2G9ZA

Thiamin pyrophosphokinase from candida albicans
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
322
structure length
297
Chain Sequence
SELIEQVIEQPDSLIISPPSYNHIQPFVYLHNVLLILNQKITIDLISLWKKCEIIVCADGGANSLYEYFNLQRSDYIPDYIVGDFDSISPDVKTYYESHGSKIIRQSSQYYNDFTKSIHCIQLHYQLNHTKENWFESIDEVDGLAKLWNGLNNSSDVVVDIDITIYVLNAIGGRFDQTVQSINQLYIMNEDYPKVTVFFITTNDIIFLLKKGVNYISYKNRLMFHKDNGSSPTPTCGLLPLSNKTPIILNSYGLKYDMRNWKTEMLGQVSSSNRISGETGFIVECSDDIVMNIEIDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords thiamine pyrophosphokinase
publication title Structural characterization of CA1462, the Candida albicans thiamine pyrophosphokinase.
pubmed doi rcsb
source organism Candida albicans
molecule tags Transferase
total genus 95
structure length 297
sequence length 322
chains with identical sequence B
ec nomenclature ec 2.7.6.2: Thiamine diphosphokinase.
pdb deposition date 2006-03-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.320 Mainly Beta Sandwich Jelly Rolls Thiamin pyrophosphokinase, thiamin-binding domain 2g9zA01
3.40.50.10240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Thiamin pyrophosphokinase, catalytic domain 2g9zA02
1IG0A 3CQ9A 2F17A 2G9ZA 1IG3A 3MELA 3LM8A 3S4YA 3IHKA 3K94A 2OMKA 3L8MA 2HH9A
chains in the Genus database with same CATH superfamily
4DARA 1ZD3A 2A67A 4K3UA 2DVAA 1JPVA 3HU5A 4GQIA 1QX4A 4OJTA 1RNLA 2ZI5A 2C29D 2BM1A 2XA9A 1U94A 2I4NA 5JT1A 3DUWA 2JLWA 3E9EA 5AKKA 3EEOA 4FPEA 3KWJA 3PXAA 4JU8A 1XK7A 5D7NA 2IOFK 2NTJA 3HABA 2GBPA 4R81A 5FZCA 3UKOA 1QOQB 3D0JA 1OSNA 1E4EB 4DT1B 2GR9A 5HXVA 3COZA 3PPVA 4EUHA 3CEHA 4NI5A 3QVGB 3RRZA 3IAFA 2WI8A 3WOHA 3JX9A 3UEOA 3CCFA 1UQRA 4UVHA 5DRTA 1C41A 4BNVA 3F49S 5H4HA 2Q6OA 1I4LD 3LXMA 3ED1A 4FDVA 1E1LA 3R9XA 2WTAA 3VDDC 2AD1A 3Q9LA 3KJQA 3CW8X 4G8CA 4CR7A 421PA 4IEPA 3K9BA 3AG5A 4XFAA 4BAGA 3OF3A 4AUEA 3R7AA 2O0MA 4J0FA 1XAIA 4D9CA 1NOVA 3VAYA 3RE1A 1KXJA 1RLIA 4BC0A 4R7ZA 2RS52 1E94E 4HMZA 1AS3A 2DU0A 4QXOA 4ISBA 1R1ZA 4Q00A 2PD3A 3AP6A 3OE7D 3SR4A 1RUE3 3GUYA 4A2PA 1AYM3 3HYRA 2G9FA 3GH1A 1QOZA 3VZPA 3SE0A 1VBE3 1G2QA 1CTQA 5AOVA 1UY3A 1OH6A 2BYVE 1XZQA 1ORTA 3IQDB 1TA9A 1CB7A 1JB9A 3SSNA 3GPIA 1ULAA 1IHDA 3F6RA 3DKPA 2LE0A 3BJEA 3VOBA 3HQ4O 4M99A 3FN9A 4JENA 1Z68A 4J76A 2P30A 4JGIA 1WB5A 3ZLIA 1BHSA 4ZT2A 3KQNA 4TRRA 3POSA 1J0DA 3IJPA 4JROA 1JLMA 1VMIA 3JCZA 5H59A 5AVKA 1WUJS 3GH3A 3KVBA 4YW4A 1EESA 3NTRA 4ZOBA 1VG9B 2R1DA 3FPCA 3KKKA 1D4FA 4JDPA 5A71A 4PHZA 3K0FA 4KWEA 4CCDA 4DBZA 1IPSA 3PE3A 3UJ6A 3IR6A 2HWWA 3QOWA 1CU1A 4JEIA 2WJHA 1PO22 2WPNA 1PG2A 4W4ZA 2YXNA 3K70B 1PMHX 3KHKA 1SULA 4LOSA 2RG4A 2CWDA 4AKEA 4FOLA 2INGX 4FR2A 3JVIA 5EJFA 4C90A 2HMAA 4O08A 4AZ3A 1HI9A 4PIPA 1EFRD 2QZJA 4N8DA 3PJQA 4AMBA 3DFZA 5E1DA 5HX7A 1YLLA 2FQYA 3D0QA 4RQBA 5FPPA 1EDOA 3CX8A 2ECOA 4CUGA 3C85A 2PSEA 1CQJA 1AQJA 1LK0A 3OU7A 1G9FA 2WZEA 2OXCA 2Y26A 4JLWA 3I05A 1HNWB 2JEOA 1SOWA 3A2NA 3MRSA 2FEMA 4P7FA 3I53A 4IIJA 5A7HA 4GWKA 4F12A 3CZUA 1FFDA 4DIMA 3VD3A 1N6IA 3CJIA 5E8RA 5IF3A 2F62A 2ANCA 3OQPA 2XJ9A 1ZI6A 1KJIA 1GUAA 1F8VA 2EL7A 4GYJA 1CZHA 4CM4B 5JDBA 2BEVB 4GM0A 1H9PA 2HRCA 3ZXEA 5H9WA 4GNRA 3T1HB 5F5QA 2WM8A 1UYZA 4HDSA 4JI8B 4CPBA 3I42A 1OCEA 3PMSA 4X8MA 2XVYA 3WL3A 4MW2A 4BB3A 4CEJB 3CKKA 5TF0A 2C7RA 5FYZA 3N7AA 4RFLA 5DM1A 4KR2A 3WNLA 2D5HA 3OZRA 2W6CX 4JP8A 2BVBA 2OYCA 1L5HB 1OV4A 2C2XA 1CJTC 1B09A 1FDIA 4PXYA 2B46X 1JT9A 3DKKA 2PGXA 5JD3A 2H1CA 1HC7A 3RZMA 1KL7A 4IGPA 3KYDB 3GLFA 2Q41A 1OX5A 5CXSA 1SCAA 1QJX2 1UOEA 4UUQA 1BS1A 3OA2A 2XADA 4RKEA 3AW8A 3LO5A 1RSZA 3HA3A 3S8MA 2WQZA 1H4TA 4JLPA 2OZLA 1T6BX 1MMFB 5AOAA 1PD1A 2O48X 3ZN5A 1OR8A 3MXOA 1JECA 2AQKA 2PV7A 2C7BA 4NOMA 5I8WA 2I7CA 4MQEA 5LK7B 3RI9A 1X6VA 4O3FA 3HM2A 1U4OA 3SM3A 3T7TA 4NBWA 3E6DA 3DNMA 4IOJA 1RMQA 4Y0AA 5CVCA 3WIVA 3QLVC 2DY0A 4ZPXA 4X84A 2VXBA 2WTXA 4F5WA 1I10A 3GLHE 3VC1A 3MWKA 1R4AA 2I2SA 4AZ3B 5FZHA 4PR0A 3RC9A 3WF4A 1DGQA 2VXYA 4OGGA 5CFDB 3ITNA 1YFWA 4M8SA 3CIHA 1IY8A 1OQAA 4RS3A 3I09A 2ZOSA 3T7DA 3ETPA 4HAUA 5G2OA 2F6BA 1ZFNA 3RABA 4BNNA 4IIJB 5LATA 1CD5A 1WTAA 2WA3A 3RVRA 5TEVA 4C0WA 5JNWA 3GLHB 2ZX4A 3I3QA 1ORIA 1M2HA 3THXA 4KREA 3KKNA 2WYUA 4TV8B 4XIIA 1W19A 5HCAA 3WB9A 1FVFA 4HZUA 4ND3A 4GPD1 4EZBA 1QAQA 1GKLA 2XF8A 3GLFE 2EXJA 3OFND 4FXGB 5DG2A 1ZCBA 4BLTA 4ZVSA 1IQPA 1DAEA 2HU5A 4F86A 4I0BA 1TKAA 3ABIA 5BQOA 1CUXA 1PR2A 2Z6QA 1FZTA 3UMBA 3K4PA 2WA4A 3GCWA 4YW6A 4UW5A 1Q7BA 4U5XA 1POXA 1JN2P 2ZYHA 2UVPA 3GEPA 3Q7QA 2ZS7A 1Y42X 4LQDA 1ZVKA 3VZCA 5T41A 5DGHA 5EIFA 4KNCA 1W94A 3L7AA 1A9RA 4LJ7A 4MI9A 3D1LA 2AMLA 4CEYA 1JE1A 3NOXA 4TRJA 5F3IA 3VYTB 3GLFB 3F7NA 1ZP6A 1KXGA 1ZVMA 4ADSG 3CUVA 1W48A 3B1KA 4FQ4A 4DQAA 2QTVA 4H3KB 2JGEA 1V16A 1ZIPA 1QY4A 2OZLB 4OUMA 5ICMA 3KR1A 4QTYA 5JR2A 3VDCA 2XJVA 1XNDA 4CDNA 3BVPA 5A06A 3GNEA 1KZ7B 4YJ2A 1X8LA 5FZ4A 3AM4A 4ZVKA 4MQEB 1WW3A 4NESA 1SUSA 5JO0A 2VJMA 1VKNA 1P0QA 3KJIA 2QN6A 2F43A 3QYPA 1I2AA 3H5WA 2JHAA 4Q4W2 1PEAA 1PNGA 4BZZA 1PFGA 1WCDJ 1I0LA 3O93A 4Z9BA 4X1KA 2M6RA 4JKMA 1T6ZA 5FOSA 3KZKA 3U78A 2OCAA 1VL1A 2YKGA 3E03A 1E69A 4N7BA 2XB8A 2I4LA 1G7CA 2JAQA 2JE8A 4IQFA 4L4RA 2QTTA 2IS1A 5KJ1A 1PGW2 4P36A 3KQ4B 2DCZA 