2G9ZA

Thiamin pyrophosphokinase from candida albicans
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
322
structure length
297
Chain Sequence
SELIEQVIEQPDSLIISPPSYNHIQPFVYLHNVLLILNQKITIDLISLWKKCEIIVCADGGANSLYEYFNLQRSDYIPDYIVGDFDSISPDVKTYYESHGSKIIRQSSQYYNDFTKSIHCIQLHYQLNHTKENWFESIDEVDGLAKLWNGLNNSSDVVVDIDITIYVLNAIGGRFDQTVQSINQLYIMNEDYPKVTVFFITTNDIIFLLKKGVNYISYKNRLMFHKDNGSSPTPTCGLLPLSNKTPIILNSYGLKYDMRNWKTEMLGQVSSSNRISGETGFIVECSDDIVMNIEIDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of CA1462, the Candida albicans thiamine pyrophosphokinase.
pubmed doi rcsb
source organism Candida albicans
molecule tags Transferase
molecule keywords thiamine pyrophosphokinase
total genus 95
structure length 297
sequence length 322
chains with identical sequence B
ec nomenclature ec 2.7.6.2: Thiamine diphosphokinase.
pdb deposition date 2006-03-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.320 Mainly Beta Sandwich Jelly Rolls Thiamin pyrophosphokinase, thiamin-binding domain 2g9zA01
3.40.50.10240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Thiamin pyrophosphokinase, catalytic domain 2g9zA02
2OMKA 1IG3A 3K94A 2F17A 2G9ZA 3S4YA 1IG0A 2HH9A 3CQ9A 3LM8A 3MELA 3IHKA 3L8MA
chains in the Genus database with same CATH superfamily
2FOLA 4GIQA 2GNPA 1QVRA 4GKJB 2BGJA 3A32A 3C7DB 4HBGA 2XTNA 3PDWA 6REQA 4BZPA 1NC1A 3SQXA 1ZVMA 2W2QA 1QGOA 1H6XA 2W92A 3J4UH 5FJHA 4UAGA 5DW0A 3CTPA 1WLDA 2D06A 1NLFA 4ND6A 4XILA 2YMZA 3G02A 1VKOA 4OHWA 1QVWA 4LX8A 1V7PC 1NQOA 1NHGA 2ZSFA 3HVJA 4BQWA 3RAEC 1WR8A 1RLOA 1GDTA 3V46A 1GZ5A 2DU0A 3GGCA 1E3WB 2WIGA 4F3TA 2GERA 4W6XA 4TTPA 2GKGA 2R79A 3R44A 2O2HA 4J90A 2B46X 3LHKA 3I4FA 3KKMA 4AFAA 3RU3A 2WSIA 4KH1A 1QJX3 3CLVA 4BDTA 1QTIA 2F7SA 1BC5A 4JHTA 2AZ4A 4BVGA 2C3YA 2DCYA 5G1OA 1DCTA 4OGGA 1CDEA 1RE1A 1MVNA 5T4EA 4LXQA 3KQQA 1YTUA 5JZGB 4H7FA 4QFMA 3VZKA 3G2KA 1E98A 4R31A 3U56A 1RUF3 4M54A 2NUAB 5BR1A 1U3GA 1C3VA 3ORYA 1DKOA 1USIA 4HLQB 4FJ0A 3WWCA 2YW2A 2WP0A 3GZTB 4LZWA 5AKHA 2EJBA 2R44A 1L7DA 3HVKA 4FO9A 4JLOA 5ALUA 2WZR2 2OBLA 5ITVA 3NFRA 1P1CA 4D6YA 5BSTA 3THYB 1HMPA 5BV8A 1EVIA 3MT8A 3FPCA 1ARZA 2P75A 3PQ6A 1OXBB 5EI5A 1YHNA 2FEWB 3P9QA 4JI2B 3KVNA 1NATA 3ITNA 3MFQA 3UK9A 2CYBA 4P7KA 3AP7A 3BWBA 3O92A 3TBKA 2IHKA 1YZGA 2NZWA 4BZQA 3RR2A 4C6HA 3A23A 4A3ZA 2I55A 4AUEA 3DGEC 3RYKA 1EDEA 1CY2A 4HPXB 3K35A 1UUFA 2JJ1A 3DHVA 1P5ZB 4FB4A 1BEV2 4H3WA 4B4OA 4D0SA 2GAFA 3C2UA 3GJZA 3KTAA 5GZ6A 2O3RA 1DLLA 1XDDA 3VZRA 3USUA 1DEOA 4HRYA 5IAAA 5EHDA 1MO5A 5KOHB 1EFPA 2EG5A 5K8VA 3DB1A 2I7DA 2OO3A 4HSLA 1LAJA 4BIOA 2IHVA 4K40A 1J6UA 1STOA 3K9WA 5B3AA 5ENVA 1Z83A 3GBVA 2XNJA 3NU1A 1R0YA 1ST8A 2AEZA 3IUPA 4TTVA 3ZCUA 3HADA 1XZQA 5DT2A 5EUBA 4TT3D 1HDEA 2C7PA 2ZB2A 3IEMA 2WJIA 3UKVA 2Y6HA 2HU5A 3BXOA 1ZQ1A 3NC4A 4E3ZA 1PJRA 2OFOA 4Q7KA 1LA2A 3QVGA 3RWMB 3ZXSA 1ULFA 1HKHA 4M99A 1GAJA 1WX1A 4PIXA 2O06A 1EAYA 2G5TA 2P2CA 2FEOA 1SIBE 1RPNA 4LDRA 1NBME 3S0MA 4BO1A 5AVVA 2RJ2A 4UAUA 1GZUA 4ZP1A 5L6LB 1FE8A 5T64A 4DC9A 4B75A 4UF0B 2XRFA 5HEKA 3VU9A 4RPCA 4EI7A 2WSVA 1F2NA 2AG6A 5TQJA 4OUDB 2WJHA 4ZS2A 4W1PA 3RIEA 1C1YA 2JG9C 1RRGA 1VLNA 5JVDF 1A88A 5DGTA 2IRWA 2C57A 1IMOA 4EKIA 1QHGA 2VJKA 4D57A 4KR9A 3N7LA 1BMDA 3ANLA 2O2JA 3BKXA 5JD6A 5JU6A 1XAJA 5IZ4A 2BF4A 3PR1A 1HE1C 2GC3A 5TJ9A 3RBZA 3RAFC 2OOKA 1CQJB 2D5FA 1I32A 2Y6UA 1JDZA 2ZX3A 2PVPA 2P2ZA 4MVJI 3SJBA 3OX3A 1AMNA 5FT9A 1JN0A 3WADA 1QG4A 4P92A 3W7BA 3RS3A 4FHFA 2E7ZA 1HLCA 4DLBA 1X0VA 4LI0A 2QE7A 3NVMB 5FZ9A 2EX0A 5GAJA 4KQFA 1EQAA 1DFHA 3QGMA 4BLOA 1RW4A 3A4TA 2ZZJA 4NMMA 1QJZA 1V37A 1NY6A 3S40A 2BM8A 4ILEA 4PLCA 1E9RA 2YC4A 1H05A 1JG3A 1CJCA 1R091 5LP1A 5JSOA 3D8SA 4KDRA 1J33A 2GHIA 2J85A 4PS1A 1O5OA 4RHV3 2HJRA 1BMFA 1XSRA 3QHQA 4GYWA 2WYHA 1B73A 3HY3A 2FSVC 3ZZTA 5A6VA 2EFYA 1P91A 3ZU3A 1I3OA 3HXQA 3WZ1A 4AX8A 5AW6A 1AHSA 4LEJA 1EPZA 3ESQA 3GRUA 2Y33A 3Q3VA 4QQLA 1T9HA 2OFXA 5JDCA 1ZISA 2EQ5A 4RNDB 3U7QB 8ABPA 4DMRA 1IXYA 1CUFA 1T13A 2LDBA 5FZFA 2CDNA 2Y1GA 4XXPA 4OHZA 1HRI3 1JAYA 2WJAA 1SC4A 1Q0SA 3N6VA 2YIDA 1X1QA 4Z8XA 5GPBA 3T38A 2MOKA 4Z9YA 3JQXA 1DBQA 3OCPA 3O21A 3DEKA 1UKCA 3B78A 4QOIA 1IS3A 2BKLA 1WF6A 3G8CA 3EFEA 3HBZA 1SHTX 4HWKA 4QPDA 2JENA 3EVTA 1YI1A 5I4BA 1FFYA 3F74A 4KR6A 2PH1A 3F2ZA 4MJ3A 2ZSJA 5FZIA 1OU4A 1CZKA 1P9OA 3ZDQA 1FUKA 4ZQGA 2WSYB 4I01A 4KLZA 3WJAA 2A88A 5HZMA 3CISA 3W05A 4A3SA 5JAOA 2V6IA 4JJIA 4R7ZA 3LYLA 1Z0SA 1AO0A 3BQNB 4Q4V3 1H1IA 4LRUA 2E89A 4YTEA 1QWRA 1TB4A 1PWXA 5DBEX 4O3MA 3CO0S 1TLLA 1YR1A 3FPJA 2ZSDA 3PVEA 2W1UA 4TL6A 1LDGA 4DJEC 3JBG3 2O0LA 1OFSA 1IS4A 2FWPA 1Y1SA 2REOA 3RJ2X 1Z07A 4IRMA 1V9SA 1II9A 3EQ7A 2YC4C 1G3QA 2F9MA 3PD1A 1GGHA 5JS1A 2VHQA 4YMGA 3SKVA 4IDBA 3CPSA 3O26A 3F71A 2VZ9A 4M7OA 5KNBA 3UAVA 3P20A 1S9HA 2GNTA 2GN3A 5E4YA 2BJVA 4JVSB 3B1XA 4MR9B 3MK31 1DGRA 2HJSA 3I6BA 1ADFA 2IHTA 4Y6LA 3VHNA 1RS0A 1Z5ZA 5L36A 2JIDA 1L7AA 4WZBA 2DEUA 2RK3A 4TM8A 4NU6A 1ENYA 1LI7A 3T7CA 2OV8A 3VNVA 3N2IA 4U7GA 3BDIA 3FYUB 5KR7A 1L5VA 2AFHB 1WQ3A 4KNYA 2CHQA 3ADPA 4J49A 4MZXA 3FRHA 4AF7A 2P6RA 3MIFA 1VMKA 5E1RA 2G77B 5LIPA 2VJXA 3DPUA 1N3IA 2HPVA 3NNSA 3OKCA 4FOSA 1WL8A 2XBUA 1YNAA 2ZAMA 