3I59A

Crystal structure of mtbcrp in complex with n6-camp
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
224
structure length
215
Chain Sequence
HMDEILARAGIFQGVEPSQLQPVDFPRGHTVFAEGEPGDRLYIIISGKVKIGRRAPDENLLTIMGPSDMFGELSIFDPGPRTSSATTITEVRAVSMDRDALRSWIADRPEISEQLLRVLARRLRRTNNNLADLIFTDVPGRVAKQLLQLAQRFGTQEGGALRVTHDLTQEEIAQLVGASRETVNKALADFAHRGWIRLEGKSVLISDSERLARRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Transcriptional regulator, Crp/Fnr family
publication title Structural Insights into the Mechanism of the Allosteric Transitions of Mycobacterium tuberculosis cAMP Receptor Protein.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 62
structure length 215
sequence length 224
ec nomenclature
pdb deposition date 2009-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3i59A02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3i59A01
1GVJA 3KP4A 1G3TA 1CAXB 1KQ9A 3C18A 4BNCA 1J58A 3RJPA 4AVBA 3EHKA 4XFAA 2TDXA 3D0SA 3KP6A 4IRGA 4XRFA 2CAVA 3P7NA 3K69A 2DK8A 1XCBA 5CVUA 2FRHA 2HQNA 3IWFA 2UY9A 1IRGA 1WKMA 2GC1A 1XDSA 2XHKA 1Z91A 4KMFA 4LG0B 1AWCA 5L3EA 2ACJA 2VBXA 4ENMA 2RQPA 3TO7A 2P8TA 4E70A 3WW1A 1L3JA 4MGZE 2IXKA 4HQEA 5KBFA 4Q0QA 4QXKA 3ULQB 3HTSB 2IJLA 1YHFA 2PAKA 4XSXF 1LJ9A 4PIZA 3E5UA 4EVIA 1UIJA 3ERED 4KU8A 2KIFA 5ILUA 2XV4S 3LA7A 1EV7A 4P96A 2LDUA 2VXZA 4P9GA 1HSTA 4NB5A 1OFNA 5DV5A 4I98B 2UZKA 1FYLA 2NS0A 1W7PA 4WXDA 4KIBA 3S7IA 1FPQA 2BGCA 3DN7A 4HVOA 2L54A 4LJZF 5FFZA 3SFZA 5LHIA 3BDDA 1HQCA 2VT3A 2Q0AA 1B1BA 5I0UA 4ZYHA 5BS6A 2Y48A 3U2RA 4RS8A 3MCZA 1MD0A 4FX0A 4KIFA 1VP6A 4LUMA 3PLQA 2GU9A 4MGIE 2IRFG 5LLQA 2EFWA 5I93A 5HLGA 2N7GA 3V7SA 3ZMZA 4IETA 2F4PA 3FM3A 3PFIA 3F8MA 2ETHA 4HVRA 2C0ZA 3EUHA 1YFXA 3LQRA 2VBZA 1NYWA 4HBNA 1S7OA 2JPCA 3V7RA 2YSRA 2VPVA 4OFGA 2MLKA 4RB2C 3I53A 1SEFA 4H7LA 4OOIA 1DZTA 4I0AA 3BZ6A 3EJKA 3HSFA 5D4SA 3GX4X 1QY4A 3WTUC 2QZ8A 5DD4A 2Z69A 1WRJA 2WC2A 3SCGA 4QGLA 2M45A 2PQ8A 5J6XA 1U5TB 1RC6A 5TRDA 4OIRF 4HDUA 4AXOA 3FXUA 2VECA 2E9QA 2VOOA 2GXBA 3EBRA 3JAMZ 2XAGA 3KETA 4F7ZA 4WVZA 5K1YA 4AWXB 3F22A 3BPZA 2L02A 4KT5C 1Y3TA 4XFBA 1KQ8A 1IXRC 1L0OC 2XAFA 3FHZA 5CVIA 2R7DA 4MTDA 4ONUA 2GA2A 2CW0F 2QYOA 1W4MA 3KLNA 3F8FA 3NRVA 2EFQA 3J81Z 2O8QA 2ZFWA 4RGSA 2H09A 4A5MA 1RUOA 1YW8A 4JTNA 2XVCA 1BC8C 2PFBA 3PNAA 3I64A 4YIFA 3CJNA 4Q0UA 1QO0D 3FMSA 4L9JA 2R3SA 1NHAA 2XAJA 4O9EA 4G6DA 1P4WA 1J0RA 2CSOA 3WW3A 4EWDA 3MEXA 2STTA 2OZUA 1R1UA 3UKVA 3S0MA 4XF4A 2FBIA 3ZP5A 2MNGA 4BYYA 2JPBA 3I58A 1WQ2A 4UV9A 3IRRA 5D6EA 1MDMB 1USSA 5FQ0A 3E5XA 1W5TA 5J8FA 5BUVA 3BP8A 4KICA 5EEGA 2CV6A 2HTSA 2KIUA 3R4KA 3ML6A 4U0YA 1Z05A 3SMHA 3FWEA 2A68F 3MZYA 2M87A 4EMSA 4LLNA 1ON1A 2PJPA 4G94A 2E1NA 2QQ9A 3ACLA 1O57A 2PHLA 1OMIA 4O5VA 4UHTA 3FXRA 2COMA 4EWEA 1KYZA 2MH9A 2MD5A 4CDGA 3BPVA 1B6AA 2HJIA 3F6VA 1SD4A 5H6QA 1FSEA 4H0EA 1BOAA 4XFFA 2KKOA 4U7DA 3QU6A 4FHTA 2MBFA 1STZA 2K0GA 4F8AA 3WE2A 1DGRA 5I91A 1K78B 2FQPA 2EAAA 1J3QA 2CO5A 2P5KA 2PMHA 3I5UA 2L4AA 4KN7X 3RNSA 1T6SA 2V09A 1SFNA 3WE3A 2RNJA 2VOPA 1LR5A 3BROA 4IRIA 2PAEA 2AXLA 1LKNA 2QDRA 1CAUA 2PMUA 4XLPF 2HTJA 3LSTA 4KYWA 2EFOA 3CLOA 4ZZDA 3KZZA 4HOBA 1GHCA 3H9AA 3WU0A 3K9TA 4MEXF 1ZZBA 1S7AA 2QM3A 1KYWA 3CUQC 4RAZA 4XFHA 2MC3A 4EJUA 4A5NA 1JXSA 2FMLA 4MNUA 4QM8A 1MJ9A 4M9SA 1J1LA 2BEOA 2PFWA 4R79A 4O6JA 2YX4A 1GQHA 2BNOA 1ZGJA 3K2ZA 5ICFA 1OR7A 2HKXA 5LRRA 4YNIA 3HOSA 3M3IA 2XLGA 2P5VA 3K1NA 1W5SA 3ZPLA 3S7EA 2PYTA 2XL7A 2YU3A 1J7KA 1XE7A 3G3ZA 2I45A 5BMZA 3GFMA 2PN6A 3CDHA 1W7PD 5HVQC 1XD7A 4Z07A 2NYXA 4N0BA 3WGIA 1LRHA 1ZRRA 4KIGA 5JR7B 1YS6A 4EQQA 3GVAA 1NE6A 5LEJA 4AQ6A 3FX3A 4BQAA 3TGNA 4UXAA 2IW5A 2D45A 3KEQA 3U1DA 5D8LB 2P5LC 3O6BB 5LGNA 2EV0A 2DPDA 4IHSA 2DPUA 5H20A 2XKOA 3KFWX 4K2EA 3QACA 1EY2A 4HMZA 2O0YA 2A61A 4AIHA 1P6RA 2XGXA 3ABUA 3LZZA 3LAJA 4D7TA 3L7WA 3G7DA 2LF8A 3TKYA 5HDKA 4KNYA 5HDGA 3W6JB 2OZJA 3ES4A 2GWRA 3BWGA 4GYIA 3NSTA 4L18B 2E1CA 1XDUA 1MJBA 1SMTA 1T38A 5CVJA 1ZARA 2EA4A 1YFHA 5L3BA 2DCTA 4XFIA 5KHKA 1CAVA 1TQ5A 5JSRA 3N97A 3OF1A 3HRUA 1IF1A 4JTOA 2OA2A 4ESJA 3WW4A 4KWKA 4JQFA 1XGSA 2W85A 3HT2A 3H92A 5FCCA 2OU2A 2WTEA 1TW2A 4A0XA 3GXOA 1ZZ9A 4LEJA 1IAWA 3F3XA 3TOBA 2VC0A 4LULA 3RTRA 5K8SA 1YQAA 2EV6A 3ABTA 2C6YA 1X7NA 3BCWA 2JSCA 4M74A 5IT9Z 4PGHA 4HSLA 3D0JA 3C7JA 5C6CA 4LGWA 5FFXA 4LB5A 4PCQA 1XB4A 1O3RA 1GXPA 3H3ZA 2D40A 2XAQA 5BV6A 1LNWA 2VODA 4XFCA 2QNKA 1P2FA 3TQNA 1K7AA 1F1ZA 3C3VA 4DINB 2AS5F 3GFIA 4IVNA 3GF2A 1J3RA 5CLSA 5BOXA 6PAXA 3WODF 2Q1ZB 1DGWA 4D0PA 4YSFA 2A69F 3BB6A 4ZU7A 3UKTA 4R1HA 3REOA 1ZN2A 3SZPA 2D1HA 2BV6A 5FLJA 5FD5A 5HLIA 3RPQA 5I8TA 4EGYA 1KU3A 1JHFA 4EJOA 4YARA 2K86A 1QXJA 2GIVA 4QWQA 4LK0F 3JTGA 4AIKA 4ORFA 4L9NA 2QVOA 4X6RB 1HXDA 4XF1A 2Z33A 4ZH4F 1IN5A 1YFYA 3RIRA 2V79A 3HRMA 3BALA 4IRHA 1BI2A 2BBYA 2JRTA 1ZGAA 1YO5C 3FXQA 1IN8A 4R8HA 1GQGA 1XGOA 4AIJA 5K5RA 4HYEA 1XMKA 1ZRFA 3NEUA 3SHRA 2XKPA 2CAUA 1XSXA 1Z6RA 1SD6A 3F23A 4Q0SA 1CAUB 1IZ1A 2KJCA 5JAXA 2A6HF 1XE8A 3J80Z 2ET7A 3VB2A 1V4RA 1RTVA 2B8MA 2MHFA 1FC3A 4RGUA 2UXXA 1ZHFA 2F5DA 3RYRA 3PVBB 2DU9A 1FYMA 2B5HA 1FLIA 1LDJA 2CWEA 3C3WA 2MA3A 4MX3A 4UVAA 4EWAA 1E17A 5DYMA 