3I59A

Crystal structure of mtbcrp in complex with n6-camp
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
224
structure length
215
Chain Sequence
HMDEILARAGIFQGVEPSQLQPVDFPRGHTVFAEGEPGDRLYIIISGKVKIGRRAPDENLLTIMGPSDMFGELSIFDPGPRTSSATTITEVRAVSMDRDALRSWIADRPEISEQLLRVLARRLRRTNNNLADLIFTDVPGRVAKQLLQLAQRFGTQEGGALRVTHDLTQEEIAQLVGASRETVNKALADFAHRGWIRLEGKSVLISDSERLARRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Mechanism of the Allosteric Transitions of Mycobacterium tuberculosis cAMP Receptor Protein.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Dna binding protein
molecule keywords Transcriptional regulator, Crp/Fnr family
total genus 62
structure length 215
sequence length 224
ec nomenclature
pdb deposition date 2009-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3i59A02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3i59A01
3MWMA 1JHHA 3R6SA 4KIBA 4ESJA 5LGTA 2V1XA 3OOPA 4QGLA 2BYVE 3HUGA 1S8NA 2NNYA 2BGCA 3I58A 1JUHA 3PFIA 3DXJF 1RC6A 3K9TA 3L9FA 1ZN2A 4ENNA 2QM3A 4EQQA 2GC2A 1NHAA 1LQ1A 5HS9A 2MH2A 3EYIA 3UKNA 3HRTA 4Q0QA 3BP8A 4XF3A 3BZ6A 5J7MA 5CVJA 3LQRA 3IRRA 1CAVB 5JI6A 1ZZCA 1ZRRA 2K4BA 3MZHA 1BI0A 1FXZA 1HSTA 1QO0D 4LG0A 2YU3A 1LRHA 3HQXA 3U2RA 3TOBA 2D40A 2XVCA 4ZYGA 5LGUA 3E3VA 5LEKA 1WKMA 4YNIA 3ULQB 3MAJA 2ZNZA 5L3EA 5HVQC 1SFEA 2ZKZA 4LJZF 5IT9K 2NRAC 2BBYA 2EV0A 4O9GA 2RDPA 4DINB 5C6CA 1J5YA 2ZJ2A 1RZ4A 2P5LC 4G7HF 3K0LA 2DK8A 3GZ5A 2PI0A 2GA1A 2F5EA 2K9ZA 1BIBA 3KGLA 5K8SA 3KGZA 1TBXA 4Z2YA 2KIFA 1ZRFA 2Q1ZB 1VP6A 4N0BA 1FY7A 1ZGAA 1TW3A 3QACA 1YFHA 3NVCA 3EQLF 3HSRA 2IXKA 1NYWA 5HS7A 3M70A 4ZU5A 5J8FA 3AAFA 3ST7A 1T38A 2Q0OA 4MUVA 1FC3A 4WXCA 4O5VA 4Q47A 3F23A 1UCRA 3WGHA 2ADUA 2PEXA 2Y48A 2DU9A 3E6MA 2JPBA 1ON2A 2YSRA 5HLHA 2P6TA 4RB3C 1FYKA 1W7PB 1USTA 3CEWA 1FYLA 3L09A 1KYZA 1RUOA 2P6SA 1TW2A 1FOKA 1JGSA 1TLHB 5I0SA 1U8RA 1GXQA 2D45A 2IXHA 3GO5A 1X8MA 2I45A 2ETEA 1O3QA 3OD0A 3VB2A 1XE8A 3IKVA 1BN5A 3HRUA 2JRTA 2ZFWA 4OINF 4EV0A 3EDPA 3F3XA 2O61A 3IRQA 3I5UA 1XDUA 4JVAA 1LB2A 1EH6A 1YFUA 3HTUA 3DKWA 1O3TA 3BJ6A 2DQRA 1R1TA 2STWA 4E2GA 3LFKA 4PZJA 1ZREA 2STTA 1IN7A 5BQTA 4HDVA 1XRUA 2P5VA 2D5FA 1J7KA 4OFGA 3FF5A 2HJIA 4M74A 2FF4A 1FBQA 3J81Z 1E17A 4H0EA 3CF6E 3KP7A 2XAGA 2EVXA 1P4AA 1EP0A 2O8XA 5A2QK 4MGKE 1R5HA 2UWMA 4LLLA 5ED4A 4Q48A 4MQ9F 3J80K 3QPTA 2L3DA 1EH8A 5ERIA 1U6GA 1DPRA 2V09A 4D7TA 4CHUA 2O6GE 1Z1DA 5BOXA 4HVOA 5CVRA 4L9JA 5HDGA 1I1SA 2B0LA 1FI2A 2Q30A 3JW4A 5I93A 3M7GA 1FBUA 2HS5A 1EPZA 2PQQA 1X8EA 2FQPA 4OIPF 2AS5F 1QNTA 4A0ZA 1QXRA 2XLGA 3H1WA 4KWLA 1ZZBA 1XE7A 2V79A 4ZZDA 4CICA 3J81K 1XDSA 3I4PA 4HAMA 1YUDA 4Q29A 2ZMEB 2MLKA 3K1NA 4YFKF 4P55A 3SZPA 3KP3A 2HYFA 4GCVA 2H6CA 4ONUA 4IXAA 1PP7U 2W57A 4HQEA 4L0YB 4XFFA 2HFHA 2Q8KA 3BPVA 1XGOA 1I27A 3ZP5A 3ZPLA 3WG9A 3TO6A 4AVBA 1R23A 3F22A 2OAZA 2RC4A 2Z69A 4A5NA 2UY8A 4CZZA 5D4SA 3RYRA 3BPZA 2VT2A 5K5RA 2JTVA 3DN7A 1IAWA 2ISYA 1U2WA 5DV5A 4EM1A 2K27A 1P4XA 3PNAA 2ETHA 2A68F 4Q0VA 2DK5A 1TQPA 3C1DA 1FSHA 3L2HA 3M1EA 4CXFA 2Q4SA 3I53A 3JZVA 4K8FA 3NQOA 2PG4A 4A6DA 3VHRA 3WTUC 5JCTA 4LLOA 1TNSA 3EHKA 3FM3A 1IRFA 1L0OC 2DLLA 3TNQA 3TQNA 4ON0A 3HRSA 4WVZA 5D6EA 4M9SA 3WTVC 1R36A 4FHTA 1W5SA 2GC1A 1Y3TA 4A6EA 3RDIA 2PMUA 1KQ9A 1S7AA 4QLCU 3JAMZ 1O4TA 2L4MA 1WGPA 4BHCA 2VC1A 2KKOA 2XV4S 1AOYA 4IEXA 5ILSA 4IEZA 3F8MA 1IXRC 1BOAA 1C0WA 4PJYA 1TQ5A 4HZFA 2A5YB 3F6OA 5E20A 5AVPA 3WTSC 3KP5A 1O7LA 4ENJA 3L00A 3I7DA 3WW2A 3EETA 3OTFA 2IA2A 1G6NA 1BI3A 4I09A 3BJOA 4IEOA 1AWCA 2DQLA 4J1WA 1PP8F 3C18A 3GF2A 2N7GA 3SMHA 1R58A 1R1UA 1T98A 4YG2F 3KP6A 5J6XA 1R22A 2F2EA 4G94A 2QQBA 2MBFA 3V7CA 2MPFA 1UB9A 2HR3A 2FEZA 4PDKA 4JQFA 3KETA 3T5XA 2H27A 1GHCA 2WWYA 4GULA 3DPTA 2ZBKA 3BJAA 3IWZA 1MDMA 3CO2A 4Z82A 5J8CA 4AVAA 2VPVA 5KHKA 2NYXA 1HKSA 3MPBA 4Y15A 1UHMA 4Q0UA 4S04A 3MDPA 3E6DA 4HF1A 1BI1A 4KU8A 4ETSA 2VBXA 1Z05A 2DO7A 2RGVA 2HGCA 2DBBA 1IN4A 3F8FA 3HT2A 3NRVA 3OF1A 2EV5A 1YQAA 4Y17A 1LDJA 3WTYC 1B9MA 1K7AA 3ZMTA 3HT1A 3M8FA 4EM0B 2CW0F 4P9FA 4IHTA 4KMFA 1DDNA 1SD4A 4GXOA 3FE5A 4AVCA 2M1BA 5AIQA 1O57A 2D5HA 3V4GA 3EQEA 2M87A 4BH9A 1LNWA 4XLNF 3SQNA 4WXDA 1W5TA 4GYIA 1MZBA 3ERED 4H7LA 5FPZA 1OYIA 1U78A 3CJXA 5FFZA 2FBIA 1CF7A 1HW1A 1ZHFA 1NE4A 2QDRA 1H1MA 3HOSA 2FU4A 1WI9A 1OR7A 4EROA 3FHZA 1OYWA 1EYBA 1PMIA 2NS0A 1DPUA 1ZYRF 3CUQC 3D5LA 3IKTA 3HHHA 1J1LA 2LKPA 1KA8A 3TO7A 4EWDA 2E9QA 2V1DA 3ETQA 3GYDA 1TQIA 1X82A 2DFIA 4I0AA 2EV6A 2P7CB 3ABUA 1ZZ7A 2EA4A 5LRRA 2IP2A 4YRDA 2CSOA 3J7AO 3ZN1A 2ET1A 4RS8A 4AQ6A 4EJWA 4B8XA 3WW3A 5EEHA 3DFGA 4L11A 4QGNA 3K69A 1KU2A 4LGWA 1O3SA 2HQNA 2CG4A 2RV8A 4D0PA 1UIKA 5DCFA 3GZ6A 1KGSA 1CAXA 1D8KA 4I0BA 4HV5A 2GC3A 1OI6A 1W7PD 4M6XA 1BM9A 1ZG5A 3BCWA 4B29A 4XRFA 4OMYA 1NE6A 4GYGA 4YSFA 3G7DA 1P92A 1P4WA 4MZUA 5L3CA 4U7BA 4PIYA 3ML6A 1Q1HA 5LHIA 4XF0A 2GH2A 3LWCA 4XFGA 2OA2A 2BNOA 2DPDA 2KJCA 2R7DA 3JSPA 2G7HA 4M6YA 2ISZA 3NJZA 2H09A 3G73A 1W7PA 4IRGA 2C0ZA 5IT3A 3SCHA 4HVRA 1R00A 5FPXA 2A3SA 5ILVA 2PYTA 3U11A 5JHUA 1B9NA 1SEFA 1V70A 1IF1A 3V8LA 3CO6C 5FD6A 2VOOA 1S29A 1T6SA 2GWRA 4LA3A 1ONVA 5CADA 3T0YA 4OIQF 2D1HA 1EH7A 4UXNA 4L5IA 4META 