1C8NA

Tobacco necrosis virus
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
189
structure length
189
Chain Sequence
NSTVVSNSELILNLTPIALAYTVQSLPLIATQPAWLGTIADNYSKWRWVSLRIIYSPKCPTTTSGTVAMCLSYDRNDVAPGSRVQLSQTYKAINFPPYAGYDGAAILNTDVTPTSAIYVDVDVTRFDKAWYSTIGTAAFAALTAFDQNQFCPCTVHIGSDGGPAVAVPPGDIFFKYVIELIEPINPTMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of tobacco necrosis virus at 2.25 A resolution.
pubmed doi rcsb
molecule tags Virus
molecule keywords COAT PROTEIN
total genus 41
structure length 189
sequence length 189
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2000-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00729 Viral_coat Viral coat protein (S domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1c8nA00
2BUKA 4CEWB 1POV0 1HRI2 1RUH3 2WZR2 4IV3C 4N43C 5AC91 1B35B 1H8TB 5A33A 1R091 1EAH2 1D4M2 2WS93 3M8LA 1PIV2 5ACA2 1VBE1 2RS33 4CDUB 2HWF2 1QQP2 1AL21 1B35C 1H8TC 1Z7S3 1QJX1 1AYN2 3ZFEC 1R082 4WM8C 1AR81 3ZXAC 4QPGA 4N43A 2RS31 1FPN3 1VRH2 1ZBE1 1PIV1 5ABJC 4AEDC 1BMV2 1RUI2 1TME1 1AL23 3VBRA 4RR3C 3ZFEA 2VQ0A 5C8CC 3VBUB 1QQP3 1NG0A 1VBC1 1RUJ3 1PO13 1HRV2 4LLFA 2RS52 5ABJA 4CDQA 3VBSB 2GSYA 1AYM2 2R073 1RUJ2 1OHFA 2WFF2 1R1A2 5C4WB 5DDJ1 1RUD1 1CJDA 1FOD2 1COV1 1RHI2 4PDWA 1RUI3 1CD3G 2RM22 1PO23 5C4WC 4QPGB 2WLPA 5BNNA 5BNOC 4CDWC 1RUF1 2XPJA 1AR73 2ZZQA 1QJY2 1MEC1 1NY72 1F8VA 1ZBE3 4QPIB 3VBRB 4GMP1 2WS92 2DF7A 4JGZB 1AR83 1ND2B 1MEC3 1BEV2 3ZFFC 1AR71 5ABJB 4AEDB 4CDQB 1QQP1 3VBSA 1QJY3 2X5IA 4Q4Y2 3JBG1 3VBUC 4CDQC 5AC93 3ZFFA 4WM7C 1FPN1 1HRI1 5A32B 2FZ2A 3NAPB 1QJX3 3VBSC 1AR63 5BNNB 4WM7B 1HRV3 5C9AA 4PDWC 4JGYA 5CFCA 1MQTB 1RUG3 4FTEA 1RB8G 1NA1C 5JZGB 3JB8A 1RUC1 1VBB2 5BNNC 1ND3C 1RUH2 2RS11 4YVSA 1PVC2 4CDWB 1QJU1 1HXS3 4JGYC 5CFCC 1QJX2 1RUG1 2XBO2 1R083 2RMU1 1PGW1 1EAH1 2R062 4IV1B 5BNPA 1C8M2 2BFUL 1FPN2 4CDXC 3TN91 1RMU2 1M06G 3ZFFB 4FTBA 2IZWA 1QJU3 2FZ1A 5A32A 3JBG3 4CDXB 3VBOB 3JD72 2GH8A 2HWB3 4Q4V3 5FMOS 2BPA2 1MQTA 1EAH3 1TMF2 1VBA2 2RR11 2ZTNA 1BEV1 1AR92 1E57A 4YVWC 1HRI3 1ZBA2 1FOD3 4FSJA 4RQPA 1NCRC 1TMF3 4YVSB 1QJY1 3VBFA 3HAGA 2HWC2 4CEYA 4Q4V2 4Q4W2 2RS13 3VBHB 1VBE3 1NCRB 4YVSC 5CFDA 4Q4V1 1RUC3 2HWD3 4CDUC 1EV12 4IV1A 5BNPB 1PO21 1FOD1 5DDJ3 5D8AA 4CEYC 1RUC2 5BNPC 1NCQC 4CDXA 4CDUA 2HWC3 1NCQB 1PVC3 1VBC3 2Y26A 1R1A3 4BCUA 1C8NA 1K5MB 2R072 2HWF3 3TN92 1NY71 4RFT0 5GKAC 1C8M1 1D4M3 1BMV1 2XBO1 1X33A 4RHV1 1RMU3 3VBUA 4IV3B 2RS32 1VBD3 5ACA3 5L7OB 1QJU2 1HXS1 3J8F2 3J8F1 5K0UA 2PLV3 4RR3A 1RVF2 1COV2 2HWF1 2WS91 5D8AB 1VBB1 1HQNA 5C9AC 1AL0G 1BBT1 1A6CA 4GMP3 1HRV1 1FMD1 1ND3A 2PLV1 4EJRA 1NCQA 2RR13 2PLV2 1GFF2 2QQPA 3J8F3 3VDDC 1K5MA 1Z7S2 5DDJ2 5C8CB 1POV3 2WZR3 4Q4Y1 3ZFGB 1TME2 2HWD1 1EV13 4N53B 1RUJ1 1RUE2 3VDDB 1W39A 2R042 4IV3A 1ND2A 2WWSA 1EV11 5L7OA 1R081 4Z92B 1R093 4RR3B 1VBC2 5ACA1 4Q4W1 3LOBA 1D4M1 2HWC1 1RUD3 3FBMA 1MEC2 2MEV3 1MQTC 4GB31 4QPGC 2RS53 2R071 5BNOB 1VRH1 1ZBE2 1ND3B 4CEWC 1IHMA 1QJZA 3IDEA 3S6PA 1C8M3 1AR82 4RQPC 1VAKA 4N43B 2HWE3 4QPIC 4WM7A 5C9AB 5J98B 4JGYB 5CFCB 1VBE2 4JGZC 4NWWA 2BFUS 1AR61 1RUE1 1R1A1 5C8CA 4GB33 4GH4B 2RMU3 3VDDA 1FMD3 1PGL2 1Z7S1 3ZFEB 4WM8B 4RHV3 1RMU1 1V9U3 1PO22 1NA1A 2R061 1RHI3 1FMD2 3ZFGC 2HWE2 1RUG2 1ND2C 1TME3 4GB32 1VBB3 1F2NA 1RUI1 1PVC1 4RS5A 5C4WA 5BNOA 1ASJ3 1PO12 1RVF1 4PDWB 2MEV1 1OPOA 3TN93 1TMF1 2R063 2R041 1ASJ1 1AL22 2XBO3 4SBVA 1WCDJ 1DDLA 2BBVA 1OOPA 4GH4A 3CJIB 4QPIA 4NWVA 4WM8A 4JGZA 4RQPB 1NA1B 1PGW2 1VBD1 3JD73 1AYN3 3VBFB 4YVWA 4CEYB 4Y4YA 1V9U1 1PIV3 3VBHA 4AEDA 2ZAHA 1ASJ2 4GH4C 1NCRA 4Y5Z0 5FOJB 1BBT2 3VBFC 3VBRC 2X5IB 2RM23 4Q4X1 5J96B 4RS5B 2RS12 4GMP0 4Q4W3 2HWB1 1K5MC 4IV1C 3NAPA 1HXS2 4RS5C 3DPRC 1COV3 1AYM3 1V9U2 4RHV2 2RM21 3DPRB 4Q4X3 1VBD2 1OOPB 5JZGA 2WFF3 1RHI1 3CJIA 5L7OC 1X36A 2HWB2 1AUYA 1RVF3 1ZBA1 3NAPC 3JBG2 1AR91 1OOPC 2WFF1 5LK7B 4CDWA 1AR62 4YVWB 1AYM1 1NOVA 1RUF3 1AR72 5JZGC 3CJIC 5K0UB 1SMVA 4CEWA 1ZBA3 3VBHC 4FTSA 1AR93 2R043 1B35A 1H8TA 1VRH3 5A33B 5K0UC 2TBVA 1RUE3 2RMU2 1BEV3 3VBOA 1VB4A 1HX6A 1RUF2 2HWE1 5FMOL 4N53C 2X5IC 1BBT3 3DPRA 1VB2A 1AYN1 2MEV2 1PO11 1RUD2 1PGL1 1RUH1 3ZFGA 3VBOC 2HWD2 4Q4X2 5CFDC 4N53A 1VBA1 1R092 2RR12 5AC92 1POV1 2WZR1 4Q4Y3 2RS51 3JB4C 3JD71 5D8AC 5CFDB 1VBA3
chains in the Genus database with same CATH superfamily
4XJ9A 4UF0B 1ULCA 4EN8B 1KXGA 3N7KA 4BMBA 1HRI2 1DQ0A 3UYJA 5G05L 1G9FA 4BJ0A 4HSLA 1O59A 3ZR5A 2HLEA 4LKDA 4ZHNA 1QU0A 2JDNA 2ZMNA 1B35B 1X8MA 3OUHA 5ANQA 3RWNA 1EAH2 4FQZA 1IPKA 3P6BA 1JYVA 5K4LA 3FHQA 4IGPA 2OXBA 5ACA2 1AJOA 1VBE1 4Q0UA 4PJYA 1H8TC 5FLIA 1XU2A 4AF9A 2C1FA 1JYTA 5I0SA 4BU2A 4G4FA 2JXAA 4AR2A 3SH5A 5AVPA 3CHXA 4A44A 5I0RA 1WW4A 3E5XA 3ZXAC 4QPGA 1EPZA 1O7FA 2VOKA 3AMHA 1F35A 3U1XA 2LTNA 4IEPA 4YFZA 5JMCA 5JOZA 1FPN3 1EPWA 1UIJA 5FIXA 2YXSA 4R8HA 4UFIA 5CU1A 3M3CA 4XMAA 2OUHA 2GMEA 3A0NA 3OJBA 4CP9A 1RUI2 1TME1 1EYBA 3I8TA 1UY4A 3U37A 2E26A 1J84A 1GLHA 1K5JA 2UWCA 5FRAA 5FUPA 5B4NA 1NXD1 2VQTA 5LATA 2VZ1A 4RR3C 4WZCA 2D6NA 4L97A 4QKFA 2C24A 4W65A 5LY2A 5C8CC 3O1SA 1LOFA 3BVCA 2K46A 4BM8A 3AXDA 4ZS2A 2R6QA 1RUOA 4ASLA 4HT1T 4PF1A 