4ASNA 2F2EA 3BY6A 1FWZA 4S04A 1HKTA 4XBFA 3HRTA 1IN7A 4E2SA 2Z5UA 4U7BA 1D8JA 2IA1A 4PIXA 2A3SA 3WTYC 3DL3A 5D4RA 5E17F 1IXCA 1D8KA 4XF3A 3OGJA 3CUQA 4RB3C 1TNSA 3HHGA 4MQVA 1OI6A 1G6NA 2GAUA 1YW7A 4ENNA 1H1MA 2KXLA 1SD5A 2HFHA 4OIPF 3L00A 5LBQA 3WGHA 4AQ2A 3WG9A 1RZ4A 3DXJF 5JFRA 2ZMEA 4BH9A 3L2HA 3D5LA 4FBFA 1T0FA 1ZG5A 5E8IA 5FPZA 3WGGA 3U0ZA 2DFIA 1EH6A 2V6CA 5T3NA 4U88A 3WTTC 2PLYA 3RI4A 3CO7C 2OA4A 5FLXK 4EGZA 3R0AA 1RIOH 3V7CA 1X8EA 2F5EA 2IC1A 2QBYB 1ZRCA 1SFXA 3SCHA 2PTMA 2A6EF 4XFGA 1T98A 1G3SA 3L09A 4MGKE 4OIQF 2EK5A 1ZZ8A 3N4MA 2GH2A 1XN7A 5I0TA 3HSEA 4RB0A 2FNPA 4J1XA 1XMAA 3QP5A 3TOAA 2DLLA 3KGLA 3LA3A 1IN6A 2P7VB 2QJVA 4HQMA 2Q30A 1UFMA 3ZMVA 1EP0A 3OCPA 2HOEA 4R52A 1CF7A 1B9NA 1CAWB 2HDCA 1K79A 2H0VA 2QUFA 4BHCA 1CAVB 4A0YA 5LEKA 3HOTA 4WBBA 4MQ9F 4HVQA 2M1BA 3ROUA 1PM7A 3ISPA 1R23A 3MQ0A 2VE9A 1Z9CA 3RYPA 4P55A 3HIFA 4HV5A 4Q29A 1OYIA 4LMYA 4DNCA 2XAHA 2X4HA 3GEZA 2G7HA 2DTRA 4IHTA 1TW3A 4I01A 1LEAA 2HEOA 4ZYDA 1UPIA 4HA8A 1SMYF 4UBGA 3RYKA 4P9UA 2V9VA 2H27A 4CHUA 2HQRA 1TNTA 2NNYA 3HT1A 2WFPA 4QMAA 3TDUC 3PQJA 1PDNC 4CICA 4YFXF 4LD5A 3LQQA 3I59A 4A6EA 5E18F 1NZCA 2K4JA 5AIQA 1R1VA 1P4XA 2MH2A 1HBXG 3KP7A 1WI9A 2P6TA 4RB1A 2DT5A 2D2WA 2FF4A 4LA3A 1FP2A 3TO9A 2NRAC 4HZFA 3BJOA 3JZVA 2O8XA 1UW8A 4B8XA 1EH7A 4K8FA 3ZMUA 4I3PA 2LF7A 5EFUA 5JI6A 4GYGA 4HW0A 4OIOF 2PA7A 3FHIB 2O6GE 3P9IA 3FE5A 3ZN0A 4L0YB 4EM0B 2LNBA 1TQIA 3M7GA 3EETA 3EQLF 2L01A 3KEOA 2IA0A 4UVCA 4HX7A 2JZYA 5E16A 5DUIA 3O3KA 3RKWA 2ZXJA 4CYDA 2RN7A 1J9IA 4WWCA 3BU7A 1P4AA 3UKNA 3RDIA 2L4MA 1O3TA 2OD5A 5JHUA 1IXSB 2OQGA 3WTSC 1I27A 1Q43A 1IPKA 4ZU5A 4M9XA 5F64A 1XGMA 4ON0A 4MZUA 3SQNA 3TNQA 3QPHA 2FE3A 1DZRA 2OAZA 1R5HA 4MTEA 1ZREA 3P9KA 3CO2A 3QOPA 1Y9QA 2BYVE 3H1WA 3CF6E 4N9HA 5EZWA 1ZAOA 2R7FA 1IW7F 3M8EA 2P7CB 3F8BA 4UBHA 1G3YA 2QWWA 5FD6A 3HYIA 1HKQA 3DV8A 1IRFA 1JE8A 4XF9A 5E1WA 4E2QA 1IPJA 2ET1A 2PG4A 2LKPA 2DBBA 5ED4A 2D5FA 1Z7UA 4ESBA 1IUYA 1O5UA 1WA4A 3CUQB 4Z82A 2ZO4A 3NQOA 1QZZA 4TV7A 1YS7A 3FZVA 1G4DA 1U6GA 2QVSB 4G9YA 1H0MA 2FA5A 1QZYA 2DI3A 3OV8A 3ETQA 2KJBA 1W7PB 5AVPA 1J59A 4UXNA 1Z6TA 4IEXA 4LTAA 5J48A 5CYVA 3KMHA 4HN1A 1SFUA 5D5VB 3BJAA 2RV8A 3Q9SA 3R60A 3DF8A 3S2WA 2K4BA 3HHHA 3VOEA 3F6OA 3ELKA 2OYZA 2PI0A 1NXMA 5FO5A 3TNPB 1S8NA 1QWRA 3FFQA 1F5TA 3M1EA 3F21A 3IWZA 2GQQA 5KHGA 5CVRA 1YYVA 2Z99A 3EYIA 5BPXA 5FLXZ 2DAOA 4OMZA 4LG0A 1VTNC 5L3DA 3DP7A 3L2CA 2K02A 3QPTA 3ZQ7A 4GULA 1V3FA 1MKMA 4KMUX 1S29A 1CF7B 4L11A 5BPDA 3H7JA 4U0WA 1HW1A 2J5OA 2FSWA 5HS8A 5HOOA 4CGZA 4G6QA 1O5LA 1J3PA 3T5XA 2OZ6A 1WLTA 3H8UA 2YPRA 1UB9A 1WGPA 3IL2A 2HS5A 2LSOA 4LK1F 4ETSA 4G7OF 3BOQA 5D5XB 1O7FA 3E97A 3JTHA 4ZZLA 3MDPA 3BJ6A 1MJAA 5E8GA 1PP7U 1O3SA 1NE4A 1J5YA 4KN4X 1KU9A 3DFGA 4N9IA 3V4GA 1A04A 1O4TA 3VEPA 1ZLKA 3V8KA 4OMYA 4J1WA 5LGTA 5ICCA 1FXZA 2VQAA 5JSOA 2VT2A 3D82A 1LDDA 1FYKA 2Q4SA 3I59B 2HYFA 4MGYE 4PJYA 4ZYGA 3EO6A 1SD7A 2CQKA 3BPXA 4IEUA 4RAYA 4HAMA 4YFNF 1FY7A 2Y0MA 1B9MA 2FNAA 3C1DA 1YLFA 3CUOA 4L2NA 1LVAA 2M5WA 3HSRA 3MYXA 4HSJA 4AVPA 4IJAA 4FT8A 4FAGA 2QENA 5BPIA 1P92A 2Z2SB 2B0LA 2ZCWA 2XLAA 2GXGA 3J7AO 2K7LA 1TQPA 2EB7A 5KK1A 4L9VA 5HS7A 3OD0A 2Y0OA 1BIAA 3CJXA 3R0JA 5LHGA 5K5QA 3LWCA 2IPQX 3M8FA 2XLFA 3QRFF 2BNMA 4MUVA 4GGGA 4IEQA 4HLYA 3IKTA 1Y0UA 3KE2A 3RPUA 3NVCA 1UCXA 3JAMK 2IVMA 4Q5SF 2ISZA 4M73A 2IXHA 3CL1A 2DQLA 1XSVA 4IEZA 5JVTA 2CFXA 1WWXA 2FQ3A 2ZNYA 2CYYA 3HUGA 3LOIA 1LB2A 1I5ZA 5KHIA 5FQ0B 4IPAA 2BNNA 4KA4A 2GA1A 3U9GA 1JHHA 1V70A 4XETA 2W84A 4EJTA 4IEWA 2M8EA 3FMQA 1RUNA 2A07F 1XRUA 3J81K 1Q5OA 3MWMA 2D1VA 5BXXA 3K1PA 4HF1A 4LFUA 2FMYA 2CGPA 2HKOA 1QGPA 4LB6B 4WK8F 4WF2A 4GXOA 1I6XA 1H9TA 3I71A 1ZVFA 2P17A 3TDZC 4Z2YA 3SXYA 2GZWA 2XL9A 1HSJA 2FBKA 2VBYA 3U11A 3KLOA 4QM9A 5FPXA 3COAC 4YRDA 3RKYA 4PGGA 2ATFA 2W57A 5KHJA 5CJ9A 1R36A 5AONA 1EH8A 3T8TA 2FU4A 5I0RA 1OYWA 3F72A 2MLGA 1Z1DA 1OPCA 1BIBA 3I4PA 1QBJA 2UWMA 4XEZA 4X6QB 4META 4UV8A 4XSZF 4L0ZB 4YG2F 3R61A 4HX4A 4QLCU 1MDMA 3EDPA 2DO7A 2G9WA 3DEUA 1KU2A 1U12A 2WV0A 4HV6A 3AAFA 3RKXA 1B59A 2HZTA 5D1IA 1UCRA 3WW2A 5IT3A 4KU7A 1BBYA 4I2OA 4MHGA 2H6CA 2EFNA 3B73A 2Y75A 1BI1A 5JR3A 3GYDA 3M70A 4DQ2A 2Z9OA 4GO1A 4WXHA 5E1XA 2PHDA 4HN0A 2PEXA 3ZMDA 1X82A 5A2QK 2DW4A 4UVBA 3GO5A 4YFKF 2MPFA 1H1IA 2J5PA 4IEOA 2OQRA 3IKVA 4D7SA 2H6BA 2OPKA 3MZHA 2H94A 3CEWA 1SAXA 1U78A 1AOYA 1B4AA 3CO6C 1U2WA 3NKTA 3CTAA 1QPMA 4KFCA 5CU1A 4RGXA 1K78A 1YFWA 1ZH5A 1H9GA 1RGSA 3SHFA 4A12A 2K9ZA 2IA2A 2UXNA 2O3FA 2V1DA 1R58A 4MEYF 2YR2A 2ZKLA 5L3CA 4WZCA 2M30A 1YG2A 4IERA 1QXRA 1ONVA 4QX5A 2O61A 4ESFA 5HS9A 1S6LA 4ENKA 4HLTA 3LFKA 4EROA 3IC7A 1EYBA 5H6RA 1KQ0A 2NAZA 2ZJ2A 4OLLA 3GUDA 5JCTA 1VR3A 3F8NA 1TTYA 3M9AA 4I02A 4IXAA 4P9FA 1DUXC 2F5FA 3GW2A 4B29A 4CXFA 1UHWA 5J8CA 3W6KB 3GLXA 4OINF 3E6MA 3ZMSA 4XLNF 5ERIA 2O1QA 5J3UA 5DUKA 2JT1A 3LAGA 2W25A 1OYYA 5ILSA 4JVAA 1U8RA 2ESNA 1ZNPA 2YX7A 4UNOA 5E1RA 2O03A 1TLHB 4BIFA 2WWYA 3GFLA 2UY8A 2IT0A 3HTUA 4Q0VA 3RZZA 2HWVA 5E20A 4LLGF 3CLPA 2EA7A 1S3JA 1WSUA 1RI7A 2E7XA 1PUEE 5JSPA 1XSDA 1ZYRF 1FBUA 1R22A 4XF0A 1KGSA 3O2PE 1QNTA 2ELHA 4I0BA 5I0SA 2RGVA 3H7YA 5FLIA 1YW9A 1G3WA 1REPC 3V8JA 