F4VA 5CYPA 1V6CA 2IPLA 2WU3A 3Q9UA 4FDUA 3A9SA 2DUJA 4GUDA 4RO0A 1VMJA 3D8HA 4BO1A 3HVRA 5ABJC 5JE8A 3R7WB 5DBEX 3PXGA 1VSQA 2RARA 4IUGA 4G56A 3LUJA 4S04A 1DIGA 2MSWA 2W2NA 1GGNA 4GWMA 3FZ3A 2GZ3A 1HV0A 4LNVA 5JSFA 5BN5B 3R4DB 3E7DA 4IKEA 1T4DA 1M3SA 4P1ZA 2IS2A 5DVZA 4BIFA 4N7JA 3I5XA 3G8YA 4E4ZA 4HK9A 3IMCA 1ZM3A 2PGXA 1HRI2 1IMOA 2H4JA 1TF5A 2HPHA 4ZEMA 2A1IA 5T41A 3HV2A 5INTA 3ZXXA 4DDKA 3H4MA 2YASA 4K6BA 3IMGA 2FUNB 5DISB 1BHO1 1TKCA 4O0LA 4D9KA 4KE7A 4ZTZB 3F9CA 2F43B 5A6VA 4LW8A 4G2TA 3NHUA 1XTTA 4E2SA 1PEYA 3EXHA 2EZ9A 4MQEB 3NOXA 3EBPA 4RA6A 4RK1A 2DEUA 3ZE9A 4BEVA 4Q0QA 1YHYA 2VBCA 2AR6A 2BH2A 4ZN6A 4NI5A 4U7GA 2GNDA 4ZOEA 1QANA 3ZE2B 4DXRA 1HXS2 4E4HA 2RS12 1AR91 3GFPA 4U02A 5DGTA 3VN4A 3H19A 1E89A 4XOGA 1KY2A 2OXIA 3PFBA 4UM5A 4MYRA 2X0IA 2NTVA 3I83A 2C94A 1VL1A 4AMUA 2ZHMA 4YS6A 1W03A 1XSRA 2H08A 2EGHA 4J49A 4GPEA 1YVPA 2EZUA 3PFCA 5CLLA 1IN8A 3T4EA 4NAHA 4HLTA 2W6JA 1T2XA 3ELDA 3ROUA 4JXZA 4ND7A 5T4EA 3F8TA 1OVGA 1G41A 2PN5A 3RSFA 4QPZA 1J33A 4DRRA 1UKCA 5J5AA 1F4PA 5FP3A 5EE1A 3I54A 3WB2A 5HZGA 1PR1A 1YB4A 1P6UA 1V25A 1RADA 1WVMA 2GESA 2P4HX 1QYVA 5BSMA 2O23A 2IP4A 1ZLYA 1F1JA 1OZFA 3RS6A 2BVNA 1MGPA 1O5UA 3OGSA 3LG2A 2P62A 2VCMA 5CGZA 4EZBA 3L1HA 1XTVA 4MDHA 5JDIC 4MQMA 4V1CA 3LCJA 4HT3B 3QF4A 3UMMA 4QX1A 5DSXA 1KFKB 3AHCA 3H42B 1XKTA 5L8VA 4K9KA 5K20A 4Y2HA 1L7BA 3WIDA 3OCYA 1WXEA 4P4TA 1GPBA 3IR6A 4E5DA 1G8MA 4HAYA 3CZMA 4UZSA 3ELWA 3L7YA 1IEWA 2ZA9A 3IAHA 5BPHA 1J3RA 4XJAA 2V97A 2BFAA 4J29A 4PVDA 4ZGWA 5CFRA 3WW4A 1E9CA 2VDQB 3RTAA 4XPZA 1UFVA 2FUG1 2AI2A 1JALA 3T5GA 2EKZA 2H1LA 4CDUA 5GZ3A 2XQJA 1BHQ1 4UVEA 4BNWA 1W6RA 3U4CA 5J5CA 1FP7A 5GVRA 4LX0A 3RS5A 3FBWA 1UPTA 3I73A 3GELA 4Q4X1 1MX3A 3IODA 2RI0A 4XIFA 3HBKA 2J7PD 1SFYA 4EVQA 3VM6A 2O6HA 3C6KA 4GMP1 5F7OA 5CURA 3VVCA 3P3PA 3EPKA 1UWKA 1X1BA 4RK5A 1E5XA 2MSKA 4FINA 1JYXA 4E51A 1IN5A 1X70A 1AQYA 4L6IA 2WZR1 5FI3A 1RWBA 1FTQA 2COEA 1ODMA 4NDAA 4FMDF 1REDA 3I5UA 4GB32 1E7YA 3PE4A 4RIGA 1KK1A 1T43A 2I78A 1XEWX 3VPAA 2OR3A 3VBFC 3QFSA 1J0EA 3GALA 3NC4A 4EQ6B 5CIWA 2WF8A 4QHYA 4XUQA 4DY5A 5JWPA 2WF6A 3Q1KA 3R0ZA 4RZ3A 3OQ1A 2W2KB 3DAPA 3Q7IA 1OFVA 1DQRA 2BDEA 2FFHA 4QB6A 4H55A 1JKMA 2HXYA 4W9MC 3PSAA 3ESQA 1ZBA3 3NV7A 4P9NA 2B8TA 2CXOA 3LFHA 4G1FA 4CCNA 3W9AA 2BLLA 3AETB 4Y0AA 2WIGA 1VRCA 4P4UA 4OREX 4XB2A 3ZIWA 3R5SA 4FHEA 3NBMA 3TDNA 3PJQA 3KJFA 2A3RA 2OKGA 1QRAA 2YBSA 4KAAA 4V2UA 3ZFGB 4JIGA 3FWZA 2XCQA 4NNPA 2MINB 2P2NA 4G0OA 4ZDWA 5J2TF 2ERCA 2WMNB 3MTIA 4DRVA 4DR6B 3LBIA 1CGPA 3A05A 3LQRA 4PX5A 4LULA 1SBZA 3VYRB 4DZZA 3ERCA 2WF7A 4QKNA 1ZRCA 3IDAA 1J8VA 3B89A 4YAJA 3WG4A 2CNWD 2V74B 5JZGB 2RSLA 4UAVA 4N65A 4JVSB 4YGEA 1T4MA 3UB3A 1NGSA 1U8EA 5M5BA 1TUIA 3FMVA 4BMNA 4GSKA 3AMHA 2GFIA 5BQPA 5H9SA 5JPCA 1XU7A 1ECCA 1FA9A 1CETA 2H0QA 1KEKA 3CWZA 1D04A 4FLMA 3BC1A 3ACDA 4NZYA 3W5UA 2ODEA 1HI9A 3UC9A 1XEAA 3O91A 4LKRA 2W47A 1WSWA 3KQ4B 3T9EA 3I53A 4TLMB 3CA8A 4HPJB 4JLJA 4RAQA 1PHPA 3VSBA 5M0TA 1WV1A 3THSA 3HBLA 3KT3A 1FYDA 1P7CA 2I2AA 2JAQA 1RQRA 2XRMA 4D7YA 2D1QA 4J3JA 5FXMA 1T1IA 1QHDA 1VBB2 2HT1A 3H9AA 3JQEA 4V2VA 2ZS8A 3P0EA 3LOIA 4B1LA 1JUDA 1GOFA 3EODA 2Q5JA 5F1KA 5DM2A 2FOIA 5B36A 2HWD3 5J5VA 3AIKA 1PGJA 2DT8A 5EYYA 3F74A 2YS6A 1QZUA 3ILRA 5IK2A 2HWWA 4F72A 2BGJA 1IBSA 2ZBJA 1PT9A 3HEAA 4OUSA 1BLZA 1S3IA 4TZTA 4WECA 2J1UA 3JWGA 3BICA 3B1WA 3Q8AA 1FS4A 4YM1A 4G4FA 2YBPA 4W5JA 5K09A 5JCJD 3TRDA 1JS9A 3I04M 3C15C 2OBNA 1BHJA 4NV1A 4COKA 5JJ5A 1YKGA 4RDIA 1Y43B 3PF9A 5FTWA 4QWMA 1S0FA 2VH5R 1UAAA 5A4IS 3W79A 4C1WA 2R7NA 1XMSA 2NT3A 1OX4A 3BZBA 4GWIA 4EW1A 3AVUA 2VSFA 3O7WA 5THQA 3SHWA 3CJIC 1H2EA 3BMXA 5JDCC 2YHIA 5BN1A 4WCVA 3R4UA 5ER9A 3DBVO 5AW0A 2EW1A 3K4AA 4HNAA 2OO7A 5EUMA 4GDFA 2GEDA 1CESA 2XYRA 1BW9A 5D86A 4N01A 1GRCA 3AKTA 3U10A 2YHUA 4AJKA 2CC2A 5ECYA 4RF4A 1DF0A 2VNHA 4LQ4A 1RVDA 4R52A 2PZEA 1P2SA 1ZY2A 3RO7A 4H7IA 2QTFA 1JYVA 4FSXA 1CR6A 2H5EA 5KBFA 4IQGA 2WP8J 3NVMB 2XBO2 2VZRA 2QVCA 3W5HA 1G0OA 3VJRA 2IHNA 5JNTA 2I7VA 4R1OA 2P5BA 1WHTA 2ZI4A 1PO22 3IQFA 1XQ9A 3A4YA 1ZGAA 1XROA 3D8NA 4K1XA 3ETNA 3WMGA 4P84A 4XFKA 4Y2RA 5I7EA 1SEFA 3MTJA 2EFCB 4LBWA 2I4MA 2R7LA 3K77A 3RSCA 3QLJA 2EIBA 4BJ3A 2G77B 3PDUA 1DCKA 