3I59A

Crystal structure of mtbcrp in complex with n6-camp
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
224
structure length
215
Chain Sequence
b'HMDEILARAGIFQGVEPSQLQPVDFPRGHTVFAEGEPGDRLYIIISGKVKIGRRAPDENLLTIMGPSDMFGELSIFDPGPRTSSATTITEVRAVSMDRDALRSWIADRPEISEQLLRVLARRLRRTNNNLADLIFTDVPGRVAKQLLQLAQRFGTQEGGALRVTHDLTQEEIAQLVGASRETVNKALADFAHRGWIRLEGKSVLISDSERLARRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, Crp/Fnr family
publication title Structural Insights into the Mechanism of the Allosteric Transitions of Mycobacterium tuberculosis cAMP Receptor Protein.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Dna binding protein
total genus 62
structure length 215
sequence length 224
ec nomenclature
pdb deposition date 2009-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3i59A02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3i59A01
2V6CA 3I54A 2FXAA 4LB6B 2H94A 5C8WA 4KL1A 2HEOA 4RB3C 4LFUA 1G6NA 4KA4A 2HKOA 1J59A 4EWAA 4WVZA 2HFHA 3DL3A 5K1YA 4HA8A 4Z2YA 5IT3A 2GXBA 2M1BA 4KFCA 2HYGD 5HDNA 1CAXA 2EFPA 1DZTA 3QACA 2VE8A 2UXNA 3PFIA 2XKOA 2VE9A 4NVPA 5BMZA 2O6GE 3FZVA 5K5OA 5KVRA 3HOTA 2A68F 2HOEA 2VBZA 4ORFA 4AWXB 4EROA 2W85A 1OPCA 2YSRA 2GIVA 4BHPA 2FBKA 4HBLA 1R22A 4WXHA 3SHRA 1T98A 2PEXA 1ZG3A 1QO0D 1UFMA 3HRTA 3K0LA 1F5TA 3HT2A 5FD5A 3QPHA 4GXOA 3GVAA 2KKOA 3MZYA 4G94A 1T0FA 3GUDA 2FBIA 3BOQA 1SFNA 5IT9Z 4AIJA 3FM5A 4E2QA 4O9GA 4XFGA 2IC1A 1DPRA 2RVCA 2PFWA 5BPXA 1S7OA 3GFIA 4I0BA 1NXMA 5FFXA 1I27A 1KA8A 1XGNA 2GC3A 1YUDA 2PJPA 2WFPA 4LULA 1BIBA 2QWWA 2FRHA 2ZMEB 3TO6A 3I4PA 2VBWA 4H7LA 1RUNA 1FXZA 3WE2A 3SFZA 4A6DA 2V9VA 5H6QA 4BH9A 1IZ1A 4ENKA 4IXAA 1IXSB 1G3WA 1IF1A 2PAEA 4UUVA 4IEXA 1YS7A 3GFMA 1DZRA 3PVBB 4KYWA 3CEWA 4HX8A 3ACLA 1BC8C 4XETA 3H8UA 1TBXA 1LQ1A 3CUQC 3BP8A 4BHCA 1MKMA 2OQRA 5JAXA 2GA2A 4UBGA 2G7HA 4E2SA 2VBYA 4A6EA 4CICA 1MJAA 1F1ZA 3IKTA 2IXLA 3RTRA 1WLTA 3ERED 5ILVA 5EFUA 1X8MA 4BXUA 4MEYF 2EFNA 1XMKA 4AIKA 1Q43A 3KEOA 4B29A 5D1IA 3O3KA 4F8AA 5I8TA 2L3DA 3ES4A 4O5VA 3UKVA 3MZHA 3TNQA 4PIYA 1P4AA 4U7BA 1K6OA 2XUBA 1H1MA 5KHIA 3R6SA 5FO5A 3HTSB 4L2NA 1J3RA 4UXAA 1ZAOA 1SMTA 4G6DA 1HW5A 4AXOA 1YFYA 4L0YB 4CHUA 2O03A 4UVCA 4WK8F 4RB2C 5BUVA 1H9TA 1O5UA 3ELNA 3KGZA 4FHTA 1BI2A 3H1MA 4HV5A 4WWCA 4A0ZA 4EM0B 1K78A 2FOKA 2F5DA 4IVNA 4HLXA 4HOBA 4P9UA 2QQAA 2QENA 4P9GA 5LGTA 4LK0F 1AWCA 3IC7A 2D1VA 4PJYA 1WKMA 3TO9A 1OYWA 4OINF 3ULQB 2IW5A 3ELKA 4UHTA 1FT9A 1K79A 4ONUA 2ZBKA 1ZVFA 3GZ6A 3CO2A 4HW0A 4IHSA 4PIZA 1A04A 2VODA 4HVRA 1YW7A 2ESHA 3COAC 1C0WA 3KP5A 4CZZA 1ZLKA 4F7ZA 3WW4A 2MH9A 4KDPA 2KJCA 1USSA 4IEZA 1K78B 4ZYDA 3JW4A 2AS5F 5E18F 2MHFA 3OGJA 4LK1F 5LHGA 2XL9A 3EJKA 4OIQF 3GLXA 5FPZA 3ECOA 4IPAA 5LGNA 2Z5UA 2RQPA 4ZYHA 3OTFA 3WU0A 3BJ6A 3C18A 5KHKA 4EM1A 2KIMA 2FE3A 1KU2A 1FZPB 2FBHA 4A5NA 3M8EA 2HYFA 3JSPA 2IVMA 2D5HA 4YG2F 2JRTA 4AD9A 2X4HA 3CTAA 5FGMA 4EQQA 1LNWA 3H1WA 3OOPA 3R4KA 1OYYA 4HF2A 2Y75A 4LA2A 1IPJA 2N7GA 1ON2A 2H6BA 3SCFA 4EJUA 4FX4A 4CXFA 4R52A 2DPUA 3G3ZA 3OV8A 4EGZA 2YX7A 1S3JA 4Q0QA 3K1NA 1PP8F 5ICCA 1J0RA 2DTRA 3F23A 5D6EA 4MQ9F 2Z69A 1ONVA 4EVIA 4K8FA 2ESNA 2RNJA 4LMYA 2O1QA 5JR7B 5K5QA 3ZQ7A 2H0VA 4PCQA 3ZMTA 4Q0UA 3KSCA 1I1GA 2XAFA 1FP1D 4FBFA 1V70A 1OR7A 1FNNA 4IESA 3MCZA 4RS8A 4Y15A 4KIBA 4X6QB 4RD7A 4X6RB 1OFNA 1EYBA 3NQOA 2BNMA 2GA1A 4U0VA 2NNNA 5D5WB 2DCTA 3H7YA 1P4WA 2LF8A 1QZZA 3V7CA 1FX7A 3LQRA 4KU8A 2EB7A 3REOA 3M1EA 1HKSA 2KIUA 2RKHA 1CAUB 2STWA 4QGMA 4YIIA 1JUHA 2QYOA 5CVVA 1UIJA 1R1VA 4WXDA 1K7AA 4LLLA 3U0ZA 1YW9A 3K2ZA 4HAMA 5CVJA 2A61A 1JE8A 3NW4A 1CF7A 4LLNA 4MNUA 1XGSA 5K5RA 3BPXA 3L09A 4KWJA 4NB5A 5FFZA 3NVCA 2LF7A 2GZWA 3UKTA 2H6CA 1YYVA 2B0LA 4HF0A 5DCMA 3S7IA 1NE6A 2ATFA 1FSEA 1H9GA 1SQ4A 5I0TA 5L3BA 3RI4A 2LDUA 2L54A 2GXGA 5KBFA 1BM9A 1SAXA 3OD0A 2IXHA 1HQCA 1CAWA 5E16A 4RGUA 1MGTA 3CUQB 1G4DA 3CO6C 4OFGA 3FMSA 2GWRA 2GC2A 3BJOA 4OOIA 1X82A 1J3PA 2UY8A 2QVOA 4KIFA 2XAJA 2XIGA 1U2WA 2UYBA 4PIXA 2M5WA 1J9IA 5D5VB 1QPMA 1J58A 3BJAA 3HOSA 4J1XA 1Z7UA 3ZPLA 2OA2A 5K8SA 5H20A 1CAWB 4AVBA 4M9SA 4ZU5A 3IL2A 5A2QK 3MAJA 3IWZA 4EJOA 4RAYA 4AVAA 1CAVA 3J80Z 3DQVC 4XFIA 4BIFA 3LZZA 5L3EA 1U8RA 2UWMA 2CAUA 1UW8A 2PYTA 4AVPA 5LBQA 2CGPA 1NYWA 1D8KA 4FAHA 3KP7A 3JAMZ 4HQMA 2F5CA 4RGSA 3TNPB 1W7PA 5L3GA 4XLNF 4ETSA 3RYKA 5L3DA 3SZPA 4GULA 1IUYA 2B5HA 4ESBA 3DF8A 3KP6A 5D8LB 3FF5A 1T39A 3WW2A 3ECHA 4KUMA 1CAVB 4UVBA 4RAZA 3R0AA 1TQPA 4K2EA 3C3WA 4YFKF 4LTAA 5BY5A 3H3ZA 1RL3A 3O2PE 4HX4A 2L01A 3QU6A 4O9EA 4MGZE 3VFZA 4BYYA 2EV6A 3RNSA 1NHAA 3LAPA 3MFKA 1GQHA 4DINB 4G7OF 1YG2A 5CU1A 1IPKA 2CYYA 2QLZA 1Z1DA 1W7PB 2XLAA 1UB9A 2X0LA 1U78A 1Y0UA 2BBYA 2DLLA 3U2RA 3HSEA 4KMFA 1MZBA 1B9MA 2PBIA 3LWCA 4DNCA 3IIAA 4S04A 5FCCA 2HTJA 3LFKA 3ABTA 2WWYA 1FLIA 3R0JA 5D5XB 3FHZA 2VOOA 2K02A 4LG0A 1L3JA 1MD0A 4M6YA 1W4MA 4YRDA 1LRHA 3LA3A 4IETA 3C1DA 5ILUA 5DUIA 4AIHA 1PUEE 1ZZ8A 2M87A 2BNOA 4QM9A 1X8EA 1WA4A 5JR3A 3GFJA 5FLXZ 1YIOA 2L02A 2XASA 4J1WA 3JSOA 5FD6A 2WV0A 5HOOA 3QU3A 2JSCA 2HS5A 2F5FA 4O6JA 2XHKA 4LG0B 1XGMA 3V7SA 2W25A 4M9ZA 3WODF 1F9NA 1NZCA 2J5PA 4MGRA 2R3SA 3KE2A 2A6EF 2RGVA 1J2XA 2XLFA 4S05A 