4UW4A

Human galectin-7 in complex with a galactose based dendron d2-1.
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
133
structure length
133
Chain Sequence
VPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVRIF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GALECTIN-7
publication title Structural Basis of Multivalent Galactose-Based Dendrimer Recognition by Human Galectin-7.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Sugar binding protein
total genus 30
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4uw4A00
3Q9OA 2WQZC 4SLIA 2NP0A 1CVNA 4Y1XA 3A4UA 3AZWA 3NV3A 5KXDA 4Y24A 3ATGA 1MS3A 5FRAA 1QKQA 1KQRA 1MVEA 1N3OA 1G9AA 2D7FA 5IK4A 3IN9A 4Q2FA 1DQ6A 2YV8A 5HCBA 3AP6A 1GZWA 1LGBA 2DVBA 2A71A 3LCPA 1N1VA 3PVOA 3FFZA 2NZ9A 1WW7A 3N3HA 4UW3A 1IS3A 4Y22B 2JE9A 5E89A 5KXCA 4K21A 4DRRA 3AZVA 4FPOB 4YG3A 2NMOA 2VW0A 2A6XA 4C1XA 1QOSA 2GMEA 4XILA 2ARBA 1CESA 1V6KA 3VKNA 1MS5A 1W6PB 3D4KA 1HKDA 3D6EA 4P9YA 4ASMB 3OPZA 2EXIA 1BXHA 3RS6A 4AYUA 4YM1A 1ULDA 2DYCA 2JDZA 3ZSJA 4BOWA 1SBFA 4M3CF 1SLLA 1W6QB 2EAKA 3IM0A 4XJZA 1SCRA 4YGBA 1Q8QA 5JOYA 2D6NA 3LSDA 2ZHLA 2UWCA 4XDQA 1D2SA 4FPFA 1QGLA 2ZGLA 2UU8A 1DYPA 3V64A 1AX1A 1WW6A 4YFWA 2WSVA 3FUQA 5DUUA 1AXZA 3OYWB 1LOFA 1W6OB 1MS9A 2YXSA 4Q1PA 5T5OA 1KJLA 5GLTA 4UW5A 5H9PA 2P34A 4LBLA 3FLPA 3GNEA 1QDCA 3TB0A 4Z8BA 1JOJA 1U0AA 2VU9A 2WT2A 5T5LA 4LBKA 3M3QA 1HLCA 4YW1A 1N3PA 1SBEA 1C1LA 1GZ9A 4AVVA 3AZXA 1Y7BA 4BLIA 1Q8SA 4GALA 4OZXA 4PF5A 2VW1A 1LOFC 1J1TA 2JE7A 2V5YA 2W68A 3ZYPA 2D3PA 2W52A 3BOPA 4D69A 1G9FA 2EALA 1LHNA 4U2AA 5EWSA 5H9SA 3M1HA 3V0AB 1VLNA 4M3CE 1QNWA 1LEMA 1LOAA 3I8TA 1URXA 4YLZA 3USUB 3ZYRA 1GKBA 3O12A 1YI7A 4M00A 3WDXA 1OFSA 4Y1ZA 1FV3A 5CBLA 3WDYA 3WG3A 2BQPA 2ZGQA 3ASIA 1ENQA 4LBOA 4ZXKA 2OVUA 4WVWA 4M3CB 1GBGA 2CWMA 4CTEA 3R4SA 1UMZA 5IUQA 2VH9A 1MS0A 1HQWA 1N1TA 2CNAA 4TYSA 2D6LX 4BQ1A 3B00A 1CPNA 1SLCA 3SH5A 1LOEA 1QOTA 4FOQA 1ENSA 5GZDA 1H30A 3ZSKA 2I2SA 5GLWA 2E53A 2ZMLA 3OJBA 2PHXA 1WD3A 3QLQA 2CY6A 1TEIA 3M2MA 5GZCA 3V0BA 2W08A 2A3WA 1Q56A 1YYNA 4MYEA 3MW4A 3UJQA 4AVTA 4YFZA 2UWAA 5JOWA 1LODA 1VIWB 2JD4A 4GWNA 2YMZA 1QU0A 1XQNA 2P3JA 2ZGNA 4PQ9A 4ATFA 1FX5A 1O4ZA 1S1AA 3WVJA 5EYYA 3WG2A 1O4YA 2ARXA 1DYKA 4I30A 4Q8KA 2ZACA 1WW4A 3WG4A 1V6IA 3AP4A 3N7JA 1W6NA 5GZEA 1Q8PA 3UK9A 5CAZA 5IK7A 1FNZA 1A78A 3T2TA 4Y1UA 2AGSA 1ENRA 1UAIA 3WHTA 4YZ1A 1D0HA 4YGEA 3T1MA 5KXBA 2DV9A 4FP2A 1RITA 1FATA 1LECA 1WUVA 4YM3A 3B69A 4FPYA 1OQ1A 1SLBA 1WLDA 3ZXJA 1PZ8A 1S0DA 4FOYA 2JECA 3C2UA 3RRDA 4XXPA 5EYXA 1IS5A 4H55A 3H0OA 4XXAA 3AYEA 4U36A 1DQ2A 3SH3A 1JYCA 2GNMA 1OKQA 1BYHA 1MS8A 2VUAA 3AX4A 4FPLA 3WDWA 3WUCA 1LESA 1ULCA 4PBOA 4AVSA 1SBDA 1G9DA 2D3RA 1R1ZA 2D43A 2WJSA 2YY1A 4R9AA 3DGTA 3BTAA 4FPEA 1X50A 4XBLA 2A7AA 1C57A 1QNYA 4LBQA 3BODA 5L73A 3VKFC 4YZ4A 2KM2A 1GLHA 5DUWA 1DBNA 1F31A 3ZSMA 1VAMA 5DUVA 1BZWA 2A6WA 4XIOA 1LU2A 4HL0A 1HDKA 3HN1A 3IMNA 3OY8A 4ISQA 4TZDA 3CNAA 1G9CA 1DQ0A 1ZA4A 1MZ6A 5GLUA 5HCAA 1F5FA 3AP9A 1LJ7A 1CN1A 1FAYA 1Z0HA 2NM1A 1GYKA 4NOTA 1DIWA 4LBMA 1QOOA 4YZ3A 1MS4A 4P14A 5JOXA 1S0GA 4XOGA 1LENA 4YG6A 5GZGA 1LTEA 3LSEA 2ZGPA 2R49A 1LULA 4LBNA 2ZHKA 2Q5TA 2WKKA 1IKPA 4CRQA 3B9CA 1AJOA 1JXNA 5GZFA 1EPWA 4XHBA 1JN2P 3R05A 3ENRA 5T5JA 1I1EA 2UWBA 3N7LA 4HANA 4XBQA 1LHWA 4FPKA 2CYFA 2GALA 3MW3A 3IKWA 4GKXA 5DZFA 3WLUA 4YGCA 1ZM1A 2D6KA 3VV1A 2VXRA 5GLVA 1AX2A 1SACA 1ONAA 2CL2A 1UZYA 2GMPA 3AXDA 3N7KA 4ATEA 3MW2A 4LBJA 4XTMA 1RIRA 1F9KA 1AF9A 1H9WA 3WUDA 5T50A 2EIGA 1LGCA 1W6MA 4YM0A 2ZHMA 5DG2A 2JJ6A 4NO4A 4YZ5A 3MPPG 1CR7A 2CTVA 5BYNA 2GNBA 1PZ7A 2R0FA 2V73A 2P3IA 1V6JA 1MZ5A 1JUIA 2AREA 1LOGA 1FV2A 4YW2A 3RQ0A 4YW5A 2WLQA 4UW6A 3WZ1A 4XBNA 1LGNA 1KRIA 3KM5A 4R9BA 5AVAA 1Q8VA 2D3SA 3JU9A 3V0BB 5F9TA 5JOZA 5DXDA 1G7YA 1S0FA 5GLZA 3WDUA 3FBYA 3NV2A 4XYXA 1KDKA 3QCWA 4Q8LA 4YGDA 5IT6A 5JLVA 4Q1RA 1BKZA 1S0EA 2LALA 4Y20A 1V00A 4Y1YA 4Y26A 3RG0A 1W0PA 3UJOA 1BJQA 1WD4A 3SLIA 2DVGA 3B3QE 2HYKA 5H9QA 1WBFA 2VY0A 1W6NB 1ULEA 2ENRA 2ZABA 4XJUA 1UZZA 3AYCA 4YW4A 1I3HA 1APNA 5FREA 2W39A 4GKYA 2ES3A 2A6VA 3OGGA 2DUQA 2D6MA 4FOWA 5JVVA 3OBRA 3RMXA 1DQ5A 4W65A 1AZDA 5HCFA 2A70A 3W59A 4DRVA 2OW4A 2ZBJA 3AYDA 3ILRA 4K1ZA 5IK8A 1JBCA 2NN8A 4Q27A 5LK5A 3SH4A 1JYIA 1DGLA 2P37A 3RMYA 2XG3A 3WV6A 2ZAAA 3AP7A 1DHKB 1AVBA 2CWSA 2DTYA 3AYAA 3IPVA 1IOAA 2EF6A 3A0KA 5F5QA 1GZWB 2DUPA 2OUHA 1MACA 4GA9A 2PHTA 1N3QA 2R0HA 3ZXEA 4YW3A 1FNYA 4RA0A 3B01A 3R4UA 3M3OA 2D6PA 2NYYA 2Z42A 2ZGKA 3N35A 3MEPA 3WOGA 2TEPA 4LBQB 5T54A 2GNDA 1ULGA 4XJ9A 1UPSA 1SCSA 1WLCA 3AXEA 5E8AA 2DTWA 2DVAA 4KBBA 5DUXA 1KDMA 4BMBA 3PJQA 4XMIA 1KJRA 3OY8B 5IK5A 3ZPYA 1G86A 1CPMA 2LTNA 3N36A 2ZGSA 1A3KA 4P9XA 4XJ8A 2DURA 1NXD1 4WZFA 4JC1A 2PELA 4XZPA 1AXYA 1MR5A 3POYA 1QMJA 2AENA 3ILNA 1LU1A 5GM0A 3M3CA 2GMMA 1DQ1A 1VAVA 1IS6A 1JHNA 3ILFA 1SLAA 4K1YA 2H0BA 4AGGA 5JDBA 2ZA9A 1H9PA 2GDFA 2PHFA 3NV1A 1S0JA 5CNAA 3GALA 3N7MA 5GALA 3W58A 2RHPA 1G9BA 3VKOA 4FPCA 4GWMA 2R1DA 3NV4A 4CZSA 2AR6A 3VUOA 3ZXLA 3O0XA 2UURA 2WNEA 4ISRA 3WCSA 4FQ4A 2E7TA 2A6ZA 3HR9A 3FLRA 2A6YA 4LBQD 2ZGOA 1UN1A 4Y1VA 4XE9A 