3DBRB 3UEOA 1U3CA 2WYWA 3DL0A 3QUSA 4DQLA 2IEZA 2VJXA 4CDQC 3OT4A 3H5AA 4DLKA 2OECA 3FZQA 5IKXA 3SVLA 5G1OA 5LZ7A 4ZZ2A 4UDOA 5JQGA 3E27A 2XUEA 1DEOA 4GPAA 5BPFA 4QPGA 4X8OA 1O9BA 1II0A 2IWHA 2GPSA 4N90A 3V34A 1RQ2A 3SC2B 1ZHHA 5KXEA 2R4TA 5BOSB 1EWRA 2I33A 1M34E 2WWFA 3P9NA 2P7IA 4DS3A 1XRUA 1AF7A 2X4IA 5JQGF 1GUDA 4HH1A 1BTOA 3BU7A 2WZR3 1HRV3 1T1SA 1FSFA 1N75A 3DLBA 2BF4A 3ZXAC 1FJGB 3BXXA 1I10A 1FTWA 1IBCA 1V71A 1MMFB 2O3UA 2QYTA 1K1EA 2CAUA 1BXHA 2NZVG 2AZXA 1ULBA 1V11B 4V0OA 3SFVA 3ZYZA 4MKRA 3D8TA 1CV2A 3RQ0A 1Q77A 3FGOA 3QI2A 1WKYA 3LHSA 4LR4A 4G84A 4X8LA 1EYZA 1U6JA 4YAGA 3BMNB 5FZBA 2NN8A 3UAWA 1PSDA 2F3TA 3DCNA 5F3DA 3VKVA 5TPWA 3PC8C 2E7ZA 3H1WA 3VOSA 3ZI7A 4DREA 3JB8A 3SJCA 1F51E 4F8EA 4D9EA 1YVRA 5DLEA 5DX8A 3VDMA 3SSNA 3W2TA 2IXAA 3M4ZA 2I6XA 2BMFA 3H2ZA 3F6YA 2AMLA 3KSUA 3J81k 4PFJA 2I7XA 4OI4A 2Q5IA 2P9JA 4AI1A 2X42A 2BERA 1FYXA 2J3HA 3AQ4A 5EWSA 3WWPA 3B3QE 3NB0A 2J3MA 4YCDA 4Q1DA 4HGQA 4DIKA 5CBPA 4OX9Y 1H2FA 4AYTA 3S6PA 3O9ZA 2AYZA 3PT5A 1MJFA 4WM7A 1UY1A 2NUPA 2EBHX 4YFWA 4O8CA 4ZI7A 3FMIA 4ER0A 2CYBA 3NWJA 3O6VA 2OP1A 2XCTB 4BCCA 5DN2A 3VBUB 4CW7A 1PSWA 1QSGA 2CE7A 1EU1A 1X86B 4RNCA 4IH9A 1QIDA 2CNDA 5EHQA 5IT0A 1ZQ9A 5FPAA 4BVHA 2BBAA 1APBA 1FPMA 4TTJA 3LEMA 1H2ZA 1D2MA 1JP7A 2A59A 3A0KA 1H5QA 4I50A 4DG8A 1EUCA 1GPNA 1FFGA 3D4KA 3UK1A 1JR3A 4JU9A 3JWJA 4AN1A 1TM4E 5HJ5A 2RJ2A 3H1EA 4BFCA 1VL2A 1U6IA 3QE9Y 1RUI3 4HSEA 3QVSA 2X53S 5DW3A 1I3CA 3MCZA 2GPWA 3B9IA 3ES9A 2KJQA 5L9BA 1H0BA 1KSJA 2PHUA 3KZ4C 2WNSA 2BHRA 5FZ0A 1PNVA 4OFZA 1T3HA 1P29A 5AM4A 2J4FA 1V8BA 4XCAA 2WT0A 3I5YA 4D80A 2QV7A 5EKUA 2VF8A 3WZ1A 1MS5A 2JCXA 5D8AA 1O4VA 6CHYA 2HZ7A 1XPOA 4B3JA 5J1XA 3EXHB 3T7RA 2NAFA 2YS7A 2ZS6B 5CEHA 1SC6A 2IE0A 2JIDA 4WVVA 2ZXFA 3MYXA 1C8LA 4HFSA 1YWGO 2I67A 2Q7XA 1C1DB 4MG2A 1WCYA 4AX8A 4FDMA 2GN3A 4EHIA 1NOIA 2CF5A 4YVSB 4NMHA 4QYIB 2W3JA 4N54A 4LHWA 5BWCA 3JASA 4XUTA 1W6PA 2ZRNA 3UGHA 4EROA 5AHKA 4OXXA 5CIQA 3ZZ0A 2XMGA 1SQFA 1YUBA 1W0OA 3MFYA 1NXPA 1XZJA 1X8JA 4J90A 3BE4A 4I4LA 1D2EA 2WZEA 4MI9A 4J1XA 4GZ5A 3NXSA 2V65A 3DYVA 5D6OA 1AM4D 4MZUA 2Z1DA 2ZXEA 4J0DA 4M1SA 3ZVRA 4PTLA 3Q9OA 1ISGA 4LJAA 2C0PA 4LNHA 4U39A 3U9LA 4PO3X 1HBJA 3HKEA 4X8NA 1E6EA 3GJZA 4Q02A 1RTTA 4I1IA 4BDSA 1OBOA 2WHRA 2JI6A 3AW8A 3E35A 1PZ7A 2FFBA 1F8UA 3J4UH 4DMHA 4NN0A 1W36B 1RC8A 2B1JA 4WEOA 1EXDA 4L11A 1ZBDA 1SUAA 5DCYA 4FYJA 1RCTE 3CO2A 3CSSA 2LNDA 1O59A 3VNQA 3DDZX 1IQPA 4B4UA 1EKXA 3JWPA 1BXKA 1QYXA 1IBLB 2I6SA 4ZEOA 1ZAKA 4S05A 2WWUA 3PZBA 2OAQ1 4K1LA 4GALA 4JTOA 5LM3A 3FOAA 3MBWA 3M5CA 3VR6A 1KNQA 2GGSA 4B9EA 4NG4A 1AK2A 4UM8B 3HJUA 2D7JA 1L5GB 2FZ1A 4XD7D 4DMKA 3ZOKA 3H75A 2X8KA 2QU7A 4Q3DA 4B44A 5JFTA 1P7VA 1QLWA 3H3FA 4KDRA 3QE0A 2R2AA 4DIFA 1RACA 1V9U3 1YKFA 1Z4LA 2D0DA 3ZYRA 2XOEA 2YOFA 1PWEA 2V7BA 3P0HA 4LNUB 1XE8A 3VTFA 4OG2A 3ZY3A 3ETQA 3AM4A 2RIRA 3B3AA 3NWBA 2PBFA 3WK8A 4S1WA 1LRKA 4HG6B 4S12A 1SXJE 3E8MA 1TA4A 5GLVA 4FT4A 1J8QA 4MVCA 5J4VA 3HVDA 1LB1B 2FR0A 5GJ6A 3PYMA 1ENSA 1ES9A 4J25A 3IKMB 2W46A 2Y1WA 2CXXA 4EIWA 2I07B 3PFFA 4O4LF 3RG0A 1VBC2 5LA0A 2VYVD 4CM1A 2W6QA 4JQSA 1OXUA 1KZ6A 1NU8A 4L8FA 4GS5A 821PA 1TYBE 1S8NA 5FZ3A 1NLUA 3DZFA 4LMFA 1VGRA 2ZOEB 1CY4A 2FPMA 3C43A 1RPNA 3K6SA 4OYUA 3N7MA 2FDXA 4GC9A 1QS0B 2XWBF 5FL3A 1RUE1 4KX5A 2QJWA 3MUNA 3HKBA 4LFBB 4QBTA 1QGAA 1D3AA 3LOUA 2ZJ1A 3PUWA 1SELA 5GZFA 3SCGA 1EK6A 1VQ1A 4DA7A 4LBQB 5AWFC 2FNAA 4G8DA 3I2HA 3IXQA 2ANCA 2L19A 3EIOA 3TPZA 4BMOB 4GE3A 4LK2A 1RHI3 3NHRA 2DQSA 3TLZA 3JZVA 3IMEA 2HA5A 3UCFA 3AKRA 4I55A 5EP3A 1XPJA 5IEBA 1QOZA 4W5OA 1GFF2 1S7CA 4CCKA 1ULPA 3J7TA 1M34B 3TZHA 1J3PA 4CV3A 2JGJA 5LBUA 1I51A 1R4NB 1AT1A 3UMYA 1RYZA 2RDMA 3R7SA 1NRJB 3VYSB 1UT5A 1CJMA 4NCBA 4FGUA 1CRPA 5L4SA 4FGLA 2CGPA 3C8XA 3V8MA 2WSMA 1JILA 2A35A 2G9VA 1XF9A 1G8AA 1QCCA 1MAAA 1YCGA 5FA8A 2IY9A 3NI2A 2DFBA 3C3DA 4CNBA 1C0IA 4S1VA 5F2KA 4MS3A 4MKHA 2V4AA 2W90A 3A31A 5DNAA 3FTQA 4Y6QA 3W04A 2I5PO 2HSDA 2NZXA 3G7SA 5AUNB 3PRKE 1W9TA 2PLV3 1L7AA 4ZCSA 1ZXLA 3OQ6A 2FW7A 3Q3VA 1YEWA 2GARA 1M54A 3P9XA 3BFJA 4D4GA 8MHTA 2XB6A 4FCVA 4I99A 3O3MB 3PDIB 4HX2A 4RPKA 4UFIA 1DU4A 3BHJA 3OBRA 3JQ7A 1X1DA 4X8PA 1OFGA 1RC0A 2FN9A 1YAJA 5K05A 2ZZMA 3UOAB 1UDCA 