2RR11

Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
273
structure length
273
Chain Sequence
TVASISSGPKHTQKVPILTANETGATMPVLPSDSIETRTTYMHFNGSETDVECFLGRAACVHVTEIQNKDATGIDNHREAKLFNDWKINLSSLVQLRKKLELFTYVRFDSEYTILATASQPDSANYSSNLVVQAMYVPPGAPNPKEWDDYTWQSASNPSVFFKVGDTSRFSVPYVGLASAYNCFYDGYSHDDAETQYGITVLNHMGSMAFRIVNEHDEHKTLVKIRVYHRAKHVEAWIPRAPRALPYTSIGRTNYPKNTEPVIKKRKGDIKSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
publication title Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses.
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Virus
total genus 44
structure length 273
sequence length 273
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1988-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2rr1100
1BMV1 2R043 1RUG3 2X5IA 1COV3 5BNOC 1K5MA 5BNNA 1M06G 1EV13 1CJDA 1V9U1 4CDWB 2MEV1 1POV0 1RVF2 1H8TC 1OOPC 1R1A1 2HWF1 4CEWB 1BBT1 1VRH1 5BNOA 1VBA2 2ZAHA 4IV3B 1FOD3 1R083 5CFCB 5A33A 1AL0G 2XBO3 2R071 4PDWC 1VBC2 1H8TA 1HXS2 1OOPA 4WM8C 2WS92 5DDJ2 3VDDB 2WFF3 2RM21 1R091 4N53B 4CDQB 1RUE1 1VBB2 2BFUL 4N43C 1RUF2 5D8AB 1PVC2 4LLFA 4PDWA 4Q4Y1 5AC93 4WM8A 1COV1 1BEV2 4CEYB 1VB4A 4QPGB 1RVF3 1F8VA 2BPA2 4GMP3 4GMP0 4YVWB 1RHI2 1VBD1 1PIV2 1POV1 1QJU2 1MQTC 1V9U2 2MEV2 1R081 1VBC3 1HXS3 2HWF2 3JBG2 1PGW1 2WS93 5DDJ3 4NWWA 4Q4V1 5CFCC 1QJY2 2XBO1 2DF7A 1X36A 2R062 2ZZQA 1VBB3 1HRI2 1MQTA 1RUF3 1SMVA 3VBSA 1PVC3 1TMF2 4Q4W2 3VDDC 2R072 4N53C 4CDQC 5CFCA 3NAPC 3HAGA 1BEV3 1RUE2 5D8AC 2PLV2 2ZTNA 3VDDA 3ZXAC 3S6PA 4N53A 4Q4Y2 4CEYC 4GMP1 4CDQA 4QPGC 5C4WB 3NAPA 1V9U3 1VBA1 2MEV3 2HWE1 2HWC2 4YVWC 5D8AA 2HWF3 1RUD2 1BBT3 5ABJB 1WCDJ 1QJY3 2R063 1VBD2 4CDXB 1X33A 5CFDB 1OPOA 4RQPC 1HRI3 4CEYA 2WS91 5DDJ1 4QPGA 1ZBE2 5K0UB 1TMF3 4Q4W3 1VBB1 2R073 4YVWA 5BNPB 3TN92 4Q4V2 3ZFEB 1PVC1 1RUE3 4RQPA 5FMOL 2PLV3 2HWB2 4GB32 4Q4Y3 1RUI2 3JB8A 2GSYA 1RHI1 1PIV1 1AR71 1QJU1 1FMD1 2BUKA 4YVSC 1VBD3 1POV3 1FPN2 3JBG1 2RS12 1ZBE3 1QJY1 3VBOB 1ND2B 2R061 5ABJC 2HWE2 1HRI1 4JGYB 5CFDC 4Q4V3 4GH4B 1NCRB 1TMF1 4YVSA 4Q4W1 4IV1B 5K0UC 3VBHB 1AUYA 2HWB3 2RMU2 1HRV2 4GB33 5BNPC 5C8CC 5ABJA 1RUI3 2PLV1 4BCUA 1ND3C 5CFDA 2WLPA 5K0UA 1GFF2 4WM7B 5C8CA 5BNPA 5FOJB 2HWC1 1AR82 4N43A 1ND3A 1RUD1 2RS13 3JD71 1PO11 1VBA3 1AR72 2HWE3 4CDWC 4RHV2 3DPRB 1ZBE1 1FMD2 4CEWC 1D4M1 3VBOC 1ND2C 3VBRB 4IV3C 3TN91 2BFUS 2RMU3 1HRV3 2RS32 1MEC1 4CDWA 3VBUB 1QJX2 4IV1C 1PO21 3VBHC 2HWB1 4GB31 4CEWA 1RUI1 1ND2A 3VBOA 3M8LA 3VBFB 3ZFFB 4IV3A 1AYM2 2WZR2 1ASJ1 4RS5B 1AR83 4IV1A 3VBHA 1RHI3 1PIV3 1AR73 4Q4X2 4SBVA 1CD3G 4WM7C 1QJU3 1RUJ1 1FPN1 4FTEA 4RHV3 2RS11 4JGZB 5BNNB 1AR92 1FMD3 1AL22 1PGL2 3CJIB 4FSJA 5L7OB 2IZWA 3JBG3 3JD72 1PO12 2RS33 1EAH2 4WM7A 1QJX3 2RMU1 1HRV1 3VBRC 5A33B 5ACA2 1D4M2 3J8F1 1RUG2 5A32B 1AYM3 2WZR3 1Z7S1 3VBUC 1MEC2 1W39A 4CDUB 3ZFGB 1PO22 1F2NA 3VBFC 1RUC1 3VBRA 1C8M2 3ZFFC 4Q4X3 1AR81 2VQ0A 1NOVA 1ASJ2 3VBUA 1NCQB 1RB8G 1B35B 1TME1 2HWC3 2HWD1 4RHV1 1ZBA1 1RUD3 3JD73 1PO13 3VBFA 3ZFFA 4JGZC 5C4WC 2RR12 1RUJ2 3CJIC 1DDLA 5J98B 5L7OC 2WWSA 2RS31 1D4M3 1VAKA 1QJX1 4RR3B 3FBMA 4CDXC 5FMOS 3TN93 1VB2A 4JGZA 5C4WA 1MEC3 1HX6A 5AC92 1AYM1 1QQP2 2WZR1 3CJIA 1PO23 5L7OA 2FZ1A 1C8M3 1MQTB 3ZFEC 3VBSB 3J8F2 4CDXA 1Z7S2 1ASJ3 4CDUC 4Q4X1 3ZFGC 2RS52 1AR91 4FTSA 5A32A 1NG0A 1RUC2 1AL21 1PGL1 2RR13 3ZFEA 1RUJ3 4QPIB 1FPN3 1NCQC 5C9AB 1B35C 1VBE1 4RFT0 4CDUA 1EAH1 3ZFGA 3NAPB 1TME2 1RMU2 2HWD2 1AR61 1ZBA2 5JZGB 5ACA1 5J96B 2XPJA 2QQPA 2R041 1RUG1 1NCQA 1QQP3 2FZ2A 1B35A 4JGYC 4RR3C 1AYN2 1RUH2 4GH4C 3J8F3 1NCRC 1BMV2 4NWVA 1EV11 1A6CA 1Z7S3 4AEDB 1C8M1 1NA1B 2RS53 3VBSC 4JGYA 4RQPB 4RR3A 1RUC3 1FOD1 3LOBA 4EJRA 1IHMA 4GH4A 1NCRA 1R1A2 3IDEA 1BBT2 1VRH2 1NY71 2X5IB 2RR11 4Y5Z0 1TME3 1RMU3 2HWD3 1E57A 1ZBA3 1K5MB 2WFF1 2GH8A 4QPIC 5C9AC 4Y4YA 3JB4C 1VBE2 2RM22 1R092 3DPRC 1AYN3 2BBVA 1RUH3 5JZGC 5AC91 5BNOB 1C8NA 1QQP1 1AR62 4QPIA 5C9AA 1RVF1 2R042 4YVSB 1COV2 5LK7B 1H8TB 1OOPB 3DPRA 5JZGA 2TBVA 4AEDC 2RS51 1R1A3 4Z92B 1EV12 1NA1C 1VRH3 1VBC1 4RS5C 1HQNA 1HXS1 1QJZA 1AR93 4FTBA 4PDWB 1AL23 1FOD2 1R082 2Y26A 4WM8B 1RMU1 4AEDA 2X5IC 5C8CB 1RUF1 1OHFA 1NA1A 1PGW2 1VBE3 5GKAC 1NY72 1R093 2RM23 4N43B 1K5MC 1EAH3 1ND3B 2XBO2 5BNNC 4RS5A 1AR63 2WFF2 1BEV1 5ACA3 1AYN1 1RUH1
chains in the Genus database with same CATH superfamily
1DGWA 2W2IA 2R043 4CCMA 4MYEA 4UXAA 1GZWB 2JDNA 5EV7A 1LAJA 1COV3 1LNSA 4BLIA 4OUEA 3ACLA 2VOVA 3VL8A 1IS5A 3VDCA 2G9ZA 3J7NA 1DGRA 1PM7A 1ZA7A 3KCYA 3ME2A 4NPRA 1O5UA 4XW3A 3ZN4A 2J42A 4DY3A 5LA1A 4R9CA 3I4IA 4MSVA 1SCSA 2QJVA 2MEV1 3KCXA 4AOCA 4MV2A 3EJKA 4PLNA 4CDWB 4GA9A 2YXSA 4QD2A 5FZDA 4OVEA 1G9FA 1POV0 1IG3A 1RVF2 1OOPC 2HWF1 3IMMA 3KT1A 2VW0A 1VBA2 3CLPA 3H9AA 2R32A 1FOD3 1R083 2A6VA 2V4VA 4OCTA 4DOUA 2VQAA 3GXUA 1Z0HA 3I97A 1V6OA 4YGCA 5FYHA 1YQ6A 2A1XA 1XNDA 3ITQA 2B46X 4BJ0A 3WQ7A 1H8TA 1HXS2 1KDMA 2WR9A 3AP4A 3B02A 3M7AA 5FP9A 1A8MA 2XL7A 3W21A 5A7OA 4N53B 2QZ2A 4BQ3A 1HV1A 2GMEA 4CDQB 5AFBA 4NR1A 4A7ZA 3VD7A 1BHGA 4HK8A 3DXTA 3MV11 5D8AB 4V1PA 1CIWA 1SFPA 4LLFA 3LPFA 2WO3A 2GNMA 1LTEA 2G9FA 3IAPA 1S0DA 2WAAA 1BEV2 1G6NA 5A3TA 1UZYA 3B00A 1CVNA 