1OLMA 3OURA 1AHNA 3IR5A 1TG7A 4DCMA 3V4FA 1MS5A 4UVEA 5DZSA 2W6IA 3UYJA 3PWTA 5THQA 4MAMA 2XTZA 3VBRA 4KBBA 3EAQA 3EEYA 4OM7A 1V0JA 2PFKA 3AK4A 4BNDB 4JGZA 3GT3A 1CF2O 4CL2A 3S8EA 2IYAA 4HDMB 5KO2A 1YVPA 4YW1A 4GSLA 4L2IB 4CL8A 3SS7X 1BS9A 2QRHA 4XUCA 3SQLA 3CH7A 1V26A 5L6MB 2ZJFA 1V5WA 2ES3A 3EGXA 4QOFA 3EASA 1SOUA 5H70A 3I9JA 4I1UA 2P3JA 1TW2A 1US8A 1E7YA 4OHXA 3GPBA 2ODNA 3LX6A 4CEJA 4FGLA 2H92A 4U0KA 2BHLA 5DTQA 4CEHA 3ZXDA 3A3PA 1GL7A 4PF1A 1BZYA 2Q2WA 2RDRA 1QWSA 2DRIA 1ND3A 3K70D 1UIKA 2BSAA 1N3QA 1KRWA 4CCAA 4OQ4A 1VIAA 4WCFB 2IX3A 1OURA 1W34A 4BECA 1TJ5A 4UVIA 4KXNA 4XB6B 2BUCA 1TD9A 2GHRA 2OLEA 5K3SA 4KGGA 1K7YA 3KZVA 1DKLA 4GMGA 4CFYA 1QHEA 1DNPA 3RFCA 2J9YB 1N7IA 4NBTA 1CD5A 1ESMA 3WG4A 1B43A 4D0RA 1V6SA 1GILA 2VN8A 3O31A 4M8NE 5CT9A 3F7MA 2QRQA 2VJLA 3FC0A 4U9IS 1U65A 4D9NA 4RTQA 2E26A 2ONZA 3EZXA 1U6JA 5EERA 4GX0A 1Y4DE 3U7EB 4X6RB 3ICPA 1PWHA 2XCIA 3VZDA 1UIJA 3K9QO 3GUHA 4EKNB 3UJ3X 2J5QA 1ND2A 3VVMA 2JIBA 3QKUA 2VTFA 3K70C 3CT6A 4YZ5A 2E4AA 3JX9A 2MJLA 4JY7A 4C08A 5D8DA 4KMSA 4HI0E 1DYKA 2C5BA 2J3KA 1NNEA 2QRVA 1WMFA 1KDMA 2X5IB 4J1TA 2O2DA 4IP0A 4U7TB 2P35A 4GZ6A 1EK1A 2HDHA 4A16A 2IXHA 3WW3A 1ZBA3 3VO8A 3MGAA 2DX7A 1W36D 5PGMA 2VJMA 3D8NA 1V48A 1JPVA 1U4SA 2D5HA 1VI2A 3T2TA 5FYHA 1UOPA 4GT1A 3QWAA 1C8BA 2GJSA 1E4EB 4UZSA 1W25A 1V11A 1GR0A 1W6OA 4OKSA 1RABA 4MHSA 4JBXA 2QGZA 1S8FA 3JD1A 2O07A 1SELA 1N5DA 4R1UA 4EGCB 5THXA 3ZZNA 1OUXA 3L49A 1M66A 1FJHA 3T0IA 2V4ZA 2QN7A 4MYEA 4YDHB 5FKJA 1SCDA 4C0KA 4IYJA 3ILVA 1LFDB 2AN1A 4CDUB 4PC3A 3U1VA 4TTJA 2CMGA 5FOSA 2CXTA 4AMYA 2FQPA 5TF4A 2PL9A 1F1JA 1AK1A 4NIIA 4G81A 1E2BA 1WB4A 3D64A 1XTPA 3VPXA 4J7CA 1VIVA 1Y3FE 2B36A 2MMGA 3ZU6A 4B33A 2C9DA 4KXVA 4J4BA 3M3PA 3H2IA 4M1YA 3IE1A 3M4YA 2FDGA 3C85A 3RBAA 4ZVQA 4Y2SA 3X1JA 2QT0A 4QX2A 2BM0A 1G16A 3PTAA 1LSUA 2AYXA 4N7MA 1J07A 3WKDA 4I8IA 1ULGA 5GKAC 3AP4A 2GA8A 1E96A 3GRFA 3LC7O 1WW7A 4FT2A 4LSZA 3LUDA 1Q0QA 4Y2TA 2FY8A 3TRDA 4KO2S 1MOQA 1WTCA 2AF4C 3GJTA 2A8YA 1E7MA 5IMBA 2A9QA 1QGZA 1D4ZA 3R5JA 2ISQA 1JDUA 4QJIA 3R3JA 1ISPA 1TIKA 2FAXA 4MZDA 3N0VA 5JJLA 3TMKA 4DLTA 3PXDA 5EVJA 4FFRA 4F3NA 4JQRA 4Z2AA 3RV4A 3FNHA 2GCOB 2A1UA 1FCJA 8OHMA 1ZJWA 1OTXA 3KUKA 1E1QD 5TT0A 5EESA 4TOIA 3IO5A 4A10A 3RDPA 3HCAA 1QIEA 4AG3A 2WTXA 1HK7A 3UJ8A 2FQ1A 1OZ0A 1B8PA 5C5TA 4KG7A 1DTWB 3B3JA 1IQDC 1J56A 1E5QA 4QGHA 3S1AA 1JECA 2AREA 1NYWA 1TE2A 4QTZA 4M0MA 4QASA 2PHDA 3HNYM 2N46A 5TMBA 5DYTA 3MC1A 1VE3A 3CNQS 1Y5IA 3MMNA 3PL1A 5AVXA 2WWIA 2ZTVA 2BN4A 2ZIEA 4L22A 1PAUA 3INNA 1GTJ1 4K6HA 4BO3A 1PV4A 3U4IA 2E5WA 2RJNA 3UPTA 3I37X 4JK3A 1US3A 4CU9A 5JBNA 4LYJA 1XNBA 1QLJA 4O9GA 5CDGA 3WX0A 3AR5A 4MQFA 5DRYA 4JH0A 3BRSA 3H65A 2E32A 4WCDA 1Z4LA 3WRWA 2R062 3W6PA 1U5YA 3I5UA 4AY6A 3VNSA 2RAVA 3BD6A 1NYQA 1PI3A 4MV8A 1P2FA 4KYUA 1YB2A 4QYXA 1NDQA 1HL7A 4QWNA 2R043 4IUBS 5C8ZA 4PYIA 2EAKA 3TG2A 1YVRA 3KP1A 2EGGA 5B1HA 2BH9A 3FYCA 3OUTA 2IU4A 1ZJ6A 3WGOA 3KAQA 4LHKA 3P52A 1N8NA 2X8JB 4RTNA 4LTMA 5A3RA 4GOMD 1W73A 3Q7PA 2V7WA 4MPPA 3VR0A 2UYCA 4JJ6A 5KC8A 1UP4A 1J99A 2IVJA 4ISQA 1QMGA 2EZ4A 1EFCA 1V6CA 4LF9B 2UXCB 4HDSB 3A70A 1DQYA 4PPNA 5BN1A 4YVSA 5K0UC 2ZR8A 4HDSA 4F93B 2DWQA 2X7XA 4YVSB 1RVF1 4ORFA 1SNYA 2AFVA 5AFSA 4M3CE 3KT7A 4RCZA 2V5AA 1KMNA 4P36A 5LU9A 4DJ5X 3E2PA 2NN3C 3U16A 3AP2A 1PT7A 1GWKA 1AQYA 4BNUA 1PV1A 2B9EA 3NGMA 1S3FA 3FFQA 2VPXA 2ZS8A 4OREX 5C34B 1TPYA 4O4LF 1GGFA 1FP7A 1I5PA 5E6UA 1T1RA 2RHPA 2ES4A 4PFJA 3AM2A 4ZXPA 2PD4A 2DZDA 3T9CA 4OV6B 5T8KA 5HIKA 5FL7A 4BNTA 2VBPA 4B4PA 1BHQ1 2O20A 4LSGA 1W1UA 5DM0A 5KWIA 4X92A 4YG3A 2CL7X 1KKUA 5JR3A 4FXKB 3MG9A 1KJYA 2BMFA 5A6SA 4HYQA 4FQ4A 3H9JA 3B53X 1VJGA 4OHYA 2C99A 1I33A 5IFTA 1JDSA 4JC8A 3THWB 3ZUPA 5J43A 1MH9A 1ODMA 1YIAA 2BEWA 5C18A 4J7XA 2PV0A 1AJEA 1Z0HA 5LDDC 1MXHA 3RTCA 1KZ1A 5I6DA 3W78A 1QZTA 1M6EX 3NOXA 1QXJA 4U9HS 3O1LA 4IGKA 1LK0A 3RYIA 1AZWA 3BRCA 1GUAA 4B73A 1OPMA 5KAMA 4F72A 3GLHA 1GAQA 5FUWA 1KE1A 2WDBA 2QVBA 1T1JA 1N7HA 2ZE7A 1DC8A 4RA6A 4XUDA 4POAA 2QLJA 1QH8A 3LYHA 4TL7A 4X6LA 4DHWA 5IEJA 2HIGA 3VJLA 3CBQA 4L4ZA 3QUAA 1ZN2A 4PBOA 4IKEA 1TM5E 3SLKA 2WWWA 4X44A 2AMFA 1PJQA 5BMVA 4DLZA 1CE8B 3VHQA 4NMHA 1IU9A 2V6MA 1WTAA 3WLFA 1SQ0A 1X8EA 4JT9A 1SG6A 3Q3CA 1MO4A 2HSWA 2ZJYA 1D2SA 1QO9A 1MAHA 4ZAZA 2M1XA 4EWDA 1OI4A 3TX6A 1ZIOA 4W5JA 5DZEA 1BCSA 2Q1TA 4HZIA 2WIDA 4KDFA 4NBSA 3QE0A 2ZOSA 4GOND 2I6SA 2QJOA 3AM1A 4I46A 3NJXA 3QYPA 2DH5A 1ZKMA 3D8HA 1O97C 1X13A 1V95A 2WNIA 2AK3A 4N3CA 1DX4A 2FZKA 4DJFC 4D69A 2ACEA 5SY9A 4Q4W1 1VL8A 3JATB 5C8CC 1NW5A 4YRSA 4IZOA 2Y60A 3N6RA 1A4RA 2YINC 4UUQA 3IIEA 1KYQA 5LCXA 3VOAA 4PAQA 4DC1A 2HXGA 2H1CA 2PZEA 2RMU2 1J5PA 4FZRA 2GFQA 2BOVA 4AI2A 3RC8A 3I8TA 2AX4A 2ZJBA 3ZHVA 2ZVQX 2WFMA 2QY6A 2JLRA 3KDPA 1CZVA 3W5VA 4RA0A 2Z09A 2ZRDA 4GOLD 4IEPA 2PVCA 1JKJB 1N25A 4CR8A 4DLYA 4MK4A 1P77A 3BX1A 4D81A 1DC7A 2RS32 2ZRJA 2L2QA 3BN6A 5C8YF 4CCLA 1ZCFA 2RG1A 1RZ3A 4TKMA 4GBGA 2BFBB 5ALVA 3USSA 4GGOA 4Q1RA 1W4BA 2QRPA 2QUHA 2Z9BA 1CQWA 1NW3A 5DYWA 3TRFA 3B5EA 2IPOA 4LK2A 1JHDA 5SV5A 4DREA 3UJQA 3PFBA 3DV2A 1UKYA 1NW9B 4AJHA 1V5EA 4YCMA 2VYFA 3V1UA 4JBGA 3TNDA 1ORTA 3N8KA 1A6CA 3KYDB 3JYNA 4L50A 4CDQC 4FZJA 4YRQA 3DW1X 