2G9ZA

Thiamin pyrophosphokinase from candida albicans
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
322
structure length
297
Chain Sequence
SELIEQVIEQPDSLIISPPSYNHIQPFVYLHNVLLILNQKITIDLISLWKKCEIIVCADGGANSLYEYFNLQRSDYIPDYIVGDFDSISPDVKTYYESHGSKIIRQSSQYYNDFTKSIHCIQLHYQLNHTKENWFESIDEVDGLAKLWNGLNNSSDVVVDIDITIYVLNAIGGRFDQTVQSINQLYIMNEDYPKVTVFFITTNDIIFLLKKGVNYISYKNRLMFHKDNGSSPTPTCGLLPLSNKTPIILNSYGLKYDMRNWKTEMLGQVSSSNRISGETGFIVECSDDIVMNIEIDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords thiamine pyrophosphokinase
publication title Structural characterization of CA1462, the Candida albicans thiamine pyrophosphokinase.
pubmed doi rcsb
source organism Candida albicans
molecule tags Transferase
total genus 95
structure length 297
sequence length 322
chains with identical sequence B
ec nomenclature ec 2.7.6.2: Thiamine diphosphokinase.
pdb deposition date 2006-03-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.320 Mainly Beta Sandwich Jelly Rolls Thiamin pyrophosphokinase, thiamin-binding domain 2g9zA01
3.40.50.10240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Thiamin pyrophosphokinase, catalytic domain 2g9zA02
3CQ9A 2HH9A 3S4YA 1IG0A 3MELA 1IG3A 2OMKA 3LM8A 2G9ZA 2F17A 3IHKA 3K94A 3L8MA
chains in the Genus database with same CATH superfamily
1CZUA 5ECDA 3NBKA 5IJ0B 1E0KA 1V6CA 3HL4A 1QH1B 3NZEA 1JYEA 3EWNA 4U02A 3UJBA 4PCAA 1LY1A 2JDYA 5A7WA 4Q15A 1Y6FA 1M83A 1HZZA 4AW7A 1ZU5A 4DMHA 3V4SA 1A8SA 3AKDA 1DDLA 4LWOA 1UIRA 4P6VF 1CY2A 3OM9A 3TBHA 4ENVA 4XAQA 4ATNA 3IPYA 1JNYA 1KOGA 1I1QB 4PPNA 3IOMA 4OHYA 1C1DA 3UV9A 2JGDB 3GARA 4JVOA 5EIXA 3TTVA 3ZM8A 2C98A 2OAQ1 4HO1X 4LCJA 1P0IA 5KKNB 3LPAA 4M1ZA 4G26A 3W5UA 2WZCA 5CU1A 4QOHA 4HH4A 5ED4A 4LKDA 1HYGA 2A0FA 4JI5B 1FPN3 2A0UA 1FMCA 1UXJA 3IT0A 2JE7A 1WXQA 4IXNA 3IP3A 3A58B 4INAA 1ZYBA 3IKVA 3NYQA 1T2FA 5AQEA 2RK3A 5CXUA 2DPMA 1GOHA 4W82A 2AZTA 1SUDA 4CQNA 3D02A 3AJRA 2SICE 4DHWA 1CRWG 4ZT4A 3RRJA 1I36A 1TADA 1Z8DA 4NOKA 4QBHA 4BATA 5BNQA 3PF8A 3GBPA 4ZYUA 3VR6H 5EP3A 4FQ5A 2ZS6B 1KZ9A 3OOEA 3T1OA 5KHIA 4QIHA 3AR6A 2C5DA 1K45A 1EFUA 2M9MA 1E2BA 1XP8A 1L8LA 4N3CA 7REQA 2VK4A 3CKLA 1EUUA 1QP8A 1KC3A 2OYCA 3WLLA 2OT3B 2PH7A 3O8NA 1EX9A 2QZ2A 3N53A 4RE5A 3ZUGA 3WIVA 3VBHB 4I02A 1CF9A 4W9RA 5I7EA 1RUH3 2H2FA 1WL8A 3HXKA 3HWWA 1HNNA 3D8UA 5T4BA 3CKYA 3RRZA 3VR3D 5T41A 5EFZA 3ILNA 1U2GC 1D2CA 1N7JA 3FMVA 3T41A 4LISA 1J2UA 2XTZA 5IH3A 1SBIA 1V5IA 3I9KA 3HAGA 4UUMA 4WN9A 1SBTA 1GITA 1XA3A 4ZI2A 1YR1A 3UENA 5KYUB 1XKTA 1S2GA 4WVVA 1HJGA 2DH5A 4LRTB 2GRAA 1FIUA 2EJBA 3A05A 5BUZA 4RZ2A 5HE9A 1YK1A 1BD4A 4EF4A 1I5OA 3ZDXB 4QXRA 2QG6A 3GJBA 4EDHA 3RJRA 4ZICA 3NYIA 2QMOA 1WD4A 1WCUA 4RVHA 4CCYB 1DC8A 1F3LA 1TYAE 3CEJA 2I3ZA 3KALA 4RM3A 3W04A 1K08A 3HMKA 5B58T 2COEA 1NDUA 4JTNA 1SXPA 2H92A 3HY6A 1URXA 2FCVA 3KYIB 4COOA 1ZI6A 1DIAA 1JYFA 1HJFA 1Z5VA 3R0QA 4QX1A 2H9IA 1XBFA 1K5MB 1O58A 1Q1QA 2ZKIA 3BREA 1O97D 2X05A 2Q2NA 3GNSA 3KC2A 2G0AA 3WDMA 2B25A 4BVJA 3G6JB 1YQTA 4HN1A 4L8WB 4HWKA 4KQFA 4LO7A 2I2FA 3HJGA 3A1WA 5KU7A 2VTEA 1QZ3A 5DSZA 2ZUBA 4KDCA 1PGW1 1LS6A 1PGNA 2VDVE 1K1EA 1XTBA 3VBRA 2VF7A 3UANA 4A5OA 4OZXA 3M6AA 4NNJA 3HM9A 2CLHB 1UAAA 2RJ3A 1R37A 3NH9A 1CEXA 2BKXA 3WL6A 4K86A 4BUJA 3ZJ5A 4IP0A 2XGGA 2RHOA 2RMKA 3RJTA 3ZIWA 4RHYA 2FEAA 2VJMA 5I4CA 4R2XA 3Q9NA 2X4DA 1ULHA 1OUXA 1Q0RA 3EVEA 2XUKA 4XAAA 2CEAA 1FB5A 2X42A 1E94E 3NP7A 4C78A 3NUQA 4E5SA 1II8A 1DZRA 4HLUC 3GZUC 4TTPA 5ALPA 4HWTA 2WZDA 2HNKA 1B41A 5B4VA 3WG1A 4YMUA 3OPNA 4OQEA 1OWPA 4GT1A 1U04A 4LQCA 3X1ZA 4XGNA 3BSFA 4BAZA 3ZMOA 5CDGA 4G8BA 2BGUA 1BS9A 3N8KA 4MV7A 5EP4A 4IESA 2ZRMA 4F72A 1HDKA 2MWMA 4HZUA 3TL2A 1Q22A 1YRYE 4FGLA 4JX9A 5JH7F 2BVNA 4ZEWA 3GYDA 4KE6A 1Y4AE 1KO7A 4Z51A 5KBYA 4KAFA 1N92A 4OU4A 2C9CA 2NMOA 1YVUA 3SF8A 4UQOA 4FAGA 2XOKA 5IEBA 2J3QA 1FYFA 4WKCA 5AOVA 4CU2A 5KWEA 3HDHA 4QDOA 5CFDC 5CH5A 1SU4A 2YHSA 1A8IA 1BHJA 4DJJA 4A5SA 2CDPA 4ML3A 1SIUA 3I12A 5EUBA 1DRWA 2R7NA 2DTYA 5U9CA 4XSHA 2X53S 1J1LA 4BQEA 3CUVA 3GJSA 1IVYA 3RHSA 1JEJA 1RUD1 3WGGA 5DUUA 3F49S 3W6PA 1V6MA 2QE6A 3KZ4C 3ECCA 3DZJA 4DJ5X 3IT3A 1NLUA 4JBIA 3OURA 1MO2A 1W4LA 4RXUA 4PNEA 3ASYA 3AVQA 3KV3O 1UMBA 1YTUA 2J31A 3RYHB 3SEZA 3FGZA 4M3CE 3R9IA 3FPLA 3VO2A 1E2UA 1JA1A 3UHPA 1B14A 2RH8A 2AVNA 4FDVA 1ARZA 4RMNA 3DC2A 3R3UA 3VC3A 2IFWA 4MQFB 3IBCA 2YXPX 5F7OA 4ECAA 3D8TA 1U80A 3CPEA 1LR5A 5GJBA 3WNCA 3GHYA 5J2TB 3EG9B 1KDTA 3AJ9A 4LVCA 1E2HA 1VBMA 2AR9A 3G5LA 4C05A 1LK0A 2H17A 4QPIA 3AETB 5CNAA 4NPCA 4RPIA 2Z09A 3ZV5A 2ADOA 2Z5GA 2EG5A 3JCIA 2Q6OA 2PO7A 4QKQA 1T3TA 3M2PA 5HUQA 5EJ2A 4HMPA 4W9MC 4WAUA 2JJYA 3A28A 2D6PA 3GR6A 2XEXA 4B4PA 2PEYA 1XA0A 4CUKA 4DLBA 2ASEA 4MJLA 4FFMA 2Q6LA 2O2DA 1O4TA 3ACBA 2ZQYA 5FWNA 2PL3A 1RGSA 4W5RA 2GCNA 4RVCA 5C7IO 1I5PA 5CFQA 1E3WB 1YFXA 1Y3AA 3TEFA 3HKDB 5IDWA 1THZA 1PTJA 1ZXXA 4E1AA 2CVPA 2VW2A 2ZEWA 1ZQ9A 4F3TA 4DBVO 2QUZA 2PL9A 3T9BA 1E3QA 4YQEA 4O65A 4WIAA 3IERA 3K75B 3S81A 5L7YA 5JEEA 2ZJ4A 2AG0A 2R8OA 4DZGA 2P41A 2QLMA 3OLXA 4YRPA 5KHGA 1HMPA 2O2JA 4CLDA 4JT2A 4TRJA 4AI1A 2PT7A 3QX3A 3OGRA 2K0GA 2WZR3 5EQUA 1MS0A 1O8CA 3DEHA 2ZUFA 1WOYA 1CDZA 4AQYB 4NPHA 3B3FA 1XYGA 