3JSOA 3P9CA 2EFPA 2GC0A 1ZG3A 1DDNA 3GYHX 1UIKA 3ST7A 3GBFA 5E1ZB 2ESHA 5DCMA 4AVCA 4O3MA 3JW4A 1ULYA 5DEQA 3E6BA 4BAYA 4NQWA 1USTA 4PZJA 5ICGA 3MPBA 4HX8A 2XUBA 2A5YB 4LA2A 1U5TC 4M9ZA 1VJ2A 3FMRA 1TBXA 4A0ZA 2GC3A 1ZZ6A 5HDNA 3G73A 2Q2EA 2V1UA 5L3GA 4JV4A 4NVPA 4G7ZF 4BHBA 1O7LA 2ZKZA 3ZMTA 4EM1A 1LQ1A 3IHUA 1DPUA 1YTYA 4YIIA 2UYAA 5IT9K 1FI2A 3MFKA 2F5CA 5D5WB 5DDGA 2JTVA 2FOKA 5LHHA 4L5JA 3PQKA 3KP2A 2VN2A 4I09A 5BQTA 3DKWA 2KRFA 1CGPA 1D3YA 3E6CC 1ZLJA 1BI0A 1QQIA 4S05A 4Q47A 1YUDA 2Z3YA 2XASA 4AD9A 4HLXA 4QGMA 5I8YA 1BN5A 5ILVA 5ICEA 1F4KA 3VFZA 3SXWA 1YIOA 1FNNA 5F6FA 5KVRA 3HQXA 3MAJA 3EYYA 2RC4A 2UYBA 3WTVC 1Q1HA 4M6XA 1HKSA 4ZU4A 3T0YA 2EV5A 2FBHA 4JK1X 1YWKA 4ENJA 1R7JA 1XGNA 4MGRA 2X0LA 4EM2A 3GWZA 2EWNA 1Q3EA 1CX4A 1ZZCA 4L5IA 1FSHA 4BXUA 4HF0A 3TO6A 3WTXC 1TQMA 2VONA 3IBMA 5DCFA 4WXCA 2HR3A 1BC7C 2QLZA 4B09A 1T2KA 3KP3A 4I7HA 1D5VA 5AIPA 3ZDSA 3FF5A 5A2QZ 2D5HA 4CO8A 4Q4ZF 2EVXA 3J80K 2ZMEB 1F9NA 1R00A 1LEBA 2QQAA 5CADA 5J7MA 3KP5A 3QU3A 2CG4A 3I7DA 5KHHA 4A2UA 4Y15A 4EV0A 1CAXA 1FX7A 2RDPA 5FB2A 5FLHA 4WCGA 2IXIA 2P4WA 3LA2A 2EA2A 1X8MA 4IEYA 1GXQA 3FM5A 4ZYEA 4AVAA 1YFUA 1EPZA 1X3UA 1RNLA 3ECOA 3B02A 2OBPA 1DPRA 2ISYA 4MH0E 4RGRA 4BHPA 5DD8A 3LWFA 4PDKA 4TLFA 5I8SA 3F8CA 2KIMA 3DPLC 5FDBA 1KA8A 4M6YA 2FXAA 2E7WA 5FGMA 1ZG1A 5BY5A 3FJSA 1FBSA 4P5OA 3WU1B 5L3FA 1FOKA 3V8LA 3ECHA 2B9UA 4FAHA 4KUMA 4G7HF 1I1SA 1ODDA 4FX4A 1IN4A 1O3QA 1RL3A 2RVCA 4QGNA 1XCVA 2PBIA 4NHJA 3E6DA 2BE5F 3WTWC 4HF2A 3KGZA 4M71A 3KZYA 3USSA 3KCCA 3HRSA 2L3DA 2PAMA 1ZX5A 4LLLA 3QP6A 3H1MA 4O9GA 4Q0PA 2VBWA 4UUVA 3NW4A 4Q48A 4HDVA 4MV2A 3VHRA 1FP1D 4KL1A 4KWLA 5K5OA 4Y13A 2NNNA 2QBYA 2IXLA 1SFEA 3ELNA 4YYOA 3IDBB 4U0VA 1YLLA 2ETEA 3GZ6A 3T1BA 2W24A 3GZ5A 2IXCA 2VC1A 1FBQA 2ADUA 5DCMB 4EJVA 3Q9VA 3FZ3A 4KDPA 3LAPA 1HW2A 3H3UA 3NJZA 3ES1A 3VODA 3T8RA 2XIGA 3KSCA 5LRSA 2ZBKA 3IRQA 3O14A 4LUKA 1CAWA 3ZN1A 3GFJA 3E3VA 1R1TA 3E5QA 5EEHA 2K27A 1J2XA 1I1GA 2RKHA 2ZNZA 4LLOA 2HGCA 5D5UB 2QQBA 1HW5A 4WX9A 1KU7A 1FT9A 2FEZA 1ON2A 2PQQA 2Q0OA 1LDKB 4M72A 5TJJA 2GC2A 1JGSA 5D6FA 1U5TA 3WTZA 3I54A 1C0WA 1BM9A 4RD7A 2VE8A 3IIAA 4G8XA 4L9TA 3K1MA 4CZZA 3JSPA 4IF4A 1T39A 5D8KB 1MGTA 4PIYA 3U10A 2STWA 5LGUA 5C8WA 4GCVA 4Y17A 3EQEA 4IEVA 2D93A 1BI3A 2EJRA 1UD1A 4KWJA 1PMIA 4IESA 5F1RA 4JBAA 1K6OA 1R5GA 2QCSB 1MZBA 3Q5FA 3DQVC 4A6DA 5HI0A 2HYGD 2IP2A 1PP8F 2IXJA 3QAHA 5HLHA 1ZRDA 1OKRA 1U3EM 2XROA 1J75A 3SZTA 1SQ4A 1BJAA 3L9FA 1E2XA 4EJWA 1L3LA 4E2GA 1ZZ7A 2DQRA 3H1YA 3DPTA 4HBLA 3IDCB 3K0LA 3H50A 2V1XA 1JUHA 5CVVA 1DP7P 3SCFA 2Q8KA 3NL1A 4OU0A 3OTFA 2DK5A 1FZPB 3R6SA 2XRNA 1OD5A 4IEPA 3OOPA 3I0TA 1UHMA 2G7UA 2P6SA
chains in the Genus database with same CATH superfamily
1GVJA 3MFCA 4CH7A 3C18A 4BNCA 2NN8A 5FY9A 2QFEA 3OYAA 5F3CA 4V2FA 1ZYBA 4PBOA 3H36A 4XFAA 3THTA 3M7AA 1AXYA 4LR4A 4IRGA 2DCYA 4ZDPA 5CVUA 4Q4W2 1WKMA 1LFPA 2W1SA 1OOPC 2XHKA 2ZHLA 1OBNA 1AYM3 1S5LC 2R7OA 3QCWA 1H8AC 2ACJA 4ENMA 1ASJ2 3WXPA 3OMYA 1WH7A 2RQPA 3N9QA 5DUUA 4UY8I 1LHOA 3TO7A 4RAGA 2ZBJA 4HKWA 3KV6A 1FPN1 4HEA2 5KBFA 4Q0QA 4CYCA 1V9U2 2LROA 4X1EA 1NG7A 2RDSA 3VDBA 1I39A 4XSXF 1LJ9A 5FKMA 3E5UA 2A05A 2JB4A 1UIJA 2KIFA 5ILUA 2OVUA 1VBA1 2VKVA 3BODA 5FLVA 2L0KA 4QXBA 3VPRA 5L7OA 4PI2A 4YZ1A 5EDNA 3SEEA 3AL0B 1MPXA 3T09A 1FPQA 2EAKA 4LBKA 1OCTC 4BQQA 2VOXA 4W97A 1HF0A 4LJZF 4A7YA 4ATFA 1WMXA 3SFZA 4DYQA 5LHIA 1HC8A 2NOJB 4AVTA 5LZ6A 2Q0AA 3C2HA 3RWNA 5HODA 4F55A 2OJED 1J09A 3T4VA 1FIAA 1MD0A 4FX0A 5LLQA 1C8M3 5BNPB 4BBRJ 3AG1H 2D97A 5A6QA 4EN8B 3V7SA 4Y24A 4AU7A 1S2BA 2ETHA 4RAFA 3S2HJ 3M3YJ 2D7FA 1NYWA 2X5IC 1DQ0A 4GFBA 4OFGA 4ZXKA 5A3MA 1DZTA 3VBSC 3HPNA 4G6TB 2H8RA 2QZ8A 3BKZA 5FJKA 4BIOA 1LTEA 4R9CA 1DU6A 2R7SA 5LY2A 3OYDA 1VIWB 5G05L 4QGLA 2M45A 1U5TB 1RC6A 3M4OJ 3UETA 3CMEI 2DYSH 3ZOIA 4KISA 2VAUA 4IW3A 4JDMA 4F91B 2E9QA 2E1OA 5GP9A 3HUGB 1AJKA 4AC0A 2GXBA 1KONA 2CL2A 3K75B 2XAGA 3KETA 2GNDA 2YUEA 1JU3A 3T0DA 4XRSA 3BPZA 5J36A 5FPAA 2HEYF 1MMGA 1L0OC 3CMMA 1XB9A 1AR91 5T55A 3LL7A 2YBSA 3LSGA 3Q8EA 2DFCA 2GN7A 4MTDA 3VBRC 4ONUA 3KLNA 1B35A 2UURA 3I3MA 3C7HA 4BKXA 1PJRA 4RLFA 1RJ7A 4P1WA 3C7OA 4RGSA 4JTNA 4F92B 3O1OA 2PFBA 2UV1A 4YIFA 3CJNA 2Y9YA 4Q0UA 1MS4A 2JSPA 3JQWA 4RR3A 3MZ8A 1NHAA 2V73A 1P4WA 2FDFA 1Z0XA 2STTA 4QQLA 4YW5A 5I0DA 4QDRA 1DCSA 4XF4A 5ABJA 3FUOA 4TXWA 4XYXA 4BYYA 2E19A 4UV9A 1CZVA 3IRRA 2AC1A 3HVDA 1RC9A 5FQ0A 1BMV1 2EIJH 5FZMA 1W5TA 3GMEA 1JKQC 3SEQA 4N8MA 2F6CA 2KIUA 3AFHA 4S2HA 4U0YA 4ASLA 2J1VA 1XE0A 3FWEA 4EMSA 2PJPA 4HXCA 4G94A 3CCQI 3X29B 2E1NA 2RR11 3ACLA 3CNAA 1O57A 2PJRB 2PHLA 1OMIA 5FRMA 3FXRA 4RA2A 1DYOA 2MH9A 3BPVA 4LHLA 4NAOA 3ZQFA 3ZXLA 3ONQA 2KKOA 4U7DA 4HKLA 2DCKA 3V65A 2MBFA 4LIUA 4F8AA 1NY71 1QVUA 2FQPA 2HU9A 1UNBA 4Q5OA 2P5KA 2QUOA 2GNBA 4QSHA 4YVSB 4OUEA 4FASD 3I5UA 3H5RA 1SFNA 3WE3A 3WG7H 3GLLA 5B4XA 5EEAA 1JOBA 1LR5A 4PQ9A 2OV7A 4KYWA 2EFOA 3A0BC 4ASKA 4OAZA 2W9XA 5FKLA 5HNFA 3N7LA 1DQ2A 1GHCA 4XR6A 3WU0A 4MEXF 4UWDA 4DZPA 2QKDA 1ZZBA 2WV1A 1S7AA 1N25A 3ZDVA 4IUGA 3WEZA 1TT0A 5IP7J 2UU8A 1RUI3 5FY1A 1KEXA 5AC91 2BGPA 1HRV2 4QM8A 1MJ9A 1J1LA 1GFF2 4EN6B 3O8HA 2VU9A 2WA3A 3ZLIA 4O6JA 