4FXGB 4FONA 2PR7A 3NNDA 2Y4OA 3I42A 1WMSA 4ZODA 3W2EA 5LNK1 1E3LA 4BRWA 2GDZA 1ZJ4A 1XL0A 1RJFA 4FR2A 3VZBA 1FX0A 3Q7QA 4ZJPA 4IEFB 4POOA 3ESXA 1E9CA 4KWHA 4LYEA 1EDOA 5KC9A 4WTOA 2FEKA 4UQLA 2ZE5A 1X7WB 1LZLA 1VIMA 4BIIA 5COQA 2KLHA 1NVXQ 4XIOA 4AAXA 1N1YA 2DMRA 3CNAA 1IQPA 1Y8RA 2IFWA 3QKSA 1NR1A 1EUZA 1Q3KA 2CXSA 4HAOA 1V00A 4YRJA 5KHHA 4EFDA 4IUGA 3RSFA 4HH3C 1E0SA 1FOD3 2W4IA 5LBUA 3EMBA 2PQQA 1BFUA 3S8MA 4LBVA 3TTVA 2EIBA 4MVJP 5CD9A 4IVPA 2XODA 1RLTA 4LE0A 3W90A 1QP7A 4LA3A 3MEPA 2RAPA 3B1YA 1BX1A 3WL7A 4KQKA 2DY0A 1PSZA 2BCEA 2WE7A 4FB5A 3ZW7A 2EFGA 4ZJYA 2VOVA 4RS3A 2PZAA 1VFPA 3I0NA 2XCUA 1FUIA 1ZXBA 2VEDA 1T6GC 1K7XB 1R6BX 2I6XA 4IG9A 4C89A 4OXQA 1TECE 1OH5A 2PUWA 1H8HA 2R84A 3CRNA 3NKTA 4M55A 3JV7A 4GNRA 5D8AC 5KYXA 1KEEA 5A9TA 1JFTA 3FMGA 2GEFA 1HR0B 3ZS8A 1L7NA 4AQ7A 1JEQA 1DBPA 3EY9A 4WJZA 2YJGA 1PJZA 4QU5A 1NQWA 4H7JA 2WNHA 3KVOA 1XA3A 3ITEA 3FCSB 4GXRA 5LA1A 1L7BA 5B5SA 4ZDKA 4LVCA 4EGQA 5I4KA 4FDLA 1AL0G 5KHKA 4WACA 1QH8B 4MLDA 1YCIA 1QY4A 5C8XA 3ZC3A 1EUCB 2OZEA 2VATA 1DDGA 2JS7A 4PIZA 3DTVB 1RBMA 3ZR6A 4M9XA 4BAZA 1VGVA 2NPIA 4YWAA 4YJ3B 4DKJA 4AJKA 5CIYA 4J16C 3IELA 1AL22 4F7WA 4TVOA 3EF0A 4H1UA 2O2XA 2YQZA 5H9RA 2PPLA 2RE9A 4DJTA 2R4QA 2F8SA 2C3OA 3FDFA 1G21B 3F49S 4HFMA 4Q00A 4L51A 5FUVA 1W49A 4QOJA 3OCJA 1W96A 3K5HA 4CMJA 4FTWA 4KUHA 4CMCA 1O3RA 2XKAA 2UVDA 3U7QA 2MU1A 4BMCA 1RHJA 2GMWA 3REOA 2F00A 4YMWA 2YBPA 3AZQA 1PG5A 2FRVA 1OOPC 3KU4A 1C4RA 3ZCXA 1W9YA 2QGNA 1LVHA 4ZT4A 4X61A 4PX2A 3KAPA 5IUQA 1C0KA 3G49A 2UU9B 1RMU3 2MYTA 2P2DA 2FLKA 2R7NA 4AJJA 4HSGA 4X20B 4AYUA 2O2ZA 2X2FA 1FOD1 3UCFA 1BJTA 2GPNA 1I0ZA 4NHEA 3ZMNA 1DIGA 4UZEA 2JFFA 3WRXC 1E99A 1RU3A 1X82A 1IL0A 1KO7A 3MJEA 3GDOA 2W6JD 2OTCA 1RXIA 1R88A 4R1LA 5AO9A 3GVCA 3CLTC 5A3OA 3LDRA 2NUPA 2UZ0A 4FPHA 1W6RA 3AF5A 3A6LA 4JNCA 2G1AA 2YPJA 1FLVA 4U7PB 4XJUA 2JFXA 2ODAA 5IS2A 2W58A 3RPEA 1NJSA 2JKXA 4FI3C 3ECAA 1AK2A 4NRDA 3WZMA 4IDAA 2FW7A 1JI6A 5DM2A 4A6XA 1V5IA 1QFZA 4K03A 3WL6A 3HJBA 3E58A 5AKLA 1M7BA 4HXCA 3RABA 4XVHA 5AW3A 4Y1RA 1VLJA 2R1VA 4FHZA 2AH2A 4LRQA 1GZHB 1S1AA 1PO13 3DJFA 1HZZA 1P2GA 1YS4A 2PKYX 1AR73 1TIBA 1OXXK 3OTIA 1XRNA 4CKWB 3SX2A 1T2FA 2ADOA 1UKGA 1CLEA 2PXCA 2IWGB 3KB2A 1QIKA 4PO1A 1IOAA 1QHDA 3SKJE 2P9CA 4Z3DA 1W8TA 2LGJA 1PMJX 4JLAA 2IIBA 4AWXA 4LVOA 1MENA 5EIHA 3P2IA 4I30A 5F3CA 3MS2A 3GU3A 3DA8A 1HXS2 3I2YX 3KQUA 2J0EA 5A2QA 2FDIA 3K8OE 1NVMB 1KJNA 1MZVA 1A95A 3GHNA 1R6DA 2CHUA 2BKXA 1Z0UA 3ZHBA 3QI7A 2CEKA 3ZGOA 4DUZB 2CMHA 2J30A 2A9FA 1SEPA 1Z36A 2CMDA 5KYUB 3TJMA 3QFHA 5FMOL 2WC1A 4KUEA 2QNBA 3HB9A 4RIEA 5DASA 4ERNA 4RZ3A 2BUAA 3PDUA 1W28A 4EF5A 4TTSA 3UUGA 4RJJA 3GG9A 2DSTA 4K7JA 2AYYA 3C6YA 3CF4A 3MPPG 1GLVA 2P7IA 3HL0A 4BX2A 4DEXA 4BLPA 4NCXA 1DIBA 5HUJA 3STTA 5F7UA 5IDXA 1L4MA 2VBIA 2GD2A 2VAXA 4HK8A 1F60A 3IERA 3O4IA 1V96A 4M1WA 2H9AA 4Z9XA 2QAJA 1MF7A 5KVSA 3W7VA 3ENRA 5B4TA 3K30A 1SBYA 4GPTA 4QUHA 3U4QA 2J0UB 3C6ZA 3PFHA 4QELA 3GBWA 2I7TA 1MB2A 4PCAA 3BBLA 4FDMA 3KT1A 5LYJA 2Q27A 1UMCA 1XRMA 5ALDA 3AY7A 5F2KA 5JYEA 5CG1A 5BPXA 5FO9B 1QJU3 4HMOA 1RM4A 1S2KA 2AJLI 3FOCA 2WQ8A 5H83A 2IV2X 4GRIA 4OATA 3M9WA 3RRMA 3WVNA 5IU6A 2P40A 3B7WA 2H4FA 3L92A 4P7JA 4MWGA 5B55A 4ITVA 5IJXA 1QZ3A 3J8F1 4HRXA 2FFAA 5FZ8A 5DRTA 1U5ZA 1W6NA 1T5IA 4MV0A 1UFVA 3R6LA 3RSJA 3L7MA 2E63A 3WGGA 4BJ6A 1KI3A 2GPWA 3AYCA 3OIVA 3CF0A 1Y98A 1JHVA 2ZUBA 2XXJA 1G2QA 4FYHA 4HDKA 3H6HA 2PGNA 4EGJA 5BN4B 5FUPA 2ZX2A 5HV0A 1OQEA 5EEHA 1ZYBA 4GBJA 2XT6A 1DMSA 2FDXA 5KYYB 2H3HA 4PGMA 1N6OA 3UGTA 1YS7A 1HDRA 5KS2A 2FSVA 2Q0SA 1XD9A 3MQ4A 2HHCA 4E6EA 1GR1A 4J0DA 3LKJA 2NP0A 3HJAA 1L7EA 2W2IA 4NMXB 4EI9A 2QMQA 3U4DA 3B9BA 3FJOA 3U17A 4C76A 3KJNA 3VBHA 5LA6F 2ZAHA 3M7AA 2BGNA 1IWBB 4FVVA 5DQ0A 2D2FA 1YCFA 2EEPA 5KB3A 5LP6A 3R6SA 3U4AA 3C7GA 3AYZB 4KSYA 1Q21A 1XOIA 5DXDA 4I3FA 3GFVA 1HQCA 1V3QE 3L4BC 3TLEA 2IDJA 2VIIA 3SCGA 2R1VB 2QTHA 4AJ9A 2GM5A 2ILVA 1DV2A 3B13B 3P9NA 4EI8A 4EUHA 5BYNA 4M1TA 3FWKA 3PRYA 4QD2A 4KMMA 4I0WB 4RADA 4UPEA 3INRA 4KQJA 2CVZA 4Y2HA 4OCZA 1A5ZA 4OTZA 4MR8A 1WXIA 1ODNA 4F96A 3EZ7A 3OHPA 4MUGA 3H0EA 3JCZA 5G05L 1HYEA 2J9RA 1LX6A 1H69A 2JBWA 1FA9A 1T2EA 3PHBE 4F4HA 1FYFA 5GONF 3UHOA 4TT3A 5HKKA 1SHUX 2YMMA 5LA0A 3DYMA 3BF7A 1LOCA 4ZI3A 4MS4B 3D43A 4LK7A 2RHLA 1V4BA 2PVSA 4W8HA 1KI8A 3VNAA 4AWDA 1FSFA 5CJJA 1E4VA 3F5QA 4ETIA 4PYRA 1GA6A 3GPLA 3UWOA 3NJYA 4ARZB 1TA4A 3OBIA 1ATIA 2RGNA 1KETA 3IBFA 1QIDA 4RPKA 3A0UA 4BJ1A 4PGAA 1VBC1 5B4NA 1N5JA 1JKXA 4C1XA 4EVIA 4GC9A 1UAIA 4KLAA 1MNQA 5BUSA 2AD5A 3OTOB 4O63O 4G67A 1IM5A 2VY0A 1IEVA 2N3ZA 2KR2A 2AEJA 3OUZA 2E4ZA 2HWD1 5G3ZA 5F2WA 2FLWA 5CVCA 1V41E 1UZMA 4IVRA 1UU5A 1CIJA 2A5FA 4FBGA 3Q40A 1K5DA 5CKMA 1I4LD 1YKGA 4ARCA 1QQ6A 1SEFA 5GM2A 2GNBA 2GZAA 5LUAA 2BGGA 3R7FA 5A4KA 1FLNA 2QQPA 5AJTA 2CJXA 2PXXA 3KJEA 3KLOA 1QE0A 4DV3B 1XDSA 4LA2A 4BQ1A 4N82A 3SE0A 2V1UA 2IYSA 1T9DA 3FHCB 3BB1A 2Q1MA 3Q0IA 1E6MA 4E2GA 1KEEB 4DLXA 4Z2WA 1QAOA 4S2DA 1N9GB 2Q3BA 2FW8A 2A7XA 1KXJA 3F1LA 2Z79A 1YGPA 3FGPA 1Z5WA 3K5IA 4KE9A 3IJRA 5F8PA 2Q2VA 4BKQA 3NAPC 3VC2A 3GP8A 4DV1B 3UGHA 3LA2A 2WZR3 2Y64A 3U26A 3IEPA 4Y3UA 4R1OA 1ZUWA 3GO4A 2PE5A 4QEKA 1Y4ZA 4RD2A 4G84A 4AVAA 2WIAA 