4IESA 3NV4A 3C7OA 1OVSA 1QOSA 1T6BX 3WSOA 1F8VA 4FP2A 3R4SA 4XFFA 5I0UA 4YVWB 2VTXJ 1N1TA 4IEXA 1PIV2 3MIFA 3LIHA 5LASA 1WZXA 5JLVA 3TBDA 4TSVA 2Y8KA 5FP4A 2XLFA 1GOHA 1VMFA 3DN7A 2MEV2 2V5YA 1GZWA 4CP1A 2FDFA 1LOEA 5K4LA 2DU1A 2IXKA 2BVVA 2HWF2 2K46A 5DDJ3 5CFCC 3RZHA 2XJPA 3ZSLA 4E2QA 1EPZA 5DAPA 1APNA 1X36A 2R062 4XTPA 4XF1A 2OUJA 1OQEA 1VBB3 4LT5A 3U0ZA 2GP5A 1HRI2 2D3PA 4IGOA 4AGGA 2ZMLA 2ZCWA 5T54A 3WG4A 2VMEA 2E51A 4S2HA 3VBSA 4RA0A 3MFAA 4I0BA 1PMHX 3Q9OA 4Q4W2 5IVBA 1EUUA 4BH9A 1SCRA 2ENRA 3BOPA 2DYCA 2GU9A 1O7FA 1ZRRA 3AVSA 1YFYA 3HAGA 4D6RA 4PIZA 5HCAA 1OA4A 2RDSA 1YC61 4AAPA 1G9DA 3A22A 1W9TA 5F9TA 1JZ8A 1C5HA 3MBWA 1G9AA 2FDIA 2XJTA 2ORXA 4EYUA 2B39A 3D8CA 5J1XA 2YHJA 2X8KA 1AX1A 1QGLA 4XMAA 4A4AA 1ZRIA 4R52A 1AJOA 4KMQA 4N53A 1JHJA 2YUEA 4X6RB 4CDQA 4CEYC 2FDHA 3NAPA 1UPSA 5DAQA 1V9U3 1VIWB 4NPLA 4FOWA 4QM8A 2HWC2 1ULPA 3RMXA 4XCAA 1PZ7A 5D8AA 3NV3A 5C6CA 1J59A 2WSVA 4AFBA 5T3NA 2QDRA 5FZ8A 1BBT3 3MW3A 5ABJB 2XKOA 1S2EA 1QJY3 2WNVB 3GALA 3CEWA 2VZTA 2VUDA 2GC3A 1X33A 4LKFA 4I2OA 1PZ8A 3HPNA 3OGRA 2VECA 2JD4A 3C7HA 4NIIA 3USUB 5K0UB 2WFPA 4QQLA 5F3GA 4O7XA 1TMF3 2R1BA 3A21A 5BUVA 2R073 4YVWA 3B01A 3CL1A 4KL1A 1XE0A 1OLMA 2PQQA 2Z69A 3F95A 5BNPB 2YBKA 1XU2A 4LJHA 5FY4A 3S5AA 3MGUA 2WNUB 2XOMA 1PMIA 3JQXA 5FMOL 1O3SA 2PLV3 2XWBB 5ANQA 2X10A 4IDZA 4Q0PA 3WD5A 4I01A 1NLSA 4GB32 4QQHA 4QB1A 4Q4Y3 1RUI2 5CIRA 5L36A 2GSYA 2P2KA 5F5IA 4C0HA 4K8RB 4XOGA 2QE3A 1QJU1 1OD5A 5FRAA 1QF3A 1RXFA 1GR3A 3OBZA 5F5CA 4Z2WA 4XEZA 4PIXA 4QU2A 3SH3A 1OQDA 3KT7A 4YVSC 4Y1XA 4P9LA 1OT5A 1RUNA 2IC1A 4CTEA 2DCJA 1JU3A 2N7GA 3JBG1 1NQJA 1Y9MA 1EYBA 3AJZA 1W8TA 3ATGA 2Q8DA 5LZ6A 3T30A 5FMBA 1ND2B 2ARAA 2WABA 3MIDA 4CP2A 4P9IA 5IVYA 3SKJE 4A3XA 5CG8A 4ZU7A 4MZUA 5IW0A 2CV6A 2D93A 4JGYB 2QFEA 3N9NA 1ULFA 2XLGA 3D6EA 3VD9A 1QWRA 1ULDA 2B5HA 3GZEA 4DXTA 5A6ZA 3V0AA 2YPJA 4IV1B 1N3OA 1LRHA 2C4XA 4XFBA 3VBHB 1XU1A 2W91A 2VQUA 5IVEA 2H0BA 1HDKA 5C8CC 4GWMA 5ABJA 4D7SA 2WNVA 2PHFA 2VVDA 4P00B 3U11A 4BCUA 3TYJA 2JE9A 2YV8A 1DF0A 1MS5A 3LZZA 5GZFA 2D3SA 1J3QA 1W0PA 2WQZC 4AW7A 4D8MA 5K0UA 2W46A 3PHMA 3RYPA 2DVBA 2VCBA 4JTOA 4DS0A 3GGLA 2ZGMA 5I8TA 3O1OA 4X8PA 3ZYJB 2WUHA 3RQ0A 5BNPA 2XKPA 1C28A 2Y33A 4AI0A 1RUD1 1YLLA 3PIGA 1H6XA 4H55A 4PQQA 4CYDA 2CAUA 1PO11 4J1XA 5J48A 5E89A 5FOBB 3SH5A 3VLBB 2HWE3 2VPVA 4OI4A 5J3UA 3RJRA 5LW9A 1CN1A 1HN1A 5T52A 2QQOA 4KWKA 4LBKA 1XB9A 1ZBE1 4E2GA 2QQJA 4NIDA 1DCSA 3HMYA 1W05A 4IEQA 2AACA 2FCUA 4KU8A 1I3HA 2LM3A 4Y22B 3VBOC 2GALA 5BNQA 3VBRB 5BYNA 1OKQA 2VNGA 3A0NA 4IEVA 3TN91 3AP9A 2RMU3 4COWA 1HRV3 3PVBB 3WUCA 3HWJA 3N4MA 3D82A 1NE6A 4XBLA 3E5QA 1JBCA 1OLME 3BPZA 3OBAA 4GWJA 3VBUB 4A7YA 1PO21 4YG6A 2ERFA 4TN7A 5FPBA 4CEWA 5FREA 2EICA 1C3HA 1ND2A 2QQIA 4CU9A 5C8WA 1UY1A 4XF4A 1GQGA 2WZR2 3OGJA 4LMFA 4PF5A 4E2SA 2NMOA 1POQA 2ZX2A 2ZOEB 2Q1ZB 2E31A 5HXVA 1GQHA 4QB6A 4IV1A 4L8QA 4AI3A 4TZDA 3T0DA 2D6OX 3VBHA 1DG6A 1RHI3 5C3SA 3AL6A 3HJRA 4SBVA 4DFSA 3IZOA 3POBA 3H3UA 5K8SA 4RHV3 2RS11 4JGZB 2QVSB 4M0HA 5J09A 5FZOB 1GWKA 1F35A 1N1SA 3RZLA 5C33A 1AL22 4LR4A 3CJIB 4FSJA 3CNAA 2KR2A 4LHKA 1OD3A 3SMHA 2XVKA 5FZCA 1CIYA 2QQNA 3I2DA 4M4RA 1PO12 4XAAA 2VCAA 2RS33 1W6PB 4HOOA 1EAH2 3DYOA 4YM3A 5C3PA 2QNKA 5CAZA 3FHQA 4XMIA 2XL9A 5IVFA 3BTAA 5D1IA 3M4FA 4LITA 2Y0OA 5A33B 4L0PA 5ACA2 1KRIA 4C8DA 5CYYA 2OYZA 2XJQA 3N7LA 1V0AA 3W58A 2ES3A 3O5SA 5T5PA 1CPMA 1S0BA 4IQPA 2W39A 4W6WA 2BP6A 1VE0A 3VUOA 4Y22A 3ZFGB 5GLWA 1PO22 3UKTA 1F2NA 3VBFC 1BXHA 1RUC1 3VBRA 3ZFFC 4IEPA 5JAXA 1AR81 4QX7A 5IK5A 3MEPA 2Q5TA 3MHZA 2J1VA 4PBPA 5FZLA 3VBUA 1F15A 2JDHA 2VBBA 3WG1A 1JYIA 1NCQB 1U0AA 2WNOA 1R64A 3JUUA 4ARXA 3W5NA 3WNMA 3BUCA 4CA9A 1QXJA 4AVBA 3UETA 1ZNPA 2F4LA 5C4WC 5EWSA 1WA6X 5FY0A 5A3PA 5FTTC 4U2AA 4BLJA 4DRVA 2VD7A 1DDLA 4FXGB 1LENA 5J98B 3WLUA 5B2GB 1LB2A 2IWGB 1D4M3 1UU4A 2V4AA 5FK8A 4CU8A 3OGVA 4GULA 1QJX1 3WG3A 2EIDA 4B29A 2ZEZA 4CDXC 5DMYA 4LO4B 5FMOS 2BVBA 4ZPIA 2K9ZA 3AP6A 4NE9A 4AI9A 3OY8B 4AVVA 4JGZA 5FZ6A 4XACA 2CNAA 3KLSA 4LHSA 2GC2A 5FZOA 1AYM1 3ZYGA 3UJQA 3CJIA 2BTVC 1QY4A 4LO8A 5C71A 5JCTA 3PU8A 2FZ1A 1C8M3 1HB4A 3D3AA 5EFUA 5FYCA 5HCFA 1RJ7A 3WUDA 4AXOA 3PMEA 1UOGA 3CZJA 5I8YA 1KFUL 1ASJ3 4KU7A 4XFIA 4DIQA 4KWUA 5KHGA 4I0AA 5FBZA 3N9QA 1PNFA 3AKQA 4IE0A 2ADEA 3KF3A 3NKGA 4QXHA 2VY0A 2XQXA 2XWJB 5CNAA 3ZPYA 1LKNA 4AEMA 1XBFA 1NG0A 1RUC2 2D6LX 2E32A 2D44A 4ISQA 5CA6A 2V72A 4MXWB 3BALA 1FPN3 1OMIA 3ZXJA 1UYZA 4WZFA 3CZUA 2IUWA 1B35C 3N9OA 5C9AB 4LA2A 4RFT0 1KJRA 2YYOA 5JVVA 2XJUA 1PNGA 4KG8A 4AZZA 5JWPA 3ZFGA 5GZEA 1RMU2 2K0GA 4LPLA 2OVUA 5KHIA 3LEGA 5IK4A 3ZXEA 1ODNA 5J96B 1LOBA 1W0NA 4GXLA 4YW1A 2JICA 2UYBA 3ZR5A 5JIAA 2CU5A 3H50A 1NCQA 1QQP3 2RJLA 5LB6A 3SCGA 3OTFA 5JI7A 2A3YA 2VL4A 1H30A 3AXEA 3RI9A 4AFMA 1JYNA 3HEIA 3CKHA 2JECA 3RZKA 5L73A 3J8F3 2HBUA 2FDKA 3GHMA 2ATFA 3KZ4C 2YMZA 4XUQA 1HN0A 3AMQA 5IT6A 4M3CB 1MS8A 2LTNA 1NA1B 3PVNA 3WOGA 4XDQA 4UFHA 3POSA 4LO5B 3AFKA 3ILNA 3AJYA 3VBSC 3OF1A 4CVUA 4IEYA 2PHWA 4QM9A 1YI7A 3SCHA 1IHMA 4YZ4A 2JENA 4L97A 2E7TA 1YQ5A 3PURA 2Z5WA 3WEZA 2AH2A 3MICA 4A3ZA 4F7ZA 1BBT2 1UZVA 3L9JT 1JYWA 2OQ7A 3K3OA 1C1FA 1WBFA 