2RR11

Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
273
structure length
273
Chain Sequence
TVASISSGPKHTQKVPILTANETGATMPVLPSDSIETRTTYMHFNGSETDVECFLGRAACVHVTEIQNKDATGIDNHREAKLFNDWKINLSSLVQLRKKLELFTYVRFDSEYTILATASQPDSANYSSNLVVQAMYVPPGAPNPKEWDDYTWQSASNPSVFFKVGDTSRFSVPYVGLASAYNCFYDGYSHDDAETQYGITVLNHMGSMAFRIVNEHDEHKTLVKIRVYHRAKHVEAWIPRAPRALPYTSIGRTNYPKNTEPVIKKRKGDIKSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
publication title Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses.
pubmed doi rcsb
source organism Human rhinovirus 14
total genus 44
structure length 273
sequence length 273
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1988-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2rr1100
4CEYB 2WLPA 4RHV1 1BEV3 4WM7B 1BEV2 1PIV1 1ND2A 1AL23 2Y26A 1MQTA 5A33B 3VBUB 5FOJB 1BEV1 3FBMA 4CDUA 1F2NA 2R043 2R042 1NY71 1ND2C 1AYN1 4WM8A 1MQTC 1RMU3 1VB2A 1GFF2 1RMU2 5DDJ3 2R041 5DDJ2 4CDUC 2DF7A 4CDQB 3ZFFA 1VRH1 5ABJA 1MEC3 1VB4A 3VBOB 5C4WA 4WM8C 1VBC3 1VBC2 1TME3 1TME2 4GB33 5CFCA 1R1A1 4GB32 1C8NA 3ZFFC 5ABJC 2FZ2A 5C8CA 5C4WC 1AR81 1TME1 4QPGA 4N43B 2HWD2 5CFCC 5GKAC 5C8CC 1PVC3 1RUJ1 1PVC2 2GSYA 4CDXA 2HWD1 2HWC3 4QPGC 2XBO3 4RQPB 2XBO2 3J8F1 2WWSA 1PVC1 4FTEA 1A6CA 1VBA3 1VBA2 4CDXC 4IV3A 1PGW1 3CJIA 1OOPB 3JBG3 1POV3 1AR91 3JBG2 1VBA1 4CDUB 1ZBE3 1ZBE2 1D4M1 4Y5Z0 2ZZQA 1NCRB 3JBG1 1HRV1 2BPA2 4IV3C 3CJIC 3JD73 1ZBE1 4SBVA 3JD72 5BNNB 3VDDB 1AUYA 1RUF3 5LK7B 1RUF2 3ZFFB 1NA1B 1R083 5C4WB 1R082 1ASJ3 4GMP1 1ASJ2 2MEV3 1RUF1 2MEV2 5JZGA 2HWB3 2X5IA 2HWB2 1ASJ1 1HXS3 4CEWA 5C9AA 1HXS2 2MEV1 2FZ1A 2ZTNA 4QPGB 5JZGC 1RHI3 2X5IC 4Z92B 1W39A 4YVWA 5C9AC 4CEWC 2VQ0A 2WZR3 2WZR2 2PLV1 4PDWB 4YVWC 1EV11 1RUI3 2WZR1 1RUI2 2BFUS 4RS5A 1ZBA1 1NCQA 4NWWA 1BBT3 1BBT2 1RUH2 1FOD3 4Q4W3 1FOD2 4Q4W2 1C8M1 2RS11 4RHV3 4RS5C 1BBT1 4RHV2 2WFF1 1RUH1 1NCQC 1H8TB 1X33A 1F8VA 1B35A 2QQPA 5BNPA 1Z7S1 4YVSA 1OHFA 5JZGB 1AYN3 1NY72 1B35C 1AYN2 1R091 4JGZA 4CEWB 5C9AB 4Y4YA 1NOVA 1VRH3 5BNPC 2XPJA 1HRI1 1VRH2 4YVSC 4JGZC 5A32A 4BCUA 1HX6A 1VAKA 1R1A3 1R1A2 2RS52 1WCDJ 5J96B 1AR83 3TN91 4FSJA 1AR61 1AR82 2RS51 4AEDA 4NWVA 4RR3A 1NCQB 1V9U1 1RUJ3 1RUJ2 2HWD3 2GH8A 1RUC1 3J8F3 4AEDC 2BBVA 3J8F2 4RR3C 4GH4A 1B35B 1PGW2 3ZFGA 1AR93 4Q4X2 1AR92 1IHMA 4FTSA 1ND2B 2RR13 2HWF3 5K0UA 2RMU1 2RR12 1D4M3 1FPN1 1MQTB 2HWF2 4JGYA 1D4M2 4YVSB 4Q4X1 5BNOA 1HRV3 4GH4C 1HRV2 5J98B 1QJZA 3ZFGC 2HWF1 2RR11 5CFDA 5K0UC 4WM8B 3VBFA 4JGYC 5BNOC 4GMP3 2ZAHA 4LLFA 5ABJB 5A32B 2R071 5CFDC 1K5MA 1EAH2 4QPIA 3VBFC 3JB4C 1RVF3 1VBE2 1QJY3 1RVF2 1QJY2 1EAH1 5CFCB 1COV3 5D8AA 1COV2 5C8CB 1VBE1 1K5MC 1RVF1 4RR3B 1QJY1 4QPIC 1CJDA 1ND3A 1COV1 1PO13 1PO12 5AC93 5D8AC 4WM7A 4Q4Y1 5AC92 2PLV3 4EJRA 2PLV2 1EV13 4CDXB 1EV12 1PO11 1ND3C 2HWE3 5AC91 2HWE2 1ZBA3 1PGL2 1ZBA2 4WM7C 1CD3G 1QJX1 1SMVA 1QJU1 5FMOS 2HWE1 1PGL1 4IV3B 3CJIB 4JGYB 1C8M3 2RS13 1FMD3 4FTBA 1C8M2 2RS12 2WFF3 1BMV1 1FMD2 1VBB3 1RUH3 2WFF2 3IDEA 1VBB2 1DDLA 1OPOA 1FMD1 3VBOA 5CFDB 1VBB1 3VBFB 1RUD1 1QQP1 2R061 1Z7S3 1Z7S2 3M8LA 1R093 2TBVA 3VBOC 1AYM1 1R092 1POV0 4QPIB 5FMOL 2BFUL 2RM23 4N43A 2RM22 2X5IB 1HRI3 1HRI2 1RUE1 2RM21 2RS33 2RS32 1PO23 3LOBA 1PO22 4N43C 4RQPA 4YVWB 2RS31 3TN93 1M06G 1PO21 1AR63 4Q4V3 3TN92 1AR62 4Q4V2 2RS53 1AL22 1OOPA 4RQPC 2BUKA 1V9U3 4Q4V1 1V9U2 1AL21 4IV1A 1E57A 1NCRA 4RS5B 1RUC3 1OOPC 1RUC2 5BNNA 4CDWA 3HAGA 3JB8A 3VDDA 3VBHA 1RUG3 4IV1C 3ZFEA 1RUG2 3S6PA 1NA1A 3NAPA 1RMU1 1NCRC 1MEC2 5DDJ1 1RB8G 5BNNC 1RUG1 4CDWC 2RMU3 1FPN3 2RMU2 1MEC1 1FPN2 3VBHC 1AR73 4Q4X3 3VDDC 1AR72 3ZFEC 1NA1C 3NAPC 3ZXAC 1VBC1 3VBRA 5BNPB 1AR71 4GB31 4N53A 4JGZB 1TMF3 3DPRA 1TMF2 3VBRC 3VBSA 2R073 2R072 2HWC2 4N53C 1TMF1 4PDWA 5L7OA 3DPRC 1EAH3 2HWC1 3VBSC 2XBO1 2IZWA 1VBE3 5ACA3 5ACA2 4PDWC 4IV1B 5L7OC 4AEDB 1POV1 4Q4Y3 5ACA1 4Q4Y2 1H8TA 4CDWB 4CEYA 3VBHB 3ZFEB 3NAPB 3JD71 1AL0G 1VBD3 1VBD2 1QJX3 1QJU3 5A33A 1QJX2 3VBUA 1H8TC 1QJU2 4GH4B 4CEYC 1R081 1NG0A 3ZFGB 1VBD1 1BMV2 2WS93 2WS92 5K0UB 3VBRB 2HWB1 3VBUC 5BNOB 1HXS1 4N53B 1RHI2 2WS91 1RUD3 1RUD2 1QQP3 4CDQA 1QQP2 2R063 3DPRB 2R062 3VBSB 1RHI1 4RFT0 1AYM3 1AYM2 1X36A 4CDQC 5L7OB 1K5MB 1RUE3 1RUE2 1RUI1 5D8AB 4GMP0 1PIV3 1HQNA 1PIV2 1ND3B 1FOD1 4Q4W1
chains in the Genus database with same CATH superfamily
4CEYB 2DFBA 1WCSA 2WLPA 5SV8A 1BEV3 1W90A 4FP2A 2OPKA 1I5ZA 3R0RA 4LULA 4PLMA 3LA7A 4C90A 1H9WA 4I09A 1U5IA 2F6BA 1MQTA 2A1XA 3AP9A 2VCAA 5A33B 1UY1A 2SLIA 2YFZA 5FIXA 1BEV1 1Y43B 3KT7A 4LBJA 3A22A 3SCHA 3GNEA 3S5QA 2NP0A 4CDUA 3C7EA 4XF1A 5FXZA 4LA2A 3RI9A 2DVBA 4M4RA 1LAJA 3C3VA 1UZVA 4O9EA 4LOSA 3WDVA 4I3PA 2K46A 3L9JT 4WVZA 5DDJ3 3LEIA 1Q8OA 2J1EA 2X09A 3H7JA 3PVEA 1DU3D 2IXHA 2ARXA 4Z82A 2EVXA 1YI7A 3N4MA 2AC1A 4GWJA 4YW2A 1G9CA 2JDMA 2W91A 1BVP1 3BGAA 1IPKA 4Y20B 4CCCA 2QUOA 4I01A 2GZWA 5FPVA 1TME2 1FI2A 1C8NA 4MH0E 5GZDA 1OFSA 2VJXA 4LIVA 5A6YA 5KHGA 3OGVA 5FP8A 2WYFA 1AX0A 2JD9A 2BWCA 4NHMA 1NLSA 3AMPA 3NV1A 4OQ9A 3IDAA 3PURA 4CCLA 2VTXA 4UF0B 3VZKA 3QCWA 2JENA 3RZKA 2BOJA 2WWUA 5K4LA 3GF6A 5L9RA 4BJ0A 2P2KA 4DUXA 3T1LA 1PVC2 1QU0A 3VD5A 3O1VA 2HWD1 3ZSJA 