1C8NA

Tobacco necrosis virus
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
189
structure length
189
Chain Sequence
NSTVVSNSELILNLTPIALAYTVQSLPLIATQPAWLGTIADNYSKWRWVSLRIIYSPKCPTTTSGTVAMCLSYDRNDVAPGSRVQLSQTYKAINFPPYAGYDGAAILNTDVTPTSAIYVDVDVTRFDKAWYSTIGTAAFAALTAFDQNQFCPCTVHIGSDGGPAVAVPPGDIFFKYVIELIEPINPTMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords COAT PROTEIN
publication title Crystal structure of tobacco necrosis virus at 2.25 A resolution.
pubmed doi rcsb
total genus 41
structure length 189
sequence length 189
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2000-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00729 Viral_coat Viral coat protein (S domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1c8nA00
1VRH2 1OOPB 1RVF3 1CJDA 2RR13 1RUD2 4WM8C 1RVF2 1FPN3 1AR91 2RR12 4IV1C 2HWC3 4CEWA 1AL23 5C9AC 1FPN2 1M06G 2GSYA 5C8CC 4JGZC 1B35C 1PO13 4Q4Y3 1RMU1 1OHFA 4QPGB 2PLV1 1AL0G 1PO12 4Q4Y2 4RR3C 1X36A 1SMVA 3VBRB 3VBSC 5AC93 1FOD1 3NAPC 4EJRA 5CFCB 4PDWC 4JGYB 1GFF2 4BCUA 1AYN3 5C4WA 1TME3 4CDXA 1AYN2 1MEC3 4SBVA 5K0UC 1TME2 4GB31 1FMD2 1MEC2 1VBB3 1ASJ1 3TN91 1VRH1 1COV2 5A32B 1VBB2 3ZFEC 3LOBA 3VBUA 2HWF2 1NCRA 1RVF1 1RUE3 2RR11 5D8AB 2R073 5L7OC 1FPN1 1RUE2 2XPJA 1RUF3 2R072 1ZBA3 2HWC1 1AL21 1RUH3 3CJIA 2ZTNA 1HRI2 4CDQC 1RUF2 1ZBA2 4RQPB 1X33A 1PO11 4CEYC 4WM8B 4GMP0 1MQTA 3VBHA 4IV1B 5ABJA 1EV12 5AC91 5C8CB 3VBFC 2VQ0A 5BNPC 1AYN1 1AR81 1TME1 4WM7C 1MEC1 3VBSB 4PDWB 5ACA3 1C8NA 1ZBE3 5GKAC 1NCQA 1H8TC 2R062 5ACA2 1NA1B 1ZBE2 1W39A 4QPGA 4YVWB 1AR72 1OOPC 1POV3 1VBD2 5K0UB 1WCDJ 3HAGA 5CFCA 2R071 4JGYA 1RUJ3 2WS92 3ZFFB 1RUF1 3ZFEB 1RUH1 1RUJ2 1R1A3 3J8F3 1OPOA 1K5MA 1R1A2 3J8F2 5A32A 3VDDA 1PO21 1IHMA 3JD72 3ZXAC 1RUI3 5D8AA 4CDUA 2BFUL 1RUI2 5JZGA 4RHV3 3VBFB 1ZBE1 4RHV2 4WM8A 4WM7B 1POV1 2ZAHA 4GH4C 4IV1A 5C9AA 1AYM3 1RHI3 4AEDB 1H8TB 4JGZA 1B35A 5BNNB 5C8CA 5LK7B 1PIV3 2RS13 3FBMA 1AYM2 1RHI2 1RUJ1 4N53B 2RS53 1PIV2 2MEV1 2RS12 4RR3A 5BNOC 1PVC3 1NG0A 3VBSA 3NAPA 2RS52 4RQPC 4PDWA 2HWD2 1PVC2 3J8F1 1ND2B 3JB8A 1BMV2 1BBT2 1RUI1 5A33B 3ZFEA 4RHV1 3VBOB 1QJZA 4CDWA 1NA1C 5L7OA 1FMD3 4YVWC 2RMU3 1COV3 5J96B 4CDQA 2BFUS 1AYM1 2RMU2 1PIV1 2HWF3 5CFDA 4CEYA 3ZFFC 1BEV3 4N43B 1RUD1 2HWB3 3IDEA 4GH4B 1QJU2 1VBA3 1PVC1 1BEV2 2HWB2 3VBFA 1ND3B 3JBG3 1VBA2 5BNPA 5FMOL 1HRI3 4GMP3 3JBG2 1BMV1 5BNOB 2RM23 4Q4Y1 1RUG3 1EV13 4LLFA 4RS5A 1VBE3 1C8M3 2RM22 1RUG2 2WWSA 2X5IB 1VBE2 1C8M2 4YVSB 5FOJB 1HXS2 1OOPA 2IZWA 3ZFGB 4CDXC 1FMD1 2R063 1COV1 4AEDC 1VBB1 5BNNC 1AR73 1VBD3 2HWF1 4N53C 1DDLA 2BUKA 2HWB1 3DPRC 1VBA1 3VBRA 4QPIC 1RUE1 2WS93 1ND2C 1HRI1 4GMP1 1ZBA1 2HWE3 2RS33 1HRV3 4NWVA 2HWE2 