3GXOA 2PFBA 4M73A 2Z2SB 4RAYA 1XMKA 3KCCA 2KRFA 4HX4A 3H50A 4E70A 3JAMK 2YX7A 1VR3A 3I0TA 1HW2A 3ISPA 2GXBA 3E5QA 4LA2A 2XHKA 4L2NA 2UZKA 3LA3A 2QCSB 2XAFA 2A07F 5D8LB 4UV9A 3DQVC 2H94A 1Z6RA 3M9AA 1ZNPA 1ZZ9A 3O6BB 4OIRF 4WCGA 3KLNA 5EFUA 1YLFA 2DCTA 3EYYA 1YW9A 4UBHA 4MV2A 4RB1A 1YLLA 2IW5A 1X7NA 2IA1A 1FSEA 4PIZA 5FLIA 3J80Z 3FMSA 4U0WA 3O3KA 2A6HF 1QBJA 4XF4A 1FWZA 2E7WA 3GYHX 4D7SA 3DV8A 4Z07A 4AD9A 2RKHA 4NB5A 1K78B 4PIXA 3FXUA 3ZN0A 2OZUA 2FE3A 3ROUA 3GX4X 1U3EM 1J75A 4BHPA 3IHUA 3EJKA 4UVCA 1X3UA 3S0MA 2B5HA 2FMLA 1MJBA 2XKOA 3ZMUA 4AIHA 4PGGA 1YIOA 4R79A 4NVPA 1T0FA 4S05A 5F1RA 5HLGA 3E5XA 2IXIA 4ENKA 1OMIA 3FZVA 1HKQA 4P5OA 4WXHA 5I0UA 1GVJA 4HF0A 2P8TA 3TDZC 2QUFA 2KXLA 5E1ZB 2G7UA 1SFUA 1YYVA 2MA3A 1JXSA 5TJJA 3R61A 5FDBA 1IXSB 4OIOF 1VTNC 2EFNA 4NQWA 3F6VA 1F9NA 2OD5A 1CAWB 1JE8A 4KICA 3HTSB 2PA7A 5E1XA 5H6QA 4Q5SF 1YFWA 4HVQA 3CJNA 3LA7A 2VC0A 3DF8A 3W6JB 3CLPA 5I91A 3V7RA 1WSUA 1U5TC 4AIKA 2BNMA 3SHRA 4KYWA 4HQMA 2JSCA 3WW1A 1PUEE 4IETA 5DUIA 2EWNA 4I2OA 1RTVA 4LUMA 3PQKA 4BIFA 4PGHA 2OZJA 4P9UA 2CGPA 5A2QZ 4MGYE 4ZYEA 4QGMA 1YW7A 2EFOA 1Z7UA 3NL1A 5JSPA 1F1ZA 2TDXA 4RGRA 5I0RA 3BOQA 5H6RA 3HHGA 5K5QA 2IJLA 2W25A 3OV8A 1ZLJA 3TGNA 4EJTA 4HX8A 2D2WA 2H6BA 1SQ4A 3WU0A 2WTEA 2OA4A 5EZWA 5HDNA 3RKWA 1CAUB 4G6QA 1HW5A 1XB4A 4P9GA 3RIRA 4AQ2A 1EV7A 5BV6A 2QNKA 2OPKA 4UHTA 1Q3EA 4M71A 3K2ZA 1S7OA 5E1RA 3FHIB 2LF8A 4Q0SA 4AWXB 4LLGF 1RNLA 4LULA 3GBFA 3RNSA 4CDGA 4YARA 2UY9A 3C3VA 1XSXA 4F7ZA 4YIFA 2VN2A 3PLQA 2XLFA 2ZNYA 3KP4A 1Q43A 1DZTA 5D5UB 2V9VA 4UXAA 4GGGA 3HSEA 5D1IA 4O6JA 1DGRA 2GU9A 5HLIA 4LK1F 3V7SA 1HSJA 5DYMA 5E1WA 2ZO4A 2PFWA 1XN7A 3TDUC 3SCGA 3ELNA 2PHLA 4HYEA 2M8EA 5JR7B 1S6LA 2VE8A 1O3RA 4XFBA 2EJRA 2GIVA 2PAMA 2XAQA 1CAUA 1G4DA 3KZYA 4F8AA 1ZZ6A 5KBFA 2ZMEA 4KWJA 3C7JA 2KIMA 5L3DA 3CUQA 3F72A 2RQPA 3ZDSA 1ON1A 4ZYHA 3M3IA 2COMA 2HYGD 4IRIA 3ES1A 4K2EA 2IT0A 3W6KB 2XL9A 3I71A 3VEPA 4P96A 1QPMA 4KDPA 3P7NA 4LUKA 5D8KB 5CVVA 1YHFA 4R52A 5HDKA 1T39A 3OCPA 2M45A 4B09A 1FPQA 3JSOA 3GFJA 4GO1A 4HSJA 1LDDA 4YFNF 3LZZA 2L02A 3P9KA 3TNPB 4MEYF 2ESHA 3RYPA 2WFPA 4X6RB 1SD7A 3WTZA 2BNNA 4FT8A 5D5WB 3WU1B 3D0SA 2K7LA 4LLNA 1B4AA 1P6RA 4RGSA 4G7ZF 3MYXA 1ZG3A 3HRMA 5FQ0B 2CAVA 4HW0A 2D93A 1DZRA 2HOEA 4L18B 3ZQ7A 4UVBA 3BDDA 3I54A 5LEJA 2GAUA 2HTSA 2JT1A 2E1CA 3GWZA 1MJAA 4KU7A 2QQAA 4G7OF 2ELHA 1G3TA 1LVAA 5CU1A 2Y0MA 1UFMA 2O8QA 2P4WA 3I64A 4HF2A 3LSTA 2PJPA 2QENA 4KFCA 3JTHA 3K1MA 3RYKA 2OU2A 2CWEA 5L3GA 2PTMA 3UKTA 4MQVA 2RVCA 2FNAA 2QZ8A 2EA7A 3RJPA 1XGSA 4RAZA 2XGXA 2EAAA 5I8SA 4OOIA 1SMYF 5FCCA 4MHGA 4QM9A 2Z99A 1XMAA 2FNPA 2HQRA 1LJ9A 1IW7F 2OBPA 2DTRA 1LKNA 4MGIE 2VOPA 4X6QB 5LBQA 3LAGA 2IVMA 2PLYA 1KYWA 5CVUA 1G3SA 5EEGA 3L2CA 3ZMVA 1L3JA 4XF9A 3GW2A 3BB6A 1WWXA 5DEQA 2HDCA 4IERA 4EWAA 5JFRA 1CX4A 3P9IA 4KNYA 1IN5A 1QQIA 3V8KA 3I59B 1ZH5A 2Z3YA 3QPHA 4M9XA 4DQ2A 4KA4A 4IHSA 5E16A 5J48A 3LQQA 2XASA 1F5TA 4MX3A 1G3YA 2GZWA 1J58A 3QOPA 2JZYA 2VBYA 1HKTA 3PQJA 1YS7A 2RN7A 1R1VA 4YYOA 1J2XA 4QX5A 1DUXC 2IRFG 1S3JA 1T2KA 2MC3A 4ZU4A 3CUQB 4BXUA 3T8TA 1TNTA 2X0LA 3WW4A 1V3FA 2QJVA 3KP2A 2QLZA 4MNUA 3U9GA 2GC0A 2OYZA 2VONA 4UV8A 3LAJA 2Z33A 4YFXF 4KL1A 2L01A 1K79A 2CFXA 4G8XA 3VFZA 3BWGA 1SFXA 3CUOA 3L7WA 1I5ZA 1LEBA 4A2UA 2ESNA 4O9EA 3N97A 5K5OA 2O0YA 4IEUA 3KLOA 4G6DA 4L5JA 4ZH4F 2AXLA 4XEZA 1PM7A 1IUYA 2B9UA 1H0MA 2UYAA 5KHGA 1XCBA 4KIGA 4IEPA 4MTEA 1FP2A 3E97A 2QYOA 3D0JA 3SXYA 1R5GA 3RPQA 4A12A 5DD8A 4XSXF 1YFXA 1JHFA 5D5XB 5C8WA 2KJBA 3QU6A 5DCMA 3N4MA 3TOAA 2VECA 1WQ2A 4AIJA 1XGNA 4HOBA 2F5DA 5IT9Z 4KWKA 1ZARA 1B1BA 4CYDA 4WF2A 2IXLA 1UHWA 1UPIA 1Y0UA 2QQ9A 1ZG1A 2O03A 5E18F 4XF1A 2MH9A 4OU0A 5CVIA 4RGUA 1V4RA 2E1NA 1ZRDA 2MNGA 3V8JA 3H7JA 4CGZA 1O5LA 5CYVA 2MD5A 1XCVA 4BQAA 5CLSA 1OPCA 2R3SA 3GFLA 1FZPB 3USSA 4BYYA 2IXJA 1QZZA 3BALA 2W85A 3F8NA 1U5TA 5BPDA 2HTJA 2ZXJA 2DT5A 5TRDA 3Q9SA 1O5UA 1ZZ8A 4E2QA 3B73A 5FQ0A 1FP1D 5L3BA 1YFYA 4MH0E 5BS6A 1SD6A 2QBYB 3O14A 1W4MA 2K86A 1Y9QA 2XAHA 4EJVA 3H8UA 1IRGA 2IC1A 2H0VA 2V1UA 2FMYA 1FX7A 1RGSA 5LHHA 3HYIA 1SMTA 1YWKA 3B02A 5H20A 1F4KA 2P7VB 4WX9A 5LGNA 5D6FA 1FYMA 2FBKA 3M8EA 3SFZA 1MJ9A 4AXOA 1WA4A 1U12A 3KFWX 2CQKA 4M9ZA 2YPRA 5I8YA 4IEYA 1MD0A 1WRJA 1UIJA 4KT5C 5FGMA 1EY2A 2PAEA 3FX3A 4RB2C 5KHHA 2C6YA 2G9WA 4FAGA 3OGJA 1KU3A 2QVOA 1XSDA 3RTRA 5DCMB 4LEJA 4QXKA 3WGIA 3IC7A 4I7HA 4R1HA 1KU7A 4IESA 4TV7A 1QGPA 4QM8A 2NAZA 4FX0A 2HEOA 1YW8A 2Q0AA 3T8RA 2LNBA 4LB6B 2IXCA 1Z9CA 3H3UA 3JTGA 3HOTA 4ENMA 3PVBB 5HOOA 1J59A 1A04A 3WGGA 3T1BA 4L9VA 2GA2A 4OMZA 4IJAA 1QZYA 1ZVFA 3REOA 4XLPF 2XROA 3E6CC 4J1XA 2FSWA 2V6CA 3DPLC 5FD5A 1UW8A 4FX4A 4KN7X 2FRHA 2FA5A 2BE5F 2OQGA 3FMQA 5LHGA 3CLOA 3IIAA 5DDGA 3E6BA 1Z6TA 2QBYA 2P5KA 3F21A 1NZCA 4IPAA 2Y0OA 5KHIA 2EFQA 2J5PA 2ATFA 4LFUA 3MFKA 2Q2EA 1D8JA 3D82A 3NSTA 2P17A 4CO8A 5ICEA 5I8TA 4PCQA 3WODF 4XFIA 3RKXA 3HIFA 5J3UA 4HLYA 2VXZA 1GXPA 4KN4X 4LMYA 3GEZA 3GFIA 1RI7A 3E5UA 2PHDA 4DNCA 3GVAA 5HS8A 2ZCWA 4WK8F 2Z5UA 5BUVA 4EWEA 2MLGA 4R8HA 4U0VA 4BNCA 1G3WA 5FLXK 1J3QA 3ACLA 1TQMA 3G3ZA 2VQAA 2XKPA 2A61A 3FM5A 5E8IA 3BU7A 3P9CA 3RZZA 5FB2A 2HKOA 3FXRA 4XFAA 4YIIA 1YS6A 