1VSTA 3EVTA 2QJVA 3TW0A 2IWRA 4FI3C 2QD1A 4WA7A 3LAGA 2GPBA 2HWD3 5HBAA 1V37A 3UFXA 3LBYA 4XVHA 4F45A 3QOWA 3EQ6A 1HE8B 5DE3A 1FDTA 4QXMA 1VBNA 2NZVG 4BJHB 2PUCA 4BCBA 1Q2UA 1QBKC 2CYBA 2YY5A 2ORVA 3EBLA 4TQ9A 3L82B 2AE1A 3ZZNA 2Q9BA 2V4ZA 2DBIA 5C3PA 3CU7A 1YGPA 1DBPA 1M1YE 2CHEA 4HN4B 3WIUA 3VBEA 4S2EA 1N6OA 13PKA 3PS9A 3ONFA 4UXJA 3FM9A 3VR4H 3T5MA 3SHTA 2QTFA 4BZWA 3ZXLA 2PJZA 2BZGA 3HGQA 5DHTA 4BEJA 3I2KA 5AIAA 4UFJA 5K3OA 2G9NA 3OKFA 1SDDB 1KFEB 1VB4A 1XZBA 2VN8A 4KN8A 3C5CA 3F5MA 3TH5A 3FOBA 1JIVA 2O50A 1QHEA 2G71A 3IV6A 4YM1A 4ORFA 3VOBA 2C8LA 1ZDMA 3V8VA 4X3OA 4Q4CA 2J3MA 3KBOA 5SY6A 2CYCA 4ZHQB 1X7GA 3GD5A 4I01A 3HNRA 1B73A 2O2EA 2E6UX 5KVAA 3QCWA 3Q9UA 1FJGB 3FIJA 3VR3A 4J9UE 1YDGA 3MSXA 1RVF1 4K3VA 1K6XA 3CJQA 1SUCA 2JRLA 2ZAMA 4GBJA 3B36A 4PIVA 1WOMA 4BKRA 5FYBA 4O4HB 1NXOA 4YP7A 3A6LA 3RYPA 2GN1A 3B1ZA 2ATFA 2YJ3A 3NOVA 2AQIA 3CUWA 1JLRA 1H6YA 3UGKA 4N65A 4QGNA 4RTOA 1NOKA 4XSVA 4DC0A 2X8BA 1BXZA 4Y22A 4NULA 3GLIA 3I0ZA 5DGHA 4I30A 3OZUA 3IOYA 1NZCA 2XE8A 2WWFA 4LOTA 4FQZA 4BEBA 1Q83A 3NWJA 5EWMA 1GNYA 3GHMA 1UL9A 1OIWA 2OUHA 1MS5A 2CVFA 4XRRA 1X9TA 1REQA 4Q00A 1FOD3 4DQVA 1SKBA 4IDHA 1QH9A 1OTHA 3JQGA 3ELWA 4A03A 1UOGA 5CYPA 4GMP1 4REMA 3P9SA 4J75A 5J4LA 4AFDA 5TQVA 4PX9A 3LWBA 4YMLA 3JRWA 5GALA 1HZJA 3O8OA 1E0AA 2BEWB 1OI3A 5TSDA 2EAUA 4HRVA 4ND1A 4OCTA 2DUJA 1ULBA 1GTRA 1ZEMA 2IYNA 3U07A 1CUFA 1M7HA 2QX4A 2BNOA 4WNCA 3BE5A 1GADO 1HYBA 2Y0DA 5KTRA 2VJPA 5JY1A 3LFHA 1PGPA 4FXKB 1YUBA 1EX1A 2FMYA 1T0UA 1IQDC 5A3QA 4UCWA 3JVDA 3U78A 2CJFA 2W2KB 4DPLA 2V9CA 5ADHA 3FOAA 1QIFA 3KWLA 2WFF1 2R86A 4M7RA 1W5SA 4E2GA 4GM4A 4MADA 3INYA 3TUIC 1QAMA 3A1EA 3M2MA 3IP7A 1NZJA 3PKJA 2Q29A 1G2PA 2GOYA 3NHYA 3ZD6A 3B2NA 3LYLA 1JMUB 1HYQA 2VAVA 2WNVA 4D57A 1HQCA 4XXHA 2PAMA 4RVSA 4YC7A 5KI6A 3IVCA 4X6LA 3I23A 3AMPA 4NO4A 1U0NA 1EFCA 3AESA 3IT2A 2CNNA 2FEMA 5JAPA 5DZFA 1X7ZA 3B48A 2C6SA 2ZBGA 5FO8B 1WDTA 5K01A 1QK3A 5ENZA 1RUJ1 3Q0TA 1N4DA 3VI4B 2HMYB 2HEIA 3O3OB 4BQ5A 1NZIA 3SSNA 4PR0A 2XDQA 2QY6A 3T2OA 5TC4A 2GPSA 4D4MA 2XY4A 1DG6A 2XUHA 2P6UA 4X6RB 2PZGA 2ODAA 1MLDA 2CJPA 2ZRFA 1GV0A 1SCUA 4LK3A 1GILA 3D82A 1U8FO 1VIYA 2KLHA 3ZDFA 5EPEA 1YIOA 1YJCA 1VHQA 2YWGA 1DGRA 2G9GA 2OHHA 1T0IA 1V96A 4QOIA 2B5HA 1WB4A 2KW5A 3KPJA 3L0PA 3CH5A 4AQ7A 2P11A 5AHXA 4YV2A 1V5WA 1OFNA 1COV1 4TV9B 9LDTA 2RHDA 4PGHA 1IXSB 4XVQA 1CAUA 3EFOA 1RI5A 3WLKX 2C3YA 1TEVA 1HI9A 4L9AA 5A33B 1GPAA 1UK8A 4EN0A 1R4ZA 5DDJ1 2NNWB 3ZKAA 1AKEA 3MEPA 3SYNA 1D4ZA 3H2BA 1QKJA 1DIWA 3V3KA 4MV9A 2BI8A 1XA4A 1LHNA 1FRZA 1R8JA 3NB0A 3RFUA 5F3GA 4I2OA 5JZOA 5BSUA 3PDIB 2RHBA 5TE9A 2FRVA 5JBQA 1Z2OX 1G6OA 2CVOA 5CA0B 1C3JA 4WZAA 4EZHA 5LU9A 2IYZA 4X8LA 2XXAB 4M8KA 2FUCA 5HV0A 2MNGA 4N0PA 1FEZA 1T3GA 4A0FA 1VCHA 2Y1WA 3E2IA 1VRCA 1Z0IA 1TMF3 1EVLA 2XQVA 4L97A 3T4EA 1MVNA 1UY0A 5KVQA 4DDKA 4CU6A 5INTA 1F6BA 3RUPA 3FPKA 1MCZA 2E7AA 1OFUX 1T1JA 3DKRA 4XWYA 2W6MA 4XFGA 2OBMA 3JW8A 1UZWA 4RCYA 4JUAA 4CT5A 5GP1A 5GAJA 3CZPA 2GBGA 4HAWA 2F4NA 5FV4A 3OOHA 4XJUA 2I6XA 2A6PA 2UVDA 2DX7A 1CQXA 3CNHA 4WKPA 5FP4A 2C54A 5CT4A 2ZXEA 1U5XA 2QXYA 1RAEA 5L7OB 2BM1A 1WZCA 5JMPA 8MHTA 2IEIA 3K72B 3R3VA 3PUVA 2D62A 3MT0A 1QEXA 2ZT7A 1JEQA 3ETLA 3Q9SA 2HPZA 3V2IA 4EO7A 3TBFA 2I87A 5G53C 3PTAA 4JP3A 1ORIA 3H8OA 3QVKA 2BKAA 4Y2XA 4KB5A 4F9FA 2IYYA 5CEEA 1HG1A 3R5KA 3WV6A 3UKJA 1SG0A 1AR93 3VDNB 1HXS3 1GPJA 2OHJA 2D0OB 3FOEC 3ZMNA 2IOFK 1MS1A 2DUMA 3S1AB 5D87A 1HDOA 1EFDN 2WD9A 3DZFA 4HPKA 2RS11 3MHZA 5DP1A 2R25B 5FUBA 1SUPA 5DVZA 3RABA 1BJRE 1TT5B 4E5MA 2A6XA 4LZJA 2BF7A 2P9JA 3WK6A 3OJOA 2CGEA 1XJWA 3BHMA 4COKA 621PA 2FSUA 3W21A 1F4VA 1OX5A 1RUI3 2AOVA 5LB6A 1H2YA 5L3ZA 4JBWA 4KHPB 2P3JA 4REOA 4KODA 3FTDA 2AH2A 2PZ8A 4PYMA 4GX2A 1MHTA 5KSYA 2A1XA 1K68A 5EWSA 2W95A 5FPPA 2JAHA 4Q3LA 2UZ3A 1BYIA 2NO0A 2W91A 2MSNA 3C1TA 2K5UA 1REDA 4HPXB 1QDOA 1W52X 5IN4A 1KI9A 3VKFA 2J42A 3LLMA 5CURA 3E4CA 1WUVA 1SK9A 3IB3A 4J90A 4MLDA 1NNEA 3C3AA 4D0SA 3PNAA 2X3YA 3M6FA 4CCAA 5K0UC 3TD9A 4GC5A 3LE0A 2CB0A 3ZE2B 2OWDA 3K70D 4HQFA 2QRLA 3LFMA 4XUTA 3VJKA 3THXA 2RS32 2QVLA 4JYBA 4Q4JB 2Q4EA 4HV4A 3SZGA 1M3SA 1LAJA 1XMOB 3LBNA 2DTXA 3FBMA 4B46A 5FZ3A 3TX2A 4Y1VA 1YU6A 2B1IA 2CW5A 5KTNA 3FHIB 2TUNA 4AMVA 1AL23 1CK4A 2A3YA 4HBGA 1JBQA 2GF9A 5K8CA 1RWOA 2RJOA 3CQOA 4AZVA 4G0XA 3FLPA 1BAPA 1Z0HA 5IVDA 4ZOBA 4YAJA 4YYEA 2JLQA 4FPXA 5M2QA 1VXRA 1W581 4AP5A 4B1LA 3U81A 3T3PB 4Y2QA 2QQMA 1POWA 2AW5A 2I3AA 4OIFA 4LK7A 1VLMA 3ULKA 5KYXB 1D3AA 2GKOA 3T12A 3IIMA 4AZ0B 2GP5A 4BUCA 1PFYA 4Z9XA 2XE6A 2QMYA 4PLZA 4ZOLB 3O8OB 5AW3A 4M1YA 3UEOA 4FC7A 2P4UA 5JVDB 4NZYA 3R4CA 5DCLA 4XE9A 4XJVA 1UPBA 4Y2PA 3NPAA 3GLFE 2W43A 5B30A 1L5YA 4NBSA 1ESMA 4FR0A 4MMZB 4X6YA 2C83A 4BFCA 3P9ZA 1Q43A 3PDUA 3GALA 4CDWB 2IU6A 2G4LA 4P9NA 3I1IA 2YQ4A 2FSFA 4OX9B 1RYFA 2QJWA 4BFZA 2B82A 1RIIA 1DBVO 5TJ9A 2VPZA 1D2EA 4G0QA 5CLJA 1W6UA 4KCGA 1X7DA 1B7GO 4IQFA 1M2GA 2RH9B 2H3HA 3HKBA 2BGJA 3K8ZA 5FUYA 2NVBA 1KMQA 5AJZA 1V4BA 3I6IA 4PSKA 3L0BA 5IZCC 1O0BA 1ZGCA 4Q27A 4AULA 3JR3A 3N8GA 3PLRA 2YUEA 2Q9AA 2BEOA 4I3PA 1DU4A 1L7PA 2IL1A 3GP5A 4TMVA 1P7YA 4U5XA 3DMFA 4PWZA 3DBRA 4P9IA 5FUVA 3HDJA 1ZZ7A 4WDRA 5TIIA 3I45A 4R9SA 2B36A 4PE5B 