1LHNA 3D6EA 4AYUA 2VBPA 2I74A 3NJYA 3Q8EA 4CRQA 4RQPB 3FHAA 5DUUA 5T5JA 5F6KA 1RIRA 2XBO2 3V64A 2FCTA 4AQSA 5IVJA 2G19A 3E6CC 4FTEA 3GALA 3CDZB 2WT1A 4Q1PA 1QMJA 3AZWA 1W0OA 4MGZE 1N47A 4CDXC 4ZY9A 4IV3A 1PGW1 3FJSA 1OOPB 3GJAA 3NO8A 3ACIA 5IJRA 4QQOA 1AR91 3A4UA 3HEIA 2VOXA 4CXYA 4WZFA 4CDUB 4OI0A 4JAAA 1URXA 1NYWA 3LDBA 3NNGA 4QWNA 2UU8A 4BDVB 1UIKA 2Z5WA 1WLCA 1WMXA 4P9WA 1GNHA 2YC4A 2ET1A 3MIHA 3AZZA 1UU4A 2JDZA 3I2JA 4OHXA 3OBTA 4SBVA 1ZA4A 3VDDB 1L7QA 3VUOA 4GWIA 1R083 1S0BA 1ASJ2 3NQHA 4LORA 2MEV2 1I3HA 5JZGA 1UW8A 4FFGA 4QHBA 3WEZA 1YQ6A 1JTZX 1HXS3 4CEWA 4ZZ8A 2FZ1A 1DGRA 4ATFA 5JMCA 4DOUA 4NIIA 4J1WA 4QXCA 3CEWA 2CYFA 1UQXA 1DLCA 1RHI3 2GC0A 4LHNA 4RL7A 3SLIA 4DEQA 1VPHA 3OD4A 3ST7A 2WABA 4YZ4A 1JODA 3WDWA 4AQ2A 1WW7A 1XB9A 3WSOA 5IVYA 4BQ2A 2C0ZA 2WWJA 1AJKA 2QFEA 2D3SA 2Q1ZB 4D7YA 5FP4A 1H1MA 2XHNA 2WZR2 1K45A 4YM3A 3I49A 5E1RA 5BY5A 5FP9A 5FZ9A 1RXFA 4JKKA 2DWRA 2AR6A 3OUIA 2P4EA 5K9YA 1RUI3 2E7TA 2A6XA 1D2SA 2AEZA 2IC1A 1AJOA 4RA0A 5F5IA 5KWRA 3K3NA 3EB7A 2IVJA 1ULOA 4TZDA 4YZ3A 1AXKA 1RUH2 1FOD3 3J4UH 5FLHA 3AFGA 3ITQA 2A70A 5SV5A 1HB2A 3B3QE 4RS5C 4BIOA 3PVOA 1R1ZA 2WFF1 2VL4A 4HFSA 3ZXGA 4ZZ5A 5FO8B 1NCQC 2XJQA 2DCYA 1W06A 3RDIA 5JI7A 4QPYA 2P6HA 3MUY1 4BHPA 5C5TA 2VUDA 3AKRA 3IIAA 5FMCA 4XOGA 4CXWA 2ZGMA 1WW6A 3GZEA 1IOAA 4GWNA 1DG6A 1D0GA 1UN1A 4NRQA 1WBFA 3DN7A 2FDIA 1W8FA 1LHWA 2VMHA 2E26A 4FO9A 1S0IA 5JZGB 5F2WA 5I0DA 3WUDA 1AYN3 1UL9A 1YI9A 4XJUA 1QH7A 3ORJA 5FY9A 2P17A 1F4AA 3B9IA 1PK6C 1L7LA 1QNYA 4CEWB 1BQPA 3I97A 3SH5A 1PMIA 2E31A 4NAOA 4LBOA 4XDPA 1VRH3 2V4VA 1ZRIA 2ZGRA 1HRI1 4BQ4A 5CG9A 5H9PA 3VL8A 2RG4A 4R9BA 2Z42A 1DHKB 1O7FA 2PMWB 2WNVC 4KBZA 3O5SA 2A3XA 1WWYA 1YFYA 3VB9A 4AFBA 5JR7B 4HN0A 1JYIA 4W6WA 1R1A2 3ZDSA 2EIDA 1SG3A 5J37A 1QH6A 1QXRA 3WNLA 1RL3A 1GQGA 5T3NA 4FOWA 5J96B 1QOSA 3LIGA 2ZGSA 3SITA 4JDMA 4XMAA 3AMMA 1MZ5A 1O6UA 4QKDA 4AEDA 4CYDA 5J09A 1E5SA 2A6WA 1UY0A 2VY0A 3IMMA 3KSCA 4OFGA 4P9YA 3WNXA 4LBLA 5IUQA 1GP4A 1PGSA 1RUJ2 3ZKUA 4AZZA 4R52A 2OPWA 3IN9A 4BZ4A 3GZUC 4MGQA 1SBDA 2YG0A 3AKQA 2XONA 5DUVA 1AXYA 4OMCA 4BQ3A 1V6MA 3WW3A 2WIIB 2R0FA 1MVEA 2EICA 4LBQA 5L73A 4BMBA 3WP6A 4FTSA 1UYZA 2VW2A 3T30A 3ECQA 1CAXA 1ND2B 3K3OA 4R4ZA 1FPN1 2CY6A 4WVVA 4JGYA 1D4M2 2VMGA 5IFPA 5FKCA 4GH4C 5FUIA 1WGPA 2OS2A 2ZCWA 5FZ7A 3WF3A 2QDRA 3IWZA 2XB6C 3NKTA 4TSVA 4XDQA 2GP5A 1RGSA 4LOTA 5CFDA 4S2HA 4DPNA 3S5AA 3MIDA 4IEXA 1N1YA 2D6NA 4DZGA 1GNYA 1LJ7A 1BYHA 4EQVA 4OZXA 5DUXA 4BOWA 5LK5A 4GMP3 5BNOC 1SACA 3T08A 3P1IA 2HBUA 3K51A 3Q8AA 3D8CA 2W1WA 3KD4A 4DUVA 2R071 5ABJB 5JLVA 4QMAA 2R16A 2BOIA 5FFOC 5FJKA 4QQHA 1WW4A 3AP4A 3CNAA 2PTMA 4YRDA 3W5MA 2ATFA 5IATA 4Z07A 1VBE2 2CGPA 1LU1A 3WV6A 3JUUA 4QB2A 5A3WA 3MLKA 1W2OA 5A1LA 1JYCA 3K46A 4YW3A 5FZIA 3HNYM 2SBAA 1K5MC 3BU7A 4OULA 4QPIC 4I30A 1JI6A 2XVGA 3D3AA 3N9OA 3ZYJB 1QIQA 3T3YA 3FUQA 2BBAA 1M4WA 2FDJA 4LEJA 4YM0A 4DNYA 4N7IA 5I91A 5D8AC 4GXLA 3VZOA 4R9AA 2PLV3 4EJRA 2VOVA 4XUOA 3SKVA 2J7MA 1RITA 1S0EA 5F5QA 2DCJA 2YUEA 3THDA 5FUPA 3H1WA 1X9PA 2HWE3 3M3IA 3OPZA 3TNPB 2V73A 5KBFA 5KXDA 1VMJA 4IERA 4WM7C 2XLFA 3M3OA 4LKEA 1UYYA 5FMOS 4E4HA 1XU1A 2HWE1 4D7TA 1JZ2A 1ST8A 3O1RA 5GZGA 4JGYB 5IK4A 2RS13 4PLOA 1C8M2 2LROA 5FTTC 2Y6HA 1H30A 2NZ9A 4UFHA 3GM8A 5A3TA 3BI3A 1TVGA 1HV0A 1WD3A 3GBWA 2YGLA 1OPOA 3PUHA 3B02A 4GJZA 5CFDB 1XYPA 2XWJB 1WLTA 1W2TA 3X29B 4UBHA 3UETA 4CPBD 5ISLA 1RUD1 3AMNA 4TWTA 2YB7A 1VIWB 4ZS3A 5FZEA 2EXHA 2YPJA 2WFPA 3ACFA 4LHSA 1W6QB 3ZIWA 2ZHNA 4JC1A 4JVAA 5KHHA 1Z7S2 1H0BA 3U07A 4B4RA 1YUDA 3KM5A 4BPZA 4CP2A 2VNRA 2VCCA 1SPPA 4BYYA 5F32A 4I0BA 1T6BX 1LESA 4P08A 2X5IB 2D6OX 4U2AA 2CSGA 4C0BA 4KH9A 4H55A 3ASIA 4AVSA 1XQNA 3WCRA 2GAUA 4AOCA 5A1AA 2JDKA 2RS33 4XAAA 3H8XA 2QQLA 4LBKA 1QXJA 2VO5A 4Q0UA 3RQ0A 5DAPA 1YJKA 2WNEA 1GP5A 3HJRA 4NIGA 1FV3A 2RS31 4ZHNA 5LBBA 3TN92 3O1SA 2OQ6A 1H2KA 1AVBA 2BP6A 3DKQA 2RS53 4Q4V2 4AQTA 2WO3A 4D7SA 1W8HA 2BERA 3AYCA 4QAWA 5C3QA 3LZZA 5FKBA 2CAVA 1V9U3 2A75A 3PIJA 4CUAA 2WDBA 4NAMA 4XFHA 4XXPA 3ZMNA 3MW4A 4YW7A 2CU5A 3RI8A 2C9KA 3U4SA 3POJA 3T0AA 1Y7BA 5IAXA 5KHJA 3DUIA 2WNUA 2Y6KA 4PHZA 3JB8A 1JYXA 3QLQA 2RDSA 4RGAA 2WR9A 3P3PA 1RUG3 2WAAA 3UGGA 2V5YA 2ZHKA 3I3DA 3FMGA 3LGRA 4COUA 3M3QA 4BA6A 3LDRA 4I3GA 4IUGA 4YW4A 5BNNC 1RUG1 1HJGA 4LK7A 1OXCA 2RMU2 1MEC1 4LUKA 4XIOA 4Q4X3 3VBHC 2ENRA 5C7GA 5FYUA 3R6SA 5E16A 1NA1C 3MZHA 1LOAA 3E6BA 2WL1A 3ZXAC 1SPPB 1K12A 2Y6GA 4LLOA 4QGMA 3KT4A 1F5JA 1IG0A 4A44A 4URAA 4YGCA 1BK1A 1E5IA 2P34A 4JGZB 2Y0IA 1KJRA 2XG3A 1NX9A 4ZPIA 3DPRA 2Q0AA 3WF2A 4ES9A 2PFWA 3HWJA 4AAXA 3VBSA 4COYA 3WQ1A 1HB4A 1OH3A 1B09A 3I2HA 4KU8A 4DRVA 5CYYA 4PDWA 2VMFA 2XR4A 5DG1A 3AVSA 5ERLA 5L7OA 4DO0A 4A7YA 2W95A 5LWBA 3H8UA 3RRDA 2XBO1 3I59A 4Y3OA 3VD3A 4YM2A 4P02B 2YBSA 2Q8OA 4YYOA 5ACA3 1US3A 4OHYA 2VZQA 2OA2A 5LBFA 1POV1 2B7YA 4XBQA 2XOMA 5CNAA 4Q4Y3 1OURA 2G9GA 3SCFA 5ACA1 1JYTA 1LHOA 1KQRA 1GKBA 1H8TA 2X29A 1XE8A 3U14A 2BEOA 2D7FA 4H14A 5FZ6A 1UOBA 1X50A 2A71A 1YIPA 4Q29A 5CU1A 3USSA 3O1UA 2O1QA 4HOOA 1WZXA 2IFRA 4LO4B 4BQ5A 4E8CA 5IK5A 2ID4A 4D94A 1NT0A 5HXMA 2JG8A 1MS3A 4K21A 3WNPA 1JZ6A 3KVAA 4LMFA 5FWEA 2HKXA 