3LPFA 4N76A 4RVGA 3BZBA 3NC1C 4IO0A 2Q6VA 3L8EA 3INTA 2FXVA 1RD4A 1RLJA 1YB7A 1RKUA 3P5SA 4EN8B 1UKGA 4GI2A 1DAKA 1NUTA 5HJ5A 4FTSA 5T5OA 1L4MA 3FUTA 1BE1A 2P6PA 2YBEA 4I6JA 1ODSA 1ZL2A 3GPDG 4ZDIA 4CKEB 3THXB 3GCDA 3I0MA 1ODJA 4LE2A 1DT5A 1YQQA 1P62B 2WM9B 3IOYA 4BVFA 1E5HA 3BPZA 4Q3NA 1DQYA 4DDHA 1ZK4A 3EPJA 1BVRA 1JBKA 1COV2 1ZBE2 1UKAA 5CDHA 3PF9A 4FT8A 3E5QA 3V7UA 5CB0A 1MQAA 5KSPA 1ZM4A 3NFRA 3B6ZA 4NR0A 2UVPB 1SHUX 3P9IA 2F90A 1ZM1A 1QGED 4B7AA 3HB1A 3PSHA 4CL2A 1XEFA 2B94A 1XDZA 2PLWA 2QL9A 2P9TA 2DPHA 3NAPC 5HJ7A 1OBFO 4PQEA 4KWCA 2CLIB 2K87A 1JHDA 2ZJZA 1TMF1 3ZTTA 3WSTA 1I30A 1G86A 4IHAA 4MMYB 9ABPA 4RV5A 2P9JA 5DDIP 3IP6A 2DHRA 5AH0A 1M5UA 2PE5A 4NHLA 3FOEC 2H0QA 1TM3E 2O2SA 1ENZA 2XB2A 1FVHA 2Q8DA 4G86A 3UBTA 2NO9A 3VH1A 4QQLA 2VHEA 2VZPA 3D7SA 2XGSA 3RTAA 1IUKA 3B51X 2VXOA 4CMIB 1Y6FA 4KGXA 1JPJA 2QD1A 3LWCA 3G8AA 3TE7A 2H4FA 5HBGA 3ATGA 2BM9A 2ZYTX 4DLZA 2J09A 5FBLB 1YBMA 3D6NB 1HZZA 3G5TA 1VJDA 4MX3A 2R7EB 2YYYA 2P1ZA 3SS7X 4ESHA 4RW0A 3CUSA 5JECA 1IN6A 1HW5A 2EERA 1QJFA 3PJRA 3IDOA 1AA9A 4IDHA 5JAOA 2ZRLA 2NUTB 1RYNA 2D00A 3A9TA 3EFOA 1FP6A 3PD7A 1HN0A 1GU3A 1X7XA 4DOUA 1KH2A 1QHGA 2VZOA 1BX0A 5G0SA 2GH2A 1FYEA 2R2AA 1RMU2 3PMEA 5TXGA 1X92A 5K0TA 1XNAA 4QEDA 3M1HA 1AA6A 3RUCA 1CR0A 4LXUA 1YJLA 1UPSA 2YWJA 4KNYA 2LW8A 4CKCB 3R4CA 4IQ0A 5B7GA 3BU7A 4DUWA 4GKXA 3AR5A 3M1AA 4LRUA 2GDFA 4CM8B 1I3KA 2FZEA 1ZA4A 1AKNA 1G3QA 5GLVA 1NXXA 1HSZA 3IGFA 1I1HA 4GWMA 1CJKC 4TLCA 2QVSB 3ELYA 5KOHB 3R5KA 3RAGA 1S0BA 4J1TA 2GNBA 3LGSA 3ZWWA 2ZPXA 2CHFA 4N9QA 3V8PA 4OM8A 1C30B 2HH9A 1Y3TA 4JVSB 4CF3A 2WYOA 2VW0A 5C1OA 4D7YA 5JS7A 1LLCA 3X3HA 1QO9A 3VBFA 2L18A 1GUZA 2C7GA 4TS3A 2C8LA 5FWEA 3VUOA 4JR1A 1EVKA 3PQ8A 2DSNA 4CP1A 1EE9A 1N78A 4JC5A 4A27A 1ABFA 4OATA 2BEKA 2XKBA 3PLAE 3HNMA 3K30A 1H5QA 1A9PA 2P8JA 4Z1OA 5LJLA 1T1GA 1E3JA 3QEOA 2PTHA 1QQ5A 3K3NA 1XAJA 5HWSA 3QEJA 3GJ4A 4XRRA 3MIFA 2BI8A 5FPSA 3GJ7A 3P9CA 4HQFA 4DXRA 5J36A 3NTLA 4WIAA 4B32A 4BBJA 1NWHA 3GMIA 4H9GA 5F5XA 4UZFA 5AW0A 1TJPB 1DFHA 1NQXA 4PN7A 2X0EA 2W4IA 5GJ6A 1FXWA 1JRLA 3OFNA 2VHUA 1XTZA 5E6RA 3TL2A 1LDNA 3QIAA 1UL9A 1PI3A 1CUDA 2Y8KA 3TFOA 3JRWA 2XKJE 2F1OA 3T3IA 1FSFA 1LKZA 3ETQA 4U2FA 2YUEA 4FWIB 1Z0ZA 2W1QA 1DG3A 1KKUA 2BEWB 1Z4MA 3PIIA 1FDVA 2W58A 4QGNA 2WAAA 4JFRA 4RHV3 1TK2A 5MN5A 1VXOA 2FR0A 2OT3B 2HCTA 2PL1A 4R9NA 3BB4A 1HTTA 3OIYA 3A6DA 4PFJA 4UYBA 5JLJA 3E48A 2VP9A 1XRMA 3FUUA 2XB6A 1D0SA 4PF1A 3LGXA 4I2OA 1PZMA 1YYNA 3TFQA 3POBA 5IJ0B 3NT5A 4RJTA 5IKMA 3WYNA 4RGAA 2NZUG 2Y1OA 5SZIA 5UKDA 1C7EA 3H50A 3CJIC 4I02A 3IVAA 1E2GA 3KLSA 5LY1A 4ZODA 3EBPA 2A0KA 2DBRA 1G5PA 1ZD2P 1DXHA 3AUTA 3KQKA 4M46A 1RCTE 2B7CA 3VH3A 3U11A 4TTPA 2PZLA 4NJMB 4C3ZA 1PIV3 1Z5GA 3QKUA 3UTCA 1YE3A 2KPOA 4OHCA 4BKOA 3M9LA 4LEIA 1JVBA 1PBTA 1TECE 1QXRA 3N5CA 1I36A 5JVVA 2AQHA 2CLHB 3BA6A 2NO1A 2JH9A 1N6RA 2BTEA 1GGEA 1SVNA 1KQRA 1JN0A 3IAM6 3BN3A 2AS0A 1RJDA 1T15A 2FPWA 1IJBA 1TO6A 2I3AA 1ODNA 2NXCA 2H29A 2PHRA 3K35A 4BZXA 3SR0A 3RKRA 4YGBA 3RANA 2PKCA 4XDYA 5AW4A 1T5HX 2RBEA 3PUJA 3HU2A 2NZJA 3QXHA 1LV8A 4HNSA 4RMJA 1W5SA 4Y5TA 5FYUA 1J2EA 1NKTA 4ESOA 3UA4A 2C5BA 2Z9DA 4DDMA 1E2JA 3WLEA 2Z56A 4DEYA 4YRAA 2VJKA 2X53S 2P67A 4L50A 2COEA 4LNVA 5A1TA 2XXAB 4XYXA 1YE8A 1PKEA 4X54A 2FDHA 2XI4A 3QI2A 4ALIA 3VNQA 3HR7A 4HX2A 2RAUA 2P7IA 1GGNA 3HCAA 3WK9A 3G59A 1USVA 4WLOA 3JQ9C 3BQ9A 2XWPA 2O8CA 1RRPA 1VLQA 4MVCA 3OJEA 3W3ZB 4MSVA 1G64A 3KDAA 1RUE2 4C91A 5EJ7A 4FEAA 4B3DA 4MUAA 1USKA 3W5SA 1VBE2 1F17A 1AL23 3K94A 5FJJA 3SS9X 4RGQA 1TAGA 1C1HA 5J23A 3L07A 1YVRA 1KJWA 3PE4A 4JSTA 1XMXA 1ZI8A 5I7VA 1T3GA 3HFGA 3TW0A 3VR4H 4DJDC 2YMMA 3TSAA 1MG5A 2O3TA 2OAGA 5D3MA 5HM6A 4WUTA 2WIJA 3HT2A 4F85A 1ZJZA 3EULA 3EXUA 5L9RA 2X4LA 1BXRA 2ZKLA 1DJNA 3HBNA 4LIUA 2AXQA 3VV1A 4YO8A 3CHYA 1XOIA 2XCTB 3NGXA 3TIFA 1YOBA 3WDSA 5KBFA 2BGUA 2XMRA 4G3YC 4XSGA 2B8TA 4PONA 4ZKDA 4JVOA 3ANYB 3AUKA 5KNCH 3NHFA 2XHEA 1CS0B 1BOFA 1ZM3A 3ESXA 1GQOA 3ZHVA 2V9ZA 3GR6A 5AO9A 3V7YA 3A6JA 1ZYUA 1OVPA 1ZZCA 2I4OA 3DZBA 4NATA 1G3IA 4FYPA 1HEYA 4MCIA 2J9FB 3QUBA 3L0DA 1V35A 4YPVA 1U98A 2PX8A 3VAZA 4XIJA 1JX6A 1E2HA 2A14A 1KZHA 2H0VA 3JU9A 4XJAA 4MWOA 1QJZA 3H5VA 3SEFA 4PYIA 4JCOA 2I66A 1PZ8A 4TMVA 4BV9A 2W6OA 1VSVA 3IAAA 1AGNA 1F4AA 5DT2A 5FULA 1ULUA 2C4MA 4XBLA 5DN6D 4K46A 4K9SA 4F84A 5FTTC 3K0KA 4HL0A 4QPZA 3ERCA 1D0IA 2HK6A 2B4TO 5K6TA 4Y9RA 2ZM6B 3MWLA 3CIOA 2JGRA 2BV4A 3OWHA 3H11A 5E7JA 3RNSA 2YBPA 1JEYA 1LJ7A 3GJSA 1HQKA 1ST8A 4RPIA 4W5TA 3ASUA 2DH6A 4TXNA 3GOHA 2CXXA 2W39A 2GN1A 4R01A 1ZZ6A 2FHPA 3A9SA 3AEUB 1HE2A 3T9CA 5LZ8A 3RK4A 4Y1RB 3SHOA 1ZZEA 3BCUA 2BPOA 2B82A 3SSAA 5KYWA 3PJGA 3VZJA 2QMQA 4P2BA 3EFEA 1G5RA 5DVZA 4C7OB 4EW3A 2OLJA 1E99A 2UYYA 2LGJA 4LHLA 2ZI7A 3JYHA 4HQRA 5HIAA 4DMKA 4JIMA 4GXNA 2A9FA 4BE9A 2NXWA 2PMEA 2GBLA 3KUKA 3N8IA 3W58A 1NLZA 3ZYRA 1X0VA 2GAUA 1FFEA 3L7KA 3K9QO 2HBRA 1UJMA 3EJ6A 1ZOOA 2I6SA 4WVZA 3HKBA 5J3JA 1IL0A 4AHXA 2HZBA 1NTRA 4AM8A 4LJ8A 3VISA 1HM5A 3KOUA 1FNMA 1RUF2 4WM8A 3VR4D 1V7ZA 1Z07A 2QLMA 1R1A2 2H59A 5CYOA 4DTIA 3WY9A 3RCBA 3FNBA 3BWDD 4RQPA 1R0SA 4M55A 1U2PA 3U6BA 1NJ8A 2GEFA 1BK0A 1T4DA 1NUKA 1V2HE 1VI2A 2K7ZA 3AHJA 2PEYA 3JBG1 4U2CA 1ONSA 