3I59A

Crystal structure of mtbcrp in complex with n6-camp
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
224
structure length
215
Chain Sequence
HMDEILARAGIFQGVEPSQLQPVDFPRGHTVFAEGEPGDRLYIIISGKVKIGRRAPDENLLTIMGPSDMFGELSIFDPGPRTSSATTITEVRAVSMDRDALRSWIADRPEISEQLLRVLARRLRRTNNNLADLIFTDVPGRVAKQLLQLAQRFGTQEGGALRVTHDLTQEEIAQLVGASRETVNKALADFAHRGWIRLEGKSVLISDSERLARRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Mechanism of the Allosteric Transitions of Mycobacterium tuberculosis cAMP Receptor Protein.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Dna binding protein
molecule keywords Transcriptional regulator, Crp/Fnr family
total genus 62
structure length 215
sequence length 224
ec nomenclature
pdb deposition date 2009-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3i59A02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3i59A01
5D5UB 4P55A 4RB1A 3I53A 3IIAA 3ES4A 5LEJA 5A2QZ 2VOPA 3SZPA 4IF4A 4EV0A 2ZNYA 1R22A 2VC0A 3QRFF 5FPXA 4Q0PA 2QLZA 3CO6C 2IJLA 3B02A 4LMYA 1UHMA 1O7LA 4XEZA 1XSVA 4KIBA 2G7UA 1OYYA 4MQ9F 3EQEA 4IEOA 2ETEA 2L4MA 5E1RA 1ZREA 1OKRA 2GQQA 1NXMA 2L02A 2HYGD 2FMYA 1QGPA 3ZPLA 4XF0A 4QM8A 1O57A 5E8GA 2UXXA 1TW3A 4EJWA 2UYAA 4DNCA 2IXKA 2GAUA 2PMUA 1AWCA 4BYYA 1VTNC 1BM9A 2QJVA 4HQEA 1QQIA 4MTEA 4I02A 2O8XA 1O7FA 3ELNA 5FD5A 1DP7P 1D3YA 1BJAA 5H6RA 1OR7A 1JGSA 3OGJA 1OYIA 4BNCA 2W25A 2PA7A 2PFWA 1ZARA 2BE5F 4EVIA 4IETA 1FSEA 4AXOA 4ENJA 4RGUA 1BI1A 5C8WA 3TKYA 2EJRA 2VOOA 1UIJA 1YFYA 3HQXA 5EZWA 3WE3A 2BEOA 1PUEE 2CG4A 5CADA 4QGNA 3H7JA 4RS8A 2P4WA 5L3DA 4HA8A 2Z33A 3GO5A 1MJAA 1ONVA 3REOA 3RTRA 2ISZA 2FBIA 4JBAA 1GQGA 4UV9A 3HUGA 4EJVA 1IXSB 2ADUA 3ECOA 3NJZA 5AIPA 1O3SA 4U7BA 3RJPA 3VB2A 3CO2A 1ZRRA 2FMLA 2ZNZA 4N9HA 4I01A 1MGTA 5FLHA 3L9FA 1PMIA 1SFEA 2IPQX 1O5LA 4GCVA 2F4PA 4ZZDA 4IEQA 1ZRFA 5KHKA 4KMUX 4G94A 5J8FA 2H0VA 1R36A 3P7NA 1YFXA 2V1UA 1BIAA 1B6AA 1W5SA 3HIFA 2GA1A 1BIBA 4D7TA 3TDUC 2O61A 1TQPA 4G8XA 1KGSA 3ABTA 1LNWA 2VPVA 4KN7X 1PP8F 1HSJA 1W4MA 3QP6A 4A0ZA 3ZMDA 3HT1A 1S6LA 5D8KB 1ZYRF 5K5RA 5ICFA 4RD7A 2F5FA 2DT5A 4LLOA 3SCFA 1IXCA 3BB6A 4AVPA 3GYHX 3GFIA 4RB0A 2HJIA 5I91A 1SMTA 1FYLA 3KLOA 3CLOA 4WXCA 2GXGA 3M70A 4WCGA 2RDPA 2Z69A 2DPUA 1O4TA 4WX9A 1K7AA 4HN1A 4HOBA 3CLPA 3ZP5A 2CV6A 5AONA 1LDDA 4M6XA 2QCSB 3RDIA 4LLGF 4MGKE 4IESA 2EV5A 5LRSA 3U10A 3KGZA 5LEKA 2B0LA 2EFNA 1R00A 2XAGA 3H1YA 5BPDA 1A04A 5L3EA 3ELKA 2F5DA 4XFAA 1DGWA 1CAUB 3WW2A 1R58A 1QNTA 1VR3A 3E6DA 4TLFA 2P17A 4IRGA 3ABUA 4ON0A 1DDNA 4Q0SA 2DLLA 2RN7A 2MLKA 3BPVA 4FX0A 1FBSA 1FYKA 3I58A 1YFUA 3HRSA 2H94A 4YFKF 3NQOA 2L3DA 3WTTC 4HF0A 3WTZA 4FBFA 2Z5UA 4XSXF 4ENKA 4CYDA 3ZMTA 5ICEA 1UPIA 4O5VA 2O0YA 3ISPA 3KLNA 1LRHA 1YHFA 1H1MA 5K5OA 5HDKA 4X6RB 4AVBA 2M8EA 3UKNA 3FMQA 3FJSA 1IN8A 1LVAA 2FNAA 3CDHA 4IHSA 2O8QA 1ZAOA 2KXLA 3ST7A 3JZVA 1WI9A 3P9KA 4YNIA 1L3LA 4LB6B 1ZRCA 3VOEA 2B9UA 3HHHA 3ZMSA 3RYPA 2XL9A 2Z99A 4AIKA 3GUDA 3IBMA 2YX4A 2Y0OA 3NEUA 3DXJF 5JSPA 5DV5A 4HDUA 1T38A 2DFIA 4E2GA 2FA5A 4J1WA 3FZVA 2IRFG 5J48A 2MD5A 1ZVFA 4KMFA 2KIUA 2DPDA 1QXRA 3SXYA 5K8SA 3WW4A 2ESHA 3J80K 1XGSA 4ZYEA 2XAJA 5HLHA 2Q30A 3JW4A 4QX5A 1W5TA 2BNNA 2OA4A 3HOTA 5FPZA 1ZG5A 2QNKA 3GWZA 4I0BA 2HYFA 2I45A 3BZ6A 3L2CA 4GO1A 2ZO4A 5HLIA 5LGUA 1HQCA 2XKOA 2JPCA 1RUNA 4BHBA 4L11A 1RL3A 5CVRA 3E5QA 2A68F 1WKMA 4E2QA 3KP6A 3BCWA 1ZZ9A 5HI0A 4A5MA 2LKPA 4F8AA 3HRTA 1ZG3A 4BIFA 3QU6A 2ZMEB 5CVVA 1GHCA 2MNGA 1RUOA 1FP2A 1S8NA 1WRJA 2RKHA 3DL3A 2EWNA 1IAWA 3LAGA 3B73A 4E2SA 1K78A 2CW0F 4U7DA 2QENA 2K02A 5FD6A 2L01A 4P9UA 1SAXA 4EJTA 1RGSA 3K1PA 5J8CA 2RVCA 3CUOA 1ZZCA 1G4DA 2YR2A 3GEZA 1JE8A 2IXLA 4QMAA 2BV6A 2ETHA 2V09A 4A5NA 2QBYA 4Z07A 3ZN1A 3J7AO 5FLIA 5ILUA 4L9VA 1YW7A 4AIJA 4XRFA 3W6KB 1YYVA 5E18F 4I0AA 2KJCA 4BHCA 1I1SA 4RGSA 4EWDA 1J3RA 2LSOA 3CTAA 4XLPF 3MPBA 2RNJA 2YX7A 2W84A 4ETSA 4I98B 1UW8A 2NRAC 5DUKA 1TW2A 2D1VA 1XD7A 5BPXA 4XF4A 2MH9A 1P4XA 3F8BA 3M8FA 4HBNA 4AIHA 3K9TA 2D5HA 3PVBB 4TV7A 1GQHA 1T0FA 4ENNA 1U12A 4XBFA 2OU2A 5FGMA 2G9WA 1WQ2A 2K0GA 2JT1A 4M6YA 4XFFA 3M8EA 2QM3A 1CGPA 1B9MA 2A6EF 4LG0A 1FX7A 4IXAA 1CAVB 3TOBA 2PAEA 3FHIB 4P5OA 3OV8A 5JI6A 4Z2YA 3D0JA 1IUYA 1XCVA 3BP8A 2K9ZA 4WXHA 3GXOA 1HW2A 2GWRA 2FE3A 5FQ0B 3I54A 2OZJA 3EETA 1YUDA 2PAKA 2ESNA 3LWFA 5E16A 4R52A 4OU0A 3N97A 4EQQA 1T6SA 2GC1A 2FRHA 4KWLA 4AD9A 2BYVE 2Z3YA 2XLFA 3GBFA 1LR5A 4HF1A 2ZCWA 2DK8A 1KQ0A 1O3QA 3RKXA 2UWMA 1H1IA 1HXDA 1MDMA 1IPJA 3UKVA 2PLYA 2DQRA 4A2UA 1KU2A 1ZLJA 2PHLA 2NYXA 3NVCA 2YPRA 2K4BA 3LA2A 1QO0D 3IWZA 3DPTA 1JHFA 5EEHA 2EAAA 2CFXA 4H0EA 1UCRA 2GC3A 4E70A 1G3TA 1X8MA 4IERA 3IRQA 5F64A 2QVOA 5D5XB 3RYKA 2HKXA 2KJBA 3I59B 3LA7A 4Q0QA 3ETQA 1I27A 1O3RA 1CF7A 1KU3A 4FX4A 3SFZA 1MJ9A 2DW4A 3T8TA 2FU4A 2OAZA 5KK1A 1FC3A 3OF1A 4WXDA 3VHRA 4Y15A 1R5HA 4FT8A 4HX7A 5J6XA 3H7YA 2B8MA 1D5VA 3IDBB 5DD4A 1LB2A 1G3SA 2ZFWA 1JUHA 3NRVA 3C3WA 3BJAA 1MD0A 2HWVA 5FCCA 2D1HA 5LGNA 3MZYA 4RGXA 5LLQA 1IN6A 2VN2A 3DN7A 1IRGA 2XROA 1X7NA 3LQRA 3KP7A 5E20A 4EWEA 2P5VA 1F4KA 2OPKA 3C1DA 2CO5A 1HSTA 2BBYA 2WFPA 3OOPA 5L3BA 4B29A 1ZGJA 1EPZA 4LG0B 1UD1A 1O3TA 3IKTA 3FMSA 1FSHA 4AWXB 