2RR11

Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
273
structure length
273
Chain Sequence
TVASISSGPKHTQKVPILTANETGATMPVLPSDSIETRTTYMHFNGSETDVECFLGRAACVHVTEIQNKDATGIDNHREAKLFNDWKINLSSLVQLRKKLELFTYVRFDSEYTILATASQPDSANYSSNLVVQAMYVPPGAPNPKEWDDYTWQSASNPSVFFKVGDTSRFSVPYVGLASAYNCFYDGYSHDDAETQYGITVLNHMGSMAFRIVNEHDEHKTLVKIRVYHRAKHVEAWIPRAPRALPYTSIGRTNYPKNTEPVIKKRKGDIKSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
publication title Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses.
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Virus
total genus 44
structure length 273
sequence length 273
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1988-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2rr1100
5C9AB 5A33B 1POV3 5DDJ2 5C8CA 1CD3G 4CEYA 2RMU1 4Q4Y2 4RS5A 1RUH3 1ND3A 2HWB2 2R042 4GH4A 1ZBE3 1R1A2 5LK7B 4BCUA 3DPRC 1NA1C 1AR93 2RS31 1POV1 5K0UC 4FTEA 1DDLA 1PGW2 4QPGA 3IDEA 1RUH1 4IV3A 1F2NA 2BPA2 2BFUL 1AR63 1ZBE1 3CJIC 1VB4A 2HWF2 1NCRC 4QPIC 5FMOS 1RUD2 4Q4X2 2XBO2 1AYN2 5C8CB 1RUF2 4CEYB 1VBD3 1AYM3 5J96B 4FTSA 1RUC2 3DPRA 4RS5B 1ND3B 1RUJ2 1QJX1 1E57A 2R073 1FPN1 4GB33 4N43B 3VBUB 1R081 2RR13 4AEDA 1BEV3 1VRH2 5BNPC 1QJU1 4LLFA 4GMP1 4EJRA 4IV1C 4QPIA 1PIV2 2VQ0A 4CDQB 5DDJ3 4YVSC 2R071 5C9AC 4GB31 1IHMA 1AR72 1BBT1 2HWB3 2R043 1VBA1 2RS32 1R1A3 1VBB3 4FTBA 4RFT0 5GKAC 1RUI2 4Q4Y1 5C4WB 4NWWA 2X5IA 2HWB1 2HWF3 4AEDB 2XPJA 1AL21 2BFUS 2FZ1A 3VDDB 1R091 1RUD3 4Q4X3 1NY71 1ND2A 1RUF3 1C8NA 4Y5Z0 1RUC3 1C8M2 5C8CC 2HWF1 4RHV2 4CEYC 1QJZA 4RS5C 4WM7A 1ND3C 1W39A 3LOBA 1TMF1 4YVWA 4Q4X1 3JB4C 1OOPA 1QQP3 2XBO1 3VBOB 3NAPA 1AYN1 3VBUC 2RMU3 3VBFB 1PO21 1RUJ1 1RHI1 3HAGA 4QPGC 1QJY2 1VBA2 3VBRA 1Z7S1 1RUG2 4CDQC 3J8F1 1PVC2 1VRH1 2RS33 4GMP0 1ND2B 2MEV1 1HRI1 1MQTB 1PIV1 4FSJA 1ZBA1 1OPOA 2HWD2 1EV12 1AR71 4CDXA 4WM7B 4N43A 1AL22 3VBUA 5C4WC 1NG0A 1R092 4YVWB 1OOPB 3NAPB 5AC92 5FOJB 1RUE2 1FOD1 1NY72 4AEDC 1RUI1 4CDQA 2BUKA 4SBVA 3VDDC 1RB8G 1QJX3 3VBRB 1AR81 2WZR1 2ZTNA 1FPN3 3ZXAC 1TMF2 1CJDA 1MEC1 5A32A 4N53B 1R083 3TN92 2ZAHA 4Q4V2 2TBVA 2WS91 5BNNA 5BNOA 1QJU3 1FMD1 1ASJ2 3JBG1 4GMP3 1PO22 4JGZA 1RHI2 5C4WA 3VBOC 1C8M1 3JB8A 4CDXB 4RHV1 1Z7S2 1BBT3 3J8F2 1QJY3 1VBA3 2HWE2 2R062 3VBFC 4Q4W1 2X5IC 3VDDA 1HRV1 2MEV2 1SMVA 1HRI2 1VBE2 1ZBA2 1NCQA 2WWSA 3JD72 4Q4Y3 2GH8A 4RQPB 4CEWB 2RM22 1HXS1 5ABJA 1QJY1 1ND2C 5A32B 5ACA1 1MQTC 1RUG1 1AL23 1PVC1 5BNNB 3VBOA 1R093 1FOD2 1B35A 2HWC1 5BNOB 4Y4YA 4WM7C 5AC93 4JGZB 4YVWC 1H8TA 3VBFA 1OOPC 2IZWA 4PDWA 3NAPC 2HWD1 1AR82 2WZR2 1VB2A 1EV11 1MEC2 2RS52 2ZZQA 1TMF3 1D4M1 2WS92 3ZFFA 3VBRC 1FMD2 2XBO3 5AC91 3JBG2 3S6PA 1RUE1 1OHFA 1BMV1 1AYN3 1NCQB 1X36A 4N53C 1MQTA 1PO23 1RUJ3 1RHI3 5D8AA 5CFCA 5ABJB 1VAKA 4RR3A 4Q4W2 1Z7S3 1HRV2 3J8F3 3VBHA 3TN91 1B35B 1VRH3 4CDXC 4Q4V1 4N43C 1ASJ1 2MEV3 1AR62 1H8TB 3ZFEA 1AUYA 1HRI3 2BBVA 4PDWB 1PIV3 4CDWB 1HXS2 1ZBA3 1AR73 2RM23 2DF7A 1V9U1 2PLV1 5ACA2 1GFF2 5JZGB 2HWE1 2R061 4N53A 4RQPC 3ZFFB 1A6CA 4CEWC 2HWC2 1PGL2 1K5MA 1AYM2 5J98B 1FOD3 1VBE1 1VBC1 3JD71 1RUI3 2RS11 5D8AB 1AL0G 5BNNC 5CFCB 3FBMA 5BNOC 1RVF1 4RR3B 2RM21 1AR83 2WZR3 4JGZC 1MEC3 1D4M2 3VBHB 1TME2 2RS53 1BMV2 2WS93 2QQPA 1FMD3 3ZFEB 3JBG3 3VBSB 4RQPA 4CEWA 1C8M3 1COV2 1VBB2 4CDUB 1PO12 4RHV3 5CFDA 1NCQC 2RS51 1RMU1 4NWVA 1K5MB 4Q4W3 4WM8B 5ABJC 2FZ2A 1HRV3 3M8LA 3ZFGA 5L7OB 4Z92B 1B35C 2GSYA 1V9U2 1HXS3 2PLV2 1AR91 4JGYB 1H8TC 4PDWC 5ACA3 1WCDJ 1RUG3 4CDWC 1PVC3 2WFF2 2HWC3 1VBC2 1AR61 5JZGC 2RS12 1NA1A 3ZFFC 1RVF2 5K0UA 1HQNA 4GH4B 2HWD3 1EV13 5CFDB 1EAH2 1QQP2 5D8AC 5CFCC 1PGL1 3CJIA 1D4M3 4QPGB 1VBD1 4RR3C 1AYM1 1TME3 2RMU2 3ZFGB 4IV3B 1RUE3 1NCRA 3VBHC 1M06G 4CDWA 2RR11 3ZFEC 1BEV1 1F8VA 1RMU2 1COV3 5JZGA 3VBSC 1PO13 1X33A 1TME1 2Y26A 3TN93 4Q4V3 1RUH2 4CDUC 3DPRB 5DDJ1 1ASJ3 1HX6A 1NA1B 1ZBE2 1K5MC 4WM8C 5K0UB 5BNPA 2R041 1AR92 1COV1 1R1A1 1VBB1 1PO11 1NOVA 4IV1A 5L7OC 1V9U3 2PLV3 2HWE3 1POV0 2R063 3CJIB 4YVSA 5C9AA 5A33A 1PGW1 1NCRB 4QPIB 2WFF3 4JGYC 5FMOL 1VBE3 1QJX2 3VBSA 1VBC3 3JD73 2RS13 1FPN2 1RVF3 4CDUA 1R082 1EAH3 1QJU2 1RUD1 1VBD2 4WM8A 4GH4C 2WFF1 5CFDC 1RUF1 1RUC1 5L7OA 2R072 2X5IB 4GB32 5BNPB 1BBT2 2RR12 3ZFGC 1BEV2 4IV3C 4IV1B 4JGYA 2WLPA 1EAH1 1QQP1 4YVSB 1RMU3
chains in the Genus database with same CATH superfamily
5C9AB 1WW4A 2GDFA 2YPDA 4F7ZA 5JXIA 2YBSA 1POV3 3AMPA 4HANA 4BMEA 4LORA 2NMNA 5DDJ2 3GM8A 4OHZA 4FP3A 4CEYA 2RMU1 5C8CA 3I2HA 1RUH3 4ZU4A 2A6VA 4HSLA 1MVEA 1NQJA 3B02A 3D82A 4CUGA 1LB2A 3Q8AA 4FPCA 3H8OA 4CPBD 5DABA 3N7LA 4XBQA 1IS4A 3NV3A 2HLEA 2PHUA 3AVSA 4O61A 4TYSA 4CU6A 1J1LA 1KJRA 3WXPA 4EJRA 1ZRDA 4XILA 3EXUA 2Q30A 3GHNA 3AJYA 4ZS2A 1WUVA 2WO2A 4ISRA 4K1ZA 4OULA 1DYOA 3RZGA 2BPA2 2BFUL 4XBLA 1TNRA 4WV8A 1ZBE1 2GNTA 1QXPA 2HWF2 3LSEA 3VKOA 2C9KA 4DFSA 3O1PA 5I0SA 3QH6A 4MSVA 3RZHA 5F6KA 2VG9A 1PZ7A 4QX8A 2VZ3A 1YUDA 2EIEA 1POQA 5J48A 1DCSA 2VD7A 3IAQA 1GANA 4CEYB 5C8CB 2CYFA 1VBD3 2BWAA 1DBNA 1EUUA 1AYM3 1EUTA 4FPJA 1RUC2 4LBKA 3AL5A 4YW7A 4BQWA 4DRVA 5IVCA 1W2UA 2OUHA 4AF9A 1QJX1 1WW6A 3U1XA 1A3KA 4GKYA 3WG3A 1F15A 1FPN1 2R073 3NSTA 3Q9OA 1UF2C 3VBUB 