4WZCA 2CV6A 3SHFA 3FJSA 4G9YA 3C3WA 3LOIA 2UXXA 1B59A 1LEAA 3I59A 4ZYDA 5E17F 2A6EF 2R7FA 3FFQA 3LA2A 3CO7C 4JTNA 4JV4A 3SCFA 3BROA 5E8GA 1I1GA 3FWEA 4HLXA 1E2XA 4FAHA 2M30A 1CAWA 1WLTA 3RPUA 1D3YA 3SXWA 2W24A 1UCXA 4I02A 2K0GA 1CAXB 1RL3A 4N9HA 1BJAA 3S7IA 4MEXF 5AIPA 5F6FA 2VODA 2XIGA 4U88A 2F4PA 2EFWA 1FLIA 4JTOA 3VODA 4ZZLA 4EMSA 4JBAA 1RUNA 5BPIA 3TKYA 1IPJA 3QP6A 1QXJA 2FQ3A 1YG2A 4RGXA 5ILUA 2D1VA 3F8CA 1L3LA 4UNOA 4L9NA 2DPUA 1XD7A 2B8MA 1OKRA 2QWWA 5BMZA 1IN6A 1J3RA 1MGTA 2XLAA 1IZ1A 1ULYA 5FLHA 4EGZA 1K78A 4EM2A 1UD1A 3IWFA 5K1YA 2FXAA 4XBFA 1MKMA 5DUKA 3COAC 2K02A 1KQ8A 1Q5OA 1PDNC 5AONA 5KK1A 3WE3A 3IL2A 2VBZA 2BEOA 5CJ9A 1USSA 1BBYA 2WV0A 1BC8C 3DP7A 4QWQA 3H1YA 2GXGA 3RI4A 4AVPA 4A0YA 1B6AA 3DEUA 1FBSA 4IRHA 3FXQA 1HQCA 4LD5A 1H9TA 3LWFA 4O3MA 1P2FA 2QVSB 3Q5FA 3ECHA 4E2SA 2X4HA 1IXCA 1J9IA 5JSOA 2O1QA 3R60A 1HXDA 1RIOH 1STZA 4LB5A 2PQ8A 1MDMB 2OQRA 2CO5A 3S7EA 5ICCA 2ET7A 2EA2A 3R0JA 4XETA 4EVIA 4JK1X 1TTYA 2BV6A 2YR2A 4N9IA 3WE2A 4MTDA 5ICGA 5I0TA 1KU9A 4HMZA 3IDCB 4KIFA 4I3PA 1DP7P 5T3NA 3QU3A 4UUVA 1BC7C 3F8BA 2VBWA 2RNJA 2F5FA 1XGMA 3K1PA 5FLJA 2LDUA 4FBFA 5LRSA 4HA8A 3BY6A 1XSVA 2OZ6A 3Q9VA 2VT3A 3GUDA 2EFPA 4LG0B 3WTXC 1BI2A 1R7JA 3KEQA 3EO6A 4I01A 4BAYA 5JAXA 4RB0A 5BPXA 1I6XA 2F5CA 2HWVA 1OYYA 4IEVA 3EBRA 4NHJA 1LR5A 3RKYA 5HI0A 5FLXZ 6PAXA 4EGYA 4XFHA 3S2WA 2FBHA 4ZU7A 1K6OA 1BIAA 2PAKA 4TLFA 2XL7A 5FO5A 4IVNA 3HSFA 3KZZA 3EUHA 1REPC 3ZMSA 2DW4A 1YTYA 2JPCA 4LTAA 5JSRA 4OLLA 1OFNA 4ORFA 2KIUA 4XFCA 2L54A 3U10A 5ICFA 2WC2A 2ACJA 3KE2A 1H9GA 4Q4ZF 1GQGA 4EJOA 2CAUA 3ZMZA 2M5WA 1SAXA 4IEWA 2XRNA 2XUBA 4Q0PA 5D4RA 1SD5A 4M72A 4XSZF 4IEQA 2HZTA 5L3FA 3ZMDA 4HN0A 2HKXA 2VE9A 1CF7B 1IN8A 2IA0A 1HBXG 3MCZA 4HBNA 4ESFA 2EB7A 2A69F 5BXXA 2XAJA 1GQHA 4Y13A 1ZAOA 4U7DA 3IBMA 3NW4A 5KVRA 4U0YA 4UBGA 5BY5A 2PN6A 4QMAA 2NNNA 4A5MA 4HBLA 3CDHA 1ZX5A 3CL1A 5DD4A 1H1IA 4LK0F 3H3ZA 4HDUA 4KUMA 2IPQX 2UYBA 4KMUX 3TO9A 4HV6A 5D5VB 1ZGJA 5JVTA 1D5VA 1CAVA 2FOKA 3CTAA 1DGWA 3QAHA 1FNNA 1KQ0A 3FZ3A 2J5OA 2MHFA 3NEUA 4HX7A 2K4JA 2E7XA 3H7YA 4ASNA 2PMHA 1FT9A 3MZYA 3NKTA 4L9TA 3ECOA 2ZKLA 4L0ZB 3GLXA 2EK5A 1YO5C 3LAPA 3UKVA 3ABTA 1CGPA 3SZTA 3KMHA 2LF7A 4HN1A 4MGZE 1O7FA 2L4AA 4RD7A 4ESBA 1J3PA 2DAOA 3H1MA 4UVAA 2UXNA 4EJUA 4HSLA 3ELKA 1IPKA 4BHBA 3WTTC 1QWRA 3U1DA 1Z91A 3IDBB 1ZLKA 3O2PE 3FMRA 2W84A 3GFMA 3WTWC 5FFXA 2CYYA 3MQ0A 3H9AA 5LLQA 4WWCA 3KSCA 3KEOA 5JR3A 1OD5A 5F64A 2Z9OA 3QP5A 4IF4A 4WBBA 3BPXA 1SFNA 1LDKB 3VOEA 2O3FA 2DI3A 3MEXA 1QY4A 4I98B 3U0ZA 1ZRCA 3DL3A 2LSOA 2PBIA 3R4KA 2GQQA 4MGRA 3R0AA 1U5TB 2Y75A 1ODDA 2YX4A 4HLTA 1J0RA 4A0XA 1VJ2A 1NXMA 5KHJA 3ES4A 3H92A 3QRFF
chains in the Genus database with same CATH superfamily
1JODA 1JHHA 4ESJA 2AREA 1LOEA 4CDWB 1A8DA 2BYVE 2AZ5A 3HUGA 1LTEA 3I58A 3CDIA 1XNBA 5FMBA 2L9LA 4IGPA 1RC6A 1D7PM 1PGSA 5A7NA 4MGQA 2GC2A 2K5CA 1Z67A 3K4NA 3EYIA 2G9GA 3HRTA 5FKLA 4GD4A 1AR73 5J7MA 2YU1A 1I3QJ 1WZ2A 2LTNA 1AX1A 1W8TA 4I3GA 5FBJA 4XBQA 1W1WE 4A3BJ 5J1UA 2K4BA 4HG6B 3MZHA 2W9XA 4IHXA 1QO0D 4NC7A 3ZR6A 3HQXA 3TOBA 2VZTA 1Q1VA 4H7MA 2MW8A 4ZYGA 4LO5B 3E3VA 3K4DA 1IS6A 5LEKA 1WKMA 1DGRM 3PJYA 5L3EA 1Y0NA 1S0EA 5IT9K 2NRAC 4XHXA 5C8CA 2EIJH 3LEGA 3SNMA 4YGCA 1AYM1 1DP0A 2DK8A 4MLOA 1U5ZA 1NG6A 4BKXA 3GZ5A 2PI0A 2F5EA 1BIBA 3DCQA 1MS8A 1NK3P 1F35A 2P3KA 4OQ9A 1V6NA 1S72I 1ZGAA 1D5YA 5FOBB 3W2WA 1ETOA 1YFHA 3VDDB 3EQLF 3HSRA 5GADJ 3ACHA 3VZLA 5HS7A 2KHMA 1UZ0A 5J8FA 3ST7A 2P37A 5FZHA 4PSWA 4XXAA 4UFJA 1UCRA 3VPRA 2Y48A 1GFF2 4DRRA 2DU9A 3NQHA 1V55H 2JPBA 1XS9A 3GZNB 2YSRA 5HLHA 5L9RA 3C8XA 3OUIA 4RB3C 3FXKA 1W2NA 3D5OA 2LBFB 1I6HJ 4II3A 3OGVA 1MMDA 1UMIA 2P6SA 1JOPA 4I99C 1VAVA 4PF1A 4BACA 2ZS6B 2E7QA 1BEV3 2IXHA 3SDGA 3EXUA 2L9SA 2VQGA 3VB2A 1BN5A 1G9FA 3VDBA 4MG2A 3AMHA 3ZXLA 4AG4A 4OINF 1UYZA 3EDPA 3F3XA 2L9RA 2GNMA 4XKVA 2O61A 3JR9A 4UW5A 1LB2A 2EALA 3BC8A 1AVBA 1K4TA 2BJSA 1ZREA 2STTA 2HWB1 5SV5A 4HDVA 1MBKA 1KS4A 5IYYA 3NKGA 3ZQQA 1J7KA 4JOMA 3J81Z 2ARCA 4RLFA 3U75A 3CF6E 4CCNA 2HXIA 4LQRA 3W6VA 2XAGA 2DMQA 4COZA 3CJIB 3A0BC 4A3FJ 1EP0A 4BE2A 4MGKE 2JB4A 3MIGA 4ZDLA 2P34A 3ZCOA 4BPZA 1X1CA 4HK9A 4MADA 1DPRA 4D7TA 1QJY2 4MO3M 2KR2A 4N43B 5LASA 3SITA 1TMF3 1XC6A 1Z1DA 1ASJ1 5E88A 2NN8A 4L9JA 1FI2A 3R4DB 3WLUA 5I93A 3BQZA 1X8EA 4EN0A 3MV01 3N9QA 1QNTA 3M4OJ 2ZMEC 1QXRA 3ZXDA 1XE7A 4L92A 1GNZA 1ZBE1 4CICA 3RWNA 1UELB 2VVDA 5JI7A 1UN1A 3I4PA 5DZGA 1YUDA 3K1NA 2B45X 4BOWA 2A6TA 2IS6A 3E1F1 4AUXA 3RI8A 3ATGA 3TBIA 2ZGUA 3K7AJ 1PP7U 2W57A 5AC91 3ILNA 1VBC2 1W6NB 2QFEA 2VIXA 2P81A 2JDNA 1RXGA 1FNZA 1I27A 3HGYA 1PO11 4AVBA 3PIGA 3H8RA 2CHHA 2Z69A 2UY8A 1H2LA 1CZVA 4CZZA 5D4SA 3RYRA 2VT2A 5K5RA 2ISYA 3SJMA 5B1BH 4BQNA 4RGGA 4EM1A 4R4ZA 4RS5A 1K42A 1P4XA 4Q0VA 1A3KA 5DXDA 3OOXA 3M1EA 5GJ6A 1WBFA 1WCMJ 3JZVA 4PLNA 3K4JA 2XB6C 1RUI2 3WTUC 5JCTA 4UF0B 1FNYA 3FM3A 3GBGA 2JE7A 3HBKA 4BE0A 3HG9A 3TQNA 3IT8A 4AI0A 3HRSA 4CDQA 1BBT1 1H30A 2XHNA 1W5SA 2GC1A 3TW7A 2GMMA 2GM4A 3RDIA 2D5VA 3TB0A 2VC1A 2Z16A 1JTYA 5ILSA 2VR4A 4RDUA 2VC9A 4NWVA 2RS13 2EINH 1MSEC 3FL7A 1MMNA 2HLEA 1RUH2 2V5YA 3N9MA 1XX5A 3C7FA 3UESA 1FMWA 1GSLA 3AFKA 1HRI2 1MEC1 