1ZGJA 5ICFA 2HKXA 4XUNA 3HOSA 2VC9A 4YG3A 2XLGA 1RUG2 1W5SA 3ZPLA 2BVVA 2CGNA 3S7EA 3PHMA 3I8TA 5EHDA 1XE7A 2NMOA 2I45A 3H35A 4U36A 5BMZA 2PLV3 4MFEA 1W7PD 2NYXA 1LRHA 5L19A 4KIGA 3PM1A 1ENXA 4JX6A 2BHZA 4EQQA 1NE6A 1NOVA 5LEJA 3AKPA 3FX3A 4AQ6A 2B42B 3TGNA 4UXAA 1O59A 2IW5A 4PCRA 3U1DA 3N05A 4DXTA 5LGNA 5J1XA 5T54A 1LENA 2DYCA 2DPUA 5H20A 1MACA 3QACA 4XUOA 1T56A 1T95A 4FPYA 1QJU2 3GNEA 1UQXA 3PUHA 3ABUA 4IQJA 4YZ2A 2WQ8A 3ZQHA 4D7TA 3L7WA 1IDZA 3G7DA 3WLUA 1PO12 4FTEA 4DQAA 3OYMA 3BC8A 3ASIA 5HDGA 1W06A 4CE8A 1OKQA 1TME2 4L97A 1QIQA 4NQWB 2XXZA 3VHOA 2E1CA 4A3ZA 2XWJB 1T38A 5CVJA 4CDQA 1C28A 2ZGQA 2R072 2FQ4A 2R7RA 2KISA 3VBFB 4K3UA 3Q9OA 3OF1A 3HRUA 1M06G 5KXBA 4M00A 5J1YA 1OH3A 1LHWA 2W85A 3T2OA 4YLZA 3M07A 2OU2A 4B4QA 4J25A 2A6ZA 1ZZ9A 4Z6YA 5DAPA 1IAWA 3TOBA 2VC0A 1QJFA 2R7QA 1YOVB 3RTRA 1YQAA 2Z16A 2OQ6A 3BCWA 4DZJA 3ZR5A 2FJ1A 4PGHA 1AXKA 1DZQA 1SEUA 1RUI1 4LGWA 2DTZA 4LK7A 4LB5A 4IE5A 2W52A 3HKZA 5APAA 4RGGA 4GA9A 5HBAA 5BV6A 2VODA 4XFCA 2QNKA 1P2FA 2YG0A 3TQNA 5DQ0A 2PMZA 4DINB 1H8TB 1QZEA 3VD9A 2ZFUA 5K9YA 1XNKA 2YZ4A 3KX2A 4XONA 2PLV1 3VLBB 2ZX3A 5J4YA 1VB4A 2A69F 3BB6A 4ZU7A 2KRHA 1JJ8C 1JS9A 4FVVA 4R1HA 4CU6A 4AM3A 5B1BH 5HLIA 3RPQA 4EGYA 3I2GA 1RESA 3N3HA 4LK0F 2QVOA 4JKLA 4X6RB 1HXDA 2BGOA 3VBOA 4QB6A 4ZH4F 2DUQA 4ZTFA 1H2KA 3BALA 2W2IA 1BI2A 3PMSA 1G9AA 3W20A 2WNUA 2NXNB 4G4FA 4R8HA 4O7XA 3NEUA 2XKPA 2ZGKA 4OZOA 3K4MA 3LEIA 2KJCA 5JAXA 4RN5A 2HH9A 1RRJA 2DJNA 1RTVA 1UAAA 1FC3A 4JDOA 3C7FA 2UXXA 1AR73 4HPQA 3PVBB 2DCZA 1FYMA 2B5HA 3JU9A 2MA3A 1VALA 1XG1A 3CBNA 3LFMA 5C3PA 2X85A 2XPWA 3ALQA 5FO8B 1FWZA 4SLIA 3HRTA 4AHXA 4U7BA 1D8JA 5FZFA 4PIXA 2ARXA 2BW8A 4BE2A 3GZUC 4MYEA 2A3SA 4RQPA 2K9LA 4FFFA 1AYN2 5D4RA 1IXCA 4XF3A 2R7ZJ 2VMCA 2W5FA 1X2MA 1OA3A 1TNSA 5DAWA 1OI6A 1G6NA 2GAUA 1YW7A 2PHUA 5FZCA 2HFHA 4QB1A 4OIPF 2L9NA 4UW5A 1DFQA 1WA6X 3DXJF 2DVBA 1UYZA 3D5LA 1HJFA 5E8IA 1OPMA 5FYUA 2WA4A 4N53C 1TC3C 2A7AA 4U88A 3WTTC 3MIHA 3CO7C 3N35A 5FLXK 1DLLA 3R0AA 1RIOH 3VL8A 1SFXA 2C9KA 4WVVA 4XFGA 3L09A 2EK5A 4RLQA 3SISA 1ORKA 4XW3A 4RB0A 3HKZN 2C24A 3ACIA 3BI3A 1XMAA 1LCLA 3ZYRA 1F31A 1NA1A 1IN6A 2LKXA 5FPBA 2PMZN 2QJVA 2VL8A 3DPRA 5JDBA 2QQOA 4HQMA 2Q30A 2HOEA 1MZEA 3HZJA 5IYBJ 3POBA 1B9NA 2HDCA 2CW8A 1K79A 4JYKA 2B39A 4FCAA 5FYZA 1CAVB 4IHYA 2VZSA 3AL0C 1QJY3 4IL6C 4FPGA 4MQ9F 1V6JA 4RS5B 1G9DA 3DBRB 2CWMA 1Z9CA 3RYPA 4P55A 5C71A 2VKEA 2LYCA 4YW6A 4HV5A 1SVMA 4LKEA 1S7EA 1N1VA 3GEZA 1W6OB 2DTRA 4IHTA 1TW3A 1N1TA 3S15J 4NPRA 2RAEA 2HYKA 5ACA3 3WNPA 3DPUA 5DG2A 1PDNC 2E2IJ 2GLOA 4YFXF 1LKXA 2XVKA 3I59A 1VQKI 5E18F 2OT7A 3NNJA 4P00B 4XKCA 5FO7B 1YX3A 1HBXG 3KP7A 2P6TA 3MW4A 1ND2B 1Q8OA 2HVRA 1C4RA 2XDVA 5IK8A 4LOTA 4XILA 1SPPA 4BXSV 2P37A 2O8XA 3T08A 4FETA 1NLRA 3H8OA 4I3PA 1CIYA 3IPVA 4A41A 1PO22 5FZIA 4X8PA 5F3IA 3FHIB 1JTZX 4L0YB 5G04L 3M7GA 4UF0A 3WF2A 5A1LA 1XMXA 4HX7A 1RUD2 4GKYA 5DUIA 4A4AA 3RKWA 1X1AA 1MS0A 5JMCA 4YGBA 1ETVA 1J9IA 4WWCA 1Y56A 3BU7A 1HX6A 3H0OA 3BR1A 4GH4B 3RDIA 1RB8G 1IG0A 4AR2A 1Y1VJ 2OQGA 5FZBA 1I27A 2WAQA 3JBG3 1MEC3 2HWE2 2XHNA 2FE3A 4QKBA 4Z2WA 1YI9A 1APLC 1SDWA 1QJY1 4GD4A 4D6SA 2LVSA 2B63J 4Q4X3 4TLGA 2KM2A 1MW7A 4UBHA 3OWTA 1G3YA 2QWWA 1DF0A 1LODA 1IRFA 2VQGA 5E1WA 4E2QA 1IPJA 1GICA 3OYGA 2JKXA 3T1LA 3PSFA 1IUYA 1O5UA 3CUQB 3D5RC 1ENSA 1R083 4AFCA 2DA4A 2VJIA 4BDZA 4XLEA 1TWFJ 3AC0A 1X1CA 4G9YA 3CJIB 4BACA 2FA5A 5IATA 2KJBA 1W7PB 1G86A 1GUUA 1J59A 5D21A 4QKDA 1VAMA 4IE7A 1QVTA 5J48A 4PSWA 2CGOA 2ZX4A 5D5VB 1Z7LA 3BJAA 3Q9SA 1RKWA 3DF8A 3VOEA 5FIXA 1XBFA 3ELKA 2VZ1A 2PI0A 5FO5A 3TNPB 1RPWA 2ZTNA 3DU5A 1QWRA 4LO6B 1QQP2 1W9TA 2YXSA 3CCMI 3D3AA 1YYVA 4Q4Y3 4L9BA 3ZXEA 5BPXA 5C4WB 1WFXA 3MLLA 2X29A 3L9JT 2ZHKA 1IOAA 4FI9A 4YVSC 4QPOA 3H9GA 4F3QA 2DA7A 2GBYA 1MKMA 2J1TA 1V54H 3MF9A 1CF7B 2R32A 3H7JA 2WS92 4U0WA 5HOOA 1W2NA 1B72B 4CUAA 2WT1A 2IS6A 2FDHA 2WWJA 1B8IA 3MBWA 4ZZ8A 5BNNA 4BPZA 2HS5A 3IL2A 3OOXA 2Z42A 3UGGA 5EYRA 1O7FA 3E97A 3DBHB 3BJ6A 3JRDA 1RUJ3 4LO8A 1YI7A 3JBG1 1MEC1 1NE4A 4GWMA 4AGRA 3V4GA 5B1AH 1A04A 5JI9A 4CDUA 4J1WA 4R9AA 4FE7A 3MPPG 1FXZA 3POJA 2VQAA 1FOYA 1AL23 4Q4X1 3O1UA 1LDDA 2IXSA 1YQ8A 4CU7A 3W5MA 5FP3A 4RYDA 3VYRB 2VXRA 1UG0A 3AYAA 2D43A 4L8QA 2WN2A 2YV8A 2WAQN 4ZHNA 4RAYA 1BR4A 1IQAA 4YFNF 3VSLA 2W94A 1FY7A 2KQRA 2Y0MA 2KHMA 2FNAA 2XJPA 3C1DA 1MBKA 2A70A 4FT8A 1KRIA 1AX2A 1P92A 4NHYA 2B0LA 1GOGA 2COBA 2XLAA 3J7AO 2ZAHA 3ZQIA 3BTXA 1JUSA 5F32A 4XUTA 5HS7A 3A4UA 5IUQA 2YFZA 2Y6GA 1OSGA 5EP9A 3CJXA 3R0JA 4K9SA 2VPRA 2RDQA 2D98A 2IPQX 1U5YA 4BDYA 3LSRA 3R4UA 2MGQA 4AI2A 3KE2A 3KF5A 4XUPA 4AEKA 2Y26A 1R4MB 2IXHA 1XSVA 4C3HJ 2Y6JA 3MIDA 3OGVA 1YRNA 1W8ZA 2ZNYA 1LB2A 1I5ZA 3V0BB 1UMHA 2YC4A 4P9IA 1JHHA 2DU1A 1SCSA 2DURA 1LEMA 1XRUA 1Q5OA 5IP9J 4XMIA 3I55I 1WZXA 4KGGA 2CGPA 3KYCB 4XLFA 1NG6A 4WK8F 3OYIA 2KIQA 4WF2A 4WM7A 5IVCA 1JYXA 2LY9A 4YZ3A 1REEA 2P17A 3IMMA 2XL9A 1HSJA 4A3FJ 5FJ8J 3M3OA 2QGUA 4E7ZA 5FPXA 4NRPA 2EZHA 1PVEA 2FDIA 3AXDA 2W57A 2MYSA 1XQNA 3AZXA 3NWTA 1W6QA 2VY0A 3LSKA 2P0WA 1Y4WA 3TEZA 2R7WA 4MGSA 4LO4B 5I0RA 4OVEA 2V5DA 2RE9A 1NUKA 5EJCA 2YU9J 1QBJA 4MXVA 2WZPP 4BDVB 3KVAA 3BQYA 2G4IA 4META 