3OJ0A 2JE7A 1YO8A 4N82A 4G6ZA 3R8FA 2H1LA 2XBLA 2ZR0A 2GZ3A 2PZ8A 4LA2A 3I3DA 3U0ZA 2SECE 5FYMA 2A9KA 1U1FA 1RJWA 5LNK6 2C6SA 2R00A 1CFJA 2IXHA 5C4WA 2C4VA 4QGMA 2FK7A 5KNCD 4KI7A 3FSGD 3JAWA 5KC6A 4NIIA 4PSUA 1VBB3 1L8LA 4DMLA 2YY5A 1XKXA 1IK4A 4FQZA 1DWOA 1CX1A 5FZFA 4IZHA 3H11B 1FPN3 4EV0A 1J90A 3QXCA 1Y3BE 1BEV1 3IP5A 2VCCA 1NLQA 3NRUA 2XBUA 1EFHA 1MW9X 4BFCA 4ZT5A 2A73B 2JATA 4QOSA 3ZBUA 1T6YA 1H4HA 1HZZC 2J1TA 2EF0A 5IAJA 4NJOA 3K5HA 2MWMA 4TXJA 4WI1A 3CRZA 2HU2A 2ZIAA 4XCVA 5ECWA 1PZEA 2GD1O 3TAYA 1Z13A 1LPMA 3TOZA 4B87A 4QX3A 3C0KA 5LZ7A 3PD0A 3I45A 3QVWA 1AY0A 1USGA 4QKBA 4ZDJA 5DSXA 2IW1A 1HPLA 5CYGA 2Q7OE 3L1JA 5LOVB 1UXJA 3ZSMA 1WDKA 3MWFA 4KRXA 2G70A 1DC5A 4AG3A 4D56A 1XTQA 3M6FA 4UU1A 1LJUA 2B1GA 4E33A 1NP6A 4ZOLF 4L2IB 2OCLA 2QD5A 2QSZA 4IYJA 1EFVA 3PUYA 3DD5A 1L6RA 2PLV3 2DWRA 2B78A 3IV7A 4MGKR 3T9DA 1SY7A 4ZANA 4XF9A 3WDKA 1YE5A 2IYSA 3KZCA 3SC7X 3ADCA 2MT9A 2Z83A 3RS7A 4UUMA 1ZWKA 2X9QA 3AF1A 1IUOA 3CPJB 4URYR 3G2LA 2WG1A 4FGZA 4EHDA 4B83A 4WM8B 3HR8A 4CGZA 2HXYA 4MMZB 4E2GA 1FOD1 5EWMB 4RM3A 4J1TC 3LZCA 4FPLA 4RQPB 3ENQA 3F5SA 3Q8WA 4J3NA 2WABA 3U75A 4FHCA 2DH5A 1TO1E 4MKHA 4R6WA 2RHLA 3DZKA 1XU4A 1YV9A 5F1RA 2ERXA 3T1YB 3VBFC 1E1YA 4F72A 1N2IA 4EAQA 3NHPA 1PJRA 4HNTA 1HRI1 1X1QA 3IOEA 4RR3B 2X14A 2IC1A 3LD9A 3LUJA 4H35A 2I6QA 5C4WB 3NH6A 4PLCA 3LOPA 5CG8A 4NZPA 3JAWB 2YY7A 3ZJTA 3ITQA 1MAWA 1Y8RA 4EVSA 3CJRA 2VYVD 4PTYA 4AZZA 4AP9A 3S7EA 3KOYA 4P3XA 5EUBA 3OUTA 2XWQA 2ZEXA 4BVEA 3N8KA 2HF8A 3P4UA 5HV0A 1XZJA 2J33A 4XOGA 4ZV7A 4KOEC 1RKVA 1XP8A 1O4ZA 1OF3A 1UCXA 4I9GA 2ZCVA 3IDAA 5DT9A 1BVP1 1YRBA 4K20A 4UVEA 2I2XB 3DBRB 1PL8A 2WNOA 1NOJA 4KYVA 1J5PA 2WKKA 2ZSIA 3POYA 5SV2A 3IVXA 2NQ8A 2OCDA 3BOWA 2AOXA 4L11A 4Q0UA 3DLPX 1AR61 2ILMA 4FE7A 1N8NA 2H6BA 1OXUA 1RIFA 1KEPA 4LITA 4NP6A 3WSVA 2XIJA 3OC6A 4JELA 1NVMB 3TZKA 1MT3A 1XU9A 4L07A 1BDJA 3WHTA 3TN91 4LZAA 2EFDB 2HTEA 2VY0A 3I5YA 4HETA 2FVYA 4MGZE 2HFKA 3CJQA 3PIRA 3L7LA 4KLZA 3NYQA 5JS2A 3TEZA 1S0FA 5HGXA 2I2DA 4B33A 4ZU7A 5DN6A 4YAWA 3N0XA 4QUBA 3UAYA 3E9ZA 2PRYA 4JXKA 5TLSA 3KHTA 4J0IA 1THGA 2IITA 2WQ4A 1LLUA 1YAJA 2XZLA 1FUUA 2VPTA 3VO1A 3FUQA 3J4UH 6CHYA 2F8SA 3I52A 3SZUA 2Y1DA 5B53A 3SZRA 3VDDA 2OUJA 4HDKB 3IJRA 4D5GA 3OY2A 3EQ2A 3U14A 2WAMA 3THWB 4HDRA 4NR1A 4FYYA 3LSDA 1F5NA 1V45E 1VG0B 4YAOA 4KMMA 1UU6A 1QIMA 3KZNA 1IY1A 1EP2B 3AYXB 3QG5A 3P6BA 1T8WA 4OVKA 5AFSA 4R2XA 4UFOA 1ETUA 2CWMA 2OOKA 4IF4A 2BP6A 2CFCA 1RUG3 3RUIA 4JYAB 2NYYA 4L74A 3OY8A 2BBSA 2H57A 2P17A 2Q49A 3H1FA 2X4DA 2VTVA 4MWGA 4RLFA 1KH1A 3JZFA 3NV9A 4R1UA 3G0IA 4HZGA 3INAA 2QW1A 2ORXA 1S89A 1W2OA 5DP2A 1G7TA 1ZJJA 3S3TA 2Z3ZA 4GMDA 2W0MA 3CCCA 4P3PA 4Q93A 1KAEA 2ZP1A 5KYXA 2F8TA 5TVGA 1IWBB 3QELA 4E31A 3UWPA 2W90A 4NOLA 2W91A 1OH7A 3AP9A 4Z9XA 3R7SA 1Q83A 5K9YA 1Z06A 3AXTA 2RDNA 2C78A 1PAUA 5DGXA 3EVFA 4ORFA 3AGQA 2SNIE 1PGJA 3G2QA 4BO1A 5CGZA 3GI1A 4RV4A 4YRFA 2I7VA 3NDJA 4PIVA 2LDBA 3E5MA 4C03A 2GPBA 1G5IA 1TT5A 4WXMA 2X58A 2AN9A 7GPBA 2WTUA 2P37A 1P9RA 3IIEA 4UTXA 1MNQA 3OOHA 4Q9KA 3VR4A 3KEOA 4OAQA 2X8JB 4YVSA 4J7XA 3MJHA 3GZJA 1M8JA 3SWWA 1LU9A 2H1IA 2WJYA 1T36B 4KQ2A 3I4FA 3ER9A 3ZI0A 4DPNA 5F7ZA 1GSHA 4H6VA 4TT3D 1BQ3A 3VPCA 1RRCA 4LCBA 4NABA 1NE4A 2J6BA 4LRTB 4DB5A 2Q5CA 3UH0A 1QH1A 1UFKA 4M1SA 5EIXA 2CHVA 3VTFA 1SNYA 5KNCA 2JKZA 3FSGA 3QH7A 3PENA 1C3VA 4MQUA 5CEHA 4M9RA 5ULLA 2R063 1C9MA 1QBKC 3VBSC 3EWIA 4DAEA 1J1ZA 5JYDA 3T3EA 1MHTA 2IPXA 4C0HA 4HLUA 4MUHA 1RAAA 3EO6A 1FXZA 2D2IA 4IXNA 4EFMA 4IERA 1EDBA 1P1RA 4X3CA 3VDDB 1QQP3 1PX2A 2PT9A 1T35A 2FFRA 3K73O 5A7SA 4OHVA 3NPMA 5EMLA 2VTFA 3D6TB 1ZS9A 4FU0A 4JYCA 4JYPA 2AHOA 3GJXC 2R25B 5LY2A 5I47A 2D7DA 3WQBA 2QEQA 3NBQA 4TZTA 3GRRA 3GY0A 1XNRB 3G1UA 5FYHA 3IMEA 4CW7A 4LNUA 4QM7A 1ZJWA 4ZOAA 4HNHA 5GJCA 3A3OA 1AKUA 5KJFA 3NV4A 2QW0X 4JLVA 2VXRA 2FFAA 4W8GA 4E5UA 3OEED 5CLFA 4QQPA 4ZQEA 3G8YA 4YW1A 1T8UA 2XVZA 4TTIA 1J00A 4RHV2 1S3FA 1OI3A 1C7ZA 4YGYA 1GSIA 1HL3A 3GUCA 4JBGA 3UNXA 3QELB 2ZSJA 2VYND 2ZGMA 4R3WA 1IOWA 4Q1DA 4ONEA 1M2WA 2HWF3 1A9TA 3OLCX 3IA7A 3DL2A 4HAIA 4OFZA 2GNPA 5DYWA 2GTHA 1I3NA 4I1OA 4A6OA 1ID1A 4BO8A 3F2ZA 3HEBA 2DVDA 4J4BA 3BGAA 5FHRA 3PS9A 5HILA 1D3AA 5T6MA 4XBQA 5DK4A 5LB4A 1LI4A 3TZCA 3PBKA 4P4TA 3BFKA 3CH5A 2XDVA 1OXCA 3WIUA 4DC9A 3KXPA 4LE0A 1W99A 2V7QD 2R65A 4AQSA 5FYTA 3QLVA 2J08A 4WLUA 5E9QA 2OKCA 3ZPYA 3EZYA 2OCXA 2AG8A 4GBMA 5FY5A 1PIV2 3TNPB 5F98A 1PR3A 3R20A 5U1PA 3IULA 1KFBB 2WIIB 2YYSA 4FP9A 5A32B 3AEYA 2B0JA 1MABA 3ZDBA 4FMDB 2O8DA 2OAQ1 2D0DA 1EFKA 4FIDA 2EBWA 1JDBC 3BMOB 3EVEA 5C5EA 2P3SA 4LQLA 1B73A 5FOVA 4RYDA 5IJ9B 3OT1A 1XTTA 4EY5A 1DQ0A 1QNWA 3T2PA 3M6XA 3TFWA 2VYVA 2P3YA 2A9JA 1NI4B 3KDPA 1B6SA 5CT5A 1SWVA 3SHWA 2GMMA 1BH6A 1SEFA 3AL3A 5KDLA 4MB0A 2I1LA 3KT8A 3NWOA 1NMEA 4Q1EA 2W00A 1CUWA 4D6QA 3C1AA 4J4HA 3ZDYB 5LKAA 1MJNA 4YRSA 2W87A 1RW4A 1NXSA 1QOOA 3HCBA 2GXQA 4C9BA 3P2KA 1T24A 1R0ZA 1NE6A 5FPUA 5THXA 4I14A 3R5JA 2B4AA 4QVIA 2EYUA 3W20A 5B58C 3KV3O 2PAAA 1BDHA 5F2KA 4GB33 4LNUB 2IPAB 3WG4A 2QTZA 2EKDA 2XTMA 6Q21A 2CDBA 1SIBE 2IHJA 1V6SA 4AQDA 1GR1A 4I0AA 4YAJA 3DVSX 3MK31 4JXXA 3A10A 4YYOA 5GLUA 5F9TA 1YZFA 1F3OA 2QUIA 4P5EA 1ENXA 4XIGS 1BDBA 2GZRA 3O0DA 