5J48A 3GLGE 3AVOA 2OSVA 4HNAA 1J9EA 2NWQA 2C95A 4LC1A 4FS3A 4DM7A 1D4VB 3EDYA 1H2BA 1CG6A 2XWSA 2VK1A 2A5YB 2R00C 4GPTA 1G2IA 3BFKA 5JBNA 3PICA 4BPBA 3K9BA 2BSXA 1YL5A 3CR7A 1U02A 2JANA 5GINE 2PVPA 3DDWA 2HNAA 1PNTA 3AZPA 1LLDA 5C31A 4HQLA 4TL7A 4YHBA 1GFF2 3PXAA 5BRJA 3N4MA 2XKOA 3E03A 5AXAA 3VHXB 2VDJA 4IDPA 3IIIA 4PHCA 1BFKA 1O6UA 1V7CA 2J3KA 1CJPA 3CBQA 3IJRA 5BWNA 3D64A 3P96A 3VZCA 2IYTA 3V6MA 5J5CA 3ZYFA 5NLLA 1NKTA 4P7GA 1NJ6A 2XIJA 5E9QA 3URKA 1PZ9A 5FLJA 3BRQA 4BB3A 1KYIA 3KSCA 5A9TA 2F48A 2O5RA 1ZY2A 2X76A 4MR9A 1CAUB 1PJ3A 4E03A 1DIGA 1USWA 3NAZA 2FP4A 1WW4A 3VPDA 4CDGA 4IX9A 5C3RA 2KBEA 5L3SA 4RQPA 4E32A 5A6XA 3HADA 4R2IA 2AG1A 5M0TA 2WOOA 1CR6A 4CKBA 4INDA 5TX7A 5EHXA 1HXHA 2ES4A 3M6XA 3O8QA 5CG9A 5KEIA 1CY0A 1KK2A 3WNQA 4RJIA 5F4ZA 3FSJX 1MGPA 1D4M1 4TGLA 4DQ0A 4RR3A 3BODA 1VRVA 3ED1A 3B9BA 3E1SA 5CIWA 4B1MA 1HV1A 3A6KA 5T6MA 1NCRC 2W5UA 4B8EA 1UP6A 1OA1A 3KS9A 4LQDA 1ONBA 5JDIC 4HDSB 1F2DA 3H1BA 2WMNB 2JVIA 2QSZA 3A0UA 1YZKA 4L5BA 4GBED 4DR1B 4B74A 3TI7A 2CZGA 4WNAA 1WCIB 2BGNA 4NH0A 3NHLA 5JANA 1K6JA 4Q3CA 2CMHA 5FUPA 1OXCA 3W2HA 3GAZA 3TD6A 3H0CA 3OJWA 1FJHA 3DFMA 1J8VA 3WIBA 1GVHA 3DHNA 3M3HA 4CKCA 4JDOA 1NPDA 3SS9X 3LF7A 3IBYA 5EJEA 1NW5A 2YFQA 1L3IA 4GOLD 5A1TA 3SOZA 4PZYA 1R9MA 2QVBA 4BECA 4CEJB 3LA3A 3OTFA 2CJWB 4LZWA 4MKRA 3LXXA 4UW9A 2CDAA 2WWIA 2RBEA 3KJNA 1U9IC 5F9TA 4GWJA 1T4BA 2JG9B 1GCGA 1VRBA 1H22A 4YJGA 3CN7A 1N75A 3UA3A 1RZRD 1W34A 3I4LA 4UTPA 1VAMA 4NXMB 1PT5A 3ZVLA 4UPVA 2RR13 1W9SA 3OHSX 2VJXA 5EHZA 5I0UA 1Q1EA 2VMEA 3INNA 2B7CA 1XZFA 1DO0A 5FZ0A 5A7FA 1FF9A 3HVJA 3O1OA 4IOKA 4WXYB 1UADA 3RG2A 2NPIA 2VDWB 2QN6A 4IRXA 3CZQA 1LRLA 1UP7A 4BZPA 3O2NA 1XRUA 2BEKA 3H0KA 4Q26A 4EUKA 1JWBB 4MK4A 1UBNA 1DT3A 2BFOA 2R7AA 3CLRC 1HDXA 3NPMA 5CDYA 2W0MA 3AC0A 3OPYB 3BICA 1UKGA 2YBSA 1UY2A 3RUAA 1CNFA 1FPMA 1IZ9A 4LC0A 2UUCB 2R1VA 4FYHA 3RDPA 1SH7A 4I8IA 1UD1A 1B2LA 3RH0A 3K6KA 2ARXA 3PFNA 1H4TA 2PBLA 2BOVA 5IJRA 2OKXA 4FYJA 4EB3A 5C8CA 4QBGB 3IUPA 2CGPA 1SKQA 2B83A 2ODNA 3NIDB 1H4VB 5U4QA 1EQUA 5F1YA 3FRIA 2G83A 3EPRA 2A57A 1IDOA 5KO2A 5C3SA 2Q8OA 1SBYA 4PLPA 3C3DA 1SC1A 3A14A 1DC5A 3FKJA 3E3OA 2VCMA 4M54A 2J0SA 2QLNA 2NUTA 3RC1A 3IE0A 2PMCA 3GRFA 1QHFA 3PGMA 4N53B 4D80A 4N3NA 3KXDA 1MZFA 4HY3A 3SITA 4NFSA 4O0MA 2O2IA 3IDEA 4BPRA 3TECE 4A42A 4EB0A 3FFQA 1RXYA 2YVLA 2R8EA 4BM8A 4MDHA 1VBD3 3A4IA 2B8JA 2CV6A 2RDQA 3DW1X 5GZGA 1RCUA 4H6PA 4YJFA 4WFKA 5F5QA 3VD3A 2GEKA 4FFDA 2HOQA 3ZFFC 3SZOA 3VR5H 3O31A 2Q3DA 4XBNA 5B1HA 2FCAA 5KQPA 1CAWA 4FC6A 3UL2A 4OMFG 1YO6A 3U3DA 3LA7A 4LJLA 4DJEC 3K8OE 4ESHA 3T8YA 4YZ2A 1ODLA 4CF6A 2P3OA 2IEZA 3RAJA 4WT7A 2Z30A 3QWAA 4FNAA 4Y20A 2KBFA 5IDQA 1EINA 4F3RA 4OL9A 4ZQCB 3EQ9A 1PNRA 3FWHA 1MZ5A 4D9HA 1AYN1 2ZABA 5I7RA 3X2EA 4BNKA 1PVVA 1U7TA 5EESA 4ERXA 4NPAA 5AK0A 4GB32 4BDSA 4QBKA 3CMMA 3KVYA 3LEKA 3KYDA 1VZ3A 1XZDA 3DWGA 2HWKA 3LTNC 1YCGA 4HZFA 1D4AA 2SHKA 1FS5A 3NAQA 1FU4A 3PI7A 4AT1A 3N8HA 3PQ8A 1NXVA 5DBGA 2DRIA 1ISHA 3PB3A 3D7LA 1CAXA 2GALA 3N2GB 3HU1A 4E15A 3EIUA 1OA0A 4B7CA 1RXFA 3ZYJB 4C6RA 1BRMA 5GLTA 1K7EB 3DTYA 1X86B 1KY5A 3B5JA 4MQEB 1X9IA 4CJXA 4DPNA 1SG9A 3E5MA 1DQSA 5G4KA 4NYMQ 5CPBA 3T7EA 1MJNA 3N35A 2GJKA 4P7JA 1ZIDA 3DOUA 4LFBB 2V6IA 2WUWE 3CN9A 2H1CA 3JXSA 4QX2A 2JFNA 4Z53A 2C8VA 1CR2A 1QJU2 1CRLA 1SQ6A 5FAXA 1NU8A 1U12A 3DNPA 5ALNA 3OIUA 2WP0A 2PX6A 4O1MA 2C4TA 3BF7A 1P80A 4RPCA 4BQ2A 2FW7A 1OBVA 2Z2KA 2EZ8A 4BN5A 2EF0A 2F67A 4KXYA 2QKYA 3DLCA 4NY1A 1P7WA 4CRWB 1PJBA 4H1VA 5IJ0A 3L92A 4LLFA 4M21A 5D86A 1QYRA 1QH1A 1LPBB 5H5JA 5JRDS 3D5QA 1CR1A 4GYWA 1ZC4A 2HCRA 3TZEA 1BEZA 2TECE 3BGAA 3RVDA 5I4BA 1NUTA 4KQ6A 1JQDA 5DAWA 2CLOB 3WHTA 1DAOA 4LTNA 2XUPA 3AVPA 3BRCA 2XQXA 2A1IA 4EI7A 4F8EA 4HMZA 4YMVA 2JGDA 4QX7A 3WYBA 1BRTA 4HN0A 3IBGA 4PYNA 1IAQA 3GLSA 3KQYA 1RC8A 2L9LA 1BNCA 1DYPA 3WGNA 3HDQA 4GE0A 2O4UX 4YGEA 2GD2A 1B3BA 4YHHB 3POFA 5JIAA 1YNOA 2MJLA 1ZH2A 5J2TF 5KOJB 1B0PA 3HQXA 1RYEA 4K6HA 2DEUA 1H3EA 4YNBA 1QXPA 4MB0A 1LX7A 3Q7RA 5HCNA 1M5TA 3ONNA 4GLLA 1GP4A 1YKSA 4AYTA 2G9VA 3QE9Y 4B09A 2UYHA 1TDJA 1TAQA 1A2QA 2WEKA 1SPBS 4B83A 1LPAB 2GN7A 1KE1A 2H9YA 3HEMA 2PUAA 3EFBA 4DQKA 4A2WA 4CUJA 2LW8A 3L04A 2XLGA 1NRIA 4MKGA 1HETA 2ZT8A 3BE6A 1ZJZA 4XGQA 3UV3A 2MCFA 4KE7A 2QN9A 1RSZA 4UAVA 4B6FA 1NW8A 4MYDA 5JBIA 2AFVA 2PEZA 4YRFA 2BW0A 1D4OA 1Z5GA 2OO7A 2QYHA 2HXGA 3V7YA 1JQAA 3VBHA 4OXRA 4MS4B 4BMDA 1K2WA 2F17A 3UMGA 4C43A 5D5QA 2VSOA 1J0XO 3B1FA 5EXSA 1AGNA 3GWZA 3MWEB 2M6LA 3VVBA 4X66B 5GZCA 3O92A 1XK6A 5FZOB 4G5XA 2PIDA 5FJKA 4WM8C 4YW3A 5FOVA 3ACLA 1GJRA 3WY9A 3BB3A 4N5IX 3QLEA 3R0IA 3QH4A 4LNAA 3KE9A 4KG7A 4IIDA 5HZKA 1JODA 5KYUA 5F12A 5EE5B 4X93A 3C3VA 2LKCA 4OLFA 3LX8A 2ZVPX 4NP6A 4QAJA 3G88A 1MZEA 3KJHA 1O2DA 4WK2B 4CCYA 4A8PA 2PA3A 1HEUA 4KBBA 1YSCA 4QDRA 5A7QA 3HUFA 3DDOA 2BRTA 4HSJA 1IHOA 2YV5A 5JISA 3OQHA 3K3NA 4J1TC 5DNVA 5FMBA 4CUAA 4LBZA 5IX8A 3KFXA 1V8ZA 1XLVA 4G6ZA 3GYGA 4K9LA 1RZRA 5U1PA 5AXDA 5C32A 3CWQA 4RIIA 5HVNA 3WMEA 4N90A 2JZCA 1U99A 1KMNA 3K9NA 2X15A 1Z2PX 4JYZA 3AHDA 2H29A 3OCJA 4N18A 1TOAA 4XFJA 1GL9B 2RCNA 4BFYA 1VDMA 4RKRA 1ZZ9A 2R62A 1F4AA 1O3RA 4HOOA 3Q98A 3WG2A 3UV7A 3ZH9B 2WIJA 4ZHQF 3WBKA 2H4WA 2GN4A 