3SISA 1MS1A 1N1SA 4BMEA 1V6MA 3VKLA 4YG0A 2AH2A 4IQPA 3DUIA 3ZVXA 3ZXKA 4AWDA 2ERFA 1JW6A 1LEDA 3POSA 2WT0A 2GN7A 4FVVA 5H9RA 2GN3A 3APBA 4FPJA 4DFSA 1BQPA 5E88A 2AYHA 5T5PA 3BIWE 1GZCA 1W6MB 4Y22A 1DFQA 1RINA 2P3KA 2PHUA 1S0IA 1WW5A 2ZGMA 3O5SA 3PVEA 3VKMA 1YIFA 1C1FA 2ZMKA 3U4XA 2A3YA 1CQ9A 1UL9A 3AJYA 5JMCA 2DU0A 4XJWA 1LHUA 1QDOA 1DLLA 4DQAA 1C4RA 2C5DA 2XB6C 3KQRA 3TAYA 3WCRA 1S0CA 1W6PA 2C9AA 2A75A 2ZKNA 3WDTA 2SLIA 2DVFA 4XMAA 2A3XA 4RL7A 5DZEA 5T55A 2DU1A 1VALA 3AP5A 1W6QA 3T1LA 3INAA 3WG1A 3WDVA 4C1WA 1LHOA 2YZ4A 1SLTA 4Y20B 1S0BA 3UL2A 2ZGUA 2A5ZA 3FUOA 4JCKA 5EXOA 1LCLA 4FQZA 4XJAA 5KXEA 2E6VA 3AZZA 1CONA 3V65A 3OYWA 4FPGA 1IS4A 4BLJA 1W6OA 2R1BA 1HQLA 1GSLA 1LOBA 3M3EA 3D5OA 5SV8A 1CJPA 2ZMNA 1GNHA 4WVVA 2R16A 1AJKA 1DQ4A 1N47A 4R9CA 2WT1A 2JKBA 1DZQA 4K20A 1V6LA 3ZXFA 5T52A 1CIWA 3I4IA 1AX0A 5DZGA 4XHXA 3SNMA 1W0OA 2EXHA 3RSJA 3IPVB 5GJ6A 1G8WA 3HMYA 1A8DA 4ITCA 1NLSA 1Q8OA 3NWKA 1SLIA 4DS0A 2EXKA 3PMEA 1SFYA 3V0AA 1V6NA 1WLWA 2E7QA 4FP3A 2OUJA 4Q26A 3L2YA 4YM2A 4F83A 2DWRA 2WSUA 2GNTA 3AK0A 1V6OA 3OBTA 3PVNA 3USUA 2NMNA 4WV8A 1LOCA 2G4IA 2ZGTA 2ZGRA 4R9DA 1YO8A 2E51A 4L8QA 4AGVA 2EXJA 3A0NA 3AFKA 2D6OX 2YROA 4BPZA 2DVDA 1WCSA 3FLTA 4XIKA 1GANA 4YZ2A 2FMDA 1YRZA 4AGRA 4DPNA 2AUYA 2FHRA 3POWA 1IKQA 4M3CA 4XTPA 1Z78A 2PHWA 4GXLA 1GV9A 4ZKTB 3O0WA 1GNZA 1MVQA 2D44A 4PBPA 1AXKA 1KITA 1UX6A 4JRAA 3AJZA 4FPHA 5CB7A 3SITA 2B7YA 3ZSLA 2VW2A 4UW4A 2ZHNA 3WNXA 4FOVA 3WHUA 1B09A 1PZ9A 5CA6A 3AZYA 4P9WA 1WBLA 5DG1A 3O0VA 2DUOA 1ULFA 2SBAA 4PCRA 1N1YA 1FYUA 3JUUA 4BM8A 4M01A 2PHRA 1QF3A 1UKGA 2P2KA 1YXWA 2ZZJA 1GICA 1LHVA
chains in the Genus database with same CATH superfamily
1VP6A 3Q9OA 2Z69A 5FXVA 5JZGB 1CAWA 1TME1 4ZU7A 4QX7A 1UIKA 5KXDA 3ATGA 4AFDA 1NAEA 2ZEYA 2C1FA 5DAWA 2RVAA 1JYWA 1QKQA 5C3SA 4P5YA 5IK4A 5IHRA 3IN9A 5KBFA 4H14A 3CJIA 4A3ZA 2J42A 2YBKA 1O3QA 3AP6A 4Z1VA 1UU5A 5FYTA 3LCPA 1N1VA 1NOVA 2NZ9A 1IS3A 2K46A 5BNPC 3ME2A 1BMV2 1W99A 3TEZA 1C8M2 3LOIA 4CP9A 3ZFFC 2VTFA 1HN1A 1PO12 2NMOA 4OUSA 4OI1A 1MQTC 5ABJA 4EN6B 2Y33A 2TBVA 1QOSA 4RS5C 5FYYA 3UKTA 2DFBA 1MS5A 1BMV1 3D4KA 1C8M1 3H9AA 3DV8A 4HFSA 1PMHX 4NAOA 3RS6A 5J7MA 1PO11 4AYUA 1ULDA 4W6XA 4XQWA 3ZSJA 4MGQA 1SBFA 3A23A 3IM0A 1V0AA 4M3CF 4YGBA 4BOWA 1SCRA 1GZTA 5HV0A 1W8HA 2ZHLA 2FCUA 5JIAA 1QGLA 2P3YA 2UU8A 5LBCA 3V64A 1YEWA 4QDRA 2PTMA 3FHAA 3PLQA 4YFWA 5K0UB 1YCIA 5FQ0B 3M4FA 3PUSA 4JKKA 1VB2A 1W06A 2YXSA 3PUHA 1UF2C 5T5OA 4CU8A 5H9PA 4UW5A 3OCPA 4MGIE 3X29B 2P34A 4QXKA 3H8OA 2DCKA 3GNEA 1QDCA 4IL7A 2IFWA 1XE7A 2BWCA 1U0AA 2VU9A 5JXJA 2WIIB 4QQLA 5EPAA 1RHI2 3A7QA 3UGHA 4YW1A 1Y3TA 1SBEA 1YUDA 3UYJA 2ZCWA 2VZ3A 3RZKA 3NAPC 4XF0A 3HBKA 2VNOA 1ZA7A 1KS4A 3IDCB 4V1PA 4BLIA 3B9IA 4BU2A 4PF5A 1E5SA 3LWCA 1OC1A 1RHI1 5FO9B 3LD8A 3O1VA 5KHJA 1LHNA 2PQQA 4U2AA 4XPVA 4EV0A 5H9SA 1JTZX 2PFWA 4IV3C 4R4ZA 3B94A 3I8TA 3R0RA 1URXA 2YU2A 5FBJA 4L92A 4MV2A 1BVVA 4CUGA 1D4VB 2W91A 1GKBA 3VDDA 3WDXA 4M00A 1HW5A 1FV3A 1U5IA 2RS32 1GP5A 1I6XA 5HCHA 1CD3G 1UZWA 4CCLA 3WG3A 3I3DA 1OUXA 3ASIA 4ZXEA 4ZXKA 4EZ4A 4CEYB 1XU2A 1UMZA 2FQPA 1HQWA 4TYSA 2RS31 5KC6A 4LUMA 2D6LX 2P6HA 4NRPA 1S55A 2OS2A 5KR7A 4LKSA 3WNKA 1G6NA 2VVFA 1NCRB 5F3GA 4FCAA 1HRV3 3I3BA 5GLWA 3ZSKA 3DKQA 2PHXA 4DNYA 1WD3A 1F2NA 5JCTA 5LEJA 1ND2B 4QKNA 3T4VA 1XOYA 3VD3A 5GZCA 3VLBB 1VJ2A 4HSLA 2VQ0A 3WT3A 3GCXA 3MW4A 1SDWA 1SFPA 4GH4C 3WNPA 4CDQB 1LODA 2GH2A 2JD4A 4E4SA 1WZXA 3ZIWA 1QU0A 1AR72 4PQ9A 5FCCA 4OQ8A 1FX5A 4LOTA 2HWE2 3K2OA 1CAWB 1S1AA 4H2AA 3WG2A 2ARXA 1DYKA 1ACCA 1HN0A 2RR12 3MBWA 5FPUA 4WM8C 5I8YA 3KHBA 4JKMA 1W6NA 4Y3OA 1UY4A 3IBMA 5IK7A 2BDRA 1A78A 3CJIB 1AR71 1GOGA 1US2A 2KA3A 1U5ZA 2HWE1 4FI9A 4YGEA 3T1MA 3WHTA 5KXBA 1YHFA 2X05A 2RR11 2RV9A 4OI4A 4YARA 3B69A 4FPYA 1WLDA 3KGZA 1PZ8A 4OUEA 1NA1C 3GXUA 4KI5M 4C91A 5EYXA 5FPBA 2VVDA 4RQPC 4UWDA 3D8CA 4YVSC 4CP9B 3SH3A 2ET1A 5C5UA 2VBBA 4XE9A 2VUAA 3J4UH 1BYHA 1MS8A 1S2EA 2P17A 4FPLA 3WUCA 1LESA 1WCQA 3OEAA 1E5HA 5F8PA 3VDCA 3ZM8A 4GB33 4D94A 2YY1A 4XBLA 4CDXA 4IGPA 1W8WA 3LPFA 2RM23 3BODA 3VKFC 2KM2A 1COV1 1GLHA 1HQNA 1YQ8A 2WAOA 2WFPA 5DUVA 1T6BX 2VCBA 4CVUA 4LPLA 4MLOA 3VBOB 1K42A 2HWF3 4LA2A 2VOWA 3LDKA 1UY0A 3HN1A 4ISQA 4PIYA 4NAMA 3CNAA 1G9CA 4KNCA 2QTWB 1CN1A 1Z0HA 3RI8A 1WMFA 1GYKA 1BBT2 1H2KA 3AMHA 1B35C 1QOOA 2BJSA 2D40A 2EIBA 3VZLA 2Y6KA 4I0BA 1QHDA 1RUOA 1S0GA 2CDOA 3ZN5A 4YG6A 3JD72 3CBNA 5L7OA 4NVPA 3ABZA 1MZEA 2C0ZA 1DGWX 1JH5A 1LULA 2QQIA 1FOD2 4D0QA 4HVOA 4N90A 3IT8A 4DUWA 2RJKA 4JDOA 1BBT1 4FFHA 1JHJA 4CRQA 5B4NA 4MGZE 3B9CA 4JX0A 4AEDC 2WYSA 4E8DA 1ASJ2 5F3EA 5IVFA 1EPWA 2QCSB 4ES9A 5JR2A 3JD71 5C70A 1RUD2 1I1EA 2UWBA 3N7LA 1GOFA 5ERLA 4M0HA 3GBFA 1FOD1 2CYFA 4PLOA 3WLUA 3IKWA 2IFRA 1NZIA 3LOBA 4LUKA 2BBVA 3ACFA 4XDPA 4YGCA 1UKRA 2D6KA 1ASJ1 4GIQA 4QPWA 4D7YA 2WDBA 3U4SA 3I2GA 1RUD1 1GWLA 3VDDB 5FDBA 2ZS6B 3THDA 3MIDA 4Q4X3 2VZVA 1AX2A 3K51A 3ZMOA 3ETQA 1FMD2 1GNYA 4GULA 4COWA 2KXLA 1F9KA 4ZU4A 1QQP3 4AAPA 4QPGC 1ULOA 1X82A 2OPKA 2DCTA 2ZHMA 1JZ5A 4NO4A 5ACA1 1AR83 1GQPA 1GOHA 1QJU3 4MXWA 5AFBA 1FMD1 1UU4A 3MLKA 5BYNA 1C5IA 1OQDA 3I2FA 5FZDA 