1HRV2 2VCCA 4PLMA 3WINE 4F7ZA 5A3TA 3SXWA 3H8UA 4RGKA 3WF1A 5DG2A 4Y1UA 1DGRA 2GSYA 2QQIA 3ELNA 4LXLA 4QQOA 3AP6A 4EWDA 2J1TA 5CNAA 1BJQA 5CVRA 5CBLA 3E97A 1ZZ8A 5GZGA 3OYWA 4AQTA 3WP6A 1XU1A 4LBMA 1S0FA 4MH0E 3AK0A 1UL9A 3B69A 4TWTA 3ZIWA 5JSPA 2D6KA 2PN5A 5H9PA 2RM22 1PO23 2P34A 1W9SA 2CAUA 4W6WA 4AVSA 3IIIA 1WA6X 2XB6C 4D7SA 4O61A 4LMFA 3USSA 4YW7A 4Q2FA 1AR73 1D2QA 2Y0OA 1PMJX 4CCKA 2YBPA 1MEC1 1CWPA 4QX8A 1ZBE3 2QQJA 3POWA 1S2KA 2PQQA 3MGUA 4XQWA 5I0DA 3VBRB 1A3KA 2VQUA 3ACFA 4GMP1 2WS92 4P9XA 4JGZB 3I97A 5F3EA 4I01A 4DEQA 3BTXA 4QXKA 2CDOA 1A78A 3GZAA 1MEC3 1GOHA 2E33A 3QH6A 3M4FA 4FFFA 4A6SA 4WVZA 4NIIA 4HKLA 2VUAA 3H42B 2W9XA 4FO9A 1IS3A 1YYNA 3V64A 5FLHA 1O6UA 1XNKA 3WT3A 5A1FA 1S0BA 1NZCA 2V73A 4C8DA 2ZGNA 4HBNA 4CDQC 4ZONA 4P02B 1URXA 1ZZBA 2AEZA 4PCRA 4AE2A 4MHUA 3GBWA 1G7YA 1X9TA 1SACA 3CIHA 4CCCA 2ZGUA 4C91A 5HBAA 3MPPG 4IEVA 4E8CA 4I2OA 2UURA 3MBWA 2VW2A 2D3SA 3APBA 5C9AA 3NWKA 4PDWC 2AYHA 5CFCA 4J25A 1MQTB 1RUG3 4K1ZA 2ZPXA 3A0KA 3K48A 1NA1C 1Y4WA 3AKQA 4XTMA 1W8ZA 1QJFA 4N9IA 2OX0A 4ZU5A 2VH9A 2GNMA 4ZY9A 4MXWA 4H14A 5C5TA 5FXXA 3ZN4A 4F83A 1ND3C 1UKGA 4UFKA 4L2NA 2RS11 3PURA 1PK6A 2ARCA 1U5XA 3BUCA 2RDRA 2BGOA 2WZEA 2ZABA 3UJQA 3ZO0B 3TEZA 4CDWB 3I2OA 2NLRA 3WHTA 5CFCC 5CKMA 1LHUA 3DEMA 5D1IA 4FAGA 2JKBA 4KWUA 4XFAA 3POBA 5FQ0A 1H6YA 4QX3A 1JUHA 5FY5A 2XBO2 5G04L 1R083 3ZSKA 4A3ZA 3PDQA 2X8KA 2R062 4IV1B 1FPN2 1RMU2 3AJZA 3GNEA 3IAQA 2EXHA 5CAZA 1LU1A 3HT1A 3LDBA 3S7IA 1UU6A 1KDMA 1ZNPA 5F5AA 4Q8KA 3ZFFB 3KV4A 4XJUA 5SV5A 1ZA4A 1QJU3 2PELA 2JE9A 1POQA 2IUWA 2Y0IA 5A32A 1QIQA 4OMCA 3WDTA 4MG2A 3DYMA 4FPHA 4C0HA 2VL4A 1MVQA 2HWB3 1IKQA 4Q4V3 4AI0A 5CFCB 1R64A 2DVGA 1Y43B 1K12A 4B4PA 1PM4A 1RITA 4ASMB 4L99A 5A6XA 1WD3A 4UI9L 2C9AA 4GKYA 4TN7A 4S2FA 3ZN5A 5FY0A 2G1MA 3RZJA 1CN1A 2PA7A 3MIBA 3SITA 3GM8A 1ZBA2 4QQ2A 4FSJA 3DF0A 4YVSB 2RDNA 5CKNA 1QJY1 2WINB 4KWJA 1F4AA 2HWC2 4LR4A 1UAIA 2W47A 5A3UA 1XBFA 3VDAA 5FYSA 1S1AA 3WDWA 2VPVA 2GN7A 4YVSC 4Q4V1 3P3NA 5IK8A 3C8XA 1SFNA 2OT7A 1EV12 2XONA 3RS6A 5BNPB 1PO21 1U5IA 2C26A 4CPBD 4FAHA 5F9TA 1T6BX 5E6HA 4LKSA 4FPLA 4DO0A 1IS6A 2GAUA 4XMIA 4FBFA 1MVEA 3VD5A 1RUC2 4Y3OA 1OLRA 4YRDA 4ISRA 1US3A 1VE0A 1XQNA 1MS8A 1VAMA 3J7HA 4IEOA 2WC2A 2XLAA 5H9QA 3T0BA 2HWC3 4LNVA 2QNKA 4X8NA 2ZCWA 4S2DA 4C1WA 2A7AA 5K9YA 3U78A 5F39A 1OD3A 1GNHA 3VZNA 3W58A 1NAEA 3Q8CA 3W5MA 5D21A 4EN7B 1W6NB 2P5BA 4OHWA 3WF0A 4BHPA 1W3VA 5LA9A 4QKBA 1KGYA 3TN92 4RFT0 1C8M1 4CCEA 1SLBA 2WUHA 1IPSA 4MGQA 5FO7B 1W6OB 1W6QB 4N90A 1QNYA 2ILMA 3N4MA 2VMEA 4IV3B 5ANNA 4YARA 3IPVA 3ILNA 4MGIE 4P9GA 5A7QA 3J8F2 3J8F1 3OPWA 4D7TA 1WCSA 2A6WA 4XBQA 5A70A 1ZRFA 2N7GA 2VULA 2HWF1 2D6OX 1KD7A 5C3QA 4CVUA 2XUMA 4H3WA 4COWA 2F6BA 1DBNA 1MZ5A 2VXJA 5FWJA 5DAWA 1A6CA 1F5FA 2Y6KA 3C7FA 3W20A 5F6KA 3HT2A 3JZVA 4I09A 5FZMA 2X10A 4EN6B 1ZZ6A 2PLV1 2YDEA 1IS4A 1KFUL 5KC5A 3ZLIA 3N7MA 3O0WA 1OH4A 3SKVA 3RZMA 1ULPA 1MR5A 2SLIA 1CAUA 3J8F3 4J1XA 1WMEA 1UYXA 3SC7X 1N1VA 2QQPA 5T5LA 1WBFA 3VKNA 1Z7S2 3LA2A 5DDJ2 5DZEA 4D6QA 2WZR3 3ZFGB 1W0PA 4AVVA 2HEWF 4JRAA 4LBNA 2HBTA 3VDDB 2BZDA 3DKWA 4CP2A 2Q8CA 2WO7A 2WNEA 2JG9A 1O4TA 1MS0A 2FCVA 2H0VA 3I3BA 3RPQA 2D6LX 2WWSA 5LB6A 4XETA 4XFCA 4Z92B 2K2SA 2XVGA 2DCYA 1ZX5A 2A5ZA 3VB9A 5A7OA 3RJRA 4P9WA 5JOYA 4XJZA 5JSRA 4L92A 5FMBA 1OD5A 4Q4W1 2Y8KA 2W68A 1DQ5A 1NE4A 1XE8A 2E32A 5AVAA 4XUPA 1MEC2 3MLJA 2CGNA 2EICA 4PT6A 4RSUA 5IUQA 3QLQA 3U14A 4QPGC 2JDZA 2ZGLA 4BIFA 1NQDA 1VRH1 1YFYA 4AGVA 1CQ9A 1GNZA 2RE9A 4ET7A 2B45X 4J6GA 2W87A 2C6SA 1QJZA 1UY2A 5FYVA 2YYOA 3S6PA 1AR82 1GWMA 4QM9A 3N9PA 4ATEA 1J3QA 2PHUA 4KMQA 1LR5A 3K4DA 4WM7A 3IKWA 1LEMA 1WMDA 5LEJA 1EUTA 5C8CA 4CP9B 4EV0A 3WP4A 4GH4B 3RI9A 3WQ0A 2JDHA 3BN6A 4AFDA 1O3RA 1J58A 1X8EA 2WT2A 4UXAA 2PFWA 3MFCA 4MO3M 2NQYA 4XACA 2EIGA 4FQ4A 1W06A 4XJAA 2R061 2Z42A 4NROA 2A70A 1BVP1 1J1TA 4FPOB 4LHSA 1GP6A 4LBJA 3TRSB 2ZS6B 3WSOA 3EHKA 5JXJA 3HBKA 1UOGA 2HYXA 2HWE2 2ZAAA 3OEAA 5E8AA 5T52A 1HW5A 1W8NA 3KQ4B 5EHDA 1VBB3 4QB6A 4XW3A 4YGDA 4DXTA 5KHIA 1WLWA 3VL8A 3OPZA 4QHOA 2JB4A 4JZRA 3RWKX 4OVEA 1GANA 1XYPA 3AB0A 3MW3A 4FPCA 2Y6HA 1ASJ3 3QD6A 4QXBA 1PO12 1RVF1 1TZOA 3PJYA 3WZ1A 4GALA 1O3SA 1VJ2A 1UMHA 1OPOA 2AH2A 4Q29A 3WG2A 5J36A 2WO2A 2R063 1AX2A 3EBRA 4CCMA 2YFZA 5TSWA 1ASJ1 3T0AA 5HCAA 1YO8A 5B2GB 1DDLA 2CSGA 4AFAA 2D43A 1F9KA 5I8TA 3I59A 1XE7A 3CQOA 4DS0A 3UKVA 4XIKA 1TQ5A 2VTFA 2YV8A 2UY9A 2YROA 3J26N 1UY3A 2MPFA 2FCUA 3KHBA 1C3HA 3AFGA 5C3RA 2VCMA 3B3QE 1NA1B 2JE7A 2UWAA 1OLMA 3ENRA 4PIYA 3VD4A 5E89A 1L7QA 1PZ9A 2B39A 2D6MA 4JDMA 2J1UA 4YVWA 5F3IA 4EWEA 1V9U1 4FOVA 4CP0A 2BNMA 1NCRA 5FOJB 3LPGA 3VBFC 3VBRC 1GICA 2RM23 3NV4A 2BGPA 3H50A 4Q4X1 1OF4A 2J42A 2RS12 4RS5B 5HXVA 4MADA 1PMHX 4N7IA 3ILFA 1JMUB 2HWB1 1K5MC 4NIHA 5T3NA 2VECA 4IV1C 5APAA 2Q8DA 3PVOA 1HXS2 1UO9A 1EP0A 4UWDA 2WO3A 4D7YA 5CZKA 4DB5A 1XE0A 2O14A 4NIGA 4OMDA 4K20A 1JI6A 4N9HA 4P9LA 1C57A 1CAVB 1SG3A 5EYXA 2XJSA 2DVAA 3KMHA 2XKOA 2OPWA 5FREA 1Q8OA 1V6MA 4D3WA 3ZXKA 3KS7A 2PHRA 3KSCA 3AKPA 5A6ZA 4QB2A 3FN9A 5GALA 1QJEA 2RJ2A 4A6OA 1AR91 1Q43A 1RIRA 2FBEA 2YC2A 4JKLA 4D69A 5LK7B 3ZXLA 1LHWA 5FYBA 4CDWA 1DQ4A 