2Q07A 3IP9A 5D3MB 3H1GA 3VPBA 1CFZA 1R2QA 1SUBA 4Z9BA 3NXSA 4HPWA 2C4MA 3U7QB 2FDRA 4IIFA 4FT2A 4O4HF 4OY3A 1FDIA 4D25A 2MU1A 2B5WA 1VJ1A 3EPHA 1FJ2A 3MTQA 5CGZA 2QRVB 1VMEA 1NVMB 1UU5A 5E4FA 3S4YA 3SICE 4QO8A 4NIGA 6YASA 5FTLA 2OGZA 4ZV4A 1CC1S 5FY7A 3OBTA 1TW3A 2ZSHA 3JYLA 4BLQA 4E3ZA 1NXXA 3LBFA 2DETA 4KYVA 3MT7A 3R7LA 4MW4A 2OV4A 3C87A 5IWAB 4HP8A 3V8RA 2EJTA 3IV7A 4O2RA 3FB1A 4KR2A 4MW5A 2ZOSA 3TLAA 3MCUA 4R7TA 1FFDA 4DA9A 2FX3A 1ODFA 4G0UA 1PFKA 1I3OA 5IBRA 5DBEX 2CJYA 3THCA 4L0DA 2VNGA 5AI6A 4X97A 3I97A 4ED9A 1N6LA 1T4DA 4R2JA 2ZJ2A 1DBWA 2I2BA 1VG9B 3QKSB 4PAOA 1CAWB 1FAYA 4LAFA 3D31A 1JYNA 1E6LA 3KLMX 4QPWA 3C24A 4QEZA 4OMCA 3WLRA 2WWWA 3LI2A 1UQXA 2DKOA 1E1YA 2HU5A 4IINA 4X44A 5C4GB 3ZQ4A 1Q3EA 4GKJB 3I7DA 4IDCA 2VNOA 1J0DA 5TQ0B 1GLVA 2RGYA 1S2OA 3ECAA 2EZTA 4F83A 1FSFA 4MUXA 1XLTC 1G66A 1PR2A 4MW9A 3BIWA 3ZWQA 2C31A 5C7OO 4QD3A 4YMTA 1VE0A 3RYHA 4YJHB 2IS4A 3R7DA 4W1SA 3TQTA 1O4ZA 4H7EA 3LQCA 3JZIA 4XHXA 4HB4A 4TN1A 5E1DA 4MQFA 1TZBA 2OM6A 2JIPA 4X65B 4LZAA 1RHRA 5DABA 1QHHB 3PRJA 1Y80A 4EYGA 3HXQA 3ZCPA 1N33B 2PTGA 4A26A 4CEIB 3EG9A 1GTG1 2BVBA 2QDRA 3LPFA 4EA6A 2W68A 1S3GA 2I6GA 3ZHQA 5EMLA 1OHFA 2G77B 1NLSA 3U0VA 1U7DA 2YNMD 3B3QE 4RPGA 1UKBA 4QG3A 1P31A 3C70A 3VNVA 2OAGA 3DXUA 3H2KA 1Y5RA 2WWXA 2VBCA 4IW3B 4W8OA 2H7VA 4X71A 2FSVC 5FTKA 5F21A 1E3WA 4PO9A 3SLGA 4X41A 4RDXA 3WW4A 3HKDA 3WDUA 1AR61 1NF2A 1DCTA 2VHCA 1NQWA 1VIMA 3P9RA 3MF6A 4M0LA 2ZI5A 1CUXA 2CEKA 2HJHA 4TV9F 2VZ8A 4UARA 1WW3A 4OBBA 4V2VA 2Y77A 3BH6A 1MEJA 2P78A 1S2KA 4KG0A 3OYWB 1X1RA 3B94A 2Y76A 3IHLA 3LGRA 1JDNA 1JQJC 1G9XA 2FOXA 3WNKA 2E32A 4X6UA 2PX2A 1DYOA 4EA8A 1EBUA 1H05A 3NAMA 3CJIB 4EZEA 2O1XA 4LHNA 1J00A 3NNDA 2HNBA 3CZ4A 1IBRA 1W2GA 5D3KA 4J1SA 4NU0A 2RGBA 4A3SA 5J47A 1D0HA 3T3MB 5A7NA 1Q8SA 4YO8A 2D1QA 4ODIA 1BH2A 1MJGA 1C4OA 4XCVA 9LDBA 4Y1YA 1ZP6A 4IO0A 5CA0F 5IWCA 2J7MA 4C0KA 4HQOA 1KP3A 5LZ4A 1YJXA 4DSAA 4K1YA 3RWMB 2P9BA 3JYOA 1CTQA 3GGGA 1VMDA 3PK0A 4M53A 5HCUA 3AHCA 2JK1A 2Q21A 3HI4A 3IUQA 2PUWA 3TCKA 5IVPA 3H4TA 3ROFA 4LKRA 2EIEA 3LY5A 2SKDA 2GYUA 2C3OA 4HVAA 3LJKA 4XASA 4X1YB 1PJSA 5K20A 4AZZA 1XG5A 2AFHE 1CS0B 4WNIA 3DKPA 3LOQA 4Q4W3 3KT7A 4FPOB 4X5OA 4KL1A 2OG2A 1KQRA 2WU4A 4Y1XA 2OBYA 4YVWB 1OT3A 1PHRA 4ARIA 5LW9A 3PQ3A 5CITA 2EEZA 3IM0A 4H7PA 1KMCA 2O2HA 4ZHQA 3E18A 5JSFA 3SIRA 2G08A 4PBRA 4HLQB 3BTAA 4MUVA 1TEIA 1XTIA 4EI8A 5L40A 2ZYVX 2OD9A 5AC92 1CIWA 5BUVA 4QHSA 2H57A 3THRA 2VL7A 3QOPA 3EB7A 4QYSA 2AR7A 3ESXA 3OOJA 1A9QA 2D2IA 1NOVA 1JMKC 1R4MB 2WV7A 3ZWNA 3WGKA 5LP1A 3BA6A 3W34A 1OHHD 5J40A 4O4HA 2X4GA 3ZN2A 1LI4A 3NJZA 2IPXA 4RTKA 2GPYA 3JQBA 3NHUA 3T1LA 3ZKYA 2CMDA 4ENRA 4R0VA 3WMFA 4IGFA 1ZNWA 4PZAA 3N59A 4LRXA 1XK7A 1C9NA 1X19A 3IIKA 2RAVA 2JG3A 3AMMA 3IXMA 2CSXA 3U7RA 1P8JA 3HM2A 2PQSA 4Q02A 2I8CA 4J7CA 4ZT7A 1N8SA 3TOZA 1Q5PA 2D43A 2GD0A 3T09A 4C5AA 5F39A 3VUOA 1WDMA 4YRAA 2VIIA 3N39C 1QPGA 4R7ZA 5C3MA 3KR0A 3GN2A 4IGPA 1TO2E 4CDRA 5IK2D 1X1EA 3M1YA 1QLWA 4IDZA 1OZAA 4LJ9A 4GPEA 2BEWA 4WFQA 2ZSKA 1DIHA 3F3KA 4HYYA 5LZ2A 1MX5A 3MIIA 2AHOA 4MA0A 4KRFA 1TC2A 5I47A 5F9HA 1SD2A 2VHJA 5LDDC 2NQTA 2O4CA 1H85A 4E1BA 4A6SA 4H4EA 5SZHB 2WWYA 4DZZA 5FYYA 3I3MA 1W1IA 1G42A 2ID7A 4AN4A 5FXMA 1RHI2 2VJDA 4W7SA 4Q1EA 3SE0A 3GJZA 4PRYA 4BLJA 3D2LA 4UW3A 3E48A 4MVYA 3WKEA 2Q0QA 3D6JA 5DBHX 2V6JA 3PD7A 4ND5A 5B55A 1IUKA 4RHV3 2VKTA 3ZCSA 1BD3A 4FPHA 2PLAA 2W2KA 3EB9A 1M76A 4RJKA 4ZAWA 2DCMA 2FW8A 2CHHA 3EGOA 3SXUB 3MDPA 2J6IA 4GOND 2HGSA 2GLXA 1UNBA 2DF8A 3K32A 4ZZ5A 2R6JA 1DKPA 1SCKA 3IUEA 2Y68A 5JC8A 2B4YA 5A3SA 4H16A 3AYEA 3TDKA 1WMDA 4IEZA 4LYDA 3VD7A 1QRSA 4YRSA 3I6ZA 1GPBA 1ADYA 4P32A 4DBLC 1AUVA 2V09A 2W2XA 3AHIA 3SQDA 4DNYA 2XJ4A 1YNAA 1QU0A 2B1JA 1OC4A 4G24A 4ZOLF 3QY0A 2YC4A 3VU1A 1VKOA 4ZXKA 2ARBA 1MGOA 5JVDF 1A72A 1A9XB 1ZM9A 1MAUA 3NVCA 1TF7A 2VAPA 4OBXA 3ADDA 1D1TA 3IRUA 1LKZA 1UCFA 4RU1A 1C7IA 3B7PA 5ALSA 3LHDA 2WC2A 4QE3A 4CL8A 1TVEA 5TY0A 4D7YA 3DEAA 2EZ9A 4B6PA 1K7YA 1P2DA 1RPAA 4IDFA 4MI6A 4DLVA 2OZLB 1R5JA 1POXA 1QVRA 3TQIA 4AS3A 1D0VA 1W8OA 4C4SA 3Q3HA 5H83A 3LWNA 2C5BA 4D8VA 4ND7A 2Q5IA 1T9CA 4OFXA 2XGJA 3TQHA 2P5BA 4P5DA 5I8WA 5K0NA 1KF0A 4DSUA 4TV9A 3HWJA 3OG2A 3RV4A 4P9GA 4Q6WA 3GGLA 4JLNA 4KWEA 2OFXA 5E7IA 3ZDSA 1EUDA 2PV0A 3DLPX 5A33A 3RKUA 1ZMOA 5AW0A 2O20A 2PL1A 4AGVA 1VGQA 2BFAA 5JAZA 4ZTZB 3FTFA 1BG6A 4Q24A 4UOQA 3EASA 3LGSA 2BD0A 5G1PA 5C3OA 5LQRA 4Z3DA 1JXMA 3PDIA 1E4VA 2YFYA 4F5ZA 1N2HA 4E4HA 1AZTA 4OYYA 5DYNA 4QPJC 1GU0A 2IELA 5CA0A 3KDPA 1RIRA 4DANA 4NCJA 2XXAA 1RZUA 5KTKA 4HH1A 2V6BA 1TJ3A 5JT1A 4LXUA 1NUQA 1Z88A 3R5XA 3KQMA 1XJ0A 2XKJE 1FVFA 5HDBB 5DZEA 2EHDA 2YNMA 1E0SA 3D8BA 3W1EA 4DUVA 4QXBA 5SYNA 2JHFA 1RXGA 4MICA 2WT2A 5BNOB 2H2AA 1XPUA 2NQ2C 3MGUA 1P2VA 4LKSA 1QC5B 3BL5A 1LVHA 1BWSA 1D0SA 3QW4B 1DEHA 3VH4A 1V9LA 2VHVA 2V7GA 3ZY6A 4R2MA 1YR3A 4XOUA 5ARDA 2XDWA 4QQRA 2F1HA 3DHYA 5KQLA 1SIOA 3EVCA 2QEQA 4R2KA 3RK1A 1G16A 4JBNA 5CK5A 1CJTC 3VU9B 5L7OA 3T99A 2O9JA 3BE8A 2HHJA 3DPIA 2P6RA 3OM0A 1CY1A 1P60A 2VKQA 3WLNA 1LOCA 1O7FA 3OTGA 1KYZA 4EE2A 1G5FA 2FV8A 1AGPA 1AN9A 4B73A 4GPIB 3IPLA 5F32A 5FLKA 3R5TA 4DILA 4Q82A 2Q2QA 4HJRA 3FZGA 1V3VA 4LJAA 3K9HA 1PR3A 1KAMA 