3I59A

Crystal structure of mtbcrp in complex with n6-camp
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
224
structure length
215
Chain Sequence
HMDEILARAGIFQGVEPSQLQPVDFPRGHTVFAEGEPGDRLYIIISGKVKIGRRAPDENLLTIMGPSDMFGELSIFDPGPRTSSATTITEVRAVSMDRDALRSWIADRPEISEQLLRVLARRLRRTNNNLADLIFTDVPGRVAKQLLQLAQRFGTQEGGALRVTHDLTQEEIAQLVGASRETVNKALADFAHRGWIRLEGKSVLISDSERLARRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, Crp/Fnr family
publication title Structural Insights into the Mechanism of the Allosteric Transitions of Mycobacterium tuberculosis cAMP Receptor Protein.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Dna binding protein
total genus 62
structure length 215
sequence length 224
ec nomenclature
pdb deposition date 2009-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3i59A02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3i59A01
3CUOA 4Y17A 4OIOF 3GX4X 2R7FA 2OZJA 2K86A 3KP5A 4KUMA 4OOIA 3WGIA 3E6CC 1B6AA 4UBGA 2D2WA 1FP1D 2ET1A 4QLCU 2Y0MA 1YLLA 1XD7A 2DAOA 2UXNA 1IZ1A 4EMSA 2J5PA 2Z99A 2RGVA 4MNUA 2FRHA 5AVPA 2CGPA 2F5FA 5TJJA 3EHKA 5JVTA 2RV8A 4AVCA 3RKWA 4I7HA 1QGPA 3OF1A 5I8YA 4M6XA 3DV8A 3V7CA 2IXHA 5D4SA 3NEUA 4DNCA 2B9UA 4IF4A 2HEOA 4B09A 5E1WA 1RI7A 2Z33A 5F64A 3P9CA 2X0LA 3GFMA 4YARA 5K5QA 3EO6A 3RKXA 1CAWB 3K1MA 1BBYA 3PNAA 1O3QA 3FX3A 1AWCA 1ZH5A 2G7HA 4MGZE 4G6QA 5JSRA 3ROUA 1LEAA 3WTSC 1CF7A 4IEWA 4KWKA 1S8NA 4G9YA 1O5LA 3CF6E 2GAUA 5DDGA 1VP6A 5HLGA 4FAGA 2GH2A 2TDXA 5ICEA 1V4RA 2HYFA 1WRJA 1Q43A 2EVXA 4UNOA 2HKOA 1H9TA 5ICCA 1UCXA 2O6GE 1PP8F 2DO7A 4ORFA 2D1VA 2OQRA 3MCZA 2UY9A 1O57A 4JV4A 2VT2A 1FWZA 4RGSA 3SXWA 4E2GA 3OD0A 2JZYA 4XF1A 3IKTA 1J7KA 3WODF 2D5HA 2A69F 1JHFA 2PFWA 3CO6C 2P5KA 4MGYE 3JTHA 3GVAA 2JPBA 5H6RA 4XFHA 2XL9A 5CVUA 2Q1ZB 4G7ZF 3L7WA 4U0YA 1TNTA 1PP7U 3K1PA 3CLPA 1ZYRF 2W25A 2RVCA 1XGMA 4EM2A 5LEKA 4OIQF 5LRSA 3FFQA 4FX4A 2X4HA 4L9JA 4E70A 4YRDA 1V70A 4IERA 3T1BA 4WXHA 3I53A 5CLSA 2QDRA 3VOEA 1MJBA 2HWVA 3DP7A 5F1RA 1NHAA 3BROA 3BZ6A 2OAZA 1C0WA 2VT3A 4Y13A 4OIPF 1O7FA 1QZZA 1XN7A 5D5WB 3CL1A 1HKQA 3DFGA 3F6OA 2Z3YA 4GCVA 3WTWC 2YSRA 3IRRA 3IBMA 2GU9A 3WGHA 1J1LA 4EWEA 1QZYA 5D6EA 2EV6A 3FHZA 3SQNA 5BY5A 4AVPA 1DGRA 3LOIA 4OMYA 4CHUA 2FXAA 1RGSA 1NYWA 4HN1A 3L00A 1GHCA 4CICA 2V1UA 3F6VA 1OMIA 4G7HF 1OR7A 3IWZA 3DKWA 4EWAA 4N9HA 2M8EA 2ZBKA 3EJKA 3KMHA 4LLGF 4RAYA 5L3GA 4FT8A 2Z9OA 3ZMUA 4QXKA 3KP7A 1MZBA 2QYOA 3LAPA 1CAXA 6PAXA 5FLXZ 5D5XB 4O9EA 4M71A 4NQWA 2A68F 3JSOA 2VONA 4PZJA 1RZ4A 2OQGA 1BI0A 3KGZA 5KBFA 5F6FA 3ETQA 2H6CA 1IRGA 2QQAA 2AXLA 3EQEA 2XAGA 4J1XA 4ESJA 4ZZLA 1FI2A 4JQFA 4LK1F 2D1HA 4XETA 3KZZA 5IT9Z 1U78A 5DUKA 3RJPA 3GXOA 3WTVC 3FXRA 3ULQB 1YW9A 4ZYEA 4Z2YA 1IRFA 1ZZ6A 1U5TC 4EGZA 1YW7A 1KQ8A 3ML6A 3ERED 2ET7A 1HSJA 1IW7F 4MV2A 3FXQA 3GEZA 2IC1A 4PCQA 2JSCA 3VEPA 2P4WA 2WFPA 3V4GA 4CGZA 1SFXA 4ENKA 3TO6A 3RIRA 5HS7A 4XEZA 2QUFA 1ZG3A 2NRAC 2I45A 2M45A 2VODA 1B1BA 2JPCA 3HRMA 1RC6A 2JTVA 3FMQA 1JXSA 2XIGA 2L54A 2PAEA 1NZCA 2GA2A 4I3PA 1QPMA 1OFNA 3E6DA 5EZWA 2ADUA 1KU3A 1Z05A 1XB4A 1ODDA 3QU3A 4U7BA 2XV4S 4YFNF 4QMAA 3HRUA 2BNOA 3QRFF 4U0VA 2XUBA 3ABUA 2QNKA 2FOKA 3E5QA 1O5UA 4G94A 1QWRA 4Q0PA 2E7XA 4FBFA 1CAVB 2GXBA 3IWFA 1Z7UA 4MUVA 1X8EA 1IN8A 4B8XA 2BNMA 3NL1A 1ZLKA 5FPXA 2NYXA 3MQ0A 1I6XA 5CJ9A 2FQ3A 2RNJA 2XASA 1IUYA 1FSEA 4HA8A 4HLYA 1RIOH 4O3MA 3RYRA 2GZWA 3ZPLA 2HGCA 5FO5A 3HQXA 3WE2A 2R3SA 2OBPA 2OA2A 1DZTA 2FBKA 1LB2A 1ZNPA 2F4PA 3GUDA 4HW0A 3C3VA 2XAHA 2V1XA 3KEQA 2MH2A 2F5EA 2O0YA 4P9FA 5LBQA 4LUMA 3MAJA 2NNYA 3O6BB 4J1WA 5HDNA 3WW4A 5JHUA 1IPKA 5DCMB 5DUIA 5E17F 1XGNA 5CU1A 3LWCA 2CWEA 2DI3A 3C3WA 3FM5A 5D6FA 2RDPA 3ES4A 3U1DA 4CYDA 5CVRA 2FMLA 4ETSA 1SD6A 1KA8A 3DEUA 1D8KA 4RAZA 1IN6A 3F8FA 4O6JA 3FMRA 4G7OF 5D5VB 2KJCA 3GYDA 3HSFA 3IHUA 1BJAA 1B9MA 1I5ZA 2G7UA 4BH9A 4ZYHA 5AIPA 2HTSA 1ZG1A 2A5YB 1DPRA 3ACLA 3ELNA 2CW0F 4IRHA 4EROA 4QWQA 5KHJA 1J59A 2V79A 2A07F 2VE8A 3KZYA 3CO7C 3KP3A 4MTDA 4HF2A 1RNLA 3FF5A 3TQNA 4M74A 2EA7A 3KETA 1R1UA 1J2XA 2CG4A 2B0LA 3T8TA 3GZ6A 3I59A 2BE5F 3NKTA 3WTUC 3H9AA 3HT1A 4LLLA 4RGUA 5BV6A 2CAVA 2PFBA 3PQJA 1ONVA 4XLPF 4ZZDA 1LVAA 3WE3A 3HT2A 1WSUA 1MDMA 1YFXA 2FBHA 1KYWA 2VOPA 4WXDA 2VQAA 4AIHA 3HUGA 2PBIA 1WWXA 4XFAA 3TOBA 1VR3A 1EP0A 4MX3A 3J80K 5FCCA 3LQRA 3M8FA 3N4MA 2HQNA 4CXFA 2XGXA 3LAGA 2M5WA 1HQCA 1SMTA 4I01A 1R36A 2A61A 3EDPA 4UV9A 2PA7A 1ZGAA 2KIFA 2LDUA 3LQQA 1YFWA 3SHFA 3HOSA 2OU2A 4L9TA 5ERIA 2MLGA 1REPC 2PN6A 1JHHA 3GYHX 5FQ0B 2PMUA 3KLNA 1D8JA 2CO5A 2DBBA 2EFOA 1YO5C 3GW2A 2V6CA 4L5IA 2BEOA 1T39A 5KK1A 3N97A 3BU7A 2IA2A 4KA4A 1VJ2A 1X3UA 4YIIA 5I91A 1EPZA 3QOPA 1SD5A 2EV0A 4D7SA 1BOAA 2EFPA 5CVIA 3UKVA 3M7GA 2QQ9A 3IRQA 3V8LA 1MJ9A 4BAYA 2LSOA 4Z07A 2IA0A 2CQKA 2XAFA 4WK8F 4YNIA 1IAWA 2PHDA 4QM9A 3VB2A 1Z1DA 1O3RA 1TBXA 2IRFG 2LNBA 5HS8A 2O8XA 2FQPA 4AVBA 3I5UA 2VC0A 5L3FA 4BQAA 1I27A 3S7EA 3T0YA 1K79A 3H1WA 3H8UA 4QGMA 1T6SA 2F5DA 4WBBA 4H7LA 2CFXA 3REOA 2GC2A 3TOAA 3FHIB 2F2EA 1O3TA 1QNTA 4IESA 3MDPA 2W84A 2BYVE 2HOEA 3ZMSA 1ZVFA 2IXLA 4QGNA 4LULA 4IEUA 5J48A 2EFQA 4HBNA 3V7SA 3CUQC 1ZZCA 1R00A 3OGJA 1SQ4A 4S05A 3VFZA 1T38A 