5D2AA 1AR62 2ZACA 3A21A 3CF6E 4IE0A 2Q0AA 1H1MA 4YFWA 1DGRN 1RJ7A 1IQAA 5CIRA 4X6QB 5IHRA 4LOSA 1F4HA 1OFSA 4QB1A 5C3OA 4LOTA 5HV0A 3TWIA 5FZ0A 5A3NA 2G9FA 4FTSA 1V6IA 2A73B 1B35A 1X7NA 5K0UC 2ZEYA 4FFIA 3PMEA 4WVMA 5EJZB 2WYSA 4I30A 2QTWB 1MS3A 4ZU4A 4GQ7A 4QXCA 2BP6A 5A3OA 4Q5OA 3TEYA 1RUF2 2HWE1 3K3NA 3NJZA 1HQWA 2VOXA 4KU7A 4BXFA 2X5IC 2JWPA 1OSGA 5T5PA 4AFCA 4AYUA 3H3UA 5JPMB 3LOIA 4FVVA 5KXDA 1VB2A 4QMAA 1OFNA 4YGCA 1H1IA 4YM3A 1RUD2 4K8RB 2AGSA 4BQWA 4N7UA 4Q0SA 4V2WA 4XFIA 3NJXA 4BE3A 2HWD2 1NLQA 3GCXA 3IDBB 2EA7A 3HNMA 3W21A 4JCKA 4CUBA 3AVRA 2GMPA 3VZJA 4RD7A 2NPIA 5F37A 2WZR1 2ZGPA 3HQXA 4B1LA 3JB4C 1JYCA 3FBYA 5CFDB 5FK8A 3IDCB 3ZSJA 3SH3A 3SH4A 2D93A 3SKJE 4CYDA 2BUKA 1GOGA 4FI9A 4FOQA 4K9SA 3LD8A 4AFBA 1UX7A 3DCQA 4XTPA 4QX5A 2C5DA 3CLPA 2V72A 2ZGSA 5FZDA 2WT1A 5A33A 4A3XA 4BQ3A 5AC91 1W8FA 4LK7A 5T54A 4ISQA 2ZX1A 1W05A 3PUHA 3MUY1 3C7HA 2WS93 1DIWA 4CU6A 2GU9A 3M8LA 3NVCA 3N9LA 4AVBA 1NYWA 5K7PA 1LJ7A 3SQOA 1LEDA 3CBNA 5I0TA 1QQP2 1Z7S3 1SLIA 4Z1VA 4HKWA 4XFGA 4K3UA 1DLCA 2QDRA 1AR81 2LROA 2PHWA 2PHFA 4KBZA 2OKXA 1LGNA 2ADEA 3AMPA 4H55A 1WWYA 4LORA 1W8HA 3CKHA 4IEXA 4LO7A 3C7EA 4UYBA 2VCAA 3AZVA 3UJOA 1ZBE1 2WNUB 3LSDA 4EN0A 3LCPA 3HVDA 1C4RA 3M3IA 3N7JA 5FK7A 2VTXA 5IVVA 2ZJCA 1BQPA 3HBZA 2GP3A 3AYCA 4ZXEA 2K0GA 3ZYHA 1AL23 1L3JA 1R1ZA 3K2OA 3U4SA 3ZX7A 5BXXA 3D0JA 1VBC1 1Y9QA 4DRVA 4UF0A 2BOJA 4MHRA 5DUUA 1HB3A 2CDPA 2KR2A 4QKNA 2WAAA 1Y7BA 2B9VA 1U0AA 3FZ3A 2PAMA 4IQPA 3VBSB 4D6SA 3GJAA 1ZZCA 3WR0A 1OHFA 3O1MA 4WV8A 5DZGA 4WBBA 3KVAA 1G9DA 4G9SB 3Q8AA 4HK8A 4KGQA 3AZWA 3R6SA 1RUD1 1ENSA 1FOD2 3LF7A 2DFBA 1COV1 3ETPA 3ACGA 1UF2C 1RHI2 4LO6B 4V2VA 1RUNA 4QKDA 3LE0A 4JHZA 4FXGB 2WT0A 1OBNA 1ZM1A 4BPZA 4QPGB 2YC4A 3IZOA 4AAPA 4NOTA 2QQWA 3TAYA 4RFRB 3AYAA 4YZ5A 3HJRA 4PF5A 3E6CC 1CZSA 1JYWA 3E6BA 5FP4A 5FPBA 1W0NA 4QPIB 3WW2A 3QACA 3U0ZA 1CIWA 3R4SA 3LKJA 4TXWA 2E7AA 2V09A 3NKTA 4B8EA 3MIFA 3ZFFC 4FPKA 1ONAA 1YHFA 4BK5A 5ABJB 1O5LA 1QQP1 4HK9A 2BOIA 4CU7A 1N47A 2JEMA 1LNSA 3NNLA 4QGNA 2AENA 2E6VA 3FWEA 4UBGA 3LEMA 4YW4A 4M0HA 1SEFA 4R4ZA 5I8SA 4IL7A 1UIKA 3H1YA 2I2SA 2W0XA 4WM7C 4XXAA 3ZFFA 1FPN1 4UFHA 1HRI1 2WN3A 5A32B 3DGTA 3FUQA 5GM0A 1KEXA 1CONA 1QJX3 3T08A 5M0TA 4QX1A 3VHNA 1AR63 2Y34A 2Y6JA 4AEJA 5C6CA 3AL5A 4NRPA 4P00B 1CJPA 4WM7B 3SEEA 4ATFA 3ZYRA 2OZ6A 1NLRA 2X05A 2XR4A 3T4HB 1V6LA 3GBGA 5FUIA 3CL1A 4J1WA 1O5UA 5J37A 1SLAA 2W5FA 2CGPA 3OGJA 4CXYA 1V6KA 4OLLA 4FFHA 5IAVA 1D0HA 4H2AA 1TEIA 4L11A 1DQ6A 1PVC2 2DCKA 5DAPA 3VKFC 4IE6A 1Q56A 3ITQA 3E5UA 3PIGA 3ALQA 1ZREA 1QJX2 4BQ1A 2A6YA 4NHLA 5FOBB 5A7WA 3D5OA 2XJQA 4OULA 1XSQA 3KZ4C 1X9PA 2KA3A 2RDQA 1IG3A 2EIBA 5LZ6A 1PGW1 3GZTB 1EAH1 4XDQA 5BNPA 2DBIA 4QU2A 3IDAA 3ZIXA 4CDXC 4NAMA 5FZ8A 1SFPA 3TB0A 1FV2A 1M06G 1J3RA 4QHZA 3NV2A 3D82A 2IZWA 2RV9A 3VKMA 3OF1A 2FZ1A 5A3MA 4GJYA 4YM2A 4LJHA 1CAWA 3JBG3 4CDXB 1U5YA 3D6EA 3ON7A 2WL1A 3PLQA 1W8UA 4MYEA 2WQZC 5EIYB 4Y5SA 5IAXA 1MQTA 4NVPA 5HPOA 4WVVA 3RZLA 1ULFA 1QWRA 3OBRA 2GNTA 2Q5TA 1D7PM 2V5YA 2JDKA 4XUQA 2YGMA 3O0VA 1XOYA 4YVWC 3WQBA 3CDZB 1PZ8A 1BK0A 3I3QA 1PK6B 4LQRA 4RQPA 1NCRC 3GCWA 5CG8A 2NYYA 2D3PA 3B01A 1OPMA 2YBSA 3HAGA 3VBFA 1SCSA 3PUAA 4Q4V2 4Q4W2 2DU1A 4UW6A 1J83A 1YFUA 5FYMA 2YC0A 4AEMA 1BKZA 1H8VA 3GHNA 2JIJA 2VM9A 4NRMA 4LE3A 1E5IA 3HNYM 2ZX2A 2GNBA 2HWD3 4CDUC 4B29A 1YQ8A 4GIQA 1OUSA 4IV1A 4R9DA 4NJ4A 1FOD1 3PNAA 5DDJ3 3UL2A 2JX9A 3S5QA 2D5FA 2VUJA 5AFEA 3LQCA 2V5DA 2EIEA 1BYHA 2JB8A 1RYYA 2IC1A 3OG2A 1H2KA 4I02A 3WNNA 5L9VA 4CDUA 2D7FA 1QEXA 3I7DA 4CZSA 2V4AA 3MF9A 1DZRA 2VQAA 2ZKLA 3KF5A 3MV01 3BOWA 3I2FA 1R1A3 3MIGA 3PTRB 4E2SA 5HCHA 2EXJA 4AZZA 1CAUB 1UD1A 4BCUA 3MW2A 3RZKA 1BZWA 4LUKA 3ZSLA 1FATA 1XNBA 3RYKA 4AHWA 1B09A 3EMRA 3LA3A 3T2OA 2GNDA 3F95A 5FZOA 1LECA 1UZVA 2R0HA 3KT1A 4ASKA 5J1XA 3F2ZA 4TSVA 3VBUA 3T30A 3M1HA 1O3QA 3JCIA 5K0UA 4AQ6A 2WWJA 2FMDA 2PLV3 2ARBA 1COV2 4B3NA 2LS6A 2WS91 5D8AB 4Q1PA 1VBB1 2PHXA 3MLKA 1HQNA 4LHKA 3LFMA 2JKXA 3OYWB 5A7PA 3R0RA 1W2OA 1VRBA 1WKYA 2FHRA 3D4KA 3JU9A 3WXPA 4D0QA 1XYNA 4DNYA 1HRV1 1FMD1 2OZJA 2VMIA 3C2UA 5JAXA 1OH3A 4EJRA 3UGHA 2RVAA 1A8DA 2RDSA 1OVPA 4X6RB 3A22A 1G9AA 2XDVA 3ES4A 4KI5M 4M3CF 5FP8A 1YEWA 4CCNA 1Q5OA 1HIXA 2W95A 3AM2A 3AC0A 2CU5A 2KD7A 5LK5A 3UK9A 4QQLA 4W4ZA 2E9QA 2XWJB 2QUOA 5ERLA 4JAAA 3ZMNA 3H1MA 1TME2 2B9UA 2G4IA 1OLQA 3H0OA 5I8YA 3H7JA 2QQLA 1GQGA 2NZ9A 2ATFA 2HJIA 3EYPA 3H8OA 1N3QA 5IWFA 1SLTA 2J1AA 4ARYA 5KXEA 2A6XA 2ADDA 4N8MA 3O1OA 1Z78A 1SBFA 3IPVB 4DUXA 1MPXA 3PIJA 1IS5A 1BK1A 1R093 2WKKA 4LK6A 2G9ZA 1UZZA 1VAVA 4DFSA 4YW2A 4Y1XA 4AI3A 2KM2A 5ACA1 4UW5A 1FNYA 3KLSA 3LOBA 3AP9A 3E1F1 2HWC1 1RUD3 3ZYIB 2W1QA 3UESA 2VMDA 2PHTA 3LAGA 1YI7A 2DWRA 2MEV3 5BY5A 3AL6A 4FXKB 3V0BA 2RS53 4GWNA 5HCBA 5AFBA 4OI0A 1MS5A 3ACLA 1JU4A 1S0DA 5FZAA 4M3CE 2WYFA 1JZ8A 1C8M3 5IVFA 2PTMA 2E7QA 4YNIA 2AREA 3ZXFA 3A4UA 2ZGRA 4UT5A 2ZZJA 2DBNA 2XJUA 4JGZC 2VMFA 4NWWA 4QXHA 2W08A 1AR61 1RUE1 2DCJA 5FKBA 3SMHA 4BYYA 5CA6A 4GB33 5IJRA 1V6OA 2RMU3 3WNPA 3V0AA 1D0GA 1NE6A 2XHNA 1JZ5A 1PGL2 1LOEA 2ZEXA 3ZFEB 1G6NA 4RHV3 3TNQA 1RMU1 2JG9B 1V9U3 1PO22 3SISA 4BWOA 1V6NA 4MGZE 2VE1A 1PMIA 