2ZNYA 3BZ6A 1P92A 3D0SA 1LVAA 3MQ0A 4U0WA 3QAHA 2KJBA 2HQNA 2B9UA 2BE5F 2C6YA 4KT5C 1ZLJA 3H9AA 5I93A 1YFWA 1ZNPA 3VHRA 2WC2A 1CAXB 1J5YA 4HVQA 5FLJA 4HZFA 2IPQX 3F6OA 2P6TA 1T38A 1XE7A 4JQFA 3RPQA 1IAWA 1FYKA 5A2QZ 1Q1HA 1R23A 2H27A 3T0YA 2VT2A 5E1WA 4LB5A 3K1MA 1JGSA 3EHKA 3I0TA 4MTDA 3WW3A 5TRDA 2Q0AA 3WTYC 4KWKA 2F5EA 2HWVA 2IRFG 4Q47A 4QXKA 1STZA 2LKPA 3VODA 2FU4A 3F8CA 3ETQA 2HKXA 2VPVA 2B8MA 4XF0A 3SQNA 1W5SA 2XKPA 3F72A 4EV0A 4CDGA 5ED4A 1CGPA 1ZREA 3UKNA 4XRFA 2DO7A 3DFGA 3FX3A 3FWEA 2V1UA 5J3UA 1BOAA 3WTUC 4BQAA 5HLHA 2LSOA 2JZYA 3FXRA 1SFEA 2TDXA 1U12A 2PAMA 1R5GA 5BOXA 4R8HA 2G9WA 3BPZA 4QGLA 4UBHA 4I0AA 1QBJA 1O57A 5DUKA 2KIFA 4HSJA 2ETEA 2AXLA 1W7PD 3QP6A 2O3FA 2PTMA 1IN8A 1TW3A 2H09A 1VP6A 5KHHA 4RGXA 3L2HA 1BI1A 4IEYA 1R58A 3TGNA 2ET1A 2UZKA 2OBPA 3ZN1A 3WTWC 2NYXA 4MTEA 4A12A 2VXZA 2XGXA 1YW8A 3F6VA 2F4PA 3M3IA 3S0MA 4M74A 5HS9A 1SEFA 1J3QA 1TTYA 3NKTA 4EMSA 2C0ZA 2MPFA 4AQ6A 3CJNA 3TQNA 3KZZA 4MQVA 1IN4A 1S7AA 2ACJA 5KHGA 2QBYA 3GF2A 3F8NA 1FBQA 3GBFA 1NE4A 3V4GA 1IN6A 3KMHA 1EY2A 1LJ9A 1R7JA 4KIGA 3T5XA 4ENMA 3KZYA 1SFUA 3IRRA 5BPIA 2O8XA 2WTEA 5T3NA 1O3TA 2EWNA 3P9IA 3HSRA 4BAYA 4KWLA 5E20A 3EYIA 3QOPA 4ASNA 3FMQA 1G3SA 1Z05A 2P5VA 4HN0A 1U5TA 4ZH4F 5DEQA 3SHFA 1FOKA 3E6MA 2EV0A 5LRRA 2ET7A 5DV5A 3F21A 4YSFA 4NQWA 5TJJA 1U3EM 4OMYA 4L5IA 1FC3A 1TQ5A 4HVOA 4IEVA 3J80K 3EETA 1J75A 3N97A 4ESFA 1Z6RA 4D0PA 1BI0A 1JXSA 4CO8A 2Q1ZB 3ZDSA 3MPBA 4N9HA 3V8LA 3NRVA 1HKTA 2EVXA 2JPBA 2IP2A 1R1UA 1QY4A 2ADUA 4LD5A 5D4SA 3JAMK 4MUVA 4UV9A 4PZJA 3RYRA 2MC3A 4E2GA 2P5LC 2K7LA 2DK5A 1OD5A 4G8XA 3KP3A 2MBFA 2L4AA 4P55A 1QNTA 4L5JA 3MWMA 4YYOA 1FWZA 1YFUA 2GQQA 3KGLA 2GC1A 3OF1A 2IXIA 4IEOA 1RTVA 2VBXA 1QXRA 4Q29A 3WGGA 2IJLA 4XF4A 1SFXA 2LNBA 3IWFA 4AQ2A 3WTVC 5FQ0A 2UYAA 5FB2A 3BWGA 1PM7A 1TNSA 2HGCA 2O0YA 4A0XA 3EDPA 3LA7A 2K9ZA 5DDGA 2PQ8A 1YFXA 4KICA 1EPZA 4I3PA 5CADA 5ICFA 1MDMA 3WTZA 4YFXF 5JSRA 5HDGA 3O6BB 1QQIA 4L0ZB 2Q0OA 5I91A 3QP5A 2CQKA 2M45A 4U88A 1ZRCA 2PA7A 3WTTC 1XCVA 2DQRA 2Q2EA 1YO5C 5FQ0B 5BQTA 1H0MA 3LA2A 1SD4A 1XSXA 2CO5A 4O3MA 4HBNA 3O14A 2HTSA 3KP2A 2DT5A 3HSFA 4PGHA 4WF2A 5ERIA 4LEJA 5FLXK 3ML6A 3H7JA 4QM8A 4XFHA 4Y13A 3BALA 2QQBA 1JHFA 2A69F 4ON0A 3KEQA 1DDNA 4N0BA 1ULYA 2EA2A 3P9CA 5HDKA 5L3CA 2PHDA 3ISPA 1WQ2A 5I0UA 2F2EA 2E1CA 1B6AA 1L0OC 4LGWA 2ISYA 1Z6TA 2D40A 4P96A 1HW1A 5EZWA 3T8TA 3K9TA 5CJ9A 3SZTA 2BNNA 2VT3A 3BDDA 4PGGA 5C6CA 4L9TA 4U0YA 1CF7B 1P4XA 4A5MA 2V79A 2VC0A 4JTNA 2EFOA 2O61A 2XV4S 4MGYE 1ZYRF 1SD7A 3C7JA 3F8FA 5D8KB 3AAFA 3L9FA 4Z07A 2G7UA 5DCMB 3J7AO 2QNKA 4UVAA 3CDHA 2CW0F 3JZVA 2RDPA 4XFAA 1SMYF 4TV7A 2IA2A 3VEPA 1WI9A 1R00A 2RV8A 4HSLA 2MNGA 1R1TA 2ZNZA 5JVTA 1ZZCA 3KFWX 2IT0A 4MV2A 3PLQA 1IXCA 3I59A 3E97A 3MDPA 2K86A 3V7RA 1XRUA 5BV6A 2M8EA 1DPUA 1UPIA 2DBBA 3I71A 2QCSB 1USTA 3E6CC 2R7FA 3EQLF 1O3RA 4TLFA 4IERA 3GEZA 1Z9CA 4YARA 2DAOA 1MJ9A 1P6RA 2HR3A 1UD1A 3M70A 2J5OA 4HX7A 3LOIA 1GQGA 3FHIB 1YTYA 1R5HA 4GYIA 4N9IA 1XE8A 4NHJA 2EA4A 3EO6A 3KLOA 2BEOA 1PDNC 2PHLA 5JFRA 3S7EA 4EJWA 3D0JA 1ON1A 1IN5A 1XN7A 3KP4A 4KN4X 4L9JA 3RKWA 1B59A 1UIKA 3HQXA 2FMLA 4Q48A 2E7XA 2XAQA 1FYLA 4MZUA 2OA4A 5ICGA 1AOYA 3SXWA 2NRAC 1XSVA 1RI7A 1P2FA 4HQEA 1CX4A 4EGYA 3F8MA 2BGCA 2CAVA 1FBSA 1QGPA 2EV5A 3FXUA 4A2UA 2XVCA 3JTHA 3D82A 3WU1B 1UHMA 3E3VA 2EFWA 3DPTA 3CF6E 2MA3A 5E8GA 5ICEA 3H3UA 3K1PA 5F64A 5BS6A 4R79A 1OMIA 4RB1A 1Q5OA 3J81Z 3U11A 1WRJA 4QGNA 2HQRA 1LKNA 2M30A 1S6LA 5FDBA 1D5VA 1GHCA 3RPUA 1O4TA 1BIAA 3TDUC 4WZCA 1FBUA 1R36A 5F6FA 5HS8A 1FSHA 1OKRA 2IA0A 1B9NA 4RGRA 1LDKB 3TDZC 2CSOA 4Q5SF 5AONA 1TLHB 2ZCWA 3Q9VA 3IBMA 3HRMA 3G7DA 4UNOA 4FAGA 2OZ6A 3USSA 3R61A 4HMZA 3KETA 5CVRA 1EP0A 2P5KA 2Q4SA 2D2WA 5HLGA 1GXQA 4FT8A 2EK5A 2XRNA 1ZRDA 4RB0A 3I5UA 4I09A 4IHTA 1YWKA 3WE3A 1WSUA 5CVUA 4I02A 2VQAA 1BI3A 3ROUA 1H1IA 4XFCA 1KU9A 5I0SA 5DYMA 1FY7A 1QZYA 3KLNA 3L7WA 2ZJ2A 2CWEA 3WGIA 4JK1X 4R1HA 4G6QA 2GC0A 4HV6A 1S8NA 4I98B 2QVSB 3N4MA 4XFFA 1LEAA 4ZZDA 4L18B 1ZZ9A 2ELHA 1REPC 2Z2SB 2JPCA 3HHGA 1TW2A 4XBFA 3OCPA 2OQGA 2OZUA 1HSJA 3E6BA 4MHGA 3EYYA 3NJZA 3KCCA 3NSTA 4CYDA 3RJPA 2ZMEA 2QJVA 4WBBA 1EH6A 1YS6A 2FNPA 2A3SA 4MGKE 2GAUA 4META 4QMAA 3P7NA 5HVQC 2FEZA 3DEUA 5I8SA 4UV8A 5JCTA 3S2WA 1ZN2A 2YPRA 2P17A 4IEWA 1J7KA 4QLCU 2D45A 3M7GA 5EEGA 3FXQA 1B4AA 2VONA 4D7SA 2FQPA 5J8CA 2P4WA 3F8BA 5LRSA 2ZFWA 3NEUA 4OMZA 1YQAA 5E1ZB 5LLQA 4Q0VA 1IRGA 2MLGA 3DXJF 1ZG5A 4QX5A 2CFXA 1ZRRA 3GX4X 3HRUA 4G7HF 5I0RA 2YR2A 5DD4A 4L11A 2KXLA 3FE5A 2OYZA 5DCFA 3ZMDA 3WTXC 2Z33A 1FYMA 3WW1A 2JT1A 4M9XA 1XSDA 2QQ9A 3BU7A 3E6DA 3RZZA 3F22A 2NNYA 1KQ8A 4KU7A 2IA1A 3ZMUA 4JV4A 1WWXA 5D6FA 3DPLC 2Z9OA 2K0GA 4ZZLA 1EH8A 2UXXA 3W6KB 1ZGAA 1XDSA 1O3QA 2O8QA 2DFIA 5HI0A 4AVCA 5D4RA 1GVJA 5JI6A 4IJAA 1KYZA 1D3YA 3HTUA 4GCVA 4OIRF 2PMUA 4E70A 5CVIA 4MGIE 1DGRA 2HJIA 2V1XA 4ENJA 2ZO4A 4KMUX 4EWEA 5DD8A 3PNAA 1RZ4A 1SD5A 3U10A 1KU3A 3R60A 1XB4A 1XGOA 3GW2A 1ZGJA 3HT1A 2NAZA 2K4JA 4XF3A 4H0EA 1QWRA 4GYGA 4I2OA 2CV6A 5J7MA 1UHWA 4GGGA 1F4KA 3E5UA 1PP7U 5L3FA 3HHHA 3B02A 2PFBA 3H92A 4DQ2A 2L4MA 1RC6A 2DW4A 1V4RA 4IEPA 1G3TA 3GYHX 2XROA 4XFBA 2EFQA 2K4BA 5CYVA 