3IIAA 1YYVA 5EEGA 2L4AA 4EJWA 1XE8A 3KGLA 2XROA 1IXRC 3HTSB 1R22A 1FYMA 4L0ZB 1J3RA 2ZJ2A 2PQQA 5I0SA 4S04A 2GA1A 5KHHA 1LNWA 2ZNYA 4BHCA 3K9TA 4G8XA 4EJTA 1CAVA 1SAXA 4KMFA 2DPUA 5D1IA 3BJAA 1OYYA 1P4XA 5DYMA 3NVCA 5L3BA 3KP4A 1ZZ7A 4QGLA 4I98B 4Q48A 4MZUA 5ED4A 5E1XA 3M70A 1JGSA 3SCHA 4A6EA 3FMSA 2QBYB 2FNPA 4MGIE 4FAHA 3TDZC 1F9NA 1J3PA 3H3UA 5D5UB 2VBWA 1ZREA 3I71A 3C7JA 4CO8A 2HZTA 1ZRRA 2HYGD 1R7JA 3HHGA 4ENJA 4IEQA 4XF4A 4FHTA 4EJOA 5E1ZB 1CX4A 4IJAA 1BN5A 3FE5A 2ZFWA 2O8QA 4XFBA 5FB2A 1CGPA 4OFGA 2HKXA 5JFRA 3L9FA 2IXJA 2DU9A 3E97A 3USSA 3E6BA 3M3IA 3LFKA 3LA3A 2LF7A 2XAQA 2FA5A 4RGXA 3C1DA 3J81Z 4KL1A 5FLXK 1Q5OA 4IRGA 1P6RA 2P7CB 3BPVA 3D5LA 4ESBA 3RI4A 4Q4ZF 4ENMA 4K8FA 4RB3C 3P9KA 1HXDA 2M30A 3GF2A 4R79A 3IL2A 3DN7A 4A12A 4A6DA 4Q5SF 2CYYA 4XF0A 5AONA 3ECOA 3LZZA 5E1RA 1U8RA 3NW4A 3U10A 2FSWA 2FBIA 2RQPA 1W4MA 5IT9K 1WQ2A 2VN2A 3ZMVA 3B02A 2KIUA 3IDCB 4XRFA 1LKNA 5JSOA 1D5VA 1X8MA 4OLLA 4KICA 2HS5A 2WC2A 2EV5A 3WU1B 1IPJA 5BMZA 4LB6B 3KP2A 5D4RA 2GWRA 4MTEA 5BPDA 1L0OC 4XBFA 3H7JA 3FZ3A 3JZVA 4OIRF 3G7DA 5C6CA 1ZZ8A 1UHWA 1P4WA 3SMHA 2QVOA 4A0XA 2PLYA 4L0YB 1GQGA 3NRVA 4ASNA 1B59A 2DK5A 3OV8A 3VODA 1OYWA 4LG0B 5BXXA 2FF4A 1X7NA 5HLIA 4AXOA 4E2QA 3K69A 4IPAA 2ZO4A 5EEHA 5J6XA 1T2KA 5HI0A 4BHBA 2LF8A 3I54A 3QP6A 1YFHA 3KCCA 5IT3A 2Q0AA 5J8CA 4Y15A 2OZUA 3M8EA 2QCSB 4WZCA 2XL7A 2ESNA 1K78B 1E2XA 3H50A 1ON1A 3TO7A 3R60A 1NE4A 1ZG5A 5A2QK 5FQ0A 2K9ZA 4O9GA 4D7TA 3I4PA 3KP6A 1H1MA 5CVJA 3VHRA 1XCBA 4IVNA 1FZPB 4R1HA 4LMYA 4KFCA 3SCFA 5H20A 4JVAA 4EWDA 1S7OA 4A0YA 2VBZA 4M73A 1YS6A 2CSOA 4O5VA 4LFUA 3I7DA 3M1EA 3LWFA 2MPFA 4LA3A 2Q0OA 3JTGA 3V8JA 5DEQA 2YPRA 1TLHB 2VPVA 4EV0A 1SFEA 3GWZA 5E20A 4H0EA 4JK1X 4LEJA 3WTYC 2QLZA 4AVAA 1BC8C 1R58A 2WV0A 4I2OA 4ZU5A 2BBYA 4UVAA 4LD5A 3WTXC 1DUXC 4R8HA 3GFIA 1O7LA 1YLFA 2VBXA 4AWXB 4U0WA 3ZP5A 2DW4A 4HSLA 2PG4A 2Y75A 4HV5A 1ON2A 4DQ2A 1FXZA 2FEZA 1T98A 3GLXA 1KQ9A 1DDNA 3LA2A 2E7WA 2DT5A 1HKSA 1U5TB 3WU0A 1MD0A 1RTVA 4KMUX 1XSVA 1TTYA 1J58A 4X6RB 5I93A 3R0AA 1FYKA 2ISYA 2IA1A 1O4TA 3HTUA 4BXUA 3MZHA 3ZQ7A 3I58A 4I0BA 3RNSA 3Q9SA 4L9VA 1FC3A 1Y0UA 2MA3A 4WVZA 4OINF 3H1YA 3ZMZA 4MHGA 3SFZA 5LHHA 4HAMA 2E1NA 3BY6A 1ZLJA 2ETHA 3M9AA 3PLQA 2MC3A 4HLXA 1EY2A 3SZTA 4HVRA 3FXUA 4WF2A 1A04A 4KU7A 3JAMZ 1CAWA 3R0JA 1UIKA 1G3TA 3BPZA 3I0TA 2GQQA 2D45A 1H0MA 2IP2A 2CV6A 4XFFA 1H1IA 5FPZA 5DV5A 2E9QA 5I0RA 2IPQX 4AIJA 1JE8A 1L3JA 3I64A 3H3ZA 2XLAA 4RS8A 4HV6A 3Q5FA 1Z9CA 2O1QA 4P9UA 3T8RA 3F21A 1BI1A 2QBYA 4PGHA 4MEYF 4NB5A 1Q1HA 1XSDA 4HSJA 3S0MA 4KT5C 2UYAA 4RGRA 4KN7X 3RPQA 2WWYA 2HQRA 3R6SA 3O2PE 3H1MA 1YFYA 2PHLA 3AAFA 1WA4A 4IEOA 4ONUA 4HZFA 2L3DA 1S7AA 1W5SA 5LGNA 1FNNA 1ZZ9A 4EGYA 4WX9A 3BCWA 1STZA 1TW3A 1LDJA 4M72A 3CLOA 3FM3A 2UZKA 3SXYA 3V7RA 4A2UA 1R5HA 1X82A 2HDCA 2O3FA 3U9GA 3JW4A 1QQIA 3IDBB 1DPUA 2NS0A 2R7DA 4ZYDA 4YYOA 3NSTA 2PJPA 2L4MA 1WKMA 5D8LB 5EFUA 3HRTA 1Q3EA 2LKPA 5DCFA 2OA4A 1BIAA 3MEXA 4WWCA 5E8GA 3SZPA 3HYIA 3KEOA 2QQBA 2ZMEB 4IEZA 2VBYA 2BV6A 1GVJA 3HRSA 2P6SA 3ZMDA 4HN0A 2PTMA 2FNAA 1EYBA 1BM9A 2WTEA 1GXPA 2EJRA 4EM1A 1R5GA 5L3EA 1FBSA 2VC1A 1Y9QA 2FU4A 5FLHA 4IHTA 1WGPA 3IKVA 1SD4A 1MJAA 1ZARA 4Q0UA 1G4DA 3QACA 4UVBA 4KDPA 1CAUB 4LA2A 3OCPA 5J3UA 3EBRA 2XHKA 1W5TA 2W57A 3EUHA 3F8MA 4KIGA 2UWMA 4I0AA 2A3SA 2IT0A 4OMZA 2XVCA 4HOBA 2K0GA 5J8FA 3WW1A 2PAKA 4YFXF 1ZRFA 1B4AA 2ZXJA 5TRDA 5BPIA 4HVOA 1ZAOA 4P96A 3SHRA 4HDVA 1FT9A 2MLKA 5E8IA 4ZH4F 3LAJA 2Q4SA 2PAMA 4KIFA 2V9VA 4RD7A 3E3VA 3KFWX 1P2FA 4WXCA 4Q0QA 3BJOA 1J3QA 2K02A 1FX7A 5I8TA 2IJLA 2C6YA 3HOTA 5HLHA 3K1NA 2QM3A 3F3XA 2L02A 2NNNA 4JTOA 2OPKA 2P7VB 1XMKA 2ATFA 1J5YA 4GULA 4JTNA 3QPHA 2OYZA 5JR3A 2PQ8A 4XSXF 3F8BA 2L01A 1U3EM 4G6DA 5FGMA 1Z6RA 1LQ1A 1ZZBA 3F8CA 1R23A 3DQVC 1EH6A 1BC7C 5LEJA 4MGRA 4BNCA 1UD1A 5ICGA 1HKTA 1KU7A 3G3ZA 4L5JA 4BYYA 1G6NA 1AOYA 2F5CA 1F1ZA 1O3SA 3D0SA 2EK5A 1UHMA 2MH9A 5HVQC 2JRTA 4P55A 1G3WA 3BALA 2H0VA 4FX0A 4GXOA 1QO0D 3D82A 1W7PB 2VECA 2O03A 1UW8A 1IXCA 1YS7A 4UHTA 1U5TA 1XMAA 4RB0A 1USTA 5J7MA 1QBJA 2HFHA 1BI2A 2O61A 3G73A 1S3JA 1R1VA 3SCGA 5C8WA 3J81K 3TNPB 1I1SA 3UKTA 2VE9A 1XGOA 2PYTA 2H94A 2V09A 3D0JA 4NHJA 3WGGA 1PM7A 1QXRA 1DGWA 4L2NA 2QJVA 4HQEA 4A5MA 5JCTA 1FPQA 2H09A 4UVCA 4XFIA 1TQPA 5K1YA 4IRIA 2M1BA 4BHPA 4KU8A 2D40A 3U11A 4HQMA 2EA2A 2DQRA 3TKYA 4I02A 3CUQB 1B9NA 1XE7A 4MEXF 1WI9A 2P6TA 2C0ZA 4XFCA 2ZKZA 1FLIA 1RUNA 5E16A 2AS5F 3PFIA 4TV7A 4F7ZA 1Y3TA 2P8TA 3ISPA 2HTJA 5KHKA 4L11A 1V3FA 1SFNA 4Q29A 4LUKA 4P9GA 3HSRA 3FWEA 4AQ2A 3BPXA 2PMHA 5FD5A 2B5HA 5DCMA 1LJ9A 4GO1A 3RYPA 3WTTC 1QY4A 2XAJA 5FFXA 2J5OA 4META 1KYZA 4KWJA 3W6KB 3CTAA 5L3DA 1LRHA 5FDBA 1ZX5A 4GGGA 1USSA 3ZN0A 4U7DA 5H6QA 4PJYA 1XDUA 4HX8A 3DPLC 4LTAA 4EVIA 2DK8A 3QP5A 4QM8A 5DD4A 4UXNA 4HF1A 3B73A 3TO9A 5ILUA 3ABTA 4MGKE 1YWKA 4DINB 4ON0A 4YSFA 4ZU4A 5FLJA 5LRRA 5L3CA 3OTFA 3GFJA 3QAHA 1LEBA 3BDDA 4MH0E 1YFUA 4HVQA 3I59B 5E18F 1EH8A 1YW8A 4AD9A 5BUVA 2YU3A 2Z2SB 3CJXA 1L3LA 4PIYA 1FSHA 1S29A 5K8SA 1OD5A 4EJVA 2D93A 2N7GA 2EFWA 3T5XA 4UXAA 2RC4A 2Q8KA 1MDMB 2DQLA 5ICFA 5LLQA 4XFGA 3MYXA 5LGTA 2XLFA 1P92A 3P7NA 2GC1A 3E6MA 4IEPA 1K6OA 