2G9ZA

Thiamin pyrophosphokinase from candida albicans
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
322
structure length
297
Chain Sequence
b'SELIEQVIEQPDSLIISPPSYNHIQPFVYLHNVLLILNQKITIDLISLWKKCEIIVCADGGANSLYEYFNLQRSDYIPDYIVGDFDSISPDVKTYYESHGSKIIRQSSQYYNDFTKSIHCIQLHYQLNHTKENWFESIDEVDGLAKLWNGLNNSSDVVVDIDITIYVLNAIGGRFDQTVQSINQLYIMNEDYPKVTVFFITTNDIIFLLKKGVNYISYKNRLMFHKDNGSSPTPTCGLLPLSNKTPIILNSYGLKYDMRNWKTEMLGQVSSSNRISGETGFIVECSDDIVMNIEIDV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords thiamine pyrophosphokinase
publication title Structural characterization of CA1462, the Candida albicans thiamine pyrophosphokinase.
pubmed doi rcsb
source organism Candida albicans
molecule tags Transferase
total genus 95
structure length 297
sequence length 322
chains with identical sequence B
ec nomenclature ec 2.7.6.2: Thiamine diphosphokinase.
pdb deposition date 2006-03-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.320 Mainly Beta Sandwich Jelly Rolls Thiamin pyrophosphokinase, thiamin-binding domain 2g9zA01
3.40.50.10240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Thiamin pyrophosphokinase, catalytic domain 2g9zA02
2HH9A 1IG0A 3IHKA 3K94A 3L8MA 3S4YA 2F17A 3LM8A 3MELA 2G9ZA 2OMKA 1IG3A 3CQ9A
chains in the Genus database with same CATH superfamily
4UE2A 3PL1A 4NP6A 5EJ7A 1E66A 3WLQA 2IX9A 4FMCF 3AXSA 5HS4A 4PLVA 4D6YA 4F4CA 3P9CA 4E2QA 3ZY2A 2FEXA 2XF8A 3J81k 1SHWB 2GN0A 1UXKA 1Z0KA 1N0IA 4MV1A 3KR9A 1GKYA 3I53A 1HKDA 3ZCPA 2EIXA 1T8WA 4OU5A 3WX5A 5BVGA 5EI5A 4E08A 3BXHA 4MVJA 2MINA 5CCXA 3UYKA 3PIGA 3UMYA 5LOVA 4O4LB 4EROA 1BJTA 5JVDA 2WNVA 1PDOA 3BL8A 1FQKA 3V33A 2C3UA 1U8CB 3QI7A 5D51S 3J7MA 3JATA 2C5DA 1IN7A 3HPQA 3T4EA 3LL4A 4MUKA 1QQP2 4BFSA 1SC4A 3THDA 2ZKNA 3IR5A 3AETB 4YIHA 4A42A 3TSCA 1MEJA 1UMBA 4V0KA 3I49A 5D8AC 3OX3A 3Q8BA 1JHAA 4I55B 3Q88A 3AW8A 1EGAA 4NPLA 5LA6F 1HB4A 1M7BA 3IXMA 3EZLA 3AY7A 1QTQA 1O3YA 4Y20B 3PFKA 3TLJA 4EO7A 1X7ZA 4BJ1A 2YFUA 1V0JA 1JYTA 2ECQA 1W2OA 1ZJZA 3UT5B 2JJ2D 3PVNA 5CFLA 2XOEA 2QTFA 1GTL1 3A6EA 3BOSA 1X8EA 1QJ4A 1RRMA 2FW0A 4N4AA 4XFGA 1U3DA 3GCZA 4ZRMA 1N2OA 3LKZA 1G8WA 3IPLA 2A67A 1NLSA 1QQP3 4X7BA 4GWJA 2PVPA 4PSKA 3AF6A 1HDCA 2JLWA 5LQCA 1WVIA 3WLIA 3KVBA 1A2OA 3FMGA 2ZZJA 3CIOA 1WETA 4XFJA 3OT1A 3NO8A 1DT3A 3QVTA 3VVMA 2BEKA 3PNBA 1MOZA 5KHLB 1GP6A 3KU4A 5F8PA 4GRDA 2SCUB 2XNDA 3C7CB 4DLZA 1ALYA 3A22A 2V4MA 2NZJA 4HGPA 5CB4A 1MS8A 1D03A 2HDNB 2BOJA 3PYMA 3LQ4A 1PWYE 3MWYW 1PQPA 4Z3KA 4EUHA 3SMHA 1ZWLA 2BOIA 2NSJA 4KFUA 1Q7CA 2FZ1A 2GMMA 1B76A 3BU7A 4OUEA 4RWEA 3OCVA 3L6RA 2DT8A 1P2UA 2C4UA 1U2RA 1GU1A 4BWOA 1WDMA 4FPEA 1TK9A 3FMPB 5CT8A 3WV4A 3EZYA 3RFTA 2IV3A 4CL8A 1MNAA 4TMFA 2JIZA 2EBHX 1P2VA 1UM8A 3QXXA 2VAPA 2RGUA 5THXA 4D8UA 4O2AB 4MGHA 2J0UA 2RGNA 3T2OA 1F17A 4KIWA 1P1CA 1YZTA 4L57A 2ZAAA 4K88A 3VC7A 3LK6A 3QNMA 5IBRA 3SHFA 3ROKA 4F4IA 3CMMA 3ND9A 4QQKA 2QZPA 2O2EA 4ES6A 5C3SA 2JBHA 1PFWA 3GXBA 1IOAA 5IVBA 4GMP0 3BGDA 4ECAA 4FJ0A 2IEZA 3T3GA 1VSUA 2G04A 5CYYA 3FFBA 4YFZA 2P0YA 3ZDQA 1Y1TA 3U16A 3DZCA 4PHCA 2FK8A 4NHOA 4Q1AA 1N0UA 1EP3B 4RXMA 3F4KA 1Y7BA 3NIGB 4PHZA 2W1SA 1X1TA 2APJA 3JYQA 5KDLA 2ENWA 1RNLA 3WK8A 3VHXA 3GEDA 2RHTA 4HDKB 1JYEA 2O50A 3I58A 3UAVA 4CZ2A 3OAAD 3FUQA 4V02A 2AYHA 5FWAA 3NM4A 3NQ41 1N2GA 2AR0A 3T7CA 3FZNA 4DIFA 1MJGA 3OZWA 2E6KA 4J03A 1GUDA 3SBEA 4I14A 2ZJ5A 5FZMA 2J9ZB 4C0XA 1K75A 4K1LA 1ZK4A 3UUWA 4C4AA 2VSOA 1YZFA 2B25A 2UYOA 4AYTA 2NXCA 4XSHA 4WZAB 2G9UA 5F5AA 1F7VA 3LGXA 3DYIA 1D6JA 3H1PA 5ALZA 1SFRA 4AFDA 3DBRA 3LZ6A 5FCDA 1YK1A 2PMCA 1EBUA 2GETA 1N6NA 2OENG 4CM1A 2ODBA 1OLMA 3T5AA 2QDNA 3LY8A 4Q39A 3PJYA 1SQ0A 4YG3A 1LBSA 3TIXB 2QG4A 1KQPA 1JZ5A 1SC6A 2VQ6A 5FZ4A 1EZZA 4PG4A 4P4GA 1PK7A 4Z2AA 3K9LA 4ZXFA 3J8F2 4QUBA 3NDIA 4PINA 1SOAA 4D99A 4QODA 5IFPA 3V8MA 3MMPA 1YI9A 4AQYB 3UJHA 1ZC3A 3DOUA 4AUNA 1CY6A 2R071 3AQ4A 1PSZA 3CZQA 3OU7A 3WICA 5E2IA 4ZHNA 3TTTA 5K0NA 3B85A 3I9V6 4MX3A 3H2IA 4IGFA 3TTSA 1LY1A 5DUVA 1YO8A 5AM0A 4EHKA 1CEYA 1RAFA 1VLZA 2XEXA 5HZHA 1G9BA 2AOUA 2I3DA 1Y8QA 1PLKA 4ALLA 5FLEX 3VL9A 4YGXB 4QBKA 1IXZA 3TEWA 2WVHA 3D3WB 2G9FA 4R6XA 4U6SA 2WAAA 3KMHA 3AX4A 4A16A 5GLUA 1WA6X 2IH5A 4CCWA 4JBHA 1K8ZB 2C99A 4JS0A 3DKRA 2DBNA 1ZNYA 3R7DA 1CFJA 3NU1A 5B3KA 2HA0A 2PHTA 3AVVA 1WRBA 4DA4A 3TWIA 4ND2A 3E9DA 3DZFA 4ARZB 4R3NA 3GFPA 2JGMA 4YZ3A 4LCJA 3PI7A 4XH9B 3PPVA 1Y5IA 3CJIA 3MBWA 4DGSA 2X2FA 3E5RA 2WW8A 1LLQA 1TJ5A 3BTXA 2YJGA 5FR3A 1GV0A 1U0BB 4UAPA 4DA0A 1V8OA 1NVMB 4ZZ8A 1ZNPA 3MIGA 2VPXA 5G0UA 1W6NA 5JXHA 5F3CA 5AVKA 1JTEA 3QLEA 1B41A 3K4AA 3CNAA 2FJUA 4MZDA 4PLGA 1MQSA 4RQPC 2AIRA 3O4RA 1RJEA 2DSNA 3KOYA 2VPZA 4MA0A 1EK0A 3RUCA 1LNSA 1C7QA 2WV7A 4MUMA 4IV3B 3PCTA 5ITZB 3P9RA 3L0YA 1P1RA 1O3SA 3W5HA 3IKJA 4CXXA 2GGSA 3DYOA 4FCAA 3MIZA 3IKLA 3K7EA 3ANNA 3AEUB 3I6IA 4FFWA 2FFRA 3VVCA 1OJ7A 4KW7A 3HMYA 4Y1GA 2D1FA 4DLKA 3GAAA 4GPAA 2BTQB 1BWPA 3X2FA 4EB8A 4L2NA 5FO8B 1PK8A 2JL1A 2HLPA 3L4BA 1TTPB 1TXGA 1C3LA 3JBG1 2BVBA 2AA3A 1THGA 5EG5A 2YCBA 1GIAA 3HJNA 2C5GA 5SYMA 3OPYI 3M4FA 3MMXA 2RDQA 3F95A 3L8CA 5BW8A 1UKEA 2XCUA 3GQBA 3STUA 2FCTA 1DL5A 4HKWA 2ZCVA 3SOZA 3L1HA 1ORTA 1E2IA 1YHFA 