2ODBA 2V7PA 1JJFA 2QX4A 4ANFA 5A32B 1K0FA 4LMPA 3QMMA 1F6BA 2W46A 2CFOA 4OH7A 3VOSA 2YTZA 1L6RA 1VJ5A 4U1RA 1Z38A 5JCJA 4JI6B 1A98A 5KKNB 3EYAA 2HWYA 2GESA 1YFZA 3L6UA 3PC2A 3DVRX 2FKNA 4FMDB 5ANQA 5AWFC 5G02A 1M33A 3QFCA 1C3JA 1P7ZA 4FFSA 2VMHA 5LBIA 1OYWA 4IESA 2GK3A 2CGEA 3V2HA 3AINA 3WOVA 4JEUA 3X1WA 3I61A 2QRVB 5EKXA 5KSOA 5LQMA 3N9LA 2X5IA 3NTXA 1DFQA 1WD4A 1N1TA 4YNIA 1IJFA 2DUJA 3F67A 4FBMA 3RHZA 2QMYA 2YVAA 2WFF3 5A7FA 3P71T 1COWD 2AHOA 1KHHA 1N0UA 3MTIA 1RM0A 4HDKB 6PFKA 3H1AA 2WM9B 1HZJA 5CTJA 5KXCA 2DT8A 3QF4B 3OZCA 1JNXX 1E1NA 1MTOA 3PQ5A 4XFJA 1JS9A 2Q4TA 5KPJA 1D7AA 3VV1A 3U7JA 4EI2A 1TCVA 1KYYA 1NPYA 1DG1G 1EVKA 3UVEA 1SBIA 4FPFA 1UBHS 2GGSA 3KM0A 2OFWA 1Q1GA 3ELUA 4FCAA 4O33A 4R52A 4YDSA 3DEAA 4UFIA 2JFUA 1OLUA 4LXLA 5FL7D 2I4RA 2GZSA 3ZDVA 1DO8A 3K92A 1XLTA 1NCRC 4HKTA 1XNRB 2JAOA 2F1KA 2WP8J 2C2GA 2JATA 3CEHA 3GLGB 2ZUDA 2AV6A 3VKVA 2G9RA 2P1BA 5C9AC 4Q9NA 4D9FA 3SP1A 2C4KA 3MINA 5IYZF 2OAQ1 4HSJA 2EYUA 3W1WA 4DPMA 1WXFA 3ROPA 3NCTA 1W0JD 1P7YA 1YCDA 5IAOA 4META 4M6WA 5ER6A 3KQTA 1DRWA 3RDIA 3O1VA 1WW4A 2UUOA 3IP3A 5FMBA 1IKPA 1IFXA 5MFZA 3LDGA 1HLGA 5JSRA 4AZZA 5A4DA 3WGKA 1R0SA 1ZD3A 1N57A 4Q4X2 1CVLA 3CJXA 3IILA 1J21A 3OEEA 2FK8A 4KO8A 2N47A 1EG7A 5KVAA 1UAAA 5HRCA 2CDOA 1CNMA 5HM6A 3I2IA 5GM0A 3HG7A 3V7NA 2OUKA 4Y1VA 4NONA 1L4HA 2X9VA 1C4KA 3FUCA 4EO7A 3U4SA 4IXNA 4RTRA 2EIEA 3LP6A 2QIOA 3SYLA 2VZ3A 3W9BA 3CS3A 2AQ8A 3OD5A 1PK6C 2DBRA 5IUJC 2EC5A 3ZU2A 2XCRB 1GEEA 5J47A 3BMNA 1NKSA 5IATA 1D0VA 2BNNA 1QHIA 2AH5A 5LBFA 5A7WA 2D2EA 2PWPA 4BLTA 2A1UB 2XBO2 3EXFB 1FIUA 1RUF2 3RUIA 3HM9A 3NTLA 4JJ7A 1S2LA 2RC6A 5C32A 1VECA 4ZKEA 2ABWA 2VH9A 3T99A 2HCTA 1E6EA 4YR9A 4BZ4A 3IMGA 3NYIA 2AQIA 3BK7A 3E8MA 2JG9B 1TKCA 4NDZA 3GVIA 4TXLA 4L9SA 4XOUA 4FSXA 2J9FB 4MGZR 2QQNA 1OZFA 2CXPA 4FFFA 5L19A 1Z06A 1WB9A 3KVRA 1X70A 4G3YC 2J9XB 1H2RS 4V1CA 3HWRA 1SFPA 1B74A 2DP4E 5E7MA 3IUJA 3GNLA 5L8VA 3QOPA 3V33A 3M1AA 5FK8A 3UMVA 1PFKA 1O0BA 4L4YA 3RWKX 4PINA 4AI3A 5C4IA 1N32B 3VD9A 4LV8B 4GZ3A 4IKPA 3TMYA 1U99A 5JAHA 1LGCA 2QJTA 1ZEJA 3JD73 3OUUA 2Z4TA 2NTYC 1EVYA 2ZRHA 3SYTA 2IK8A 3KZCA 5IUNC 4HDRA 2PLAA 2DBVO 4BQXA 3OTGA 3ZWBA 4LJAA 1H2NA 5CLIA 3PUIA 4MKHA 2CUKA 3M6WA 1BWQA 3GGOA 4HS4A 4HUQA 5CBKA 3R9XB 3JZFA 2BWAA 3H7YA 1QKIA 2XV1A 2D54A 5L4LA 2C97A 3AVOA 5FA5A 3MBIA 3JQQA 2BERA 4B47A 3KUUA 4C5BA 2WSUA 3P0EA 1RUE3 1JTVA 2I1VB 2GJKA 3NYRA 4ZEWA 4BLUA 2W6MA 2P4QA 5F9MA 4NF2A 1Z6ZA 4V2WA 2Y6VA 3AF3A 3AFIA 2NUBA 1GFIA 2DETA 3V7YA 2UWCA 1QQP1 2B4QA 5ED4A 3DPRC 1PM7A 1CW2B 1CQXA 1V35A 1Z0IA 3LL4A 5TGDA 4FHCA 2XTJA 1VMEA 4MYUA 5JWRA 4NQRA 5JNLA 1RUC3 5LA6B 5BP7A 3LCUA 5B36A 2ZI7A 5J4KA 2IELA 4MUVA 3RJMA 3SFZA 2ZBFA 4TS4A 1IHYA 2ERXA 2Q0XA 3TUIC 3T2PA 4M89A 3A6ZA 3SD7A 1IBSA 5EXDA 4GH4B 1KOFA 2YJ6A 3IOBA 3A2LA 2N1MA 1QRSA 1CAXA 4KR2A 2ZJ7A 1V5GA 2AMLA 3AKSA 2YR0A 5K8SA 5GLVA 1PFUA 5G2OA 4KQ9A 4EZHA 1U5AA 3ROEA 4DCVA 2YU1A 4R3UC 2IE8A 2A1XA 4RAOA 4JYBA 3VZOA 1YFWA 1MG0A 3WB1A 4UDOA 5D1NA 1Z4OA 1T6ZA 2JDYA 4XEHA 1P7CA 1KP9A 1A9PA 4OBXA 3T0FA 2BH2A 2PHLA 2BF7A 4X90A 3O2SB 5IK8A 3W06A 3AOGA 5JMOA 1V47A 1XPRA 4QRHA 4DSTA 1U0BB 5F21A 4AZ3B 5ENDA 2IY9A 2BTQB 1B09A 5IN4A 4COUA 1DOAA 5DMXA 4D4LA 4QUEA 1AS0A 2BGIA 3QFSA 1R8QA 1HNWB 1H8VA 1R00A 3WNNA 3LT5A 3OP4A 4X66B 2XVAA 3SR3A 3G0IA 3I5XA 2NO6A 1ZNYA 5HCBA 2ZABA 4O0LA 3R77A 4EENA 2PS0A 5H4HA 5BNTA 4UXJA 2QTLA 3PS9A 4ZU3A 4ZT2A 4AK9A 3I53A 1T36A 1EEHA 5FZ0A 5ICFA 3VDRA 3M6XA 1EKXA 1FPN2 1PEYA 3RBXA 3P0FA 3GCDA 5IJWA 2JFYA 1AUYA 3FI9A 4EY3A 4EW3A 3E61A 1L5KA 4LO4B 3A2NA 4QPIC 2J0VA 3TL3A 3H7AA 4PQ9A 2O23A 4PF5A 2OZKA 5AIAA 1XHFA 1Z7BA 1UPIA 3ZWQA 2A4MA 4ER5A 5DOVA 1IUKA 1OH6A 2R8EA 2W2OA 3G9UA 4RHXA 1NN5A 5AVSA 2F2TA 2EXHA 3EH1A 1JILA 5ANNA 3W5BA 1GQQA 4FINA 1A8UA 2ORVA 4UW3A 3F5DA 1AYN2 1G5RA 2UY9A 4HWSA 5AHRA 1YMVA 2XRYA 2QTAA 3IVGA 2HJGA 3IEXA 1VE7A 2PUTA 5A6XA 2CF5A 2CZQA 3BF8A 5F5CA 1O8BA 1MS8A 4FVTA 1CULC 3VDMA 2B6NA 1O58A 3PGA1 1QTQA 4MLOA 3NJ8A 4A8HA 4FPKA 1E64A 5IFLA 3FNQA 2WTNA 5A05A 1XCJA 3S7EA 1F48A 3BGVA 3TKAA 2QW1A 2CGPA 1JZ3A 3MPOA 4GX2A 5AK4A 1H2WA 4G5SA 4JV5B 3GLUA 4U7DA 1W06A 3L6OO 3CH6A 4CRWB 3DT9A 1RUC2 1QUFA 4LKDA 2AVNA 3LQ4A 3OM1A 3X3HA 2A3WA 4HQLA 4I1RA 3W34A 4NS1A 5CFMA 2XUKA 4JB0A 3KFXA 3WQSB 1TUIA 2C4NA 4JKMA 4XI9A 2GEKA 1I0LA 4D4KA 4GMFA 2VPQA 3VKHA 1C0PA 3BHIA 3QEAZ 5JJBA 4M0FA 5C7IO 2JKZA 2NZ8A 4FSDA 1FXZA 3T8YA 2EGUA 5IHXA 4I0BA 1CJBA 3DULA 5C1BA 1XMOB 4N0MA 1QP4A 4WV3A 4AK3A 4C22A 3WT3A 1PGW1 4ZOAA 2EXJA 1QNWA 2BGTA 4FS3A 4OP2A 2B25A 5L4NA 2X4LA 3EBRA 4WM8C 4ITRC 3WNCA 1NAIA 3WF2A 2OE2A 1X8KA 3PGXA 4QDSA 1OBNA 3NNNA 3RARA 5T6BA 3STXA 1BCRA 4YI5A 1CLUA 5A1JA 2ATFA 2XHEA 4E30A 4LJRA 1F17A 2VHUA 4IJUA 4TMWA 5DGIA 4ZV7A 2QQLA 2E6UX 4P54A 3CUKA 3Q8BA 3GP5A 3M3DA 1M34A 2PS9A 1X3LA 5DPMA 4I55F 5GVSA 3L6BA 4N01A 4EO9A 4D6SA 4TRJA 4KNWA 5JCPA 1SXJA 1G60A 4R1NA 5E3HA 5JBQA 5JEEA 5BUVA 5IC6A 1T6BY 4GZLA 1OPXA 1MIOB 3M3IA 1MIOA 5K3DA 4IEWA 5A4FS 2VNSA 1HXS1 1KBOA 3I6MA 4TWAA 2QG9A 1OKQA 5TLSA 4MI6A 3WLPA 4JLWA 2FLVA 5DFAA 1B3BA 3PZRA 2VDMB 4YT8A 3C24A 4PIMA 3EDQA 2XBMA 1J9ZA 5EZ5A 4JR0A 3PGLA 4K9PA 2CHEA 4FNGA 2FSHA 1US2A 4U2FA 1P5JA 1UZLA 4IFEA 