2RKHA 2ZMEA 4LJZF 3CEWA 4N0BA 1LR5A 1PMIA 4L9NA 3DXJF 1EV7A 4AIKA 4HLTA 4HDUA 1HW1A 2EWNA 2K4JA 4KIBA 4PDKA 2IVMA 4YIFA 4KWLA 2OD5A 3COAC 3RDIA 3E5UA 4QX5A 1TQIA 3PQKA 3LSTA 2IXIA 2UY8A 2A6EF 4R52A 1YHFA 5CYVA 4IEVA 1J0RA 1CAUA 4XF9A 3GO5A 4ENNA 1SFUA 2Z5UA 2GC3A 1FBUA 1LDKB 3ELKA 3H92A 3CO2A 3ST7A 2V1DA 5KHIA 3WW2A 1BI3A 3GFLA 4A0ZA 1ZRDA 4LLOA 3LA7A 3EETA 4CDGA 5FLIA 1SMYF 4Z82A 2Y0OA 5HDKA 1W7PD 4MQ9F 3K0LA 1SD7A 3H7YA 4IXAA 3TNQA 2KJBA 2Z69A 3RPUA 4IETA 1R1TA 5BPXA 4EQQA 3NQOA 1ZGJA 3HIFA 1H9GA 5LHGA 3F72A 1JUHA 2IXCA 2DPDA 4AQ6A 5JSPA 4PGGA 4U88A 1YTYA 1ZHFA 3JAMK 3RYKA 5BOXA 1G3YA 1LDDA 4Q47A 2EFNA 1FOKA 1FYLA 4HX4A 3W6JB 3EQLF 4LB5A 5K5OA 3L09A 1ZRCA 2KKOA 1IN4A 2CAUA 2ACJA 2GXGA 2JT1A 5LGUA 1S6LA 1F5TA 5JAXA 4L18B 1Z6TA 4JBAA 2K7LA 1VTNC 1G3SA 4ZYGA 2ESHA 4IEXA 3NJZA 4CZZA 3BOQA 1DP7P 2YR2A 2ETEA 5KHGA 3KLOA 3P9IA 2Q30A 1W7PA 2GIVA 5A2QZ 2P5LC 3WW3A 2B8MA 5ILSA 1PDNC 1FP2A 2P17A 1MGTA 4GYIA 2KXLA 1EH7A 3L2CA 2QENA 4XLNF 2STWA 5BQTA 4TLFA 4N9IA 4OU0A 3ECHA 3ES1A 3BJ6A 2ELHA 4LGWA 3E5XA 3CDHA 3ZN1A 3F22A 3GBFA 3MFKA 5CVVA 2HJIA 2Y48A 1CF7B 2MD5A 4BIFA 1MKMA 1F4KA 3O3KA 4D0PA 3DPTA 5D8KB 3R4KA 4YG2F 1XSXA 3TDUC 2BGCA 1IN7A 1TNSA 3KE2A 2VXZA 3WTZA 5I0UA 1BIBA 3J7AO 3CUQA 3U0ZA 4HX7A 3JSPA 2NAZA 4GYGA 4YFKF 1XGSA 2W85A 4ZU7A 1YUDA 3RKYA 4IHSA 3IC7A 1J9IA 1HW5A 2FMYA 3V8KA 1IF1A 2STTA 1FY7A 1UPIA 3HHHA 2D5FA 2K4BA 3ZDSA 3L2HA 3R61A 1OI6A 2H6BA 3S7IA 1GQHA 1U2WA 2Q2EA 2ISZA 2M87A 1K7AA 2COMA 2EA4A 2XKOA 4K2EA 1U6GA 3RZZA 1UFMA 2E1CA 5JR7B 5BS6A 4M9ZA 4E2SA 4HYEA 4HMZA 5FD6A 2DTRA 3BP8A 5FFZA 2IW5A 1SEFA 4LK0F 3WG9A 2MBFA 4XF3A 4PIZA 2OZ6A 2EB7A 4Q0SA 1XDSA 5LHIA 1ZN2A 5CADA 2HR3A 2BNNA 3HSEA 4B29A 4UV8A 2DCTA 2FE3A 4MQVA 3OOPA 1UB9A 3BB6A 4X6QB 3MPBA 1OPCA 3CJNA 2UYBA 1RL3A 2H27A 2IXKA 3RTRA 4LLNA 1KU2A 4KN4X 3QPTA 2XRNA 1KQ0A 5KVRA 4UUVA 3GZ5A 1XRUA 3BWGA 3Q9VA 2RN7A 1WLTA 1GXQA 1TQ5A 3QU6A 3ZMTA 1RUOA 3FZVA 3TGNA 1DZRA 4UBHA 1T0FA 5HOOA 3DL3A 4M9XA 2ZKLA 1XCVA 4EJUA 2PEXA 3O14A 4RB1A 1CAXB 1P4AA 4PIXA 2YX7A 3F8NA 3DF8A 4HF0A 3PVBB 3U2RA 2KIMA 3UKNA 2P5VA 1OKRA 5HS9A 4KNYA 3MZYA 1NXMA 1YIOA 3F23A 2UXXA 1OYIA 4KYWA 2EAAA 1D3YA 4A5NA 4EM0B 2XLGA 1QXJA 1J75A 3FJSA 5JI6A 2ZNZA 2KRFA 4LG0A 1HW2A 1UCRA 5T3NA 2MNGA 4M9SA 2MHFA 1IN5A 1I1GA 1NE6A 4XSZF 4Q0VA 1YG2A 1Z91A 2XKPA 3KSCA 1K78A 2W24A 1PUEE 2DLLA 4M6YA 4P5OA 5K5RA 4HBLA 5DD8A 4NVPA 3EYIA 2QWWA 3K2ZA 1IXSB 1YQAA 4WCGA 4ESFA 5AIQA 1KU9A 1U12A 5ILVA 2PI0A 2QVSB 2YX4A 1ULYA 3C18A 1HSTA 3EYYA 1FBQA 4RB2C 2GC0A 5I8SA 4IEYA 1KGSA 2K27A 1TQMA 5HDGA 2A6HF 3MWMA 2QZ8A 1TW2A 3S2WA 1HBXG 1E17A 4F8AA 4I09A 1UIJA 5I0TA 2DFIA 3J80Z 2ZCWA 2G9WA 2VOOA
chains in the Genus database with same CATH superfamily
2DWRA 4AGGA 1QU0A 4G4FA 2R7FA 4CP1A 2K86A 1MBHA 3KP5A 1PVEA 4GAZA 3WGIA 1OC1A 5F5IA 4G12A 4AOCA 1XD7A 2DAOA 3ASIA 5E3OA 3P6BA 1IZ1A 3L1PA 2J5PA 2Z99A 5CKNA 1UF2C 2LROA 5TJJA 3EHKA 2RV8A 2GNMA 2XH6A 5LFAA 4AVCA 5C5TA 1IS5A 1SLLA 4I7HA 2CUJA 1QJU2 1QGPA 5C3PA 3VPRA 4IQPA 5D4SA 4DNCA 2B9UA 2HEOA 3H5AA 3CQOA 2X0LA 4A69C 5K7PA 2VOVA 5J1XA 4DW6A 4P14A 3U07A 3HQRA 4GMP3 3PNAA 3VZOA 2M9HA 3BUCA 1AWCA 5K0UC 2K9SA 4G6QA 2XF5A 3KCYA 2I8DA 3OSDA 1DQ6A 4IEWA 3OY8B 1S8NA 2DA2A 3CF6E 1R1A3 5DDGA 2OPTA 1OA3A 4AEMA 1ND2B 3ZX7A 1UZCA 1OH4A 2W46A 4KT6A 2E1OA 1EJ9A 2VQHA 2HKOA 5AC93 3T2QA 4CDUA 1UCXA 2Q8OA 4X8NA 5CZKA 1X1AA 2D1VA 4COVA 5F7UA 2UY9A 4N43C 4LBOA 2ZABA 4N7UA 5EWSA 3SXWA 3OD0A 2JKBA 4GH4C 3AZZA 4XXPA 1D0HA 2RVAA 2A69F 2WFF1 4AFBA 2QQUA 4IE0A 2P5KA 1DGWX 5H6RA 5K0UB 4WM7A 1B35C 2WB1A 2QE3A 1JOPA 1RKWA 1OFSA 3LSMA 4ZJZA 3PUSA 5A6QA 3KX2A 1ZBA3 4UAPA 3PIJA 1ZYRF 5FKMA 2ZEWA 1AR62 1D0GA 2W25A 1DU0A 1XGMA 4EM2A 5LEKA 3CMAI 2GDFA 4L9JA 4E4ZA 3EUHC 4IERA 2RJLA 3T1BA 3SH4A 2BJSA 5CLSA 1S0FA 3VOEA 2HWVA 2HYXA 3J4UH 1C5HA 3A0HC 3DP7A 1NHAA 3BROA 2OAZA 1C0WA 1JU4A 4HRIA 5D5WB 1QZZA 4MHRA 3WG1A 3GZUC 1GMMA 2Z3YA 1X1DA 1S72I 2Y6JA 1OQ1A 1J1LA 3BTXA 4EWEA 2NQYA 1PYVA 4NJ4A 4GH4B 3O1RA 3LOIA 3MEPA 2FXAA 4HN1A 1GHCA 2BY3A 1C3HA 4ZDPA 3F6VA 4JGYA 4DBRA 1Q56A 1B35B 1W6PA 3K4JA 2M8EA 3EJKA 3KMHA 4RAYA 2H8WA 1OH3A 3S1MJ 2XMLA 2QYOA 4N4OB 1AXKA 6PAXA 2BUKA 5D5XB 1IGNA 3PFYA 2E51A 1R082 1LECA 3R4DB 5FOJB 1F2NA 1RUF2 1RZ4A 1DQ4A 4ES9A 2JD9A 4V19K 4Q2FA 1AJOA 2AXTC 2H6CA 3ETQA 3VKMA 1ETXA 2QQWA 1DGLA 1TMF1 3U14A 5BNOA 5A7WB 3I3QA 3CCVI 3D5SC 1W36D 4UI9L 3RJPA 3MFCA 5JLWA 3SDBA 4E7SA 2AO9A 5FPVA 2B7EA 4V1PA 4EGZA 3L2RA 2WNVA 2ZHKA 1AYM3 5CQEA 2X48A 4K9SA 1POGA 3VEPA 2FCVA 3AK0A 3V4GA 3KS7A 4LLFA 2P37A 2KRCA 4EN6B 2W82A 3LIHA 1SFXA 4YM1A 1R093 3FISA 1PMJX 2A3YA 3RIRA 5HS7A 2WA4A 1VBB3 2QUFA 2R0QC 3GCWA 1WD3A 2MGQA 2VODA 2JWPA 1AZDA 1H6YA 1GBGA 5C9AB 1RC6A 2I07B 2GA2A 3E6DA 5EZWA 2ADUA 3BQZA 1W2NA 1BYHA 1W0OA 1UAAA 1BCXA 2DYRH 2QF7A 2XV4S 4YFNF 3CNAA 3HRUA 3CCSI 5FKBA 5A80A 1W6OB 3LKJA 2XUBA 2QNKA 2FOKA 3E5QA 1PUFB 2E7XA 5FRAA 2ZGKA 1RXGA 5FZOA 2WAFA 1RYYA 1IN8A 4B8XA 2BNMA 4W1UA 3UT0A 1I6XA 1M1EB 2HLEA 2RNJA 3RZJA 1IUYA 1RMU3 4O3MA 1VBD3 3K4KA 2GZWA 4FTBA 3A0BC 5FO5A 4QB1A 2HWC2 4BBSJ 1DZTA 3LEGA 5CFCA 3C7GA 4AGRA 4B7KA 3A01B 1Y39A 2XAHA 1W05A 3KEQA 4B4CA 2ZGMA 