4XFIA 2XUBA 4L0ZB 3F8NA 4EWAA 1T39A 5LGTA 2J5OA 5JAXA 4ASNA 3R61A 4UXNA 3AAFA 1FYMA 5AIQA 4L9JA 4EMSA 1LQ1A 2K4JA 3E6MA 4LB5A 3Q5FA 1LEAA 5BXXA 3JTGA 1BN5A 2MA3A 4I09A 3VEPA 2IVMA 2Z9OA 2MH2A 3OCPA 5HOOA 4XF3A 4MZUA 4IEZA 1OYWA 2MLGA 4IRHA 4L2NA 1R1UA 4MGRA 3D5LA 4HDVA 3EO6A 1TNSA 4QLCU 5DD8A 3R60A 2IA1A 3CUQB 3IHUA 3T1BA 3T5XA 1ZX5A 5ILSA 3GZ5A 2ZXJA 1FT9A 1R1VA 3GLXA 2VQAA 5BPIA 2FBHA 3S7EA 2P8TA 4EROA 2JTVA 2XRNA 4OMZA 1BI0A 4MNUA 3F8FA 2IP2A 1KQ8A 4QGMA 4HVRA 5E1WA 2D2WA 2XHKA 1J59A 2CAUA 1H9TA 2P5LC 1SQ4A 2UYBA 3TO9A 3I0TA 4KIFA 4PGGA 1MJBA 1Z6RA 3FFQA 4S05A 1G6NA 1R5GA 1HBXG 3KFWX 4PCQA 3WU0A 4UVBA 4Y13A 1UHWA 2Q4SA 3H3ZA 1RIOH 4G9YA 2DAOA 3H92A 1U5TB 5CJ9A 4PIZA 2ZBKA 2EFWA 1R7JA 4M9SA 5DCMB 1IW7F 2Q8KA 4BH9A 4LLNA 4YIFA 1XB4A 1BI2A 3CEWA 2OZUA 3CJXA 2BNMA 3HSEA 3F72A 3V8JA 4XFHA 4UBHA 2OD5A 2HDCA 4Q0VA 4XFGA 2Q1ZB 4ZU5A 1SD4A 2PQ8A 4JTNA 1J9IA 1UB9A 3CO7C 4QXKA 2CQKA 4K8FA 1RNLA 3VODA 4KWJA 4HVQA 1YW8A 3KEQA 5FFZA 1J3PA 3L2HA 3V4GA 2NNNA 4L18B 2EA7A 1RZ4A 3ZMUA 4Q29A 5TRDA 1GXQA 5EFUA 1I1GA 4LULA 2DU9A 2GA2A 4X6QB 2PFBA 2E1NA 1HW5A 4EGYA 2XIGA 5H6QA 2DK5A 3S0MA 4H7LA 2JSCA 1TNTA 4FAGA 4IEPA 2C0ZA 5HDNA 3BDDA 1GVJA 5BQTA 4IRIA 1XN7A 3HRUA 4RAZA 2Y0MA 3HHGA 2Y48A 3WG9A 4AVAA 5JSRA 2FQ3A 1J7KA 1QY4A 4G7HF 4F7ZA 1W7PB 5H20A 5ILVA 4Z82A 1BI3A 4KT5C 2RQPA 4GULA 5HS7A 2Q0AA 4O9EA 2DBBA 3USSA 3CL1A 5IT9K 2XL7A 3R6SA 2STTA 3TDZC 3LOIA 1WSUA 3LWCA 1XDUA 3GFMA 2H27A 3I4PA 1SFXA 5D5WB 1LDKB 5D8LB 4ESJA 2FXAA 2W85A 2L54A 1VJ2A 5ERIA 2XAQA 2STWA 4D7SA 5LRRA 4A0XA 5D1IA 1J0RA 2IW5A 3SXWA 2GIVA 2X4HA 5E17F 4JQFA 1JXSA 3ULQB 2DCTA 4HSJA 2K27A 3F22A 1FLIA 3GFJA 1X8EA 5I93A 4O6JA 1IZ1A 1YLFA 1FZPB 4KICA 5F6FA 1YQAA 1F1ZA 1E17A 4M71A 1ON2A 1ZLKA 4FAHA 4B09A 3IDCB 2HOEA 5FLJA 3EBRA 2GH2A 1IXRC 3DQVC 3BROA 4JV4A 1K79A 2XAFA 1HKTA 2X0LA 3QOPA 4RGRA 5I0RA 5L3GA 3KP3A 1K6OA 4OINF 1LJ9A 1PDNC 3H1MA 2VBXA 2OA2A 1OD5A 1DGRA 4WVZA 2BGCA 3HTSB 5JVTA 1Q5OA 1J75A 1PM7A 2HR3A 1FWZA 2H6CA 1CAVA 3DF8A 2QQBA 4HF2A 5I8SA 3V7CA 5L3FA 2H09A 5E1XA 4MEYF 4S04A 4FHTA 3MCZA 5LHGA 3O14A 1G3YA 3EJKA 3WTUC 2ET1A 2B5HA 1XE8A 2H6BA 2A69F 2IXHA 3KZYA 5IT3A 2E1CA 1V4RA 1Z05A 3E97A 2IC1A 3QPHA 2EB7A 2A3SA 2FF4A 2VBYA 2OQGA 1QZYA 3KSCA 1UCXA 1SMYF 4EM2A 3PFIA 3K2ZA 1V70A 2RGVA 1KYWA 4U0WA 4YFNF 2K7LA 1ZH5A 4D0PA 1UFMA 3FXQA 4KN4X 2ATFA 3WGHA 1FNNA 2IXCA 3MEXA 1DPRA 3WTYC 4ZZLA 1D8KA 1DZRA 4META 1S3JA 3KEOA 2L4AA 3R4KA 1QPMA 4N9IA 2VECA 4O9GA 3ERED 3ZQ7A 5CYVA 1NHAA 4RB2C 1SFUA 1KYZA 4GYIA 4PJYA 2ZMEA 3JAMZ 5K5QA 2HS5A 1Y3TA 3RYRA 3WTXC 1U5TC 3S7IA 3QAHA 4ZH4F 4MHGA 3V7SA 3C3VA 3T8RA 3SCGA 1TTYA 2VE9A 4PIXA 1EY2A 2J5PA 2LNBA 5CU1A 4ZU4A 3F3XA 5JFRA 2O3FA 5DUIA 1EP0A 2XASA 3BY6A 1USTA 5AVPA 2HQNA 5FDBA 2EV6A 3KZZA 3LSTA 4A6EA 5ICGA 4UHTA 3SMHA 3BU7A 3G7DA 4U88A 1B9NA 4OFGA 2VBZA 1FI2A 1LEBA 5DCMA 3RPUA 1IN4A 2HZTA 4PZJA 3FXUA 5KHHA 4Q47A 1ZZ8A 1ZRDA 2BNOA 1RC6A 2ET7A 3DEUA 4Y17A 1LDJA 4MQVA 4YRDA 1YO5C 2D40A 5D5VB 2LF8A 2V1XA 5FB2A 5JHUA 3IWFA 4KA4A 3WGGA 3T0YA 4UBGA 3UKTA 1FBUA 4WF2A 1ZZ7A 1W7PA 5LHIA 5CVJA 3MFKA 5HVQC 1J58A 5FFXA 2OYZA 4L5IA 2JPBA 2P6SA 4UNOA 3VFZA 4OMYA 2HQRA 2EFOA 3PQJA 5D6EA 1CAXA 1HKSA 5HLGA 2DO7A 3DPLC 4HV6A 2O03A 4IJAA 5I8YA 2TDXA 2HKOA 4MTDA 4CHUA 4WBBA 4LEJA 2G7HA 4MEXF 2P6TA 3F8CA 2P5KA 2QQAA 4OIQF 3ES1A 3RZZA 4U0VA 2O1QA 3FE5A 4JK1X 4IHTA 3FM3A 1Z91A 5CLSA 4MV2A 1RTVA 3WW3A 1X3UA 4MUVA 2OZ6A 3D0SA 2IXJA 3JTHA 4M72A 2UY8A 4Q48A 4YYOA 2PQQA 4IEYA 3RNSA 5T3NA 3RPQA 4IEUA 5KHGA 1WLTA 1SFNA 2HTJA 1FP1D 3H1WA 5I0TA 1TBXA 1BC8C 2EVXA 1ZZBA 3TNPB 1FBQA 4M74A 2ISYA 1ODDA 2DI3A 4LGWA 2CAVA 3FX3A 4XFBA 3KCCA 4LUMA 2IA0A 3EYIA 2KKOA 2DQLA 1GXPA 1NE6A 2FBKA 1FXZA 2RC4A 1F5TA 3U9GA 2EFQA 5D6FA 4JTOA 4HYEA 1F9NA 5E1ZB 1EV7A 3QP5A 2O6GE 3S2WA 1EH8A 2VONA 1P2FA 3KE2A 3WTSC 1U6GA 5BY5A 1YS6A 3CJNA 2ZKZA 2V1DA 4G7OF 1YFWA 1EH6A 1Q43A 2PYTA 3IL2A 4CGZA 1XCBA 2V9VA 1KA8A 1XDSA 1MKMA 2M1BA 2JRTA 4ONUA 3PLQA 3U0ZA 3OD0A 5BUVA 2D93A 2GC0A 3E6BA 1XE7A 1JHHA 4CICA 1YFHA 4P9GA 2FOKA 2EV0A 1Z6TA 1IN7A 4QWQA 4M9ZA 5HDGA 2WV0A 3P9CA 2XV4S 2VODA 2UXNA 3WTVC 1FOKA 4HX4A 1HKQA 4YG2F 2OQRA 2P7VB 2QZ8A 4GXOA 3WODF 1YS7A 5L3CA 1ZGAA 2V6CA 4L9NA 3BWGA 2PI0A 4GGGA 2WTEA 4ZYDA 3LZZA 3NL1A 1J2XA 5FQ0A 4CZZA 5IT9Z 1MZBA 3SHFA 2UY9A 3MAJA 3PQKA 4I2OA 2YU3A 5C6CA 3Q9SA 1SD5A 3COAC 3L7WA 4KFCA 3ZMZA 1RI7A 2V79A 5ICCA 3F23A 1NYWA 3TQNA 4KWKA 4AVCA 1H9GA 3BPZA 1OMIA 1TQ5A 1FY7A 4HLYA 1YG2A 2EA2A 1R23A 1B59A 3DP7A 1J3QA 1TLHB 3JAMK 3TO6A 2FNPA 4KU7A 3O6BB 2KIFA 4LLLA 4WZCA 3C18A 4K2EA 1XGOA 3CUQA 2A07F 1AOYA 1W7PD 1HW1A 1QWRA 2JZYA 1L0OC 4Q5SF 3DV8A 3M3IA 3E3VA 4HLTA 3RKYA 3ROUA 4IEXA 2CYYA 1CF7B 3K1MA 3K0LA 4G6DA 3MWMA 1T2KA 4LJZF 4ZU7A 1PP7U 3TO7A 1ZZ6A 1ZN2A 2R3SA 4HZFA 2YSRA 2P7CB 4UVCA 2VE8A 3MZHA 3SZTA 1U8RA 1S29A 1IN5A 3U1DA 4B8XA 4G6QA 2VC1A 2VT2A 1Z1DA 3BPXA 3TGNA 4NB5A 1IRFA 3LQQA 2HTSA 3OTFA 3V8KA 2NAZA 4OOIA 1X82A 1Q3EA 2OBPA 4MX3A 4HAMA 3GX4X 4EM0B 1R1TA 2MBFA 1XGMA 1XGNA 3QPTA 5KHJA 3D82A 4LD5A 2C6YA 3H3UA 1IPKA 1C0WA 4HQMA 2F5CA 3J80Z 1P6RA 3QU3A 4NHJA 4YIIA 2A5YB 3KP5A 5I8TA 3H50A 1QXJA 4NVPA 1CAXB 3E6CC 2HGCA 4A12A 