3OTFA 4QDQA 2V73A 3MHZA 1V6JA 4LEJA 5KHHA 5FZCA 3RQ0A 4YW2A 1AL0G 1AR93 4UW6A 4YW5A 5JSRA 2XWJB 4XBNA 2HBTA 3KM5A 4R9BA 5BXXA 5AVAA 5F6LB 2KR2A 5FYHA 3VBFB 5GLZA 3OBZA 3HPNA 5FZKA 5L9RA 4DOUA 4XYXA 4AI2A 5T3NA 4ZZ5A 5IT6A 1Q5OA 2LM3A 3SXWA 1NYWA 3U11A 2WYFA 3K4ZA 1S0EA 3FHQA 4Y20A 4E2QA 4Y26A 3T09A 3WQ1A 3B3QE 2QQNA 1MPXA 2QBXA 1W6NB 3FBMA 5FP3A 4YW4A 2G19A 1APNA 1FXZA 3C7OA 2R073 2W39A 1L7QA 2A6VA 2ATFA 4M4PA 1AR63 1PVC3 1MEC1 5SV5A 3WD5A 4BYYA 3W59A 1IHMA 1K45A 2OW4A 5IK8A 4K1ZA 4TTGA 1F4HA 3WV6A 1EAH3 1PO23 3RMYA 2GSYA 3NNMA 4DO0A 2ZTNA 2OT7A 4KU8A 5FYIA 1W9YA 4HVRA 3I3EA 1VMHA 1DHKB 4FTSA 2CWSA 2DTYA 3DPRC 3AYAA 5LZ6A 1BCXA 2EF6A 1ND3C 1OVSA 3A0KA 5F5QA 1GZWB 4PF1A 2QQMA 3VBHA 2FMYA 4D6RA 1N3QA 1CGPA 2F6BA 3SC7X 5EJ3A 3T0AA 1VRH3 3UESA 4CDXB 3R4UA 2RMU2 3M3OA 5KHIA 1H2LA 2CDPA 1W28A 2F17A 3SQOA 4XJ9A 5L9VA 2WS93 5FP9A 3LE0A 2XQXA 3VBRC 5DUXA 1SHWB 3B02A 5FXZA 4BMBA 2ET7A 4CCNA 3PJQA 1OA4A 4MHRA 3F2ZA 4XMIA 5F39A 1KJRA 4AI9A 2QNKA 2RMU1 5IVCA 1RUF2 3OOXA 3MDPA 2HWC3 3N36A 5E16A 5IJRA 3IDBB 4URAA 5DN2A 4ET7A 3J7HA 1NXD1 1NLQA 2FDFA 1UMHA 1AXYA 2AENA 4HLTA 5L7OB 3FMGA 1RUF1 3DECA 1QJY3 2WNUA 1RUC3 4MO3M 1CX1A 4M0NA 1JHNA 3ILFA 1SLAA 1YQCA 2H0BA 2OPWA 4K3UA 2YDEA 2HJIA 1W8OA 1DYOA 4KWJA 3I2KA 3NV1A 4I0AA 3VL8A 3KHCA 1VB4A 1WCDJ 2RHPA 4QX3A 1DP0A 2VMCA 1JZ2A 2Z2SB 3V56A 1RVF2 1FI2A 2P6CA 3O0XA 2FDHA 2BP6A 2UURA 2Y6HA 4ISRA 1WA6X 2E7TA 2IXHA 3HVDA 3TNQA 2A6ZA 5C7GA 4XF4A 5A6QA 1RUI3 2L9LA 1V6MA 4YG0A 4IQPA 1RVF1 3ZN4A 4MSVA 3PIJA 4UBGA 3EXUA 2VNGA 1LEDA 3O1TA 2TNFA 2WT0A 2XKOA 2ZZQA 3OUJA 4GWIA 4A7ZA 4JTOA 4MGTA 3APBA 1BQPA 4CSWA 2X5IC 5C71A 1K5MB 3NNFA 1R092 4W8JA 1TNRA 2P3KA 2D93A 4OQ9A 1JU4A 2GP3A 4MXWB 1H2NA 2ZMKA 3CHXA 2A3YA 4Y5Z0 4NR1A 5ANNA 4MX3A 5FZGA 5FZOB 5IAVA 4Q4W3 4UFIA 4C0HA 1GU3A 1R091 3TOJA 4YVWA 2XB6C 3KQRA 4BZ4A 3ST7A 3KB5A 2ZKNA 1EUUA 1UOJA 2D5FA 2SLIA 1W8FA 2G9ZA 5FTTC 4XMAA 5DZEA 4RL7A 3N9OA 1W6QA 2ZKLA 1BK1A 1SLTA 2YGLA 4Y20B 2BEOA 2JDAA 2JDUA 2YFUA 2W5FA 3T2PA 3POGA 2XLAA 3ACLA 4LITA 3AZZA 4QHBA 4RN5A 3OYWA 4ORFA 1W6OA 5C3OA 1WMDA 1CJPA 2ZMNA 4A2UA 3HQRA 3WSOA 2IWGB 2BU9A 2QFEA 4GMP0 1HB1A 1TQ5A 4KGQA 1ZYBA 4D7TA 5G05L 3K3OA 3NNGA 4R9CA 1RUH2 2B39A 3CLPA 5FOBB 4PLMA 5BNOA 1V6LA 5T52A 3I4IA 5DZGA 4XHXA 1O3SA 2PA7A 3JBG2 1P8JA 3VHPA 1F8VA 5HXVA 1L7LA 1G8WA 3HMYA 4HETA 1JZ7A 4CDWA 2WO7A 3IDEA 3VBHB 1ODMA 1PK6C 1QJX3 1RUH1 2W9XA 2E31A 4E4HA 4ARXA 2VOKA 1ZBE2 4QQHA 1SLIA 5FZIA 1Y9GA 1XE0A 3PMEA 4CDUC 5L36A 1WMEA 3V0AA 3K48A 3TEYA 4FP3A 3JBG1 4Q26A 3L2YA 4CYDA 1J58A 1IPJA 2HYXA 2Y64A 3PVNA 4LO6B 2NMNA 3S6PA 2ZGTA 4Q29A 4AGVA 1R64A 1O3RA 2E51A 4CUCA 2Q8DA 1ZBE1 3AFKA 4AW7A 5CVRA 1POV0 3AKTA 4LO8A 1GANA 1NUKA 4GJYA 3HEIA 1IKQA 2Q1FA 4DEVA 1JYVA 4BQXA 5FMDA 2MEV3 2RG4A 1VBE2 2VNVA 1ALYA 1GNZA 5FMCA 5FIXA 1UX6A 1KITA 4JRAA 3SCFA 3ZSLA 3KS7A 3SITA 2B7YA 2GH8A 2VW2A 2WNUB 4Y5SA 1YQ6A 1STMA 5LBEA 3WNNA 1OOPA 1VBE1 2BUKA 2DUOA 4GD4A 1ULFA 2JG9C 4LMFA 4D8MA 5FZ8A 3KGLA 3PTYA 4DY5A 4AHZA 2AEZA 1W2UA 1N1YA 4PCRA 5A7OA 1F5JA 2P1BA 2VG9A 1QF3A 1GP4A 2ORXA 4NJ4A 2ZZJA 3KT4A 2QZ2A 3MIBA 4NHYA 1H8VA 1LHVA 5BNPA 3WX5A 5FY0A 1CVNA 5CKMA 3AZWA 4Y24A 1UOFA 5LY2A 2LROA 3ZFFA 2DCYA 2JENA 5A7PA 1KQRA 1MVEA 1OH3A 5KHGA 1YFUA 2D7FA 2WABA 1J3PA 4CXWA 2J1TA 4IV1A 4R4XA 3HT1A 2PLV3 1ZRFA 4KWKA 3ZFGC 5IVBA 4HBNA 1GMMA 3POFA 3PVOA 5DAPA 4KU7A 3WR0A 5F2SA 3N3HA 2JE9A 2NQYA 3CMGA 4Q0SA 3GJAA 2YPDA 3ZPOA 4K21A 1OFNA 1J84A 1H8TA 3AZVA 4AF9A 3RYPA 1HJGA 3MIGA 1SPPA 4P00B 4NIAA 5A6YA 2VW0A 1BEV3 2A6XA 5C4WA 1UCXA 3O1PA 3RYRA 4XILA 4YVWB 5C8CA 2ARBA 1CESA 3RZMA 4HXCA 5APAA 3GZUC 2O1QA 2E32A 1CJDA 2EICA 3CO2A 4JKLA 3TNPB 3OPZA 2Z5WA 3M3IA 4YM1A 2JDZA 1SLLA 1W6QB 2EAKA 1NCQC 5JSPA 2D6NA 4CCJA 2H6BA 1C5HA 3HAGA 1RTVA 4FPFA 3IAQA 1ZBA2 3ITQA 5JR7B 1DYPA 2WFF3 3UGGA 1WW6A 1VBC2 4TXWA 1GP6A 3OYWB 3ZFEA 1W6OB 3HOBA 5DDJ2 4E2SA 1KJLA 3I49A 3G6JB 1PIV3 1AYM3 1PVXA 3ZKYA 4CUAA 1JMUB 4QX1A 3C8XA 3KV4A 1PM7A 4N53A 1RJ7A 4UFMA 3TB0A 1VBC1 5T5LA 4EN0A 5BNOB 5F5AA 5DDJ1 2YC4A 2JDHA 2OX0A 5KWRA 1UYYA 4AVVA 3GJBA 3PIGA 1Q8SA 4CDWB 2LS6A 3USSA 1KXGA 2V5YA 5F37A 3FE5A 4IE7A 2D3PA 2JIGA 2W52A 4D69A 3PU8A 3KWVA 5EWSA 5LY1A 5AC91 1AYN2 2FBEA 5FZ1A 3WF4A 3V0AB 1VLNA 2BV4A 5G04L 1TME3 4BJ0A 1LOAA 4IEYA 2HEYF 3S7EA 3PJYA 1IQAA 1REDA 4AAXA 5FPLA 4PDWC 4JDNA 3WDYA 1HB4A 2BQPA 2ZJCA 2ZGQA 3SHRA 1AYN1 2VD7A 1D4M2 4LBOA 4LLOA 3P6BA 2W95A 4BWOA 2OVUA 4WVWA 2Z79A 2WZ8A 1UZ0A 3C7FA 3G7DA 3HBZA 5BNNC 3R4SA 4QGNA 3W21A 2UYBA 5IUQA 5EFUA 2UY8A 2CNAA 3S5AA 3QH6A 4ZZ8A 5F7UA 2WNVA 4IEQA 1SLCA 4WM8A 4G4FA 1LOEA 4FOQA 1D4M1 1ENSA 3CL1A 4OHVA 4IEZA 3QLQA 3TN93 4W50A 1AHSA 3N9LA 1OOPB 5D8AC 1XB9A 4XAAA 2V5DA 3PUQA 4EZHA 3V0BA 2W08A 2JB8A 4UXAA 4QPIA 1QJZA 4MYEA 3UJQA 5JOWA 2UWAA 3DCQA 1VIWB 5FP8A 1C8M3 1O59A 1H1MA 1AL22 1XQNA 1HXS2 4ATFA 1PO13 3JQXA 3P5BA 4AHWA 4OHWA 4L9BA 5EYYA 4Z82A 1O4YA 2QQKA 2WR9A 2IXJA 3MV01 4I30A 1WW4A 1DDLA 2OIIA 5FBZA 1YJKA 1V6IA 1RJ8A 3GZEA 3JXSA 3KV9A 3N7JA 5GZEA 3UK9A 1AL21 2XH6A 1CAVA 3FL7A 4IV1B 1UWWA 1HXS1 4YW6A 4AI1A 1ENRA 1D0HA 5FYZA 2JX9A 1RITA 3URFA 2Q0AA 1YFWA 