4UW4A

Human galectin-7 in complex with a galactose based dendron d2-1.
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
133
structure length
133
Chain Sequence
VPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVRIF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords GALECTIN-7
publication title Structural Basis of Multivalent Galactose-Based Dendrimer Recognition by Human Galectin-7.
pubmed doi rcsb
source organism Homo sapiens
total genus 30
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4uw4A00
2GMEA 1OFSA 2WT2A 2ZACA 3D5OA 4YW2A 4YG3A 4FOQA 1JYIA 3AZYA 3SH3A 3LSDA 1CPNA 2YY1A 4YW5A 2ZKNA 4FPEA 1FAYA 1VAVA 1YYNA 5DUVA 2UU8A 1H30A 5KXBA 4K1YA 4AVVA 4BM8A 3MW3A 1MS1A 1JN2P 1W6OB 4YGCA 2CTVA 1SFYA 4PBPA 3AFKA 4M3CF 1O4YA 3W58A 2ARXA 1PZ9A 4Y22A 1BYHA 2FHRA 3AYDA 4AVTA 2ZGNA 1H9PA 1GZWA 5F5QA 1C4RA 5GLVA 3ATGA 4XJUA 3N7JA 1HDKA 1AX1A 4LBMA 2V73A 1CPMA 1DHKB 4XXPA 2D6NA 5GZDA 3QCWA 2LTNA 1URXA 2DU0A 1UPSA 5IK4A 2FMDA 4RL7A 1V6JA 2UWAA 2R1DA 3FUOA 3N3HA 3POSA 3OYWB 2JDZA 4YW4A 2UWCA 1SCRA 3NV2A 1V6LA 2AYHA 3N7KA 3WUCA 3ZSKA 1DYKA 3AYAA 4P9YA 3POYA 2NZ9A 3KM5A 1GZCA 3LCPA 3V65A 3ZSJA 2C9AA 2P37A 2ZHMA 4XJ8A 2ZGLA 1APNA 5GZFA 4FPFA 1QU0A 3ENRA 2D6OX 1C1FA 4ATFA 4YFZA 3WNXA 1LOFA 4FPLA 2GN7A 1ZA4A 5HCFA 1QOTA 3DGTA 1LHWA 1YI7A 4P9XA 2H0BA 4Z8BA 2P2KA 3M1HA 4WVVA 3OBTA 3T2TA 3AXDA 2DVDA 5T54A 4XMIA 2DVBA 2R16A 2A71A 3A0KA 4AGGA 3L2YA 1N47A 1BQPA 4U2AA 1LULA 1S1AA 5SV8A 2EXIA 1LOGA 1SLAA 1A78A 1D2SA 5IK8A 2C5DA 2DU1A 1LOFC 2PHTA 5JOWA 4LBOA 1NLSA 1IS4A 1WW7A 3NV3A 1QKQA 2VY0A 2YZ4A 1W6NB 3WHUA 1ENRA 1XQNA 3APBA 4RA0A 3VKOA 5EWSA 4FPYA 1S0JA 1Y7BA 3AYCA 1LODA 1DQ1A 1DQ0A 5DUWA 3IKWA 1W6MA 1VLNA 3OJBA 4FPOB 4FPCA 3WZ1A 3SITA 4Y20A 2XB6C 3ILFA 1N1TA 2DUQA 1Z78A 3M3EA 4XHXA 5AVAA 1F5FA 1G9DA 4DRVA 1GBGA 5CA6A 4XDQA 4FPJA 3VKLA 5T52A 1GZ9A 4XHBA 2D6MA 4P14A 1MS0A 1CQ9A 4ATEA 4XE9A 1W6PB 5GALA 3V64A 2E7QA 2GDFA 1C1LA 5GJ6A 4LBNA 1QOOA 1ULDA 4FPKA 4YZ2A 1DFQA 1YXWA 1LOCA 1MVEA 1H9WA 1Z0HA 2DTWA 3B01A 3FFZA 3OPZA 3WDVA 1OKQA 1WLCA 1AZDA 5DG1A 3DUIA 3WDWA 2ZABA 4K20A 3ZSLA 1AF9A 2JE9A 2ZGQA 3N35A 4BMEA 2WJSA 2D7FA 1KDMA 2HYKA 5GLUA 4Q8LA 3WV6A 1WBFA 1JHNA 1GNZA 1CR7A 3BOPA 2VXRA 1LJ7A 1UZYA 3WUDA 4WVWA 4Y1YA 5KXCA 1FX5A 1SACA 1BZWA 1PZ8A 1LEMA 4K1ZA 4OZXA 3V0BB 1LGBA 3V0AB 2AREA 4R9CA 3OY8B 4DQAA 3PJQA 1G7YA 1SLTA 4XJ9A 3ZXFA 2CNAA 1WD4A 2R0HA 4BMBA 1HQWA 4I30A 1IKPA 1ENQA 2E51A 3WOGA 1KDKA 3RG0A 3R05A 1FYUA 1DYPA 2NMNA 2D43A 3N7MA 3HR9A 4LBLA 2CYFA 2WLQA 2P3KA 1CVNA 5DZEA 3UK9A 1MS8A 5EYYA 2AR6A 1SBEA 1X50A 4FQ4A 2VU9A 1JYCA 5H9QA 5T50A 3O5SA 1BJQA 1Q8PA 1QNWA 2ZGOA 5T55A 1N1VA 1LTEA 5JVVA 1Q8VA 3TB0A 1UZZA 4LBQB 3RMYA 3C2UA 3WCRA 3B3QE 2ZMNA 1RITA 3ZXLA 2VUAA 2D44A 4Q8KA 1LECA 1GSLA 4AGRA 5T5OA 4XBLA 5EXOA 4YGBA 4F83A 3JUUA 1MS5A 2A7AA 2W39A 2XG3A 3IN9A 4Y1UA 4YW3A 1G86A 2NM1A 3AYEA 1WBLA 5DG2A 3ZVXA 2OUJA 1IOAA 2VW1A 2WSUA 2A6WA 2A6YA 3WLUA 5JOYA 1G9AA 4YLZA 1ULFA 2CY6A 3JU9A 1JXNA 5E89A 2YMZA 5GLZA 4L8QA 1MS9A 3WG2A 3SNMA 3WDUA 2YXSA 2JE7A 1DQ5A 4M3CB 4Y1VA 4XYXA 4K21A 2ZZJA 3AZZA 4HL0A 4LBQD 1IS6A 1FV2A 4BLIA 3H0OA 3ZXKA 1DBNA 1G8WA 1LU2A 2D3PA 2AH2A 2P3IA 4Y24A 5GM0A 1N1SA 1A8DA 1W6QB 1WW4A 2NN8A 2PELA 2SBAA 5DXDA 1V6KA 2ZHLA 4XBNA 1AX0A 1FNYA 4FVVA 2ZHNA 2ZA9A 1W6PA 1MR5A 2DVFA 1D0HA 1GV9A 4XIOA 4YM0A 1U0AA 1V6OA 1V6MA 1ONAA 1C57A 1UAIA 3AP7A 3O0WA 1AJKA 4ITCA 1S0CA 2EXHA 1BXHA 3SH4A 2GN3A 2ZBJA 1BKZA 4GA9A 3GALA 3USUB 2ZHKA 1CN1A 4C1XA 2V5YA 4YG0A 1LU1A 1LOAA 2A3WA 3KQRA 5IUQA 2ZGUA 2GALA 3M3CA 1Q8QA 5JOXA 4FP2A 4XTMA 4Y22B 4BLJA 3AZVA 3R4SA 3VKMA 1G9BA 4JCKA 3FLPA 2GNMA 4FOYA 3QLQA 3RMXA 1DQ4A 3M3QA 1AXZA 2ZGTA 3RSJA 3V0BA 3V0AA 4W65A 2OW4A 3OY8A 1SLLA 5HCBA 1NXD1 3FUQA 3RRDA 1QDCA 4DFSA 2D6KA 3IMNA 4JC1A 3IPVB 1F9KA 4JRAA 4GKYA 5E88A 2EIGA 3W59A 1I3HA 2NYYA 3M3OA 2OVUA 4XZPA 1MZ6A 3FBYA 5LK5A 2AUYA 1S0DA 2EAKA 2WT1A 3AP6A 4GXLA 3PVEA 4M3CE 1WCSA 4XJAA 1W6OA 1LHNA 3MW4A 2ZGMA 4GKXA 2A6VA 2PHUA 5DZFA 1QOSA 3O0XA 4UW3A 2W52A 2PHXA 4YM1A 1O4ZA 4XILA 1UN1A 4FPGA 2DWRA 1LESA 1QDOA 3CNAA 4PBOA 4LBQA 5L73A 4GWNA 2CWMA 4XXAA 1LHVA 3RS6A 5GZGA 2OUHA 4MYEA 5E8AA 1RINA 3O0VA 5JDBA 1MS4A 2CWSA 3O12A 1S0IA 5DUXA 3VKFC 1EPWA 5CNAA 1N3QA 1OQ1A 4XTPA 1MACA 4AVSA 3WDYA 4HANA 3OYWA 4UW6A 1N3OA 2DURA 2P34A 4ISQA 4LBKA 4AWDA 1CONA 1UKGA 1WLWA 2A6XA 1AXYA 1HKDA 1G9FA 2ERFA 1IS5A 3OBRA 1I1EA 4AYUA 1F31A 4KBBA 4BOWA 2PHWA 5GZCA 2YROA 2AENA 3OGGA 1QMJA 4XOGA 5GZEA 2P3JA 4M3CA 4BQ1A 4DRRA 1KJRA 4LBJA 2JD4A 4XIKA 2WNEA 3AX4A 2GNTA 3NV4A 1B09A 3A4UA 3Q9OA 1LHOA 3NV1A 1YO8A 4YZ1A 1CIWA 1W6QA 2W68A 3T1MA 4AGVA 4TZDA 1RIRA 2KM2A 5CB7A 2RHPA 2A3XA 4YG6A 4UW5A 4IQPA 3PVNA 3BIWE 1AVBA 3AP5A 5KXDA 4Q27A 3AP4A 3M2MA 5FRAA 1GANA 3AP9A 3AZWA 2E7TA 4Q2FA 2SLIA 2ES3A 4D69A 4Y1XA 3VUOA 2ZGRA 3BODA 3USUA 4YGDA 5IK5A 4FOVA 5IK7A 1V6NA 3SH5A 2ZAAA 4SLIA 5F9TA 3LSEA 3B69A 4XJZA 2DYCA 4YM2A 2WQZC 3WHTA 3INAA 4CRQA 1W6NA 2ZMLA 3AZXA 2DVGA 3NWKA 3T1LA 1KITA 1SBFA 2CL2A 3A0NA 4M01A 3TAYA 3WG4A 1UX6A 4YFWA 1JUIA 3WVJA 4NO4A 4GALA 2R0FA 1ENSA 4YGEA 2GNBA 1R1ZA 2AGSA 