5DDGA 1XRUA 3EYYA 3HT2A 1B1BA 1XMAA 1KQ9A 1MDMB 1B4AA 2PJPA 4KL1A 5LHHA 4OLLA 3KMHA 4LK1F 4I7HA 4XF9A 3BJ6A 4LK0F 2QDRA 2K86A 5I0UA 4OIPF 2F2EA 1ULYA 3NSTA 2XKPA 5BV6A 5KBFA 3EDPA 3FXRA 2RV8A 4LA3A 4HN0A 4EM1A 3WU1B 3P9IA 1OPCA 4M73A 2PTMA 3WGIA 4U0YA 1O5UA 1CAWA 4XF1A 4BHPA 2PEXA 3V7RA 1V3FA 5HS8A 2PMHA 1TQMA 1UIKA 6PAXA 4WWCA 2ACJA 1ZG1A 3NKTA 1YIOA 5JCTA 2M87A 3ACLA 2Q2EA 5DYMA 1DUXC 1DPUA 4MH0E 1G3WA 5KVRA 5D4RA 4KDPA 1XSXA 1TQIA 2D45A 4PIYA 3CUQC 4LFUA 4AQ2A 5BS6A 2PG4A 2ZKLA 4Q0UA 1I6XA 4KIGA 1CAWB 5J3UA 3L09A 3H8UA 5K1YA 4LTAA 4UVAA 3KP4A 2KIMA 3GZ6A 3EQLF 4LUKA 3C7JA 1XMKA 2NS0A 2Y75A 3F6OA 1S7OA 3GW2A 3M1EA 3I5UA 4RAYA 4EGZA 3U11A 3M9AA 2FQPA 1REPC 5FO5A 5LBQA 1E2XA 3E5XA 5E8IA 2R7FA 1H0MA 2WWYA 1J1LA 3ZDSA 3GF2A 2ZJ2A 3GYDA 5JSOA 3G73A 3GVAA 1WWXA 1WGPA 4R1HA 1EH7A 2ELHA 2CGPA 2DTRA 3SQNA 2EFPA 4ZYGA 5A2QK 3PNAA 3WW1A 1Q1HA 1U2WA 2XVCA 3F8MA 5DCFA 3O3KA 1U78A 1QBJA 2PBIA 3HYIA 4EJUA 1YWKA 3SCHA 4RB3C 1J5YA 4PGHA 3BJOA 2VXZA 4XSZF 4XLNF 4IPAA 3IC7A 3FF5A 1S7AA 3Q9VA 3U2RA 1WA4A 4HMZA 1Y9QA 4MGIE 1NE4A 3HRMA 3HSFA 2A6HF 3CF6E 2QWWA 2XAHA 1FPQA 2E7XA 3SHRA 2UZKA 1KU7A 4ENMA 2QYOA 2AXLA 1DZTA 2A61A 4MGYE 4WK8F 2QBYB 4HSLA 2GZWA 3W6JB 4KUMA 1P92A 4AQ6A 1VP6A 2CWEA 2FEZA 3K1NA 4IEVA 5I0SA 1KU9A 2VBWA 4KYWA 4UXAA 5ED4A 4M9XA 2Q0OA 1T98A 4QM9A 2EA4A 5F1RA 3I59A 1OI6A 2W24A 5JR3A 3HOSA 4HV5A 2D5FA 4ESFA 3L00A 1USSA 2PN6A 3HTUA 2E9QA 2COMA 2XGXA 4ESBA 5BOXA 2EK5A 2FSWA 4IVNA 1QZZA 3JSPA 4LA2A 5FLXZ 2NNYA 1D8JA 3R0AA 3I71A 3ML6A 3NW4A 3FM5A 2PAMA 1EYBA 3MYXA 3ZN0A 1K78B 3IRRA 2QUFA 4UV8A 4ORFA 5CVUA 2VT3A 2MHFA 4KU8A 2IA2A 3HSRA 3ZMVA 2MC3A 3WE2A 4OIRF 4BAYA 4A6DA 1BBYA 1P4WA 5DEQA 1STZA 3MDPA 2M5WA 2KRFA 3EHKA 4BXUA 4KNYA 1U3EM 2XLGA 2IT0A 3JSOA 3RI4A 4L0YB 2IXIA 1IF1A 2Z2SB 4R8HA 4PDKA 4L9TA 3K69A 3G3ZA 4YSFA 3O2PE 3BOQA 5BMZA 3FHZA 4EJOA 4HW0A 4CO8A 5CVIA 2GC2A 4P96A 3KP2A 3LAJA 4DINB 3LAPA 3KGLA 3DKWA 1SD7A 2LDUA 1NZCA 4IEWA 1OFNA 4G7ZF 4DQ2A 4Q4ZF 3GFLA 2HFHA 3F6VA 4O3MA 5FLXK 2WC2A 5KHIA 3RKWA 2CSOA 1Y0UA 4CDGA 2R7DA 2PHDA 2AS5F 3IKVA 1LKNA 1Z7UA 4QGLA 3I64A 3ECHA 1U5TA 2M30A 2GU9A 4YFXF 3TNQA 3EUHA 3QACA 3KETA 4HVOA 1ZNPA 3FMRA 3N4MA 1Z9CA 3TOAA 3I7DA 2GXBA 3M7GA 4CXFA 4J1XA 4HBLA 2QQ9A 5J7MA 1I5ZA 5EEGA 1YLLA 2XLAA 2HEOA 5D4SA 4GYGA 4NQWA 1SEFA 4MGZE 3F21A 3J81K 4R79A 4BQAA 1CAUA 5JR7B 1ON1A 4A0YA 1BC7C 5TJJA 4JVAA 3DFGA 3LFKA 3E5UA 2W57A 3J81Z 1XSDA 4UUVA 1CX4A 2QVSB 4ZYHA 4XFCA 3RIRA 4OIOF 3V8LA 2F5EA 2LF7A 3R0JA 3MQ0A 1ZHFA 1BOAA 3LA3A 1L3JA 4HX8A 3H9AA 1P4AA 4HLXA 5HS9A 4L5JA 3WTWC 1SD6A 3FZ3A 2N7GA 2MPFA 3FWEA 4XETA 4YARA 3BALA 1YW9A 2M45A 1YTYA 4I3PA 4N0BA 2E7WA 4P9FA
chains in the Genus database with same CATH superfamily
5CFDC 4EV0A 2DA4A 4E7LA 1NH3A 2VC0A 2QLZA 3F2ZA 1KXGA 3RI8A 5C7GA 2DF7A 4Y26A 2IS6A 1H1AA 2H8WA 2XONA 1RIRA 4LMYA 1NG6A 1IZ3A 1RUF2 1YIFA 1UHMA 1AA7A 2Y6GA 4XL9A 3AKTA 1CESA 4YZ1A 1QDCA 1S2EA 5E1RA 1NXMA 1A5JA 3I2JA 4HFSA 3WF4A 2RM22 1X1CA 5J1RA 2XOMA 3HAGA 1AWCA 4ZXKA 5JVGF 3DKYA 4AL9A 3VBRC 4GDFA 3FLRA 4YW2A 1N3PA 4IV3A 3WDVA 2A6WA 2O8XA 3OSDA 1DP7P 1ZTRA 2R7RA 5FJ8J 1OR7A 4E7SA 2W25A 1UXZA 3G6EI 2DMTA 5DDJ2 4AXOA 1H9PA 2WS91 3BTZA 4QDQA 5C8WA 4NBQA 4A3EJ 2OS2A 3SQOA 2EJRA 2VOOA 1OVPA 1ULEA 1R9TJ 2LK2A 3TN91 2ZS6B 1TZOA 3J26N 5CADA 4HA8A 4XTPA 4DEVA 1RUG1 1UZCA 1RITA 1GQGA 5GM0A 5CB7A 3HUGA 2XH6A 1IXSB 2CQ7A 1RC9A 2ADUA 4XZUG 1O3SA 2W0XA 4U7BA 4QX7A 5DQ0A 2FMLA 4SLIA 1NXD1 5FLHA 1UAAA 3P3NA 1QIQA 4UT5A 1VB2A 2OIIA 5KHKA 2Y38A 4BDVB 4G94A 5J8FA 2H0VA 2Q8OA 1R36A 3WVJA 2Y60A 1W5SA 1ZBE2 2E1MC 1DGRN 1TQPA 2WJSA 4G8XA 4OI0A 2O8KA 1MQTB 3VKLA 4LO8A 2WY7Q 1TME3 2VU9A 1EJ9A 4Y1YA 2E60A 2JB8A 5FKOA 2YBKA 5K5RA 4Y1XA 4RD7A 1UYPA 2ADDA 3LSEA 4FFGA 1W6NB 1XOYA 2K9MA 2OXBA 1SMTA 1WCQA 3KLOA 2DU1A 3K3OA 5C9AA 4EN6B 4GAZA 1JYXA 2ZSHB 3M70A 3ZN6B 1SFYA 2VE1A 2DPUA 1O4TA 2L2OA 4HOBA 3I2DA 3JRDA 1PX3A 3ZP5A 3V0AA 2VUDA 2A75A 3RZLA 1UYYA 4AG4A 2Y64A 1AHSA 3DYOA 4QX1A 1HRI1 2QFEA 4MGKE 1PNGA 4IESA 5F0CA 1V9U3 4UAPA 3O5SA 2B0LA 3BUCA 5DZFA 1A04A 4L0PA 3A0KA 5L3EA 3MKZA 3WW2A 3VZMA 2HWE3 4YGDA 2P17A 5IP7J 3M07A 4OZXA 3RZGA 2EBIA 2W87A 4NAMA 2MLKA 4AF9A 2LOOA 2GN7A 4Q4Y3 2LY1A 2ZEXA 3ZYIB 4FBFA 2Z5UA 2V4VA 4CYDA 1QHGA 4O5VA 2GBYA 3EYPA 3ISPA 5FP3A 1H1MA 2R061 1S0DA 4FI9A 4CCMA 2M8EA 3FMQA 1WVRA 3CDHA 3MN2A 4OZOA 4PBOA 1RYYA 3DYMA 3J9SA 1NA1A 4RL7A 3FUOA 4LHSA 2B9UA 3O1PA 1QJU1 3HHHA 1W36D 1VAKA 1S9HA 1O91A 3RYPA 2Z99A 1D0HA 3ZKUA 3IAPA 2Y0OA 1D1AA 3DXJF 4AFDA 3GTOJ 2HBTA 1O4YA 4KMFA 1JXNA 2KIUA 4N4OB 2DPDA 1UJ8A 1SAUA 2XPJA 1VB4A 2ESHA 3BI3A 4BM8A 3J80K 1XGSA 3Q0UA 3PSIA 4ZYEA 1VZ0A 2Q30A 4HSTA 4WZFA 3K6GA 2BNNA 3CJIC 5A32A 3ZQLA 3IP4B 3LSGA 1F5FA 3BZ6A 4QPQA 3VYRB 2YY1A 1YHQI 3LDRA 1SLIA 1APLC 3G6JB 3I97A 1RUNA 5BNPA 2VXRA 2A68F 4E2QA 1MMDA 2O7OA 2X1DA 1S0EA 5F6LB 3K48A 1V6NA 4F8AA 1SBFA 1E57A 1ZG3A 4BIFA 1JTYA 3TYJA 3QU6A 1GHCA 1RUOA 1S8NA 1WRJA 5GTHC 3VKNA 2E34A 3LAGA 4FVVA 4C91A 2HWF2 2WB1N 3B73A 4E2SA 2CW0F 3VLBB 2J22A 4AWDA 5L7OC 1TT5B 3K1PA 4AFAA 2EPFA 1ZZCA 2YR2A 2VNVA 4JGZC 5DXDA 1H8TC 3AZYA 2IXLA 4JQTA 1LESA 3QODA 3KF5A 1AR83 4QMAA 2BV6A 4Z92B 