4AO8A 4L8FA 1IPFA 2LR0A 1LR5A 5TGDA 2BM8A 3ROUA 3KKQA 3V33A 2A6VA 4AG5A 1TO2E 2OMKA 4MHRA 2JI9A 3BWYA 1WWYA 3U80A 2WZR2 3EXHC 4GP9A 1J8QA 1K7SN 1NMYA 4BU0A 4JJ4A 4ZT4A 1M74A 3MQFA 3NJ8A 3MJDA 1I14A 2EG5A 2PKEA 5CLLA 1E4OA 2R1VA 5LEKA 2R4UA 2W2NA 1D1PA 2MSDB 1RJ9A 3ZPXA 2B35A 5BURA 3GVXA 1X94A 4B2PA 4KFTA 1SDDB 2F3QA 4OG2A 4G8DA 2H0RA 1VYUA 1RUH3 4LKDA 4B29A 1MABB 1XP5A 4D8XA 2C4KA 1X7DA 3GZTB 5HA5A 1M7HA 3I6MA 3RYHA 2XBO1 1EGMB 2FKAA 4P6VF 4Q16A 2VBPA 2B1IA 3PFCA 2AL7A 3LYAA 2Z6UA 4XQEA 3ABOB 5FJIA 5G4LA 1E6EA 2IUFA 2PPLA 3MCZA 1E9FA 4OJQA 2HY7A 4GR5A 2R6JA 4KIWA 1AS0A 1J07A 3DOEA 3ZVKA 1INLA 3I2JA 4KB5A 4DC0A 2QVYX 4A16A 2PUAA 1TCCA 3TB6A 3SLGA 2KD7A 4PLFA 4ATFA 1NYLA 1X3SA 4LWOA 2J7PD 3KR0A 3O0TA 3DYBA 3SHFA 4E88A 4FWBA 2AR7A 4FT2A 1OBCA 1LRKA 5CBLA 2XNKA 4FFNA 2O8NA 1Z7S3 2XTNA 2I6UA 4FS8A 2C7OA 4NPAA 3LBFA 4H2DA 1Q44A 1JW6A 4HSLA 4NNJA 4N5NA 5I7WA 1NVDA 2GNDA 4H1WA 3HY6A 2EIGA 3N5KA 4PO3X 4UAVA 2QQEA 3AK4A 4C0KA 1JJAA 3BC1A 1GQPA 4W8JA 2EARA 4QOHA 2QNKA 2QX4A 2E37A 2C5HA 1HQNA 2ET1A 3W2EA 5IXYA 4D9FA 2VDJA 3LCRA 1E7RA 3EDOA 4JLDA 1JHZA 1CGPA 1XC6A 1H4GA 3OUZA 3L77A 1KDZA 2P6OA 5JS1A 1Q19A 3U31A 3U1TA 2JZOA 1OU4A 3NAPA 2RVAA 1FNYA 3NONA 4TT3A 2G67A 4ZU4A 2IFTA 4E1VA 3RJ5A 4CTOA 1P73A 4M7OA 4BEJA 1KYIA 1AQUA 3X1YA 1R6XA 3GRCA 4UMEA 3TZLA 1A5ZA 3MEPA 2X09A 2JICA 3SHRA 4GZ9A 4B6QA 3V4RA 4LVNA 3TM4A 5TF4A 2C4HA 2CFSA 2QUKA 1NBMD 5F3RA 3R41A 4ZZIA 2OECA 1VE3A 5BT9A 4HK8A 1E9RA 4E2ZA 4LKRA 3NUZA 2CD7A 2FP4A 2R1VB 4QL3A 3EEFA 2JLBA 1J39A 1IQAA 1Q8SA 4AMVA 2A4MA 3L92A 5H16A 1H2MA 5DGTA 4YMGA 5T5PA 1XKLA 4MW4A 3RBVA 4BUZA 1FLDA 2JKXA 2IZZA 4C4SA 5B6IA 1GP4A 2OWDA 3L5KA 1K0UA 4O1IA 4IWYA 1SLTA 1PGPA 2I22A 2QV0A 2R8PA 5EVCA 3PI7A 4DMUB 3MICA 1SBFA 2OFXA 3L0ZA 4NMHA 2W5FA 2FI1A 4MV6A 3PXBA 4DM3A 5T54A 1F9EA 5G04L 5BXXA 3L6EA 3EWNA 2NTEA 3OEEA 3IPXA 4BNMA 4CQMB 5FA5A 2AACA 2ZBDA 2IZ5A 3MJVA 4A8JC 4V2WA 5FZAA 2VYNA 4LJ5A 3AR4A 3EA4A 5U9CA 1W29A 2YV4A 4I3HA 4MGIE 1V9LA 3I9V6 1L5LA 1GGVA 1VCNA 2HCFA 3NW4A 3HXQA 3E2IA 1OQDA 4H31A 4YMUA 2ZITA 3HJBA 4NJEB 1H85A 1W30A 4EFLA 3A05A 4AUKA 2WRZA 3HNPA 1N3OA 3LC1O 1XOYA 1I3OA 1I01A 1MA0A 3JASB 5LL6P 4WL0A 4TSFD 3A3YA 2OQIA 1Z5WA 2B4RO 1FTQA 1XZPA 4RLHA 2V7QA 1N4DA 3LRPA 4EW1A 5B6JA 3C5HA 1JMKC 1FMLA 2AOTB 4QOEA 3K96A 2P2DA 5AFEA 3NAPB 3LUHA 4MV5A 4LG1A 5KHGA 1ILEA 1CLUA 1FS6A 4UPEA 3IOBA 5HRAA 4GI3A 2BWJA 3GZNA 3T2OA 1OXTA 3K2IA 2PLRA 3K0EA 3R8CA 4YRMA 2RI0A 4GWNA 4QDTA 2XMCA 5F9HA 5ICGA 3VM6A 4NYIQ 3RUPA 1LODA 2O2ZA 2Y4OA 3UJ7A 3NJZA 5AW6A 1UMDA 2ZWOA 1P1FA 4META 1I2ZA 4QE3A 3PPXA 2R7KA 3CKLA 3UICA 3O3CA 1LOFC 2CLSA 2J48A 5B36A 3SVZA 2PLV2 3WVJA 1A9XB 3NB0A 2FPLA 4KKVA 4OB8A 4L4XA 5FOJB 3ZGNA 4TLAA 1O87A 3FIJA 2OV1A 3N2GA 1R091 1UO9A 5KCZA 4URUR 5IT9A 2OFFA 1DAGA 2BF7A 1KU0A 3DXYA 2GARA 4XGIA 2GWHA 2I2AA 1Z2EA 2MR5A 2WHEA 4PYJA 4RVSA 4YVSC 1JXNA 5ACA3 1EVIA 2WICA 3QJ5A 5THQA 3FDIA 4DILA 4W1PA 1IHYA 5HKLA 1UZLA 2QM3A 2FEXA 1DGWA 3PUSA 3GYGA 1UDCA 5GZFA 1R5NA 2X2PA 3BD7A 4WV3A 4MS1A 1QZ3A 5IARA 4KNWA 4E14A 1LBHA 2N0SA 4XJTA 4HLNA 4ER5A 1H3FA 4PAOA 1MEC1 2V7PA 1K7EB 2OHFA 3D31A 2YZ2A 1VPDA 3ZZUA 2WFF1 1S0GA 2CBGA 4LMAA 2PGJA 1W8NA 2IQIA 3K31A 4L3VA 1RP1A 1IMJA 4XQCA 4ZOEA 1IS4A 4C4RA 3EX7C 3ZWAA 4Q4X3 5FOBB 4CQLA 4HLUC 4F3JA 1SG6A 4JUCA 1AHIA 3R9XB 3LXXA 1U5BA 3LWNA 4QTZA 3QQ5A 1TUBA 2FPRA 1YBVA 2Q1XA 3K1JA 1ZN9A 3MO4A 1WLCA 4LQ4A 1AHPA 2HJIA 3B01A 2WK1A 4AG6A 4KPUA 1FPQA 2OB2A 2L9LA 1YQEA 1K4MA 5BVHA 3EWAA 3RUAA 3DE3X 1OD6A 1CG6A 1F48A 1NN5A 5SYNA 3MINA 1NNI1 8LDHA 1ISIA 1VYVA 5KJEA 3ZK8A 4HO1X 5K99A 1B8VA 3AINA 3QFSA 3IUPA 2H4ZA 1MPTA 5FWXA 5IC4A 2H2AA 1FYXA 1UEXC 3HY4A 3H0OA 4JQTA 2XUPA 1E1MA 3AHDA 2O1XA 3DLIA 3BIJA 4NCNA 3AMMA 3N6VA 3B1XA 2ZGRA 1ZNWA 2J7PA 1TYZA 2A0XA 4FFHA 2DF7A 4W5WA 5IJRA 1EA7A 3K9CA 5D3KA 2CZCA 5FR1A 3GRVA 2QIPA 5FZ3A 1B26A 4DMIA 1ZGZA 3N2GB 4JJ7A 2GNAA 4GKAA 4OMUA 3SJ7A 2PBRA 1BBT1 2ZUSA 3U7GA 3K0FB 5B1YA 2J3DA 5LMCA 1H1LA 2GK3A 5TS2A 1OC4A 4AY4A 5FOTA 1EK1A 2C31A 3EAFA 2HI0A 2QKDA 3L6UA 1Z74A 1XFDA 2VT6A 3JQ9A 1E5IA 1RADA 4HWTA 1QDLB 1T13A 1U6IA 1AHNA 1RUG2 1U0FA 1V7QA 3N1UA 3KFXA 5FL3A 3OZAA 1K98A 2IEIA 4OJKA 1COWA 1TAUA 5FP0A 1IOZA 4Z4EA 1CQJB 4FZRA 4Q9LA 1XDSA 1G2OA 2R043 3UK9A 5BNPA 2JIQA 1ZUIA 1QYIA 2QCSB 2A7AA 3SDZA 1E1KA 3PVNA 1NBMA 1U5YA 1YQ6A 4FKZA 3NWEA 2RMU1 2VMIA 2OQ2A 1YS1X 3CJIB 1VG1A 3M83A 2HAEA 2CLFB 4D82A 2FJUA 3UKTA 1MGPA 1P31A 2IYAA 1WKVA 2HO4A 5BNZA 1A8UA 4ZCMA 3JQRA 2VRBA 4HDSB 2QDRA 3FZGA 1TF7A 3I2GA 1XVTA 3VDNB 4Q7KA 5BVHB 1UOQA 3CYFA 1T5TA 1D4M1 4Q7QA 4RPGA 5A5DA 2ZRKA 2ZI6A 2GPYA 1Q5PA 3OM1A 2F6RA 3ZDCA 3MINB 1WETA 1RXEA 1TEXA 1W9HA 3DMGA 3MJSA 4XGNA 4NVPA 3OJBA 1G4AE 3J8F3 1DCMA 4GECA 5KYGA 5E7QA 3P2EA 3AFKA 1LU2A 5FWXB 2Q46A 2GF9A 4J0DA 3RSQA 4CU9A 5JSYA 4P5DA 4O9GA 1Z0UA 4G0PA 1N5DA 1FRFS 5FTMA 4LW8A 1AXZA 4A1FA 4LFCB 3H86A 4F4CA 4R8SA 4F4IA 3Q8FA 1MG0A 5IAOA 5CDYA 5F32A 1JDJA 1QV6A 3W3AH 2EG9A 2G5TA 5JLVA 2X40A 3PQDA 3JPWA 4L7VA 1E1DA 3C39A 3GEMA 3M4JA 4GIBA 5CXUA 3MLEA 3RVSA 4S1TA 3K71B 4WE3A 1UZWA 4Q0MA 3QKSA 3KWFA 1HWYA 2XUOA 4ZFNA 1P39A 1LCLA 2O1QA 5BSRA 4JLOA 4IS3A 2JDZA 1YI7A 3ZR5A 4LRWA 4TSFA 4PX5A 3MVEA 4P34A 