3UV9A 2ERFA 4JKKA 1DGLA 3WQ7A 3ZXEA 1QXPA 4XC9A 1ALYA 5CB7A 4ITCA 3ZYBA 3ZFGC 2JG9C 2VUCA 3N7LA 2ZA9A 1TME3 3CZUA 5J09A 1K45A 3I2DA 5A3PA 1RXGA 4Q0PA 3FLRA 1RUI1 4RS5A 5F1RA 4W8JA 4RYDA 3AFKA 4B7EA 1ZYBA 3ILRA 4AXOA 5KBFA 1I1EA 1QXRA 2VZTA 1LHVA 4PDWB 2A3WA 4GWJA 3I54A 1TMF1 2P6HA 3HWJA 5FPLA 4QGLA 2R041 3NL1A 4Q26A 3TBDA 1AL22 3BCWA 3URFA 4SBVA 3PVEA 1Y9GA 2BBVA 1GQPA 3KV5A 5LA1A 1I3HA 1OQDA 2X53S 5KWRA 2QQMA 5F5IA 3C3VA 3P1IA 4IEWA 3ZXGA 1ENXA 4QHBA 2IXCA 3JQXA 4NWVA 2VZRA 4L9BA 2FDKA 1WD4A 3AP4A 2R1BA 1D2SA 1JYNA 5JXIA 1LGCA 2VG9A 3DECA 1QOOA 1VBD1 1DCSA 3A23A 3JD73 4KG0A 2ID4A 4OI4A 4XBNA 2I07B 5FPXA 1GBGA 1XYOA 4HZFA 3T3YA 1PIV3 3ZR6A 3VBHA 3ACIA 2Z2SB 2ZAHA 3RVHA 2DV9A 1KQRA 4CUCA 3MHZA 4JDOA 4IE7A 1W2UA 4WVWA 5GZEA 1S0GA 2A75A 2IXKA 3NSTA 4Q4W3 4DUVA 3ATGA 4OUEA 1AX0A 1HDKA 1DZQA 1DFQA 4YPJA 1M4WA 2D5HA 1JYXA 1CZTA 1QNWA 3DPRC 3SCFA 1SLCA 5FYHA 5JLVA 3WW1A 5FZBA 2O1QA 2YY1A 3KV9A 3T1LA 4ZXKA 2HEYF 2GZWA 2XJPA 1VBD2 5LBBA 1OOPB 3U4XA 3MF6A 3RFRA 5JZGA 2WFF3 3RI8A 2YUEA 3CJIA 1KITA 5L7OC 1ZRRA 1O4ZA 1RVF3 2CAVA 2JG8A 5F3GA 1YCIA 3AKSA 4XZUG 3X29B 2WFF1 3FFZA 4LO4B 1AYM1 4HONA 4XPVA 3VD7A 1NOVA 3AKTA 2Y60A 1HN1A 1LHOA 5JZGC 3CJIC 1E5SA 1S0JA 5LY1A 3VUOA 4CEWA 1ZBA3 3AZZA 4MOAA 1YI9A 1JOPA 3FJSA 1K3IA 3MUZ1 4ZS3A 4LBQB 4AOCA 2XVKA 1IZ3A 3GF6A 2WIIB 1Z0HA 3CJXA 1RUE3 2VTXJ 3AP7A 1CESA 1CAWB 3AXEA 4IERA 4Q0QA 1BEV3 2QBXA 4INDA 1DGWA 1HX6A 4CCLA 1QDOA 2VGDA 1CAVA 3DUIA 3NRUA 5JOWA 1OA4A 4CCOA 1C5HA 1PO11 1OA2A 4P9IA 5FZ6A 4XYXA 4BIOA 2WNVB 1L7RA 2EXIA 5BYNA 1H1AA 2WNVC 1UKRA 2PXJA 2ZEZA 2I45A 4BXSV 2B4KA 1POV0 3EO6A 1RUH3 2Q8OA 1PK6C 3MFAA 4CPBA 3CO2A 1UWWA 1MZEA 4N43C 1H8TB 1R091 4M0NA 4MVTA 4URTA 5I0UA 3MPBA 3WV6A 3WG3A 5BUVA 1PIV2 4ORFA 1BCXA 2QFEA 4UW4A 2RS33 2W91A 1PVXA 2HWF2 1B35C 4JHTA 4CDUB 5FPAA 2CYFA 3GZEA 1QJX1 3NQHA 2Y64A 4WM8C 1DG6A 2HEVF 5IK5A 1UCXA 1U5ZA 4N43A 3BU0A 2RS31 5LBFA 3IMNA 4YG6A 3PVNA 3P3PA 1PIV1 3H7YA 5GLVA 3WDVA 1SFYA 4C0BA 5ABJC 4AEDC 1BMV2 4CCDA 5EP9A 3AVSA 4Y4RA 4BDVB 3THTA 2ENRA 3RZZA 5JI9A 2J1EA 2VJXA 3BGAA 3Q9OA 2P3KA 3GDBA 5LA0A 2OPKA 3VBUB 1WLDA 4FOYA 1NG0A 1RUJ3 2LRPA 3C7OA 4XURA 4Q1RA 4AI8A 3AYEA 3KWVA 5FXVA 2WQ8A 2RS52 1FX5A 5ABJA 2SBAA 4ZPIA 3THCA 1DQ2A 5JPNB 4O65A 4BISA 4IEUA 1NUKA 3POYA 5FO8B 5A6YA 1YNAA 4LITA 2WFF2 3ETQA 1UZWA 4QT6A 5HI0A 2MHFA 1GMMA 1R1A2 5F32A 3H3ZA 3WF4A 2CY6A 1YIPA 4XF3A 4AL9A 1CJDA 1TE1B 1YQ2A 2XQRA 5L36A 1XRUA 1RUI3 5FZCA 3SNMA 4E8DA 1CD3G 1YQ5A 1AZDA 1Y3TA 2ZMKA 5DG1A 5EV7A 4NPLA 3V65A 4JTOA 5BNOC 5BNNA 1O8PA 1UX6A 2B42B 3BTYA 3RSJA 4LHLA 2XPJA 3N9MA 4AHYA 1MS1A 5DUXA 2J7MA 3I59B 4PHZA 4R4XA 1W9WA 4M3CB 5IVEA 2ET1A 4HSJA 1QJY2 4G3YC 4FCAA 2Y6FA 4EZHA 5KHJA 1F8VA 4RA0A 4XZPA 3I2JA 3BALA 2J22A 1CX4A 1LOBA 2DF7A 4AGRA 1AR83 2VD7A 4KWLA 1GP4A 3OCPA 4QD2A 4PIZA 4Y24A 3S0MA 1BEV2 4UFMA 3QH7A 5F8PA 3FMGA 3NNMA 3FHAA 1VR3A 4MZUA 3P5BA 2ES3A 2K9ZA 4NN0A 3VBSA 2W92A 2ZHMA 3OBZA 4CDQB 1UU5A 3IBMA 4RGAA 4K1YA 3VGIA 4H7LA 1JN2P 1YRZA 4QWNA 4V1PA 4XQDA 4QDSA 1ULGA 3HD8B 4XAAA 4E2GA 3AMQA 3B9IA 2A71A 1W8TA 4OI1A 3MDPA 4CRQA 1LU2A 2VZVA 1Q8VA 4OHZA 3V0BB 5AC93 5L73A 3RG0A 1ODMA 3R05A 5K8SA 3VKOA 4AGGA 2FZ2A 3NAPB 3D8CA 1HJGA 3VBSC 1DYPA 2VZSA 4CA9A 1UN1A 3JUUA 3BYWA 1JHJA 4IGQA 4EWAA 4UBHA 4HETA 1O3TA 4JGYA 4E4ZA 5FWEA 5LA2A 3O1TA 2RHPA 3H8XA 4W50A 1KJLA 1HQLA 2P37A 1RUC1 1N1TA 3HPNA 3MI8A 1VBB2 2PQSA 3ASIA 3MIEA 3WQ1A 3V0AB 1UZ0A 3I4IA 3KD4A 4K21A 5BPXA 3OUIA 3ZYGA 3LIHA 3BTZA 5JOXA 2VOWA 4HOOA 2Y38A 3POFA 3DKQA 3BTAA 4E4HA 2WLQA 4UOJA 1UY0A 1XC6A 3PUQA 2WJSA 4BMEA 1QJU1 2RJLA 1YWKA 1HXS3 2TUNA 3DYPA 4JGYC 4JVAA 5EYYA 1NQJA 4DOUA 1RUG1 1CPNA 1JXNA 3FE5A 1MZ6A 2DCZA 4CTEA 1CGPA 1C8M2 2P4EA 3NV3A 2BFUL 3G7DA 1F31A 2VW1A 4GWIA 1AHSA 3KCCA 4KG8A 3BIEA 4P9YA 2D98A 1WW5A 1T2XA 5E1RA 4WVMB 1W2NA 5FMDA 3VD3A 3VBOB 3W9AA 2QZ2A 2UY8A 2OYZA 5DUVA 1ST8A 2JDPA 2BPA2 4EQVA 1FAYA 2IXLA 1TMF2 2ZTNA 1BEV1 1V6JA 1IOAA 2TNFA 4JQRA 1YFXA 4A7KA 2CTVA 4OHXA 3WG1A 3O1PA 1XSRA 1GP5A 1OT5A 3DYOA 1HRI3 4K7JA 3ECQA 4MGTA 3K4ZA 2XLFA 2P17A 2YZ4A 3J7MA 1FI2A 2NN8A 2VMCA 3J7LA 5IVBA 2GALA 2O8QA 1W90A 4NRQA 4NHMA 5FP7A 3W59A 2WRAA 4SLIA 2ZGTA 4P5YA 1OQEA 2RS13 3VBHB 5IFPA 3KV6A 3WD5A 1VBE3 1W8OA 3WLUA 5CFDA 4OHYA 2DVDA 3OSDA 5FP3A 4YM1A 4FT8A 4YG0A 5FBZA 4HPKB 2OUJA 3I3MA 4IESA 3DL3A 3VD9A 3ES1A 1GYKA 4QX0A 3M2MA 4YZ3A 5D8AA 2C0ZA 3ZYFA 4IW3A 3OBAA 2IXJA 4CU9A 5IATA 5GJ6A 5JI7A 5BNPC 1NCQC 3GZUC 4Y22B 5A3LA 2XXZA 1GZWA 4CDXA 1ZZ9A 3MIHA 4D8MA 3ZM8A 3RQ0A 3RDIA 4XDOA 4CP1A 3S5AA 3MIDA 4YW1A 3TEXA 1NCQB 5FY1A 3HN3A 1PM7A 3T2QA 2DUOA 2G9GA 2R072 3CEWA 1CX1A 2HWF3 2OS2A 2ZOEB 3B5LB 5CKQA 5GKAC 4XF4A 1QF3A 1VLNA 3OBTA 1D4M3 4LIUA 3POEA 2J1SA 2BW8A 2WN2A 4HANA 4RHV1 1RMU3 3E6DA 5FY9A 4NR1A 4QPYA 4OUMA 3JQWA 2BGCA 5DABA 5ACA3 3ROUA 5L7OB 1QJU2 3PMSA 4BQ4A 3VDBA 3ZXJA 2BNOA 4PI2A 2VU9A 4XE9A 5T55A 3WUCA 3EJKA 3HN1A 3VHRA 3MZHA 3N9OA 1AJKA 2QQVA 2WBKA 1SPPB 3WNKA 3I3DA 2HYKA 4BOWA 5C7GA 1LULA 1WLTA 1AL0G 1YLLA 2OQ6A 5EFUA 5C9AC 5LW9A 2PMWB 1NZIA 2LW8A 2JDUA 2CNAA 4FFGA 5A7SA 3K3OA 5F2WA 2VUDA 5JWPA 2ZX0A 4GMP3 1UPIA 1ND3A 3T0DA 4NO4A 2VC9A 1BXHA 4KQ7A 