3OTFA 3I97A 1G6NA 4CEYC 3BJOA 1K45A 1PP8F 2E1OA 3M3QA 1S2EA 5IATA 1R58A 1IUFA 4YG2F 4LHNA 3ZYHA 1EJ9A 3N9NA 1HRV1 4CCMA 1XNTA 1UB9A 2P6CA 2XJPA 4PDKA 1S0IA 4JQFA 1HC8A 1GHCA 2ZBKA 3GMEA 1HRV3 1LOAA 2A75A 3BJAA 3IWZA 1PX4A 2RS52 1DQ4A 3CO2A 3WG2A 2RMU1 2ZB9A 4AVAA 5KHKA 3K4CA 2VQHA 4S04A 1SZBA 3MDPA 3E6DA 1BI1A 2VBXA 2DYCA 2RGVA 2YU2A 4P08A 5F3GA 2HGCA 1HB2A 1IN4A 2HWF1 1LHWA 4OHXA 3OSDA 4DPNA 2E35A 1WA6X 4CEYB 1YQAA 2PELA 4C0BA 2K85A 4N7IA 1LDJA 1DDNA 3MD2A 2F17A 3BI3A 2XBO3 3ECQA 1UY3A 2M1BA 3ACFA 1REFA 1G86A 5FZOA 2IGNA 5FPZA 3VDXA 1PIV3 5FFZA 5T5LA 5CZKA 3HOSA 2R5ZA 1YRZA 1OYWA 1DQ5A 1V6MA 2R1DA 1EYBA 3TN91 1ZYRF 3CUQC 3GXUA 4QU1A 1J1LA 2LKPA 3TO7A 1OCCH 3PUFA 3VSLA 1X82A 2W95A 4I0AA 3PTYA 2AGSA 1CD3G 1H6XA 2K3FA 1HB1A 1XC5A 2WQ4A 3JRIA 3VBFB 4RS8A 5DG2A 4AQ6A 1H89C 4B8XA 3WW3A 3MICA 5T5JA 1VE0A 4ZC3A 2VXJA 4KGQA 3WHTA 1N3QA 3PJQA 2XG3A 4Q1PA 2L7FP 5IFTA 1PVC3 3U78A 3TEWA 2Q5TA 1KGSA 4I0BA 4DOUA 1W36D 2WZR2 4PK4A 5FWJA 1ZG5A 3OPTA 5FYBA 3HBZA 5C4WC 4NHYA 1LHOA 4B29A 4OMYA 4N53C 3WDWA 3HM5A 1T6GC 1P4WA 4Q4Y2 4MZUA 3ML6A 2QQKA 3MKLA 4E7HA 3AKPA 5LHIA 1LOFC 4CCEA 4P00B 2BNOA 3PTRB 2KJCA 3PUHA 3JSPA 3UR3C 4IE7A 2G7HA 5F6LB 5DZFA 4M6YA 2V7FA 5DMYA 1ND3C 2R043 4XJUA 3UJOA 2VJIA 2C0ZA 1RUI1 2CL2A 1Y8RB 3RRDA 1MW7A 4AFCA 1V70A 2IFWA 3KQRA 1J1TA 2QQMA 2WAFA 2QQLA 3CO6C 1W28A 3BKZA 1SBEA 2JECA 3K75B 4LA3A 1ONVA 4CUAA 4OIQF 4O7XA 2YFZA 5JXHA 1EH7A 4CXYA 4F52A 4L5IA 4META 3T30A 3F9KA 3WHBA 4XW3A 4RAYA 4V2VA 4HX4A 2JG9C 1PHMA 1SPPA 1WCKA 3I0TA 4ATFA 3AFHA 2GXBA 5FY1A 3VBOC 2ZGRA 3AXEA 1HJFA 3LA3A 4TSVA 1NLSA 2XAFA 1BQPA 5ACA2 5D8LB 4UV9A 4JGYA 3IPVA 4Y33A 2LM3A 1ZZ9A 2WNVB 1ENRA 4OIRF 2WNUC 1YW9A 1X7NA 3RG0A 1QJZA 1GWKA 3PNTA 2BFUL 2RS33 1YJWI 1QBJA 4C0HA 1FWZA 3T09A 3I49A 1J09A 4PJMA 1XYOA 2L5QA 5FMDA 4CH7A 4Z07A 3UGGA 2D6PA 5EG0B 2YB7A 3ZN0A 2FE3A 5T5PA 2DMTA 5JOXA 3GTJJ 3OEBA 2X6OA 3BPSA 4UVCA 4QKNA 2FCUA 5IT6A 3ZMUA 1UYPA 4NWWA 1R6RA 3VSKA 2FJ1A 1W8NA 4R79A 4BM8A 1T0FA 2BW3B 2W48A 4S05A 5HLGA 1AKHA 5B2GB 4BK4A 2IXIA 1OMIA 3LSPA 1C28A 2J22A 3OMYA 5DM6F 4P5OA 4WXHA 5J3LA 1PK6C 4FPOB 1GVJA 5CNAA 5E1ZB 4PBPA 3VBSA 1SFUA 4Q4V1 2WYFA 1ND2A 4IQ4A 2NS7A 4LLFA 5GZGA 5KWRA 1JE8A 3ZFEA 2PA7A 5H6QA 4HVQA 1YFWA 4K20A 4LO4B 4QPGC 1JYTA 3W6JB 1HDDC 3PM1A 3CLPA 4CP9A 2BVVA 1AYM3 4AIKA 1LGBA 2BNMA 3QD6A 2L0KA 4KYWA 4HQMA 2LUWA 3S1NJ 3LSHA 4CYCB 2LKXA 1WUVA 4Y7NJ 3VLBB 5DUIA 2EWNA 2GDFA 4I2OA 2WABA 5FMCA 4PGHA 1OF3A 1RUC1 4P9UA 2DCKA 5A2QZ 4QGMA 3DUIA 1F1ZA 5A3MA 3AKTA 2TDXA 4LE3A 4FPLA 4D7YA 3HHGA 2IJLA 3DKYA 1H8VA 3TGNA 1KGYA 1PMHX 4BE3A 2B39A 1S0GA 2H6BA 4XN3A 3WU0A 1SQ4A 2WTEA 1NTCA 4YW6A 3OIPA 4YW7A 3RKWA 4CZSA 1XB4A 3JB8A 2VOWA 5BV6A 1CN1A 4M71A 3K2ZA 1UAAA 4BIOA 2BXZA 4XQFA 4YG0A 3FHIB 2LF8A 2X6XA 4WM8B 4LLGF 1US3A 1RNLA 4QQLA 4LULA 1NKGA 4YARA 1TZLA 2JG8A 1REDA 5LW9A 3HWJA 4F7ZA 4YIFA 3PLQA 2XLFA 4B7EA 5FAXA 1DZTA 4GB33 1E3OC 3U21A 2JUGA 1JZ5A 1HXS3 1DGRA 1YHQI 2I8DA 3B01A 3CP8A 5DYMA 3K77A 2JDZA 2H8RA 5JUVA 2ZO4A 3L2UA 1R093 3SCGA 3ELNA 2BY3A 1S6LA 2EJRA 2PAMA 2XAQA 3ZYBA 4F8AA 5KBFA 4QQOA 3LSJA 3WT3A 2ZMEA 1S2KA 2KIMA 3MF9A 1JZ8A 3ZDSA 2RQPA 2WS91 1ON1A 1BHGA 4ZYHA 3J8F3 2COMA 2A70A 4IRIA 2IS4A 4DXSA 4FTEA 2JE9A 5EGOA 4K2EA 2WFF3 4XQDA 3I71A 3WF4A 1QPMA 1GMMA 1UU4A 2DA7A 1Y43B 4A6SA 4XR6A 3HVDA 2RQQA 4M6VA 1UU5A 1RIRA 2L02A 3P9KA 4W6WA 3TNPB 4X6RB 5KAFC 1JHJA 4LLNA 5BNPC 4XJ8A 1B4AA 5FXVA 4G7ZF 2XF5A 3MN2A 1YRNA 3JD72 3ZMOA 3MYXA 2WR9A 1ZA7A 3BTZA 4OCTA 1WVRA 5CISA 3V0BB 5LEJA 1B35B 2GAUA 1ZRIA 4OI4A 2VPLA 3NAPA 2ELHA 2R7VA 4CE8A 1G3TA 5CU1A 1COV3 3K4LA 4NRMA 4KQ7A 1Q8QA 1SVOA 3WG4A 2DWRA 2O8QA 4Y3OA 2P4WA 2B46X 2QENA 4KFCA 4CDWC 4BEHB 3ZGKA 2CWEA 5L3GA 2PTMA 4BLJA 2VOKA 2BOLA 3LDKA 2Y33A 2HI3A 4BL0B 2MEV1 3O1UA 2XGXA 4OAYA 1E5SA 5I8SA 4OOIA 3UNPA 2VW0A 5FCCA 4GWNA 1F31A 5DDJ2 2E5NA 1RUJ1 2BPA2 1JT0A 3VZJA 2E63A 1BW6A 1XMAA 2FNPA 1IW7F 3CMMA 2DTRA 1LKNA 1R091 4DXRA 3LAGA 2IVMA 1SVMA 4P9LA 2XPVA 5IK5A 4MVTA 3L2CA 3ZXKA 4XF9A 3GW2A 2WV1A 2R4GA 4LR4A 4BXFA 3M8JA 1VQNI 1RUD3 4YW3A 1ZH5A 3QPHA 1WMXA 3THPA 2JDMA 1JUPA 3PIJA 3N3HA 1MS9A 3KT4A 4MO7A 1J58A 2FDGA 2JZYA 3O7OA 2B42B 4M3CF 2CQXA 4PJNA 1YS7A 1R1VA 2HOSA 3ZLIA 2DODA 2ZHNA 2X9DA 3ZN6A 3M2MA 2DYRH 4QX1A 3HXLA 3WD5A 3D4KA 4WVMA 3U1KA 1POV3 3W5NA 3P5JA 3CUQB 3T4HB 3MIDA 1TME3 2R7SA 3WW4A 5CBLA 2G9FA 4QIWN 5GLUA 3ETPA 2R072 3U9GA 1F43A 5CFCB 2VONA 3NARA 2SLIA 2Z33A 4YFXF 4KL1A 3C7GA 3WP4A 4AZZA 2E2HJ 2XUMA 1YX5A 3VFZA 2J1VA 3ZSLA 2R7TA 1LESA 5LY1A 3CUOA 3L7WA 1CX1A 3WHUA 4HKWA 4JQRA 5CPRB 4LBNA 3TYJA 3V65A 2F4IA 4XLAA 2ZEYA 4XM3A 5BNGA 4IEUA 3K10A 3KLOA 5T54A 4L5JA 4ZH4F 2AXLA 4XEZA 4DQAA 2VCMA 2VJJA 3AL0B 3HPNA 4IEPA 1FP2A 4HT1T 4CA0A 1CPNA 4HFSA 4G4FA 1A8MA 3ABLH 1W6OB 3IMMA 3S5QA 4GMP0 2ZX1A 3J7YJ 3A7QA 2KJBA 5FZ3A 5CQGA 5HCAA 3J7AY 1GQPA 3NMBA 1RKTA 5FY9A 1KONA 1GOGA 1URXA 2IZWA 3ZYPA 2IXLA 1Y0UA 2R7OA 2QQ9A 4FOQA 2A7AA 3R0RA 1E57A 2TUNA 4XF1A 2MH9A 4OU0A 2VULA 3OPZA 1DLLA 2DFCA 5K4LA 5CVIA 3VBUC 3ENRA 2QKDA 1V4RA 2ZSHB 3P5BA 2MNGA 3DXUA 3V8JA 3A23A 5FZLA 3H7JA 5CYVA 2TCTA 3QWLA 1VRBA 2JICA 5JZGB 4G3YC 1OPCA 4HNUA 4WVVA 2BOIA 