4YM3A 1SLBA 1RXGA 2YPJA 3B93A 1BVP1 5J37A 4Z92B 3I2HA 2GC1A 2ZX4A 3K4AA 3H0OA 2Y26A 2JG8C 1HV1A 3AYEA 1H8TB 1POV1 2VZTA 4IGOA 4N9IA 1SPPB 3WQ0A 4EN7B 5K7PA 2GNMA 3AX4A 3WDWA 4X6QB 3GZAA 3VZOA 2H0VA 4N9HA 5IATA 5C4WB 1ULCA 1ZX5A 4OULA 3S30A 3KLSA 1CX4A 1C3HA 1R1ZA 1JODA 2D43A 5A3LA 5C8CB 5EV7A 3ES1A 2XONA 3BTAA 4R9AA 3CKHA 2A7AA 4RD7A 3WF2A 1PMIA 1QNYA 4B3NA 1PNGA 4LBQA 5HV4A 1UXXX 4F8AA 3ZSMA 1CWPA 2VOTA 4LK7A 1BZWA 2VZSA 4EYUA 5HXMA 4JGYA 3F95A 4XIOA 1UOGA 4HL0A 3ZR5A 3OY8A 4TZDA 2G9FA 2X29A 1DQ0A 2B9UA 3M70A 4B7KA 1F5FA 3AP9A 1LJ7A 3RZHA 2JD9A 2R062 3ZFEB 2NM1A 4NOTA 2RS53 4KH9A 3A21A 2CV6A 2R042 4QM8A 2VZ1A 5JOXA 4N53B 4XOGA 3LIGA 5E1RA 3VBSA 1LTEA 3LSEA 2WC2A 1RUE2 3OEBA 4S2FA 1XYNA 2R061 1RUJ3 2Q5TA 2RDSA 3OPTA 4QWNA 1ODNA 1OD5A 1IKPA 2R041 2WKKA 1JXNA 5GZFA 1QXRA 1JN2P 3WW3A 2Y6GA 2RDRA 3KQ4B 3MICA 1NG0A 4JRLA 2ILMA 5T5JA 5CFCC 1RUE1 1XPWA 1RC6A 3RYKA 1L3JA 3T2OA 3MW3A 5JIUA 3WF1A 3VDAA 5J3UA 1JYTA 5IVJA 4OHXA 1PX3A 3VV1A 5JZGC 1SQ4A 5DAQA 4NPLA 4O61A 2VXRA 4MADA 4XDOA 2VTXJ 5J96B 3UETA 3CZUA 3AXDA 4ATEA 1UZYA 4O65A 5BPXA 3E97A 1AR73 1WGPA 3MW2A 4XTMA 3I7DA 2HWE3 3AMNA 5T50A 2RR13 1W6MA 4YM0A 5C8WA 4OZOA 2XVLA 3H7YA 4HPKA 4NPMA 5DG2A 4YZ5A 1CR7A 2WNVB 1NXMA 1QXJA 3OGVA 4MGYE 1PZ7A 2CGNA 2R0FA 2AREA 4LQRA 2ZPXA 4NWVA 3SCGA 4XCAA 4IE4A 1Q8VA 2D3SA 4IGQA 4JTNA 5F9TA 5JOZA 3V0BB 1G7YA 1LRHA 1S0FA 4QPIB 5LBBA 1DZTA 4I01A 3FBYA 3LEIA 4Q8LA 2VMFA 2BOIA 1BKZA 1COV3 2VMHA 2D5HA 3VDBA 2VUDA 2XLFA 4AHXA 1DGRA 4YW7A 4LIVA 1WD4A 3SLIA 1W2TA 5DMYA 2HYKA 1WBFA 2VY0A 1TMF3 1UZZA 4FFGA 1I3HA 1CAVB 5JSOA 1UPIA 3OGGA 5K0UC 3O1RA 2Q1MA 3LPGA 3ZOIA 3OBRA 1X7NA 4MUVA 3PMSA 5HCFA 4XAEA 1EY2A 4DRVA 3VZKA 4PIXA 2ZBJA 2VTXA 1VAKA 3RWNA 2AC1A 4BXSV 2NN8A 4Q27A 3ORJA 3FN9A 2F4PA 4XFGA 3CEWA 3BN6A 5DABA 2ZAAA 3KF5A 1BBT3 3IIIA 1AVBA 1R082 4UYBA 2BERA 3IPVA 1IOAA 4BQ3A 3BVCA 3K75B 2OA2A 2ZEXA 3S57A 2DUPA 2OUHA 1ULPA 1MACA 3JD73 2PHTA 4KMQA 4Q4Y2 5A6ZA 5F1RA 3HN3A 5A1AA 4RA0A 1RGSA 1FOD3 2D6PA 2NYYA 3AKQA 3JQWA 4LBQB 5A3NA 1R081 5IAXA 3HIFA 2VQUA 5E8AA 2DTWA 1Q43A 1ASJ3 1W9SA 3OGRA 4H3WA 1S2KA 4XEZA 4CCOA 4E4DX 4JGYB 1RUD3 3FZ3A 2PXJA 4Q4Y1 3OY8B 1EPZA 2CAUA 3EB7A 5ABJB 1JZ6A 3ZMNA 4FSJA 3KSCA 4DY3A 1SDDB 2RJLA 4KG0A 4N43A 2VOVA 5FZ4A 2LTNA 3BOWA 5A6XA 2Q30A 4LO7A 4XJ8A 2FZ1A 2CU5A 2VGDA 3THPA 4CEYC 5CFDA 1MR5A 3POYA 4CA9A 1ST8A 1LU1A 3VBSB 4D7SA 1F15A 5ACA3 2BGCA 2GAUA 2GMMA 5FLHA 5I0RA 4BXFA 3ZO0B 2O8OA 1NCRC 1KEXA 1PGSA 1OF3A 1CZTA 3LA7A 1IS6A 4QU2A 1OPOA 2EAAA 2W87A 3JZVA 4AGGA 2RS12 5JDBA 1H9PA 3JB4C 2PHFA 1ND2C 3MZHA 1S0JA 4RR3A 1ZNPA 3W58A 1HRV2 5GALA 4GQ7A 4RHV2 3VKOA 4FPCA 1W2OA 3WXPA 1HIXA 5I0TA 2BGOA 3I3QA 1SMVA 4QU1A 3PL0A 4CDQC 2XVKA 1UO9A 4HN1A 4CP2A 3T30A 4DIQA 5JI9A 2WNEA 2ETEA 3WCSA 1RUG3 3KV6A 4FQ4A 1I9RA 3H8XA 3BYWA 2RS11 1PGL2 1HRI3 2WQ8A 3FLRA 2A6YA 4LBQD 4JQRA 2ZGOA 2W47A 2OYZA 2BW8A 1HRV1 1N1SA 4RHV1 3VKLA 4BMEA 2AH2A 4ONUA 3H3ZA 4CXXA 3ZVXA 1W9TA 2OZJA 2D98A 2ERFA 2J22A 2ZEWA 4ASLA 3CJIC 3POSA 3AFGA 1PGL1 1MEC3 4X8NA 5KHKA 1NT0A 1W6MB 3O5SA 3EO6A 4W6WA 5A7QA 3VKMA 3O1MA 3MYXA 1YFXA 2R30A 3NRUA 4SBVA 1C1FA 4XF1A 3HJRA 4GAZA 2GZWA 3E6DA 1CQ9A 4XJWA 1QDOA 1XC6A 3TBDA 4DXTA 4DQAA 3OGJA 2B8MA 2X53S 3BU7A 3TAYA 4JVAA 1S0CA 1W6PA 3WW1A 2FD8A 2HWD2 2WO3A 2DCZA 2VE1A 3JCIA 2ZX1A 1O5UA 1VALA 2DU1A 5A7SA 4GB32 3WG1A 4TSVA 4Q0UA 1S0BA 4BH9A 2ZGUA 3NVCA 3RZLA 2RM22 4XACA 1TG7A 1W9WA 4JCKA 1H1AA 4LE4A 5EZWA 4R8HA 3VBOC 2HWD1 2QDRA 4E4ZA 2RMU3 5KXEA 2E6VA 4RGAA 4LOSA 4IW3A 5B2GB 3RWKX 1HQLA 1GSLA 3SKVA 2HWF2 5SV8A 4IXLA 3LDRA 1KGYA 2FDIA 2RM21 2VMEA 3T4HB 5I8TA 3ACIA 3MIEA 2K9ZA 4AI3A 4OCTA 1RUF3 5LCWL 5FZ9A 4QHOA 2CGPA 1AX0A 3LAGA 3SNMA 2YC0A 3IPVB 2J1RA 1I5ZA 4KQ7A 1DU3D 1KD7A 4FFIA 1Q8OA 4J25A 5JUVA 4KWUA 2DDUA 5F5CA 2EXKA 3VBUA 3WY6A 4NHLA 3WQBA 1V6NA 3OF1A 2E7QA 2VC9A 3R6SA 1GQHA 4L99A 4YM2A 4A6SA 4AVAA 4CEWA 2WSUA 3AK0A 3USUA 3U1XA 1YI9A 3ES4A 3LIHA 4QM9A 1LOCA 2ZGRA 4PI0A 1GWKA 3VDDC 3K77A 1CAUA 2JG9A 4HVQA 2D6OX 1RVF3 4ZU5A 1H4HA 3KCYA 3FLTA 4N43B 3ZN6A 4FAHA 3BPZA 1DCSA 1NX9A 1OUSA 2FMDA 4QX2A 3U10A 4Q4X2 1TNFA 1Z78A 2XHNA 3AKSA 1L7RA 5CFDB 3O0WA 4BCUA 1VBA2 3N9PA 2FCTA 5CB7A 1QQP2 4UW4A 3ZR6A 4Z2AA 3WNXA 1PZ9A 4Z07A 5CA6A 1I5PA 2C6SA 3SMHA 2DF7A 1OLRA 4Q4X1 3AB0A 5DG1A 1QJU2 1YLLA 4HKWA 2BPA2 2I07B 2VZPA 4Q0QA 1KS5A 1VBA1 5C3RA 4RR3B 4JGZA 2PHRA 1YQ2A 4M01A 4QKFA 4XUPA 3OB8A 5FPAA 3VBFC 1YXWA 3GHNA 1VBD2 3MLJA 4CCCA 3IAPA 4SLIA 2VVEA 4K9SA 5FPVA 4XFAA 1RB8G 3WEZA 2NP0A 1ZRCA 1O8SA 4Y1XA 1QJU1 4LO4B 1VE0A 3NV3A 1WKYA 3TRSB 4AEMA 1OT5A 1XSQA 4AE2A 1TE1B 4A4AA 5C9AA 1MS3A 5FRAA 4UF0A 3RZJA 5CKNA 4Q2FA 4C8DA 2XJVA 2XL7A 1VBD1 2YV8A 3HT2A 3LEGA 4AI0A 4AFCA 1UZVA 2ORZA 2DVBA 4A44A 3J7MA 4PT6A 3U37A 4BIOA 3FFZA 5AVPA 2WQ4A 2R072 4NIDA 4A42A 4EWAA 4A3XA 4DRRA 4I2OA 3LEKA 4QD2A 4FBFA 3GGLA 1EV12 4FPOB 2XXZA 4HN0A 4LKDA 1XE8A 2Y38A 3DKWA 4LLFA 3DYOA 5FZLA 5FAXA 1BHGA 2R071 1R1A2 3N4MA 4NMIA 4ES8A 1V6KA 1W3VA 1RUH3 1W6PB 2DFCA 4WVMA 4IEXA 4DMIA 3D6EA 1IGOA 3DXTA 1EV11 3PHMA 4BQ2A 4E2GA 3CIHA 4OHZA 4CDXC 2Y60A 1BXHA 4COYA 2GP5A 2WL1A 3HD8B 1OXCA 4N7IA 