2RR11 2EAKA 3CMGA 2VXRA 4W6XA 2OA2A 4H3WA 2HWD3 3ABZA 3H1YA 1JI6A 1F4AA 1OH4A 3C8XA 3K2OA 2BBAA 1MACA 3LFIA 4QPIC 3WP5A 2P1BA 3WP6A 2JG8C 4YRDA 1I1EA 2AYHA 4RSUA 4IEUA 3F2ZA 2ARCA 4Y3OA 1AYN3 3TWIA 1G9BA 3NV1A 1PK6C 2VCCA 4XYXA 2ET7A 5C7GA 1HQLA 5DPNA 1S0CA 3WNOA 1GNYA 2D3RA 2GN3A 2P6CA 5CISA 3APBA 5C9AA 3HVDA 2RV9A 1UXXX 1AHSA 2A71A 5LY1A 4YVSB 3ZSKA 4IE5A 4JQRA 3URFA 1J83A 4W65A 1HLCA 2JE7A 4XCBA 5JSOA 4E27A 2JDYA 3GJAA 3L2YA 2TBVA 4AEDC 4XJ8A 3N35A 2RS51 1TNFA 4R4ZA 1V6KA 2DCKA 2YROA 4UFIA 3DKWA 3H8XA 5E88A 2Q1MA 3B93A 1OA3A 3PUSA 4Q1RA 5EIYB 5LBFA 3W5MA 3OCPA 4DXSA 3WW3A 2XMLA 4MX3A 3O1PA 2C24A 3ACGA 5AVPA 1V00A 4GJYA 5FZ1A 5KXEA 4FTBA 4PDWB 4UBGA 1RITA 1L3JA 5JXHA 2Y26A 5L9BA 1Y3TA 5C8CB 2PAKA 4K1ZA 4R9AA 1OHFA 1OSGA 1NA1A 1PGW2 1QMJA 4WV8A 4HN0A 5GKAC 2CYFA 1TZOA 1YQ8A 1A8DA 1K5MC 2XBO2 4JAAA 4N43B 4Q0SA 5K9YA 4RS5A 2D5HA 3K75B 2IFRA 1DFQA 1ODMA 2ZHKA 3UYJA 3NNFA 1Q8VA 1US2A 2A6ZA 2G4IA 1RUH1 1NXMA 1W9YA 3H3ZA 4AHWA 5KXCA 1BMV1 3OOXA 1RUG3 1XNTA 3WDYA 1OC1A 5BNOC 1XNCA 1ULOA 3NRUA 3O0VA 3N9LA 4EWEA 3B9IA 3ALQA 3OUHA 1HW5A 4FOQA 2O0OA 1EV13 2Y34A 2P3KA 3B5LB 4AWDA 1YIFA 3BKZA 3H8OA 1DU3D 1EY2A 2WO7A 3FE5A 3QH6A 3WV6A 1DQ6A 1R1A1 3M70A 4IGQA 2WO2A 4UW6A 3THTA 1KJLA 2ZPXA 1DQ1A 3WF0A 1HJGA 2VMIA 2JXAA 4XJ9A 2R49A 3A0KA 2GNDA 1OA2A 4Y33A 3SNMA 2EIBA 5I0SA 4OHZA 4WM8C 2WS92 3WG2A 2WFF3 4ET7A 1OFNA 1W9WA 1R091 2RM21 4AG4A 4C90A 3RZMA 4DB5A 1RUE1 3HNBM 3PIJA 1YJKA 3T3YA 3FL7A 3GCXA 1LEMA 2A5ZA 2FDJA 5KR7A 5A1AA 2R0HA 1PVC2 5CG9A 1JH5A 5GLVA 2BGPA 2CWMA 1GSLA 4B1MA 4PDWA 5AC93 4LHLA 1JUHA 1OLQA 2VZUA 4XAEA 5FPZA 2JEMA 2NPIA 2G19A 1VB4A 2ZGLA 3RPQA 3DCQA 2RG4A 3H8RA 2XGXA 1VPHA 5C70A 4OZOA 2WC2A 4QHZA 1QKQA 4YW7A 1SBDA 3OEAA 4GMP0 1RHI2 1YHFA 4QPWA 4XC9A 1POV1 4Y5SA 3LB9A 3QACA 3ES1A 4K1YA 4LUKA 3MDPA 5JOWA 1XOYA 1K45A 3K4AA 4AVAA 1W03A 3IBMA 5LATA 1PGSA 1CESA 2VMDA 2I74A 5I8SA 3INAA 1H1MA 1VBC3 4LBJA 4NRQA 3MZHA 4O9EA 1W2TA 4BZ4A 2XJRA 2Y38A 3FZ3A 3VB9A 1XJAA 3CDZB 1GANA 3RZZA 4RGGA 4A44A 3NJVA 2FCTA 4BB3A 3ZSMA 3HNYM 4M3CE 4Z82A 4J1WA 5E8AA 4BA6A 1ALYA 2R7EB 2QDNA 1MQTA 1RUF3 5BV6A 4K21A 5EHDA 4AI1A 3POGA 1UZZA 3VDDC 3OUJA 4LA3A 4BK5A 5BXXA 4FCAA 5LRSA 3V64A 4PF1A 3CQOA 3HQXA 3N7KA 3O1RA 1RUE2 1JW6A 1MS3A 5GZGA 5FYIA 3ETQA 4AGVA 2DCYA 2DBIA 2Y6GA 4JHTA 3NO8A 1H2NA 1ZA4A 2RDRA 3C2UA 2ID4A 4FXKB 5JXGA 1YFWA 3ZXAC 4P9WA 2OKXA 3VHPA 2O8OA 3VZNA 3ZMOA 5CKQA 1FAYA 1J1TA 1Q43A 1CZVA 4GWIA 4QPGC 5C4WB 2VBPA 4KI5M 4LK6A 1VBA1 2UU8A 3WX5A 2B42B 1JS9A 1KXGA 1ZZCA 2BNMA 4DRRA 2VMHA 2Y6LA 4CDXB 5F3EA 5CFDB 1OBNA 4RQPC 1UAIA 1QH7A 2IXCA 2ZAAA 4HKOA 4UF0B 2PELA 1DHKB 1FNYA 3B94A 4TXWA 2A6WA 5A1FA 5A7WB 2DCZA 2PHXA 3OEBA 4KGGA 3WW1A 4CPBD 3WXPA 4QKDA 4I09A 4KNCA 1U12A 5T50A 4XXPA 2YBSA 4D69A 3RYKA 3ZVXA 2C5DA 1VMJA 4FBFA 1O3QA 1REDA 3VHOA 2D6MA 4JTNA 3FMGA 2HWB2 4PI2A 4XABA 4M01A 5JXJA 4E8CA 3KSCA 5IVVA 1JZ6A 4GZ9A 4AFAA 1VLNA 4Q0VA 3FC0A 2WLQA 3GDBA 3J7HA 4ES9A 4U36A 1PIV1 1RTVA 3QCWA 1AR71 4OMCA 4FAGA 3V56A 2VU9A 2BV4A 2W0XA 3PJQA 1LHVA 1UOJA 2AUYA 2PHLA 4NIGA 3KS7A 3P3NA 1YWKA 4UFMA 1FMD1 2Y64A 4BPZA 1MS0A 1V6MA 5FDBA 1VBD3 3A23A 3PMSA 3WHTA 5EJZB 1RGSA 1FPN2 2VAUA 5JR2A 4JKLA 1AXYA 1ZBE3 4D6QA 2R061 5T55A 4BDVB 5HXMA 4N7UA 4HFSA 1HRI1 1ACCA 5LY2A 5GALA 3K51A 4Q4V3 3E6CC 2GN7A 2A7AA 2VUJA 3M3OA 4Q4W1 4XFHA 1GYKA 2RJ2A 3ELNA 1WMFA 5T5OA 4W50A 4AK3A 2BQPA 3FHAA 3TNQA 4MH0E 2DFCA 2VO5A 4ZZ5A 4ASLA 4P9GA 1P8JA 3VHNA 5KC6A 3FX3A 3MI8A 2DCTA 4CPBA 3HD8B 2VZ1A 4EN6B 1ND3C 5FQ0B 5CFDA 4CCNA 4FAHA 2WLPA 3JCIA 3PUQA 4E4HA 3GJBA 4TLFA 5A7WA 5GLZA 3WR0A 5FPVA 4WM7B 5CU1A 3H1MA 5EYXA 3WY6A 2HWC1 1VP6A 3WDVA 3ZKYA 2RS13 4ES8A 1K5JA 2JG8B 1YXWA 4KGQA 4XIOA 5IHRA 4LLOA 1AR72 2NQYA 2XJSA 4NOTA 3NNMA 5LA9A 2ZGTA 2FHRA 1FMD2 3LFMA 4WVZA 4ASMB 4B8EA 4XPVA 3ENRA 4IEOA 4FOYA 4CCKA 4IV3C 1WMXA 1O4TA 4Z07A 2WL1A 3WF2A 2OS2A 3MW2A 3AMPA 1LULA 1N1YA 4Q5OA 1W6MB 3H1WA 3JXSA 4CDWA 3NQHA 2AGSA 1JHNA 5DABA 4DPNA 1F4HA 1JOBA 4L9BA 3LQCA 3VZMA 4W4ZA 4GB31 4HSLA 4CUCA 5J36A 1SLIA 4R9DA 3Q8CA 5FPXA 1RUI1 2UURA 4KBZA 2CHHA 4B7EA 5C5TA 4YW2A 5F2SA 1LOGA 2Z79A 3LPGA 1JYXA 2GAUA 2D6KA 1PM4A 2D43A 4FPGA 1PX4A 1AR83 2VZQA 1SLCA 4L92A 3I2IA 4NPMA 4S2DA 5GZDA 5A6QA 3GCWA 3FLPA 3SXWA 2OW4A 1LOFA 4OUMA 4COZA 4QX3A 3M1HA 5LCWL 4Q4X2 4FTEA 4XVHA 1RUJ1 1T2XA 3E5UA 4PHZA 1DBNA 5C5UA 2EXKA 2JDAA 3UGGA 3UKNA 4ONUA 5FQ0A 3DEMA 4HLTA 2VMCA 3C7FA 3OUIA 2Q8CA 1JTZX 5I0RA 3ACFA 3R4UA 4WZCA 3WZ1A 5FO9B 2BU9A 5A7PA 3RWKX 1UU5A 2VTXA 4WM7A 3ES4A 1QJX3 2Y6JA 2LW8A 5JMOA 5ANNA 5GM0A 3P1IA 2VVEA 5FYUA 1GV9A 1UOBA 3MIGA 5FO8B 1ZREA 2PQSA 3HN1A 2ZGPA 3R6SA 3KWVA 5CVRA 2W1WA 3T2QA 3CF6E 1RUG2 1ENQA 1AYM3 1I6XA 3BU7A 5A32B 1WLTA 3AK0A 3WQ1A 1Z7S1 3WNXA 1XSQA 4HONA 1REEA 2JKXA 4BMEA 4MG2A 3AX4A 3UL2A 2WT2A 4FVVA 4CDUB 4B1LA 3TEXA 3JU9A 1OURA 4LORA 3NJZA 4EQVA 4GQ7A 1C57A 3UK9A 1UY3A 4M0NA 1W6MA 2Y6KA 2YGLA 4WVMB 1WCUA 5A3UA 1NOVA 2VBDA 4BQ1A 3E6BA 5APAA 3O1MA 3OPZA 4ATFA 4AF9A 3WDXA 2WT0A 2ZHNA 4IE6A 1ZBA1 3HOBA 4BWOA 4AQSA 1KITA 2XUEA 3JD73 4URTA 2PMWB 2EIEA 1XNKA 5FUIA 4QHOA 4XURA 1RUJ2 2E26A 3U78A 2P34A 3I2KA 2EAAA 2J1EA 5JSPA 1I5PA 