2WQ4A 1CPMA 1R081 2YB7A 2RDQA 2WNUB 3ZYGA 1W2OA 5H9RA 2VZUA 2WO3A 4JKMA 2UYAA 5D1IA 3UJQA 2VUAA 3VZJA 3IDAA 3KMHA 2JDKA 3LDBA 4HPKA 4A3XA 2AUYA 4M3CF 3KF3A 5FY5A 1YJLA 1YQ5A 1EPWA 2VQ0A 2NM1A 3MW3A 4PI0A 4F8AA 4MHRA 1OLQA 3O1VA 2IUWA 2R043 4XFFA 5I0UA 5BPXA 3ETQA 4AQTA 2RS32 1F4AA 1R1A3 2WNVA 5E89A 1CAXA 3O1SA 3KLSA 1WCQA 4FTBA 1UX6A 3R05A 4QU2A 1ZZCA 3TRSB 4OQ8A 5FMCA 3PUHA 1REEA 3S0MA 4AVSA 5GKAC 3ILRA 1NX9A 2R1DA 3MLJA 2R6QA 4HK9A 4Y1UA 1OD5A 3WUDA 1HB1A 1HIXA 3LEGA 3RI8A 1LOFA 1PK6C 2X5IA 3W59A 4F83A 3ZXJA 4YPJA 2CTVA 4FQ4A 3QD6A 2WT2A 4LULA 5EFUA 3R4SA 4Z1VA 3VDDB 4WVVA 2VMHA 3FJSA 1OVPA 2JENA 4LBMA 5LA9A 1RUD3 2O8OA 4HPKB 1UY4A 4PIXA 1V6OA 4N7IA 3KQRA 1DHKB 1C8NA 5T55A 5FV3A 2ENRA 4K20A 4I0WB 1GQPA 1XOYA 2HWF1 4QWNA 1QJZA 1IPKA 1W39A 1LULA 3CU7A 4W6YA 5FP7A 3VZKA 5J36A 4Q8LA 1CAXB 3Q8CA 4DEVA 4C91A 3S5AA 4YVWA 3TNQA 1QQP3 4ZPIA 3VBOB 4P9XA 1BYHA 5JPMB 3MUZ1 4IEXA 2VMIA 4K3UA 4EWEA 2RMU3 2OQ6A 2G9GA 2ZHMA 4NHKA 3ZX7A 4B1MA 5FXXA 4MXWA 1RHI1 2IFRA 5F5AA 4CP2A 4QPGC 1CX4A 1H9PA 1NLSA 2JDMA 2JIGA 3N9NA 1QJY2 5F3GA 1GMMA 2DVAA 2VZVA 1U5XA 4FPOB 3M4FA 4I3PA 4CDQC 1RJ8A 1Z0HA 5FMBA 4JCKA 1W90A 4O7XA 3OD0A 3GBFA 4QM8A 1MZ6A 5T52A 2QQKA 1LESA 4Y33A 2O0OA 2E7AA 5K4LA 1UPSA 1OPOA 4CP9A 2WN3A 2UU8A 2XJRA 4CPBA 4MVTA 1E5HA 2XLAA 2WAAA 2JB8A 4XIOA 5DZEA 3BOWA 3NJXA 2K9ZA 4XFHA 3QLQA 4YVWB 4BQ4A 4CCDA 3GZAA 2Q0AA 2IWGB 4I0AA 1E5RA 4LA2A 4HL0A 4Y5TA 3WP4A 2WC2A 5FLIA 2W1WA 4FPFA 4ZU5A 3R4DB 3O1UA 1QDOA 4MXWB 2FCUA 4SBVA 5SV8A 1W0PA 2P3IA 5A7NA 1QJX3 2W52A 2VVDA 1UPIA 4FT8A 1AR81 1Q43A 3AXEA 5IWFA 4LOTA 1FPN3 1DQ6A 5CKMA 1H0BA 3ZO0B 2UYBA 3EMRA 2OIIA 4XUNA 2Q1FA 2A3XA 4FFIA 4FOQA 3WINE 1R083 5A32A 5GLZA 5FZ1A 3TN92 1GNYA 2G9FA 2V09A 3BTAA 2TBVA 2BZDA 5DQ0A 1IGOA 2QQUA 1GWLA 3JBG1 4DIQA 2JX9A 1TNFA 3C7EA 1NAEA 4LKFA 3WNOA 3NV2A 5C4WA 4B4RA 3V0BA 3LEKA 2PA7A 1HQLA 4AEKA 1O3RA 1JYIA 2KR2A 3PUIA 4QD2A 2PHDA 1J59A 4OYUA 3HNMA 3J7HA 2YG0A 1QNWA 2HWE2 2R062 3MZHA 4ASMB 3T2TA 5IT6A 2WR9A 1XNAA 3T4VA 4D8MA 1UXXX 4DNYA 3P1IA 1HRI2 4FOYA 1JODA 1IS6A 2HBUA 2A3YA 2VC9A 4DXRA 3NV1A 2WWSA 2WIIB 4XF4A 1CAUA 3H9AA 4CTEA 3SCHA 3KB5A 3HIFA 5C5UA 3AP6A 5FZEA 3SNMA 3KCYA 4IGOA 1QJY1 5FZBA 3X29B 3AKTA 3EHKA 1DP0A 5A32B 2F4LA 4UT5A 3I2OA 5LBBA 4QX5A 5FZHA 5C8WA 1ZZBA 2QBXA 2AENA 4WM7C 4OI1A 1QHDA 2JWPA 5AC93 3WF4A 3GCWA 3V0BB 1H8TA 1OOPC 1XNTA 3I7DA 2FCVA 2O8QA 4QHZA 4BLIA 3AL6A 1VB2A 4NIIA 3WNNA 3WHUA 2J42A 1W8UA 2FHRA 2OX0A 4CCJA 4IE5A 1GOHA 4HLTA 3T1MA 1CX1A 1TZOA 4Y5SA 4BMBA 4RGAA 2O1QA 2VMGA 4AW7A 2YXSA 3ZFFA 1FMD2 4LT5A 3RZZA 3SCGA 4NPLA 5FAXA 3SC7X 5GM0A 3UYJA 2I07B 1X36A 4N53C 5G05L 1UYPA 3CZUA 3U07A 5LW9A 4JC1A 4CP0A 4M0NA 3PU8A 3HOBA 1RHI3 2Q8CA 1UY3A 2EIGA 4FOVA 3S30A 4EN6B 3TBDA 4LUMA 4NHMA 3ZYHA 3PURA 2YBKA 2D6MA 4PQQA 4KWJA 1I9RA 1ZX5A 3T1LA 3VBHA 2E31A 3TN91 5HCFA 3WF1A 3VB9A 2WYFA 4N43C 2GNDA 5FYBA 3HQUA 4YM1A 4UI9L 2UY9A 2VUDA 1JS9A 4KBZA 1KRIA 1H8TB 3FFQA 1KGYA 3GBWA 1AUYA 1LTEA 2CY6A 3KT1A 5IK7A 2AR6A 3FBYA 3K46A 1CIWA 1K42A 5C33A 4BLJA 3THDA 3DXTA 4BHPA 4D3WA 3BODA 4PIZA 2XDVA 3WW3A 5ACA2 1V9U1 1GFF2 3AKRA 3ECQA 3H3ZA 4JDMA 4LO4B 4AYUA 2HWE1 2DCYA 2R061 4RQPC 3ZFFB 4YRDA 2HWC2 4AGGA 2D44A 4JTNA 4XBNA 2VBPA 4XTMA 4Y1ZA 5J98B 3GNEA 3RI9A 3RZMA 2XWBB 2WNOA 3DKWA 5FLJA 5LBCA 3ZYBA 5A3LA 1U5YA 3WF3A 1H8VA 1ZYBA 2RS11 1AL0G 2QQJA 1JHJA 1W8TA 4GJYA 5BNOC 3LEIA 3UKVA 1QOOA 2YU1A 2CGPA 4P02B 4UBGA 3ENRA 4UFJA 1AR83 3CEWA 4XQWA 2PMWB 4JGZC 3D4KA 4NAOA 3RDIA 4QX7A 1I3HA 2BBAA 4O65A 1DGWA 3VBHB 4CU9A 4HVRA 1ZVFA 5LBFA 4Y1VA 2B5HA 3WNMA 3CLPA 4MADA 3UGGA 5DN2A 2XKOA 2XVKA 1OH4A 1VPHA 3MPBA 3VL8A 4EN0A 2QQPA 4ARYA 3WSOA 3JBG3 2L9LA 5IVEA 1O6UA 3MO4A 1WA6X 3LAGA 5FBZA 4A3ZA 1DZRA 4AEJA 1Q8PA 2VOVA 5DXDA 5JOZA 3NW4A 4FI9A 1NCQC 3THPA 1S0JA 2DFCA 3AK0A 3LE0A 2W08A 4UFIA 4WM8B 5IVBA 3IAPA 3M2MA 4DY3A 5ABJC 4NAMA 5HBAA 1RXFA 1DLLA 2WO7A 3C2UA 1HDKA 3M8LA 1V6LA 2B4KA 1PHMA 1YC61 5DUUA 1APNA 2ZEYA 1OA2A 1W05A 5FYYA 1Y9QA 4JDOA 4BDVB 5IK5A 1B35C 5JSPA 3FLPA 1HB2A 4LQRA 4COZA 5F3CA 5E1RA 5KHIA 3FZ3A 3GF6A 4JGYB 1Q56A 2H6BA 2JE9A 1UY0A 5FXWA 4D7YA 1YYNA 3I4IA 4DXSA 2ARBA 2IXLA 3U14A 3DYMA 4YG3A 4P9LA 1VBC2 1Y3TA 2JD4A 5JZGC 2W0XA 1NA1A 5F37A 1PZ9A 4AFBA 1CN1A 1UOJA 2C4XA 1HB4A 4O9GA 1HQNA 2J1AA 4GH4B 4QQPA 2BOIA 5EZWA 1I1EA 4GWNA 4GZ9A 3EJKA 4UFMA 4A6SA 4CCEA 2OT7A 1ULOA 2R30A 4ZZ5A 5CFCC 3POEA 3TNPB 1MS5A 1S0DA 2VZOA 1OT5A 4QPGB 1JZ6A 1G9FA 1TME3 1US3A 1ZA4A 4KMQA 4UOJA 3UKTA 4V2WA 4QXHA 3ZYPA 1ODNA 1VP6A 2VBDA 2W39A 2BDRA 1OBNA 2EALA 3F2ZA 3HBKA 3SMHA 3W58A 1JZ3A 1ST8A 4R9BA 1ZREA 1TQ5A 2W87A 5HPOA 1YQCA 3AYEA 2OPWA 2CL2A 3BIWE 2DU1A 3H3UA 1BEV1 2OQ7A 4IGQA 3WY6A 2QVSB 1AX1A 5A3MA 4META 2VZQA 1X33A 3NNLA 1OMIA 3I3QA 4YVSB 4L0PA 3TN93 1RUH2 4CDUC 1LNSA 1PGSA 2B42B 1HX6A 1NA1B 2VZ1A 3RRDA 3ACHA 3I3BA 3JQXA 1W2TA 5F2WA 5GLVA 1K5MC 4NIAA 1XNCA 5FO8B 1ENXA 3PVOA 4D7SA 1LEMA 2C9AA 5EWSA 3ZIXA 5GZFA 4Z82A 2HEWF 3MIGA 1V9U3 2Q8OA 2HWE3 2R063 5HI0A 5JOWA 5K7PA 3SH4A 5L19A 3DXUA 4IEWA 4P9GA 1S4CA 3VKMA 2QKDA 4N90A 4QPIB 4YZ4A 1LOAA 3VZLA 4ZXKA 1W6NB 4CCMA 4AR2A 1QKQA 1OXCA 1MS1A 5APAA 3J9SA 5C71A 4I02A 