1FQJA 1BDBA 2AH2A 2DF8A 2JAXA 3O38A 5EMLA 4IWNA 4EA6A 3PGMA 3ESBA 5K03A 4AROA 3DDNA 2CD9A 3ZDCA 3KQSA 2Z2XA 1F5JA 2B2NA 3PZRA 3ORSA 4H16A 2RGEA 2Q1TA 2P5YA 1TCBA 2PZEA 4BN4A 5IG2A 2GDFA 3O82A 3MUZ1 3VISA 1ST2A 10MHA 2QN8A 5C3PA 2HA2A 3UJ9A 4KN8A 1M2EA 3BMNA 3EAGA 1A95A 1YXMA 1BDJA 3U6KA 2Q9AA 3DTVB 1UAIA 3OF5A 3DVAB 4RPGA 1U0JA 1GZUA 1ZNXA 3G7UA 2H1SA 3RW9A 1QOOA 3TTVA 4GOKA 1ZITA 4HB3A 4B31A 4K5QA 5ER6A 2O06A 2FG7C 4GB32 1T43A 1TQDA 4FXKB 1UBJS 4DMCA 5KQSA 4P4LA 3OY8B 4OYUA 2D40A 3QPAA 3L1JA 5EYYA 4GULA 1IXKA 1H93A 4X24A 2A1IA 3TPFA 4YRPA 4EFKA 4O08A 3R7LA 3RM3A 5DYTA 1V00A 3ZK7A 4GNRA 5LA6A 2FDJA 1EB8A 1ULCA 1Q0UA 4MULA 3MTGA 2FN8A 1US8A 4NNOA 5E2AA 5FUVA 3TXYA 2RG4A 1CHDA 1OIVA 3NDRA 4AQ6A 3MTQA 2Q8CA 2ORWA 4HWTA 5FMDA 5J1XA 2X6RA 5T41A 3OPMA 2O8NA 2A84A 2HNKA 4JRLA 5IZ4A 1UXZA 2AFHA 2O5VA 2EJVA 1WBJB 3CGGA 5TVKA 2GFQA 3ZQKA 4GB33 1QRTA 1CZVA 3LT4A 3MELA 3TDKA 3ZK8A 3WXPA 1CQ9A 1OLQA 4Q82A 4CLOB 1EDDA 2R97A 4TZDA 1KQNA 1A9XA 1N5DA 1SQ6A 1Y4UA 3UAZA 1DJLA 2V6MA 5EMJA 2IUYA 1P4HA 4X5OA 2YOFA 3EUEA 4R05A 4JGZC 2V7QA 4OQZA 4JKMA 2OZLA 4X1IA 3N0RA 5K0LA 1YWKA 4EPRA 4ER3A 3G5UA 1F60A 2R6HA 5LY1A 1JDJA 2PBRA 4LITA 1WDTA 1QGAA 2FFQA 4M00A 2ZGTA 4M8NE 1VE7A 2WT1A 3E53A 1EDZA 4OU4A 1ZIDA 2A5DA 5JS6A 2GMEA 3ZE6A 4Q3AA 1UOFA 4Z4GA 3U4QB 3T4HB 4NJEA 1O9BA 1C1XA 3K0CC 4JOBA 4V0NA 2AUTA 3ZHSA 1NN0A 3WV6A 2CEAA 4G8CA 2J0SA 4F91B 3SLKA 2XT6A 2R6ZA 5JDIC 2RIPA 3HEAA 2IHYA 2Z9BA 1ZJ5A 5JPNB 3PCXA 4OOFA 3AZPA 5H5JA 4FCTA 1RHRA 3QF4B 3NP9A 1YVUA 2R7AA 1G6OA 1DKLA 2BMVA 4KSCA 5JAZA 1IEVA 1BDIA 2QZ2A 3Q6NA 2PUWA 5A5GA 4C3UA 1F5NA 4KH9A 1I10A 2WJ6A 4RUKA 5EFUA 2RK3A 3CBQA 1TL7C 1OV4A 2X9NA 1W2HA 2WT9A 3GY0A 1PGSA 1VLMA 3F2IA 4MDEA 3GN1A 2A7AA 2AV6A 5IJ0A 5DKFA 1YOVA 3BALA 4NFYA 5BNIA 4OSPA 1E0DA 3L6DA 1W87A 3NEPX 2ZTLA 3FPKA 1IL0A 4EYQA 2O3UA 2W9XA 2PZAA 3G6WA 5A9RA 2PQQA 1JR2A 4G63A 1ATZA 2YBPA 3PMEA 3TR0A 4PO8A 2O3JA 3GUVA 2RGRA 1JJIA 5KWEA 1MCZA 2QP9X 2FSVA 2ZXFA 1X2EA 2WIAA 3EE6A 1HIXA 5LQRA 3AB3A 4YMIA 1SPPB 3UK9A 4NAUA 4Y9RA 5B7NA 3A21A 3NFRA 4G26A 3HOBA 4PS0A 1Q3EA 4HAWA 3FC0A 5C8CA 3WMGA 5TR9A 4UOEA 5K6AC 3QEJA 1M0EA 2W71A 1UKRA 4DRRA 1ZMBA 3ZM8A 3DUWA 1RWPA 2QG9A 1YKFA 3T1QA 4BFXA 4FR2A 4YHHB 1NBMD 2H4ZA 2BGWA 3THOA 4S1WA 2NIPA 3HWJA 2XTAA 4EEXA 2IOYA 1GUFA 3RBXA 5E6SA 4G1MB 2IIBA 1YQ5A 1GUIA 2VNRA 2JJQA 2NO7A 5AVTA 4O0MA 5JOYA 1UD1A 1AB5A 3GF4A 5FHRA 4Q19A 4AQ7A 5TS2A 1VPEA 1CE8B 3NFYA 5JECA 3O12A 3PRJA 3HWRA 5FJHA 1T8TA 1LV8A 1VJCA 1L5LA 5F6LB 4BLTA 1QHYA 2QRPA 4I5DA 1EUCA 2ECKA 5CBKA 5CX4A 1XVVA 4LNAA 2W70A 4WWHA 3G6KA 4L2IB 1BYHA 4OA8A 5EJGA 4KR7A 4DO0A 3Q15C 2MSNA 2PIDA 3PA8A 1SFPA 2FSPA 2QTVB 1CJDA 1ZD9A 4LDAA 1NNUA 4ABYA 4YH1A 3Q3CA 4GP6A 4WBSA 2YU1A 3TTUA 1EPUA 4JEUA 3SS9X 3OE7D 1IBSA 2BKXA 5AKIA 3L77A 4EHHA 2WSYB 2GARA 5JYCA 2J32A 4X6RB 3CJRA 1GNRA 1JVBA 5DU2A 2QTBA 1J42A 4ND6A 4DILA 5C1BA 4KR9A 4P2BA 1JQAA 4V1CA 3QBEA 1RUF1 4MGYE 4MV4A 4LGCA 4YRIA 3W8EA 1QYCA 5C9ZA 2SKDA 2VCYA 3W6OA 1DO2A 1NR7A 4LRXA 1NF8A 3OIUA 2FSUA 2H1IA 1WUVA 1JFFB 3O4IA 2VEOA 1PD1A 1IXYA 5DQ0A 4KL8S 3EFHA 4ZAVA 5BV2P 3POJA 3OFSA 5GLWA 3L8ZA 1NP3A 2BWCA 3KDAA 3M81A 1WW5A 1NUKA 5FQ0A 4CFZA 1O9GA 5A3PA 2A0KA 2XJPA 4MQFA 5K1ZA 2C2KA 3P0JA 2YS7A 1SN7A 1EFVA 1GTZA 4IJWA 2X58A 1NYRA 2GYUA 4BVKA 4J2TA 1GNTA 4NAMA 5JXGA 3PK0A 1MHPA 4MB2A 4QZVA 1UBLS 5AJZA 1MOPA 2C95A 1SCJA 3WGMA 4CA9A 3HDTA 2Q8EA 1G2PA 2MR5A 3I8SA 4L07A 4RGYA 4P31A 1ZIYA 1WKCA 3IC5A 4NYMR 5H7XA 4AKEA 5AH0A 2IVJA 4XVHA 3REFA 3PC6A 4DB4A 1NASA 3MRTA 1S4CA 2XB9A 1KDYA 1LHWA 4TXHA 1N4DA 3T06B 3WLFA 2C00A 1TO6A 1MGPA 5JOQA 1RYEA 1U0FA 3VYRB 2Y76A 3RJ2X 2QRGA 5CFRA 3KT3A 4BXSV 2VCCA 2IYTA 1S3IA 4R1NA 2WDPA 1LKNA 3N9PA 4TLCA 1E1RA 3WNZA 2G4CA 2R11A 3RFRA 1DT5A 1BX1A 1TJ4A 2DU1A 2WFZA 1K3IA 1RJ7A 3STHA 2HWF1 1C1DA 3UWPA 3UXMA 3KOXA 3PGA1 1J8DA 3JD2A 1KC1A 5BQPA 2EFCB 1U2GA 1WXIA 1V39A 3CZMA 4GMP1 2H0BA 5HE9A 1MS3A 4US0R 1KHHA 4J0GA 4DIDA 3CUYA 3THWA 1NVVQ 4RM3A 2Y4OA 1UZZA 2EXIA 3QBVA 4A91A 1IATA 3AHEA 4RF2A 2C54A 4JVMA 4ZU7A 3BD6A 1EWVA 3BTUA 2GM9A 1HFJA 1ONSA 3VSBA 1DEXA 4TOIA 2CYBA 4E14A 1U9JA 3OCPA 1MRZA 2Y1OA 2D06A 4CLXA 4JB8A 4D4LA 1JEAA 2ZRDA 5HHTA 3AKTA 2R7EB 1XCMA 4GXNA 3ZX7A 4U00A 2GILA 3DZHA 4RESA 2HW8A 3R44A 5LEJA 2C82A 3AI3A 3OP4A 3OZCA 4QDUA 3T2PA 4JC0A 5DPNA 2EA7A 1M6HA 4QEKA 1NJ8A 3HGTA 3AFHA 5IVYA 3OETA 4PSAA 4J7UA 2Y67A 3K4DA 3I64A 1NCQA 1GNZA 1OIXA 1WMFA 3MHZA 1R0RE 2IXEA 2QYOA 1IE3A 3LF7A 1JZ8A 4WKGA 5TSDA 2G06A 4TS3A 2IU3A 2GRJA 2YWCA 4AE2A 2BT4A 1ZLXA 2HADA 5SV2A 5EESA 5C4IA 3N86A 2IU4A 2I66A 4KWIA 4G5QA 2H6CA 1ORRA 4C4OA 3K70B 3L7YA 3FJ1A 1E9VA 1NQDA 4JI3B 2O14A 3UYJA 2QNBA 3MJRA 3IT2A 1I6LA 1L2TA 3L7DA 4B46A 3R5KA 3D4PA 4XWGA 3M6XA 3RRYA 4ZXEA 4KIGA 4XKJA 3WL4A 1D9XA 5DM0A 1I32A 4RACA 4FQ4A 3WTCA 5I9IA 3GLFA 1E1CA 1M3SA 4FGKA 1PFGA 2O7QA 4IOJA 4A03A 4JGBA 4LZPA 3T7AA 4OFXA 1JLLA 3I9NA 5EIFA 3QEOA 4KQCA 1LHVA 4WM7A 4Z9YA 4FPFA 3I9MA 4DR6B 4LYGA 5JFOA 3IPYA 4HGZA 4XIOA 1PTKA 1SZJG 3CLPA 2WAYA 3N7JA 2B4TO 1ZRSA 2QRHA 2PGNA 3VD4A 4NICA 3L9JT 2B9VA 2GEKA 1BVYF 4LS3A 3WF1A 4LNUB 2W8BB 4R4JA 2QLNA 5E7IA 3BB3A 3QWBA 1P4JA 2VP0A 4TKVB 5F4ZA 4G0MA 3HBFA 1MEC1 5IUQA 3O4HA 