4DUXA 5L7OC 4LIVA 2VW1A 3QBQA 1W8OA 4NRMA 4C1XA 2OPWA 1GU3A 3L2HA 5EZWA 2ZGQA 5DAWA 5HCBA 4Z2AA 2Z42A 3LCPA 4EROA 4ZKTB 1W6NB 2SBAA 1UU6A 2IFWA 5M0TA 2JDZA 1MEC3 3AKRA 3KD4A 5AC92 2H0VA 3GYDA 4HKLA 2EA7A 1J58A 1JN2P 3OB8A 5CZKA 2WZR1 5F3IA 5GJ6A 3UT0A 3KQ4B 5DXDA 1W8ZA 2XLAA 1WW7A 4P5YA 4ITCA 3ZFEC 3J9SA 3IPVB 1EPWA 3ROUA 3O1VA 3KCCA 3D5OA 3VN4A 1Z7S2 4YARA 4KWLA 1NLQA 3ZKUA 5DAVA 2R0FA 2XH6A 1NZCA 2XUMA 3USUA 1S55A 3ZM8A 3PVEA 3LA3A 5F7UA 1UKGA 1A3KA 5C3RA 2JG9B 5A32A 4FI9A 1AL21 3PUAA 4EE2A 2RR13 4NHLA 1LHWA 1SPPB 2O14A 3ZYHA 1I9RA 1VR3A 4LUMA 3GZUC 1VBE1 2WNUA 1J3PA 2WQ4A 3PLQA 4FFGA 1ULCA 1LHUA 4CDUA 4AEJA 3IT8A 3Q8FA 1EAH1 4NHXA 1PMJX 4CUGA 3ZYRA 3M3CA 2BNNA 2Y0IA 1AR61 3I2HA 2L9LA 1ZBA2 2F4PA 1RXGA 1LODA 4NUBA 4Q1PA 5E1RA 3I3DA 1EUTA 4QDSA 3ZLIA 5ACA1 4YM1A 3JQWA 3FFZA 3OBTA 1IQDC 4CCEA 2QQPA 2R041 1CAXB 4I02A 4OZXA 5FP7A 2FDGA 3T0AA 1UW8A 4V2WA 4RR3C 1GOGA 1WBLA 4V2VA 4YG3A 1OH3A 1LOCA 1W99A 4GH4C 1UYPA 1NCRC 3ZN6B 3U1XA 4AFCA 1DQ0A 1A6CA 1DYPA 1V70A 3NNJA 5GLUA 1H6YA 3SEEA 3U75A 3UJOA 4JKKA 4LHNA 1KFXL 3NJXA 4DMIA 3CBNA 3PL0A 4FPFA 1JYCA 1GLHA 2RS53 1GZTA 4CXWA 4LTAA 4ZXKA 3M3QA 4EN8B 4JGYA 3NNLA 4RQPB 4I0WB 1FOD1 1UX6A 2XB6C 2XHKA 1U5ZA 3U4SA 4DUWA 1W6NA 3ACHA 3AYAA 1W8FA 5L9RA 3RJ2X 1LHNA 3ZXDA 2G9GA 3FJSA 1QXRA 1VRH2 1OLRA 2XQRA 3MF6A 4O61A 2X5IB 4EN7B 3GZAA 1OPMA 1TME3 5A3NA 1YQCA 3IKWA 4Y1UA 1US3A 3KMHA 4XQ4A 4BXFA 3IPVA 4CCDA 1MZ6A 4XXAA 5I0DA 2X29A 3S30A 4Y4YA 2LUWA 3IDBB 4E4DX 2I45A 1SZBA 1VBE2 2AREA 2DUOA 1S4CA 2MPFA 4HK9A 3DPRC 2BBVA 1RUH3 1Q8SA 5JZGC 1E5SA 2JG9A 3AKPA 4BQXA 1AR62 2OUHA 3KHBA 5T5JA 3TAYA 4D6SA 1SPPA 2DTYA 3VKOA 2W1UA 3SKVA 1SFYA 5FLJA 1AF9A 2HJIA 2R042 3LF7A 1U5XA 2ADDA 3NW4A 2KXLA 5JSRA 5LWBA 5A3MA 5FFOC 1COV2 2MNGA 3PNAA 4HVOA 3N36A 1OOPB 1WWYA 3U37A 4A2UA 4ZU4A 1S0GA 1R1A3 4Z92B 4NAMA 4A7KA 5F1RA 2J1AA 2DVGA 5HCHA 1CAXA 1V6JA 4FPCA 3DYPA 4JDMA 3ST7A 1HQNA 1RINA 1YO8A 4UBHA 1AR93 1LU1A 4MUVA 1XQNA 4COYA 1FOD2 1KD7A 1QIQA 1R082 3ASIA 4QHBA 1RMU1 5FJHA 5FY5A 2IVIB 4RL7A 1MVEA 1IS3A 1UMZA 3WNLA 5JXIA 3B69A 3BU0A 2RM23 1R093 3FUQA 3SISA 4GD4A 3UNPA 1ND3B 5BNNC 3O1TA 3VGIA 4BYYA 3AZWA 2HH9A 1YFUA 4K40A 1Y9GA 2P3JA 3MLJA 4QGNA 3WW2A 4C0BA 1Q56A 1BK0A 5FKBA 4I30A 2OIIA 4FQ4A 4XQDA 4D3WA 5HV4A 5KXDA 3NL1A 1GMMA 2PFWA 4LO7A 3PUIA 2X5IA 3H7YA 3IWZA 5FZBA 1WLCA 3A7QA 3A4UA 3MF9A 1O4YA 1X8MA 3MPPG 4NROA 3QD6A 4CSWA 4K7JA 4UT5A 1GWMA 1UMHA 2W47A 2YC0A 1UOFA 4JVAA 2ZA9A 3LA7A 1V9U1 1N3PA 4AQ6A 5A7SA 3RZJA 4AVSA 5FUNA 1QEXA 4UOJA 2DTWA 2J7MA 1A34A 3TEZA 3O12A 1H8TC 1W6PA 2ZGRA 5J37A 3UGFA 1BBT1 1CR7A 3ZYBA 1BJQA 1DYKA 1OKOA 2ZAHA 4IV3B 5IVCA 4IEWA 5CFCB 5A33A 4ZS2A 3AMNA 1W04A 2JD9A 1WLDA 2TUNA 2VGDA 5FZ9A 2ZMNA 5FZ0A 1SLLA 2R071 2X05A 4H7LA 4A42A 1OOPA 4XFAA 3O1UA 1R1ZA 5DDJ2 5DZEA 1NX9A 2ZGOA 4R8HA 3FWEA 3NVCA 1MZFA 3ZXGA 2HYXA 3LKJA 2RE9A 1VBB2 1Y9QA 2VZOA 4BU2A 3O1SA 2QBXA 2FCVA 3MUY1 1XYNA 4MVTA 1W9FA 2BYVE 2QKDA 3KV6A 4Q4Y1 3DV8A 2WYSA 2QQVA 3DKQA 4M4PA 1YYNA 4GALA 2XHNA 1UWWA 2P4EA 3CJXA 4IXLA 4UW3A 4QX5A 4CEYB 1RVF3 5JPMB 4K8FA 5SV8A 3SHRA 2BPA2 3WCSA 2ETEA 3K3NA 1B09A 5FV3A 4QX0A 1H2KA 2BEOA 2B9UA 2CSGA 2OXBA 3KGLA 2JKBA 4LXLA 5A3WA 4QX1A 5GZCA 1TVGA 4QDRA 3WCRA 4OQ8A 2VH9A 5KC5A 3RYRA 5F39A 2GDFA 1V9U2 2RHPA 3HQRA 2R6QA 5FPAA 4X6QB 5FXZA 3POIA 4XDPA 4BMBA 4PI0A 4YZ2A 3VD4A 3RZGA 3SCFA 2PYTA 5FZ3A 4UFLA 1HXS3 3OY8A 3ZXKA 3BTXA 1FT9A 1PGW1 4J25A 5DUUA 1JUIA 3EMRA 4PCRA 3T1MA 1QJY2 1QDCA 1ST8A 1ZZ6A 2XBO1 4HT1T 3KQRA 3BGAA 3SC7X 1H1AA 1LHOA 1D2QA 2JDPA 2I07B 3I7DA 1D0GA 1BLZA 4LBNA 4HANA 1TMF2 1G7YA 3POFA 2R072 4N53C 5A6XA 2BWCA 4L99A 4CDQC 1ZRFA 2AR6A 3ZIWA 5CFCA 3NAPC 1BEV3 5JOXA 4YGBA 5D8AC 5CKNA 2PLV2 2VG9A 3HT1A 3C3VA 2NM1A 4MGIE 2GC0A 1BQPA 4MXWA 1DYOA 2ZTNA 1U5IA 2JDKA 3D0SA 4AR2A 4NIHA 1H9WA 5JR7B 1ZVFA 4Q4Y2 4XF0A 4GMP1 1NUKA 2MHFA 3POJA 4AL9A 2CDOA 2MEV3 1NXD1 1BKZA 1MS4A 3LA2A 5C3OA 2HWE1 1CONA 4YVWC 4YW6A 4Q29A 4QB2A 2HWF3 3WP3A 1JZ7A 5FY1A 5DQ0A 1WCDJ 3DF0A 4HZFA 2R063 3LAGA 5JI9A 1TQ5A 3WP4A 1LESA 1OPOA 1HRI3 2ZBJA 1CX4A 2WS91 4MXVA 5CB7A 3WF3A 4CEYA 5FAXA 4ZHNA 2HLEA 4XBQA 4QKBA 5KXBA 4MGTA 1UF2C 2WN2A 2ZEYA 4Q4W3 3AP5A 4ZU5A 3NMBA 4M3CA 4CCLA 2WIIB 4GAZA 4AVTA 1OF3A 2XR4A 2WZPP 5A80A 3ZFEB 3K48A 1PVC1 3HT2A 5IVJA 2HEWF 4H14A 5FY7A 1VALA 3RDIA 1ZRCA 1PX3A 2Y6HA 2J1RA 2DVAA 2BOIA 1JOPA 2J22A 1QHDA 3K4DA 3VZLA 3MUZ1 1AX2A 1PZ9A 2YG0A 3NKTA 1W2AX 1C5IA 4G3YC 4YZ5A 3OJBA 1RHI1 4RFRB 1OXCA 1OF4A 4E8DA 3KV5A 2ZX3A 3MO4A 4IEZA 2VVFA 5DUWA 4EN9B 4EV0A 1BYHA 3E5XA 3SLIA 2B45X 1LCLA 5A1LA 4ZONA 2VZSA 3WINE 1FYUA 1MZEA 1I5ZA 1ZX5A 4QWNA 2GP3A 1YRZA 3VKNA 3NSTA 5F5AA 1LGCA 5I91A 4XFCA 4BQ5A 3VBOB 1IKPA 4QQ2A 4BQWA 1FV2A 1FXZA 1W8WA 5ABJC 1JYVA 1WGPA 2HWE2 2WNVC 2WQ8A 3HQUA 4YFZA 3ZO0B 5KBFA 1MS1A 4DQAA 3MLKA 1W28A 4R9BA 4NMIA 2Q4SA 2WZEA 4GH4B 2NYYA 3AYCA 1NCRB 4YVSA 3IDCB 2BGCA 1GZ9A 4YM2A 3LEIA 4A45A 1X9TA 4N8MA 2YZ4A 5K0UC 2JJ6A 3Q8AA 1Y7BA 4XBNA 3W59A 1JZ3A 1AUYA 2RMU2 1HRV2 4DY5A 4GB33 4BHPA 5BNPC 4QPYA 5DN2A 4K3UA 1ENSA 1RUI3 4O9GA 4JDOA 5A70A 1F5FA 4UYBA 4JRLA 5CADA 1O4ZA 5FWEA 4QDQA 4NO4A 1J1LA 1RJ8A 3ZDVA 2F6BA 1IPJA 