4UW4A

Human galectin-7 in complex with a galactose based dendron d2-1.
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
133
structure length
133
Chain Sequence
VPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVRIF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GALECTIN-7
publication title Structural Basis of Multivalent Galactose-Based Dendrimer Recognition by Human Galectin-7.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Sugar binding protein
total genus 30
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4uw4A00
5DXDA 1FNZA 3AFKA 1S0GA 3HN1A 1X50A 5DG1A 1SLTA 3O12A 5GM0A 1KITA 1UZZA 4BPZA 2GNBA 2Z42A 3M3CA 1ULCA 2ZGKA 4OZXA 5DUUA 2D6LX 2CWSA 3LSEA 3NV1A 3A0KA 1IKPA 4ATEA 3POYA 3IPVB 1MVEA 3D6EA 3WDTA 2B7YA 1MZ5A 4YG3A 4YW1A 4R9CA 1WW6A 4LBJA 1YI7A 3VKNA 2OUHA 3M3EA 1FYUA 2VY0A 1MZ6A 1V6KA 1YIFA 2FHRA 5F5QA 1KDKA 2VXRA 4Y1ZA 5T54A 1BJQA 1UX6A 1LOAA 1QMJA 3MEPA 1CN1A 3O0WA 3RMYA 3WG3A 2I2SA 3ENRA 1LEDA 1QNYA 4I30A 2A71A 5DZFA 1DQ6A 3I4IA 2P37A 4M3CE 5GJ6A 1C4RA 1G9DA 5IK7A 1LODA 1Q8VA 1YRZA 2AYHA 3RS6A 4P9WA 4DPNA 1AJKA 1W6QA 1OQ1A 2D6MA 1MR5A 2A70A 3D5OA 4RL7A 4XE9A 4YFWA 4K1ZA 3WDYA 4TZDA 1IS3A 5IT6A 1Q8QA 2P3IA 3AP6A 2EAKA 2A3WA 1LGNA 3SH5A 1FV2A 2EALA 1GKBA 1H9PA 2ZMLA 4Q1PA 1LOEA 4Z8BA 1VAVA 5T55A 2ZABA 4BLIA 1O4YA 1UZYA 2BQPA 3ZSLA 3AP5A 3AP9A 1LULA 2W52A 2A75A 4WV8A 1BXHA 3KM5A 2WNEA 3WDUA 3WHUA 2E7QA 1GZWB 2ARBA 2HYKA 3V0BA 3ZSMA 1O4ZA 2PHRA 3ZPYA 2DV9A 4P14A 1IOAA 3UJOA 5KXEA 4FQZA 5EXOA 1MVQA 5H9SA 1GNZA 1DYKA 1SBFA 3AYDA 1SLAA 2WSVA 1PZ7A 3RSJA 1UAIA 1SLBA 3OY8B 4PBPA 1V6OA 5SV8A 2ZKNA 1RIRA 1GV9A 2GNTA 1MS0A 2V5YA 4AGRA 3AZVA 3RQ0A 4LBQA 4UW4A 1QOTA 1UL9A 1VAMA 2E53A 4R9AA 1WW5A 3NV4A 4YZ3A 5KXCA 1LHOA 3N3HA 4M00A 3SH3A 2A6VA 3BTAA 1AJOA 1WBFA 2CTVA 3AXDA 4XDQA 1MACA 1DLLA 2CNAA 1IKQA 1DFQA 2PHFA 4YFZA 1KRIA 2DTYA 1WBLA 2YXSA 2JE9A 3T2TA 3DGTA 3V64A 1IS6A 1AX0A 1G8WA 1A78A 1Y7BA 3AXEA 4XHXA 3UL2A 5IUQA 1G9CA 1GSLA 1ULGA 4LBOA 2AENA 5IK8A 3FFZA 2R16A 3A0NA 1V6NA 5HCAA 1G86A 4FP2A 3QCWA 3AYEA 2A7AA 2W68A 1AXYA 2WJSA 5AVAA 4ZXKA 5JOYA 1SLLA 2R1DA 3OBTA 3ZXEA 5F9TA 1GZCA 3FUOA 2EF6A 2A3XA 4YLZA 1N1YA 4GA9A 2P3JA 1ULDA 2UWAA 4XIKA 1H30A 1JHNA 3VKMA 1KQRA 4XTMA 4Y20A 1V6MA 4TYSA 1HDKA 1G7YA 1GNHA 4FP3A 2G4IA 2WT1A 3N7JA 1CONA 4LBLA 4ISRA 4UW5A 3R4SA 3AYCA 1AZDA 4XBLA 4Q26A 4YGCA 3WNXA 3OJBA 1S0JA 2JECA 1GANA 1ENSA 4FPYA 3POWA 1SBDA 1R1ZA 3IKWA 3SITA 4YZ4A 3WDVA 2NP0A 3ILFA 3O0VA 2WT0A 1LHUA 1DZQA 4PCRA 1GLHA 5DZGA 3BODA 1N1TA 5H9PA 1LCLA 2ZMNA 3MW4A 1UN1A 5EWSA 3W58A 4BLJA 2XG3A 3RMXA 1URXA 1NXD1 1LOFC 1D2SA 2JD4A 3MW3A 4YW5A 1LGCA 3IN9A 2YY1A 3VV1A 4DS0A 2GMMA 3VKFC 2E51A 1CQ9A 2EXHA 1KJLA 1LEMA 2R49A 5GLWA 4WZFA 1ULEA 1V6JA 4AVSA 2UU8A 2DYCA 2DVBA 2ZGLA 4Y24A 1LJ7A 2NN8A 3AZXA 5CAZA 2W39A 1FV3A 2JKBA 1LTEA 1QU0A 2A3YA 5GZDA 2YROA 3SLIA 1JBCA 3NV2A 1G9BA 1W0PA 3PMEA 4XJUA 4ISQA 4F83A 2PELA 1DIWA 5JVVA 2CYFA 2AUYA 5E89A 1LENA 4FPLA 1WCSA 4HL0A 4BOWA 2KM2A 2DVFA 1SLCA 1UPSA 3O0XA 2R0HA 3PJQA 1I1EA 3V0BB 2WSUA 3RRDA 3FUQA 3AZYA 2ZHKA 2VW1A 2R1BA 1WLWA 2D6PA 3WLUA 3ATGA 2ZGQA 3ASIA 5FRAA 4JC1A 1U0AA 3T1LA 1V6IA 2OW4A 3R05A 5GZCA 1LU1A 4FPFA 3M3QA 2DVAA 3SISA 2ZACA 1PZ8A 2R0FA 3WG2A 3AX4A 2ZGRA 1BYHA 1TEIA 4LBQB 4XBNA 1JOJA 3AP4A 1CIWA 1QOOA 2D7FA 4M3CA 1XQNA 2TEPA 5DUVA 4Q8KA 1UKGA 3WOGA 5T5JA 4ZKTB 3DUIA 4BQ1A 2A6XA 1I3HA 4DFSA 5IK5A 1A8DA 1BZWA 4DRVA 1DYPA 3N7LA 4PF5A 3WUDA 1MS8A 2WQZC 4FOYA 2NMOA 3POSA 2C9AA 2ZA9A 4XJWA 3USUA 1A3KA 4ASMB 5GLUA 4WVVA 2EXIA 1Q8PA 2P3KA 4FOQA 1YO8A 1W6PA 3V0AA 1QGLA 2D43A 3CNAA 2D6OX 2VH9A 3BIWE 4YW3A 2ZGMA 3WZ1A 3RG0A 4HANA 1LOCA 2AH2A 3AYAA 1G9AA 2VW0A 5T52A 2NZ9A 1LHVA 3B9CA 4M3CF 2AREA 4BMBA 3B3QE 1FNYA 1W0OA 5JLVA 2XB6C 3MPPG 4FPOB 2WKKA 4GXLA 4GWMA 3TB0A 2FMDA 1W6MA 4C1WA 3U4XA 2JE7A 1GBGA 1Z0HA 2ES3A 2VU9A 3B00A 2GALA 3FLPA 5JMCA 1LGBA 4LBKA 2CWMA 4Y1UA 4LBNA 4XTPA 1CESA 4ATFA 5T5LA 5JOZA 2CL2A 1Z78A 1WUVA 4Q2FA 1BKZA 1FAYA 1LECA 4LBMA 4XMIA 2DUQA 1C57A 2H0BA 4H55A 4UW3A 4YGEA 2WLQA 4K21A 2D3PA 2YMZA 1DHKB 1QOSA 2UURA 4YM2A 2ZZJA 4XMAA 3WG4A 4GWNA 1S0BA 2C5DA 1V6LA 3AZWA 3BOPA 2PHTA 3B69A 4XZPA 5DZEA 3WCSA 2AGSA 2EXJA 4D69A 2A6YA 2PHUA 1AVBA 4DQAA 3AJYA 4FOWA 1IS5A 1J1TA 1DQ4A 1AX2A 3C2UA 1JW6A 2NM1A 3PVNA 2DU0A 1LOBA 1EPWA 2OUJA 1F9KA 1Q8OA 1QF3A 1AXKA 4R9BA 2SLIA 3UK9A 3GALA 2ZGPA 4P9YA 2DVGA 3O5SA 1ENRA 5HCBA 3FBYA 3A4UA 4DRRA 1VLNA 2D3SA 2ZAAA 5FREA 2GNDA 5CBLA 3N35A 1KDMA 5EYYA 2DU1A 1S0EA 4FPEA 3GNEA 4K1YA 4XYXA 3ILNA 2ZGOA 3UJQA 1SBEA 4WVWA 4Y22A 1SCRA 1AX1A 1QKQA 3ZSKA 1SLIA 2JJ6A 3HR9A 1H9WA 3H0OA 4GKYA 1LHNA 1W6OA 2GDFA 5JOXA 1SFYA 4XOGA 1AXZA 1YYNA 4Q1RA 1W6QB 3KQRA 1CPNA 5LK5A 1V00A 1S0DA 1ZA4A 2YV8A 3AJZA 4AVVA 4JCKA 2NMNA 2UWCA 1HQLA 1WW7A 2E7TA 2EIGA 4PBOA 5E8AA 3WCRA 1W6NA 1LOFA 4XJZA 1SCSA 3OYWA 4XJAA 3WG1A 4AGGA 4YZ5A 3OPZA 3INAA 5EYXA 1JN2P 3MW2A 3ZYPA 2PHXA 4SLIA 1BQPA 4Q27A 1JYCA 2LTNA 3FLTA 5HCFA 2GN3A 1F5FA 2ZBJA 3N7KA 4IQPA 1QNWA 3L2YA 1B09A 3IM0A 4M3CB 4C1XA 1ZM1A 1ULFA 1DGLA 2Q5TA 3AZZA 5GALA 4YM3A 3ZXJA 2AR6A 4CTEA 1CPMA 1WLCA 3USUB 5IK4A 