2ZA9A 2RS13 5JPNB 2PAEA 1KEXA 2ERFA 4LBQD 2DFBA 1N47A 2R16A 1N1YA 3HNBM 1GP4A 1QY4A 3BB6A 5HCAA 5TSWA 5I0RA 2DCKA 3AVRA 3Q8FA 5JSRA 2Z69A 3K75B 1EAH3 1VBD2 3NNMA 2PQQA 4AI8A 5CFDC 4C0HA 1OA4A 1RUF1 2F17A 2PYTA 5B4NA 2ZZJA 2JDPA 1MR5A 3PUAA 5L7OA 5H9QA 2R072 3M70A 4A7ZA 2GN7A 2ZACA 2ZHNA 3D0SA 5E88A 1BBT2 1YO8A 4R9AA 3ZFGC 1LRHA 2PQSA 2TUNA 1QXRA 3RG0A 2BNMA 3IZOA 3OJBA 4ZS3A 1G86A 4MGKE 4NHYA 2X29A 4UXAA 4YGBA 1W6MA 3PUSA 4M4RA 1CD3G 3ACGA 2OUJA 4IERA 4Q4Y2 3ACIA 2QE3A 4QQ2A 1EYBA 5IFTA 4Q0SA 4HKWA 1YQ8A 2D6NA 4DO0A 1IKQA 5FZDA 2R042 1EY2A 3MLKA 5HV4A 3CHXA 2ZHLA 2VMEA 1R1A2 5LK7B 4BM8A 4Z2AA 1HJFA 1WMEA 2BGOA 4NPRA 2J7MA 3ST7A 2YC2A 5A1FA 2RG4A 4Y4RA 1DGRA 1POV1 2BEOA 2P1BA 1XE7A 2VZSA 3C8XA 5K0UC 4FTEA 4MG2A 4FQZA 4XXPA 2G19A 2BWCA 3IDEA 1RUH1 3ZN4A 4IV3A 4B7KA 1OFNA 1OKQA 2RJKA 1W8WA 1G9CA 3I2IA 2O14A 1UNBA 2MPFA 3CJIC 3JUUA 3T08A 3KGZA 2WZPP 5KR7A 2EF6A 2QJVA 1SG3A 3WR0A 1NCRC 1SEFA 4MGTA 4QDQA 3URFA 1SCRA 3CMGA 4FBFA 4MGZE 4QKNA 1RUD2 3D8CA 2W1UA 1JYXA 3T2QA 1O4ZA 4AQ6A 1W6MB 1G9AA 1O91A 3TEWA 2ADEA 3N36A 1W2NA 3OG2A 3DPRA 2WNVC 1RC6A 1Z78A 1XPWA 4NRMA 1RUJ2 1GKBA 2G4IA 3ZXLA 2QQWA 5CNAA 2ZGKA 5AFEA 5K8SA 1IS3A 4HKLA 3INAA 5CKNA 4N43B 1UQXA 3S5QA 5FDBA 1IQDC 4AEDA 1BEV3 4XFGA 4XETA 3KZ4C 3AZXA 1VAMA 2GN3A 3E6DA 2BYVE 4LLFA 2BJSA 2Q1ZB 1LHWA 3ROUA 4IV1C 2RV9A 4FPYA 1QGLA 1PIV2 2VECA 4ARXA 3ZKUA 3AXDA 4GWJA 2R071 4TSVA 4LK7A 4E8CA 5C3OA 5A7PA 3ZDVA 1AR72 1BBT1 2DCJA 3BYWA 3H42B 4IUGA 5IVVA 1C4RA 1CVNA 1VBA1 2RVAA 4ZY9A 3GZEA 1OUXA 4W4ZA 5FY0A 4RFRB 1G9DA 4ISQA 4LEJA 3HNYM 4NRQA 1JOPA 3IPVA 4KU7A 4OI2A 4JV4A 5FUIA 2ZX3A 4ORFA 1KS4A 1CWPA 4Q4Y1 5EYYA 2R7EB 3DCQA 3IKWA 4MZUA 5FUPA 1RITA 2IXHA 1JUIA 1LGNA 2WRAA 3P3NA 1G8WA 2DYCA 1REDA 3WW4A 1F5JA 4WVWA 1JZ2A 2DUPA 4CXXA 2WA3A 4AEDB 2XPJA 3RZLA 1AL21 5A3NA 4H2AA 5A6YA 2CAVA 1XU1A 2K2SA 1D2QA 1GV9A 2QDNA 3ACFA 1R091 4P5HA 1ACCA 2P6HA 1RINA 3A7QA 4Q4X3 5FUNA 3W5MA 3ABZA 1NY71 1RUF3 2ZHKA 2VU9A 5IVJA 5FZOA 4E4SA 4C1XA 5CU1A 2FBEA 1OUSA 2YDEA 5FPAA 4F3JA 1YFXA 4LBQA 4XJUA 4RS5C 1MS3A 1ND3C 3AB0A 4NOTA 3LOBA 5F5QA 2DVBA 4FPHA 3WLUA 3W5NA 2OZ6A 3HPNA 1PNFA 4YM3A 4E8DA 1X82A 4M00A 1MPXA 1DYPA 3IPVB 2PAKA 4XUPA 1FNYA 1BK0A 1XNDA 2GZWA 3WG4A 4XMIA 4R8HA 4CP1A 1GP5A 1JYVA 1NUKA 1W0OA 4V2VA 4BA6A 3IIAA 4NIHA 1XRUA 3H1WA 3USUA 3VBFB 2Y38A 5I91A 1RUJ1 2ZMLA 2VQUA 1RUOA 5A7SA 1MS4A 3VBRA 2WT1A 3S7EA 3O0XA 5FO9B 4YW6A 5FWEA 2ATFA 2E63A 3WVJA 3OF1A 1Z7S1 5F3EA 1RUG2 1CZSA 3DYPA 3D6EA 1PVC2 3KVAA 3IMNA 1YNAA 3POFA 3VD3A 2V4VA 4LE3A 4Q0VA 5LEJA 1CZVA 5JSOA 5E8AA 2EA7A 4CUCA 4AE2A 2MEV1 3AKQA 3B9IA 4GULA 3MPPG 4KI5M 4QKDA 4ZXEA 4DQAA 1MQTB 1PIV1 4NN0A 5FZOB 1NZCA 1ZBA1 4Q8KA 1XE0A 2JDAA 5IHRA 4KQ7A 3POJA 3CJXA 3KV9A 3H8UA 5T5PA 1AR71 4LBQB 4CDXA 1VMFA 4B29A 5FR3A 1F31A 1AX0A 5FZ0A 3VBUA 2VL4A 4AVAA 1NG0A 5C4WC 2WNUA 3WW1A 2ZGNA 3BKZA 1W9WA 2WINB 4QGMA 3VL9A 4BJ0A 3O1TA 2ARAA 3JXSA 5AC92 5FOJB 3DGTA 4CXYA 1UIKA 1RUE2 4XPVA 1S0EA 2A5ZA 2ZEWA 3AFGA 5GZGA 5FY7A 1D0GA 1W99A 2D6OX 2WQ8A 3CL1A 3USUB 2EIDA 2YGMA 1RB8G 4JQRA 3PHMA 1J58A 4YZ1A 3VBRB 2WZR1 3TB0A 4S2FA 3FLTA 3T4HB 3T0BA 4IE4A 4IE0A 3ZXAC 4R4ZA 1MEC1 4A4AA 2ZGMA 1HN1A 3VD9A 3K77A 3BPSA 3ZR6A 4AAXA 4TWTA 1KJLA 1ASJ2 5FP4A 1QMJA 2XJQA 1RHI2 5KWRA 3MW4A 2SBAA 3MFAA 1PMHX 4ATEA 1LU1A 4CDXB 3WOGA 4QQHA 5FFOC 4EZHA 1BBT3 2ZOEB 1VBA3 3H3LA 4BQ3A 1V00A 2VW1A 2CWMA 3A21A 1LGBA 5FJHA 2E33A 1X9TA 3VDDA 2HKXA 1HRV1 1CESA 1SMVA 4X8PA 2JG8A 3IIIA 1S1AA 4JDNA 3RMXA 4IETA 2X05A 4Q4Y3 4E2QA 1OQDA 1DGWX 2W1QA 2GH8A 2QQLA 3D3AA 4CEWB 4G9SB 5EV7A 4YYOA 2VVEA 1LODA 3O14A 2A71A 2H6CA 4HMZA 4WZCA 2ZGSA 1ND2C 4WVMB 4OI0A 1NT0A 4LKEA 1YCIA 1RUG1 3O0VA 3ORJA 1AL23 2W46A 1PVC1 1WLDA 1UMZA 3QCWA 3VBOA 3MIEA 1R093 3ZMOA 4J25A 1RYYA 4LHKA 4XTPA 5EJ3A 3FMGA 4C0BA 4OUEA 5JMOA 3WF0A 2Y8KA 4LHSA 4QQLA 2IZWA 4W65A 2FDJA 1JYCA 3HR9A 3NAPC 1AR82 2BTVC 3MLLA 1T6GC 4IEYA 3IMMA 3R4UA 3CBNA 5CVRA 5EXOA 4GWIA 3VZNA 1Q8VA 2W68A 1F5FA 4XJ8A 2JKBA 4D0QA 4AG4A 1N3QA 4QGNA 2OPKA 2IXIA 4KWUA 4EYUA 3VUOA 3ILNA 5AC91 3JBG2 1DG6A 2JG8B 2PELA 1RUE1 3OUIA 1LU2A 5CKQA 1D7PM 5B4XA 1JYWA 4A2UA 1OQEA 1ZM1A 3LDRA 5F5IA 3LQCA 5T5OA 4H7LA 3AP4A 2ZGQA 2D6LX 3POIA 1RUJ3 4Q1RA 1OURA 1ULGA 1VAKA 2Y6FA 4KG0A 4RR3A 2CWSA 4XABA 4CCLA 4L99A 3OCPA 1V0AA 2W3JA 2ZS6B 3B3QE 3SQOA 1Z7S3 2MNGA 5HCBA 1LAJA 4FP2A 1UMHA 4N7UA 4PBPA 1G6NA 2Y6GA 4OUSA 3K3NA 3DF0A 3H7YA 3MGUA 2Y64A 4Q27A 1ASJ1 3WUCA 3Q8BA 2MEV3 3UJOA 4OZXA 3N9LA 1W9TA 3ZFEA 3N4MA 2BBVA 2WZEA 3ON7A 1PIV3 1JTZX 4CDWB 3MIBA 1ZBA3 1ZRIA 4UW4A 2BNOA 1VMHA 1SBEA 2ARXA 4UFKA 3MDPA 5JIAA 1AR73 2DF7A 2PLV1 4CRQA 5KXDA 2VZRA 5M0TA 3CZJA 1VIWB 4ET7A 3KD4A 1DGRN 1PMJX 1KFXL 5J96B 3MEPA 3B94A 1GOFA 1UYYA 3GHMA 2FDIA 3T2OA 2CU5A 5JCTA 2E7QA 2A70A 3T2PA 2VQTA 1W9SA 3POBA 2ZKLA 3N7MA 2QCSB 5BNNC 1UY1A 1IG3A 1WWYA 1RVF1 4RR3B 4XC9A 3ZYRA 2DVDA 2WZR3 5LBEA 3ZLIA 4Q2FA 4CUBA 2OVUA 3WHTA 4HZFA 4RGKA 1MEC3 4I3GA 1WMFA 5I8TA 1DQ0A 4BU2A 1TME2 3KWVA 2AACA 3ME2A 2D7FA 1MACA 2RS53 2UWCA 3FHQA 3OEBA 4PQ9A 1VJ2A 4MXVA 1XJAA 2P34A 1C28A 4XMAA 2IC1A 3KV5A 3NNFA 3GBGA 4Y3OA 3ZFEB 2XG3A 2R49A 1Q8OA 1J84A 3FHAA 2JJ6A 