4RZXA 3NKVA 3GV0A 4ZHQA 4IP0A 2O8OA 2LKDA 3BJMA 1NBME 4CN9A 4YIHA 4OD0A 3MBWA 4ML3A 1LGBA 1QOPB 2WUFA 4PBOA 3D4KA 1P2BA 2RS12 5GJBA 3O0VA 4WBBA 2FQQA 4C0XA 4AG4A 3BFJA 5CB4A 4HNVA 3AU8A 3M4XA 2R11A 4OUEA 4M86A 2XB9A 1F8GA 3TZBA 4D1YA 2HWKA 1IQDC 2KM1A 2Y1LA 2H4JA 5AM1A 4II3A 2IQ5A 3E8SA 3BWVA 1PQUA 2PLNA 1UDRA 1W8IA 4UEWA 1N7GA 3PICA 4OY3A 4RD6A 2CXHA 3HMQA 4A10A 2ZB7A 1TF5A 2BFUS 2HWF2 2Y1WA 1H42A 2C07A 4RGYA 3U9TA 2JDID 2R97A 2CGNA 4YLEA 5GQSA 4HZUB 4MW7A 2BEUA 4GJYA 4OJMX 4MWCA 4UDYX 1SG3A 2HWC2 4EARA 4BX3A 5KTNA 4IJKA 1H6YA 1AKTA 4UHKA 3NBMA 5FADA 5FZ8A 4AJJA 4V1PA 2I7TA 5EHGA 1U8YA 1R6UA 1Y3HA 2BWCA 4A6PA 3JSXA 3VZQA 3VZDA 4P3KA 1ZGBA 4MP8A 4Z8BA 4BXSV 4PPGA 5KBYA 3GJAA 4A0FA 2C00A 1J25A 5H83A 4J07A 4WBNA 2GPAA 2VT3A 1GPH1 4KHZA 3A04A 2ZRCA 4CEYB 5JZMA 1JR3D 2W9XA 2QQGA 1BJTA 4XUNA 2UDPA 3B8HA 1NXD1 4B4WA 1LV7A 2WLTA 1KI1A 2PU7A 3EW9A 1BX1A 2YXDA 4UW9A 3WP1B 2QTVB 5D2AA 2P2GA 5CM8B 1V16B 1YZNA 2VCEA 4FW9A 4RCVA 4CDQC 3U49A 1KGDA 3FZYA 4LXHA 3HDGA 4MGTA 4ND7A 4WV8A 2W98A 1SD1A 3LWZA 3TQOA 4DF3A 4UI9L 1T9AA 2CNNA 5F2EA 5BO5A 2ETVA 4YJ2B 3WW1A 2F1JA 2VJMB 5DHSA 2Y6GA 4QPJC 5AR1A 4C1BA 4NOKA 2F43B 2YGMA 3TMKA 3JWGA 3H9EO 2ZEWA 3BXGA 3PTAA 2HIMA 5ALOA 4X1KB 2F00A 1XRUA 1H8HA 3SNMA 3AJRA 5DP1A 2GC0A 2PX5A 2QTMA 1IM2A 1TZKA 4Y9DA 1V9SA 3D7NA 3MGAA 4GB32 3G6KA 2Z2KA 4G1UC 4AT1A 1C3OA 2X19A 1M0EA 4DLXA 2OMEA 4FDLA 2VRCA 4NVRA 2Z4TA 3ZWQA 1U0EA 3OIWA 1ZAYA 3G2OA 3ZE2B 1P72A 4RTSA 3T5DA 3F3MA 2RE9A 721PA 3R6GA 4AQTA 5JJCA 4HGNA 4FIZA 3MTIA 4R9BA 1BS9A 1SCIA 4I36A 5KHLB 1I9GA 1WMFA 4CUZA 4RC9A 1A82A 2R85A 2B8EA 3VD4A 4Q8LA 1YFLA 5DBIA 4FI3F 3S6JA 1X8JA 1LUAA 1S8NA 5E7IA 3Q3EA 4LDZA 3ANLA 4JBXA 5TGTA 3LU1A 4BCUA 2ZTMA 2EL9A 2RARA 2IZ0A 3ELNA 3WQHA 3TQQA 1HXS1 1OTXA 1NUAA 4GOOD 2PA0A 1YACA 3SMQA 4M9CA 2WU8A 4PX3A 3JQDA 3H1PA 3DO8A 2GETA 4FDTA 1XALA 1OAOC 5F52A 4FB4A 1FMD2 3CVJA 4HFSA 3PHBE 4OO3A 1MAUA 2NSJA 5LMUB 3B5LB 1IN4A 4JQCA 1X9GA 3CNQS 1OGIA 5IFTA 4EI9A 5FUMA 1FQOA 3IT3A 4WBNB 4YMTA 4IH1A 3FB4A 4DCJA 1RUH2 2Q9AA 3NHUA 2BRUC 3K53A 4JB8A 5I7FA 4TYSA 2ONYA 3KM0A 3E35A 1MFPA 3WD5A 2X4IA 1EUUA 3GFQA 2QPLA 3HYLA 1HDZA 1IBKB 1E57A 1X9TA 1Z8DA 3Q6IA 3F4BA 3F95A 4BLOA 2UYCA 4B4QA 3U5TA 1HT0A 2I45A 1DKQA 5T5LA 4CCLA 5FLKA 1TPYA 2HK8A 3GU3A 4LXQA 2Y64A 4FNMA 3WMWA 4Y26A 2XBMA 1G42A 3LT5A 3V8EA 2G1KA 3AP4A 4K6BA 2VHVA 3PGXA 2AN3A 2P6CA 1UFOA 5C37A 3NVMB 3OGSA 4P1ZA 3ZGOA 2HT1A 4PBTA 4CLXA 2AW3A 3ZDDA 4PZDA 2IPLA 3M4NA 4ITVA 3T7RA 2ZVJA 1L7VC 4UHHA 4UNRA 2AIRA 3E0QA 3D1JA 3HZOA 4EZEA 4DBVO 2H7CA 5HXMA 3WV5A 1C3OB 3B3QA 4MUFA 4L5CA 3K05A 1DBIA 1OV6A 1RITA 1RQ7A 1HB1A 5HK9A 3T7SA 2WHPA 3A0RB 5I4KA 2GSWA 4JB2A 1VA4A 3OFSA 5A9TA 3EFOB 5K45A 1K0FA 4DEVA 3TOXA 4X7MA 2DEUA 1SUPA 1X7XB 4RFVA 4R9SA 4ZOCA 4NY1A 3NAMA 3BF7A 3OZSA 1D2AA 4FEYA 4BKUA 3EHKA 2J85A 1PNRA 4IEWA 3C4VA 1UK6A 1L7RA 4D3ZA 1Y1LA 1ZCAA 4Q19A 1TM4E 2ORIA 2QQLA 1RM0A 3JR7A 1IN5A 3I37X 2W46A 3KSMA 2UURA 4PC7A 3KZ4C 2AXNA 3TPCA 3NJXA 1YRWA 1L7AA 5JQGA 3D7KA 5F35A 4QUEA 3E81A 3ZGZA 2Q3JA 5JIBA 2D40A 1J5XA 3HPRA 3KLPX 2PUWA 4EY3A 3WJ2A 4XCAA 4G4SP 4ENVA 1NQUA 5J5VA 3T1LA 1ENSA 4R8MA 1E7WA 4UTZA 3OCPA 2A94A 1Y9QA 1EFTA 5EP3A 4LJ9A 2W5UA 4OX9Y 2WZQA 4YDSA 1TYDE 5FWAA 3GARA 1CAWA 2HLHA 3VBFB 2OLKA 4BB5A 1RUC1 4OYHA 2GMEA 4UT5A 1OFIA 5BQ3A 4D8YA 2XUEA 1MX5A 1P17A 3SFTA 2O4UX 4AJIA 3DZHA 3WLAA 1Q7GA 3NMBA 1JQEA 3EBOA 2CY6A 4DREA 3LQ1A 4EZ4A 1FMTA 4J0QA 4WTOA 3B3QE 5FUVA 5L40A 2FN9A 2R8OA 1MP0A 3PDUA 3CGGA 1M0WA 2ZMKA 3U7RA 1LJLA 2RK4A 1MZVA 2V6IA 4ZXFA 2NSHA 4M1QA 4ZJYA 2AN5A 4LTAA 2W2PA 2FMKA 2JDIA 1M4WA 1YQUA 3PK0A 4IKPA 5IDXA 3I61A 3Q3GE 4RF5A 3GA0A 2IDJA 4GX1A 5J59A 1OZ0A 5DNAA 5FF9A 5IC6A 2HJ9A 1QHHA 3DVLA 5E6RB 1TK3A 2WIGA 3T0AA 1SU4A 3RZJA 1KYVA 5LLTA 1P7WA 2D6MA 1XWWA 3M1LA 3W2IA 3T0GA 1A2BA 4FQ7A 2B1QA 3OTIA 3LX5A 1NUSA 2BLLA 4OM7A 1IH8A 1SOAA 4H6WA 5BN1A 3FTPA 2MSKA 5LK5A 3C6XA 1A3KA 3P94A 1SXGA 1HETA 3UJ3X 4L8VA 1VE5A 4WWHA 4YDHB 2Y27A 3W6ZA 4AWAA 3P2YA 2Z8YA 1JR3A 3BORA 4J1WA 3HDHA 3E27A 2GM4A 1AYM2 5DCLA 4EZIA 1DXOA 2WP8J 3R9IA 3FHTA 5IXSA 2WWUA 4UREA 5FYSA 1KY3A 3PC2A 3GWGA 2G28A 2CMKA 1ASJ1 5JWHA 3RO7A 4EPRA 3KXDA 2I1WA 1BEUB 5BNPC 1P2FA 1ZSVA 3KSDO 1B00A 5FPTA 3MW3A 3VBSA 1K6IA 1GICA 2IVZA 3QXGA 3SOPA 4EKDA 5IKXA 7ADHA 3LA8A 5FLIA 4UJ3A 5JAMA 2XRYA 5HI0A 3ETNA 1QKJA 4NKRA 1WHSA 4R40A 3MQ2A 2QG6A 3VZSA 1QIJA 2EJUA 4YQZA 4EAAA 1E66A 2GJ8A 1KEWA 2DUWA 1K6JA 2NWQA 2IUEA 2QXTA 4A3SA 4E2SA 2GC3A 4BVJA 1O8PA 1M34A 3WGYA 2G9RA 4CV3A 1ZLXA 4GL4A 4RD1A 1LB1B 4M83A 3MV11 1CAWB 2CSGA 3W3AA 1K9SA 4KK3A 3THOA 1JDSA 4QDQA 4AWXA 5JS8A 2C5FA 4DQLA 2VRNA 2G1MA 1O58A 1SGWA 2RHOA 1FATA 5LBCA 1ECCA 5DXDA 2GZAA 3EVTA 1VBD3 3A9RA 3GJ8A 1PGOA 2EDAA 2BFUL 1E7QA 3LKVA 2ZZJA 3N70A 2IX9A 2R84A 3A0NA 4WOCA 3KBOA 3ZCSA 5KNDH 4J0JA 3A3NA 3ND6A 5C3OA 2JJ2D 1GU1A 1LHNA 4MV8A 2EWVA 3IUJA 4IHJF 4DLVA 3K5WA 4LFAB 4KR3A 4YUVA 1LSOA 4JODA 2CJYA 1JR3E 5GOTA 1HBJA 3DSRA 4LJYA 4HFNA 1Q0HA 4X7BA 1QHHB 5FK8A 1HRV3 4BHTA 1O5TA 3DB2A 1PZFA 2FCRA 3OZGA 2VF4X 2CSXA 1KZGB 1UKZA 2IP4A 3CKMA 1C8NA 4DADA 4CJXA 3ZY6A 4P9GA 4DCOA 1QH0A 4LZJA 1VL2A 1EJ0A 4QO8A 4BNTA 1U3GA 2FZWA 4MVJM 2VQFB 3WNNA 2ADMA 