4GKXA 4YG0A 4M01A 2DURA 2ZHLA 3N36A 4RA0A 1G9FA 2D6NA 1IS4A 1SACA 1FX5A 2WT2A 3V0AB 1S1AA 1W6PB 1FATA 4YW4A 1PZ9A 4K20A 3JU9A 2GNMA 5CNAA 1NLSA 5L73A 5T5PA 4Y1VA 1WLDA 3PVEA 4NOTA 4XXAA 4KBBA 2A6ZA 3JUUA 1RITA 5CA6A 5GZFA 1OKQA 4ITCA 2RHPA 2DTWA 5E88A 4YGDA 3ZYRA 1JXNA 4NO4A 4CZSA 4Y1XA 1GICA 1LOGA 2D3RA 2VW2A 4XBQA 1W6MB 1MS3A 3LSDA 3IPVA 4Y1YA 4YGBA 2SBAA 3VKOA 1WD3A 1MS4A 2ZGUA 2ARXA 4FPGA 4UW6A 4W65A 3ZXKA 5KXBA 4FQ4A 4R9DA 2ZGNA 1LHWA 2DWRA 3ZSJA 3OBRA 2EXKA 4FPHA 1C1FA 1N1SA 3V65A 1GZ9A 1DQ1A 2DUOA 1D0HA 1DQ2A 2DUPA 3T1MA 1QDCA 2ENRA 4JRAA 2ZGSA 1Q8SA 4Y20B 2GMEA 1JUIA 4MYEA 4YW2A 3FLRA 3W59A 1S0IA 1APNA 2ZHMA 1C1LA 2GN7A 1ONAA 3Q9OA 1AF9A 1VALA 2W08A 4BM8A 1MS1A 4GALA 4XHBA 2D44A 1GYKA 3SH4A 2VUAA 3WDWA 4YM0A 1YXWA 1F31A 1QDOA 4XXPA 4P9XA 1DBNA 4BMEA 4Q8LA 2E6VA 1S0FA 2NYYA 3N7MA 1ENQA 2ZMKA 3NWKA 1CJPA 1CR7A 4XIOA 3ILRA 4CRQA 4FPCA 1DQ0A 1GZWA 4XJ9A 1UMZA 2ZHNA 4FOVA 2CY6A 5GLZA 3LCPA 4Y22B 1LESA 1LU2A 3WDXA 1OFSA 1WW4A 2ERFA 2JDZA 3M1HA 3OY8A 3APBA 4FPKA 4YZ2A 4AYUA 5DG2A 1W6OB 3WVJA 3WUCA 5JOWA 3IMNA 1HLCA 3SNMA 4Y26A 2GMPA 3QLQA 1CVNA 1RINA 3AK0A 3AP7A 5GLVA 4YZ1A 4PQ9A 3WV6A 4FVVA 5GZGA 4AGVA 2YZ4A 2P34A 1W6NB 2V73A 3PVOA 3OYWB 4U2AA 2PHWA 5CB7A 3ZXFA 2A6WA 5H9RA 3R4UA 3NV3A 1N3OA 1N1VA 3M3OA 1MS5A 3I8TA 4FPJA 4YM1A 2UWBA 4XILA 3M2MA 1HKDA 3ZVXA 2D6KA 2DVDA 4XJ8A 4AWDA 2P2KA 1S0CA 5T5OA 4AVTA 2A5ZA 3TAYA 5GLTA 4U36A 3WHTA 3HMYA 3VUOA 1N3QA 2LALA 1MS9A 5H9QA 4L8QA 1JYIA 4LBQD 5GZEA 1Q56A 1N47A 1KJRA 5DUXA 1HQWA 3VKLA 5BYNA 1VIWB 1N3PA 3B01A 3ZXLA 4YG6A 2ZGTA 2OVUA 3D4KA 5KXDA 1WD4A 3OGGA 5T50A 5JDBA 1DQ5A 5DUWA
chains in the Genus database with same CATH superfamily
3KLSA 5EP9A 3ZFEA 2H0VA 3VD9A 5DG1A 3E5XA 4Z92B 4GULA 3O12A 5GM0A 2V4AA 5KR7A 3CL1A 5FZ3A 1C5IA 5C9AB 5D8AC 2VNOA 5JI7A 4PI0A 4Y5TA 1YJLA 1HIXA 2O0OA 4PHZA 3CDZB 4ATEA 3NV1A 3POYA 3WP3A 4YW1A 3RYRA 5LBCA 2R041 1WW6A 2UYBA 3AKTA 1C8NA 1PM7A 3C7HA 4KBZA 4W50A 4I3PA 3VBSC 5J96B 2HWE2 3PNAA 2VBBA 2W9XA 1XNDA 3D0JA 1J1LA 3H50A 3VHRA 3WF2A 1V6KA 1QH6A 1YIFA 4HVQA 1XNBA 2VXRA 4OUMA 4Y3OA 2FDGA 2JIJA 4AHWA 2B5HA 5LA1A 3O0WA 3VBHC 5A6YA 4ASKA 1KEXA 5FOBB 1IPKA 2CV6A 2YU2A 3H1MA 3UKNA 1C4RA 4EWDA 4LO6B 5FXVA 5IK7A 1NA1B 1YLLA 4KWUA 1UOGA 2W0XA 2DCTA 2H6BA 4DPNA 5A3LA 4IEXA 1OQ1A 4CXWA 4RL7A 4LIVA 1VAKA 3VD7A 3ZN4A 3GCXA 4JV4A 2IZWA 2EIDA 5IT6A 4TZDA 5FIXA 3HJRA 1NX9A 2HWD2 2YC2A 3LGRA 1EUTA 2QQIA 4SBVA 1FV2A 4RGKA 1UNBA 1PGL1 1R1A2 2YGMA 1UZYA 2BQPA 5FZ7A 3ZSLA 1CX1A 1LULA 1AYN3 2W52A 3VL9A 2DCKA 3BTXA 1GOFA 2WNEA 4AHZA 1RUH2 1L3JA 2E7QA 2HYKA 4YARA 5A80A 1O4ZA 3WNPA 4P9JA 2BOJA 1ZRFA 2DV9A 4K8RB 1POQA 4RSUA 1GOHA 1TMF3 3H7JA 1MVQA 5EXOA 3OY8B 5B4NA 3KMHA 1JU3A 4XF1A 5J48A 1RIRA 4EZ4A 2BGCA 1MS0A 2JDMA 2V5YA 4XPVA 2Y6GA 4FFFA 4C0BA 4NIAA 3AZVA 1ND3C 3RQ0A 1V9U2 1VB2A 3AMNA 2RVAA 4OHXA 4YZ3A 2PLV1 4M00A 3SH3A 2HEWF 2A6VA 4CEYA 4OHWA 4MXWA 2K9ZA 1MACA 2CNAA 4EN7B 3N9MA 2GC2A 4HOOA 1DFQA 1H8TA 1QJX3 3N9LA 5FPVA 1WBLA 5JR7B 3T2TA 1CAVB 1REEA 1IS6A 1YFWA 1C5HA 5D21A 3VZJA 1DYOA 4MGIE 1A78A 1Y7BA 2VMCA 4XHXA 1WMFA 1GSLA 4LBOA 4N53A 3A0NA 1V6NA 5HCAA 1VBD1 2GP5A 1LR5A 5LWBA 2A7AA 2W68A 1OD3A 1W3VA 3KD4A 4PF1A 4QDSA 4MGYE 1SLLA 5AVAA 4ZXKA 3ZXEA 4AFAA 1RUE1 4CDXC 4GD4A 5IFPA 1RJ8A 3DXTA 4HBNA 5F8PA 3WF4A 4D7SA 1CZTA 2JDAA 2YC4A 4XURA 3NNGA 4JHTA 1OQDA 4CUAA 2Y0IA 5ACA2 1OA3A 1MPXA 5JIAA 1QJZA 3ZFEB 1C8M1 4Q4W2 2XOMA 4FP3A 4CCNA 2G4IA 1QJU3 2VMEA 2KR2A 4MOAA 1W8UA 4DEQA 4EN0A 4B8EA 1AZDA 3LFMA 3RI9A 3N4MA 1X82A 2JDYA 3M8LA 4RFRB 3WF0A 4COZA 3IT8A 4UF0A 4NE9A 2QQUA 2HWF2 3BPSA 4HVOA 1RUI3 4YZ4A 1RUNA 1MZFA 3O0VA 4PCRA 5J98B 1QJY1 3HN3A 4RHV3 3SC7X 5C3PA 2X8KA 1UN1A 4NRMA 3PUQA 5HCHA 3JD73 1YC61 1URXA 1UCXA 5FP8A 4BK5A 2YDEA 3LA2A 4UOJA 2JD4A 4YW5A 1YFUA 2QKDA 2WYFA 3HNMA 4JRLA 2FBEA 2YBKA 4AVBA 2E33A 3OB8A 3VKFC 2E51A 4CDQB 2EXHA 5GLWA 4WZFA 1ULEA 2UU8A 1FT9A 2DVBA 5FTTC 1NY72 3UYJA 5CAZA 2W39A 2JKBA 3D8CA 1H2KA 1YQ5A 4P00B 5GZDA 3SLIA 5C8CC 3MI8A 1OUSA 2VOKA 3DKQA 1XNTA 3R0RA 4ISQA 5A33A 3URFA 4D6SA 5A7OA 4H3WA 3HVDA 3T3YA 1J84A 2RM21 1QHDA 1UX7A 5GKAC 2YYOA 1RUD1 2KM2A 1XOYA 1UPSA 4HN1A 4MZUA 4D6RA 2WS91 1W39A 3RRDA 4O61A 4JGZC 3IAQA 1RUJ2 1JOBA 2R1BA 2BBVA 5ABJC 2FDJA 1BEV3 2D6PA 3ATGA 2ZGQA 4QQ2A 4YW6A 5JXHA 5FRAA 1OA4A 2IVJA 2OQ7A 5LY2A 4JC1A 3T1LA 4FTBA 1V6IA 1KS5A 4XACA 3SISA 3I2IA 3VBRC 1H1AA 1UO9A 3WD5A 2CAVA 1T2XA 1BYHA 1TEIA 2W1SA 3KQ4B 4CEWC 5HV0A 1J3PA 3AP4A 1UXXX 3EB7A 1CIWA 4CEYB 1WCQA 1XQNA 2Q8OA 4MXWB 3KT7A 2WWJA 1YUDA 1UY1A 2A6XA 4DFSA 2W1QA 4DRVA 3MIDA 3J4UH 1FOD1 4NRQA 1H8TB 1HB2A 2VCCA 2R30A 2VBPA 3POSA 4AVCA 4XJWA 4AZZA 1D4M2 5CFCA 3WXPA 1AL21 1F8VA 1Q8PA 4B7EA 1YQ6A 2QJVA 5L9RA 4YW3A 4N53B 5ANNA 4JKLA 4OMCA 1AYM2 3RG0A 4HANA 2FDFA 3ZX7A 5BPXA 2MEV3 1VRH1 4A3ZA 3NL1A 1RMU1 4UXAA 1COV3 1UQXA 4JDNA 2NZ9A 4P02B 3IDCB 2TBVA 1W9SA 3KV6A 4Q4X3 4QKNA 2W87A 2E63A 2O8OA 1O4TA 3ON7A 4LE4A 2J7MA 4KL1A 4Q0QA 4BMBA 1PIV2 3B3QE 2E31A 4N9HA 1FNYA 5F3GA 2YC0A 1UY2A 4K9SA 1RXFA 4KH9A 4FPOB 4URTA 2XQXA 1OVPA 4OLLA 4A45A 5IAXA 1JYWA 4LXLA 1GP5A 3S57A 4ATFA 3OD0A 4Y1UA 4CCCA 4XAEA 