2OYCA 2DSTA 3UPDA 2B0CA 5FK8A 3ZN6A 2JI8A 2OCXA 1SPBS 2JB9A 4FX2A 2F48A 4CIAA 3P4UA 4O1HA 3C6XA 4ZPIA 3PPWA 4RYDA 1GPYA 1P4AA 1T9AA 1IL0A 3G5TA 2SICE 3DV2A 3NYQA 4UFHA 1RQPA 3D4PA 4O2LA 1R083 3H7AA 1UY3A 2DCJA 3VZPA 2ZUEA 5L3SA 1ONNA 3DM9B 1YNOA 5JBIA 4RCZA 3D82A 3MRTA 1NLQA 3OTFA 4F4JA 1WLSA 5J4LA 3V55A 3SM9A 3Q5DA 3BG5A 1PZMA 3AV0B 4HLUA 3ZXDA 3R4VA 4DLVA 3UHOA 1A8SA 3IPRA 2XA9A 1R10A 2KW5A 4E11A 5C51B 2ZSIA 3PJYA 4BNDA 2CFIA 5AQ1A 1WMAA 3CPSA 1PWXA 3JD3A 2GTHA 1ULZA 5G40A 4Y1VA 3KPWA 1JDBB 1XPRA 1K3UB 5LC1A 1T6BY 4H2AA 5ALYA 1S1CA 2Y1KA 3LPAA 1KYYA 5B4UA 4Q01A 1TJ5A 1P60A 2XXJA 3U3JA 2H1VA 3ISTA 2WWXA 4EPRA 2ZSEA 1X36A 1N0VC 1EFUA 4EFKA 4JELA 3E82A 2ZIXA 5KX5A 2FEXA 3QVLA 2Q5HA 1OTHA 2C88A 3RVPA 2OV1A 4QATA 4LJ6A 4O3FA 2CFTA 1Z88A 1PJLA 3PEFA 4QOFA 3G2LA 4AGVA 3P0JA 4XSGA 4KH9A 4JUIA 1V5IA 2C20A 1C8M1 4LYDA 4M99A 3OZCA 4IV3C 1AKNA 3KYCB 3BWYA 5C46F 3A6EA 4TL9A 3RKRA 1DUIA 1OWPA 1TM3E 1IEQA 3CU5A 3D6VA 2IEGA 2CXPA 4RTSA 1CYEA 4HSLA 4Q66C 4Q34A 5DM70 3PUAA 3FLBA 4IHKA 2IUEA 1K6JA 3R4SA 3KTOA 1SA0B 2H4ZA 5ICCA 2Q4RA 1S0GA 5IWAB 5FZFA 4NOLA 4UQPA 3GJTA 3HDJA 3AEUA 2N0SA 3KR2A 2R62A 4Z53A 4Q4DA 4XOIA 1RTVA 3WKEA 2FN4A 1OPRA 6PFKA 3MD0A 3CZCA 1L6RA 2ZZJA 2CDPA 3ZYJB 4EYUA 3ZJVA 4WM8C 3DP9A 1KJRA 3GZUC 4AC9A 4Q0UA 2PBZA 1HLDA 1WW5A 4DMUB 3OWOA 4NRQA 4Q4JA 1CBUA 5KSPA 1L4UA 2RC5A 2ZS7A 5AXDA 3IIJA 2AG8A 4BATA 4AIRA 4EFDA 2XBUA 4OXRA 2WG1A 1AHIA 1U94A 3RBAA 3VR4H 3KKKA 4GBMA 3CH6A 4IDPA 1HDRA 2RJLA 4B47A 2XHNA 4KC0A 4EN8B 1ZIYA 3VPGA 1Y9QA 1YMQA 2HEGA 1ALYA 1CRWG 3I04A 4M1TA 3AL0C 3UUFA 5K0JA 1MW9X 4EYQA 3VR4A 3A3KA 4MW4A 4L4SA 4E2WA 5BQXA 3CDZB 5GM1A 4ZAZA 2IUYA 1E77A 2AUTA 3UK6A 3PDCA 2XUMA 2P6MA 4XDQA 3PQ6A 3R76A 5ICSA 2CV2A 2GBLC 5EIBC 4C0WA 3DMTC 4DSAA 1IXYA 4TTQA 3MLEA 1AR71 1NZFA 3HJRA 1LLUA 4BVFA 4AQSA 2X7JA 4DEVA 3FVRA 4L5AA 1CP3A 5AOVA 5ED4A 1VSTA 2RR11 3DR3A 4B6PA 3OPYA 1P5JA 4W1PA 2IU4A 1MNQA 1U0BB 3T4PA 1BS2A 2WD9A 1DU3D 1CU1A 1QR6A 3OF3A 1ZRHA 1U3TA 2CWMA 1NW6A 1QH1A 1LENA 4KNYA 1SXGA 2UXBB 4TSKA 4YJ2B 5EFZA 4G0MA 4K20A 1QF3A 2EWVA 4JR2A 1LDEA 3GLQA 2RGEA 2NSHA 1GQFA 2OFFA 4AEDB 4US0R 2HYIC 4WSOA 2FR8C 4ZYVA 5AK5A 3GGPA 1EG2A 3FVTA 2IF2A 2BTVC 5JS7A 1ZL0A 3F5MA 2VOWA 4LHEA 4C7JA 3RYPA 2X3YA 1BE0A 4PHTA 5KTRA 4IFIA 1UU4A 1U63A 4YGYA 2JA2A 3U3RA 2FPIB 3RS8A 4CVNA 3RZLA 5JRJA 1XTQA 4CUAA 2Z4TA 3EBOA 2NU6B 3I3QA 2RIPA 2XRFA 4LRSB 4MV3A 3RI8A 3WIOA 3MA0A 5AESA 1NMQA 3CEWA 2PG3A 2A3NA 2DQKA 3WLIA 2HHCA 3ZFFA 4INJA 1XNTA 3L93A 1MUUA 4AI3A 3S57A 4D3FA 5LB4A 3PGLA 3T7TA 2AQKA 4DRZA 1P91A 1NT4A 2FMXA 5ALKA 3B2QA 1XTRA 421PA 1N1GA 3VTZA 3I7DA 4UE3S 4W9NC 4F97A 2ODTX 3NJ8A 3TB4A 4YRLA 5YASA 2JFUA 2QPOA 3CN9A 1DI0A 1XX6A 4AWAA 3MWDA 5EJ1B 3BFXA 3OLWA 5J2TB 5IKMA 3HRIA 1ZNPA 4U0KA 4AP6A 5I3CA 1V3TA 3GHYA 2X0FA 5I8PA 2OAEA 2ZIVB 3GDFA 1HTTA 4FKZA 1Q6ZA 4JK3A 1WTAA 2GN4A 2GILA 3X1ZA 3CHXA 1XVLA 1ZC3A 3I6YA 3Q87B 3EIHA 4WM8B 5KB3A 2YJ5A 4P5HA 1QOTA 3D7KA 2WWYA 1ULCA 3AL5A 2Q8QA 3VAYA 1KI9A 1ELOA 5DHSA 1AKRA 4FFVA 3LSEA 1OU0A 4X94A 1VJ5A 2ET7A 4K9OA 3TOVA 3Q9LA 4F2HA 4XWKA 4BO2A 2NSYA 2C3MA 5E6SB 3I1FA 1X7NA 4Y1RB 3LDUA 1ZI6A 1JIJA 1TME2 3IILA 5AKHA 1EQ2A 1EFRD 4JL5A 3MIGA 2X3FA 1W6OB 1MJGA 3K15A 1YRYE 1GL6A 3ODPA 1F9AA 1S2BA 1U9CA 2GS9A 1FYEA 4EELA 4RL6A 3M1IA 3KHCA 4PCRA 1XIVA 3WOHA 1QHXA 5JVDF 1BCXA 2G63A 4F3TA 1QG4A 4IIBA 2JFPA 3QLVC 1I3OA 2OE2A 4JJIA 4W6QA 3LX5A 4NYMQ 4ITCA 1Y1RA 1KMMA 4BGIA 3KKPA 1Z4IA 3RHZA 1HQDA 4F8JA 2IYFA 3N1UA 1XCMA 1QQ7A 3F5QA 2QQPA 2QOEA 2V7VA 2E7AA 3IULA 1NRWA 4AW9A 3SZLA 4Q1BA 4E22A 3BL5A 1FLAA 4D26A 3IV7A 2WFPA 3OPVA 1Z0HA 3OIFA 3PVNA 3FJSA 2D4AA 1YJBA 3KYJB 3Q40A 3GQVA 3I4CA 2I6QA 3OZFA 5FAKA 1B6TA 4MWZA 4AO7A 2X29A 4HEJA 3TZBA 3LRPA 1HFJA 1QPBA 4BUZA 4XCXA 3KETA 1RUH2 2Q2QA 1PO7A 5FIXA 4DUYB 1C0PA 2UYGA 3WNNA 4BX8A 3GVCA 5CVJA 5H59A 3R40A 5LQCA 3E48A 3U56A 3DYBA 1UJMA 2XGGA 3MAGA 1KI7A 1MT3A 4H4EA 4R9CA 2OSVA 2J1EA 1ZW1A 4DILA 4KFSA 3UMCA 3LTNC 5JASA 3BORA 1IUOA 4FYIA 1GDDA 5LXTF 3OFND 4F83A 3CX7A 3VOTA 4YR7A 3WX5A 3H6HA 4YV0A 5MDHA 1HDKA 4BUJA 3GEPA 3JTMA 2EJBA 5FYDA 1XQXA 2GPJA 2OCGA 4L8YA 1DT3A 4JRAA 3F1LA 4GD3Q 3ANNA 2IXJA 5A3OA 3GARA 1RUH1 4KO3S 3RFFA 1U5AA 1AKEA 