2ZKNA 3S7IA 1BMV2 2ZEZA 2WS92 3N9PA 4ATEA 4NRMA 4YM1A 4AVTA 3VBUC 3FC0A 3MICA 2WAOA 4QX2A 3ZDVA 2VR4A 4OQ8A 1RHI2 2ZX2A 3N9NA 2D3RA 3FZ3A 4W8JA 1IS3A 1QQP3 5FRAA 4Y26A 1UZWA 3DPRB 4JKMA 2E51A 4A45A 2R062 2VNOA 3VBSB 4Q27A 1C3HA 3WNNA 4DINB 4KBBA 4HZFA 2ZGOA 2RHPA 4JTNA 1AYM2 2Q1MA 4AI8A 5FPZA 3KMHA 2Y60A 2PHWA 3NVCA 5JPNB 3WINE 3MPPG 4SLIA 4ISRA 1Q8QA 4NPLA 4CDQC 2FMDA 5FR3A 5L7OB 2PHTA 4K3UA 5JI9A 1XNDA 4LXLA 1O4TA 4CCEA 2IFWA 1U5XA 2B46X 1K3IA 3AZXA 3ZYIB 1YWKA 5DQ0A 1RYYA 1QHDA 2IXIA 2AH2A 3M3CA 4GZ9A 1PMHX 2ETEA 3WY6A 5I8TA 1UIJA 5JSOA 4AWDA 3ZYRA 1QOTA 5FZCA 4MGKE 1YHFA 4NROA 1PIV2 5LBCA 1HB1A 1EUUA 3WUCA 3ZXEA 4B3NA 1O8SA 3LSEA 2Y38A 1MS1A 1CAUB 3LAGA 3N7MA 3RWNA 3EMRA 1W9WA 2J1AA 2YBPA 4NMIA 2P6CA 4R9DA 1ZRDA 4P14A 4XFAA 2PELA 4ES8A 1AL23 1Y9MA 1MS4A 2Y26A 2JXAA 5BUVA 1PZ9A 1JHJA 1O4ZA 3PTYA 4TLGA 4A7KA 3UJOA 5FOJB 3O1TA 1RJ7A 3T0DA 3H9AA 4ASLA 2Q30A 2WZPP 5GZFA 2W94A 2R043 4E2SA 3S57A 4CU6A 2JDAA 4EN7B 3NRUA 3POYA 1W6MA 4DIQA 5DZGA 3N9QA 2ZX0A 4UFIA 1RMU2 4DS0A 4HKOA 2R041 4FAHA 3RZGA 1X8MA 3AL6A 2P37A 2VW1A 1Q8SA 1DCSA 3WP4A 3C8XA 2FMYA 3HBKA 3VBOB 4NIHA 4WM8C 3CO2A 4XZPA 2ZEXA 1UMHA 3AXDA 3PIGA 4LTAA 1VBC2 4AL9A 1BK0A 3MDPA 3N36A 5CKNA 4GB33 2JB4A 1R1A1 3ZFFC 5GM0A 5FLJA 5FYZA 1W8ZA 2VUCA 3CU7A 4FPFA 5C4WC 2WQ8A 3WQ0A 1OVPA 4IGQA 4IDZA 4N43B 3VZNA 3BVCA 1N1TA 4MXWB 1POQA 5CFCC 4F83A 2QZ2A 3IDBB 3LPFA 5C8CC 3BYWA 1I5PA 1RUJ1 3ZN5A 4CDXA 1IS4A 2RDQA 4QPGC 4X6QB 4XIKA 5A7OA 4J25A 5FYMA 5I0RA 4P9JA 2WWSA 3MV01 1BXHA 1K5JA 5LW9A 1VR3A 3CF6E 1VBA3 4DY5A 1O3SA 1V6LA 1J59A 2YFUA 5FZ1A 1Y9GA 3QD6A 5LA0A 2E7QA 4XUPA 2B42B 3JBG2 1W8NA 2DYCA 3VHNA 1VBA1 2QQWA 5HBAA 3WQ7A 1ZBE2 3A23A 1CAVA 1JH5A 1D4M1 2ZZQA 5T54A 1NCRB 1J1TA 2OKXA 1VJ2A 4TN7A 2ZEWA 3CJIC 3K77A 3UK9A 3LIHA 4KWUA 1IPJA 3NV2A 5CIRA 3JD72 2XJPA 4OI1A 1AUYA 2QQIA 1RUF3 3A0KA 4CSWA 3OG2A 5CG8A 5I0SA 5G04L 1DF0A 1SHWB 1W9SA 3DECA 4LBMA 2JDYA 5FZ3A 4CP0A 1EYBA 1RUF1 1W2NA 2HWB3 2ZZJA 4UFKA 3ZYGA 4AGGA 1O5UA 5J7MA 1CWPA 2ORZA 4UW6A 1L3JA 5GALA 4RGGA 3S0MA 3WOGA 3LD8A 3K4ZA 1HDKA 2XJRA 1UWWA 2ZA9A 5FYBA 3KV9A 4CU9A 2XVKA 4XXAA 2JG9B 2BZDA 2BDRA 2QDNA 1ULFA 1W39A 2PHUA 4D6SA 4QX7A 4W6XA 3ZR6A 4AAPA 2YV8A 1ZZ6A 4EZHA 1CZTA 2JDNA 2R1DA 5AVPA 3W21A 4WVWA 4YWAA 2UURA 4AFAA 2WN2A 3S30A 2HEWF 2VMEA 4IETA 3HT1A 1Y4WA 4YVWC 3ENRA 1YO8A 2QQMA 3OF1A 2FDGA 2BFUS 4MVTA 4RS5A 1QOOA 1UU5A 1XC6A 2WO2A 1NCQA 1YLLA 1XE7A 4BU2A 2YYOA 2UWBA 1BBT2 1LEDA 5C8WA 1QWRA 3N7LA 2DVAA 5J1XA 1ONAA 4Q4W3 2ZACA 4FOVA 1CAVB 5LRRA 4FOYA 1DP0A 2GNBA 1C8M1 4HKLA 2J1VA 3IB3A 4AFCA 4RHV2 1ZZCA 4F8AA 3APBA 3MF9A 1J58A 3O1OA 5J36A 4PF1A 4OUMA 3GZAA 3ZYFA 4CA9A 3F2ZA 3E5UA 1PK6A 2F4LA 2WKKA 3WG2A 2PXJA 3U4XA 2R32A 1UZYA 2KM2A 4RN5A 2QQPA 1E5HA 1Z7S1 2LTNA 3MYXA 4CZSA 3LA3A 2E33A 4PT6A 5L36A 4WBBA 4XVHA 3EJKA 3BPSA 5FBJA 1OC1A 2WNVA 4D0QA 5FPUA 2OX0A 4Y4YA 1J3QA 3W5NA 2YMZA 5LA1A 2W1QA 2WINB 4JDOA 3GCWA 3BALA 1NOVA 1KD7A 5GJ6A 2FD8A 3WP5A 3WF1A 4AI3A 5BNPC 4YVSC 2K2SA 5BV6A 1UOFA 2RVAA 2QQOA 4AHWA 4XF0A 1F31A 2XLAA 3ZN6B 2DUQA 1HX6A 3H3UA 4LPLA 1GMMA 1W0NA 1W6OB 2C5DA 4QKBA 3THPA 3VDCA 2RS52 3LOIA 1ZNPA 3WZ1A 4G9SB 3H3LA 1OMIA 1ZRRA 2YC2A 1ZZBA 3U1XA 4COVA 4LE3A 3TN91 2QJVA 4FSJA 1AR82 4DFSA 4PIXA 2P1BA 3UGHA 2XDVA 5A3MA 1UMZA 5IYYA 3VD4A 3GBFA 3OY8A 4B1LA 3CBNA 4RFRB 1NCQB 5FYTA 3W20A 2CDOA 3H3ZA 2VBBA 2HWD3 1UOGA 1SLBA 2HYXA 4QM9A 1QY4A 4J6GA 5FO7B 1GOGA 1N1VA 5KXCA 1LGNA 2WT0A 3J8F2 1GQPA 5EJ3A 4RR3C 1ALYA 3UESA 2D3PA 3VZMA 5JIUA 5IVBA 5A3NA 4GH4A 2XWBB 3SC7X 4LO8A 1AR93 2ARBA 4FPHA 4Q4X2 3VHOA 4XQ4A 5LA9A 1ZRFA 2AUYA 3LB9A 5A3OA 1HJFA 2RMU1 1MQTB 2HWF2 2RR12 4TYSA 5BNOA 4UAPA 2DBNA 2JJ6A 3IAPA 3Q9OA 1HRV2 4YNIA 5FP3A 4ZU7A 4XJ8A 4YW6A 3ZFGC 4EWEA 2AEYA 3EQEA 2JB8A 1G9FA 4Q1RA 3MEPA 1WMEA 4D3WA 1H2MA 5K0UC 3N7KA 1UZ0A 3OD0A 3HD8B 2Q5TA 1V6OA 5EZWA 1BVVA 5EYYA 3N35A 5EQUA 4EYUA 2BRTA 4LLFA 3VL9A 1OUSA 4ARYA 1F15A 3KT1A 4L2NA 5L19A 1K5MA 5FOBB 4CVUA 1XSRA 4GIQA 4QPIA 3VBFC 1DQ4A 3WVJA 1RVF3 4R4XA 1HV1A 2DU1A 1QJY2 2WYSA 2XHKA 2YGMA 3I2GA 1EAH1 3K4DA 3TEYA 5D8AA 1AX2A 1COV2 2GNMA 5IK8A 2JIJA 1RVF1 2VBDA 2JDHA 2UYAA 4NO4A 5IVCA 1DGWX 5AFBA 1OF4A 1S2EA 1KS5A 1WMDA 4MV2A 1ZZ7A 4M3CE 4XMIA 1PO12 1RINA 5D1IA 4WM7A 5AC92 4XAEA 4B7EA 3C7OA 3DKWA 4CCNA 5EV7A 1RTVA 4CUCA 1EV12 2P3IA 3POEA 4FFFA 1ND3C 3OSDA 5A80A 2KR2A 5CAZA 4ZU5A 4MGIE 3ILRA 1WBLA 4EE2A 1ZBA2 3DXUA 2D6MA 1CD3G 2W52A 1SMVA 3KCCA 5FY4A 1PGL1 4IV3B 5A6ZA 1FMD3 4FTBA 1BMV1 2WFF3 5F8PA 3MIFA 1VBB2 2VG9A 3HPNA 3PMEA 4OI4A 4D6RA 5C70A 3TEZA 5FY1A 5T5LA 2BNOA 4KNCA 2EAKA 1FMD1 5JCTA 3PU8A 4ZKTB 2C1FA 3MW3A 1SLAA 1D4VB 2O0OA 3POBA 4XFIA 4EWAA 5FQ0A 1Q43A 4LQRA 3UT0A 2R30A 4MZUA 2R061 1QJEA 4XCAA 3M70A 3M8LA 5FZFA 1EPZA 1C57A 5FYSA 3FUOA 1LHUA 1AYM1 1R092 2J1TA 4IEWA 5HI0A 4QPIB 5C3RA 2BFUL 4JZRA 3OGSA 2VVDA 3FLPA 1ODNA 2RM22 1VAMA 3T2OA 1HRI3 1PHMA 4MGTA 4Y5SA 1UU6A 5HCHA 1JXNA 5ANQA 1QNWA 5JOXA 3BTXA 4PLNA 2D43A 1PO23 3LEGA 4F3JA 4HBNA 4O9GA 5F1RA 1UPIA 4QB6A 3K75B 5IFTA 5EIYB 5A7WA 3PTRB 5FPLA 1SBFA 4GD4A 1M06G 1N1SA 1PO21 3OGGA 3WG3A 1NQJA 4FPJA 3IT8A 3LDKA 1ACCA 5L9BA 3PLQA 1S0GA 4ET7A 4Q8KA 