1YWKA 4QHOA 2R072 5JPMB 3NKGA 4UF0B 5C3RA 5JOZA 5FYZA 3BALA 3LDRA 3O14A 5A3NA 1OA2A 3FBMA 4YGEA 5LASA 1WA4A 1RVF1 2WLQA 1FMD3 1XPWA 2BVBA 4HN0A 4IE0A 2D3PA 4Q4V2 3VZOA 1FXZA 2YMZA 1DHKB 1QOSA 3TN93 1UYPA 2UURA 2WAOA 3AZWA 2G1MA 3NMBA 2PHTA 1W03A 1VE0A 1OOPA 1SDDB 2AGSA 2EXJA 3WNMA 2BV4A 3ACIA 1VR3A 3THCA 5K0UC 3O1OA 1DQ4A 1W2UA 2E7AA 2OS2A 4W6YA 3H8XA 4LO7A 3ZYBA 2DU0A 3VBUA 1F9KA 2F4LA 4NVPA 4RQPC 2SLIA 3UK9A 4P9YA 4I09A 1ENRA 3A4UA 2ET1A 1RTVA 1EAH3 3IMMA 3LF7A 1HV1A 2RMU3 5CBLA 3UESA 4AK3A 3N35A 4XFHA 5EYYA 5A33B 5JSPA 2ZGOA 3GDBA 4WVWA 1EV11 5FP3A 1OURA 5FLHA 4BZ4A 4NPRA 1E5RA 3S5QA 3VBOC 1PO12 1ZBE3 4GWJA 3ZSKA 4QXHA 1QIQA 2VZ1A 4LA3A 3I3MA 1VB4A 3H0OA 1W6OA 2GDFA 1SFYA 3MIGA 1GP4A 3O1VA 2OZ6A 2WA4A 5FZCA 1W6QB 2DCYA 4BB3A 2N7GA 2V4VA 1CPNA 1V00A 1ASJ1 2NPIA 1W06A 3QBQA 4AVVA 4MG2A 2YFZA 4JCKA 3DPRC 2E7TA 3E6BA 3LEMA 3WCRA 1LOFA 1ZZ8A 1SCSA 4XJAA 5FP4A 3WG1A 3U11A 1JYXA 3INAA 5EYXA 1JN2P 1YI9A 3DECA 5FZEA 2O8QA 5FLJA 1OSGA 5EFUA 2VMFA 1K45A 1DGWX 1YEWA 4IV3C 2ZBJA 4IQPA 4MGKE 3N7KA 5FYYA 4QAWA 3RJRA 2X10A 4DUVA 1ZM1A 3AZZA 3KZ4C 2Q5TA 3MHZA 4XFFA 5GALA 3PUAA 3S7EA 4YM3A 5HI0A 1PGL2 3NJVA 3PHMA 4COYA 4CTEA 3BN6A 2C0ZA 2XLFA 5LW9A 3K2OA 5FXXA 5CFCB 4I0AA 2OX0A 3ST7A 2WT2A 1SACA 4XF9A 5LBBA 4UFKA 2Q8CA 4RR3C 1W9FA 1SFPA 3ZKUA 1RHI3 4OI4A 5CNAA 2OPWA 3K4AA 4PJYA 1Z7S3 3MIFA 1VJ2A 4KBBA 2FMYA 5EJ3A 4AAPA 4CSWA 3O7OA 3JUUA 4WVZA 2PQSA 3ZLIA 3RGBA 2RHPA 1JXNA 2WWSA 4CVUA 1RUG3 4UBHA 4FSJA 4CZSA 2QNKA 2MNGA 2WO1A 3POGA 1GICA 1LOGA 5LATA 3SEEA 2PLV2 3LSDA 1YQ2A 3IPVA 5FY1A 1TNRA 3O1MA 1FI2A 4Y1YA 5BV6A 3WX5A 2LW8A 4BIOA 4EROA 1WD3A 1MS4A 3C7OA 3UETA 2ZGUA 3CHXA 3ZXKA 3JQXA 4BH9A 5DPNA 5JIUA 2JE8A 3OBAA 2FCUA 1IPJA 5DQ0A 2RV9A 4NWVA 5LEJA 1T6BX 3B5LB 3ZSJA 4E8CA 3H3ZA 2VZOA 1W2NA 4B4RA 1LNSA 2L9LA 1WWYA 2WBKA 1C1FA 4JAAA 4YYOA 4ARYA 4CDWA 4FAGA 4QXCA 3V65A 5FOJB 1NQDA 2W3JA 4NUBA 4B1LA 4AQSA 3NNJA 2DUOA 3T1MA 1DQ2A 1VBD2 2VNRA 1DGWA 1QDCA 4W8JA 5FYSA 2OXBA 4KGQA 4MYEA 4I0WB 3T4VA 1UZ0A 3W59A 1OOPB 1O3SA 5A7WA 1AHSA 1R082 1AF9A 3PTRB 1OPOA 1R1A1 5C71A 5FY7A 1PVC3 4GALA 4UFHA 4XHBA 2BFUL 2BGPA 5FMOL 1C8M2 2D5FA 4L92A 3VBUB 3Q8EA 3T0BA 5KHGA 3O1PA 1WCUA 4YM0A 5FZMA 3UKVA 4FI9A 1RUH1 3IIIA 2ET7A 4JGYB 1VBB2 3DV8A 4BMEA 4GH4A 2XJPA 4AXOA 2E6VA 2PMWB 4FCAA 1S0FA 5CISA 1F4HA 3RNSA 4BIFA 1CR7A 2XQRA 2W47A 1ALYA 4A2UA 4CRQA 1GZWA 1KFXL 3I59A 5IW0A 1A34A 2CY6A 4V2VA 1LESA 1LU2A 3WDXA 2JDPA 2JG9C 3FZ3A 2Z5WA 1VMJA 1UU6A 3PIGA 4FPKA 3APBA 3E5UA 4IEQA 4L0PA 5CZKA 5I8YA 3W5NA 1W6OB 4LO8A 4NHYA 5JOWA 4XETA 4AFCA 2IFRA 1CVNA 5B4XA 5LA2A 2XL9A 1YJKA 4J1WA 2Q30A 3E5QA 5LY1A 5EIYB 2VTXJ 5GZGA 5CG9A 5CB7A 3LE0A 5FY5A 4GB33 3ZXFA 1CAXA 1H2LA 4XF4A 2ADEA 2HKXA 5A32A 4CDUA 2DBNA 3LEGA 3ABZA 3KHCA 4E8DA 2ZCWA 1ZBA2 1NLQA 3ES1A 3IDBB 5FJHA 1NE4A 5T5OA 2A5ZA 2BEOA 2W94A 1A6CA 1S2KA 4N43C 4WZCA 2CDPA 5GLTA 3HMYA 3VUOA 1E5IA 1N3QA 2LALA 1MS9A 1JMUB 2RS13 3AMQA 4NHXA 2RM22 4LBQD 3UGFA 5AC92 2ILMA 1ZA7A 5GZEA 1Q56A 5ACA1 2ZOEB 3CEWA 4QHZA 3VKLA 3BKZA 1UMHA 4Q4W1 3DCQA 3PU3A 3B01A 3B7MA 3OGGA 5T50A 1BBT3 3ZFFA 1NUKA 1QXJA 4LHNA 2VO5A 5DUWA 4L99A 1D2QA 1FNZA 3ELNA 1CX4A 3HN1A 2CU5A 5IWFA 1WA6X 1X50A 5FZ4A 3MLKA 3F95A 5JUVA 2HWF1 3WW4A 1U5IA 3BYWA 4NHLA 4QU2A 1NG0A 1L7QA 4QX5A 3Q8FA 2GNBA 3M3CA 5DUUA 1ULCA 2ZGKA 5L9BA 2Q8DA 2DF7A 1J58A 2QQMA 3JBG3 3A0KA 1IKPA 2QQVA 4XFBA 3IPVB 2B7YA 1MZ5A 4N9IA 4YG3A 4R9CA 4KQ7A 5IVBA 4OHZA 5FYMA 3ETPA 1IPSA 3VKNA 3LKJA 2OUHA 4WM7C 5AC91 1FOD2 4CA9A 2VY0A 2K0GA 1OPMA 2WZR3 4Y1ZA 1KS4A 2JG8C 4AEJA 4TTGA 3OPTA 5T54A 5LBFA 3J7LA 4CDWB 3U1XA 2JDKA 4XUNA 3I3DA 1QMJA 3MEPA 3FHIB 5CKNA 5JWPA 3WG3A 2ARCA 1ND2C 1LEDA 1QNYA 1NXMA 2NQYA 4I30A 4YPJA 1DQ6A 3I4IA 4M3CE 2QQJA 1LRHA 2AYHA 2R063 1VRH2 1GQHA 2W1WA 1HQNA 3KCCA 4P9WA 4URAA 4I0BA 4V1PA 3CO2A 1MR5A 4YFWA 4XE9A 2VJXA 5IJRA 5A7WB 2VOVA 2B39A 2PTMA 1IS3A 1WGPA 2Y64A 4XFGA 3JB8A 3HNYM 1PHMA 1ZYBA 3MPBA 3SH5A 4AI3A 2EICA 2MPFA 4Q1PA 4Z8BA 1NCRC 1WLTA 3MBWA 2ZABA 4KMQA 1X36A 1Y4WA 3PL0A 4GH4B 5JZGA 1JYVA 4B4QA 1UWWA 1WKYA 2A75A 4GJYA 4XCBA 5FO7B 3WHUA 3V0BA 1GZWB 3I59B 4PQQA 2BNNA 1QQP2 2PHRA 4MX3A 4PLNA 3ZPYA 2FQPA 3LOBA 2A73B 3N9OA 1SBFA 2Z4FA 4EZHA 1PZ7A 3RSJA 1SLBA 2P1BA 1JZ8A 4DEVA 2VZPA 5SV8A 1RUI1 2ZKNA 3UGGA 1NYWA 4AGRA 1DU3D 4Y4RA 4TSVA 1ZZ9A 1JZ2A 4H7MA 4LBQA 1QOTA 4R9AA 2IXKA 5BNOC 3IDAA 1WW5A 5KXCA 1LHOA 1QXPA 3KWVA 1H4GA 4JX0A 4R4ZA 2Q8EA 1D4M1 1GFF2 2CTVA 3AXDA 2WNUC 3H3UA 1CAXB 4MHUA 3VD4A 1DLLA 1AR72 4CDUB 3VZNA 1IKQA 4HKOA 3U0ZA 4XAAA 2W46A 2PHFA 3A21A 4A7KA 4W6WA 5C5TA 4EYUA 2JE9A 2OKXA 3DGTA 1AYM1 3VDBA 1AX0A 4NIDA 3R4DB 1IQAA 4CU6A 3AXEA 2P4EA 3UL2A 5IUQA 1EV12 1R64A 3WNOA 2BPA2 4EQVA 2V09A 5IVEA 3H8UA 3FFZA 5IK8A 3PMSA 4J1XA 1J83A 2UY8A 3OBZA 3QCWA 2HYXA 1XB9A 3AYEA 2WJSA 1AXYA 1PIV1 4FP2A 4QGNA 4QQLA 5JOYA 5LCWL 2R1DA 3OBTA 2G19A 1H2MA 1GZCA 2Q4SA 2XUEA 3KV5A 2BWCA 2EF6A 2A3XA 1BCXA 5FZ1A 2Y6KA 2QQLA 4XIKA 2UWAA 1H30A 3VKMA 4E4HA 4XTMA 3PURA 4Y20A 5CIRA 1OXCA 1HDKA 2KXLA 1H4HA 4LORA 5L36A 2R071 3N7JA 4UW5A 4A41A 2HWE3 3AYCA 4OFGA 3T4HB 2QQKA 4XBLA 1UU4A 1GR3A 4M4PA 4BQXA 4YGCA 