1BJAA 4ZU4A 2D5FA 4HDUA 3B73A 3H50A 2I45A 2QBYB 2A6HF 3HIFA 1IW7F 2E9QA 5E1RA 2VOPA 1VR3A 2EA7A 3Q9SA 2OAZA 2GH2A 4WCGA 4KNYA 3HYIA 3JTGA 2FQ3A 4Y17A 4MEXF 3RKXA 3ST7A 4OU0A 5KK1A 4MX3A 4M6XA 3FFQA 3M9AA 2K27A 3WTSC 1ZZBA 2COMA 1XD7A 2RN7A 4LLGF 2PN6A 3BCWA 4JTOA 3I64A 2PAKA 2JTVA 2VECA 1YLFA 2OPKA 2GU9A 1SD6A 3WGHA 4PDKA 1U5TB 4XSXF 5CLSA 5LEKA 1UCXA 1RUOA 4OIPF 2KRFA 2W57A 1I6XA 1V3FA 1KYWA 3H1YA 5FLIA 3W6JB 4HDVA 4ZYGA 1FPQA 2QZ8A 4HF1A 1HXDA 3ZMSA 3V8KA 1FP2A 4IF4A 2FSWA 4Q0PA 4XEZA 3T1BA 3IKVA 1RNLA 1S29A 2V1DA 2PLYA 1RGSA 3GXOA 2PI0A 5HLIA 1XDUA 3QPTA 3LSTA 3GYDA 2W24A 1T2KA 1LR5A 4YFNF 4WX9A 3EQEA 5KHJA 1O7FA 2ETHA 5LGUA 4ESJA 1BC7C 3CL1A 1VTNC 1HKQA 4P9FA 4IRIA 3DN7A 2DQLA 2A07F 2ZKLA 4B09A 3SCGA 3SMHA 4IRHA 1XMAA 4G7ZF 2P7VB 3GO5A 1D8JA 3E5XA 3EUHA 3ABUA 5FLHA 2EJRA 1XCBA 3GZ5A 1IRFA 3ZMVA 1KQ0A 5J6XA 2XL7A 1BBYA 5JHUA 1MJBA 3Q5FA 1YLLA 2FF4A 3BPVA 1CAUA 2OZJA 3MYXA 5BXXA 2PMHA 5H6RA 2E1NA 2YX4A 3V8JA 2P8TA 4UXNA 3J81K 1Y9QA 5EEHA 3ZN0A 1ODDA 3NL1A 1GXPA 4HN1A 3I58A 1J1LA 2QDRA 2PQQA 2Z99A 5E1XA 5LHIA 1B1BA 1MDMB 3E5QA 2DK8A 2E7WA 2HZTA 3WG9A 1DP7P 3IRQA 4WXCA 4JVAA 1OYIA 2P6SA 3FM3A 2CG4A 2EAAA 4LA3A 4LLOA 2Q30A 6PAXA 5BPDA 3PQKA 1ZZ6A 3DV8A 1E17A 3CUQA 5JSOA 3HRSA 1G3YA 2DU9A 3GWZA 1UCRA 3GFLA 4XF1A 1IXRC 3ZP5A 3IHUA 2UY9A 4YIFA 4D7TA 3U1DA 2D1HA 3RYPA 5LHHA 4A0YA 1IN7A 3I53A 4I7HA 1Q3EA 4KN7X 3LQQA 4OLLA 1JHHA 3I7DA 3IDBB 4HLTA 2DPDA 1BN5A 2ISZA 2YU3A 3QRFF 2R7DA 4G9YA 1TQIA 1RIOH 2XLGA 3EBRA 1ZZ7A 5JSPA 3TKYA 2NS0A 1HW2A 1LDJA 5FPXA 4JBAA 2QUFA 3CLPA 2P7CB 4FX0A 4L9VA 3TOAA 2RC4A 1LDDA 1X3UA 3D5LA 3VOEA 4IRGA 1E2XA 3TO7A 4IEQA 1YFHA 3MEXA 4EWDA 2MH2A 3PQJA 4M72A 2BYVE 1HBXG 1VJ2A 1ZX5A 1O3SA 4MH0E 2ZXJA 1KQ9A 2ZKZA 3T8RA 5IT9K 1T6SA 4M71A 4Q4ZF 1LEBA 4GO1A 3SCHA 5ILSA 2FA5A 3FZ3A 4I01A 5F1RA 4HYEA 5E17F 1KGSA 1DGWA 1YHFA 2XAHA 2IXKA 2DI3A 2MLKA 3CJXA 3U9GA 1ZH5A 3L2CA 2Y0OA 3K69A 4XLPF 3HUGA 3ZMZA 3LAJA 3LAGA 3VB2A 3RDIA 2D93A 4BNCA 3BY6A 4LUKA 2HDCA 5E8IA 4L9NA 1TQMA 3I59B 3LWFA 2A5YB 3SXYA 5LEJA 1I1SA 5J48A 1QXJA 3CUOA 3RIRA 1WGPA 4Z82A 1FI2A 4XF9A 1U6GA 1O5LA 3C3VA 4EJTA 2Q8KA 3ES1A 5HS7A 1I5ZA 1Y3TA 2W84A 1Z91A 2FMYA 2Y0MA 4M73A 4Q0SA 1HSTA 2MD5A 1W5TA 2V09A 3RKYA 5AVPA 4ZYEA 2VC1A 2FNAA 2IXJA 4HLYA 5AIPA 1KU7A 3BB6A 3TOBA 4OIOF 1DUXC 1O7LA 1TNTA 4CGZA 3DP7A 4YNIA 3CO7C 2STTA 2QM3A 2XAGA 1ZRFA 1EH7A 4ENNA 2OD5A 1PMIA 1L3LA 4P5OA 4XSZF 3P9KA 4U7DA 2PG4A 3BROA 3IDCB 1EV7A 4IEUA 1ZARA 3G73A 1LB2A 4LJZF 2OU2A 1ZG1A 2Z3YA 3DKWA 3M8FA 2VN2A 2IXCA 1U5TC 5AIQA 3FMRA 2Y48A 5J8FA 4ZU7A 2BV6A 4BHBA 4EJVA 4QWQA 4EM2A 3L00A 1ZHFA 1OI6A 4LUMA 5D5UB 3CLOA 3F3XA 4B8XA 1X7NA 5I8YA 3FJSA
chains in the Genus database with same CATH superfamily
4XJ9A 4XLCA 5C8WA 4KL1A 4RB3C 3K48A 1UYZA 4KA4A 5FR3A 2HKOA 4XUOA 1J59A 4NROA 3MGUA 4EWAA 4Y5TA 3PIOF 3T3YA 4AGVA 5L9VA 3K3OA 5IT3A 2VW2A 1ETXA 2VU9A 1REDA 3LDRA 4TYSA 1NZIA 3E0JB 2A05A 5HDNA 1CAXA 3ZKUA 3V42A 1VFCA 1HV0A 4F3QA 3POJA 2D44A 3POWA 5K5OA 1YJKA 4XUQA 1NQJA 4C3JJ 2A68F 3IMMA 3POIA 4AWXB 1GUUA 1ASJ2 1OPCA 2YSRA 2WZR2 1JTYA 2FBKA 4HBLA 1YQ5A 1R22A 1HN0A 3AYDA 1QO0D 1UFMA 1YYNA 1Z7S2 3PSFA 1CVNA 3LIGA 5F0FA 4A6SA 4AUXA 3MZYA 4KBZA 4ZS2A 2DA1A 3AP9A 5FZ4A 1ND3A 3FBNB 3AJYA 1G9FA 1W36C 1DPRA 4BKXA 2VNVA 4QXBA 3AFGA 2XJRA 5GPCA 3KYDB 2VMIA 4A6OA 3H8XA 2DDUA 4A7ZA 2XPVA 3ZFEB 1I27A 3ZN4A 1BR1A 1KA8A 1VBA2 1WPKA 2AREA 2GC3A 5IVFA 4XCAA 5IVVA 3S5AA 4LULA 1F31A 5E88A 2QWWA 1VBB2 3JRGA 2FRHA 3TO6A 1W8ZA 4RA0A 1H8VA 1NK3P 2PHXA 5F37A 5H6QA 2DURA 4S2HA 5GLZA 1IZ1A 2CYFA 2K2SA 3T1MA 3VBSA 1G3WA 3W20A 4YGCA 4E7SA 1IF1A 4UUVA 4IEXA 4CUBA 1ZM1A 3J7ZI 3PU3A 3KEYA 5IP9J 1PIV3 3AL6A 4BLJA 2E60A 2ZPXA 3HEFA 2XB6C 1LQ1A 3AL5A 2JA7J 2OQRA 4OHZA 3HZJA 1JS9A 2VBYA 4A6EA 3BUCA 2WKKA 2DA7A 5T5JA 3BR5A 1F1ZA 4LK7A 1WLTA 5EFUA 2DU1A 2EIMH 3VDXA 3I3EA 1AYN1 4AIKA 5BNNB 3KEOA 2ZGSA 5A7WA 1ENSA 5C44J 3AP7A 5I8TA 2BVBA 1Y6IA 4O5VA 4DZJA 5EYYA 2B45X 3JRCA 2OCEA 1K6OA 3M1HA 4IO9F 2IVIB 2KQRA 3PJQA 3R6SA 1NKGA 1S0DA 4AXOA 5EHDA 1YFYA 3ZIXA 2X1CA 1H9TA 1RMU3 1O5UA 3MKLA 1BI2A 2RS51 4HV5A 4WWCA 5LA1A 4EM0B 1V6KA 2F5DA 4IVNA 2R1DA 1FNZA 1UWWA 1GP5A 2ZHNA 2FOWA 4HLXA 1YI2I 1X4OA 3CCMI 3IC7A 2D1VA 4PJYA 3CMYA 1OYWA 2IW5A 1FT9A 4F91B 5F5IA 5T52A 4AW7A 1FMWA 2W00A 4MADA 5LB6A 2HEYF 2ZBKA 3HBLA 3CO2A 2HPIA 4UWDA 1VQOI 1JUSA 4C8DA 2ME0A 2W4SA 3SFIA 1V9U3 1YW7A 3COAC 3KP5A 1ZLKA 3OYWB 4F7ZA 3WW4A 2HOAA 2MH9A 5FY7A 4KDPA 4ET7A 1R4MB 3JW4A 5FO8B 1IDYA 2MHFA 3SH5A 2XL9A 3NV2A 1VBC3 4OIQF 2Y31A 3GLXA 1S0FA 3AZWA 5LGNA 1Y43B 4ZYHA 1LOFA 2E2HJ 5KAFC 1H8AC 2OQ7A 5ACA2 2KIMA 2FE3A 3I3MA 2X9DA 2EZLA 3CCEI 4A5NA 4ARXA 1QOOA 3PMEA 4YGBA 2D5HA 3ZXGA 4FPFA 1LNWA 4XKVA 2X48A 2Y75A 3FXJA 5A3UA 3CMEI 4D69A 4QXCA 1QPIA 2N7GA 1AYN2 3RG0A 1X3WB 4CXFA 1QA6A 3SCFA 4HFSA 4G12A 1BMV1 3MF6A 3SC7X 3OV8A 4P1WA 4ZJZA 1ULGA 3KV6A 2YX7A 3PHMA 4A3CJ 4Q0QA 3K1NA 1PP8F 2WZ8A 2WYSA 5EXOA 5D6EA 1TNFA 1RUC1 5JR7B 2O1QA 2RHPA 3PTYA 3ZQ7A 5A3OA 3RCOA 4EN9B 2YS9A 5B1BH 1QVTA 1V70A 3JCUC 5FZOB 3RI8A 4QX0A 4DXZA 4IESA 4Y15A 4KIBA 5E3LA 4RD7A 5BNGA 3MW4A 2BNMA 1K5MB 2R7RA 2IGOA 2NNNA 4UAPA 1P4WA 1HRV3 