2DUQA 2WDBA 1GU3A 3VBSB 2XL7A 3APBA 4LMFA 1S0GA 3GZUC 4IEVA 3MF9A 4W8JA 4EE2A 2DU0A 4XFIA 5JDBA 2PHTA 2SLIA 4QDSA 5FP3A 3LIHA 3H8RA 3DN7A 3VD4A 4XQ4A 1T2XA 1S2BA 3KS7A 1H6YA 3TWIA 1HRV3 3T0DA 4UW6A 4MH0E 4Q5OA 3HWJA 4Y1XA 2D3RA 3K4ZA 5FZAA 3WNPA 5FZFA 5FZ3A 4G4FA 3CQOA 3LDKA 3THCA 1V9U2 1WBFA 1VALA 2D3SA 3LB9A 3N9OA 1AR91 1BVVA 2Y6KA 3NJVA 3NO8A 3PL0A 4WZFA 4FFFA 4B4QA 1S2KA 4PDWC 4YGEA 1RUG3 2EAKA 2Q5TA 3IDBB 1WBLA 2DWRA 2EICA 4RGGA 1PVC3 2VH9A 4CCCA 4RA0A 1XYOA 1H30A 4S2HA 1EPZA 1SFYA 3J7LA 5F6LB 1AJOA 4DY5A 1JZ7A 2RS12 5DAVA 5T5LA 3VHRA 5CA6A 1CZTA 4Q0QA 4LUKA 1U5IA 4A7YA 1EAH2 2A7AA 3OD4A 2WA4A 5D8AC 5A7WB 1UU6A 1V6NA 5IUQA 1JZ4A 2JECA 3GZTB 3WP5A 1YI7A 1WZXA 1WW5A 3I59A 1RUE3 3DECA 3BALA 3PTRB 4IEQA 5FZ8A 2NPIA 3W9AA 4YM2A 4ZU7A 1ZNPA 3ZYIB 1GP6A 4B4PA 3UETA 1B09A 1JU3A 4HETA 2E26A 3O0WA 3WQ7A 3AZWA 5ANQA 1F8VA 1MS8A 2B9VA 2EXIA 2ES3A 1COV3 2EXJA 2ID4A 2VE1A 5FPZA 3OGVA 1QU0A 3WEZA 3USSA 1TME1 2Y26A 1XC6A 1XXNA 2AC1A 3CKHA 1FXZA 3ZN6A 1FYUA 5FY1A 1GUIA 4X8NA 3SKJE 1JYTA 1BZWA 1C1LA 1ASJ3 3LKJA 3THTA 4QPYA 4TN7A 1LOGA 1Q5OA 4IGPA 1JW6A 3E97A 3I2FA 3RS6A 4JRAA 2XUMA 4LO6B 4H55A 1RUNA 5L7OC 1HJGA 1GQGA 2NQYA 2PLV3 2ET1A 1ULFA 2RDNA 1SBFA 2V72A 2W5FA 4QXKA 3WNLA 3ZXDA 1SDWA 3BPZA 3T0AA 1K3IA 5FK8A 5IJRA 1L7LA 2VZPA 1PGW1 3I59B 1K45A 4N8MA 1JHNA 1IKPA 2VQAA 5DZGA 4YW1A 2FDHA 1JXNA 3BN6A 3EQEA 3WW2A 3MHZA 4H3WA 5FZ4A 2DURA 4DUXA 3POGA 4NHXA 1REFA 3LFIA 4OHVA 2GC3A 3M3OA 1RVF3 3WQ0A 2DVGA 4K6BA 2ZX1A 5DMYA 2VVFA 2PHFA 1QJU2 4WM8A 3C7HA 3ZN6B 1PK6A 1XE8A 3NRUA 3UL2A 1WA4A 4XZPA 1D0HA 1NE4A 2JG9C 2Z2SB 3LPGA 3OYWA 1OSGA 2DDUA 3NWKA 4NMIA 5ANNA 2Q8EA 1UOBA 3FUQA 3UK9A 2VTFA 1O8SA 1V6KA 4LKSA 1H4GA 2VAUA 4AWDA 1BEV2 1JN2P 1VR3A 4IV3C 5A70A 2VCAA 2E7TA 4JGYA 1UZ0A 5EJ1B 1EAH1 1OVSA 2PHXA 1JUHA 2ZGRA 3ZPYA 2A6WA 4MGIE 5A80A 3ZIWA 3P6BA 4MOAA 4FPLA 2OS2A 1CIYA 4QB1A 1W0NA 1OC1A 4EQVA 3RYPA 5L9BA 1UOFA 4Q0PA 2DCTA 5CG8A 1SHWB 4YGCA 5GZCA 4GH4A 5KC5A 3K48A 2ZEZA 3L9JT 5BNQA 4UWDA 3ZM8A 5DAWA 3DPRC 3HMYA 1JI6A 2ZGLA 5FZKA 4Z8BA 1AR93 3N9PA 3ZDSA 4KBBA 4URAA 2BVBA 1PVXA 3N3HA 1PK6B 1DDLA 2QFEA 3KHBA 2VULA 2XXZA 4QPGA 3T3YA 5J3UA 3OYWB 4WVZA 4JKLA 3P3PA 2GC1A 4NIGA 2XR4A 2WZ8A 3ZSLA 3ZXKA 5FQ0A 4H7MA 4M3CB 4IDZA 3ZMNA 2E9QA 1SPPA 4GIQA 3SEPA 3A22A 5AFBA 1UW8A 3EYPA 4P00B 1W8ZA 4LBOA 4LIUA 1JH5A 4O9EA 1HB3A 4PHZA 5D2AA 3ILFA 3PVBB 4Q4X2 2LTNA 1W04A 2JICA 2XBO2 3M3QA 5C3SA 5A1AA 2D93A 1C5HA 4D94A 1MVQA 1QNYA 1RUF2 5FPBA 2VOKA 4FO9A 4R52A 1MZEA 3CO2A 2VGDA 4FAHA 1RIRA 5CISA 1E57A 4BQ2A 4L2NA 2OA2A 2EIBA 3OY8A 4LITA 3SITA 1NXD1 4GB33 1LKNA 2LALA 4K21A 2C26A 1ONAA 1N1SA 2ZX2A 2YROA 3AYDA 3GXUA 3PLQA 5FZMA 1VRH2 5FZLA 5LA1A 1UN1A 2D6KA 1TEIA 5BNPC 4HFSA 1QJU1 4JX0A 3ES1A 4GMP1 2XONA 1SLCA 2WBKA 1OI6A 1W9YA 2DTWA 4QPIA 2QDRA 3VDCA 2DBIA 2JDZA 5GZDA 4YW2A 1J3QA 1AVBA 1W6NA 2WSUA 5DZFA 5FQ0B 4AI0A 4CDQB 4YVSC 1SPPB 1Y7BA 3ZPOA 5C9AC 4K8RB 4LO8A 5EP9A 3AC0A 1QH7A 5H9SA 4D6QA 3B00A 4EN9B 2HWB3 1C5IA 1Q8QA 3VDBA 2HBTA 2KM2A 3MBWA 2XOMA 4FFHA 4BQ1A 3H0OA 4YGDA 1X8EA 1GSLA 1J3PA 1GWMA 1ULEA 4IEZA 4LA3A 4U36A 2PN5A 2XMLA 4AHXA 2Y6JA 2NP0A 1YFWA 5FXVA 3BTYA 4EWAA 1NLRA 5GJ6A 4W6XA 3U4SA 4RFT0 1PX4A 1RUI2 4U2AA 2UWBA 4NWWA 1AJKA 3BTXA 3WCSA 3OY8B 1W9FA 5SV5A 1UZYA 2ZEXA 1AXZA 3F95A 4I01A 3CDZB 4W6WA 1NZIA 3QBQA 2D3PA 4A42A 2FZ1A 4N9HA 3RPQA 4P9YA 3UV9A 2OKXA 1AXKA 1ZRCA 1YHFA 3AZYA 1XNBA 4YSFA 1DQ1A 2GH2A 2VOTA 3MV01 1D2SA 3LF7A 5FZIA 5LATA 1O59A 1WCUA 5JWPA 5ISLA 1W6QA 3AMMA 1C8M2 4YG6A 3RFRA 2LS6A 3R6SA 3W21A 5C8CC 4CEYC 4GXLA 3TEXA 1GWKA 2VOWA 1DGLA 1LHOA 3AMQA 3HBZA 1YEWA 2VTXA 4WM7A 1UU5A 2ORXA 5IVYA 4D6SA 1TMF1 1UY2A 4QKBA 3VV1A 4AQSA 2WJSA 4Q4X1 3JB4C 1OOPA 2XBO1 5IATA 4AZZA 5KXCA 2VNOA 4XJAA 5J7MA 1O4YA 4NJ4A 4Z07A 1U0AA 4GA9A 3VBUC 5C3QA 1VLNA 2WNUC 1SZBA 3NKGA 1PO21 2BGPA 2YV8A 1WCSA 3LCPA 5AVAA 4B8EA 4BE3A 4HKOA 1R1ZA 3KT4A 1JZ5A 2ZGUA 1VBA2 1YIPA 5EHDA 4LHLA 4M01A 4MUVA 1GZWA 2F6BA 2QQIA 3IWZA 4MV2A 4AGVA 1JMUB 3KT7A 3J8F1 3GJAA 4XUQA 4Y22B 3TYJA 2XLFA 1VRH1 3WT3A 4CCKA 1CQ9A 3C7FA 3POYA 4QU1A 4E4ZA 2E6VA 4AVTA 4GMP0 1F4HA 4QDRA 3SISA 4ASLA 3VLBB 2PAMA 3J7MA 1CGPA 4QKFA 1I5PA 1H1AA 1UWWA 1W6QB 4W50A 3HD8B 4FSJA 4P5YA 3GGLA 4ES9A 4AXOA 5BY5A 2ZAAA 5F1RA 2XJSA 1US2A 2N7GA 1EV12 1DZQA 1G7YA 2ZX4A 1K5JA 3CF6E 4WM7B 4N43A 1BXHA 1AL22 3I3MA 2QQOA 1VE0A 3BOPA 2ZGTA 1R092 4AK3A 1OOPB 2XWJB 2V4AA 4NUBA 4YW3A 4LXLA 3SCFA 3GDBA 1S0FA 2YGLA 4XEZA 5AVPA 5A7QA 1JU4A 5IW0A 1FOD1 1NY72 3B9CA 4QB6A 1KDKA 2TNFA 2VW0A 4UW3A 1JBCA 1HW5A 3O7OA 4OVEA 1WD3A 1GNHA 1RUI1 2BUKA 2NN8A 3VDDC 4PIYA 4YFZA 4K1YA 1CAVB 1Y9GA 2K46A 5L9VA 5J37A 1J83A 1GZWB 1H2MA 1LOCA 1CJDA 2KD7A 3V0AA 4N53B 2XB6C 3WV6A 2FMYA 2V5YA 1HN0A 3N9MA 2BV4A 2WS91 5BNOA 1QJU3 2XJPA 2H0VA 5F7UA 4IESA 5I0TA 4GMP3 2DVFA 4CU8A 2WABA 3H50A 2OZJA 3O5SA 3LGRA 4JGZA 4K8FA 3VKLA 4AFMA 4MYEA 3SKVA 1JZ8A 2RDRA 1YLLA 5FP9A 3VBOC 1STMA 5FMDA 1C8M1 1W8FA 5H9PA 4AHWA 4CE8A 3JB8A 4S2GA 1V6JA 3D0JA 4BB3A 3OBZA 4D7TA 1ULCA 3S7IA 1Z7S2 4GKXA 2YHJA 2VXRA 4OMCA 3SH3A 4AHZA 3J26N 4YARA 4Q4W1 1LOFC 2X5IC 5B2GB 3ELNA 2XHKA 4RYDA 1GZ9A 4UFLA 3RQ0A 4DB5A 1SDDB 