4CDXA 3IAPA 2ID4A 3UNPA 1GANA 1ENSA 3POWA 5FYUA 1Y9GA 2Z2SB 1R1ZA 3IKWA 4HXCA 5FMBA 1HXS3 4HETA 5DMYA 1PGW1 4Q4Y3 5LK7B 4IEOA 2NP0A 4ZU7A 5BNNC 2WT0A 5KWRA 3ZIWA 3O1TA 2D93A 1N1TA 1O7FA 2W95A 1RUF3 1PO22 1W8ZA 3EXUA 3MW4A 2XLGA 2HWC3 1VBE1 5EWSA 3W58A 5FUIA 3SKVA 5IVJA 2HWD3 2VZVA 2XBO1 4HLTA 2QE3A 1BLZA 4DS0A 1NCQB 1CD3G 5FZOA 3GZUC 3M7AA 3SMHA 3GCWA 2WNVC 3WP5A 2VVDA 1R091 4Y24A 2FCVA 1ZZ7A 2PYTA 1WMXA 2ZGLA 1LJ7A 1RYYA 2G9FA 2NN8A 5G05L 1VPHA 2P17A 1TME1 1LTEA 5A6QA 5EV7A 1QU0A 3K46A 1PO11 1W2AX 2C4XA 4LO5B 1JBCA 2EA7A 3NV2A 1G9BA 3PMEA 4XJUA 1DIWA 2VCMA 2CYFA 3V56A 4WM8C 1LENA 2WC2A 5JZGB 3D82A 3ZO0B 4HL0A 3O0XA 2DVFA 1SLCA 2R0HA 2YBPA 3PJQA 4DO0A 5IVVA 1I1EA 3V0BB 2WSUA 3SXWA 4KU8A 2ZHKA 3NAPA 2ARAA 2VVFA 2VW1A 5HXMA 1V9U3 3CQOA 2XVLA 2VOWA 2BOIA 4ZHNA 1B35C 4LT5A 5DDJ1 5FV3A 5EJ1B 2WQ4A 5C9AC 1FPN1 5GZCA 5JSRA 4JTNA 2VTXA 3K4ZA 1LU1A 1MZEA 4FPFA 1AR83 2DVAA 1PZ8A 2R0FA 3AMHA 3MV01 3FFQA 2ZGRA 2J1RA 3MDPA 4JGZA 4LBQB 2CDOA 5FMCA 1JOJA 2XWJB 2HBUA 3EJKA 5ABJA 1I5ZA 1HRI3 2QZ2A 2W92A 4QGMA 1NKGA 1QOOA 3NVCA 2D7FA 3RYKA 4BK4A 2RDRA 2LUWA 5DUVA 5E1RA 3TWIA 2NLRA 1ZZ6A 4QXBA 1CJDA 2BYVE 1P8JA 2W5FA 5T5JA 3WOGA 4ZKTB 1I3HA 1A8DA 3T2QA 4PF5A 3WUDA 5I0DA 1MS8A 1JH5A 4KWKA 3USUA 3ZR5A 4CCMA 2C9AA 5I93A 3ME2A 1RXGA 1A3KA 1GZTA 5K9YA 1WMEA 2QFEA 4WVVA 2EXIA 1CAWB 2DDUA 1ZZBA 4YVWA 1KFUL 2OPKA 4FOQA 1YO8A 4O9EA 3V0AA 4I01A 2D43A 2C26A 1NA1C 2D6OX 4TLGA 5KBFA 4DINB 4GQ7A 2VUCA 2ZX2A 1EYBA 2AH2A 5I91A 2FZ2A 4V2WA 2XUMA 4XQWA 5T52A 4A6SA 4OCTA 4Z2WA 2CGPA 2Y34A 3ZSEA 3ZYIB 2Y6LA 2G9GA 2VZQA 2EVXA 4C90A 1JZ3A 3EYPA 5FJKA 5B2GB 2HWB1 3NJYA 4FFIA 2I07B 5JLVA 3MPPG 4JZRA 2BWAA 5D2AA 4UT5A 5G04L 5D1IA 3S6PA 1VBC1 4TWTA 2JE7A 3NSTA 2ES3A 5FYCA 4CCKA 3RZGA 2VU9A 3GHMA 1D7PM 3J8F3 3MFCA 4LE3A 3ITQA 5IFTA 3ZYHA 3BIEA 4LBKA 2CWMA 2IUWA 4ASLA 1BKZA 1FAYA 1LECA 2RJ2A 4LITA 4QPGC 3EBRA 5KHIA 2H0BA 3BB6A 4BQ2A 3R6SA 4H55A 4UW3A 5A3TA 3CKHA 3PU8A 4D0QA 1UPIA 1R081 3M3IA 3BU7A 4HONA 5F2WA 3OCPA 4GMP3 4KG0A 4AEDA 2BFUS 2ZZJA 4XMAA 1Y3TA 5FMOS 3WG4A 4GWNA 2C5DA 1V6LA 1HB4A 4NMIA 5FBJA 2JB4A 5BNQA 5DZEA 3WCSA 3WNKA 3MV11 1OMIA 2PHUA 3J9SA 1H6YA 4DQAA 3AJYA 2KA3A 2DFCA 3I3QA 1VBB1 1J1TA 1AYN2 3C2UA 2NM1A 2OT7A 4XUPA 5FZOB 4IUGA 4QM9A 3EMRA 3C8XA 1POV0 1UYYA 4AEKA 2Y26A 4XF0A 1QF3A 2YPDA 1AXKA 4ONUA 5F2SA 2XJQA 3CU7A 5DAPA 3P6BA 2ZX1A 3I49A 2DFBA 2JXAA 5JXGA 4HKLA 2GNDA 1RUJ3 5K0UA 5A1FA 4XEZA 1KDMA 1EP0A 3TYJA 4AHXA 4XYXA 1S0EA 4K1YA 3GNEA 4WVMA 3UJQA 3B94A 3CJIA 3ILNA 3DF0A 2BU9A 3KGLA 3Q8BA 3H8RA 4RQPA 1QKQA 4LR4A 1OFNA 3HR9A 4JQRA 5FXZA 1CIYA 3NAPB 1LHNA 1O91A 4YVSC 2VE1A 3ZFEC 2PA7A 1K3IA 2XJSA 3OUIA 1OQEA 3KQRA 3ROUA 4Q0VA 1S0DA 3MUY1 2J1AA 2OYZA 3WNNA 1DG6A 4NIHA 2X5IA 4XUOA 3VBOA 3SCFA 2UWCA 5A7NA 4PBOA 5E8AA 4ZU4A 2JD9A 1W6NA 1ZBA1 4XJZA 1YFXA 1OI6A 4YZ5A 3OPZA 1UU5A 3WNLA 4JGZB 3KVAA 3MW2A 3GHNA 3ZYPA 5ABJB 2PHXA 4Q27A 4EWAA 2A1XA 3RI8A 4CE8A 1XE0A 2AEZA 5LZ6A 1VBA1 2GN3A 3AKSA 3HNBM 5C4WA 4OHYA 1B09A 3H1WA 3T2PA 3O1RA 1ULFA 4E2QA 1ZRCA 2CGOA 2R32A 5JXJA 4UYBA 3USUB 2Z69A 5J37A 4GKXA 4KU7A 3UGHA 1XC6A 4BCUA 3I2JA 2DURA 2ZHLA 4LMFA 2BJSA 2LRPA 4YVWB 1QJU2 5FAXA 2D6NA 4IV3A 2FDHA 3V0AB 2LM3A 2F17A 4CDQC 1FATA 3GGLA 4PDWA 2XL7A 4YW4A 3U4SA 5CADA 1RUC1 4NIGA 1EY2A 3C7EA 2ZEZA 4GJZA 3PVEA 4Y1VA 4NOTA 4XXAA 2VZUA 4YWAA 1RITA 2XDVA 4COWA 3HD8B 2VM9A 4XFAA 4ITCA 3WQ1A 1RUI2 4YGDA 1XXNA 4XQ4A 2QUOA 4BHPA 2Z79A 4Z1VA 1T6GC 3VDDA 1VMHA 4RFT0 2VUDA 5BY5A 5J7MA 1K42A 3AC0A 4Y1XA 5HBAA 1AR61 4ZXEA 5FPBA 4XBQA 4IGQA 1MS3A 4ZS2A 1D0GA 4LLOA 2RS31 3JD72 2GH2A 5DAVA 5BUVA 4GWIA 2X09A 3H9AA 4Q4V3 4DXRA 2VGDA 1HJFA 2ARXA 4FPGA 5K4LA 4X6RB 5KXBA 2GP3A 3CZUA 2XVKA 1LHWA 3MIBA 2DWRA 4P9IA 2EXKA 3VDCA 1ST8A 2P3YA 1U5ZA 3S5AA 1H8VA 5FK8A 4HVRA 5A7PA 3CJXA 1DQ1A 1TNFA 3DYMA 4PLMA 3BGAA 3K77A 4AEDB 3A22A 2ENRA 2ZGSA 3POJA 1HJGA 1JUIA 3B02A 4YW2A 5C6CA 4XF3A 4HSLA 2WN2A 1S0IA 3KV4A 4QQPA 3Q9OA 4CEYC 5C3OA 4BM8A 1W04A 1GYKA 2QVSB 2IFWA 2O14A 4LLFA 5FYHA 1O3TA 3I2FA 2O1QA 2R043 4P5YA 2RJKA 1QXRA 1YXWA 1F31A 1UOFA 5LBEA 4NIIA 1BEV2 4P9XA 1K5MA 1QQP1 1W8TA 2C1FA 2QDNA 1ENQA 3WR0A 4AE2A 1E57A 1CJPA 4EJRA 5K0UB 4N53C 2QDRA 3ILRA 4FPCA 4Q5OA 1UY0A 4N7IA 4WVMB 3CJIB 2D5HA 1PGW2 3VD3A 2RDNA 3CLPA 5FY0A 5GLZA 3LCPA 4F7ZA 3ORJA 5F3CA 4HFSA 2CHHA 3I97A 1BMV2 1OFSA 2RR11 4E9KA 4LUMA 1MEC1 2ERFA 4RS5A 2WRAA 3HEIA 4YZ2A 4AYUA 3FHAA 3GJBA 5DG2A 3WVJA 4DY3A 1VBE2 2HJIA 2RDSA 5CFDA 1LB2A 1HLCA 1QJEA 4ZS3A 4D6QA 2XBO2 2Y33A 1AR71 5IAVA 5A7QA 1RINA 5BNPA 3SEPA 2X5IB 4BQ5A 3VBOB 5IVCA 3WV6A 4FVVA 4IL7A 2JG9A 4AGVA 1OF4A 1W6NB 3PVOA 1GP6A 2PHWA 1R092 4JVAA 2A6WA 3VZMA 2WFF1 5H9RA 3I3EA 3OF1A 4ARXA 1N1VA 3M3OA 1TME2 5ERLA 4PI2A 5C3QA 3LWCA 3GZEA 5C4WB 2D6KA 1COV2 2P2KA 4Q4X2 3FWEA 1MQTA 2IWGB 3TAYA 5DN2A 4U36A 5FYIA 1OUXA 1JYIA 1M06G 4QX7A 4DXZA 1H1IA 5F37A 3LQCA 1HQWA 4IV3B 4H14A 4XZUG 1VIWB 4AI8A 5BYNA 1UOBA 4PDWB 4ES8A 4B3NA 1D4VB 3M4FA 1OLRA 4N43A 2PLV3 2GC1A 1DQ5A 5DDJ2 1GQGA 3WP4A 2VD7A 5C7GA 1FPN2 3VN4A 1S0GA 1OD5A 1JOPA 3OD4A 1KITA 4PT6A 5J1XA 1US2A 3UT0A 1PK6C 4OULA 1FMD2 1POV1 3IDEA 4GMP0 3VDDB 