4MKXA 1WVMA 3MAGA 3CZJA 1NY71 3AR2A 1OYVA 3WXBA 4WLVA 2X8LA 4V0RA 2DWUA 3RFFA 1JYSA 3IRUA 2FDIA 1JG3A 4C05A 4WVLA 3OZDA 2G19A 5BP7A 4GPIB 2G7MC 2OXRA 1QANA 3LSTA 2E7QA 4Y6GB 1RABA 5FY5A 4PC2A 4X7PA 4Z2WA 4TL8A 2DFKB 3G3EA 4KHZA 1ODFA 2X5IC 5FWNA 3LQRA 1B6TA 5JQWA 4WXEA 1EI9A 5AXBA 2LCFA 2B8JA 4E2WA 2BVNA 5THKA 3ZV4A 4Z0PA 2BDRA 1GPNA 3T5PA 1YR6A 5COAA 3L1KA 1OZAA 2W90A 4RV5A 4H3VA 2NAFA 1RYBA 1OPRA 3KSMA 4BZPA 3TSOA 3H2KA 1KRWA 3SEZA 3KPWA 5FBJA 2BGCA 1RMQA 4MADA 4IIXA 4D9EA 4A41A 1T6YA 3NHAA 3PXUA 3AKRA 1DELA 3JQFC 3RTEA 1VRH2 5JAHA 2NU6B 4NOLA 5FTNA 4B33A 2J4FA 1LF5A 1L4LA 2G71A 1P2BA 4BIMA 4V0ME 4YM2A 4CT4B 1NY5A 1WCDJ 2PS1A 2PV0A 4BO2A 4EPXA 1XSQA 4XYBA 5HQJA 1KSJA 1FFXA 4QRDA 1C8M2 3LCPA 1B6RA 3OU6A 1R2QA 3DAYA 4YAEA 1WMDA 2VC2B 3UIEA 3GALA 2GCGA 3MZ0A 2ZUTA 4M3CE 5M3BA 4B6PA 2ID8A 2WWTA 4QPIB 2RGYA 5KNCH 1VL1A 3U3RA 4DXZA 1WTAA 4HAZA 3ICQB 2WR8A 1JN2P 2NG1A 1U9ZA 4CTOA 1KP3A 4UFOA 2D74A 2OZ6A 3C7DB 5AC92 4BX0A 5L6LB 1IZ3A 5DT9A 4IHJA 2P17A 3MLBA 4RENA 3HO1A 2KB0A 5HVNA 1XEWY 1A4IA 3FE5A 2FUG1 1F8YA 3OH8A 4RULA 4FSXA 2OE2A 2DHCA 3BCUA 1C8M3 1ZXLA 1JI0A 3K1YA 3LA8A 1DJMA 2YJTD 3VDDA 1QMGA 3HB7A 1O4YA 2E7ZA 1E3DA 1FRFS 1P1KA 4OJNA 4ZT2A 1N2HA 3L9WA 1WW3A 2VAMA 2I1VB 3GZJA 1NJFA 2JWPA 1Y33E 4Y3OA 1H1MA 1VIVA 1TADA 3BSFA 1RXYA 1M6YA 4J8PA 3DF7A 2FRDA 4JA2A 1YJ8A 4YB8A 4TQ9A 3IWZA 3OFND 5BSVA 1X80B 2R4QA 3OIGA 1GPH1 3T4PA 1V6MA 2V6BA 5IKOA 5AC93 2IHTA 5F2SA 1XPUA 2HLDD 5EE1A 1TEIA 1WUHS 1NL3A 3ICCA 3ZK9A 3D5TA 1MAHA 2ZRQA 4IE7A 3JY6A 1A7JA 4JQCA 4KFSA 4B80A 5KHOC 5GZ6A 3ZXYA 2AJTA 3IUMA 4ZY9A 3ACGA 2B98A 1KSGA 3TQOA 3ELWA 1D0VA 4FD3A 1O5LA 1LLCA 1PIV2 4YCLA 3D7NA 2DV9A 5IAOA 3HP1A 2OLKA 3I28A 3ZTYA 1W2UA 1GRVA 5FXVA 1EQUA 2B0CA 2F3SA 1HTBA 1BRMA 4J16A 5JNUA 1OI6A 3MWFA 3TEMA 4PQRA 5FYYA 3RQIA 3H1EA 3DB1A 4BFUA 4IRUB 4MUGA 4BZXA 4JJAA 2DBZA 4AWDA 2B94A 2A71A 1ZBE2 3EVBA 1XPOA 1WQ3A 3QW2A 2DUPA 2UZ1B 5HUHA 2XUGA 7REQA 1RR6A 1HXS2 4ZK6A 4FTWA 3TNYA 3GAFA 1C4XA 2PX6A 4HXFB 4IR7A 1V4NA 3GUUA 3GJ8A 3VPCA 5H02A 4N47A 2DYCA 2QY9A 4Y4RA 4AQTA 3P1JA 5BNOA 3TR6A 2W42A 2KJQA 5KBYA 1QHEA 4D3XA 2VDUE 1LTHR 4C0AC 3CE6A 5LLTA 3CWQA 3RC7A 1XMVA 2IZ6A 3DNFA 4NJOA 5EUCA 3ZFFB 1RYYA 4WLUA 2JDYA 4RIIA 4RY9A 2GXUA 3SGLA 4DGQA 2P5TB 4K9RA 2UUOA 3TQQA 3AKPA 2P34A 3UV3A 4RHYA 3E5QA 3BKXA 1Z6QA 4UNIA 2X6TA 4ONUA 3E5MA 2Y0CA 4AJ2A 1QG6A 3LP6A 4BC0A 3NXSA 4JGIA 2CUKA 5DHUA 4CF7A 1L7BA 2VN8A 3VR5A 3NWOA 1XMPA 4U6QA 1ZBE3 1LOFC 3RC9A 3I2YX 3LXXA 4J2HA 3OGRA 1U4SA 5H4HA 4FYPA 2E4VA 1PSDA 1K6XA 3F5DA 3GFRA 5I4CA 4XYXA 1ZCBA 3RB8A 4DDHA 2RS13 1MO6A 1N6PA 3CB2A 1YI7A 4G86A 1J5EB 3BVCA 2LW7A 3MIBA 3BMQA 3JWIA 3FCYA 2B2XA 3MO4A 2WTNA 2QQPA 5EP3A 1U0GA 1UJ6A 4R1UA 3E9QA 3DLTA 3P0EA 2J9FA 4WCFA 3OBTA 1JODA 5TPWA 3MWGA 3PLRA 1M1ZA 1TZ2A 1U0RA 3BFJA 2C2ZA 5IBCA 2ZZMA 4I1UA 4ZREA 1PZGA 3FROA 4B44A 4UUOA 3ZR6A 3VR1A 2Q9CA 3PEVA 4S2FA 3DBLB 3A6FA 3PC8C 3VTKA 4G97A 1RYMA 3BIOA 1Z88A 4ZZ1A 1YL7A 3HJRA 3AP6A 3NHBA 5A3NA 4CNBA 4QEDA 2GK6A 1VRCA 2Q6IA 3BXXA 3F3SA 5D1NA 1F2UA 3CO2A 5KJ6A 5K2MA 4FTSA 3ZY5A 5BPHA 3TYJA 1W05A 3AKCA 2H07A 4C22A 3OSZA 1Z29A 4GAZA 2FKAA 3GJTA 5FUYA 1EPZA 5FY0A 5JOWA 2WYOA 3DMGA 5JHGB 2ZTMA 4BZWA 4EN0A 3N2KB 3KTFA 4NATA 4N5HX 2PSFA 2J1VA 3GPCA 4HQLA 5HKAA 4INJA 1AY0A 3AFIA 3T7EA 2M6RA 5DXDA 3QUTA 5JQGF 4LDPA 5ICCA 3HG7A 1KI6B 5INTA 5F1YA 2C7PA 1DXQA 4TYQA 1QZXA 1BIFA 3SN6A 4DL9A 1SHZA 2V1XA 1AN9A 2E6UX 4MW7A 4XPZA 1LPMA 2RHDA 1OYWA 1JEOA 5AW6A 1THZA 4EE2A 1M5UA 3DBHB 3NJZA 4GI2A 5ECDA 2PSJA 3N6XA 1FFEA 4BB0A 5GPBA 1VBA2 3V65A 2CV6A 3OJCA 3HZOA 4RZQA 4CTEA 4EN9B 1FXWF 1ECLA 3I4FA 1N1VA 5KNDA 4UFMA 2EJBA 2P78A 1E2HA 1NLRA 3T7SA 5JNSA 2ZI6A 1TE1B 1NVXQ 5EE0A 3VM6A 4YMWA 4U7DA 1LWNA 4KDEA 1GLGA 2V72A 3OQMA 3T6KA 1I3MA 4KBGA 1TTQB 3DW1X 3ZXXA 5JS8A 2OA0A 5JCTA 1BKZA 4PLTA 1G2OA 5M0TA 1CWPA 1QH8A 2NLRA 1R6XA 1PX4A 1BEEA 2Q5LA 1DEHA 1XNAA 2VPWA 3E9YA 1PR0A 2GN6A 3AEQA 2H9IA 2F3TA 5HKBA 4A3XA 3I5MA 4Y22B 4RHTA 4YEDA 3RHSA 3RTCA 3TS1A 2PLV1 3A4UA 3KDPA 1KPHA 4WZBB 4JC1A 3FPGA 2X7HA 2QLLA 5C31A 1AR73 1VBA3 3GJRA 3WLNA 4LRYA 4NRPA 4YJ3A 5AHKA 4P0PB 1UQRA 3ENVA 1E8NA 1OFTA 5AHWA 4GRAA 5GADl 1W44A 3BMOA 4NWWA 3PQ5A 4IDAA 3RF7A 5CYGA 4ZI2A 1JNXX 3WGQA 1OBFO 2DKNA 5BXQC 4NMHA 3VVLA 3AM1A 2RJOA 4YZ1A 4Q8KA 3W7BA 3IP8A 3QG1A 4QNRA 4Q4HA 5IHXA 3QUQA 4C0HA 2H1LA 5LQKA 2WK1A 3HKEA 1NLFA 1JMKC 1BVUA 4DY5A 2KBEA 1DDGA 4OHBA 2C9YA 5CVTA 1XQWA 3GJZA 2GBGA 4W5TA 1QQP1 3S2IA 3MRXA 1AV7A 2JB4A 1YT5A 2HZBA 1QPZA 1ZN8A 2BNOA 1I1OA 3K4PA 2WZR2 3M4ZA 1TF5A 4LFAB 1O96B 4XF1A 4FC6A 2ONKA 2OO3A 3ASZA 3RYFA 3NHWA 2ARBA 3PUWA 3TTWA 5CYOA 4FDTA 3EW7A 2X42A 1TW2A 1YZ3A 3H4VA 4M7RA 3FN9A 3HYNA 1E6KA 4F11A 3A4VA 4KYVA 5ULLA 3U26A 3R0ZA 2NU8B 1WF6A 4D6PA 4FLEA 1RVF1 1IN1A 4JX8A 5FZ8A 5BY2A 5JO0A 3IILA 4IFTA 4AFNA 1BNCA 4YO8A 4B4DA 3B13B 4ESHA 1SFNA 1NMQA 3F2VA 5CFCB 2D62A 4PLFA 3FWYA 3BRWD 1OWOA 4NECA 1BZYA 1PWEA 1O0SA 4FOQA 4B6OA 2LGJA 3HFSA 5IWFA 4AY6A 5E7MA 1V6SA 2WZR3 1A9SA 2R1TB 1M10A 4XSGA 1N2XA 1W8OA 2XUDA 3WWZA 3ITNA 3WX0A 4XASA 3N07A 4W8JA 1J84A 5JRJA 3B89A 3TQSA 2SECE 1T2AA 5CA0F 1TKCA 5HCIA 5JANA 2A4KA 4IOKA 2WC2A 3G1TA 4QXQA 1FUKA 1PJBA 1W2GA 2RDMA 