1WAMA 1T34A 3K5WA 3KG2A 4UW9A 1NC3A 4G4JA 1UQRA 4O3MA 1FATA 4IW3B 3IAXA 3TD2A 3LA7A 3L0IB 3GRYA 1P5ZB 4WUTA 3L07A 5JSKA 2ZRAA 4I6JA 2VDJA 1TG7A 1OX4B 1C1XB 3TSOA 1Z29A 4B40A 4DVGA 1W46A 4BEBA 3INNA 1UC5B 2YMMA 5EN4A 1MIOA 2BH9A 2XMQA 2DR2A 5JDIA 4TKUA 2QG6A 3LQFA 4TLGA 4J4TA 4RS3A 3QFFA 1AUPA 3NC1C 3AM3A 4CCYA 2XPCA 3TNPB 5LOVA 5GJWC 4RLSA 3TPCA 1SUBA 3LE8A 4CFSA 4I3PA 5CA6A 5K6TA 4PFQA 2DCTA 1YIPA 2QTCA 3ONNA 3UYLA 4XF3A 3JQBA 2Q7DA 4F91B 1PVC2 3C7FA 3L02A 4TLEA 1UWCA 1PR5A 2JI9A 3AXSA 3GP3A 1ESDA 2L0XA 1CY2A 2FE4A 1NXXA 1WRBA 3NBXX 2BZSA 1JLKA 1NY72 4M7OA 2PGLA 2RJ3A 1V3QE 3AMPA 4A8JC 3E5XA 3R5JA 4ND8A 5CBPB 4D9HA 5AM0A 1CTQA 3F9IA 2HV8A 2HMYB 1FI2A 4BFZA 3U49A 5CB4F 2WYFA 4HAOA 1Z7WA 3ZXYA 2ZQYA 5JTTA 1GYRA 3EX7C 3DV0A 1Z5WA 1BMV1 2ILTA 3ZTYA 1GU7A 2GSYA 1G1AA 1LUAA 3G0OA 4NBRA 4I02A 4BNJA 4H27A 1FYVA 4AXBA 3IJPA 2JB4A 5TS2A 1WBFA 1VBNA 1ZRDA 5FUXA 3KLNA 5HTKA 4PBSA 2ZYSA 3AZPA 4FFBB 1KQPA 3VVBA 2X13A 3K96A 4BMDA 1U0EA 3QF7A 4BXSV 4R3WA 3OB8A 2W2LD 2DXIA 3FPGA 5U4QA 2X0KA 4YG0A 4K6CA 2XWQA 2YH2A 2GB4A 1C5KA 1RQGA 3BJIC 1J8YF 1J2TA 1LV8A 2J33A 3FUWA 1YULA 1RUI2 1OSNA 4IH4A 4M1MA 2XUIA 2IVJA 1V7QA 3DE6X 2Y4OA 2VNGA 1LBHA 3BYZA 2RS31 1SD1A 2BR3A 4DANA 2ODPA 3WNXA 4EA7A 1QZ3A 3PDJA 4HVCA 4DCGA 3J7AC 5JYCA 2C26A 5LQUA 2ROQA 1HK7A 1VE5A 3DT9A 3B7WA 2D0IA 1DO0A 3IKLA 5IJ9B 2FPOA 2AMYA 1UMBA 4NE7A 1O6CA 2E7TA 4RX1A 5B6JA 4EMTA 3HMYA 4FZVA 3IT0A 3ZJ4A 2PVSA 3H9QA 2FW1A 4C7KA 1MOQA 4G0WA 1DX6A 3K0CA 3C16C 3LX4A 3SH5A 3V8QA 4CPDA 2RM22 5FZ9A 4Y6LA 4QTUB 5D00A 5H4GA 3MERA 1PUXA 3F5FA 2FDJA 4QOSA 3DUIA 4EJ0A 3K0AA 1ZESA 3KVRA 1C7JA 1WE2A 1W39A 1GR3A 1M0SA 1VAKA 4L3OA 1MZPA 2DYCA 3ETGA 3MIZA 4L0QA 5K0UC 3PHCA 2KYRA 3POIA 1Y5RA 4QQOA 1LBSA 3FYHA 3V7UA 3EGOA 4M7PA 4E7PA 1Q43A 4UTRA 2QYHA 4DWWA 3JATB 3DR5A 4HEHA 2QQOA 1XVAA 3CKHA 5KSOA 1U8XX 3DO5A 3E22A 5CB4A 2HX1A 1YR2A 3T1MA 3EZ7A 2YPDA 4IL7A 2P1DA 2XB4A 1SRQA 1Q7RA 3RNSA 1SURA 1KQRA 4IINA 2IZ7A 4F45A 3EWIA 4DMLA 1GYPA 2Z8YM 4WMLA 1CX9B 1V7PC 4FZRA 2P8SA 2RGAA 5C9AA 2HF8A 4BQSA 2KLHA 4ZICA 4XGRA 4HANA 4EN9B 3D5OA 1A5SB 2NYAA 2YIDA 4AZ0A 3GNEA 4BO9A 1GWKA 3F49S 4G5QA 1KK3A 2FQ1A 3O9MA 4NAMA 2ICAA 5BW5A 3NC0C 3QVWA 3GJXC 3RVDA 3K94A 4NPAA 1JDBC 3UWOA 1H2KA 2O2YA 3LP8A 3RGWS 1WZEA 1DZTA 3ZGLA 4IOJA 3A4IA 1NA5A 4JQOA 1XFDA 3RC1A 1D4OA 4M8KA 3H7JA 4MO3M 3G5UA 4FTSA 4XAQA 1X50A 1ENQA 2AE1A 3MT7A 1UFQA 1WKCA 5ALLA 1GTVA 4YASA 1OKOA 4LKFA 3ZFFB 1JTFA 1BBT3 4KR7A 3TBDA 3E5UA 4F93B 5FY4A 1L5HA 2E4WA 5JVDA 1WUIS 1IDOA 4MGTA 3UOWA 1BMDA 1B4DA 1SU7A 5I9LA 4UNRA 1RJGA 3SNMA 4K9NA 4XJXA 3WLJA 3F67A 3CJIA 2OGSA 2JFBA 3EEYA 4EI2A 3N6VA 3NYRA 4WZZA 3RAEC 2I1WA 1P1JA 3P9ZA 2H5LA 4RZXA 3QYPA 3UJ3X 1VBMA 3SNKA 2AWOA 4O4LA 1U31A 4NVRA 2J67A 5GAJA 5KC8A 2A70A 1LECA 3WUDA 1FPQA 5JSRA 2J22A 1CZRA 4U6QA 4ATNA 3KZMA 2OZKA 5AI4A 3OZ7A 4AY6A 1DTEA 1FTNA 7MHTA 1QDEA 3AERB 2QTNA 3FRIA 1Q11A 1JXOA 4A6EA 2JLWA 3O1IC 3IC5A 1L5OA 5FNZA 1XZLA 4K9DA 2HWYA 5EJIA 3TRSB 4P35A 4TLCA 1GKYA 1DIRA 3G5AA 3I12A 4OB6A 2PAEA 3INGA 1CHDA 3PK0A 4QG3A 2Q3JA 1KJ8A 3J7NA 4M8IA 2Z2YA 3TTSA 1K7YA 2B4KA 3JAWA 5KJ6A 2UAGA 5I4BA 3OIYA 4DS0A 1MQ8B 1CVLA 3NAPB 3CUTA 2UUOA 1D0VA 4XARA 3GG9A 3GVHA 4CIDA 2OPBA 3R9XA 3DE0X 1NBMA 4I4TF 3VZJA 4BMYA 3HWWA 3K72B 2O0OA 4G67A 1E7RA 1DGWA 4MVXA 2WWJA 1PR3A 2YHSA 1P81A 1E1KA 3EC2A 1XEXB 3EJWA 2JKZA 3ROEA 3NM5A 4QUAA 5BW6B 2ILMA 5BNOC 4QPIC 2ZYVX 3CEPB 4KACA 4N9QA 2HFKA 3CLSC 1PK6C 1E7QA 4AROA 1EUTA 3T1NA 2P9EA 3BREA 3H86A 1N6OA 3QFCA 1ESZA 3EC7A 1BWPA 4I3GA 1T1EA 2YFHA 1N6PA 3ZZ1A 2NTJA 3UWPA 1XCBA 1RI1A 3RMYA 1Y9JA 2IL1A 4QXOA 1KZHA 1JA1A 3AKDA 2W8BB 2J5KA 4FILA 5TMDA 3OA2A 3QJGA 4J16A 2PKYX 3OQNA 1SZBA 3ZFEC 4ZHQF 4I09A 2MWMA 2PUGA 5CLJA 3IDBB 4RACA 3AZXA 2I4NA 4L5CA 3ZU3A 4RETA 1NXOA 1XWWA 5C3SA 4ALJA 4B7KA 1LLFA 2PH1A 5CPFA 1IQAA 2A86A 1ADGA 3T5BA 4XGKA 4G1MB 4R81A 3USUA 4U00A 4UDNA 1ZMRA 3IAS1 1LTEA 5TPZA 1K08A 4RCYA 3W7BA 3K9FC 1YZLA 1JEYA 2WWRA 2GCPA 1GA6A 3KHUA 4KODA 2BHTA 1ISPA 1H42A 5IMBA 1NW7A 3SJZA 2IH5A 3T3PB 1Z26A 4EZEA 3PKJA 3R8FA 2BMVA 4GKVA 1P61B 5ABJA 4P9WA 4BV3A 1AR62 3RUDA 2HT6A 4AY3A 4OB8A 1W8IA 4QYIA 2X0NA 4UUNA 2FPUA 4BMBA 3N9MA 1ND2A 5FYBA 1RUD1 5BSVA 