1ZOOA 3WP1B 4BIFA 2Y0EA 4UAVA 1DRJA 1SZBA 2A92A 1O4YA 5EXPA 2VNRA 3LUGA 1OC2A 3LUHA 5FOXA 4US2R 1JLKA 4C7XA 1C1HA 4BO4A 4C1WA 3WF0A 3ZGYA 3AEQB 3TB0A 4NULA 3L4SO 3KZ1E 2KS6A 2OHFA 1GR3A 4ED9A 3WYEA 3J7NA 3B3QA 2OXCA 4N5NA 1I6LA 1Z0FA 3LY8A 1GKBA 4DB4A 3C3YA 1Y82A 4FZ5A 3G0DA 2APJA 1I2DA 2FSGA 3E3NA 4LV6A 5C4MA 4QLAA 3GVXA 5C37A 2YMQA 1J8FA 4XPIA 3Q8AA 1OC4A 1YB6A 1QNFA 2E4VA 2PWBA 1EUTA 5E4TA 4P9IA 4ZALA 2BYVE 2XCLA 3CH4B 4KGDA 3I52A 1JDTA 4PZUA 1U9YA 5LYJB 4RY9A 2G8LA 2MHFA 4FFGA 1MV5A 4GMP3 1IB0A 3X2EA 4URXR 3SE7A 4B8YA 4UHJA 2NZ9A 2C9KA 4GEGA 5CHEA 3AFMA 5J2TA 1UQRA 1KS5A 2DV9A 4JVOA 5BNQA 1VG1A 4L5BA 1RLJA 4C7BA 5FZCA 4EFNA 4RY0A 2N9UA 4EH1A 3Q11A 2K4MA 4C0AC 1B93A 3IQHX 2D97A 4WFJA 3T94A 1CS4C 4JL6A 3PURA 2PG3A 4CLOB 4NIAA 3LPGA 3O94A 1JOBA 1OTYA 4C7MA 2OW4A 1PO11 4SBVA 2R62A 4OHKA 4BQNA 1GTSA 3OCCA 3DR5A 4NFLA 3MWEA 2X77A 3PB3A 5AXBA 3LQ1A 3D4NA 1KOGA 2EFDB 5FYMA 2JIZA 1T5TA 1ZK2A 4YC7A 1L3CA 4X93A 1X50A 2ZBVA 3QLEA 5TVGA 3EZ6A 1WO8A 4D74A 1GGMA 2NMOA 4MKRA 1Q0RA 1YVUA 1R083 5L4SA 4Q1PA 5F3RA 3LP8A 1JVSA 4HMZA 1JEJA 1V3VA 3OQIA 1PKEA 1X9IA 5L3RA 1GQGA 3NSTA 3GWGA 4W9RA 1VBA3 1D9ZA 3S2FA 5EYPB 2WHRA 1U3UA 3QVGB 1YBHA 1XVUA 4ZDIA 1SIUA 4GKVA 4KXMA 2D93A 3RSGA 4ENQA 3HVRA 5AKGA 4LOTA 1PGL2 3UJPA 4Q3BA 5BW4A 2XDVA 3TINA 4FWTA 1AYN1 3DZGA 4IUYA 5HF9A 3QRWA 4WSOA 4TTRA 4RA9A 5TQ2A 2NUTA 3IQEA 3DLHA 4UHBA 1INLA 4MRNA 1PYDA 1NRXA 3EVGA 1QIFA 3SX0A 1GY8A 1O7JA 1LGNA 4X6UA 1NUSA 2F1IA 5FYSA 4HDCA 4YG0A 5EIYB 3DD5A 2HH9A 4L02A 4EQ6A 2OOSA 1ZM2A 3V65A 2P3KA 3PLAE 1JL3A 1EWRA 3OG2A 4F06A 1L4UA 3H1BA 4Y5TA 1C9MA 4RFSB 4WLFA 3LEMA 2RGWA 5KCZA 2NAFA 1LJUA 3TJRA 2NP6A 4PWYA 2PX5A 2GN7A 1DI0A 1VE9A 3PTYA 3LV8A 2BZGA 3OBBA 4AY2A 1MAVA 4WASA 3NJ4A 4BMNA 3OFVA 3RRYA 1H2LA 4GXQA 4BQIA 2REQA 4Z1OA 2HWB2 3W8RA 3WIUA 1T8TA 4XFGA 1DWPA 2JGRA 5F2SA 3EMRA 1GPAA 3EIHA 3SXWA 1AMUA 4H7KA 5CNIA 4QX0A 2Z6QA 2G83A 2RGEA 3KX2A 1WCUA 2MSKA 3GB9A 1JLMA 1FRNA 2ECOA 4JTNA 1LV8A 1NI4A 4N03A 1NU8A 3HKCB 4LXHA 1P3Y1 3BIOA 1ESZA 4Q1VA 3DBHA 3WA7A 3T2QA 2NV6A 3THCA 2VZSA 1RM5A 3DBHB 1X1RA 4U00A 1BW9B 1ILEA 1E7RA 1VAMA 4MXWA 2PTGA 4JJ4A 1JLSA 1DFIA 2F6BA 4INZA 1WLWA 2FJUA 2WTMA 3A0KA 3C43A 2C96A 3C3JA 2AKAB 3AOEA 2TECE 1EDBA 2B1GA 1FDRA 4EJSB 3BXGA 1OWPA 1PR9A 2ZUEA 1SKYB 3ZGVA 3IQZA 2PKQO 2PCLA 1E2PA 4JDNA 3ADOA 3WHLA 4R8LA 1XZJA 2P9FA 4G63A 1OLXB 3KEMA 5A6YA 1SC1A 2AR7A 1BDBA 2IYPA 1IZ3A 1J39A 1FTNA 3M6UA 3QXCA 2B34A 3CNBA 3TD2A 2IH5A 1AJKA 3DE0X 1QYVA 4YBZA 4KZPA 2XA1A 1Y7TA 2IU6A 3VC3A 3WEZA 4EYQA 1OLSB 5IVCA 4BQ4A 2OVBA 2EIGA 3LCVB 2WB4A 3Q5DA 3FUXA 2OQIA 2BKEA 1RXGA 3MW2A 2CCJA 3MGGA 1ULEA 3BB6A 4KLRA 4JQCA 5C80A 1Z26A 5I0RA 2I8AA 3BFVA 1FZTA 1NA5A 2ZJ4A 3DVAB 3NC0C 4KXUA 2X3UA 2PD6A 4GKAA 4FT4A 1WABA 3V6LA 4HNHA 4MJLA 2XJVA 4HLCA 1R50A 4B5LA 1R4AA 1ONNA 4QFDA 5JOQA 3V7WA 1VKNA 3UENA 4URYR 2ZANA 3HHPA 3T4UA 2H6CA 2D8MA 1CAWA 1NBHA 3CZ4A 5HPYB 3L8MA 3Q88A 3SG0A 1KQOA 4A8JB 2HSJA 4M4RA 1Y8CA 2YIVX 4HQFA 3LEKA 3D3QA 1ODTC 4BXSV 1CRLA 3B70A 4YRMA 1LD3A 1Z4IA 1HBJA 3PQFA 1DEAA 1OJLA 1HF3A 4W1SA 1WCIB 3MOIA 3OMLA 4TLMB 3R6GA 3H5RA 2PPVA 4ADSG 3SXUA 3F73A 5KNCD 4XFIA 3NR2A 3ICCA 3GZAA 3WK6A 4WXPA 4E1AA 1NVDA 3AERB 3POSA 1K7CA 1X38A 3SHTA 4QT6A 2RR11 4XASA 4OO3A 2FPRA 5CBLA 5JFTA 2ZUWA 1W4RA 2YWEA 4CIYA 1WV0A 3AG6A 4ZXEA 4EQ6B 2HBQA 3BGWA 4AC9A 2J08A 5K5EA 3UTCA 3KXDA 2XMRA 2NSJA 2QSZA 5A0FA 2FDRA 2VF7A 1F4AA 5G1PA 2XXAA 5TPZD 3LFIA 2E82A 4BFLA 1OUMA 4MPJA 3ZHZA 5AI0A 1OD5A 1N2XA 1XZGA 4AVTA 2EP5A 5LBEA 4B48A 2VZQA 1M8PA 1LX7A 2VOXA 3B6JA 4G1EB 1M2VA 4D3YA 1VBD3 3C3DA 1T6NA 3DCIA 1SBCA 3GCGA 1AY0A 1RI5A 3PNAA 3T3HA 4LEIA 4UFNA 1IOZA 2VYVA 1ACLA 2XBLA 2OMKA 3I1IA 4YW3A 4J0FA 4J75A 1VBB2 4Q4W3 1WW3A 3S2GA 5JT1A 5A5VA 1OA2A 4PYMA 4EA9A 3ZIDA 4LMFA 5FZOB 1IBLB 5AOAA 3N2KA 5GY7A 1QHHA 3EVFA 2XZLA 1RINA 1ZJJA 3KPVA 4PW0A 1T5BA 4CXXA 2PA7A 4IV8A 1AUOA 1UBEA 1N2ZA 4MARA 1QU3A 4KAXA 3PIIA 1DCSA 1GPLA 2GMEA 2P90A 5FFFA 1PGL1 1JYSA 1WD5A 4AUNA 1CXZA 5KKAA 5KX5A 1BE0A 1SLLA 1W9FA 4X1YA 1F6DA 4CEJB 4F2PA 3CLPA 3MJDA 3NRCA 3DC7A 3O38A 2G80A 3AJRA 4AQDA 3FCYA 5DVZA 3QA9A 2Q7OE 1E58A 3FCEA 1OYOA 3CLSC 3FPAA 4DIBA 3UICA 2OHHA 3EA4A 1E9AA 5KPDA 3LHFA 2GUWA 4L76A 3P97A 4NCAA 3WLTA 4MUIA 1C7QA 2C61A 1MJGA 4K88A 4D8MA 3NIGB 3MCZA 5K0GA 1W2TA 1L4LA 1WXQA 2X14A 2VRNA 3KJQA 2Y6GA 1Q6YA 3JAKB 5GONA 4TN7A 4D43A 3DZDA 3VM6A 3EZFA 2EKPA 4BVEA 3B1WA 4FCVA 1O4ZA 3ENZA 3MUNA 2JFHA 3LPMA 3V4OA 1BWSA 4LGCA 4MWCA 1EGAA 4PR3A 1GYQA 2Z8YA 4X64B 4RS4A 5A32A 4HT1T 2I8CA 2HWF1 5C1IA 4D8WA 4L7VA 3HVIA 3IBYA 4Z4QA 1OA1A 3GFQA 1O54A 1TVCA 3LGXA 1G7CA 3IALA 1QOPB 3LO5A 4A8JA 4L0MA 3NV4A 4D5GA 4AFNA 3PUKA 4CQNA 5LKRA 1ZIDA 3E9EA 1B26A 1ZA4A 2CAVA 1QF3A 4QPYA 221PA 5LBTA 4FOLA 1F2TA 4GL2A 3KCCA 2NPFA 2XMZA 2QVZX 3PJYA 3QWFA 4LFAB 4YMHA 3KQRA 1MEC2 2VZUA 1F9EA 2VUUA 2ZSAA 1LH0A 4MWZA 3AKRA 6Q21A 5J1XA 4JDPA 4ZO4A 5G40A 3DNFA 5CYOA 5LQRA 4AM8A 1R18A 3WBBA 3DLPX 1HLDA 3BTUA 3TZBA 4UUOA 4K0KB 2ZI5A 3BTZA 1E66A 3NUQA 4YN3A 4DY4A 1I13A 4LE4A 4MUHA 1A9YA 3W5NA 3WSWA 1HYGA 3HXPA 1ZICA 4EUKA 4K6KA 1Q20A 3TLBA 1M2OB 5CXSA 1E5TA 3HKDB 4JNKA 3LSTA 4B3NA 4P2GA 3WLOA 4F3RA 2W83A 4FOVA 3NWBA 3TW0A 