1D4VB 3V7CA 1FX7A 2WB1N 4CDQA 3VBUB 2WINB 4F93B 3LSMA 1OF3A 3M1EA 3Q0WA 2KIUA 4J19A 3NAPC 3H9JA 4YIIA 1POGA 2EILH 3AFKA 4AM3A 1K7AA 4LLLA 3U0ZA 1YW9A 1F9KA 4HAMA 2K9NA 2OJED 5M5WJ 5A33B 1JE8A 2RG4A 4AEKA 3AL0B 5JLWA 4CZSA 1VQKI 2BUKA 4KWJA 4NB5A 4DPNA 4QQOA 2LF7A 2GZWA 3O1SA 1DHKB 2H6CA 3KHBA 5DCMA 2HYJA 1NE6A 2ATFA 1NG7A 2QKLB 1Q8SA 2L54A 3U1KA 5HCFA 3ZLIA 5KBFA 2YBKA 1A78A 1A5JA 1HQCA 5A3WA 1MEC1 1BVVA 4CXWA 4OFGA 1U9OA 1HXS2 2GWRA 1X82A 1J3PA 4NC7A 2M8GX 2QVOA 2XIGA 5HPOA 4YW1A 5IK4A 3RZJA 2DODA 2EIJH 2M5WA 1J9IA 1IS4A 3MIFA 1VAMA 1W2TA 4R9DA 4RA2A 1QPMA 1J58A 4Z92B 1TEIA 3RVHA 3W2WA 3WG4A 2CGOA 4FFFA 3ZPLA 2OA2A 4UUSB 3WCSA 5A2QK 1H6YA 2YMZA 4EJOA 4RAYA 4A45A 4AVAA 3MZ8A 3DEWA 3J80Z 4XFIA 2IS1A 4BIFA 1U8RA 3HKZN 3FN9A 3VBSC 2UWMA 4B8EA 1RUC2 1PMJX 2JG9A 5LBQA 1VAKA 4BUPA 5KCMA 4FAHA 1JYTA 2A7AA 4RGSA 5L3GA 2WBMA 1R4NB 3ZFFB 3I2OA 1NCQB 4GULA 3RZHA 1W05A 2JSPA 4LPLA 3CCQI 3DF8A 2B7YA 3WSOA 2LUWA 4NHMA 2ZXIA 3NV3A 1KFUL 1VBE1 3C3WA 5I0DA 1MIJA 4LTAA 1ZK8A 1DQ6A 4PCRA 4O9EA 1FPN2 4W8JA 1UYXA 5FZBA 1IPKA 2CYYA 3WP6A 4P9LA 5EDNA 5EJ3A 2Y6FA 3WD5A 1U78A 2NMNA 2BBYA 3NWTA 3E7LA 2ARBA 1S0BA 4ATFA 5J37A 1S0GA 5F3IA 4DNCA 3IIAA 4S04A 1LHOA 3LFKA 1LCLA 2VUCA 1REEA 3LEKA 3R0JA 2JA2A 1N1TA 1PNGA 3FHZA 1IRXA 2QA4I 2VOOA 3VD4A 3V0BA 4Y5Z0 2VCMA 1RHI3 4IETA 3GTMJ 2OIIA 3SDBA 4AIHA 1PUEE 1BA5A 5FY1A 3USUA 1FOXA 1ZZ8A 2EALA 4LBNA 4QM9A 3RFRA 1X8EA 3B3QE 1POV3 2R93J 4OCTA 2XGEA 4PF5A 4H4KC 4OUEA 3L2UA 4ZDLA 5K7PA 1O4YA 1EV12 3LSKA 1AXKA 5HOOA 5K0UC 3QU3A 4BJTA 1YIJI 4UFJA 3KLSA 4LG0B 3MPPG 1TZOA 4QX2A 4YVWC 2ORXA 5IAXA 3O8HA 2EZHA 3WLUA 1F9NA 2Y34A 1LOFC 3K3NA 2A6EF 5LY2A 4EJRA 1E5RA 3QODA 3JRDA 3OYAA 4XM3A 4FQ4A 3VZOA 1W3VA 3CJTB 1AF9A 2KJBA 4RMNA 4Q4V2 1QQP2 2B9UA 5FY9A 2BE5F 2R7VA 2W3JA 2WLQA 5IHRA 1YFWA 2WC2A 1CAXB 3KCYA 1J5YA 4HVQA 2VQLA 1MZ6A 4HZFA 2IPQX 4IUGA 3LDKA 3BR0A 1PVC1 1GSLA 1FYKA 1Q1HA 3NJYA 3B7MA 1QJY2 1GV9A 2DMUA 4MTDA 4YFZA 1Y56A 5CNAA 2DUPA 2P2KA 5C4WA 4KWKA 4ASMB 2F5EA 4UB6C 3D3AA 2IRFG 1JH5A 4AFBA 3LIHA 4QXKA 1STZA 3VODA 4XN3A 4CCDA 3F8CA 2HKXA 4C9YA 2B8MA 3C7GA 3DU5A 3SQNA 4XTPA 2XKPA 1A6QA 1LOBA 3QH6A 1ND3B 1KJRA 1C5HA 4EN0A 3BR3A 2VUMJ 2X10A 2DO7A 3DFGA 3FX3A 2OUMA 4XQDA 4RS5A 5IK8A 5J3UA 4CDQC 4MXVA 1FV3A 3WHUA 2WT1A 3IH3A 2C6SA 3M3CA 2JZYA 3A0KA 2TDXA 4CZCA 4YM1A 3ESWB 2IGMA 4IE7A 4YIRX 1ULEA 4V2GA 5DUKA 3MW2A 4B3AA 3GLLA 3WU2C 3SDGA 3DEMA 1RUG1 4JDNA 3QP6A 1K45A 1W9YA 2H09A 5FKNA 3JRAA 3BTZA 5CIRA 4IEYA 1R58A 3L9JT 1YRZA 4BY7J 3SYTA 2OBPA 4NRMA 3QYBA 3ZN1A 1CJPA 2NYXA 4UFKA 3B94A 2FCUA 3RZDJ 2IS4A 2DTYA 3I2IA 2XGXA 1YW8A 3F6VA 4IGOA 5DG2A 3S0MA 1YOVB 2A6WA 3ABZA 4B4PA 3GDBA 4EMSA 4N53A 3TW7A 4AQ6A 2FDIA 3IKWA 1BCXA 5A7PA 3KZZA 3CMAI 3F8NA 5F8PA 2DMTA 4NHXA 3FISA 1JJ6C 3SEEA 2XPWA 3KMHA 1EY2A 1GT0C 3DPUA 1YQ6A 5A7WB 2WAOA 3VSKA 1HC8A 3HOYJ 2CY6A 3IRRA 4NPMA 1PVC2 4D5CA 5T3NA 2P37A 2FMDA 2DUQA 3KZ4C 4ASNA 1S7EA 1AL23 5A6XA 4PLNA 2D6NA 3E6MA 2VG9A 2ECCA 5LRRA 2ET7A 2Y9ZA 4YSFA 5C3SA 2NZ9A 2RM23 1TQ5A 2XVGA 4L5IA 3CC4I 4HVOA 5FYSA 3J80K 3N97A 1ENHA 4IDZA 1LODA 4NIDA 4E6KG 1BI0A 3ZDSA 3HL2A 2JPBA 3MFAA 2IXSA 1OT5A 2DYSH 4LD5A 4F92B 2FDFA 4MUVA 5L7OB 2MC3A 3FK6A 4E2GA 4BQXA 1DYOA 3H1CA 1OD5A 3MLJA 3IV5A 4Q4X1 1JKQC 5FRNA 4OMCA 3ZFGA 2ICWG 1QKQA 1RUG2 3OF1A 1G8XA 1AL0G 1QXRA 4Q29A 3HM5A 2LNBA 3K70D 3GMEA 2LMDA 2L0KA 5B1AH 4IHWA 3ASNH 3AMPA 5FKBA 4JX0A 5LBFA 2O0YA 3JRFA 2H1LA 3LA7A 5DDGA 1EPZA 3ZSMA 5ICFA 4D5FA 1SCRA 2BERA 2C24A 2VQTA 4LKEA 3BC8A 1LHNA 3O0WA 1V5GA 3QP5A 3HOWJ 2ZX3A 5C8CA 1ZTRA 1ZRCA 1SPPA 5FO7B 3AJZA 4QWNA 1WJ5A 1W06A 2DQRA 5BQTA 1CPNA 1EAH1 1DGWY 5JIUA 2HXIA 1ZA4A 4IL6C 4HOOA 1M1EB 2G19A 3VKLA 1GNHA 2JEMA 2HTSA 4Y1XA 2DT5A 3ZR8X 3WDXA 1HF0A 3W5NA 1DDLA 4KNCA 2FDHA 1JHFA 4XBQA 2ZTNA 2XBO3 3KEQA 3NKGA 2BPA2 3SISA 2RS53 3PIJA 3NV4A 2BZDA 1XPXA 5L3CA 3ISPA 5FZAA 3K70C 3CU7A 2ZGOA 3DYOA 1L0OC 5IP7J 2ISYA 5JR2A 4AAPA 1ODMA 4P96A 1U5YA 4ZY9A 1HW1A 5EZWA 1ETQA 1BXHA 3SZTA 2R073 4DEVA 4H55A 1POQA 4PGGA 2CMPA 4U0YA 4JC1A 2VLAA 4A5MA 2JIJA 2EFOA 2O61A 4QHOA 2RS11 1ZYRF 4Q4X2 1SD7A 3C7JA 3CKHA 5LATA 5AFEA 2G7UA 1Z0HA 5DCMB 2M7BA 2RDPA 1HQLA 3DF0A 4XFAA 2WQZC 4BE2A 4B47A 1A3KA 4HSLA 5J4YA 1R1TA 5JVTA 1ZZCA 1ULFA 4JGYA 4MV2A 3I59A 3E97A 2D6KA 3CJIB 3V7RA 2YDEA 2WL1A 4NIGA 4W65A 3CC7I 5DUXA 3V65A 1F8VA 2DBBA 4IV1A 3BCBA 3I71A 1UY4A 4RS5C 2WSUA 3IN9A 1NA1C 3E6CC 2R7FA 4IERA 4HETA 3P1IA 2ZZQA 3LFUA 2W1OA 1GQGA 1JZ4A 4GYIA 4NHJA 2H0BA 5EYXA 5FZLA 4CP2A 2IWGB 4H3WA 5BNPB 2WADA 1U8BA 2JUGA 4EJWA 2WA0A 2B9SA 4C3HJ 2JG9B 3KP4A 2O5RA 2W5FA 3QYFA 2VASA 2HWE1 1FYLA 3ZVXA 4IV3B 1OCRH 4II2A 1XSVA 1P2FA 3S3OA 4HQEA 1WMFA 4N53C 3CZ6A 1ST8A 2BP6A 3BYWA 1IQAA 1JZ8A 4XLAA 2YGLA 1FBSA 2EV5A 4BQ3A 3LMMA 3RZGA 3FXUA 4GJYA 1T8IA 1AR72 3D5SC 3ILNA 3B00A 1RUH1 3DPTA 3H3UA 5BS6A 1OMIA 3OYGA 1WCQA 4KWUA 2HQRA 1ZYBA 4H14A 1K42A 5FJHA 3OPZA 4RDUA 1WCSA 3RPUA 3LSJA 4NC6A 3WDWA 3ZYBA 2EIKH 3LCPA 4Q5SF 5AONA 2VVDA 2ZCWA 3UV9A 1HDKA 5D21A 1WVRA 4FAGA 3USSA 3R61A 1MEC3 4RAFA 1RVF2 2P5KA 2YPDA 2ECBA 1HB2A 1A34A 2GOXB 2C9KA 1NXD1 3W58A 2XRNA 1QOSA 3USUB 4I09A 1Z67A 2TRTA 2ID3A 1BI3A 4XFCA 