5A7NA 4XJZA 2XMLA 3T0BA 1Q8QA 5A3TA 1VRH2 4XDQA 1R1A1 2UWCA 2R7EB 2UY9A 4MZUA 2ZGLA 4PI2A 1ZZ9A 4AQ2A 1YJLA 4BHPA 1UYZA 5LK7B 1ZBE3 2BVBA 2Y8KA 3J26N 1AXZA 4MH0E 3DXUA 3KVBA 1XBFA 3ACHA 1XSRA 5I0DA 4MHUA 5GLTA 1PMJX 4PQQA 3Q8AA 4WM7A 3EMRA 4Z8BA 2HWC2 3LFIA 5FWJA 5L7OC 3MF6A 4LBKA 3M3QA 3NJYA 4HT1T 4P9JA 3ZLIA 5FUIA 1HLCA 4QQ2A 2ZX0A 1VBB3 3DF0A 1UD1A 3FFQA 3RI9A 3U75A 2VECA 4OVEA 2QJVA 1V9U2 4DXZA 4EROA 4XC9A 1VBE3 5EIYB 1Y7BA 2RDNA 2VL4A 3H1WA 2HWC1 2VW1A 5LASA 1OLME 1LOFC 1J1TA 2W68A 3AKRA 3BOPA 2EALA 3B7MA 4QQPA 3VBUB 3M1HA 1V9U1 4OMDA 4DXRA 1UQXA 4RFRB 4YLZA 4CEWB 3PVBB 4DEQA 4O9GA 3USUB 3ZYIB 2J1UA 4Q0PA 3AMPA 1OFSA 2XBO2 3HNBM 4QHZA 1O4TA 4EN9B 1CAUB 4AQTA 2Q1ZB 4B1LA 1X36A 2V72A 2WINB 3ZN6B 1OVPA 1Z7S2 1RUI2 1XNBA 5L19A 1GBGA 1DGWA 2YBPA 1UOBA 5DQ0A 5JWPA 5FZ6A 4M4RA 3N9QA 1MS0A 2XBO1 1W3XA 4P5HA 1K5MC 1ZZBA 3GZTB 1CPNA 4AL9A 1ZRDA 3E5XA 4HG6B 4FFFA 1H30A 2I2SA 1Z7S1 2E53A 3NO8A 4N7UA 2WZR3 2CY6A 1H6YA 4P9IA 2WZPP 2NLRA 1KFXL 1X9PA 1BK0A 1W04A 2JDNA 4MOAA 1D7PM 1Q56A 5A7WA 4JGZB 4GWJA 5F6KA 2WO1A 3PURA 4YNIA 4Q4W2 3BTXA 4EWEA 2YMZA 4I3GA 2ZGNA 4KGGA 2VNRA 3J8F3 3UV9A 2R6QA 4B4PA 4X6RB 5BY5A 2J1EA 3O1OA 5C9AB 3H42B 4UF0B 1FPN3 3AP4A 5CAZA 2ZOEB 1X9TA 2VR4A 3POJA 2RDQA 4CZSA 2AGSA 5C33A 3MFAA 5CU1A 1WWYA 3OD0A 4FP2A 1FATA 1Y43B 3IIAA 2CHHA 2VPVA 3MO4A 2LRPA 4QX8A 1OPMA 1OQ1A 2UYAA 3ZYGA 4OUMA 3VB9A 3ZXJA 1S0DA 4FOYA 2BNMA 3C2UA 4LE3A 4Z2WA 3VL9A 1XRUA 4H55A 1DGRN 4G9SB 4XXAA 2Y34A 4U36A 5LB6A 2IXCA 1WA4A 4F3JA 5DDJ3 3VD5A 1MQTA 1S4CA 3BTZA 2BOJA 2J1SA 2OQ6A 4PJYA 2Y6JA 4RS5A 2DBIA 3RDIA 1SBDA 4URTA 1G9DA 1OA3A 2D3RA 1WLTA 3VBHC 3WP4A 2XVGA 1X50A 4WVMB 1C57A 2E26A 4TLGA 5AC93 4YZ4A 4B1MA 5DUWA 1F31A 1QJX2 2MPFA 2A6WA 1MZFA 3BALA 1HDKA 5D2AA 4AHYA 1XNCA 2Q8EA 4FTBA 1ZA4A 5GLUA 1MZ6A 4JZRA 1AYN3 5JAXA 4LBMA 4ARYA 4A6OA 1HX6A 4YZ3A 1MS4A 3CF6E 4AVCA 2BVVA 4LKFA 4P14A 4WM7B 2YC2A 1LENA 1H6XA 1YFYA 3NJXA 4UOJA 5GZGA 4H7LA 3P3PA 4HKLA 3MIFA 4PLNA 2R49A 2W1SA 1D4M3 2ZHKA 2MEV2 4QXCA 2WNUC 3NAPA 3IDAA 4NRQA 1AJOA 4PIZA 5FYCA 4ZHNA 5CYYA 1GFF2 1JZ3A 4P9GA 4GMP3 4XHBA 3R05A 4QB1A 3ENRA 3RVHA 4HANA 1Q3EA 4META 4XBQA 1LHWA 3H1MA 2GALA 3PUIA 4GKXA 2MEV1 2AEYA 1BLZA 1ZBA1 4QB2A 4IV3A 2W94A 2XPJA 4CXYA 2GU9A 5ISLA 1HV0A 4BA6A 4K8RB 2HWB2 2VMIA 1EUTA 1WCKA 2YBSA 2J7MA 5GLVA 2ZX2A 4TN7A 4XURA 1SACA 3N7KA 1AL23 2BZDA 3HNMA 3WW2A 1HXS3 1RMU2 2VO5A 4LBJA 3ZYHA 5E6HA 1RIRA 4B4QA 3WUDA 5AFEA 3NNJA 2EIGA 3THCA 2HWB1 4P02B 4UFKA 1ZZCA 4NHKA 1OQEA 4I0WB 5J09A 2PLV2 3MPPG 3RZZA 2CTVA 1SEFA 5F5IA 4DZGA 1RMU1 5FY7A 5F2WA 1POV3 2PN5A 2XR4A 2XGXA 2XUEA 1JUIA 4XFCA 4IEPA 1OURA 2WNOA 4QXHA 1KRIA 3CJXA 2PLV1 4GH4A 4LXLA 2V4VA 3BIEA 3D0JA 3PTRB 2QQOA 5DXDA 4YVWC 4IUGA 5A7WB 3VN4A 2MHFA 5EQUA 2Y0OA 3NV2A 1KDKA 5FY8A 5EP9A 5GKAC 5JLVA 2ID4A 3J7NA 3MV11 4K6BA 5FP7A 3RJ2X 4Q1RA 1LKNA 1T2XA 3AVRA 1V00A 4XF9A 4Y1YA 3J7LA 3RJRA 3UJOA 1BJQA 4E8CA 2VAUA 3KZ4C 4FT8A 3ZX7A 1K3IA 2WRAA 5H9QA 5LWBA 4YPJA 5FJHA 2ZABA 3B5LB 3AYCA 4NN0A 4GJZA 3ZYJB 2IXKA 5FREA 5FZ7A 1OKOA 2ES3A 1DZRA 1VMFA 1OI6A 1XYOA 2HLEA 3GCWA 2XQRA 2DCJA 2BWAA 2PAEA 2YYOA 1DQ5A 3UT0A 2WFF2 1NA1A 1V70A 2KD7A 3GBWA 3AYDA 3ILRA 3K46A 3WNLA 5BNPB 5LK5A 4AQ6A 4BK5A 4RQPA 3ZSEA 3VZNA 4YVSA 4OHYA 3ZFFB 2R063 3WF3A 3UKVA 1DF0A 5BNOC 4LTAA 1MQTB 4ZS3A 2R043 1Y4WA 2WFF1 4XUNA 1ZZ6A 4DB5A 2W3JA 5CEHA 1J3RA 4RS5B 4DXSA 5FLIA 1LNSA 2BFUS 2R0HA 4GA9A 2WA3A 4IE6A 2FDJA 4YW3A 4CDWC 2QQWA 4CEYA 3B01A 4BK4A 2Z42A 2ZGKA 3GHMA 3WOGA 3MEPA 5FY4A 3AMMA 2GNDA 3EBRA 4HOOA 4AR2A 1UPSA 1SCSA 3M8LA 4QB6A 4NPRA 4UI9L 2JIJA 1RUNA 4FO9A 4KBBA 1RL3A 4Q4V2 3OUIA 3OUHA 1YWKA 4JDMA 4DUXA 5I0SA 4XVHA 3C7HA 1G86A 3DN7A 4BIFA 1B35A 5M0TA 3Q8BA 2ZGSA 5FPZA 5FYMA 1JYNA 4CU6A 1RHI3 5A33A 2BYVE 2IXIA 4Q4V1 4CPBA 4J6GA 4JC1A 2PELA 1O8PA 1YNAA 4XZPA 5EHDA 5C6CA 1QMJA 2XJTA 5JPNB 3FX3A 5LEKA 5FZAA 3M3CA 1C8NA 3U14A 5CIRA 5FUNA 1DQ1A 4AEDA 1RYYA 3NAPB 2AZ5A 1NE6A 4K1YA 4NUBA 1WCUA 5K4LA 1OOPC 4K8FA 2BFUL 3CZJA 4WBBA 3GALA 3N7MA 3NKGA 5FZBA 3TN92 3BB6A 4GWMA 4HONA 4HZFA 4QXBA 2AR6A 1XYPA 5FV3A 1NKGA 4B29A 2RS33 1A34A 4IV3B 4L2NA 5JXGA 1K5JA 4QT6A 1WMXA 4OI2A 5FO7B 1UN1A 1YQ5A 3SISA 5FLJA 1MS1A 1VR3A 1JI6A 3TN91 4CUBA 2VMGA 4KWLA 3ZXKA 4AWDA 3MI8A 3M7AA 1JW6A 4IE0A 4IV1C 2GN7A 4CCMA 4QPGA 4XUTA 5IFPA 5JXIA 1IPKA 2J1VA 4DFSA 2YU1A 5T5PA 5CKQA 1GZCA 1REFA 3KV5A 2IXLA 4Y22A 1DFQA 1RINA 3VGIA 1REEA 3PVEA 5LRRA 5FOJB 1YIFA 2WUHA 3ZKUA 3U4XA 4QX5A 3VBOA 3KCCA 3OGSA 1H8TC 1UL9A 5JMCA 1O7FA 2F4LA 1CAXA 1C4RA 3VD7A 5C5TA 1KFUL 2WBKA 4GH4B 4IEWA 3WCRA 5C4WC 4LHSA 2C9AA 4JHTA 3H1YA 2A75A 3RFRA 3T08A 3WP6A 2QQVA 4QGMA 5C8CC 3WDTA 3T2QA 5K8SA 1QIQA 2DVFA 4QKDA 2O0OA 5T55A 1R083 4RYDA 1EYBA 1ZZ7A 3T1LA 5FZHA 3INAA 4WM8B 4QPYA 2QKDA 3WDVA 4INDA 2YZ4A 2VCMA 5HPOA 1QXPA 3OD4A 3ZXGA 3IWZA 3SKJE 4Q4Y3 4Y33A 1JYXA 5EXOA 4FQZA 5FY9A 5EJ1B 2JXAA 3V65A 1CONA 3BI3A 4FPGA 1IS4A 3IMMA 4BLJA 2R1BA 2Q8OA 1LOBA 3QACA 1ZVFA 1PM4A 3D5OA 3ZFEC 1IPSA 4WVVA 3FHIB 2X09A 1NA1B 3MIHA 1AJKA 3QOPA 1DQ4A 4IERA 1C28A 3GF6A 3LA3A 2WLPA 2JKBA 2RS52 4N53C 4RQPB 4NIHA 4YVSB 4XCBA 5DAVA 5C3PA 5CZKA 