2RR13 2VOTA 4I0AA 3FL7A 1NLSA 3NNFA 1GFF2 2XKPA 4B1MA 3VDDC 1K5MA 4OYUA 3WCSA 2JD9A 3K77A 1ZVFA 1HV0A 1POV3 2GC0A 1WW6A 3O1UA 5FZOB 2WNVA 2HWD1 1MS4A 1EV13 1RJ8A 3AZXA 1RUJ1 1RUE2 3FFQA 4N53B 4NAOA 3OGRA 1VALA 4QU1A 2XG3A 1E5HA 2XOMA 2P3IA 1Q8PA 2WZ8A 2ZGQA 3THPA 1ND2A 4S2GA 4OQ9A 2BVBA 1EV11 1MZFA 1R081 1XNAA 4RR3B 5FYZA 1VBC2 5A1AA 4I0BA 4ZZ5A 1DF0A 3AYDA 3OEBA 2WSVA 1IGOA 1KJRA 3B9CA 2EXKA 2AC1A 4YSFA 1SDWA 1Q3EA 1AF9A 1FYUA 3J7NA 3UT0A 2AACA 5B4XA 2JENA 5GZDA 1PHMA 4XEZA 1SZBA 1S0IA 4ZKTB 4RN5A 2R0FA 4MGSA 3MYXA 2R071 4XF0A 2QCSB 3ZN6A 5LEKA 2ZX3A 5HXMA 1ZBE2 1GZTA 5IVJA 3NO8A 2AZ5A 2O8OA 4YZ4A 2H6CA 4Q0VA 4N43B 2HWE3 4LUMA 4QPIC 1JS9A 1NT0A 3U11A 3ZSEA 3AZYA 1RTVA 5L9RA 3LSEA 1IG0A 1R1A1 1WLCA 4COZA 1LKNA 3QOPA 2QQNA 3WF3A 3LB9A 2J1RA 5EJ1B 2OVUA 2ET7A 1FMD3 4LLOA 4P08A 1Z7S1 4XXPA 4WM8B 4DIQA 3RZHA 5DAQA 4FPEA 2A1XA 4L0PA 1UW8A 3ZKYA 4AG4A 5FLJA 4BQ5A 2I74A 1LAJA 1GWKA 5C5UA 1RHI3 3USUA 4EZ4A 3SHRA 4AVAA 5J48A 5CEHA 1PX3A 2DTWA 1AXKA 2YB7A 2CWMA 2R7EB 3T09A 2FD8A 1RUG2 2DVFA 3WDUA 2QQOA 2EAKA 5A7WB 4PLNA 3NNJA 4GB32 3HR9A 1F2NA 2BRTA 3RNSA 1JZ7A 4MGYE 1O8SA 1PVC1 3LPFA 5IFTA 4CSWA 1KDKA 1V00A 1XB9A 2GP5A 1HB1A 1UMZA 5IK7A 3WOGA 1RC6A 1SBEA 1A8MA 5BNOA 4GAZA 4Y1VA 4OQ8A 2PHDA 3O12A 3KCXA 3FC0A 3IMMA 1G8WA 2QDNA 4KGGA 1REDA 2Z79A 4CUAA 1JODA 4YM0A 2P2KA 2XBO3 3VLBB 1S2EA 3IM0A 5IYYA 3OTFA 1W9TA 1OOPA 4AHXA 4O9EA 4K6BA 1W9FA 3VZKA 3B94A 3CJIB 4C1XA 1V0AA 1Q8SA 1JW6A 3D3AA 2A6ZA 3V56A 5GLWA 4JGZA 1RL3A 2AEYA 3LEIA 2RJKA 4R9AA 4JKMA 4QQHA 4RQPB 4C90A 3ORJA 4LKFA 1UU4A 2XUEA 1AYN3 4QX7A 5FY7A 5JVVA 4HKOA 3R4UA 4LPLA 3VBFB 4CEYB 4QDRA 2FDIA 4ARXA 1ASJ2 1FXZA 4AI9A 2D97A 2DVBA 2NP0A 3MEPA 1BBT2 4XFHA 1XNDA 1C1FA 2C4XA 4NE9A 1LRHA 3ST7A 1IQDC 1X82A 5GLUA 4GMP0 2GC1A 1GSLA 4Y1ZA 2PAEA 3KT4A 3AMNA 5EJ3A 5FPZA 4YZ1A 1EUUA 3I2GA 2YHJA 1JZ3A 4UFLA 1S2BA 5FZFA 2RG4A 3OPTA 1W28A 3NAPA 1PNFA 1YJLA 3KM5A 4RS5C 1GU3A 2ZBJA 1SBDA 4AWDA 3M3QA 3UETA 5LRSA 1H4HA 3ZDVA 1COV3 3ZKUA 4XVHA 1HB4A 1V9U2 1REFA 3IB3A 3OOXA 1UZYA 2B5HA 3LFIA 1OI6A 3NMBA 3S7EA 3BKZA 4PQQA 4M4RA 1W6PB 2BWAA 5FXZA 2GC3A 2RM21 1OLME 2D6PA 3MICA 4MX3A 4NPRA 4Q4X3 5KXBA 2YMZA 4A45A 1EY2A 2BERA 2MNGA 1X36A 1AUYA 1DZTA 1ZBA1 3NAPC 2YFUA 4JQTA 2VZPA 4JDNA 1FV3A 3JBG2 2EF6A 4LA2A 4URAA 3OY8A 1WMXA 1GZCA 3NV1A 1QH7A 4A41A 4COYA 4F3JA 1US2A 2ZMLA 5IVYA 2OIIA 3PJQA 1LESA 3PL0A 2YG0A 5FYCA 1ZRIA 1RUF3 3OGSA 4YYOA 3LZZA 5FP9A 2HBUA 3NW4A 5C8WA 4HN0A 1AR72 1CAXA 2D3RA 5K0UB 2QZ3A 3VL9A 2XJTA 2NM1A 1WA4A 5GLTA 4HL0A 2ZHLA 3VBHC 1LOCA 2R043 4XBLA 3VDCA 5I93A 5FPVA 1H8TA 1VRH3 1WCQA 3GYDA 1JZ4A 5H9RA 1OXCA 2PHLA 1JOBA 5F2SA 5EPAA 5C33A 2WA4A 4P5HA 1YUDA 1TG7A 2RMU2 3VBOA 5T50A 1VB4A 1ODNA 2JDAA 4QDQA 4QX2A 3RYRA 2XWBB 5A6QA 2YGLA 4E2QA 3DPRA 5CADA 1AX1A 1HN0A 4FP2A 3M7AA 1L7LA 1QKQA 2Q4SA 2MEV2 4YGEA 4ZU7A 4KU8A 1LTEA 3M3OA 4Q27A 4R9CA 5FZ4A 5J7MA 3QCWA 2BQPA 3LDKA 3S30A 1F5JA 1YC61 2Y6GA 2WFPA 1KS5A 4O7XA 1PGL1 1RUH1 2JG8B 1OVSA 3U75A 3VBOC 4Q4X2 5JR2A 4E9KA 5CFDC 5CG9A 1LOFC 1QOTA 2QKDA 1E5RA 1S4CA 1R092 1VBA1 2RR12 5DXDA 1X50A 5GZCA 3B93A 2YBKA 3BIWE 3FX3A 4HFSA 1POV1 4EE2A 2FDGA 3O0XA 4U36A 4IXLA 4XF1A 3JD71 5D8AC 3LGRA 4PI0A 3NNGA 1VBA3 1JOJA 3WW3A 2E53A 1OQ1A 1S0CA 1RINA 3KT7A 3L9JT 3BOPA 2D40A 4XDPA 4CEWB 2JD4A 3HOBA 3N36A 2WZR2 4IV3C 4M01A 1PZ7A 1W9YA 2L9LA 2TEPA 5FTTC 3EXUA 5A3WA 4K8FA 3WNOA 2F17A 4XUTA 2BJSA 1D4M2 2DUQA 2LUWA 4Z2AA 2VZQA 5E88A 2KXLA 2VVFA 3J4UH 3FUOA 4LO5B 1AL21 2XJRA 4P14A 1AYN2 1LODA 3ZFEC 1R082 2XHKA 1XJAA 2A3XA 2XL9A 2Z4FA 3Q8EA 1NXMA 1OC1A 3POSA 4LBOA 3B7MA 4NHXA 2VVDA 1VRH2 4HMZA 1W03A 1UYZA 2DDUA 3MO4A 3K75B 4FPYA 3BPZA 1UOJA 2CHHA 2ZKNA 3RJ2X 2WA3A 1W6OA 5FZLA 3VBRA 3ZFEA 5C70A 1W6MB 5CYYA 2CL2A 1W0OA 2VQ0A 4QPWA 5A7NA 5KC6A 3SCHA 2XVLA 1QQP3 4MUVA 2P3YA 5JUVA 3RMXA 3NJYA 5FJHA 1PO13 1YFWA 4IEQA 4XUOA 1RGSA 4LLFA 2Q8EA 4X8PA 3HMYA 4MGKE 5FJKA 4CDQA 1LOGA 4HN1A 3WP5A 1BVVA 3TYJA 1AYM2 2QJVA 2R073 3WVJA 4BA6A 2VZ3A 1RUJ2 4CCJA 4JTNA 3EB7A 3H3LA 2VCBA 1OKQA 4A7YA 5C4WB 4CXWA 5DDJ1 3KHCA 1CPMA 2YU1A 2IXIA 1IKPA 1GUIA 5C3SA 1KFXL 3LEGA 4XHBA 5FZIA 1JH5A 2XH6A 1G86A 2NMNA 4PDWA 2WABA 1QH6A 4P9JA 3PUIA 5FYYA 5C4WC 1VIWB 1JZ2A 4Y1YA 2GMMA 2WLPA 1YQ6A 2LALA 2W1SA 3N3HA 4LBQD 4XCBA 4DRRA 1C1LA 4ES9A 4CDWC 1RUF1 2P1BA 1C28A 4LTAA 4LA3A 4E27A 4IE4A 3U07A 2ZZQA 3J9SA 2BVVA 4DXZA 2A3YA 1NY72 3HIFA 4AW7A 4HVOA 4B4RA 2IXHA 3IAPA 1VPHA 3R4DB 2WZPP 3KB5A 2Z69A 4KNCA 3WCRA 1ND2B 2R32A 3DN7A 2OQ7A 4M4PA 5FZGA 5LRRA 1BLZA 1OA3A 1AR71 1WZXA 4Y20B 2VNRA 3CZJA 1N1SA 1JHNA 4UW3A 5FZ7A 5FQ0B 4AEDB 1CZVA 5GZFA 2Q1FA 3OGVA 4XJ8A 1QJY3 3HEIA 4Y26A 5GLZA 3WF2A 4NMIA 2R16A 2X5IA 3RYPA 4AEKA 2Q1ZB 4Q4Y2 3JBG1 4XOGA 3VBUC 5J96B 5EZWA 3ZPYA 1YXWA 5L9BA 4AI1A 3ZN6B 3VKLA 4YW5A 3Q8BA 3ZVXA 1UXZA 1GQHA 4I3PA 3T1MA 4BZ4A 3EQEA 4BQ2A 3H8RA 4BLJA 2ZHNA 5IK4A 5KHGA 3RGBA 1GOFA 3POGA 4TLGA 4RGGA 1OUXA 5BNNB 3SCGA 1HRV3 2W1WA 2VY0A 2BYVE 4BB3A 4CUGA 2VAUA 5FPUA 4FTEA 3UGFA 1RB8G 1Q8QA 3WNLA 2P6CA 1H6XA 1N1YA 5JZGB 2XL7A 4QQPA 3JB8A 5FZKA 2BU9A 4XF9A 5BNNC 4YLZA 1RUH2 2W1UA 4A2UA 3ZOIA 4NIDA 5FKCA 4Z82A 5FXWA 1KRIA 4YVSA 4ES8A 