4XSZF 3M1HA 3H0GJ 1LNSA 4IX7A 2ECCA 3TB0A 3F0CA 2X9DA 3EDPA 2W87A 2G9WA 2DXIA 2IWGB 3DEUA 1D1AA 4HV6A 1B59A 2XRLA 1UCRA 1HDPA 3IKWA 4I2OA 2V5YA 2DMTA 3ZN4A 2Y75A 5JR3A 4CXYA 5DM6F 5EF6A 2WY7Q 3HG9A 3FXMA 4WXHA 1Z0HA 4K21A 4M0HA 2E71A 2GOXB 4UVBA 1VQ5I 3GO5A 1QOOA 2MPFA 2EXKA 2J5PA 1HB4A 4D7SA 1TZLA 3MZHA 4DS0A 3CO6C 1T6BX 3NKTA 1D0XA 3CIHA 3GDBA 1YQCA 1BBT2 5CU1A 3KF3A 1H9GA 1RGSA 1S0BA 1RUF2 2VZ3A 2K9ZA 5BNQA 3CCUI 2UXNA 3H9JA 2V1DA 1UOFA 4II2A 2RJ2A 1E5IA 4XACA 2YR2A 3A7QA 4P9XA 4WZCA 1TMF3 1ONVA 3B6CA 5HCBA 4PK4A 3DTIA 3S6PA 5C33A 4ENKA 3SZGA 2ADEA 4PDWC 4EROA 4A3XA 3Q3SA 4TWTA 1KQ0A 1SBDA 4XMYA 4LG3A 2PQSA 2VE1A 4AIDA 1TTYA 4CXFA 2JA7J 3ECQA 1GOHA 4OINF 4E4SA 2IGOA 3CCEI 1UOJA 3SFIA 3J8F2 5DZFA 2RNGA 2NVQJ 3PNVA 1JT0A 1OYYA 2KP6A 1HXS2 1JOJA 3PJYA 3BTZA 2QQUA 2VZRA 3CCLI 4UNOA 2O03A 1N47A 1RHI3 1TLHB 1PZ8A 2XBO2 3LB9A 1FOD3 4YW7A 2IT0A 2HWVA 1W99A 4GKXA 3WF1A 1R1A2 4XF0A 1QNTA 1JUPA 1YW9A 1HJGA 2XB0X 3V8JA 4NR1A 3KPHA 3GYHX 3KQRA 3ST7A 2CU7A 5IVFA 5E1ZB 2JN6A 1PVC3 2HWF3 4JX0A 4RS5C 3JW4A 5ISLA 3O1MA 5DEQA 2R063 1CPMA 4HK8A 2BDRA 4DNYA 3WP5A 4BE0A 3BLYA 1IV6A 2EXJA 2VW1A 1ODNA 1G9BA 4QPQA 3BCBA 4LA2A 1CQTA 1O8PA 1TBXA 3FXLA 1VQ8I 1PK6A 2BP6A 2Q2EA 1E3PA 4JV4A 3CF2A 4AHZA 4ARYA 1YTYA 4XPVA 3ILNA 1VBB1 3MFKA 4AI1A 2XB6C 1GNHA 1LFUP 2HWD3 4M4RA 2HNHA 3RI9A 1GR3A 2WAEA 4QHBA 2NP0A 2OC6A 3NMBA 3ILRA 1GANA 3FKJA 5BQTA 4CUGA 2AXTC 4KWUA 2A6TA 2YBKA 1YJ9I 5FYSA 2E34A 4AD9A 1ZK8A 2FZ1A 1WGXA 1BN5A 2PXJA 1S0DA 4XZPA 2E6VA 4PQQA 4Y20B 2VTXJ 5KVRA 4GXLA 2QQJA 3WTVC 4IE6A 4M6XA 4HSRA 4OI2A 1XNAA 4BQ1A 2XWBB 3ACHA 3KEYA 3QYEA 5D2AA 3ZYIB 3Q0VA 2BW3A 4EM2A 5IT6A 1FOD1 1FSHA 4BXUA 3BR5A 2VONA 2E7TA 5DCFA 1NTCA 1P9QC 2HR3A 1YHQI 2B45X 3WR0A 3DEWA 3ZDSA 5A2QZ 2D5HA 5GZDA 4LBNA 5JI7A 1FYUA 4OQ8A 1BEV2 2D3PA 1VF9A 2ZMEB 1F9NA 3RZKA 3ZSLA 2QQAA 5J7MA 1R1ZA 5T5OA 3A0HC 2HWF1 3BR6A 4LBOA 4EV0A 4DRVA 1E5SA 1Z21A 2RDPA 1GNYA 4Q8KA 2R061 2XB5A 3TRSB 5FZ9A 4QPGC 3T2TA 2P4WA 3LSPA 4IEYA 1X8MA 4DXSA 1GXQA 3CDIA 3FM5A 4ZYEA 4AVAA 3IAQA 2BPA2 4W6YA 3OIOA 2M7BA 1X3UA 4IV1B 4D1QA 4YRVA 3VZOA 4CRQA 2VJ5A 2DA1A 4DYCA 1V00A 3LWFA 1DQ6A 2DT7B 1VMHA 1KA8A 3BZCA 2HOSA 2EIBA 3VBHA 1YJNI 5FGMA 4CCCA 3BG5A 5E3MA 3WU1B 5L3FA 1FOKA 3V8LA 3ECHA 2D6KA 4FAHA 5JOWA 4EN7B 5IPAA 1OVSA 5IVVA 2YC0A 4XQWA 3B3QE 3VYUB 3E6DA 2DF7A 4QDQA 3KGZA 1KDKA 3KCCA 2B4KA 2L3DA 4W50A 1B09A 2VBWA 1SACA 3UR3C 4YFWA 1YQ5A 4Y13A 2QBYA 2I74A 3S30A 2QQMA 5C4WC 3FHQA 2JA2A 2IXLA 3VD3A 4Q4V2 4YYOA 3DLAA 1HV1A 2OKXA 1LOEA 2W24A 5LA0A 5BNPA 2VC1A 3TP0A 5M5WJ 4E9KA 3N9MA 1UY1A 2YYOA 4RSUA 3VODA 2LW8A 4UAPA 3T8RA 2V4AA 2XIGA 4G12A 1AL0G 4EQVA 3KSCA 5JVGF 3VHNA 5LRSA 2ZBKA 4IL7A 4LO5B 4OHZA 1CAWA 4V2VA 2WO7A 4IQ4A 4C1WA 3E5QA 4CEYB 5EEHA 1FMD3 1EAH3 1J2XA 2ZJCA 2RKHA 2EF6A 3ZXGA 4A93J 4CP9A 2E2HJ 2VZOA 1HW5A 2ZMKA 5F04A 4YG0A 2AYHA 2WZEA 2EQRA 5CA6A 4I0WB 1U5TA 3WTZA 3I54A 2MG4A 3ZYPA 3SDBA 4RD7A 2VE8A 2K9NA 4DW6A 3TBDA 2J42A 4IF4A 4CZCA 2HWB2 4PIYA 3WDVA 5DG1A 5LA2A 5LGUA 4GCVA 4EN9B 1Y1WJ 1JZ8A 4IEVA 4BEHA 3M1CA 2ZGLA 1V6OA 3BTYA 5LCWL 4FFIA 4YEJA 3OBTA 2QDNA 5HPOA 3Q5FA 2QE3A 1TWCJ 2HYGD 4XBQA 2IP2A 3FL7A 3VD4A 3VYTB 2IXJA 4UW6A 3QAHA 4R9DA 2GSYA 5FXZA 1C57A 1H2NA 1JTXA 1QXPA 1J75A 1SQ4A 1E2XA 3AM2A 4EJWA 2LKSA 1ZZ7A 2DQRA 5FZ4A 3C7GA 2JQ7A 3DPTA 1NK2P 1H88C 3LCPA 1VBC3 2V1XA 3SCFA 1D4VB 5IOYA 2WQZC 1D5YA 5F0HA 5L73A 1VBD3 2MEV1 1UHMA 4MVTA 3VKLA 1WCKA 3KP4A 3ZIXA 4E8CA 4A7KA 1J58A 4QU1A 1PX4A 2BU9A 5K7PA 3EHKA 4BISA 4BS9A 1XX5A 2ZX2A 2M0MA 1PGW2 3ZKYA 3FDYA 2TEPA 3ETPA 3NWKA 3EUAA 1IS4A 1XCBA 1FMD1 1LHVA 3NWSA 2FRHA 2UY9A 1BZWA 3W2VA 1GMMA 2PJRA 2B9SA 2R1DA 3MMYB 4ISRA 1Z91A 4KMFA 4LG0B 1H0BA 3I97A 4DXRA 5L3EA 2VBXA 1LUJB 4ZXEA 5EG0B 2P8TA 4YVWB 3ZIWA 4Q4W3 3DWLE 5FFOC 3LEGA 5FMOS 4E70A 3IIIA 1L3JA 4MGZE 1RVF1 1QF3A 4QXKA 3ULQB 3HTSB 1YHFA 2LBFA 1ASJ3 4PIZA 4EVIA 4KU8A 4LLFA 2AZ5A 1EV7A 1REFA 4P9JA 5F6LB 4GWIA 1HSTA 1V9U3 3MKZA 1MMSA 1OFNA 4I98B 2UZKA 3HB9A 4QPWA 3WCSA 4FOQA 4WXDA 4KIBA 5JZGC 2NM1A 4YZ5A 4B8EA 1HQNA 4LORA 1OR7C 2RMU2 4OCTA 3BDDA 2ZEWA 4GB32 1HRI2 5JLWA 4JGZC 5A7QA 5I0UA 3L2QA 4ZYHA 5BS6A 3WUDA 2Y48A 5F1JA 4ZKTB 1VP6A 4AFBA 3PLQA 4BK4A 2GU9A 1X1PA 1T8IA 1S0IA 5I93A 3IDAA 1W2UA 5FO9B 2N7GA 2P5BA 2EZKA 2FCVA 2O7OA 2YU2A 2BTVC 2YGLA 5EWSA 3O1RA 3PJQA 3PFIA 2WNVB 2VUMJ 2C0ZA 3VGIA 2HEVF 4P9WA 2E35A 1CR7A 3EUHA 4KGQA 1NQDA 4YM0A 3VBUA 1S7OA 3V7RA 2VPVA 3LDRA 3HOYJ 3I53A 1SEFA 4FPJA 4OOIA 1VBD1 3BZ6A 3BR3A 3EJKA 1IGOA 5D4SA 1M1EB 3K4BA 2Z69A 3RS6A 3I2FA 3L1PA 3AZZA 5TRDA 1JYIA 4AXOA 3EXUA 4GJZA 1BW6A 2PN5A 3FXUA 3K46A 1D4M2 1W36D 3C8XA 3G2BA 2VOOA 1I9RA 2QQNA 1IZ3A 2VGDA 1S2KA 2JDYA 2QCOA 4OI0A 2XJRA 1JT6A 2L02A 4A3GJ 4PT6A 1KQ8A 2V6EA 4LKFA 4BZ4A 5A7WA 3CCYA 2XAFA 4BWOA 1NCQB 1COV1 4C90A 2LRPA 1WVRA 1ASJ1 4ZPIA 5C8CC 4P5HA 2XQRA 5A6ZA 3F8FA 4AVSA 3VBFA 2EFQA 4CDWB 5FYHA 2O8QA 2JD4A 1FMWA 2ZSHB 4DZGA 4A5MA 4ZTJA 4QPIA 2QZ2A 1ND3A 1W2OA 2TRTA 5BNGA 4NAMA 3M3CA 1QO0D 5GLWA 4L9JA 5JOZA 2XAJA 1GV5A 1VQOI 3K70D 1J0RA 2CSOA 3GZEA 4JKKA 3S1QJ 1R1UA 3S0MA 4XKWA 5DUVA 3NJVA 5BNOB 4RMNA 3WINE 2JPBA 1X9TA 1W28A 5D6EA 5GLVA 1H4HA 2LFBA 