4QKNA 4ASKA 1DZTA 3ZIXA 1GFF2 2EXIA 3PDQA 3C7GA 3FUOA 3ZDSA 1ZZ7A 4QKFA 5C8CA 3LIGA 5FOJB 4DO0A 5ISLA 1XNAA 4XUPA 3AKTA 4WVWA 5EP9A 1QJEA 4N43A 4D7YA 5AFEA 4QMAA 5F5QA 2VR4A 3RNSA 1CGPA 3U4XA 4YW5A 3BIWE 1H0BA 4O65A 5LRRA 3VDAA 1YJLA 4RHV2 3DPRB 4ARYA 4MOAA 2ARBA 4XE9A 4CEWC 1D4M1 4XF3A 5FIXA 3MPBA 1ND2C 4NVPA 2H6CA 3DL3A 4MGYE 4Y1ZA 2SLIA 2Q8EA 2RS32 3AM2A 2W1SA 1BVVA 3HN3A 5F6LB 4LKSA 1DZQA 3BPSA 1SDWA 2A75A 4IV1C 4KWJA 4XJWA 3VBHC 2HWB1 2W94A 3POYA 4P5HA 4HG6B 3MLLA 2OZ6A 4CUBA 2ZX4A 3QOPA 1UO9A 1U5YA 3OD0A 5F32A 3RMYA 3VBOA 5IAXA 3I59B 3VBFB 3ZFFB 1ASJ1 1JZ4A 5JOYA 4COUA 4HL0A 2YFZA 4B7KA 2LRPA 2JB4A 1SLTA 2YBPA 1WCSA 4HXCA 2PHDA 2BJSA 1DGLA 1QXPA 1KEXA 2UWCA 1CD3G 4CCOA 1QJU3 2JE8A 1FPN1 2CTVA 2VNVA 3DXUA 2VOWA 4NHMA 3K4ZA 3JZVA 5BNNB 3KV9A 1AR92 1RUOA 2YFUA 5FZMA 4LOSA 3CU7A 1PGL2 1RL3A 1MPXA 2P3YA 1S0JA 2IZWA 2JIGA 3KB5A 3JBG3 1G9CA 1DGWX 4OQ9A 1T6GC 1IG0A 1UQXA 2W95A 4CCCA 2C1FA 3K77A 4LIUA 3G6JB 2XG3A 2ZXQA 3HBZA 4FFFA 3RS6A 3EHKA 1QU0A 5GLTA 3KF5A 3VBRC 1VJ2A 1JU4A 1D4M2 4YG0A 1XXNA 1URXA 2NMNA 4AHZA 1CAWB 3J8F1 4UWDA 1QOOA 5A6YA 2WZR3 2QQMA 3VBUC 5F2WA 5L9VA 1NAEA 1V6IA 2GC1A 4GKXA 2EVXA 4OI1A 1TE1B 1LGNA 1W6QB 3ZX7A 4R4XA 3IB3A 5FLHA 1WD4A 3LWCA 4M00A 3T4HB 1C8M2 1ULEA 2VC9A 4HETA 4YM0A 1YQ2A 2ZHLA 2I2SA 5JIUA 4BXSV 4YGEA 1M4WA 2PAMA 5EQUA 3I2JA 4KG0A 1ASJ2 4QQOA 1DGRN 2CL2A 5F6KA 1B35B 1DLLA 1W6OB 2HWD1 1NQDA 1DZRA 4QX8A 1LOAA 3BIEA 3LD8A 3ECQA 1RUD3 3THCA 1PO13 1CQ9A 3VBFA 1O8SA 4XHXA 4JGZC 5H9QA 3ZFFA 2WDBA 1Z78A 3TOJA 1IS6A 1WA4A 4M3CF 1IPSA 4XHBA 1S0FA 1K12A 3CJIC 3ZYFA 1EP0A 1KS5A 2NLRA 4FT8A 2WWSA 4F83A 3TEWA 2WSUA 4J6GA 3TB0A 5DZFA 1UY0A 2GNTA 3UKVA 4D0QA 4FPHA 3H0OA 1UZ0A 2VUAA 1JZ2A 1X82A 2B7YA 2EIGA 2R16A 3P3PA 1X8EA 4Y4RA 2VMFA 3KT4A 2ILMA 3TN93 3BI3A 1VB2A 1H9PA 4HBNA 5C4WA 2RVAA 2ZGNA 4WBBA 3EQEA 2QQUA 1GICA 4FO9A 1QQP2 5FK7A 1PO23 3WDTA 3FN9A 3OGSA 1E5HA 3VBSB 3J8F2 2G1MA 3RFRA 3ZSEA 4CDXA 5A7QA 4UF0A 3ZN5A 3M2MA 4Q4X1 3WF1A 2A6XA 1BVP1 2WO1A 3ZFGC 4B3NA 4CZSA 1QJFA 5FY9A 5LA2A 2CY6A 1C1LA 2BWAA 4QU1A 4FTSA 1CAWA 2WWUA 1NYWA 4AFDA 3BN6A 4N90A 2JDMA 2YGMA 2VW2A 5T5LA 2DDUA 2HKXA 2FMYA 4QPIB 1NCQC 2BERA 2W87A 3O14A 5B4NA 2Q0AA 1GKBA 3LDRA 2WNEA 3S7IA 4LK7A 4H7MA 1W6QA 1XNBA 2B8MA 3NAPB 4LEJA 1GP6A 2HWD2 4FQZA 3ZOIA 3VL9A 4CRQA 2VUCA 1PK6B 4YWAA 1E5RA 3Q8EA 4AAXA 3RGBA 1XPWA 2NZ9A 3IAQA 1RUG1 2DURA 4XUOA 2C26A 4NRPA 1B35A 1W6OA 4IE7A 5BY5A 4LE4A 1O5LA 2GMMA 3NJYA 3D4KA 4B4RA 1AYN2 3AMMA 2ZHMA 4INDA 1AJKA 4S2GA 4XZPA 5FP8A 1EV11 4GKYA 1W2OA 3PVOA 4N9IA 4AEDB 3LGRA 5FZGA 1CX1A 2A6YA 2DVDA 5IJRA 1VAVA 2DU0A 3J7MA 2QQLA 1RUC3 2EALA 4MADA 1LR5A 3LEKA 1L7QA 2KA3A 4OYUA 1CPNA 5FR3A 3ORJA 5F8PA 2CGNA 2J1SA 5G05L 5H9SA 5IATA 1YI9A 3OPTA 5DG1A 4RYDA 4LBLA 1RMU3 3T2OA 3BB6A 4G9SB 4LKDA 3KVBA 2YB7A 1WMEA 1WLWA 1K5MB 2DWRA 2WFF1 2E53A 2GH8A 3AVRA 4FPEA 4BQ4A 2R1DA 5C9AC 4W6YA 3N7JA 1UX7A 3S0MA 1WW4A 3IMNA 3GF6A 1UIJA 4A6SA 4SLIA 3EYPA 5FLIA 5FZAA 2C9KA 2UWBA 2B4KA 3J26N 3PU3A 5AC91 5BNOB 1C8NA 5A3OA 2ZEWA 1H2LA 5LBEA 1O3RA 4QPIA 2E63A 3AL5A 3P5BA 2VJXA 2D5FA 2JG8A 2TEPA 3MIBA 3NV2A 4PT6A 5K7PA 2WKKA 5FKCA 3ZPOA 2VNRA 3V0AB 3E1F1 4FFIA 3ACIA 1AXKA 1W2NA 1TG7A 2ZEXA 2ZKLA 1SDDB 4MO3M 4QGLA 4RD7A 4CU6A 4LE3A 1S2BA 2X53S 1PK6A 4L11A 2LALA 5JOZA 5G04L 3RI8A 1EV12 1NA1C 3IIIA 1ENRA 1A78A 4HKWA 4PLOA 3OG2A 4B4QA 1VBC1 4RS5C 3TNPB 2QCSB 5B4XA 3K46A 3ILRA 1XE8A 1CZSA 1GQPA 3C7EA 5HBAA 1X7NA 5FUPA 4WM8B 2AZ5A 4JC1A 4AEDA 2DUQA 1KQRA 1RUF1 4L2NA 4Q2FA 3N9MA 2ZGSA 1XYPA 2YC4A 3GBGA 4GWNA 5JMCA 4LULA 3BTZA 2WAOA 1D4VB 5FCCA 2ZMKA 3RRDA 2A3WA 4BM8A 1RC6A 4ZY9A 1IQAA 4UI9L 3TEYA 2J1TA 3H42B 2WFF2 5F3CA 1WD3A 4K6BA 5FXXA 4HVQA 2PXJA 2W5FA 1REFA 4IL7A 5F37A 4DUVA 1GOFA 4PQ9A 1UMIA 4I3PA 2UWAA 4GIQA 1K5MA 2TNFA 4JDNA 3ZYIB 1M06G 3LEMA 1GZCA 4C1WA 3O0XA 4UAPA 1CJDA 4LBOA 4Y1VA 4XUTA 2HEYF 2WINB 4AHYA 4QXBA 3U14A 1OI6A 5FZIA 2P3IA 2ZZJA 4CEWB 4MGQA 1VRH1 1SBEA 2D6NA 3CIHA 4QGMA 5BNOA 1SEFA 3EXUA 4EZ4A 4NIAA 3WNNA 2Z2SB 3AZYA 5LBCA 4P08A 4HN1A 3OPWA 1IGOA 3I2OA 1F9KA 2ZJCA 2E33A 4JX0A 1AL0G 3X29B 1W9SA 2ZGUA 2XBO3 2R30A 1X50A 2X09A 3I3BA 3I2GA 4PDWC 1VBC2 2BNOA 2AEZA 3OGGA 4CXXA 3M3EA 5FYYA 1WUVA 3VDDB 5HPOA 1N1VA 5DZGA 1FNZA 3I3EA 4BQ2A 3AZVA 4Y20B 3ON7A 2BFUL 4N43C 1RUF2 2XVLA 3DGTA 3VD3A 3AC0A 5JUVA 5FYSA 1ZYBA 3T09A 4IE4A 3OD4A 4WVMA 1C4RA 3HNMA 5FZKA 2Q8OA 2DUPA 3I54A 4WM8A 1COV1 2GNBA 4Y24A 4F3JA 3GBWA 1UKRA 2YC2A 3IM0A 4PLMA 3WQ0A 2IVJA 3B7MA 4QPGB 3SH4A 3ZR6A 1V6LA 2E9QA 4FPKA 1L7RA 4FPLA 4GMP3 3ZXFA 4AGRA 1RIRA 1VBD1 3PTRB 1J3RA 2ZKNA 1QJU2 2B9VA 3FHIB 1MQTC 3MFCA 2IXIA 4OMDA 5D21A 1R081 1WW5A 2W1QA 3FFQA 2WN3A 1VMHA 2AENA 2OX0A 3VZJA 1OUSA 4C91A 1BK1A 3JBG2 4PIYA 2WS93 3ETPA 4K9SA 4NWWA 4Q4V1 2VZPA 4XQWA 2XXZA 4UFKA 4LNVA 2RDNA 1YIPA 2DF7A 1UY4A 2ZZQA 2VOTA 4FFHA 1S0IA 5LK5A 3O7OA 2D97A 2VQTA 3BTYA 1SMVA 1UYYA 3AZXA 4DXRA 3AB0A 1PVC3 2FMDA 4YYOA 1IKQA 5DAXA 3DECA 4XJZA 2ZS6B 2PAEA 3T08A 2W9XA 4P9XA 5SV5A 2FQPA 4Y26A 2OZJA 2LS6A 3USSA 2FD8A 3LSEA 3WVJA 4OHYA 4URAA 4AI8A 1H4GA 4RGKA 5BNNA 4A6OA 2ZABA 4HVRA 1AX0A 1H4HA 2OPKA 3UGHA 3VDDA 1Q8PA 3S6PA 3GNEA 4XJUA 