4MLOA 5KHKA 3B00A 4KWKA 4S2HA 4IUGA 5HCFA 1YQCA 5EQUA 3OGGA 3HNBM 4LO8A 4OHVA 2QE3A 3D0SA 4XILA 3SEPA 1DGWX 1CVNA 1IPJA 1H2NA 2RMU1 3VZMA 2OW4A 2JICA 5DAXA 3I2KA 2R30A 1OMIA 4LBQA 3TN91 4COUA 5J3UA 4AFMA 5IW0A 2X29A 5FYTA 4FTBA 3M3EA 4DINB 1V70A 3A7QA 4BK4A 1VMFA 4R52A 1STMA 2VNVA 3UKTA 1WGPA 4QM8A 2DFCA 4IEZA 5T5OA 2VBDA 3JD72 4OCTA 2GH8A 4HVRA 5FMOS 4GWMA 5FY4A 1U12A 2E31A 1EAH3 1UOFA 1VBA2 2RR11 4XCAA 3BI3A 2EIDA 1T6GC 1AR92 1E57A 1GKBA 5FMCA 2NMOA 2ARAA 4I0WB 1OURA 4Q8LA 1H2MA 2DYCA 1FOD3 3PTYA 5FZ9A 2EVXA 1TMF3 3KGLA 2DTYA 3I49A 4TTGA 1W6QA 3KF3A 4CEYA 2VMGA 5FR3A 2ARXA 5DAVA 2HKXA 5H9SA 5F3CA 2ZGOA 1NX9A 1NCRB 1RUC3 4YG3A 5DPNA 4CU8A 2JJ6A 2FQPA 2VW0A 2PYTA 3CU7A 4B4QA 2W39A 1ZA7A 1PGSA 2ORZA 1SPPA 1TNFA 4BQYA 1G9CA 2FDHA 2H0BA 1WMFA 4LT5A 3WG4A 1OF3A 4CEYC 5LCWL 1LOAA 5DQ0A 4E4SA 4XFFA 1SQ4A 1C5IA 1W2AX 4PLOA 1QGLA 5JXGA 1H4GA 2CV6A 3TEWA 5LWBA 1HKDA 3GJBA 1JU3A 3INAA 1W8WA 1QDCA 4IE5A 3H9AA 2W94A 5FAXA 3WUDA 1PVC3 1QXJA 1W6PA 1HLCA 2CGOA 1VBC3 2Y26A 5SV8A 4DEVA 1K42A 3ZYJB 1TNRA 4TYSA 2VOVA 2XJVA 2OA2A 3B02A 5FFOC 1C8NA 1K5MB 3WY6A 1ZRCA 2JDYA 5BNQA 2ZX4A 1NY71 3OD0A 4JRLA 1SDDB 1DQ1A 2VO5A 2IFRA 2VZUA 4O9GA 5EXOA 2BTVC 2ZEWA 4LKEA 4KL1A 1YJKA 2IVJA 1BMV1 2XBO1 3K46A 4HVQA 3LA7A 1X33A 3POIA 3Q8FA 4GJZA 4XABA 4A7ZA 2Z5WA 1D4VB 4D6RA 4GD4A 2RS32 1I5PA 1VBD3 1H2LA 1O4YA 1HXS1 1QOSA 1GV9A 2BWCA 4GZ9A 2GH2A 4Y33A 3IT8A 2VNGA 4RR3A 4GULA 2VR4A 3WDXA 1RVF2 2LM3A 1UMIA 4PBOA 5E16A 5A80A 2GN3A 4AAXA 5JIUA 3N9NA 3C7GA 2VXRA 2VBPA 2WSUA 1H0BA 1UYYA 1UYPA 2W52A 3ABZA 4GXLA 2UWBA 4MXVA 4Y22A 3WDYA 1BBT1 3AJYA 4AHZA 4E4DX 2AR6A 4DZGA 4Y5TA 3VHPA 2QQKA 4A42A 2BBAA 2CWSA 2ZGKA 1NCQA 2F4PA 3G6JB 3OD4A 2J1VA 1FT9A 1I5ZA 2XLGA 4YGBA 2PLV2 4DMIA 3FHIB 2FDJA 1QHDA 1LHNA 3GHMA 4Z07A 3TOJA 4HLTA 4NHKA 5C8CB 4M3CA 4Q4Y1 5F7UA 3RMYA 2ZXQA 3ME2A 2UYAA 4JV4A 4QAWA 5FUNA 4DPNA 3NJVA 3WNXA 5C71A 2X09A 3GALA 3LEKA 1W39A 5C3PA 3WEZA 1LB2A 1CR7A 4W6YA 2R042 3WX5A 2BEOA 4IV3A 2Y6LA 5DUWA 2F4LA 3MV11 4EN9B 4XHXA 2WO1A 4YW6A 2QQUA 5BV6A 5L7OA 3USUB 2DCTA 4BQXA 5JMOA 3OUJA 3UGGA 2JG8C 1VMJA 1ZZ7A 1ENQA 2YPJA 1W3XA 1Y9MA 4RL7A 2ZHKA 4DUWA 1VP6A 3UNPA 1D4M1 3MW4A 3FBMA 5FO9B 4YWAA 1SLLA 5KXCA 1GNYA 4L8QA 4LBKA 5FZ3A 1MQTC 4GB31 3T2PA 3K4AA 5LBCA 3K51A 4A4AA 5BNOB 4HG6B 1WCKA 4OUSA 1ND3B 2B7YA 4CEWC 1IHMA 2ETEA 3AMMA 2ZGMA 2YU2A 3DXTA 2JIGA 3GGLA 3IDEA 4FPJA 4LIVA 1XNTA 4RQPC 3ZPOA 4OZOA 2H6BA 1VAKA 5L19A 1OKOA 3N9QA 4FOWA 3O1RA 5FCCA 5C9AB 5JDBA 5J98B 3IIAA 2E7TA 1VBE2 4JGYB 2BFUS 3VZLA 5KR7A 4LE4A 4TZDA 3S57A 4AQSA 1HV1A 4MXWB 1WUVA 4XJWA 1DYKA 5FZHA 3VDDA 1H30A 1FNZA 4TLFA 2BV4A 4ONUA 5LASA 3WNMA 1ACCA 4DY3A 1NA1A 3BB6A 5IT6A 2GDFA 4M00A 1O91A 1H9WA 1I6XA 5LBEA 2WNOA 1GZ9A 3GBFA 1JZ6A 4PBPA 3FLTA 2EAAA 3PHMA 3O1VA 2R49A 1FMD2 2A6VA 3AKRA 1HB2A 1AVBA 1ND2C 3IN9A 1G9BA 1J59A 1DHKB 2DUPA 1MACA 4I3GA 1S55A 4PIXA 5FY8A 1F15A 1DLLA 1LCLA 5FDBA 3GXUA 1HJFA 4XAEA 5C4WA 3VV1A 4DQAA 3L2YA 4ZZ8A 2XMLA 4AI2A 5FBJA 4CE8A 2W46A 1PNGA 2MEV1 2AUYA 3TN93 2JE8A 3HQRA 4AVTA 1GR3A 2BNNA 2E63A 3I2IA 4W6XA 2FDFA 4H7MA 5DZFA 2HH9A 3IWZA 2EALA 5FZEA 1WCDJ 4BH9A 3ZYPA 1UOBA 3O14A 2Q30A 1ZRDA 4JX0A 2BDRA 5FYUA 1ULOA 2C9KA 4GH4A 2IFWA 1J1LA 3UKNA 1DU3D 2VZOA 4GKXA 3PU3A 2WWUA 4IGOA 1UNBA 2IWGB 4QPIA 3THDA 5JXHA 4XIOA 3VHOA 1REEA 2VVEA 4WM8A 4OFGA 3O5SA 3N35A 4WZFA 3WP3A 4AQ2A 5F5QA 3ZMOA 3DXUA 5FV3A 1AXZA 1JTZX 1PGW2 2D44A 5DMYA 3VN4A 4KBBA 2DURA 4UFJA 4F8AA 4LBLA 1JUIA 1ENRA 1SHWB 3FLPA 4JC1A 2W2IA 3BU7A 4Y4YA 4R9BA 4Y20A 3U10A 4DXSA 4MSVA 4YZ2A 4AEDA 4GH4C 4CXXA 2WQ4A 1JBCA 4Y5Z0 4FP3A 1CAXB 1BHGA 2WAOA 1SCRA 4IDZA 2IVIB 2G19A 4HPKA 2X5IB 3ACHA 5F5CA 3PUSA 2UU8A 3SLIA 4COVA 1LGBA 1WCUA 4YW3A 4NPMA 2Y33A 1KS4A 3ZXDA 1AXYA 2PAKA 4IETA 4K40A 1LENA 2JECA 3RRDA 2FCTA 1DYOA 4Z2WA 3QBQA 1VMHA 3NKGA 5I91A 1GZWB 2V4VA 5IVCA 3L2HA 3OB8A 1NKGA 3BPSA 1AYM3 4NHYA 4EROA 2GC2A 2VBBA 4RHV2 1WW7A 3CNAA 3DPRB 2DU0A 3I2HA 5KHHA 1RXFA 1YIFA 1DP0A 5T5JA 5CISA 4FPFA 1RHI1 2E51A 4DY5A 1W6NA 3POJA 2HWB2 4LEJA 5JSOA 5HV4A 2R1DA 3CMGA 2YPDA 3KCYA 5JR7B 2WDBA 2W3JA 3VZOA 3M70A 1ULEA 3KVBA 1OOPC 5A1LA 2XQXA 4META 2FMYA 1QMJA 4YVWB 3TNPB 2O0OA 1XXNA 3O7OA 3AX4A 4LULA 1GWLA 2Q1MA 3W5NA 5ISLA 1MS9A 1APNA 3KQRA 1H9PA 1I9RA 4NIAA 5JCTA 1QY4A 2WR9A 1SMVA 4IEYA 1XPWA 1UY1A 1W99A 2P3JA 5FZ1A 4DXRA 5EWSA 2VNOA 1AR93 1CIYA 5FYIA 4UAPA 3PU8A 3LDRA 4FPGA 1JYIA 2B8MA 2UYBA 5A33B 1A34A 3HQUA 2TBVA 4AK3A 2WNUC 4U2AA 3ZSMA 4XQ4A 3LIGA 2JDMA 1N3OA 4HXCA 4NUBA 4EYUA 3BODA 5F6LB 4OZXA 5DN2A 4GA9A 2QVSB 5FMOL 3LWCA 4N53C 4QGMA 4LHNA 2B46X 3ZDSA 1TVGA 2VMHA 1BBT3 1ULDA 1UQXA 3E5QA 4XFBA 4MV2A 1AYN1 4OI2A 3KGZA 2WNUA 4XUNA 4BLIA 1P8JA 3DV8A 3H1WA 3MLLA 3WW4A 4B7KA 3ZFGA 1XNCA 4Z8BA 3OY8B 1J3PA 4KH9A 4N53A 3PVBB 3WHUA 1S0EA 3T4VA 5AC92 1W6MA 3RZGA 1W2TA 4D94A 3JXSA 3AP5A 4PQ9A 4Q4Y3 2RS51 3I3EA 5JIAA 1UPSA 1W04A 2ORXA 2XGXA 3T2TA 1UXXX 1WBLA 1PX4A 1N3PA 4AVCA
chains in the Genus database with same CATH topology