2ZTHA 3ESDA 3S1AA 1UBOS 2BHLA 4AG5A 1GYKA 1GZWB 4FZ5A 5KDOA 3F9RA 4BNXA 1KEPA 4RMIA 2UXCB 1I0LA 4D4LA 5A06A 1Z6QA 3ZEIA 1ULCA 1XFAA 5JAIA 2XOXA 4ZI5A 1TT5A 4YLGA 1XF9A 1YULA 1HSZA 4OHXA 3UQZA 4QPCA 4CQLB 3K9LA 4JQZA 2K2QB 2COKA 3TQSA 3UJOA 5HI0A 1XL0A 2JLAA 1P2SA 1JJAA 1J21A 1CY6A 1F14A 5JADA 1CYEA 4FINA 1NQUA 3L6RA 1IRIA 4CV1A 3B6ZA 1E8NA 4R3NA 5JPMB 2JKVA 1G3QA 1BHGA 4DCNA 3S7IA 4NHYA 4XPIB 3IODA 2GZ1A 3NBAA 5E8RA 4AKSA 2QD2A 2R8XA 2C4UA 4UCQA 3TSCA 3HK2A 3D0QA 3MW3A 1EDDA 2JD1A 3OETA 2OFWA 4BO0A 5DTMA 3GRYA 4JENA 3O4HA 2YWJA 1MEC2 3CX8A 3BWMA 1CJCA 3DLTA 1NP7A 4CM3A 1Z7S1 2NTJA 4M89A 3OZTA 4R1LA 2PKQO 2MSCB 2YCLA 2IZZA 1OBNA 1UEJA 4Q4JA 1TE2A 1XROA 1WA5A 3N8IA 3JRNA 5FBVB 4LMBA 5CVDA 3PIJA 5EMNA 3RSLA 1BWQA 1OHHA 3HI6A 4YW5A 2GMPA 1VGRA 2V98A 3RS3A 3PC2A 2G4VA 1Q0UA 5D8DA 2Q7DA 2PHFA 5FYCA 2XR1A 4N5NA 1W29A 4LYGA 4G5YA 3HO1A 1CUUA 3EXHC 3COJA 5IFPA 3I30X 4KR3A 4TTRA 1QF7A 4NHLA 4B3HA 3FI9A 4LJ7A 4ILKA 2X10A 5KYXA 1CIYA 4WY2A 3SM3A 1WU7A 3KQTA 5HOEA 1FK8A 3GLUA 4AZ0A 1QANA 1MR5A 3CRZA 1G0OA 3M5PA 1CJMA 1T5LA 1QKKA 4OHWA 4OI2A 3V9PA 3CG4A 5ISMA 1F5NA 4JJEA 4ZOLA 3A2MA 1UPIA 1XVLA 5JVDA 1Q91A 5FLIA 5LZ8A 1UXHA 4ANFA 3Q88A 5ALUA 1ULOA 4R9DA 5IK2A 4ETIA 4JSRA 3CEPB 1KJ9A 4DS3A 3QMPA 3DVQX 3C2UA 6LDHA 2QE3A 4CDWA 3SQOA 3W5VA 3WBFA 4IJKA 2NPFA 2AJ8A 5JCZA 1JE1A 3QZUA 4E2YA 2OGUA 5LK5A 1R0ZA 9GPBA 3AYAA 5EJMA 3SAJA 3Q8MA 3FBGA 4SBVA 1EFRD 4R8MA 5JMOA 5L6MB 4BXFA 4EWDA 1DXQA 4OYUA 4TVBA 3GK3A 1AK1A 2J1RA 5JVVA 3TRJA 3JQEA 3TRKA 5C1DA 4J4TA 4YRZA 1S0BA 4COYA 1QJY2 3V4FA 5C4MA 3PPWA 3QBTA 2R0FA 3VD5A 2Y60A 2HHLA 4G67A 1J3QA 2A59A 5ELLA 3T08A 1FVXA 2RC5A 1PUXA 1ZBA2 2A35A 2JI6A 2QT9A 1IHMA 3VKMA 2AHRA 1EGQA 3UAWA 4F5WA 5ICEA 2AN3A 3LKZA 1C7FA 3PC4A 3OVMA 4FCWA 1DQ4A 2WD8A 3ZQKA 1W6QB 1YAHA 3ZKWB 1FLNA 3I0NA 4KP7A 3TRSB 3LA6A 3Q15C 1Z0UA 4CYMA 2TSYB 4H7KA 3AFGA 3ZXIA 3GCDA 1U7ZA 5ABJB 4HDNB 3WRYA 5E7QA 3VHXA 3O1PA 5LP6C 2YC0A 3W3ZB 3DT9A 1F35A 1O4WA 5H4GA 4OUMA 3MIGA 3VMMA 4G5QA 3AR9A 4LDNA 4TLDA 2GEUA 2HDHA 1SCIA 4PQRA 3K5HA 4UNSA 1U2EA 4TXJA 3D1VA 4BKMA 3RS5A 3VZNA 2UYGA 3ZJ4A 2PZAA 1VL0A 1EUDB 5F52A 2C9BA 2W08A 2PZLA 1HTBA 3KXIA 4A2PA 3S68A 4WZCA 3NIGB 4XILA 2CF6A 1J39A 4M60A 2ZWMA 1JXAA 3NVDA 5IULC 1XYVA 3ABSB 3AL5A 1J8YF 1GKBA 4KXUA 4PLMA 4PAGA 1OVPA 1D1SA 5F37A 4JI4B 1UC5B 1D6SA 2JDKA 3AEQB 1FL9A 1U0GA 3R9XB 3RT1A 4O2AB 3A0KA 4OSOA 2FFBA 1QE3A 1IULA 3FLRA 1V5GA 1EXWA 3HB1A 4JC5A 3D3EA 1X92A 1CX4A 4HDSA 1KQPA 4AQ6A 1W0PA 2DCTA 2AQKA 4DLLA 3TDNA 1ZNPA 2B69A 3OT5A 3DTNA 2VA8A 3SKYA 5M7EA 1H42A 4C0HA 1WCIA 2ZM5A 5F5NA 2ECFA 4FCAA 3HWRA 4WKGA 4XABA 3U7FB 4Y2UA 3TNLA 4IG4A 5JSZB 1V3UA 1NASA 4YBRA 4XFAA 5AVPA 1MFZA 3R7NA 4H1HA 4JXKA 1JZ3A 4K9KA 1QQP2 2RS31 4I5EA 3B7MA 1T6NA 4CEJA 2I7VA 4PS0A 3F78A 3AK4A 2CJWA 4HAYA 4CIXA 3MBIA 3BT7A 2IBSA 2GN6A 3K4QA 4IXWA 3AP3A 1Z5ZA 2FSSA 4UAUA 2XH6A 4WGGA 3T7DA 4BRZA 2D0PB 1W8DA 2QVGA 4JKOA 2GNDA 4UHKA 3EW7A 3V7NA 3MRXA 1LC3A 2JG9A 2AQHA 1NR5A 1N4AA 4YQYA 4G84A 1O57A 2EXXA 4UUBA 3ABIA 2OC9A 5IT0A 2JFXA 4F4CA 3KWFA 4CGYA 3ZFGB 4UMVA 3ZN6A 1I4EB 4ZP1A 3L8FA 3CB2A 3GFVA 1C0IA 3B7GA 2JDPA 3RRMA 4F91B 4DUYB 3U49A 4HR7A 1R8YA 2VDWA 3V8EA 2C1FA 1NMSA 3BEOA 1T25A 1PLKA 1HDYA 4PV7A 4QDXA 4AMYA 1RR6A 3VPAA 2JAWA 2DUOA 2FQQA 2D5AA 3DVAB 1P5FA 2NSHA 4ZHNA 2VWQA 2X1HA 2FZWA 5U4XA 3OPYA 4O4LB 1PR1A 4JDUA 1DELA 4MYEA 3B2QA 4CN9A 3A9TA 4FXPA 3K77A 4JB0A 3X1WA 1CKEA 2C2XA 3U9LA 5I9LA 3JQ8B 3BFXA 1RXCA 5TR9A 3E82A 5DBIA 1GG8A 4D8YA 1H8ED 1YZNA 1Q20A 1S1CA 5KNCH 3POBA 4BQFA 5LRSA 1IBMB 3LZCA 3G2KA 4Q9DA 4EHHA 3IS3A 2G5GX 5ERXA 5CVTA 3ILFA 2O59A 5LEJA 3EIXA 2HU2A 4F8JA 5B3LA 3ZVNA 1AOXA 1Z73A 3PQFA 5F5CA 1OXSC 4JB2A 4KVGA 5FADA 1PSZA 1A76A 1Q21A 4X8NA 1UOFA 2YXLA 1T8WA 4CODB 5CDFE 5IKPA 4N53A 5E2IA 4WECA 4QUEA 2Y6JA 3FOFC 1YKFA 5IXJA 4Q5IA 5F5XA 1NPYA 3FZNA 1FMJA 2HCFA 1WQ4A 4ZCMA 4O2BB 3EC1A 3U6KA 3HNOA 2D6FA 1WETA 2OVUA 2ZUUA 2YUTA 3I42A 3NEPX 2EW2A 1OFTA 1X1QA 5HILA 1N2BA 3VOTA 5JSUA 2O3RA 1LVUA 5FKJA 1Z4MA 1AXGA 4XLTA 2VPWA 1PZ8A 2HHAA 2JFQA 4WOCA 1OW3B 2JLVA 1CVLA 2HMAA 4BMVA 2XB6C 4BLIA 2H6CA 4L8YA 2WNUC 3H1EA 3I58A 3W5CA 2WAOA 2D6KA 1RQ2A 1YCHA 3TJRA 1OKOA 4RWZA 1WA6X 3H5NA 3IAM1 2D5LA 3WV4A 1XPJA 1DGQA 3HIFA 4CF5A 1PHMA 3INTA 4IOLA 2IFRA 4AY6A 1JSLA 1I6MA 1RWQA 2ZJOA 1I4TD 2XJSA 2XGMA 3U4IA 5SV2A 1KP2A 5ITZB 1P2UA 1Q0HA 3U4SA 2GILA 3PXUA 5CA1A 5AVUA 1EUCB 4COUA 2GRJA 1LJUA 1IQAA 4L57A 2MYPA 3U61B 1Q15A 1S5PA 3P4YA 5DDIP 3N2GA 4E4SA 3OICA 3T7TA 1XZIA 1PGQA 4I19A 1P81A 2AX3A 4MQEA 4Y2TA 1Q0PA 2EX1A 3QVVA 1U9CA 4R1TA 5F73A 3I3BA 3I3DA 4MHOA 2ZMNA 3P0FA 3G9XA 3AR5A 1JA9A 2AENA 1EFRA 3UPDA 2UYAA 1W8HA 3KP1A 4GVLA 3L5KA 2OHOA 1OF4A 1CSEE 4JRLA 2POQX 4XDPA 3SX4A 1E0JA 5HF5A 1DQ1A 1RTKA 3ZI7A 4EJRA 4JI1B 3WI7A 1Y63A 3NWOA 3CQ9A 2IP2A 1OQDA 2WM3A 3WYCA 5AVZA 3B5IA 4J25A 3BAZA 1XU1A 1XJCA 2Q7XA 5AKLA 1EM8B 2C82A 4W1RA 3UYLA 5DMXA 3TOXA 1PU2A 3HCNA 3H5RA 2C2WA 5F1OA 4BXSV 1NUHA 2A1TS 5K7PA 2VYVD 4J0QA 2DCYA 3RHTA 1KDZA 1PK6C 1US2A 2DFNA 1BS1A 1ORVA 3H0OA 4D56A 3I37X 4CKEB 3NAPC 1AH2A 2Z04A 3WNBA 2RJKA 2NU8B 4X95A 1UOOA 4DCTA 1EUYA 1WB5A 3JQ9A 4CV3A 1W36C 5KOJA 1MP0A 4XVCA 1O94D 5FB3A 2Y67A 3HU2A 