2BWAA 3POIA 5DAQA 1QZZA 3M1HA 1GP4A 3ZN4A 1UNBA 5BPDA 3LPGA 2HTJA 4EN6B 5CEHA 1NA1A 2ECCA 4X1EA 2K86A 1Y9QA 3W59A 4EJVA 1Y6IA 3H8UA 4XRSA 3USUA 1N78A 5SV8A 2WL1A 1QZEA 4IV1C 1RGSA 2EILH 4LBQA 4IKFA 2HQAA 1R1ZA 5KNLA 2VUCA 4WX9A 3J7HA 1DIWA 4KH9A 2FBKA 2WJSA 4AXOA 1G59A 4OMCA 4Z92B 2YFUA 2WSUA 4M9ZA 3BTCA 5DDJ1 4AQTA 4IEYA 4XXPA 4KT5C 5FGMA 2CV2A 4OUSA 1KU3A 2BHYA 2HWB2 4LEJA 3RTRA 2JN6A 2OC6A 1IRZA 3WGIA 4NC8A 3I3QA 4R1HA 4IESA 2V9KA 4QM8A 4YVWA 2NAZA 1OCZH 4FX0A 2HEOA 4DYRA 3T8RA 4CCLA 3NNGA 3H8XA 2IXCA 2UWAA 1D4VB 2GN3A 3S3OA 3HOTA 4UFLA 5J47A 4OMZA 1HV1A 5IYDJ 4Y20B 2XROA 5C3OA 2JKXA 4J1XA 3UK9A 1BBT2 4D6RA 3FIWA 4FX4A 2L7MP 1HQNA 3CLOA 3IIAA 1NZCA 1AU7A 2ATFA 2Q2EA 4NAOA 4HG2A 3H35A 1O4ZA 1YC61 4CO8A 5ICEA 5I8TA 1WZXA 3WODF 4XFIA 2IS2A 4XUNA 3HIFA 2MG4A 5JVGF 4YW5A 2OQ7A 1W8HA 4CU8A 5AFBA 2VXZA 2NM1A 1FOXA 2ZJRF 2MC4A 1DGRN 3BR1A 4LBKA 3E5UA 3O1SA 1MEC2 4DNCA 4OHWA 3RQIA 1QIQA 2R5YA 2ZCWA 2MLGA 4R8HA 1K5MC 4BNCA 1J3QA 2ZJPF 2ZGTA 4E8CA 3S1QJ 2A61A 5E8IA 5ACA3 3I4NJ 3K2AA 3CNAA 4Y5SA 1PO12 5JXGA 2CV6A 2DCEA 3SHFA 5FKBA 4G9YA 2M0MA 3LOIA 2UXXA 1PZ9A 3POYA 3VL9A 3GF6A 2CU7A 2A6EF 4QWNA 4E7IA 2XXZA 3FFQA 1R5ID 1KD7A 2X29A 5TISC 4E27A 2MABA 1E2XA 2ZX3A 3JU9A 1LHUA 2VXRA 3SXWA 2WT0A 1NLRA 1OCTC 2Y8KA 3V0AB 1M4WA 3VBSB 5BNOA 2W5FA 4UWDA 2BVMA 3DTIA 2K9SA 3Q3SA 5F6FA 2VODA 1JBCA 3D6EA 3H3VK 4HONA 3SEQA 1HDPA 3BR2A 2EFWA 3CMGA 2RS12 1MS4A 1JZ7A 4MFDA 4ZZLA 3LL7A 5IUQA 4ARYA 4CP1A 4EMSA 2GXAA 4Y4YA 2BZTA 4A3JJ 1RUG3 3F8CA 1L3LA 3GTMJ 1V54H 3S8PA 1XYNA 2QSHX 2VVEA 2HNHA 4NUBA 5BMZA 3AKQA 1IN6A 4DUXA 4A3CJ 1LJ7A 1AR82 4OVEA 2XLAA 4ZY9A 1KFXL 5A7PA 5EG0A 3CDLA 3LSEA 4J01A 1AHDP 1TWCJ 2JWPA 1HV0A 1UD1A 3IWFA 3T4VA 2RS31 4AI9A 5K1YA 2VJ4A 1P7IA 4XBFA 4GDFA 1MKMA 5FPAA 4E7LA 1SLCA 3COAC 3LPFA 3ZKYA 2JA5J 5KHDA 3K3NA 1XPWA 1ZYBA 1VBD3 3GCMA 5KK1A 3WE3A 1AL0G 2JJ7A 4Q8KA 2WY8Q 4QWQA 3SKVA 4FFHA 3UV9A 3ON7A 5DS9A 3IPVB 1E5HA 2ZXIA 2GXGA 3VV1A 5C3QA 1VMJA 5BNQA 2UUZA 1ENSA 4B43A 1FBSA 4XTPA 2VM9A 1UY0A 3LWFA 1P2FA 1SPPB 3L1PA 1HA8A 1IS5A 1IXCA 2NYYA 1WGXA 5JSOA 4W97A 1JI6A 1YIPA 3H8OA 5FUNA 3T2PA 2JB8A 1STZA 2D3PA 5AC92 3WP3A 1MDMB 2OQRA 5ICCA 2YDEA 4EVIA 4JK1X 4PCRA 4FTBA 3WE2A 2RDNA 1IKPA 4FE7A 4HMZA 4LITA 3B93A 2NOGA 4A42A 1XMXA 5T3NA 3QU3A 1BC7C 2C24A 5DUXA 2E19A 1DU0A 3VBHB 3F8BA 2VBWA 1XYPA 4AGVA 2YPJA 4N53B 2F5FA 1DZQA 5FLJA 5C4WB 5LRSA 4HA8A 3G4SI 1OVPA 4XUQA 5DG1A 3BY6A 1MS3A 4BLIA 2Y6LA 4LG0B 1RUC3 2VBDA 2A3XA 1POGA 2AO9A 1HXS2 2EPFA 1R7JA 3ZYRA 5A1FA 2M4GA 3ZMNA 3ONQA 3EO6A 4I01A 4DFSA 2LRDA 5BPXA 4FXKB 3ZR8X 4DGWB 2YGLA 3S2WA 1JKQC 4ZU7A 3DCFA 2PAKA 5FO5A 4N8MA 5A33A 3HSFA 3ZXSA 2WZ8A 2DW4A 3RSNA 3K4AA 2QSFX 4ORFA 2E7AA 2BGOA 1LHNA 3U10A 4IX7A 1F4HA 2WC2A 2ACJA 3L2WA 4Q4ZF 1GQGA 1U5XA 3C2GA 1BMV2 4EJOA 2CAUA 2M5WA 3M1CA 3CC4I 5D4RA 1HXS1 4D0QA 2E6VA 5HCHA 4XSZF 3MKYB 2VE9A 1W0TA 1RPWA 3OYKA 3U07A 1OD3A 1H4GA 3MCZA 4HBNA 2P3IA 5BXXA 2XAJA 5EZGA 1GQHA 1LOGA 4TYSA 5FZOB 2HBUA 4U7DA 2ZXHA 4A45A 2AYHA 1XNDA 4UBGA 2PN6A 4IL6C 1C3HA 3OYMA 1JZ4A 3B9CA 5D5VB 3OWTA 5CKMA 2FOKA 4XNFA 4PHZA 4AI2A 5GLZA 5ABJB 3JD73 3DECA 4A3XA 2VJ5A 2K4JA 2DCZA 2E7XA 4RQPA 3MZYA 2OF7A 4L0ZB 1QU0A 2EK5A 2VU9A 1YO5C 1ULPA 3POEA 2VMHA 1CGPA 4G12A 3LSGA 5JMOA 1BLZA 2VKVA 1JTZX 4MGZE 1BYHA 1O7FA 2L4AA 1Z21A 4ES9A 4NJ4A 2DAOA 1FOD3 3I3BA 1W36C 1IPKA 4BHBA 3H5AA 1QWRA 3EUAA 3I2OA 5C5UA 2RS11 3O2PE 2WNVC 3O1PA 3AP9A 4GJYA 1I1EA 5J1RA 1NQDA 3ZSEA 5BNOC 1DCSA 4DZJA 5LBFA 3KSCA 1QH7A 3VD7A 4KJZA 5JR3A 4ASMB 2DFFA 2IUWA 3QP5A 3BPXA 1SFNA 2WNVA 2DI3A 3MEXA 1QY4A 3EPZA 3KIOA 3AG4H 4M0NA 2GQQA 3AYEA 1NH3A 3AMPA 5EZHA 3HZJA 2Y75A 1MS1A 2MYSA 4AVZA 1J0RA 4A0XA 1VJ2A 5KHJA 2K9NA 1XBFA 2YUEA 3QRFF 3MWMA 2CRGA 3R6SA 2YUSA 4KIBA 1OLME 3MHZA 5LGTA 2V1XA 4JAAA 3OOPA 5KC5A 4TN7A 1S8NA 2VY0A 1JUHA 4CCJA 2R073 3DXJF 3K9TA 2ELJA 4ENNA 2QM3A 3NJXA 3QOEA 4CXWA 3UKNA 3RQ4A 1Y1WJ 1R71A 3BZ6A 4FASD 5CVJA 1X1DA 3IRRA 1RUD1 3PU8A 3KT1A 4TWTA 4BQ3A 1RMU2 4BGDA 1U8BA 1ZZCA 2QF7A 1QJY3 1BI0A 3NO8A 4H3WA 4PDWB 3NJYA 2V9PA 3U2RA 1JHNA 3MEPA 2P3JA 3N7KA 3BT9A 1EV11 3CD6I 3MLLA 3MAJA 4IEJA 2F5VA 2WY7Q 5JHFA 2ZNZA 5HVQC 1SFEA 2ZKZA 5K7HA 4LJZF 4IHYA 1XU2A 2V4VA 2EV0A 2DA6A 4Q2FA 1D0YA 1TME1 3H42B 4CPBD 1C1LA 5HV4A 5IAVA 1H8AC 5FYHA 2GA1A 3BZCA 1GWLA 1MPXA 2DJNA 4OWRB 1WMEA 5FV3A 4HSTA 4Z2YA 4Q4X3 1RR8C 1S2BA 3H0GJ 4XYXA 5FRNA 4C1XA 3G6JB 5EYXA 4JYKA 3NVCA 4YM0A 2IFRA 3SH3A 3M70A 4R9DA 4ZU5A 3GJBA 2F4OB 3IH3A 4C9YA 2DU0A 3F23A 4YLZA 4JX0A 2DA1A 1EV12 1UMQA 1RJ8A 3K6GA 3VBUA 2ILMA 3N35A 1ZBA1 1RHI3 3A0NA 1C4RA 3AP5A 1ENHA 4XURA 1FYKA 3W20A 2VW1A 1W7PB 3CEWA 1QQP2 4XC9A 1QDOA 4A3GJ 3GTOJ 2BWCA 4IE5A 3L09A 1LPQA 1RUOA 2AEYA 5E6HA 3MPPG 1TLHB 5I0SA 2D45A 4XRSG 4PDWA 3GO5A 2K9QA 4LBOA 3J7MA 3Q0UA 4LE4A 2VTFA 5IJRA 3AZZA 5EYYA 3OD0A 3A01A 1C8M2 3HRUA 2ZFWA 4EV0A 3IB3A 4GKXA 4PI2A 4CA9A 3I5UA 4YVSB 4CCOA 3HTUA 3BJ6A 5D21A 1PVC1 4YG3A 3FDYA 3BTLA 3LFKA 4XDOA 4YW4A 3QYEA 1T8IA 2FBEA 4BXXJ 4FQZA 1XRUA 2ZZJA 2D5FA 3FF5A 2M4KA 3DPUA 1GANA 4M74A 2FF4A 4CUGA 3GCXA 1P4AA 1E5IA 2C5DA 1NA1C 2O8XA 3RZKA 2DN0A 5ED4A 4J6GA 1OPMA 1DQ6A 1OLMA 4LBQD 2L3DA 2AEZA 