3LA7A 2MEV2 2EXHA 1YIFA 2D40A 3VN4A 2D6PA 2FMDA 4CCOA 4UFHA 1VBE2 4YFWA 3B7MA 2W2IA 2GNBA 1ZBA2 1NCQA 4RQPB 3HEIA 4SLIA 4AL9A 1HXS1 4QPWA 4AI2A 5LY2A 5ABJA 4OFGA 3V0AB 1UOGA 1C3HA 2ARCA 3FL7A 4DUWA 2AREA 4KNCA 2WUHA 2JE7A 4OHXA 2JB4A 2J1RA 2JDUA 5E6HA 5BNOB 1B35A 4HBNA 4M3CE 4Y4YA 2B46X 2Z42A 4IEPA 4QHOA 4L8QA 3A0KA 4BH9A 2VMFA 3M3CA 3Q8EA 4JGZB 5FKCA 3JZVA 4YVWC 5T50A 4EZ4A 3VBFA 4E4DX 2I2SA 2WZR2 1EV11 4XYXA 4JKKA 1MEC2 2P3YA 1KFUL 1GLHA 4JQTA 1ZA7A 3I2DA 3OGJA 3ZN5A 2RS52 4Y1YA 2CV6A 4BQYA 1TMF3 3PDQA 3U10A 1D4M1 5FCCA 2VMCA 4KWKA 4A41A 2XBO3 2GC2A 3S6PA 2VNVA 4ZHNA 1BMV1 3QACA 1ZRFA 1NCQB 1WW7A 3L2HA 3FE5A 4XUOA 1MQTA 1LHUA 5CIRA 1PO23 1U12A 2CGNA 4COUA 3FN9A 5CFCA 5ABJB 1NLQA 4XDOA 3IT8A 3GYDA 1LHVA 4A44A 5C6CA 4J1XA 4L97A 1UU4A 4RL7A 1XSQA 5EQUA 3SLIA 5FLHA 3O1MA 1HRV2 1YQ6A 3J8F3 3PVEA 1B35B 2CGOA 1VRH3 5FYHA 3UGFA 4QAWA 3ZSEA 2WFPA 1DQ2A 4PBOA 5C3PA 1WCKA 3U11A 4ATFA 3NL1A 4Y26A 3VKFC 1ZZ7A 1AR62 3LFMA 5F32A 4QM9A 3RVHA 1RXGA 2C1FA 4HK8A 4IEUA 1Y43B 1OFSA 3EBRA 3LA3A 1GYKA 4LTAA 3KHCA 4NPMA 3WDUA 1S0BA 3W20A 2RM23 4YNIA 3B5LB 3MIHA 2HYXA 5JZGB 3ZYFA 2HJIA 2V5DA 1UXZA 5JR7B 5IVFA 1A6CA 1PGL2 5C7GA 1K5MA 2NYYA 3I97A 1O3TA 5IFPA 1R64A 3N9QA 3PMSA 1FOD3 1VBE1 1W03A 1DQ4A 2JD9A 2YFZA 4NE9A 2W9XA 4UF0A 3AMNA 1JYNA 4TZDA 1WLTA 1RUI3 2XVGA 4LO7A 3J7NA 5CFCB 4INDA 4ITCA 2YZ4A 3FBMA 4TTGA 3I49A 1KD7A 4JHTA 1H2LA 5KHJA 3PJYA 5T3NA 2IVIB 2J1TA 4AOCA 5JLVA 2GAUA 4AFDA 2J22A 4QQOA 4R4XA 1H1IA 5F8PA 2B8MA 2WO1A 2WS93 5HXVA 3HT1A 4P14A 2ORZA 2Q1MA 4X6QB 1W6PA 2VY0A 2VNRA 2RE9A 2VZTA 4YG0A 4CEWA 4GAZA 2R32A 4CZSA 1C8M3 1V70A 1WKYA 1H2KA 2JDNA 1COV2 1VBB2 4K7JA 4WVMA 4CDUB 4DUVA 5CFDA 1W28A 2XKPA 5K9YA 2RS51 1RMU1 4NWVA 2VMDA 1K5MB 3IN9A 4Q4W3 3AFKA 2D5HA 5GLTA 4YZ5A 2FZ2A 2ZKNA 2A3WA 2TEPA 3B93A 1BJQA 3AYAA 4UF0B 3TOJA 3ZFGA 5CB7A 3S57A 2X10A 2P2KA 4Z92B 1QJEA 4A7KA 3AP5A 1AZDA 3LWCA 1LOEA 2PLV2 1HXS3 4A45A 5A7OA 5I8SA 1H8TC 4K9SA 1XYPA 2B45X 3LPFA 1W6OA 1EP0A 1W3VA 5DG2A 3V64A 1WCDJ 5JOYA 4HVQA 3ATGA 3RMYA 4Z2WA 1UZZA 1BKZA 5KHHA 5KHGA 3OGGA 4Y24A 2FDKA 3RWKX 2ZMKA 1W6PB 2Y6HA 3FWEA 2BP6A 3MIDA 1AR61 4OHWA 5DAPA 5LB6A 2VJXA 4NIDA 1SLBA 4XCAA 3HQXA 1LECA 1RVF2 3WP3A 3ZFFC 4E2GA 3ALQA 5K0UA 2P17A 3DV8A 5T5JA 1EV13 4LHNA 5CFDB 2W91A 1TG7A 3B69A 5GALA 3K4AA 2X8KA 3E6BA 1LENA 4YZ2A 1PZ8A 1NQDA 2DUOA 3E1F1 5DG1A 1PGL1 3CJIA 1D4M3 3PJQA 4AI1A 4AI3A 1CONA 3ETPA 3BGAA 3WG2A 2NMOA 3ZFGB 2ZJCA 1NCRA 4CSWA 1ZZ9A 4XFAA 1S0IA 3VBHC 5LASA 3OBRA 1XB9A 2CDOA 3U75A 1LJ7A 4B3NA 4CDWA 4PF5A 5LRSA 5FPUA 3WQBA 1OF3A 3KM5A 1WLWA 2YMZA 4LPLA 2D97A 2XJUA 1VMJA 2RR11 1W6OB 1SLTA 4Q1PA 5FRAA 1UD1A 2JEMA 1PO13 2X09A 4I0BA 3H8XA 3QOPA 3M1HA 2P4EA 4AVBA 2A1XA 2MHFA 4PT6A 3IB3A 5JR2A 4QT6A 2BNNA 1ENSA 2D43A 5LK5A 5DDJ1 5C70A 3FUOA 1W8OA 4DPNA 3RZJA 1AX2A 4QB2A 4WM8C 1ENQA 5K0UB 1HV1A 1FNZA 1OA3A 2QZ3A 1WLCA 5A3PA 2AH2A 1AR92 3BU0A 1O3QA 1COV1 2J1EA 1VBB1 4FOWA 4CU7A 3IM0A 1NOVA 3FC0A 3FLRA 4IV1A 5FIXA 5DPNA 1S2EA 1P8JA 2Y60A 3KVBA 3ZXGA 4EWDA 1ULPA 3HVDA 3JU9A 3CJIB 2AGSA 3BIEA 1OLME 2WN2A 3MW2A 5A33A 4DOUA 1NCRB 3I2GA 4XQDA 2Q4SA 2WFF3 1OF4A 4JGYC 3ZVXA 2V73A 4BK5A 4XF3A 1VBE3 1XU2A 4UBHA 4GWMA 2C5DA 3VBSA 5FPXA 3VHOA 3ACLA 5FOBB 2YFUA 4DXTA 3BTZA 1V6IA 3WF2A 3R0RA 2B39A 5DUXA 1S55A 1O4TA 3A4UA 1X50A 4V1PA 5F39A 2WNVB 4LOSA 2VCCA 2P5BA 2HEVF 5DAQA 2VR4A 4GH4C 1QOTA 2JDHA 3TEYA 3VD5A 1O7FA 4OHYA 4FXGB 1LHNA 4PCRA 5FO7B 1PM4A 5FYSA 3AP7A 1RUC1 5FYMA 2ZCWA 3SXWA 4OZOA 2A6YA 5GLWA 2X5IB 2Y33A 3JCIA 1GQHA 4XUTA 5FYZA 1FX5A 4GB32 4IEOA 1A8MA 2VM9A 5E16A 4IW3A 4IV1B 3H1YA 2C24A 1F9KA 3ZYJB 2ADDA 4CXWA 1RMU3 5EIYB 4AQ2A 1O8PA 4I30A 1AF9A 5A33B 5KC6A 4GQ7A 5IYYA 2QZ2A 3LD8A 3NNJA 1C1FA 2PXJA 5A3OA 1OKOA 1FATA 2FDFA 4Q0UA 4RS5A 1ND3A 3ZSJA 4EV0A 4L92A 5JXJA 2HWB2 5I8YA 4YW4A 2JXAA 1YI9A 2WKKA 2YBPA 1ODMA 1ZBE3 4XCBA 4YM0A 3M3EA 4BCUA 4QXCA 4QX1A 3RGBA 1NA1C 4P9WA 2D5FA 1GZTA 2RS31 5LA0A 3NJZA 3FHIB 3LEMA 5A7WA 3CIHA 1CPNA 4KH9A 1PGW2 3KQ4B 4LO5B 1BQPA 1UO9A 3LSDA 4UAPA 3ZXEA 5LZ6A 4IQPA 1F2NA 3M7AA 1NKGA 1FV3A 4ASKA 1AR63 1PMIA 2W95A 1MZ5A 5LCWL 5EPAA 1X7NA 1VB4A 3RYRA 3VKNA 5BYNA 2JDYA 5A3TA 4QPIC 5FMOS 4QX3A 1GBGA 4RN5A 1U5ZA 3E5UA 1GR3A 1GNZA 3H1MA 3OBAA 4AEMA 1MS0A 4E27A 4M4PA 2W1SA 1W8NA 3SHRA 4BYYA 1PX3A 5FP8A 2IXKA 3WP6A 2VXJA 1KITA 1AYN2 1BLZA 2XQRA 3OBTA 2OYZA 2VTXJ 4FTSA 3C7OA 3WCRA 4RS5B 1ND3B 3C3VA 1UZWA 1XSRA 5BV6A 2A73B 2ILMA 4QX0A 4CP9B 3RJ2X 2XHNA 1QDCA 2CNAA 2LW8A 3GALA 1FT9A 2RR13 3N7JA 3SH5A 1SQ4A 4BZ4A 3TAYA 1H6XA 5BUVA 3MFCA 2QUOA 2RDSA 5JOXA 1A34A 3LOIA 4XHBA 4PJYA 5FZ7A 3KF5A 4MX3A 4LBJA 5A6XA 4QX2A 1LOBA 5DDJ3 4PI2A 4URTA 1SLLA 4BWOA 4HSJA 3PTYA 1DF0A 1YXWA 2VUCA 4IL7A 1D4VB 1KXGA 3CNAA 1IHMA 4GB31 4TLFA 2J1VA 1X8MA 5JI9A 3K51A 3OOXA 1VBB3 4OQ9A 1WMXA 3UESA 2YYOA 3OPZA 5F9TA 3OPTA 3EO6A 3ZR5A 3WDTA 2W47A 1TE1B 4AFAA 4FPEA 3KV6A 3I3DA 3LZZA 1DIWA 1DZTA 4BQ5A 5C4WB 4B1LA 5CAZA 3HN1A 1QEXA 2HWB1 4J6GA 1SACA 2E32A 3DUIA 3BCWA 1URXA 3UGHA 5JXHA 2HWF3 1Q8SA 3OB8A 5FYUA 4CYDA 5DAXA 2BFUS 1H1MA 4L9BA 5F2SA 3MICA 4MLOA 4EROA 3HT2A 5F3IA 2LRPA 2PFWA 1UYXA 4C1WA 1AXYA 1ND2A 1GOGA 2IXJA 4IE6A 