2YRFA 4KJXA 4FGJA 2BMJA 2HWE3 3KQSA 4URTA 3NNSA 4BIMA 5IWFA 4KFCA 5FEUA 1K7XB 1ESCA 3GJRA 1QH8B 5ED0A 3VH2A 1AO0A 4DVGA 5EZYB 1XTVA 1ZC3A 2Z58A 5BNNB 3GOQA 3H3UA 5ALGA 3LOBA 1F9EA 1V9U3 3BMOB 2LM3A 1SZDA 4NARA 4PSAA 4GJZA 1NLYA 3MB8A 1C4XA 2ATIA 4J8PA 1Y6JA 1L5VA 4WLFA 4BZZA 1W2OA 2QTRA 1SLBA 3L0CA 4L4UA 4MRRA 3GDWA 5B58C 5LK7B 2P3YA 1A8PA 1I01A 2IVZA 1YZUA 4D4KA 3A22A 3JD72 5EIYB 3HYCA 2FLKA 4BGUA 4KOEC 3V4OA 3EUFA 4Q48A 4N5DA 1M2KA 3H50A 3UPUA 4GKYA 3ER9A 3F3SA 4QAQA 2XCLA 2IX9A 4DNOA 1WQ1R 4RV5A 1PM4A 3T0BA 3KQLA 4MS4A 4Q39A 1CEQA 2VJAA 2E5WA 2YQZA 1LPMA 2P0AA 4EHBA 2VNKA 1R6XA 3MWEA 1L5HB 5IBPA 3FWPA 2PAEA 1NY5A 4AUKA 5FZOA 1TCCA 1OV6A 2QPOA 3JYPA 5DT9A 4TQGA 4BNIA 4LOJA 1PTKA 3MUNA 1Q77A 4TS9A 3CR3C 4TZ6A 2QDKA 2R1ZA 1EG2A 4FNMA 2WQ8A 4U6QA 3ZZUA 1UT5A 3P45A 2GWHA 3I9FA 1PAUA 1PQYA 2CWSA 2BDUA 4OCZA 4BOWA 1CV2A 4P31A 1PWXA 4PX3A 3N2EA 3JZFA 4AGGA 4ZU1X 3PI6A 1W9TA 1V9SA 4P53A 3VDMA 5DCWA 1YGYA 3ZN6B 3CMGA 4CKXA 1DTEA 5A1LA 3DOEA 4OXIA 3EIHA 1MJGM 3T7KA 2YWHA 2V7VA 4X92A 4FHEA 4KVAA 1XMPA 3SHFA 1FA9A 3I61A 3AVVA 1W9YA 5C7GA 5K4GA 1DQ2A 1P7CA 2NN8A 1YV9A 3FPFA 4B3IA 2XONA 4IQ4A 2VW0A 4LVUA 4ZU7A 1HKUA 4KHZA 1GTZA 4ZZIA 2AJBA 4AYXA 2UU8A 5GV7A 4GMFA 3MLJA 1Q1BA 4KO8A 5D3MA 1FFBA 2QLJA 2H1WA 3EXEB 3F5QA 4NU8X 1Z26A 2WTBA 1NONA 1ADJA 4AJLA 4IVQA 3REOA 3SF0A 3U7QA 1PQWA 5JI3E 3QWFA 2C88A 4OQYA 4XLZA 3RQSA 5AOBA 5FQOA 2R1TB 2JFUA 5SY9A 4LO8A 3L9WA 2FDHA 4RDHA 4N9IA 2CUTA 2G63A 2QRVA 1F6DA 3KVAA 1ST3A 3G0IA 1H8EA 1WKYA 2VPVA 3FUCA 3K09C 5BYNA 2WSSD 3VV1A 4PT6A 2OW4A 1LPOA 5IG2A 5AT1A 3FPSA 1QJU1 3OI7A 5DX0A 1QJZA 4HQ0A 4ENWA 2HRZA 1TM3E 4LV8B 4K9QA 1NLZA 5JOXA 4HDMB 1GZVA 1XU2A 1HT1E 1L4LA 5B7QA 2EWWA 1GVNB 2J30A 3LLUA 4FPJA 3N6XA 3ER8A 1T26A 1ONPA 4LHSA 1GGFA 1UMKA 5BNPB 3N07A 3WL4A 3CZ9A 2NUPB 5DBFA 3UC5A 4FYXA 4BC0A 3SYLA 1SG3A 5ECWA 1CN1A 3PD1A 3K9WA 1ADGA 5HKAA 4QGAA 3OCUA 1JTVA 4AG3A 2QROA 4PIMA 2ZBJA 5B7PA 1IU9A 2FPXA 3QKSA 4GYYA 3ZCUA 2II6A 3U9SA 2E4WA 3FNFA 3PIGA 1KBQA 1SU6A 3RF7A 4PQ9A 1L5GB 5G0TA 2BRUC 4E2SA 1XHFA 4KXXA 3ENWA 5TQ0A 4QATA 2QL9A 1P1CA 2D3WA 4OXQA 3UMSA 1V8OA 2ZUCA 3S1LA 4CM4B 4GXRA 2RS53 2FYTA 2FFHA 2JWPA 4MZDA 4P80A 1Z35A 4RGKA 5AKZA 1IUOA 2QM8A 2DLDA 3DE5X 1WBDA 4YS6A 2W92A 5BSEA 4MKIA 3QLUA 1Z7BA 1RRMA 4YJHA 2BMAA 4KAXA 3EXUA 1MB9A 2GCIA 4BFTA 1YLLA 2YQ5A 5CA1B 3T06B 4CP1A 4JB3A 3GV0A 3A6JA 3KCNA 4OATA 3BWXA 1ODIA 4J03A 4DRXB 4HLTA 4MXWB 3N9MA 1XU9A 2IEYA 4L4XA 4GJYA 4MITA 4A41A 1QHHA 4AHXA 2PCLA 4IIVA 2CVQA 3Q6IA 2ZIUB 5AJYA 4CEIA 3LYUA 1JEAA 1W73A 4BX2A 1W48A 2CNOA 1YBVA 4BFLA 1CCWA 1S1AA 3KHUA 2Z4FA 5LB2A 2AREA 3LC2O 4J0KA 1M0EA 2QMHA 4IOJA 2AZ4A 2AS0A 1TM4E 5IMBA 2EP5A 4IW3A 5LUBA 1FMD2 1WCSA 1VE7A 2C94A 4OF4A 4QU5A 1T3HA 4AIIA 3KG2A 4MKZA 1F12A 4YQFA 2FWRA 3B82A 4QGSA 1XHLA 5EIHA 1SCNE 4GQBA 4RTLA 1H6DA 4YFWA 4E2QA 1XQXA 4JODA 5AVTA 1U94A 1AN0A 3AQ4A 1HN0A 2YYOA 3SS7X 3SP1A 1QOZA 4KK4A 2JGMA 1ISFA 2A5ZA 2GH8A 1GFSA 3KSUA 4KV9A 3OYWA 3MICA 3ITQA 1V6IA 3CX3A 5DBOA 2K87A 4E6PA 4HH3C 5KC8A 4JZRA 3O6VA 5C4IA 6ABPA 3A3KA 1UU4A 1L4HA 2ATEA 2X5KO 1AYM1 2VYVA 4Q2FA 3CJIA 1HYHA 2XOEA 2FP3A 2GHQA 3VV2A 2PHDA 1EE1A 3FE2A 2PGLA 3MUOA 3KT4A 3AXTA 4RMJA 3DP7A 2Y9PB 3RC3A 2VA9A 5HG0A 1IPFA 3ISVA 4LE0A 4OAQA 2WLQA 4P83A 2VMFA 1L4KA 3MS7A 5C1PA 2IZWA 2CN1A 1A1VA 2X4IA 3ONEA 4ZO7A 1D2SA 4DYHA 1R0BA 1YDMA 5T5JA 4PC3A 4TYQA 1XUOA 4U3JB 3BOSA 1O94A 3LY8A 1FDSA 2QUAA 4B4WA 5HKBA 1LBTA 2WTAA 3WCRA 4GW3A 4BKOA 1FSZA 4N40A 3KHSA 2IXLA 4NHMA 1U4SA 4LE2A 2RMU1 4BGEA 5JY6A 4DNFA 2GBPA 1BVP1 1MC5A 4H3VA 4B3CA 4X1YA 3M9WA 1N6KA 1JDTA 1VCOA 1Y9AA 4JV5B 4PR3A 4PNPA 1CS0A 1OREA 4HGYA 2B5VA 4AUEA 4DXZA 3PV0A 4XJXA 4TRMA 1VHJA 4DEQA 2WIGA 2ZIZA 3U1XA 3ND5A 4W1QA 2PFSA 5IKEA 4JJIA 5ER6A 4YVWA 1HQNA 2I7XA 2QE7D 3GFBA 3FVVA 5JR2A 1DKRA 3DULA 1PJCA 3QBVA 1WUTA 2QRJA 4ZVUA 4FB4A 4C2TA 4HNVA 2HQ1A 2EWMA 2B94A 2X1VA 3JWJA 2G06A 3LIIA 1B0ZA 3R4SA 3TRDA 2PD6A 1A77A 1R4MA 4Z9AA 4L95C 4EITA 1I2CA 2GTIA 3N9QA 2XT9A 2FBEA 4TLFA 3UKOA 3MMXA 1JG2A 4QUBA 4RFRB 4I0WB 1VYUA 4E14A 2IPAB 2PJRA 2O0MA 4IMIB 3GZAA 4HMQA 2ZE6A 4N5LA 2ZJBA 1TIBA 2HPVA 1QB8A 1QDUA 2X5XA 1R1A2 5EMMA 5DYTA 1YS7A 2NPOA 1Z0SA 1NF3A 4L75A 3L7YA 3KXPA 2NO9A 4O7XA 3NNLA 2HC9A 5FQ0B 1J42A 4KXQA 4HRYA 2J45A 3O82A 1N7HA 3GLIE 4CQJA 4DS0A 5GIPE 2X4LA 1ZISA 4E09A 3RNSA 1SZJG 2A9FA 3Q8WA 3PX3A 3QEBZ 1HH4A 3SHWA 4JAVC 1BQ3A 1S7CA 4EKYA 1SBEA 3SE7A 1ETHA 4TTSA 4FT8A 4M36A 3C5EA 3MBKA 3O4JA 4MV3A 4BO6A 3E6BA 2F3QA 4BC1A 3QXHA 1U0LA 4QOJA 5BUSA 2OXBA 5LQUA 2CXUA 5LBUA 4NABA 4C4TA 1IKQA 1DWOA 3NOQA 5JZGB 1P91A 1PS8A 3JQPA 4PXYA 1Z45A 1I3KA 5HRUA 4LBVA 5EQJB 1QWOA 3KSBC 4Z54A 2VSXA 2HK9A 3NSTA 5AJUA 1SLLA 3FKQA 2WBKA 2QNIA 1NYLA 3SH5A 4NYIQ 5CPFA 4RUKA 3SXUA 4PHTA 2L18A 4YALA 3OP4A 1RRCA 2QI9F 1LNSA 3T4HB 3PQ6A 1EVQA 1SLIA 3WDLA 3FTQA 4S2UA 1J58A 1NJ2A 1JJBA 3ZXKA 2AFIB 3IP5A 1IPJA 3H7IA 4YRJA 5HJ5A 3OZEA 1A50B 1IWOA 1YCFA 5CB4B 4P9LA 4LYFA 3INAA 3ON7A 1EWQA 2IGTA 4C4RA 2F6RA 1VB2A 2HBUA 3VHRA 2Q1FA 3WGQA 1SUWA 2FZKA 3V65A 5DO9A 1A9XA 3A2NA 3CONA 1PZFA 1VAKA 4MHRA 3RUIA 2WNSA 3BGVA 3JCZA 4HG2A 5JEDA 2M1ZA 1PD0A 4O1IA 4UHEA 2JARA 3KZMA 3PGJA 4YRNA 2F64A 1DKUA 4GL2A 4RGAA 