3W5NA 3DPRA 3BTYA 4XABA 1ND3A 4BQWA 1W0OA 5LBFA 1XU1A 4OYUA 3RSJA 1XNKA 3A22A 4XFIA 2IUWA 1A8DA 3D0SA 5J48A 4ITCA 1RUJ2 1NLSA 5J98B 2RS51 3E6CC 2WO2A 5FO8B 1OF4A 2BNNA 2EVXA 1SFYA 1ZREA 5DPNA 1NZCA 1W8TA 3VBRA 1WLWA 2WAAA 3NJVA 4I02A 1QJEA 3J9SA 2DWRA 2RS13 5I91A 1V6OA 2JDPA 1RUJ1 3S5QA 2G4IA 4R9DA 1YO8A 5BNQA 4RHV3 3A0NA 4AEJA 2H6CA 4IESA 4AVBA 2FDKA 1VMJA 1WCSA 2NPIA 4LHKA 2JEMA 2EIEA 2JDMA 1B35B 3VBFA 4AGRA 4DPNA 2VOXA 2AUYA 3POWA 4M3CA 1JOBA 4XTPA 4CU7A 5A33B 2PHWA 3L2HA 1GV9A 3C7GA 3I2IA 1D2QA 2E33A 3ETPA 3KVAA 4P08A 4ZKTB 1MVQA 2D44A 3VHRA 1AXKA 3I97A 4FPHA 5I0UA 3BU0A 2PYTA 2ZHNA 2WNVC 2XDVA 3Q8FA 3K3NA 3GM8A 1B09A 2OKXA 3WHUA 4AEDB 1H2MA 1UY2A 3AZYA 4P9WA 4FAGA 4ASKA 2P4EA 2XUMA 2VMDA 3O0VA 4LR4A 5I8SA 3E5UA 4Q5OA 4NWWA 4CCKA 3RZGA 2SBAA 4P9LA 3U07A 1GR3A 3PUAA 4AEKA 4BM8A 3LKJA 1D0GA 3D82A 1W9FA 2P2KA 4QPIC 3DYPA 1GICA 2XLGA 2WQZC 5FP4A 3LZZA 4KBZA 3A4UA 5FZMA 2E7AA 2JICA 5J36A 1FMD3 3MUY1 4W4ZA 4XUQA 2W92A 4QKBA 2Y0IA 4AK3A 4NROA 3OPWA 1N3OA 1G9AA 2VULA 1JOPA 4V2WA 5FY1A 1O3TA 2HWD3 1DQ6A 1IQDC 1COV2 3MUZ1 5HCBA 3VZJA 1SZBA 1JU3A 3AL6A 3U78A 3POIA 1GZWA 1LGBA 5DAXA 1M4WA 4QPGB 1QEXA 2A71A 2X5IA 3LGRA 3O1SA 5FZ3A 3NL1A 1TMF2 5CISA 5ANQA 1LB2A 2QQUA 3VHNA 4ZS2A 2O14A 1WW7A 4Y22B 4UW3A 2XJRA 5E89A 5KXCA 4HSJA 1RXFA 2FCVA 4CPBD 4O7XA 2B9VA 4HMZA 3S7IA 2VZRA 3AVSA 2OXBA 4V2VA 4YSFA 4YG3A 1TMF1 2AACA 4KG8A 1NQDA 1CAXB 4BDVB 4C1XA 1E5IA 3E1F1 2GMEA 1QJFA 4B8EA 2I45A 3VKNA 5KC5A 3IB3A 2B46X 2MNGA 2XJUA 1HKDA 1QY4A 4P9YA 2RE9A 4ASMB 1PNFA 2EXIA 3CU7A 3P3NA 4YWAA 4HPKB 2E9QA 2DYCA 3DEMA 5JOYA 2C26A 3KCXA 3LSDA 1TVGA 3AKPA 3ON7A 2E63A 1D2SA 4CP0A 5FZEA 1OMIA 4JGYC 1AX1A 3H3LA 5A3MA 4XFFA 2WSVA 3FUQA 5ABJC 4RSUA 5DUUA 2VZQA 1LOFA 4QDSA 1MS9A 2K2SA 4Q1PA 2ZX3A 2W1UA 1ZZ8A 3E5QA 4LKEA 4D6QA 5JPMB 3N9MA 4Q0VA 1CZVA 4LBLA 3FLPA 4AFMA 4L97A 2VQAA 4D6SA 1JOJA 1NY72 4LO5B 2WT2A 4UT5A 4K7JA 2WN3A 3VBSC 4BB3A 1XNDA 1JUHA 1TZOA 2LUWA 3WNMA 4AFAA 3DPRB 1N3PA 1C1LA 2EA7A 1ND3B 5D21A 4I09A 1GZ9A 3AZXA 4CP1A 5ACA2 5FR3A 1PK6A 4GALA 3KD4A 4OZXA 1NY71 4GB31 2JE7A 1VBA3 3ZYPA 2A1XA 4MG2A 3WINE 3TWIA 4CDUA 1G9FA 2W0XA 3I2DA 2GC0A 1K5MA 3H50A 1IZ3A 5FXWA 4M3CE 3VBRB 2QDNA 4XQDA 1QNWA 2VBDA 4R52A 1LEMA 1Y9MA 4IEOA 2W1QA 3WP5A 2JB4A 2HWF1 4LNVA 3ZYRA 3O12A 1YI7A 5FZOA 4Y1ZA 5CBLA 1GUIA 2HKXA 1SG3A 2IVIB 1QH7A 3O1UA 4RGKA 1RUG2 1NQJA 1VBD3 3ELNA 1HRI2 1ENQA 3CDZB 1OHFA 1X8EA 2JKXA 4LIUA 4M3CB 2CWMA 4CTEA 2VH9A 2QE3A 3EJKA 1N1TA 1OH4A 4BQ1A 3B00A 1RUG1 3SH5A 1HRI1 1QOTA 2PHDA 1MEC2 1HB2A 5GZDA 2XJSA 1OLMA 2ZMLA 3OJBA 4J1WA 5FJKA 1TEIA 4AI8A 2QZ3A 3M2MA 3PU3A 5F3IA 2A3WA 1YYNA 1JZ8A 4AVTA 3I3MA 2WWJA 4XQ4A 4CU9A 4OI0A 4GWNA 1EV13 4X8PA 2P3JA 1UW8A 2PQSA 2V4AA 3AM2A 5A32A 2WWUA 4XF3A 5D1IA 1O4ZA 3EQEA 3WVJA 4LK6A 4YYOA 4Q8KA 2ZACA 1HB3A 5LATA 3WG4A 1R1A3 2GC3A 5JMOA 1Q8PA 1AR82 3O14A 1FNZA 1W2AX 2CGOA 4ZY9A 5F32A 3T2TA 3ZFGA 1R093 4LA3A 4Y1UA 5CG8A 1UAIA 4YZ1A 4XZUG 4EWDA 3AMQA 2DV9A 2QQLA 3LB9A 2XWBB 1LECA 1QQP1 2X5IB 1WUVA 4FTEA 1AR92 4MVTA 2VZOA 5IVYA 3P1IA 2JECA 1A8MA 2VJXA 5CG9A 1AR81 4XXPA 3RRDA 1IS5A 3ZXDA 1H4GA 1DQ2A 4QMAA 2HEVF 2VCAA 2XJPA 1JYCA 1OKQA 1AR91 2JE8A 3LEMA 3Q8EA 2QUOA 2OQ7A 5TSWA 2BRTA 4PBOA 4AVSA 5HI0A 2WJSA 3I2OA 1UMIA 3WW4A 1K12A 2ARAA 3DGTA 1W8ZA 3AC0A 4FPEA 3NJZA 1X33A 4QX0A 3JB8A 3VD4A 3ACGA 2QQPA 1U5YA 5L73A 1NCQA 3KF3A 1V9U3 1DBNA 1ENXA 1GWMA 1PVC2 1VAMA 3ECQA 3TYJA 1AR62 2XOMA 2B5HA 3BPSA 1LU2A 3BUCA 4EJRA 2CSGA 3IMNA 1UIJA 3IZOA 1EAH2 1PO22 2XHKA 3ZDSA 2IZWA 1H1IA 2ARCA 4YRDA 5LA2A 3WP3A 4E9KA 2W1WA 5HCAA 1J59A 1FAYA 3T0DA 1S2BA 4N43C 4COZA 1DIWA 1AR61 1PVC1 4OFGA 5LW9A 2FDGA 3QBQA 3LF7A 2XBO3 4HKOA 4QAWA 1NLRA 1EAH1 1PO21 1F35A 3JBG3 4BQ5A 5CFDC 2ZGPA 1UYPA 3NSTA 4QQOA 3UGFA 4LBNA 2R32A 2P5BA 2YUEA 4TWTA 5CADA 5IWFA 3FWEA 1Z7S3 2EIDA 4DUVA 2WS92 3ALQA 2I74A 2C9KA 4CCEA 1PK6B 3QH7A 4QGLA 1O91A 3U0ZA 5LA9A 2JDYA 1O5LA 1VRH1 4B7EA 2Y6LA 4BQYA 4YFZA 4CDUB 2BGPA 4FPKA 2ZAHA 4RR3C 5DZFA 2YG0A 1E57A 1J83A 1ZM1A 2WS91 2X8KA 5IYYA 4RGGA 1H0BA 2B45X 5JI7A 3AL5A 4MXVA 4PDWA 5BV6A 1X8MA 2CL2A 1ONAA 4AZZA 2GMPA 5C3QA 1QJY2 4PHZA 1RUC2 5FZFA 1OBNA 4XW3A 3THTA 5FXXA 5BNNA 1ZRRA 1H9WA 1AF9A 3PNAA 3TEWA 2QQJA 2Y6FA 1LGCA 4XFHA 3C7EA 2JJ6A 2J1AA 3UKNA 1W0NA 1QJY1 2QVSB 1RUC1 3POEA 4IEUA 1CIYA 2GNBA 2HEWF 2X10A 2P3IA 5K9YA 5D8AA 1MZ5A 1LOGA 1FV2A 2JG9B 5EJZB 2WLQA 3WZ1A 1LGNA 3OG2A 3HQXA 5A80A 4K40A 2PAMA 3JU9A 3I59A 3WDUA 1CZSA 4AFBA 4YGDA 5FWEA 3HNYM 2PMWB 3QCWA 4COUA 1UYXA 3VD9A 3R4DB 5FPXA 5A32B 4JQTA 2LALA 4F7ZA 5F3CA 4OMCA 3RG0A 1W0PA 1JS9A 4NE9A 1RUI1 2DVGA 2VBPA 2OZ6A 3LA2A 1ULEA 2ENRA 1YIPA 2W2IA 4RFT0 4XJUA 4EE2A 5LA1A 2G9GA 2ZXQA 3Q8CA 1U12A 4GKYA 3ZFGB 1AUYA 1J1LA 2DUQA 1O6UA 2D6MA 4FOWA 2C24A 4L0PA 5JVVA 1XNTA 2TUNA 1J3QA 4W65A 5FZ0A 1AZDA 3I2JA 3RMXA 1UY3A 2A70A 4C90A 5A3PA 5BUVA 5A3OA 2PHLA 1JBCA 3SH4A 2YGMA 2JG8A 1DGLA 2P37A 4JAAA 2XG3A 1JYIA 1W8NA 4UFJA 3BGAA 4EQVA 5FFOC 4UFLA 3AP7A 2XL9A 4AG4A 4Q4W1 1LAJA 3FC0A 5J1XA 1QWRA 3ZDVA 4EN8B 4COVA 4BQ4A 3OSDA 5L9BA 3ZXEA 3E6BA 1VBB2 4J1XA 2BBAA 1FNYA 4KL1A 2Q8CA 4NRMA 4AQSA 3BCWA 4IE5A 1UY1A 