4NRPA 2GP3A 4OUMA 3WDYA 4KG8A 2QQMA 3BI3A 3K2OA 1CAUB 1F35A 1RUC3 2ET7A 4JTOA 4Y5Z0 5KXEA 4QHBA 3E6CC 2DCZA 5DUVA 5T54A 4RHV2 4JZRA 2R1BA 4Q26A 4CCNA 4ES8A 5KBFA 3BUCA 2HYKA 5IAXA 2XUEA 3VGIA 1IS5A 2FCTA 4XJ9A 3ZSKA 4R9CA 3VZMA 2YC4A 5FZGA 2K0GA 3I2KA 3NAPA 4OMDA 1VRBA 2AYHA 1AYN1 3OGRA 4XVHA 3AJZA 4OCTA 1G9BA 1PM7A 4QMAA 2GMEA 4NR1A 3HAGA 4M3CA 1IOAA 3M3IA 1OD3A 3AZVA 5LWBA 5JVVA 3RWNA 4AFCA 1E5IA 3H7JA 4A6OA 1N3PA 4CVUA 4AHYA 5L36A 2RS33 3NV4A 1H2NA 5FREA 3WNKA 4HONA 4DXZA 1QF3A 4LNVA 1ND2B 3VHNA 3DL3A 3EB7A 1HRI1 1NYWA 1XBFA 3PU3A 4XOGA 4S2DA 3KCCA 3WDXA 2HWD2 2ZGOA 3I8TA 4NO4A 5FY8A 4GD4A 4RD7A 5A6ZA 4HN1A 5FKBA 2Q8DA 1RJ7A 2GALA 1DYKA 1IG0A 4XE9A 3ZOIA 1UZVA 2DBNA 4MHUA 2PHLA 2XVLA 3NAPB 3PUQA 5FYVA 5CBLA 1HV0A 2CAUA 2XQXA 1GICA 2PTMA 4WBBA 2AEYA 2WWUA 4AEDC 4X6RB 1JOJA 2R0HA 4CDQA 3ASIA 1CAWA 1DQ5A 4JRLA 4CA9A 4AI9A 2YY1A 4MGSA 3L2YA 4IXLA 2Y34A 2ZX0A 4P08A 1IZ3A 4TXWA 2PHWA 2ZTNA 4FXKB 4AGRA 1N1VA 1E5SA 1TMF2 3FX3A 4XACA 3ITQA 4TLGA 1H4HA 3DYOA 2GMPA 1GZCA 3MF6A 3KV4A 1ALYA 2ZAHA 4FAGA 4Q4V2 1J3RA 2G9ZA 5BNNA 1SBDA 4HVOA 4BXFA 1JOBA 3U4XA 3WZ1A 1FMD1 2GNMA 3I54A 1QH6A 4FFGA 1NXMA 3VDAA 1PO22 1QOSA 3DKQA 3P5BA 5A3UA 5I93A 4I2OA 1RL3A 2CDPA 2E51A 5FY4A 5A3WA 2QQNA 4BXSV 3OUHA 4RHV1 3A23A 3WDVA 2UWAA 4RSUA 4OLLA 3JQWA 2BU9A 4COVA 3IBMA 1QJY3 1Y4WA 3HJRA 3J8F2 5LRRA 1A78A 3VBFC 1UX7A 1H9WA 5A6QA 5JAXA 3I3EA 4XAAA 3D5OA 3N7KA 1J1TA 4XURA 5KHKA 3OTFA 2EXKA 1IPSA 2J1SA 4JHZA 4QXBA 1W8HA 1DLCA 4LLOA 1CAWB 2P37A 2RHPA 1UMIA 3JD72 3NKTA 4KGGA 3WG1A 2WLQA 2VOXA 2RM22 3G7DA 4LK6A 1X9PA 4HN0A 1NE6A 2D98A 1AHSA 2ZPXA 1BK1A 4C8DA 1ZZ8A 5KXBA 3T09A 3UT0A 5ACA1 1MQTC 3POWA 2FQPA 3WX5A 4DEQA 1T6BX 2C0ZA 3HN3A 5FZ6A 5BNNB 5FJKA 1FOD2 2HWC1 5F5CA 5IK8A 5FPVA 1DFQA 5JMCA 3SEEA 5C5TA 4MO3M 2G1MA 4COYA 2XH6A 4PDWA 3MYXA 2A75A 1UKGA 2HWD1 2W94A 1L3JA 1W06A 1Y9MA 1UCXA 2WSVA 2I74A 3OGSA 3V65A 5JUVA 2YPJA 4COWA 1MZFA 2ZZQA 1RTVA 2XL9A 4R9DA 1M4WA 4Y22A 2WYSA 3RNSA 4AVCA 5A1LA 2B7YA 2WS92 4I09A 3VBRC 5G04L 2AZ5A 3U0ZA 2QTWB 1OHFA 5FBJA 1AYN3 2WAOA 3WNXA 4FCAA 5FPLA 5FXZA 1ZRRA 2H0BA 4FPGA 2BERA 2AEZA 1OLRA 1XYNA 2XGXA 4DRRA 5D8AA 4BIOA 1QJFA 1YQ2A 4Q4W2 4BQXA 5EJZB 2JIJA 3FFZA 2I45A 2DV9A 1KQRA 2ETEA 4E2SA 4CDXC 2P3KA 2WT0A 4Q4V1 1BCXA 3IDCB 4Q29A 3O1RA 4XDQA 2FD8A 1CJPA 2GU9A 3NJYA 4XIKA 2J1UA 1HRI3 4PDWB 4LBLA 4XF0A 5LA2A 2LROA 1HXS2 1CAVA 1OH3A 2EAAA 1UYZA 3WD5A 4M0HA 3LA2A 3OPWA 5FY9A 2IFWA 2NLRA 2WQZC 1PNGA 3ZXFA 4BISA 3WQ1A 2W92A 4N53A 1O5UA 2OXBA 3MV11 4KL1A 5CZKA 4CEWC 1LCLA 1A8DA 5FZ9A 3ZSMA 2RJ2A 1AYM2 4E4HA 4DINB 2VUJA 3RJRA 4XJZA 4J1WA 2QNKA 5C3RA 1KS5A 4G3YC 3V56A 4BK4A 1SLIA 1VBC1 3BU7A 3GCXA 3JD71 4KGQA 5D8AB 2RJLA 3AP9A 2RM21 4XAEA 4K40A 2Y0IA 4GALA 2QQVA 4KWLA 1I5ZA 2VO5A 4LR4A 1D4M2 1HKDA 3MIFA 3VZOA 2ZMNA 5FYIA 3NQHA 5J1XA 2FDGA 5LY1A 2BVVA 5CG9A 1BMV2 2Y6LA 1L7QA 2BRTA 2NZ9A 2X53S 4BOWA 2BGCA 1FMD3 5FTTC 1UL9A 3MI8A 2CHHA 4N9IA 5CADA 4PLNA 2A6XA 2P3JA 4RQPA 1OLMA 5IAVA 1L7RA 4HXCA 4L11A 5J09A 1IPJA 2JG8C 3NMBA 1PO12 1SFPA 4PF1A 4RHV3 2JG9A 1QWRA 4ZKTB 4HG6B 1Q3EA 2XLGA 2YC0A 4FVVA 4JAAA 4XXAA 2BW8A 4YWAA 4PLOA 2ZABA 1IQAA 3VD7A 4P9JA 3AM2A 5L7OB 1N1TA 3NNGA 4PLMA 1DU3D 1MS9A 2B9UA 2GSYA 4FPKA 2R0FA 4D6RA 4XFCA 4LIVA 5ACA3 4XJWA 1HQWA 5HXMA 4CDWC 3UNPA 2ZXQA 4H14A 2WFF2 2Z4FA 2WL1A 1KDMA 4XDPA 3TEZA 1XNKA 2HWC3 3AKSA 3BVCA 3KGLA 2JE8A 1C57A 5D21A 2IVJA 4ZONA 5GLUA 3ZKYA 2HEYF 4CUAA 2VPVA 2WNEA 3RSJA 3WDWA 5FWJA 2UURA 2UY8A 3C7GA 1YJKA 2HWD3 4D69A 4YW5A 2JG9B 4LE4A 3T30A 4OI4A 4P9IA 3AX4A 1N3OA 2JKXA 4QGLA 1QQP2 4LJHA 5LEKA 2EVXA 3K4DA 3AYCA 1UAIA 4RR3C 3OSDA 1VBD1 2LUWA 4AAPA 4MGYE 1AYM1 1FAYA 5HCHA 2RMU2 2ZBJA 3LIGA 4IV3B 4BPZA 5I0DA 4E9KA 3POSA 1M06G 3E5QA 2GC0A 2VCMA 2WWJA 2XJTA 1O5LA 1QXJA 1W3XA 3ES4A 3AMHA 2Y0OA 2KXLA 3A0NA 2A6ZA 1I6XA 3ZFEC 5FYTA 1RMU2 5JZGA 1ENRA 3VBSC 1YWKA 1LEDA 4DZGA 2GP5A 4KU8A 5FK7A 1YFUA 1WD4A 2DTYA 3KSCA 5FYCA 4AVVA 1WGPA 2E53A 4NROA 5DUWA 3MUY1 4Q4V3 3NVCA 4ZZ8A 3O1OA 4Y20A 3DPRB 5CEHA 2Z5WA 4HOOA 3O12A 1UIJA 3PVNA 1ZBE2 3B01A 4YZ3A 3U78A 4DMIA 2VCBA 4MGQA 1SLAA 2IXCA 5L9RA 2YU2A 5BNPA 2R041 2C6SA 2HH9A 4GJZA 1R1A1 1UKRA 1PO11 2BQPA 1BHGA 3HQRA 5HV0A 4JVAA 1FI2A 3PNAA 2OW4A 1OPMA 1YRZA 4XZUG 1POV0 1LGCA 1ZZ6A 5EYXA 4YVSA 1RGSA 1YFYA 3PIJA 5C9AA 4LKDA 5JXGA 1WMDA 1BVP1 1K12A 5FMOL 1V6MA 1HLCA 2GMMA 4XHXA 1FV2A 2PHRA 5CYYA 1QJX2 1OQ1A 5FZCA 1VBC3 2ZGPA 3JD73 4DS0A 5ERLA 2VBBA 1FPN2 1S0CA 4NHLA 3E5XA 4IE7A 3PMEA 5GZEA 4EN7B 2F4PA 3N35A 4CDUA 3RYKA 1O3SA 1R082 3QH7A 5IK4A 4XF1A 4XFBA 2BOJA 3G6JB 2VNGA 4BIFA 4XF9A 3U37A 1RUD1 2XJVA 2Z79A 3AKPA 3DEMA 3PIGA 2CSGA 2P6CA 3AZZA 1LR5A 2WFF1 4UW5A 3VHPA 4EN8B 3RZKA 2YUEA 4UYBA 4Y20B 1W2AX 4NVPA 3KCXA 4XW3A 5BXXA 3UKNA 5JIUA 1TVGA 2LM3A 1SFNA 3J4UH 4ONUA 4HT1T 3GJBA 5BNPB 2KA3A 4YLZA 3K3OA 1SCSA 2RR12 5L73A 3OEAA 5JI7A 4B7EA 1CR7A 1XQNA 3OUJA 2WLPA 2VW2A 1ULDA 3I2JA 4C90A 1QQP1 4LBNA 1VAVA 1QIQA
chains in the Genus database with same CATH topology