5HZKA 1KTIA 4FC7A 3NWBA 3HBZA 4FEYA 1W9HA 2XAAA 3HA7A 1Z74A 2I8CA 3VB9A 1LBQA 4BMYA 1AZLA 3NUZA 2D2FA 3H19A 1PNOA 1DKUA 4J0CA 1CONA 2AQHA 4NCBA 1ZRFA 3AP1A 4JQTA 5KQLA 4LKSA 1QHDA 3GNEA 1THMA 3KVNA 1DWQA 3HPNA 3LO8A 1WLCA 1VDMA 4BJ3A 2PN5A 1GCUA 3VTFA 2Q6OA 1BZWA 1I2MA 5BSRA 4UOJA 2IC5A 2MEV2 2EHJA 4FSJA 3ZOKA 4EK9A 4MJ3A 2YVLA 1ODLA 4LULA 4JBWA 4TTRA 4B2YA 3LT0A 3N2YA 5F1KA 2O0JA 2B92A 1KAOA 1GN9A 3D3EA 3LT1A 4MI1A 1G8JA 4US1R 3T94A 1Z0FA 5AI6A 4M3CB 4BQ4A 4W5NA 3KQOA 3K48A 2FPSA 3FMVA 3WADA 3ICEA 4B9AA 2O7RA 2WD8A 2XXAA 3MFYA 4KITB 4OV6B 3ZH2A 2X19A 3L79A 4ZV9A 3AZVA 3FGNA 3D59A 1U5AA 1XCLA 3LD8A 2JFBA 5KDOA 2DOKA 2WP8J 5JMPA 4ESOA 3B6ZA 2A9VA 4Y2GA 5DNVA 3POFA 1N0WA 3UFXB 2Y8EA 3IQZA 2SKEA 3WOVA 5GV8A 4Y6OA 3A05A 3ZJYA 3N75A 4DV2B 1DIRA 4YP5A 2ZWPA 4JWTA 4N7MA 3NBMA 4CDUB 1DI0A 3O8NA 2V74B 3KUCA 3PXBA 1U31A 2YR0A 5U1PA 2IYPA 2AOXA 4IDOA 4P0QB 1UDAA 4FXPA 1C3JA 4EGSA 4U5QA 5FZBA 4PU0A 5HBAA 5CDYA 4IEXA 5JMOA 5DMHA 4QLOA 5LU8A 2FEWB 4P98A 2J3LA 1D2CA 3JRNA 3SIWA 3NATA 3H1YA 5E9AA 1U3TA 4JX9A 5FUXA 2H3EA 5FZOA 5CB7A 3V80A 3SS7X 1COWD 3CLTC 1NSFA 3PTLA 3UXYA 3JQBA 1UZLA 2I33A 3TW0A 5LYJF 2ZSBA 5H9RA 2TECE 1H0RA 3ONEA 4YC7A 1XK6A 3KKOA 5ALRA 1CAWA 4G0UA 1NHGA 1IS4A 3AL3A 3SYKA 3CN9A 1NVDA 1X9TA 4O3FA 3NOXA 2HRDA 1KH1A 1PN3A 3HQXA 1P1BA 2Q21A 1IYZA 5KJ1A 3ZWKA 4MROA 2F1IA 3AM2A 2OO5A 4DXSA 5DVZA 3HLKA 2Q0AA 3OOYA 5AFBA 4LZZA 3REQA 1BK1A 4LLFA 3KVAA 2Y38A 4R7GA 2IZ5A 3TQIA 2P35A 1X14A 3F97A 2ZX1A 1E2QA 1OBOA 2JDIA 2OV4A 4FYKA 2QVXX 2YN0A 4GI7A 3PHGA 2CJFA 1KEEA 4JJFA 4C4TA 1JZQA 3E23A 1GUYA 3L92A 5H3CA 3E9MA 3A1SA 4PCRA 2J45A 2WC1A 1Q83A 5J3JA 1JR3A 3L7KA 1K66A 1K68A 4WKOA 1LNQA 3UESA 2ZS7A 2K87A 3FA2A 5JDCC 4A2WA 3V8VA 1Z3CA 3K70C 4YCJA 3FNQA 2FPKA 1ZEJA 3HNPA 2QKYA 3LM8A 4GKBA 2A92A 4IDNA 5M04A 1KS9A 3WSOA 3E0XA 3RIEA 2FUNB 1Q7TA 1D2SA 5EHDA 1A82A 2C98A 1XZBA 4ZEMA 5DBHX 2ALJA 2VHXA 3N2LA 3OBAA 1IZ9A 3E15A 2EXKA 1JVNA 5KYWB 4BVHA 3CWZA 3V7YA 3TD2A 3VNAA 1C0PA 3T9BA 1ZPDA 3O2NA 3IV9A 1THTA 1KOJA 1ZINA 3AJDA 3REOA 5J4KA 2Y1CA 1R5BA 4AN1A 5IX8A 1F20A 1PJLA 2ZIZA 1R0KA 1A3KA 2GPAA 4MGYR 3R6SA 3WLEA 4RFVA 1ZOPA 2V6JA 5AVPA 2CXUA 3DN7A 1J0XO 3SZUA 3G49A 1ZIXA 1XEAA 4P32A 1ZIOA 3N76A 5CH5A 1QHNA 1NKSA 5GZFA 3CCBA 3LDUA 2C9CA 1PUJA 2FB9A 1RUI1 3CNBA 2VM9A 3WDVA 2XLGA 5GY7A 1NRWA 3ROUA 2B9UA 2QQJA 4B6JA 2PKCA 3BQ9A 4NMIA 4I09A 4ENPA 3H1WA 3RFVA 1SBTA 1Q56A 2H7YA 2JLCA 4JGGA 3RSFA 1P9LA 4HC4A 1PFUA 1TIPA 4LQCA 3I30X 4WKNA 4CLDA 4Y1RA 2UWCA 1FXWA 3FRJA 3W90A 3FCOA 3WHPA 1W06A 4LUKA 1ZXXA 3A1WA 4JC4A 3W3AH 1J1UA 1UBSB 2NUAB 1H2HA 2WR9A 1DXOA 2B82A 3GZ4A 1N9KA 5JSKA 1K12A 1DUSA 2I4TA 3JARA 3NPMA 4XB6B 4ZMBA 1PVC2 2D6KA 2AMYA 2DVFA 2G6TA 2QRUA 1P39A 4URHA 3BTAA 1W8HA 4TMTA 1CEEA 4OI4A 3I72A 4KTTE 1YHNA 2DY1A 1AZDA 4IRMA 1DGWA 4ZI5A 4WFJA 2UZ0A 1QC5A 3TECE 3D4OA 4FN4A 3K6KA 1UF9A 2LNDA 3EY9A 4I2VA 1DAPA 2Y64A 5HCAA 3WCSA 1R092 5A7WB 3JUUA 5HEKA 2X5IB 1RXVA 4XQCA 1X70A 2GJAA 4F3CA 3H9GA 1QIDA 1E0KA 3VR6H 3W2HA 5DO9A 4ZU5A 3SFTA 5FXZA 2JFXA 4EWAA 2PL9A 5A62A 3Q3EA 3HNRA 2AJBA 3T3EA 3QVSA 4I36A 3IN9A 4EL0A 3AERB 4Q9NA 3JXSA 3M6AA 3N59A 3I04A 4BV3A 3W79A 4AKSA 1H8HA 2W43A 3I32A 5COBA 3IOEA 4CZSA 1PFQA 2AVDA 1T2EA 1XDUA 1PVC3 1TCUA 4EA8A 3BQMB 1E98A 1YZGA 1IHOA 4QPIC 4GH4B 4JT2A 2B45X 4JLBA 1X39A 2XBUA 1R0YA 3HU2A 2ORZA 3JZMA 4MEJA 5CPBA 3Q5DA 1SG0A 2QQFA 3TRIA 1OVPA 5C2JB 2BFEB 1S55A 2SBTA 2CGEA 1WDKA 2I8AA 5CLFA 2PSEA 3ZKAA 4FNOA 2BSQA 4K05A 1RPJA 2PQ2A 1R093 1O5OA 3Q9LA 5JZBA 4YRNA 1P5RA 3PE6A 3HI6A 4ZQIA 2FXVA 1QZ3A 1T0UA 5JI3E 1GFIA 4V3BA 4FGJA 4DUPA 3WINE 2PTMA 1XKQA 2DKFA 1W46A 1OI7A 3TNLA 3KSDO 3ODPA 2JEMA 2DBIA 2QPLA 1QZTA 2XOXA 1QSGA 3H17A 4I19A 2Z5LA 4NDAA 1WCYA 5JS1A 2O0MA 3MQ2A 3ETLA 4HRAA 5A3RA 1OQAA 1UBTS 1DC5A 1HE2A 3H9EO 2XCIA 3UATA 2ZYTX 2QMQA 2IEGA 3ROXA 1G20E 2RJNA 4MLOA 4RANA 3F4BA 4WHMA 3SZOA 3K1AA 1BAPA 2HTEA 2V7PA 5BR1A 4N7JA 1UPXA 2WNHA 4LOTA 1F1BA 2D5HA 2DEUA 3DPRB 2OQ7A 4DUZB 4JV4A 1CLUA 5CA0A 4CDQA 4PYIA 3FTFA 4EQVA 3OPNA 1JOPA 5E88A 1KH3A 2ARKA 3KT1A 4IDFA 4HB4A 1OWLA 1R8XA 2WWSA 2KMLA 2PLNA 2CJPA 1NYTA 4E11A 3WYNA 2G09A 3OE5A 3J8F3 3TQTA 4KXQA 4NRMA 1MC1A 2H06A 2D7CA 3OY7A 1ND6A 3L5KA 2ISQA 1G3QA 2CJXA 5KTOA 3M3DA 4HQOA 2BUCA 4YAOA 3CLTD 4L76A 4BISA 5FF9A 3UOGA 5IJWA 2NTVA 2RGAA 1PR3A 1A77A 4MGIE 3MEQA 5DZSA 4C7MA 1D4FA 4CXWA 5DAVA 3BCRA 4LHWA 2WT0A 2ZJZA 4XGRA 5FP8A 1YRHA 2IOQA 5EUMA 3AMQA 1HZZA 5JWOA 3ZI7A 2ZUFA 3ZCVA 1Y5MA 1JECA 2GU9A 4UW9A 4BFVA 3W8FA 1M6VA 1U9YA 4UTZA 5IW8A 4AOCA 5L3SA 1PTJA 1QLWA 3O1TA 3T99A 5GZGA 3ZPYA 4Q66C 2DFPA 5DULA 1AG9A 4MKHA 1M34E 2ZJ3A 4R40A 3GFFA 4UNPA 4PQYA 3ZFFC 2ZWVA 4MDHA 3QFSA 3A37A 4RK6A 1NQTA 3EGVA 3Q0IA 3WDWA 4XI9A 5B4XA 4Y1FA 4BNIA 1Y3HA 3WW3A 3GJXC 2JS7A 3SF8A 4Q4V2 2GR9A 1DC3A 3FVWA 5E0KB 2OCAA 5L4SA 5FEMA 1OH5A 4AK3A 5IM4F 4JHLA 4CQNA 2BHLA 4EHLA 4C6RA 4I6GA 2DHDA 3GOHA 4BCCA 5H9QA 1P9WA 1R6TA 2HKIA 1RYHA 2GN3A 3MT7A 1RWVA 3PDIB 4B4VA 2W58A 4C7XA 4Y26A 2NT4A 4PRZA 3K70D 2A3RA 1Y63A 3D64A 4ZYWA 2YFYA 1SB9A 3EYAA 1OZHA 4MRMB 4F5WA 2R44A 4NAOA 1W6OA 4NJ4A 4D25A 3PUQA 3ZXEA 5C4MA 3LIGA 3FY4A 4Z9BA 1ZOSA 3BIWE 2EKDA 3CX6A 4MYDA 4OB6A 4EW1A 3EZ6A 1WAMA 4KU7A 