3N35A 1ZBA3 4L11A 2O8QA 2TEPA 5T54A 3GYDA 1ULGA 3SEEA 1NCQB 5FKBA 3VBUC 1VBC3 1WLCA 3AXEA 4HK8A 5FYSA 3SEPA 1PX4A 5A1FA 2DVAA 3UNPA 1KDMA 4WVZA 3N9NA 1LR5A 3MLLA 2HBUA 3T3YA 4CE8A 4CEWC 1VBB1 2BNOA 1OD3A 4Y5TA 5IK5A 3LQCA 2A73B 3RNSA 4UFHA 3ZPYA 1QH6A 1CPMA 3DL3A 3HQUA 4A41A 4P9XA 1A3KA 4UAPA 4JHZA 2DURA 4N8MA 5HBAA 2HWB3 4WZFA 1ZRIA 4NHXA 2D97A 3NMBA 1XJAA 3ILNA 4NHMA 4CCDA 3RGBA 1T6GC 4XFBA 3I54A 3K4DA 5GM0A 4BE3A 2VCCA 3KT7A 1RMU3 5A3UA 4LT5A 2W46A 1VAVA 1U5XA 5A70A 1W8UA 5CFCA 2ZA9A 3SCHA 2VXJA 2GDFA 5FMOS 5FMBA 1QJX1 5CNAA 1G9BA 4FXKB 2WZR2 4XUOA 3H8RA 2R1DA 3NV4A 4JGZC 1PGW2 3VUOA 4ZPIA 3ZXLA 5JZGA 2HH9A 5A1LA 4D3WA 2N7GA 3HR9A 4LORA 4B4RA 4Y1VA 2ADEA 4IDZA 2G1MA 2VUJA 2WZEA 1DLCA 4PDWB 3J8F2 1F4AA 1SFNA 2WZR1 3DYMA 3QD6A 5C9AC 2XKPA 3DUIA 1PGW1 4IEVA 4S2GA 3BKZA 3MPBA 4FVVA 5BNNB 5H9RA 1W03A 2GN3A 4FPJA 1FPN2 5E88A 1UXZA 2AYHA 5FK7A 4LULA 4A7YA 3BIWE 2ZEZA 5FK8A 1NE4A 3NW4A 3J8F1 2PHUA 1S0IA 1WW5A 2ZGMA 3KT1A 4UBHA 4XETA 2WA4A 4AXOA 3O7OA 4A45A 2DBNA 2VM9A 3AJYA 4TLFA 1FPN1 2DU0A 5D8AB 1LHUA 2WWSA 3NKTA 2Q4SA 3MGUA 1DLLA 4MGKE 4FXGB 4A7KA 3D3AA 4LHLA 4IETA 2C5DA 5FMOL 4BISA 3PDQA 1PHMA 2VZUA 1VRBA 2RJ2A 3I59B 2LW8A 4W6YA 3VZMA 3GBGA 1A6CA 1W90A 2A3XA 3EYPA 3AP5A 5FY5A 5IW0A 3WQ7A 4DINB 1UU6A 4C1WA 1LHOA 5LRSA 5IVEA 1W39A 3UL2A 5A3WA 3VHOA 5FYBA 3ZIXA 2A5ZA 3FUOA 3W20A 5AC92 2VQTA 2IVJA 4JV4A 4E27A 1LCLA 5K0UA 3L9JT 4XJAA 3EHKA 4S2DA 4LHNA 5FQ0A 1EP0A 4MGSA 3TEXA 3H7JA 3LFMA 3M3EA 3MFCA 1GNHA 1GQGA 1JZ4A 3ZYFA 1W2NA 1BEV2 1OSGA 2R16A 2V09A 4Q4V3 2B42B 1IG3A 4O9EA 1N47A 2WT1A 3GDBA 2JG8B 3NNLA 4GZ9A 4WM7C 4NIIA 3WF0A 5IVVA 1DZQA 1VPHA 4K20A 1M06G 3ZXFA 4G3YC 1UNBA 1CIWA 1YC61 3ZXAC 1US3A 1OA2A 2EXHA 4WZCA 1IG0A 3ZYBA 1BEV1 5GJ6A 2IC1A 4H7MA 3RPQA 2PAKA 2FZ2A 3NWKA 4AOCA 1DG6A 5FKCA 4HK9A 5FYUA 4I3PA 3W9AA 4DS0A 1Y9QA 3H8UA 3KMHA 1OLQA 2JDKA 2OUJA 1HJFA 2JWPA 5FYVA 4F83A 1PIV2 1AYM2 2GNTA 3OBTA 4C0BA 1XXNA 4WV8A 5I93A 2YB7A 4L8QA 3FJSA 2EXJA 4LJHA 2YROA 4BPZA 4Y4YA 2DVDA 5IFTA 2CAVA 4GMP1 4XIKA 2VUCA 4YZ2A 1YRZA 1RUE3 2FHRA 3ROUA 3OBAA 1PIV1 1AYM1 2WN2A 2XJQA 5FUPA 3S0MA 4GXLA 5JXHA 3POBA 1E5RA 2YHJA 1XNAA 4PBPA 2Z4FA 5B4XA 1W05A 2GC2A 3CQOA 3AJZA 3MF9A 2BTVC 4Y4RA 1NCRA 4NIGA 4FOVA 2B4KA 2ADDA 3H3UA 1FT9A 4OLLA 1WBLA 1TME2 3W5MA 3WNOA 1ND2A 1UX7A 5CFCB 2K0GA 1FYUA 3JUUA 4S2HA 4CDQA 5LA0A 3NQHA 1POQA 1UKGA 2YFZA 3HWJA 3C3VA 3LDBA 4ZONA 2C4XA
chains in the Genus database with same CATH topology
1VP6A 3Q9OA 2Z69A 5JZGB 1CAWA 1TME1 4ZU7A 1UIKA 5KXDA 3ATGA 4AFDA 2C1FA 1QKQA 5IK4A 5KBFA 3IN9A 4H14A 3CJIA 1O3QA 3AP6A 4Z1VA 1UU5A 3LCPA 1N1VA 1NOVA 2NZ9A 1IS3A 5BNPC 3ME2A 1BMV2 1C8M2 3LOIA 3ZFFC 1PO12 2NMOA 4OUSA 4OI1A 1MQTC 5ABJA 4EN6B 2TBVA 1QOSA 4RS5C 3UKTA 2DFBA 1MS5A 1BMV1 3D4KA 1C8M1 3H9AA 3DV8A 4HFSA 3RS6A 5J7MA 1PO11 4AYUA 1ULDA 4W6XA 4XQWA 3ZSJA 4BOWA 1SBFA 4M3CF 3IM0A 4YGBA 1SCRA 2ZHLA 5JIAA 1QGLA 2UU8A 3V64A 2PTMA 3PLQA 4YFWA 5K0UB 1YCIA 5FQ0B 3M4FA 1VB2A 2YXSA 5T5OA 1UF2C 5H9PA 4UW5A 3OCPA 4MGIE 3X29B 2P34A 4QXKA 2DCKA 3GNEA 1QDCA 4IL7A 2IFWA 1XE7A 2BWCA 1U0AA 2VU9A 2WIIB 4QQLA 1RHI2 4YW1A 1Y3TA 1SBEA 1YUDA 2ZCWA 3NAPC 4XF0A 2VNOA 1KS4A 3IDCB 4V1PA 4BLIA 3B9IA 4PF5A 3LWCA 1RHI1 5FO9B 5KHJA 1LHNA 2PQQA 4U2AA 4XPVA 4EV0A 5H9SA 1JTZX 2PFWA 4IV3C 4R4ZA 3B94A 3I8TA 3R0RA 1URXA 4L92A 4MV2A 1BVVA 1D4VB 1GKBA 3VDDA 3WDXA 4M00A 1HW5A 1FV3A 1U5IA 2RS32 1I6XA 1CD3G 3WG3A 3ASIA 4ZXKA 4CEYB 1XU2A 1UMZA 2FQPA 1HQWA 4TYSA 2RS31 5KC6A 4LUMA 2D6LX 1S55A 1G6NA 2VVFA 1NCRB 3ZSKA 4FCAA 1HRV3 5GLWA 4DNYA 2PHXA 1WD3A 1F2NA 5JCTA 5LEJA 1ND2B 5GZCA 3VLBB 1VJ2A 4HSLA 2VQ0A 3WT3A 4C91A 3MW4A 1SDWA 4GH4C 4CDQB 4YARA 4YFZA 1LODA 2GH2A 2JD4A 4E4SA 3ZIWA 1QU0A 1AR72 4PQ9A 5FCCA 1FX5A 2HWE2 1CAWB 1S1AA 3WG2A 2ARXA 1DYKA 2RR12 4WM8C 5I8YA 1W6NA 3IBMA 5IK7A 1A78A 3CJIB 1AR71 2KA3A 1U5ZA 2HWE1 4YGEA 3T1MA 3WHTA 5KXBA 1YHFA 2RR11 4OI4A 3B69A 4FPYA 1WLDA 3KGZA 1PZ8A 1NA1C 5EYXA 2VVDA 4RQPC 3D8CA 4YVSC 3SH3A 2ET1A 2VUAA 3J4UH 1BYHA 1MS8A 2P17A 4FPLA 3WUCA 1LESA 4GB33 4D94A 2YY1A 4XBLA 4CDXA 2RM23 3BODA 3VKFC 2KM2A 1COV1 1GLHA 1HQNA 2WFPA 5DUVA 4MLOA 3VBOB 2HWF3 4LA2A 2VOWA 3HN1A 4ISQA 4PIYA 3CNAA 1G9CA 4KNCA 1CN1A 1Z0HA 3RI8A 1WMFA 1GYKA 1BBT2 1H2KA 3AMHA 1B35C 1QOOA 2D40A 3VZLA 4I0BA 1QHDA 1RUOA 1S0GA 5L7OA 3ZN5A 4YG6A 3JD72 4NVPA 1MZEA 2C0ZA 1DGWX 1JH5A 1LULA 1FOD2 4HVOA 4N90A 3IT8A 2RJKA 4JDOA 1BBT1 4CRQA 4MGZE 3B9CA 4AEDC 1ASJ2 1EPWA 2QCSB 4ES9A 3JD71 1I1EA 1RUD2 2UWBA 3N7LA 4M0HA 3GBFA 1FOD1 2CYFA 4PLOA 3WLUA 3IKWA 2IFRA 3LOBA 4LUKA 2BBVA 4YGCA 1UKRA 2D6KA 1ASJ1 4GIQA 4D7YA 1RUD1 3VDDB 5FDBA 2ZS6B 3MIDA 4Q4X3 1AX2A 3K51A 3ZMOA 3ETQA 1FMD2 4GULA 4COWA 2KXLA 1F9KA 4ZU4A 1QQP3 4QPGC 1X82A 2OPKA 2DCTA 2ZHMA 4NO4A 5ACA1 1AR83 1QJU3 4MXWA 5AFBA 1FMD1 1UU4A 3MLKA 5BYNA 1C5IA 1OQDA 3OTFA 2V73A 1V6JA 4LEJA 5KHHA 3RQ0A 4YW2A 1AL0G 1AR93 4UW6A 4YW5A 5JSRA 2XWJB 4XBNA 3KM5A 4R9BA 5BXXA 5AVAA 5F6LB 3VBFB 5GLZA 4DOUA 4XYXA 4AI2A 5T3NA 5IT6A 1Q5OA 2LM3A 3SXWA 1NYWA 3U11A 1S0EA 4Y20A 4E2QA 4Y26A 3WQ1A 3B3QE 3FBMA 1W6NB 4YW4A 1APNA 1FXZA 2R073 2W39A 2A6VA 2ATFA 1AR63 1PVC3 