5C9AB 1WW4A 2GDFA 4F7ZA 1POV3 3AMPA 4HANA 4BMEA 2NMNA 5DDJ2 4OHZA 5C8CA 4FP3A 4CEYA 2RMU1 1RUH3 4ZU4A 2A6VA 4HSLA 1MVEA 1NQJA 3B02A 3D82A 4FPCA 3N7LA 4XBQA 1IS4A 3NV3A 2PHUA 4TYSA 1J1LA 1KJRA 3WXPA 1ZRDA 4XILA 3EXUA 2Q30A 3GHNA 3AJYA 1WUVA 4K1ZA 4ISRA 4OULA 2BPA2 2BFUL 4XBLA 1TNRA 4WV8A 1ZBE1 2GNTA 1QXPA 2HWF2 3LSEA 3VKOA 4DFSA 5I0SA 3QH6A 4MSVA 5F6KA 2VG9A 1PZ7A 1YUDA 5J48A 5C8CB 1GANA 4CEYB 2CYFA 1VBD3 2BWAA 1DBNA 4FPJA 1AYM3 4LBKA 4PLMA 1RUC2 5J96B 4DRVA 1W2UA 2OUHA 4AF9A 1QJX1 1WW6A 1A3KA 4GKYA 3WG3A 2R073 1FPN1 3NSTA 3Q9OA 1UF2C 3VBUB 2WQ4A 1CPMA 1R081 3ZYGA 2WNUB 5H9RA 3UJQA 5D1IA 2UYAA 3VZJA 2VUAA 3KMHA 4A3XA 4HPKA 2AUYA 4M3CF 1YJLA 2VQ0A 1EPWA 2NM1A 3MW3A 4F8AA 1OLQA 5BPXA 2R043 4XFFA 5I0UA 3ETQA 4AQTA 2RS32 1R1A3 2WNVA 5E89A 1CAXA 3KLSA 4FTBA 1UX6A 3R05A 4QU2A 1ZZCA 3TRSB 1REEA 3S0MA 4AVSA 5GKAC 3ILRA 4HK9A 2R1DA 3MLJA 2R6QA 4Y1UA 1OD5A 3WUDA 1HIXA 3RI8A 1LOFA 1PK6C 2X5IA 3W59A 4F83A 3ZXJA 2CTVA 4FQ4A 3QD6A 2WT2A 4LULA 5EFUA 3R4SA 4Z1VA 3VDDB 4WVVA 2VMHA 3FJSA 2JENA 4LBMA 1RUD3 2O8OA 4HPKB 4PIXA 1V6OA 4N7IA 3KQRA 1DHKB 1C8NA 5T55A 2ENRA 4K20A 4I0WB 2HWF1 1QJZA 1IPKA 1W39A 1LULA 3CU7A 4W6YA 3VZKA 5J36A 4Q8LA 1CAXB 4C91A 4YVWA 3TNQA 1QQP3 3VBOB 4P9XA 1BYHA 5JPMB 4IEXA 4K3UA 2VMIA 4EWEA 2RMU3 4NHKA 2G9GA 2ZHMA 3ZX7A 4MXWA 1RHI1 2IFRA 4CP2A 4QPGC 1CX4A 1H9PA 1NLSA 1QJY2 2DVAA 1U5XA 4FPOB 3M4FA 4I3PA 4CDQC 1RJ8A 1Z0HA 4JCKA 3OD0A 3GBFA 4QM8A 1MZ6A 5T52A 1LESA 2O0OA 2E7AA 1UPSA 1OPOA 2UU8A 2XJRA 4MVTA 2XLAA 4XIOA 5DZEA 3BOWA 4XFHA 2K9ZA 4YVWB 3QLQA 3GZAA 2Q0AA 2IWGB 4I0AA 4LA2A 4HL0A 3WP4A 2WC2A 5FLIA 4FPFA 4ZU5A 3R4DB 1QDOA 4MXWB 4SBVA 5SV8A 1W0PA 2P3IA 1QJX3 2W52A 2VVDA 1UPIA 4FT8A 1AR81 1Q43A 3AXEA 1FPN3 1DQ6A 3ZO0B 1H0BA 2UYBA 2OIIA 5A32A 2A3XA 4FOQA 3WINE 1R083 5GLZA 3TN92 2G9FA 2V09A 3BTAA 2TBVA 1IGOA 3JBG1 2JX9A 1TNFA 3NV2A 5C4WA 4B4RA 3V0BA 2PA7A 1HQLA 4AEKA 1O3RA 1JYIA 1J59A 4QD2A 2PHDA 1QNWA 2HWE2 2R062 3MZHA 4ASMB 3T2TA 5IT6A 4DNYA 1HRI2 4FOYA 1IS6A 2A3YA 3NV1A 2WWSA 2WIIB 4XF4A 1CAUA 3H9AA 4CTEA 3SCHA 3KB5A 3HIFA 3AP6A 3SNMA 3KCYA 1QJY1 3X29B 3AKTA 3EHKA 5A32B 4QX5A 5C8WA 1ZZBA 2AENA 4WM7C 4OI1A 1QHDA 5AC93 3V0BB 1H8TA 1OOPC 3I7DA 2O8QA 4BLIA 1VB2A 3WHUA 2FHRA 4HLTA 3T1MA 4BMBA 4RGAA 2O1QA 2VMGA 4AW7A 2YXSA 3ZFFA 1FMD2 4LT5A 3RZZA 3SCGA 5FAXA 5GM0A 2I07B 1X36A 4N53C 3U07A 4JC1A 4CP0A 4M0NA 1RHI3 4FOVA 2EIGA 4EN6B 3S30A 3TBDA 4LUMA 4NHMA 2D6MA 4KWJA 1I9RA 1ZX5A 3T1LA 3VBHA 3TN91 5HCFA 4N43C 2GNDA 4YM1A 2UY9A 1KRIA 1H8TB 3FFQA 3GBWA 1AUYA 1LTEA 2CY6A 3KT1A 5IK7A 2AR6A 3FBYA 1CIWA 5C33A 4BLJA 4BHPA 4D3WA 3BODA 4PIZA 3WW3A 5ACA2 1V9U1 1GFF2 3AKRA 3ECQA 3H3ZA 4JDMA 4LO4B 4AYUA 2HWE1 2DCYA 2R061 4RQPC 3ZFFB 4YRDA 2HWC2 4AGGA 2D44A 4JTNA 4XBNA 4XTMA 4Y1ZA 5J98B 3GNEA 3RI9A 2XWBB 3DKWA 5FLJA 5A3LA 1U5YA 1H8VA 1ZYBA 2RS11 1AL0G 5BNOC 3UKVA 1QOOA 2CGPA 4UBGA 3ENRA 4XQWA 1AR83 3CEWA 4JGZC 3D4KA 3RDIA 1I3HA 1DGWA 3VBHB 4HVRA 1ZVFA 4Y1VA 2B5HA 3CLPA 3VL8A 4EN0A 2XKOA 2XVKA 3MPBA 2QQPA 3JBG3 3LAGA 5FBZA 1DZRA 4AEJA 1Q8PA 2VOVA 5DXDA 5JOZA 3NW4A 1NCQC 3THPA 1S0JA 2DFCA 3AK0A 2W08A 4WM8B 3M2MA 4DY3A 5ABJC 5HBAA 1DLLA 3M8LA 3C2UA 1HDKA 1V6LA 1PHMA 5DUUA 1APNA 1OA2A 1Y9QA 4JDOA 1B35C 5JSPA 3FLPA 4COZA 5E1RA 5KHIA 3FZ3A 3GF6A 4JGYB 1Q56A 2H6BA 2JE9A 4D7YA 1YYNA 3I4IA 2ARBA 2IXLA 4YG3A 4P9LA 1VBC2 1Y3TA 2JD4A 5JZGC 2W0XA 1NA1A 1PZ9A 4AFBA 1CN1A 4O9GA 1HQNA 4GH4B 5EZWA 4QQPA 1I1EA 4GWNA 3EJKA 2R30A 5CFCC 3TNPB 1MS5A 1S0DA 4QPGB 1G9FA 1TME3 1ZA4A 3UKTA 3ZYPA 1VP6A 2W39A 2EALA 3SMHA 3W58A 1ZREA 4R9BA 1TQ5A 3AYEA 2CL2A 3BIWE 2DU1A 3H3UA 1BEV1 3WY6A 2QVSB 1AX1A 5A3MA 4META 1X33A 1OMIA 4YVSB 3TN93 1RUH2 4CDUC 1PGSA 2B42B 1HX6A 1NA1B 3RRDA 5GLVA 3JQXA 1K5MC 1XNCA 5FO8B 1ENXA 3PVOA 4D7SA 1LEMA 2C9AA 5EWSA 3ZIXA 5GZFA 4Z82A 2HEWF 3MIGA 1V9U3 2Q8OA 2HWE3 2R063 5HI0A 5JOWA 5K7PA 3SH4A 5L19A 4IEWA 4P9GA 3VKMA 2QKDA 4N90A 4QPIB 4YZ4A 1LOAA 3VZLA 4ZXKA 1W6NB 1QKQA 1MS1A 3J9SA 4I02A 2ZA9A 2RS13 5JPNB 2PAEA 2ERFA 4LBQD 2DFBA 1N47A 2R16A 1N1YA 1QY4A 3BB6A 5HCAA 5TSWA 5I0RA 2DCKA 5JSRA 2Z69A 1EAH3 1VBD2 2PQQA 4AI8A 5CFDC 4C0HA 1OA4A 1RUF1 2PYTA 2ZZJA 1MR5A 5L7OA 5H9QA 2R072 3M70A 4A7ZA 2GN7A 2ZACA 2ZHNA 3D0SA 5E88A 1BBT2 1YO8A 4R9AA 3ZFGC 1LRHA 2TUNA 1QXRA 3RG0A 2BNMA 3OJBA 1G86A 4MGKE 4YGBA 2X29A 4UXAA 1W6MA 1CD3G 2OUJA 4IERA 4Q4Y2 2QE3A 4QQ2A 1EYBA 4Q0SA 4HKWA 2D6NA 1IKQA 2R042 1EY2A 3MLKA 2ZHLA 1R1A2 5LK7B 4BM8A 1WMEA 4NPRA 3ST7A 1DGRA 1POV1 2BEOA 5K0UC 1XE7A 4FTEA 4FQZA 4XXPA 2BWCA 3IDEA 1RUH1 3ZN4A 4IV3A 4B7KA 1OFNA 1OKQA 2RJKA 1G9CA 2MPFA 3JUUA 3CJIC 3KGZA 2WZPP 2EF6A 2QJVA 3WR0A 1NCRC 1SEFA 3URFA 1SCRA 4FBFA 4MGZE 1RUD2 3D8CA 1O4ZA 4AQ6A 1W6MB 1G9AA 1O91A 3N36A 3DPRA 2WNVC 1RC6A 1Z78A 1RUJ2 1GKBA 2G4IA 3ZXLA 5CNAA 2ZGKA 5AFEA 5K8SA 1IS3A 4HKLA 3INAA 4N43B 5FDBA 4AEDA 1BEV3 4XFGA 4XETA 3KZ4C 3AZXA 1VAMA 2GN3A 3E6DA 2BYVE 4LLFA 2Q1ZB 1LHWA 3ROUA 4IV1C 4FPYA 1QGLA 1PIV2 2VECA 3AXDA 2R071 4TSVA 1AR72 1BBT1 2DCJA 1C4RA 1CVNA 1VBA1 1G9DA 4ISQA 4LEJA 3IPVA 4KU7A 4OI2A 4JV4A 2ZX3A 4ORFA 1KS4A 4Q4Y1 5EYYA 3IKWA 4MZUA 1RITA 2IXHA 1JUIA 1LGNA 3P3NA 1G8WA 2DYCA 1REDA 3WW4A 1F5JA 4WVWA 2DUPA 2WA3A 4AEDB 2XPJA 1AL21 1LB2A 2CAVA 1XU1A 2K2SA 1D2QA 1GV9A 2QDNA 4P5HA 1R091 1RINA 4Q4X3 1NY71 1RUF3 2ZHKA 2VU9A 4E4SA 4C1XA 5CU1A 2FBEA 