5IFTA 3VDDB 4GDFA 4OVEA 3L7WA 4FI9A 3CCUI 4YLZA 1OLQA 2BVLA 3WGIA 3ZFGC 3J4UH 3BTAA 4R1HA 2QVSB 3O1MA 4PSWA 1LEAA 2ELHA 3TRSB 4AYBN 3HHGA 3ENRA 3KT4A 5KC5A 2A70A 3E6BA 2VD7A 4MHGA 4FPHA 5FOJB 3NJZA 3KCCA 4NNJA 1X2NA 1W2AX 2QJVA 2FNPA 2VKVA 2GAUA 1LESA 2FEZA 4HRIA 3A2KA 4COZA 1VRH3 1PVXA 4IEWA 2R16A 5EEGA 5EEAA 1B4AA 1KS4A 5C8CC 1VBE3 5J8CA 2FQPA 2JKBA 4JRAA 2P4WA 1YQAA 1IRGA 2MLGA 3GX4X 3HRUA 1PO22 2YR2A 5DD4A 4L11A 5JLXA 2W91A 4BQ4A 1JI6A 3ZMDA 4H7MA 2Z33A 3WG1A 3SEPA 2JT1A 1XSDA 1RC9A 3E6DA 4BMEA 5C4WB 2ID6A 5JZGB 3F22A 4IQJA 2OC6A 2NNYA 3TN92 2WAAA 4KU7A 3ZMUA 1W99A 4CDUA 4AFAA 4ZZLA 1EH8A 3W6KB 3DTIA 5IVYA 1XDSA 4XUTA 4S2GA 1O3QA 3E1SA 2KLOA 4LBLA 1S0IA 2NMOA 3ZYGA 4IJAA 3GHNA 2GMEA 2W68A 3JBG3 2DCEA 5JMCA 2VXDA 2PMUA 1ITYA 4LJHA 1DGRA 5C3QA 5A3LA 2HJIA 1DQ2A 2Y0SN 1K6YA 4KMUX 4XZPA 2PLV1 2WZEA 1R5ID 1RZ4A 2PELA 3H3LA 4FPJA 1KU3A 2RR13 1ZGJA 2E71A 2E53A 2NAZA 1ALYA 2AQFA 4B1RA 4H0EA 2QE3A 3OB8A 1CIYA 1XB9A 3E5UA 2JDPA 1JBCA 4DQ2A 2UWBA 2BDRA 4A3ZA 1PZ7A 4XABA 4IEPA 3POYA 4IOCF 1G3TA 5A3PA 1JUMA 5C33A 4JGYC 1NG0A 1NOVA 2HLEA 1PX4A 4Q2FA 3OYDA 5FYHA 1J1TA 5E1RA 1VR3A 3Q9SA 2OAZA 3I3QA 4WCGA 2X6OA 2BVVA 5JPMB 3Q8FA 3WHBA 3RKXA 4K3UA 3ST7A 5KK1A 5LA2A 3FFQA 3M9AA 3WG2A 4PF1A 2VZRA 1ZZBA 5C71A 2K46A 3J9SA 2DA2A 3W9AA 2OPKA 3I2HA 1B35A 4U2AA 4WM7C 3WGHA 5A3TA 4PDKA 5CLSA 2EPFA 3PL8A 2UU8A 1RUOA 4V2VA 4Y4RA 2NQYA 5A1LA 5B5EC 4LE4A 5C3OA 4HF1A 2QZ8A 1FP2A 4IF4A 1W6QA 3BG9A 5FZ8A 2FSWA 5K7ZA 4Z8BA 2DTWA 4XUPA 2HNHA 3GXOA 3CMMA 4CCKA 4BDYA 4FFGA 4NAMA 3WNOA 1JYWA 1APNA 4F3JA 3V56A 5HLIA 1XDUA 2R5YB 2UV1A 2W24A 1LEMA 4OI0A 2ZOEB 3DLLF 1BC7C 3HOZJ 4IL7A 2XQXA 3KX2A 4BQ1A 1HKQA 1MVQA 4QB6A 2XWBB 1P7JA 4IRIA 2DQLA 5J98B 2KRHA 2XSJC 4K20A 3ZQQA 3DXTA 2DV9A 2X6XA 1IKPA 1XMAA 2PLV2 4G7ZF 2ZJPF 2VIXA 1V6OA 4XBLA 2CUZA 3OYCA 4DUWA 1G9AA 4BZ4A 4ISRA 1OA3A 4QQ2A 2WB1A 1C8M2 2XDVA 3ZXKA 2FF4A 1CAUA 4BGDA 3MYXA 3F0CA 5J40A 3Q8EA 3W2AA 1GV2A 5H6RA 2L7MP 1KQRA 1KFXL 2E1NA 3V8JA 2VL4A 5GZDA 2P8TA 4UXNA 2WA3A 5EEHA 4BWOA 2W9XA 2QQPA 4XXPA 4HN1A 4FE4A 2QDRA 5KXBA 5C3PA 3CC2I 3OYFA 3WG9A 1BK0A 2ZMKA 3IRQA 2R7UA 2P3JA 4PBOA 4LA3A 3FM3A 2VMEA 3K6GA 5A70A 4AE2A 5C8CB 5FZEA 1X33A 1XC5A 2A6ZA 1Z78A 3DV8A 3HRSA 1ZQ3P 1MQTB 5FLMJ 2E36A 3ZP5A 1HB3A 2UY9A 1RUI2 4D7TA 2D1HA 1UF2C 3VKFC 1QEXA 5IUQA 1NG6A 5BNOA 2E1MC 2V5YA 4CSWA 2VW1A 2P4EA 5FKKA 3RQ0A 3FBYA 2ISZA 1ZBE1 3U37A 2SBAA 1TQIA 1VPHA 2XLGA 3EBRA 5JSPA 2NM1A 1LDJA 5FPXA 2WJSA 2QUFA 4FX0A 4GWMA 3HKZA 1Y7BA 3ZXEA 1RRJA 2AXTC 3DBLB 1SLCA 5J1YA 1E2XA 3TO7A 2ZHLA 5IVBA 3H0OA 1GU3A 4EWDA 1F5FA 4M72A 1OF4A 1WI3A 2BRTA 3BU0A 1ZX5A 2ZXJA 1KQ9A 2WAQN 4MXWA 2Y26A 5IOYA 1PUFA 2P34A 2AUYA 1WKYA 4GO1A 2HU9A 4QPWA 1DGWA 4MVTA 4DZPA 2DI3A 2MLKA 1N3OA 3U9GA 1IS3A 1XQNA 2RREA 1QH6A 1ZH5A 3K69A 1YRNA 4DOUA 4AHYA 4FSJA 3RDIA 1D4M1 3K4DA 4XOGA 3QLQA 4CDUC 4BA6A 4LO5B 2ZACA 2JE8A 3WDTA 4UT5A 2DN0A 3I59B 3OWTA 3GTGJ 3PNVA 2LM3A 5A32A 3W2VA 3RIRA 4IV1B 5FO9B 1FI2A 4XF9A 1U6GA 1UNBA 3OBZA 1D7PM 3ACHA 3ES1A 3RJRA 2NPIA 1I5ZA 2HQ5A 2W84A 2IFWA 1Z91A 2FMYA 2Y0MA 2DFHA 1KD7A 5M3FJ 1OURA 5DZEA 3CF2A 3HUGB 2ZGTA 5AVPA 4ZYEA 4E4SA 5LK5A 4RFT0 3TOBA 1EAH3 3CD6I 4Y1UA 5C3RA 2YV8A 4BQOA 4CGZA 5KNLA 2A5WA 2XAGA 2BTVC 4ENNA 4QAWA 1L3LA 4FTHA 4XJZA 3ASIA 3BROA 1ZARA 2GMPA 5F3CA 1OLTA 2BBAA 1LB2A 3HQUA 4QPQA 3M8FA 1G9DA 2Y38A 3FMRA 1QHGA 2Y48A 2A6XA 5J8FA 1VE0A 3EMRA 1DLLA 2ZX1A 3A03A 5A6YA 2LRPA 1ZHFA 1BR4A 3RKQA 1UN1A 5D5UB 4YZ1A 2DMPA 2V6CA 4AI2A 1RUD1 4IW3A 1ODNA 2WT0A 1G6NA 3POGA 1BW6A 2Y6HA 2KHMA 2RJLA 5K9YA 1KXGA 4WVZA 4M4RA 3TB0A 1RXFA 4FPGA 4GA9A 1AR91 2I2SA 5B4XA 4Z2YA 2RS13 5DS9A 2HZDA 3J7MA 4KFCA 1UZVA 1H88C 2EFPA 2E1OA 1DZTA 3QACA 3PFIA 1C3HA 1A6CA 2O6GE 4AVVA 1UG2A 5KVRA 2VZUA 4H2AA 3HOTA 4QTRA 1I9RA 3AM2A 4ORFA 3LSIA 3VKMA 4N4OB 1E3PA 2BU9A 2BW3A 2GIVA 4ITCA 3ZCOA 1E0EA 2J1SA 4CP9B 2WAEA 4BHPA 2BHZA 2ZGNA 2CUJA 4QPGB 3NWSA 4QKDA 3VD3A 3SHRA 3DYPA 2J1VA 2QBXA 1QVUA 3GVAA 2A5ZA 2KKOA 1PM4A 4IXLA 2BBVA 3GUDA 2FBIA 3S14J 5IT9Z 4UY8I 2Y6LA 5FZIA 1SEUA 3G6EI 1DF0A 4AEDC 4O9GA 4XFGA 1GP6A 3DGTA 5DUWA 5AC91 2IC1A 2E1MB 1MW7A 3OIPA 3N3HA 2CRGA 1S7OA 1OFSA 4I0BA 5IAVA 4XKBA 3LDBA 4RL7A 1IO2A 1DP0A 2WFPA 4GALA 2Y0IA 1ETKA 2IAIA 3QBQA 3MIDA 1WD4A 1FXZA 3ZSJA 2HWE3 2V9VA 1MMSA 4IXAA 4RM3A 3JXSA 1QJFA 1YS7A 3L2YA 4FQZA 2BWCA 4HX8A 4A42A 4Y3OA 1UOGA 1BC8C 1LEDA 1DQ1A 1MMDA 1FOD1 1RUD2 5DDJ3 1VQ5I 2XJTA 3BP8A 4BHCA 1VB4A 5FP3A 1MKMA 4AYUA 5JAXA 3LGRA 4UBGA 1WJCA 1ND2A 4E2SA 2N8GA 1GZ9A 2VI6A 1AR92 1S0JA 3VZNA 4MEYF 1ENXA 5BNOC 2EFNA 2HWB1 3BI3A 4NMIA 4N8MA 5G05L 4F8AA 3L2VA 4XQWA 3ES4A 3JB8A 5FP9A 3TNQA 4CDUB 4U7BA 4DZGA 2ZHMA 3HWJA 1WJBA 2VOXA 3UGHA 2D3RA 2ZX2A 5F6KA 2L9NA 5FP7A 3AZZA 4CP0A 4Y20B 4Z2WA 1PZ9A 2QUOA 3J8F3 4L0YB 2O03A 4UVCA 3RQIA 4AWDA 3H36A 1LTEA 4RB2C 5BUVA 4FHTA 2R7EB 2YU2A 4IHVA 4BEHA 4JAAA 2ZGKA 3ZXJA 4ZC3A 3H1MA 2WZPP 4A0ZA 2WT2A 1K78A 1JU3A 4HOBA 3AMMA 4A3FJ 4JKKA 2WIIB 4FCYA 3ILRA 4P9GA 4LK0F 2VH9A 2F48A 3ELKA 5GPAA 1H8TC 1K79A 2FHRA 5FMOL 3GZ6A 3T08A 4YGEA 4HW0A 2M34A 1A04A 3RQ4A 4HVRA 2ESHA 4LO7A 2XJSA 2VTXJ 3D8CA 4CPBA 4IEZA 1Y8RB 4RYDA 4ZYDA 2HWC1 1Y9MA 4BDVB 