2WO3A 4BPZA 2YUEA 3FHQA 3WP6A 2Z42A 3TN92 2XPJA 2XR4A 1KD7A 3LSEA 2QQOA 1OC1A 1PO21 4Z82A 3WDTA 3D6EA 2WLPA 3K3NA 4LBJA 1YI7A 1VBD3 4Z2AA 4HG6B 3M3EA 1MZ6A 4CCLA 5F5QA 1RUE3 2FHRA 2XJVA 2YPJA 3AL6A 5KC5A 4CUBA 4P08A 3OGSA 5C5UA 1CN1A 3J7HA 3RMYA 4I3GA 1DF0A 3ENRA 3WSOA 4B7KA 5DZFA 1C8M3 2XH6A 1ENXA 1UZVA 5J36A 1X9PA 5GJ6A 4W4ZA 2RMU2 2XWBB 4WM7A 4OUEA 1Q8VA 3TEXA 1YRZA 1NQJA 2JEMA 1G9DA 3POEA 4LK6A 2D6MA 2A70A 3RPQA 2CSGA 4K1ZA 3WDYA 4IERA 4CU9A 2J42A 1UYXA 3K3OA 1Q8QA 1ND2A 1Q3EA 2HWB2 4G3YC 5FPAA 4D7TA 2A3WA 1LGNA 5FZ8A 2VBDA 2WFPA 4ZY9A 1VBC2 1I6XA 1GKBA 1H9PA 1QJY3 2EALA 1LOEA 4Q0UA 5CFCC 1VAVA 5T55A 1K5MB 3MICA 1O4YA 3MIHA 1UF2C 3AP5A 2V72A 3KV9A 2Y8KA 1XE7A 3QH6A 2J1SA 3WDUA 2C24A 4E2SA 2ARBA 2YGLA 3ZSMA 5KHJA 3IIAA 1AR91 3KT1A 2QZ3A 4P14A 1IOAA 5KXEA 4YRDA 2PAEA 1NCRA 1X8EA 4OVEA 4RS5B 3DL3A 5FZ9A 1UAIA 4DXTA 4PBPA 3AMPA 3PDQA 1HXS1 1V6OA 5CFDB 3ZFGA 1GV9A 4LULA 2GNTA 3AKQA 1O59A 5LRRA 1CZSA 2BUKA 4UW4A 1UL9A 2E53A 3EQEA 4IV1A 5BNPB 3ECQA 3N3HA 1W05A 3A7QA 3DYOA 1O8SA 3KB5A 1AL0G 2HWC1 3RWKX 4COVA 3BTAA 1AJOA 1WBFA 3QOPA 2X53S 4XDQA 1RL3A 2X29A 2RM23 5AC93 1RHI2 1RUD3 2VMDA 4LPLA 4LKEA 4MO3M 1Z7S2 5FFOC 1KRIA 1RB8G 2WS93 4YW7A 2DTYA 2YXSA 3LOIA 2P6HA 4QX8A 3V64A 5M0TA 2AC1A 1CGPA 4OYUA 5KHKA 1MQTB 4J25A 4LOSA 2AENA 1BK0A 3WF3A 4OQ9A 1G86A 2ZX0A 4S2GA 4OQ8A 3FMGA 3ZKYA 2WZ8A 5CU1A 5FQ0A 5F9TA 3O1UA 1QEXA 1N1YA 3VBUC 2BERA 2WA3A 4X8PA 3ZR6A 1XYPA 1ULDA 1IGOA 3H3LA 3LAGA 4XQDA 1OLQA 1JHNA 2ZAHA 4N43B 3UV9A 1U5XA 3OGJA 4JGYC 4JTOA 4FFHA 3FJSA 1V6MA 4TYSA 3POBA 1G7YA 1F15A 2ZXQA 4XDPA 1QJFA 4NAOA 2E32A 5JXIA 4ISRA 3WT3A 3R4SA 3PVBB 4GZ9A 1FOD3 4L11A 4F8AA 1W2OA 1HRV3 5A3WA 2DCJA 4Q26A 1S4CA 3WY6A 3OJBA 1S0JA 2JECA 1AL23 3S30A 4O7XA 1V0AA 1SBDA 1VBA2 2JICA 4IE6A 3OEAA 3KF5A 3A23A 2P5BA 4FTSA 4IEZA 3SITA 5FR3A 3WDVA 3ILFA 1JZ7A 1LHUA 1DZQA 3I2GA 1GLHA 5DZGA 3BODA 1JODA 1RUOA 1PVC2 4IW3A 1SPPA 3KGZA 4LOTA 1RMU3 1V70A 3LB9A 5I8SA 4CU8A 2ZMNA 1ZREA 3AKPA 2VZTA 1AYN1 1NOVA 5IHRA 4BLJA 1ZVFA 2XG3A 3RMXA 4IDZA 2JDHA 2YU1A 1NXD1 1RUC2 1F2NA 1LOFC 5FP9A 1D2SA 3U14A 4M0HA 1LGCA 1K5JA 1TMF1 3HQUA 4QB2A 3AB0A 1CQ9A 4RD7A 4WM7B 5KHHA 1I5PA 1LEMA 2R49A 2VZ3A 1V6JA 3FC0A 4AVSA 3GM8A 4AFBA 3ZM8A 5FO8B 5HV4A 4UFMA 5L7OC 3Q8AA 3AZXA 4DMIA 2F4PA 3QD6A 4FO9A 5C8WA 4LHKA 1RJ7A 2A3YA 1AR62 4A7ZA 2GAUA 3LA3A 4I2OA 1RVF3 3HT1A 2RS32 1XU1A 5D8AA 1SZBA 4BWOA 3HAGA 5E89A 5AVPA 4AAXA 3O1SA 1WCSA 4KWLA 5K8SA 3TNPB 2J1UA 5F1RA 4FAHA 3VBSA 1QJX1 3BPZA 3WQ0A 1W8HA 3VHOA 2JDUA 3W21A 4GB32 2IXHA 5IVFA 3TEWA 1UIJA 1H1MA 1WLWA 1JI6A 2VQTA 4HPKA 1W99A 2ATFA 5LRSA 1U0AA 2OW4A 3R05A 4QKFA 3VBHA 4AL9A 4CCJA 4D3WA 5FPXA 2Q0AA 2WL1A 3M3QA 4IEVA 5FY4A 3ZFGB 3FN9A 3LEIA 4NWWA 5F3EA 4E27A 2H6CA 1WCDJ 4XBNA 4IV1B 3ZYGA 2XMLA 4JKMA 4GMP1 3OGVA 4EN6B 1B35A 2B46X 1TE1B 3P3PA 4M3CA 4QM8A 4OI1A 5A6XA 1PX4A 5C9AA 3M70A 3H7YA 3CBNA 1TVGA 4AOCA 3DUIA 3MZHA 1QJU1 4NPLA 5FYVA 4YSFA 4CDWC 4I02A 4FOYA 3ZN6A 2XXZA 3VBFC 2VNVA 4BQYA 4E4DX 4DY5A 4NJ4A 1XU2A 3NJZA 4ES9A 5I0UA 4ASMB 5GLUA 3BTZA 2P3KA 4HSJA 3KHBA 3CNAA 4DZGA 5CVRA 5FXWA 4M4RA 1ASJ3 4EN9B 2ZKLA 2ZGMA 1W9TA 2B4KA 2WUHA 3WZ1A 2RR12 1MEC2 1BHGA 3WW2A 5JPNB 1L7RA 3JBG2 4RHV1 4TXWA 5FQ0B 2RS53 1O5UA 3ZYFA 1CWPA 5EJZB 1SHWB 1XNCA 2AREA 2G9ZA 3JD71 4MXVA 5A32B 4QPIC 5A3MA 2W2IA 2XB6C 4GH4C 1RC6A 2WKKA 4GXLA 4GWMA 1W6MA 2Y38A 3K75B 3OUHA 4RN5A 3VDAA 3U4XA 1ND3A 5JCTA 1O8PA 3LFIA 2WFF2 3RZJA 2GALA 3FLPA 4XTPA 1CESA 3ZXGA 2CL2A 1WUVA 2OZJA 3HQXA 4LBMA 3T2OA 4XMIA 5DABA 4CP9A 2B42B 2IXIA 3CIHA 2Y6JA 2CAUA 5FZLA 2HEYF 4K21A 1SPPB 4KG8A 4K40A 4LTAA 4UFJA 4D8MA 3LIHA 3ZFFB 3UKTA 4PIZA 1S0BA 3BOPA 2Q1FA 2JB8A 4QPGA 2W91A 4WBBA 4AVAA 4BXSV 1QH7A 2ADDA 2BBAA 3HIFA 1AVBA 4FOWA 3NRUA 1BEV1 4NROA 1IS5A 1AX2A 5A1LA 5FZIA 1ACCA 1X8MA 4S2HA 5FP7A 3SCGA 1Q8OA 5FZGA 1XNKA 4R9BA 4XDOA 2DVGA 5FYBA 5HCBA 4AHYA 4DRRA 2JDNA 2PHDA 3I2KA 4IESA 3LPGA 5ANQA 1BMV1 5FREA 2WNOA 1OKOA 4YNIA 4RYDA 2DU1A 3ACFA 4FPEA 5D8AB 2EAAA 2EIEA 1SBEA 3PIJA 4MLOA 5FZDA 3ZXAC 1AX1A 4IE5A 4KWJA 2IXLA 1OH3A 2VAUA 3VBSB 2UY9A 4Z07A 4QPWA 3LPFA 3J7MA 1R1A3 1YFYA 4XOGA 1AXZA 4ET7A 3B93A 3G7DA 2C9KA 2OA2A 3WW1A 5I0SA 4HPKB 5A6ZA 3DEMA 3PUHA 3AJZA 5LK5A 4QB6A 2YV8A 3VBHB 1HQLA 1RUH3 1WW7A 4DXSA 3VHNA 2MEV1 1REFA 3VGIA 2ZX4A 1COV1 4NRPA 1PMIA 4ORFA 2BTVC 3OG2A 2UYAA 3AMMA 4Q4X1 4IXLA 4YVSA 5A70A 2FD8A 1BQPA 2ZEYA 1JYCA 3LEKA 5A3UA 1B35B 5FY9A 4CU7A 2ORXA 1QNWA 3L2YA 4M3CB 4C1XA 1W8WA 3WEZA 4G4FA 1DGLA 1WZXA 2KD7A 5APAA 4D7YA 3MFAA 3OOXA 2AR6A 2B9VA 4AFMA 1CPMA 1WLCA 2PAMA 1DGRN 3ZN6B 5C8CA 5IK4A 4XC9A 4LUKA 3POFA 5FZ6A 4S2FA 1S1AA 2RE9A 1NCQC 1DCSA 3PUSA 1AR92 4IGOA 2ZPXA 3LIGA 1DZRA 2GNMA 5T5PA 1FMD1 2WAAA 3W9AA 3HBZA 2A6ZA 5F7UA 3S0MA 1OF3A 5CA6A 3TN91 1HXS2 4CCEA 5GZFA 1OKQA 5LA0A 1PX3A 2DTWA 2OQ6A 4Q4Y2 4QKDA 1W8NA 5F5IA 1Y43B 4NO4A 4LNVA 4CDQA 2PN5A 5CG8A 1RUF2 2DCZA 1BVVA 1SFNA 3VBRA 5JZGC 2B9UA 2VW2A 3H8OA 3D0SA 2XJRA 1W6MB 2YG0A 2HWC2 3TRSB 3RZMA 4CEWA 4AI2A 1ND3B 4YGBA 2SBAA 2XJTA 1PNGA 2VULA 5CEHA 5ACA3 1IQDC 2WWUA 3THDA 2PXJA 3MGUA 2ZGNA 3L9JT 4HK9A 1EAH1 1E5HA 4Q4W3 4CP9B 3OBRA 