2F3SA 1GA1A 1U3UA 5FWYB 1JHQA 3R0ZA 5A3TA 3ZVXA 2VP2A 2OZLA 3I8XA 3ZQJA 2GPJA 2QAGC 2VSQA 2CF5A 1Z4OA 3R6WA 4PYQA 3WWZA 1RAGA 3ORSA 4EELA 1BDJA 4IGAA 2WSLA 1W87A 1IY1A 2BFWA 1ZK3A 4C7OB 2XBO2 1PW7A 3WP5A 3PUJA 1E8MA 2LDXA 4N47A 4RTRA 3GJAA 4MH0R 2R7EB 2GNOA 4KQ1A 4PJYA 4RPJA 3CGWA 2PUEA 3G1WA 1JIJA 2QRGA 1P7VA 2WU3A 5L6LB 3ETCA 4CDXB 3HEAA 4GPD1 3MIFA 3LEGA 2AZDA 4NG5A 5K09A 4UW4A 4HXCA 3CVOA 3GEHA 3EA4A 4KXNA 2CXSA 2C2OA 1O87A 1OU4A 2G36A 5ALQA 3JWIA 2BBWA 4EQ6B 2Q99A 4D45A 1QHXA 1M06G 1N2JA 5COAA 3S2EA 3QUAA 1NVEA 3VNQA 4QB1A 2O7VA 4DXSA 5LASA 2VNHA 1Z6TA 5CJJA 5FZAA 4WOPA 1EV13 5FZMA 2PUHA 2JIRA 9MHTA 2PYDA 1EDBA 4OQFA 1E5HA 1M7GA 5BV7A 4BQYA 1OI7A 4OLJA 4HCJA 1T91A 4LZPA 2I62A 4WZAE 3L6OO 1FVHA 4AHWA 4HYTA 4EHDA 1RUC2 2WHPB 4QOFA 5JO9A 1UAYA 3OTQA 4M2LA 1AUOA 1CR0A 2FG6C 1C4WA 3HUDA 4EGFA 5BNOA 1E7QA 2GAAA 5GZ6A 1BDHA 3C7AA 5HIKA 1QC5A 1DV2A 1K3IA 4GM0A 2ZRPA 5LYJB 2WRZA 3I28A 2RK6A 1XZPA 5EE9A 3AM4A 5LQMA 1USIA 1ZIXA 2I7DA 5EKSA 4HUTA 2VDUE 1SO8A 2W94A 2Z83A 4BWYA 3GXOA 1FCJA 4B75A 1U0RA 2BU9A 3CF2A 3VU9A 1GNTA 2XT0A 1IOAA 4DJDC 5JD4A 5A5FA 1M2WA 3NBXX 4POAA 2AT1A 2VUDA 4O2AF 2MPFA 3MO4A 1CF2O 3U1BA 3MOGA 3TLJA 1U9JA 4J0HA 4MH0E 4RKWA 4YW4A 2FSHA 4FDTA 3KSRA 3BL6A 2P6OA 5LJLA 3NCTA 4CW7A 4D0RA 2R1DA 5AKGA 4BZXA 3JQFA 4QUKA 2RIPA 2CV2A 2EFHB 1GZWA 4RGVA 3LCPA 3ILXA 1W9FA 1PO12 3AKRA 3DQZA 4GRIA 5IAOA 4FFRA 1RMU3 3HP1A 3QU7A 2YFHA 3L18A 3G1TA 3RV3A 3WQSB 2ZDQA 5FZFA 3OCCA 2FZ4A 4CQLA 1C2YA 5HR5A 4OK6A 3P9PA 1U2DA 2JFGA 4B7ZA 1X2EA 1YJKA 2PU5A 2W2MA 3FJ1A 2ZAIA 4LO6B 4LY0A 4HFRA 1NW4A 1R00A 1A9PA 2PS3A 5C8ZA 1T9GR 3YASA 1B35B 3MRSA 4P7FA 4LF8B 1KI6B 2C5AA 1FNZA 1I8TA 1YS6A 5JFOA 4I9GA 4YGCA 4WI1A 1LUAA 1YBAA 2HM7A 4FXOA 2PA7A 4X8HA 4XPIA 4BLVA 1UK7A 3BJMA 3HH8A 4GM1A 2CYFA 2JJ6A 2QE7A 5FUIA 3OZRA 2IUSA 1QCDA 3ADKA 2ZIAA 1QRRA 4YZ5A 5K2MA 4XQEA 4HX5A 2VZTA 4DQLA 5BRAA 4L51A 1Z33A 3CUSA 3DEKA 5I0SA 4ZONA 5DT2A 4Q18A 4ZOEA 3ZDBA 4HDCA 1KWKA 2IYFA 3PJRA 2CCJA 4XW3A 5JNTA 4D3DA 1N0WA 3SJCA 3IJ5A 3F4LA 3NV7A 1A5AB 3F7MA 1T2AA 2B1GA 2IU3A 5CT6A 1ODJA 1EVZA 2AN4A 4O4LF 1GQFA 4QXCA 3ITDA 1LRKA 2ZXUA 1JFRA 1FS4A 1M0SA 3VKVA 3ZBUA 5KMGB 1AY0A 1GKKA 4G56A 2HCJB 3VDBA 4FYIA 1E2IA 5KJCA 1RZ3A 3RGWS 1L7EA 1FTWA 4EJSC 2VG9A 4LO4B 1ESNA 5H9RA 4J3JA 4ZPXA 2P3QA 2VXOA 3A7EA 1YF3A 4TWZA 3ACIA 1HTWA 3A0RB 4F7DA 3H7JA 3AWDA 3QQ5A 2PELA 2X0DA 5G02A 1DFGA 3PLQA 3IIEA 1ZJ5A 3MWFA 4QHOA 1UMHA 2W52A 3NMBA 1ZAKA 5HWSA 2BCGY 3W6OA 5BW6B 5CHEA 4A0RA 3WP0A 4DFDA 1MQ8B 2VECA 2ZZJA 2O8CA 2EYQA 1XTZA 4UBNA 4O2BF 5KXBA 4KN9S 3PCTA 2QQEA 1X1DA 2AVDA 2W2QA 4KI7A 4HDRA 3K05A 5K0EA 3SC2B 2P8JA 1I7NA 3A1TA 3ZNOA 2UZIR 3R77A 4EL5A 4Q4V3 2HMUA 4XETA 1S3FA 1HW5A 4A8HA 5J4YA 1TGVA 2XZPA 3RUDA 2QA5A 1UJ2A 1SIBE 4A4DA 4LKFA 1MR3F 2YOHA 1QUFA 2O1WA 4ENUA 1DCMA 1MRNA 2GESA 5K0BA 5G04L 2XB2A 1W6QA 3TTSA 2QTWB 2I6QA 1XLUA 5FZ6A 3C41J 3ZKWA 3WLSA 3JU9A 3C5WP 3C3CA 2YIJA 1XDGA 5PNTA 5KAMA 3S5AA 4P84A 1QQBA 3ZG6A 6REQB 5L3QB 3ZHOA 2XBUA 3GDOA 2Q6KA 1N1GA 1NU6A 1DKNA 1QGLA 1P3DA 1O8SA 1C8BA 3IUSA 4QQLA 1X8LA 1E2DA 4TM8A 1HC7A 1KU6A 2IZOA 3NQ41 1B93A 4MW1A 1R15A 4MWSA 3BBLA 4AEJA 4LDZA 4DKJA 1GV9A 2VQ6A 5ABJA 1THMA 4HDNA 4GUAA 1VG1A 1XD9A 4MWGA 1TIPA 5EJ9A 1XAIA 4MSUA 3WP3A 1XL1A 4OSPA 2EX0A 4DNPA 4QICA 4RF3A 1KEKA 1MVOA 1E5DA 3UJDA 4N48A 3VU3A 2Q0XA 3CNLA 3M4FA 1YC61 1TAGA 1GKLA 5D5HA 4AFBA 2E1PA 5ANNA 3RR2A 1BMFD 3CZMA 4TL8A 3SGLA 1ATIA 2OXIA 3D8HA 3QKRB 1BEEA 5CR9A 5HEKA 4DQAA 4JEHA 2WILA 4W8GA 4PF5A 1H9AA 1OFIA 3A1CA 4IUBS 6PFKA 3QPCA 1VA4A 2Z5FA 5KR7A 4IGOA 3VBUA 1A5TA 1E1MA 1P39A 1SVKA 5E3HA 1W8TA 2B92A 1KORA 5HM6A 1FXWF 3F73A 3FZQA 1XMIA 1KFBB 3AEQA 1IATA 2Y6HA 3A4TA 1I5EA 5ALRA 5C80A 2HJWA 4KXFB 3R9XA 2Q5QA 3K0CA 4O2AA 5JWRA 3F0TA 1D2NA 1JFSA 4PDWB 4IVRA 4Z7NB 2D54A 4M46A 2DHQA 2IXBA 2BGLA 1MQAA 4GU5A 5C4WB 1HY3A 4CKZA 4B3JA 1B43A 4BLOA 4XF9A 4MRPA 3V8BA 3EDOA 4XQ0A 3ORQA 2D1RA 4MAAA 4DB5A 4GSYA 4J0GA 2FHRA 2Q4TA 2ZYGA 1ZSYA 1JOBA 4QQOA 4JOCA 4EFNA 5T3UA 4AJ2A 2D5BA 2WO7A 3MPOA 4DIEA 5JSZA 1LC0A 2JGJA 3V4VB 2OO5C 1JI6A 1X7NA 2ZVDA 2B8WA 2GTPA 4IS2A 1PS0A 2QUOA 3OIWA 1STOA 3ROKA 2DUQA 3DYOA 2D7DA 2BDRA 3LEMA 4DCCA 2RD2A 2NU9B 1QYCA 1U0TA 3I2DA 5EZYF 1YL6A 4I0AA 4C1WA 1NXPA 2LVBA 5JROA 2OGSA 3U6BA 4DUZB 5JOWA 4V0NA 4R8RA 1RNLA 3ONDA 1KKUA 1E9EA 2OQIA 2FR8A 3VDDA 4L72A 1K8ZB 5IDVA 5CFCB 4L16A 1VBA3 3TKLA 3ZFGA 1AQJA 1Z0KA 2HXYA 3AO0B 4PTZA 3L01A 1EUTA 4F2WA 2W6NA 1Q7RA 1QJEA 1DBQA 2A8YA 4FVTA 4GLOA 1J33A 2OXEA 6NULA 1ZUWA 1L4EA 5BOVA 2WG0A 4XPVA 1W76A 5EFOA 3LK7A 4KE9A 4AK9A 2IYPA 2FW9A 4FOYA 2AV6A 4W4TA 4OL0A 5DW3A 2A73B 3DVAA 2CXOA 4FX5A 4KQWA 1ZI9A 3QBEA 3WLUA 4IX1A 4BGVA 4FDLA 1H2RS 3GJXC 1JF8A 3NBFA 4O4LA 1FNMA 4G1UC 4RE6A 4NBVA 5B2ZA 2X6RA 4IDGA 3JQ8A 1RWNA 4L5YA 4UQLA 4RZIA 3ABOB 2RI0A 1W3XA 1C3VA 2W6ZA 1QJY1 1QDEA 3W2IA 4UTVA 1OIVA 2QORA 4TX1A 2ZYRA 2OP0A 3NT2A 4RHXA 1G2OA 2Q5TA 5HRAA 1FFHA 2ZIVB 5TEWA 5CLFA 3PHGA 1K9VF 1MO6A 2G8NA 5ETJA 1ML4A 1U4OA 2HWUA 2D4AA 3C6XA 4W6YA 5TMDA 4V38A 2Z2JA 4OI0A 2J32A 2V7PA 2R073 5HFAA 5ALHA 4LI0A 3L7CA 4ISBA 1FFXB 4R8SA 3J8F3 5HF6A 3ZI0A 1Z75A 1KBOA 3TFOA 1IY0A 4P93A 4O2BA 3S0JA 1Y3TA 2OKGA 4L02A 4FBGA 