1AL22 1ZYBA 1DYKA 2C6SA 2XVLA 3D0SA 4RQPC 1H9PA 5DAWA 2BUKA 2O8OA 4YLZA 5E88A 1JMUB 4K1YA 3MIBA 4HANA 5F6LB 3LQCA 2Z69A 1ENXA 2VZTA 3WNKA 1WLWA 2BNMA 3I2FA 1OLQA 4OUSA 4Y22A 5FAXA 2X53S 4K7JA 4EWDA 3L2YA 1OF3A 1RC6A 2XUEA 2XJVA 3RSJA 4KMQA 4Q8LA 1OOPC 4XJWA 1RUC2 3QH6A 1C1LA 4FPGA 5BNNA 5JSPA 5IK7A 2P3JA 5FJHA 3VBHA 3ELNA 4LKDA 2D5FA 3S6PA 5F39A 1NA1A 4YFWA 1PM7A 1RMU1 2ARCA 3LFMA 3AZVA 1US2A 2OUJA 3ALQA 1BCXA 3BOPA 3WD5A 2W87A 5F3CA 2YBKA 3B93A 1RB8G 1PX4A 3OGJA 1H8VA 4ZXEA 3UV9A 4CDWC 5A6XA 1FPN3 2LUWA 1UMIA 1GNZA 5DAVA 4GA9A 3VDDC 2J1RA 1J3RA 4META 1AR72 4AR2A 2ZX4A 4JQTA 4FPLA 2Q8CA 4B8EA 3VKMA 1VBC1 2GP3A 1QEXA 3BN6A 3LF7A 3HNBM 3UNPA 1IQDC 2LRPA 1CR7A 4XC9A 4UFJA 5AVAA 2XQXA 4L8QA 1N3QA 2GN3A 3PVBB 4HPKA 3LEKA 2ZEYA 3MLJA 3TBDA 5F5CA 1TMF3 3MIEA 3RYRA 1JOPA 1LHVA 4CCDA 2GC2A 2R073 4AGVA 1LULA 1XNCA 3DF0A 4GQ7A 2P3KA 1TMF1 3ZSKA 1NKGA 2CGOA 2VZ1A 4YZ5A 1UY4A 2EIBA 2HWC1 3KHCA 1LKNA 2DVDA 2IZWA 1W8UA 4FPKA 2JDPA 2QE3A 3ILFA 5EFUA 4DMIA 1HB3A 2Y33A 4AEDB 1IGOA 3R05A 4HSLA 4FFHA 1ULPA 4XURA 3ROUA 4CCJA 4COZA 1SFPA 2V72A 4NRPA 4QX8A 2HEVF 3HBZA 4GKYA 3VBHB 3AK0A 4IEPA 2ZGPA 4FBFA 2PQSA 3EXUA 4EN0A 2DCZA 3JD71 1AL0G 4LT5A 3AMQA 2WQ4A 2DCKA 1VBD2 4FXGB 4O61A 3SEEA 3MPBA 1QJX2 3VBUA 1QJU2 2DTWA 2YDEA 3VDAA 4IQPA 2CNAA 1NG0A 5TSWA 4LBQB 3ZVXA 1GV9A 1CGPA 2DVGA 5FPBA 4OHWA 4IEYA 2B9VA 1DFQA 4HG6B 1CX1A 2GNTA 3OB8A 1CAXB 1XJAA 1DQ6A 2C9AA 3EHKA 2VUJA 3VZLA 1UXXX 1EP0A 5FZKA 3WG4A 1A34A 2QKDA 1OD3A 3AVRA 3FFQA 4CUGA 1RUD3 4YG6A 2PHDA 4HPKB 4CDQA 1LOFC 2VCBA 5C3PA 1G7YA 3H1YA 4N9IA 4FI9A 1JS9A 4GALA 1H6XA 2RJ2A 5C71A 4QX0A 1KDMA 4P9XA 3AP7A 1H1AA 4YPJA 2QQUA 4XHXA 5T5PA 1FXZA 1RUE2 1YCIA 2VXRA 3HMYA 4MSVA 2A3WA 1YQCA 1S0CA 3V56A 2E6VA 2PAKA 4AEKA 4F7ZA 2VAUA 5T52A 1S1AA 3KGLA 4X8PA 2ZXQA 5FUNA 3ZO0B 2E7AA 4GMP0 3RWKX 4DXSA 1HQNA 2DDUA 1XXNA 3PJYA 4RHV1 2D6KA 2R1BA 4CP1A 3ZN4A 1BEV2 5DG2A 5BYNA 3GHMA 4NN0A 1WUVA 1DGRN 5FZHA 4WV8A 4DUWA 1X8EA 5A7NA 2ADEA 3VBUB 3FBMA 1MS5A 3KCYA 4QQPA 4A3XA 4YG0A 4D69A 3I3BA 2CL2A 5FXVA 4WVMA 4E8DA 3O14A 1FATA 3CZUA 2ZKLA 4IEZA 4BISA 1ND2C 4NR1A 4WM8A 4H3WA 3HIFA 4UI9L 2A5ZA 2DV9A 2YC0A 1VB2A 4UFLA 1GFF2 3DL3A 1DQ1A 1JZ3A 1DIWA 3IKWA 3TEWA 2QZ3A 5DDJ2 2DF7A 4NPMA 3TAYA 4CDQB 5KHKA 4AG4A 4XE9A 3BIWE 3ZFFA 3JZVA 1MEC3 1VB4A 1QKQA 4FP3A 5C4WA 4AGRA 3R4UA 5APAA 5EHDA 5F5AA 3RJRA 4Z2WA 1J83A 1MS0A 1G9BA 4XQWA 1E5RA 1TME3 4LO6B 3LFIA 5FZMA 4K20A 5CFCA 3GYDA 3CHXA 4KG0A 5ABJC 2FZ2A 3IPVA 1PZ8A 5C8CA 2JECA 3SKJE 1SBEA 1TNFA 3EO6A 4JCKA 1AR81 5DAQA 1TME1 4QPGA 2XL9A 1DYOA 2G9ZA 5F3GA 3D0JA 2FDFA 5FYVA 2HWD2 2NMNA 5GLZA 3MGUA 5GKAC 3FX3A 1V0AA 3ZXFA 5GLTA 5I8YA 1PVC3 2IXJA 2B45X 4X6RB 3HVDA 4HETA 1RUNA 4OYUA 1O3QA 5D2AA 4M3CA 4NOTA 2XBO3 2ZGTA 2D6PA 3I2KA 4Y24A 3J8F1 2E32A 1PVC1 1XSQA 1A6CA 1SEFA 1D7PM 1GWMA 1TG7A 2NPIA 1JZ8A 1J1LA 4D6QA 3FHQA 4S2DA 3CJIA 1ZRCA 4AE2A 1POV3 2D40A 2VD7A 1LOGA 4IE7A 4AK3A 4BWOA 4M3CF 3P5BA 3HT2A 1OVSA 5EXOA 3UYJA 5CKMA 3AB0A 4LE4A 1LRHA 4BMEA 3WNMA 2RJLA 1SCRA 4BLJA 2ES3A 2MPFA 1HRV1 2BPA2 5M0TA 4NHYA 4L11A 2VW0A 5K7PA 3KB5A 2VE1A 1W2AX 2WNUB 2BTVC 1GZCA 1WW5A 4FPEA 4I0AA 4AI1A 3C7HA 4IE4A 3ZFFB 4B1MA 3SCGA 4C1XA 2UY8A 5C4WB 1R082 2VOWA 1ASJ3 4W6YA 2MEV3 4BK4A 4EZ4A 2R7EB 3FLTA 1LTEA 4QDRA 2KXLA 3E97A 2QVSB 1Z78A 3DYPA 1XE0A 1DGWA 3QH7A 4V1PA 4A41A 1ASJ1 1CQ9A 3L2HA 1HXS2 3IPVB 2MEV1 2GNDA 4YGDA 5C3SA 4CE8A 2ZTNA 1C1FA 4OVEA 3ZXLA 4Q0QA 4QPGB 5CA6A 1KDKA 2B9UA 1W6NA 2CAUA 3O12A 2X5IC 2ZMNA 3ZYPA 5C5UA 2J1SA 4Z92B 5JAXA 1YQ8A 3A21A 3T1MA 4YVWA 5C9AC 4CP9A 5EYXA 5BPXA 4Z8BA 2JDUA 2VQ0A 1GU3A 3GZTB 1UKGA 2ZX3A 1OUXA 3TEXA 2BV4A 2WZR3 4NVPA 3POWA 4HK9A 1W05A 3I7DA 1N3OA 3RZZA 5A6QA 1OLRA 4PDWB 1GOFA 5EJ1B 3VHPA 1EV11 1JYWA 4AI9A 2WZR1 5JUVA 1RUI2 1KJLA 4RGKA 3I2IA 2V5DA 3IBMA 1V6NA 3UKTA 3I59B 4I2OA 1ZBA1 2KD7A 1UY2A 4KWLA 4NWWA 2WO1A 4MX3A 1OQ1A 5IHRA 2JE7A 3T2TA 4TTGA 5JOWA 1UCXA 1XRUA 2J22A 4EN8B 1FOD2 3PNAA 2Y0OA 3VD7A 1JOBA 1GICA 2OQ7A 4ORFA 1RUOA 3WXPA 2AYHA 1RUH1 3O7OA 4PQ9A 2ZAAA 4Y4RA 1HQLA 1H8TB 1V6IA 3WLUA 1MS9A 4RYDA 3TNQA 3USUA 1FV2A 1YYNA 3BTZA 2XQRA 5LY2A 1OH4A 4TLFA 3I4IA 3PDQA 5LRSA 1P8JA 2GMEA 3JU9A 1YRZA 3AP5A 5BNPA 5HV4A 3HQXA 1NUKA 4HVRA 3KGZA 4NJ4A 4YVSA 3U11A 1NQDA 4AEMA 1NY72 2JG8B 4LBQD 1B35C 1AYN2 1R091 2DU0A 3F95A 3S7EA 2CDPA 1FT9A 2YPDA 1S0FA 3B7MA 3ZSLA 2Z79A 3SEPA 5FMDA 1FYUA 1REDA 5IVFA 5JMOA 1VRH2 4FFIA 5L9VA 4XACA 5EWSA 4YARA 1SDDB 4A7ZA 3NNFA 4HVOA 3SISA 5J3UA 4JGZC 3B5LB 2C26A 3CJXA 4CP9B 2VMDA 4JKLA 4BCUA 1VRBA 4QGNA 1VAKA 4ZU4A 1R1A3 1Y3TA 3MIGA 2P5BA 1TE1B 3BODA 4NIAA 4DEVA 3G7DA 2ET7A 3LPGA 4LIUA 4OLLA 5GLVA 1RJ8A 1AR61 5FK8A 3ZPYA 4XDOA 1ULGA 5B2GB 2DURA 3SH4A 5F3EA 4UW5A 1KRIA 3AX4A 2X10A 4C1WA 4RR3A 1MACA 1OSGA 2ZPXA 3N3HA 4D8MA 3A7QA 3Q8FA 2ZBJA 1NAEA 1RUJ3 5FZAA 1C5IA 2E53A 2QTWB 4QXKA 4EROA 1KEXA 3I8TA 4LJHA 5B4NA 3T4VA 1RUC1 5I93A 3I2OA 2G1MA 5FP7A 4G4FA 3NSTA 5GZEA 2BBVA 5JIAA 4KG8A 4A6OA 3O1MA 4K1ZA 1UZZA 1ZA7A 1G9DA 3MFAA 5CEHA 3AKTA 4QGLA 3ZFGA 4LR4A 2QCSB 1JYVA 1JOJA 1WA6X 1N3PA 1YJLA 3G6JB 5K0UA 1QDCA 3H7YA 1Q8PA 1DQ0A 5F2SA 1D4M3 3ETPA 4YVSB 4JDNA 2PHXA 5FK7A 