1N3OA 2JG9C 3A01A 1D0HA 1YJWI 1H8TA 4XJUA 4HT1T 3AKQA 5EEGA 3EYPA 3BR0A 1ZR4A 2CV6A 1GBGA 5FKKA 2HTSA 3QLQA 3H0DA 2XPUA 3PUAA 3MZYA 3TYJA 1QH7A 5GADJ 4O5VA 1MR5A 5M0TA 5C3OA 1KYZA 3BVCA 4CDGA 4RHV2 3WDXA 2G0EA 4MADA 3K4CA 1SD4A 3D6EA 3ZFGC 3HOVJ 4V1PA 3DXUA 2L9SA 4XFFA 1BOAA 2VOKA 4FHTA 2K0GA 3RQ0A 4DO0A 1X1DA 3WE2A 2Y6KA 5I91A 5F27A 4HPKB 1J3QA 4IV3B 5JXGA 3NKGA 2L4AA 2QQWA 2CTVA 2VOPA 3BQZA 3J9SA 2QDRA 1DQ1A 4XLPF 4S2FA 3CLOA 4HNUA 5FZ8A 1GOFA 5D8AB 3LSHA 1N77A 4EJUA 2OF7A 1AKHB 4M3CF 1X50A 3ZXDA 2DV9A 4A7ZA 3WY6A 4M9SA 2PFWA 3OSFA 3NNMA 3UJOA 1MBFA 3K2ZA 4PF5A 4YNIA 1MQTB 2ZMEC 1GYKA 3K7AJ 2FBEA 4XJ9A 3K1NA 1HRV3 2YPDA 5L36A 4KT6A 5HNHA 2RM22 4QIWN 2YU3A 4JGYB 1XD7A 3F95A 4FPCA 3WQBA 1RUG3 3HOXJ 3GVAA 4WV8A 3GHMA 2JJ7A 2ZZQA 3KT4A 4BQAA 4CDXA 4OAYA 2JG8C 2D45A 2JA8J 2P5LC 1V6MA 3O5SA 2J1RA 2LR8A 3EPZA 2XKOA 3ZGKA 4K2EA 4HMZA 2O0YA 1AR81 4AIHA 3T30A 1SLIA 2QA4I 1ETWA 3OY8B 1LOFC 5EYYA 2C1FA 2LF8A 5EPAA 5GM0A 3CMGA 3QWLA 2VCMA 3J7NA 1GVDA 2GWRA 2CUEA 2AQEA 5HV0A 3BWGA 3NSTA 2WA0A 2X1CA 3BZKA 4RBOA 1SMTA 2D6NA 4DYRA 2EA4A 2W7NA 3BU0A 3WSOA 5KHKA 1CAVA 3POSA 1TME3 4RM3A 5JSRA 3JRAA 3BN6A 2JDKA 1FPN2 4WZFA 4NC7A 1MZFA 4JTOA 3G71I 5DAXA 4JQFA 1XGSA 5FY5A 1WMFA 4J00A 1US2A 4CXWA 3GTKJ 5FCCA 5FZAA 1O8SA 2WTEA 1VBA2 1F4AA 5CNAA 1W6OA 2YGMA 1X3WB 4A0XA 3GXOA 4LEJA 4OUSA 1VQLI 3ABTA 2C6YA 1BQPA 4M3CB 1F9KA 2JSCA 4M74A 4XIKA 4LXLA 3C7JA 3ZN6B 1PIV1 3GCXA 4BU2A 2Y6FA 3H5AA 4PCQA 5EZHA 1I3HA 4XUQA 1W1WE 3UJQA 3H3ZA 2D40A 3UESA 5FLMJ 2MW8A 4CEYC 1ND2A 2AS5F 2BZDA 2ZXHA 1J3RA 1JODA 3AZYA 4Y22B 3ZFEA 1VB2A 4K1YA 4Y26A 4UFIA 1TE1B 1XS9A 4C8DA 3PIJA 4AGVA 4C2TA 2BV6A 5FLJA 5FD5A 3AP7A 2NS7A 4FISA 3UYJA 5GZCA 4AYBA 4QWQA 3JTGA 5GPCA 1XPXA 3TAYA 3GTPJ 4AZZA 2Z33A 1QJX1 3FBYA 5CFDB 4I3GA 1YFYA 4QQOA 4MHRA 4CEWA 1OOPB 5F5AA 2VMEA 5A7SA 1QGLA 1YO5C 5IJRA 4GH4A 5B66C 1XGOA 4AIJA 1VQ7I 1XMKA 1ZRFA 3THPA 4Y52J 2CAUA 1SD6A 3PTRB 2VOWA 3F23A 3NV2A 4Q0SA 4PJNA 1CAUB 4E7IA 3ACFA 2A6HF 3J80Z 1HB3A 5CPRB 3I3EA 2BOLA 1IG7A 3ZQLA 3RYRA 3BTIA 2DU9A 5ANNA 1TME1 4AQSA 2R5ZB 2R92J 3T2QA 4UVAA 3B94A 3POGA 4XM3A 4C3IJ 1AR92 2V4VA 2F2EA 1Z7S1 4E2SA 2ENRA 3M3QA 3W58A 3DKYA 3NO8A 3RQIA 2M3AA 1SLAA 1DP0A 1VLNA 1XYNA 4AI9A 1D8KA 2EICA 3OGJA 2V26A 3CUQA 5AVAA 4RM2A 4RB3C 1GWKA 2JDMA 2WZR1 1H1MA 2J1UA 4GWJA 3HPGA 1AYN3 3L00A 3CJIA 4IGPA 1LAJA 4AQ2A 2FDKA 3S1NJ 1I50J 5FMOL 2XF7A 5JFRA 1RINA 3JB4C 4BH9A 4JRAA 3WV6A 3L2HA 4AF9A 4FBFA 1T0FA 2DDUA 3KHCA 2DFIA 1EH6A 2VZUA 3SYTA 5CEHA 4WM8B 2LY1A 1X8EA 2X5IB 1Z77A 1ZRCA 1BMV2 3B5LB 3SCHA 4Z2AA 4OIQF 4I99C 4E7SA 3N4MA 1HN1A 1ZZ8A 1XN7A 5GJ6A 5IAVA 2Y60A 3VBSB 2M2EA 3QP5A 3TOAA 1MNDA 4JRLA 3VN4A 2JENA 3HQUA 3LA3A 1YRZA 2W1QA 5AFEA 2RR12 1P7JA 3OSDA 2HYJA 3OCPA 2A6YA 1H9WA 2EIKH 4R52A 1CF7A 4L92A 2E7AA 5DAQA 2KMUA 2QUFA 4LHNA 1B72A 4Z1VA 5LEKA 1CESA 2M1BA 1JGGA 5TSWA 2ZPXA 2GNTA 4X6AJ 5A7OA 3NNLA 1NY72 5DXDA 4AYBN 3U1XA 4XIOA 4LMYA 3OEBA 5DMYA 3WD5A 4DNCA 4XHBA 2AUYA 2CW7A 1JZ6A 3OYWB 4QHOA 1UPIA 3WDWA 4GJYA 2BQPA 4UBGA 4P9UA 3VKOA 2V9VA 2H27A 2HQRA 3GHNA 2N8GA 2L2OA 2WFPA 2R043 4QMAA 3PQJA 1WZ2A 2BVMA 4RFRB 3N9LA 4LD5A 4N43C 4LBMA 1DLCA 3QODA 5AIQA 1R1VA 2R5YB 1AHSA 1R64A 2Q1MA 5AC92 3FK6A 1OQDA 4RB1A 1ZKGA 1MVQA 1SLCA 1FP2A 2IGKA 1K5MC 4HZFA 2WINB 1BLZA 4B8XA 1AYN1 3S93A 1OURA 2NMNA 4XDQA 3ZMUA 2AACA 2V7FA 4Y5TA 5EFUA 4GYGA 5CFCA 3FLPA 3FXJA 3S5AA 4B7KA 4EM0B 2OW4A 3TEWA 2F6BA 1TQIA 3Q8FA 1VMFA 1PO23 1OCCH 1XJAA 3KEOA 2O8KA 5FUPA 3VZJA 2JZYA 5E16A 3GM8A 3H8RA 2OPWA 4MG2A 4BQWA 2TNFA 1YQ2A 4V2WA 4GMP3 1Q1VA 2LP0A 4CYDA 3RWKX 1NCQC 3A0NA 1SCRA 1P4AA 1F36A 2XH6A 4XN3A 1RUD3 5C9AA 2OD5A 1IXSB 3WTSC 4A3MJ 4BLJA 1Q43A 2FDJA 5F64A 1XGMA 4ON0A 4MZUA 3SQNA 1XPWA 1PHMA 3QPHA 1DZRA 1PMJX 1ZTRA 2OAZA 5FKOA 2IAIA 3Q0WA 2PHFA 3WOGA 1OLME 2W1OA 2IFWA 3CO2A 2AR6A 2XVGA 4QT6A 5FZ3A 4N9HA 2A3YA 1ZAOA 4UUSA 1IW7F 3M8EA 1POV3 3HN1A 4HKOA 2P7CB 2RS32 3F8BA 3GCWA 5FD6A 1HKQA 1FX5A 4COUA 2QKMB 1WJFA 1ENHA 2ET1A 2A6XA 2JIJA 4CYCB 1PNGA 4HETA 1XNCA 1WA4A 5K0UA 5IYDJ 4BE1A 2R041 1HCRA 4CU9A 5CISA 3HEFA 2UWBA 1U6GA 2B9VA 2L5QA 2QVSB 5L7OB 4QX1A 4C2MJ 3ETQA 1VMJA 3USUA 5AVPA 3RCOA 2Y8KA 3RFRA 3INAA 5F0CA 1W6MB 1RUI2 2WBKA 4DGWB 2WO2A 2JA5J 4PJLA 5FK8A 4LTAA 5EXOA 3ZQQA 1GP4A 3KMHA 3PIOF 2C6SA 2G19A 3D5OA 3N7MA 2MSYA 1GLNA 2RV8A 2CWSA 2Y38A 1VQMI 4AVVA 3AXEA 1EUUA 3JRHA 5FMBA 1VQPI 1RMU2 5IK7A 3FFQA 1F5TA 3M1EA 3F21A 5IHRA 2GQQA 5KHGA 1T33A 3NAPA 3EYIA 5FLXZ 1ETYA 2DAOA 3BYWA 1VTNC 4IV3C 2I8DA 3ZQ7A 5C3EJ 1CQ9A 2VB6A 1QQP3 4KMUX 5HV4A 5BPDA 1V6NA 1C1LA 2ADDA 3RSJA 2FSWA 5HS8A 1NCRA 3OYJA 4PHZA 1XTAA 4GMP1 2QF7A 4K20A 1MS5A 1WLTA 1WGPA 2LSOA 1UPSA 4LK1F 4ETSA 2WS93 3VL9A 4RGKA 1D2QA 4QHZA 5A3TA 5E8GA 2BVLA 1J5YA 4KN4X 1QDOA 1KU9A 1CIWA 4UW4A 4F83A 1QOTA 3LNQA 2QSHX 5LA9A 3VEPA 1V6IA 5ICCA 3WUCA 1YO8A 3D82A 2RDRA 5IYCJ 4CCJA 1FYKA 1CZTA 1POV1 2A5ZA 1QU3A 2ZHNA 2XF5A 4YIRX 2HYFA 4PJYA 3K4KA 4ZYGA 3S16J 4YZ4A 1SHWB 2I2SA 4JGYC 4IGOA 4HAMA 3OD4A 2VJXA 2LREA 5E3NA 4GWNA 2NVXJ 1LVAA 2M5WA 2E63A 3MYXA 1T2XA 3PVEA 4AVPA 2OTLI 3ZR8X 2QENA 1AVBA 4CCOA 2K7LA 4L0PA 1TQPA 4L9VA 3IV5A 4TTGA 2Y0OA 1EKEA 2BV4A 