2O0YA 1TWGJ 4P9FA 3S3OA 3VGIA 4LUMA 4Q5OA 1MBFA 2VKVA 2DJNA 4DXTA 2VUAA 3VN4A 3ZKYA 2HYJA 4B48A 4PF1A 3P1IA 4J1WA 3VB9A 5JHUA 3KV4A 1XGNA 3C3WA 3FM5A 4A3BJ 1RUH2 1H89C 2VZQA 3GALA 4JKKA 3FKJA 2ZMEC 3DEUA 4RAZA 1IN6A 3F8FA 5FZGA 4G7OF 3Q3SA 2X10A 4NN0A 1RUD2 1W2UA 2L9SA 5IP9J 3CZ6A 2WADA 4AFDA 4CU7A 4EROA 5FZ4A 2QZ3A 3USUB 3MKYB 2V79A 2LBFA 3KZYA 2JG9C 3RSNA 3WF0A 2HVQA 1N77A 5JZGA 2FDJA 4Q8KA 1VI0A 2LC2A 3KT4A 2CG4A 5F2SA 5BYNA 5FPUA 4D7NA 2TBVA 4XOPA 3T8TA 4ASMB 1UKGA 2VNRA 4JZRA 4XUPA 3H9AA 5FZMA 1V9U1 4RGUA 5BV6A 2BQPA 2OT7A 2PFBA 3VYSB 4FXGB 5B4NA 2LG4A 4M3BA 1YHQI 4XBLA 4ZZDA 1QOOA 1LVAA 1WSUA 5A33A 5FZ0A 2FBHA 3MIFA 1KYWA 2AUYA 5A7OA 4LKDA 2RS31 1SVMA 3CJIA 1WWXA 5HCBA 1APLC 2R7OA 1WCSA 2VO5A 2MYSA 1QJY2 2Z42A 1EP0A 2JN6A 2HQNA 4CXFA 3ZO0B 2XGXA 4JQTA 1AL21 2L9LA 2JG9B 1UN1A 1B09A 1R36A 1W9FA 5E88A 4LBQB 5J09A 2OU2A 4L9TA 1MMAA 2AENA 3S1RJ 2MLGA 1GWLA 3KWVA 4XRSA 4RYDA 3GYHX 1F15A 3H8OA 2CO5A 2DBBA 1CZSA 4Y1XA 1EUUA 5A7SA 4P9XA 5A1AA 5J4VA 2QDNA 2GNDA 4YGEA 3UJQA 1VJ2A 4FASD 4KA4A 1T6GC 5I91A 2VXJA 4D7SA 1K4SA 2DCEA 3E0JB 2A3XA 1MNMC 3IRQA 1W6MA 4I99C 4B44A 3DLLF 2XAFA 1RXFA 1TME2 4YNIA 2ENRA 1O3RA 2R16A 5HS8A 4KJZA 2VMIA 1SHWB 2ZHMA 1O59A 2ZHLA 2B4KA 1T6SA 5IVYA 1VQ7I 3K70D 4BB3A 1Y8RB 4IESA 2EXKA 2W84A 5ABJA 4P00B 4CVUA 3ZMSA 1ZVFA 2OX0A 5LCWL 2GSYA 1AR91 4BA6A 1O4XA 1OKOA 3TEYA 1X3ZB 4BJ5C 1VF9A 3CUQC 4NUBA 4DO0A 1R00A 4YVSB 4XKBA 2ZXIA 3BZKA 4FETA 2JK3A 2MD0A 5EEGA 4EJWA 5ACA2 1BJZA 2XROA 1IXRC 1OLMA 4L0ZB 3JRGA 4BMEA 4KISA 1H2LA 2ZJ2A 1POQA 3JR9A 2ZBJA 4BHCA 1IJWC 4G8XA 3IZOA 5DDJ3 5FP7A 1QHDA 2ELJA 4OI0A 4NC6A 3TN92 3LEMA 3KP4A 4QGLA 3OIOA 3HOWJ 2IFRA 4XM3A 1PM4A 5A1FA 5FRNA 2A6XA 2RMU2 2VH9A 3POIA 3HN3A 3EB7A 4UFJA 5IATA 3DPRA 4JCKA 2FNPA 1IPSA 4FAHA 4QAWA 4MOAA 1F9NA 2PMZN 1N78A 2VJ4A 3H3UA 5D5UB 2ECCA 2A3WA 4CO8A 2HZTA 2OUMA 4DYCA 3BQYA 2FOWA 1R7JA 3HHGA 4IEQA 2IVIB 3VKNA 4FHTA 4YW5A 5F04A 4EJOA 2EIBA 5E1ZB 5FKKA 1CX4A 1WZ2A 3FE5A 2ZX2A 4XFBA 4AI2A 3OEBA 1CGPA 4OFGA 2HKXA 4QU2A 1I5PA 3L9FA 3E97A 3E6BA 1VRH3 3M3IA 4XC9A 3AB0A 2QGUA 1LOFA 2ZGOA 1BHGA 1ZBE2 5FZHA 2A5WA 2JVGA 3BPVA 3D5LA 4ESBA 4XAAA 2ZTNA 4R79A 5FV3A 4Q5SF 3ZKUA 4DQAA 2XPWA 3LZZA 5E1RA 1MPXA 3JBG2 3RSJA 3ZMVA 3F2ZA 2G1MA 4XRFA 1N1VA 5IVFA 3NNLA 1WJDA 1X36A 3BR3A 4PDWB 2WC2A 5IPAA 1LOAA 2PELA 2F4OB 1V6KA 2A6WA 2GWRA 4R9CA 2AYHA 5BPDA 4K1YA 4AL9A 4OIRF 3IB3A 3G7DA 5JIUA 3ZYPA 3IPVA 1GUIA 3SMHA 3OYJA 2YXSA 2V9KA 1WVRA 1ZTRA 4NHKA 1HQWA 1OYWA 2FF4A 1X7NA 5FREA 4E2QA 3WY6A 5F6LB 2VKDA 4IPAA 2ZO4A 3KHCA 1YFHA 2P3JA 3QPLA 1D4M2 5IT3A 5EG0B 5CYYA 1EV12 2OZUA 4WZCA 2DOAA 4P5HA 2R073 4Y1YA 1NE4A 3HXLA 3TW7A 1MMDA 1WMXA 2K9ZA 3I4IA 5FMDA 2J1UA 4O9GA 3I4PA 5T5JA 1CQTA 3BG6A 1IKQA 1ZA7A 1XXNA 2IEKA 3ECQA 1S7OA 1FPN3 4RR3C 1MBJA 3VKOA 1FMWA 3I7DA 3LWFA 4LA3A 2Q0OA 3JTGA 2VPVA 5E20A 1K6YA 4LEJA 3WTYC 1BXHA 5FYHA 1XC6A 2L9NA 1BC8C 4RS5C 1FV3A 5FIXA 4OI2A 4I2OA 5HCHA 4ZS3A 1I6HJ 2M3AA 5FLVA 1N3PA 3PO3J 2BERA 4I30A 5FTTC 2YS9A 3S5AA 2CJJA 2R7UA 2R043 5ANNA 2PG4A 5F0HA 1ON2A 1FXZA 2FEZA 3GLXA 3LA2A 3FFZA 3AYAA 1MD0A 1GOFA 2ZSIB 3NMBA 2OCCH 2V6EA 2IA1A 2X9DA 4RR3B 2X1CA 1COV2 4ZHNA 3ZFGB 2ID4A 2VZ1A 5FZIA 3ZQ7A 1XSQA 1RUJ3 1H9PA 1BLZA 2E2JJ 4I0BA 1W0UA 2WZR3 4C3HJ 4LITA 4L99A 3N9PA 2MA3A 2QTWB 4WVZA 1VAMA 4OINF 3H1YA 2DF7A 1JOJA 4RS5B 4OI1A 2EXHA 1X2NA 5GAGJ 3VLBB 3M9AA 2W9XA 1CPMA 1CN1A 1L7QA 3FXUA 4WF2A 2HDWA 3WF4A 1WBLA 2GQQA 1H0MA 2F17A 2YG0A 5FPZA 2P4EA 2JENA 3O1OA 3OY8A 3CESA 1JT0A 2MW8A 5FAXA 1N75A 1Z9CA 1TZLA 1BI1A 5E3MA 2QBYA 4NB5A 2ZX1A 3X29B 1QMJA 1FOD3 2O9LA 5IK8A 2XDVA 2UYAA 3O1PA 4KN7X 5FY8A 2HQRA 4X8PA 1WJCA 3R6SA 3H1MA 1YFYA 3KCXA 2AH2A 2P3IA 5FMBA 3JREA 1WA4A 3U1KA 4ONUA 4CP9B 4HZFA 5LA1A 4A3ZA 1W9SA 1REFA 2CUEA 1FNNA 1UU6A 2WO2A 1SFOJ 1STZA 1TW3A 1UO9A 4NHXA 1LDJA 4LQRA 5K0UA 4M72A 2JDYA 2IGOA 3OGGA 3GM8A 2UZKA 3V7RA 5LY2A 1LU1A 2YROA 3MIGA 2JJ6A 2O3FA 5BNPC 1QQIA 3MPPG 2D3SA 2R7DA 1MW7A 2Y38A 4NR1A 4NPMA 4XILA 2PJPA 5FO7B 3OYLA 1RR8C 2VZPA 3HRTA 3NJYA 1YQ8A 1XBFA 4P08A 1Q3EA 1MNDA 5DCFA 2F6CA 3SZPA 3HYIA 3ZRGA 3A21A 4N43A 2VBYA 1UZWA 1VBC2 2VJIA 3HRSA 2AZ5A 3PL8A 2P6SA 4GH4A 4HN0A 3VBUA 1H8TB 4GRIA 5JMCA 4XLEA 1GXPA 4PF5A 2EJRA 2HBUA 2DCZA 4FOWA 2VC1A 3UGGA 4W8JA 2FU4A 3AFKA 4IHTA 1B35A 2VVDA 3QACA 4H3WA 4UVBA 2E7AA 1DG6A 1F5JA 1CAUB 1IV8A 4BWOA 2EZIA 1UJ8A 3PHMA 5BNPB 5EDNA 3OCPA 5FZAA 3AG1H 3I56I 4M6VA 4S0HB 4V2FA 2JKXA 3EUHA 4RFT0 2IT0A 1Z78A 2WAOA 3B9CA 2KFDA 1S0GA 2JICA 4Z2AA 4YFXF 1NCQC 2PHRA 1B4AA 2IXSA 5TRDA 4P96A 2I10A 3SHRA 4Q4Y1 4HDVA 4KGQA 1HDDC 5E8IA 3S2DJ 3LAJA 1AA7A 4BXFA 4IKFA 1BL0A 2V9VA 2ZMNA 4RD7A 5A7WA 2Y9YA 3CP2A 2WFF2 3E3VA 2HWD2 1H1AA 1J3QA 3ETPA 2IJLA 1YC61 3VL9A 5HLHA 2XPUA 1QKQA 3F3XA 2LYCA 2NNNA 2E33A 4SBVA 2P7VB 2K85A 1G2HA 3LSDA 2FUG2 3J26N 5CBLA 1J5YA 5KAIC 1JHNA 4JTNA 2OYZA 4AFAA 1U3EM 3L2VA 4NAOA 1LQ1A 4K1ZA 3RZLA 1V0AA 3RG0A 1BW6A 4N7IA 4MGRA 3NJXA 4UW6A 3J7LA 1NCQB 5J96B 1ENXA 1G6NA 1NG6A 4BQ1A 2EK5A 2IGMA 5HVQC 4IQ4A 5IVVA 1ODMA 1ETYA 4BUPA 2XJRA 5J47A 5ANQA 1RKTA 4GALA 1NZIA 4XLAA 2O03A 3MLLA 4XJ9A 4IGOA 3CF2A 4UHTA 3FIWA 3AXDA 4RB0A 1QBJA 4PI0A 2O61A 