2PHFA 2ZGKA 2LALA 1IS3A 2NMOA 3POWA 3B00A 3VV1A 3WCSA 1ULCA 4R9BA 3AJYA 3B9CA 4ZXKA 1AJOA 2A70A 2ZGSA 3VKNA 4C1WA 1LEDA 4BPZA 1SLBA 1GYKA 4FPHA 3WDXA 2NP0A 3ZXJA 3I8TA 1FNZA 1QF3A 2VH9A 3HN1A 3IPVA 1LOBA 2EXJA 3ILRA 4YW1A 3FLRA 2GMMA 2R1BA 3I4IA 4TYSA 2JECA 4NOTA 5CBLA 1G9CA 4Q1RA 1FATA 4Y26A 3N36A 4YZ4A 1DQ6A 1FV3A 1GLHA 2PHRA 1VAMA 2DVAA 2E6VA 2ZMKA 1JOJA 3UL2A 1S0FA 1MVQA 2A75A 3HMYA 3MEPA 1WW5A 3PMEA 4P9WA 1S0BA 2BQPA 2EXKA 4GWMA 1LCLA 2ZGPA 1LGNA 3MPPG 2DV9A 2YV8A 4PCRA 4FP3A 5H9SA 2VW0A 2Z42A 4FOWA 3U4XA 1DZQA 3PVOA 3ZYPA 5KXEA 3AJZA 1GZWB 1MZ5A 1Q56A 2D6PA 3MW2A 1GICA 4YZ5A 1KQRA 1YRZA 2UWBA 1A3KA 2DUOA 1CESA 2D3RA 1QNYA 4Y1ZA 2WKKA 3UJQA 1W0PA 1WUVA 4FQZA 1N3PA 5H9RA 3ZXEA 1S0EA 5T5JA 2WSVA 1DLLA 4ASMB 1PZ7A 2EF6A 1SCSA 3AK0A 2A3YA 2EALA 3ILNA 2B7YA 1GNHA 2DTYA 1SBDA 2GNDA 4U36A 3D4KA 1DGLA 5JOZA 1UMZA 2E53A 5CAZA 4YZ3A 5JLVA 1ZM1A 1J1TA 4CTEA 4PQ9A 4XBQA 5DZGA 5HCAA 1LENA 2Q5TA 2UURA 4PF5A 1JW6A 3RQ0A 4Q26A 2G4IA 1UL9A 2JJ6A 1SLIA 3WDTA 5GLWA 1GKBA 1QGLA 1Q8OA 3SISA 1TEIA 1DQ2A 2DUPA 1IKQA 1LOEA 2JKBA 3WG1A 4CZSA 4ZKTB 4DPNA 2ARBA 3AXEA 3WG3A 3R4UA 5JMCA 1SLCA 1ULGA 1W0OA 2A6ZA 2R49A 1MS3A 4WZFA 4Q1PA 1N1YA 1VALA 1WW6A 1YIFA 4R9AA 4WV8A 4XJWA 3N7LA 1WD3A 1VIWB 1JBCA 1LHUA 3ASIA 1V6IA 3UJOA 2W08A 4YM3A 3FLTA 2TEPA 3IM0A 1KRIA 4UW4A 3ZPYA 1AXKA 4R9DA 1ULEA 5H9PA 1CJPA 1Q8SA 5EYXA 5T5PA 1DIWA 1HQLA 2D6LX 2VW2A 1AX2A 4H55A 2GMPA 4XMAA 3BTAA 4M00A 3ZSMA 4DS0A 5DUUA 5IT6A 3D6EA 1WLDA 1S0GA 2ENRA 3GNEA 5T5LA 1LGCA 2I2SA 5FREA 3ZYRA 3SLIA 1HLCA 1W6MB 2A5ZA 4ISRA 2D3SA 4Y20B 1KJLA 5GLTA 1V00A 2WT0A 5BYNA
chains in the Genus database with same CATH superfamily
1PO23 3D5OA 2O8OA 3AMPA 3KB5A 1SHWB 3SCHA 3T0BA 2JE8A 3LE0A 2W94A 3PURA 2LM3A 4Q4W3 4CUBA 2WFF1 5C8CB 4FSJA 2VNRA 3JD73 4AHXA 2QDRA 3ZX7A 3W5MA 2B4KA 1VBC3 5KXBA 4XFIA 4XPVA 4AVVA 3SXWA 3H8UA 1MS1A 2A1XA 5JAXA 3VZKA 1OXCA 4AF9A 4E4DX 3CQOA 2V72A 2ARXA 3K75B 1COV2 2GC3A 4HK9A 1BYHA 3I2GA 3M70A 4PLOA 4QB2A 3ZKUA 3E5XA 4AE2A 1H9PA 1GZWA 2EVXA 2X05A 1TME2 3N7JA 1HDKA 5LEJA 3KLSA 3VL9A 4LBMA 2V73A 1RUI2 4XXPA 1FOD3 3QCWA 1PVC3 2LTNA 5FY1A 4OHWA 2DU0A 4OUMA 1JS9A 1UPSA 5LW9A 2UWAA 2X5IB 5LEKA 3C3VA 3T0DA 3N3HA 3POSA 3BI3A 1QY4A 2JDZA 3BTYA 2DF7A 3FHIB 4Q4Y3 1V6LA 2BP6A 2AYHA 3GCXA 5FUIA 4FAGA 4HKOA 2HWD3 5FJHA 4QD2A 5DABA 1XSQA 4HN0A 5BNQA 2XL9A 3UT0A 4Z07A 4NN0A 3T2QA 2Q8DA 2RDSA 2P37A 2BRTA 4I09A 4HG6B 4XJ8A 2VQ0A 4LO7A 2G1MA 1APNA 3EJKA 2H6BA 3ZO0B 4FPFA 1QU0A 3T3YA 5LK7B 4BH9A 4BHPA 1QEXA 3RZMA 3D8CA 3ZSEA 2OQ6A 5CISA 4PDWA 5EHDA 3J4UH 1X9PA 3MF6A 2WZ8A 1H8TB 3M1HA 1FXZA 2RM22 4A42A 1W8NA 3UESA 4I0WB 4Q0QA 1IPSA 2FDHA 2A71A 5JXJA 3A0KA 3I2KA 4AGGA 1N47A 1ZBA3 2C26A 4YYOA 1AL22 3RVHA 2W5FA 2EXIA 1D2SA 4JQRA 2VJXA 5FXZA 2G19A 2E33A 4X8PA 4JV4A 3VBFB 2TUNA 3NV3A 3TN92 2YZ4A 4XZUG 1NCQA 1F35A 1OI6A 1POV1 4P9JA 3APBA 3N9LA 2GSYA 3K51A 4BK5A 4JGZB 4LA3A 2IUWA 4LJHA 4LIVA 3MPBA 3GHMA 5CZKA 1REEA 2FDFA 2PLV3 3ZMNA 3H7JA 3OBZA 3AYCA 2QQMA 1QQP1 5FOJB 1W6MA 1KS5A 4RD7A 5BNPA 1LKNA 4A7YA 4NWWA 3SITA 4Y4RA 2BBVA 4K8FA 5DAWA 1ZRFA 2JDHA 2OS2A 3I3QA 4K8RB 1NCQC 5IW0A 1OSGA 1GBGA 4DRVA 4XDQA 2J1EA 1FI2A 1NCRA 3RFRA 2D6MA 4HT1T 1A34A 1MS0A 1CQ9A 4IDZA 2WWUA 2WYFA 2X29A 4GIQA 5FO7B 4DO0A 3KV4A 2DBNA 2E7QA 2GDFA 2JD9A 1C1LA 3ACFA 3CL1A 4NROA 5I8SA 1X8MA 1QOOA 2R063 1X9TA 4GB33 4IEYA 5C33A 3LEMA 2OKXA 5BNPC 1DFQA 1WA4A 3B01A 5JWPA 2QE3A 4EE2A 4Y5Z0 3WDWA 2ZABA 1C28A 4CDUB 2XBO2 2PQQA 1UO9A 2WJSA 1NCRC 2YG0A 3N35A 4IV3B 3TNQA 3VD5A 5F1RA 5GLUA 1ODMA 1WCQA 4LMFA 4B1LA 3MYXA 1GNZA 3MIBA 5IATA 1K42A 3GZAA 1BBT1 3T4HB 4COYA 3HBZA 4QWNA 3LEKA 1SACA 1PZ8A 4FXKB 4K1ZA 3LFIA 1DGRA 4NUBA 3UNPA 1REDA 3V0BB 2AREA 2WZR2 3OY8B 1ZZ9A 3CHXA 5I8TA 4XCBA 2Y6GA 5FP7A 2R0HA 4BMBA 4GMP3 2HKXA 3ABZA 4XUNA 3TWIA 3WOGA 4EN6B 3R05A 4CU8A 1EAH3 1PM7A 2EIDA 1WMFA 2C0ZA 3N7MA 5L7OA 1ND3A 2DDUA 2RS53 2WLQA 1CVNA 3ZFEA 5JXGA 3S0MA 5I91A 5EJZB 3GXUA 1QJU2 1SBEA 1X50A 4Q4X3 1PM4A 5LA9A 3FBMA 1VBE2 2VZTA 3OSDA 5FYCA 2HEWF 4HSJA 1Q8PA 1QNWA 2ZGOA 1LTEA 1ACCA 1KFXL 2XJPA 1WGPA 4NRMA 3DEMA 1H1MA 3C2UA 3GYDA 3LPFA 3B3QE 1R092 3K4ZA 3N9QA 2Y6KA 2VUAA 4IE7A 3ZXLA 1LECA 1WLTA 4AGRA 1HRV3 3B7MA 5BNNC 2QZ3A 5L9RA 1U5ZA 4GULA 4XBLA 4CCMA 3VZNA 2DCYA 3H3UA 3H42B 1MS5A 3OBAA 5LRSA 2A7AA 2BOIA 3IWZA 1HXS1 5FCCA 3VBSB 4BQWA 5ERLA 5A3MA 5EPAA 2WSUA 3AKSA 1QXJA 2A6WA 3OPWA 4KQ7A 2JB4A 3U75A 4QPGB 3IIIA 5JOYA 1R081 1RC6A 3IBMA 1G9AA 2CY6A 1FMD3 4XCAA 2YMZA 3H3LA 5GLZA 4L8QA 1UMHA 3WQ0A 3KSCA 3HQUA 4AQ2A 5HCHA 1RUC1 4XYXA 5J3UA 4M3CB 3WR0A 5FBZA 5FUNA 1MEC3 2RS31 4BLIA 3S7IA 4CDWB 3ZXKA 5D8AC 1DBNA 1G8WA 2D3PA 1H6YA 3TB0A 2IFWA 2NN8A 4EN8B 2VZUA 1VRH3 5JIUA 2J7MA 1RUD1 2XJVA 2VZSA 1O5UA 1H4HA 2J1VA 1FNYA 1BLZA 2ZHLA 3PHMA 4FVVA 4XBNA 5FMDA 2DVFA 1D0HA 2BNMA 1UAIA 1C57A 3PJYA 4ZU4A 1EUTA 4M4PA 3PU8A 4ITCA 1W2AX 1RUF3 1S0CA 3ZXDA 1HV0A 1NQJA 2EXHA 2GN3A 4P00B 1BKZA 4GA9A 5L36A 1UIJA 1F4HA 2IVJA 2ZHKA 1NY72 4CCNA 1RXFA 2V5YA 4XW3A 5FZEA 3V56A 3J26N 2XMLA 5FZ6A 4BISA 4X8NA 4CYDA 5LA2A 2Y0OA 2W3JA 3LOBA 1HB3A 1X7NA 3I3EA 2GALA 3F2ZA 2A73B 4RGGA 4FP2A 3NRUA 