1XMOB 5CNIA 3MFCA 3TIXB 1WB6A 3PTAA 2VPTA 4BVKA 1CUIA 3ZLUA 4P34A 2Q5LA 3IQDB 5FFMA 4GMFA 4AN4A 5A7OA 1CZSA 2UKDA 4QD3A 5CJPA 4W6YA 4EKIA 3OZAA 3WY9A 5JY1A 3Q7RA 3ZO0B 2C2WA 3ZGXA 2P9TA 3JVVA 3ZX7A 5E3HA 5EKTA 1II9A 2JEZA 3WP5A 3QH7A 1G3UA 4NBTA 2O50A 4LBKA 4YRSA 3TSYA 3ADPA 4CKWA 1YS7A 2XEXA 4IG9A 5FI1B 3S2GA 4M3CA 2VU9A 3LO5A 4MMZB 2PQQA 1V3UA 2NUBA 1T8RA 3V8RA 2P40A 1ZC4A 2JLCA 3UMSA 1R5JA 2MYTA 3LU1A 1JYSA 4JGYC 3IUSA 4J6FA 5HM6A 1VRH2 3G49A 4G24A 4AJNA 4RQUA 2VJBA 2VOXA 4DAOA 3V6MA 4D6YA 3P9YA 3AEKB 1YXWA 4UF0B 1DE0A 4DCCA 5FPBA 4GOXA 5CLFA 1BJRE 1ZM1A 3EVNA 1G5QA 4H14A 5LBCA 1R6BX 3WGTA 1HQKA 3KGZA 1JRLA 1REEA 4XUPA 1N2CB 4E4DX 2HYDA 2ZE7A 4ROTA 1MVNA 4Y9UA 3EQ6A 4CP9A 1CERA 4RVCA 4FFBA 2Q49A 4EHNA 4BVEA 2JDZA 3TINA 3MICA 4CEYC 4HQ6A 2GM4A 2C9DA 3BFKA 3IS3A 3PR2B 2B78A 4KR9A 5JI7A 4RE5A 1OPOA 5FY8A 4Y20B 2HW8A 1PD1A 4BQPA 3HFJA 5EY5B 4CG1A 1BGXT 1MABA 1OA4A 2A9KA 3EZFA 1CQJA 1AO0A 2IUWA 4FBLA 4HWTA 7ADHA 3OGGA 5FWYB 2AUYA 1L4NA 1JDPA 2CXHA 1CUVA 4XVQA 5BRJA 1VKJA 2VP4A 4UQLA 1KO5A 3WQ0A 3HU3A 5CB8A 4LXLA 2ZMNA 1H4SA 1CX4A 4BU1A 4COOA 3TQCA 1TGYA 1UBFA 2GHTA 3DDHA 1OI7A 1ZHFA 3KQWA 1PL7A 2C9KA 5I7SA 4NK5A 5EIFA 1IZ7A 3WV5A 1AZWA 1CJTC 4OQZA 1J5XA 2QPLA 1OBVA 3S99A 1U7TA 4XDYA 2GD0A 1DDLA 4BO5A 3LPCA 3M1AA 2X40A 3PHLA 4S0XA 2QMEA 1OH8A 1RUC1 3BD9A 1MH1A 4A6PA 4YMWA 2IZ1A 2PBLA 3G2MA 1DUVG 1Q16A 1BCRA 1AR81 1BN6A 1CZOA 1RMQA 1W0PA 521PA 3SHTA 5D7NA 1Y8ZA 2V59A 1WW7A 4MGSA 5DF1A 1OY1A 3U61B 4IQFA 4OUDB 4ZC1A 2WT1A 1Y6FA 1IPSA 4ESVA 3D0QA 2GSDA 3RWKX 1PRYA 1IE3A 3ZX4A 2P2ZA 3ZNOA 3CF6E 9GPBA 1G7TA 3OD1A 2JLYA 1IJFA 1BH6A 3I23A 3WS7A 2FG5A 3G82C 3Q8WA 2WTUA 5E9QA 1KKMA 1D5WA 4XDPA 3N2IA 1CN1A 3L8MA 3NNNA 2WN3A 1HE1C 4V1CI 1NVDA 4X44A 3NNGA 5FLIA 4N43A 2AT1A 3JR7A 3UJOA 4AQ6A 4I6EA 2RMU2 1ZUHA 3H7IA 3KFLA 5A80A 2P17A 5EP2A 2RS51 4NECA 4XJTA 3AH8A 2RK4A 5AKEA 1CPMA 3ITEA 2BZ1A 3GNSA 5FBQB 3TIIA 4LK7A 2IEAA 2JDHA 5HHTA 1CUDA 2B30A 3FB4A 1UAIA 2N75A 2WFMA 1YQ5A 3BS4A 3ZSJA 4JJAA 2IZZA 4NOKA 1FNMA 1F5SA 3PQDA 4DWVA 4C4PA 4CCMA 1ZO8A 4X62B 2C0CA 4BKPA 1R4ZA 1KI1A 1XUOA 3QBJA 4PY2A 3GXUA 5F3IA 1JSLA 5IUKC 2PXHA 3LPMA 5CEEA 3NTRA 1DQNA 2PLAA 5KHJA 4ZVOA 4E4TA 3I0ZA 1RCUA 2ODNA 2Z4FA 1X3SA 1YA8A 4B7AA 4OSPA 2G9FA 1QS0A 1IPHA 3EOBI 3T3NA 1QMPA 4CT0A 1BWSA 5CK4A 3A11A 3OHMA 1R1ZA 1SXHA 2DWQA 1U2RA 4RPCA 1EFPA 1V5FA 1KEEA 2VA9A 2F62A 3GFTA 1F9KA 1Z4NA 3AXDA 3D0SA 1DLCA 5DULA 4DIDA 4ENSA 2I2BA 4E13A 3VDNB 5D8AB 5EKSA 4IVQA 2BONA 1W4RA 2ONCA 5FTKA 4JDPA 2G5PA 1WL8A 2VBGA 1QTQA 3FCYA 1TMKA 2D06A 1JQDA 2I7CA 1NVWQ 3WIUA 4A23A 1AV7A 5FB3A 3AHEA 3VVMA 4KYUA 3RNLA 5JW6A 5G3ZA 4HMQA 4O2AF 1XDZA 1L4MA 1ODCA 2ZIFA 1YHFA 2A5ZA 4COYA 3PL1A 4LISA 3BTXA 2VTXJ 1E2LA 2IXFA 1QGOA 5IAKA 4EATA 1FTGA 3QVVA 2JHAA 4JOQA 2AN3A 1U2GA 1JAIA 1PFVA 1FRNA 4RGAA 1ONPA 2C7RA 1LF5A 1KH1A 1QEXA 4C4SA 3FYTA 3AUJB 1X7YA 3R5FA 4QC2A 3LZZA 1QLHA 4F11A 5FPSA 3VR5A 4F7DA 1X8LA 2XX3A 4KIJA 4B87A 2VNJA 4IVPA 3WK5A 4DMIA 1H4HA 4RV9A 5LXTB 4BO8A 4RFT0 3VD9A 1XNGA 4DV0B 2R1UA 4EA9A 2IIBA 4G0ZA 4O4IB 2GJ8A 3SN6A 5IZCA 4JDNA 3FOZA 1TADA 2GH1A 2UYOA 5DCWA 5IVDA 2AGVA 4O4HF 2ZGQA 3BEDA 1DKOA 2GXUA 5C8YA 1ZGBA 4LJ8A 4PLCA 4LUCA 3NASA 4X54A 4HD8A 5FT9A 5AQEA 3LY7A 4WCFA 1GKKA 3MGCA 4PYIA 1H1DA 2O59A 4WH0A 4XRGA 4URAA 5J7MA 4QPWA 3FOWA 1WW8A 2JCVA 1OVSA 1YI9A 5DNWA 2W8BA 5IBQA 3BL6A 5EZYF 2ET1A 2C4KA 1SXJC 3JAKA 5JBQA 5FOVA 5A7HA 2YW9A 3EARA 2PKEA 1HMPA 2Z04A 1OH6A 4IHJF 5B58T 5KYWA 4RC9A 1O3SA 2VDMB 5DGIA 4IQ4A 3T1QA 2EALA 4XYBA 3WSWA 2AG0A 4ERNA 2VJDA 4FJ2A 2TMKA 3PNPA 1GPWB 1MS8A 2HWE2 4ZI3A 4LOKA 3LQCA 1WBDA 5DLPA 4ZMBA 1NJ2A 3O1HB 3G85A 4YVWA 3H8SA 1UBJS 3IQGX 3V6LA 4CDRA 3L6EA 2QQEA 5M7EA 1C30B 5D6NA 1QWOA 3TAYA 1N2CE 3STVA 4Z54A 1OC4A 4LDZA 1RL3A 2B9EA 1R8QA 4CQMB 4QAJA 4G5RA 1NBAA 4UM9D 2R87A 5T64A 4G5YA 4DIUA 1KMCA 4NKRA 4XDZA 4FYYA 5DNUA 1XE7A 1MC1A 5B1SA 2C9CA 1KEZA 1ZOLA 4MITA 5I7UA 5KYKA 2Q28A 1R6VA 5JYEA 1UDWA 5A5EA 1KAEA 4WL0A 5MFPA 1F5JA 1JUHA 5BQOA 3TGPA 5ETJA 5C5TA 4QWWA 1AR92 3MIEA 1CAXA 4ZMSA 1ULUA 4TQGA 4WQMA 4AK3A 4RVOA 3P2YA 3X1YA 3LT0A 2CMFA 4NHMA 3FBMA 1OFUA 1LTQA 3QMPA 3U1TA 1DBRA 3GDHA 1IRIA 5IUNC 4EA8A 4B4KA 2UDPA 4M88A 1I8TA 1IG0A 