1U6GA 4BS9A 2LROA 1RVF1 4YZ4A 3CCRI 4XRMA 5BOXA 4UUSA 5HDGA 3JW4A 1VQ8I 2HS5A 1AYM2 2FQPA 2XF7A 3KT7A 1DGWY 4A0ZA 3B9IA 3H1WA 4KWLA 4HPQA 5C5TA 1BBT3 3J81K 2R0QC 3G6EI 3ZQHA 2WAQN 2DURA 2C4XA 4C91A 3PMSA 5A3OA 2MLKA 3KV5A 3KYDB 4E7JA 1ETQA 3Q8BA 3WR0A 4YFKF 4P55A 3KP3A 2H6CA 4ONUA 4YGBA 2CS3A 1G7YA 1OQEA 5DAWA 5ACA1 3IAPA 1V9U3 5T50A 4AI3A 4HANA 2X1EA 3HN3A 1ZBE2 4Y26A 1OFCX 2K2SA 3WG9A 4A5NA 5DDJ3 1PZ8A 2VZOA 4OAZA 2JTVA 1IAWA 3J9SA 2X1CA 1LGCA 2K27A 3JXSA 1MBGA 2CUEA 4L8QA 2JA8J 1FSHA 2DV9A 5EDNA 2K40A 4CXFA 3OYLA 3I53A 4B48A 5LK5A 3NQOA 2PG4A 3VHRA 1BVP1 2D43A 1JW6A 4DRVA 4YPJA 1IRFA 1W6NA 5EJ3A 4Z2WA 2DLLA 3TNQA 4NN0A 1R092 3IH2A 4ON0A 1BK0A 4RFRB 5LA9A 4B4RA 4WVZA 3Q8CA 5D6EA 3WTVC 2JD9A 3WCRA 4BWOA 1ZR4A 1HB4A 4MYEA 5HLTA 1MZFA 2HEWF 3IZOA 1SLAA 4XJ9A 3JAMZ 1O4TA 1ND2C 5E3MA 1QHGA 3HUGB 2AQEA 2WO2A 4IEZA 1BOAA 1GOHA 3CMEI 4HZFA 1ITYA 3WQBA 2DFHA 2JQ7A 4LO7A 2VTXJ 3HEIA 4RGAA 4RYDA 2QUOA 4DZPA 4ENJA 2H0BA 3CZ6A 3OGRA 1VALA 3H9QA 2IA2A 4I09A 2QGUA 4NQWB 3C18A 3SFIA 2N7GA 1T98A 2JIGA 1BCXA 3LSMA 3KP6A 2ZC2A 1R22A 4XCAA 3VBHA 3LEMA 3T2TA 3Q0WA 1D2QA 3MFCA 2MBFA 3V7CA 1TMF2 2NPIA 2CTVA 3KETA 5FROA 5DAVA 3BIWE 1T2XA 5F7UA 1AR63 2FCVA 1MDMA 4MOAA 3I2DA 2IWGB 2GOMA 5C4XJ 1UOJA 4LIVA 3MPBA 1JUMA 4Y15A 4Q0UA 2AHQA 5IVJA 2HVRA 4KU8A 1BOBA 2MEV2 2DO7A 3WDUA 2BDRA 1W8OA 3ZYJB 3F8FA 3EUHC 2EV5A 1ZR2A 2CUZA 4RHV2 3URFA 1FX5A 3BQYA 2CW8A 4Y17A 3WTYC 1POV0 3ZMTA 1YYNA 2QQNA 3KF5A 2ID6A 2CW0F 4IHTA 3W3CA 1YO8A 5A3UA 4FTSA 5J40A 3VGIA 1DGWX 4XLNF 3IIIA 3SQNA 4QX8A 2RS32 1TT0A 3USUB 1W5TA 1TMF1 1O91A 1K61A 2Y31A 4GYIA 1MZBA 1NG7A 2HWC3 3ORJA 3HDDA 1U78A 4MSVA 4OYUA 4IQJA 3CJXA 1DFQA 3WZ1A 3DEMA 1XU1A 1RUD2 4D69A 2FBIA 1CF7A 2R92J 1NAEA 2DMNA 2VL4A 1ZHFA 1H1MA 1G9AA 2FU4A 4AK3A 4LHSA 1OR7A 1PMIA 2NS0A 3M7AA 2TNFA 3ETQA 1SCRA 4YELA 3JRFA 2QZ3A 3ZXFA 1GT0C 2P7CB 3ABUA 4WM7C 4LIUA 4X8NA 2EA4A 5LRRA 4YRDA 1X1AA 1X36A 2HOTA 1VQOI 1R9TJ 3AYDA 5FYSA 3ZN1A 2ET1A 1WWYA 1V9U1 1RINA 3G2BA 5EEHA 3ZYGA 4LGWA 5D8AB 2HQNA 5GZFA 5DCFA 3BR3A 3GZ6A 4D94A 1T08B 2R071 3V0AA 4HETA 4M6XA 1NUKA 5EF6A 1DBNA 2B9VA 3W9AA 1NE6A 3EYPA 4U7BA 1QOOA 1RYYA 4ZXEA 1Q1HA 5FZCA 4YGDA 4N90A 3LWCA 4AGRA 3VKLA 3TBDA 1VBA1 2ZGMA 3VHNA 1W8UA 2ISZA 4C3HJ 3NJZA 2H09A 4BY1J 4EYUA 3G73A 4NAMA 3SCHA 4HVRA 4YZ2A 4N43C 1R00A 5F3IA 4EZ4A 2PYTA 1OQYA 2RE9A 3U11A 2P1BA 4URAA 3LDBA 4CUBA 2YZ4A 1NXD1 5FD6A 1W0OA 2VOOA 2JG9A 3ZFGC 2M3AA 4COWA 3BTYA 2E34A 3K48A 2R5YB 2DFEA 5CADA 3L2YA 5H9SA 1ZBA3 1HRV2 1ACCA 1XNAA 2WT1A 4M73A 2Z2SB 1T56A 3DXTA 2KRFA 3CDZB 1OUXA 2YX7A 3S6PA 1HW2A 3ISPA 4Y1ZA 4CEWB 1LUJB 3F2ZA 4FOYA 4LA2A 1IV6A 3RCOA 4L2NA 3ZN6B 1POQA 3AX4A 1LKXA 1U5YA 2X51A 5F5AA 1VMFA 5FYMA 1D1CA 3M9AA 1ZNPA 2JIJA 1BKZA 3UNGC 1RVF2 4Y4RA 3ESWB 4RBOA 3ZOIA 1STMA 4Y1XA 3KLNA 5EFUA 1RESA 3EYYA 4UBHA 4MV2A 4RB1A 4EZHA 3QPSA 4DIQA 1DYKA 3J80Z 1W9FA 4U0WA 3B6CA 4PJJA 2ADEA 3LIGA 3NV1A 4AVSA 4IV1B 2E7WA 3GYHX 2WNUA 4D7SA 3RZDJ 3PSIA 2JX9A 5C3PA 4IV3C 4AD9A 1VQ7I 2RKHA 1K78B 3DEEA 2OZUA 2K9MA 1J75A 3CMYA 3TEDA 4A3EJ 4E7SA 5EXOA 1N1YA 1NX9A 1MJBA 4ZS3A 2DVDA 2Y6HA 5HV0A 3NNFA 4MFEA 1N47A 1K3IA 4W6XA 2G4IA 1QHDA 2HWE2 2ZHLA 3WVJA 1LGNA 3FC0A 1BR2A 3BG7A 1HKQA 1WJCA 5DPNA 2XJRA 5I0UA 2DVAA 4QXBA 1QMJA 3NNJA 3NWSA 3D5RC 4HF0A 3TDZC 2QUFA 2R16A 3DTKA 3AJZA 3B6AA 2CQQA 3CCEI 4CZCA 2YXSA 2XPJA 1VTNC 3BCBA 3ZVXA 4D5CA 1UOFA 3MW2A 2ZHKA 2OD5A 1UPSA 1CAWB 5FJHA 3IH4A 4BU2A 3HTSB 2VJXA 2NVQJ 3CJNA 2K46A 5F9TA 2AUYA 1W9YA 2LP0A 3LB9A 1QF3A 5I91A 3V7RA 1WSUA 2J1EA 2RM21 4E4SA 3CCMI 1JS9A 4IETA 2VW2A 3VL8A 4FETA 5F3EA 1UX6A 3HBLA 4MGYE 1KITA 3HJEA 1YW7A 3THDA 2QQ8A 5FTTC 5GP9A 2Y64A 2VNOA 5I0RA 3ZRGA 5H6RA 4P1WA 3MMYB 3GM8A 3BTIA 3KV6A 3M8LA 3H0OA 5A7SA 2OA4A 2QZ2A 1MEC3 5EZWA 1FATA 3DBRB 4G6QA 1HW5A 1AX2A 3FLPA 2BW8A 5JLVA 4UHTA 5FP8A 2EZIA 4C2TA 5A1AA 4GALA 1MMAA 1S7OA 4AWXB 1PO13 5LBEA 1APNA 3GBFA 3NJVA 4DXTA 1XSXA 4FVVA 5C8CC 1MNMC 1GZTA 3K4MA 3KP4A 1R1A3 2M9HA 1Q43A 5D5UB 4UXAA 1PGW1 5IP9J 1HQWA 1M06G 2GU9A 1FEXA 5E1WA 1JXNA 5DUVA 2DT6A 1XN7A 3POGA 3THCA 4HYEA 2YPDA 2FX0A 2VE8A 4XKBA 2XMLA 3PVEA 2F4LA 3SKJE 2Y26A 3KZYA 4CUCA 5LATA 1JUSA 1IV8A 4KWJA 3H9GA 4GH4B 4XLCA 3CUQA 3F72A 4PJ0C 1MNDA 2WINB 3T0DA 2IT0A 3W6KB 3U4SA 2W1OA 4P96A 3ZSKA 4KDPA 2I10A 3P7NA 1SMVA 1VRH3 4LUKA 5GM0A 1G9CA 4KISA 4XAEA 1T39A 3OCPA 1W8FA 2YY1A 3FXOA 1VRH1 1FPQA 4XUPA 3JSOA 1WMDA 1ND3A 4GH4C 1LDDA 4YFNF 3LZZA 4DEVA 4XIKA 5FY5A 1IS4A 3RYPA 3GALA 5FZAA 1ULGA 4FT8A 2CWSA 1EAH2 4ZZ5A 4QPQA 3VZOA 1V6JA 5L7OC 3OBAA 1MBEA 3NAPC 4CCDA 2CDPA 4YVWC 3HRMA 4D1QA 1W9WA 2D93A 3I54A 3HN1A 4PQQA 2DOAA 2JT1A 5K0UC 1MJAA 4KU7A 2LREA 2VG9A 1R083 3VN4A 1UWWA 1LVAA 2Y0MA 2L2OA 1UFMA 1D4M1 3LSTA 3BLYA 3K1MA 1NT0A 1KFUL 3OS0A 3APBA 3I2GA 2XR4A 1V5GA 2OU2A 4YIRX 2LTPA 4BEHA 3UKTA 1KEXA 4KBZA 2JG9B 2LD5A 2EA7A 5EJ1B 4S0HB 3RJPA 1XGSA 2IXSA 4AOCA 3ZIXA 5J4VA 4NIHA 1BMV1 1APLC 4QM9A 4XORA 4HK8A 4Q26A 4AFDA 1L7LA 2OBPA 3JCUC 5C3RA 3PUAA 1Y4WA 2R1BA 5LBQA 2XSDC 4QAWA 4A3KJ 3RZGA 1G3SA 3BB6A 2YROA 1DLCA 2HDCA 2NXNB 3O8GA 4EWAA 3P9IA 3WINE 3N9PA 4AEDB 4D3WA 4DQ2A 5E16A 2XASA 5KAIC 1F5TA 4MX3A 3CQZJ 3ASOH 