1CESA 5J98B 4FPCA 3EYPA 5DMYA 2UY9A 4A6SA 2AGSA 4XFCA 3RZLA 1O3RA 1SLTA 1UXZA 1OQDA 1VLNA 1W6MB 3GJBA 5DUWA 3WF0A 3VBFA 3U37A 4J1XA 1KFXL 3KQRA 3ZYBA 1H4HA 4YGBA 2ZAHA 3LCPA 4C91A 2OT7A 3UKVA 3H0OA 3SNMA 3LKJA 4FT8A 3AXEA 3FLRA 5T55A 2W46A 4BIFA 3V0BA 3JQWA 5FXWA 2RE9A 4MHRA 2MHFA 3DXTA 1JZ4A 2R49A 1X9TA 1OA4A 2ADDA 4M4PA 1OT5A 2EF6A 4UYBA 2XKOA 3GCXA 4N90A 2BGCA 2J1UA 3CZJA 3NV4A 4MHUA 5B4XA 3AFKA 4AVAA 2EXKA 2VVEA 4QU1A 1VBE1 1XU2A 3OOXA 3ES1A 4RR3B 4V2WA 3LE0A 1VE0A 1APNA 1CJDA 1ND3A 1AR62 4LHKA 2W2IA 4MLOA 3OBZA 4W4ZA 1AX1A 2CTVA 3Q8BA 1GZ9A 5JXGA 3BIEA 5LBEA 2PLV2 5IAVA 4CDXB 1BLZA 2HYKA 1S0DA 5D21A 4W65A 4OZOA 1I9RA 2HWE2 2UYBA 5FPAA 4IL7A 3VDBA 5DABA 1XOYA 5LA2A 3RNSA 1MR5A 1QJX1 3SH3A 1QJU1 1C5HA 4UT5A 1CX4A 1OLME 1HQWA 3J7LA 3OCPA 1JW6A 1C8M3 3NV3A 3ETQA 4QHZA 2D44A 4LO7A 2RS12 4BXSV 4XCBA 3IDEA 4FOQA 1XNBA 1DZRA 3TWIA 2W1SA 5CKQA 3ACHA 5I0UA 2DVFA 5A7SA 2A6ZA 1YC61 1YQ2A 4IE6A 1GWLA 3IMNA 2JEMA 3VBFB 5KHIA 2JIGA 4Y20A 4PI2A 3SHRA 1Z7S3 2ZJCA 1W9TA 1YIFA 2BYVE 3AJZA 3M4FA 3V0BB 2TBVA 2VZUA 3AYDA 3J7HA 3VBOC 4FCAA 3DV8A 1W6PA 4XFGA 1UPSA 4XF4A 2GMMA 1D0HA 5FYIA 3VN4A 4JQRA 4B7KA 1A8DA 4X8NA 4OUEA 2VNVA 4UF0A 2XXZA 4A42A 3BTYA 3W9AA 1RUE1 1OBNA 4HK8A 4LNVA 2RS32 3LOBA 2BGPA 3RVHA 3QACA 2BQPA 1I1EA 4N43C 5A3UA 3DYMA 4RQPA 1UOJA 2KA3A 3MF6A 3WDUA 2XGXA 3AZYA 2OVUA 2Y6LA 1V00A 3TN93 4K8RB 1AHSA 1RXGA 1ENQA 4Q4V3 1H6YA 4A4AA 3B94A 3HQUA 3ABZA 1OOPA 1G6NA 2VTFA 3J7NA 4N8MA 5F9TA 5JPMB 2HEYF 4K9SA 3ZR5A 4UW3A 2W3JA 3RMXA 4Q4V1 4E27A 1W28A 1V9U2 4LUMA 2N7GA 1C4RA 4MUVA 1JZ5A 3GGLA 1YFXA 1E57A 1GZWA 1Q3EA 2V09A 4RS5B 1BKZA 1OKOA 3U78A 2WNOA 4KQ7A 2JKBA 3HQRA 4PBOA 1KGYA 4CPBA 5FDBA 4CDWA 1H2LA 3WG1A 4PBPA 2Z4FA 4NHLA 4K8FA 3VDDA 3WP3A 4E2QA 1LOCA 4IV1C 1MZ6A 1RUG2 3PUAA 4ZXKA 1DQ5A 1NCRC 1MEC2 2VOKA 5DDJ1 1HW5A 1SLCA 1W3XA 1WCKA 5FZ8A 5A70A 5GZCA 4QDQA 1Q56A 3AYAA 2RMU3 4L97A 2HBTA 4UBGA 2VZVA 4ARXA 4EN6B 3M7AA 4Q0SA 5FY7A 1JU4A 2VH9A 3DEMA 3ZFEC 1PK6B 1REFA 3MV11 3NAPC 3KVBA 1W6PB 4M0NA 1LGCA 3H8OA 1TNRA 2A6VA 5ANNA 3KQ4B 2R6QA 3T2QA 3AP6A 2XL7A 1GQHA 3MHZA 4MYEA 2WNVB 1ZZ8A 4C8DA 4QXBA 2H0BA 5LASA 4Y33A 3VBRC 1GWKA 2AACA 2VQAA 3KV4A 4NIDA 1TZOA 1IG3A 4FPYA 4KWJA 4U36A 1OI6A 1ZM1A 3AYEA 4N53C 2JG9C 3OUJA 4OHVA 1W9FA 1BZWA 1JYNA 1A78A 4CTEA 2XJTA 1EAH3 3B9CA 1STMA 2IVIB 3OEBA 4LKSA 4FQZA 4AI2A 4UOJA 2LS6A 4AFDA 2H0VA 1YFUA 4UW4A 4AXOA 5ACA2 3IM0A 4YW5A 3W58A 4FXKB 2L9LA 3ZM8A 1GZWB 3OY8B 4L0PA 4XYXA 2VPVA 3H1MA 1UX6A 3RZMA 4Q4Y2 2B39A 3I3QA 3VKFC 1R64A 3FN9A 3POIA 1EPWA 4Q0PA 4XETA 1QJFA 2JWPA 4CDWB 1OKQA 5T50A 2WSUA 1HIXA 3RYKA 3C7GA 3KWVA 3ACGA 1CIYA 4MGYE 2AREA 5CB7A 4QPWA 2D93A 4COWA 2VZOA 3ZYHA 2BVBA 2ZGLA 4NUBA 4BQYA 2ORXA 3HN3A 4GH4B 4CEYC 4YZ2A 5CISA 3PL0A 1R081 2ZABA 1JUHA 4JX0A 3MBWA 4K40A 2BNNA 1LOFA 5KR7A 1OFNA 2WS93 3INAA 2RDNA 3RZHA 3QOPA 3MO4A 4R9CA 2WZEA 5BNOB 4MGSA 2IUWA 5A3LA 2VM9A 1HXS1 2BU9A 3UL2A 2W5FA 2WS91 1S0JA 1QQP2 2R063 4AW7A 1AF9A 1KS4A 2ZMKA 2UWAA 2X05A 2VQTA 3H8RA 1RHI1 2Y34A 5JXJA 1KXGA 4CU8A 3HR9A 1AYM3 2WSVA 2A3YA 4B4QA 5KC5A 2YU2A 2PA7A 1X36A 5EJZB 2JKXA 4BB3A 1QDOA 1REEA 1GR3A 5FREA 1K5MB 3VLBB 4XTPA 2K0GA 3AC0A 4CCMA 1G9AA 1W3VA 4CUBA 1RUI1 2YROA 2EIEA 1QF3A 2RJKA 3C2UA 3WDTA 1ODMA 4QQ2A 5D8AB 2XMLA 3V0AA 4LO5B 4HSJA 4L92A 4ASMB 1LOEA 4IGPA 3ZSMA 1CJPA 4ZONA 1PIV3 3JXSA 1C28A 2ZHLA 4N7UA 1FOD1 2VMCA 2YU1A 4IESA 1ULCA 3KS7A 2XKPA 5FO9B 1AXZA 1VMHA 3KF3A 4WM7B 4HN1A 3J26N 2Q8EA 3SMHA 1PIV1 2WN3A 5IW0A 1V6JA 4IEQA 2PQQA 1ND2A 5JR2A 1GUIA 4KU7A 1ZX5A 1O91A 4LKFA 4XFFA 2PAMA 3VV1A 4HLTA 1SLIA 3HOBA 3KV6A 1F2NA 4XW3A 1XYOA 1NLRA 1DLLA 4JHTA 3RG0A 1MS8A 2DFCA 2R042 1CN1A 2ZGKA 5FY5A 3KF5A 1G8WA 3RPQA 1NY71 1AYN1 1MQTC 1UAIA 2H6BA 2Q1FA 3AM2A 1RMU3 4OMDA 4S2GA 4CCOA 1A8MA 5F7UA 3IDCB 4H7LA 1JUIA 4CDUC 2W1UA 1PVXA 1JHNA 4XILA 4XJZA 2X8KA 1VRH1 1IZ3A 3NWKA 5ABJA 1LB2A 1JU3A 3TYJA 3RS6A 4UWDA 4HKWA 1VBC3 5FQ0B 5C3OA 3ZXJA 1PX3A 4PIYA 4PJYA 2CWMA 4GB32 2ILMA 2JE8A 1WMFA 5FZ4A 1W8TA 2C24A 3FE5A 1PNGA 4DXZA 3ZKYA 2A73B 1LECA 1CONA 1SDWA 3V0AB 4NE9A 1IPSA 2ZMLA 4DQAA 2GSYA 3I2DA 2GALA 2HWC3 5F3IA 2GN7A 3VKLA 2E9QA 4XJ9A 2IXKA 5A7WB 1CZVA 3K48A 2VNGA 2NN8A 1KITA 3JCIA 4MO3M 4BQWA 1UYXA 3U10A 1S4CA 4YGEA 1VBA2 3FFZA 1NXD1 4BLIA 3OPTA 4EN9B 3ZMOA 2K9ZA 3O0VA 1W8OA 2VZSA 3C7FA 3JBG3 2NMOA 3J9SA 4IE5A 1FNYA 4DXTA 1LOBA 3AKSA 3E5XA 4MG2A 1ZBE3 4H2AA 1LEMA 4LITA 1OLMA 4QKFA 2HH9A 4Y22B 3N9LA 3E6DA 2JD4A 3LWCA 4Y5Z0 5H9SA 4B29A 1OPMA 3JBG1 4YG3A 4BQ1A 4K6BA 4IV3C 1WD4A 4ZS2A 3JD73 1ZBE1 4GJYA 5BNNB 1WCUA 2VZRA 3DYOA 1W6QA 2TNFA 2W92A 2YZ4A 3MFCA 3KHBA 5E89A 5I8SA 5LK7B 1OQEA 1RUF2 2GMPA 4ISQA 1NA1B 3ZIXA 2QQNA 3AMHA 4GMP1 4AQ6A 4XUQA 1QGLA 1NLQA 1W0PA 3KLSA 1WCQA 1UKRA 2HWB2 2X5IA 3NJZA 1AZDA 4I0WB 1BJQA 2WQZC 5GLUA 5LY1A 3WW2A 5LEJA 5JVVA 5C9AA 2AZ5A 4PQQA 4AVVA 2NYYA 4AI0A 2NM1A 5CVRA 5KXEA 2B8MA 4IEUA 1OA3A 4A3ZA 2PN5A 3NKGA 5JZGC 2EXJA 3OBAA 5BNQA 1WLDA 2W9XA 2D5HA 1O3TA 3CKHA 4CEWC 5FZOA 2H6CA 1LENA 3BB6A 3D4KA 3NNJA 4QU2A 2PHFA 4IW3A 5IVVA 4XBNA 1K42A 4AVBA 4FPOB 4AHZA 1W8WA 1CPNA 1XNKA 4OI2A 2EALA 1ULEA 1GANA 1KFUL 2VUAA 2Y8KA 4MXVA 3U75A 