4F6RB 1D8AA 2VZ3A 4AN0A 3S28A 2A7QA 2YHBA 3NMUF 1XMXA 1XKLA 2XEDA 3FFTA 3CJXA 5EYPB 4UTOA 1XTPA 4DAOA 3I72A 2D93A 3ETPA 5IP5A 4B17A 1K2VN 3CUYA 4W6ZA 3UB2A 5C5CA 1WCQA 3TIXB 1S2BA 4LHXA 2OB2A 3TM4A 4IR7A 1VQ1A 3EVDA 5APAA 4FN5A 4AY3A 3EYWA 2PX4A 4S0XA 2WWHA 2C9OA 5C3UA 3HNYM 5LNK6 3ACGA 2WYHA 2HA2A 2Z1MA 4KR9A 1L1EA 4QZVA 3CO5A 4FEYA 1JOJA 1CF4A 1DRJA 1G7CA 3FTPA 3N0VA 4X8OA 4OG2A 1KNXA 3HLYA 3P27A 4BV2A 4WERA 2CL6X 2PN1A 3B52X 2X9VA 1P17A 4OXKA 3CCCA 5ITZA 2WQZA 2BEVB 2I6UA 2O8CB 2O57A 1EUCA 1RM5A 4FN4A 1SUIA 4KQ9A 2YFUA 3TQQA 4YTEA 2GXQA 1ADFA 4ZYZA 1AQ6A 3B6MA 3UBTA 4HDRB 1OJ7A 2ZVJA 2O52A 3AY3A 4RTNA 3T3GA 3LMKA 3NUZA 4L74A 2OUJA 1F2NA 3GLQA 3L6BA 3MRVA 2GU9A 1H23A 4IBOA 3ZIUA 5LSAA 4LGMA 4INOA 2H1OA 3BXOA 4ZEOA 3LP6A 1VKHA 4IS3A 1TRKA 1VBC2 1NVVR 4AAYA 3T3IA 5BSMA 2VDKB 3VBSC 1JZ2A 4JZKA 5MDHA 1N7GA 3HNBM 4FGUA 3NALA 4YG6A 3D6FA 4E5KA 4D7SA 1ZMRA 1FXWA 2O3UA 4V0RA 4DSOA 1QQP1 1XRSB 1UK6A 4Y1RB 4BUZA 2NP7A 1ORTA 5JARA 4JI0B 4NE7A 3H17A 3OBRA 3B38A 4ARXA 5K3DA 4JROA 4JBXA 3MGCA 1EM8A 1IS6A 5FD8A 1RJEA 4NOMA 4RVNA 1LGCA 1NXSA 3QUBA 4R5MA 5GONB 3K9FC 4V0LA 1PX2A 2YN2A 5CA1F 1Q7CA 3HCBA 4KG8A 4CHGA 1YYNA 3QV1A 1KOFA 4CKEA 4YXFA 4XIFA 3VPGA 2NU8A 3AGPA 1UKYA 3RUCA 3A4MA 2O06A 3L40A 5IFLA 2B37A 2JJMA 4HEJA 1U65A 3RRNA 1JLKA 1ORRA 4IICA 4PCLA 1W4RA 1YH3A 4MP8A 1XTKA 4R2WA 3KX2A 4YGXB 3OUJA 3EQZA 2Q3HA 5LWQA 2IYUA 3AEKB 1N1DA 5FXZA 1YI1A 1PR0A 1QH8A 1BBT2 2LCQA 1N5IA 1HFKA 5EZYA 2XJPA 1P2FA 4MVTA 2RK4A 5BNNA 1E4OA 4Q3EA 3VBUB 2XQKA 5EKXA 3BMOA 3PT9A 5H68A 1BMFA 1JEEA 1ITZA 2ZB4A 3T0IA 3TXXA 5JSQA 3SZMA 4EHIA 1OLRA 2HB6A 5CW1A 4R8KA 5LATA 4KITB 3I34X 1M0TA 3MFQA 1M2EA 3KV6A 1MA0A 3FNHA 3KAQA 4PYOA 4IQ0A 2C7OA 4WACA 4PG5A 1Z5OA 4NH4A 4AU1A 3I8SA 3P4UA 3WADA 1OV4A 2XZOA 3N7UA 2IEDA 1FP1D 4Q8LA 4ONUA 1QK5A 4YUWA 1J24A 2W4QA 2Z3ZA 4MKFA 5K6RA 1HNXB 2GK3A 1DHRA 4ZDWA 2JEZA 1J22A 1Z28A 1L5HA 3C7GA 4LV5B 5BWMA 2F4PA 5ITWA 2N0SA 3E5HA 1RHUA 1PEAA 2FN3A 3RI8A 3UWPA 2Q8PA 4CDUB 4HWOA 3EZFA 3QU5A 3OT1B 1ND3C 2X5JO 4PO1A 2XRZA 2AF4C 2XMGA 3OBBA 2V8OA 3TUJC 2JS7A 1W44A 1VL5A 2JASA 2JEMA 1QXSA 4Z8XA 3ZZ0A 1WMAA 3INGA 4XC9A 4IFIA 4P54A 1KMMA 3DMYA 1ZVKA 2APJA 1MS3A 5T8KC 3O1TA 1MENA 2O48X 1BW9B 4Q9HA 2HYXA 5EUMA 1IK4A 1AK9A 1QBGA 4MVJI 2ZAYA 1HQWA 4P5YA 3VDDB 3RYCB 4EFLA 2HMTA 2BHRA 4FFGA 3BHJA 1JHNA 3RUHA 4WXEA 1GBGA 3ASUA 3GXBA 1C0EA 4NBKA 1V8FA 2HYDA 4IQ8A 3WGYA 1R27A 2PDAA 3T7JA 3HWX1 1JHOA 2JLUA 4G86A 1MN6A 1EK2A 2P2KA 4B79A 3DMTA 4U00A 1IZ8A 2WJ4A 3H3LA 4O3MA 3ZE8A 2R6R1 3PENA 2OV6A 1N2GA 1XNAA 5A6SB 4B31A 3IZOA 3WRWA 4IKOA 3C3JA 3WXPA 5AH0A 4O25A 5JPNB 2XB9A 4CFYA 4YCDA 1PR6A 3EXEA 1OH5A 2NAPA 2JECA 2BM8A 4ER6A 2W42A 1JN2P 2Y2VA 3FHAA 3LV8A 5FOSA 4LUKA 4IVPA 1E1RD 1R083 1DSSG 4ID3A 2R1TA 1ZCJA 2OQ7A 4YRMA 2YR0A 4E5NA 1B09A 4RVDA 1FU8A 2J9FB 2AZMA 1WBJB 3PC8C 4N3AA 4G81A 3WF2A 3VZSA 2RE9A 1ZRIA 1VIVA 1DAEA 4G9GA 3V4ZA 1N34B 3FUXA 3NHSA 4IE4A 1U0EA 2JA1A 1YR7A 3QIVA 2XYGA 4KQKA 4YM3A 4WV3A 3VU0A 5FF9A 4OHRA 2BUKA 4HDMA 4MQUA 3U5ZB 3UJ3X 2W4MA 2WE8A 2H9AA 3PYXA 4ITUA 2VMHA 1BMDA 1ZVFA 5BNPA 3U4DA 2DY1A 2GEFA 2QL7A 2FN7A 2NUPA 2O3SA 4UWDA 3O83A 1KGSA 2TNFA 4B47A 4BQXA 1TZMA 3U5TA 3NXKA 2XB4A 4XIJA 3E1F1 2CZQA 2DR0A 4EY6A 2A9JA 4JELA 5SY4A 2JGRA 5A7OA 3L7MA 1JZTA 2SCUB 1MZPA 1QCZA 1AQNA 3BIFA 2W71A 1C9JA 1Q17A 3ASIA 1SBZA 4FOOA 3VD4A 4JUBA 1PEYA 3LDFA 2UXDB 2A6YA 4EY7A 1JHJA 1JQBA 3WGZA 1E64A 1T10A 1VI6A 2Q3EA 3CLTD 3QLVA 1FNYA 4L0MA 3QWIA 3H6GA 1SQ5A 4M8LA 4CM4A 1L5SA 3F97A 3AL2A 4GR4A 1IEVA 4M1QA 4WN3A 3NGMA 3MUZ1 3IIAA 4FYMA 1E92A 3PFWO 1EK1A 4KIWA 1P72A 4AEKA 4IL5A 2MHCA 2NYUA 4GDFA 3U3KA 5JUVA 4V1CI 2GDFA 4H31A 2VGDA 3VH1A 4LHYA 1BX0A 1DPFA 4XZ3A 3BIWE 1W5EA 1YB7A 4S2FA 5DUVA 1WXGA 4DRXA 4MXWA 2LUWA 2WS93 1BX3A 4KH0A 4PGGA 3RB8A 3L84A 1DWPA 2CC2A 3OQ1A 4K21A 5CB4F 4LCEA 1YFUA 5LWHA 2PLV3 3ZWAA 5LYYA 4D3SA 1V4VA 5F7ZA 3IVGA 1X7WB 2O23A 1SHZA 5FIUA 5LR6A 5IJ9B 3H7YA 4F3KA 3QSGA 4G0WA 3C6KA 1SHUX 3PC6A 1OR8A 4H59A 3RTAA 4AC9A 3EY4A 3T7AA 3ZBTA 3PZBA 4IWNA 1XXHB 4ND2A 1RUF2 4JTOA 3CLSC 2ECQA 4GZ6A 2VDLB 1Q92A 1ZH6A 3PL0A 4YWAA 5H9WA 3CXUA 1QAOA 3ZHCA 1Q1GA 3BSYA 4I7EA 2UUBB 1D2HA 2PZKA 3ZDQA 2RKWA 1R6VA 3X1MA 3T9CA 1QG0A 3ECSA 3HD8B 3K0FB 2FPIB 3ON5A 1POV1 2DZDA 2QIPA 4RIFA 1XX6A 3GJQA 3POIA 2A4KA 3HJUA 1ZZEA 2ZRBA 3LQ2A 4F1JA 1SBFA 2YZ2A 5EKDA 2VP0A 4JLWA 5HZMA 3EDQA 4G4SP 5CIQA 3RLFA 3W0LB 4ZVTA 2EIGA 1QJ4A 4CLHA 3FLTA 3V46A 4BVLA 5LUAA 4QPZA 1PNVA 3S29A 2FQPA 3BX1A 3EODA 2YZ7A 3W9AA 2E89A 2X0KA 4KWUA 4R4JA 2RG1A 2WA1A 1HEIA 3DGFC 3SSOA 4LDJA 3LIHA 4NNOA 3S2FA 3P52A 3TPFA 4C87A 1GTVA 2DOKA 4QQPA 5DXFA 3WVNA 4U3JA 1ESDA 2VR4A 1E2FA 5K4AA 4N1AA 1XYYA 2IYQA 3HSSA 1YS1X 1J8MF 4X91A 4US2R 3FX2A 1WWYA 3O4RA 2XZLA 1DTSA 2GEDA 3ZXEA 3EIWA 5JNUA 4RFLA 2JHPA 3HG7A 4BJ5A 1Q0TA 3D81A 1EK0A 1JB9A 2J5RA 4YREA 1CS4C 4Y6QA 2X8KA 4AMUA 3C1UA 4DV5B 3H5WA 1QGAA 2EBFX 3FDXA 1OD5A 4IJWA 5E89A 3ZD9A 4KIUA 1QIHA 1PVC2 5LYJF 1Z12A 1NW3A 1RKBA 4M9XA 3EHDA 3GRUA 5GJWC 3T0AA 4CHTA 4R4ZA 4EAQA 4EIWA 1PKXA 3MUY1 2B39A 2GC1A 1U1IA 1ZUNA 3VSDA 3I9LA 3ABZA 1R0YA 1WZ2A 2PTMA 1FBNA 1HL7A 4FLMA 2WTNA 1NG9A 1YHFA 5FUNA 3OQIB 5JRJA 1RJWA 5K3EA 2TMDA 1KY2A