2QGUA 3OGJA 2CV0A 1OH4A 5JOWA 1WMEA 3N9NA 2A6TA 3AFHA 4BQNA 4BXSV 3S3MA 1E3HA 4IPAA 1W9SA 2VMFA 3BTXA 4LOCA 4IQ4A 3OTFA 3O7OA 3WU0A 3C18A 1HDPA 1T08B 4B7EA 4EM1A 3HN3A 1KU2A 2WNEA 1SANA 2HYFA 3R4UA 3OPWA 4RR3A 4YG2F 2JRTA 1W2NA 3TEWA 3PUAA 4AD9A 3KQRA 3CTAA 4XJWA 5FGMA 4C91A 4IKFA 3SJMA 1B35B 3R4KA 5M5YJ 5FY4A 4HF2A 1CD3G 4I0WB 3E1F1 1W6OA 3HAGA 1R093 2HWB2 1ON2A 5CKNA 4EGZA 1N1SA 4COUA 1YQ8A 4LBKA 4C2UA 1DG6A 2WUHA 1HIXA 4AHZA 2BZTA 3GTKJ 1LFBA 1ONVA 4EVIA 2ESNA 2RNJA 5EPAA 2H0VA 3JU9A 2V26A 3ZMTA 1UZYA 2OF7A 4Q0UA 2R0QC 5CISA 5C4JJ 1OR7A 3U4XA 3PIPF 3VGIA 5FXXA 1I3HA 4JKMA 3KZIC 4X6RB 4Y24A 1OFNA 5GZEA 5FYBA 4U0VA 3FL7A 2NS8A 3RWKX 3UJOA 2DCTA 1OLRA 4XKCA 1BQPA 1COV1 1QZZA 4CEWA 3J7HA 4QDQA 1HKSA 1QNWA 2RKHA 1CAUB 4OWRB 4QGMA 4EN6B 1JUHA 2QYOA 1R1VA 1SACA 4C0HA 3FUQA 2A61A 1CF7A 1VBD1 4FOWA 4IGPA 4MNUA 2XVLA 3PFYA 1XSQA 5TGTA 3TYJA 1NLQA 1S55A 1O4XA 3NVCA 2E2IJ 5FPVA 3B5LB 4Q4W1 1FSEA 2HWC2 2GIZA 1SQ4A 5I0TA 5L3BA 3FHAA 1W8OA 1D1BA 2LDUA 2WO3A 2VQHA 4LO4B 1BM9A 2FQ4A 2J1UA 3OD0A 3IAQA 4BJ0A 5M0TA 5T5OA 3WP3A 5E16A 1FJLA 4RGUA 3PU8A 2WWSA 2CNAA 3OY8A 1MZEA 1WLCA 2OT7A 2FCTA 1HCRA 1GYKA 5FAXA 5BNOB 1JUPA 1MR5A 2IGKA 5DZGA 4YW4A 3H8OA 1SFPA 4C1WA 4QXHA 2LOOA 1GOFA 3Q3SA 3N7LA 5FZ3A 3VPRA 5K8SA 1XNBA 1TMF2 3POEA 1CAWB 2OTJI 2EXJA 4M9SA 3GBWA 5LZ6A 3MAJA 2ZGQA 5APAA 2WS92 4YEJA 3DLAA 1CAVA 4HPKA 4WVWA 3H3VK 3LZZA 1F15A 5L3EA 1DZQA 3KB5A 4JGZB 2PYTA 3JB4C 4TZDA 4AVPA 3CCVI 1ULDA 3BLYA 3KP7A 3JAMZ 1NAEA 5FYCA 4HQMA 3TNPB 2I8DA 5C7GA 3RYKA 3HNMA 4Y1VA 4MXWB 1IV6A 2R7XA 1PUFB 2B5HA 1YJWI 1REFA 3KP6A 1S9HA 3I4MJ 3WW2A 1W04A 3ECHA 1LENA 1I3QJ 1OQYA 4Q27A 1COV2 2X5IA 3OBRA 4CPBD 4RAZA 2G9ZA 4YZ4A 1TQPA 3ZOIA 1BR2A 1LOCA 5ERLA 2ZEWA 2L01A 2JENA 1YRNB 3D4KA 4MGZE 3VFZA 3RNSA 2EV6A 4C90A 4DINB 1T6BX 2J7MA 5CU1A 2QTWB 1VBD2 1H2NA 1UQXA 4RSUA 1FAYA 1W7PB 2XLAA 1UB9A 3MKYB 4XAEA 4D7NA 3T0AA 3ZN6A 4XC9A 1UXZA 2CTVA 5A32B 2A71A 3TW6A 4Q4W2 1N3PA 1PIV1 2L9LA 1MZBA 2PBIA 3LWCA 4GIQA 4KGQA 5FZDA 3ABTA 1TL8A 2WWYA 1FLIA 2VNOA 2FZ2A 5D5XB 3QH7A 4P5YA 2K02A 1W6NA 3LB9A 2WBKA 2YYOA 1LAJA 3LA3A 3K77A 5DM6F 2M87A 2BNOA 4LHLA 1DU0A 3CCSI 1OOPC 4OAYA 3ZSEA 5JR3A 5B3SH 5DN2A 5FLXZ 2XASA 1ZBE3 4UFHA 4NHKA 3JSOA 2WDBA 5H9SA 2O14A 2JSCA 2HS5A 1NCRA 5FP4A 1KONA 1WFXA 2R30A 2L7KA 1AXZA 4U87A 2RV9A 4GH4A 5GLVA 4EEFG 4AYBA 5CFDC 1SHWB 1EV13 4MFEA 1J2XA 5FBJA 5EG0A 2E35A 4S05A 3BZ6A 5FUNA 1P92A 3BKZA 4ES9A 4B1MA 4FPKA 3MQ0A 4U0WA 4RR3C 2R063 4P14A 4JOMA 4RQPB 1TE1B 3VKOA 1QIQA 2DJIA 2C6YA 1JXNA 1WCMJ 1MBKA 4B48A 4XDQA 2GDFA 5I93A 1X1AA 2ZHKA 1VNDA 4JQTA 3NARA 1IS6A 3FXKA 1XE7A 4JDOA 1V9U1 4GMP0 4Q4V3 2YC2A 1A36A 1MZ5A 1QU0A 2GLOA 3T0YA 2VT2A 1D4M3 2BW3B 1WW6A 3C2GA 5G04L 2M7AA 4XHXA 1JGSA 5SV5A 3EHKA 3WTYC 1OA4A 1JJ8C 3M8LA 2GALA 4WZFA 1PIV2 4ZTFA 2Z42A 3HPHA 1ZR2A 3VD7A 1ACIA 1DGLA 5ED4A 1ZREA 2ZMNA 2E51A 3AG2H 2UUZA 1BEV3 2D98A 3ZRGA 4CEWC 1OHFA 1DP3A 3WTUC 1D2QA 5HLHA 4E8DA 4UW4A 3VYSB 2HVRA 5EJZB 3FXRA 3QD6A 5F39A 2K40A 1UY2A 4RFRB 3S30A 5BOXA 4JX5A 5EYRA 4M4PA 1ETWA 1U9NA 4AQTA 3GZNB 1JTXA 2AXLA 1ZBA3 5KHHA 3L2HA 3RI9A 2DCYA 1O59A 3K46A 3KIOA 4XJAA 3S1RJ 2LR8A 3OEBA 1QJX1 4HG2A 1RMU2 1PK6C 1AUYA 4P9JA 5HS9A 2JA6J 1MS1A 2QFEA 1SEFA 1J3QA 2HEWF 5DQ0A 3VBHA 4R9BA 4DRRA 1ND2B 3CJNA 1BYHA 3TQNA 3VV1A 1NY72 4MQVA 1IN4A 3GF2A 2LD5A 3S32A 3Q8CA 3GBFA 3VWBA 1NE4A 4WVMB 3V4GA 1IN6A 5KXEA 5IK5A 4KIGA 5HCAA 3A0HC 4A3EJ 1MZFA 5BPIA 2O8XA 4XIOA 3KCXA 3HNBM 1O3TA 2EWNA 4PJNA 5E20A 4OYUA 1ETYA 3FMQA 2P5VA 4HN0A 1YJLA 1XNDA 1FOKA 4K1YA 5A7NA 1VBC2 4M00A 4P5HA 3CLQA 4NQWA 2RQQA 1U3EM 4OMYA 2YXSA 3DBRB 4HKWA 4IEVA 5FZMA 2BOLA 1XMXA 3MV11 3L2RA 3A1YA 3R0RA 2EVXA 3CZUA 4LBMA 1I1EA 2IP2A 1R1UA 2PQSA 2ADUA 2X5IC 3IB3A 2R1BA 2QZ3A 4LR4A 3JAMK 5AC93 3WF0A 2G4IA 3JCIA 4UV9A 4PZJA 1O91A 4DW6A 1RB8G 3RYRA 2P0WA 3CF5F 2DK5A 2XB5A 3KP3A 3UGFA 1RIRA 4L5JA 4YYOA 1E5SA 3WEZA 1JW6A 4LIVA 5GALA 1FTTA 4IEOA 5CZKA 1RTVA 3JUUA 2D7FA 2WLPA 4AQ2A 3WTVC 3B9IA 4CU8A 5FQ0A 2GOMA 2UYAA 3BWGA 4E8CA 4MSVA 3LKJA 3TBDA 1DU6A 5KXDA 4PSXA 4RM2A 4AEMA 1EPWA 4RR3B 2VKEA 4CCNA 2HYXA 1MDMA 3WTZA 1SG3A 1X58A 4QHZA 4YFXF 5F0CA 1HRV2 2LYCA 3I55I 1R1A1 4RHV1 1QQIA 4L0ZB 1W6OB 3M3OA 2E19A 2M45A 4U88A 2MEV3 1QDCA 2VZ3A 3VBRA 3B6CA 2ZFUA 2Q2EA 4ZZ8A 1PGW2 1H0MA 3BG7A 1OPMA 3MF9A 1SD4A 1XSXA 3QPSA 3Q8BA 5E3NA 1W6MA 1NCRC 4HBNA 1LKXA 3IAPA 2RVAA 5EJCA 2VULA 2K5CA 3BG6A 5FLXK 3K4MA 2PHRA 2QQBA 3JD73 4AK3A 5TSWA 3VSLA 5DAWA 1DDNA 2DVFA 2VPRA 3R05A 3G2BA 3P9CA 2PHDA 1UPSA 1RHI1 1B6AA 4CEWB 4LGWA 3OY9A 1Z6TA 2D40A 4PBPA 1SLAA 3ACGA 4LOTA 4I3GA 3K9TA 5CJ9A 1POV1 5C6CA 5FYUA 1CF7B 1VMFA 2WAQA 5A80A 2VC0A 1G8WA 4XUNA 1LU1A 2XG3A 4MGYE 5JMOA 5EF6A 5D8KB 4RGAA 5E79C 2F6BA 4JX6A 4W50A 3LEIA 2QSFX 2XJQA 3WHTA 2VTFA 5LBCA 4YZ3A 4YRVA 4BOWA 1R00A 2MNGA 3VLBB 1ULOA 3OSGA 3AZXA 2AR6A 2RMU1 1IG7A 2K86A 3OY8B 4BPZA 1GOGA 5EGOA 2L7FP 2E63A 1N3QA 2D3SA 2RS33 4XZUG 2LP0A 1USTA 2Q5TA 4PJMA 4RGGA 2PXJA 1O3RA 3GEZA 2D3PA 4YARA 2ILMA 1MJ9A 4BS9A 2VTXA 4AFMA 3TMOA 1H1AA 4ATEA 1PO11 1CONA 4J25A 2Y60A 2L5QA 4JDMA 3FHIB 4N9IA 1C4RA 3EO6A 1NUKA 1BL0A 2BEOA 3VD5A 2DBNA 5A1FA 1HJGA 1G9BA 