3V0BB 4XETA 4Y20A 3T2PA 5DUVA 5KWRA 4XFGA 2VULA 3KGZA 5FPLA 1S0EA 1D2SA 2CWSA 2W68A 2VMGA 2HYKA 3NNGA 1RUD2 2BDRA 5FZ7A 3VKMA 4LOTA 3J7LA 1VBD2 2GH2A 2RDQA 4UW5A 2ZGKA 1WMDA 5JPNB 4AEKA 2H6BA 1CZTA 2XJVA 1QNYA 4DINB 2LROA 5DDJ1 5KHHA 4KH9A 3LSDA 4QPGA 4Y5TA 3I3MA 1TEIA 1ZBE2 2EF6A 3ZN6A 4BOWA 3I8TA 1VBB1 2V73A 3ZYPA 5CEHA 4Q8LA 3ZSJA 1W2UA 3TN92 1CWPA 4Q4V2 2Q1FA 4IERA 1GUIA 2IXLA 1DIWA 1RUE3 4DZGA 2UY9A 4RQPA 2RJKA 4BQYA 3HIFA 3LOIA 3GZTB 4RGAA 4CCJA 1KS4A 3HBKA 1GNHA 2O1QA 2Y60A 2IXJA 3JB8A 2W08A 4LO6B 4EN0A 1Y4WA 5IAVA 2DBNA 1PHMA 2P6HA 2UYAA 2PN5A 4XILA 3S57A 3FLRA 3GBFA 4JCKA 2JIJA 2NN8A 4OHXA 5FY8A 2WT1A 1IPKA 1YFXA 2HBTA 4YFWA 1LGBA 2BUKA 1POV3 1W8UA 2VZ3A 5FZFA 2WJSA 1DQ4A 4N7IA 4ZS3A 5ERLA 4CXYA 3VDBA 1XRUA 2C0ZA 3B9CA 1D7PM 2RS12 1D0HA 4QQPA 1QJY1 4JKMA 4OLLA 5LEJA 2BRTA 3U10A 3I2FA 3KV4A 1DQ5A 1WW6A 4NHKA 1RYYA 4QXKA 5EPAA 4JQTA 1Y43B 3T2TA 3U07A 5CFDC 3V0BA 2WRAA 4DEQA 1TMF1 1ULGA 4LKEA 3BYWA 4W8JA 5FZ4A 1HB1A 3R4DB 3QH7A 3UESA 1NZIA 5DG2A 2KM2A 4ISRA 1SLBA 3POWA 1UL9A 2K2SA 2NP0A 2HWB3 5HV0A 3GM8A 4HPKB 3AKSA 3AZZA 3RWNA 2PLV1 1UD1A 2EXJA 2W92A 2Y6FA 4ZXEA 3AYDA 3ZMNA 2QUOA 1W0OA 2D6PA 5FXWA 3TRSB 3M3IA 3FBYA 3H3LA 1W3XA 4PBOA 4PJYA 5FJKA 4QAWA 1V6NA 4MHRA 4K20A 1W06A 1MR5A 2W52A 3NWKA 4YPJA 2W3JA 1AR82 1LECA 2ORZA 5IK8A 1HIXA 4EWDA 1ND3A 3JD71 1STMA 1G8WA 4YNIA 2JX9A 2A3XA 1GWLA 1VBA3 2CAVA 1CAUB 5IK7A 3J4UH 4CDWC 1ONAA 4FPYA 1JYTA 4IW3A 2FBEA 1N3QA 2XVGA 1AZDA 3R0RA 1K42A 3E97A 4Q27A 3VZOA 3ZXLA 4XIKA 4E9KA 1NE4A 4X8NA 2VOKA 5IYYA 4META 2BFUS 1UNBA 3VD5A 3I49A 2VXJA 2Q30A 3B3QE 5FYTA 2D98A 1MEC1 5AVAA 3QLQA 1SFNA 2C9AA 1QJX2 3EB7A 3SITA 2PA7A 1BZWA 1LOFC 4JHZA 3WNPA 4XF9A 4OI2A 3AFGA 4AHXA 2AC1A 3M8LA 4JV4A 4OFGA 1ZZ8A 1AYM2 4IV3A 2BGOA 5TSWA 3VKFC 4CP9B 4EWAA 5CBLA 4MLOA 4RS5B 3SEPA 2A70A 1SACA 2QTWB 1NLRA 3ILFA 4AI2A 1H2MA 4MGZE 1BCXA 2ET1A 3AMHA 2PHUA 1UY2A 4H2AA 1SG3A 1LJ7A 1O91A 1Q8OA 3EBRA 4IUGA 4NAOA 1PIV3 4CUAA 3BOWA 1AR73 3D0JA 2VZRA 3LDBA 4ORFA 2UY8A 3GHNA 4G4FA 4WM7C 1HB2A 1ENXA 1K3IA 1SHWB 4HPKA 3S7EA 2Z4FA 1Q3EA 3WT3A 1FMD3 4TTGA 2D40A 2VM9A 2V5DA 1XC6A 5FZHA 5L7OB 3MIEA 4P9YA 2CGOA 1L7LA 3JD72 3N9PA 3LE0A 4BIOA 5IWFA 4YW4A 2P37A 2RMU1 2ARXA 3N3HA 3S5QA 1HRV1 1E5IA 1SLAA 2GZWA 3DUIA 3Q8BA 4NHYA 1UYXA 1HQWA 1QH6A 1AXZA 3CO2A 5FYMA 5A7NA 4ATEA 4YZ1A 5IFPA 2PTMA 5FYBA 4BISA 3T0BA 1CAUA 1OUXA 3PJYA 1CAVB 2P17A 2YPDA 4AE2A 5C3QA 1MEC2 2XDVA 2OT7A 2BW8A 1W39A 4LQRA 4OULA 4XDOA 2VE1A 3KVAA 4Q0UA 1W8HA 1WCKA 4Q4X3 5LA0A 1HV0A 2DFBA 5EJ1B 4YW3A 1LU2A 4TWTA 2VNOA 2VQ0A 4FOVA 1PVXA 3O0WA 2V09A 3VV1A 2BOJA 4AYUA 1RB8G 2A73B 1JODA 1TME1 2HWC3 1HB3A 2OQ6A 1MS9A 2WA4A 1UPIA 4P9JA 4RHV1 4TLGA 5FXVA 1Q5OA 4UFJA 1OQ1A 4MGSA 1O3TA 4CP9A 4AQTA 4P02B 2RR12 3R05A 2E6VA 1WCQA 1QNWA 4HMZA 4MGKE 1XE7A 3PTYA 5CKMA 4D7TA 1OFSA 4BK4A 1XSRA 2RS31 4DXZA 4EZHA 4NJ4A 2VTFA 1VAKA 3IDAA 3W20A 1CJPA 1DQ2A 4RR3B 3FBMA 3THPA 4XJAA 1UN1A 1W8NA 3AXDA 1HX6A 1YCIA 5FYVA 5FBJA 1GP5A 1UXZA 2WBKA 5EXOA 3VHRA 5FWJA 5L7OA 3MYXA 5LBBA 1F31A 1MQTB 4GJZA 1DP0A 4NN0A 4B4PA 4E4SA 1YEWA 1S1AA 3BVCA 3I3QA 2ZX1A 4FPOB 5I93A 4P14A 2WNUC 1WKYA 5EYYA 1VRBA 3RSJA 3T1LA 4CDUC 3UV9A 1KGYA 3EO6A 3OYWB 4TYSA 4YLZA 4JZRA 3WNKA 1FX5A 4E4ZA 2RS52 5FP3A 1AR91 3V65A 1JOJA 1PGL1 4XZUG 1NT0A 2E7AA 4QT6A 1O59A 4Z1VA 3E6DA 1CAVA 2CDPA 2JDUA 1RUJ3 3ZFEA 1KDKA 2WYFA 5IFTA 4S2FA 1YUDA 1NKGA 5FO7B 1F5JA 1UCXA 1TME2 1W90A 1O6UA 2PHTA 4LBQB 5J7MA 4I3GA 1X9PA 4IGPA 4QXCA 5JZGB 3KHCA 4Z8BA 3H7JA 5FYZA 3MV01 3IIAA 4FP3A 2XPJA 4ZZ8A 4KQ7A 4WVVA 4N9HA 2D7FA 1S2KA 4XTMA 2FZ2A 1DLCA 1YNAA 2PHRA 1H1IA 1G86A 4JGYC 4LBQD 2JWPA 1RUH2 1UIKA 3OSDA 1GNZA 1FATA 5A3LA 1BMV2 4NWVA 4Q8KA 2XONA 2J1UA 2WA3A 1Q8QA 2QZ3A 1Z7S3 2JB8A 5FZEA 1C8M1 4F8AA 4OHWA 4YSFA 1QOTA 3P6BA 3WHUA 4UW4A 3WW4A 2KD7A 2EXHA 3DYMA 5I0TA 4CU7A 4BIFA 3WQBA 2P5BA 4CE8A 1TNRA 4RR3A 1HJFA 1SQ4A 3LOBA 2C6SA 1ZM1A 2E7QA 3POEA 4BE3A 4EJRA 2GMPA 1IS4A 3AP7A 1NCRA 4GH4A 4D94A 1R1A2 2WZ8A 5LEKA 1W3VA 3IDEA 5IUQA 1NY71 3FLTA 3WF4A 4Q26A 5E6HA 1J84A 1JXNA 2O8QA 4XUNA 1MVQA 1FI2A 4Y5Z0 4YZ3A 2JG9C 5DUXA 4AVCA 3RVHA 1E57A 1GBGA 1ZBA3 3BCWA 1H8VA 3MIHA 2YDEA 4YGDA 5E16A 1XYOA 4AQ2A 2YU2A 4OHVA 3W9AA 3OYWA 3JB4C 4OI0A 4DNYA 3G7DA 5KHJA 3N7MA 1OVPA 2RM22 1R092 2HEVF 3SQOA 2VCMA 3PUHA 4COVA 1QQP1 5H9PA 4JRAA 2DV9A 3HR9A 2CGPA 2IXHA 4LBMA 1SBFA 3BODA 2YU1A 5FMCA 1QDOA 1ZZBA 1N47A 1RVF1 1IOAA 5LK7B 3MW4A 3RG0A 2F17A 1H8TB 4HSJA 3DPRA 4LBQA 5D2AA 5BPXA 4DEVA 4CP0A 2WWJA 1FV3A 4OUSA 2QQWA 3KM5A 5FPUA 5HI0A 4RN5A 5JZGA 4QX2A 5KHKA 5FMDA 2ZX0A 3VZKA 3AYEA 1VRH3 1HKDA 1JZ5A 1O8PA 2VOXA 3LDKA 4IETA 3OBRA 4A41A 2ZACA 1IZ3A 4Q0QA 1HXS1 2BZDA 1LEDA 4MHUA 1QJZA 1AL23 5JDBA 3WDWA 3T4VA 2X5IC 1VBE3 1ZZ9A 3I59A 1NY72 1VAMA 3THDA 1EAH3 2AEYA 4FPJA 2DVFA 3CHXA 5L19A 3IN9A 2QQKA 2YY1A 1ZRDA 1AVBA 1AR63 1UZWA 2VZVA 4KBBA 1JMUB 1GP4A 3H8UA 3WDUA 1MZ5A 1BEV1 3VKLA 5ACA3 5H9RA 1AYN1 4Y1YA 5EJ3A
chains in the Genus database with same CATH topology