4UOJA 4AQSA 4RS5B 3A0BC 4Z07A 1Y9GA 2ZAHA 1NG0A 4L9VA 1AL0G 2DU0A 2PHTA 3W6KB 1YYVA 2KJCA 1MS0A 2XJQA 1K61A 1XPWA 3OYKA 3VYUB 4RGSA 3RS6A 4XLPF 5A7NA 4EN0A 4QHBA 3BN6A 4X0GA 2X51A 4E4ZA 3HVDA 2FDKA 3KZIC 3OPWA 5BPXA 1POV3 2R5ZA 2VBPA 3ZSKA 1RHI2 3F8BA 2D5HA 1NKGA 1U12A 1T0FA 4ENNA 2D3SA 2CS3A 3POJA 5KXDA 4CTEA 3KT1A 4BQOA 4XOGA 4XRMA 2R92J 2BY2A 4M6YA 2YZ4A 4K6BA 5C4JJ 3FHNA 4CDXC 2HOAA 4YZ2A 4DY3A 3UR3C 1CGPA 1B9MA 2A6EF 1DBNA 5DUWA 1QEXA 3AP6A 4JDNA 3IAM2 3TOBA 3OV8A 1VQLI 1IGOA 5LK7B 4Z2YA 1GANA 1XCVA 4WXHA 1W0OA 2DJNA 2FE3A 3I54A 5DAXA 1HA8A 4FO9A 1UZYA 4EQQA 2GC1A 4M3GA 4Q4W1 5IVCA 1RINA 5KHDA 1LR5A 2ZCWA 2DK8A 1KQ0A 3HG9A 1SLTA 2VOXA 2UWMA 5EG0A 1HXDA 3ZKYA 3OEBA 2VC9A 4IXLA 5TGTA 3ATGA 3UKVA 4FPEA 2RS33 1AR92 3ZMOA 1WW4A 3SLIA 1LUJB 2YPRA 2K4BA 1BK0A 5IVVA 1QO0D 3IWZA 2E63A 3W2AA 4A3IJ 1UCRA 3EUKL 3IV5A 3WP3A 1IV8A 2RM21 3NARA 3VBFA 1IV6A 1E5SA 3GBWA 1X8MA 4CUCA 4IERA 3IRQA 1Z0HA 2NMOA 1W6OA 4Q2FA 3K2OA 2D5VA 2X6WA 1RUH3 1I27A 3ETQA 1H89C 2ZGRA 2WZPP 4LBNA 4FX4A 4OYUA 1GNHA 2VKDA 2FU4A 2OAZA 1BEV1 2CL2A 4JX4A 2HWD1 4CXYA 4FT8A 5IP6A 3KQRA 1XQNA 4HX7A 4MHUA 1VMJA 1LB2A 2ZFWA 2JJ7A 3PNTA 3BT9A 4FASD 3CZUA 4Q1PA 3FIWA 3H8RA 5GZCA 1EAH1 1PVC1 5DAVA 2D1HA 5JPNB 3MZYA 5LLQA 4Y5SA 2VN2A 5IVEA 1Y43B 2YROA 3DN7A 4PSXA 1X7NA 3H9QA 2Q5TA 3C1DA 2CO5A 2DCZA 1HSTA 4NIIA 5GZFA 5IFPA 3UETA 4B29A 3TL4X 3SYTA 2VKEA 3FMSA 3HL2A 1WUVA 2XUBA 4BQ1A 2JA8J 3F8NA 3Q3SA 1DLLA 2XJTA 3EXUA 2IBDA 2Y6FA 4HNUA 1QKQA 1JYCA 5FZBA 2XGEA 1Y1VJ 3VBRA 4JHTA 4EMSA 1PZ8A 1QQP2 2EQRA 3Q5FA 3URFA 4PI0A 1R4NB 4FCAA 3I4IA 4RSUA 1XYPA 4OMDA 1NCRB 3AJZA 1BN5A 4I09A 2MH2A 2KISA 2GN3A 4MZUA 2YUEA 2X29A 4HDVA 1PK6B 4URAA 1MR5A 3RWKX 4QLCU 2WUHA 3I3DA 5F27A 1YI2I 4XR6A 2RS32 2RVAA 1ZKGA 3ZO0B 3T1BA 2XVLA 4PJJA 3ZXGA 5ANQA 5ILSA 3GCWA 4JRLA 3QOEA 1FT9A 2MEV1 2CGOA 3CU7A 3FISA 5BPIA 3S7EA 1W05A 5K7ZA 4LMFA 4EROA 1ETWA 1S0FA 4OI4A 2XRNA 1BI0A 3DBHB 1FTTA 1Y8RB 3F8FA 4DPNA 1KQ8A 4AE2A 2P5LC 1SQ4A 1RUI1 1V5GA 4GMP0 3W5NA 1JKOC 3QBQA 4YGEA 4KIFA 1ETYA 4M3CB 1MJBA 3VBFC 5HCHA 3KFWX 2DA5A 2QKMB 4QT6A 5IK4A 4QPYA 2VNRA 1IQAA 5CJ9A 4AAXA 2ZBKA 2QZ2A 4PK4A 2MSYA 2RV9A 2E53A 2J1EA 4YM0A 3MZ8A 4YIFA 2W08A 2OZUA 3GGLA 3CJXA 3CCJI 1R081 4NHXA 5J09A 4BE2A 3M4OJ 4FPKA 4Q0VA 2VMHA 1AKHA 4E7ZA 4ZU5A 2ZMKA 1J9IA 1UB9A 4QXKA 1NUKA 4QAWA 4YW5A 1J3PA 3V4GA 1ITYA 2KMUA 2WYFA 2WS93 2ARXA 1RZ4A 3BTIA 1W8HA 1PMHX 3ZFFA 2OUJA 1RKTA 1JBCA 1ODNA 1NY72 5CZKA 2HWB1 2YU2A 3ZQQA 1DGWY 3UV9A 4RGKA 3S57A 1XB9A 2GA2A 1T56A 2E1NA 1HW5A 2J1AA 4BB3A 2RMU2 4JX5A 5ANNA 1AYM2 4K20A 3IMNA 3IPVB 5HDNA 5L9VA 2WFF1 1GVJA 4LK7A 5FJHA 1R1A1 2Y0MA 4XCAA 5ABJB 2R7SA 2Y48A 3NV4A 3WG9A 1OCRH 2HVRA 4DO0A 3K4MA 5JMOA 3DU6A 2W5FA 1UWWA 4GULA 1QU0A 3KT4A 1TG7A 2XL7A 3K4CA 4GALA 4CXWA 4KWUA 1H2NA 2JECA 4XQWA 1F2NA 1LE8A 3N9QA 1SLBA 4WM8B 1SFXA 1UNBA 1LDKB 4XPVA 5D8LB 3ILFA 4ESJA 4CP9B 3FKJA 2FXAA 5IHRA 4BBSJ 1VJ2A 2J1TA 5ERIA 1MVEA 2A7AA 2STWA 2WNEA 1A6CA 2Q8DA 4ATEA 4XKBA 3UT0A 2KQRA 5DAPA 1LGNA 1DGLA 5FY0A 4JQFA 2BP6A 4IUGA 2K27A 4CDUB 5FUIA 1FLIA 3GTQJ 3GFJA 1X8EA 3HOVJ 2WZ8A 4IZZA 5GAHJ 4R4XA 3OGSA 3INAA 1E17A 2Q1MA 4LO5B 1ULPA 1ZLKA 2W9XA 4B09A 2YYOA 3CHXA 3EBRA 2ARBA 1AJOA 1IXRC 3AL6A 1ASJ1 1K79A 2XAFA 1V9U2 1M06G 5F39A 4RGRA 3DXTA 4FXGB 1XMXA 1LJ9A 1PDNC 4D1QA 3JB4C 3H8XA 1U0AA 1RVF1 2CHHA 2VQGA 1NCRC 1APNA 1Q5OA 4FPOB 3UGGA 2LMDA 2KDZA 1J75A 1L7LA 3CD6I 2ZOEB 3NQHA 1FMVA 3OYHA 3SC7X 4CP2A 4M4RA 2VW2A 5A3UA 2DA1A 2IVJA 4RDUA 5JXHA 1BK1A 3MI8A 4AQTA 4MEYF 2QUOA 2DVGA 4W65A 2OTJI 2HVSA 3O14A 2CV0A 3EJKA 2EALA 3OPZA 1Q56A 4J01A 1Z7S2 3A2KA 1W6NA 2A69F 1F36A 3H5AA 1GWKA 1NY71 3KZYA 2BBVA 3FK7A 4DW6A 3VWBA 4HONA 4Q27A 3ZIWA 5EHDA 1MSEC 2OQGA 1W8WA 4CU8A 3LSKA 2OCCH 4A6OA 2VJ5A 2QKLB 4UB6C 3CESA 3OYIA 3PFIA 2KDOA 2ZX0A 2G9FA 2IGKA 4XC9A 2K7LA 2Y31A 1C1LA 2ZBJA 1FNNA 1JT6A 1TMF1 3DTEA 1Z7S1 3WTYC 4ZZLA 1W36C 1D8KA 2HBUA 4DEQA 1ND2C 1ONAA 3BZKA 4N9IA 3ERED 1URXA 1SFUA 1NHAA 4JGYA 3DKXA 1FMD1 1SEUA 2V5DA 2BTVC 5K5QA 4M6VA 4LBKA 1Y3TA 3IDEA 1U5TC 2E36A 1TMF2 1UL9A 1O8PA 4ZH4F 4MHGA 2LROA 3SCGA 5FMDA 3FHAA 1TTYA 2WR9A 3LCPA 2LKXA 1C8M2 5CU1A 2W1WA 4LKFA 4W6XA 1GV2A 1USTA 1MVQA 3TBDA 5ICGA 2OPTA 3BU7A 3G7DA 4OFGA 3WG2A 5DCMA 3VBHA 2K9NA 3RPUA 2XG3A 4Q47A 1PO11 5FLVA 1RC6A 4Y4YA 5J4VA 4DQAA 3DEUA 4Y17A 1C3HA 4MQVA 2JDNA 1PGL2 3GHMA 4ZKTB 1OHFA 1YO5C 1Y56A 5D5VB 3TN93 2J7MA 2EXHA 2LF8A 4FFIA 5FB2A 3PMSA 5JHUA 3IWFA 1X33A 2YPDA 4KA4A 2Y6HA 4D3WA 4BUPA 4CDQA 2VL8A 5L19A 5GKAC 4DGWB 3MFKA 5FY8A 1S2BA 4RGGA 2OYZA 4IOAF 2P6SA 4PJLA 2HQRA 3T09A 3B00A 1TNRA 5D6EA 4MFEA 1EV12 1W9TA 1AR72 4HV6A 2HKOA 1MH4A 3DPRA 1RUG3 2G7HA 1C4RA 1XU1A 3F8CA 2QQAA 4NIDA 4OIQF 2QQOA 1RUI3 1CIWA 4IE7A 3FE5A 3ACHA 2AXTC 2IGOA 1NK3P 3VV1A 1H2MA 3WW3A 1X3UA 2QQJA 4AVSA 1J1TA 4QIWN 2HPIA 3D0SA 2PJRA 4M72A 2X8KA 4YYOA 3POFA 3RZJA 1QH7A 2DOEA 3J8F1 5EG0B 5T3NA 1PGW2 4IEUA 1WLTA 2HTJA 1FP1D 1TBXA 1ZZBA 3TNPB 5FPVA 1VQMI 3AP5A 1WZ2A 3HM5A 3CJQB 2BFUL 4C90A 3FX3A 1UZZA 2FCVA 3Q8FA 3EYIA 4JGZB 1PGSA 1IGNA 2DQLA 1FNZA 1QA6A 1GXPA 2PHXA 2V26A 3C2HA 2RC4A 3F95A 3GJBA 2EFQA 1FMD3 5D6FA 4MVTA 3NNFA 1HN0A 4CDQC 