1L7RA 2DCTA 3PJQA 2PLV1 2PHRA 3T09A 4XTMA 3MI8A 2WZ8A 2ZX1A 3THTA 4YW1A 3WF4A 4FVVA 3ATGA 4BM8A 1BBT3 2ZOEB 1YNAA 4YZ1A 1JZ7A 1YQ5A 1J3PA 1O4YA 1PZ7A 2ZGNA 3RFRA 4P5YA 4Q4W2 4JTOA 5FXXA 2DTYA 3RJ2X 3D5OA 2EA7A 2RS11 4RHV3 1VAVA 4EV0A 2W47A 1BBT1 4FQ4A 1DBNA 2VZPA 4BQXA 3WW4A 2RDRA 5HV0A 1X33A 1F9KA 4B4PA 1F8VA 1ZZ9A 1UY3A 4L99A 5A3PA 1B35A 3EBRA 1H1IA 3W59A 4Y1VA 1SQ4A 2F17A 3M2MA 4P00B 4WZCA 5FBZA 4L9BA 4IE0A 3AKPA 5IT6A 1DZTA 2LALA 2WC2A 4XUTA 1IQAA 4UFMA 3RYPA 1LODA 1S55A 1UO9A 1W04A 4AEJA 1OHFA 2Q8DA 2QNKA 4URTA 2CGNA 1MVQA 5EP9A 3CQOA 5I0TA 4JGZA 3V65A 4BE3A 4QXHA 2PHLA 5C9AB 1NZCA 4QQLA 2Y6JA 2Q4SA 2XPJA 4RD7A 2O8QA 2W08A 3ACLA 4TXWA 2A6YA 3LA2A 5FCCA 5BXXA 5JDBA 5JOZA 2C4XA 3Q8CA 3NNLA 2DUPA 5FZOB 3WDYA 3B00A 3O1PA 4KWKA 5A32A 1DGLA 3ON7A 3RGBA 5FPXA 4Z2AA 1ULDA 2Y64A 3R4SA 5IWFA 1OD5A 2XUMA 1WCDJ 5K8SA 1AR83 3WQBA 5AFEA 2FDHA 4QD2A 4CXXA 4BH9A 2I07B 2JE9A 2RS51 1V70A 4GAZA 5FZ0A 4M0HA 2TEPA 1LR5A 1JBCA 3QBQA 5CADA 1NE4A 1U5ZA 4NWVA 2A7AA 5DAXA 5LB6A 1V9U1 2FCVA 2WJSA 3H42B 4HT1T 2PYTA 3ZXDA 2BVVA 3FHIB 1XPWA 5DZEA 2NLRA 2GH8A 4Y1ZA 3ZOIA 5C33A 3ILNA 3KZ4C 3D82A 3J8F3 4AEDC 5KXBA 4QX1A 2VOTA 3PUSA 3WR0A 1PM4A 3T2PA 3OJBA 1NZIA 1IKQA 1B35B 4PI0A 1PGW2 2FCUA 1MPXA 1YXWA 4NHKA 5JXHA 5IVEA 4PIZA 1AR92 1IHMA 2F4PA 1MZFA 2FQPA 4IGOA 2HWF3 2RR13 3CLPA 3ZX7A 5A1FA 5JOYA 4LHLA 4KGGA 4QX5A 4Q4X1 1HRV3 5DZFA 1FAYA 3OGRA 1QJZA 1FNZA 4WVMB 2HWF1 2RR11 4Q0VA 3A0NA 5FMBA 3WHUA 2V4AA 1MZEA 2UWCA 1ZVFA 4KI5M 4WM8B 4JGYC 1F4HA 4KL1A 4XABA 4Y1XA 3SXWA 1GZTA 5J48A 5DN2A 2BWAA 1V6KA 4QKNA 3WX5A 4XF9A 5A32B 3KV5A 2VC9A 3LSDA 4CU7A 5CFDC 5CZKA 4Y1YA 1EAH2 5G05L 2W39A 1DQ2A 1TEIA 3HNMA 1CZSA 3JB4C 5FY0A 1FX5A 4Q2FA 1QJY3 1LU2A 1RVF2 3WDXA 2VGDA 3NNMA 5E8AA 2I2SA 3PU3A 5CFCB 1COV3 4JV4A 4HL0A 4P9IA 2DBIA 3TOJA 5H9QA 5C8CB 1EY2A 4MADA 4E2GA 3UKNA 1QJY1 3N9MA 4RSUA 2P3YA 5LATA 2WA3A 3ZXKA 5EPAA 1COV1 1S2KA 1H2NA 1UF2C 4O65A 1CAUA 3UJQA 4YSFA 1PO13 1HKDA 3CMGA 4ASKA 4DB5A 5KC6A 5AC93 4Q4Y1 1I6XA 2G4IA 3VKOA 4AHXA 1LGBA 1EV13 1X82A 1IS6A 1U0AA 1PO11 2ZGUA 3PUIA 4M3CB 3K2OA 5AC91 2WLQA 3KCXA 5GLWA 1ZBA3 1PGL2 1DZQA 2BJSA 3E1F1 1D2QA 3MUZ1 2ARAA 2OXBA 2WO7A 2OZ6A 4IEVA 2IWGB 3BUCA 3CJIB 3FWEA 5C6CA 2J42A 4LBNA 3O0WA 1FMD2 1VBB3 4N9HA 1RUH3 2WFF2 5FYHA 4AF9A 4HMZA 2OUHA 2XJUA 1SCSA 3RMYA 1DDLA 3VBOA 4BXFA 1U5YA 2VVFA 1F5FA 1VBB1 4H7MA 3NL1A 1HN0A 3OUHA 2WUHA 3CIHA 1QQP1 4AVCA 1ENSA 2OYZA 3VZJA 3OTFA 1CPMA 4IXLA 3I3MA 3OEAA 4GWMA 5CBLA 4M01A 2VMIA 3WHTA 1R093 3GXUA 2W68A 1HN1A 1POV0 4LA3A 2YY1A 1Z0HA 2QBXA 5FMOL 1O59A 2RM23 3NJVA 3NW4A 4N43A 4XJAA 5T5OA 1Y9QA 2HLEA 3I54A 4MXWA 3ZSEA 2E63A 4GKXA 1HRI2 2WRAA 3UGFA 4AHYA 1XYNA 3TRSB 4E4DX 2I45A 3VHRA 2GU9A 2RM21 1GOHA 4UXAA 1DYPA 1CAWA 5FYYA 4IEOA 1XNAA 2CV6A 1SFYA 5LCWL 1PO22 3GBGA 3MLLA 4XPVA 1GSLA 1W6NB 2Z2SB 3AJYA 5E6HA 4YVWB 2GDFA 5HXVA 2XLGA 3NJXA 1AR63 4KGQA 2XJSA 3VKNA 3AL5A 3OPWA 3WT3A 1UX7A 4Y1UA 1O5LA 4E4ZA 2YXSA 3T4HB 3HN1A 3PHMA 3DCQA 1IKPA 2CHHA 5F37A 4S2FA 2WA4A 1VP6A 2OZJA 3IAQA 4GULA 3GDBA 1AL21 5HCBA 4IV1A 3FBYA 2FBEA 1NE6A 2GH2A 2VXJA 2EXIA 4Z1VA 1NCRA 4Q26A 4YFZA 4XF3A 4INDA 3THCA 4C0HA 4OHZA 1RUC3 2VTXJ 4LK6A 1SZBA 4W50A 3HAGA 1GYKA 1LNSA 1A3KA 2GC1A 3K4AA 1U12A 5DXDA 3P6BA 3ZFEA 4QHOA 3J7MA 3NAPA 2TUNA 3POFA 4Q5OA 1IS5A 2WNUC 2DUOA 4BK5A 4P5HA 3USUB 2QQVA 1FPN2 1AR73 2R0HA 1XBFA 2JX9A 1HLCA 3MW2A 2QQKA 4PCRA 3VBRA 5FZBA 5BNPB 4P9LA 3H50A 1AR71 4GB31 2VQUA 2ERFA 4XEZA 4N53A 2JG9A 4HVQA 2W0XA 3IZOA 3JQXA 3TB0A 1F35A 2ZS6B 1CIWA 3WNOA 1LCLA 1TMF2 3POGA 4XBLA 2B5HA 1CAWB 3O0XA 1UD1A 2R072 3BTAA 3OYWA 1XNTA 2HWC2 2Y6FA 3BPZA 4R8HA 4JRLA 2WT2A 5DPNA 2EIGA 5A7QA 3WCSA 4FAGA 3VD9A 1VALA 3DPRC 1WKYA 2HJIA 3B69A 5A7PA 1UNBA 1GP6A 1UYPA 4NHXA 2D97A 3VBSC 1VBE3 4G3YC 1T6GC 3I3EA 3ZPOA 4DXRA 4E4SA 1YEWA 1W9YA 2VU9A 2ZGQA 4PDWC 1CVNA 4IV1B 5L7OC 4QX3A 5FYCA 1PMJX 2CWSA 3PUQA 3R4DB 5FZDA 4QT6A 1O8PA 4Y5TA 3BU0A 1T2XA 4QDSA 2WBKA 3WW1A 5FLIA 4CEYA 1J84A 5JWPA 3BKZA 4P9GA 4XQDA 5JXIA 3RZJA 4ITCA 4DY3A 3ZFEB 3ME2A 1BHGA 3NAPB 4V2VA 1SLLA 3SQOA 1VBD3 4M00A 1QJX3 1QJU3 2ZHMA 5A33A 3U0ZA 1H8TC 1GBGA 5HCFA 3M3EA 5FWJA 1Q5OA 1ENRA 2OIIA 4O7XA 1YFWA 3ZFGB 1VBD1 1OA2A 3VGIA 1NXMA 4DRRA 3DGTA 5FZGA 3LEMA 3URFA 2LM3A 4OCTA 2O14A 5K0UB 3VBRB 1VMFA 2FHRA 2HWB1 2IXCA 2RV9A 2LW8A 3PVNA 4CCKA 1TQ5A 2VZ3A 5HCAA 2FDKA 1Q8VA 3BOWA 1W03A 4JRAA 5H9RA 4N53B 3NMBA 2JG8C 4E9KA 5JSRA 4A2UA 3IIIA 5LZ6A 3BCWA 4XUNA 1W99A 1RUD2 3M1HA 3POSA 2OW4A 4PF5A 3P3NA 1G86A 2G9FA 4XFBA 3E5QA 3ZN6A 5FZLA 3ZLIA 1W6OA 4MOAA 4QM8A 4XZUG 1GLHA 2XH6A 2VECA 3GHNA 3ES4A 3OYWB 4RFT0 5FY8A 2D98A 2NQYA 1WA4A 5FV3A 3B01A 4JHZA 5HPOA 1SFNA 2IXLA 1QXPA 2BGOA 1X7NA 4I02A 2JICA 1PNFA 2QQJA 3T0BA 3PMSA 2EAAA 1EUTA 1RUE3 2B4KA 1H4GA 2VULA 4HONA 1JN2P 2D6LX 3CL1A 1S2BA 5LEKA 2GC3A 3FL7A 3N7JA 3OBRA 4NPRA 4QB1A 4HXCA 4ONUA 1ZREA 2AENA 2MNGA 4XHBA 4AFMA 2PAEA 2BW8A 1ND3B 1W2UA 4Q4W1 2YHJA 2VCMA
chains in the Genus database with same CATH topology