1QVRA 3DBIA 2CSGA 2CXNA 5KHGA 1RUD1 1QO0A 2IE0A 2PR7A 4CPBD 1GFSA 4QYIB 2EU8A 2BZDA 4RHFA 2ZFUA 2FUG6 4Q4V3 1TUEA 4U7HA 1E5VA 5IF9A 1JS1X 1WW7A 3ZZUA 1GZTA 3EQ2A 2VZVA 3QKWA 1A2QA 4D9BA 1LBIA 1NV9A 1NN1A 3ORQA 1A8HA 4O1MA 1SCNE 4DDUA 1WBDA 3QX9A 1EP2B 3H04A 1ZW1A 2B5VA 3H2ZA 3MD9A 2KW5A 3W04A 3K72B 2G1AA 1RJ9A 1TD9A 3NWPA 1NA1A 3UW3A 4BFCA 4XGKA 2ISCA 1SLIA 2CKDA 4BL5A 5FWYB 2YMPA 3WNOA 2AMLA 3UJ8A 4I5EA 4N5MA 3QACA 1QK5A 1AUOA 3LW7A 3ENWA 5BN5B 3NH9A 4MI6A 2JVKA 4CNQA 5AT1A 4XTCS 2UUCB 3HFGA 5LLDA 1U6JA 1SUWA 3TK1A 1F6DA 2XMGA 4POAA 3MCWA 2J5XA 3NBAA 2X8KA 3KSCA 2UAGA 3AZWA 4FGWA 3ETNA 2CAUA 2VFAA 1DUVG 2WICA 3OQBA 3G79A 4DEXA 2DJ5A 4IJ6A 2NV0A 3ILRA 2FPXA 4O8CA 3PQ6A 4BMBA 5EZYB 5KBFA 1UKYA 2AXQA 3W2GA 1M6EX 3NVKI 4F8YA 3TKYA 4I3GA 2WO1A 1QIMA 4KGGA 4G01B 3SNKA 1OGIA 4KODA 3EFBA 2YBSA 3VKGA 4PAGA 4L73A 2A9KA 3MTBA 1DC7A 1TQ8A 1NFFA 4LV5B 4ZQEA 3ZVMA 2FGJA 2GNMA 1AR91 2XHZA 4NEGA 3DF0A 4HLUA 1T0PA 4DNPA 4TLLB 2VMGA 4AKIA 3OGGA 5DI3A 1TM4E 1JU4A 1OR8A 3ZV7A 2YROA 3MERA 5C8VA 2FV8A 3E6CC 2QSZA 4UAUA 4BLQA 4XIGS 3F71A 2FU5C 2UKDA 3U6BA 3DR5A 2P2SA 3KR0A 1TNFA 1XXHA 4GI3A 3A0RB 4EO9A 4GBED 2O2HA 6ABPA 2IHKA 3BRSA 2RKBA 3G23A 2XMDA 2DJIA 3HU3A 1MAWA 1N8SA 1YS9A 3Q2KA 4RABA 4CRQA 2HH9A 4LXLA 3THRA 4UMEA 3W6ZA 5K9ZA 1C41A 5K0TA 4UNRA 2IEYA 5ITSA 4HDRB 2FX3A 4C08A 4JNCA 1O1YA 1VA5A 4N9HA 1ZGBA 2WKRA 1A5SB 2J1AA 2AEFA 3I39X 3CEPB 3LTNC 1OH3A 2IYLD 1KRXA 4QGSA 1C9KA 4GBGA 3WW2A 2ZYHA 3GV0A 5AKJA 1OUMA 3WIDA 3RYPA 2VJMB 4QIHA 1EKXA 3AP9A 1VL2A 4HNTA 2HD4A 2XJ9A 2XVMA 3KF5A 5LQSA 3RVJA 5F2WA 4IDBA 2ZJ4A 2W6JA 4NIHA 2B37A 2HHCA 4M0FA 4V2IA 4XX0A 2NSDA 3DQQA 2XXJA 4YYOA 3ZWOA 1ND5A 1VE1A 4XFDA 1YRBA 1PGJA 3HUTA 3FCSB 2PHWA 1MVOA 1M83A 1WKYA 2PK3A 2E4WA 5C3OA 3OA0A 1SU4A 3PUZA 1JDVA 4FMDB 4EY7A 1GSAA 5DGDA 1I5ZA 3IBCA 4ZVOA 3IUYA 1D1TA 1OXUA 3WIVA 5JATA 1UPSA 4IH9A 1LDEA 4NTZA 1H0BA 3KJQA 4W4ZA 3AP3A 1R6UA 3FW1A 3TI7A 3VH1A 3SVTA 4AYXA 3GUHA 2ONCA 1R4NA 4LBQD 4XQ9A 3A3OA 1W6QA 1JDUA 1DEAA 2UZIR 4MW4A 1B0PA 5BR7A 1FDIA 5CFCC 4CEHB 3X1KA 1XRNA 3IIKA 1GTSA 2NU7B 4XJ9A 1VLVA 4IIFA 1V2GA 2YBDA 1VPDA 1LDYA 4GR9A 4BX2A 3BICA 4IMRA 1PIWA 1RMU2 4BCDA 1QGUB 2UVPA 4XGNA 4RN5A 4ZCTA 1SHKA 1Y9EA 5HF9A 3UV9A 5T8KA 5K2OA 4FFDA 3JZIA 2B78A 1JYXA 4DXAA 3QBJA 3D5QA 4CCEA 4S12A 1TRKA 2TSYB 3WLUA 1MS4A 3RT1A 5DGCA 3RFCA 1QVWA 4O4LF 1ESZA 1KS5A 2D5AA 3SFZA 1ORVA 2Y1DA 3BN3A 3VSAA 4KVGA 2PX0A 3OZBA 2OVUA 4UE3S 3IAXA 2JAPA 1SBCA 4URTA 1RAIA 2LRPA 3K9CA 3AM5A 4RR3B 4LY9A 3IP6A 3KV5A 1E9CA 1I9RA 5I0SA 5FP4A 3EWSA 3UMBA 1J1ZA 1XVUA 2G8NA 3QV2A 1Z5OA 2BD0A 4J94A 4DQDA 3IP3A 3CO0S 5C7GA 1Z0DA 1ML4A 4RA6B 4U7TB 2PN1A 4I55F 4QT0A 4EJSA 3WHKA 4CEJA 3GHMA 4Q0MA 1YF3A 1P6UA 4EKEA 4ARBA 2A30A 4P82A 4EARA 1YJBA 3K0EA 2JFNA 4TTSA 3DONA 1RAEA 5JRDS 1SMVA 5KYUB 3DMPA 3WL7A 4MIOA 2DWRA 4YQFA 1GO2A 2BFFB 4HQNA 4E7PA 1Y1LA 4EZBA 3EGIA 1KR2A 1I1EA 2OUKA 5DRYA 1IG0A 3EPJA 1A1VA 4E22A 3KO8A 4HDOB 3EN0A 2IKQA 1N4AA 1J07A 1RQXA 3EEOA 2GN8A 3E9CA 4O4HB 3HKDA 3KUUA 1H6AA 5E9QA 3DS8A 3PUAA 1WB9A 4F72A 1NMSA 1FYVA 2C9KA 5PGMA 4LJLA 4A8HA 4K86A 3L9XA 5D86A 3DXXA 4CU9A 1GT91 4CDUC 1B43A 1M2VB 5IRCD 2OBNA 1UMCB 4PBRA 3I42A 3HEMA 1KEXA 3TD6A 5KYYA 4S05A 3FSRA 1BK0A 3BK1A 3D0KA 5LRSA 1QVZA 1SM4A 2Q3HA 3DYMA 3V97A 4QGLA 5KWRA 2RGCA 1D0IA 3OSDA 4Z0NA 1RUOA 3OO0A 4MLZA 1UXJA 4WGGA 1E20A 5BYAA 2PLRA 4KZKA 4EG4A 4HK8A 3FPCA 5JLAA 1S3FA 1RQLA 1G20B 2EW2A 3FHJA 4EGCB 1C8M1 3PUSA 3ZWWA 5AI0A 1UWCA 3CG4A 1NYQA 1ISGA 4DSUA 3QEMB 3WGIA 2JHCA 1FRNA 1CFZA 2X7XA 1D7PM 3ICPA 2XHEA 5CBPB 4O2AF 5JLVA 3HI4A 4K6FA 2GC0A 9GPBA 5FKJA 2FSIA 2Z2SB 5EJ8A 3WMXA 5IJZA 4FBGA 5DHFA 1HB3A 3MBKA 3HDQA 1ZK0A 2PA0A 3RAPR 2OESA 2PJUA 1AR62 2WNUA 1WW6A 3JPWA 1WLWA 2C57A 2BTVC 1O6GA 2QIOA 5K3DA 5BNFA 3H0OA 4BFLA 1GMMA 4RGAA 5A4DA 4GG1A 1T4GA 5EJIA 2O8DB 4OVKA 3OP1A 1PFVA 1WNFA 4A2CA 3W1VA 3RYCB 4IS2A 3O14A 3W8RA 1HURA 2D3SA 5JHHB 5L3QB 1LGNA 4IRXA 1I4OA 1UPCA 5BRNA 3AESB 4Q93A 3A58B 4GKKB 2GP3A 4KVFA 2Q30A 3MWEA 1U2PA 3RHTA 3V6LA 3UBTA 5C51B 1BXRA 1DQ2A 5C5DA 4LF6B 3RABA 4GL2A 1Z5UA 2YN4A 2JEOA 1J9GA 2FPWA 3LUKA 2L18A 5K3SA 3LAWA 1B2RA 5AM3A 1UMDA 1SKYE 3RVDA 4R41A 3EXEB 2N47A 3TTYA 3W77A 2O8FA 1AR63 1WLYA 2A86A 4GYYA 3RAEC 3U3KA 5KQMA 1TOAA 3IDEA 1I13A 3L1UA 3INTA 4C90A 4KP7A 2D2XA 1O0CA 4B3MB 2BPOA 1N3BA 4FKBA 2J87A 2QG6A 4QBTA 3MCTA 4AKHA 1M34B 4AUEA 1FPN2 4YM3A 3BWEA 2PUEA 3AVXA 3LK7A 4L8YA 2HU5A 2VQ3A 5EVJA 3F5SA 4ZO6A 1M5TA 2E55A 3UM9A 4X1OA 4LT5A 5EWJB 1M1YE 2ZABA 2FFHA 4MQ5A 1H5NA 1JU9A 1USUA 4H7MA 5F32A 2AC1A 4PG6A 4GLFA 4GPEA 1IXRC 2JI8A 1GAWA 3NT4A 4HG6B 2ZUVA 2JD1A 3HPRA 3UHFA 5FT9A 3FWNA 1K6IA 4E30A 5HIJA 3SICE 3JZAA 1N6IA 3U39A 5EAIA 1R4ZA 2H48A 1L4YA 4N0PA 2ACKA 4HP8A 2UZ4A 1C5KA 1LODA 3GGGA 1NX9A 4N5IX 1ASJ1 1YDGA 5CEJA 1AZTA 2CJYA 4PI0A 4FFOA 3B01A 3WBFA 3LCUA 3AMNA 2FCAA 1MHTA 3L7CA 3IAEA 1TI7A 2M1ZA 2BBSA 2X13A 2RS11 4U1RA 1FTSA 2H9YA 2XKPA 5T64A 3S1LA 4C7OB 4LXYA 2G08A 3D4NA 4YAKA 1DFIA 1R0LA 4TWAA 3FTNA 4UWDA 1SHLA 1REFA 3A26A 3GEHA 4XQ4A 1U2QA 5HX7A 1SCQA 2UYBA 5IASA 2ZI9A 4DBLE 2EXJA 3I9OA 5JH7B 1SA0B 5DHPA 1PEKE 4G1FA 1XCGB 1YWGO 4EZEA 1HDZA 4G2TA 2I45A 3LP8A 3D7SA 2UYHA 4IIGA 