1EV7A 2DYRH 1VBC1 4KBBA 3WTSC 3CJNA 3AZZA 1W6OB 2V1DA 4G7OF 1QVUA 4B4PA 5FZFA 5DDJ1 1BKZA 4BIOA 1XDSA 2JRTA 2E7AA 4CEYB 2CUFA 1OH3A 4HNTA 3OD0A 3WLUA 2R5ZB 4HKLA 1XE7A 1JHHA 4AVTA 5A70A 1IN7A 4M9ZA 3BG5A 3ASIA 3CC2I 5CBLA 1D5YA 1OISA 2QQWA 1UY4A 3OYBA 5LA1A 4XLEA 1XNKA 3W2WA 4G4FA 4GXOA 2IS2A 1IG3A 1W8ZA 2BERA 4UF0B 3J7AY 4XDPA 4GGGA 1S1AA 4YGBA 2R0HA 2M7BA 1BMV1 4QX0A 4CXXA 4CZZA 4TLGA 3SHFA 1GMMA 4J25A 4I2OA 1T08B 5K0UC 2EZHA 4CEWC 4B3AA 3PIOF 4A6SA 3AG4H 4MO7A 3ZMZA 1D2QA 3GF6A 3RJ2X 2FHRA 3BU0A 2PHRA 1A35A 1NYWA 5E3OA 1YG2A 2EA2A 4QPGA 4QSHA 3JCUC 4JGYB 2WO3A 1B59A 2FDFA 2WAOA 5FKCA 4GQ7A 1TLHB 5IW0A 4Q1RA 4UFLA 4RAGA 5FY7A 2WNUA 5HPOA 2K9SA 2M9HA 4H55A 1B35C 2WAFA 1W2NA 3H0DA 1WCDJ 4P9YA 5LD2C 4ARXA 1QWRA 2KRHA 5K7FA 3O0XA 2XVKA 2YBPA 2ZEYA 1L0OC 2DA6A 5BNPC 3DV8A 4IQ4A 3U78A 3FXJA 3O0VA 3E3VA 3CCMI 1YIJI 2ZGUA 2ZGKA 4D5FA 2CYYA 1WJAA 4G6DA 3K0LA 1CF7B 4ZU7A 2QQNA 1T2KA 4BWOA 1ZN2A 2YSRA 2JDMA 2VZOA 3MZHA 3T2QA 2JK3A 2AYHA 5HLTA 2XGCA 2VT2A 5EIYB 4FFHA 2A3YA 3CNAA 3GLLA 2HTSA 4V2GA 1B35B 2RS31 2XBO1 4PQ9A 4M00A 5DUXA 1E5IA 2NAZA 4OOIA 5KWRA 4CDWA 5IYBJ 4MG2A 1VBB3 2ZPXA 3T3YA 3HQRA 1R1TA 1UKRA 1V5FA 1NCQA 3LEIA 2RDSA 3QPTA 3T08A 4JGYC 3A01B 2HDDA 2COBA 2QDNA 2ZMEC 4Q4V1 2L0KA 3WY6A 4AUXA 3H3UA 1V55H 1O4XA 4MXWB 1POQA 2DMNA 3GJAA 2BQPA 5CFCB 4D7MA 1P6RA 1GUUA 4NHJA 1IKPA 1LHUA 4QQPA 1DQ5A 4FXKB 3SH3A 2AREA 5FZIA 1CAXB 2LS6A 3EYYA 3PVEA 1B1BA 3AP7A 1MDMB 5BNNC 1B4AA 2KR2A 4OLLA 5HNFA 3ZDVA 3D1NI 2K86A 1BVVA 2A6YA 5I0UA 2ZJPF 1OXCA 1JOBA 2TBVA 1LOCA 1WH5A 1D1CA 5EJ3A 5KBFA 3I2GA 4LA3A 4YGCA 4WV8A 3P9IA 4B4CA 4XUPA 5IK5A 3LIGA 4U0YA 4NE9A 5FY5A 1UMQA 1WJBA 3V7RA 4LIUA 2PMHA 3VUOA 2EIKH 3VD5A 3MIDA 1ZBA2 1ZBE1 2VTXA 2ACJA 3PSFA 2CGNA 1AR71 2Q2EA 1S0GA 3JBG1 1B72B 5KVRA 1CONA 1S0JA 4CEYC 2EILH 3HQUA 4DUXA 3I8TA 5EGOA 3LFMA 4PIYA 4W6YA 2B46X 3A4CA 2KD7A 4Y7NJ 4DRVA 1I6XA 3SITA 1PK6C 1YJKA 1LU2A 3BTXA 2R0QC 1MBKA 3EUHC 4GJZA 3GZ6A 4Y3OA 1WA6X 5LA0A 2A3XA 4AI2A 5CQEA 5F37A 4CCOA 2DYSH 1MZ6A 4TWTA 5JI9A 3C7JA 3F6OA 3UESA 3I5UA 2PQSA 2AZ5A 3R0RA 2H1LA 3M9AA 2FQPA 2BHZA 3HXLA 5F0FA 2VJXA 3E5XA 5FZMA 1H0MA 3RG0A 5FKNA 2X53S 5JSOA 3G73A 2E7QA 3GVAA 1WGPA 4Y22B 4FPHA 3I3MA 2DTRA 4ZYGA 2HH9A 5A2QK 3PNAA 2ZXIA 2WNVA 1Q1HA 2CQNA 3KB5A 4PF1A 1BYHA 1GLNA 3CC7I 1DLCA 3UL2A 4IE5A 1OQ1A 3AG3H 1LGBA 1IG7A 3TN92 1S7AA 4HK9A 5G04L 5D2AA 1GQPA 1AXZA 1S2KA 2XPVA 3PMEA 4MGIE 3C7GA 2HEYF 4TXWA 1YX3A 3AFKA 3HSFA 2MD0A 1Z0XA 4PDWB 4B4RA 5EQUA 5JOWA 4JC1A 1BR4A 4UWDA 1LOBA 2CW7A 4K8RB 2QYOA 2D6OX 2A61A 2QBYB 3U07A 3I49A 3H3VK 4AQ6A 1YRZA 2CWEA 4JAAA 3HZJA 3AXEA 4KYWA 3W3CA 1GZWA 2Q0OA 3IAQA 1T98A 2EA4A 4XABA 1OI6A 4UFIA 3SDGA 2TUNA 2DODA 4PJNA 5KR7A 2VMCA 3KYLA 3I2IA 1SFOJ 3HTUA 2E9QA 2COMA 1W28A 4NIAA 4ESBA 3MF6A 2EK5A 2P34A 2FSWA 4IVNA 3FBMA 2HOSA 1JYIA 1PZ7A 4FE7A 3N9OA 4LE4A 2WNVC 3I71A 3FM5A 2PAMA 1GP5A 5FZ6A 1RXGA 1G86A 4D5CA 3ZN0A 3IRRA 2FDJA 5JR2A 4IL7A 5CVUA 4KU8A 1NQJA 5AVAA 2MC3A 3WE2A 4AEDB 4OIRF 1X19A 4BAYA 1UYZA 4A6DA 3A1YA 3LSHA 1X2MA 1XTAA 3LSRA 2QTWB 2M4GA 2WWJA 2M5WA 2OVUA 2KRFA 4BXUA 4KNYA 1OA2A 1W9YA 1OQEA 4AFMA 1ND2B 3KF3A 4Z2WA 2VY0A 2IT0A 2J42A 1IC8A 5FOJB 2IGMA 3KV9A 3RQ4A 1V6KA 1IF1A 4NPMA 4R8HA 4PDKA 2BOLA 2WABA 3O12A 3J7YJ 1GICA 3LGRA 1W8UA 2XR4A 3WF3A 4BE0A 4CO8A 4JKMA 1RUD2 5DUVA 2GC2A 4LK6A 2SBAA 1SVMA 3KYCB 1QNYA 3HPGA 3DTKA 3LAJA 3LAPA 3PVOA 3KGLA 3CCVI 4DQ2A 4P5YA 2OT7A 3GFLA 1G9FA 1NG7A 2GOXB 2CJJA 4DUWA 1W5CC 2AACA 3IKVA 3ETPA 1HCRA 3UKGA 2JENA 5LA2A 3I64A 1OC1A 3THPA 3L2QA 5BNNA 5GZDA 4HVOA 1W39A 5H9RA 1I3AA 2WWUA 2LD5A 2R041 1OQDA 4LHLA 2LVSA 3TOAA 3I4NJ 3TWIA 1LOEA 1K4SA 3M7GA 1HJGA 4J1XA 1RVF3 1I5ZA 4A3LJ 3W9AA 5JIAA 1F31A 4GYGA 3K70D 3F21A 3J81K 2W95A 4A0YA 1BC7C 2VQ0A 3ZYPA 3DFGA 1Z67A 4XILA 2QQMA 1ETKA 2W57A 2WSVA 3J81Z 1XSDA 5K7PA 3RKQA 2QVSB 1CX4A 4XFCA 2E6VA 3V8LA 3U21A 4CVUA 1DU3D 2LUWA 3KV6A 2YUSA 3MPPG 3LA3A 1DIWA 2CTVA 3H9AA 1W6MB 2R49A 1CX1A 2MFZA 4L5JA 3WTWC 5DS9A 1DFQA 2F4LA 2RMU3 2QQ8A 4WVVA 4YARA 3BALA 4I3PA 4N0BA 2J1RA 4Q4Y1 3IIAA 4BXFA 3RFRA 5LEJA 4UW4A 5A2QZ 2VOPA 3SZPA 1VRH3 1WJ5A 3QRFF 5FPXA 1VRH1 1Z21A 1DQ6A 3LEKA 5T55A 2IJLA 5LK5A 1LHWA 3AC0A 4A3JJ 3PVNA 3D5OA 3VL8A 1G2HA 4I6ZA 3DKQA 4WVMA 1O7LA 4XEZA 3B94A 1W2OA 4KIBA 4XRSG 1DZQA 2P37A 4K1YA 3HN1A 2C24A 3IH2A 2GQQA 2D7FA 2HYGD 2JA5J 1ACCA 3LFIA 1BZWA 4PJ0C 3AVRA 2V9PA 5FO9B 1HDPA 2UXXA 3VDDB 4ASKA 3N7LA 2R071 2UYAA 3CDIA 5IFTA 1TWGJ 4DNCA 1REFA 5LY2A 4MSVA 3OBTA 4D6QA 1VTNC 3BR0A 4RA0A 4YVSB 5FRAA 1JOPA 5BNQA 5E6HA 1O7FA 3B3QE 4PCRA 3ELNA 3GCMA 1D3YA 4NN0A 5H6RA 4A93J 3AKRA 3HNMA 4EVIA 2NVYJ 4AAPA 2IEKA 4IETA 4RGUA 1ULGA 2JVGA 4K9SA 5FZGA 1ULOA 3K2AA 5FYYA 1EKEA 5FKLA 4UW6A 2IXSA 2NMNA 4W6WA 1JU4A 3AMMA 3H7JA 4RS8A 2P4WA 4CCNA 3GO5A 3BG6A 3H0OA 1ONVA 3BTLA 2ORZA 5DUUA 2FBIA 4JBAA 5GZGA 2NVXJ 4K1ZA 2XQXA 5CQGA 1A8DA 1DF0A 3AYCA 5FK7A 3RJPA 2BY3A 2ZNZA 3BODA 4N9HA 2HWC1 1QJU3 1O5LA 1ETQA 3PJYA 1ORKA 3OGVA 1ZRFA 1HB1A 2C9AA 1CVNA 2OX0A 3OYDA 2GA1A 4YPJA 1PO12 2O61A 1X1AA 1KGSA 2LBFA 4LKDA 1LNWA 4A41A 4YIRX 1W04A 1XX5A 2EIDA 3HT1A 1ALYA 2EF6A 2IAIA 5ICFA 3DCQA 4LLOA 3CLQA 4COVA 1U5XA 