4GMP0 4JKMA 4IGOA 3UKNA 4XTMA 4BLJA 5JSRA 3POEA 3AZVA 3VKMA 3WF0A 1W2TA 5A70A 4JCKA 5G05L 3K46A 3FLPA 1JZ3A 1UIKA 1ND2A 3L2HA 3OGSA 2XJUA 2XKOA 4CCLA 5A7WB 2PMWB 4AXOA 1S4CA 1SLLA 3K48A 5C7GA 1NXD1 4EN0A 3FUQA 3K3NA 5CYYA 5F32A 4XFHA 3OEAA 1K5JA 4B3NA 2NYYA 3M3OA 1QXRA 2OVUA 3GDBA 1TZOA 5FZ3A 3H8XA 1Q5OA 2EAKA 4LOTA 4RS5C 4ZU5A 2GH2A 1TMF1 5TSWA 2ZGMA 3E97A 3CJIB 5DZFA 1QOSA 4O7XA 1UN1A 3MIGA 4YARA 2XVGA 3HQRA 4E4HA 5CFCA 2W92A 4QU2A 3RNSA 4Z82A 1YI9A 3TNPB 4XF4A 5CADA 4OMCA 1YFYA 5F3IA 3DXUA 2CWMA 1LHVA 3B9IA 1VMHA 3BIEA 1HQNA 1RINA 1UYYA 1OD5A 4Q0VA 1MS4A 1YIPA 4OVEA 1JZ2A 1OBNA 4ZS3A 4AFMA 2WRAA 5DUXA 5A6QA 4CVUA 5CNAA 4ES8A 1OQ1A 1O5LA 3OYWA 3L9JT 1N3OA 4UW6A 4AWDA 2W1WA 5CFCC 1C8M1 1WLWA 4W6WA 3FL7A 3AMNA 4DMIA 3FWEA 1PNGA 3ZDVA 4COUA 1IS5A 4UFMA 1XC6A 4V2VA 4IESA 5FP4A 3ZIWA 3ZYBA 4WM8C 4D6SA 5GZCA 2YROA 3OGGA 5GZEA 1QMJA 1UQXA 2P3JA 5J96B 1KJRA 4LBJA 3SMHA 2WFF2 2RR11 1WCDJ 3WNKA 5AC91 4YVSB 5CFDB 3NV1A 2ZTNA 3I2FA 1UX7A 4K9SA 2P1BA 5FZ7A 3WSOA 1HB1A 3CZUA 2LROA 3I3DA 3DECA 1D2QA 3PVNA 5A32A 4QM8A 2VG9A 4Q27A 1BK0A 2Y6LA 2C9KA 3P6BA 1COV3 3M2MA 4AFBA 5I8YA 2D93A 2J1RA 1VBD1 1GWKA 1DG6A 1NZCA 4Q2FA 2GC1A 1VBB3 3CIHA 4Y1XA 3MUZ1 3HN3A 4QPIB 3VL8A 3VUOA 3USUA 3URFA 2HWF3 4FCAA 5FPLA 5LWBA 2R32A 4LO6B 4UI9L 2ZAAA 3SH5A 4TTGA 5F9TA 2JB8A 2WAOA 3N4MA 4QU1A 4XJZA 4QKFA 2JDAA 2B45X 2DYCA 2DCKA 2VTXA 3WHTA 4ARXA 4AHZA 5F39A 4LHLA 3AZXA 2VL4A 4MXWA 2BFUS 2DVGA 3G6JB 3I2IA 1KITA 5FPZA 2WQ4A 3CEWA 2R0FA 4O9GA 1ENSA 5F6KA 1DDLA 1VMJA 4CXWA 2LALA 4S2FA 3VV1A 3WCSA 4GH4B 1OHFA 3VDDA 1YFXA 2A70A 2YHJA 2ZGSA 4GQ7A 4LUMA 5F3GA 4EWEA 5KC6A 2HLEA 3PL0A 3WDXA 3ZXJA 1FNZA 3P1IA 4IEZA 2BUKA 2JDNA 2XJQA 4N9IA 3FLRA 1XU2A 1ZREA 5IHRA 3I4IA 3JBG1 2Q0AA 3NMBA 4QB6A 1FPN3 5FXVA 3CMGA 5FPBA 1JUHA 5DAXA 2PHRA 4B4PA 4CEYC 4MOAA 1ZZBA 5K9YA 1MVQA 2R073 3OGVA 1AYN3 3MEPA 1S0BA 2BQPA 3RWKX 4GWMA 2PHLA 1AL23 1ND3B 3ZFEB 3ZOIA 5LASA 3BCWA 1E5IA 5LCWL 4ZONA 4AEMA 2DV9A 2YV8A 4MGQA 4PCRA 1TQ5A 4OYUA 2J1UA 4EN7B 4AAPA 4QMAA 1DZQA 2B42B 1PIV1 1ULPA 3PVOA 1NA1B 4UF0A 4A41A 1PO11 5KXEA 1MZ5A 4D7YA 5C3QA 2PA7A 4LR4A 4Q29A 1KQRA 5FAXA 2MEV1 4EROA 5FPXA 2D3RA 5E6HA 5LRRA 2CV6A 3ZR5A 1AYM3 3RZKA 3PUAA 2BVVA 1QQP2 5DQ0A 4FQZA 1N3PA 1RGSA 3MGUA 2O8QA 2ZXQA 3POBA 1F2NA 1VRBA 1W8TA 3ACGA 4ASMB 3CKHA 3H1WA 2P6HA 1H1IA 4DNYA 2B7YA 4N90A 4IGQA 4MX3A 4SBVA 3VBRB 1YQ6A 4S2GA 1DGLA 3OG2A 5G04L 5JLVA 1SQ4A 4FFIA 4MO3M 3GZUC 2BERA 2I45A 3AMMA 2IXLA 1OUXA 3U0ZA 1JW6A 3U37A 4JHTA 1UL9A 4AFDA 3LFMA 3GBFA 2XHKA 2R6QA 1QGLA 3SISA 2DUPA 3WT3A 2RDQA 4CZSA 3ORJA 5BY5A 1O3TA 2FDJA 4ZXEA 3BGAA 2A6ZA 5FV3A 1OA4A 1JI6A 4Q1PA 5IVEA 3LOIA 1YIFA 4TWTA 4XUTA 3N7LA 1JBCA 1V6IA 5CG9A 1BBT2 3HNMA 3IM0A 3AKQA 4JRLA 1JZ4A 3RYKA 2WIIB 4D6RA 3MUY1 4HK8A 1VPHA 3KHBA 2Y6JA 1ULEA 2WNVA 3DXTA 5LBFA 2WZR3 2Y60A 4CDQA 4E9KA 5C3SA 1Q8SA 5T5PA 1HQLA 3ZFFA 2VW2A 2VE1A 4JZRA 1AX2A 1XNTA 5C8CC 4EZHA 2J1AA 4V2WA 2Q8OA 2XWJB 3BTAA 3ZSMA 3FHQA 4AI3A 1J83A 1JHJA 2ENRA 4XACA 4C8DA 1JYXA 4E2SA 4C0HA 3ZFGC 1UXZA 3D3AA 2FBEA 2I2SA 3NKGA 1ND2B 2IXCA 4QX5A 4ISRA 1ASJ1 1CAWA 1S2EA 4IE6A 2YU2A 2QFEA 5FY0A 4CDQC 1KJLA 4HZFA 4UXAA 3ZFFC 3T2OA 3BTXA 4IUGA 4YW2A 1XNCA 2VCCA 4HVQA 2FZ2A 2RDNA 3LSDA 3WNPA 4OUEA 1WZXA 2W9XA 3VD9A 2ZKNA 4FPEA 4G4FA 1VAVA 2JWPA 2XVKA 3ETQA 1UYPA 1R093 4BIFA 3LDBA 3X29B 4CPBD 2X5IC 1L3JA 4K1YA 3AVRA 4YGCA 4QM9A 4BQXA 1SFYA 1UY2A 1YJLA 2N7GA 1EYBA 3N9MA 4JHZA 4KG8A 1F15A 3KV5A 1HXS2 5F2SA 3W58A 3ZN6B 4NPLA 1PZ9A 5FZOB 5FY5A 3JCIA 5F5QA 4KWKA 5FYTA 5FYUA 5FWEA 1E5HA 1R082 2E63A 3ATGA 3AC0A 3LQCA 4XJUA 1F5JA 3J7NA 4HFSA 1JU3A 2XUMA 5J36A 2WABA 1AX1A 4KL1A 1CPMA 4R52A 2XVLA 3ACLA 5F3EA 1URXA 1GWMA 1RUC2 1W2OA 1HRI1 4RL7A 2RS32 4FFGA 1BK1A 1GNYA 2ATFA 4QX1A 3OYWB 4YW4A 5ABJA 2W95A 2UWCA 3NV2A 5KWRA 4D3WA 5A7QA 1RUD2 3ZSKA 3AYAA 4IL7A 1ZZ8A 3LAGA 2NZ9A 1GZCA 3GM8A 4LA2A 3WP6A 3V65A 5FZ8A 2QDNA 2VZOA 1VB4A 5C8WA 3O14A 2D6OX 2ZOEB 1ZBE1 4TLGA 4FPLA 5ABJC 2B46X 3RI8A 2F17A 1AR81 2VBPA 2OPKA 4QDSA 5A32B 3WNOA 4CA9A 2P2KA 1GZTA 3OBTA 3PLQA 3THCA 3U4SA 2WO7A 4JDMA 5T54A 2DVBA 2R16A 3POGA 5IJRA 3MIDA 3L2YA 5DPNA 1BQPA 2HWB1 4U2AA 3I3MA 1DZTA 3MLJA 1LOGA 1SLAA 1A78A 3C7OA 4AEDA 2C5DA 4RR3A 3E6BA 5IK8A 3O1OA 5JOWA 2PHTA 4LBOA 1T2XA 1IS4A 3AMQA 3MICA 2GC2A 5FOBB 1IQDC 2B9UA 3O1PA 4AQTA 2PAKA 2VQTA 3WX5A 5F5CA 4LXLA 1GFF2 1XYOA 1CZSA 4CCJA 3RZJA 1Y7BA 1H0BA 1LODA 1DQ0A 2VUCA 3NNJA 4FPOB 4AEDC 4FPCA 1TMF2 5FP8A 1UKRA 1W3XA 4IV1B 5K8SA 3ILFA 3WW4A 1J58A 2DUQA 4MGKE 4QAWA 5AVAA 3C7GA 4IV3C 1UOFA 4LO4B 1G9DA 3OCPA 5CA6A 2FDKA 2RMU3 3ZYJB 4CSWA 4C90A 1GZ9A 2D5FA 4P14A 4N53A 4YNIA 4AFAA 4ATEA 5I93A 1B35A 5FKCA 1W6PB 2WBKA 4MV2A 3S57A 3BOWA 4LTAA 2RS11 1ULDA 4XF1A 4XDPA 2PAMA 2OYZA 4QKDA 4YZ2A 1YXWA 4RA0A 3GZEA 3FFZA 4XJAA 5FPUA 3KCXA 2QQVA 3OGRA 4NVPA 1RUG1 3WQBA 2GC0A 5DG1A 5JR7B 3PUSA 2LS6A 3EBRA 1DF0A 1MQTA 2ZJCA 1KDMA 5FWJA 1C8M2 1EPZA 2ARCA 3ELNA 1AR61 1B35C 1WBFA 5L9BA 5ACA1 4JAAA 1RYYA 5EIYB 1JYNA 1Z7S3 2VXRA 3JZVA 5A3WA 1UZYA 2XJSA 4UFHA 1RUE1 3AM2A 4HN1A 2RR12 4AQSA 5AC92 1CAVA 4LUKA 3MDPA 4LIUA 4R9CA 1ZRCA 3UKTA 