3R6DA 4WK2B 1SLCA 2HFKA 5DNDA 4PFJA 4QQNA 3GROA 3N9MA 1JTVA 3COPA 3GBWA 3BMXA 3EPPA 3OQNA 4F5ZA 3K6SB 4RMGA 3P7MA 2ZA9A 2V9ZA 1JFTA 5AM1A 4DG9A 3ZXSA 1E77A 3B9BA 2FPOA 3HO6A 3WIEA 2DKOA 1XTTA 1K7CA 3KXKA 1AR82 1GVHA 4O4JB 3P45A 5EC8A 4AVAA 3TMKA 2ZXQA 2OAP1 4CCYA 5KJEA 4W1SA 3NANA 2P7HA 2VK2A 4FUQA 4JJ4A 4OQEA 5JXWA 3VZKA 3GR6A 4P5HA 4HYQA 3RV3A 2YWBA 4H1UA 4YUWA 4MKRA 4AVVA 5CH8A 4WL0A 3H3UA 2IS2A 3O73A 5GJ6A 4B8YA 4IEVA 5TEVA 1NF9A 1JR6A 2QE7A 4TM7A 4GH4C 3NAMA 2MSLA 3D6HA 5JCJA 2QXUA 3RUHA 2G07A 4KX5A 3ZHBA 1S0BA 3EMVA 1V6IA 4GFDA 1QEXA 5CLIA 4KWKA 3TAYA 2CMFA 1WUTA 3N8NA 4ZEVA 4ATNA 1XKXA 5JZGB 2QRJA 5K8IA 1OHFA 2KQUA 3T0BA 3HYLA 3PX2A 3T5CA 3D8BA 4XF3A 4MXWB 1C0KA 3VHQA 1OBNA 1W25A 4G1BA 3GPDG 4OQNA 1XP5A 2OORC 1VL0A 3I34X 2PAFA 3H7AA 4JHZA 5EQUA 3ZD8A 2JFYA 4MS3A 4DR5B 5A3TA 3KD2A 4XAAA 1Z34A 5E8RA 3S8YA 2VZ9A 1XKTA 4XE5A 2X4LA 1T2CA 1EG2A 2Z56A 2DBVO 2E33A 3MJDA 3OWXA 4OHPA 5A4JA 3QE0A 3H84A 4F8JA 4RTOA 4RMNA 3WNLA 1VRH3 3U7QA 3W4JA 3M1LA 2ZRAA 3CBGA 1TAUA 3ZD7A 3AR8A 5TQ0A 1VP6A 4DPKA 1AR71 1VBA1 1DWUA 1S2KA 4HQFA 4KRFA 5E9WA 1SOVA 3GT3A 1B00A 3KYDB 4B3GA 3T30A 3KV4A 3HV0A 1O7FA 4NG4A 3DPRC 4XPVA 3UAOA 1KVSA 3AL0C 3MLKA 1BX0A 4K0KB 2XR1A 3H97A 1K97A 2XLCA 1GFWA 3PWKA 2G77B 5A7HA 3UKVA 4QPWA 1LZLA 2BRUC 1NQWA 3KL2A 2VP2A 4E3WA 4O4LA 3GYDA 1EH5A 2WJAA 4PANA 4LBQB 3QELB 1RPNA 2PGDA 1SG6A 1XVIA 2O3QA 3IT0A 1MS1A 1V6NA 3HFJA 4QAJA 1E1QD 1XTUA 3BPSA 1DRUA 1T6XA 3NYQA 4HDMB 3OZ7A 1SXHA 3STXA 1DQ0A 4I55A 4J6FA 5AJTA 4K26A 5G3YA 1VI6A 4QGNA 2FR1A 2DCJA 2YWGA 3ZPXA 4K9PA 4CHTA 1I33A 4II7A 5ANRB 2Y1XA 2H1CA 4Y20A 2Q4BA 1J09A 1R0CA 4OQMA 2UXCB 4LYYA 1N7IA 1RJDA 3AHCA 1RC0A 3GEIA 4QSMA 3LBFA 4L85A 5CPFA 4LMAA 4MWSA 4FFBB 1Y8RB 5A33B 4L22A 1F6WA 1L9XA 1HK7A 2QCSB 1H9CA 3O91A 1VCOA 1M6NA 1JHVA 4YGYA 4QDXA 1VLHA 1QFXA 4IEUA 2PUGA 3ZN5A 2DMRA 5A1LA 4BB3A 4G81A 2HT1A 2PVSA 3LEGA 2P11A 4I8XA 4XJTA 5MDHA 2BONA 4TN1A 1DIHA 2FWPA 4H7PA 5F1RA 5A0VA 3GAMA 3KALA 5BUQA 1KMIY 4OMCA 2O0OA 2YN2A 1JZ3A 1L7VC 2VCEA 1UMKA 2WZR1 4AQDA 3MIDA 2C83A 3M6MD 3S5UA 1MDBA 4UATA 4DMHA 1TYAE 2PPVA 1DIOB 1J3PA 3JWHA 3QX3A 2CLLB 5K0UA 1EFAA 3QOXA 4DINB 1CW2B 5HP4A 4C6TB 2IUWA 1TA4A 4A2PA 1E7SA 2UU9B 4IDHA 4CQMB 4AG6A 1K8YB 4YUAA 1PIV3 2BHTA 4HGNA 4BYYA 3PYLA 3ZFGA 1JI6A 4L6CA 5T7BA 1TVCA 2GN1A 1WXWA 3GD5A 5B7PA 3VKWA 4F2HA 2PXCA 1BD3A 4I2OA 2JASA 3NW9A 2C7VA 1CR6A 4EYOA 4H3WA 3QH4A 3DFMA 3H2YA 2RG7A 3L07A 2K7ZA 2F90A 1KI3A 2X9LA 4FQ5A 5KNBA 1F5SA 2W00A 3NM6B 1Z6TA 1JF8A 3TQFA 2DAPA 5FTMA 1HXS3 2D93A 3SC7X 1XNBA 4ROTA 2ENUA 1QXRA 3BMCA 3HHEA 3EQZA 5IULC 1C29B 1NYLA 1W6RA 4C21A 3NV1A 1T36B 2V54A 1E64A 1T2FA 3ITKA 3ZIWA 1PZMA 3LBHA 1WV0A 4L5IA 3X0DA 5E16A 3O3CA 3UA3A 3T9FA 4DABA 1AKTA 3PDQA 1MNQA 3UT0A 2IL1A 5F7UA 1K6MA 3DMYA 3IKMB 1A5AB 1DEOA 1Q8VA 1I30A 4MWOA 1JJAA 1E99A 1Z8DA 1RQPA 3V4PB 4PRYA 4ER7A 3NTLA 4RNDB 2ZIUB 2AEJA 3Q12A 4BRUA 3L6EA 3H8WA 4KE7A 3RODA 2ZWIA 2Y3IA 1XMJA 4HDKA 3MJFA 1OH8A 1QF6A 5D3KA 2D7FA 1SBZA 1RZUA 4BGEA 2WG2A 2NQTA 2AMFA 2EVXA 2FPRA 3VYWA 4F4UA 3JQPA 1XJAA 2G25A 3ZFEC 1VXRA 3KQRA 2ZT7A 4Q0QA 2IUFA 2ZW9A 1QKJA 4FOLA 4CR6A 1PCXA 3J7AC 2X3YA 4RGKA 4QYWA 5IAAA 3K8OE 2Q1XA 1UYPA 1EEXB 1SDDB 2BSXA 3LUJA 4YFWA 3SC6A 1TU0A 1OT3A 4NY1A 2OLEA 2JIDA 1CEXA 4QO8A 1RFLA 1UZUA 3CB4A 2VZQA 3KE8A 3VBCA 4CE8A 1N5KA 5G2OA 5B1YA 5KSZA 6REQB 1SQFA 2RSLA 3BIFA 1WZEA 2EKPA 1ZZ8A 4W99A 3TLGA 4B7XA 2HBYA 2IYOA 5F2OA 1LJ7A 3KGLA 3UGQA 4ERNA 3ZWDA 2Y1GA 1JAIA 4A0SA 1BS1A 3G0CA 1VYUA 1ORWA 4MGIR 4WNAA 3FBWA 4XM0A 4BE4A 1M6WA 4M88A 3L0OA 3R3JA 5CFMA 5ESDA 1W6MB 5DXJA 1DX4A 1NLMA 1V41E 3AYDA 1JMYA 2OZJA 3E18A 3L82B 4WBNF 1TVMA 5CLGA 1SK8A 2I67A 1UZNA 3AF2A 5L3RA 4PLHA 2YFHA 1PMHX 4CDXA 3RAGA 2WYVA 2XCOA 4ISCA 1BMDA 5CVJA 1BGVA 3LLUA 4CM8A 3E5UA 1CY7A 4QTXA 3ISTA 1K6JA 4OSOA 1SKYB 3UCEA 1Q8QA 4KEAA 4JZYA 4Z82A 2J59A 2EEPA 5LB2A 3U61B 5T50A 4X0EA 1ZGGA 1FUYB 3STYA 1YQQA 3D3WA 3HXKA 4CDMA 3LFUA 2ZRBA 2FETA 2OYSA 4Q7QA 2Q5QA 4P4SB 1RMTA 3T7RA 1DJPA 4UBIA 3IXLA 1XVLA 5IU6A 2BBAA 4FONA 1U7PA 2YIVX 2H08A 4XLZA 4ZOLF 1M1YB 4KPGA 2PMBA 5I7WA 2W3JA 4K6KA 1J7KA 4FZ5A 4ARZA 1EPWA 1NVVR 1MQTB 3LHKA 2I1WA 4XQ0A 3X1YA 3ZG6A 3C48A 4HWSA 2QL6A 1TMOA 1KERA 3A4YA 3IO3A 4GVXA 3G7NA 2JLXA 2GSDA 2GVNA 1K92A 2WTMA 4D4KA 5AUPB 1R9NA 4R01A 2CNDA 3OICA 3SXUA 4URWR 3S7TA 4WNCA 5FPUA 1PNFA 4JXKA 4EO4A 1SUDA 3N2EA 2QGZA 4I66A 3DUFA 1KWGA 4COUA 3S8EA 3QEAZ 3V7FA 2V03A 4YW2A 3D7KA 1JALA 1AMUA 4A7YA 3E7DA 1LGCA 4HQ6A 5HRAA 1NZIA 4IV3A 1E6MA 2CUTA 3ASIA 1E9FA 3QYJA 3P20A 4YJGB 3G5MA 3UK7A 3COWA 2DDUA 3LLCA 3CNQS 5AOBA 2GBCA 2B6HA 4KLNA 4DUWA 1TVKA 2WWXA 2KYRA 1GAJA 2H1FA 1A3CA 2VRCD 2L9LA 1GQPA 2I78A 3UVEA 1JKFA 5FP9A 3V64A 1Z35A 2NX2A 3B6JA 1YQGA 4HDAA 1VHQA 1CAXA 4AZ0B 4RR3C 3Q87B 4F4JA 2GAOA 3ILHA 2H2WA 2OBLA 2BTQA 1QP4A 3EZNA 4A7KA 4D9MA 1QTRA 1CUGA 3PNKA 1Z45A 2IXDA 1U90A 1QQTA 3NIDB 1MFZA 4I9HA 3QEBZ 4Y4YA 4BWGA 2YC4A 2VJYA 2Z1MA 5TPZA 3WP6A 2BEWB 1MABB 2WJHA 1C1FA 1MF7A 2JE7A 1HUQA 2VT7A 3MSCA 1H0SA 3NDPA 2VCBA 5DX0A 1HKUA 2RAVA 4G3XA 4RX1A 1BH2A 5LQJA 1DGRA 3OZIA 3NKFA 1T1GA 4DKJA 3R3YA 2IPOA 3D8SA 1F06A 4C3VA 1W0JA 3LUGA 4DRYA 2ZGLA 3DL7A 3VUFA 3AB0A 1LLUA 1JH9A 4BXOB 