4L92A 2LY9A 3SCFA 3GFIA 2WYSA 2HJIA 5LZ6A 4AYBN 4AYUA 3CLOA 3H8OA 1XNCA 1R6RA 2GXGA 5IVJA 4WCGA 1LTEA 3M1CA 1HXS3 1JT0A 1U0JA 4XQFA 4HN1A 5FZ8A 3CLPA 3K4ZA 2CV6A 4MOAA 2CUEA 1I3QJ 2DFEA 2QCSB 5CKTA 4Q4X1 2M7AA 2VPRA 4F55A 4AI1A 2EV5A 1LAJA 5LRSA 1OCZH 5LEKA 1UY1A 3ZPYA 1N77A 4KJZA 3WG1A 2XAGA 2BJSA 2KZVA 4YVWC 2F5DA 1VFCA 4KI5M 4AEKA 1DGWA 3OBZA 5HNHA 1R58A 1QNTA 4L9BA 2XSDC 4TLFA 4FQZA 5F3GA 1MBHA 4ON0A 4DYQA 1DDNA 1UYXA 4Q0SA 2RN7A 1QJX2 2C9KA 1DYKA 1AF9A 2JDUA 1TZLA 4Q4X2 1HB3A 2H94A 2ICWG 2L3DA 2V1NA 3SDBA 3IM0A 4XSXF 4ENKA 1RUE1 2UWCA 4DNYA 3HKZN 2KPMA 1TEIA 3IMMA 2X9DA 3KLNA 1LRHA 1YHFA 1JI8A 5FYBA 3GZNB 3UKNA 2F17A 4A3BJ 1IN8A 1LVAA 2FNAA 3F9KA 4P1WA 3AZXA 3G71I 3BKZA 5EYYA 3J8F3 1ZRCA 2GP3A 4NR1A 4L5EA 3ZMSA 1OVSA 5BNOC 1C5IA 2E33A 1FOD2 2R073 1X1BA 4HDUA 1PHMA 3ZFEC 1VRBA 4MFDA 3FZVA 2IRFG 5J48A 1ZVFA 1AR61 1MSFC 4C2UA 4YVWA 1QXRA 3SXYA 1V6JA 5K8SA 1WCUA 2L7FP 1GBGA 1HF0A 3JQXA 2XAJA 5EWSA 3O8HA 4NC7A 5H9PA 5DAWA 3HOTA 3OYAA 2QQIA 2E5NA 3S1RJ 2I45A 4UUTA 2Y30A 2KFDA 3QWLA 4YW7A 2JIJA 4FPYA 5J1XA 4L11A 3P5JA 3JR9A 2E26A 2N8GA 5CVRA 1RUC2 2LR8A 2A71A 5C5TA 5T50A 4BQQA 1FOD1 1VBC3 3HJEA 4INDA 5E79C 2BZDA 2L7ZA 4A5MA 2LKPA 2DFFA 3ZIXA 2LC2A 2KZGA 5CAZA 4XRSA 1FP2A 2UU8A 2RKHA 3G1OA 1HN1A 2XPWA 1IAWA 2H1KA 2DDAA 4A3CJ 1JKRC 2K02A 4XMAA 2L01A 4EJTA 1SAXA 1RGSA 2CDOA 2VVDA 1SCSA 1FNYA 3VBSC 2Y9YA 1LU1A 2JKXA 2VZ3A 1JJ8C 4BEHB 1UQXA 4H2AA 3OUHA 4ZDPA 3J7AO 1NK2P 3KQ4B 2PX9A 5T5LA 4XRFA 4HL0A 2CW8A 2JKBA 1WKYA 3VGIA 1KFXL 2YS9A 2WO2A 1J3RA 2LSOA 3CTAA 3MPBA 4ETSA 2KT0A 1UW8A 1OOPB 1VBD3 1Z7S3 4XF4A 5B4XA 3ALQA 3KLSA 1PVEA 3HOBA 4CU9A 1ASJ3 4TV7A 1GQHA 2NLRA 1HRI3 1SHWB 4BU2A 3DPRC 3ILNA 5I0DA 4XBFA 1ZA4A 2OU2A 2GXAA 1WQ2A 4CSWA 2JT1A 2ERFA 3ITQA 2VMFA 5J36A 3WQ0A 2Z1DA 4LG0A 4UFMA 1MQTA 3SJMA 2PAEA 4P5OA 1R1A2 4C3JJ 1TME1 2HWE1 1IUYA 2W91A 1OR7C 1DQ0A 3SEQA 4A4AA 3EPZA 5F3IA 2OZJA 5FO7B 1YO8A 1YUDA 3B9CA 4B1MA 4NHYA 4AK3A 3PURA 4AD9A 1HLVA 5IP9J 2VIXA 2Z3YA 2XLFA 5C9AB 2B45X 3RKXA 2R6QA 2YU9J 4KGGA 3Q8CA 1MDMA 1IPJA 3MIHA 4YZ4A 5H2FC 3PUIA 4K3UA 1RKWA 2DN0A 4DIQA 2AUYA 4QD2A 4M3DA 1CIYA 5KC6A 1E3OC 3T0BA 2NYXA 4WM7A 4NMIA 5JPMB 1SANA 1V0AA 3AMHA 3ZSEA 2GLOA 3DPTA 1UMZA 4QHZA 4ET7A 1CR7A 4PSWA 1RUH2 1GOGA 5T54A 2QSFX 3OYLA 1G3TA 3R05A 5F64A 1FOYA 4XDQA 2ZHMA 2DURA 4Y20B 2UWBA 2QVOA 2AC1A 5D5XB 4ZTJA 4V2FA 1RUH1 1ETVA 1G7YA 2VCBA 5FJKA 2WAQN 1JYTA 1KU3A 1NCQC 1QPIA 1I6HJ 3ZPOA 1X3ZB 3OF1A 5KCMA 1R5HA 1O4ZA 1W2UA 2XB0X 3IDBB 1G3SA 5M3MJ 1JUHA 2X5IC 2UWAA 2VTXJ 1IO2A 3C3WA 4DRRA 3BJAA 4W4ZA 1XNDA 5FCCA 4Q8LA 1EA3A 2HPMA 1IRGA 2OQ6A 2XROA 2AQFA 5E20A 2P5VA 2OPKA 2DDBA 2JG9B 4MGTA 3OOPA 1UOFA 2TRTA 1ZGJA 3FK6A 1JU3A 1EPZA 2CQQA 1I50J 3IKTA 1CQTA 4AWXB 2PHWA 2ARCA 3VKFC 4BMBA 4O61A 1T39A 1WBLA 5LGTA 4LKEA 4QB2A 4GIQA 2VZRA 4XUNA 1T2XA 1Z3YA 3R61A 3M1HA 4RQPC 3PL0A 5GLVA 5AIQA 4L9JA 1F9KA 5JLWA 3ACIA 3GHNA 2CMPA 2P81A 1WBFA 3LSPA 4CEYA 2RDRA 4BLJA 3JTGA 2MA3A 2VZQA 2IVMA 3SEZA 3OCPA 4H14A 2MLGA 1GSLA 3ZYRA 2W82A 1R1UA 3CIHA 4UW5A 3EO6A 4G12A 2V9KA 3GZEA 3U37A 5DG2A 5DD8A 1Y4WA 4QPIA 4JZRA 3VD7A 3R60A 1MIJA 2IA1A 2E2JJ 4XLFA 2VQLA 1BBT2 4M3BA 1KJRA 2W3JA 3IHUA 1RUC1 3T5XA 1ZX5A 4BE1A 4PJMA 5EZHA 1IS5A 2FBHA 1A36A 2QSHX 2VPLA 5DZGA 3B69A 3L2WA 2OW4A 4QQLA 2LKSA 2G19A 2IP2A 4F92B 2D2WA 3TO9A 5GADJ 3FBNB 1MBEA 1Z6RA 4RGAA 2A73B 2KHMA 3O1UA 5A6QA 2LTPA 5ACA1 4PCQA 4CZSA 5IYYA 1A8MA 1UHWA 1UOGA 3H3ZA 1RIOH 2DAOA 2CV1A 2W1QA 4PIZA 1DGRM 1H4HA 2L7KA 5LATA 4FP3A 2NYYA 1XB4A 1BI2A 2RDNA 3LSMA 5ABJC 2WLQA 2BNMA 3HSEA 3OS0A 1WW6A 3ACFA 4XFHA 2D3PA 1D2SA 3CO7C 2F48A 2CQKA 1FV3A 3O1RA 2VW0A 4KWJA 1NX9A 5FFZA 3L2HA 4OHYA 2R16A 1C57A 3IAS2 2E35A 1JMUB 3ZMUA 4NHKA 2K85A 1LHNA 5TRDA 3ZSLA 3DPUA 5GAEJ 5JLVA 5HV4A 5C33A 4LULA 2DU9A 2PFBA 1EV11 1JZ4A 4EGYA 2XIGA 5H6QA 3S0MA 2JSCA 2C0ZA 4MHRA 5JLXA 1ZGWA 4JHZA 4CH7A 2K5CA 4IRIA 3HRUA 4FETA 4LBQD 2H0BA 1PVXA 2V73A 4DS0A 4RAFA 5C8CB 3UGHA 4F7ZA 3GNEA 1SDDB 1W7PB 3MMYB 1V5EA 3WNMA 2ZKNA 5F3CA 2RQPA 4DBRA 4HPKB 5HS7A 4AU7A 4O9EA 1H4GA 2HVQA 1XYNA 4QKDA 5F8PA 2WT1A 3DGTA 4Y33A 2VMDA 1JTZX 3LWCA 1XDUA 1K5MC 2H8RA 2H27A 1MS9A 2E19A 5D5WB 1JGGA 3TEZA 1COV3 2NPIA 2OUHA 2ZABA 3WG3A 2WFF2 2L54A 5FP4A 2VG9A 2I10A 1BJQA 2NP0A 5EZGA 3NMBA 4XOPA 2GIVA 2X4HA 5E17F 5FYVA 3H9JA 1JXSA 1OA3A 3VDAA 2JJ6A 3VYSB 2JWTA 5F5AA 5I93A 1BL0A 1R4MB 1VQ9I 4NPLA 3QYEA 4V2WA 1F1ZA 4M71A 1R091 3PUFA 4FAHA 2AQEA 3IDCB 3HEIA 2GM4A 5A3TA 3BROA 4RM3A 1H8AC 4GMP1 1H0BA 3ZXKA 2JSPA 3KP3A 1ZK8A 1YRNA 1KS5A 1OD5A 1G9CA 2WT0A 3PO3J 2CWMA 1ETOA 3WX5A 1YIPA 3GTPJ 1GV9A 3RCOA 5B66C 1XYOA 4MIMA 1FWZA 4C3HJ 1B35A 2VH9A 3OL4A 4HF2A 2BVLA 4ASMB 5A1FA 1CJDA 1S72I 1QQP1 2H09A 2HI3A 1HB2A 3A03A 3ECQA 5FZ7A 3MCZA 3FBIB 2VTFA 3CCEI 4QX8A 1KDKA 1JYNA 2ET1A 2H6BA 1T8IA 1US2A 3JB8A 4XM3A 2WA3A 2E1CA 3V65A 3ZXFA 4YVSA 3VBSB 2JUGA 4DFSA 3UNPA 4QPGB 2FF4A 4P9WA 2VUJA 3X2QH 2J1UA 3WU2C 1UCXA 1RMU2 1PIV1 1WFXA 4A7KA 1PIV3 1OH4A 1OA4A 4BS9A 3K2ZA 1BOBA 1V70A 2RGVA 4RM2A 3HMYA 4D0PA 1UFMA 1B8IA 4IGPA 4N43A 5FPAA 3AXDA 1COV2 2ATFA 3WGHA 3DTIA 2IXCA 1DPRA 3CF5F 4META 3R4KA 3K4KA 4O9GA 3PJRA 3ZQ7A 3ZCOA 4GYIA 