4Q3LA 4QQFA 3DYOA 4F3YA 3SM3A 3EDCA 3FPHA 4KGQA 4QULA 5DXJA 1OXUA 3TNFA 1ZVKA 4RJ2A 1XRJA 2J5KA 3PNSA 1P0PA 2YB7A 4CODB 3IEIA 1MQTA 1MS1A 1U0HC 3BE4A 1AA9A 4OK5A 7GPBA 1Z37A 1I1EA 1YYNA 3BTOA 4BPRA 1MEEA 3KLMX 1XI2A 1TMF2 5M5BA 3T54A 3EARA 4R2JA 4LYHA 4KVFA 2OXRA 2XDYA 3D4IA 1TZOA 1DPGA 4D98A 3B60A 5EWMB 2HZ7A 4UU7A 3WG9A 1WW5A 1WOMA 1XMXA 1UK8A 1IEQA 1G8YA 2BFEB 1H0HA 4HDQB 4JVAA 3LD8A 5CBPA 5DHPA 1HM5A 2A3XA 5CBPB 2FF7A 1GCGA 5BXXA 1DSSG 4LYDA 2HLPA 3V1TC 2JCVA 1J20A 1T34A 3OE7A 4GWIA 1B35B 1EXDA 1A9TA 4QM8A 4WJKB 2UUBB 4WM7A 2DVBA 3SFTA 2J8ZA 3BXZA 3POJA 5AICA 2ZQZA 4BB6A 2EATA 4OAQA 1HNZB 2BZ0A 1BIFA 1ZO8A 4YT2A 4OQFA 3TRSB 2PX4A 1KH3A 1BQPA 4UCXA 2VZ0A 4CDWC 4Y9UA 3AHEA 1FEZA 1QK5A 4RK1A 5DN6A 4N5HX 4AFCA 3I1FA 5KBYA 4HNUA 1HW5A 2ZCUA 3ELDA 2DCZA 1A2BA 2G9VA 2H08A 2G1PA 2I2XB 2NVBA 5J3UA 4CQJA 3GLVA 1Y63A 3S2IA 1FMD1 4YRBA 3N2NA 5EWLB 1M6VB 4BEWA 2O1XA 3V8BA 1RDFA 1DE0A 1OR8A 1ZM7A 4BRZA 5HUHA 1PUIA 2DWOA 4LSWA 1KEZA 2VQ6A 3WP3A 5FJIA 4CIDA 3DAPA 1OSGA 3PUYA 1UZ0A 4Y26A 2QQ0A 3DT8A 5AKYA 4PSAA 4NJEB 1NOIA 4J25A 3HXOA 4B3IA 1U2TA 3DC2A 1JZ2A 3EJ6A 4JOBA 1FNDA 4N7UA 2JG3A 3BULA 3QEKA 3S4YA 3OQ6A 1MPTA 5BRJA 2AGSA 3FRJA 3D7SA 1ZWKA 3QVVA 1UPUA 4P38A 2Q28A 4YRIA 4UHDA 2TMKA 3O91A 4KWEA 1UL9A 3BJRA 3FUTA 1G4HA 3K2BA 2E21A 3FTDA 4X91A 2AGVA 2WYIA 4XAQA 2ETEA 3EWAA 5KXEA 2CVQA 2KA3A 1XA0A 5FXVA 3EG5A 5KREA 4JHLA 3GEBA 4U8GA 3NX4A 3N76A 1O9HA 1THZA 2O59A 3OFJA 4X65B 1YL6A 3HDVA 4IDFA 4C06A 4DV0B 1ZOPA 3I5MA 3SMQA 1EH5A 1JPUA 1UZWA 1K27A 1CWPA 1DBVO 4WEOA 3TIXB 4E2QA 5FWJA 3JTEA 2X6TA 3QXSA 1EX9A 1XQ6A 4XIKA 2JG8B 3DWIA 5AW4A 1KXZA 1KORA 3LA6A 2IOQA 4WT7A 2E53A 4NBKA 4TXHA 5IJAA 1J0AA 3KEFA 2FJ0A 2ZWAA 1B41A 4PLWA 2YRFA 2JAQA 2YH2A 5C4WA 2ZT5A 2JIOA 1J3RA 4WXHA 3L7YA 4LBQA 4Q4X1 1AXKA 4IZ6A 3AKPA 3TX2A 1X3SA 3QPUA 1RUG1 1UPCA 9LDTA 1I3LA 1RRVA 5LA6A 4JI8B 1NNSA 3M6IA 4CR7A 1LSJA 2NLRA 4PE5B 4XFKA 1IHDA 2XD9A 2NOAA 5F9HA 2C3UA 2WJJA 5BNWA 1L8OA 3KL4A 2D5CA 2J4CA 3AEXA 2ZTNA 5BXQC 1BRTA 1SCIA 4QHOA 5GINE 5IVYA 3UJ6A 4H08A 3NT4A 2YASA 2VG8A 4QVKA 2OHXA 1ODLA 4HMQA 1KS9A 4O5OA 5J3JA 4BO2A 4R3WA 1K4KA 3TTUA 2G4VA 1SCQA 2NSLA 3T5AA 1TZMA 4MS3A 4CPDA 3LU1A 5CLHA 2IHBA 3ZXXA 1NVVQ 3KYIB 1ADGA 1GQYA 2JLQA 4HCJA 3R09A 1OFUA 1Q7GA 2WHXA 3OU6A 2YXSA 5ECYA 1GAWA 3L79A 2QF7A 2YUEA 1U28A 4KUGA 2PGJA 1Z47A 3C98A 4XCXA 3CWQA 5HFNA 4BUJA 2JW5A 3EFOA 5IH3A 4NK4A 2P78A 2BTQA 2H52A 3WGIA 5CT8A 5BNNC 1SVLA 2B3DA 2O8VA 5LKAA 3H1PA 2JDPA 1RVF3 4Y98A 3MIGA 3QLUA 1DINA 4JDUA 3HJGA 1KPIA 4KWIA 3WV6A 2Q0QA 4IJQA 2WE8A 4OZXA 2O7RA 3DEFA 1T4CA 1F14A 1G0NA 3HKBB 1U8CB 2IS2A 4B79A 3AU9A 5C52B 1O4VA 1NL3A 3TOJA 2O3UA 3UAOA 4IDOA 2ZAIA 4RMGA 1U0FA 4GF5A 3F6SA 2H16A 2QU8A 1YDMA 5AK5A 2FZ2A 4W5HA 5LNK6 5DTJA 4YG6A 4RGQA 1QE5A 1ZD5A 4P3OA 1R16A 4CHGA 1AR91 4MDHA 4JBHA 3HU2A 4KWKA 3KKOA 2VDJA 3MIIA 2W8BB 1I5EA 2X42A 2X0IA 1DYPA 3JVIA 3I05A 1UIMA 1Y9DA 4GXTA 1MRNA 3QWBA 3AVRA 4RPJA 3MEQA 3X1YA 3PHIA 1NCRA 5J2UF 4IGAA 3PQDA 3OCUA 3PU8A 4GGMX 4J0GA 2ZHMA 1QJY2 3ZE1B 2YHSA 1UY0A 1H5QA 1XROA 4CI0B 3M6FA 3QWHA 3BTXA 1NLZA 3FFWA 3A14A 2FXIA 5A5EA 5CT4A 3NDJA 3ZK8A 2FPPA 3GA7A 4CN8A 3AMQA 3R7LA 1P0MA 4NHXA 2ZRIA 4EF4A 2DUMA 4AKHA 2CBXA 4XM1A 3PXEA 5K6AC 1QC5B 1PZ9A 2ADFA 4P14A 2FYTA 3L8YA 3R3VA 4MI1A 3OTQA 4OI2A 3GUYA 2MEV2 4ZAFA 4BAUA 3Q9LA 3QZUA 3PHHA 1N6HA 4XUPA 4KRGA 1W03A 4BEBA 5FD8A 1DBSA 4WH0A 4MDFA 3DE7X 2QL9A 3WLMA 3W8NA 4CU2A 4F6RA 2FDHA 4AEMA 1CIVA 1YBFA 5KTKA 2ZM5A 2JZCA 4G4GA 4IGQA 4JL8A 4ARBA 4EM6A 2FZGA 1R9GA 3FR7A 2LD4A 1Z6YA 1OWOA 4PZZA 3ZR4B 3KV5A 3LA7A 2WD9A 3AZXA 4C01A 3UA4A 3KSZO 2DFBA 1EFLA 3ORRA 2O8CB 3CFYA 5DABA 2WNUA 3LCJA 3FZYA 4N9QA 2VT3A 1I7SB 4CFSA 2CJYA 2QIPA 1ETUA 3C6MA 2F3PA 2C2ZA 3IIAA 1H8EA 1MORA 3TNLA 2VQAA 5J59A 5JY6A 2RCNA 3J8F2 1W85B 3GBFA 3WLJA 2WMOB 4OIFA 5KTPA 4L11A 3MFYA 4FS8A 4H7IA 4XJXA 3C7TA 4F83A 1ZKDA 1Q95A 3WSOA 5DX1A 3TN92 1RIFA 1NVKA 3TQTA 3JWIA 1HRKA 4MRSA 2H00A 4LOIA 1Y8RB 5CNJA 4CNQA 4PLPA 3PNOA 4CA9A 1NGSA 2IYEA 4CZSA 1BZWA 1JQ3A 4Q7QA 4M9QA 4H14A 3TH5A 2DHEA 3B7GA 3HJRA 1XDWA 3TSOA 4MGYR 4NZYA 5FLIA 1BSVA 1GIAA 4DCJA 1PIV2 3DAHA 4EJSC 1ID1A 4ER3A 4KXLA 4BPZA 3F6RA 3OYWA 3VU9B 5DSTA 3GCZA 2XNDA 3GAAA 1ND3C 5FP7A 4IYRA 2W9XA 2IEDA 4QQRA 1X1BA 2HA4A 2HNBA 2QUJA 5E2IA 5C3MA 1XJ5A 1ILWA 4C7KA 4OBBA 4G6ZA 3WB2A 4HRVA 2HWB1 1P0CA 3QU4A 4I2VA 3CL1A 3B82A 1Z6XA 1TLTA 5HXMA 4JCKA 5FNZA 4B3HA 3BMOB 1GV9A 2Q8PA 2QUBA 1L7LA 1B6GA 1HI9A 2C4MA 4Q48A 3VR2A 1OC1A 3KQMA 5KYWA 4LISA 1EAH1 5CYGA 2L82A 2UAGA 2FZWA 5A5GA 4ZS3A 4NLLA 1M5RA 5J9FA 3KD4A 4P9NA 1FQOA 1U1EA 3H5NA 3RZMA 2J1UA 1PSWA 3JVUA 1U0SY 2NUAA 3ZZMA 1Y37A 5KQRA 4E70A 3AHHA 3UAGA 1Q7BA 3JD2A 1TADA 1MB4A 4F60A 3HT2A 1AR83 4MG2A 3LXRA 3VPFA 1PVXA 1OH8A 1GQHA 1SUPA 4LS3A 3NV7A 1NLRA 4ZYVA 1R4MA 5DG1A 1VRWA 1EE9A 2JA1A 2QM7A 3L5OA 3DBVO 2G9NA 3MTBA 4ZCQA 5EZQA 4F2HA 2GPBA 4B3FX 4QXHA 4TLBA 1BTOA 1FDOA 1SQGA 2CTVA 1H2EA 1UL1X 1EXMA 3NNGA 3GNSA 3IP1A 4XDGA 2GRJA 4MO9A 4RKFA 1PR6A 3WQQA 2BSXA 2QPAA 4Z53A 2DE0X 2ZBDA 3WOGA 3OCYA 1UYPA 5EMJA 2Q5EA 1BX0A 1RQLA 1DIOB 2BNOA 5CDYA 4KAFA 1OI2A 4KPGA 2RGAA 4CSWA 2ZBQA 1A2OA 3QUTA 5EZYB 4QX6A 4Z07A 5KC6A 1DAOA 