5AUNB 1NW8A 4RETA 2CNLA 1S9DA 2ADFA 4UEOA 3PXGA 2O1QA 4KAAA 2GFHA 1DCKA 3ZWXA 3S7ZA 1E1DA 3OJXA 1VIMA 4UM8B 5ELMA 4MCAA 2YC2A 5LR6A 4KR6A 4QU8A 2CFSA 1C5IA 2W6NA 3ETEA 1NYWA 2WTUA 1W47A 1VECA 3DTVA 3BKZA 3CXUA 1DQ4A 4MS1B 3GA7A 3DVAA 2GJ8A 3VNQA 4AI8A 1VG1A 1QU2A 1ES9A 3ZW7A 1Y37A 4CQLB 3T35A 2H1OA 1YFXA 4UDYX 2XWPA 1I01A 5HCFA 2AENA 3CH6A 1A50B 2BDTA 1Z0AA 3IUBA 1JYCA 3BCSA 1T9GS 4XYMA 3DGFC 3FE2A 1Y7PA 5H4GA 3ZV3A 2I7XA 1PZHA 3K30A 3OIWA 1R091 2D8MA 5JSQA 3ME5A 2X15A 4BGVA 3O8BA 1PYDA 4AECA 2UURA 2QQWA 1R9MA 1KYQA 1HOXA 4A8JB 3PUJA 2WL1A 2DVDA 4DUGD 4L0QA 4Y9SA 3K3NA 2HMUA 3CCCA 1LRJA 1JIVA 3GWGA 3TL6A 3UPUA 4CKBB 4G09A 1DQYA 4PYNA 4IIDA 4G5GA 3NOOA 4OL9A 3T7JA 2MEV3 2P69A 4W8OA 4XR4A 5JJIA 2RCYA 4AFMA 4FFFA 1RZRA 2F55A 3NCHA 4FAGA 3LPLA 1YFJA 1I4LD 1M76A 2Z0MA 4M0NA 2A0YA 5FKCA 1B8OA 2FUCA 4BKMA 3KZXA 4JVLA 2BEVB 2FEMA 5EWLB 4HJRA 1VBMA 2BP7A 1XN4A 5HTOA 3PVEA 2BZ0A 3KJFA 1GNHA 4GH5A 4MW1A 4CLOA 4RELA 4RLHA 2FVYA 4QREA 2ASEA 2R86A 3G2PA 2F4LA 4COVA 4RTKA 3WY9A 1TC2A 2PHXA 5LPNA 2Y99A 2IP1A 2HJSA 2Z79A 3OLCX 4HBNA 2COEA 4W6ZA 2WAMA 5AUQA 1H6BA 2PPLA 1PGL2 1TIKA 2BFMA 3EGOA 4D02A 1RHJA 4QPDA 3EVTA 3WLAA 4WK6A 2WINI 3L0SA 1Z2DA 5EXPA 2EKQA 1HDYA 2JJ2A 3H5WA 2GMPA 3T5GA 1WCKA 3J8F1 3S2YA 3INAA 1Q8PA 3JALB 4HR7A 3VBHB 2LP4Y 4LDRA 3PJEA 4U02A 4RVSA 4I1YA 2FA9A 4P0TA 2PR2A 4R0VA 3QF4A 2JLBA 5C37A 4LFCB 4OFGA 3AYAA 5AKZA 3SBXA 4L5BA 1Y81A 4K28A 2G88A 3MGUA 1B0AA 2VWHA 3TLZA 3FDFA 4BMPB 1ZU4A 5CIQA 4PYLA 3U1XA 5FXXA 1M8KA 5TMDA 4G24A 2A35A 3EAFA 1O3TA 4NEHB 1JZSA 2OB2A 4FMPA 1YU9A 2WNEA 3H3JA 4BNGA 1SQ4A 1E9EA 2JF0A 1JBEA 1WQ1R 5KHKA 4Q5IA 4XM1A 1P7PA 2NPIA 2ATFA 1PNGA 2CTVA 1E3LA 2DLDA 3QYAA 3VDBA 1PR5A 4B5LA 2CLCX 2AFIA 5JNRA 1RBZA 4RL7A 3RYTC 5ISLA 5BWLA 1QNYA 2RH9B 1OF1A 1J90A 2BFBA 2IU0A 1DMRA 1K89A 2OZEA 3AP7A 1K9VF 5K4HA 4ZCPA 4XIYA 4BATA 1SIWA 5T5LA 2Z4FA 3RDIA 1NMZA 3ZMOA 1ZR2A 3BYWA 1L7DA 1P9NA 1M7HA 2RHWA 4DMGA 1S1CA 2OQ2A 1II0A 1CVIA 2GLXA 3OCXA 4WK4B 4B7EA 2GZ1A 4UTOA 1SPPA 3FYUC 4UHBA 3PRYA 1VGQA 16PKA 2RDSA 4F9GA 5F76A 1O54A 1CEQA 1EXWA 3AHFA 1QQ5A 4UVHA 4QDSA 1AKRA 1IWOA 5CGQB 4B3RB 5FJKA 2VG9A 2COKA 2QTZA 1HN1A 3WRXA 3TB0A 1OU4A 2QJVA 2PTGA 1K7YA 4MTCA 2G76A 4CL3A 3ZKWA 4KWJA 1E4EB 3KVRA 1KYWA 2X1MA 4P9YA 5TQ2B 5F5CA 5JQGA 3NAGA 1O6BA 3FDJA 1SPXA 4UBKA 5DCLA 4DV4B 2DU8A 3EIQA 1HQKA 4KQXA 2VYVD 3ES9A 4NHYA 4NRDA 4F83A 2DPHA 5DSXA 4EPYA 1PR2A 3U4IA 2YH2A 4DA6A 5KKNB 1YFLA 1E2MA 4L4SA 1XTBA 1E3EA 3OAAA 3WAJA 1LFAA 2BBWA 4WJLA 1FOEB 1NQAO 4RK0A 4C4PA 4Y6RA 3QUCA 3WVJA 5EIOA 4EG8A 3SEQA 5FI1B 1JYWA 2FPIB 4LHSA 3O0DA 5E1DA 3VI4B 2O9JA 2G5GX 4NH0A 3RRNA 3V5NA 4BLVA 4WBNA 4ETIA 3T5BA 1DKOA 4KH0A 4F9FA 4DDKA 5BPXA 4R2XA 3AU9A 3SF0A 4EGAA 1UYZA 2JCSA 2QRMA 4F7ZA 2GKSA 4N90A 3BX1A 3EVGA 1MU0A 4DJJA 3RVBA 3TZCA 1JWAB 2XVLA 5GAJA 2GPSA 3MWDB 5CDGA 5EQJB 2FN7A 1BHO1 3R9KA 4BJ6A 1ADBA 2H2FA 4TYSA 4Q9LA 3ZI4A 3IHWA 2XWQA 3QOFA 3E48A 1UOOA 1TW3A 4R68A 3RO7A 1DJOA 1NWHA 3OF3A 2CL6X 2O8VA 3EGXA 4MYUA 4YJHA 4N53C 1Y80A 1U0NA 5JZGC 3NV7A 2J1RA 1JFFA 4PJYA 2M1XA 3LJKA 1YR1A 2ECFA 1MEOA 3UPTA 1OA0A 4L7QA 3KM5A 3TOXA 1AO3A 4DEQA 3Q72A 5CHEA 4QGBA 4LYAA 1W9WA 4ZOLA 1WCSA 3BTZA 4MWGA 3ED5A 3UNPA 2Z69A 1PWZA 5AICA 4X61A 3WBBA 2ZUCA 4XDZA 2DCTA 3D4LA 1IHPA 2EW8A 3OF2A 4GB31 4JVAA 3T0AA 4IFIA 1KVRA 1X1SA 5IANA 1N3YA 3E61A 3QSGA 1JDPA 3N2ZB 2OHFA 5B6IA 4MMXB 4C4ZA 4MR7A 3RU3A 3G17A 1G8MA 1UDXA 2WF7A 3LO5A 3R09A 4X6YA 5FNZA 4DVJA 5C53B 3O1SA 5LDDC 4X54A 3KOUA 1D8AA 4ZQHA 3IP1A 3MMSA 4D56A 4LOLA 1L7RA 2Z2IA 1R9JA 3WP1B 3LD9A 3H6HA 2ZULA 4YRJA 5EOVA 4BO4A 4EG7A 3UJOA 1W6PB 2X2OA 4MHOA 2FW7A 3VJLA 4EY6A 4FSHA 3MD0A 3OEBA 3CLVA 5B3JC 2V5YA 4XD7A 1TT5A 3PBKA 3U5ZB 1O94D 3V0AB 4ZCRA 4YZ5A 5TQVA 3DOJA 5EIYB 4R3WA 2W0MA 3PNQA 3DMTC 3BAZA 3WYCA 4QU9A 1Z62A 2B7LA 1T24A 4XAEA 4K3VA 4Q7JB 5IVJA 5CDFA 3M1HA 3VO2A 4F0JA 3V8EA 4HSEA 2FTKE 1ZM3A 4ZVSA 4JBYA 1LW6E 4KDCA 1MO4A 2R68A 3ENQA 3B5EA 2DFTA 2BDUA 4Y6SA 2B4KA 2VPPA 1W28A 2PHFA 2Q1ZB 2FZ5A 4G5XA 1D7AA 2AN4A 1ULGA 1RM5A 2H5EA 1Z7EA 1UF2C 2AJLI 1FFSA 4PT6A 4LMPA 2WF5A 1D2QA 2FWRA 4TM8A 1DXYA 1CC1S 1GQOA 2JGAA 1TLLA 2ATVA 1WWYA 4O6VA 4XUCA 4O2BF 3VU0A 3BB4A 3RVOA 2PO7A 5WRFA 1VSVA 4MQEB 3OKPA 2QDKA 3WYGA 1V6LA 3KGZA 4WEQA 5FHQA 1E0SA 1ZD3A 1Y48E 2KS6A 3M3HA 1EP9A 4ZOQI 1C2TA 4CLRB 1K06A 2P3SA 1Z16A 3M82A 1BQEA 4KLAA 2YW9A 1VKRA 4R16A 2XRFA 5A6XA 1B3RA 3BG5A 1EK2A 4OX9B 1OYOA 5D8AA 5FLJA 2XVAA 2DR2A 2TS1A 3HDHA 5FY8A 4AI1A 3O6VA 2PJRA 1MQ8B 2ZPUA 5C5UA 4CEWC 2NU9B 3W5AA 4LOIA 3BWBA 1GL7A 1OXXK 5FR2A 1Y5LA 2LD4A 1IMOA 1SUFA 1ZNWA 2DURA 5FO7B 1OLSB 3RI9A 3STWA 5F5NA 4G0ZA 4LNHA 1ULAA 5FZHA 3WP4A 2UZ3A 4LQ4A 1UU6A 3HB4X 4PYKA 2JGJA 1TGYA 4LF4B 1UFVA 2J1LA 4AY4A 2P9YA 4AU1A 3A6DA 2JCBA 4LQDA 5JG7A 4HGRA 3N53A 4ZOAA 3DQZA 5I45A 3NJRA 2QBYA 4LXXA 4N8EA 4XVQA 5NLLA 2JDMA 2QI9C 2C92A 2CY6A 1BJKA 4QGAA 1ZJ6A 1NV8A 5GONB 1STOA 2Q5HA 3FMIA 3HDVA 2LKDA 3IT3A 4EKDA 1A9RA 3D4BA 4YVSB 1EWQA 4J3FA 1SBYA 4KXWA 3ZDDA 4AFAA 2G70A 2ZVPX 4MW2A 1WXFA 1KEZA 1V8PA 3PDCA 2ADMA 4YNIA 1W19A 2DULA 1UPBA 1EDBA 3EZGA 3GNTA 2WO3A 1XAGA 3L0PA 5B30A 3CZAA 4P3OA 5IABA 3RRZA 1V7CA 2QQGA 1QHHB 3RI3A 4B17A 3Q41A 3DLAA 