1SCRA 2ZMEA 5IPAA 2BY1A 2W46A 3S7IA 3QAHA 4FOYA 5GTIC 3V7SA 2NVUB 3T8RA 5FY4A 2VZSA 4PIXA 1EY2A 1ND3B 5FPBA 5JFRA 1B09A 2Y69H 1GP4A 3PUHA 2DTWA 3O8GA 1E5RA 5AVPA 2HQNA 4M01A 3KZZA 4IV1B 5IT6A 4ZS2A 2EZKA 5HCBA 4HXCA 1LEBA 2PMZN 3VN4A 1W9FA 1VBA1 4OQ8A 5KHHA 1NZIA 4HG6B 2DOFA 2HYKA 4IW3A 4FCYA 3FN9A 2JWPA 3FHQA 2V1XA 2WDBA 1I9RA 1FOXA 2W94A 5GLUA 2KP6A 4YFZA 3T0YA 5KAFC 2W52A 4UBGA 1UHSA 3ZFFB 1E0EA 3TBIA 2RR13 1TP4A 3TEYA 3U14A 1W7PA 5LHIA 1D1BA 1J58A 4UNOA 4OMYA 1RUI2 2RHPA 3PQJA 1HKSA 1W6PA 2W47A 1IG0A 4LLFA 1WI3A 1IS6A 4IJAA 5I8YA 4C3IJ 4WM7C 4MTDA 2P5KA 4COZA 2JE9A 2NQYA 4MLOA 2WN2A 4U0VA 2DDUA 2O1QA 1OPOA 4IHTA 1Z91A 1OPMA 2A5ZA 2YG0A 4CUBA 4NC6A 3FBYA 1N3QA 4Q48A 3M8JA 3M3YJ 1GLHA 5JZGB 4XURA 2DA2A 5KHGA 5FY1A 4BQ5A 1SFNA 3MIGA 3H1WA 1BC8C 4DB5A 5IVFA 4HNVA 4A3XA 1COV1 4XORA 3ZQIA 3W20A 3QCWA 2ISYA 1NTCA 3POEA 3L2UA 4Y4RA 2ZEZA 2KKOA 2G0EA 1UF2C 4XLHA 1NE6A 3AP4A 2D6PA 1F5TA 4BMEA 1DQUA 3U9GA 1WZXA 4JTOA 1T0FC 2KLOA 3J7HA 2C4XA 4PT6A 3H36A 1ZRIA 1EH8A 1P2FA 2IS4A 1KONA 2VZPA 2DVBA 1YFWA 1EH6A 3GTJJ 1Q43A 4EN8B 4FFFA 1SDWA 2VZVA 1XCBA 4ZYAA 1BJZA 2LALA 2M1BA 2GP5A 4ONUA 3U0ZA 4NDLA 1IPSA 2XDVA 3RQ0A 5BUVA 2D93A 1SPPB 1BR2A 2VOVA 3N7JA 4JRAA 5HDGA 5HXVA 3MUZ1 1PGL1 2XV4S 2UXNA 1W2TA 3WTVC 4Z8BA 4O7XA 3BTAA 3DECA 4E7JA 2P7VB 4N53C 1Q8QA 4D6SA 5FLMJ 5CFCC 5L3CA 2BPA2 1ZGAA 2V6CA 4L9NA 3BWGA 2X48A 2WTEA 2VOTA 3LZZA 1J2XA 2GNBA 3WDYA 5FZEA 1MZBA 4PLMA 3Q9SA 2JG8C 5FYCA 3L7WA 4N7IA 5C3PA 1UU5A 1JOJA 3OR1C 4QX2A 3HJRA 5JOZA 4L99A 4PLOA 2VXDA 2V79A 1PYVA 3HOYJ 2B9VA 1FY7A 4NRPA 1JZ5A 3DP7A 3VSLA 3JAMK 3RZKA 3S5QA 5BNOA 1LNSA 2KA3A 2KIFA 3BTJA 9ANTA 1IUFA 1OUSA 4K2EA 2A07F 1JZ7A 2XGDA 3V42A 2GNTA 2L9NA 5F0HA 1HV0A 5A6YA 1X2NA 3JRGA 4Q5SF 1PO23 1Q8OA 4XJZA 5G05L 4D69A 2RAEA 3VYTB 3UK9A 1YOVB 4IEXA 5HCFA 5L73A 1W90A 4LJZF 3TO7A 1ZZ6A 3Q8EA 3T2PA 2R3SA 4C0BA 4HZFA 4UVCA 4BXXJ 1RUF3 5J1YA 2BWCA 1S29A 3FXKA 2ECCA 3BG7A 3T0AA 1M1EB 4RFRB 4PHZA 2VC1A 2JA6J 4WVWA 1VBB2 1Z1DA 3BPXA 2WSUA 1W1WE 2VBBA 1VBA3 2VW1A 4C2MJ 3QYBA 4IEJA 1X9PA 2R063 4XXAA 3POIA 3GTKJ 4MX3A 3PJQA 3GX4X 1DYPA 1DQ2A 4M3CE 4EM0B 4BPZA 3V0BB 1NT0A 2HWC2 5KHJA 4BQ4A 1A78A 1RUJ1 1BEV3 2NOJB 4LD5A 1C0WA 4HQMA 1WJDA 4XBQA 3TOJA 5A3WA 4ZDLA 3WHUA 5I8TA 3I2HA 3OIQA 2G4IA 2VKHA 4NVPA 4OUEA 5AC91 1XRUA 4XLCA 4OULA 1FEXA 1ZA7A 5FREA 2FZ1A 2PJPA 4R4ZA 5LHHA 3KMHA 4IV3C 3BJ6A 2OQ7A 3OPTA 3GM8A 3QD6A 2F2EA 2F4MB 4QKBA 5BV6A 3JD73 3I9V2 4LBMA 4AI8A 4XK4A 4QB1A 2P0WA 2PTMA 2W1OA 3D5SC 3DLLF 4GB33 1CN1A 1CAWA 3A23A 1K5JA 1TQMA 1UIKA 1HXS1 3N7KA 4WWCA 4LOCA 5GLWA 1YIOA 5JCTA 4OVEA 1ASJ2 2M87A 4GWMA 1WCMJ 4MH0E 5D4RA 2OUMA 3SKVA 1WW7A 4D7YA 3C2UA 4XHXA 5AFBA 4LFUA 3CP8A 3B6CA 4AQ2A 3BTYA 2R043 3ZXEA 3FMGA 4XE9A 2PG4A 1QDOA 2ZKLA 1XXNA 3VBUB 1CAWB 3M7AA 5T5OA 5J3UA 3ZQFA 4LTAA 4UVAA 3DXUA 3ASOH 1VRH2 4LKSA 4P02B 4ZJZA 1AX2A 5M5XJ 2EH3A 4YG3A 2RNGA 3H5NA 1NLQA 2PLV1 3WNKA 1XMKA 4M4PA 2JE8A 2NS0A 2Y75A 1S7OA 3GW2A 5FKKA 3U11A 4NOTA 5IY5H 3OYEA 4AEDC 4M3CF 3WQ7A 1CZVA 1E2XA 4C30A 1P7JA 1Y1WJ 1J1LA 3OY8B 2DCEA 4PFOA 4LO6B 3RI9A 1PX4A 2NVTJ 4IL6C 4R1HA 1EUUA 3T1LA 1NLRA 2ELHA 5LA9A 1FPN2 3HEFA 2EFPA 3QPSA 1RMU1 3T2OA 1U2WA 2VJJA 2JEMA 3F8MA 1QHDA 5C5UA 2G1MA 1QBJA 2XBO2 3RZHA 3HYIA 3IN9A 3CCQI 4PGHA 5J98B 1V6MA 1AVBA 1YJLA 3IC7A 3W2VA 3OYWA 4OMCA 4JDOA 1UY3A 3Q9VA 3U2RA 1WLWA 1VE0A 1YJWI 1C28A 3H1CA 4FOVA 3CF6E 2XAHA 1G59A 1VALA 4CP9A 1H9WA 1XPXA 4YFWA 4BJ0A 2R7VA 3OOUA 1KU7A 2MEV2 1AYN3 4MGYE 2XVGA 4A44A 4NAOA 4P14A 2NM1A 3K1NA 5FYHA 4IEVA 2VBWA 5A6XA 3MUY1 4FQ4A 3FXOA 1KRIA 5JVVA 1H6XA 3O1VA 3I59A 4BA6A 5JR3A 3JBG3 4A3MJ 4YWAA 3WNXA 1R71A 1USSA 2PN6A 2VASA 4C9YA 3JSPA 3K46A 1BHGA 3NAPA 2WAQA 3O1MA 3E7LA 1K5MB 4RLFA 3NW4A 2Y33A 3BQYA 3MYXA 1VF9A 2VL4A 4IQPA 3T4HB 2DT6A 1BBT3 2CUJA 2WO7A 3AJYA 3GCXA 4UV8A 3THDA 4C0HA 2MHFA 2IA2A 3HSRA 3ZMVA 5IVBA 3S1NJ 5DEQA 1AR93 1W0TA 4P9JA 3WCRA 1RRJA 2W00A 1X50A 5A80A 5EJ1B 3OOXA 4L0YB 1AX0A 2Z2SB 2B42B 4MADA 3K69A 3HBKA 4CDWC 3CCLI 3AFGA 1GZ9A 1Q8VA 4HW0A 4DY5A 5CVIA 2WIIB 3KP2A 1MACA 4QB6A 2B39A 3C7HA 1JZ6A 1SD7A 4I99C 1NZCA 1QOOA 3G1LA 4G7ZF 1UKGA 5FLXK 1XNAA 2WT2A 1UY0A 5KHIA 3RKWA 2CSOA 3NNMA 4CDGA 3AM2A 4DXRA 1YYNA 1AR82 4QXBA 4QQHA 4A7ZA 3AL0C 4QGLA 2LTNA 2DFCA 3LEGA 1U5TA 2M30A 2GU9A 2ME6A 3TNQA 3L1PA 3QACA 4ISQA 3ZYBA 1ZNPA 3N4MA 2EXKA 1WMFA 3C7FA 1C1FA 1KJLA 3I7DA 3P5BA 3LD8A 2HYJA 1AZDA 1US3A 4CXFA 3LOBA 3S14J 5EDNA 2HEOA 5GLZA 3CCUI 3WINE 4OAZA 3NAUA 3SKJE 5L7OA 3MLLA 1W3VA 1CAUA 5JR7B 1ON1A 2E1OA 4BE3A 3G4SI 2WB1A 3VHOA 1AR62 4KG8A 3LFKA 1VNDA 5A7WB 4XUOA 4ZYHA 2QBXA 3RIRA 4OIOF 2F5EA 4EJRA 2P6CA 2WZR2 3KCYA 4BACA 2LF7A 4LNVA 1BOAA 1L3JA 1L7RA 4HX8A 3RSJA 2W1SA 1P4AA 1SD6A 2O0OA 3OYMA 3U1XA 2N7GA 4XETA 3ZR8X 2YB7A 3VBUA 2M45A 5D5UB 4RB1A 4XKWA 1HRV3 4Q26A 2ZNYA 1R22A 5GLTA 4PF5A 5EJZB 3W21A 3CO6C 3ZFGA 3VD3A 5F2SA 3B02A 1AU7A 2JE7A 1AR91 4RQPB 2YU1A 3M3OA 2TNFA 2G7UA 1OYYA 4MQ9F 5B1BH 2ZGPA 4IEOA 2ETEA 3J7MA 3SH4A 1OKRA 2L02A 1QGPA 3ZPLA 4QM8A 3VDCA 1MEC2 1O57A 1AYN1 5E8GA 5L36A 1RR7A 1N25A 3ME2A 3BIEA 4EJWA 2DVAA 3U1KA 2IXKA 2GAUA 2PMUA 2FZ2A 4CDWB 4COUA 1G8WA 2QJVA 3R4SA 4RQPA 4HQEA 