1QJEA 1YFWA 3PJQA 3C7HA 4E2GA 1MQTC 1NUKA 2CNAA 2OIIA 2VR4A 4JGYC 4Q4V3 1D4M1 2YB7A 3WW3A 4PIYA 5C4WC 3LA2A 1PK6B 5JZGB 3RG0A 1S55A 1JOBA 2JDYA 1FYUA 2QTWB 3O1RA 2NMNA 1M06G 1VBD2 2QCSB 3PIJA 2CYFA 2F4LA 1KEXA 5B2GB 3PMSA 1MS8A 1RVF3 2Q1FA 4WM7A 5EYYA 1E57A 1W03A 3DV8A 5HV0A 2WO1A 3VBOB 3NAPA 5FZAA 4X6RB 1BJQA 2VMIA 4HPKB 5T55A 4XUOA 4QX8A 5JVVA 1UZZA 3K4AA 2C1FA 4LBQB 5F5AA 1CAXB 2HWC1 3GGLA 4IEOA 4CP1A 3VBHB 3WCRA 3BYWA 1U12A 1RITA 4D7TA 2D44A 2BJSA 2OPWA 4AK3A 1GSLA 4OHZA 5C3OA 2GH8A 5EXOA 4H7LA 4YGBA 4WM7C 2QQKA 3KT4A 1UPIA 1W9TA 4Y33A 3VLBB 4CCKA 1H2LA 4YW3A 3RZHA 3NAPC 1G86A 1PO21 5FYVA 3FN9A 2E32A 4OLLA 3WLUA 2A6YA 4UFIA 2GP5A 1W3VA 1Q3EA 4AI9A 2WL1A 4Q4W1 3GZTB 2WNVB 5FK7A 1NXMA 1ZYBA 2WUHA 4KGQA 5HXVA 3JD71 5KHHA 1ULFA 3WINE 3JBG2 4B8EA 5IFPA 1ENXA 1UY3A 3MIHA 3WG2A 3SNMA 2YFUA 4LHKA 1PMHX 2JE7A 1DQ5A 4K21A 3AZZA 4HL0A 4K3UA 1LR5A 1FV2A 4UBHA 5BXXA 3U1XA 2WN3A 2DCJA 4Y24A 1K3IA 4AI2A 4DY3A 2PELA 3PUHA 1W8OA 3ZPOA 4DIQA 5DDJ3 5IVYA 1UU4A 4XQ4A 4Q5OA 2ID4A 4H7MA 3N9OA 4HXCA 1DLCA 4MGSA 1WCUA 2J1SA 3KCYA 1V6OA 1V6MA 1FOD1 1PIV2 4K40A 4QQLA 1A6CA 1PVC1 2FMYA 1PO12 5DMYA 4LOSA 5FZ1A 1QJX3 3KMHA 2WWJA 1SDDB 2Y26A 2ZBJA 5C9AB 4BXFA 3CO2A 2MEV2 2VVFA 4L2NA 4C1XA 4LLOA 5FPAA 2VULA 2QQOA 2Z69A 4NE9A 5SV5A 1VBA3 4Q4Y1 2A3WA 4OZOA 3T0AA 1REFA 3B5LB 1AR71 4Z1VA 2HWD1 1Q8QA 2CU5A 5E1RA 2WS93 3ECQA 1CIYA 3H9AA 5FLHA 5FZIA 4CU9A 3R4SA 1SFPA 4AR2A 1G9BA 2VXJA 1GOGA 1XOYA 4OHYA 4CU6A 3E5UA 1AXZA 2ZGTA 3M3QA 4MHUA 3VHOA 3RZLA 3V0AA 4W65A 2OW4A 4I0AA 5HCBA 3J7LA 5A6ZA 3RRDA 4BQ4A 4I0BA 2P5BA 5K4LA 5FLJA 1QWRA 4IEXA 1GP4A 1F9KA 2ADEA 2HJIA 5C5UA 4DXTA 4GKYA 5E88A 4AVCA 4D8MA 2FDGA 1JODA 5CKQA 2YC2A 1ZBA1 2AUYA 1RHI3 1VAKA 4E27A 3AP6A 4IEUA 2QJVA 3PVEA 4BU2A 1W6OA 1LHNA 1R1A3 3MW4A 2JG8B 3IZOA 4I01A 4GKXA 4EWAA 1JU4A 1UF2C 3S5AA 2W52A 4LKFA 2PHXA 3B93A 1O4ZA 2BVBA 4XILA 4YM1A 5GKAC 4DOUA 3NKTA 1QDOA 3CNAA 4NIDA 4LORA 4PBOA 4O65A 4QQHA 2VPVA 3KGZA 2WA4A 1XYPA 2PLV1 1E5RA 4TSVA 4WVMA 5E8AA 5LB6A 3W20A 3D0SA 2E31A 4CDXA 1KD7A 2CWSA 5CFDC 5C5TA 2YGMA 2K2SA 1HX6A 5BNOB 1ZRDA 2YC4A 4RQPB 3O1MA 4HKWA 1OF4A 4EV0A 2WYSA 4LBKA 4P5YA 1ASJ2 1UKGA 1YQ8A 2A6XA 1AXYA 5E16A 1HKDA 1H2MA 2ERFA 1G9FA 1GP6A 1L7LA 2Y33A 3DPRA 1J3PA 2R043 3J8F1 4HETA 3VD3A 2GAUA 1I1EA 1F31A 2WNUA 5C70A 2PHWA 4QPIC 1AR93 1ZRRA 2R061 3SHRA 4GB31 4AI8A 3HD8B 4CDXC 3VD7A 4DRRA 1W90A 2JD4A 1SPPB 4XIKA 5BNNA 3O1SA 3EXUA 2BNNA 1B09A 1C8NA 3A4UA 2YBSA 3GBWA 3Q9OA 3QH7A 4QX3A 3C7FA 2VZPA 2VGDA 3NVCA 4DB5A 4TZDA 1CIWA 1W6QA 2W68A 3T1MA 4QPWA 4AI1A 2X09A 2KM2A 5CB7A 2A3XA 2O14A 4XAEA 3WF4A 1RXGA 3BIWE 1AVBA 1V9U3 1W8WA 3DPRC 3S7EA 1OKOA 4I3PA 2YFZA 2WNUC 3AP9A 4PIXA 2E7TA 1AHSA 2W1QA 3SCFA 1GQGA 5A6YA 1OQDA 2EIEA 1W2UA 3HVDA 2XLAA 2ZGRA 3BODA 5FY7A 5IK5A 5CVRA 5AVPA 1W06A 4SLIA 4OI2A 4XABA 4EYUA 2HYXA 3BPZA 5D8AA 3TBDA 1RMU1 2ET7A 3O7OA 1HRI2 1J3RA 3SKJE 2WQZC 4CRQA 1K12A 1LNSA 2ZMLA 3HNBM 5C71A 3JB4C 1FT9A 3KVBA 4GMP1 4IEPA 1SBFA 3A0NA 1SDWA 1YQ5A 4YFWA 3MHZA 2AEZA 1XNBA 5J37A 4NO4A 1OPOA 1EAH1 4GALA 4PJYA 4X6QB 2FDIA 4YGEA 1RUD3 2ZGKA 4CXYA 1UW8A 1IS3A 2NMOA 2Q1MA 2RS51 4R9BA 3ZYFA 4Q4X1 4BE3A 4C1WA 1JYWA 4KI5M 1GYKA 4LO5B 2VQAA 4ONUA 1UCXA 1NAEA 4H2AA 1BEV1 3ZMOA 4BQ5A 2VH9A 5A7PA 3IPVA 1LOBA 2VTXJ 4RHV3 1IGOA 1RUH3 3S5QA 2UY9A 4XFAA 2GMMA 4N9HA 3WQ7A 5IAXA 5LA0A 1ZBE2 4TYSA 2JECA 4LKDA 1UZ0A 4ZHNA 4H3WA 2PQSA 3RPQA 1AR82 3ES1A 2CGNA 4Y26A 2G9GA 3E6CC 4YZ4A 1W9FA 1OH3A 2ZMKA 5FUPA 2ZS6B 4Z92B 2BWCA 1EUUA 2DCZA 3P3NA 4XURA 1QJY3 2HWB2 4DEVA 4FP3A 2ZAHA 5FJKA 4LEJA 4R4XA 5FZ4A 4UWDA 1FMD1 3S30A 2W2IA 2B5HA 3LIHA 1ALYA 3ZYPA 2VZRA 3K3OA 2DFBA 1T6GC 3AJZA 1GZWB 1Q56A 3ZYGA 5A3PA 4YVWA 4BQYA 1MEC1 4RS5A 1CJDA 2UWBA 1A3KA 2DUOA 1QNYA 5KHKA 2HWE3 1K5MA 3I7DA 4R8HA 1G6NA 2WKKA 3ACIA 3FMGA 4COWA 1VRH1 1PGW1 1CWPA 2PAEA 2YUEA 5A80A 4PLNA 4ZZ8A 3ON7A 2WSVA 2EF6A 3ALQA 3ILNA 2A3YA 2VZ3A 1GNHA 2JG9A 1RUF1 1SBDA 4YVWC 2WLPA 3EHKA 4LT5A 1KFUL 5JOZA 1OPMA 5CAZA 3MLKA 1J1TA 4QGNA 5HCAA 1Y9MA 2TNFA 3I2JA 4ASLA 1K5MC 4W8JA 3NJVA 5BV6A 1W8ZA 3RQ0A 1ZZ7A 2RS12 2YPJA 4FBFA 2JJ6A 5CU1A 5A6XA 4RFT0 4O61A 5GLWA 1GKBA 1RUG2 3WG1A 2JKBA 3AXEA 4BQ3A 4KGGA 2JG9C 4PDWB 4WM8A 1ULGA 1S2KA 1W0OA 1AR62 1MS3A 5ACA2 3TEWA 1VALA 1WW6A 4E8DA 1VMFA 3UJOA 1VIWB 1LHUA 2VBBA 2VNOA 4YM3A 1K45A 2W08A 5JCTA 3FLTA 1RUE2 1EV13 3IDEA 2RR13 2VO5A 3DN7A 1JYVA 5FMOL 3ZPYA 1AXKA 3HBKA 3I49A 5A1FA 2YBPA 2BU9A 3KGLA 4JVAA 2D6LX 3BB6A 3NNGA 2JENA 2AZ5A 1NCQB 3T08A 2ZEYA 2VOTA 4H55A 5ANNA 3RZGA 4XMAA 5FK8A 1D4M2 3OD4A 4M00A 4LHSA 1OURA 5LBEA 5F2WA 5BPXA 5HXMA 4OHXA 5HI0A 1XNDA 4PHZA 1OC1A 4CXXA 4CP9A 5FREA 4META 1W6MB 1NQDA 5BNPB 3RI9A 5FIXA 3I2OA 3NQHA 1OOPA 1YWKA 1NG0A 5IWFA 1YQCA 1V00A 2WT0A 3IDBB 5BYNA 2DFCA 2GMEA 2ZACA 5J09A 4MGZE 3VZMA 2XLFA 1UYXA 4NHYA 1JYIA 1NCRB 1CPNA 4YW5A 5FO8B 3POIA 4E8CA 1O7FA 1TME3 1FAYA 1YYNA 2DCTA 2HWC2 3OOXA 2V4AA 4KU7A 5DUVA 5I0SA 3FHAA 2E7AA 4YWAA 1RUI3 2CDOA 1TVGA 3J7HA 5JXIA 1CAUA 1H30A 2Y64A 4BM8A 1JN2P 1W6OB 3FX3A 4UYBA 1H2NA 4PBPA 1OOPC 3AFKA 1O4YA 2BBAA 2RJKA 1PO22 4Y22A 5EJ1B 3WW1A 2X10A 4Q4W2 1C4RA 5JUVA 