4FFMA 3D02A 1F4LA 1UPFA 4R1MA 3GLFA 4OA5A 2PMKA 3NHJA 2Z08A 2C83A 2XD4A 1DXHA 2Q1TA 5FOTA 3PE3A 1Q5OA 4HUJA 3N74A 3CJTA 1U1GA 1NFQA 4CBVA 3DL2A 2QRHA 3CWCA 2B6HA 2FHPA 2C3UA 2XUDA 2V9ZA 1NG0A 1TM1E 4B3IA 1NZJA 2G0NA 3HCCA 1XTUA 5CPBA 4CMIA 2HMWA 5CHYA 3O2JA 1O03A 3ZG6A 5J2UA 2RGXA 3VH4A 1POXA 4MB2A 1QX4A 3CPEA 3WCSA 2R2GA 1W0CA 2XIQA 1YDWA 3NHSA 4ZFNA 4LPLA 4WERA 1D9ZA 2OBXA 4MCAA 1NASA 5K0SA 4QX5A 5A9RA 4RN5A 1COWA 5F4BA 5JPNB 4HL0A 5DABA 1XXHE 4MA0A 4G4GA 4A6OA 3CCBA 2IY7A 1ECJA 1EFLA 3NLLA 5C8CC 3LCVB 4MXVA 2IYZA 4UNQA 1GVHA 1GEGA 4LF6B 2OK7A 1PIV2 3TRKA 4ZXKA 3BGVA 3G0IA 3FFAA 1RUJ1 4MGQA 3OAAD 1SUEA 2GRJA 4UD2A 5DHRA 1WOYA 4FPYA 5DOZA 5BW4A 2DYKA 4Q5OA 4IJWA 4LZAA 3GVPA 4JSYA 1OCEA 1W5AA 4I0AA 3K70C 1APNA 2XUFA 1Q0PA 3IALA 4EWEA 1O4ZA 2SCUB 2BFPA 4DIBA 3QG1A 5ALMA 4AY5A 4GF5A 3GDBA 2GYVA 1MHTA 4ZU5A 1PJ8A 1C2YA 3UXMA 3UATA 2ZR7A 4GC5A 1ZZEA 1M2JA 1C0EA 1BE6A 1UODA 3D1VA 5BSTA 4ENVA 5JDBA 3RRDA 1SCBA 1QXPA 2D7CA 3HQ4O 2JK0A 1N6NA 1RWKA 5CNJA 2VYND 1U1CA 4B4PA 1DPFA 2KQUA 3MOIA 2WJWA 3WLMA 4KK4A 3V00A 4DCPA 2PHTA 1RHRA 1YBVA 4W7HA 1W6OA 4ZVKA 3QWHA 3UG7A 2H2HA 4RGBA 3BRWD 2R44A 4DSOA 4JBIA 3STYA 3M3PA 4LYJA 2WP0A 5F5NA 4E12A 2EZ8A 1EM8A 4O4JB 3DOCA 2NO5A 2ZSFA 3NFRA 2IYUA 3TEMA 5DXAA 1NE7A 4ATFA 2IXBA 4X84A 2J6HA 1XKXA 3NEPX 2QVGA 1BS9A 1AF9A 4AWDA 1BW9B 1QFYA 4A8HA 1FQKA 1W4BA 1V1MA 2XY4A 3CUWA 3LYLA 4HGYA 3U16A 1IY0A 4JJGA 3R0JA 4BGVA 4EUNA 3UWDA 2WD7B 1CR4A 2WT8A 4BDVB 3QEKA 1WUTA 4YYOA 3DB1A 2VYNA 4H7HA 1W3VA 2HEYF 4ZS2A 1RM4A 2PGAA 2FVYA 4NRMA 5JZGA 3ISJA 1Z6PA 3BILA 4JENA 221PA 4ASKA 1UBHS 4M9SA 2V6GA 3Q7QA 1BVRA 4Y1GA 1JFLA 5JI2E 4W65A 1T2VA 3OCUA 4L22A 2VCBA 5C31A 4G0QA 1H8ED 4IVRA 3ZDCA 3EGCA 2EA7A 1OILA 4DQDA 4JBXA 4XZPA 4CLOB 3RJTA 3GN1A 4BMCA 4JD5A 4NROA 4RDXA 3PSHA 1GILA 1AX1A 5FXZA 2QN9A 5A05A 3D3EA 4FMPA 1A82A 5IKEA 1W5SA 1XYGA 4IS3A 4YWAA 1NXTA 2WIJA 5TJ9A 3KOXA 2AJ8A 2QLBA 1NJ5A 3GIDA 2HWE3 1E6WA 1K3FA 1MEJA 3L7CA 3VOBA 4RU1A 3VO1A 1X7WB 1XDWA 2V5VA 2AX4A 3K70D 4PRLA 4YYZA 5LA9A 3H5RA 3K71B 5SY6A 1M0TA 1MJGM 2D6KA 1XHFA 1QQP2 3D3KA 3EN0A 3AYZB 5JRDS 1EIZA 1ZM9A 4OJNA 1Y1QA 3TR5A 3V1YA 1CJSA 1QYDA 2E4VA 2MHCA 1X15A 4MGKR 4RFSB 5TY0A 3W9SA 2HYKA 1FXWA 3OCJA 2NX2A 4CEIA 3O3CA 2AQHA 3GQBB 1NJ8A 1T9KA 1THGA 3LUAA 3GT0A 2PLFA 4TZDA 3BE5A 1OGJA 1UBUS 3DL7A 3RR2A 4I3FA 4I9NA 3PPIA 4TS3A 3NAMA 1RM3A 1RUJ3 2NXEA 2QAGC 1GL3A 1W9FA 1Y4ZA 5ALHA 1YL5A 3UH0A 4E1VA 2F3UA 2FKNA 4LBQA 3PFNA 3VA7A 5CLIA 3LC2O 2R072 1J70A 1EGMB 1M2VB 4OYHA 5KXDA 4BKUA 3VDXA 2XJUA 3HCFA 3MVEA 3O2QB 5EEHA 1V95A 4GX5A 2BFBA 1CAXB 3A26A 2JGNA 4ZJYA 3L7AA 2X2PA 1DEKA 3TR0A 4RELA 3RU9A 1CCWA 5IF3A 1CIJA 3SLGA 3EFOA 1GD1O 1ND3C 2BEUA 1ZINA 3B7PA 4RNDB 1GUZA 3BTSA 4RD0A 1RJWA 5DT2A 3A9VA 3UWSA 4H3VA 1QHHB 5IYZF 1P1FA 5SZHB 4LLOA 1TUBB 2C9YA 3FCXA 5G4LA 2NUAA 2HC9A 3LGRA 2WNUC 1YE3A 3PNAA 5FDBA 3QSYA 4YZ1A 5LZ9A 3ABOB 3ZWYA 1KARA 3CNHA 2CWDA 3BA1A 1PZEA 4KBGA 3FBGA 1V5EA 4E03A 2HWB3 3B53X 1RJ9B 4CGZA 3AF5A 2O0JA 1C7QA 3CIHA 2OX0A 4AKEA 3AHFA 5HG0A 1GZ3A 3VHRA 1KGDA 4GXQA 2OOSA 5ENDA 3A2NA 3TDKA 2ZWVA 2I6GA 4B2IA 3ZDEA 2UWAA 4X65B 4JGYA 1MAUA 1RQNA 5CNKA 4B6QA 2HGSA 1WIWA 5A7NA 3V65A 4AIIA 3QUAA 1CUYA 2Z6VA 3I8SA 5FZHA 4D99A 1VMFA 3CBGA 4LJ7A 4DB5A 4LQCA 1RXSA 2GERA 1V6AA 3O1RA 1WXIA 2ZAAA 3KXKA 5ALXA 2OIIA 3VJKA 1PNFA 1BEV1 4X66B 2F7SA 5AI0A 1CUFA 4O02B 2VAUA 4IQPA 4KXVA 1NTRA 4TMWA 3ZYIB 1DKUA 3PIDA 1L1FA 4DLWA 3FLPA 5F5AA 1I6LA 1DMRA 4AJ9A 3IEXA 3U19A 5L6LB 3H4TA 1OX6A 1NVEA 2DCKA 1C7IA 2DBZA 3QX9A 4YM0A 2PXAA 2R3SA 1QIGA 3EWAA 1KJQA 1WBBA 2DVMA 3B38A 3V42A 1W5FA 2AYXA 3IJ5A 5CIRA 2WWVD 4QGGA 2EW8A 3RGGA 2EX0A 5AFSA 2JH3A 5IX8A 4EGJA 3IELA 4NUBA 1ACCA 4A2WA 1TCUA 2VULA 1H9WA 3C8ZA 3JQXA 3X1WA 3HWX1 3GDOA 2NU7B 1S4CA 3EB7A 1RM0A 2VZTA 1J8DA 2DH5A 1IY8A 1F48A 1H4QA 3PQ2A 2FPLA 4IUCS 2NYVA 2P6RA 2G5TA 1UBEA 2EQAA 3FNFA 2XBO1 2FAXA 1RUG2 3D6UA 3LKZA 4N8DA 1T26A 5FYHA 3U14A 4XYMA 4Q82A 1E4OA 3VKHA 4V1PA 5DZEA 5T5LA 2D0PB 1C0KA 1M67A 4P14A 3WNDA 3W2GA 3P0RA 4PFKA 2BGGA 5BN4B 2EBFX 4DQXA 3SMVA 4E15A 4LORA 1TU0A 5J63A 3RF7A 3GNQA 3O0TA 2FOLA 1EAYA 4YPVA 3THPA 4KBZA 4R5HA 4LHZA 4FYMA 5HXAA 2AREA 4NCKA 4FR5A 3KD2A 2WOJA 4FYVA 