1XNTA 2JWPA 1Y8RB 4X8NA 1JKPC 2BNMA 4IEQA 4HLYA 5E89A 5FP4A 3RPUA 1G8WA 4Q5SF 4M73A 2DQLA 2WUHA 5JVTA 5E8AA 1O4XA 2R7EB 1VI0A 4BJ0A 1WWXA 2RHPA 3RRDA 3LOIA 3BT9A 5FQ0B 4KA4A 1GP5A 4EJTA 1WUVA 2GNMA 5T52A 3E7LA 1RUNA 2CH0A 5CG9A 2A07F 1AZDA 3PIPF 5F5CA 1F4HA 2D1VA 2ZAAA 4Y4YA 3T3YA 3K1PA 3X2QH 4BQ3A 4LFUA 2VMFA 4A6SA 1UY3A 5E3OA 4AHWA 1SVLA 2ZZJA 1I6XA 2I5UA 3I71A 3HBKA 3PL0A 3HJEA 2FBKA 4WVWA 4QB2A 4CUBA 3VDAA 1PGSA 1YITI 1LEDA 2XSJC 5F7UA 1WJAA 5F0FA 3EB7A 3BG7A 3JREA 3S32A 1OYWA 3KCYA 3IM0A 2E26A 4E4DX 3ZSJA 3J7AY 1NG0A 4RGAA 1BIBA 5J3LA 5JPNB 4X6QB 4NMIA 2HLEA 4UV8A 4NHXA 4DUWA 4QLCU 1MDMA 2DO7A 2ARAA 1U12A 4Y20A 2HZTA 2R93J 3GTQJ 3MUY1 4KU7A 3ZYJB 4MHGA 2EFNA 3B73A 3OS2A 1A5JA 2GMEA 2R7UA 3M70A 2WT2A 2PHDA 1F43A 3AFGA 4RFT0 3ZMOA 4FOWA 1X82A 4I6ZA 4N53B 5CFDC 2XVLA 3B9CA 3CJQB 1CVNA 1REDA 2X1EA 4YFKF 2VUAA 3HGYA 1MNEA 2OQRA 3IKVA 2I07B 2H6BA 2OPKA 4F52A 1QJEA 3ASNH 2W00A 3OYCA 1B4AA 3CTAA 2WT0A 4KFCA 2YHJA 3PUQA 3UNGC 2VD7A 4Y1XA 4AOCA 4RGXA 1K78A 5J47A 4XAAA 4BQYA 3GTMJ 1K83J 3ATGA 2LUWA 5FBJA 4XICA 3WX5A 5IVEA 1BBT3 2ZKLA 1RUC2 5L3CA 2XG3A 1YG2A 2K85A 4IERA 1RUF3 4ESFA 1W3XA 3A4CA 4B1RA 3WHBA 4HLTA 1VNDA 1BYHA 2VW2A 4NIGA 3RZLA 4BA6A 5EYXA 2WAFA 4IV1A 4OLLA 2J1EA 2X05A 3OYLA 4XJWA 3HD8B 4H7MA 1QJY2 4CA0A 3ACGA 1R092 3AG4H 3F8NA 2ORZA 2WRAA 4AFAA 2R0QC 2WN3A 3M9AA 4BQ4A 3RJRA 4I02A 4BQ2A 1X4PA 4PI0A 4B29A 1P7IA 1UHWA 3W6KB 3GLXA 2HDDA 5GLTA 3O1VA 3ZMSA 5ERIA 2Q8OA 3VDCA 1OCPA 5J3UA 3CKHA 2JT1A 5FUNA 4WM8C 5DDJ1 1FNYA 5A3OA 4JVAA 2ESNA 4BQXA 1ZNPA 4P14A 2YX7A 5T5LA 2K3PA 5IVYA 3J8F3 2UY8A 1VBE1 1LPQA 1HDKA 1W36C 1HXS3 2EA7A 3CLPA 1RI7A 2E7XA 4H3WA 4M3GA 1ZYRF 1R22A 1KGSA 2XBO3 2ELHA 3MLJA 5I0SA 3ZQCA 2P6CA 1REPC 1R1A3 2GC0A 1ZG3A 1DDNA 4AEDA 2PHRA 4FPHA 2DTYA 4AVCA 1AYM1 1ULYA 3GCMA 4A3BJ 5ICGA 3MPBA 4HX8A 2A73B 3VZKA 3HWJA 4M9ZA 3S3MA 3PMEA 1VJ2A 3FMRA 4XJ8A 4A0ZA 5H9RA 1XOYA 2P3IA 4NBQA 2ZKZA 3E1SA 1MH3A 4DFSA 1OT5A 3K70C 1FI2A 4CCKA 1E3HA 3URFA 1W9WA 5D5WB 2JTVA 3JCUC 1RUF1 2FOKA 5LHHA 2KRFA 1CGPA 5DUXA 1D3YA 3JBG2 4Q47A 4EYUA 2HVQA 3AYDA 3K48A 4YGCA 2BY3A 2XASA 4E4HA 4QGMA 4Q4X2 2VUCA 5ICEA 1F4KA 4BQOA 1JTYA 1C8M1 4EEFG 3SXWA 1S0JA 1SMVA 1S0EA 4BCUA 4I30A 5EQUA 5IAXA 2RC4A 2UYBA 1Q1HA 3IAPA 4XIDA 3A1YA 1LVKA 2KT0A 4ZU4A 1YWKA 2VCCA 1A78A 2YU1A 1R7JA 2L7ZA 3U75A 4XXPA 3WNMA 4RQPB 1KDMA 1XGNA 3AMHA 4ZS3A 3GWZA 1ZZCA 4L5IA 1U5ZA 3KWVA 2GIZA 3IBMA 2FUG2 4C9YA 1ULEA 5F3GA 1GDTA 3KP3A 4XLHA 3LD8A 1SANA 3FF5A 3GZAA 1W0NA 2BWAA 3J80K 4HL0A 4NO4A 5F6KA 1R00A 1O6UA 1R1A1 2F17A 1UY2A 5KAFC 3KP5A 2W46A 3QU3A 3KZIC 3CZ6A 1BCXA 1UYXA 3FKIJ 1MMAA 2A75A 4A2UA 1PUFB 1CONA 1BEV3 1LOCA 1X1BA 2GDFA 2P2KA 1LE8B 2JVGA 4M0NA 2A1XA 1URXA 3AX4A 4B48A 3KD4A 1YFUA 1RNLA 4IQPA 1ETXA 2F4IA 3B02A 3M8JA 4BHPA 2R7XA 3WDUA 5DD8A 3OR1C 4TLFA 5I8SA 2VTFA 2KIMA 4YVWA 2ARCA 4J19A 5L7OC 5E88A 2ARBA 1ZG1A 2VNGA 3A0KA 3J7YJ 2EBIA 1LOAA 3U4SA 3O7OA 5A6YA 3G1LA 1ODDA 5FWJA 1IN4A 1O3QA 3TEYA 2KRCA 3H1CA 2RVCA 2ZX0A 4B3AA 4HF2A 3VKMA 4A3LJ 1X4OA 3USSA 4QWNA 3BOWA 1D0GA 4KNCA 3IUOA 1QMJA 4O9GA 4UUVA 2XJUA 2ZXQA 3VHRA 3POIA 3A22A 3OIQA 5TISC 3CC7I 4KL1A 3O0WA 3IT8A 4XBNA 4N90A 2M9HA 3ZKUA 5H2FC 3ON7A 3K51A 3IDBB 3RMYA 1WMEA 5GKAC 3GZ5A 3WDTA 5F8PA 2IXCA 3MGUA 1MBGA 4DUXA 5IYYA 3Q9VA 2QQLA 4Q4V3 4UFHA 3OL4A 1HW2A 3ES1A 1GP6A 3WHTA 1AR63 2WNVA 2WIIB 2R6QA 1JYTA 2R1BA 3W21A 1DQ5A 3GFJA 2VZVA 3IPVB 3E3VA 1R1TA 1IPSA 1WCDJ 4E6KG 1LGCA 2GALA 1Q8SA 1R71A 3S5QA 5HCAA 2QQBA 3E0JB 2IBDA 2E53A 5KR7A 1KU7A 1CX1A 1SLTA 4EATA 4UF0B 3APBA 3SJMA 1ON2A 5A3PA 1GWMA 2HOAA 5GLUA 3OYKA 3O12A 4G8XA 3OSGA 4AI3A 4L9TA 3ABKH 4CZZA 3VDDA 1DU0A 3BUCA 2ZMNA 1BR1A 2STWA 1B35C 2YB7A 1W0PA 5HCFA 2KDZA 2LLKA 3EQEA 4XE9A 5LB6A 3WQ1A 2D93A 2EJRA 2HWB3 5A32B 4KWJA 1PMIA 1GZTA 2DODA 2VOTA 4JBAA 5FAXA 1K6OA 1MZBA 2YUSA 1HLVA 4RR3C 3QH6A 2WWUA 3RGBA 2WO3A 3DEMA 4A6DA 4CDWA 1FOXA 1K4TA 1QHGA 4DUVA 5ABJC 1UOBA 5J1UA 1V6KA 1ZRDA 1OKRA 5A3LA 2JDAA 3D1NI 1L3LA 3DTEA 1IKQA 1TL8A 3CC4I 4DBRA 1LOBA 3H50A 3I4NJ 1DP7P 1FMVA 5H9SA 3FBMA 5BNOA 1GNZA 1CZSA 1WCUA 3OTFA 2VPLA 2XRNA 3P3NA 4S2GA 5T5PA 4IEPA 2CS3A 3TW6A 2V72A 1ZBA3 3OOUA 4CU8A 3PUFA 1CAXB 1KQ9A 4B44A 2FD5A 3RJPA 1AR61 4AVBA 3WQ0A 2WZ8A 3SKJE 4PJMA 2TDXA 5FZ7A 3LMMA 4XRFA 2CAVA 3P7NA 3WHCA 3VWBA 1Y9MA 2DK8A 4ZC3A 3LEKA 4FP3A 1IDYA 4WVMA 1NXD1 5A3UA 2GC1A 1I5PA 1XDSA 3L2YA 3CMAI 1AWCA 1RUH2 2ZS6B 2DCJA 3V42A 1VQ9I 3GF6A 4PDWB 2IXKA 4HQEA 1ACCA 1VBB2 2PAKA 1WCSA 4RDUA 2DVGA 2XV4S 5BNNB 2LDUA 2W48A 1OFCX 2VXZA 2NQYA 3PDQA 4NB5A 4NN0A 3GJBA 2CJJA 2ZGUA 1JHJA 5IY5H 2VQTA 3HMYA 3S7IA 4BJTA 2BGCA 3DN7A 1JUIA 4A69C 5D8AA 3VD5A 4LKDA 3VSKA 2VT3A 1I3AA 1MVEA 1UMZA 1RXGA 1AKHA 5DN2A 1YCIA 1IKPA 1W5CC 3U2RA 3V0AB 2A5WA 3ZSEA 3MCZA 2RMU3 2PELA 4KIFA 4LUMA 2Q8DA 3A23A 4MGIE 4YW3A 3SNMA 2EFWA 1O91A 4GB33 5HLGA 3WP3A 3BIWE 1MQTA 3BPSA 4IETA 3K6GA 3FM3A 2QQKA 5FUIA 3F8MA 2JKBA 2VNRA 1YFXA 3HOBA 2WSVA 1S9HA 1U5XA 2VBZA 3SH3A 2JPCA 2JUCA 2YSRA 1UN1A 2R7TA 1A8MA 2MLKA 4RB2C 4FOVA 1U0JA 4H7LA 4FXGB 4I0AA 2TUNA 3CCVI 3AZVA 4UOJA 3HSFA 3GX4X 1QY4A 1ZBA1 3MW3A 4ZY9A 5DD4A 4Q8LA 2B7YA 2XAUA 2F4LA 4XL9A 2ICWG 2PQ8A 3LSDA 