2FB9A 2Y0PA 2O8CB 2PKQO 2UAGA 2VF8A 1UIRA 1B1AA 2V8OA 1MS3A 2VJXA 3UPTA 1FSSA 1I51A 3DWIA 3OYWA 1EHIA 1CQZA 4DNOA 1K06A 1M34E 5DI3A 3ABQB 4CXXA 4KGVA 2LS6A 4MUIA 1CUJA 4MP3A 3RU2A 1C8M1 3UGHA 1IOLA 3VBSB 3BK2A 2AEFA 4EG1A 4UBJA 1RRFA 1N3IA 5D3MB 1NY6A 4N9IA 3W8DA 3UMSA 1DSSG 3SEQA 1BXRB 2C0PA 1JG3A 1D5CA 4JP3A 1IS6A 4AS2A 4BQWA 3NHAA 2BELA 3MSXA 1FP7A 3W21A 1SUFA 4GD4A 2QG4A 3AO0B 2WBLC 1M1NA 2GALA 3G8CA 2ZX0A 1G8AA 2XUDA 5HOQA 1E1QD 5BV1A 1V9U1 5J09A 3B2NA 3PKIA 4XCQA 5HZHA 2BUKA 2R7MA 1UWWA 2X0DA 3TJRA 4MR7A 3DFFA 1M5RA 3I23A 2QRNA 2P3KA 3DLBA 3A1SA 4QGAA 1MDBA 1DQ6A 5EE1A 3IHLA 2RI6A 4AFDA 1JS1X 4UTPA 4F5EA 2ZSDA 1KZ6A 1Y81A 2E51A 1UOPA 3CB2A 2OC4A 1IVSA 3FHLA 2YOHA 4ZVPA 4MCAA 4R1PA 1GFZA 3F7OA 1KDPA 3LDAA 1UYXA 5EJGA 1N6LA 1HNXB 1HO3A 4QJ3A 2M2IA 1ML3A 3GAZA 4MQBA 1D2MA 1FLNA 3EK2A 1RWQA 2GM9A 2J8ZA 2C9BA 2CNWD 3EXHA 4AMYA 2JGAA 1W39A 4P98A 2O3QA 2BMDA 4DUVA 1P9NA 2GFIA 4EIWA 1QX3A 1JEYB 2AF4C 5C8YA 4C5CA 2WE7A 1N5MA 4B4KA 3GT0A 5E2IA 2WIKA 1H6DA 3UC5A 4L95C 3ZGXA 4HRYA 3DDNA 4JLJA 2DP4E 5ITZA 3OYWB 4FPXA 3ENZA 5SV5A 4I1YA 3V97A 4P0PB 3O1LA 2D59A 4BFUA 4J9VA 1UN1A 5KYWB 1W0CA 4JBLA 2GDJA 2WAYA 1JDBB 1KVUA 2GLTA 1ZH2A 5IYZF 4YMLA 4XF4A 1XXHA 1JYEA 4F11A 4FOOA 1O3RA 1BHO1 1KI8A 2CE7A 1PLJA 3NIDB 2WKPA 2J5BA 4LEJA 1VLZA 1M2FA 3O14A 4IEVA 5IJWA 4INOA 5SY4A 1XMIA 4TS4A 4DINB 1OI7A 2XX3A 1Z2CA 1A78A 1OLMA 1OT5A 1CW2B 4F97A 2YDEA 1ISGA 3TTYA 4X97A 1BKYA 3DPRC 4TMFA 4V3BA 5DWDA 3PUQA 4M0UA 1FNNA 2C3YA 4DSUA 1Z0JA 4L22A 4WOPA 3HKBB 1ULCA 3O1OA 1LCIA 4YEDA 2O20A 2C9KA 5K8VA 3V0AA 4HWKA 1XLVA 4QHYA 3I30X 4GVLA 3GRYA 1KJ9A 1JYNA 3GG2A 4MR7B 3GHYA 4XEZA 4OYYA 4OQMA 4FPCA 3OZTA 2WLPA 1T6NA 3RSZA 4DSAA 4GGOA 2EP7A 1HYBA 1IBSA 2OE2A 2C96A 2FSFA 4JLAA 4PAGA 4S1NA 4HAXA 4EGFA 2DFDA 3ZLBA 4GYWA 4RIIA 2KS6A 1H22A 2IIVA 1H4QA 4IJ5A 3HL0A 1Y1QA 3RMYA 4MDEA 1SCQA 2B6HA 2X22A 3KVYA 4A3XA 4CM3A 2DQKA 3ZLVA 5FWNA 2RGDA 2AZMA 1MV8A 1U9ZA 2PAEA 5DWVA 3A23A 1XXHE 2IUYA 2R6ZA 3TEFA 1OIXA 3I49A 1KF0A 1PLKA 1Q0RA 3EVAA 1HDKA 4C07A 1JAHA 1NGSA 5CBKA 3REOA 4P4LA 1NPYA 3WDUA 2ZGLA 3R7LA 1YGPA 4AHZA 1VIDA 1A7AA 2OPHA 4MCJA 1DEOA 1JV2B 5FOQA 3ZKWA 5JPDA 5LQJA 3T2TA 2JJ6A 1QJ4A 1ZA7A 1TE2A 5IVDA 2ZHMA 1OLME 2HSJA 1SO8A 2WB4A 2A1UA 4O61A 2REBA 4Y30A 1K7YA 5L7TA 5CGQB 4F60A 1BCSA 1XXHB 3ZGVA 3DGTA 3DT9A 4KDFA 1BNCA 5LD2C 1IU9A 5JNRA 4C3OB 3HA5A 1U7OA 1CS4C 2RG1A 4NPRA 4A03A 5K01A 2GI4A 1DMSA 4BO7A 1K9VF 5LIRA 4A8JA 2ZJ5A 4DQXA 3ILYA 5EJ6A 2OYSA 1E9VA 2JJ2A 2IODA 4M1ZA 3UGJA 5H5JA 2AFHA 3ZBPA 1XZHA 2X7JA 1IUNA 4ZCLA 1CHNA 2IZ6A 2WKSA 1E7MA 3ZWNA 1EFVB 1XF1A 4UNPA 5L9BA 1R3UA 3HQUA 3P7MA 4L08A 5K8SA 2WHYA 1I4OA 4EBFA 1DIRA 3IAM1 4URTA 1N6KA 4CKXA 2C4TA 1JI3A 5K3SA 3AVVA 3IO3A 2QRZA 3OCXA 4JL8A 1K4YA 2CK3D 5CNIA 3KWVA 3R7DA 4CNQA 3DWEX 5IRCD 1PFVA 1YHZA 4NFLA 3OHSX 5EXOA 4WERA 4NE9A 5C3QA 4O29A 4Q2FA 2YFZA 4A8TA 4W8HA 1L3JA 4QPNA 3K8YA 2R47A 1HLPA 3FPKA 3I62A 5AC93 1NF2A 1BWRA 4KSCA 2SICE 2H2GA 1EDEA 2WF7A 2H6CA 4QBGB 5AW2A 3D82A 3V0BA 3WC4A 5GIPE 1G6KA 1TB4A 2Z2XA 4YCLA 1I2MA 3WS7A 1HXHA 2RJ2A 4L0PA 4OTZA 1E64A 3RC1A 1BEZA 2HBQA 2GAJA 3HU3A 1Y8RB 2Z58A 4CMEC 3P45A 1CQXA 3I3MA 1HEIA 4YO7A 4AZSA 1G41A 4NCIA 4EG4A 1MZPA 4NEGA 4IJWA 4AYWA 4DWVA 4UDOA 4LKFA 4CMJA 2QF7A 1LOFA 5FYYA 4DKJA 3H87A 5BSFA 4R5HA 5ALEA 3USCS 2Y1XA 4TWJA 4WZZA 4M0FA 1XVLA 4LYAA 3TD9A 3HBJA 2HGZA 1ZJ6A 3DXZA 2II6A 1P5ZB 5ENZA 3ZIXA 1GQ2A 4NWWA 3OCJA 1S2EA 2AFHE 4OHKA 3HI4A 3MIDA 1E1QA 5KHKA 2QTHA 5D00A 2ZRAA 1N5KA 4NCHA 3K0CC 4B2IA 1NR7A 5G0TA 3TAUA 1BCSB 4G0ZA 5ISMA 4UEOA 1JU4A 3HIFA 5HZGA 1ZYBA 2QLTA 4HHEA 1UD1A 5IKEA 4PCLA 3CDZB 3HA7A 2JGLA 4AYTA 1CY6A 3A21A 3NJVA 4RETA 3K2BA 4A8JB 4ZU6X 3LY7A 3RDIA 2X2EA 3ZWBA 4PQQA 2B9VA 1ULFA 3RYIA 3CF6E 3I97A 1CR4A 1OX4A 1P5HA 2Z98A 2AFHB 2UWBA 1X42A 2KBEA 3UJCA 3VA7A 1P75A 4BPRA 4GDMA 4QKDA 4RTOA 1DCKA 2WC1A 2JK1A 4K6GA 1OI2A 4NMMA 4IUCS 1O7JA 4HWPA 1NBEA 1Q17A 3LCJA 3RSCA 2CNWA 1L6IA 1Z8FA 4Y1XA 4BLSA 3OD5A 2Q5OA 2ZRNA 1IDN1 3NHMA 2PSSA 5EMMA 1WDMA 2O4CA 4P14A 4IE4A 4RPJA 3PR1A 2RDSA 5KNDA 1Z63A 3SEEA 1ESEA 4AKSA 4L72A 2J3HA 4HDRB 4N43C 2FWBA 4RGVA 1F8YA 4MVJH 1X8MA 5LUAA 5H02A 4B6RA 3ZU6A 3ONDA 5E7MA 1DC3A 3AYDA 2CXQA 4BZPA 1E9DA 2V9PA 3E70C 2CLMB 2W2KA 3OY8B 3AV3A 4LF9B 3PCXA 4C7JA 1DJLA 1DRWA 4XQWA 4L4YA 5K3FA 1RAGA 3CMGA 1I13A 1MBZA 3LA7A 1IMOA 1X7WA 2C92A 5KYXB 3BAFA 2BFAA 1G9SA 1REEA 3IBGA 4JTOA 4Y2SA 5CYFA 4A92A 2LTNA 2VK1A 3P3PA 1UZMA 4IDOA 4DUGD 4CP2A 1Q50A 2Z2ZA 5CVEA 1E63A 4OZOA 3D3KA 1P8JA 2ZSKA 3LDRA 5DLYA 4BCDA 1DAIA 1XMJA 1TT5B 3MUZ1 4BVHA 3RJZA 2XNJA 3A2KA 2C9ZA 4HGQA 3UUGA 4FD2A 4FFWA 4YVSB 4G4FA 1W76A 5AKGA 3K0AA 3ZLJA 4XW3A 5F37A 2IU6A 3OX4A 3RJTA 4F2DA 1Z0AA 4B85A 3BOSA 2A92A 4Y18A 1ZOPA 2XE7A 3KLNA 3RYIB 5E3JA 1DEAA 4I4NA 1XWFA 4N48A 3D54D 1OX4B 4ZMBA 1P4RA 3PUIA 1CJDA 5MFPA 1QH1B 1K6XA 3WSOA 4UBNA 4NE7A 2WJ3A 5DEOA 3WNMA 2IEZA 3NWBA 4RTNA 2R1BA 3AXEA 4HNGA 2Z3VA 4QREA 3N2KA 1ODMA 2J59A 3ENWA 3LV8A 4UNNA 3IEUA 1U5IA 2WNSA 2HKIA 3T3GA 2Q27A 4O9EA 1MT0A 3OWXA 2HK9A 1W9FA 3NBYC 2HNKA 4IZOA 2Q28A 1BXHA 1L2TA 4Q4JA 3KOMA 2PGDA 1O77A 2RHBA 3TQRA 1JNYA 4GLOA 2H85A 1P8AA 5LNK1 4YP7A 1II0A 2VK2A 2GN8A 4P2GA 3ADOA 3O83A 