3SHVA 2EXXA 1K7XB 3K6RA 2R32A 3D3WB 2CXQA 5ADVA 4P7BA 5G53C 4OIMA 4EMBA 1BEV3 3B9QA 3BHNA 4WZBE 3UJ8A 3EW9A 3F6CA 2XNDD 2PK3A 3I3MA 3ZYFA 3WLTA 4FOVA 4DRXA 4QPPA 4D98A 1N7GA 3S6JA 1QJX1 5LA1A 1U8AA 3MXOA 2EXIA 1RMTA 4CCAA 2PR2A 1RLIA 3ZK7A 1SR8A 3BGOS 5F12A 4RLQA 2OTCA 4HO1X 1U2ZA 3E7PA 3GLSA 2Y6KA 3LLCA 1U2QA 4QELA 4B4QA 1NBMD 3SQLA 1K3IA 3QU2A 5ER6A 1R081 2J9FB 2DHDA 5JZVA 1WLCA 3RT1A 4D0LB 3V5NA 4IO0A 1V3VA 4P4SB 1KXJA 1SFRA 2J41A 3WLNA 2JDYA 2C29D 4MUNA 1Q0TA 4FKMA 3POFA 2EP5A 1LRLA 1Z5OA 4DWJA 3VU9B 5EE9A 2LS6A 2PFKA 1DC7A 4BKMA 5AHOA 2WN2A 4WGGA 4QRDA 4A6DA 2XNDA 1KPGA 1NNI1 3DGEC 2FRDC 2SNIE 2Z5LA 4YRKA 1H2XA 4UATA 1TVKA 4EN0A 3B1XA 3UETA 2CVPA 1N78A 1YZGA 2DPLA 5B2ZA 4LJLA 1NURA 2VZQA 2ZYHA 1XSQA 4FTWA 3SSOA 2GLUA 3ZS8A 2GZWA 1KVUA 4KDFA 3H5NA 5AM5A 4C9BA 1VIVA 3PEVA 3M3CA 2AXPA 1L8OA 5E4TA 3E5HA 2R073 2OOKA 1NXSA 2J0QA 3VBFA 1EK1A 2E89A 3EEFA 3ZXKA 2Q3DA 4OQPA 4H59A 2WAOA 4CDWC 3F90A 1VPEA 4RTMA 1LOGA 1FEZA 3HWSA 3A04A 4CHTA 2NMOA 3KGLA 3K2QA 4RJIA 2EF6A 1FMD1 1ST2A 4MHUA 1W5BA 2HUPA 3AG6A 3OIWA 1US8B 3OCCA 3LQYA 3QOPA 3UV9A 2AVNA 1BDMA 3REGA 1W90A 2O8VA 4LV5B 3ETHA 2CMKA 3LXMA 1RXGA 3VSEA 1XAIA 1C9EA 1YI1A 3W7VA 1I4OA 1GFSA 2QY9A 1FUEA 2DBIA 1R64A 3AWDA 5IK5A 2DTXA 4RMNA 1D2NA 3EXG1 2CUTA 2QUBA 3IBYA 4U9UA 3QU5A 2ZDQA 4Q1AA 3I3EA 3G9ZA 3W21A 3NWKA 4AB1A 1HT1E 2Z5FA 3OHPA 3SNHA 4I5IA 5EA2A 3HY6A 5LWQA 1HT3A 3L0YA 4MYUA 1M5RA 4MGIR 2P6OA 4OSEA 3DOUA 3INAA 2O7VA 3NHMA 1SXJA 4J3NA 4ZD6A 1Q0ZA 5KNLA 4P38A 2VDLB 4N3AA 2XQKA 4EGAA 1KP2A 1SHTX 4L95C 5CB7A 3EMDA 3LL4A 2IBTA 3A4UA 1ZA2A 1Y4DE 3TQOA 3UC5A 2MR6A 3C3PA 1YIDA 3G1UA 3M4FA 1N8SA 2WAXA 1JKFA 1JOJA 3IPAA 5K3FB 3ZYPA 3JZIA 3DEZA 2Q7OE 1XELA 1ZP6A 2NPOA 3ZY4A 4PZPA 1JDJA 3CIOA 3OFVA 1V37A 4XJ9A 2W70A 1I9CA 3U4MA 1AOXA 3HOBA 2KE5A 3F6EX 4UCWA 3THWA 5JOQA 2HJWA 3AKCA 1ZYUA 4FFPA 4P33A 3HP4A 1N8KA 4EY4A 3B8HA 4JQCA 3KZVA 3N0TA 3RGBA 5TEWA 4UNPA 3VR2A 1A77A 5J40A 2DHCA 4QGHA 3Q0IA 5EV7A 1ZD3A 1GAXA 1SVLA 3K5HA 1CAWB 1Z25A 5BNWA 2O8DA 4HF7A 2E9SA 3KZXA 3K35A 4EVIA 4QWNA 2VDWA 3PQCA 1BVVA 3N6RA 4EITA 2OZ6A 3ITKA 2ZEWA 4FU0A 3VV1A 4DLUA 2YWFA 1B2RA 2X86A 1NC1A 1AL21 1NL3A 3QVUA 3EASA 2BMJA 5GZ6A 2BP7B 5JOWA 3RWBA 4L4RA 5JS8A 1PEKE 3MZHA 4RZQA 1D2RA 2WSBA 4S1TA 5HYVA 2W7TA 1H6BA 4LN1A 4IE6A 2ZBFA 3EVTA 2ZYGA 4C6RA 3KMHA 3K1ZA 3HAGA 5A7FA 4IP0A 4D8WA 4Y1FA 1PCXA 2Q9CA 4BPZA 3EDCA 3MQ4A 1W8TA 3AB8A 3KAJA 5DQ0A 1G5PA 4R9BA 4GMDA 3C41J 2FSUA 1MV5A 2JZNA 5IJZA 3HM9A 1FDSA 3MJHA 4LDNA 3JVIA 1T3TA 2XIJA 3L1UA 1YQ8A 4M01A 2NO7A 5BSHA 1PHMA 5I01A 1J4AA 2BNMA 1DJMA 5KTPA 4QE3A 4A44A 2LTAA 1T5DX 1ZSYA 3H3ZA 5AK6A 1KFCB 5IJ0A 4GLJA 4JBLA 3L4BC 4C7OA 4PYQA 1I3KA 5KYXA 2X2EA 3WISA 2ZMLA 1RHKA 5AC92 1D7PM 4KL1A 4HN1A 1YASA 4RVFA 1JPJA 4PONA 4PLPA 5CTJA 2CLDX 4CQLB 3R5KA 4JKMA 3U4GA 1S02A 2QUHA 3L2YA 1KKUA 1P7PA 5FY1A 1S96A 3FWKA 4GX0A 3QVMA 1E1RA 3WLKX 1MTOA 4JTNA 4OLLA 1U8ZA 1F1BA 4CTEA 2ZAOA 4YZ2A 3ZD9A 1CUEA 1A2KC 3AGPA 4U7TB 2FLWA 5DYIA 3P52A 5I5GA 1NYRA 3PUVA 2A78A 3UMRA 3I0NA 1HE5A 1XTZA 3BCSA 1DRVA 3TKAA 4BCUA 1AUQA 1A8HA 1H3FA 4N3CA 5TGZA 4PWYA 3Q7EA 1QVVA 3KIPA 1JQEA 2W2TA 3IMFA 1BYHA 2IELA 1EE9A 5AJHA 2BELA 1DRWA 3WZLA 2QA5A 1Z4QA 1X7XB 2OQRA 3WWOA 1EE1A 2HJSA 1NMZA 3ZXIA 3ZBPA 4D41A 1ZBE2 4NQRA 1LD3A 1TT7A 2VKTA 2K6GA 3JCZA 4QX7A 3V4SA 1XL1A 4XLLA 2WLQA 2OA2A 1NYQA 3GPLA 2YY7A 2V0CA 1R27A 2VP2A 3GYBA 1GPMA 1XD2B 2FYTA 3SXUA 4J0FA 3POWA 5HQ3B 1JWLA 3ACFA 3IQZA 5F1RA 1XMXA 2IYVA 1YGYA 3PHJA 5IZCC 5L40A 5DGHA 1KMQA 3B13B 5B5SA 4EGFA 1ZZGA 1ONOA 2DVAA 1FU7A 1NZIA 1H2AS 2ZGKA 1US8A 1SB8A 1XSEA 1IQRA 2AEEA 2QP9X 2RKBA 4MI1A 4X1OA 4WZBA 4A2PA 4KRXA 1TM2A 4FQ5A 4RDCA 4CG3A 2R00C 2EFHB 1C7FA 2O07A 1WD5A 1DFIA 3M1HA 4CPBA 1KNXA 3OQOA 3BPZA 2GZDA 1Z6XA 3B2NA 3E1SA 5FWJA 1LS6A 3D4OA 1D4FA 1IHPA 3VLBB 1RT9A 4ZU6X 1WSDA 1FT9A 3RSQA 4RUKA 2F1JA 4XQ9A 2QMHA 1Z0IA 1R12A 3A1TA 5C70A 3R24A 2K5UA 3U2QA 5LYJA 3TVTA 2VO5A 4B1MA 3HCWA 2BE9A 3RC2A 1JQKA 5CT8A 3MTBA 4ENWA 2QJTA 1JZ3A 2QEQA 3M9LA 4L9BA 2ACWA 4PR3A 1W9HA 4YW4A 4AM8A 4INDA 4XLZA 3LM8A 2P2YA 3I9OA 4K26A 4BFYA 2Q3CA 4J1WA 4I9UA 1GN9A 2HKIA 1R0KA 1YS2X 2B92A 3PDWA 4US1R 5GIOE 3OBIA 5DXDA 2J45A 4PG6A 1JH8A 3R6LA 