1UYYA 4MLOA 3S7EA 3W59A 2RNGA 3D0JA 1SCSA 3FUOA 3VN4A 1IN5A 2M0CA 1VI0A 2VNRA 4XXAA 2Y69H 5IWFA 2JG8A 4QPIA 1OSGA 4URAA 3PUSA 3HGYA 5GAGJ 5BYNA 1V6LA 3RKWA 3N9MA 2IS2A 1FOYA 3S5QA 3WNNA 2FMLA 4Q48A 4MZUA 3ZXLA 2OA4A 2NRAC 3DKYA 3KF5A 3VBHC 3WINE 5JXIA 5AFBA 4BQWA 1P7IA 3PVOA 4OI2A 2YPJA 2BGCA 2CAVA 2LROA 2R7ZJ 1QGPA 1QMJA 4CCMA 1RHI2 2WNUC 3JRHA 1UHMA 1S2KA 2VOVA 4XE9A 1AXYA 5DAXA 4F52A 2EFWA 3CF6E 5HNFA 5E8GA 2CQ7A 5F64A 3GNEA 4BB3A 3TP0A 1Q5OA 1SLBA 2BOIA 3U11A 1GKBA 2VM9A 4HANA 3ZN6B 1R1ZA 4HKOA 2AACA 1O4TA 3TDUC 4CA0A 4WZCA 5HS8A 1FSHA 1TME2 4Q8KA 4RGRA 1YITI 1EJ9A 2W08A 3TDZC 4Y22B 4NIAA 1WJDA 3Q9VA 5CYYA 3G7DA 4GB33 4UNOA 1IDZA 4KITB 1BKZA 2OZ6A 1TWGJ 1KDKA 4HMZA 1MMAA 5C3EJ 1EP0A 1W6NB 4CDXA 4L92A 1GXQA 3OYLA 3KT7A 3WT3A 2EK5A 1WD3A 3I5UA 4MIMA 4PQ9A 1MBGA 4IHTA 1KGYA 1SC7A 1LOAA 1IPSA 3NAPA 4HK9A 3WE3A 4QX1A 1ORKA 1UOBA 3GZTB 2OVUA 5F04A 1RVF3 4OHXA 4I02A 4D6RA 1H1IA 1TVGA 1CESA 4BQYA 4DIQA 3A21A 1QZYA 4P9YA 1VQPI 3CCRI 4JK1X 1AL21 4Y1YA 1D1AA 4BE3A 1EF4A 2RDNA 4A3MJ 1NCRB 1QJZA 3EPZA 4HV6A 4XMAA 4K21A 1UYPA 1ZZ9A 1CR7A 1REPC 4GH4B 4GD4A 3FLTA 2R32A 4XBFA 5IOZA 1IUFA 1X3ZB 1OCPA 2RM21 3NSTA 2EH3A 1YE9A 3D5RC 4MGKE 1V5EA 3M8JA 1LJ7A 3P7NA 2ZEYA 4Y26A 3ZYIB 3C7HA 5JCTA 1QJU1 3IPVA 4GKYA 3MEPA 1UOFA 2HBTA 3M7GA 2HVQA 3FXQA 3ZGKA 2X6WA 3WZ1A 3VBRC 2GP3A 1JYCA 1GNYA 2EXHA 4Q0VA 5LLQA 4NIIA 4QX5A 2CDOA 5FRAA 1ZRRA 2NVTJ 2OYZA 4A3DJ 2BXYA 3WTXC 2YUEA 3VBFA 4BJ5C 2YBSA 5FY8A 3WQ0A 3O1VA 1WW7A 2KM2A 1V5FA 2YFUA 1C57A 4LKSA 1KQ8A 4PLMA 3PVNA 1PO23 1WWXA 2BY0A 4HK8A 1WH5A 3BQZA 1W2OA 2J22A 3DPLC 1UAAA 2H1KA 3NNGA 1UMZA 3BOWA 2NS7A 3HN1A 1ZGAA 1UL9A 1H4GA 2O8QA 3DPRC 1WH7A 5HI0A 3WQ1A 4AAXA 3P5JA 1GVJA 2ZJRF 3TN93 5T5PA 2VQGA 1OPOA 1D3YA 5IPAA 2KT0A 4OIRF 2W48A 4MGIE 2W95A 4DYRA 4BCUA 2V1XA 4CA9A 2JN6A 3AG4H 2JDUA 2GM4A 1W0NA 5FWEA 5DD8A 1W0UA 1XB4A 1XGOA 4ANJA 4J6GA 2K4JA 4LE3A 4XF3A 3M2MA 4D3WA 1AL22 4JYKA 1XNAA 5J7MA 3Q0UA 1FTZA 4TWTA 3BTYA 2PFBA 4P08A 3OD4A 4JQRA 3FDYA 1GWMA 1OJLA 3FHNA 2DW4A 1H2LA 2RM22 2Q1FA 2XBO1 4XFBA 2EFQA 2K4BA 1WCUA 3MLKA 3CZJA 5FY0A 3VL9A 4YVSA 4ZU4A 1W0PA 3G1OA 3GZEA 2WO1A 3H50A 3GJAA 4GWIA 1SBFA 3CBNA 2E9QA 4XKWA 2VVEA 2DJNA 3HYIA 1F2NA 2R071 2VMDA 5GTHC 3AX4A 1TT5B 4OU0A 4MX3A 2COBA 2KD7A 2VMGA 3ZYHA 2FJ1A 5F32A 2COMA 2L9RA 1JYNA 1RJ7A 2XPUA 3BCWA 4JTOA 4BU2A 1BBT1 1RUE3 2GU9A 2O0OA 5K0UA 1BJQA 5FZCA 5FK8A 4CCOA 4YVWA 2EINH 2KRFA 3VUOA 3PL0A 1I6XA 2JG8C 4QPIC 5FPUA 1V3FA 4CUCA 4AI1A 3H1YA 4FFIA 4DUXA 4HDVA 2Z79A 3I2DA 4EYUA 2X6YA 1OLMA 4LG3A 3ZR5A 2XMLA 4MFDA 3T1BA 2JB8A 1S29A 1CIWA 1PGSA 5HV0A 4D0QA 3QPTA 3GYDA 1ZELA 1PYVA 2WY7Q 2BXZA 5LGUA 2DCZA 5J3LA 2HBUA 3MI8A 2VC9A 3QCWA 3SMHA 4IRHA 1HLCA 4YG6A 3GO5A 4E7KA 2WYFA 3VDCA 2P3IA 3ABUA 5FLHA 4JCKA 1UY1A 3O12A 1KQ0A 2DXIA 2FUG2 2XC7A 1MJBA 3Q5FA 3IH4A 1YLLA 2TBVA 5JDBA 5KWRA 5C4XJ 2F4IA 1M06G 3CIHA 2OZJA 4QU1A 4BY1J 5BXXA 4JKLA 4NAOA 2DUOA 1Y9QA 2P3KA 1QJX3 4P9IA 2DMNA 1GXPA 1Y8QB 3I58A 1R083 4GWNA 2XBO2 2DVBA 5E1XA 5LHIA 1MDMB 2RS52 2ME6A 2DK8A 2E7WA 4CDXC 4FPOB 2KDZA 2M9HA 2IUWA 2KPMA 3I2KA 2X1DA 1OYIA 4FETA 4EE2A 4LLOA 2CG4A 2EAAA 2KR2A 1RUJ1 6PAXA 4D1QA 1UU6A 4MG2A 3VBRB 2JK3A 2Y6KA 4AI8A 1E17A 3CUQA 1HRI3 2Q2EB 1GV5A 3GWZA 1UCRA 1I5PA 4XF1A 3IM0A 5ABJA 1IXRC 3PUBA 5HNHA 2JDYA 2LY1A 4FQGA 3I3LA 3I53A 4I7HA 3RWNA 4KN7X 4OLLA 1JHHA 2ZXHA 2PHTA 1EKEA 2DPDA 3RZMA 5ISLA 2MD0A 5F5AA 3LD8A 1QHDA 2R7DA 1RUI3 3WHCA 4DMIA 4CEYA 3IAM2 1V6IA 3A7QA 4C2TA 5F9TA 4XW3A 3CLPA 4QDRA 2R5ZA 2VL8A 2YU9J 4L9VA 1AYM1 5FPBA 2KL4A 3UJQA 1LDDA 3JRBA 5FKOA 3D5LA 1F36A 2M2EA 3VOEA 3KT1A 4IRGA 3T4VA 3U75A 4B7KA 3MEXA 3SH3A 4P9WA 4DO0A 2D43A 1NLRA 1AJOA 5FK7A 3AKRA 4Y4YA 1O3SA 4MH0E 4AR2A 5JWPA 1O8SA 2ZKZA 3T8RA 1GOHA 4DB5A 4Q4ZF 1BMV2 4FXGB 5HCBA 5FJKA 4I01A 3GTOJ 3CCJI 5E17F 1KGSA 5CB7A 3VBFC 3ZYPA 2CUEA 4QDSA 2R0HA 4FOQA 3BVCA 4EZ4A 2IXKA 5D2AA 2JDAA 3TEYA 3DTEA 4XONA 3ECQA 2Y0OA 3MUY1 1GBGA 3W21A 3LAJA 4BNCA 1KITA 3BY6A 4LUKA 3OL3A 1TC3C 4XCBA 4DY5A 5E8IA 1XU2A 3APBA 2A5YB 5C9AA 3I3BA 5DUVA 1I1SA 5J48A 4RLFA 2OTLI 2HOTA 3FXOA 1VRH1 1WGPA 2RJKA 2XOMA 2XGCA 4OULA 3C3VA 3MIGA 4EJTA 1UX6A 2DFFA 4P9XA 1R1A3 4RHV3 3V64A 1Y3TA 5FZ1A 2A6YA 4ZKTB 1X9PA 1OQ1A 4YPJA 4M73A 4D8MA 3WUDA 3RKYA 5IYYA 4HLYA 1KU7A 2VQ0A 3BB6A 1MBHA 1S72I 3HR9A 1TNTA 3BGAA 2STTA 1ZRFA 4EZHA 2OD5A 1IKQA 1SMVA 1GNZA 4U7DA 2GNBA 5JOXA 3BCAA 2VXJA 4ZDPA 1Z0XA 2ZABA 1LFUP 2Z3YA 1MEC2 1JZ3A 5H9QA 1U5TC 4YVSC 4BHBA 3JBG1 4EM2A 4GJZA 2VY0A 3L00A 2JDKA 4LUMA 3CLOA 1K5JA 4FOVA 4B8XA 3I54A 2FXAA 1XC6A 1F43A 4Y5SA 4JRLA 5FYTA 1JYVA 4AI0A 3VZJA 1FX5A 3ZPYA 2W47A 2HFHA 2TEPA 4ZPIA 2RR11 2HWF3 4ZHNA 3VB9A 4YW6A 3KV5A 3ZQIA 5K1YA 4HA8A 5FJ8J 3S2DJ 2HYGD 1DFQA 1GDTA 3OYNA 2JDNA 5GZFA 5J4VA 2A1XA 2VE8A 2ZXWH 2UXNA 5BMZA 4NRPA 1DCSA 4I30A 3FZVA 3HQRA 3GCXA 2VOTA 2HOEA 2VBZA 4EROA 3FC0A 3LEGA 2BV4A 2F5VA 2BQPA 2VUDA 3CDIA 2RMU3 2Y9YA 4N43A 1VRH2 3BTLA 5H2FC 3HRTA 3K0LA 3THPA 3NAPB 2WFF1 1F5JA 4PJLA 1VBE2 4MGQA 1PGL1 2QQVA 3FM5A 1JYXA 1WJAA 4IOAF 3QOEA 1PO13 3LNQA 3PJRA 1PVEA 1T56A 5DUUA 2PFWA 5BPXA 2DFBA 4XYXA 1OVPA 3ATGA 5FFXA 2HDDA 1XGNA 4L9BA 1RR8C 1YUDA 2EXKA 