3NAPA 5FZ4A 5JXIA 4CKBB 3V0AB 1AX9A 1OLXA 2IYFA 3K96A 3SDZA 1M3SA 1RUOA 3QV1A 1DXYA 1RYMA 3ITKA 4GQBA 1OXKB 5EL0A 2B2XA 1E5RA 3ROZA 2C1XA 1HH4A 3ZDEA 1RITA 1XWIA 1Z0ZA 4UW9A 5AVJA 2A6ZA 4YP9A 5C3UA 1MXFA 2EF1A 2BUKA 4LOLA 4D44A 5M7EA 5F76A 4EG7A 2WPDD 4XTCS 1LESA 4OL9A 2A6YA 2GLTA 4LJSA 4N76A 4CQMD 3CKLA 1FTGA 5AD1A 4CQLB 3TTSA 3ZLTA 2QTRA 4K1YA 4RF5A 4PX5A 3ZV6A 2WYFA 4A7PA 4RK5A 4CE8A 4J4TA 3OPWA 1AD2A 2LBPA 1CZSA 1CPMA 4DR5B 4JJKA 3HWX1 2WHYA 1MVEA 4AKEA 5CFDC 3OTWA 4N43C 3MJ4A 1KDOA 3QEBZ 1P62B 4BQFA 2TMYA 3E8SA 3FVQA 1I36A 4XDOA 2P79A 5FPQA 2UYQA 2ZZKA 3K1TA 3WICA 5LQDA 5CA1A 3LFMA 5LWBA 3IT8A 1UWKA 1QU0A 1GSLA 2OXEA 3EISA 2O6LA 1C4WA 2QLNA 1OWLA 3ICVA 3LLMA 4D80A 5EGNA 4ZVMA 4J94A 2IUUA 2GK4A 4HF7A 4PYKA 2AXQA 4KL1A 3JAWA 5IHPA 1EVZA 5EJMA 4YFWA 2B4YA 4G8JA 5KTTA 1K3TA 4LJYA 5ESWA 1GSOA 1UC5B 3M1IA 3P2OA 1QDUA 3FFTA 4B35A 3VR1A 3JYHA 5FLKA 4E4YA 3SZOA 2DBQA 3NBKA 1PUJA 1UXOA 2XSZD 4FFMA 3KCNA 4LZAA 4B7UA 1OBVA 4CU7A 4ZIRB 4XX0B 5I7HA 1FP4A 5AW8A 2ATIA 2Z2XA 4N8MA 4DEVA 5A1TA 1H4HA 5IP5A 3K9GA 4UHCA 4ZGWA 1SUDA 3QVJA 1IAVA 4QWWA 2ORIA 5LWQA 3LMKA 4DV4B 4RQPB 1THMA 2EXXA 1TCCA 2XUDA 2D1FA 2QRGA 2PBZA 3IPCA 5I9BA 1UY4A 1O89A 3FLRA 2B2NA 2VNAA 3SKXA 2VA9A 4QICA 5FO8B 2D5AA 3WQ0A 3IIKA 1F5SA 3AJDA 5IW0A 4UTRA 1OAOC 3W8FA 2Q0HA 3MWGA 4CDUA 3FUOA 3B1VA 4KWTA 1Q2UA 3KBOA 2HK6A 5JV5A 1FOEB 1XZBA 4B7CA 2BDRA 3MLKA 3DE5X 3FUQA 2ZW9A 2UVPA 4B2YA 1MN6A 1YIDA 4N3BA 3LAGA 5ALZA 3UFXB 4DW8A 1AH2A 4OI0A 3QBJA 2XUMA 3C41J 2NW6A 2OV6A 4HNSA 1R74A 3L0OA 3G13A 5CADA 1OLOA 3EAGA 3HZOA 1USUA 4Y4YA 2Y38A 4Q4V1 1K7FB 5EXTA 3NANA 1C8VB 4OQPA 9ATCA 3FWEA 5LU8A 3ELNA 3TGPA 3D3WA 2IEBA 1F4VA 3OZWA 4BLWA 2RHRA 1ISIA 5IYYA 3LP5A 5LWHA 3SMVA 3D0RA 4P5DA 2PXHA 4BNKA 3EULA 1CC1S 3M33A 1AYM3 5IVFA 3C7EA 3WDMA 5EHXA 2CL6X 1NF9A 2FWNA 5BQFA 1A72A 4WK0B 3E3LA 1XBTA 2OXFA 2FMYA 1KI7A 2IEIA 1C8M2 2OS2A 1BXZA 2CFTA 3LT1A 4Y2PA 1XP5A 3KXKA 2DKOA 5TIIA 3V56A 4MIYA 1MA0A 3EVDA 3VDDA 3AP5A 3CUSA 1CRWG 3VDDB 4WN9B 1UMKA 3VDCA 3DH0A 5JZOA 1CQPA 1CZNA 1IUNA 4ZCLA 1JYCA 2RH5A 3U5ZB 1HDKA 1GVHA 3T7DA 2QUKA 4DB2A 1TO6A 2JD0A 2AMYA 4ZQIA 4YBRA 3T7KA 2LVBA 1X7DA 1RTVA 4UMDA 3RIGA 2WT2A 2E37A 3IXQA 1YQ6A 5FZ6A 5ALHA 5BNOA 1UPXA 2NT4A 1T5DX 2XYHA 2ZIVB 4QT4A 3EPRA 1LBIA 2ZS9A 5CK4A 2VTKA 2ZVDA 3QM1A 2QL7A 1L3JA 2OCBA 4ODIA 1VHLA 2ZYWX 4C0XA 5ITZA 3QJGA 4F2DA 2WTEA 2FGJA 1Z12A 5EHIA 2IDZA 3DONA 4JLSA 1SU6A 4FKBA 5KQPA 1BLZA 4ESVA 1G2PA 4XQEA 4FQ8A 4CEYB 1JR3A 5DHFA 3KNZA 2C94A 5B7NA 1G6Q1 1TAHA 3V4RA 4XGNA 1MHPA 1G8WA 3PNPA 5HS4A 1RWNA 1QQ5A 1A8HA 3MM4A 2IIVA 8MHTA 2R6CA 1CEEA 1YQ5A 4I4TB 4MO2A 1XEXB 4AO8A 3WLSA 2HJVA 1BG6A 3NTVA 1GZ3A 3GALA 3BTYA 4ZMRA 3ABQB 4RVDA 5FYCA 5FDFA 4R4JA 2E5LB 3FYUA 3D8TA 2WKQA 2RM21 1G1MA 4W8OA 5ALRA 4PGHA 1QGED 4L28A 1PZ8A 2GZMA 5CLLA 4IF6A 4ZJUA 1XRPA 2QQGA 5AXAA 4AMUA 3OBRA 1MC8A 1LHNA 3ZQKA 1OBOA 3BQMB 2OYZA 1Z3CA 3RU9A 3NBUA 4CF4A 4P5HA 2PO7A 3EIXA 1ZA7A 4GQAA 5FXWA 4D6XA 1P9NA 3LRXA 4ML3A 3U1BA 5ALWA 1VJCA 3F95A 2A7AA 2VBDA 1ZQ9A 3FW1A 5DH9A 4HK9A 1VTKA 4DZZA 3ELYA 3E5QA 1SBQA 4EPVA 3FR8A 5AESA 1C1XB 4YP5A 1DHRA 1K5MA 3KETA 3GNEA 3NIFB 2ZB7A 1WDLA 4NPCA 3PR3A 2K2QB 4P34A 3A1SA 2BONA 1ORVA 4HO1X 3H1FA 1RWBA 5BMVB 4O4JA 4KLNA 1QLWA 2IBSA 4UNPA 2IPLA 5JD5A 4R2HA 4R9UC 3DYPA 1IN7A 3NP7A 3GQVA 3GA5A 3Q6IA 3LPLA 4ZOCA 4XDQA 1HUQA 2BMEA 5EQFA 1W6QB 1WE2A 3TSZA 3I72A 3ME2A 1PU2A 1S4CA 1J8YF 4GOKA 5I48A 3NV9A 4IGEA 4E5PA 1ZH6A 1O4WA 3VR4H 2BCJQ 1QGUA 5H82A 4BVAA 1OD3A 4Q4LA 4F0JA 3BICA 4GRAA 2Q1SA 1FSPA 3L7AA 2PGIA 1JP7A 3BVPA 3GFGA 2ZMNA 2HSGA 3MWFA 5FPTA 1TQ2A 2O4UX 1V6IA 4BC0A 2Q8EA 4NRPA 4ENRA 4R9RA 4M7PA 4K8OA 3ZH9B 1MJGM 4WVZA 1M2HA 1ZRRA 3AT1A 3JXSA 1I24A 4KIJA 2FP4A 1DBRA 1P45A 4LYGA 4QPNA 1YCHA 1KZ4A 3MMZA 4PICA 1P4SA 2QQWA 2BDUA 3L8EA 4P86A 3E48A 5EHNA 1BMV1 1RCFA 3E9MA 2X8AA 1TAQA 4MB6A 2WTBA 2PMFA 3W2IA 1ZK0A 3H9EO 4KIUA 5AUOB 2OK7A 4NAVA 3C1TA 2VHJA 3NXSA 1UBOS 4CM6A 3KKKA 3H86A 2D6MA 3NEAA 2P6PA 2H2IA 3KF5A 4UBIA 1JFSA 3F3MA 1F8FA 3PQ3A 3FFXA 4YPJA 3E0XA 4ALMA 5LA9A 1DAPA 1KGDA 4Z8BA 2YY7A 1UBLS 4DWOA 4CU8A 1A96A 1LULA 4YGCA 5K9ZA 4KGVA 3WG2A 3FZEA 1YIPA 5FXMA 4XGIA 1V1MB 3N2LA 1JZ4A 2VFAA 3RGGA 4BP8A 4M7RA 2VJMB 4XIYA 3VRHA 3NAGA 1LPPA 2PX8A 1Z4MA 2VBBA 4XUTA 4X71A 3OIWA 4LJKA 2FCRA 1B6RA 3DMRA 3FGZA 3H9QA 3HCWA 4DFSA 5JIUA 2PWZA 3CJQA 4RTKA 1PZFA 2BBOA 4UTPA 2VC2B 1T0BA 5B1YA 2FN7A 4I6GA 3LY5A 4RK0A 2WM3A 3THXA 2DPHA 2RARA 3GEHA 1RJ9B 3BIFA 4E2XA 1RC0A 4MWBA 2FSSA 2HF9A 1U5BA 4JYAB 2XB2A 3AF4A 4BU2A 4AVVA 4MV9A 3L05A 3RREA 1CF9A 5IAGA 3GN2A 2VT7A 1G2OA 2IPAB 2R5NA 4TYQA 1HB4A 3CKKA 1B1CA 3OLYA 3TRJA 4JITA 1OYYA 1SWWA 3DG9A 3QKSB 2H57A 1USWA 3TCNA 4R7TA 4OUKX 4BKRA 1Z0AA 1RRKA 4P8RA 5HCIA 4LX0A 1TMYA 1E2DA 5T67A 4JU8A 1L2TA 5HMMA 1NZDA 3DWGA 2G40A 4XIGS 3O8BA 2WZPP 2ZYSA 5SYAA 3VL9A 1NUPA 4QDTA 3HP7A 1SXHA 4TVSA 3BJIC 2HU2A 5EUCA 3OUIA 5EXXA 2X5JO 3S44A 4DSZA 1SC9A 2HWE3 4CKZA 3K05A 1R10A 2Q6IA 2QTZA 2J45A 4LTNA 4FPLA 4P1ZA 2B3TA 1RAIA 1ZINA 2Z2YA 4ZC1A 4H6WA 2GCPA 3RUDA 2GT1A 2ZIXB 4FLEA 1VHTA 2HGZA 4AHWA 1VLVA 3VPBA 2ZIXA 1DB3A 3FI0A 5F2OA 4V2VA 5FZMA 4EA7A 2K5UA 1PR5A 2WWHA 3I23A 1ISHA 2AFHA 5FTJA 1S2MA 