4B5LA 4KQKA 1K5MC 4J0CA 2A0FA 3GDGA 4Y22B 3GMSA 4EVRA 2R0HA 3KEOA 3TQSA 3M5PA 4RZHA 1E57A 1OB5A 4IIVA 1FPN3 4Q3EA 1CFZA 2F17A 3W5CA 2EFYA 1L7VC 1AMNA 3RIGA 5GLZA 3EC1A 4DLRA 2G40A 3DXXA 3EJ6A 4TYNA 1W94A 1N4AA 1M1NB 1W29A 4LCJA 4LZWA 5ALNA 5EJGA 3GLIA 2YWXA 3GHNA 4M9RA 4Z4IA 2GF0A 4H3SA 1Z12A 5IXJA 4KI0A 1DBSA 4WBNA 1DG6A 4NYMR 4HEQA 4TTRA 4AN0A 3TZEA 2ZYAA 5EVJA 3VBHA 2NW6A 1LKNA 3FB1A 5THKA 2RG7A 1EAMA 2D2FA 4XUNA 1E7SA 5FL7A 1Y3HA 1D4VB 2VH2A 1SCRA 3N28A 4U6NA 5DLDA 3OPQA 2QKYA 2VRCA 3DLCA 2E18A 3FNGA 1DKMA 1C8VB 5HIJA 2OUJA 4OKIA 1EG7A 4PAOA 2RGWA 2VK1A 4K8FA 4QXAA 1SM4A 3MUY1 3IXLA 2CLEB 3CGGA 5KWVA 2ZREA 1J5PA 4Q5IA 3B60A 1BZWA 2VMHA 1EFRA 5BMVB 1PNRA 3I1IA 5DTJA 1C1YA 5ANQA 5TEVA 4K8RB 3T54A 1M8PA 1IN6A 3WAKA 1LWOA 2RH4A 1X77A 1NJSA 4MRRA 3G1TA 1KYTA 3CEAA 1GCAA 4B1FA 1EWKA 3ELYA 1TEZA 5IDYA 2DUQA 4CMAA 2H8GA 4ALNA 2FRVA 2GN7A 5LA2A 1CF9A 4S2EA 2CSUA 4C78A 3E9DA 4WNAA 3A4NA 3ESCA 2P9FA 2XITA 1OXVA 4OQQA 1ENZA 4LGCA 1TD1A 3SX4A 4MUIA 3O73A 4E5KA 4KIUA 3DUFA 2AFRA 4CN9A 4A26A 4M9ZA 4MTCA 1YSCA 4Q6WA 3A7QA 1JHAA 1EBFA 4GSYA 1E3WA 3LLMA 4U2DA 5EIOA 3POGA 4BV8A 4XFHA 4RHEA 3GWZA 3KFXA 4E2XA 5KQGA 2WM2A 1EUCB 2IYPA 5CXUA 2XCSB 4BB5A 4LO5B 1NJ1A 3QKTA 1JJAA 1U5CA 1E4VA 4PC3A 5BV7A 4G5XA 4L73A 1G9BA 2J1TA 1JOBA 3UZUA 2PCJA 1NDQA 3MT9A 3RFRA 1LA2A 2BNOA 2V4ZA 2VT2A 1RW4A 2Y6UA 4F9GA 2OHFA 4C5AA 2J6BA 1NOJA 3Q7PA 3D64A 1QJEA 1WF3A 4QZVA 4D7SA 5A3RA 4CMJA 2BGTA 3GZNA 1II8B 1CQPA 3QPCA 4KE6A 1CQZA 1YOVB 3F97A 1NI3A 2R65A 1XZBA 2AZ5A 3JU3A 1ZBE3 3AOEA 3VVLA 4B2LA 4AI6A 3OFSA 2EXHA 4Z1VA 4Q6BA 3VH1A 4PNZA 4F3NA 3PC2A 2J85A 1WCQA 4DFSA 3M2MA 5KXBA 2YFQA 1LBEA 1JIIA 2EV9A 2NVUA 1RKUA 3AM5A 1GPDG 2Y6HA 1XRRA 3ZNQA 4ZYXA 4K28A 4OGKA 3N39C 3ZIDA 1LNQA 4DSNA 3AIMA 4NIDA 1QB8A 2ZB2A 4Q3AA 3I59B 3E53A 4OQ4A 4E2GA 3D9QX 1KMIY 3Q10A 2UUPA 3AYDA 2VKQA 2CVOA 5IJXA 5CDTA 2RS32 5LLDA 3NNLA 3PG5A 3EPLA 3UY4A 1F0PA 1RIIA 2WINI 1C4XA 1SRRA 1R8SA 1W0KD 3F71A 2HRBA 3JBG1 1JZTA 2VZ0A 3FTEA 3M6AA 2LDBA 3TCNA 2FSVA 3H9EO 5IN5A 2VWGA 3WQSB 4MWGA 2FN3A 4NEQA 5L95A 2JLAA 1GQGA 2UUAB 2BBTA 4KYVA 4P3NA 1YC5A 2J5XA 5LBBA 3TZKA 5FLXA 1FVFA 1ZXBA 1J5EB 3HQXA 4B7CA 4MWEA 4PYMA 4M9QA 5B7NA 3IRVA 3WO1A 3IIIA 2PMBA 4LG1A 2H2FA 4Q4Y3 1JFSA 1QXJA 2PT9A 1P5RA 2HR1A 3NAGA 1C1HA 3S4YA 2WYHA 4KAFA 2JFFA 2OZEA 5SZJA 4IV5A 2PMDA 1S1AA 3FAZA 3AESA 4INZA 2AC2A 4YAEA 3PC6A 2BBOA 2OCIA 3AUFA 3R3UA 4LFAB 2VJLA 2WT4A 2O4CA 2P3JA 3ECQA 1VJRA 3PFHA 5FRDA 2ZCUA 3ES1A 1GWNA 5JCOC 2GHRA 1OBFO 3ZEIA 1IWOA 5FO1A 1S0CA 2JF0A 3UAOA 4AZ0B 3AG5A 4MW1A 1WDKA 3TLGB 5AD1A 5LCWL 1F35A 1Y6GA 4K87A 2GMMA 2CVQA 4V0LA 3CZRA 4BHPA 4G36A 3IDCB 4ECAA 4WFKA 4KFTA 5D1HA 1WW3A 1JHDA 1NKTA 4GOOD 1UOOA 1VE7A 4KFUA 3L9XA 1IZ8A 4HAWA 1Q0RA 1ETUA 1ADYA 3C87A 1S2DA 2YB7A 4MZDA 3TOZA 4TOIA 1F14A 3IEKA 3N2NA 3GGDA 1NRXA 3WMXA 3HBAA 5LFAA 3GHHA 5CM8B 4A4DA 1ISSA 3GNLA 1XN4A 1KHHA 5L7YA 4YJ3A 2HWF2 5D3MB 1ZD1A 1I5OA 1JJFA 1OUMA 1OFNA 1G5HA 1NMSA 3AUKA 3DYOA 5E3JA 5KJCA 2JGKA 2RONA 2FTKE 3KJEA 2DHEA 5AW4A 1R8XA 5DHAA 2WZQA 4M87A 4LC0A 2H00A 4RGGA 1N3OA 4PRZA 1D2QA 5I0DA 1AXYA 3LBFA 2IE8A 4MWBA 1TVGA 4H60A 1MC8A 1ZRFA 4GH4A 3QY0A 1H6XA 2O9JA 3T7AA 1HRV2 2CXNA 4RORA 2MEV1 3S70A 5BNFA 2D5IA 4OF4A 1W47A 1XEWY 4RS5B 4OM7A 2FZCA 5GLTA 4MQEA 5EJ8A 2I7TA 2FMIA 3RS4A 3RV3A 4W8JA 2GNTA 2F4VB 4OGGA 2QQUA 2IY8A 3QVTA 1F2UB 1HN0A 2BI4A 3AERA 4YJKA 3CPHA 3BM5A 4YX9A 1N2BA 4IEOA 1QRRA 1T6XA 3IPYA 1ZX1A 3IH5A 4TS1A 2GK7A 1UADA 1C1DA 3U60B 1LI4A 1M2EA 4CIYA 3L49A 2OBBA 4HP8A 3D3NA 4LPKA 4FE7A 3RHTA 2X8AA 1RUD3 4CT4B 1N8NA 2FPRA 1BVHA 2D1SA 1T4CA 2ZBQA 3OCVA 2IXHA 4XYXA 4E21A 4CDXA 4IOLA 4ALMA 4KHZA 1E58A 1CEXA 1WXWA 4N3BA 1C9NA 4HRAA 2REQB 5D5HA 1UJNA 5KC6A 5FOSA 4OH1A 1NWHA 3RVRA 4F8AA 1HDOA 4QGLA 2JCGA 5KAMA 4AJIA 1XQVA 2NO6A 3UJ9A 1KFJB 2FCAA 2C2GA 3DVSX 3D6JA 2BUCA 2B7BA 1D4M1 3U62A 5JAIA 4R9UC 5CBKA 1AHPA 3EAGA 2BGUA 3T12A 5TB5A 3BMQA 5LK5A 4LBVA 4XX0B 2HRDA 4WZBB 1P4RA 2UURA 2IYSA 2Q0XA 5LBIA 1U2PA 5FYUA 4MW2A 2HDHA 3D8SA 3G6JB 4J75A 3AB3A 2VXBA 3EG5A 1N5LA 1TC2A 5G0UA 3FCSB 2GN2A 1IXKA 5FO7B 3LIIA 5L51A 2LRHA 3R44A 5K8UA 3OQVA 3NTVA 5EP1A 1OLXA 5HWSA 1QXSA 2HJIA 4KLNA 3LGAA 4XC9A 3H8UA 5LQJA 4I4TB