2YDEA 4F3JA 1YFXA 4LBQA 4XJUA 4RS5C 1MS3A 1ND3C 3AB0A 4NOTA 3LOBA 5F5QA 2DVBA 4FPHA 3WLUA 2OZ6A 1PNFA 4YM3A 1X82A 4M00A 1DYPA 3IPVB 2PAKA 1FNYA 1XNDA 2GZWA 3WG4A 4XMIA 4R8HA 4CP1A 1W0OA 4BA6A 3IIAA 1XRUA 3H1WA 3USUA 3VBFB 2Y38A 5I91A 1RUJ1 2ZMLA 1RUOA 1MS4A 3VBRA 2WT1A 3S7EA 3O0XA 5FO9B 3WVJA 2ATFA 2E63A 3OF1A 1Z7S1 1RUG2 3D6EA 1PVC2 3IMNA 1YNAA 4LE3A 4Q0VA 5LEJA 5JSOA 5E8AA 2EA7A 4AE2A 2MEV1 3AKQA 3B9IA 4GULA 3MPPG 4DQAA 1MQTB 1PIV1 4NN0A 1NZCA 1ZBA1 4Q8KA 4KQ7A 3CJXA 3H8UA 5T5PA 1AR71 4LBQB 4CDXA 4B29A 1F31A 1AX0A 3VBUA 4AVAA 5C4WC 1NG0A 2WNUA 3WW1A 2ZGNA 2WINB 4QGMA 3VL9A 5AC92 5FOJB 3DGTA 1UIKA 1RUE2 4XPVA 1S0EA 2A5ZA 3AFGA 5GZGA 1D0GA 2D6OX 3USUB 3CL1A 2YGMA 1RB8G 4JQRA 3PHMA 1J58A 4YZ1A 3VBRB 2WZR1 3TB0A 4S2FA 3FLTA 3ZXAC 4R4ZA 1MEC1 2ZGMA 4TWTA 1KJLA 1ASJ2 1QMJA 2XJQA 1RHI2 5KWRA 3MW4A 2SBAA 3MFAA 4ATEA 1LU1A 4CDXB 3WOGA 4QQHA 5FFOC 1BBT3 2ZOEB 1VBA3 1V00A 2VW1A 2CWMA 1LGBA 3VDDA 2HKXA 1HRV1 1CESA 1SMVA 4X8PA 2JG8A 1S1AA 4JDNA 3RMXA 4IETA 4Q4Y3 4E2QA 1OQDA 1DGWX 2GH8A 4CEWB 4G9SB 5EV7A 4YYOA 2VVEA 1LODA 3O14A 2A71A 2H6CA 4HMZA 4WZCA 2ZGSA 1ND2C 4WVMB 4OI0A 1YCIA 1RUG1 3O0VA 1AL23 1PVC1 1WLDA 1UMZA 3QCWA 3VBOA 3MIEA 1R093 3ZMOA 4LHKA 4XTPA 5EJ3A 3FMGA 4C0BA 4QQLA 2IZWA 4W65A 1JYCA 3HR9A 3NAPC 1AR82 2BTVC 3MLLA 1T6GC 4IEYA 3R4UA 5CVRA 5EXOA 3VZNA 1Q8VA 2W68A 1F5FA 4XJ8A 2JKBA 4AG4A 1N3QA 4QGNA 2OPKA 2IXIA 3VUOA 3ILNA 5AC91 3JBG2 1DG6A 2JG8B 2PELA 1RUE1 1LU2A 4A2UA 1OQEA 1ZM1A 5T5OA 4H7LA 3AP4A 2ZGQA 2D6LX 4Q1RA 1RUJ3 1ULGA 1VAKA 4KG0A 4RR3A 2CWSA 4L99A 3OCPA 2ZS6B 3B3QE 1Z7S3 2MNGA 5HCBA 4FP2A 4N7UA 4PBPA 1G6NA 4OUSA 3DF0A 3H7YA 3MGUA 4Q27A 1ASJ1 3WUCA 2MEV3 3UJOA 4OZXA 3N4MA 3ZFEA 2BBVA 1PIV3 1JTZX 4CDWB 3MIBA 1ZBA3 4UW4A 2BNOA 1SBEA 2ARXA 3MDPA 5JIAA 1AR73 2DF7A 2PLV1 4CRQA 5KXDA 1VIWB 3KD4A 1DGRN 1KFXL 3MEPA 3B94A 3GHMA 5JCTA 2E7QA 2A70A 2ZKLA 3N7MA 2QCSB 5BNNC 1RVF1 4RR3B 3ZYRA 2DVDA 2WZR3 4Q2FA 2OVUA 3WHTA 4HZFA 1MEC3 4I3GA 1WMFA 5I8TA 1DQ0A 1TME2 3ME2A 2D7FA 1MACA 2RS53 2UWCA 4PQ9A 1VJ2A 4MXVA 2P34A 1C28A 4XMAA 2IC1A 3GBGA 3ZFEB 2XG3A 2R49A 1Q8OA 2JJ6A 2DUQA 3VBSB 2XL7A 3APBA 1S0GA 3GZUC 4IEVA 3MF9A 2DU0A 4XFIA 5JDBA 2PHTA 2SLIA 3DN7A 4XQ4A 1S2BA 3KS7A 3TWIA 1HRV3 4UW6A 4MH0E 3HWJA 4Y1XA 2D3RA 4G4FA 1V9U2 1WBFA 1VALA 2D3SA 3LB9A 3NO8A 1AR91 1BVVA 4B4QA 4WZFA 1S2KA 4PDWC 4YGEA 1RUG3 2EAKA 2Q5TA 3IDBB 1WBLA 2DWRA 4RGGA 1PVC3 2VH9A 4RA0A 1XYOA 1H30A 4S2HA 1EPZA 1SFYA 5F6LB 4DY5A 1AJOA 2RS12 5T5LA 3VHRA 5CA6A 4Q0QA 4LUKA 1U5IA 4A7YA 1EAH2 2A7AA 3OD4A 2WA4A 5D8AC 1UU6A 1V6NA 5IUQA 2JECA 3GZTB 3WP5A 1YI7A 1WW5A 3I59A 1RUE3 3BALA 4IEQA 2NPIA 3W9AA 4YM2A 4ZU7A 1ZNPA 3ZYIB 4B4PA 1B09A 4HETA 3O0WA 3WQ7A 3AZWA 1F8VA 1MS8A 2ES3A 2EXIA 2EXJA 1COV3 5FPZA 1QU0A 3USSA 1TME1 2Y26A 1XXNA 1FXZA 3ZN6A 1FYUA 4X8NA 1BZWA 1C1LA 1ASJ3 3LKJA 3THTA 4QPYA 1LOGA 1Q5OA 1JW6A 3E97A 3RS6A 4JRAA 2XUMA 4LO6B 4H55A 1RUNA 5L7OC 2NQYA 1GQGA 2PLV3 2ET1A 1ULFA 1SBFA 4QXKA 3ZXDA 1SDWA 3BPZA 1PGW1 3I59B 1JHNA 1IKPA 2VQAA 5DZGA 4YW1A 1JXNA 3EQEA 3WW2A 4H3WA 2DURA 1REFA 4OHVA 2GC3A 3M3OA 1RVF3 3WQ0A 2DVGA 4K6BA 2ZX1A 2VVFA 2PHFA 1QJU2 4WM8A 3ZN6B 1PK6A 1XE8A 3UL2A 1WA4A 4XZPA 1D0HA 1NE4A 2JG9C 2Z2SB 3OYWA 1OSGA 3NWKA 3UK9A 3FUQA 1V6KA 1H4GA 4AWDA 1BEV2 1JN2P 1VR3A 4IV3C 2E7TA 4JGYA 1EAH1 2PHXA 2ZGRA 1JUHA 3ZPYA 2A6WA 4MGIE 3ZIWA 4FPLA 3RYPA 4Q0PA 2DCTA 5CG8A 4YGCA 5GZCA 4GH4A 5KC5A 3K48A 3L9JT 5BNQA 3DPRC 3HMYA 2ZGLA 4Z8BA 1AR93 3ZDSA 4KBBA 2BVBA 1PVXA 3N3HA 1PK6B 1DDLA 2QFEA 5J3UA 2VULA 4QPGA 3OYWB 4WVZA 3P3PA 2GC1A 3ZSLA 3ZXKA 5FQ0A 4H7MA 4M3CB 3ZMNA 2E9QA 4GIQA 5AFBA 1UW8A 4LBOA 1JH5A 4O9EA 3ILFA 3PVBB 4Q4X2 2LTNA 3M3QA 2JICA 2XBO2 2D93A 1C5HA 4D94A 1MVQA 1QNYA 1RUF2 2VOKA 4FO9A 4R52A 1MZEA 3CO2A 2VGDA 4FAHA 1RIRA 1E57A 4L2NA 2OA2A 3OY8A 3SITA 1NXD1 4GB33 1LKNA 2LALA 4K21A 1ONAA 1N1SA 2ZX2A 2YROA 3AYDA 3PLQA 1VRH2 1UN1A 2D6KA 1TEIA 5BNPC 4HFSA 1QJU1 3ES1A 4GMP1 1SLCA 4EJRA 1OI6A 2DTWA 4QPIA 2QDRA 2JDZA 5GZDA 4YW2A 1J3QA 1AVBA 1W6NA 2WSUA 5DZFA 5FQ0B 4AI0A 4CDQB 4YVSC 1Y7BA 5C9AC 4LO8A 5H9SA 4EN9B 1QH7A 3B00A 2HWB3 1C5IA 1Q8QA 2KM2A 4BQ1A 3H0OA 4YGDA 1X8EA 1GSLA 1J3PA 1ULEA 4LA3A 4IEZA 4U36A 4AHXA 2PN5A 2NP0A 1YFWA 4EWAA 1NLRA 5GJ6A 4W6XA 4RFT0 1RUI2 4U2AA 2UWBA 4NWWA 1AJKA 3WCSA 3OY8B 5SV5A 1UZYA 1AXZA 4I01A 4W6WA 3QBQA 2D3PA 2FZ1A 4N9HA 3RPQA 4P9YA 3UV9A 1ZRCA 1AXKA 1YHFA 3AZYA 1XNBA 4YSFA 1DQ1A 2GH2A 1D2SA 5JWPA 1W6QA 3AMMA 1C8M2 4YG6A 3R6SA 5C8CC 4CEYC 4GXLA 2VOWA 1DGLA 1LHOA 3AMQA 3HBZA 4WM7A 1UU5A 1TMF1 3VV1A 4AQSA 2WJSA 4Q4X1 3JB4C 1OOPA 2XBO1 5KXCA 2VNOA 4XJAA 5J7MA 1O4YA 4Z07A 1U0AA 4GA9A 3VBUC 1VLNA 2WNUC 3NKGA 1PO21 2YV8A 1WCSA 3LCPA 5AVAA 4B8EA 4BE3A 4HKOA 1R1ZA 3KT4A 2ZGUA 1VBA2 1YIPA 4LHLA 4M01A 4MUVA 1GZWA 2F6BA 3IWZA 4MV2A 4AGVA 3KT7A 3J8F1 4Y22B 3TYJA 2XLFA 1VRH1 3WT3A 1CQ9A 3POYA 4E4ZA 2E6VA 4AVTA 4GMP0 3SISA 4ASLA 3VLBB 2PAMA 1CGPA 1H1AA 1W6QB 3HD8B 4FSJA 4ES9A 5BY5A 4AXOA 2ZAAA 5F1RA 2XJSA 2N7GA 1EV12 1DZQA 1G7YA 2ZX4A 3CF6E 4WM7B 4N43A 1BXHA 1AL22 3BOPA 2ZGTA 1R092 4AK3A 1OOPB 2XWJB 4YW3A 3SCFA 1S0FA 2YGLA 4XEZA 5AVPA 1FOD1 1NY72 3B9CA 1KDKA 2TNFA 2VW0A 4UW3A 1JBCA