2DFLA 1S1CA 5CD1A 3W8NA 2W7TA 3P8ZA 3TEXA 3WHPA 1KYTA 2D3SA 1WCYA 3IEVA 4EX7A 2VZVA 1P5JA 1JU3A 3AZZA 4PHHA 1L5OA 1SIOA 3RTDA 3IFSA 2XA1A 3KB8A 1KZYC 1ULOA 4L1KA 4IZIA 2IF0A 1GG8A 3D2BA 4L8LA 4C2TA 3WLQA 2JLYA 2VI5A 5K3FB 1ADBA 1NN1A 4QX2A 1EJ2A 1M5TA 1X7WB 4MKXA 2P0YA 4P8RA 1KSJA 1L8OA 1NF8A 3RHZA 1AL22 1GCIA 3AFNA 3MIGA 2E31A 3DV8A 5IJZA 3MWDA 2HJSA 3FYCA 1E62A 1ZQ1A 3FVVA 1BMDA 4MVJD 3OJOA 4OQZA 3CUUA 1LKNA 4WKCA 2FHSA 4X0EA 2IZ7A 2VDPB 4XAAA 1XQ1A 2J41A 1Z8NA 4E7PA 1TJ3A 1HRKA 3ZWCA 5JTTA 3AZYA 5AHWA 3PNKA 2CK3A 3IDEA 4O33A 3VBUC 4PDWC 2DKFA 2CJWA 3I7DA 2RHMA 5B12A 1J84A 1OTHA 4FMCB 4YMWA 2BH2A 4RPKA 5HBAA 1ACJA 1NW5A 3KR2A 2Y1KA 4DR6B 1MENA 3BWMA 4B44A 3HBFA 1E58A 1OA1A 3Q9UA 2TMYA 1RRKA 4EUEA 3IE0A 4C1WA 3LPAA 5C53B 2Q4OA 5E0KB 2O8DB 1VBD2 4Y1EA 3CEPB 1POV3 4M9SA 3H13A 3KEGA 2HYIC 4F83A 3OBZA 1TFRA 4FUTA 4LF7B 1Z2OX 3OT1B 2JWPA 5TS3A 2BY4A 3CPEA 4UMVA 3SLIA 5CVJA 3D81A 3UJAA 5D8DA 4P0QB 2VZTA 4IZ6A 5TC4A 5ICSA 1UPTA 4DDUA 1CJBA 4OKNA 2DM6A 4JDOA 4NPLA 3S6PA 2AFRA 4LZOA 1Q7TA 4E4YA 4K3VA 3OTQA 2Y68A 1VPEA 3OPZA 5ALHA 1H3NA 3WFZA 1HRV2 3GEDA 3HSYA 1NQVA 4PWYA 5BWMA 3INGA 4K6HA 2DT5A 4OGKA 5E88A 2JFWA 2JAHA 1O5OA 4QUIA 1Q3HA 1Q77A 1FYVA 4EA6A 1X8KA 1F6BA 3FFQA 4EWAA 3MGBA 5EUQB 1KETA 5G4KA 1XKQA 3QMVA 2AMYA 5EUMA 2PS3A 1QJCA 4NS1A 4QOIA 1KAMA 4J7CA 3KLOA 4Q7EA 4ZYYA 2J4FA 5IK7A 3H5IA 1JKXA 3FBMA 1YJQA 3M0EA 3IV6A 5BSWA 4Q9AA 4EVRA 2X6RA 4M3CF 4RDIA 1JQLB 3QHPA 5BYAA 4EUFA 1COWD 4N5IX 3PJDA 2Q1WA 2O50A 3TMAA 4EABA 3VH2A 5H7XA 4CDQA 2XEXA 4AZVA 3AVXA 3B9RA 2C7VA 4RENA 2VAXA 2WU3A 2PH1A 3N74A 1XB9A 4YFZA 4FYVA 1B0PA 1B43A 1DFGA 2YV8A 1VHQA 3PURA 1MKYA 1RL3A 1PFKA 4EJ6A 4BEBA 5G05L 1VBKA 1KK0A 1Q92A 3KQWA 4COYA 2AF3C 3R3WA 3EWSA 2PUEA 4WOKA 1T8SA 4QYSA 1WULS 1RJ9B 4A2WA 1UMBA 4KI5M 2F1IA 4PLTA 3NDPA 5LJIA 5J48A 3QW2A 4CPDA 3RYHB 4PO8A 3KKOA 2MEV3 1V37A 3RVLA 1TME1 5KC9A 1E2DA 4OXYA 4JKIA 2XMBA 4G1EB 1XZBA 4YM3A 3PQCA 3WNDA 4A6EA 2Z09A 5H9VA 1RYYA 1T2NA 4JDMA 1HEUA 4RJLA 1XZIA 1VMHA 3D0KA 4ITRC 2XQGA 2RMKA 3VU0A 5FA8A 1R12A 4KIJA 4MV1A 2JCGA 1N3YA 1IY2A 1W85A 4BNFA 5AXBA 3RYFA 5TQ0A 1R0BA 3R05A 4DUGA 1M66A 4D57A 3INYA 3HKDA 1VBB2 3TRSB 4AVVA 3A6KA 4RVDA 4DR2B 3ZIUA 3HCRA 2PJRA 2GERA 4YUZA 2WA2A 1TEZA 1OAOA 3DF9A 1FPN2 3FF1A 4XWOA 3X2FA 2WR9A 3CF4G 4N3BA 4Y7DA 2QN2A 2O8BA 3C7AA 1WB6A 3ZXGA 1G17A 3IODA 1TLFA 3NNNA 4E21A 2XHNA 4GMHA 2H4WA 4EYOA 2IIPA 2H92A 2BRUA 4BQPA 4J91A 4L27A 2P5BA 1KWKA 1H94A 3POEA 4RV9A 4RULA 5NULA 4RY8A 1PGL2 1HFKA 2QIOA 2QZZA 4MULA 1AD2A 2JCVA 3ZWPA 1NIJA 2GXUA 4A15A 2OD7A 4CDQB 1P2VA 3MM4A 2QWXA 1I4EB 3TR5A 3HUUA 2XE6A 2BKUA 4XZPA 1V41E 1V39A 1DI0A 2BBAA 2BYTA 5FBZA 2AJTA 4D94A 4YZ1A 4XASA 1QLJA 2FP4B 4HWRA 2CVHA 2JI8A 4W5HA 5C3PA 1IULA 3MBIA 2RM21 2D2EA 1GQYA 4D0SA 1M06G 3U81A 3FR7A 3H7IA 5DLPA 1E1RD 2PUTA 1XCMA 2G9ZA 3CBNA 2VGDA 1CIYA 3ME5A 1YC2A 3OG2A 1UIKA 5CP8A 1NDUA 3WISA 2XQKA 4L0CA 1VI6A 3GW8A 5IHPA 1Z39A 5J37A 4AJ1A 4LBKA 5FXXA 3DTYA 3BH6A 1AR71 2VW2A 4H4EA 3MCAA 1Q16A 1VXRA 4D4GA 2CUZA 2ZX3A 3HEMA 4DZZA 1W85B 3N4MA 3DYPA 3RYFB 5TQ0B 4HYYA 4MVJA 2C26A 1PMJX 1X74A 2ISCA 1SB8A 4GBGA 2C83A 4RHUA 3HKDB 2VHZA 1JHJA 4E5SA 1ZJ5A 3UV6A 5H9PA 2Q1TA 1H2BA 3JVVA 2UZ3A 4JK3A 4X8HA 1P4JA 4OUSA 1PT8A 5K2OA 5FKBA 2WN2A 1OFTA 3DMPA 3DKVA 4DCMA 5F8PA 1DKOA 2WSMA 3VDQA 1DLJA 3O1TA 2RH8A 2DPXA 2GEJA 1NULA 3OOYA 3F5DA 2EKQA 3ZV4A 1VQ1A 3C4JA 1XE8A 1Y4AE 1VLMA 2MSWA 1S8OA 2CVQA 2E63A 3ACLA 1H8HD 1KAGA 1KRHA 4GQ7A 3OP1A 4NULA 1QU2A 5FEMA 2ZOEB 2XNDD 4JJZA 1E96A 1L5MA 5EI5A 5ALMA 5HRUA 2IGBA 4KUEA 4URWR 1RUJ1 3QUQA 5DYGA 3GZNB 1XU2A 2VRCD 2YJGA 4QX0A 1WP9A 2QSJA 3SF0A 1XTPA 4HLCA 2YBSA 2HHLA 3IUBA 1E5RA 2FPIA 4QHTA 2FMXA 4HXYA 5DNEA 5K0ZA 4JOSA 1QP0A 2CXRA 3C87A 4OHMA 1UMDB 3P9PA 3ZIWA 1RXVA 1N7HA 2YX1A 1HLGA 4Y0NA 4W63A 2FSIA 1NMXA 1LEHA 5JYCA 1G0OA 3ZMNA 1F35A 2QTFA 2ZJYA 4UU8A 3T0FA 3O73A 1DHRA 3PVEA 3LFHA 5FUYA 2ODNA 3IAUA 3PPWA 2XQFA 4KXFB 2P35A 4U1RA 1HV0A 1ZMRA 3AGPA 3EQEA 5BMOA 3WLTA 1K5GA 5F2OA 1RQGA 2WE8A 3H05A 3CO5A 4MVJE 3TF5A 3WLJA 1O97C 2J1AA 4OHXA 3TKLA 2PGLA 3EGXA 1KHHA 3C3DA 1QJY1 3NU1A 1ZRRA 2CZGA 1QVVA 3ON5A 1G3MA 4QATA 3ZD6A 1DKUA 1KJQA 4IPTA 1ZM9A 1IRXA 5KOYA 3VPDA 4NFHA 1MX1A 1YU6A 2XJPA 1HG1A 3L7IA 1PHMA 2I9KA 3TRFA 4MS1B 4KQFA 3GLIA 3VHPA 2HEYF 5A7PA 2X8KA 1ESCA 2ZTUA 1XQNA 2ZEZA 1AS2A 4FBGA 5E9WA 1DWPA 1JHQA 4P81A 5EFZA 4YG3A 3TS1A 2VZQA 3QF7A 4OSOA 2D5FA 1KI3A 4MWSA 5JR3A 3OUIA 4PT6A 5DHTA 2QKYA 1PS9A 3TJMA 4A7YA 1RACA 1VDMA 4Q9IA 3ADDA 4ZQBA 5CPBA 4CQLB 5GZCA 1K3FA 4I9NA 4NAHA 5BRJA 5ED0A 1X1AA 1U5BB 1VSBA 3HJTA 2VVDA 2YG0A 1TUBB 1UJ2A 5EVJA 5BXYA 4CSWA 4QWNA 3UATA 2WTNA 2Y4NA 2DU8A 4KRYA 2J9GA 4KPUB 4C7BA 3BDAA 3CXUA 3LBIA 1XPUA 2CL6X 2WHXA 3G68A 5DE3A 5AVWA 2I99A 2HXGA 4KFSA 4ZQFA 3PWSA 2RR11 3NVKI 2XMLA 3FGPA 2HPZA 3KXLA 2GD6A 2QT9A 4CUJA 2OORC 1NVGA 2MSEB 3QPWA 3D8SA 4CLHA 2O2IA 3SXPA 4PU0A 1USWA 4DRZA 2YGLA 1RZRD 4YM1A 5JPNB 1HF3A 4A91A 4R4XA 1EY2A 2CDPA 5FL7D 2NTVA 3CHXA 4PIMA 1Y9ZA 3RZHA 4HVCA 1U3FA 3H84A 5HW0A 4FGWA 4RQAA 1UBHS 3R6WA 2R062 3GLIE 3GELA 3NHKA 2O0KA 1YUNA 1YBAA 3AKZA 1CFZA 4H2AA 1T3LA 4ZVOA 1FTSA 5DUUA 1M2VA 2WMDA 1QQP2 3DE7X 1H1LB 5JANA 2KLHA 