4UUSB 2XOMA 2R1DA 5C8WA 3TNPB 1JTYA 1PUFA 1E5RA 2A05A 5FUPA 3RZKA 2WKKA 1DGWA 2F5VA 5IK5A 2P1BA 2KQRA 4LHSA 1TQPA 1TMF2 4KU8A 2D40A 3LEIA 3U11A 2EA2A 3BCBA 3DGTA 3WCSA 3OYFA 3AMPA 2JB4A 1B9NA 5FYTA 4ZXEA 3OMYA 4IE6A 2P6TA 1ASJ1 3K77A 5FY4A 1C8M1 2HTJA 1JKQC 3JD72 1V3FA 2JE9A 4C1WA 4Q29A 1WCDJ 4PBOA 1RUE2 3HJEA 4AQ2A 1MMGA 1I50J 2R063 2PMHA 5FD5A 2IGNA 3BG3A 4PI2A 4Q4W2 1UMZA 2QQ8A 2ZEYA 3LFIA 1OVSA 2XAJA 2AACA 2VKEA 4KWJA 3W6KB 3U21A 5FDBA 1ZX5A 3OYIA 3HPNA 1QZEA 3ZN0A 4U7DA 1RUG1 4KBZA 3KEYA 3LNQA 4PJYA 1LJ7A 5F9TA 2VBDA 1XDUA 1DQUA 3FXLA 3DPLC 4LTAA 4QPGC 1XS9A 4Z2WA 3IMMA 2ILMA 3QP5A 4QM8A 3CJRB 1W8HA 2R5ZB 3USUA 2B7YA 3TO9A 3RFRA 1ULPA 4KQ7A 5E3LA 1GP5A 4ZU4A 2HPIA 5L3CA 3GFJA 4MH0E 2YU1A 2HWE1 2KISA 3PVNA 2QQMA 5BUVA 3CJXA 4CCOA 1XPWA 4JAAA 1WW6A 5E79C 1OD5A 1KITA 5FYUA 1HRV3 2XF6A 2RDQA 1WA6X 4MLOA 4UXAA 3VD4A 1HXS3 2BTVC 3VWBA 2V4VA 2DA4A 2XLFA 1PIV1 1K6OA 2ZMEA 5FRMA 3CEWA 5FZ9A 4D1QA 1GWMA 2D6NA 3PSFA 4NWWA 3ITQA 3R0RA 5JI7A 4HLTA 2K4JA 5F5QA 2VNGA 2IVMA 4KWLA 2J42A 5EF6A 4XUOA 1ZELA 2LY1A 2A6EF 3A1YA 1JKPC 1YHFA 3WQ0A 4PLOA 2VZTA 3LSKA 1IO2A 2JIGA 4IEVA 1J0RA 1HV0A 3S15J 3SEPA 4UFMA 4LBQA 3LMMA 1DGWY 2Z5UA 1HIXA 4PUSA 2V1DA 1K83J 2VMCA 1MSFC 2V26A 3K48A 1BI3A 5FWJA 4FPLA 1QPIA 4Z82A 2GMMA 1W7PD 1UOJA 3K0LA 2RR11 3WUDA 4CZCA 2KJBA 3K46A 2Z69A 2ORZA 1D2QA 2WS92 1QXPA 1ZQ3P 4IETA 1BMV1 2DT6A 4ABZA 4BE2A 1IUFA 2EIDA 3SZGA 3SNMA 1OT5A 4QQHA 1H9GA 5JPMB 3F72A 2IXCA 4AQ6A 1YE9A 5JSPA 1YTYA 3L2YA 3JAMK 4OWRB 3RYKA 5BOXA 4QKFA 5GP9A 3UKGA 2CY6A 4B3XA 5GPAA 1VQ5I 5K5OA 4MFDA 1V9U2 2O0OA 4ATFA 1H4GA 5LGUA 1OQDA 1F5TA 4XABA 1DGRN 3K70C 3A4CA 3TEZA 1A78A 1ITYA 3WDVA 4CA0A 3GHNA 4JBAA 3QH7A 2VG9A 2GOMA 3WP6A 2RS32 3ABLH 2CS3A 3BOQA 5KHGA 2CUZA 3NV4A 5FMCA 1IGOA 1AL22 3CCJI 2B8MA 4RM3A 1FP2A 4CCMA 5TISC 3GNEA 2NVXJ 1BR1A 3PNYA 3L2QA 5L7OB 4AUXA 4TLFA 3ZSEA 4N9IA 5FYBA 4A7KA 4XJWA 3ECHA 3M3YJ 3BJ6A 4DXRA 2ELHA 2YY1A 3MFKA 1G59A 3OYWA 2MD5A 3MLKA 4IHYA 1I3QJ 3O3KA 2MC4A 4D0PA 4BQQA 3NKGA 5IFPA 3VYTB 1XSXA 1IN7A 2VXZA 1SEUA 1W8TA 1WW4A 1JI6A 2VULA 3CUQA 5G05L 1XC5A 3IH4A 1SCRA 3T2PA 2EZHA 5F1JA 3WDTA 4ZU7A 1YUDA 3RKYA 3AKPA 1X33A 3VBSA 3HHHA 3U4SA 2NS8A 3R61A 1JXNA 2WO1A 4P1WA 4UB6C 3H42B 1WMEA 2KPMA 1YJWI 2Y30A 4P5YA 2COMA 2EA4A 3CDZB 3TYJA 3QLQA 5JR7B 5IOZA 4A41A 4GB31 1ENQA 3MLJA 4XHXA 4M3CB 2KT0A 2DMTA 1N25A 2IW5A 4XYXA 1A8MA 2WNEA 2E36A 2MBFA 1R49A 3TRSB 5KC6A 3S1QJ 2C24A 2R93J 4Q0SA 1UG0A 4MO3M 5CADA 2HR3A 1UOGA 3EXUA 4IE4A 4MQVA 4ZS2A 3BGAA 3RZGA 3NAPA 4M4RA 1SANA 1XJAA 1JHJA 2IXKA 2XRNA 2F6BA 4UUVA 1VPHA 2VB6A 2UU8A 2RN7A 3SEEA 1V6MA 1WLTA 2BWAA 4XKCA 1RUOA 3VBFB 5EJZB 4M9XA 2ZKLA 4ZKTB 2PEXA 3O14A 4YW4A 2K46A 2YX7A 3VYRB 3PVBB 3U2RA 3MZYA 1YIOA 3F23A 2UXXA 4XL9A 3WHBA 4LO6B 2EAAA 4A5NA 2I5UA 3M1HA 4LORA 3SKVA 1NG0A 5DZGA 4CP0A 4TSVA 2NM1A 5T3NA 3BTLA 2LUWA 3ENRA 5GZGA 3RWKX 1XNCA 5EG0A 1IN5A 1I1GA 4Q0VA 1YG2A 5SV8A 4RMNA 3B7MA 4F3QA 5DN2A 2XB6C 3SEQA 4M6YA 2DFCA 3O1TA 5DD8A 3EYIA 2DBIA 3BOWA 3RQIA 3WDUA 4P9JA 2BRTA 5HNFA 2HI3A 2PI0A 5FXWA 1ULYA 4C90A 2Y31A 2OW4A 1TG7A 4QX2A 4AAXA 4QT6A 1UYPA 3FHQA 2A6HF 4GDFA 4LBNA 1XU2A 3BTIA 2LVSA 1X1CA 2J22A 3W6VA 1U5XA 1DQ5A 3GX4X 5E6HA 2PLV3 2OZJA 4Q4X3 3NV1A 1MS8A 2D2WA 1FMD1 3POJA 3LSPA 4L97A 3UYJA 4IGPA 1HX6A 3RMXA 2UXNA 3AVSA 2FRHA 3RGBA 2CQNA 3ZXGA 4COWA 1PNFA 3GZAA 2ORXA 3V0AA 3RKWA 1K5MC 3VBOC 1YJKA 1BEV1 5I8YA 1T08B 2IXHA 3H0DA 1SVOA 4IF4A 1LFPA 2JDZA 1QQP2 5E1WA 4KNCA 1RI7A 5IYBJ 1I3HA 4GJZA 2K9LA 5J36A 3OYGA 2E60A 4DXZA 4COZA 2HXIA 4ZYAA 4XDQA 3DKXA 1O3QA 1ZH5A 2QFEA 1B8IA 5HV4A 4ET7A 3BTYA 3OB8A 5LATA 2E1MB 3OS0A 4OAYA 5FK8A 4QKDA 1Y9GA 5J1UA 2Y6KA 1QU3A 5HLGA 2JDAA 1PMHX 4FAGA 2TDXA 5ICEA 2EVXA 4DOZA 3SH3A 1K5MB 4AYBN 1VE0A 1QGLA 2W00A 2O6GE 3OG2A 2DO7A 3NV2A 4J25A 2OQRA 2JA7J 2DXIA 3TEXA 1W0TA 1O57A 4JV4A 2VT2A 2ZA9A 1FWZA 4HK8A 1I1EA 1UZZA 3HNBM 3WT3A 3WHTA 2D5HA 2R7SA 2NYYA 2XHNA 1GOHA 3JTHA 3GVAA 1ALYA 3AL5A 4XFHA 3QD6A 4G7ZF 2CDOA 2QSFX 1PP7U 3K1PA 5BNNC 1D1AA 2UUZA 3NWKA 1Y43B 2R7WA 1YCIA 2HWB3 4OIQF 1IHMA 5LRSA 3FFQA 5FKCA 4RAGA 4Y4RA 4IV1C 1RHI3 4YRDA 5D8AC 4NWVA 3ZXJA 3I53A 2L9RA 2ZGPA 3ZXEA 1XN7A 2DVAA 1X1PA 3CL1A 3C2BA 3DFGA 3F6OA 2MEV3 5DMYA 4UW3A 2YSRA 3LPGA 2E32A 5F5AA 1QZYA 4RHV1 5BY5A 5FKOA 1DGRA 1GU3A 1UKRA 5D2AA 5GPCA 3BCAA 3U4XA 5E89A 4I76A 5FZ3A 3DKQA 4EWAA 1NCRC 1UY3A 4YWAA 2YGLA 3UV9A 4LLGF 5L3GA 4FT8A 2KD7A 4XIDA 2YGMA 5BNNB 4QXKA 2X6WA 3M4FA 1JGGA 4GKXA 2QUOA 4O9EA 2FD8A 5BNPA 4ASLA 1PK6C 5D8AB 3WXPA 2WT0A 1HQNA 5FUNA 1V00A 1W99A 3KGZA 4XURA 2XVGA 5KBFA 1IRGA 2QQAA 1MZ5A 2AXLA 4ZC3A 1R1A2 4EATA 4YG3A 3SJMA 1JYTA 2ZHNA 3I97A 4JQFA 5DS9A 2YBSA 4XETA 4NDLA 5IT9Z 3I2FA 2X29A 3GXOA 3WTVC 3FXRA 1UX6A 3ULQB 1V5EA 4Z2YA 1IRFA 3J8F1 5FKNA 1U5TC 5FXVA 2FDFA 1NCRB 1YW7A 5FXXA 3W2AA 1KQ8A 1VQMI 3ML6A 2OIIA 4RA0A 3DECA 1IW7F 2VBBA 4XLHA 4MV2A 3PU8A 3GEZA 1V6LA 3PSIA 1PVXA 4KITB 1YJLA 4PK4A 1PK6B 2WAEA 3LIGA 3OUHA 4CYCA 3OWTA 4JRAA 2KLOA 2Y2ZA 3QPSA 2OPWA 4FE4A 4NRPA 1J84A 4BQXA 4XEZA 2DN0A 4C8DA 1YI9A 4P9WA 4PFPA 2NRAC 2VCCA 2RV9A 2AEZA 1B1BA 1C4RA 3T09A 2W47A 1RVF3 2JTVA 2FJ1A 1NZCA 1DP3A 4BK4A 5M3MJ 4CCEA 