5IATA 4FPGA 2HOTA 4MTEA 2JD9A 3KIOA 4GKXA 1NCQB 1ODMA 3WNOA 2YHJA 5E3MA 3OGJA 2EICA 1OYIA 4BNCA 3N3HA 1ZARA 2FQ4A 2BE5F 1HB4A 1QJX1 1GNZA 3GBGA 2Z4FA 2P4EA 2ZHLA 3CZJA 3ZMNA 1XC5A 1U5IA 4IKFA 3TKYA 2ZC2A 2DCKA 4BK4A 3ACGA 3HQXA 3MHZA 1KFUL 4H3WA 1QH6A 2Y6JA 5JZGC 2LRPA 2GMPA 1H30A 1PUEE 5FUPA 2CG4A 5L3DA 4QTRA 2Z33A 2W7NA 2Z16A 1MJAA 3REOA 1RUD1 5EEAA 2ISZA 5BNGA 3W59A 4EJVA 3VHPA 2OTLI 1W0PA 3ZXAC 3ECOA 1XE0A 5AIPA 3WXPA 3VB2A 1ZRRA 4NWWA 4I01A 2FX0A 3HPNA 4LHNA 1MGTA 5F6KA 5FRNA 1PMIA 3A01A 4ABZA 4OQ9A 1F4HA 4ZZDA 4KMUX 3HOUJ 2P3YA 3P7NA 1TVGA 1YFXA 2V1UA 1BIAA 4GH4A 3HIFA 1UELB 1BIBA 2HNHA 4D7TA 1FX5A 3TDUC 3C8XA 1L7QA 2ID4A 3BR5A 4CRQA 4Q4V3 3MICA 3ZR5A 1PP8F 1HSJA 1W4MA 4A0ZA 2HWD3 3OUJA 1ZYRF 3HNYM 1DYOA 5AFEA 2V5YA 4YW4A 2F5FA 3ZYGA 4CDQB 1IXCA 4AVPA 3GYHX 4RB0A 5I91A 1A34A 3ORJA 3I3EA 4YZ3A 3KVAA 3P3PA 2RDPA 4I0WB 1K7AA 2JMWA 1X9TA 2LW8A 4M6XA 1JTXA 3FFZA 3RDIA 3Q0VA 3NNGA 3MVPA 4S2GA 5CA6A 1LFBA 4CDXA 2R062 1R00A 3H1YA 2GSYA 4B7KA 4JX0A 4XFAA 4IV1A 2OPWA 1CAUB 4DZPA 3OB8A 3MV01 1VR3A 3S2HJ 3IDAA 1YC61 2X6YA 5JMCA 3TEDA 4CYCA 1TWCJ 1E5HA 3VB9A 3BPVA 1FBSA 1FYKA 3I58A 1OJLA 4BJ5C 3HRSA 2WV1A 3NQOA 4HF0A 3WTZA 3ZOIA 4R9CA 3WNPA 2RREA 3IIIA 1VBD1 3KWVA 2O0YA 4X6RB 5HDKA 5FTTC 3WEZA 3OS1A 3FJSA 1ST8A 3RJRA 3ST7A 2O8QA 4ZY9A 3JZVA 1WI9A 2WLPA 1XU2A 4YNIA 3JCIA 4LB6B 2E5ZA 1SG3A 2YFUA 5FBJA 4RHV1 2F4IA 2D6KA 4XNFA 4YW3A 2YMZA 4HSRA 3IBMA 2YX4A 5DV5A 1T38A 4E2GA 2FA5A 3A7QA 2MD5A 4QDRA 1JODA 1I39A 1GYKA 4BKXA 2EXIA 2FJ1A 2I5UA 4IV3B 5HLHA 1R1ZA 3JW4A 4QX5A 4Q5OA 2QNKA 1VBE2 4I0BA 1K4TA 2W92A 2HYFA 4A69C 2YBSA 2M4KA 1AUYA 2ZO4A 5HLIA 1HQCA 2XKOA 2JPCA 4BHBA 1RL3A 3VD4A 2L5QA 1J83A 2ZB9A 2ZACA 4EN7B 1PM4A 4C1WA 1X1PA 1UG2A 2Y2ZA 3LKJA 3O1TA 1LVKA 2EWNA 4FPFA 5C3QA 1W3XA 1LFPA 4TYSA 1RUD3 4FPLA 4XMYA 1K78A 4XW3A 4U7DA 2X1CA 3NO8A 3VZLA 5FD6A 2XAUA 4P9UA 1OD3A 3NAPC 2RVCA 4ANJA 4P9XA 5A7SA 4CCDA 1MZFA 1AX1A 1YQCA 4ASLA 1QMJA 4A5NA 1GOFA 1KS4A 3ZN1A 5FLIA 1ZYBA 5ILUA 5JZGA 1F43A 3NJVA 1YW7A 1I5PA 5E18F 1RHI1 1T6BX 2RNJA 3USUA 1YQ5A 5DTDA 2HEVF 5D8AC 3K4BA 3MIFA 2E51A 4I98B 5DUKA 1TW2A 3BC8A 3PIJA 1XD7A 1QJY1 2JG8A 1RJ7A 2MH9A 3MFAA 3M8FA 3OD4A 1RXFA 5ACA3 3W5MA 1BW5A 1K5MA 3AG2H 3BIWE 2HZDA 4XJWA 2JA2A 2K0GA 1W9WA 4XFFA 5DPNA 3M8EA 4RR3B 1BA5A 5C4WA 1FX7A 4IXAA 1CAVB 1VAVA 1YEWA 3FHIB 5JI6A 2R7UA 5FYIA 1RESA 3D0JA 2L9SA 1QNWA 2VZTA 3WCSA 4ARYA 3GXOA 3HGYA 2GWRA 3ZSJA 2AEYA 3S15J 4Y52J 3LWFA 2JX9A 2B63J 5C8CA 5M5YJ 3UJQA 1FIAA 3T1MA 2VO5A 3N97A 3LOCA 2DTZA 3GBFA 3LIHA 4HF1A 1LEDA 1VQKI 4B44A 1O3QA 2K40A 1XSQA 4Y1UA 1H1IA 2Z42A 2CUZA 2ME0A 4M3FA 3TRSB 2MGQA 3N9NA 1F5JA 1DHKB 2DQRA 1RUF1 4A2UA 4OAYA 3VSKA 1KU2A 4BK5A 4BQYA 2PHLA 3NVCA 5TISC 3WR0A 4FQGA 1D0ZA 1AJKA 3AL0B 5EEHA 4EYUA 2EAAA 2CFXA 1JI6A 1KITA 2GC3A 2W68A 5CEHA 1RUJ3 3T30A 1BEV2 3OGGA 5FMOL 2A6TA 4BY1J 2G9GA 2YFZA 2RJKA 5FYZA 1GZCA 3KCXA 4QQ2A 2KJBA 3I59B 4Q0QA 4B8EA 1FPN1 1O3RA 1CF7A 3SFZA 1MJ9A 3T8TA 5KK1A 1VQ7I 3F0CA 4V2VA 1H8TA 2X6XA 4YVSC 4WXDA 3OL3A 1HRV1 5J6XA 3H7YA 3PL8A 1YRNB 2FMDA 1VLNA 1U5YA 3K7AJ 1MZEA 4YW1A 3LMMA 4UUSB 4XUTA 4RGXA 1IN6A 2VBDA 4A42A 1F4KA 2R7WA 2BWAA 2PLV2 2BBYA 5B3SH 5L3BA 2TEPA 1AYM1 5FYSA 1UD1A 5FPLA 2R5YB 1RUG2 4L0ZB 4EWAA 2VOWA 2DV9A 3MBWA 4GJYA 2V7FA 2HWB3 2DCJA 5JAXA 1AR63 3N35A 5C71A 3VBSA 3E6MA 4LB5A 3L2YA 1KZHA 1AR81 4GKYA 1W8TA 3VEPA 1TME2 2Z9OA 5HOOA 3DYPA 2LH9A 3OJBA 4WM7B 4YLZA 4RMNA 5IWFA 4MGRA 5A32B 3D5LA 3LL7A 1AL22 1TNSA 4DOUA 3X29B 1W8FA 4EATA 3CUQB 1AXYA 3WHTA 3GZ5A 2ZX2A 3CMGA 2ZXJA 3JRCA 2PN5A 1IS4A 1R1VA 3GLXA 2VQAA 2J1VA 2P8TA 5JIUA 1R082 1ZELA 1UZVA 3FXMA 4YG0A 4MNUA 4GD4A 2TCTA 1GZWB 1HLCA 4TZDA 1ZR4A 2XHKA 2UYBA 1H2LA 3I0TA 2K3PA 3FFQA 4S05A 4YM1A 2HLEA 5FYTA 1G6NA 5JXJA 1DQ4A 1HBXG 1OFCX 4P00B 4UVBA 4Y13A 3AKSA 1FYUA 2X09A 4GMP3 4ZHNA 3BR1A 3ZFEA 3EUAA 5IK8A 4G9YA 3H92A 3ZYFA 3POYA 2Y34A 4CPBD 1G8XA 3OSGA 2XB5A 2EFWA 1R7JA 2Q8KA 4BH9A 4Z1VA 3WP5A 5FZCA 3BG3A 3CEWA 5GAGJ 5J40A 5BYNA 2Q1FA 5K4LA 1B72A 3V8JA 4UBHA 3PFYA 4KITB 2Q1ZB 5F2WA 4JTNA 2PQ8A 4F3QA 5EF6A 3KEYA 4K8FA 1RNLA 3VODA 5F5CA 4HVQA 4N90A 3KEQA 5C4XJ 5CNAA 2NNNA 1GWMA 4L18B 5ABJA 2WADA 3ZXJA 3JBG2 4B3XA 4IGOA 3O1SA 3T0DA 3AZWA 1GXQA 4S2DA 1S55A 3CMMA 5EFUA 1I1GA 3VBRB 5FWJA 3PUQA 5C4WC 2DUOA 2X05A 3S8PA 2BXYA 4H7LA 3PM1A 4FAGA 4IEPA 3DPRB 1ZQ3P 1RPWA 4DZJA 2WNUC 5BQTA 5J47A 5FZOB 4RAZA 3HHGA 2ZGMA 4BL0B 2K46A 5JSRA 1VQNI 1J7KA 1QY4A 2HDWA 4G7HF 2WNVB 5FAXA 3ZRGA 5ILVA 2DCYA 5C3RA 1NOVA 4KT5C 5F3EA 1BCXA 2VMGA 3MGUA 3BVCA 2Q0AA 2QQKA 2DBBA 1ENXA 3USSA 4N43C 2HXIA 5IT9K 2C6SA 4KH9A 5FZ3A 1CD3G 2BVMA 2ECBA 4ITCA 3V0BA 4EN9B 4CDUA 3R6SA 2STTA 1JW6A 3TDZC 2P3KA 1Q8SA 1WSUA 2K2SA 1MS3A 3HWJA 3GFMA 4COWA 2XPUA 2X85A 1SBEA 5FZ0A 2V4JC 1RETA 1UOBA 2W85A 3ABZA 1F15A 5JI7A 4P9IA 4D7SA 5D1IA 1J0RA 4QWNA 2IW5A 3SXWA 3KZ4C 3N7MA 2DCTA 1FJLA 1J09A 3KYDB 5FBZA 5FV3A 4IHWA 2RE9A 4LBQB 4M0HA 2R1DA 4UFJA 4PLNA 2OV7A 4CU7A 4KICA 4F91B 4PUSA 1YQAA 5D21A 1ON2A 2J1SA 2JQ7A 2GH2A 3AMQA 3WP6A 3DQVC 4JV4A 1HKTA 3K51A 2CQXA 2ADEA 4CCEA 5I0RA 5L3GA 5CIRA 4OINF 1WPKA 4OUMA 4WVZA 3N9LA 1GV5A 2BGCA 1V00A 1OCPA 3HTSB 3CQOA