4DBQA 1W9SA 1IQAA 2FD5A 2D6KA 3AYAA 2MC3A 4B4QA 3T8TA 4EJRA 1UZZA 4JGZA 5ABJC 5E89A 1GVDA 2FDJA 1V3FA 3HOZJ 2GC0A 1ODMA 1EA3A 2VNGA 1UY2A 2D7FA 4AAXA 3PMEA 1WI3A 3VDAA 4M3CB 1YI2I 5CKNA 4YM3A 1PVC2 5F3CA 4UB6C 2JENA 4CVUA 3WOGA 1W05A 1SFXA 1MSFC 5L9VA 1C8NA 1F8VA 3HOYJ 1GU3A 1HX6A 4R9CA 4NNJA 2BV4A 2Y9YA 1RB8G 4G6DA 4GB31 3FFZA 1PM7A 1OCOH 2UYAA 2B9UA 3N9OA 1ULCA 3VBSC 5J1YA 5J4YA 3BG9A 2VCAA 2C6SA 5FZ8A 1R5GA 3RPQA 3P1IA 4A12A 5DD8A 1YFXA 1JHFA 5D5XB 4EEFG 3VYSB 2JUCA 4A4AA 1RUJ3 5K9YA 4NHXA 5IT9Z 1ZARA 2DOFA 2MD0A 1B1BA 4WF2A 2LYCA 3VBFA 1F5FA 1UKRA 1ZG1A 2O03A 5E18F 3ZDVA 2XUEA 1T33A 2WB1A 4QPYA 4QT6A 3WSOA 2I74A 4FFIA 1PO21 1ZRDA 3UGHA 4CGZA 2MD5A 1LE8A 2R3SA 1FZPB 5DTDA 5GKAC 3VBRB 3M3EA 2O5RA 2W85A 4I0WB 3WNMA 2ZXJA 2OQ6A 1YI7A 2DT5A 3B73A 5FQ0A 3UJQA 2NMOA 1POV1 2E32A 3O14A 1H1AA 3ZOBA 2EF6A 4KI5M 2H0VA 3ZYFA 4B1RA 1SMTA 3B02A 2KDOA 4XBLA 3BR0A 5A32A 2GMPA 3C7OA 3M8EA 1YQ5A 4W65A 1PIV2 2R7QA 2VZQA 1LEDA 2CQKA 5BNNC 1S9HA 2Z4FA 5ISLA 4XVHA 3HPHA 1WJAA 3FX3A 4RA0A 3HJRA 3OGJA 2WLQA 2QVOA 4WM7A 3MO4A 5DAPA 4I7HA 4QPGB 1MH3A 3GTLJ 1QGPA 2NMNA 2RDSA 2ZGSA 5CFDA 4NIGA 2Q0AA 2LNBA 5GTHC 3H3UA 3JTGA 1VBE3 1X58A 3WV6A 2LG4A 1BR1A 3N7LA 2NVXJ 3J26N 4Y1UA 3ZPYA 3WGGA 3S32A 4KGGA 2ZX4A 2GA2A 4IJAA 2VMDA 4XUTA 1VAKA 1ZVFA 1F36A 3ZFGB 3I8TA 3VBOA 2V6CA 2RR11 4XILA 3HD8B 1UW8A 1JJ8C 3TEXA 4KN7X 3OL4A 2FA5A 3FMQA 2OQGA 2JSPA 1VQ5I 3E6BA 1Z6TA 2QBYA 3F21A 3GZUC 4YWAA 5KHIA 4UFMA 2MSYA 4LFUA 2JA7J 2LC2A 5DM7F 1SLBA 3WNOA 5LCWL 5TSWA 5GLWA 4ZS2A 5A1LA 3D82A 5FZ6A 2P17A 1IG7A 5HXVA 2WO1A 1QRYA 3RKXA 1AYN3 4GMP1 4NR1A 4NIDA 1B72B 5J3UA 2KP6A 5CKTA 3HNMA 1GP6A 3PURA 3VB9A 2M7AA 1V6OA 2GNBA 4U2AA 3I3LA 2WUHA 3GFIA 4LOTA 2PHDA 2GP5A 3BR6A 1TP4A 3RSJA 3CJQB 2E36A 2Z5UA 5BUVA 4U0VA 5FLXK 5HNFA 4OQ8A 3ZO0B 2SBAA 3BU7A 4BQOA 5FB2A 3GHMA 1FOYA 2W1UA 2OTLI 4UF0A 5K7FA 3VKFC 1Z7LA 1EAH1 1LEAA 3CCYA 5E17F 1RUI3 1LOBA 3VKOA 2E2IJ 1PVXA 1VIWB 5IP6A 1IG3A 3Q8EA 1AHSA 2OUJA 5FBZA 3FWEA 2M30A 3CP2A 1PM4A 2O7OA 2W24A 4I02A 2K0GA 3TMOA 2RAEA 3IAQA 5EV7A 5AIPA 1YIFA 1YE9A 4U88A 3OEAA 1FPN1 2HDWA 4CCKA 2F4PA 1GLHA 2UWBA 1FLIA 1VBE1 4NOTA 4YVSA 4JTOA 3VODA 3IDEA 5GPCA 3TKYA 1IPJA 2JWTA 2KRHA 4L9NA 2DPUA 2EXHA 1X2NA 2CUJA 1CONA 1BW5A 5DUUA 2Y6KA 3HL2A 2QWWA 5FZ1A 5FLHA 3OUJA 1H9WA 4EGZA 2QDNA 2I2SA 2D6NA 3T1MA 4EM2A 4V2FA 2FXAA 3S1MJ 3HQRA 5GAEJ 4ZKTB 2X09A 4PQ9A 2A3WA 4IXLA 1X9TA 5EEAA 4RM3A 1Z7S1 4Y5Z0 2K02A 1Q5OA 3IL2A 1GOFA 2VBZA 1NCQA 5CJ9A 1GV5A 1USSA 1RJ7A 1BBYA 1OQ1A 1FJLA 2WV0A 2C9AA 1BC8C 5M5YJ 1BEV1 1MBHA 1RR7A 4DJAA 1UKGA 3WU2C 1DDLA 1YIJI 1PMJX 4GFBA 4O3MA 2QVSB 2Z79A 3ECHA 3FKJA 2X4HA 3VZKA 2IBDA 2JA6J 5E3LA 4BJ0A 3ZKUA 3IM0A 1GNYA 4LK7A 1AZDA 1WW7A 2WQZC 3BOPA 2CO5A 4UUTA 2ET7A 2EA2A 3B5LB 1CWPA 1TTYA 4MTDA 1V6LA 5I0TA 1KU9A 3P3NA 4KIFA 1DP7P 4XABA 2ID3A 2RNJA 2H1LA 3AL5A 2W91A 5C9AB 1XGMA 2LDUA 4K3UA 1SFPA 3ZQGA 4JRLA 2WLPA 2OZ6A 2A5WA 3GUDA 2EFPA 3A0KA 1Z7S2 4QTRA 2CYFA 3U14A 3C2UA 3I4IA 3KEQA 4DZGA 3NAUA 3A1YA 4BAYA 5JAXA 4RB0A 5E3NA 1I6XA 4U36A 1LR5A 3RZHA 3GTKJ 2ADDA 4UI9L 5FLXZ 4NRQA 4ANJA 3KF3A 2FBHA 4QKFA 3VD4A 1W2OA 2VKEA 3WF1A 5E79C 1EKEA 2QEXI 2JPCA 4RAFA 3MIFA 4W1UA 2KL4A 4AHXA 5JSRA 5AFEA 2VH9A 1OFNA 1XJAA 2KIUA 1AX0A 1X1PA 2HXOA 5ICFA 2BBVA 1CJDA 2D97A 2VZ3A 2XRNA 4RR3C 4Q0PA 1WBLA 2X5IA 5GTIC 5D2AA 4M72A 3N9LA 4HN0A 2N8GA 1DQ0A 2NVUB 4AL9A 3RI9A 4FFGA 3VBOB 4QD2A 4RS5B 1F9KA 3POBA 1ZQ3P 4UFIA 1OJLA 4IZZA 5CFDC 1ZAOA 3IBMA 3NW4A 3HOVJ 3U37A 3QLQA 4QMAA 2DU1A 3ZFGA 2R93J 1J83A 1ZX5A 1H1IA 5FPUA 4LK0F 3H3ZA 4HDUA 4PUSA 1JJ6C 1ENQA 2IPQX 4KMUX 3ZQIA 1ZGJA 1COV2 1IJWC 4WM7B 3O1TA 3IUOA 1H4HA 1LECA 3TWIA 3FZ3A 5I0DA 4CRQA 1U9NA 1Y9GA 2G19A 3H7YA 2A6XA 1FT9A 3NKTA 3PSFA 4RQPB 1G9DA 1B8IB 2ID4A 2XWBB 2CMPA 3BTJA 3LAPA 3S15J 5JOYA 2L9NA 1RVF3 1ZBA2 1PGL1 3ABTA 1SG3A 2LF7A 4Q4W3 2VMIA 4CDWA 2FMDA 1AF9A 1JZ6A 3FXLA 4ESBA 4AF9A 4DUVA 2DVFA 1RHI2 3H1MA 4EJUA 2WQ8A 4Q4W1 2WAEA 3IV5A 2ZGQA 5A32B 3U1DA 1Z91A 3OJBA 1MQTC 4Y24A 5HPOA 4P5HA 4FQ4A 3WTWC 2C1FA 5FFXA 5AVAA 5LLQA 2CDOA 4P5YA 4WM8C 5FYCA 2DDBA 1OOPC 1OD5A 2Z9OA 3VBRA 2OS2A 4AR2A 4I76A 5FYVA 3GJAA 1WCDJ 3DL3A 4LK6A 2LSOA 2PBIA 3R4KA 5FY4A 4MGRA 4NC6A 2ZGNA 1RUC2 1DQUA 4A3DJ 5FO7B 2YX4A 2H8WA 3AKSA 3VD3A 3DYPA 3ES4A 2EIDA 2OUMA 2X48A 1TL8A 2NNYA 2BGCA 4AYUA 5IFPA 2LOOA 1W0NA 2WBKA 5A33B 3L9FA 4EQQA 3CCVI 1LQ1A 3M3OA 5HS9A 2O14A 2E7TA 3HOUJ 4CDUA 3HAGA 4Q0QA 5FMOL 5FZIA 5IOYA 3LE0A 4D9JA 4HEA2 1D4M3 1VQ9I 1FXZA 3V56A 5LBCA 4AVTA 3X2QH 4LG0A 1W9TA 2YU3A 1LRHA 1UQXA 4FCYA 1OBNA 4CCCA 2XVCA 5LGUA 3DWLE 4B1MA 2BVLA 2UURA 4D5FA 5M3FJ 1PNFA 2YC4A 3WDYA 2ZXQA 2RDPA 4O9GA 5C6CA 3MKWB 2WSVA 5CYYA 2ZJ2A 5CQEA 2P5LC 2BOJA 4V1PA 4G7HF 3OL3A 2QQVA 2DDUA 1AYN2 2K9ZA 1UXZA 3VZNA 1FV2A 2LFBA 5K8SA 3KGZA 1TBXA 1L7RA 2KIFA 2Q1ZB 5FZBA 3QH7A 5LD2C 3ME2A 1FY7A 4P9JA 1TW3A 2HOAA 1UYYA 1VBC3 2W94A 4Q1RA 1NQJA 2IGOA 2ARBA 3WUDA 1BJQA 2J42A 2WB1N 1UG0A 3QPLA 5FJ8J 3OBTA 2Q0OA 4Y22B 1ETVA 1FC3A 4WXCA 3MUZ1 4RL7A 3WGHA 1JOJA 2ADUA 2PEXA 1VF9A 2FDKA 3CESA 4P9XA 1SFOJ 3QODA 1USTA 1W3VA 1MVEA 2XQRA 1DQ2A 3PHMA 2CQ7A 4Q4V2 1KYZA 3WNPA 4XKCA 4B44A 1N77A 1E5RA 1FOKA 