4I3PA 2OUJA 4FI9A 1KU3A 1RB8G 1RIRA 1AR73 2Y0IA 1ODDA 2MABA 3QU3A 3T4VA 4U7BA 4QMAA 5DABA 4E7KA 4U0VA 2LLKA 2B46X 4Q0PA 5KXDA 4Q4V1 5FLMJ 4UUSA 4UW5A 4COUA 5GZEA 1X4OA 4FBFA 4NROA 3IWFA 1VRBA 1Z7UA 4MUVA 5CA6A 1PVC3 1QJX3 3PUBA 4BQOA 3FK6A 2BY0A 5FPXA 2NYXA 3CBNA 4ZTFA 3PMSA 4FFFA 3IUOA 5C3RA 1JW6A 3A2KA 1Y4WA 5FYIA 5GLZA 2XASA 3CMEI 4YW6A 4HA8A 2EIKH 5JVGF 1W3VA 1R6RA 3D5RC 3WQ7A 3ZPLA 1YXWA 2IZWA 1EA3A 3AMQA 1DU6A 3WE2A 4G9SB 2R3SA 2HPMA 2OBPA 3DYMA 1V6JA 4GWJA 4RFRB 1LVKA 2GN7A 1LB2A 3QODA 5A7PA 1UPSA 2GM4A 2E5NA 3PL0A 3H8RA 5JUVA 4DPNA 3M07A 3P3NA 1RUF1 1ZA4A 3GTQJ 1SDWA 4K3UA 2ZGNA 4Z1VA 3WW4A 1IPKA 3K2OA 4JKMA 4W65A 5DCMB 5DUIA 2A71A 5CU1A 3LWCA 3B94A 3O8HA 3PIOF 2RDPA 4IUGA 5GZFA 4HSRA 3U1DA 5CVRA 2FMLA 5ISLA 2V1NA 1LPQA 2FDGA 2WA3A 1D8KA 2PHTA 4O6JA 2VLAA 1DLCA 2KJCA 3GYDA 3NAUA 3IHUA 1BJAA 1YI2I 1I5ZA 3HG9A 5DXDA 3TBDA 4C0HA 1LUJB 2A5YB 1ZG1A 1DPRA 5EYYA 3ACLA 2CW0F 3W21A 3I3LA 1WGXA 1WMFA 5KHJA 1VBB2 2A07F 3UGHA 1XNAA 4HF2A 3CHXA 2R5ZA 1S55A 2Z5WA 3OJBA 1R1UA 1PHMA 2VCBA 3AG4H 1CJPA 4NRQA 3HT1A 1LOEA 4LLLA 3RMYA 1JTXA 2CAVA 2GALA 5CKQA 1NAEA 1QJU3 4OMDA 4NHYA 4XLPF 3WE3A 3I4NJ 4LHLA 4QDRA 2J1VA 1MNEA 4WXDA 4AIHA 3HUGA 4AG4A 2WINB 4D3WA 4JGZC 4C30A 3W9AA 4MX3A 5A6ZA 3J80K 3KQ4B 3X2QH 3M8FA 2G0EA 3GDBA 4E7ZA 3LAGA 2M5WA 3AKZA 2R32A 1U9NA 1HQCA 3BTCA 1SMTA 4QPGA 3TEWA 3CC4I 4I01A 4UV9A 1YRNB 4QQOA 2LDUA 3GLLA 5F3IA 2VTFA 4HNVA 1F4HA 2YC0A 1MMSA 1REPC 2PN6A 1YRZA 4LBMA 1DCSA 2BW3A 3S2HJ 2V6CA 3ATGA 2BEOA 3CCLI 5KK1A 4CRQA 3C2GA 2PJRB 2JA5J 3VBHC 2IA2A 2XJUA 1X3UA 1VBA3 4YIIA 2HWC1 3RQ0A 2EV0A 2XJSA 3E7LA 2WUHA 2CSGA 1MS3A 2EFPA 1QVTA 2QQ9A 1MJ9A 4BAYA 1A3KA 2IA0A 3POBA 1YQ2A 1Z1DA 5EGOB 2LNBA 2GBYA 1DHKB 2O8XA 2LMDA 1IKPA 1XPXA 1OF4A 2RS13 3W5MA 5L3FA 4BQAA 1I27A 2HWE2 3T0YA 2WY7Q 1AR63 2XR4A 5FR3A 3RWNA 1VQ8I 2ZACA 3HOBA 3AP5A 2GC2A 5HBAA 1RUH1 3G1OA 3LDRA 1UY4A 3ZYRA 1E0EA 4YFWA 1QNTA 5FUIA 3MDPA 2Y69H 3N9NA 2VIXA 3QCWA 2BYVE 1PIV2 3VBHB 1E5HA 1VQLI 1RUD1 4LULA 2LY9A 2V73A 1GUUA 2EFQA 3V7SA 2YHJA 2YPDA 2L9VA 1ZZCA 5DAWA 2KIQA 5DUWA 1HB2A 4PSXA 1NK3P 1TC3C 1O8PA 1T38A 4HPQA 3CLQA 3J7HA 1JZ6A 2VXRA 2FZ2A 4LKEA 3VDDC 1R1ZA 4BDYA 4QDSA 4S04A 4CEWC 5KHHA 1LNWA 3ALQA 3DWLE 3OYKA 4EJTA 2W91A 1CAVA 1IS6A 1W9WA 4KMFA 2QQJA 1R083 3PJRA 3POGA 5D1IA 3AMMA 3LSHA 1ZZ7A 3BYWA 3K75B 2JSPA 2VOWA 4I98B 4Q48A 2YMZA 1IC8A 5E1XA 3M70A 1JGSA 3SCHA 1AHDP 4W4ZA 3G71I 1OHFA 3FMSA 4V2GA 5IHRA 1SLBA 3TDZC 3WHUA 2VBWA 1ZREA 3I71A 3C7JA 2WNOA 4CTEA 3GTJJ 3AFGA 4XF4A 1LEDA 4IJAA 3HBZA 3VDDB 4Q8LA 3RVHA 5L19A 2O8QA 5FB2A 2Q2EB 5JFRA 2IXJA 3USSA 3OYDA 3OIQA 2Y0SN 3H0GJ 1GV5A 3LA3A 4QIWN 1OXCA 1TZOA 2LF7A 4AVVA 2XAQA 2K40A 2FA5A 4RGXA 1TL8A 3ZOBA 2DCKA 1TWAJ 3M8JA 5FLXK 1Q5OA 4FPOB 2DCYA 1P6RA 2P7CB 1HB3A 4ENMA 3DCQA 4M3CA 4RB3C 5FZEA 1HXDA 2M30A 3BU0A 4OHWA 4A12A 4A6DA 3N7KA 1Y0NA 4Z92B 2KDOA 1TME1 4O65A 2ZXQA 2OS2A 3U10A 1LHUA 2RDSA 2FBIA 4BU2A 4XZPA 1EKEA 4ZTJA 1W4MA 1PNGA 2E19A 1ULFA 3FC0A 2AR6A 1JJ8C 1D5VA 2ZJQF 1LULA 1YYNA 3BI3A 2V5YA 3SLIA 2HS5A 3K4LA 3H9GA 2JDHA 3WU1B 5EJCA 3VDCA 3F95A 3RJ2X 5BMZA 3AZWA 2VZOA 1KEXA 2DMUA 4JOMA 3AP7A 4XBFA 2EXJA 3JZVA 5KC5A 5C6CA 1ZZ8A 2E35A 3EUKL 5AFEA 3DBRB 1TE1B 2PLYA 4L0YB 1AYN3 3AP6A 1PGL2 4ASNA 2DK5A 2KZVA 3VODA 4RGAA 4QHOA 4LG0B 1UZYA 5HLIA 1MBKA 3T4HB 3K69A 4BGDA 4R4ZA 4YM3A 5EEHA 4XICA 5HI0A 2Y64A 2LF8A 3I54A 4Y22B 3KCCA 2Q0AA 2YU9J 1UYYA 1XNBA 4W50A 2ZFUA 3HEFA 4XDOA 1U8BA 2ZB9A 2EQRA 3M8EA 3ACGA 2QCSB 4E4SA 3SQOA 1K78B 1E2XA 3WD5A 3H50A 4OMCA 2WL1A 1FX5A 3T0BA 4WVMA 5FQ0A 1OFCX 3VHRA 3TN91 4D5FA 2N8GA 2VOXA 1QOTA 4GWMA 4LMYA 4KFCA 4PJMA 2WLQA 3WF3A 5H2FC 4JVAA 4EWDA 3HJRA 4A0YA 5DAQA 4GB32 2EH3A 4M73A 2MPFA 1VRH2 3R05A 4Y26A 1R4MB 3M3CA 2WB1N 1SFEA 3WUCA 4JK1X 3RZDJ 4IGQA 2QLZA 4AVAA 3AC0A 2DMNA 3E1SA 2WV0A 5EQUA 2OC6A 5IT6A 2CQXA 2MFZA 3MKWB 2ZGRA 3V42A 2VZRA 1XX5A 1REEA 5JLXA 3WTXC 4R8HA 3VD3A 3GFIA 2B9SA 4U0WA 3SFIA 3I2DA 3K4BA 2DW4A 4HSLA 2LKSA 1R64A 4K7JA 2AEYA 2WABA 4M3GA 3ZGKA 2DT5A 1W2OA 3OEAA 1KS5A 4K6BA 1RTVA 3ILFA 4KMUX 3IAS2 1H9WA 1J58A 2WO3A 5FYZA 1O4TA 3OOXA 3HTUA 4YW7A 5LW9A 1UNBA 4LIUA 3AL0C 3JQXA 3WG7H 3I58A 3JBG1 2LRPA 3Q9SA 4L9VA 2RREA 2RS53 1FC3A 3AYCA 3IH2A 1BKZA 1KGYA 1QJY3 4R9BA 4A4AA 4HAMA 2E1NA 5FPLA 3BY6A 4HT1T 5C33A 1F5FA 2MC3A 4HLXA 3PLQA 2Q8DA 1EY2A 2WN2A 4A6SA 3OR2C 5GTHC 2F4LA 2NVTJ 2VUMJ 1UIKA 4OHXA 3I0TA 4WZFA 1M4WA 2L7FP 3ZSLA 2DBNA 5DV5A 4A7YA 4QPIC 4XK4A 4XQWA 4AEDC 2IPQX 2BXZA 1JE8A 3JB4C 2BOLA 4CPBD 4HV6A 4INDA 2O1QA 2E53A 3F21A 2HYKA 3LCPA 5JPNB 1P7JA 1K5MA 1IS4A 4PGHA 4MEYF 4QX0A 3BKZA 1N3QA 4XBNA 3VBOA 3D1NI 1DIWA 3ZQQA 1D4M1 5A7NA 1PO13 2TUNA 1EV11 3H5RA 1LHWA 4KMQA 2BGPA 4UF0A 3RCOA 3M2MA 3GZTB 3MV01 1S7AA 2KRHA 5LGNA 4F55A 2W2IA 2DA5A 4GJYA 3BCWA 4CDXC 1SMVA 2O5RA 4BXXJ 1LAJA 3FM3A 3ESWB 3SXYA 4UW4A 4A2UA 4QPIB 4B43A 1X82A 2ZMKA 3DXTA 4CSWA 1CPNA 3JW4A 3I2OA 5FP8A 5J37A 2L0KA 2R7VA 1DPUA 1JKRC 1A6IA 4CEYC 4F93B 2R042 4C2TA 2X85A 3ZIWA 5FYYA 3MUZ1 2L4MA 4ZDOA 1BEV2 1OUSA 1GV2A 3OY9A 1QJEA 2LKPA 2OA4A 3K4NA 1BIAA 4ANJA 4S2GA 4DFSA 4IEZA 4XORA 5ACA3 2I74A 2BV6A 1GVJA 5JXHA 2JUGA 1GZWB 3OGSA 3GJBA 