5GLVA 2J1TA 3JD72 4CEYA 1IHMA 2ET1A 3NL1A 1XSRA 1WCKA 1DHKB 1SFNA 4A2UA 2D6NA 4XFCA 3D82A 3H8OA 1O91A 4B29A 2VECA 1V6JA 4BA6A 3UV9A 3ITQA 1UMIA 4BDVB 5FZFA 4KH9A 5JSPA 5D21A 4GAZA 2WZPP 2O0OA 2QNKA 4D6QA 4ORFA 1VBB1 4OMDA 1YFUA 3WUCA 1RUJ1 5FZHA 2IC1A 5J48A 2HWF1 5C3RA 4AVAA 5JSOA 2RM23 3HQXA 4P9YA 4AZZA 3POYA 1JOPA 4AHWA 1PIV3 3J9SA 3LCPA 1FOD2 3W5NA 3BUCA 1PVC2 2C9AA 5A7OA 2ZHMA 3S6PA 2VBDA 5L7OB 2VUDA 2ZGLA 5GZFA 2XGXA 3ENRA 1C1FA 3VBUC 4ATFA 4CUAA 5FYIA 4CP2A 2GN7A 1ZA4A 4Q4Y2 3DYPA 1QOTA 5HCFA 1LHWA 1TNFA 3TN93 4P9XA 3WW2A 4CEWA 1AR72 2HWD2 3OEBA 1AUYA 4WVVA 2JIJA 4UBGA 1Y9GA 3T2TA 3AXDA 2DVDA 3IDAA 4F3JA 5A33A 1XJAA 1DGWX 2ORXA 4RGKA 1J1LA 4N43C 3U10A 3WF3A 1J3QA 4GWIA 1S1AA 5SV8A 3MIEA 1JMUB 4ARYA 1DP0A 2DU1A 2GP3A 3RJRA 3OGJA 4QPYA 4N7IA 5D8AB 1QKQA 1FPN1 1CX1A 4CEWC 3J7MA 3NNFA 5JR2A 3LWCA 1SEFA 4PIZA 3ZYHA 4CPBA 3WHUA 1XQNA 4PLMA 2VMCA 2W91A 5CIRA 1NLQA 2R071 1AYN1 4XQWA 3LGRA 4LKSA 5EWSA 4FPYA 3POFA 1S0JA 1ZBA2 3LEIA 3GBGA 3IKWA 3ZKYA 4Y20A 3M4FA 3PTRB 1UY4A 1N1TA 4XC9A 3M3EA 4XHXA 4B4QA 1F5FA 1F8VA 5FFOC 5CEHA 2XBO3 5EFUA 3VKLA 5EV7A 5T52A 2Z5WA 4XHBA 2I74A 2LRPA 5C8CA 5FYHA 1GUIA 5GALA 3V64A 2PLV2 1NX9A 2W0XA 4AL9A 1AYM1 1OQEA 5GJ6A 4FPKA 2BW8A 3ZFGA 1Z0HA 2DTWA 1LOCA 5F37A 2RJ2A 2XWBB 2VM9A 3WDVA 1OKQA 5ANQA 4A6SA 1AZDA 1H2KA 1OA2A 2JEMA 3A7QA 2LUWA 3DUIA 4M0NA 1SMVA 3ZSLA 5A3UA 4Q0SA 2JE9A 4BMEA 1ASJ3 2D7FA 3ES4A 4DXRA 2IZWA 3WY6A 2Q30A 3WV6A 1J84A 1JHNA 2WR9A 3J8F2 1XE7A 4UFKA 5IVJA 2R7EB 3H1MA 1WA6X 2R062 2UYAA 2UYBA 2ZKLA 3DF0A 3E5QA 1KGYA 4GB32 5CKNA 5KXCA 1HB2A 1FX5A 4LO8A 4XEZA 2X5IA 2B39A 3W9AA 1BZWA 4AFCA 4OZXA 3DKWA 3KV9A 1QJU3 4MADA 4QXCA 1LGBA 3SQOA 2ZPXA 1SG3A 2BYVE 4OQ9A 4KWJA 1VBE3 4S2DA 1A8MA 1SLTA 1VB2A 4R4ZA 4XJ9A 4Y5SA 3VDCA 2VMHA 3ZXFA 1RUNA 3BN6A 2Q8CA 5A3NA 1HQWA 3M8LA 1ENQA 2E51A 1UYZA 1KDKA 3Q8AA 1ST8A 4GJZA 4ET7A 3H3ZA 2FZ1A 2QKDA 3F95A 1HN0A 3HR9A 1XPWA 4LBLA 3HPNA 2P3KA 2ZX0A 3UK9A 2YGLA 4FQ4A 1VJ2A 4XETA 2VU9A 3R0RA 1RTVA 3KQ4B 4LKEA 3O5SA 1RMU2 4M4RA 4BJ0A 4DXZA 4DUWA 3ZM8A 5CFCB 1H8TA 1O8PA 3EB7A 4C91A 3RMYA 4KBZA 2WFPA 4ZU7A 1EAH2 4HOOA 3WNMA 2IXKA 1HIXA 1UY1A 1PVXA 3CBNA 3SCGA 2IWGB 3ST7A 2RS52 2Z79A 3LEGA 4F83A 5IVBA 3JUUA 4Q4X2 2YU1A 2W39A 3VBFA 5JI9A 3CU7A 3IN9A 3WD5A 4CUGA 4QDQA 5DG2A 1WBLA 5IVFA 1BEV2 2OUJA 3ME2A 4CU7A 4P9IA 1W8HA 1ZZ6A 1H8TC 5IFTA 4YLZA 1LB2A 4JGZA 2BPA2 5E89A 1MPXA 1MS9A 3WEZA 3ZN5A 3WDUA 4NAMA 4LBQD 4NIGA 1IS6A 4ES9A 4XFBA 3VBFC 2VUJA 4FTEA 2WO3A 4XFFA 1ZVFA 1XU1A 2SBAA 1A8DA 4D7SA 3THTA 2JKXA 1OT5A 4B4RA 1V6KA 1V70A 4E2QA 5KC5A 4B7KA 3KZ4C 4J6GA 4JGZC 1KS4A 4QGLA 2ZHNA 4LULA 5D2AA 4NIAA 2ZA9A 1FMD2 3ZN4A 4AQ6A 4BCUA 3I3BA 4YM0A 4XIOA 3LD8A 1U0AA 3AFGA 5IAVA 1ONAA 4BK4A 3O0WA 2RG4A 4EN9B 2NPIA 1H4GA 3KD4A 5FXXA 1BXHA 3SH4A 4EQVA 5A1LA 1MEC2 2KA3A 3USUB 3GALA 1JH5A 4JKLA 2W87A 3LDKA 4UFJA 1QHDA 4YG0A 1LU1A 1LOAA 1QIQA 2PN5A 4CDUA 1US3A 2IXHA 1VRH2 1PGW2 4IV3A 4W6YA 5B4NA 3BU0A 4LPLA 1QXPA 1PGSA 2K0GA 4MXWB 3PDQA 5JPMB 3QOPA 4Y22B 5F6LB 4RGAA 4NHKA 1BVP1 2VZ1A 3BTZA 1RUF2 1AL0G 1DYOA 5A7SA 3WNLA 1NYWA 4CEYB 3RMXA 1PMIA 3VDDB 3V0BA 3PUQA 1Y4WA 3OY8A 2XJRA 4CDUC 2XONA 3B94A 1QDCA 1O3QA 4INDA 4QXHA 4DFSA 2Z2SB 2VVEA 2D98A 2VOXA 2CAUA 4MVTA 1I3HA 4TN7A 1NKGA 3VD4A 1POQA 4WBBA 5DAQA 1MZ6A 4XUQA 5LK5A 2VVDA 2Y38A 1S0DA 2WT1A 5FP3A 4GXLA 4M3CE 1WCSA 3CZJA 4NIIA 2MPFA 2VMGA 2A6VA 4OUSA 1GWLA 2PHUA 3O0XA 4UW3A 4LE3A 4KWUA 3VZOA 3TOJA 4FPGA 2XHNA 1H8VA 4FT8A 4LNVA 1CGPA 5FPVA 2IXJA 1HB4A 5L73A 1GQHA 1H1AA 4JGYA 1YNAA 1IZ3A 3KF5A 3KF3A 5C4WA 5GZGA 5FZ0A 4W4ZA 1CZTA 2OUHA 4MYEA 4UF0B 3O0VA 5A3TA 5A1AA 5JDBA 3JB8A 3MF9A 1MZEA 3O12A 1UNBA 2WFF3 4IW3A 1S0IA 5FXWA 5FDBA 4PF1A 3VBSA 5A3LA 1EPWA 2BV4A 2H6CA 1MACA 1OMIA 4HANA 2RMU1 2LW8A 2DURA 4ISQA 2PTMA 4QPGA 3WF2A 5FZCA 1CONA 5F3CA 3T30A 5JI7A 3VZLA 3ROUA 4DXSA 1W28A 2FCTA 3B02A 5FZBA 3SEEA 4AYUA 2XL7A 2Y6HA 2WDBA 2QQUA 4XOGA 4BQ1A 4M3CA 3RYPA 4L99A 3UYJA 4CDWA 3H7YA 3VBSC 1KXGA 1LHOA 4RYDA 3TRSB 4XFGA 4AGVA 3CDZB 1WMEA 2RDRA 2RHPA 3N9NA 4QPGC 4IQPA 4KNCA 2JXAA 3AP5A 2WO2A 2Y34A 1X8EA 4KWLA 3NSTA 1Z7S1 2J42A 1IPJA 5FRAA 3AZWA 3UGHA 4I2OA 4ASKA 2O1QA 1I5PA 4QX7A 5F5IA 4S2HA 1OFNA 3H1YA 4CDWC 3LB9A 4EWDA 2W46A 4FOVA 5IK7A 1V6NA 2XDVA 4YW7A 5KBFA 1GOFA 1H6XA 1XE8A 3B69A 3LSEA 4OFGA 2VOWA 5J98B 5BUVA 3ZFGB 5FO9B 1OVSA 4A6OA 3INAA 2CGOA 1W6NA 4J1XA 4Q4V1 4LHNA 3T1LA 3TAYA 2Q1ZB 3WG4A 4CDQB 2HEVF 1UX6A 2VNGA 1JUIA 2VOKA 1O3SA 3ZFFB 2JDUA 2GNBA 1R1ZA 1TG7A 2PHFA 1VBB2 1VBC1 1QJFA 2OZ6A 3KS7A 1RUJ2 5JMOA 3B00A 1XE0A 1ULCA 2HWF2 1RVF1 4IETA 4ZXKA 1AJOA 2BOJA 4BQ2A 1ULOA 5A7WA 1LEDA 5KHJA 4BPZA 4FPHA 1HJGA 4CE8A 5JXHA 2NP0A 5FZLA 3ILRA 2YPDA 3UKVA 1CAWB 2R1BA 3SC7X 1U5IA 5FYSA 1O3RA 2XJTA 1XXNA 2JDPA 3DL3A 1Y3TA 4HVOA 4YW6A 5B4XA 1L7RA 2P17A 5CBLA 2PXJA 4UAPA 4Q1RA 1AR73 1G9CA 4P08A 3VDBA 1FATA 3N36A 3MV01 1DQ6A 1FV3A 1GLHA 1POV3 5CKMA 1IPKA 1VAMA 3NJXA 4BZ4A 1HN1A 2DVAA 3NJZA 1C3HA 3TEZA 4XF9A 2A75A 3CJIA 3GF6A 3HMYA 3PMEA 1UOGA 2EXKA 1JZ8A 1LCLA 3IAQA 1LGNA 1QQP3 3MPPG 5FZMA 1VE0A 4JX0A 5L19A 4QT6A 1C5IA 1OD3A 5H9SA 4FOWA 1ZZCA 3OUJA 4MGTA 