1L7LA 2RMU1 1O3RA 5C70A 4COUA 3TNQA 1XBFA 1GU3A 1Q43A 1H0BA 1JUHA 4CP0A 4NHMA 1D0HA 3I3BA 3MYXA 5E6HA 2YHJA 1W0NA 1ZBE1 3E6DA 1Q8SA 4Y20B 2HWF3 4CXXA 4EV0A 1RGSA 3OUJA 4C8DA 2GMEA 1XYOA 3BU0A 1JYTA 4QPGB 3FLRA 2GN7A 4UFIA 5F39A 4A44A 1MS1A 4NAMA 4QQOA 1E5SA 2D44A 4QX0A 4CDXB 4JQTA 4LA2A 1K12A 2VUAA 3WDWA 3NO8A 4ZZ5A 1REDA 2Y6HA 4HKWA 2JIGA 4QXKA 4PLOA 1QDOA 4XXPA 3WQ7A 1AUYA 2VMGA 5CKQA 5A7SA 4BU2A 3P1IA 2NYYA 4RGGA 4EN8B 1JZ5A 1U5YA 2JX9A 2ZMKA 1CZVA 5J09A 1AR82 1DQ0A 4O9GA 4FOVA 2HLEA 4K3UA 3N9QA 1TQ5A 3OGRA 5F6LB 4D94A 4MGSA 4UWDA 2K2SA 1WW4A 4LIUA 5DAWA 5FYTA 2K46A 1HRI2 1XJAA 2JDZA 2Y6FA 1ZX5A 4BDVB 5JI9A 2XGXA 4LEJA 4HMZA 3ACGA 5CKMA 4A42A 2WIIB 5L19A 4QU1A 2PFWA 3SNMA 3OSDA 1KXGA 1DDLA 2GMPA 2C6SA 3QLQA 5GLVA 3T09A 3AK0A 1RHI1 3GYDA 3RVHA 1TMF2 1Z7S1 4B29A 2Q1MA 1SMVA 5I8TA 2V73A 2AZ5A 4U2AA 4QX2A 2VCBA 3F2ZA 3R4UA 4YVSB 3OPWA 4HT1T 4YM1A 3BUCA 4XILA 1RUG1 4GAZA 1A8MA 1HKDA 1H6XA 3ZVXA 3GZAA 2DVDA 4QDQA 4XJ8A 3ZDSA 4HK8A 1S0CA 3RZZA 1F5JA 5F5AA 3WHTA 4A6OA 5C8CB 1XYNA 3VB9A 4IE7A 4L8QA 1W90A 2R6QA 5LA9A 4QWNA 2BNMA 1N47A 1KJRA 2J1EA 1QJX2 3HWJA 5AFBA 1UMIA 1N3PA 3MLLA 4FT8A 2FZ1A 4MH0E 4QMAA 3D4KA 2OVUA 3J8F2 3BTYA 4P5HA 5KXDA 4KNCA 4BQ3A 5IVYA 1YHFA 5DXDA 1D4M3 3AFKA 3MF9A 2J1TA 1SLTA 2IVIB 1UZZA 5HPOA 2HBTA 3DPRA 3I7DA 1AYM3 4OZXA 3VBRB 3ZYJB 2D6LX 1PVC1 2CWSA 2ZTNA 2WO2A 3P3NA 1MVEA 2BNOA 4CEWB 2XHKA 3NNLA 2XONA 4OUSA 4ZU5A 4MV2A 4FXKB 4UBGA 4XW3A 3NJXA 4EE2A 3NAPC 1NLRA 4LJHA 1PIV3 1FYUA 4OHVA 4O65A 1PK6A 3I2HA 1KDKA 1KGYA 2GSYA 3ZXDA 1BJQA 4ZPIA 1UX6A 1LOAA 3NNMA 3RYPA 2I2SA 3SHRA 2QQWA 1SG3A 2A71A 3BCWA 4B1MA 5L9VA 3JZVA 2R073 2P37A 5F3IA 1JZ6A 1QWRA 1LODA 2VOXA 2YBSA 4RR3A 3ES4A 4RHV2 3RS6A 4C0HA 4CP1A 1AJKA 2VQAA 1W6QA 2VQUA 3D5OA 1DZTA 2ZEXA 3NW4A 4QD2A 2FDIA 2P3IA 3AP6A 3RZLA 4BISA 1ULOA 1GWMA 2EAKA 4X8NA 4BA6A 3E97A 4E2GA 3VHPA 2ZMLA 1WMDA 4K6BA 5DAQA 4BLIA 4YVWC 3CZJA 4GB31 5FPUA 2HEVF 2VMIA 3MIEA 3AP9A 4WV8A 4LHLA 1BXHA 1VBE3 3KF3A 3KM5A 3PJYA 4CUGA 4MGTA 1J59A 1DLCA 1SQ4A 2YFUA 2XBO3 1HRV1 3NKTA 3UJOA 4FQZA 5H9SA 1GNZA 1DYKA 3AYDA 1JU4A 1SLAA 2WSVA 4KGGA 4QX3A 2RS11 1R093 4IEUA 4JDOA 4XABA 5FMDA 1O6UA 2XKOA 1TME3 1H8TC 2IXCA 4K7JA 1W9YA 4LKSA 5LB6A 4CYDA 2BP6A 2OIIA 4P9LA 5SV5A 3E6CC 5FBZA 1PO13 1VAMA 4BE3A 3NV4A 1BBT1 3RZHA 4H2AA 3HT2A 3GJAA 5I0TA 2FDKA 1CAUA 3W5MA 4TLFA 1W3XA 4HZFA 3DXUA 4IEWA 1NZIA 1OBNA 3H42B 1X33A 1C28A 4YFZA 4BQWA 4RQPB 1OT5A 4AFDA 5F32A 4AW7A 3RWNA 4XFIA 1G8WA 1GMMA 3PUIA 4Y4YA 3LD8A 4AEDC 3JBG1 1HW5A 1G9CA 5DDJ3 1ULGA 1FPN3 1US3A 2R16A 5JAXA 4NN0A 1G6NA 3C3VA 4Q0SA 3DKWA 2WZR1 3FUOA 4N90A 4YLZA 4QPYA 5FZAA 1HB3A 4MADA 4GA9A 4AEMA 2P3JA 3KSCA 2VUJA 1KQRA 1JS9A 1SEFA 1YCIA 2RDQA 4GIQA 4F3JA 3BI3A 1GNHA 4MHRA 2WT1A 4LBLA 4PIXA 1CONA 2VZSA 3CF6E 2MEV2 2R061 4INDA 2QQPA 3T0DA 4Q0PA 3C7GA 3CJIC 3DPRB 3WNXA 4AI9A 4FPYA 5FWJA 2YB7A 4IEYA 4JGYA 3MO4A 2GZWA 1NZCA 4TN7A 5FPZA 5I0RA 1PK6B 2IC1A 2VVEA 1LCLA 3L2HA 4OZOA 5H9PA 4DOUA 3ZIXA 2R042 2VR4A 4RGAA 3AVRA 3FE5A 2X5IC 1ZZCA 1ODNA 1PMJX 3PLQA 3GZTB 3BOWA 3VZLA 2HWB3 2I74A 3MW3A 1ZRIA 3IN9A 2YY1A 3VV1A 1J3RA 3K48A 1X9TA 2GMMA 1VBC3 4RR3B 4Y33A 3IBMA 1KJLA 2JENA 1UY4A 3BVCA 3CMGA 2DYCA 2WZEA 3WINE 5C4WC 4QKBA 5IATA 1FV3A 1JYNA 2YROA 4N8MA 2BRTA 1W0PA 2VXJA 3JXSA 2RS51 4F83A 5JMOA 2PELA 1HX6A 2WQ8A 4MGZE 3C7FA 5F6KA 5JVVA 2AUYA 1R083 4FPLA 5L7OA 3ACHA 2GU9A 1IG3A 4BOWA 4PDWC 4QQHA 1VP6A 1IG0A 2BZDA 1EAH2 3FUQA 3AZYA 1DGRA 1LKNA 2VZRA 2BDRA 4DIQA 1DP0A 1UW8A 2WYSA 3TOJA 1O5LA 3USSA 3VLBB 1VBB3 3WLUA 3ASIA 2JG8A 1F4AA 5DAXA 3T08A 1YQCA 2TUNA 3VDDC 4BYYA 1ZBE2 3ALQA 3KS7A 1XSRA 1ODMA 2VPVA 3GBWA 1GWKA 2ZACA 3WG2A 3AX4A 4NPMA 4IE4A 5FPLA 4XVHA 3RJ2X 1W8OA 2IXJA 3H1YA 3LA7A 4JHZA 4W6XA 5FUNA 2B8MA 5BXXA 4AR2A 2PAKA 1OVSA 2TEPA 4Q8KA 1UKGA 1CAUB 1C3HA 5IK5A 4BQ1A 5EQUA 1BZWA 2HWE1 1DYPA 3N7LA 5EPAA 3DN7A 1PMHX 1H2NA 2NMOA 2WQZC 2ZA9A 5FO9B 4UFLA 1GQPA 2LROA 4XCAA 4H7LA 3LDKA 1BVP1 3TEZA 4AQTA 4MUVA 2J1VA 3AFGA 1W6PA 1STMA 1QGLA 3P5BA 4E4ZA 2VH9A 3BIWE 1UYZA 1ZNPA 2AEYA 1I9RA 3N9NA 4Q4Y1 4BJ0A 5LEKA 5FZ0A 1JHJA 1LOCA 1UOJA 1GUIA 3AYAA 3EHKA 1ZBA3 1G9AA 2VW0A 4CXYA 1RUF1 3VBFA 3WF1A 1GNYA 1BK1A 3Q8CA 1LHVA 2JG9B 1UY3A 3B9CA 4M3CF 1PVXA 1VMFA 1U12A 1VBA3 1HN0A 1W0OA 3JQWA 4IETA 1RUE2 2HWD1 4R52A 1K5MC 1UIKA 5J3UA 1SDWA 4L2NA 3MLJA 4C1WA 3TB0A 4A7YA 2FMDA 1W28A 5FZKA 1GBGA 1Z0HA 3N9PA 3NQHA 5BNOA 2Q1ZB 3SQOA 3B00A 5JMCA 3U10A 4OI0A 1LGBA 3T30A 3IB3A 4LBNA 4FXGB 2BW8A 4QB1A 5T5LA 1RUG2 1Z78A 2WNUA 3MF6A 4Q2FA 4AG4A 3ZOIA 4B4PA 1OOPC 2QTWB 2DUQA 4LKFA 4QPIA 1C57A 1RUC3 2CGNA 4RS5C 2ZZQA 3FL7A 4BQ4A 4DNYA 1TG7A 1M4WA 4MGQA 5CFDC 3HPNA 2X05A 1GOGA 4YM2A 3RZKA 1NE6A 4QT6A 3I2DA 4FFGA 5BNPC 5FKCA 1PNFA 4LHSA 1QJY2 3B69A 1W2TA 4XZPA 4Y5Z0 4CP2A 1VRBA 2QQNA 5FZHA 3ACLA 4D69A 1AR63 2A6YA 2ZX3A 1V9U1 4UAPA 3TEYA 4MSVA 4R8HA 3LZZA 1JW6A 3PVNA 2RS33 1LOBA 2VOTA 5FK7A 1EPWA 2OUJA 3J7NA 5FZBA 2XJUA 4Y5SA 5C33A 2AACA 3VD5A 1AR81 3GALA 2ZGPA 3O5SA 1MQTC 3FBYA 5FWEA 3QACA 1VLNA 2D3SA 2ZAAA 3U75A 2W1UA 3SKJE 1HRI1 1VRH3 3ZMNA 4AQ6A 2WABA 3S7IA 1HB1A 1PGSA 4Y22A 3IWZA 1SCRA 2QBXA 5L7OB 