1DGWA 2R043 4MYEA 4UXAA 1GZWB 5EV7A 1COV3 4BLIA 3ACLA 2VOVA 3VL8A 1IS5A 3KCYA 1DGRA 1PM7A 3ME2A 4NPRA 3ZN4A 5BNNA 1O5UA 4XW3A 4DY3A 4R9CA 3I4IA 4MSVA 1SCSA 2QJVA 2MEV1 3KCXA 4CDWB 4MV2A 3EJKA 4PLNA 4GA9A 2YXSA 4QD2A 4OVEA 1G9FA 1POV0 1RVF2 1OOPC 2HWF1 3KT1A 2VW0A 1VBA2 3CLPA 3H9AA 2R32A 1FOD3 1R083 2A6VA 4DOUA 2VQAA 4YGCA 1Z0HA 1V6OA 1XNDA 2B46X 3WQ7A 1H8TA 1HXS2 1KDMA 3AP4A 3B02A 3M7AA 1A8MA 2XL7A 4N53B 2QZ2A 1HV1A 2GMEA 4CDQB 5AFBA 4NR1A 4A7ZA 4HK8A 5D8AB 4V1PA 1CIWA 4LLFA 2GNMA 1LTEA 2G9FA 1S0DA 1BEV2 1G6NA 1UZYA 3B00A 1CVNA 4IESA 3NV4A 1QOSA 1F8VA 4FP2A 3R4SA 4XFFA 5I0UA 4YVWB 1N1TA 4IEXA 1PIV2 3MIFA 5JLVA 3TBDA 4TSVA 2XLFA 3DN7A 2MEV2 2V5YA 1GZWA 4CP1A 1LOEA 2DU1A 2IXKA 2BVVA 2HWF2 5DDJ3 5CFCC 2XJPA 3ZSLA 4E2QA 1EPZA 1APNA 1X36A 2R062 4XTPA 4XF1A 2OUJA 1OQEA 1VBB3 4LT5A 3U0ZA 1HRI2 2D3PA 4AGGA 2ZMLA 2ZCWA 5T54A 3WG4A 2E51A 4S2HA 3VBSA 4RA0A 3MFAA 4I0BA 3Q9OA 4Q4W2 4BH9A 1SCRA 2ENRA 3BOPA 2DYCA 2GU9A 1O7FA 1ZRRA 1YFYA 3HAGA 4PIZA 5HCAA 1OA4A 1G9DA 5F9TA 1C5HA 1G9AA 2XJTA 2B39A 3D8CA 2YHJA 2X8KA 1AX1A 1QGLA 4XMAA 4R52A 1AJOA 4N53A 2YUEA 4X6RB 4CDQA 4CEYC 3NAPA 1UPSA 1V9U3 1VIWB 4FOWA 4QM8A 2HWC2 3RMXA 1PZ7A 5D8AA 3NV3A 5C6CA 1J59A 2WSVA 4AFBA 5T3NA 2QDRA 5ABJB 1BBT3 3MW3A 2XKOA 3GALA 1QJY3 2WNVB 3CEWA 2GC3A 1X33A 4I2OA 1PZ8A 2VECA 2JD4A 3USUB 5K0UB 2WFPA 4QQLA 1TMF3 2R1BA 5BUVA 2R073 4YVWA 3B01A 3CL1A 4KL1A 2Z69A 2PQQA 5BNPB 1XU2A 3MGUA 2WNUB 1PMIA 3JQXA 5FMOL 1O3SA 2PLV3 2XWBB 4Q0PA 3WD5A 4I01A 1NLSA 4GB32 4QQHA 5CIRA 4Q4Y3 1RUI2 5L36A 2GSYA 2P2KA 4C0HA 4XOGA 2QE3A 1QJU1 1OD5A 5FRAA 1QF3A 1GR3A 4Z2WA 4XEZA 4PIXA 4QU2A 3SH3A 1OQDA 3KT7A 4YVSC 4Y1XA 4P9LA 1RUNA 2IC1A 4CTEA 2DCJA 2N7GA 3JBG1 1NQJA 3ATGA 1EYBA 3AJZA 1ND2B 3MIDA 4CP2A 4P9IA 4A3XA 5CG8A 4ZU7A 4MZUA 2CV6A 2D93A 4JGYB 2QFEA 1ULFA 2XLGA 3D6EA 1QWRA 1ULDA 2B5HA 3V0AA 2YPJA 4IV1B 1N3OA 1LRHA 4XFBA 3VBHB 1XU1A 2H0BA 1HDKA 5C8CC 4GWMA 5ABJA 4D7SA 2WNVA 2PHFA 2VVDA 3U11A 4BCUA 3TYJA 2JE9A 2YV8A 1DF0A 1MS5A 3LZZA 5GZFA 2D3SA 1J3QA 1W0PA 2WQZC 4AW7A 5K0UA 3PHMA 3RYPA 2DVBA 4JTOA 4DS0A 2ZGMA 5I8TA 4X8PA 3ZYJB 3RQ0A 5BNPA 2XKPA 1C28A 4AI0A 1RUD1 1YLLA 4H55A 4CYDA 2CAUA 1PO11 4J1XA 5J48A 5E89A 5FOBB 3SH5A 3VLBB 2HWE3 2VPVA 4OI4A 5J3UA 3RJRA 1CN1A 5T52A 4KWKA 4LBKA 1ZBE1 4E2GA 3HMYA 4KU8A 4IEQA 4Y22B 5BNQA 1I3HA 2LM3A 3VBOC 2GALA 3VBRB 5BYNA 1OKQA 2VNGA 3A0NA 4IEVA 3TN91 3AP9A 2RMU3 4COWA 1HRV3 3PVBB 3WUCA 3HWJA 3N4MA 3D82A 1NE6A 4XBLA 3E5QA 1JBCA 3BPZA 3VBUB 4A7YA 1PO21 4YG6A 2ERFA 4CEWA 5FREA 1C3HA 1ND2A 5C8WA 4XF4A 1GQGA 2WZR2 3OGJA 4PF5A 4E2SA 2NMOA 2ZX2A 2ZOEB 2Q1ZB 5HXVA 1GQHA 4AI3A 4IV1A 4L8QA 4TZDA 2D6OX 3VBHA 1DG6A 1RHI3 4SBVA 4DFSA 3H3UA 5K8SA 4RHV3 2RS11 4JGZB 2QVSB 4M0HA 5J09A 1N1SA 5C33A 1AL22 4LR4A 3CJIB 4FSJA 3CNAA 4LHKA 3SMHA 2XVKA 3I2DA 1PO12 2RS33 1W6PB 4YM3A 1EAH2 2QNKA 5CAZA 4XMIA 2XL9A 3BTAA 5D1IA 3M4FA 2Y0OA 5A33B 5ACA2 1KRIA 2OYZA 2XJQA 3N7LA 3W58A 2ES3A 3O5SA 5T5PA 1CPMA 1S0BA 4IQPA 2W39A 4W6WA 3VUOA 4Y22A 3ZFGB 5GLWA 1PO22 3UKTA 1F2NA 3VBFC 1BXHA 1RUC1 3VBRA 3ZFFC 4IEPA 5JAXA 1AR81 5IK5A 3MEPA 2Q5TA 4PBPA 3VBUA 1JYIA 3WG1A 1NCQB 1U0AA 3JUUA 1QXJA 4AVBA 1ZNPA 5C4WC 5EWSA 5FTTC 4U2AA 4BLJA 4DRVA 1DDLA 4FXGB 1LENA 5J98B 3WLUA 5B2GB 1LB2A 2IWGB 1D4M3 1UU4A 4GULA 1QJX1 3WG3A 4B29A 4CDXC 4LO4B 5FMOS 2BVBA 2K9ZA 3AP6A 3OY8B 4AVVA 4JGZA 2CNAA 3KLSA 2GC2A 1AYM1 3ZYGA 3UJQA 3CJIA 2BTVC 1QY4A 4LO8A 5JCTA 5EFUA 2FZ1A 1C8M3 5HCFA 4AXOA 3WUDA 1RJ7A 3PMEA 5I8YA 1KFUL 1ASJ3 4KU7A 4XFIA 5KHGA 4I0AA 5FBZA 1PNFA 3AKQA 3NKGA 2VY0A 2XWJB 5CNAA 3ZPYA 1LKNA 4AEMA 1NG0A 1RUC2 2D6LX 2D44A 4ISQA 5CA6A 4MXWB 3BALA 1FPN3 1OMIA 3ZXJA 4WZFA 5C9AB 1B35C 4LA2A 4RFT0 1KJRA 2YYOA 5JVVA 2XJUA 1PNGA 4KG8A 5JWPA 3ZFGA 5GZEA 1RMU2 2K0GA 2OVUA 5KHIA 5IK4A 3ZXEA 5J96B 1LOBA 4GXLA 4YW1A 2JICA 2UYBA 5JIAA 3H50A 1NCQA 1QQP3 2RJLA 3SCGA 3OTFA 5JI7A 2A3YA 4AFMA 1H30A 3AXEA 3RI9A 2JECA 5L73A 3J8F3 3GHMA 2ATFA 3KZ4C 2YMZA 5IT6A 3AMQA 4M3CB 1MS8A 2LTNA 1NA1B 3PVNA 3WOGA 4XDQA 3POSA 4LO5B 3AFKA 3ILNA 3AJYA 3VBSC 3OF1A 4IEYA 2PHWA 4QM9A 1YI7A 3SCHA 1IHMA 4YZ4A 2JENA 4L97A 2E7TA 2Z5WA 2AH2A 3MICA 4F7ZA 1BBT2 3L9JT 1C1FA 1WBFA 2RR11 2EAKA 4W6XA 2VXRA 2OA2A 4H3WA 2HWD3 3H1YA 1MACA 4QPIC 3WP5A 3WP6A 2JG8C 4YRDA 1I1EA 2AYHA 4RSUA 4IEUA 1AYN3 3TWIA 1G9BA 3NV1A 1PK6C 4XYXA 2ET7A 1HQLA 1S0CA 2D3RA 2GN3A 3APBA 5C9AA 1AHSA 2A71A 4YVSB 3ZSKA 4JQRA 3URFA 4W65A 1HLCA 2JE7A 5JSOA 4E27A 3L2YA 2TBVA 4AEDC 4XJ8A 3N35A 2RS51 1TNFA 4R4ZA 1V6KA 2DCKA 2YROA 3DKWA 5E88A 2Q1MA 3B93A 1OA3A 4Q1RA 3OCPA 3WW3A 4MX3A 5AVPA 1V00A 5KXEA 4FTBA 4PDWB 4UBGA 1RITA 1L3JA 2Y26A 1Y3TA 5C8CB 2PAKA 4K1ZA 4R9AA 1OHFA 1OSGA 1NA1A 1PGW2 1QMJA 4WV8A 4HN0A 5GKAC 2CYFA 1A8DA 1K5MC 2XBO2 4JAAA 4N43B 4Q0SA 5K9YA 4RS5A 2D5HA 2IFRA 1DFQA 2ZHKA 1Q8VA 2A6ZA 2G4IA 1RUH1 1NXMA 3H3ZA 4AHWA 5KXCA 1BMV1 1RUG3 3WDYA 5BNOC 1XNCA 3O0VA 4EWEA 3B9IA 3ALQA 1HW5A 4FOQA 2O0OA 1EV13 2P3KA 3B5LB 4AWDA 1YIFA 1DU3D 1EY2A 3FE5A 3QH6A 3WV6A 1DQ6A 1R1A1 3M70A 4UW6A 3THTA 1KJLA 2ZPXA 1DQ1A 2VMIA 2JXAA 4XJ9A 2R49A 3A0KA 2GNDA 1OA2A 3SNMA 5I0SA 4OHZA 4WM8C 2WS92 3WG2A 2WFF3 1OFNA 2RM21 1R091 4AG4A 4C90A 4DB5A 1RUE1 1YJKA 1LEMA 2A5ZA 2R0HA 1PVC2 5CG9A 1JH5A 5GLVA 2CWMA 1GSLA 4PDWA 5AC93 4LHLA 1JUHA 1OLQA 5FPZA 2JEMA 2NPIA 1VB4A 2ZGLA 3RPQA 2XGXA 