4CEYB 2DFBA 1WCSA 2WLPA 5SV8A 1BEV3 4FP2A 2OPKA 1I5ZA 3R0RA 4LULA 4PLMA 3LA7A 4C90A 1H9WA 4I09A 1U5IA 2F6BA 1MQTA 3AP9A 5A33B 2SLIA 1BEV1 1Y43B 3KT7A 4LBJA 3SCHA 3GNEA 2NP0A 4CDUA 4XF1A 4LA2A 3RI9A 2DVBA 3C3VA 4O9EA 3WDVA 4I3PA 3L9JT 4WVZA 5DDJ3 1Q8OA 3H7JA 3PVEA 1DU3D 2IXHA 2ARXA 4Z82A 2EVXA 1YI7A 3N4MA 4YW2A 1G9CA 1BVP1 1IPKA 4Y20B 2QUOA 4I01A 2GZWA 1TME2 1FI2A 1C8NA 4MH0E 5GZDA 1OFSA 5KHGA 1AX0A 2BWCA 4NHMA 1NLSA 3AMPA 3NV1A 3VZKA 3QCWA 2JENA 3GF6A 2P2KA 3T1LA 1PVC2 1QU0A 2HWD1 3ZSJA 1LHNA 3D6EA 4AYUA 2I74A 4CRQA 4RQPB 5DUUA 5T5JA 3V64A 5F6KA 1RIRA 2XBO2 4AQSA 3E6CC 4FTEA 3GALA 2WT1A 4Q1PA 1QMJA 3AZWA 1W0OA 4MGZE 1N47A 4CDXC 4IV3A 1PGW1 3FJSA 1OOPB 3NO8A 4QQOA 1AR91 3A4UA 4OI0A 2VOXA 4WZFA 4CDUB 4JAAA 1URXA 1NYWA 2UU8A 1UIKA 2Z5WA 1WLCA 4P9WA 1GNHA 3MIHA 2ET1A 3AZZA 1UU4A 2JDZA 4OHXA 4SBVA 3OBTA 1ZA4A 3VDDB 3VUOA 1R083 1S0BA 1ASJ2 2MEV2 1I3HA 5JZGA 1UW8A 4QHBA 1JTZX 1HXS3 4CEWA 2FZ1A 1DGRA 4ATFA 5JMCA 4DOUA 4J1WA 3CEWA 2CYFA 2GC0A 4LHNA 1RHI3 4RL7A 3SLIA 3ST7A 3OD4A 3WDWA 4YZ4A 4AQ2A 1WW7A 2C0ZA 1AJKA 2QFEA 2D3SA 2Q1ZB 4D7YA 1H1MA 2WZR2 4YM3A 5E1RA 5BY5A 2DWRA 2AR6A 5K9YA 1RUI3 2E7TA 2A6XA 1D2SA 2IC1A 1AJOA 4RA0A 5KWRA 4YZ3A 1AXKA 1RUH2 1FOD3 3J4UH 5FLHA 3AFGA 2A70A 5SV5A 4BIOA 3B3QE 4RS5C 3PVOA 1R1ZA 2WFF1 4HFSA 3ZXGA 5FO8B 1NCQC 2XJQA 2DCYA 3RDIA 5JI7A 4QPYA 4BHPA 3AKRA 3IIAA 4XOGA 2ZGMA 1WW6A 1IOAA 4GWNA 1DG6A 1D0GA 1UN1A 1WBFA 3DN7A 2VMHA 1LHWA 4FO9A 1S0IA 5JZGB 3WUDA 1AYN3 1UL9A 1YI9A 4XJUA 1QH7A 2P17A 4CEWB 3B9IA 1PK6C 1QNYA 1BQPA 3SH5A 1PMIA 4LBOA 1VRH3 2ZGRA 5CG9A 1HRI1 5H9PA 3VL8A 4R9BA 2Z42A 1DHKB 1O7FA 2WNVC 3O5SA 2A3XA 4AFBA 1YFYA 5JR7B 4HN0A 1JYIA 4W6WA 1R1A2 3ZDSA 5J37A 1QH6A 1QXRA 1RL3A 1GQGA 5T3NA 4FOWA 5J96B 1QOSA 2ZGSA 3SITA 4JDMA 4XMAA 3AMMA 1MZ5A 5J09A 4AEDA 2A6WA 2VY0A 3KSCA 4P9YA 4OFGA 3WNXA 4LBLA 5IUQA 1PGSA 1RUJ2 4R52A 3IN9A 4BZ4A 3GZUC 1SBDA 3AKQA 5DUVA 1AXYA 1V6MA 3WW3A 2WIIB 2R0FA 1MVEA 5L73A 4LBQA 4BMBA 3WP6A 4FTSA 2VW2A 3ECQA 1CAXA 1ND2B 4R4ZA 1FPN1 2CY6A 4WVVA 4JGYA 1D4M2 2VMGA 4GH4C 1WGPA 2ZCWA 2QDRA 3IWZA 2XB6C 3NKTA 4TSVA 4XDQA 1RGSA 5CFDA 4S2HA 4DPNA 3MIDA 4IEXA 1N1YA 2D6NA 4DZGA 1LJ7A 1BYHA 5BNOC 4OZXA 5DUXA 4BOWA 5LK5A 4GMP3 1SACA 3K51A 3D8CA 3KD4A 5ABJB 5JLVA 2R071 4QMAA 2R16A 5FFOC 4QQHA 1WW4A 3AP4A 3CNAA 2PTMA 4YRDA 2ATFA 4Z07A 1VBE2 2CGPA 1LU1A 3WV6A 3JUUA 3MLKA 1JYCA 4YW3A 2SBAA 1K5MC 3BU7A 4OULA 4QPIC 4I30A 2XVGA 3ZYJB 3FUQA 1M4WA 4LEJA 4YM0A 4DNYA 4N7IA 5I91A 5D8AC 4GXLA 3VZOA 4R9AA 2PLV3 4EJRA 2VOVA 1RITA 1S0EA 5F5QA 2DCJA 2YUEA 3H1WA 2HWE3 3M3IA 3OPZA 3TNPB 2V73A 5KBFA 5KXDA 4IERA 4WM7C 2XLFA 3M3OA 5FMOS 1XU1A 2HWE1 4D7TA 5GZGA 4JGYB 5IK4A 2RS13 4PLOA 1C8M2 5FTTC 1H30A 2NZ9A 1HV0A 1WD3A 3GBWA 2YGLA 1OPOA 5CFDB 3B02A 1XYPA 2XWJB 1WLTA 3X29B 4UBHA 1RUD1 3AMNA 4TWTA 4CYDA 1VIWB 4TZDA 2EXHA 2YPJA 2WFPA 1W6QB 3ZIWA 2ZHNA 4JC1A 4JVAA 5KHHA 1Z7S2 1H0BA 3U07A 4B4RA 1YUDA 3KM5A 4BPZA 4CP2A 2VNRA 4BYYA 4I0BA 1LESA 2X5IB 2D6OX 4U2AA 4C0BA 4KH9A 4H55A 3ASIA 4AVSA 1XQNA 3WCRA 2GAUA 2RS33 4LBKA 1QXJA 4Q0UA 3RQ0A 1YJKA 2WNEA 1FV3A 2RS31 3TN92 1H2KA 1AVBA 4Q4V2 2RS53 4AQTA 4D7SA 3AYCA 3LZZA 2CAVA 1V9U3 2A75A 4XFHA 4XXPA 3ZMNA 3MW4A 3RI8A 1Y7BA 5KHJA 3DUIA 2WNUA 3JB8A 3QLQA 4RGAA 3P3PA 1RUG3 2V5YA 2ZHKA 3FMGA 3LGRA 4COUA 3M3QA 4BA6A 4I3GA 4YW4A 5BNNC 1RUG1 4XIOA 2RMU2 1MEC1 4LUKA 3VBHC 4Q4X3 2ENRA 3R6SA 5E16A 1NA1C 3MZHA 1LOAA 3E6BA 2WL1A 3ZXAC 4LLOA 4QGMA 3KT4A 1F5JA 4YGCA 1BK1A 2P34A 4JGZB 2Y0IA 1KJRA 2XG3A 3DPRA 2Q0AA 4ES9A 2PFWA 3HWJA 3VBSA 4COYA 3WQ1A 1B09A 4KU8A 4DRVA 4PDWA 5DG1A 5L7OA 4A7YA 3H8UA 3RRDA 2XBO1 3I59A 4YM2A 2Q8OA 4YYOA 5ACA3 4OHYA 2OA2A 1POV1 2B7YA 4XBQA 5CNAA 4Q4Y3 5ACA1 2G9GA 3SCFA 1LHOA 1KQRA 1GKBA 1H8TA 2X29A 1XE8A 2BEOA 2D7FA 4H14A 1X50A 2A71A 1YIPA 4Q29A 5CU1A 3USSA 2O1QA 2IFRA 4LO4B 5IK5A 4D94A 2JG8A 1MS3A 4K21A 2HKXA 2ZKNA 3S7IA 1BMV2 2WS92 4ATEA 4YM1A 4AVTA 3VBUC 3FC0A 3MICA 1RHI2 2ZX2A 2D3RA 3FZ3A 1IS3A 1QQP3 5FRAA 4Y26A 3DPRB 2E51A 2R062 2VNOA 3VBSB 4Q27A 1C3HA 4DINB 4KBBA 4HZFA 2ZGOA 2RHPA 4JTNA 1AYM2 2Q1MA 4AI8A 5FPZA 3KMHA 2PHWA 3NVCA 5JPNB 3WINE 3MPPG 4SLIA 4ISRA 1Q8QA 4CDQC 2FMDA 5L7OB 2PHTA 4K3UA 5JI9A 1XNDA 1O4TA 2IFWA 1U5XA 2B46X 3AZXA 3ZYIB 1YWKA 2IXIA 1QHDA 2AH2A 3M3CA 3WY6A 5JSOA 2ETEA 5I8TA 1UIJA 4AWDA 3ZYRA 1QOTA 4MGKE 1YHFA 1PIV2 3WUCA 3ZXEA 4B3NA 3LSEA 2Y38A 1MS1A 1CAUB 3LAGA 3N7MA 3RWNA 4R9DA 1ZRDA 4P14A 4XFAA 2PELA 4ES8A 1AL23 2Y26A 1MS4A 2JXAA 5BUVA 1PZ9A 1O4ZA 3PTYA 4A7KA 3UJOA 5FOJB 1RJ7A 3H9AA 4ASLA 2Q30A 2WZPP 5GZFA 2R043 4E2SA 4EN7B 3POYA 1W6MA 5DZGA 2ZX0A 1RMU2 4DS0A 4HKOA 2R041 4FAHA 1X8MA 2P37A 2VW1A 1Q8SA 3WP4A 2FMYA 3VBOB 4WM8C 3CO2A 4XZPA 3AXDA 4LTAA 1VBC2 3MDPA 3N36A 4GB33 1R1A1 3ZFFC 5GM0A 5FLJA 3CU7A 4FPFA 5C4WC 3WQ0A 4N43B 3VZNA 1N1TA 4MXWB 5CFCC 4F83A 2QZ2A 3IDBB 5C8CC 1RUJ1 3ZN5A 4CDXA 1IS4A 4QPGC 4X6QB 4XIKA 5I0RA 4P9JA 2WWSA 1BXHA 1VR3A 3CF6E 1VBA3 4DY5A 1O3SA 1V6LA 1J59A 3QD6A 2E7QA 2B42B 3JBG2 3VHNA 2DYCA 1VBA1 5HBAA 3WQ7A 1ZBE2 1CAVA 1JH5A 1D4M1 2ZZQA 5T54A 1NCRB 1J1TA 1VJ2A 3CJIC 3UK9A 1IPJA 3NV2A 5CIRA 3JD72 2XJPA 4OI1A 1AUYA 1RUF3 3A0KA 5CG8A 5I0SA 1DF0A 4CP0A 4LBMA 1EYBA 1RUF1 2HWB3 2ZZJA 3ZYGA 4AGGA 1O5UA 5J7MA 4UW6A 1L3JA 5GALA 4RGGA 3S0MA 3WOGA 1HDKA 2XJRA 2ZA9A 2XVKA 4XXAA 2JG9B 2QDNA 1ULFA 