1LAJA 1X7NA 2VNGA 1XE8A 4LO4B 2GC3A 1SLIA 4QHBA 2JJ6A 3GBGA 1UXZA 2E9QA 1H9WA 5BNNA 5JR2A 2FCTA 3ETQA 4GKYA 5JOXA 1XSQA 1PM4A 4LQRA 4IEPA 1YYNA 3FX3A 4MVTA 1RUD2 4Q1RA 2JG8B 5JSOA 2WDBA 3VL8A 3E1F1 1XNAA 1ZA4A 2F6BA 2WS92 3AM2A 2XVGA 3GXUA 2NMNA 2EIGA 1ND2B 2TNFA 2WO7A 1WCKA 1UZWA 3LDBA 3OYWA 4AGGA 5A3PA 1QQP3 3KVBA 3RFRA 1GWLA 2WN3A 2DBIA 4SLIA 2WNVA 4CPBD 2LTNA 5HCFA 3FLTA 4S2DA 4M0NA 1F5FA 3AKRA 3IM0A 3U37A 2BVVA 1ZRRA 2ZEWA 3ZXJA 4X6QB 2PQQA 3SCHA 2RR13 1MEC3 3HOBA 2D97A 2J22A 4UI9L 3J8F1 2QCSB 1QY4A 4YG0A 4M01A 4AQ2A 4RA0A 3N36A 1NCRB 1G9FA 4QGLA 4JDMA 4G9SB 4WM8A 1IS4A 4OMDA 1FX5A 2ZJCA 3HQRA 1W6PB 5EZWA 4KI5M 4A3XA 4FBFA 1PZ9A 1JZ4A 1AR73 1HRV2 4K20A 3B9IA 5IYYA 2Y60A 3JU9A 4ZONA 5FCCA 1NLSA 2D40A 4N7UA 5L73A 1AL22 4A4AA 1WLDA 2BGOA 2RG4A 4XFCA 1NAEA 1ZRDA 2RS12 3JCIA 5E16A 3VBFB 2WFF3 3ZYRA 2VTFA 2D98A 5FUPA 5E88A 4BXFA 3EO6A 2WZPP 2P6CA 3JB4C 1NY71 1EV13 3WW3A 5FDBA 2Y0OA 5T3NA 1NCQA 3D3AA 2ZS6B 1RMU2 3W20A 1BBT2 1OLME 2I45A 2D3RA 2ORZA 1JTZX 3WQBA 3K51A 1S2BA 1UKRA 1Y9QA 2GC0A 1J3QA 2MHFA 3VKOA 5BNOB 4UW6A 4W65A 2VECA 3VZKA 1HV0A 1UD1A 3J26N 5A1AA 1IZ3A 5AFEA 2WNUB 4FQ4A 4R9DA 4XUTA 1XRUA 3GBFA 2RJLA 4QPIB 4FPHA 1RUJ1 2HH9A 3IZOA 1N1SA 5A3OA 3U07A 4CCDA 1GZ9A 3ZFGC 1S55A 2EIBA 2GH8A 2DUPA 5FZFA 1OLMA 4JRAA 3KT4A 2VMHA 1NA1A 3PTYA 3MUZ1 4IV1C 1RVF2 3TBDA 2WZR2 2JKXA 3X29B 1POV3 1F35A 4QDRA 5KC6A 1APNA 2ZHMA 1C1LA 4CUCA 1ONAA 3ZDVA 1VALA 3ZN5A 2W08A 1PO23 4R4XA 3SH4A 2PHLA 2VC9A 3T0AA 4JKKA 5FLIA 4OI2A 3ZMOA 2R062 4DUWA 4DB5A 1DBNA 2V5DA 2B45X 4Q8LA 1ULPA 3POIA 3N7MA 3NWKA 1NT0A 1IHMA 3AL5A 2VG9A 4XIOA 4AI1A 4XJ9A 1W8FA 5FY8A 1UMZA 2ZHNA 3U78A 1YIPA 4Y22B 2JWPA 4CPBA 1TZOA 1CAWA 1YNAA 3M1HA 3OY8A 5BNNB 1HN1A 2VQ0A 4NR1A 1O3QA 4CDUC 4CCOA 3KCXA 5K7PA 4NHKA 3WUCA 2VCAA 3IMNA 3THTA 2VL4A 4Y26A 4FTEA 3I2OA 4META 3THPA 3AP7A 4C91A 4YZ1A 2WR9A 4PQ9A 1Q5OA 4ZZ8A 3QH7A 1YQ8A 3K4DA 2YZ4A 2P34A 3GF6A 3I54A 4P9GA 3KCYA 3OYWB 5HXVA 4AF9A 5FKBA 4EWEA 2E26A 4J6GA 1ASJ2 4QX1A 3NV3A 1N3OA 5ISLA 1OHFA 1MS5A 3I8TA 2WNVB 4FPJA 4L9BA 5CYYA 2UWBA 3HBKA 4K8FA 5EHDA 4AI0A 5C3SA 3M2MA 3DYPA 4IGPA 3ZPOA 2WINB 1CAVA 4AWDA 1AR93 2XHNA 1W9WA 2R7EB 2RS52 4AVTA 4E4SA 3ZFFC 3OTFA 4PIYA 4XUQA 3AVSA 1EPZA 2XLAA 4Q4V1 5H9QA 3NNFA 2LS6A 4LKDA 4Q29A 4L97A 1OH4A 3G6JB 5DUXA 1EUUA 4WM8B 5TSWA 4LK7A 2XKPA 3OEBA 3RDIA 1Y9MA 3ZXLA 4YG6A 2ZGTA 5F5CA 4DUXA 2ETEA 1S2EA 1WD4A 5JDBA
chains in the Genus database with same CATH topology
3KLSA 3ZFEA 2H0VA 5DG1A 3E5XA 4Z92B 4GULA 3O12A 5GM0A 3CL1A 1C5IA 5C9AB 5D8AC 2VNOA 5JI7A 1YJLA 1HIXA 2O0OA 4ATEA 3NV1A 3POYA 3WP3A 4YW1A 3RYRA 2R041 1WW6A 2UYBA 3AKTA 1C8NA 1PM7A 3VBSC 5J96B 4I3PA 2HWE2 3PNAA 1XNDA 3D0JA 1J1LA 3H50A 3VHRA 1V6KA 1QH6A 1YIFA 4HVQA 1XNBA 2VXRA 4OUMA 4AHWA 2B5HA 3O0WA 3VBHC 5FOBB 1IPKA 2CV6A 3H1MA 3UKNA 1C4RA 4EWDA 4LO6B 5IK7A 1NA1B 1YLLA 2W0XA 2DCTA 2H6BA 4DPNA 5A3LA 4IEXA 1OQ1A 4RL7A 1VAKA 3ZN4A 4JV4A 2IZWA 4TZDA 5IT6A 2HWD2 3LGRA 4SBVA 1FV2A 1PGL1 1R1A2 2YGMA 1UZYA 2BQPA 3ZSLA 1LULA 1AYN3 2W52A 3VL9A 2DCKA 2WNEA 4AHZA 1RUH2 1L3JA 2E7QA 2HYKA 4YARA 1O4ZA 4P9JA 1ZRFA 2DV9A 4RSUA 1TMF3 3H7JA 1MVQA 5EXOA 3OY8B 3KMHA 4XF1A 5J48A 1RIRA 2BGCA 1MS0A 2V5YA 4XPVA 4C0BA 3AZVA 1ND3C 3RQ0A 1V9U2 1VB2A 3AMNA 4OHXA 4YZ3A 2PLV1 4M00A 3SH3A 2HEWF 2A6VA 4CEYA 4OHWA 4MXWA 2K9ZA 1MACA 2CNAA 4EN7B 2GC2A 1DFQA 1H8TA 1QJX3 1WBLA 5JR7B 3T2TA 1CAVB 1REEA 1IS6A 1YFWA 1C5HA 3VZJA 4MGIE 1A78A 1Y7BA 4XHXA 1WMFA 1GSLA 4LBOA 4N53A 3A0NA 1V6NA 5HCAA 1VBD1 1LR5A 2A7AA 2W68A 3KD4A 5AVAA 4ZXKA 4MGYE 1SLLA 4AFAA 3ZXEA 1RUE1 4CDXC 1RJ8A 4HBNA 4D7SA 1OQDA 2Y0IA 5ACA2 1OA3A 5JIAA 1QJZA 3ZFEB 1C8M1 4Q4W2 4FP3A 2G4IA 1QJU3 4EN0A 4B8EA 1AZDA 3RI9A 3N4MA 1X82A 3M8LA 4COZA 3IT8A 2HWF2 4HVOA 1RUI3 4YZ4A 1RUNA 1MZFA 3O0VA 4PCRA 5J98B 1QJY1 4RHV3 2X8KA 1UN1A 3JD73 1URXA 1UCXA 2YDEA 3LA2A 2JD4A 4YW5A 1YFUA 2QKDA 4JRLA 4AVBA 2FBEA 3VKFC 2E51A 4CDQB 2EXHA 5GLWA 4WZFA 1ULEA 2UU8A 1FT9A 2DVBA 5FTTC 1NY72 5CAZA 2W39A 2JKBA 3D8CA 1H2KA 5GZDA 3SLIA 5C8CC 3MI8A 2VOKA 3R0RA 4ISQA 5A33A 3URFA 4H3WA 2RM21 1QHDA 5GKAC 5AC91 2YYOA 1RUD1 2KM2A 4HN1A 1UPSA 4MZUA 2WS91 1W39A 3RRDA 4JGZC 1RUJ2 2R1BA 2BBVA 5ABJC 1BEV3 2D6PA 3ATGA 2ZGQA 4QQ2A 5FRAA 1OA4A 4JC1A 3T1LA 4FTBA 1V6IA 1KS5A 3SISA 3VBRC 1H1AA 3WD5A 2CAVA 1BYHA 1TEIA 4CEWC 1J3PA 3AP4A 1CIWA 4CEYB 2Q8OA 1XQNA 4MXWB 3KT7A 1YUDA 4DFSA 2A6XA 4DRVA 3MIDA 3J4UH 1FOD1 1H8TB 2R30A 3POSA 4AVCA 4XJWA 1D4M2 5CFCA 3WXPA 1AL21 1F8VA 1Q8PA 4B7EA 2QJVA 4YW3A 4N53B 3RG0A 1AYM2 4HANA 3ZX7A 5BPXA 2MEV3 1VRH1 3NL1A 1RMU1 4UXAA 1COV3 4JDNA 2NZ9A 3IDCB 2TBVA 4Q4X3 2E63A 2O8OA 1O4TA 4LE4A 4Q0QA 4KL1A 4BMBA 1PIV2 3B3QE 4N9HA 1FNYA 2YC0A 4KH9A 4K9SA 4FPOB 4URTA 4OLLA 4ATFA 3OD0A 4Y1UA 5JPMB 1YWKA 2R072 3NKGA 5JOZA 3BALA 3O14A 1OA2A 3FBMA 4YGEA 1WA4A 1RVF1 2WLQA 1FMD3 4HN0A 2BVBA 2D3PA 4Q4V2 3VZOA 1FXZA 2YMZA 1DHKB 1QOSA 3TN93 2UURA 3AZWA 2PHTA 1OOPA 2AGSA 2EXJA 1VR3A 5K0UC 1DQ4A 1W2UA 2E7AA 4W6YA 4LO7A 2DU0A 3VBUA 1F9KA 4NVPA 4RQPC 2SLIA 3UK9A 4P9YA 4I09A 1ENRA 3A4UA 2ET1A 1RTVA 1EAH3 1HV1A 2RMU3 5CBLA 4AK3A 3N35A 4XFHA 5EYYA 5A33B 5JSPA 