4XJ9A 1ULCA 4EN8B 1KXGA 3N7KA 4BMBA 1HRI2 1DQ0A 1G9FA 4HSLA 1QU0A 2ZMNA 1B35B 1X8MA 3RWNA 1EAH2 4FQZA 1IPKA 5ACA2 1AJOA 1VBE1 4Q0UA 4PJYA 1H8TC 5FLIA 1XU2A 4AF9A 2C1FA 5I0SA 4G4FA 2JXAA 5I0RA 3SH5A 5AVPA 1WW4A 3E5XA 3ZXAC 4QPGA 1EPZA 1O7FA 2VOKA 3AMHA 2LTNA 4IEPA 4YFZA 5JMCA 5JOZA 1FPN3 1EPWA 1UIJA 2YXSA 4R8HA 5CU1A 3M3CA 4XMAA 2OUHA 2GMEA 3A0NA 3OJBA 1RUI2 1TME1 1EYBA 3I8TA 1GLHA 2UWCA 5FRAA 1NXD1 4RR3C 4WZCA 2D6NA 4L97A 4W65A 5C8CC 1LOFA 4BM8A 3AXDA 2R6QA 1RUOA 4ASLA 4HT1T 3WINE 1HRV2 4F7ZA 4PLMA 3SXWA 3H8UA 5DG2A 4Y1UA 1DGRA 2GSYA 3ELNA 4QQOA 3AP6A 4EWDA 5CNAA 1N3PA 1BJQA 5CVRA 5CBLA 3E97A 1ZZ8A 5GZGA 3OYWA 4AQTA 3WP6A 1XU1A 4LBMA 1S0FA 4MH0E 3AK0A 1UL9A 3B69A 4TWTA 3ZIWA 5JSPA 2D6KA 2PN5A 5H9PA 2RM22 1PO23 2P34A 2CAUA 4W6WA 4AVSA 2XB6C 4D7SA 3USSA 4Q2FA 1AR73 1D2QA 2Y0OA 1MEC1 1ZBE3 3POWA 1S2KA 2PQQA 3MGUA 4XQWA 5L36A 3VBRB 1A3KA 4GMP1 4P9XA 2WS92 4JGZB 4I01A 4QXKA 1A78A 3GZAA 1MEC3 3QH6A 3M4FA 4WVZA 4HKLA 2VUAA 4FO9A 1IS3A 1YYNA 3V64A 5FLHA 1XNKA 3WT3A 1S0BA 1NZCA 2V73A 2ZGNA 4HBNA 4CDQC 1URXA 1ZZBA 4PCRA 4AE2A 3GBWA 1G7YA 1SACA 2ZGUA 4C91A 5HBAA 3MPPG 4IEVA 4I2OA 2UURA 2VW2A 2D3SA 3APBA 5C9AA 3NWKA 4PDWC 2AYHA 5CFCA 1MQTB 1RUG3 4K1ZA 2ZPXA 3A0KA 3K48A 1NA1C 3AKQA 4XTMA 4N9IA 4ZU5A 2VH9A 2GNMA 4MXWA 4H14A 3ZN4A 4F83A 1ND3C 1UKGA 4L2NA 2RS11 1PK6A 1U5XA 2ZABA 3UJQA 3ZO0B 4CDWB 2NLRA 3WHTA 5CFCC 1LHUA 5D1IA 4FAGA 2JKBA 4XFAA 5FQ0A 1JUHA 2XBO2 1R083 3ZSKA 2X8KA 2R062 4IV1B 1FPN2 1RMU2 3AJZA 3GNEA 2EXHA 5CAZA 1LU1A 3HT1A 3S7IA 1UU6A 1KDMA 1ZNPA 4Q8KA 3ZFFB 4XJUA 5SV5A 1ZA4A 1QJU3 2JE9A 2PELA 2Y0IA 5A32A 3WDTA 4FPHA 4C0HA 1MVQA 2HWB3 1IKQA 4Q4V3 4AI0A 2DVGA 1Y43B 4B4PA 1RITA 4L99A 1WD3A 2C9AA 4GKYA 4S2FA 3ZN5A 1CN1A 2PA7A 3MIBA 3SITA 1ZBA2 4QQ2A 4FSJA 3DF0A 4YVSB 1QJY1 2WINB 4KWJA 2HWC2 4LR4A 1UAIA 1S1AA 3WDWA 2VPVA 2GN7A 4YVSC 4Q4V1 3P3NA 5IK8A 1SFNA 1EV12 3RS6A 5BNPB 1PO21 1U5IA 4FAHA 5F9TA 4FPLA 1IS6A 2GAUA 4XMIA 4FBFA 1MVEA 1RUC2 1OLRA 4YRDA 4ISRA 1XQNA 1MS8A 1VAMA 4IEOA 2WC2A 2XLAA 5H9QA 2HWC3 4LNVA 2QNKA 4X8NA 2ZCWA 4S2DA 4C1WA 2A7AA 5K9YA 3VZNA 1GNHA 3W58A 4EN7B 1W6NB 4BHPA 4OHWA 3TN92 4RFT0 1C8M1 1SLBA 5FO7B 1W6OB 1W6QB 4N90A 1QNYA 2ILMA 3N4MA 4IV3B 4YARA 3IPVA 3ILNA 4MGIE 4P9GA 3J8F2 3J8F1 4D7TA 1WCSA 2A6WA 4XBQA 1ZRFA 2N7GA 2VULA 2HWF1 2D6OX 1KD7A 2XUMA 4H3WA 4COWA 2F6BA 1DBNA 1MZ5A 1A6CA 1F5FA 5F6KA 3HT2A 3JZVA 4I09A 4EN6B 1ZZ6A 2PLV1 2YDEA 1IS4A 1KFUL 5KC5A 3N7MA 3O0WA 1MR5A 2SLIA 1CAUA 3J8F3 4J1XA 1WMEA 2QQPA 1N1VA 5T5LA 1WBFA 3VKNA 1Z7S2 3LA2A 5DDJ2 5DZEA 2WZR3 3ZFGB 1W0PA 4AVVA 2HEWF 4JRAA 4LBNA 3VDDB 3DKWA 4CP2A 2WNEA 2JG9A 1O4TA 1MS0A 2H0VA 3RPQA 2D6LX 2WWSA 4XETA 4XFCA 4Z92B 2K2SA 2XVGA 2DCYA 1ZX5A 2A5ZA 3RJRA 4P9WA 5JOYA 4XJZA 5JSRA 4L92A 1OD5A 4Q4W1 2W68A 1DQ5A 1NE4A 1XE8A 5AVAA 1MEC2 3MLJA 2CGNA 4RSUA 5IUQA 3QLQA 4QPGC 2JDZA 2ZGLA 4BIFA 1NQDA 1VRH1 1YFYA 4AGVA 1CQ9A 1GNZA 2RE9A 2B45X 4J6GA 1QJZA 2YYOA 3S6PA 1AR82 4QM9A 4ATEA 1J3QA 2PHUA 1LR5A 4WM7A 3IKWA 1LEMA 1WMDA 5LEJA 5C8CA 3WP4A 4GH4B 3RI9A 3WQ0A 4AFDA 1O3RA 1J58A 1X8EA 2WT2A 4UXAA 2PFWA 3MFCA 2NQYA 2EIGA 4FQ4A 4XJAA 2R061 2Z42A 2A70A 1BVP1 1J1TA 4FPOB 3TRSB 4LBJA 2ZS6B 3EHKA 2HWE2 2ZAAA 5E8AA 5T52A 1HW5A 1VBB3 5KHIA 4XW3A 4YGDA 1WLWA 3VL8A 3OPZA 4OVEA 1GANA 1XYPA 3AB0A 3MW3A 4FPCA 1ASJ3 3QD6A 1PO12 1RVF1 3PJYA 3WZ1A 1O3SA 4GALA 1VJ2A 1OPOA 2AH2A 4Q29A 3WG2A 5J36A 2R063 1AX2A 3EBRA 5TSWA 1ASJ1 5HCAA 1YO8A 5B2GB 1DDLA 4AFAA 2D43A 1F9KA 5I8TA 3I59A 1XE7A 4DS0A 3UKVA 4XIKA 1TQ5A 2YV8A 2UY9A 2YROA 3J26N 2MPFA 1C3HA 3AFGA 3B3QE 1NA1B 2JE7A 2UWAA 3ENRA 4PIYA 5E89A 1PZ9A 2B39A 2D6MA 4JDMA 4YVWA 4EWEA 1V9U1 4FOVA 4CP0A 2BNMA 1NCRA 5FOJB 3VBFC 3VBRC 1GICA 2RM23 3NV4A 4Q4X1 3H50A 4RS5B 5HXVA 2RS12 5J96B 4N7IA 3ILFA 2HWB1 1K5MC 5T3NA 2VECA 4IV1C 3PVOA 1HXS2 1EP0A 4D7YA 4DB5A 4K20A 4N9HA 4P9LA 1C57A 1CAVB 5EYXA 2XJSA 2DVAA 3KMHA 2XKOA 5FREA 1Q8OA 1V6MA 4D3WA 3ZXKA 3KS7A 2PHRA 3KSCA 3AKPA 5GALA 1AR91 1Q43A 1RIRA 2FBEA 4D69A 5LK7B 3ZXLA 1LHWA 4CDWA 1AR62 1DQ4A 2ZACA 3CF6E 2Q0AA 1H1MA 4YFWA 1DGRN 1RJ7A 1IQAA 5CIRA 4X6QB 1OFSA 3TWIA 2G9FA 4FTSA 1V6IA 2A73B 1B35A 1X7NA 5K0UC 3PMEA 4WVMA 4I30A 1MS3A 4ZU4A 4GQ7A 1RUF2 2HWE1 3NJZA 1HQWA 2VOXA 4KU7A 2X5IC 1OSGA 5T5PA 4AFCA 4AYUA 3H3UA 5JPMB 3LOIA 4FVVA 5KXDA 1VB2A 4QMAA 1OFNA 4YGCA 1H1IA 4YM3A 1RUD2 2AGSA 4N7UA 4Q0SA 4XFIA 4BE3A 2HWD2 3IDBB 2EA7A 4JCKA 2GMPA 3VZJA 4RD7A 2NPIA 2WZR1 2ZGPA 3HQXA 3JB4C 1JYCA 3FBYA 5CFDB 3ZSJA 3IDCB 3SH3A 3SH4A 2D93A 4CYDA 2BUKA 4FOQA 4K9SA 4AFBA 4XTPA 4QX5A 2C5DA 3CLPA 2ZGSA 4A3XA 2WT1A 5A33A 5AC91 5T54A 4ISQA 2ZX1A 2WS93 1DIWA 2GU9A 3M8LA 3NVCA 4AVBA 5K7PA 1NYWA 1LJ7A 1LEDA 5I0TA 1QQP2 1Z7S3 1SLIA 4Z1VA 4HKWA 4XFGA 4K3UA 2QDRA 1AR81 2PHWA 2PHFA 5KHKA 4EV0A 1LGNA 3AMPA 4H55A 4IEXA 4LO7A 3AZVA 3UJOA 1ZBE1 2WNUB 3LSDA 4EN0A 3LCPA 1C4RA 3M3IA 3N7JA 2ZJCA 1BQPA 3HBZA 3AYCA 2K0GA 1AL23 1L3JA 1R1ZA 3ZX7A 5BXXA 3D0JA 1VBC1 1Y9QA 4DRVA 5DUUA 1Y7BA 1U0AA 3FZ3A 2PAMA 4IQPA 3VBSB 1ZZCA 3WR0A 1OHFA 4WV8A 5DZGA 4WBBA 1G9DA 4G9SB 4HK8A 4KGQA 3AZWA 3R6SA 1RUD1 1ENSA 1FOD2 2DFBA 1COV1 1UF2C 1RHI2 4LO6B 1RUNA 4FXGB 2WT0A 1ZM1A 4BPZA 4QPGB 4NOTA 3TAYA 3AYAA 4YZ5A 4PF5A 3E6CC 3E6BA 4QPIB 3WW2A 3QACA 3U0ZA 1CIWA 3R4SA 3LKJA 2E7AA 2V09A 3NKTA 4B8EA 3MIFA 3ZFFC 4FPKA 1ONAA 1YHFA 5ABJB 1O5LA 1QQP1 4HK9A 