2DLNA 3T5MA 3T4PA 3E3AA 3VPCA 3V42A 4MS1A 1VRH2 4RXUA 2G4IA 1JRLA 3SJ7A 1SHZA 2C7BA 3N3BC 5A1FA 3EC7A 1NMSA 1SLCA 1L5ZA 4ZYXA 1RMU1 4OPMA 3C3KA 1IXZA 4UEQA 5F39A 5EMMA 1J1LA 3OU2A 1G291 1LOAA 3ZLBA 1W90A 1DLJA 2CCGA 2J46A 2A6VA 1J23A 5TC4A 3IMCA 5T5QA 1MQTC 2FJPA 1VBC2 5T4HA 3VOTA 1KI6A 1V9U1 4FGSA 4KBYA 5JJKA 1RPTA 5CVUA 3IV6A 4KL8S 5CVJA 3IUQA 1ZA1A 5HA5A 3BA1A 4JGZB 3SC2A 1O3TA 3KGLA 5KWVA 3RFFA 4YRRA 3RT7A 5BNPA 3IVRA 2FFRA 3U0ZA 3CO2A 3IJPA 3W5IA 5K6AA 1R66A 4AN4A 1W2WB 2R073 3VPDA 3EXHA 2W98A 3WL3A 5C3SA 2QYOA 3QV2A 1XFAA 4GA9A 3PIGA 4M0NA 3H9BA 1XXHA 2OORA 1P1IA 1OQ1A 4YSFA 3OZFA 3PC7A 3PA8A 1G5PA 3QELA 2IUFA 2V4VA 1WMDA 3NHUA 1SQFA 1TRKA 3EC1A 4OQ9A 3ZNQA 4QPCA 3OBAA 3RUHA 4FCWA 4HBNA 1E2MA 2IZOA 2CZGA 2Q8DA 4UEOA 1RAGA 5DIZA 3HZRA 1HTBA 2AHRA 1NCRB 1Q19A 4P7FA 3M1YA 1GNYA 2I45A 1GQ2A 3GMIA 1LW7A 4XPZA 1Z82A 2AWNA 3CN9A 3MYRA 3WHIA 1PJCA 1YD7A 4RQTA 3NAQA 3GPIA 1SCRA 4Q4AB 1SFNA 2EZUA 5GZCA 1F2UB 3ORFA 4QEZA 1YJCA 1XEAA 1QNLA 1MQ8B 2QLFA 1LJLA 1RYDA 4OMDA 3FLTA 2I78A 2RDMA 3NDIA 4DVGA 2NVWA 1CT9A 4LHSA 1U0GA 3AHIA 3EDRA 5KAPA 1WZNA 1LXCA 4UEWA 1PZMA 1QU2A 4TMFA 2QN2A 7REQA 1USVA 4LHEA 2V96A 2R0HA 1DZRA 3PFWO 5IMSA 3LDBA 2PSHA 3QG1A 1EB8A 4AEDA 2EFJA 3IFSA 5C5EA 1QXSA 1XVAA 2TNFA 4CM9D 2P2LA 2QRLA 3QKTA 1R3UA 1JQBA 1EFRA 2QX6A 5F73A 2YNMC 3RVQA 3COSA 1J4AA 3KV6A 4O4IB 1GG2A 3JPWA 3IULA 3BFKA 2MSDB 4AIIA 1P9WA 4N49A 3P9KA 3ZI7A 4TZKA 4E5UA 3CF6R 2EIHA 4NZPA 2CXNA 4R8VA 4I1VA 1RHI1 4BQEA 3C8XA 1FYUA 3ORSA 3DFMA 2GSYA 3B6MA 2A9KA 4Y1FA 2I07B 2FOXA 4UBKA 1I7LA 1YR8A 5JXGA 4LNUA 4LT5A 4C7VA 4ROTA 2W94A 3RG8A 4ZMSA 5AHKA 5CNKA 2ZGPA 2D7FA 3UHFA 3KAJA 2G06A 2KPOA 1KDZA 4JU9A 4L5CA 4OYLA 4D79A 1Z2PX 1HRV1 6AT1A 4R6WA 2O2EA 1MU0A 1XG5A 4YQZA 1JSXA 4DZTA 4IKOA 1N5RA 1AQJA 2HWKA 3V9AA 2ZZNA 1E1YA 1KFCB 2CL2A 1NVWQ 4GB31 1ULAA 3WIBA 3LT2A 4LORA 4O8ZA 1AKYA 4XLTA 3AYXB 1M1XB 3BK1A 5HR5A 3RZGA 1LOBA 1YHZA 3WXBA 3ESAA 3KWJA 2BGWA 1JIUA 4FHGA 2Y1LA 1PIV3 1DYOA 3H5LA 3KLBA 3MRVA 3JYOA 3MLAA 1ZIXA 2WAYA 1SA0B 3A4LA 5I7FA 3M82A 1RQ2A 4IW3A 1ZD8A 1Y33E 4O61A 4F5EA 2NSDA 1Y1RA 4MRAA 2XE6A 2KMLA 5ILOA 4PIVA 4GKYA 3CUVA 1E3TA 3OO0A 4CW7A 2YKGA 2ERFA 3OQVA 2IYWA 2VAVA 3WQBA 2V4MA 5FFNA 3I2JA 2V7XA 2XLBA 2PMWB 2VTXA 1MBZA 5KJEA 5TGZA 1CIYA 5DG2A 1SRQA 1ENXA 4OJTA 2V7QA 3JQ7B 5BSGA 3VR5A 4PXSA 1ZX5A 3RZJA 3CF4G 2A0FA 1HB3A 2VT6A 2HFKA 1VIDA 4WK4B 2FMKA 4Q1FA 4MW7A 2ONCA 3AX6A 4IE0A 2H9YA 2Q4EA 3EMKA 4YAJA 5KWRA 2WO2A 4B40A 5BN4A 5A62A 4RS5A 2DUPA 3PDHA 2OQVA 1YAJA 3OT1A 1M1ZA 1G7TA 5EIBC 3CE9A 3PIRA 1Z5PA 1PNQA 1VDMA 3C3BA 2V9CA 1ML3A 3F7OA 4LHZA 1L5RA 5J1TB 1SPXA 1H8TB 2B4KA 2RJLA 1AKTA 5DGCA 5IVEA 3AH8A 3L01A 2WTAA 1OVGA 3K4ZA 2JA2A 1FLAA 4FQ5A 1ID8A 4KREA 3BH6A 3V5NA 2QTMA 1RMU2 4IEVA 5NLLA 4EYKA 2DBIA 3H6KA 5FB3A 2NXWA 3BWDD 1E77A 4AWBA 3IIMA 2JDNA 4Q19A 4PRKA 1ZHOA 4TZTA 1T8YA 3WK8A 4BTLA 5JARA 1XYPA 2D98A 3NEPX 3LWZA 1GCOA 2WYSA 1BGVA 2ZI4A 4J0IA 4M49A 5JISA 4CE6A 2Z3ZA 4LPLA 1W6NB 4Y3OA 2OC4A 5AW1A 4CYMA 5CKNA 1CJTC 3MIBA 1IOLA 1JHQA 5FZKA 2AE1A 4DA0A 2QT9A 2Y0CA 1SVIA 2FR0A 3GGJA 2FRDC 2YHIB 2QTVB 4FI3F 3IBMA 1U9CA 4N3AA 1GA4A 2KQUA 3VPSA 2GFIA 3OE4A 3WY6A 4HQKA 5ERXA 3PVNA 4IR7A 1VLZA 3W1VA 4QKDA 2VVFA 4ZQCB 1C7RA 2WABA 2BPA2 1SXJE 4XR9A 2AQHA 2ZBRA 2EERA 5AJXA 1J7JA 4IRUB 1WV1A 3DO8A 4HHEA 4D1YA 1SQSA 3VHXB 3BE5A 1TEZA 2I3DA 4EEZA 3P32A 3BN3A 1R092 1EINA 2B5WA 1B3RA 1UOEA 3H8VA 3GJQA 3CR3C 2VQEB 4YJ2B 4QB1A 4C0SA 5LY1A 1A9OA 3KHCA 3SLGA 3N0XA 2HD4A 1EP9A 4IY1A 5D6OA 2EEZA 1O6GA 3FUWA 2XB6C 5HQ3A 1QIMA 4N5MA 2ZHNA 1CY6A 3B51X 1UT8A 4D3DA 1L5MA 4PNHA 1A7JA 2FZEA 4L5IA 1S0CA 2JIGA 1O6CA 3CWCA 3L7LA 4LCBA 1RUH2 5K4AA 1JIIA 4NG4A 1XL1A 4UNQA 4JFAA 4EHKA 3ZWWA 1W6MB 1Z7WA 1T2XA 2WZCA 4ZVOA 4ZIRA 5C3OA 1V7ZA 1XHLA 4YWJA 2H2WA 2I2SA 2R25B 5F32A 5EHGA 1Y6RA 1EYBA 2RH4A 4LZZA 5GGYA 1PJ3A 3CWZA 3NQ41 3N87A 4YP0A 2B7LA 3C3EA 2A4KA 2ZIAA 1HQNA 3BFJA 3W9UA 3JWPA 5E8JA 3CC8A 5REQB 3AETB 3F3SA 3QOWA 3DQZA 1JJIA 3K4QA 3TVDA 4YAUA 4HVTA 5JJ5A 4BMZA 3QOFA 2GJ9A 3KEGA 2PT7A 5D1IA 3GCWA 4LNHA 4RA6B 2WLPA 3TB6A 3EGVA 3ZN6B 1MKYA 4FE3A 3C3PA 5FQ0B 2OGTA 2AG5A 3NVKI 1ASJ1 2CD9A 1XTBA 4CM8B 4QXRA 3WG1A 3IDZA 4NUBA 4J07A 2N1BA 4BO7A 3DOUA 2JE9A 4LIPD 2R11A 2IW1A 2CKMA 2EX4A 3TK1A 2QAIA 1L3IA 1MD9A 4F4DA 2NU8B 4HTFB 2PN5A 1X87A 3H17A 2CLKB 4QDJA 2DR0A 1TME1 4KNCA 3FFAA 1GHTA 1OA0A 3H9AA 4EATA 1NXD1 4HEJA 4INOA 5BW5A 3OE5A 2MCFA 4ZEVA 1K5PA 1Y89A 2G0AA 4B4QA 1J0XO 2JJ2D 3I54A 1ADJA 1RHMA 3ND6A 3AZPA 1ZBE1 3OGVA 4H31A 4MGKE 1UEIA 1TUEA 2J7KA 4GB32 3FOWA 3K53A 4D8YA 3OFSA 1RVDA 2HUNA 3FVWA 1OTHA 1WRBA 4DQXA 5EJGA 3G5AA 3URKA 3IAM1 1DCKA 4XIIA 3QFRA 4G0NA 4BMBA 3N9MA 4L4SA 2Q5QA 2RKOA 5C8CB 2UVQA 4XQWA 1YFJA 4LNVA 3Q5EA 1A27A 4BTVA 2AX3A 2GJ4A 2D0PB 1HOXA 1P1RA 2L69A 5AK0A 4JS0A 3BSSA 2NQ8A 4UM5A 1DG9A 2ZIWB 5FZDA 2FPUA 1U1CA 4EVSA 4W7SA 2W2MA 3PE3A 1SLIA 3RS7A 2WJSA 1Y7LA 1GNRA 4Q4DA 3DMTA 1TJPB 3RVOA 1ULUA 1R4ZA 3DDNA 1EK2A 2PU7A 2ZT8A 2R87A 3PICA 3UJDA 4J2TA 3HWWA 3A3OA 3R0JA 3OOWA 1ZGCA 4AICA 4OQXA 2XWPA 2Q5CA 1GXSA 4LN1A 2QZSA 3ZWOA 1XALA 2ZTUA 4RJIA 3OEBA 5K0NA 3I2KA 1GAXA 2QN9A 1W0CA 5I7RA 1NW4A 5K4LA 1Q7CA 2X15A 3JQ6A 1TA9A 4IDQA