1FPN2 1M4WA 3LKJA 5JIAA 3HEIA 3VGIA 4LK7A 3P3PA 4JDNA 2D6PA 3OUHA 2HBUA 3KT7A 2R072 1EP0A 1AYN2 1YRZA 2K46A 3CJIC 3ZIXA 4HVRA 4MXVA 2VMEA 5A3OA 1IG3A 2ZEWA 3IAPA 1PX4A 4BIOA 3UJQA 4XF0A 1W0PA 5DDJ1 2D97A 1WUVA 4MLOA 5FKBA 5H9RA 2EAAA 1ZX5A 4KU8A 1S0EA 4UFLA 4TLFA 1J59A 2WWSA 2XQXA 1PZ7A 3HOBA 4PDWC 5ABJB 2WN2A 2GNDA 1QJX1 4U36A 3D4KA 1UMZA 2E53A 2IXIA 4OHVA 5J7MA 1ZM1A 5CFDA 4YVSA 1D4VB 2VAUA 4XBQA 1BCXA 5DZGA 1LENA 1RJ8A 3I54A 3JQXA 4J25A 4YPJA 1AYM2 4PF5A 4NIHA 1VBA1 3EQEA 1EY2A 1BBT3 1O6UA 1XNAA 3TYJA 1WWYA 4GD4A 2WS91 4IEWA 1IKQA 4QXBA 3VHPA 4ZKTB 1V0AA 2ARBA 3K2OA 2Y8KA 4FI9A 3FE5A 5JMCA 1UY0A 4UOJA 4AW7A 4QPIA 2QQIA 2R49A 3J8F3 4YVSC 2BGOA 1N1YA 1PMJX 5I0DA 3OD0A 1WD3A 3ASIA 1W8UA 1DCSA 2FQPA 3MIFA 1OLME 3DCQA 4QKBA 1PGL1 4AEDB 4UW4A 4IE5A 4RR3B 4R9DA 4XDOA 4AAXA 1BHGA 5H9PA 4NWVA 4V1PA 1DIWA 4W50A 4DUVA 2GMPA 1NLRA 1RHI1 2OZJA 1POV0 2VC9A 3CJXA 4EJRA 5M0TA 2E26A 4E4SA 4DS0A 2XKPA 3E6DA 4JDOA 4GH4A 1R1A1 4NMIA 5IVCA 5DAVA 1S0GA 5IYYA 4IEQA 2QQJA 4A44A 3LA7A 4BB3A 3GNEA 5FMCA 5CG8A 1T6BX 1LGCA 2ZEXA 3A23A 3SLIA 4RSUA 3POJA 2A5ZA 2D3SA 4FAHA 2WAAA 2ES3A 1HXS3 4CCOA 2RVAA 5GLTA 1RMU3 1W8FA 1OFSA 2WT2A 4URAA 4YG3A 4FOQA 3AZYA 2YDEA 3SH3A 3AL6A 4W6XA 2YY1A 3QD6A 4COVA 2G9FA 1R083 4GH4C 4N53B 4MG2A 1B35B 4GWJA 3DYMA 5IVVA 3M7AA 2UU8A 5FZKA 2RE9A 4FTBA 2JICA 1OLMA 5C3PA 1JZ7A 1RUC3 2VZVA 3MW3A 2CTVA 4XVHA 1BMV1 2RS33 3PUIA 4M3CF 5FBJA 2V4VA 2R041 1LAJA 1BEV3 4L9BA 4Z2WA 1YC61 1NA1A 1AR91 2FHRA 2ADDA 3AYDA 4AVTA 2ZGNA 3VB9A 1MQTB 3PVBB 3KV6A 2WNOA 4JGYB 4J1WA 5JPNB 1TE1B 4URTA 3AB0A 3BPSA 1HW5A 1W9YA 5GZDA 5L7OC 3H8RA 1ND3C 3ZFEC 2QBXA 1HV1A 4FO9A 2FMDA 3BVCA 3I97A 5IK4A 1V9U1 1CAVB 2QZ2A 2R1DA 3CLPA 2BNOA 3FUOA 4NPMA 2WA3A 3I2HA 3Q8FA 2ZEZA 1NA1C 1SCRA 4IEVA 1OH4A 5T3NA 3VBRA 2C6SA 3N7KA 3HAGA 4CCDA 4AG4A 1HRV1 3A22A 1QJZA 1DYKA 2ILMA 2OT7A 3CF6E 1WKYA 4QX2A 4L97A 3KM5A 3LA3A 4LITA 2XLGA 3C8XA 3ZSJA 4MGIE 3WF1A 2WQ8A 2H0VA 4WM7B 4YFZA 5I0UA 1LOFA 2BWAA 3WNXA 1D0GA 4DY5A 3AKTA 3HWJA 3NAPB 3DGTA 1YI7A 3VBRC 2H0BA 4K6BA 4Z8BA 4A7KA 4QX0A 2XH6A 2VMFA 4NHMA 3HIFA 4XMIA 2XOMA 3HT2A 1LULA 4RHV1 1RUH1 3GJBA 1TMF3 1OA3A 1OUSA 1LOFC 4HLTA 4AEKA 1NLSA 4QQPA 4L92A 1WW7A 4MUVA 1CZVA 1ZA7A 1UOJA 2VY0A 4PQQA 3O1TA 5A7NA 1W6NB 1O59A 1UU5A 3WNNA 1ENRA 2E9QA 2ORZA 3R6SA 3VKOA 3LDRA 2FCVA 4UT5A 3IIAA 1QJY1 3QBQA 5DUWA 1DQ1A 3OJBA 1VLNA 2V5DA 3EO6A 4FFHA 2W47A 3WZ1A 3MBWA 2Z4FA 2XB6C 4MH0E 1Z78A 1S2BA 3ACHA 2ZZQA 4N8MA 3ZXGA 3WP3A 3Q8CA 3MLLA 4FPJA 1C8M3 5FZDA 4XE9A 1P8JA 1GP5A 4G9SB 3FC0A 3R4DB 2Q8EA 4I3GA 4MSVA 4P9LA 3ZYIB 1GOHA 4I02A 2HWE1 4LBNA 4KMQA 1ND2C 2UY8A 3KCCA 3Q8BA 4L11A 5K7PA 3OPZA 2XXZA 1MVEA 1H9WA 3I59A 1WMDA 3LZZA 4AEJA 5AC93 3GJAA 4HSLA 5LATA 1UWWA 1WLCA 2R30A 3ZN6A 4O9EA 2XPJA 1UU6A 3KT1A 3MFAA 4K20A 1OLQA 2JDKA 5FZOA 2RMU2 1AF9A 2ZGQA 4QXKA 3RWNA 1VR3A 3KVAA 1RUOA 2HYKA 2Q4SA 4Q8LA 2EICA 2VQUA 2JIGA 1CR7A 3BOPA 2ETEA 3FFQA 3THPA 2BFUL 3NNLA 4IE0A 1LJ7A 1VBD3 4PI0A 3WUDA 4WVWA 4Y1YA 5FR3A 3VZJA 5LY1A 1Y9QA 2YC0A 5I0TA 5ISLA 2VCAA 1LEMA 3V0AB 1X82A 2NQYA 3IB3A 2QQWA 4DQAA 1G7YA 4N7UA 2DBIA 4HMZA 1WD4A 4F7ZA 4QGMA 5J1XA 3U07A 1ZRIA 3HT1A 1IKPA 4I30A 3BU7A 3UGFA 1W99A 1Z7S2 3NJYA 1DYPA 2QQLA 3AKRA 2D43A 4CUCA 2KR2A 1EV11 5DZEA 4AVBA 2AR6A 5FY8A 1O8SA 5L9VA 3QACA 1JYCA 5H9QA 2GZWA 5T50A 4IERA 1PNFA 1XRUA 5FYBA 4COZA 3UGGA 5K0UB 4Q4V2 3THDA 1N1VA 5DN2A 1Q8VA 4JKKA 2OX0A 2OXBA 1UD1A 3JBG3 4P5HA 2G9ZA 1VP6A 5FMOS 2ZMNA 4NAOA 4WVMB 4Q8KA 1NZIA 1O4TA 1RUJ3 1VBC2 5T5OA 4CDXB 3RZZA 1JYTA 4QDRA 2F6BA 2HH9A 1RVF2 1ZNPA 3RDIA 4D0QA 2XG3A 4Y1UA 1DU3D 4F8AA 3VBUA 5C4WB 2NM1A 3AYEA 2ZX4A 1COV1 2W1UA 3ZVXA 2ZX1A 1IOAA 2VW1A 2B9VA 4LE4A 4Y4YA 1Y43B 1TME1 3MI8A 3DPRB 3EMRA 4JQTA 4A45A 3JU9A 1JXNA 4A7ZA 1RUI1 2WNUB 1RB8G 3BKZA 1PO13 2YXSA 5C6CA 4HKLA 4N43A 4Y1VA 2ZZJA 4ZPIA 5BNNB 3T2PA 4IV1A 2MEV3 3MV11 3H0OA 2I07B 5EZWA 3U11A 1LU2A 2P3IA 2AH2A 2KD7A 5GM0A 4A3XA 1N1SA 1W6QB 1WW4A 5DXDA 2BDRA 3ETPA 3LF7A 5FQ0A 1NE6A 1AX0A 2C24A 1W6PA 1MR5A 1GV9A 3VN4A 2EIBA 3AP7A 3NW4A 1U5YA 1AJKA 5AFBA 1OF3A 4HBNA 3VDDC 1WMXA 3TEYA 4AHYA 1QH6A 3EYPA 2OA2A 4NR1A 4IV1C 1RJ7A 2XR4A 1F4AA 2OQ7A 4QHBA 1CN1A 4WZCA 2FCUA 4XUPA 3WP5A 2VMDA 3DKQA 3AVSA 4A3ZA 4YRDA 3KQRA 4BWOA 4MHRA 2P6CA 3AL5A 3OTFA 5DDJ2 5IUQA 2ZGUA 5F7UA 3M3CA 5JOXA 2J22A 1W9WA 3FZ3A 4TXWA 2RM21 4BXSV 3K77A 4Q0PA 2VCMA 4XAAA 5FY4A 3RJ2X 3A21A 1D7PM 1QJX2 3KHCA 1AL21 2GNMA 2TBVA 3QLQA 4FOYA 2X53S 3VHRA 1DQ4A 3WP4A 5HV4A 2K9ZA 1VBA2 4YSFA 3TN91 2D6KA 3IMNA 4JC1A 3IPVB 2HBTA 4P02B 3M3IA 4JRAA 2EIGA 3SKVA 2ZX3A 1GQPA 3W59A 1PK6A 2WS92 5JZGA 4NHXA 2AEYA 4XZPA 5FYZA 5AFEA 3NNMA 3FBYA 4GJYA 5LBBA 5HPOA 1GU3A 3WQ1A 4IGPA 1I9RA 4XQDA 5LY2A 4LLFA 2HEYF 2ZX2A 2RV9A 3BALA 5FYMA 3VBOA 3GCWA 1YJKA 1UXXX 5HBAA 5FY9A 4HPKA 2DWRA 1LESA 2C4XA 2Y6FA 1YQ2A 1PGL2 1NE4A 4LBQA 1PK6C 5JZGC 1CAXA 4GWNA 5FZGA 3VBHA 4WVZA 1QH7A 4XXAA 2JDMA 3RS6A 1IG0A 2P3YA 5LA1A 2WC2A 2PYTA 1RHI2 4QKNA 3JXSA 3ZR6A 4KG0A 1IQAA 4YVWB 1R1A2 3KWVA 4NPRA 4RS5B 3RYRA 3VKFC 3RGBA 3VBOC 5KHIA 1CX4A 1N3QA 2RJLA 4XTPA 1K5MB 4AVSA 3WDYA 4CP0A 1W39A 2XBO1 2P34A 