1USUA 1VHTA 1WJGA 4AF9A 1XD2A 3NP7A 3OWOA 4WJKB 4ARCA 3FLRA 4QDRA 4F6RA 2HV9A 1PMIA 3C98A 4N4AA 2WJ4A 3R23A 3UK1A 3T3MB 1T4GA 2VK4A 2PHDA 1PFUA 3GLIB 4D8UA 1NVTA 2Q6TA 2DCJA 5IDYA 2X8WA 4ND2A 5KTOA 1EXMA 4LYGA 3QSGA 4DDTA 3QJGA 1M6HA 1UH5A 3ZYGA 3JWPA 5TEWA 1I2CA 3B5IA 1GZ7A 5CJ2A 3DOIA 5BNPB 3NCTA 4GWLA 2RHPA 2V65A 2WUWE 2E4UA 2HFJA 1UOJA 1Z33A 2JIOA 4MINA 2VSFA 3NQ41 5JAXA 4UXHA 3OSUA 3I59A 3BKXA 4E12A 4XB1A 1V7CA 2JECA 1I7PA 4B7ZA 5C71A 1J1UA 5GONA 4WKBA 2FA9A 3WDWA 2AA3A 1W4ZA 1YVEI 5A4AA 4AX8A 1Z62A 4DV0B 4AW9A 2X7HA 4M8LA 1L5VA 2HBUA 1HIXA 3SH3A 2V6GA 4EJSA 2Q8EA 4FFIA 2OILA 1E79D 1E1RA 2MINA 2YMLA 2ZSUA 1DPGA 1ZUD1 3GIDA 1YRZA 3MT8A 3QVTA 4R9UC 4E4SA 2C2MA 5JTUA 4NFSA 1Q8QA 4WCVA 4F2PA 4WXYB 1VYTA 4YUWA 4BLUA 1TI7A 2XUJA 4KG8A 1EIWA 5EJAA 4UUPA 2PFWA 5A4JA 3CT6A 3MTQA 5F3WB 4D4IA 4CF6A 3QA3E 2JG8A 3IELA 1JBEA 3LFMA 2HHAA 3MJRA 1FAYA 4DG8A 2XWBB 1SZPA 2D4HA 1KYWA 2C8KA 5ELXA 4CU5A 4RJKA 4MO3M 2O5EA 1ND2C 1OI6A 2OBBA 3PCTA 1M6WA 2BGKA 4UU7A 2QL5A 4DJEC 3CNOA 1KDRA 3B2EA 4ZYXA 4FAHA 3QKSB 1V6AA 4B3SB 3LA2A 2WVJA 1UCFA 4LK6A 1W4BA 1L5NA 4JT8A 3POJA 1OUXA 2QOEA 4PQYA 2NVOA 4L2NA 4Q4V3 4ZHQB 3NIBA 2WDPA 2HU7A 3U40A 3I9V1 3U61B 4F6RB 2VBGA 4XTCS 1I6XA 2BKEA 3C70A 4F6CA 4RD4A 1IGOA 3T9FA 1SB9A 4N7IA 2XNDA 5CR9A 2CCKA 3W3AD 1KZ4A 1U63A 3K77A 1DADA 2AB0A 4Q3LA 5CB4B 3A9CA 5MGNA 4PC2A 1IRIA 1WD7A 3RREA 2FDCA 3K8ZA 5ERYA 2O1EA 3BE5A 4GLBA 3DJFA 1Z7EA 1K3UB 3WKAA 1GNSA 3UT0A 2FW9A 3C3PA 3E1KA 2FMTA 2HMWA 4EW2A 1FFGA 3ON7A 2OKXA 4WT7A 1Y5IA 4BO6A 2BMWA 1F38A 1G8WA 3I59B 3W6OA 1H8ED 3A9UA 2YU2A 3K9NA 1HFWA 4RSUA 1N3QA 1XZ8A 2WWIA 4QB1A 3DPRA 2AC2A 3Q6MA 2RHGB 2X7XA 3OIUA 1KVQA 3SYTA 3O8BA 2BEUB 2EZTA 3TRDA 1GAQA 4YARA 1KXZA 2H9YA 1KDKA 3N3BC 3VR3D 4C0AC 4AI3A 3NV7A 4JI5B 1T8YA 3EASA 1KJ8A 6YASA 2Q6LA 5DSTA 1FP4A 5LA1A 3MWGA 1PG0A 4RNCA 1W9YA 3F1KA 2I78A 2VAUA 3MA0A 4D4JA 7YASA 4IVQA 4RD7A 1PO11 4NZ9A 1USIA 2I6GA 2FSVA 3PF8A 5DULA 4D9GA 4LBYA 5LIPA 2WJZB 3DMHA 4XETA 1YZHA 5IFKA 1AK9A 2OBMA 3R0VA 3N9MA 3T3YA 5JCZA 1F15A 5FZ1A 4XVRA 3AVYA 4Q3DA 3RTGA 4J6EA 1WZCA 5IC5A 2G25A 3CJTA 4C08A 3P9KA 3R8XA 3RTCA 1NW9B 2Z5VA 3VO9A 1NA1A 3HT1A 3UWMA 4EGAA 1K7FB 2QTAA 1UMCA 3BRWD 3ICQB 4C8DA 4YR7A 5EYYA 4IHQA 1Q2UA 3B3GA 2QAJA 5J5AA 2CBZA 4K81B 3H9BA 1Z7S2 3VU9A 4TLMB 3A1UA 2CVOA 4JWTA 3LP5A 5C1BA 3GZEA 2GN4A 2I67A 4DR3B 1UIJA 1N8KA 1MX3A 3KPWA 3NR2A 3R7BA 2VRWA 2DFNA 3IT0A 3TGLA 5KQPA 4F46A 3DDHA 3C4QA 1QQAA 4Z07A 1ZX1A 5IM5A 1UMHA 5AOBA 4ES8A 3FYUC 4D6RA 2CD9A 3EQ9A 4BOYA 1P91A 3JY6A 5MN4A 4X6UA 4LAFA 1RZRA 1D6SA 5E38A 2Z5FA 1W2AX 2Z8ZA 1RINA 2HR1A 2AUTA 4HWGA 5FL7A 2Z9CA 5KO2A 5JSPA 1YULA 3TX6A 4Q3BA 1JGTA 3ZXXA 3DPRB 1FTWA 1XMSA 1DEHA 4CA9A 2WSLA 4DV7B 3H8XA 3O4HA 4UM5A 1Y7HA 2PTGA 4LR4A 4IUDS 3F4LA 5EQDA 4Q6BA 3LYUA 5A6YA 1ZK0A 5G0UA 5ALQA 4RZQA 1XDUA 1JHVA 1SZBA 1FP4B 3ECAA 3U4AA 4LMPA 5L4LA 2X5XA 4ARBA 2WOJA 4DY6A 3WWDA 2ID8A 1E8MA 3ZCXA 4COUA 3ZWDA 3CLVA 4CUBA 2NTNA 4G0WA 3ZDVA 3ITDA 4YZ4A 4FFGA 3HNOA 3WLIA 5EJ4A 1IBLB 5C9AA 5KCMA 2Q7DA 1SKMA 1NHGA 1VKRA 1I4TD 4DPKA 1YIPA 3KCQA 4TLDA 2ID9A 1KE2A 1FJHA 1FDRA 2JFGA 4RZSA 2HNBA 2OO7A 3CQ9A 3AUSA 2R2GA 3MJ4A 1MS5A 5C8WA 1I6MA 4CMEA 2BMEA 2FW6A 1WZXA 4PO9A 3AUYA 2FDIA 4R2HA 2VPXA 2C8VA 4IJ6A 5K3BA 3CTPA 3K5IA 1RUOA 1UW8A 4XSVA 2GK7A 4LPSA 4C6TA 2GRAA 3AJZA 5E4TA 1LDYA 1X1SA 3O75A 3BN6A 1JQ3A 4F3CA 3RW9A 5I8ZA 4MROA 2J0VA 3A6EA 3AKQA 4AJ4A 4JJ8A 3S1LA 1QLWA 4S2UA 4WDQA 3DL3A 1AJOA 2WZPP 4FFFA 3BKWA 4EPXA 1E79A 3IDQA 1SN7A 4P9NA 2QD2A 3V8MA 1U5ZA 3WWZA 2PMFA 4JC1A 1UANA 3CVOA 3RYPA 2H6EA 1QV7A 4YWHA 5SZKB 1P2TA 5IUKC 5K8UA 4EJ0A 4FMPA 3DN7A 2ZUTA 3K0CA 4ZCTA 4BNUA 3KFLA 3RJRA 4X45A 5B3AA 2WHPB 2GAIA 5J98B 5JIAA 2BW8A 4B45A 5LD2B 1I5OA 3PGMA 1NKGA 4FYHA 4DWOA 1DS6A 4QXBA 4TKLA 1U3CA 2H07A 2ZZMA 5FNVA 1SZCA 2VTBA 5T67A 4B0PA 4Q26A 5FY4A 2BE7A 3GDHA 4POOA 3FKJA 2IXFA 4II2A 5AVZA 2F9LA 2VJQA 5JHGB 2VTXJ 2V5DA 4KNVA 2OCKA 1W1IA 4BNXA 1FYFA 1MB4A 1CAUA 2I34A 1IXZA 1F51E 4EHNA 5JPMB 5JQGB 5DB4A 3B69A 3MTGA 4HWOA 5I4CA 4IAOA 4RLQA 2V7GA 1CCWA 1I0IA 5AQ1A 1E2FA 2ODEA 4UATA 4LQRA 2IYZA 5C8CC 2HSZA 4CUAA 5I0TA 2EIDA 2Y99A 2JIGA 3OPTA 3DEFA 2C4UA 2XRFA 2EQBA 1T5SA 521PA 1N2EA 4WAUA 1TC1A 2PUCA 5M04A 4N43A 4FLMA 4DUYB 1WF6A 1C8KA 1GG5A 2ILVA 7MDHA 3L0OA 4X3OA 1U5XA 4RYLA 2OCIA 2VATA 2PQ0A 4BPZA 5AW3A 1Z6QA 3M3QA 5F76A 1XYPA 5ACA2 5EP9A 1OXXK 2HA6A 3EIWA 2QRMA 4Y7CA 2XYHA 2WT0A 5GPBA 3TJZA 3AVUA 2A3NA 4QELA 2ZBVA 1S3SA 1M76A 1D07A 3TNFA 1XYNA 5B4XA 3V56A 4KCGA 1O54A 1G9XA 1YZYA 4TSRA 4KAAA 4J6GA 3VMFA 4QQ8A 1H8EA 2ZZQA 1PDVA 4MQLA 3ZXYA 2OUIA 4Q02A 3IYLW 2DCUA 1UBKS 1W8WA 3DOHA 1W6NA 4EF5A 1PV2A 4W50A 3RMXA 4KWLA 1A1SA 2JLQA 4Q4X2 2FZ2A 3VR3A 3LQ2A 1VGVA 3LS2A 1JDVA 2G9VA 4QPCA 4HEA6 3AF0A 1B0UA 1KU6A 2YVUA 1ZM2A 3W05A 4RD0A 2E21A 4R1TA 4DM4A 1RAHA 4RPLA 1UYPA 4A0GA 2GPTA 2LVBA 3VHXA 5HPYB 5HR5A 4YLGA 3SCFA 1N0IA 3M8KA 3H6GA 1QFJA 3G7NA 3ZWOA 4ZD6A 5ALYA 1XF9A 4CM6A 2WWHA 3U3JA 4C22A 3JQXA 4OSEA 4RKQA 5FNVB 3DO6A 1X82A 5CNJA 3AY7A 2ZRJA 3HVIA 2Y9PB 4DGQA 4GPIB 4D0LB 2UYAA 2BGOA 2DWOA 4F4FA 1PVC3 2BN4A 2Q5LA 1HGXA 3I1JA 4L0DA 3C7GA 5TMEA 4EYQA 4HQNA 3N2LA 2EKBA 2ZDHA 4A82A 3FMVA 1CR7A 1R8XA