2ZGOA 4WVWA 1EV11 4BZ4A 5FLHA 4NPRA 3VBOC 1PO12 1ZBE3 3ZSKA 4LA3A 1VB4A 3H0OA 1W6OA 2GDFA 1SFYA 3MIGA 2OZ6A 2WA4A 1W6QB 2DCYA 2N7GA 1CPNA 1V00A 1ASJ1 2NPIA 3QBQA 4AVVA 4JCKA 3DPRC 2E7TA 3E6BA 3WCRA 1LOFA 1ZZ8A 1SCSA 4XJAA 3WG1A 3U11A 3INAA 5EYXA 1JN2P 1YI9A 2O8QA 5FLJA 1OSGA 5EFUA 4IV3C 1DGWX 2ZBJA 4IQPA 4MGKE 3N7KA 3RJRA 1ZM1A 3AZZA 3KZ4C 2Q5TA 4XFFA 5GALA 3S7EA 4YM3A 5HI0A 1PGL2 3PHMA 4COYA 4CTEA 2C0ZA 2XLFA 5CFCB 4I0AA 3ST7A 2WT2A 1SACA 4XF9A 4RR3C 1RHI3 4OI4A 5CNAA 4PJYA 1Z7S3 3MIFA 1VJ2A 4KBBA 2FMYA 5EJ3A 3O7OA 3JUUA 4WVZA 2RHPA 1JXNA 2WWSA 1RUG3 4UBHA 4CZSA 2QNKA 2MNGA 1GICA 1LOGA 2PLV2 3LSDA 3IPVA 1TNRA 1FI2A 4Y1YA 5BV6A 3WX5A 4BIOA 4EROA 1WD3A 1MS4A 4BH9A 5JIUA 2ZGUA 3ZXKA 1ZRCA 3JQXA 1IPJA 4NWVA 5LEJA 3B5LB 3ZSJA 3H3ZA 4B4RA 4CDWA 4YYOA 1C1FA 4JAAA 4FAGA 3V65A 5FOJB 1NQDA 4AQSA 2DUOA 3T1MA 1DQ2A 1VBD2 2VNRA 1DGWA 1QDCA 4KGQA 4MYEA 4I0WB 3W59A 1O3SA 1OOPB 1AHSA 1R082 1AF9A 1OPOA 1R1A1 1PVC3 4GALA 4XHBA 2BFUL 5FMOL 5KHGA 1C8M2 2D5FA 4L92A 3VBUB 4YM0A 3UKVA 1RUH1 2ET7A 4JGYB 1VBB2 3DV8A 4BMEA 4GH4A 2XJPA 4AXOA 2E6VA 4FCAA 1S0FA 3RNSA 4BIFA 1CR7A 1ALYA 4A2UA 4CRQA 1GZWA 1KFXL 3I59A 2CY6A 1LESA 1LU2A 3WDXA 2JG9C 3FZ3A 2Z5WA 4IEQA 1UU6A 4FPKA 3APBA 3E5UA 5I8YA 1W6OB 4LO8A 5JOWA 4XETA 4AFCA 2IFRA 1CVNA 2XL9A 1YJKA 4J1WA 2Q30A 3E5QA 5GZGA 5CG9A 5CB7A 4GB33 3ZXFA 1CAXA 1H2LA 4XF4A 2HKXA 5A32A 4CDUA 2ZCWA 1ZBA2 3ES1A 3IDBB 1NE4A 5T5OA 2A5ZA 2BEOA 1A6CA 1S2KA 4N43C 4WZCA 5GLTA 3HMYA 3VUOA 1N3QA 2LALA 1MS9A 2RS13 3AMQA 2RM22 4LBQD 5AC92 2ILMA 5GZEA 1Q56A 5ACA1 2ZOEB 3CEWA 3VKLA 4Q4W1 3B01A 3B7MA 3OGGA 5T50A 1BBT3 3ZFFA 1QXJA 4LHNA 5DUWA 4L99A 1D2QA 1FNZA 3ELNA 1CX4A 3HN1A 1X50A 3MLKA 2HWF1 3WW4A 1U5IA 4NHLA 4QU2A 1NG0A 4QX5A 2GNBA 3M3CA 5DUUA 1ULCA 2ZGKA 2DF7A 1J58A 3JBG3 3A0KA 1IKPA 4XFBA 3IPVB 2B7YA 1MZ5A 4N9IA 4YG3A 4R9CA 4KQ7A 4OHZA 3VKNA 3LKJA 2OUHA 4WM7C 1FOD2 2VY0A 2K0GA 1OPMA 2WZR3 4Y1ZA 1KS4A 2JG8C 4AEJA 5T54A 4CDWB 1QMJA 3MEPA 3FHIB 5JWPA 3WG3A 1ND2C 1LEDA 1QNYA 1NXMA 2NQYA 4I30A 1DQ6A 3I4IA 4M3CE 1LRHA 2AYHA 2R063 1VRH2 1GQHA 1HQNA 3KCCA 4P9WA 4I0BA 4V1PA 3CO2A 1MR5A 4YFWA 4XE9A 2VOVA 2B39A 2PTMA 1IS3A 1WGPA 4XFGA 3JB8A 1PHMA 1ZYBA 3MPBA 3SH5A 4AI3A 2MPFA 4Q1PA 4Z8BA 1NCRC 1WLTA 2ZABA 1X36A 4GH4B 5JZGA 4B4QA 2A75A 5FO7B 3WHUA 3V0BA 1GZWB 3I59B 2BNNA 1QQP2 2PHRA 4MX3A 4PLNA 3ZPYA 2FQPA 3LOBA 2A73B 1SBFA 1PZ7A 3RSJA 1SLBA 5SV8A 1RUI1 2ZKNA 1NYWA 4AGRA 1DU3D 4TSVA 1ZZ9A 4H7MA 4LBQA 1QOTA 4R9AA 2IXKA 5BNOC 1WW5A 5KXCA 1LHOA 1QXPA 1H4GA 4R4ZA 1D4M1 1GFF2 2CTVA 3AXDA 2WNUC 3H3UA 1CAXB 1DLLA 1AR72 4CDUB 3VZNA 1IKQA 4HKOA 3U0ZA 2PHFA 4A7KA 4W6WA 2JE9A 3DGTA 1AYM1 1AX0A 3R4DB 1IQAA 3AXEA 3UL2A 5IUQA 1EV12 2BPA2 5IK8A 2V09A 3H8UA 3FFZA 3PMSA 4J1XA 2UY8A 3QCWA 4FP2A 3AYEA 4QGNA 5JOYA 2WJSA 1AXYA 1PIV1 4QQLA 2R1DA 3OBTA 1H2MA 1GZCA 2Q4SA 2BWCA 2EF6A 2A3XA 1BCXA 4XIKA 2UWAA 1H30A 3VKMA 4XTMA 4Y20A 5CIRA 2KXLA 1HDKA 5L36A 1H4HA 2R071 3N7JA 4UW5A 2HWE3 3AYCA 4OFGA 4XBLA 1UU4A 1GR3A 4CDXA 4YGCA 1GANA 1ENSA 3POWA 2Z2SB 1R1ZA 3IKWA 1HXS3 4HETA 1PGW1 4Q4Y3 5LK7B 4IEOA 2NP0A 4ZU7A 5BNNC 2WT0A 5KWRA 3ZIWA 2D93A 1N1TA 1O7FA 3EXUA 1RUF3 1PO22 3MW4A 2XLGA 2HWC3 1VBE1 5EWSA 3W58A 2HWD3 2XBO1 4HLTA 2QE3A 4DS0A 1NCQB 1CD3G 3SMHA 3GZUC 3M7AA 2WNVC 3WP5A 2VVDA 1R091 4Y24A 1ZZ7A 2PYTA 2ZGLA 1LJ7A 2NN8A 2G9FA 2P17A 1TME1 1LTEA 5EV7A 1QU0A 1PO11 4LO5B 1JBCA 2EA7A 3NV2A 1G9BA 3PMEA 4XJUA 1DIWA 2CYFA 3V56A 4WM8C 1LENA 2WC2A 5JZGB 3D82A 3ZO0B 4HL0A 3O0XA 2DVFA 1SLCA 2R0HA 3PJQA 1I1EA 3V0BB 2WSUA 3SXWA 4KU8A 2ZHKA 3NAPA 2VW1A 2VVFA 1V9U3 2XVLA 2VOWA 1B35C 4LT5A 5DDJ1 2WQ4A 5C9AC 1FPN1 5GZCA 5JSRA 4JTNA 1LU1A 1MZEA 4FPFA 1AR83 2DVAA 1PZ8A 2R0FA 3AMHA 3FFQA 2ZGRA 3MDPA 4JGZA 4LBQB 1JOJA 2XWJB 3EJKA 5ABJA 1I5ZA 1HRI3 2QZ2A 4QGMA 1QOOA 3NVCA 2D7FA 3RYKA 5DUVA 2LUWA 5E1RA 3TWIA 2NLRA 1ZZ6A 4FSJA 1CJDA 2BYVE 3WOGA 5T5JA 4ZKTB 1I3HA 1A8DA 4PF5A 3WUDA 1MS8A 1JH5A 4KWKA 3USUA 2C9AA 5I93A 3ME2A 1A3KA 5K9YA 1WMEA 2QFEA 4WVVA 2EXIA 1CAWB 1ZZBA 4YVWA 1KFUL 2OPKA 4FOQA 1YO8A 4O9EA 3V0AA 4I01A 2D43A 1NA1C 2D6OX 5KBFA 4DINB 4GQ7A 2ZX2A 1EYBA 2AH2A 5I91A 2FZ2A 2XUMA 4XQWA 5T52A 4Z2WA 2CGPA 3ZSEA 3ZYIB 2G9GA 2EVXA 4C90A 5B2GB 2HWB1 2I07B 5JLVA 3MPPG 2BWAA 5D1IA 3S6PA 1VBC1 4TWTA 2JE7A 3NSTA 2ES3A 2VU9A 3GHMA 3MFCA 3J8F3 4LE3A 4LBKA 2CWMA 4ASLA 1BKZA 1FAYA 1LECA 4QPGC 3EBRA 5KHIA 2H0BA 3BB6A 3R6SA 4H55A 4UW3A 1UPIA 1R081 3M3IA 3BU7A 4AEDA 3OCPA 4GMP3 4KG0A 2BFUS 2ZZJA 4XMAA 1Y3TA 5FMOS 3WG4A 4GWNA 2C5DA 1V6LA 5BNQA 5DZEA 3WCSA 1OMIA 2PHUA 3J9SA 4DQAA 3AJYA 2KA3A 2DFCA 1VBB1 1J1TA 1AYN2 3C2UA 2NM1A 4QM9A 1POV0 4AEKA 2Y26A 4XF0A 1QF3A 1AXKA 4ONUA 2XJQA 3CU7A 2ZX1A 2DFBA 2JXAA 4HKLA 2GNDA 1RUJ3 5K0UA 4XEZA 1KDMA 1EP0A 3TYJA 4AHXA 4XYXA 1S0EA 4K1YA 3GNEA 4WVMA 3UJQA 3B94A 3CJIA 3ILNA 3DF0A 3KGLA 4RQPA 1QKQA 4LR4A 1OFNA 3HR9A 4JQRA 3NAPB 1LHNA 1O91A 4YVSC 3ZFEC 2PA7A 2XJSA 1OQEA 3KQRA 3ROUA 4Q0VA 1S0DA 2OYZA 1DG6A 2X5IA 3VBOA 3SCFA 2UWCA 4PBOA 5E8AA 4ZU4A 1W6NA 1ZBA1 4XJZA 1YFXA 1OI6A 4YZ5A 3OPZA 1UU5A 4JGZB 3MW2A 3GHNA 3ZYPA 5ABJB 2PHXA 4Q27A 4EWAA 3RI8A 1VBA1 2GN3A 3AKSA 5C4WA 4OHYA</