5K0UA 3I2DA 4A4AA 1PX3A 1SZBA 2WINB 4PT6A 1Q43A 3VBHC 3OBRA 3Q8EA 1XBFA 4KBBA 4B1MA 4BOWA 2CDPA 4D94A 2AENA 2JG9B 4FFFA 4ZZ5A 4QB1A 3MZHA 4DUXA 1C5HA 2WNEA 5FTTC 3AX4A 4BYYA 3OPTA 5KR7A 2GNTA 3NV4A 2D40A 1US2A 1YO8A 2WZR1 4YZ1A 1RIRA 4CCCA 3JQWA 1HRI3 3D0JA 4YG6A 4UW5A 2WNVC 3ZXAC 2D5HA 2P4EA 5K0UC 3USSA 1BMV2 5KXDA 3ZLIA 4HONA 1YLLA 3AP4A 2R042 4FXGB 1L7QA 4OI0A 2GU9A 2VD7A 1BVVA 1GANA 1UOBA 4LK6A 1AR92 3AMHA 3G7DA 4PI2A 3P5BA 3U78A 2VZQA 2SLIA 4WM8B 4D69A 3WXPA 5C9AA 4YGDA 4NRPA 1QJU1 4EZ4A 4H14A 4QHOA 1VBE1 2CSGA 1W0NA 2V09A 4YM2A 2MNGA 3I59B 1V9U2 4OI1A 3NWKA 2CL2A 3HNYM 3T4VA 2W1SA 4M01A 1ZBE3 3WVJA 1GR3A 1I5ZA 1ODNA 3OUIA 3OB8A 4G3YC 3ZDSA 1R091 2FD8A 2AGSA 1AR83 4XF3A 1HRV2 3POWA 4Z2AA 5C9AC 3AJYA 3B9CA 4Y5TA 5I0RA 1XYNA 5EQUA 2AACA 1YHFA 3E1F1 3VKNA 2CGPA 1SLBA 2CHHA 4CP9B 5F8PA 3I8TA 1QF3A 1W2NA 3HN1A 2HWB3 3N9PA 2EXJA 1I6XA 4RFRB 5DAPA 5FLIA 4YW1A 2QUOA 1RL3A 2VOVA 3K4DA 1OOPB 3LIGA 4NOTA 2MHFA 1GMMA 1JTZX 4OQ8A 4DINB 2BZDA 1W9SA 4QQOA 4L0PA 3UETA 4Y3OA 2E6VA 2IFRA 1JOJA 3UL2A 1S0FA 2JG8A 4MGYE 4ZY9A 1E5SA 1WW5A 4JTNA 4P9WA 2QVSB 1CAUB 4FTSA 2ZGPA 2AC1A 3IMMA 4RHV2 1OVPA 1RUH2 3H50A 2VNVA 1DZRA 5KHGA 2VW0A 2Z42A 2X8KA 4AOCA 2IVIB 2KXLA 2EA7A 2VCBA 5EJ3A 3U4XA 4E4ZA 1JZ6A 2ZCWA 3O1VA 2QQNA 3AKPA 3W21A 4B7EA 5LZ6A 2PFWA 2XQRA 1XB9A 3NO8A 1DGRN 3MW2A 4MZUA 2JG8C 2JX9A 1GICA 4YZ5A 1MZFA 2B8MA 5BNOA 1NY71 4AI0A 1CESA 1HJFA 4RQPA 4Y1ZA 1QJY2 2RS13 4OULA 3PIGA 3O1UA 5FP9A 4JTOA 4P9GA 2L9LA 3ZXEA 3GHNA 5T5JA 3VBUB 1DLLA 1RUG3 5LBCA 1SCSA 2VTFA 3AK0A 2EALA 4IXLA 1TNRA 3DYOA 4RN5A 1NT0A 2YYOA 2DTYA 3FJSA 5EP9A 2ARAA 2QQPA 1SPPA 1UZWA 1AR63 1YCIA 2PHDA 4YZ3A 5BNOC 4CTEA 1W04A 4PQ9A 4K7JA 2F4PA 2YBKA 5ACA3 4RQPC 2Q5TA 2UURA 2HWE2 1STMA 3LPGA 4N43B 1UZVA 2WZEA 3PTYA 4QHZA 4Q26A 2G4IA 1PHMA 1NOVA 1R64A 1U5XA 2CAVA 4GZ9A 1SLIA 1RUE3 4IE4A 4QQ2A 4RR3C 5APAA 3WDTA 3PU3A 1Q8OA 1OLRA 4NHLA 1TEIA 1DQ2A 1LOEA 4ZS2A 4DPNA 4CEWB 2BEOA 3WG3A 3R4UA 5FQ0B 1SLCA 1YUDA 1D4M3 2BTVC 2NLRA 4WZFA 4M0HA 4XJWA 4R9AA 4WV8A 3RSJA 4C0BA 4DEQA 5A33B 1YEWA 1W05A 4OCTA 1XNKA 3IT8A 2TEPA 5FYYA 1KRIA 4OI4A 2XUEA 1CD3G 2Y0IA 1X33A 1CJPA 4NJ4A 3QH6A 5EYXA 3IDCB 4CCEA 3C7EA 1X36A 4N53C 5FMBA 1DGWA 3VHNA 3PNAA 1JZ5A 3MO4A 5IT6A 5DUUA 3D6EA 4LQRA 4Q0UA 1WLDA 2HWC3 3HJRA 3U14A 3SEPA 2BGCA 3TEXA 1LRHA 5D1IA 5T5LA 3VDAA 3ZYRA 1EV12 1HLCA 5FZ9A 2BGPA 4DZGA 4Y20B 4NRQA 3T09A 3MFCA 3OF1A
chains in the Genus database with same CATH topology
1PO23 3D5OA 2O8OA 3AMPA 3KB5A 3SCHA 2LM3A 4Q4W3 2WFF1 5C8CB 4FSJA 2VNRA 3JD73 4AHXA 2QDRA 3ZX7A 1VBC3 5KXBA 4XFIA 4XPVA 4AVVA 3SXWA 3H8UA 1MS1A 5JAXA 3VZKA 4AF9A 4E4DX 2ARXA 1COV2 2GC3A 4HK9A 1BYHA 3M70A 4PLOA 4AE2A 3E5XA 1H9PA 1GZWA 2EVXA 1TME2 3N7JA 1HDKA 5LEJA 3KLSA 3VL9A 4LBMA 2V73A 1RUI2 4XXPA 1FOD3 3QCWA 1PVC3 2LTNA 4OHWA 2DU0A 4OUMA 1UPSA 2UWAA 2X5IB 5LEKA 3C3VA 3N3HA 3POSA 1QY4A 2JDZA 2DF7A 3FHIB 4Q4Y3 1V6LA 2AYHA 4FAGA 4HKOA 2HWD3 4QD2A 4HN0A 2XL9A 4Z07A 4NN0A 2P37A 4I09A 4XJ8A 2VQ0A 4LO7A 3EJKA 1APNA 3ZO0B 2H6BA 4FPFA 1QU0A 5LK7B 4BH9A 4BHPA 3D8CA 3ZSEA 4PDWA 3J4UH 3MF6A 1H8TB 3M1HA 1FXZA 2RM22 4I0WB 4Q0QA 2A71A 3A0KA 4AGGA 1N47A 1ZBA3 4YYOA 1AL22 2EXIA 1D2SA 4JQRA 4X8PA 4JV4A 3VBFB 2TUNA 3NV3A 3TN92 2YZ4A 1NCQA 1OI6A 1POV1 4P9JA 3APBA 2GSYA 3K51A 4JGZB 4LA3A 3MPBA 3GHMA 1REEA 2PLV3 3ZMNA 3H7JA 3AYCA 1QQP1 5FOJB 1W6MA 1KS5A 4RD7A 5BNPA 1LKNA 4A7YA 4NWWA 3SITA 2BBVA 4K8FA 1ZRFA 1NCQC 4DRVA 1OSGA 1GBGA 4XDQA 1FI2A 1NCRA 2D6MA 4HT1T 1MS0A 1CQ9A 2X29A 5FO7B 4GIQA 2E7QA 2GDFA 3CL1A 1C1LA 5I8SA 1X8MA 1QOOA 2R063 4GB33 5C33A 4IEYA 5BNPC 1DFQA 1WA4A 3B01A 5JWPA 2QE3A 4Y5Z0 3WDWA 2ZABA 1C28A 4CDUB 2XBO2 2PQQA 3N35A 2WJSA 1NCRC 4IV3B 3TNQA 5F1RA 5GLUA 3MYXA 1GNZA 3MIBA 3GZAA 1BBT1 4COYA 3HBZA 1SACA 1PZ8A 4FXKB 4K1ZA 1DGRA 3V0BB 1REDA 2AREA 2WZR2 3OY8B 1ZZ9A 5I8TA 2R0HA 4BMBA 4GMP3 2HKXA 3WOGA 3TWIA 4EN6B 3R05A 1EAH3 1PM7A 1WMFA 2C0ZA 3N7MA 5L7OA 1ND3A 2RS53 2WLQA 3ZFEA 1CVNA 3S0MA 5I91A 1QJU2 1SBEA 1X50A 4Q4X3 3FBMA 1VBE2 2HEWF 4HSJA 1Q8PA 1QNWA 2ZGOA 1LTEA 1KFXL 2XJPA 1WGPA 1H1MA 3C2UA 3GYDA 5C4WB 3B3QE 1R092 3ZXLA 2VUAA 1LECA 1WLTA 4AGRA 1HRV3 3B7MA 5BNNC 2QZ3A 1U5ZA 4GULA 4XBLA 3VZNA 2DCYA 3H3UA 1MS5A 5LRSA 2A7AA 3IWZA 3VBSB 1HXS1 5FCCA 5A3MA 2WSUA 3AKSA 1QXJA 2A6WA 4KQ7A 4QPGB 5JOYA 1R081 1RC6A 3IBMA 1G9AA 2CY6A 1FMD3 2YMZA 5GLZA 4L8QA 3WQ0A 3KSCA 4AQ2A 1RUC1 4XYXA 4M3CB 3WR0A 5FBZA 1MEC3 2RS31 4BLIA 3S7IA 4CDWB 3ZXKA 5D8AC 1DBNA 1G8WA 2D3PA 3TB0A 2IFWA 2NN8A 4EN8B 1VRH3 5JIUA 2ZHLA 1RUD1 2XJVA 1O5UA 1H4HA 4XBNA 1FNYA 4FVVA 3PHMA 2BNMA 1D0HA 2DVFA 1UAIA 1C57A 3PJYA 4ZU4A 5BNQA 4ITCA 3ZXDA 1RUF3 1S0CA 1HV0A 1NQJA 2EXHA 2GN3A 1BKZA 4GA9A 5L36A 1UIJA 2ZHKA 1NY72 2V5YA 4XW3A 3V56A 3J26N 4CYDA 4X8NA 2Y0OA 3LOBA 1X7NA 2GALA 2A73B 4RGGA 4FP2A 4GMP0 3UKNA 4XTMA 4BLJA 5JSRA 3AZVA 3VKMA 4JCKA 3FLPA 1UIKA 1ND2A 3L2HA 2XJUA 2XKOA 4AXOA 1SLLA 3K48A 1NXD1 4EN0A 3FUQA 4XFHA 4B3NA 2NYYA 3M3OA 1QXRA 2OVUA 1Q5OA 2EAKA 4RS5C 4ZU5A 2GH2A 1TMF1 5TSWA 2ZGMA 3E97A 3CJIB 5DZFA 1QOSA 1UN1A 3MIGA 4YARA 2XVGA 5CFCA 3RNSA 4QU2A 4Z82A 1YI9A 3TNPB 4XF4A 5CADA 1YFYA 