2VASA 4RBOA 1T6BX 3HAGA 1VBE3 4EM1A 5J4YA 5L3EA 1FBSA 1Y9QA 4QB2A 1MACA 5FLHA 4CDXB 3D3AA 1ZARA 3MMYB 5L9VA 3WNOA 4KDPA 2R7QA 1K3IA 4BE0A 3EBRA 2COBA 2XHKA 1RRJA 2BFUL 2R0FA 4XDPA 4CEYB 5DTDA 5FZ7A 2RMU3 1U0JA 1YIFA 4IV1A 5GLTA 3F8MA 1BQPA 4I0AA 5D8AA 1ENHA 4JQRA 2A3SA 5FP3A 1SFYA 2JE7A 3WW1A 2PAKA 3GBGA 2AQEA 3MW2A 2BOIA 3C2UA 1NLQA 4LE4A 2Y60A 1E5SA 4Z8BA 2VXDA 1FOD2 1P2FA 2ADDA 2VJXA 4D7MA 3H0OA 3HKZA 2C6YA 2TNFA 3HOTA 3KF3A 4E8DA 1FOYA 4FVVA 1Q1VA 3EUAA 3MGUA 1GZCA 4JTOA 2BW8A 5IAVA 5C3EJ 2E6VA 4BJ0A 5A6XA 1XMKA 4BJTA 3OYAA 2BVMA 1ZBE3 1ACCA 1KD7A 4G6TB 4P02B 3F8BA 3IDAA 2ZAAA 4FPCA 3M4OJ 1OLRA 1WKYA 2YYOA 5C3SA 1ZZBA 4F52A 1FNYA 3F8CA 5FY9A 1PK6A 5LEJA 4FQGA 4Y5TA 3QWLA 3ABMH 3HPGA 1KU7A 1F43A 3WNNA 4L5JA 3HB9A 1JZ2A 1UHMA 4RHV2 1POV0 3MV11 2JRTA 5JHFA 4TWTA 4NIGA 1G3WA 2Q5TA 5A3TA 4FPFA 3ZYBA 5LB6A 1QO0D 2G4IA 4CU8A 4AI3A 5HV0A 1GP4A 1GLNA 1U5TA 4NIDA 1EAH1 3OYEA 1ND2C 2W08A 1BI2A 1U5IA 3ZR6A 5JVVA 1RESA 3P5JA 1R1VA 3SCGA 3J81K 3S5QA 1XGOA 2PYTA 1S0EA 4XJAA 2E5ZA 1ZK8A 4NHJA 3A4UA 4JC1A 3ZMNA 1QXRA 1OF3A 2QJVA 4DBQA 4A5MA 5JCTA 2H09A 1FPQA 2GOXB 1VBC1 4UVCA 5K1YA 4IRIA 2M1BA 2BPA2 3CCEI 2IS6A 3K4AA 2D6LX 1JI8A 5KNLA 1XU1A 3RZOJ 2C0ZA 4XFCA 3J8F2 4RLFA 1FMVA 3WDYA 1BBT3 1JZ3A 1FLIA 1RUNA 3ERMA 2K3FA 5E16A 3PFIA 4F7ZA 2CWMA 2P8TA 5KHKA 4L11A 2UWCA 1IV6A 3JU9A 1V6IA 3FWEA 1NQJA 4BQ5A 5DCMA 4DGWB 4DS0A 2KDZA 2VUJA 3WTTC 1QY4A 3QH6A 2DUOA 2YZ4A 4LHKA 4META 1KYZA 4AGVA 3CTAA 4GGGA 1USSA 2HWD1 4WV8A 3PIPF 1AVBA 1UHSA 5JOWA 1LFUP 1MH4A 2CQ7A 4EVIA 2OTLI 3LSRA 3BT9A 5GADJ 4FPGA 3B73A 3HZJA 2I2SA 3ABTA 4KG8A 4MGKE 1YWKA 5K4LA 2VPLA 3ZXDA 3DYOA 5FLJA 5LRRA 1MS0A 3QAHA 4AFMA 3BDDA 4HVQA 5E18F 1YW8A 4AD9A 2Z2SB 1AJKA 4Q4V2 1ND3C 1COV3 1FSHA 3S14J 2VTXJ 1UYXA 2DODA 3URFA 2J1SA 1SLCA 2RC4A 1W28A 3RPUD 1UAIA 5ICFA 3MYXA 4BLIA 3P7NA 4IXLA 4PJLA 3E6MA 3JRCA 5A32B 5LWBA 4LJZF 2E26A 4IW3A 2UV1A 3UNPA 4N0BA 2P34A 3DXJF 3JCIA 4H14A 2R5YB 3IKWA 4Y20A 2XBO3 2CV2A 1G9DA 2OD5A 3RDIA 1XE0A 5B1AH 1ULDA 1TQIA 3LSGA 4J6GA 2DU0A 3PQKA 3LSTA 5F0CA 3R4SA 2FCUA 1PO21 3HOXJ 2HQAA 4CUBA 2C26A 5F32A 4BDVB 3ME2A 4DIQA 2ARBA 5DZFA 1FOWA 2WA0A 1FBUA 2BVLA 3QYBA 1ND3B 1LDKB 2A7AA 3K4DA 3H92A 3CO2A 3JRIA 3WR0A 5KHIA 5EJ1B 3WW2A 3GFLA 1ZRDA 4GZ9A 3LA7A 1W6NA 5FLIA 4Y1ZA 5C9AC 1CJDA 4MQ9F 1O6UA 1TT5B 3TNQA 5A3NA 5IYCJ 4O7XA 1AX1A 3A02A 4EQQA 3U75A 4JGZA 4Q1PA 3ZR8X 2DPDA 3FDYA 1N1SA 3JD71 3MUY1 3RI9A 4B1LA 3IMNA 4AZZA 2QQOA 1ZHFA 3CU7A 3KYLA 1UOBA 1BVP1 2A73B 5EGOA 5FYMA 1OLQA 1G3YA 2V72A 1RUE1 4Q47A 2WN3A 2OJED 4A3DJ 3W6JB 3EQLF 1ZRCA 4Q4W1 2A75A 4AK3A 2ACJA 4D6RA 1S6LA 3AMHA 3ZXAC 2JD4A 4PCRA 3WEZA 4MGTA 2M4KA 2M7BA 5JAXA 3GMEA 1Z6TA 2K7LA 3RQ4A 3VBHA 1JT6A 1VTNC 2E31A 1G7YA 2R7ZJ 4II3A 4ZYGA 4OHVA 4IEXA 3AZXA 3CZUA 1DP7P 1NY71 2ETEA 1HXS2 1W7PA 2GIVA 4CCKA 3OYMA 5FY1A 3J7ZI 1OCZH 3DTKA 5IVBA 1PDNC 1Y1WJ 1FYUA 1SACA 3TMOA 1MGTA 4BLJA 5HPOA 2ZGQA 2STWA 3CZJA 5BQTA 2IUWA 1KZHA 4OU0A 4MHUA 2UURA 2VAUA 3CCQI 4LGWA 3E5XA 1STMA 3O7OA 1MKMA 4QU1A 4Y5Z0 3JQWA 2AHQA 1WJ5A 3GF6A 4FPJA 1YX5A 4YW2A 4FOQA 3VBRC 3WTZA 1OA2A 2ZMLA 4PHZA 3SH5A 1Y9MA 4CDUB 2H1LA 3POFA 2WFF3 4GYGA 1RUI1 4N53C 3V8KA 4QKBA 3WV6A 1W2AX 4IV3C 5CFDC 1FY7A 4LO5B 4BKXA 2W95A 4QHBA 4LO8A 2WWUA 1MS4A 2CV0A 1GVDA 3KIOA 3HM5A 3VDDA 1OI6A 3S7IA 1H30A 5FPBA 2J1RA 1W90A 1H2KA 4Y3OA 4JGYC 2Q2EA 1R71A 4WM7B 4CEWA 2ISZA 2QQIA 2CW7A 2X6OA 4DJAA 1Q8QA 1WLDA 2D6KA 4AI0A 1UFMA 2E1CA 4AHZA 5BS6A 4OCTA 4HYEA 4BZ4A 5FD6A 1YIJI 3HR9A 3KD4A 3EPZA 2DFBA 1REDA 1SEFA 2WS91 2VU9A 3WG9A 4E7IA 1AXYA 3VBRB 2OZ6A 3MICA 5H9RA 1XDSA 3WOGA 4MXWB 1K42A 3HBKA 2TEPA 3POWA 1AHSA 2BNNA 5T50A 4N53B 2DCTA 2QQKA 3GBWA 4IV3B 1UB9A 5CFDB 3BB6A 3BR6A 4X6QB 5GLUA 1OPCA 3CJNA 5LA9A 2W1WA 1MIJA 4DEVA 2WWSA 4RQPC 1RL3A 2H27A 4LLNA 4KN4X 2G9FA 4JGYB 3ZPYA 3ZQCA 3BR1A 5KVRA 3K4CA 1W6PB 4QQLA 1POV1 1U9OA 2EINH 2F4MB 2J7MA 1TQ5A 3QU6A 3ZMTA 2LM3A 1G9FA 3FZVA 4UBHA 2VQ0A 4C0BA 2NVQJ 4EJUA 2KMUA 3VHOA 1NA1C 4BEHA 4NNJA 4LE3A 4OHYA 2KIMA 4UYBA 3VZLA 1TMF3 4LIVA 3HL2A 5H9SA 1OYIA 4FTSA 2DYSH 1D3YA 3SYTA 2XLGA 5FROA 4DRVA 5IUQA 3SISA 2MSYA 2HWF1 2ZNZA 2KRFA 4LG0A 1XMXA 4ISRA 1T8IA 2K9MA 2MNGA 4K20A 2WSVA 3OYCA 4Y22A 2LREA 2D97A 1NE6A 3IAQA 1X2MA 2XKPA 4RQPB 3WNPA 1K78A 1GKBA 3JRBA 2W24A 4P5OA 4UB8C 5C70A 2WNVB 2QWWA 1IXSB 1CQ9A 2YFUA 5I0DA 5B2GB 2W5FA 4YGBA 3T08A 1NA1B 4YVSC 2Y6FA 3IAM2 4U36A 3VKFC 1RJ7A 2DVDA 3OBZA 4Q26A 1HSTA 3EYYA 3UL2A 2GC0A 3O0XA 5I8SA 1S0CA 2K27A 2QZ8A 4LG3A 4FOVA 3S2WA 2A5ZA 4K21A 4I09A 2JE8A 3QYFA 5I0TA 3LL7A 4Y4YA 1MEC1 1RC9A 2G9WA 2VOOA 3CUOA 4OIOF 1WZXA 2QCOA 4UWDA 5J40A 3NNJA 3ASOH 2GMPA 3BR0A 1SDDB 3K3NA 4UBGA 1PZ9A 2ET1A 4QLCU 2EBIA 2Y0MA 5CFCC 4FXKB 1JZ8A 4ARXA 3M1CA 3SITA 2RGVA 2X05A 4MNUA 5AVPA 5FZDA 2F5FA 5JVTA 1IG3A 1JU3A 2EIEA 1UU4A 1NUKA 2ZEZA 3OF1A 4CUGA 1AKHA 2C5DA 4FQZA 1VQNI 3OL3A 3V7CA 2JVHA 2ECBA 3JB8A 5FZOB 3NEUA 2ZSHB 4BDZA 1JODA 2K9NA 4B09A 4Y52J 3PUAA 2XUMA 3P9CA 3PU3A 2HQ5A 2ZJRF 4YARA 3KVBA 2LKXA 4YW1A 3EO6A 3RKXA 1CAWB 1FIAA 1WBFA 1BBYA 4E27A 3FX3A 2RM21 3VD5A 4MGZE 4NE9A 1PX4A 1JYNA 3G4SI 5CFCB 5JSRA 2VL8A 1LEAA 1CF7A 5JZGC 4KWKA 3M7AA 3S6PA 