1YS7A 1KQRA 4DLSA 3RSOA 2IXFA 4AZ3A 4FKZA 2O2XA 4N76A 1V43A 4ZVKA 4WNYA 1W8TA 2IUSA 3NTOA 4M0KA 1ZYUA 3GGPA 5LYJA 1C80A 3QPDA 3LUAA 3GK3A 1GQSA 2OZKA 1XNRB 3SYMA 4GXTA 4BNXA 3VOSA 4ODIA 5E7QA 2CF5A 5HQTA 4BEJA 4L3VA 1JEYB 3POWA 3WMWA 3V3KA 2XRYA 4B0OA 1ICEA 3ZNPA 1EUUA 5T3UA 5C1PA 1EX7A 2WKQA 1CAVB 3FJYA 4QQPA 1POWA 4MDFA 2O2ZA 1ZKDA 3F67A 4XDQA 4KSBA 4INZA 5HKLA 3CVXA 4JUCA 3GYGA 4JSRA 4OEHA 5A7PA 2NU6A 2E0IA 2FPGA 4UZSA 5FY4A 4IG9A 4IXNA 1WU7A 4AB1A 3FM9A 1AQUA 5B7QA 4AUKA 2Q41A 1G86A 2FZGA 1TPZA 4DMKA 4F2GA 4HPKB 4HNAA 2QXTA 3K3PA 3V8PA 3PEUA 1IQPA 1U6KA 4DIBA 2YVUA 1VYHA 4E3ZA 2YDYA 2HYXA 3IX7A 4LJ9A 3DKWA 2ZVJA 5JI2E 5I4BA 2W2OA 5IK7A 3ZFEB 1X86B 5DISB 3PVZA 1L5OA 1N3OA 4FWBA 4G23A 1M33A 1WB6A 3P9SA 1GP2A 5D6OA 5KOJA 3CJQA 4UHDA 3T2QA 4QPGC 3B3QA 2NVOA 4KREA 1QYVA 4P9XA 1I3NA 4TV8B 4DR7B 1UKCA 1IBCA 2HPAA 1L8AA 3LQ2A 2K46A 2VTDA 3NHLA 3M2PA 2MCFA 2OKGA 2RS52 2VUSA 4ZV4A 4XEHA 1M8JA 3M2TA 3R3UA 1QHGA 1RXCA 3DP7A 4RVDA 4D9FA 4MCIA 2PHLA 4FOSA 1GAQA 5IT9A 5AFSA 1EIZA 3ZBUA 3CT6A 4R98A 1XMSA 1PNVA 4D8TA 4DQKA 5AP9A 3R0JA 4LNVA 5J37A 1WBLA 2JE8A 1I7SB 4FOPA 1UPAA 5DB4A 3NAPA 2XKBA 3JD4A 4ZHSA 4M1EA 1H65A 1TRHA 4PTLA 4HSLA 2FP4B 4EY3A 4CE6A 4MCJA 3TZLA 1J2EA 3H1GA 4Q3NA 2DHRA 1AR61 3NNFA 1YQEA 3BOWA 2VTBB 5K01A 3KQUA 2XPJA 4BO0A 4QA9A 4GJYA 2FQQA 5HFAA 1P6XA 3P9QA 2G5TA 4JZKA 1B42A 2RS53 2PKEA 5BVHA 1V6KA 4R8MA 4FPGA 3ANYB 1OMIA 1UXXX 4EVRA 4I4LA 1MQTC 3NKLA 4QWMA 2PL1A 2QLBA 5KSYA 1TZBA 3IVXA 2QLJA 2FX5A 1LU1A 3JU3A 1U3WA 4W50A 2NYVA 5GWXA 4IIJF 1LJ8A 4FTBA 2Q4RA 2BBTA 4IYRA 5BNNC 4WADA 3S2UA 2I2WA 3PURA 1O4ZA 1ZHFA 4TQAA 3Q8FA 5FQNA 3FN4A 4WERA 1G7CA 3FFZA 1NBMA 3FOWA 4QUDA 4EKYA 5CK4A 1FFGA 3R2JA 4HS9A 2ZSEA 2VZRA 1UOPA 2J7PD 2FEKA 3SCFA 1C7IA 4QX0A 3P2OA 3MUFA 5L53A 1KMHB 3A6GA 2IIVA 5JAOA 1LHNA 3K75B 1WCWA 4IO0A 2UZ1A 3P26A 4IV0A 1E2BA 4DBLC 3LY7A 3VC1A 3LA7A 4PZ0A 2DR0A 2PZ8A 1WLTA 4DY3A 4A45A 3SZRA 4UHEA 2JI7A 3DKPA 3WLLA 2OUIA 2JH3A 1Z33A 1I51A 3NJVA 2P4UA 4RQPA 2IQ5A 2I55A 1NQOA 4OHYA 2FWIA 3R24A 3OE7A 5H82A 3P52A 3D5OA 1JP7A 1LJLA 1DU4A 1H3FA 3UKOA 2WFLB 2VZ3A 2JFFA 5B57C 3E82A 5DLQC 4XQEA 1KHTA 3PXAA 1ONNA 1UMHA 4URFA 4MCHA 2BCGY 2IUTA 2O19A 4FPHA 2Q0SA 4R2KA 2HLNA 5CG2A 2VHVA 2A5LA 3VPSA 3T9CA 2HZ7A 3AP4A 3PWSA 3BFXA 2R8BA 1BEZA 3CUWA 3ZE0B 1UBMS 1WW2A 2B1QA 1PQYA 1RMU3 4I0WB 4YASA 4EFLA 3QWFA 3KT8A 3PKIA 3T61A 1HRKA 4CQMD 2GYVA 5AKKA 3KNZA 2G1JA 4TS4A 4PTZA 2HDHA 1KEPA 4M1TA 4Q1DA 3DDUA 4NWIA 1EUDA 2NXNA 3LGSA 4QPYA 3QLJA 2DHEA 2GEFA 2YMZA 3T4XA 3W6UA 4L4RA 2JK1A 4TSVA 4XYEA 3W21A 3L84A 1YZHA 2C4KA 5EP1A 1OFUX 2A5ZA 2P9EA 5E1RA 4FYIA 1Z6ZA 4BQ3A 5F52A 2RD2A 3PE3A 3R7NA 3FPSA 5ANNA 4QVGA 4QPZA 2VT2A 4J9UE 1IIBA 2X9VA 5DLYA 4R4ZA 5BW4A 3TEZA 1QZZA 3ZVLA 5D3MB 1S9HA 3OJOA 4A8JC 4LJAA 1EYBA 4IW3A 1NP6A 2DPLA 2GA8A 2VJKA 1RWMA 4O2BA 3I76A 4D94A 2HBUA 1F2NA 2EJUA 3BKWA 2QZ9A 3T0IA 1X1RA 2J42A 1UM9A 3WV5A 2JAQA 5HS6A 3EUWA 5FR1A 4GEGA 3DC7A 1J0EA 5JO9A 4MB6A 5AVRA 3PR2B 1VRH1 1OD6A 1V1RB 3QMVA 2TUNA 3ZYRA 2BUBA 4FE3A 4EB3A 3VDXA 4CIAA 4X8MA 3GJ3A 4BRWA 1IHUA 1X9HA 2IEAA 3DBHA 5CJPA 1FX0A 2C7OA 3M3EA 1AX9A 4N5NA 3L5OA 5G0SA 4XJXA 5AFEA 4HWOA 5L9BA 4CGYA 1HL7A 4UUAA 2CFOA 4TMVA 1KK2A 4WCVA 1Q1GA 2D4AA 1LB1B 1XSRA 2VPIA 1I2CA 5ALKA 3BWDD 3K46A 4Y30A 1SVNA 1MKYA 2D5LA 5AK5A 4B4RA 4O9GA 2IT1A 5IKEA 5BT9A 1P3JA 1JHZA 1YLLA 1HNXB 2H1RA 4MGQA 4FN5A 3KUDA 4FHCA 3DC2A 4F6RA 1E92A 1HLFA 4Y5TA 1OXVA 2HUPA 2WF9A 1QH6A 4ZA2A 2ZJYA 1T5LA 3VBHC 3QD6A 5IK2D 1OOEA 1JYVA 5KB3A 2AE2A 2AC7A 4D7YA 5K3EA 3ZJ5A 1E1NA 2ZSDA 4NBVA 2V7EA 5AC91 1W8DA 4B3SB 2C2BA 4C7KA 4Y22A 1EDOA 2CFIA 4RLQA 2XD4A 4WZBA 4UUBA 4TMKA 2YNMC 5IM4A 3KLBA 3R05A 3IE2A 4JGZA 1YR8A 1KDZA 2ZDHA 3IELA 5DTEA 4LIPD 5FYMA 1DARA 1WP4A 2QUHA 2XTJA 3C8XA 5EXSA 1H6DA 4G4SO 2P8JA 5DRTA 1LRHA 2QE3A 3O0WA 4GE3A 4EOGA 1IKPA 4L8WB 3QVVA 5BV0A 1PL0A 2ZSAA 5G3ZA 3V4VB 3K0CA 1P2TA 4GKAA 3CRMA 2CNAA 1BXGB 3IDAA 3SBOA 3VBEA 3FWZA 5JDIA 5I7HA 1ZWKA 4PM4A 5LZ7A 4QYTA 2W2PA 3ZW9A 4X60A 3T15A 3U3ZA 3C3JA 3K0FA 4NZZA 1GYKA 4WM8C 4JLVA 3S57A 9LDBA 4DSZA 4KN5A 2VOTA 2CFCA 2JBAB 4U4AA 1UDWA 4CUJA 3JQQA 3AVSA 1P6QA 2QD1A 1RRKA 3FBTA 1PK6B 5A6ZA 1UQUA 3Q2IA 3THXA 2JLSA 4FPXA 3GLIA 3VKOA 1F3LA 1PIV1 2BM8A 3TRHA 4EN6B 2NZYA 3GNLA 4TMXA 1JB1A 1YDMA 1MP0A 2XQVA 5IVHA 1KJWA 3WP0A 2WTEA 1JIQA 1NZJA 4JP3A 2O8EA 1VIAA 2ADDA 4INPA 2HMWA 1QP0A 3VI3B 1GOTA 2OS2A 4WESB 4MV3A 1C30B 1ZZGA 2ET7A 3WHLA 3GZNB 1XYOA 2AD5A 1NVAA 1TC1A 3SH4A 4XQDA 1IJBA 4IZ6A 4X20B 1R00A 2IDZA 1Q1AA 4RY2A 4HGQA 2W6ID 2XJVA 1X7GA 4PC6A 3ZQ4A 1TQ2A 3FYUB 1SH7A 1ZBE1 1CRWG 1X74A 4H4EA 2QR3A 3JPYA 1HXS1 4U7PB 2AQIA 2MYUA 4CYMA 1FPN3 2DQ4A 1DZQA 1QO9A 1DAGA 5K6AA 4HRXA 1XZMA 4IETA 1S2IA 4ZVQA 1N2BA 2HU8A 1M1NB 2EJCA 4M9XA 3C5WP 3MGCA 4PYQA 3OZEA 1OWNA 1ML3A 1M0SA 4NR0A 1H05A 2VCMA 5EJ1B 4UDNA 2OD7A 2XUMA 1PDWA 4GSYA 3R4UA 4G4GA 3C98A 5IKPA 1UBOS 1QOZA 5BYBA 4B81A 3DO5A 3ADOA 3WQQA 1SFYA 3TXAA 1MB3A 1VZ2A 4N3GA 2WNSA 3I2HA 4Q3DA 4FR0A 1GU0A 4KNYA 4FFIA 4WCDA 4RJLA 1PJQA 2HIHA 2XUPA 3WQSB 1SIOA 3QU7A 5LLSA 1Q21A 1J25A 1XPJA 1T3TA 5TY0A 1V6JA 1SPBS 1MIHA 2BMJA 5HMLA 1L5MA 4AF7A 2VNJA 5CNKA 4JUAA 2Y6JA 3A2MA 3L04A 1CZLA 1KMMA