2WC2A 1QKQA 1SBDA 4GMP0 1RHI2 1YHFA 1POV1 3LB9A 3QACA 3ES1A 4K1YA 4LUKA 3MDPA 5JOWA 4AVAA 3IBMA 1PGSA 1CESA 2I74A 5I8SA 3INAA 1H1MA 1VBC3 4LBJA 3MZHA 4O9EA 4BZ4A 2XJRA 2Y38A 3FZ3A 3RZZA 1GANA 4RGGA 3ZSMA 4M3CE 4Z82A 4J1WA 5E8AA 4BA6A 1ALYA 2QDNA 1MQTA 1RUF3 5BV6A 4K21A 4AI1A 1UZZA 3VDDC 4LA3A 5BXXA 4FCAA 5LRSA 3V64A 3HQXA 3N7KA 1RUE2 1JW6A 1MS3A 5GZGA 3ETQA 4AGVA 2DCYA 3NO8A 1H2NA 1ZA4A 3C2UA 4FXKB 1YFWA 3ZXAC 4P9WA 3VHPA 3VZNA 2O8OA 3ZMOA 1FAYA 1J1TA 1Q43A 4QPGC 5C4WB 3WX5A 1VBA1 2UU8A 2B42B 1KXGA 1ZZCA 2BNMA 4DRRA 2VMHA 4CDXB 5CFDB 4RQPC 1UAIA 1QH7A 2IXCA 2ZAAA 4HKOA 2PELA 1DHKB 1FNYA 3B94A 2A6WA 2DCZA 2PHXA 4KGGA 3WW1A 3WXPA 4I09A 4KNCA 1U12A 5T50A 4XXPA 4D69A 3RYKA 2C5DA 4FBFA 1O3QA 1REDA 3VHOA 2D6MA 4JTNA 3FMGA 2HWB2 4M01A 3KSCA 4AFAA 1VLNA 4Q0VA 3FC0A 2WLQA 4ES9A 4U36A 1PIV1 1RTVA 3QCWA 1AR71 4FAGA 3V56A 2VU9A 2W0XA 3PJQA 1LHVA 2AUYA 2PHLA 3KS7A 3P3NA 1YWKA 4BPZA 1FMD1 1MS0A 1V6MA 5FDBA 1VBD3 3PMSA 3WHTA 1RGSA 1FPN2 1AXYA 1ZBE3 2R061 5T55A 4N7UA 4HFSA 1HRI1 5GALA 3K51A 4Q4V3 3E6CC 2GN7A 2A7AA 2VUJA 3M3OA 4Q4W1 4XFHA 1GYKA 3ELNA 1WMFA 5T5OA 4AK3A 2BQPA 3TNQA 4MH0E 2DFCA 4ASLA 4P9GA 3VHNA 5KC6A 3FX3A 3MI8A 2DCTA 3HD8B 4EN6B 1ND3C 5FQ0B 5CFDA 4FAHA 2WLPA 3JCIA 4TLFA 5GLZA 3WR0A 4WM7B 5CU1A 3H1MA 5EYXA 3WY6A 2HWC1 1VP6A 3WDVA 2RS13 4ES8A 2JG8B 1YXWA 4KGQA 4XIOA 4LLOA 1AR72 2NQYA 2XJSA 4NOTA 2ZGTA 2FHRA 1FMD2 4WVZA 4ASMB 4B8EA 4XPVA 3ENRA 4IEOA 4FOYA 4IV3C 4Z07A 1O4TA 2WL1A 3MW2A 3AMPA 1LULA 1N1YA 1W6MB 3H1WA 4CDWA 2AGSA 1JHNA 4DPNA 4L9BA 3VZMA 4GB31 4HSLA 5J36A 1SLIA 4R9DA 5FPXA 1RUI1 2UURA 4B7EA 4YW2A 1LOGA 2Z79A 2GAUA 2D6KA 2D43A 4FPGA 1AR83 1SLCA 4L92A 4S2DA 5GZDA 3FLPA 3SXWA 2OW4A 1LOFA 4OUMA 4COZA 3M1HA 4Q4X2 4FTEA 1RUJ1 3E5UA 1DBNA 2EXKA 3UKNA 4ONUA 5FQ0A 4HLTA 1JTZX 5I0RA 3R4UA 4WZCA 3WZ1A 5FO9B 1UU5A 4WM7A 3ES4A 1QJX3 5GM0A 2VVEA 1GV9A 3MIGA 5FO8B 1ZREA 3HN1A 2ZGPA 3R6SA 5CVRA 3CF6E 1RUG2 1ENQA 1I6XA 1AYM3 3BU7A 5A32B 1WLTA 3AK0A 3WQ1A 1Z7S1 3WNXA 1REEA 4BMEA 3AX4A 3UL2A 2WT2A 4FVVA 4CDUB 3JU9A 3NJZA 4GQ7A 1C57A 3UK9A 4M0NA 1W6MA 2YGLA 4WVMB 1NOVA 4BQ1A 3E6BA 3OPZA 4ATFA 4AF9A 3WDXA 2WT0A 2ZHNA 1ZBA1 4BWOA 4AQSA 1KITA 3JD73 4URTA 1XNKA 1RUJ2 2P34A 2EAAA 5JSPA 5L7OC 2VW1A 3QBQA 4C1XA 3L2HA 5EZWA 2ZGQA 5HCBA 2Z42A 3LCPA 4EROA 4ZKTB 1W6NB 2SBAA 1UU6A 2IFWA 2JDZA 1MEC3 3AKRA 3KD4A 5AC92 2H0VA 3GYDA 4HKLA 2EA7A 1J58A 1JN2P 2WZR1 5GJ6A 5DXDA 2XLAA 1WW7A 4ITCA 3ZFEC 3J9SA 3IPVB 1EPWA 3ROUA 3KCCA 3D5OA 3VN4A 1Z7S2 4YARA 4KWLA 2R0FA 2XH6A 1NZCA 2XUMA 3USUA 1S55A 3PVEA 3LA3A 1UKGA 1A3KA 2JG9B 5A32A 1AL21 2RR13 4NHLA 1LHWA 1I9RA 1VR3A 4LUMA 3GZUC 1VBE1 2WNUA 1J3PA 2WQ4A 3PLQA 1ULCA 1LHUA 4CDUA 4AEJA 3IT8A 1EAH1 3ZYRA 3M3CA 2BNNA 2Y0IA 1AR61 1ZBA2 2F4PA 1LODA 4Q1PA 5E1RA 5ACA1 4YM1A 3JQWA 3FFZA 3OBTA 2QQPA 2R041 1CAXB 4I02A 4OZXA 1UW8A 4RR3C 1WBLA 4YG3A 1LOCA 4GH4C 1NCRC 3ZN6B 4AFCA 1DQ0A 1A6CA 1DYPA 1V70A 5GLUA 3UJOA 4LHNA 1KFXL 4DMIA 4FPFA 1JYCA 1GLHA 2RS53 4LTAA 4ZXKA 3M3QA 4EN8B 4JGYA 4RQPB 4I0WB 1FOD1 1UX6A 2XB6C 2XHKA 1U5ZA 1W6NA 3AYAA 3RJ2X 1LHNA 3ZXDA 2G9GA 3FJSA 1QXRA 1VRH2 1OLRA 3MF6A 2X5IB 4EN7B 3GZAA 1OPMA 1TME3 3IKWA 4Y1UA 3KMHA 4XQ4A 3IPVA 1MZ6A 4XXAA 2X29A 3S30A 4Y4YA 2LUWA 3IDBB 4E4DX 2I45A 1VBE2 2AREA 2DUOA 2MPFA 4HK9A 3DPRC 2BBVA 1RUH3 1Q8SA 5JZGC 2JG9A 3AKPA 1AR62 2OUHA 5T5JA 3TAYA 2DTYA 3VKOA 1SFYA 5FLJA 1AF9A 2HJIA 2R042 5JSRA 1U5XA 3NW4A 2KXLA 5A3MA 5FFOC 1COV2 2MNGA 3PNAA 4HVOA 3N36A 1OOPB 4A2UA 4ZU4A 1S0GA 1R1A3 4Z92B 4A7KA 5F1RA 2DVGA 1CAXA 1V6JA 4FPCA 4JDMA 3ST7A 1HQNA 1RINA 1YO8A 4UBHA 1AR93 1LU1A 4MUVA 1XQNA 4COYA 1FOD2 1KD7A 1R082 3ASIA 4QHBA 1RMU1 4RL7A 1MVEA 1IS3A 1UMZA 3B69A 2RM23 1R093 3FUQA 3SISA 1ND3B 5BNNC 3VGIA 4BYYA 3AZWA 1YFUA 4K40A 2P3JA 3MLJA 4QGNA 3WW2A 4C0BA 1Q56A 4D3WA 4I30A 2OIIA 4FQ4A 4XQDA 5KXDA 3NL1A 2PFWA 4LO7A 2X5IA 3H7YA 3IWZA 1WLCA 3A4UA 3MF9A 1O4YA 1X8MA 3MPPG 3QD6A 4K7JA 2YC0A 4JVAA 2ZA9A 3LA7A 1V9U1 1N3PA 4AQ6A 4AVSA 2DTWA 3O12A 1H8TC 1W6PA 2ZGRA 5J37A 1BBT1 1CR7A 1BJQA 1DYKA 2ZAHA 4IV3B 4IEWA 5CFCB 5A33A 3AMNA 1WLDA 2TUNA 2VGDA 2ZMNA 1SLLA 2R071 4H7LA 1OOPA 4XFAA 1R1ZA 5DDJ2 5DZEA 2ZGOA 4R8HA 3FWEA 3NVCA 1MZFA 3ZXGA 3LKJA 2RE9A 1VBB2 1Y9QA 1XYNA 4MVTA 2BYVE 2QKDA 4Q4Y1 3DV8A 1YYNA 4GALA 4IXLA 3CJXA 4UW3A 4QX5A 4CEYB 1RVF3 5JPMB 4K8FA 5SV8A 3SHRA 2BPA2 3WCSA 2ETEA 1B09A 1H2KA 2BEOA 2B9UA 3KGLA 2JKBA 5GZCA 3WCRA 2VH9A 5KC5A 3RYRA 2GDFA 1V9U2 2RHPA 2R6QA 4X6QB 4BMBA 4YZ2A 3SCFA 2PYTA 1HXS3 3OY8A 3ZXKA 1FT9A 1PGW1 5DUUA 1JUIA 4PCRA 3T1MA 1QJY2 1QDCA 2XBO1 1ZZ6A 4HT1T 3KQRA 1H1AA 1LHOA 1D2QA 2I07B 3I7DA 1D0GA 4LBNA 4HANA 1TMF2 1G7YA 2R072 4N53C 2BWCA 4L99A 4CDQC 1ZRFA 2AR6A 3ZIWA 5CFCA 3NAPC 1BEV3 5JOXA 4YGBA 5D8AC 2PLV2 2VG9A 3HT1A 3C3VA 2NM1A 4MGIE 2GC0A 1BQPA 4MXWA 2ZTNA 1U5IA 3D0SA 1H9WA 5JR7B 1ZVFA 4Q4Y2 4XF0A 4GMP1 2MHFA 2MEV3 1NXD1 1BKZA 1MS4A 3LA2A 2HWE1 1CONA 4YVWC 4Q29A 2HWF3 3WP3A 1WCDJ 3DF0A 4HZFA 2R063 3LAGA 5JI9A 1TQ5A 3WP4A 1LESA 1OPOA 1HRI3 2ZBJA 1CX4A 2WS91 4MXVA 5CB7A 4CEYA 5FAXA 4XBQA 5KXBA 1UF2C 4Q4W3 3AP5A 4ZU5A 4M3CA 2WIIB 4AVTA 2WZPP 3ZFEB 3K48A 1PVC1 3HT2A 2HEWF 4H14A 3RDIA 1VALA 1ZRCA