1D7PM 5LK5A 2PN5A 1VP6A 1V4RA 2HYFA 4MADA 4OULA 4AAPA 1LOBA 2C9AA 4EN7B 5ICCA 1BVVA 1VQPI 1OLME 4ORFA 3MCZA 3O1UA 4LBLA 4RGSA 4D0QA 2Y8KA 5GLWA 4XF1A 1A34A 4PDWC 3IKTA 4XZUG 3BVCA 4AI8A 1JHFA 3C7HA 2PFWA 4AI9A 3CO6C 3IT8A 4MGYE 5CG9A 1L7LA 5A3LA 4BCUA 4U0YA 1TNTA 4XONA 1V9U3 2CH0A 1AR81 1YJ9I 5JZGB 1KXGA 3O0VA 1LOCA 3CLPA 4QPIA 4QX8A 4L92A 1GZTA 4AEDA 2E63A 4FX4A 5H9QA 2NXNB 1V70A 1ULOA 4AE2A 4WXHA 1GZ9A 5LBFA 2RS33 3CQZJ 5F1RA 3VHPA 1ACIA 4F92B 1JJ6C 3CDLA 1O7FA 5GAEJ 2ZAHA 3I2GA 3WTWC 3IRRA 5TGTA 3IBMA 5IAXA 2GU9A 3WGHA 3MFAA 5D6EA 1LHNA 3FHZA 1AL23 1RITA 1GSLA 1OQEA 3PURA 1F36A 3RZMA 2CU7A 3HBLA 4OMYA 3MKZA 1YQ5A 3IIIA 3L00A 3KPHA 5DUVA 4CICA 4G7HF 4S2FA 3DKWA 4N9HA 3B5LB 3KYCB 4CDXA 4CCJA 2Z9OA 1SAUA 3M3EA 3KP7A 1CAXA 1DYKA 4AM3A 2WQ4A 3J7NA 4WM8A 3Q8AA 5JOXA 4XMAA 4NQWA 1DQ0A 2A68F 3JSOA 5GALA 2VONA 4PZJA 4CEYA 5AFBA 2OQGA 3LFUA 1W06A 1QQP1 5F6FA 3IAPA 1X50A 3EQEA 5ABJC 3T3YA 3ZPOA 2XAGA 4J1XA 4ZZLA 4UFLA 1Y6IA 2DA7A 4XOGA 4LK1F 2D1HA 1ETVA 3I2IA 3KZZA 2V7FA 2VW0A 5DUKA 1RUC1 5C71A 1V6NA 1YW9A 1W6MB 4ZYEA 4YZ4A 2OCEA 3HEIA 2L5QA 5F39A 3BG5A 3ERED 5LD2C 3ZFGC 2CDPA 3FXQA 1PX3A 1SG3A 5F3GA 4PCQA 2W87A 1AR93 2NPIA 2VJJA 2VMFA 4CGZA 2BZDA 3TO6A 5JXJA 4FFGA 4RL7A 5ABJB 3ZXSA 2EZLA 2E71A 5LA0A 1Z7S1 1ZM1A 1VQKI 2V5DA 3GHMA 4FPKA 1RHI2 2I45A 5FZBA 1HRI1 2JPCA 3HRMA 3FMQA 2L54A 2PAEA 5EP9A 3FK7A 3H5NA 5TSWA 1QPMA 1WCQA 2MEV2 1LE8B 1BJQA 4OZXA 4IZZA 3FHAA 5FZCA 3E1F1 2H0BA 5IFTA 1WJEA 3QRFF 3ABUA 1O5UA 3AVRA 1G9AA 4FPYA 1OVPA 1UXZA 3MBWA 2A6TA 4NC7A 4K8RB 1YJNI 2BGOA 1X8EA 3GJAA 1FEXA 3AJYA 4XOTA 4M3EA 4EN9B 5CJ9A 1UMIA 2FQ3A 3HMYA 2VL4A 1VLNA 4HLYA 1RIOH 3GTKJ 4PBPA 2DTWA 2DV9A 1WPKA 2W68A 1MZFA 1F9KA 5C44J 4UFHA 5K7ZA 1LOGA 2OA2A 3P3PA 2WYSA 2FBKA 1ZNPA 4HW0A 3T2TA 4GMP1 1MQTC 2V1XA 4MVTA 2MH2A 5CISA 2F5EA 3DBHB 3MAJA 2NNYA 3O6BB 1ND2A 1CVNA 1E3OC 2E7QA 5HDNA 1WLCA 3H35A 5E17F 1R1A1 2CWEA 3OUIA 3ES4A 4CYDA 1DQ2A 4GIQA 3CF5F 1SD6A 1SC7A 1KA8A 2DA1A 1S2BA 1APNA 4I0WB 3WNKA 3FMRA 1ZR2A 5AC91 5J1YA 1H8TC 3V0BB 1X19A 3HSFA 1JN2P 1B9MA 4CCNA 1MS1A 1SFKA 4C3JJ 1XNKA 3K6GA 4IRHA 4QWQA 4RLQA 1J59A 3OBRA 2DFHA 3CO7C 3KP3A 4MTDA 1D0ZA 3IH3A 1ONAA 1W8WA 3FF5A 5LZ6A 3TQNA 2Y6HA 4DYQA 1MQTB 2EA7A 4HOOA 1EAH2 1RVF2 1J2XA 3W2VA 5FPAA 3B69A 4AF9A 3PM1A 2BE5F 3D8CA 3NKTA 4LXLA 1EF4A 1ZBA1 1AR72 1QDCA 1QEXA 3PQJA 4E6KG 2VMGA 3HT2A 4YEJA 2YUEA 1IS3A 4BQYA 3HOZJ 2VQAA 1GNHA 2P2KA 3Q0VA 5A32A 4LJHA 3U37A 4XFAA 3LB9A 5F3EA 3TOBA 1VR3A 3B6AA 4D69A 1OSGA 2CUFA 1U5ZA 5FCCA 3LQRA 1VB4A 4R9AA 2R5YA 1HN1A 1W8NA 2ADEA 4XAEA 4JHTA 3J7YJ 5DPNA 2PA7A 4JYKA 1ZGAA 4XLFA 2KIFA 3SHFA 2R92J 4CXWA 3I3DA 5ERIA 4XCAA 4A42A 3WCRA 4KWUA 2JUCA 2EICA 1D8JA 4XUTA 2EFOA 2WRAA 2B39A 5DG2A 4L5IA 1W8OA 3A22A 2OF7A 1D2SA 3LSEA 4NIAA 2VI6A 5JLVA 4DZJA 5IK4A 2ICWG 3FKIJ 5CVIA 3UKVA 3BZCA 3M7GA 4FP2A 4HEA2 4Y1UA 4Z07A 2CQKA 3W5NA 1GR3A 1CESA 2HNHA 2XUEA 5DM6F 3BR5A 4A3MJ 3KV9A 4FOYA 5CB7A 4AVBA 3B00A 4BXSV 4LOCA 3AJZA 3S7EA 1K79A 3H8UA 1V54H 2F5DA 4WBBA 4TXWA 4H7LA 2CFXA 3REOA 3VDAA 4A3KJ 1XG1A 3FHIB 1AYM1 4QX1A 2F2EA 5A3MA 4FFHA 3OUJA 5DZEA 3I2HA 1W1WE 1HJFA 2IXLA 5J48A 4HBNA 4LT5A 5C9AA 2VNOA 4KGGA 1R091 1XYOA 5T54A 3GZEA 3N05A 3ZQIA 1VBB1 4S05A 4ZDLA 1YYVA 1XE8A 4CE8A 3J9SA 3KF5A 1BZWA 2W39A 1GNZA 4UUTA 1T2XA 2XGEA 4WVWA 3HTSB 1P8JA 1PO22 2D6MA 4URAA 1W6OA 2PQQA 5I0SA 2J1AA 4PJ0C 2GA1A 1S0JA 1WW7A 3G1MA 2BDRA 2W1OA 3S3MA 3Q8BA 3OYNA 4IDZA 3K51A 5DYMA 1P4XA 3NVCA 4AFCA 4KG0A 1KJRA 4MZUA 2VW1A 3SC7X 3JRAA 4FPEA 4GFBA 1GT0C 3MKLA 1SPPB 1VAKA 2QBYB 2BHZA 3HDDA 4F3JA 4MGIE 5GZDA 3INAA 4W6WA 4OVEA 4E7LA 4P9IA 3DU6A 2HYGD 2QSHX 1RMU1 4QTRA 4IL6C 4ENJA 3A01A 2AQFA 1VBD1 4HETA 1VBA2 1QH7A 5DUXA 1GP6A 1BN5A 3HGGA 1DF0A 3VBUC 5T55A 2RJ2A 4EE2A 2LS6A 2LD5A 2DU9A 1E3PA 1ODNA 3OR1C 3PO2J 1YI7A 4KL1A 1T0FC 4FO9A 2DUQA 3B01A 4JDOA 2GP5A 4EQVA 4IRGA 2RS12 1US3A 2BHYA 1S0IA 3P9KA 1DBNA 4B47A 3BODA 3PJQA 4B4RA 4XF0A 5AONA 1FIPA 4QPWA 3K10A 3VBRA 1NK2P 1U8RA 1JTZX 1SVLA 1NY72 3NW4A 2DU1A 4M3DA 3V65A 3LPFA 3UR3C 4MXWA 2NVYJ 4DUVA 1WQ2A 2VN2A 2KIUA 3KQRA 4N53A 1LKNA 2C1FA 4N43B 3CKHA 1XNDA 4OAZA 4X1EA 4OLLA 1JUMA 4IV3A 5CFDA 2EV5A 3VBUB 3THCA 3KP2A 3N9LA 4MTEA 3KT1A 2X1DA 3FZ3A 1AU7A 1OCPA 1UQXA 1UHWA 4H2AA 1WD4A 1P4WA 5A3PA 4A0XA 4KI5M 1GQGA 3NRVA 4AQTA 4Q4Y3 2IWGB 3ZVXA 3OV8A 1B72B 1VMJA 5J6XA 1T2KA 4Y7NJ 1YIPA 1RUI2 2JG9A 4NOTA 3AFHA 2WAQA 5KXCA 4E4HA 1ZR4A 4BQ3A 4IHXA 4Y15A 3ORJA 4D9JA 2XL7A 2D3PA 4NRMA 2W48A 2VZ3A 2ESNA 2VQGA 2HBTA 3TO7A 2DFEA 3R60A 1NT0A 2ZKNA 4RQPA 3ZN5A 3PJYA 1HLVA 3KP6A 3S1NJ 1H1MA 1XCBA 1F35A 5IK7A 3SCFA 2DT7B 3DTIA 1KDMA 2Y34A 2W94A 3HOYJ 2VD7A 1LCLA 1YS6A 4O5VA 2JG8C 3V8JA 5DEQA 1NA1A 4EV0A 5DUUA 2BU9A 2DA6A 2R7XA 5FYSA 4CXXA 4AHYA 3ZN6B 4AI1A 2EALA 4B4PA 1I3AA 3TWIA 4ZU5A 2BBYA 2JA8J 4B7EA 4UVAA 5L7OC 1VNDA 1DUXC 1R9TJ 1R5ID 1YO8A 5L9RA 1XOYA 3S57A 5LBCA 5FYCA 2Y75A 4DQ2A 1T98A 1DDNA 3WDWA 3DEMA 3CMMA 2E7WA 2JMWA 1HKSA 3DCFA 2D3RA 3AZVA 3WU0A 3WX5A 2XGCA 4A3CJ 4QX3A 3OGRA 4E8CA 1IDYA 3PNTA 5I93A 3R0AA 1MS5A 3U1XA 1GNYA 2W1UA 5DAVA 4FFIA 2JG8B 4BQ4A 2K5CA 1E5IA 3MZHA 3ZIXA 5E8AA 4YVSA 1J09A 1DLLA 4B3NA 4XJUA 1FOXA