1N47A 2JEMA 4QGNA 2AENA 2E6VA 3FWEA 4UBGA 4YW4A 4M0HA 1SEFA 4R4ZA 5I8SA 4IL7A 1UIKA 3H1YA 2I2SA 2W0XA 4WM7C 4XXAA 3ZFFA 1FPN1 1HRI1 5A32B 3DGTA 3FUQA 5GM0A 1QJX3 1CONA 3VHNA 1AR63 5C6CA 4AEJA 1CJPA 4WM7B 4ATFA 3ZYRA 2OZ6A 1NLRA 1V6LA 3GBGA 3CL1A 4J1WA 1O5UA 5J37A 1SLAA 2CGPA 3OGJA 1V6KA 4OLLA 1D0HA 1TEIA 4L11A 1DQ6A 1PVC2 2DCKA 3VKFC 1Q56A 3E5UA 3ALQA 1ZREA 1QJX2 4BQ1A 2A6YA 4NHLA 5FOBB 3D5OA 2XJQA 4OULA 3KZ4C 2KA3A 1PGW1 3GZTB 1EAH1 4XDQA 5BNPA 4QU2A 4CDXC 3ZIXA 1M06G 3TB0A 1FV2A 1J3RA 3NV2A 3D82A 2IZWA 3VKMA 5A3MA 3OF1A 2FZ1A 4YM2A 1CAWA 3JBG3 4CDXB 1U5YA 3D6EA 2WL1A 3PLQA 4MYEA 2WQZC 1MQTA 4NVPA 4WVVA 1ULFA 1QWRA 3OBRA 2GNTA 2Q5TA 2V5YA 2YGMA 3O0VA 4YVWC 1PZ8A 1PK6B 4RQPA 1NCRC 5CG8A 2NYYA 2D3PA 3B01A 1OPMA 3VBFA 3HAGA 1SCSA 4Q4V2 4Q4W2 2DU1A 4UW6A 1YFUA 2YC0A 4AEMA 1BKZA 1H8VA 3GHNA 4LE3A 2ZX2A 2GNBA 2HWD3 4CDUC 4B29A 4GIQA 4IV1A 4R9DA 1FOD1 3PNAA 5DDJ3 3UL2A 2JX9A 5AFEA 2D5FA 2VUJA 1BYHA 2IC1A 1H2KA 4I02A 4CDUA 2D7FA 3I7DA 4CZSA 3MF9A 1DZRA 2VQAA 2ZKLA 3BOWA 1R1A3 3MIGA 4E2SA 2EXJA 1CAUB 1UD1A 4BCUA 3MW2A 1BZWA 4LUKA 3ZSLA 1FATA 1XNBA 3RYKA 4AHWA 1B09A 3LA3A 2GNDA 1LECA 2R0HA 3KT1A 4TSVA 3VBUA 3M1HA 1O3QA 3JCIA 5K0UA 4AQ6A 2FMDA 2PLV3 2ARBA 1COV2 4B3NA 2WS91 5D8AB 4Q1PA 1VBB1 2PHXA 3MLKA 1HQNA 4LHKA 3OYWB 3R0RA 2FHRA 3D4KA 3JU9A 3WXPA 1XYNA 4DNYA 1HRV1 1FMD1 2OZJA 2VMIA 3C2UA 5JAXA 4EJRA 1A8DA 4X6RB 1G9AA 3ES4A 4M3CF 1Q5OA 1HIXA 3AM2A 5LK5A 3UK9A 4QQLA 2E9QA 2XWJB 2QUOA 3ZMNA 4JAAA 3H1MA 1TME2 2B9UA 2G4IA 1OLQA 3H0OA 5I8YA 3H7JA 2NZ9A 1GQGA 2ATFA 2HJIA 1N3QA 5KXEA 1SLTA 2A6XA 1Z78A 1SBFA 3IPVB 1IS5A 1BK1A 1R093 2WKKA 1UZZA 1VAVA 4DFSA 4YW2A 4Y1XA 4AI3A 2KM2A 5ACA1 4UW5A 1FNYA 3KLSA 3LOBA 3AP9A 3ZYIB 2HWC1 1RUD3 3LAGA 1YI7A 2DWRA 2MEV3 5BY5A 4FXKB 3V0BA 2RS53 4GWNA 5HCBA 5AFBA 4OI0A 1MS5A 3ACLA 1S0DA 4M3CE 1C8M3 2PTMA 2E7QA 4YNIA 2AREA 3ZXFA 3A4UA 2ZGRA 5CFCB 2ZZJA 2XJUA 4JGZC 4NWWA 2W08A 1AR61 1RUE1 2DCJA 3SMHA 4BYYA 5CA6A 4GB33 1V6OA 2RMU3 3V0AA 1D0GA 1NE6A 1PGL2 1LOEA 3ZFEB 1G6NA 4RHV3 3TNQA 1RMU1 2JG9B 1V9U3 1PO22 3SISA 4BWOA 1V6NA 4MGZE 3UV9A 1PMIA 2ERFA 1DGLA 3WQ7A 3ZXEA 1QXPA 1ALYA 5CB7A 4ITCA 3ZFGC 2JG9C 3N7LA 2ZA9A 1TME3 5J09A 3I2DA 4Q0PA 3FLRA 1RUI1 4RS5A 5F1RA 3AFKA 4B7EA 1ZYBA 3ILRA 4AXOA 5KBFA 1I1EA 1QXRA 1LHVA 4PDWB 2A3WA 3I54A 1TMF1 3HWJA 4QGLA 2R041 3NL1A 4Q26A 3TBDA 1AL22 3BCWA 3URFA 4SBVA 3PVEA 2BBVA 1I3HA 1OQDA 2X53S 5KWRA 3C3VA 4IEWA 3ZXGA 1ENXA 4QHBA 2IXCA 3JQXA 4NWVA 4L9BA 1WD4A 3AP4A 2R1BA 1D2SA 1LGCA 2VG9A 1QOOA 1VBD1 4KG0A 3JD73 4OI4A 4XBNA 2I07B 5FPXA 1GBGA 1XYOA 4HZFA 1PIV3 3VBHA 2Z2SB 2ZAHA 2DV9A 1KQRA 4JDOA 1W2UA 4WVWA 5GZEA 1S0GA 2A75A 2IXKA 3NSTA 4Q4W3 3ATGA 1AX0A 1HDKA 1DZQA 1DFQA 1M4WA 2D5HA 1QNWA 3DPRC 3SCFA 1SLCA 5JLVA 3WW1A 2O1QA 2YY1A 3T1LA 4ZXKA 2HEYF 2GZWA 2XJPA 1VBD2 1OOPB 3U4XA 3MF6A 5JZGA 2WFF3 3RI8A 2YUEA 3CJIA 1KITA 5L7OC 1ZRRA 1O4ZA 1RVF3 2CAVA 2JG8A 1YCIA 3AKSA 3X29B 2WFF1 3FFZA 4LO4B 1AYM1 4XPVA 1NOVA 3AKTA 1LHOA 5JZGC 3CJIC 1S0JA 3VUOA 4CEWA 1ZBA3 3AZZA 1YI9A 3FJSA 4LBQB 2XVKA 1IZ3A 3GF6A 2WIIB 1Z0HA 3CJXA 1RUE3 3AP7A 1CESA 1CAWB 3AXEA 4IERA 4Q0QA 1BEV3 4INDA 1DGWA 1HX6A 1QDOA 2VGDA 1CAVA 3DUIA 5JOWA 1OA4A 1C5HA 1PO11 1OA2A 4P9IA 4XYXA 4BIOA 2WNVB 2EXIA 5BYNA 1H1AA 2WNVC 1UKRA 2I45A 1POV0 3EO6A 1RUH3 2Q8OA 1PK6C 3MFAA 3CO2A 1MZEA 4N43C 1H8TB 1R091 4M0NA 4MVTA 4URTA 5I0UA 3MPBA 3WV6A 3WG3A 5BUVA 1PIV2 4ORFA 1BCXA 2QFEA 4UW4A 2RS33 4CDUB 1PVXA 2HWF2 1B35C 2CYFA 1QJX1 4WM8C 1DG6A 2HEVF 5IK5A 1UCXA 1U5ZA 4N43A 2RS31 3IMNA 4YG6A 3PVNA 3P3PA 1PIV1 3H7YA 5GLVA 3WDVA 1SFYA 4C0BA 5ABJC 4AEDC 1BMV2 3THTA 2ENRA 3RZZA 5JI9A 3Q9OA 2P3KA 2OPKA 3VBUB 1WLDA 4FOYA 1NG0A 1RUJ3 4Q1RA 4AI8A 3AYEA 2RS52 1FX5A 5ABJA 2SBAA 1DQ2A 5JPNB 4IEUA 3POYA 5FO8B 1YNAA 2WFF2 3ETQA 5HI0A 4QT6A 2MHFA 1R1A2 3H3ZA 2CY6A 1YIPA 4XF3A 1CJDA 1TE1B 1XRUA 1RUI3 3SNMA 1CD3G 1AZDA 1Y3TA 2ZMKA 5DG1A 5EV7A 3V65A 4JTOA 5BNOC 5BNNA 1UX6A 2B42B 3RSJA 4LHLA 2XPJA 4AHYA 1MS1A 5DUXA 3I59B 4R4XA 4M3CB 2ET1A 4HSJA 1QJY2 4G3YC 4FCAA 5KHJA 1F8VA 4RA0A 4XZPA 3BALA 1CX4A 1LOBA 2DF7A 4AGRA 1AR83 4KWLA 4QD2A 3OCPA 4PIZA 4Y24A 3S0MA 1BEV2 3QH7A 3FMGA 4MZUA 1VR3A 4CDQB 2ES3A 2K9ZA 4NN0A 3VBSA 2ZHMA 1UU5A 3IBMA 4RGAA 4K1YA 3VGIA 4H7LA 1JN2P 1YRZA 4XQDA 4V1PA 1ULGA 3HD8B 4E2GA 3AMQA 3B9IA 2A71A 4OI1A 3MDPA 4CRQA 1LU2A 4OHZA 1Q8VA 3V0BB 5AC93 5L73A 3RG0A 3R05A 5K8SA 3VKOA 4AGGA 2FZ2A 3NAPB 3D8CA 3VBSC 1DYPA 1UN1A 3JUUA 4EWAA 4UBHA 4HETA 1O3TA 4JGYA 4E4ZA 2RHPA 1KJLA 1HQLA 2P37A 1RUC1 1N1TA 3MI8A 3MIEA 1VBB2 3ASIA 3WQ1A 3V0AB 3ZYGA 3I4IA 3KD4A 4K21A 5BPXA 5JOXA 2VOWA 2Y38A 3BTAA 2WLQA 2WJSA 4BMEA 1QJU1 2RJLA 1YWKA 1HXS3 2TUNA 4JGYC 4JVAA 5EYYA 1NQJA 4DOUA 1RUG1 1CPNA 1JXNA 3FE5A 1MZ6A 2DCZA 4CTEA 1CGPA 1C8M2 3NV3A 2BFUL 3G7DA 1F31A 2VW1A 1AHSA 3KCCA 4KG8A 4P9YA 2D98A 1WW5A 5E1RA 4WVMB 3VBOB 3W9AA 2QZ2A 2UY8A 2OYZA 5DUVA 2BPA2 1FAYA 2IXLA 1TMF2 2ZTNA 1BEV1 1V6JA 1IOAA 2TNFA 4JQRA 1YFXA 4A7KA 2CTVA 4OHXA 3WG1A 1HRI3 4K7JA 3ECQA 2XLFA 2P17A 2YZ4A 1FI2A 2NN8A 2GALA 2O8QA 4NHMA 3W59A 4SLIA 2ZGTA 1OQEA 2RS13 3VBHB 3WD5A 1VBE3 3WLUA 5CFDA 4OHYA 2DVDA 4YM1A 4FT8A 4YG0A 5FBZA 4HPKB 2OUJ