3E0JB 1GXQA 2XVLA 1X8MA 1QJFA 1O3QA 3RFRA 3AFGA 4OI1A 1S4CA 4BZ4A 2ME6A 1XE8A 5LFAA 1RITA 5HCFA 2OT7A 1XDUA 4JVAA 3Q8FA 1IDZA 3OYCA 3MV11 1Y9MA 1D1BA 4NPRA 5IAXA 3OSGA 3H0DA 1YFUA 4XLHA 1O3TA 2BVBA 4OI0A 4XMIA 4PZJA 2TEPA 1IN7A 3HOWJ 5BQTA 1LENA 5M3MJ 5GPAA 1QA6A 5F2WA 4NPMA 1FPN3 5KXEA 2WFF2 1FBQA 1E17A 1WD4A 3J7NA 2EVXA 2E26A 4GAZA 4AEKA 5GAHJ 3ZXAC 4HSRA 2XDVA 2ZMNA 4Q48A 2HWB3 3QPTA 4M3EA 5ERIA 1RKWA 1B35C 2V09A 1VBD2 4LT5A 2XJUA 2O6GE 4QHBA 3BU0A 5CVRA 1ND3B 1SDWA 2VBBA 2B0LA 3SC7X 1N75A 2W68A 1HF0A 1EPZA 2EIGA 1OSGA 3FXJA 1S0DA 4ZTFA 5EP9A 4OIPF 2VXDA 2AS5F 2VQ0A 2PHWA 1RUF2 4GKYA 1I5PA 4H14A 2V79A 4P9IA 1W6QB 2HU9A 2A3YA 3AXDA 3OYJA 3ERMA 4QPOA 2Z42A 4Q29A 1X9PA 3A2KA 2VZ1A 3LEKA 3OYWB 3SZPA 4GCVA 1BJZA 1DYPA 4N4NB 5FY0A 4IXAA 3T3YA 3PNYA 3K4KA 4RSUA 4XFFA 4PLOA 2VASA 1VBA3 1P7JA 2Q2EB 2ZGPA 4BQQA 1XGOA 3ZP5A 4W4ZA 3ZPLA 3B3QE 1FV3A 1QJU2 1RUH1 1W0UA 5C70A 3JQWA 2OAZA 2RC4A 1ENXA 1NY72 3BPZA 5GLVA 3DN7A 3SISA 5DV5A 3OYAA 5FIXA 2HPIA 4IV3A 4Y20A 2PHFA 3WF0A 2ETHA 2A68F 4LHKA 3UYJA 5A7QA 1OISA 2IEKA 2Q4SA 4YVWB 1RETA 3C7HA 5JWPA 5LA1A 4K8FA 5H9QA 4A6DA 1UL9A 3FBMA 4LLOA 3VUOA 1TNSA 3EHKA 5J36A 2XB0X 1W39A 5F1JA 5JLWA 3B69A 4OZXA 2Y0IA 2V72A 1DYOA 2WBMA 4QPIC 1R36A 1SLTA 4FHTA 3LIHA 3BYWA 1Y3TA 2PMUA 3WDTA 4BCUA 2L4MA 1Y8QB 4ZTJA 2KRCA 2KKOA 2XV4S 3WNNA 2DUOA 2PHXA 4N4OB 3OYDA 3MVPA 2RNGA 3F8MA 1IXRC 3QBQA 5KCMA 3RS6A 1UOGA 5HXMA 5E20A 1YJNI 4Q4Y3 3WTSC 3N7MA 2HWE1 2WT2A 4FP3A 2ZAAA 3L00A 4JHTA 5LA0A 4ATEA 4RR3B 4AWDA 3WW2A 2WWUA 2EH3A 2C26A 4TXWA 1BI3A 5TGTA 3KZ4C 4IEOA 2DQLA 9ANTA 4AIDA 3NNMA 4ITVA 1GYKA 3LFIA 3SMHA 1DHKB 2ZA9A 4AGGA 2ZJCA 5J6XA 2F2EA 4G94A 1GZWA 1V6IA 3OIOA 2QQBA 3LCPA 1GZ9A 2O0OA 2HR3A 4BISA 1A5JA 2WWYA 3DF0A 3AVSA 5FWEA 3S3NA 3QYFA 2F6CA 5GAGJ 2QE3A 5J8CA 3POJA 4UW4A 4QB2A 2NYXA 1HKSA 1HOMA 3VKNA 5G05L 4XOGA 5IVYA 2JDAA 1IO2A 3V42A 1IQDC 2DUQA 4HF1A 3HOBA 2NP0A 4CDXB 1LVKA 1Z05A 1JYNA 2PMZA 1VBB1 1OURA 2DBBA 4FPYA 3OYWA 2WS92 5EJZB 5FYZA 3BN6A 5FZ7A 1SBDA 2W47A 3ZXEA 4YZ1A 2RMU3 1K5MB 1N3OA 1K7AA 3W21A 4P9FA 1SD4A 3JBG3 5A7WB 1BR4A 4AFBA 3BIEA 2D5HA 3V4GA 3EQEA 2WNUB 1LNWA 4IV1A 4BBRJ 3ACGA 4M4RA 1XNCA 4WXDA 3UT0A 2HQ5A 2Q8OA 3MW3A 3PO3J 1Q8SA 4B3NA 4CXXA 5FR3A 3GTGJ 1TE1B 1AR81 1HW1A 3HKZN 1NE4A 4GWJA 3KCXA 3E1SA 4DUWA 3BCAA 5A3WA 1WLCA 4A7ZA 5L36A 3D5LA 1S1AA 4BDVB 4ZJZA 1QH6A 3IKTA 4ES8A 1AXYA 1OFSA 2E9QA 2C9KA 2V1DA 1Z7S3 4QU2A 2HWE3 2LVSA 3GYDA 1TQIA 2DFIA 2EV6A 4M01A 4CEWA 1PIV1 2VUMJ 1X19A 3DEWA 3SEEA 3J7AO 1A78A 1RHI1 3T2QA 3SQOA 4JCKA 4NDLA 5FZ4A 1AR72 3ZFFB 4EJWA 4QKBA 3DFGA 4L11A 3K69A 1KU2A 1O3SA 4HKLA 2CG4A 4D0PA 1UIKA 3ILRA 1QJEA 4H55A 2GC3A 1VFCA 3BCWA 2L9VA 1Z77A 4XRFA 3DBHB 5KXCA 4GYGA 4COYA 4YM2A 1JT6A 5L3CA 4U87A 2D3SA 5IVFA 3OB8A 3WP5A 4XF0A 2GH2A 1JU3A 1BK1A 5HBAA 2DPDA 2L7ZA 1W2AX 3PFYA 1UZYA 2ARAA 5F5QA 2TRTA 1OT5A 4LO6B 3S14J 1RUE2 5IT3A 5T52A 1U5IA 3OR2C 1OCPA 2A3SA 1LOFA 1Q8PA 2JKBA 3H5NA 5JHUA 1B9NA 1SEFA 4YW1A 2XJVA 4MGTA 1IF1A 1A6IA 2KIQA 3E7LA 1S29A 1T6SA 2ZSIB 5FXZA 5D8AA 3L2VA 2PLV3 2WZPP 2GWRA 2EAKA 2D1HA 3LSRA 2R041 1A6QA 5IK4A 1ZA4A 1AR62 4C2MJ 4J19A 3H50A 3JAMK 4NE9A 2NVYJ 5FREA 3E5QA 2XHKA 2UZKA 4Z8BA 2GN7A 3LSIA 3V0BA 5F39A 1N1SA 5JXIA 3O0VA 1Z6RA 3O6BB 1COV1 2KISA 3CCUI 2DCTA 4PBOA 1YLLA 1DG6A 4AVVA 5FO9B 1H8TA 3THTA 2VB6A 4PIZA 3TW6A 5FLIA 3OYIA 1WCQA 3RWKX 3CQOA 5GLTA 4YVSC 2B7EA 5FZ9A 4FPEA 5BNPA 3I3MA 4AC0A 4IUGA 3ROUA 3MUY1 1WD3A 1Q8VA 2JE8A 1X3UA 2B5HA 2FMLA 5JR2A 4AIHA 2CWMA 1LHVA 1YIOA 1HKDA 3NV3A 3JREA 1QHHD 3E5XA 4EN7B 2LMDA 3B00A 1WW4A 2DCJA 1MACA 3CHXA 3CJRB 5EIYB 2KXLA 3C2HA 5IVBA 1WJDA 1ETWA 2V6EA 3HNBM 1JXSA 3RZMA 5TJJA 3R61A 5FDBA 3ZPOA 1IXSB 2ICWG 1R1A1 1VBE2 2EFNA 4NQWA 3F6VA 4KICA 3AJYA 3TN92 4ZZ8A 1GNHA 2Y30A 5E1XA 4Q5SF 3KB5A 2JG8B 3LA7A 2KZGA 5F27A 2NVTJ 2LLKA 3S2DJ 5LY2A 5DUWA 1R082 1D0ZA 1ZELA 2VO5A 3MIHA 4C3IJ 3JRAA 2A1XA 2M7BA 5JIUA 1PUFA 3W58A 4DO0A 4LUMA 4BIFA 1E3PA 3CMAI 4Q4X2 4ZYEA 2V26A 4NIAA 1YITI 1Z7UA 5JSPA 1SDDB 4RGRA 4QX7A 2O9LA 3KV9A 3BOQA 5K5QA 2W25A 3KEYA 1ZLJA 2YS9A 4EJTA 1YI9A 4HX8A 2D2WA 4NMIA 2QQWA 2FZ2A 2ZZQA 3AB0A 5A6XA 1RUF1 1XG1A 2JDUA 5HDNA 4XK4A 1CAUB 4C8DA 5M5WJ 4P9GA 4XJZA 4AQ2A 2W0XA 5BNNA 3O8HA 1EV13 4GMP3 2EICA 2QNKA 2OPKA 4QPIB 3VKMA 1O59A 2W39A 5JOZA 4Q0SA 4B8EA 1OC1A 5HODA 4CP9B 2J1UA 1NCQC 2V4AA 1QQP3 3RNSA 3ASIA 1WPKA 1P9QC 5GZDA 4Q4V3 2EIMH 1HDKA 1R4NB 1KRIA 4HL0A 4JDNA 2NS8A 1YJLA 5DZEA 5JLXA 4NRPA 4W50A 4QXHA 5FOJB 3HSEA 5FFOC 5D1IA 4DS0A 2UV1A 4YW2A 4Q4X1 5ANNA 1UZWA 2VUDA 1HSJA 2XH6A 4JRAA 1C8M3 5T5OA 4AHYA 3TDUC 1NOVA 2PHLA 2KZVA 3I2JA 2EIBA 3CC2I 3WF2A 2M8EA 1EPWA 2LY9A 2E60A 3S3MA 2GIVA 2K3PA 4RM2A 2WN2A 2LR8A 1G4DA 1PZ7A 2I5UA 2ZX2A 2BRTA 2QQIA 1AL22 1Q56A 3GTQJ 2DXIA 3C7JA 5A80A 2ZXWH 1BXHA 5IW0A 3I9V2 3M3IA 2HYGD 2JDKA 1FPN2 4PLMA 3ES1A 1VZ0A 4BQYA 3KX2A 3K70C 3NV2A 3PVNA 1H8TC 3WNXA 4AQSA 4A3MJ 3OYFA 5HDKA 1C1FA 4KWUA 2Q8DA 1JZ2A 3GFJA 4GO1A 4UUSB 2ARXA 4DMIA 4MEYF 1W6MA 1UY4A 3PL0A 2JXAA 3T0AA 2ESHA 2LH9A 1SD7A 3WTZA 5B1AH 1OA4A 3WU1B 1OR7C 2WFF1 1P6RA 2V4JC 1V6KA 4HKOA 1GBGA 5C71A 4XIDA 1MMSA 1ZG3A 5FLVA 2MFZA 1YJ9I 4AEDC 3FISA