2VVDA 4OIRF 4HSTA 4HDUA 2QSGX 1YRNB 2HWF2 3KYDB 1XNBA 4LE3A 5GLZA 2VECA 2HI3A 2R062 1AR71 1UU4A 3OY8A 4CDQC 3TW7A 1ZBE3 3CZUA 3EBRA 3NV4A 3JCIA 3DF0A 3JAMZ 1D4M3 4F7ZA 4CP1A 2C4XA 3N9PA 4AWXB 1IGNA 1Y3TA 1H6YA 4XFBA 1IXRC 2AEZA 1US3A 4NHMA 2QEXI 2CHHA 2DMQA 2E2JJ 5FZ1A 5FY7A 5CVIA 2R7DA 4W65A 3T0AA 3RVHA 2GA2A 2CW0F 3NRVA 1OC1A 2RS52 1A8DA 5H9QA 2ORXA 1CWPA 3JRGA 2HWC3 1RUOA 4XAEA 2FMDA 2FHRA 1WJEA 2XVCA 3HC7A 2XGDA 3PNAA 3I64A 2BY2A 3ZFFA 3DXTA 4LT5A 4PSXA 3JD73 2VUJA 3OBRA 2ZJPF 2R3SA 4O9EA 4G6DA 4XABA 4EWDA 2OZUA 5C7GA 2ZXIA 4M3CA 4M3CE 3UKVA 1MIJA 2VCAA 1I3QJ 4J01A 3ZN6A 4B4CA 4BXXJ 2MNGA 1AUYA 1QRYA 3I58A 3HEIA 2C26A 3ZSKA 5J8FA 5BUVA 1XNDA 2H1LA 1X2NA 4KICA 4JOMA 3VV1A 1X9PA 3R4KA 1W8FA 3ML6A 3SMHA 2A68F 3WNKA 2M87A 3VBOC 2LTNA 4YELA 2QQ9A 3TMOA 4SBVA 3ESWB 3KT7A 3POWA 2O9LA 4LHSA 1R4NB 2OCCH 2COMA 2WNUC 4XQFA 4QPGB 2HJIA 3F6VA 5H6QA 3PUIA 2YBPA 4D8MA 4JP0A 1IG3A 1D7PM 3MV11 3TN93 2BZTA 4DJAA 1STZA 1YE9A 1WCMJ 1DGRA 4RHV3 3N36A 1OOPA 3RJ2X 2EAAA 5ACA1 2OPTA 1ZBE1 3K4NA 3W59A 4KN7X 3CCRI 1T6SA 1ALYA 1HQLA 3F2ZA 1D4M1 1FIPA 2RNJA 2WFF2 4H14A 3BROA 2PAEA 1LKNA 1CAUA 4AQTA 2PMUA 2HTJA 2KFDA 2WYFA 3KZZA 1PM4A 3I2HA 3H9AA 3K9TA 4RQPC 4N4OB 1M4WA 2OUHA 4D9JA 4XOGA 2QM3A 4RAZA 4XFHA 3WHUA 3UKGA 1LHUA 4QDSA 1BOBA 4OHYA 2ERFA 2HWC1 4UYBA 2FMLA 4MNUA 1OHFA 2CUJA 1W8UA 1YIJI 2DFEA 4R79A 3OL3A 2YX4A 5A33B 1GQHA 2BNOA 1IUFA 5L9RA 3JD71 3GZTB 3RZJA 5LRRA 3FMGA 1OXCA 2J1AA 5LA1A 3AB0A 5JUVA 3HOZJ 4XBLA 2PYTA 3I3LA 2XL7A 1J7KA 1MNMC 2MD0A 3GFMA 2VTXA 3CDHA 1HN0A 2AHQA 5HVQC 2OXBA 4Z07A 4N0BA 1ZRRA 2RM23 3KHBA 3UNPA 1FV3A 2GN3A 2A3WA 1NA1C 2E31A 4EZ4A 3KIOA 4Y3OA 2DPDA 5KXCA 3DPRC 2X5IA 2MEV2 1EY2A 1W0OA 2A61A 4DOZA 4OWRB 3L2VA 1DDLA 3CD6I 3LZZA 3LAJA 4UI9L 3VBSA 3HOUJ 3KV9A 3BCAA 3S2DJ 3ZO0B 1UY0A 4ZS2A 4P9YA 5J96B 5HDKA 4KNYA 5FR3A 4E4ZA 2OZJA 3ES4A 3DYMA 2VMGA 1J83A 1UJ8A 4GYIA 4L18B 2L9RA 3LSEA 3OB8A 2JECA 1YC61 3TN91 2O8OA 2DCTA 2G9ZA 3O8GA 1PK6B 1R081 3VB9A 4BY7J 1RVF2 3RZDJ 3TOJA 1IF1A 3LPFA 2OA2A 4KWKA 4W6WA 4XORA 3H92A 3AL6A 1WLWA 3RKQA 3DECA 2VQCA 5KC5A 3PL8A 2DOEA 3VBRA 3OYBA 4Y1YA 3F3XA 3OYWA 2FZ2A 1DGRN 4LULA 5K8SA 1OCRH 2BFUL 3ZVXA 4LBQA 4INDA 1X7NA 3ZMNA 5CKMA 3O1SA 3D0JA 2XJTA 5FFXA 1EF4A 2R16A 2VASA 1YI2I 4D6QA 1XB4A 1OF4A 3NJXA 1GXPA 1J84A 2XAQA 3DGTA 4K40A 1LNWA 3HXLA 2JEMA 3FFZA 1F1ZA 3C3VA 2CDOA 4Q4Y1 1W6NA 1ULOA 1ENQA 1RJ8A 1YIPA 3GF2A 5CLSA 1JXNA 6PAXA 2Q1ZB 1BKZA 4YSFA 1OLTA 1V55H 5CZKA 4NHKA 3HPHA 1VRH3 2DVDA 3KB5A 5F5IA 3REOA 5C4JJ 2KPMA 3SZPA 2BW3B 5I8TA 1KU3A 1JHFA 2XUEA 3DLLF 1QXJA 2ZGPA 4E8DA 4AIKA 4ORFA 4L9NA 1G9CA 3NNFA 1VBD2 2Y64A 1RUJ1 1WW5A 2KZGA 4NWVA 1IN5A 1OQEA 2EIMH 4IRHA 3I2JA 2JRTA 5GZFA 3FXQA 1IN8A 1AL21 3DTKA 4HYEA 3S1MJ 3SHRA 1XSXA 2VXDA 1Z6RA 4NRMA 3G6JB 1IZ1A 2JRMA 5LD2C 4XRSG 1LGBA 2ET7A 5SV8A 4CZSA 1ZHFA 2F5DA 1UAIA 4XURA 2E51A 1LDJA 3C3WA 1FTTA 1MS9A 1H9PA 4MX3A 3I56I 2IS4A 1E17A 2ZACA 4II3A 3LEMA 2M4GA 4ASNA 5A70A 1STMA 4FQZA 1COV2 2VXJA 4OZXA 4E7JA 4AEJA 1HB1A 4CVUA 1IN7A 4NNJA 1S0GA 3OG2A 2Z5UA 2BRTA 5JZGB 4XQ4A 2IA1A 1DG6A 4AWDA 1AR93 3VBHB 1YNAA 2EIEA 3B7MA 5IVJA 1VRBA 1JN2P 3FN9A 2HQ5A 3WTYC 3DL3A 5E17F 2W4SA 5JXHA 3ERMA 1GZWB 1E5HA 3AMNA 3HHGA 4JGZB 4W8JA 4XJZA 3WDYA 2KXLA 1SD5A 5EGOA 4YGEA 2RJKA 5F2SA 2F4MB 2ZB9A 1OISA 5M3MJ 1R9TJ 2O5RA 3WG9A 4NPMA 1RZ4A 3LFIA 1ENRA 2VQLA 4V19K 4FOYA 1W6MA 4N7UA 1ZG5A 4FQ4A 1WKYA 2E33A 2Y0IA 2RS13 2VVFA 4FQGA 1ZM1A 4B1LA 2PLYA 2W92A 2QTWB 2OA4A 4EGZA 1GWLA 4I76A 1BL0A 1POQA 2F5EA 2DJIA 2IC1A 2QBYB 2PTMA 1ODMA 1UZVA 1HLCA 4MGKE 1GLHA 2R7VA 1X19A 3HSEA 5I0TA 3GBWA 2FNPA 2Y30A 2K9SA 1VRH1 4J1XA 2K40A 4MFDA 3JRCA 1JYNA 2EINH 4QD2A 2EZIA 2P7VB 2D6LX 4UUTA 4BY1J 4D3WA 3FBNB 5BNNC 1UFMA 2ECBA 4C1XA 1CAWB 1S4CA 1O4ZA 4TYSA 2VJ4A 5DZEA 2RR13 3HOTA 3BGAA 3ROUA 4DMIA 3ISPA 4CDUC 2VE9A 2Y69H 2V9KA 4CP9B 2WL1A 2CV0A 5T50A 1OYIA 3K4DA 1LU2A 2EPFA 2XAHA 2ID6A 2X4HA 2ZJRF 1RIRA 4B4PA 1UMIA 4I01A 2LRDA 1LEAA 5C8CB 2HEOA 3N7JA 4ZYDA 1JMUB 4HA8A 1SMYF 2JICA 2Y0SA 1W8TA 2NNYA 4IOCF 4KH9A 1LESA 3P1IA 4CICA 3OEAA 3BG9A 3FISA 2ZGTA 3LQQA 2P3KA 4A6EA 5LBBA 1NZCA 4BEHB 2JIGA 4FSJA 1A6QA 2SLIA 3TEDA 1P4XA 3I3BA 3CU7A 5IFPA 2D2WA 2FF4A 4LA3A 2IFRA 1IO2A 1WJ5A 3JZVA 4ZDOA 1UW8A 5KWRA 5AC93 3I4MJ 1EH7A 3GJAA 2C5DA 2JG9B 2LF7A 2BOJA 4OIOF 2KZVA 2O6GE 3FE5A 4M3BA 1QOSA 3MN2A 2RS11 5KCMA 2LNBA 4DIQA 2L01A 4CCMA 1TMF1 2KA3A 3O3KA 4BBSJ 4R4ZA 2ZXJA 3PNTA 2RN7A 1YYNA 1U9NA 1UZCA 1DGWY 1AR82 3UKNA 4WM7C 2X6YA 2L4MA 1O3TA 2JUGA 4G3YC 4TSVA 3ZFGB 1TWHJ 4FPOB 1WJBA 5JHUA 3OUIA 5LK5A 1IPKA 3Q8AA 5CQEA 5LFAA 4M9XA 2HZDA 5B3SH 4D5CA 2DA3A 3W2WA 3P9KA 2YDEA 4K6BA 3QOPA 1Y9QA 3H1WA 2XPJA 3CF6E 4B4RA 4A3CJ 2EZLA 5EZWA 2R7FA 4C3JJ 5FZGA 2WYSA 5M5YJ 3AMQA 1UO9A 4BJ6C 3MFAA 4A42A 4Z8BA 3DV8A 4XF9A 3PSIA 2JVHA 2DBBA 1RHI1 5ED4A 1QH6A 2D5FA 1Z7UA 2RS33 5JLVA 2LBFB 4Z82A 2VNOA 2ZO4A 1SG3A 4TV7A 1YS7A 1UF2C 5FRAA 1EV13 3FLTA 1NLQA 2CU5A 5B2GB 1G4DA 3MVPA 4LMFA 4LE4A 3B9IA 1H0MA 4IDZA 1POGA 5FV3A 3OV8A 3LGRA 1TNFA 3N9NA 3PFYA 1PIV2 2AH2A 4GAZA 5FTTC 1F5FA 5FY0A 1JI8A 2Y0SN 2RV9A 4Y4RA 1PVC1 5CYVA 4HN1A 3VZLA 1SFUA 1A31A 2NVUB 3ILFA 2K9MA