1W39A 2PHUA 4W6XA 2YV8A 1ZZ6A 2R1DA 5AVPA 4WVWA 2UURA 4AFAA 3S30A 2HEWF 4IETA 3HT1A 4YVWC 3ENRA 1YO8A 3OF1A 2BFUS 4MVTA 4RS5A 1QOOA 1UU5A 1NCQA 1YLLA 1XE7A 2YYOA 2UWBA 1BBT2 1LEDA 5C8WA 1QWRA 3N7LA 2DVAA 1ONAA 4Q4W3 2ZACA 4FOVA 1CAVB 5LRRA 4FOYA 4HKLA 2GNBA 1C8M1 4AFCA 4RHV2 1ZZCA 4F8AA 3APBA 3MF9A 1J58A 5J36A 4OUMA 3GZAA 3E5UA 1PK6A 2WKKA 3WG2A 3U4XA 2R32A 1UZYA 2KM2A 2QQPA 2LTNA 1Z7S1 4CZSA 3MYXA 3LA3A 5L36A 4WBBA 3EJKA 2WNVA 4Y4YA 1J3QA 2YMZA 2WINB 4JDOA 3BALA 1NOVA 1KD7A 5GJ6A 3WP5A 4AI3A 5BNPC 4YVSC 2K2SA 5BV6A 4AHWA 4XF0A 1F31A 2XLAA 3ZN6B 2DUQA 1HX6A 3H3UA 2C5DA 1W6OB 3THPA 2RS52 3LOIA 1ZNPA 3WZ1A 4G9SB 1OMIA 1ZRRA 1ZZBA 4COVA 4FSJA 4LE3A 3TN91 2QJVA 1AR82 4DFSA 4PIXA 1UMZA 3GBFA 3OY8A 1NCQB 3H3ZA 2HWD3 1SLBA 4QM9A 1QY4A 4J6GA 5FO7B 1N1VA 5KXCA 1LGNA 2WT0A 3J8F2 5EJ3A 4RR3C 1ALYA 2D3PA 3VZMA 5JIUA 4GH4A 2XWBB 4LO8A 1AR93 2ARBA 4FPHA 4Q4X2 3VHOA 4XQ4A 1ZRFA 2AUYA 3LB9A 2RMU1 1MQTB 2HWF2 2RR12 4TYSA 5BNOA 2JJ6A 4YNIA 4ZU7A 3Q9OA 1HRV2 4XJ8A 3ZFGC 4EWEA 3EQEA 1G9FA 4Q1RA 3MEPA 1WMEA 4D3WA 1H2MA 5K0UC 3N7KA 3OD0A 3HD8B 2Q5TA 1V6OA 5EZWA 1BVVA 5EYYA 3N35A 4LLFA 3VL9A 3KT1A 4L2NA 5L19A 1K5MA 5FOBB 4GIQA 4QPIA 3VBFC 1DQ4A 3WVJA 1RVF3 4R4XA 1HV1A 2DU1A 1QJY2 2XHKA 2YGMA 1EAH1 5D8AA 1AX2A 1COV2 2GNMA 5IK8A 1RVF1 2UYAA 4NO4A 1DGWX 5AFBA 1WMDA 1KS5A 4MV2A 1ZZ7A 4M3CE 4XMIA 1PO12 1RINA 5D1IA 4WM7A 5AC92 4B7EA 3DKWA 5EV7A 1RTVA 1EV12 2P3IA 1ND3C 5CAZA 4ZU5A 4MGIE 3ILRA 1WBLA 1ZBA2 2D6MA 1CD3G 2W52A 1SMVA 3KCCA 1PGL1 4IV3B 1FMD3 4FTBA 1BMV1 2WFF3 3MIFA 1VBB2 2VG9A 3PMEA 4OI4A 5T5LA 2BNOA 4KNCA 2EAKA 1FMD1 5JCTA 4ZKTB 2C1FA 3MW3A 1SLAA 1D4VB 2O0OA 4XFIA 4EWAA 5FQ0A 1Q43A 2R30A 4MZUA 2R061 3M70A 3M8LA 1EPZA 1C57A 3FUOA 1LHUA 1AYM1 1R092 4IEWA 5HI0A 4QPIB 2BFUL 2VVDA 3FLPA 2RM22 1VAMA 1HRI3 1PHMA 1UU6A 1JXNA 1QNWA 5JOXA 4PLNA 2D43A 1PO23 4F3JA 4HBNA 4O9GA 5F1RA 1UPIA 1SBFA 1M06G 1N1SA 1PO21 3OGGA 3WG3A 1NQJA 4FPJA 3IT8A 4Q8KA 1AR62 3PLQA 1S0GA 1AL22 1ZYBA 1DYKA 2XVLA 3D0SA 4RQPC 1H9PA 5E88A 2BUKA 2O8OA 4YLZA 4K1YA 3MIBA 4HANA 5F6LB 2Z69A 1ENXA 1WLWA 2BNMA 4Y22A 1OLQA 4OUSA 5FAXA 2X53S 4K7JA 4EWDA 3L2YA 1RC6A 3RSJA 2XJVA 4Q8LA 1OOPC 4XJWA 1RUC2 3QH6A 1C1LA 4FPGA 5BNNA 5JSPA 5IK7A 2P3JA 3VBHA 3ELNA 2D5FA 3S6PA 1NA1A 4YFWA 1PM7A 1RMU1 3AZVA 2OUJA 3ALQA 1BCXA 3BOPA 3WD5A 3B93A 1RB8G 3OGJA 3UV9A 1H8VA 4CDWC 1FPN3 2LUWA 1GNZA 3VDDC 4GA9A 1J3RA 4META 1AR72 2ZX4A 4FPLA 4B8EA 3VKMA 1VBC1 1CR7A 5AVAA 4L8QA 1N3QA 2GN3A 3PVBB 4HPKA 3TBDA 3MLJA 1TMF3 3MIEA 3RYRA 1LHVA 2GC2A 2R073 4AGVA 1LULA 1XNCA 3DF0A 4GQ7A 2P3KA 1TMF1 3ZSKA 2CGOA 4YZ5A 2HWC1 1LKNA 2DVDA 2IZWA 4FPKA 2QE3A 3ILFA 5EFUA 4DMIA 4AEDB 1IGOA 3R05A 4HSLA 3ROUA 4COZA 2HEVF 3HBZA 4GKYA 3VBHB 3AK0A 4IEPA 2ZGPA 4FBFA 4EN0A 3EXUA 2DCZA 3JD71 1AL0G 4LT5A 3AMQA 2WQ4A 2DCKA 1VBD2 4FXGB 3MPBA 1QJX2 3VBUA 1QJU2 2DTWA 2YDEA 4IQPA 2CNAA 1NG0A 5TSWA 4LBQB 3ZVXA 1GV9A 1CGPA 2DVGA 4OHWA 4IEYA 1DFQA 2GNTA 1CAXB 1DQ6A 2C9AA 3EHKA 2VUJA 3VZLA 1EP0A 3WG4A 2QKDA 3FFQA 1RUD3 4YG6A 2PHDA 4HPKB 4CDQA 1LOFC 1G7YA 3H1YA 4N9IA 4GALA 1KDMA 4P9XA 3AP7A 1H1AA 4XHXA 5T5PA 1FXZA 1RUE2 1YCIA 2VXRA 3HMYA 4MSVA 2A3WA 1S0CA 3V56A 2E6VA 2PAKA 4AEKA 4F7ZA 5T52A 1S1AA 3KGLA 4X8PA 3ZO0B 2E7AA 4GMP0 1HQNA 1XXNA 3PJYA 4RHV1 2D6KA 2R1BA 4CP1A 3ZN4A 1BEV2 5DG2A 5BYNA 3GHMA 4NN0A 1WUVA 1DGRN 4WV8A 1X8EA 3VBUB 3FBMA 1MS5A 3KCYA 4QQPA 4A3XA 4YG0A 4D69A 2CL2A 4WVMA 3O14A 1FATA 4IEZA 2ZKLA 1ND2C 4NR1A 4WM8A 4H3WA 3HIFA 2A5ZA 2DV9A 2YC0A 1VB2A 1GFF2 3DL3A 1DQ1A 1DIWA 3IKWA 2QZ3A 5DDJ2 2DF7A 3TAYA 4CDQB 5KHKA 4AG4A 4XE9A 3BIWE 3ZFFA 3JZVA 1MEC3 1VB4A 1QKQA 4FP3A 5C4WA 4AGRA 3R4UA 3RJRA 4Z2WA 1MS0A 1G9BA 4XQWA 1TME3 4LO6B 4K20A 5CFCA 3GYDA 4KG0A 5ABJC 2FZ2A 3IPVA 1PZ8A 5C8CA 2JECA 1SBEA 1TNFA 3EO6A 4JCKA 1AR81 1TME1 4QPGA 2XL9A 3D0JA 2HWD2 2NMNA 5GLZA 3MGUA 5GKAC 3FX3A 3ZXFA 5GLTA 5I8YA 1PVC3 2IXJA 2B45X 4X6RB 4HETA 1RUNA 1O3QA 4M3CA 4NOTA 2XBO3 2ZGTA 2D6PA 4Y24A 3J8F1 1PVC1 1A6CA 1SEFA 2NPIA 1J1LA 4S2DA 3CJIA 1ZRCA 4AE2A 1POV3 2D40A 1LOGA 4AK3A 4BWOA 4M3CF 5EXOA 3HT2A 4COWA 4BMEA 3AB0A 4LE4A 1LRHA 2RJLA 1SCRA 4BLJA 2ES3A 2MPFA 1HRV1 2BPA2 4L11A 2VW0A 5K7PA 3KB5A 2WNUB 2BTVC 1GZCA 1WW5A 4FPEA 4I0AA 4AI1A 3ZFFB 3SCGA 4C1XA 2UY8A 5C4WB 1R082 2VOWA 1ASJ3 4W6YA 2MEV3 3FLTA 1LTEA 2KXLA 3E97A 2QVSB 1Z78A 4V1PA 1DGWA 3QH7A 1ASJ1 1CQ9A 3L2HA 1HXS2 3IPVB 2MEV1 2GNDA 4YGDA 2ZTNA 1C1FA 4OVEA 3ZXLA 4Q0QA 4QPGB 5CA6A 1KDKA 2B9UA 1W6NA 2CAUA 3O12A 2X5IC 2ZMNA 3ZYPA 4Z92B 5JAXA 3T1MA 4YVWA 5C9AC 5EYXA 5BPXA 4Z8BA 2VQ0A 3GZTB 1UKGA 2ZX3A 2WZR3 4NVPA 3POWA 4HK9A 3I7DA 1N3OA 3RZZA 1OLRA 4PDWB 3VHPA 1EV11 2WZR1 1RUI2 1KJLA 3UKTA 3IBMA 1V6NA 4I2OA 3I59B 1ZBA1 4KWLA 4NWWA 4MX3A 1OQ1A 2JE7A 3T2TA 5JOWA 1UCXA 1XRUA 4EN8B 1FOD2 3PNAA 2Y0OA 1GICA 4ORFA 1RUOA 3WXPA 2AYHA 1RUH1 3O7OA 4PQ9A 2ZAAA 1HQLA 1H8TB 1V6IA 3WLUA 1MS9A 3TNQA 3USUA 1FV2A 1YYNA 4TLFA 3I4IA 5LRSA 2GMEA 3JU9A 1YRZA 3AP5A 5BNPA 3HQXA 4HVRA 4YVSA 3KGZA 3U11A 4AEMA 1NQDA 1NY72 2JG8B 4LBQD 1B35C 1AYN2 1R091 2DU0A 3S7EA 1FT9A 3ZSLA 1S0FA 3B7MA 2Z79A 1FYUA 1REDA 1VRH2 5EWSA 4YARA 4A7ZA 4HVOA 5J3UA 3SISA 4JGZC 3B5LB 3CJXA 4BCUA 4QGNA