2CWMA 1LHVA 3B9IA 1HQNA 1RINA 1OD5A 4Q0VA 1MS4A 1YIPA 4OVEA 4AFMA 5DUXA 5CNAA 4ES8A 1OQ1A 1O5LA 3OYWA 3L9JT 1N3OA 4UW6A 4AWDA 5CFCC 1C8M1 1WLWA 4W6WA 3AMNA 4DMIA 3FWEA 1PNGA 4COUA 1IS5A 4IESA 3ZIWA 4WM8C 5GZCA 2YROA 3OGGA 5GZEA 1QMJA 2P3JA 5J96B 1KJRA 4LBJA 3SMHA 2WFF2 2RR11 1WCDJ 5AC91 5CFDB 4YVSB 3NV1A 2ZTNA 4K9SA 1D2QA 3PVNA 5A32A 4QM8A 2VG9A 4Q27A 1COV3 3M2MA 4AFBA 5I8YA 2D93A 1VBD1 4Q2FA 1DG6A 1NZCA 3VL8A 2GC1A 1VBB3 4Y1XA 4QPIB 3VUOA 3USUA 3URFA 2HWF3 4FCAA 2R32A 4LO6B 3SH5A 2ZAAA 5F9TA 3N4MA 4XJZA 2B45X 2DYCA 2DCKA 3WHTA 4AHZA 4LHLA 3AZXA 4MXWA 2BFUS 2DVGA 3G6JB 1KITA 5FPZA 2WQ4A 3CEWA 2R0FA 4O9GA 1ENSA 5F6KA 1DDLA 2LALA 4S2FA 3VV1A 3WCSA 4GH4B 1OHFA 3VDDA 1YFXA 2A70A 2YHJA 2ZGSA 4GQ7A 4LUMA 4EWEA 5KC6A 3WDXA 3ZXJA 1FNZA 4IEZA 2BUKA 2XJQA 4N9IA 3FLRA 1XU2A 1ZREA 3I4IA 3JBG1 2Q0AA 1FPN3 1JUHA 2PHRA 4B4PA 4CEYC 1ZZBA 5K9YA 1MVQA 2R073 1AYN3 3MEPA 1S0BA 2BQPA 4GWMA 2PHLA 1AL23 1ND3B 3ZFEB 3BCWA 4AEMA 2DV9A 2YV8A 4PCRA 4EN7B 1TQ5A 4QMAA 1DZQA 2B42B 1PIV1 3PVOA 1NA1B 1PO11 5KXEA 1MZ5A 4D7YA 2PA7A 4LR4A 4Q29A 1KQRA 5FAXA 2MEV1 4EROA 5FPXA 2D3RA 5LRRA 2CV6A 1AYM3 2BVVA 1QQP2 4FQZA 1N3PA 1RGSA 3MGUA 2O8QA 1F2NA 4ASMB 3H1WA 1H1IA 4DNYA 2B7YA 4N90A 4MX3A 4SBVA 3VBRB 4S2GA 1DGLA 5JLVA 1SQ4A 3GZUC 3AMMA 2I45A 2IXLA 3U0ZA 1JW6A 1UL9A 4AFDA 3GBFA 2XHKA 2R6QA 1QGLA 3SISA 2DUPA 3WT3A 4CZSA 5BY5A 1O3TA 2A6ZA 1OA4A 4Q1PA 3LOIA 1YIFA 4TWTA 3N7LA 1JBCA 1V6IA 5CG9A 1BBT2 3IM0A 3AKQA 4JRLA 3RYKA 2WIIB 4HK8A 1ULEA 2WNVA 4CDQA 2WZR3 4E9KA 1Q8SA 5T5PA 1HQLA 3ZFFA 2VW2A 1AX2A 5C8CC 2Q8OA 2XWJB 3BTAA 3ZSMA 4AI3A 2ENRA 4E2SA 4C0HA 3ZFGC 3NKGA 2FBEA 2I2SA 1ND2B 2IXCA 4QX5A 4ISRA 1ASJ1 1CAWA 2QFEA 4CDQC 1KJLA 4HZFA 4UXAA 3ZFFC 4YW2A 1XNCA 4HVQA 2FZ2A 3LSDA 2ZKNA 4FPEA 4G4FA 1VAVA 2XVKA 3ETQA 1R093 4BIFA 3X29B 2X5IC 1L3JA 4K1YA 4YGCA 4QM9A 1SFYA 1YJLA 2N7GA 5KC5A 1EYBA 4KG8A 1HXS2 3W58A 3ZN6B 1PZ9A 3JCIA 5F5QA 4KWKA 5AFEA 1R082 2E63A 3ATGA 4XJUA 1F5JA 4HFSA 2XUMA 5J36A 1AX1A 4KL1A 1CPMA 4R52A 2XVLA 3ACLA 1URXA 1RUC2 1HRI1 4RL7A 2RS32 1BK1A 2ATFA 3OYWB 4YW4A 5ABJA 2UWCA 3NV2A 5KWRA 4D3WA 1RUD2 3ZSKA 3AYAA 4IL7A 1ZZ8A 3LAGA 2NZ9A 1GZCA 4LA2A 3WP6A 3V65A 2QDNA 1VB4A 5C8WA 3O14A 2D6OX 2ZOEB 1ZBE1 4FPLA 5ABJC 2B46X 3RI8A 1AR81 2OPKA 5A32B 2P2KA 3OBTA 3PLQA 4JDMA 5T54A 2DVBA 2R16A 3MIDA 3L2YA 1BQPA 2HWB1 4U2AA 1DZTA 3MLJA 1LOGA 1SLAA 1A78A 4AEDA 5IK8A 2C5DA 4RR3A 3E6BA 5JOWA 2PHTA 4LBOA 1IS4A 3AMQA 3MICA 2GC2A 5FOBB 2B9UA 4AQTA 2PAKA 3WX5A 1GFF2 1XYOA 1Y7BA 1H0BA 1LODA 1DQ0A 4FPOB 4AEDC 4FPCA 1TMF2 1UKRA 4IV1B 5K8SA 3ILFA 3WW4A 1J58A 2DUQA 4MGKE 5AVAA 4IV3C 1G9DA 4LO4B 3OCPA 5CA6A 2RMU3 3ZYJB 4C90A 1GZ9A 2D5FA 4P14A 4N53A 4YNIA 4AFAA 4ATEA 5I93A 1B35A 1W6PB 4MV2A 3BOWA 4LTAA 2RS11 1ULDA 4XF1A 2PAMA 2OYZA 4YZ2A 1YXWA 4RA0A 4XJAA 3FFZA 3KCXA 4NVPA 1RUG1 2GC0A 5DG1A 5JR7B 3EBRA 1DF0A 1MQTA 2ZJCA 1KDMA 1C8M2 1EPZA 3ELNA 1AR61 1B35C 1WBFA 5ACA1 4JAAA 1Z7S3 2VXRA 3JZVA 1UZYA 2XJSA 1RUE1 3AM2A 4HN1A 2RR12 4AQSA 5AC92 1CAVA 4LUKA 3MDPA 4R9CA 1ZRCA 3UKTA 1YFWA 3PJQA 4E2GA 1MQTC 2CNAA 2OIIA 4JGYC 4Q4V3 1D4M1 3WW3A 4PIYA 5C4WC 3LA2A 1PK6B 5JZGB 3RG0A 1S55A 1FYUA 2NMNA 1M06G 1VBD2 2QCSB 2CYFA 5B2GB 3PMSA 1MS8A 1RVF3 4WM7A 5EYYA 1E57A 3DV8A 3VBOB 3NAPA 4X6RB 1BJQA 2VMIA 4HPKB 5T55A 5JVVA 1UZZA 4LBQB 2C1FA 1CAXB 2HWC1 4IEOA 3VBHB 3WCRA 1U12A 1RITA 4D7TA 2D44A 4AK3A 1GSLA 4OHZA 2GH8A 5EXOA 4H7LA 4YGBA 4WM7C 3KT4A 1UPIA 3VLBB 1H2LA 4YW3A 3NAPC 1G86A 1PO21 4OLLA 3WLUA 2A6YA 1Q3EA 2WL1A 4Q4W1 3GZTB 2WNVB 1NXMA 1ZYBA 4KGQA 5HXVA 5KHHA 3JD71 5K0UB 1ULFA 3WINE 3JBG2 4B8EA 1ENXA 3MIHA 3WG2A 3SNMA 4LHKA 2JE7A 1DQ5A 4K21A 3AZZA 4HL0A 4K3UA 1LR5A 1FV2A 4UBHA 5BXXA 2DCJA 4Y24A 4AI2A 4DY3A 2PELA 5DDJ3 1UU4A 4XQ4A 4H7MA 3KCYA 1V6OA 1V6MA 1FOD1 1PIV2 4K40A 4QQLA 1A6CA 1PVC1 2FMYA 1PO12 1QJX3 3KMHA 2Y26A 2ZBJA 5C9AB 3CO2A 2MEV2 2VVFA 4L2NA 4C1XA 4LLOA 2VULA 2Z69A 5SV5A 1VBA3 4Q4Y1 2A3WA 1REFA 3B5LB 1AR71 4Z1VA 2HWD1 1Q8QA 5E1RA 2WS93 3ECQA 5FLHA 3H9AA 3R4SA 1G9BA 4OHYA 3E5UA 1AXZA 2ZGTA 3M3QA 3VHOA 3V0AA 4W65A 2OW4A 4I0AA 5HCBA 3RRDA 4I0BA 5FLJA 1QWRA 4IEXA 2HJIA 1F9KA 4GKYA 5E88A 4AVCA 1ZBA1 2AUYA 1RHI3 1VAKA 4E27A 3AP6A 4IEUA 2QJVA 3PVEA 1W6OA 1LHNA 1R1A3 3MW4A 2JG8B 4I01A 4GKXA 4EWAA 1UF2C 2W52A 2PHXA 3B93A 1O4ZA 2BVBA 4XILA 4YM1A 5GKAC 4DOUA 3NKTA 1QDOA 3CNAA 4PBOA 4QQHA 2VPVA 3KGZA 2WA4A 1XYPA 2PLV1 4WVMA 4TSVA 5E8AA 3D0SA 4CDXA 1KD7A 2CWSA 5CFDC 2YGMA 2K2SA 1HX6A 5BNOB 1ZRDA 4RQPB 4HKWA 4EV0A 4LBKA 1ASJ2 1UKGA 2A6XA 1AXYA 5E16A 1HKDA 1H2MA 1G9FA 2ERFA 3DPRA 3J8F1 1J3PA 2R043 4HETA 1I1EA 2GAUA 1F31A 2WNUA 2PHWA 4QPIC 1AR93 1ZRRA 2R061 3SHRA 4GB31 4AI8A 3HD8B 4CDXC 4DRRA 2JD4A 4XIKA 5BNNA 3EXUA 2BNNA 1B09A 1C8NA 3A4UA 3GBWA 3Q9OA 3QH7A 3NVCA 2VGDA 4DB5A 4TZDA 1CIWA 1W6QA 2W68A 3T1MA 4AI1A 2KM2A 5CB7A 2A3XA 3BIWE 1AVBA 1V9U3 3DPRC 3S7EA 4I3PA 2WNUC 3AP9A 4PIXA 2E7TA 1AHSA 3SCFA 1GQGA 1OQDA 1W2UA 2XLAA 2ZGRA 3BODA 5IK5A 5CVRA 5AVPA 4SLIA 4OI2A 3BPZA 5D8AA 3TBDA 1RMU1 2ET7A 3O7OA 1HRI2 1J3RA 4CP1A 2WQZC 4CRQA 2ZMLA 3JB4C 1FT9A 4GMP1 4IEPA 1SBFA 3A0NA 1SDWA 4YFWA 5J37A 1XNBA 4NO4A 1OPOA 1EAH