1MEC1 5SV5A 3WD5A 4BYYA 3W59A 1IHMA 2OW4A 5IK8A 4K1ZA 3WV6A 1EAH3 1PO23 3RMYA 2GSYA 2ZTNA 4KU8A 4HVRA 1DHKB 4FTSA 2CWSA 2DTYA 3DPRC 3AYAA 1BCXA 2EF6A 1ND3C 3A0KA 5F5QA 1GZWB 3VBHA 2FMYA 1N3QA 1CGPA 2F6BA 5EJ3A 1VRH3 4CDXB 3R4UA 2RMU2 3M3OA 5KHIA 1H2LA 4XJ9A 2WS93 3VBRC 5DUXA 3B02A 4BMBA 2ET7A 3PJQA 1OA4A 4XMIA 1KJRA 2QNKA 2RMU1 1RUF2 3MDPA 2HWC3 3N36A 5E16A 3IDBB 1NXD1 1AXYA 2AENA 4HLTA 5L7OB 3FMGA 1RUF1 1QJY3 2WNUA 1RUC3 4M0NA 1JHNA 3ILFA 1SLAA 2H0BA 4K3UA 2YDEA 2HJIA 4KWJA 3VL8A 3NV1A 4I0AA 1VB4A 1WCDJ 2RHPA 2Z2SB 3V56A 1RVF2 1FI2A 3O0XA 2UURA 4ISRA 2E7TA 2IXHA 3TNQA 2A6ZA 4XF4A 1RUI3 1V6MA 4YG0A 4IQPA 1RVF1 3ZN4A 4MSVA 4UBGA 3EXUA 2VNGA 1LEDA 2TNFA 2WT0A 2XKOA 2ZZQA 4A7ZA 4JTOA 3APBA 1BQPA 2X5IC 1K5MB 1R092 1TNRA 2P3KA 2D93A 4MXWB 1H2NA 2ZMKA 2A3YA 4Y5Z0 4NR1A 4MX3A 4Q4W3 4C0HA 1R091 3TOJA 4YVWA 2XB6C 3KQRA 4BZ4A 3ST7A 3KB5A 2ZKNA 2D5FA 2SLIA 5FTTC 4XMAA 5DZEA 4RL7A 1W6QA 2ZKLA 1BK1A 1SLTA 2YGLA 4Y20B 2BEOA 2XLAA 3ACLA 3AZZA 4QHBA 3OYWA 4ORFA 1W6OA 1WMDA 1CJPA 2ZMNA 4A2UA 2IWGB 2QFEA 4GMP0 1TQ5A 4KGQA 1ZYBA 4D7TA 4R9CA 1RUH2 2B39A 3CLPA 5FOBB 4PLMA 5BNOA 1V6LA 5T52A 3I4IA 5DZGA 4XHXA 1O3SA 2PA7A 3JBG2 3VHPA 1F8VA 5HXVA 1G8WA 3HMYA 4HETA 4CDWA 3IDEA 3VBHB 1PK6C 1QJX3 1RUH1 2VOKA 1ZBE2 4QQHA 1SLIA 4CDUC 3PMEA 5L36A 1WMEA 3V0AA 3K48A 4FP3A 3JBG1 4Q26A 3L2YA 4CYDA 1J58A 1IPJA 3PVNA 4LO6B 2NMNA 3S6PA 2ZGTA 4Q29A 4AGVA 1O3RA 2E51A 1ZBE1 3AFKA 4AW7A 5CVRA 1POV0 3AKTA 4LO8A 1GANA 1IKQA 2MEV3 1VBE2 1ALYA 1GNZA 1UX6A 1KITA 4JRAA 3SCFA 3ZSLA 3KS7A 3SITA 2B7YA 2GH8A 2VW2A 2WNUB 1OOPA 1VBE1 2BUKA 2DUOA 1ULFA 2JG9C 4DY5A 3KGLA 3PTYA 4AHZA 4PCRA 1W2UA 1N1YA 1F5JA 2VG9A 1QF3A 2ZZJA 3KT4A 2QZ2A 3MIBA 1H8VA 1LHVA 5BNPA 3WX5A 1CVNA 3AZWA 4Y24A 3ZFFA 2DCYA 2JENA 1KQRA 1MVEA 5KHGA 1YFUA 2D7FA 1J3PA 4IV1A 4R4XA 3HT1A 2PLV3 1ZRFA 4KWKA 3ZFGC 4HBNA 3PVOA 4KU7A 3WR0A 3N3HA 2JE9A 2NQYA 4Q0SA 4K21A 1OFNA 1H8TA 3AZVA 4AF9A 3RYPA 3MIGA 2VW0A 1BEV3 2A6XA 5C4WA 1UCXA 3RYRA 4XILA 4YVWB 5C8CA 2ARBA 1CESA 3GZUC 2O1QA 1CJDA 3CO2A 3TNPB 3OPZA 2Z5WA 3M3IA 4YM1A 2JDZA 1SLLA 1W6QB 2EAKA 1NCQC 5JSPA 2D6NA 2H6BA 1C5HA 3HAGA 1RTVA 4FPFA 1ZBA2 5JR7B 1DYPA 2WFF3 1WW6A 1VBC2 3OYWB 3ZFEA 1W6OB 5DDJ2 4E2SA 1KJLA 3G6JB 1PIV3 1AYM3 1PVXA 1PM7A 4N53A 1RJ7A 3TB0A 1VBC1 5T5LA 4EN0A 5BNOB 5DDJ1 5KWRA 4AVVA 1Q8SA 4CDWB 3USSA 1KXGA 2V5YA 3FE5A 2D3PA 2W52A 4D69A 5EWSA 5AC91 1AYN2 2FBEA 3V0AB 1VLNA 1TME3 1LOAA 4IEYA 2HEYF 3S7EA 3PJYA 1IQAA 1REDA 4PDWC 4JDNA 3WDYA 2BQPA 2ZJCA 2ZGQA 3SHRA 1AYN1 1D4M2 4LBOA 4LLOA 4BWOA 2OVUA 4WVWA 2Z79A 3HBZA 3G7DA 5BNNC 3R4SA 4QGNA 2UYBA 5IUQA 5EFUA 2UY8A 2CNAA 3QH6A 2WNVA 4IEQA 1SLCA 4WM8A 4G4FA 1LOEA 4FOQA 1D4M1 1ENSA 3CL1A 4OHVA 4IEZA 3QLQA 3TN93 1AHSA 1OOPB 5D8AC 3V0BA 2W08A 4UXAA 4QPIA 1QJZA 4MYEA 3UJQA 5JOWA 2UWAA 1VIWB 1C8M3 1H1MA 1AL22 1XQNA 1HXS2 4ATFA 1PO13 3JQXA 4AHWA 4OHWA 4L9BA 5EYYA 4Z82A 1O4YA 4I30A 2IXJA 1WW4A 1DDLA 2OIIA 5FBZA 1YJKA 1V6IA 1RJ8A 3N7JA 5GZEA 3UK9A 1AL21 2XH6A 1CAVA 4IV1B 4AI1A 1HXS1 1ENRA 1D0HA 2JX9A 1RITA 3URFA 2Q0AA 1YFWA 4YM3A 1SLBA 2YPJA 3B93A 1BVP1 5J37A 4Z92B 2GC1A 2ZX4A 3H0OA 2Y26A 2JG8C 1HV1A 3AYEA 1H8TB 1POV1 4N9IA 3WQ0A 4EN7B 5K7PA 2GNMA 3AX4A 3WDWA 4X6QB 3GZAA 3VZOA 2H0VA 4N9HA 5C4WB 1ULCA 1ZX5A 4OULA 3S30A 3KLSA 1CX4A 1C3HA 1R1ZA 2D43A 5C8CB 5A3LA 5EV7A 3ES1A 3BTAA 4R9AA 2A7AA 4RD7A 1PMIA 1QNYA 4B3NA 1PNGA 4LBQA 4F8AA 3ZSMA 1BZWA 4JGYA 4XIOA 4HL0A 3OY8A 4TZDA 2G9FA 2X29A 1DQ0A 2B9UA 3M70A 4B7KA 1F5FA 3AP9A 1LJ7A 2R062 3ZFEB 2NM1A 4NOTA 2RS53 4KH9A 2CV6A 2R042 4QM8A 5JOXA 4N53B 4XOGA 3VBSA 5E1RA 1LTEA 3LSEA 2WC2A 1RUE2 4S2FA 1XYNA 2R061 1RUJ3 2Q5TA 1OD5A 2WKKA 1IKPA 2R041 1JXNA 5GZFA 1QXRA 1JN2P 3WW3A 5T5JA 3MICA 1NG0A 4JRLA 2ILMA 5CFCC 1RUE1 1RC6A 3RYKA 1L3JA 3MW3A 5JIUA 5J3UA 4OHXA 3VV1A 5JZGC 1SQ4A 2VXRA 5J96B 3AXDA 4ATEA 1UZYA 5BPXA 3E97A 1AR73 1WGPA 3MW2A 4XTMA 3I7DA 2HWE3 3AMNA 5T50A 2RR13 1W6MA 4YM0A 5C8WA 2XVLA 3H7YA 4HPKA 5DG2A 4YZ5A 1CR7A 2WNVB 1NXMA 1QXJA 4MGYE 1PZ7A 2CGNA 2R0FA 2AREA 2ZPXA 4NWVA 3SCGA 1Q8VA 2D3SA 4JTNA 3V0BB 5F9TA 5JOZA 1G7YA 1LRHA 1S0FA 4QPIB 1DZTA 4I01A 3FBYA 4Q8LA 1BKZA 1COV3 2VMHA 2D5HA 2XLFA 4AHXA 1DGRA 1WD4A 3SLIA 2HYKA 1WBFA 2VY0A 1TMF3 1UZZA 1I3HA 1CAVB 5JSOA 1UPIA 3OGGA 5K0UC 2Q1MA 3OBRA 1X7NA 4MUVA 3PMSA 5HCFA 1EY2A 4DRVA 3VZKA 4PIXA 2ZBJA 3RWNA 1VAKA 2NN8A 4Q27A 2F4PA 4XFGA 3CEWA 2ZAAA 1BBT3 1AVBA 1R082 3IPVA 1IOAA 2OA2A 2DUPA 2OUHA 1MACA 3JD73 2PHTA 4Q4Y2 5F1RA 4RA0A 1RGSA 1FOD3 2D6PA 2NYYA 3AKQA 3JQWA 4LBQB 1R081 3HIFA 5E8AA 2DTWA 1Q43A 1ASJ3 4H3WA 4XEZA 1S2KA 4E4DX 4JGYB 1RUD3 3FZ3A 4Q4Y1 3OY8B 1EPZA 2CAUA 5ABJB 3ZMNA 4FSJA 3KSCA 4DY3A 2RJLA 4N43A 4KG0A 2VOVA 2LTNA 3BOWA 2Q30A 4LO7A 4XJ8A 2FZ1A 2VGDA 3THPA 4CEYC 5CFDA 1MR5A 3POYA 3VBSB 1LU1A 4D7SA 5ACA3 2BGCA 2GAUA 2GMMA 5FLHA 5I0RA 3ZO0B 2O8OA 1NCRC 1PGSA 3LA7A 1IS6A 4QU2A 1OPOA 2EAAA 3JZVA 4AGGA 2RS12 5JDBA 1H9PA 3JB4C 2PHFA 1ND2C 3MZHA 1S0JA 4RR3A 1ZNPA 3W58A 1HRV2 5GALA 4GQ7A 4RHV2 3VKOA 4FPCA 3WXPA 1HIXA 5I0TA 4CDQC 1SMVA 4CZSA 5JI9A 2XVKA 4HN1A 4CP2A 2WNEA 2ETEA 3WCSA 1RUG3 4FQ4A 1I9RA 2RS11 1PGL2 1HRI3 3FLRA 2A6YA</