4DXSA 2PJPA 3WCRA 2RDRA 2JWTA 1VMHA 5FYIA 1V00A 3I4PA 2VBWA 4H7LA 4D7MA 1RUNA 4DS0A 3WE2A 1R64A 4A6DA 3S1MJ 4BE1A 3UGGA 3WDVA 1JN2P 4QIWN 1T33A 2BGOA 3UL2A 3OIQA 3C2BA 2PAEA 2D5VA 1H2KA 3GFMA 3NMBA 1ZR4A 3PVBB 4XQFA 3JBG2 4KYWA 1H9WA 3CEWA 1NA1A 4OQ8A 1H6XA 3ACLA 3PJYA 3S2HJ 1TBXA 3CUQC 4AGRA 2EZKA 5ABJC 1H9PA 3K75B 2RR12 3SEZA 2B42B 3IKTA 2IXLA 3RTRA 4B3NA 3OIOA 3VBFB 2HWD1 2XUMA 1VQ6I 1Z3XA 1JOBA 2GN7A 4YW7A 3ITQA 3VBSB 1WLDA 5D1IA 4COVA 1X1CA 2L3DA 2D6LX 4PIYA 4M3CF 4AHXA 4CEYC 2PMWB 3AMQA 2XUBA 3T1LA 1H1MA 5KHIA 1AA7A 4DYCA 2R043 4QB2A 5GLWA 1SMTA 4G6DA 1YC61 1HW5A 2LH9A 2KA3A 2XQRA 4CHUA 4IGQA 1GUIA 4S0HB 1W90A 1JODA 5FIXA 2M3AA 3QPLA 3LF7A 2I74A 2HQAA 2MC4A 1VAVA 3UYJA 2YGMA 2FOKA 3K4NA 3PMSA 3SITA 4FTEA 1YX5A 2W2IA 4DEQA 2P3YA 2QQAA 3IDEA 3IAS2 1X19A 1WKMA 4OINF 4XMIA 2A3WA 3HJRA 5EIYB 5FKCA 4UHTA 4ONUA 3POBA 2TNFA 5JXJA 1ZVFA 5GZGA 3KHCA 2D97A 4ARYA 5GADJ 4IHSA 4PIZA 3AG3H 4XLFA 1AR63 1C0WA 5H9RA 4CZZA 2PMZN 3TOJA 5FZHA 3TEXA 2KJCA 2UWCA 5C9AC 3N7KA 3MIBA 2AS5F 2X53S 1ERDA 1AR81 5LHGA 1NX9A 1QOTA 3BN6A 4PQQA 3GZAA 5FPZA 1S4CA 1CJDA 2WA4A 1QJU3 2RQPA 3BJ6A 1Q1VA 3CDLA 2ZMLA 3AP4A 1A8MA 4GAZA 1FZPB 2FBHA 1UELB 3NRUA 3M8EA 3JSPA 2Q8CA 4NC8A 2ARXA 2OPTA 3G4SI 4QQPA 1OFCX 3H1WA 1TWHJ 5K0UB 1OYYA 1Y1WJ 1STMA 2JIGA 5FZOA 4YVWB 4LA2A 5F0HA 1MVEA 1VRBA 2BY2A 3UNPA 1AX1A 4R52A 2FZ1A 4E4ZA 3OYMA 2MG4A 1S3JA 5A6QA 1J0RA 3WQ7A 2IGNA 2DTRA 4PDWA 2ORZA 5DTDA 2ZA9A 4E9KA 3T30A 3MLLA 4MQ9F 2Z69A 2QEXI 4LMYA 5K5QA 1FMD3 5IP6A 2VUAA 1LHUA 1TWAJ 4PCQA 2V5DA 1QGLA 2K9SA 1KDMA 3KSCA 5DAQA 1FP1D 2TUNA 5FZFA 4FVVA 1HKDA 2F4MB 1FNNA 1Q8VA 4RS8A 2Z16A 3ZXAC 4LKDA 5FMCA 1QF3A 1EYBA 4NHYA 2GA1A 4CVUA 4OAZA 3H7YA 2LF8A 4OHWA 3MKZA 2ZX0A 3REOA 4BDZA 4XBNA 2VB6A 4QSHA 2STWA 4A7KA 5CVVA 4CTEA 4WXDA 4QPOA 2ZJCA 3EUKL 5CVJA 3A01A 3H5RA 4COWA 3HMYA 4LLNA 2JVHA 5K5RA 5JI9A 3BPXA 3L09A 3WF3A 5L9RA 3UKTA 1YYVA 2QF7A 4NE9A 2B0LA 3IZOA 3S7IA 4E4DX 2KIQA 1H9GA 3ZFEC 4L97A 4N43C 3RI4A 5LWBA 1GZTA 1F4HA 4CDQB 2BW8A 5KAIC 1HOMA 2VW0A 4O7XA 1FOWA 2IXHA 4EATA 3POFA 1S0CA 1OCOH 4R4ZA 3B6AA 1MGTA 4FP3A 3CUQB 3WNXA 3FBIB 5DZFA 2LC2A 1D5YA 3CO6C 2DA3A 3S6PA 3ZYJB 3O1OA 4HT1T 1U2WA 5ANNA 1MBEA 1RUF3 2UYBA 3H35A 4PIXA 2K9MA 1BBT3 4FTSA 1UU4A 1Z3YA 3ZFFA 2VR4A 1NCQA 4FXKB 3AXDA 3NNJA 2J42A 4AVTA 1LOGA 4A93J 3T4HB 5H20A 4CEYB 4ZU5A 1E57A 4RGKA 3WNMA 1LGBA 3GXUA 1KJLA 2R5ZB 1UU5A 3QQAA 3DQVC 2QQWA 1U5XA 3WG3A 2JECA 5BNNC 1C1LA 1X36A 2CAUA 1UW8A 4KI5M 2ZXQA 3T0DA 5KXCA 2F5CA 2E5NA 4XLNF 2DU0A 5L3DA 1YEWA 1IUYA 4A3XA 2HEVF 3O1UA 1C8NA 2RDQA 4BK5A 3OGVA 4FFHA 5D8LB 3FF5A 1T39A 4YG3A 2E6VA 2ZSHB 1EAH2 4XLEA 1OKQA 5EZHA 1WW5A 4PK4A 4WM7A 4YW5A 3R0AA 4JHTA 4YFKF 3H3ZA 4HX4A 3QU6A 3WDYA 3OS1A 4BYYA 2Y30A 3MFKA 1Y9GA 1YG2A 5FLVA 4TTGA 4XOPA 4S2FA 5C9AB 2CWMA 1J84A 2QKDA 5A3NA 2QCOA 5GJ6A 1Y0UA 1K61A 2DF7A 2FD8A 3R4DB 5GP9A 4AOCA 3U2RA 3FK7A 2GXAA 3HSEA 4KMFA 2QQIA 4IHYA 2J1RA 2B9VA 4XMYA 3NAUA 3WNLA 4K6BA 4O65A 5DDJ1 2EAKA 4R9AA 1RUJ3 1KZHA 2GNMA 2OW4A 4LG0A 1JZ7A 1GVDA 1MD0A 5J1UA 4UUTA 1JGGA 3VZMA 3C7FA 4M6YA 1W4MA 4YRDA 1LRHA 5SV8A 2RS12 4D6SA 3WVJA 3DKQA 3C1DA 5DUIA 3VYRB 1UMHA 4P02B 5FZ6A 5DG1A 3ONQA 2TCTA 4D9JA 5FZ9A 4E27A 2F17A 1OC1A 2V4VA 4AFDA 1VQNI 4XVHA 1IRZA 4MGSA 3Q8AA 1I39A 1DQ0A 1OH3A 2WV0A 4CUGA 4YELA 2F5FA 5DXDA 4O6JA 2JB4A 2XHKA 1XGMA 3OYHA 3V0BB 1AYM3 2X85A 3J8F1 2W25A 4M9ZA 3AVSA 4B4QA 1D0HA 2J5PA 1E5IA 4HEA2 5JXGA 2HYKA 4W4ZA 2RGVA 3ZO0B 3JQWA 4ES8A 5A7OA 2WWUA 3D0SA 1LVAA 1POV0 4CU6A 2CWSA 4YGDA 2HQNA 2VGDA 3OOUA 4I6ZA 4XURA 4KT5C 1RR7A 4Q4Y3 1ZLJA 3H9AA 1ZNPA 2LRDA 1PX3A 3U07A 2WO7A 3F6OA 1AKHA 2DT6A 1T38A 4JQFA 3EUAA 5EJ1B 4DJAA 4QQLA 5DAVA 3NWKA 1IAWA 2YZ4A 4LBQA 1K5MC 5A2QZ 3PNYA 3EUHC 5FMOS 5IFPA 4LB5A 5FYVA 4PDWC 2HWE2 3VBUC 3K1MA 2MYSA 4W1UA 4HXCA 3MICA 2VUJA 4Q5OA 3I0TA 1SLLA 4N43B 1K12A 2Q0AA 4BXFA 1OA2A 2M4KA 2C1FA 3SQOA 2HWVA 1YXWA 4O61A 2DA5A 1CN1A 2LKPA 3AL0C 5JVGF 2FU4A 4XF0A 5KR7A 5DDJ2 4EV0A 3PO2J 1RUH2 4XRFA 2X8KA 1P9QC 5IYCJ 2V1UA 2JA8J 1JT0A 3K4CA 2BFUL 1D0ZA 4QPYA 5ACA1 4FCAA 1R091 4B4CA 2WQ8A 2JRMA 2NYYA 1SFEA 4CYCA 4TSVA 2G9WA 3BPZA 3GF6A 1UZCA 4UBHA 1QBJA 3M7AA 2A75A 2ETEA 4X1EA 2Y6GA 2PTMA 1IN8A 3LSGA 2ET1A 5CG8A 2UZKA 3THTA 3V0AA 4C0BA 3JQXA 4X6AJ 3J8F2 2C5DA 2QQNA 4RS5B 5FUIA 4MTEA 2VXZA 2L9SA 1NA1B 2EIGA 3JRIA 2KFDA 1LUJB 3M3IA 2NLRA 4M74A 3LPGA 4ZXKA 1D0YA 4DNYA 1TTYA 2LKXA 2CV1A 3NKTA 2Y6JA 3RMXA 2FDGA 2NVXJ 5FUPA 3OJBA 2YBPA 4M01A 2VXRA 3MN2A 1DGRN 3QWLA 1LJ9A 4K8RB 4HSRA 1R7JA 3TAYA 3ZFFC 3F95A 2WNOA 1NCQC 2YHJA 5J1RA 1MNMC 3OS2A 3J26N 4R9CA 1LNSA 3HBZA 4BAYA 4KWLA 1D2SA 2JWPA 3EYIA 2VBBA 3FIWA 2ZEZA 1KEXA 1Z05A 1LHVA 5FYMA 5CBLA 4N53B 1X4PA 2A73B 5L7OA 4ZH4F 3SHFA 4AC0A 1V0AA 3ZYRA 2OX0A 2E7AA 2VMHA 2JD4A 2LTNA 1GICA 1XOYA 5TJJA 4XPVA 4UW5A 1FC3A 2JJ7A 3DWLE 3EETA 1J75A 2WFF3 3O0XA 3HB9A 1MS9A 3SKJE 1Z6RA 4BK4A 2Q1ZB 3UESA 2UWAA 2IVJA 3BTJA 3ZXSA 1JU4A 5D4SA 3N36A 4LMFA 3X29B 1HXS1 4C3IJ 1OKOA 5HCHA 3CQOA 1R092 4DFSA 2PHUA 4NRQA 2EQRA 2OUJA 2YFZA 3ZSKA 4G8XA 4E7LA 2MBFA 2ADEA 4ZONA 3W6VA 1QNTA 5KHDA 1X1PA 1D0GA 1FWZA 1YFUA 2JMWA 2GC1A 2NVQJ 4D7YA 2VOKA 2VBXA 2AYHA 2W46A