4Q4X3 1R083 1QJY3 1NOVA 1EV11 1CD3G 1HRV2 2RS32 4Q4X2 1R082 1C8M1 1QJY2 4CEWB 2BPA2 2R043 3JD73 1VB2A 5FMOS 2R042 4GH4A 3VBOC 1VB4A 1QQP3 3M8LA 2R061 1QQP2 5ACA1 5BNOA 4RQPA 1AR71 4CDXB 1VBD1 1F8VA 1D4M3 2Y26A 4N43C 4Q4W3 1A6CA 1D4M2 4IV3C 2WS91 4Q4W2 1ND3C 4FTEA 2PLV3 2HWE1 1R093 3DPRB 2HWD3 2PLV2 2RS31 1HRV1 4QPIB 4Q4X1 1R081 1HX6A 1QJY1 2XBO3 1R092 1R1A1 1FOD2 1RB8G 2XBO2 1NA1A 2GH8A 1AUYA 1E57A 1HQNA 3JD71 1QJX3 1BBT3 2X5IC 4YVSC 4YVWA 5K0UA 4GB33 2DF7A 1QJX2 1MQTB 2QQPA 1ASJ3 3ZFGC 3VBHB 1V9U3 4GB32 5ABJB 1QQP1 5JZGC 1ASJ2 3TN92 3ZFFA 1V9U2 1D4M1 4NWWA 4Q4W1 1NCQB 4Q4V3 2FZ2A 1RHI1 2HWC2 1AL22 1RUC3 1QJU3 2RS11 4Q4V2 1Z7S3 1RUC2 2RS51 2ZZQA 1R091 1Z7S2 2HWD1 4IV3B 1EAH3 1TMF3 2XBO1 1VBC3 4Y4YA 5AC92 1AR83 1EAH2 4CEWC 1TMF2 1VBC2 4WM7A 1QJX1 1AR82 1BBT1 3S6PA 4AEDA 1H8TA 5BNNA 1AR63 1HXS3 1V9U1 1K5MB 4FSJA 3VDDB 4N53A 1AR62 3DPRA 4CDWC 4CDUB 5C4WC 4QPIA 1F2NA 1ND2A 5JZGB 2TBVA 1PGW2 1VAKA 3JB4C 2RMU1 1PGL2 4Q4V1 1RUC1 1RUH2 5CFDC 1QJU1 1Z7S1 1BEV1 3VBUC 1NCRC 5C9AB 5J98B 1PO23 5A33A 4JGZB 1B35B 1EAH1 1TMF1 1VBC1 3VBOA 3JBG1 1PO22 3CJIC 4RR3B 2WZR3 2WFF3 3NAPB 2RM21 4FTBA 2WZR2 4RS5C 5DDJ3 1RUG1 1MQTC 2WFF2 3VBHC 1VBE1 1AR61 1HXS1 5ABJC 5DDJ2 4N43A 4IV3A 1NY72 1PGW1 2FZ1A 1ND3A 1PGL1 1POV0 4FTSA 2MEV3 1NCQC 4CDWB 5C4WB 2MEV2 5L7OB 1AR93 4QPGC 2BBVA 1AR92 3VBRC 5CFCC 4CDQB 2X5IA 4Z92B 4JGYC 4YVSA 4CEYB 5CFDB 1RMU3 3ZFGA 3VBUB 1NCRB 2WZR1 1RMU2 1FOD3 2WFF1 4RFT0 5DDJ1 5BNPB 2WLPA 1K5MC 2R041 3CJIB 3VDDC 1NY71 5D8AC 4CDUC 4RS5B 3TN93 1VRH3 1RUD3 4Y5Z0
chains in the Genus database with same CATH superfamily
1N1VA 1W0OA 3T0DA 1QNYA 5FYCA 1RVF3 1CJDA 5T55A 2RR13 3QH7A 4LOSA 5C3PA 3WNMA 1GZWB 2X53S 2FCVA 4KG8A 5JIUA 4XIOA 4FPOB 5JSOA 3KM5A 3V0BA 2E7TA 5C9AC 1FPN2 2OIIA 3LA2A 3VD5A 3IKWA 4FPCA 1RL3A 1PM4A 1PO13 3WF3A 4UFJA 3GZUC 3IIIA 2Y6JA 4QQHA 3U78A 4BQ4A 1EPWA 1E5HA 2JIGA 1CAUB 4QPGB 4Y1YA 4WVWA 3BI3A 1AL0G 1QH7A 2Y8KA 4NHKA 4Q4Y2 5E6HA 5FY5A 4FAHA 1DQ4A 1FOD1 2J22A 1OA2A 5J48A 2XDVA 3J7HA 2YZ4A 4OMDA 5A70A 2ZEWA 4IE0A 4XAEA 4CDXA 2GDFA 1F5JA 4LQRA 4AR2A 4SBVA 1GOFA 5FIXA 1QXRA 4E4DX 1TME2 2Q1ZB 1U5XA 1CONA 2YU1A 3PIJA 1MEC2 2Y38A 5FZOB 3M3CA 3AM2A 4ES9A 1CGPA 2JE8A 1CZTA 1COV2 3OBTA 5FY9A 3LZZA 3ZFEC 2WLQA 3FJSA 5EFUA 3VBUA 3VD3A 1FX5A 5HI0A 1RUE3 1W9SA 4H14A 1UKRA 3I3EA 3I54A 4YFZA 1WLCA 2CNAA 2QQWA 3AMMA 2HEYF 4Y5SA 3SH5A 1UZ0A 2XPJA 2R072 3HBZA 2WAAA 4BM8A 3I7DA 4OHYA 2R7EB 1AL21 4ZS3A 5KC5A 4CSWA 1FNZA 2A3WA 1SEFA 2VMIA 2WZPP 1RUF2 3T2PA 4MV2A 4LHKA 2DU0A 3GGLA 4CEYC 3KSCA 3EMRA 3PVOA 1UY0A 3W5MA 1B09A 3MIGA 3N9QA 3VBHA 1OFNA 2WZ8A 1RC6A 2D3SA 1WMFA 3QCWA 1EV12 1LESA 1DGWA 3VL8A 1O91A 1DZRA 1W6NA 3VBFC 1HW5A 4XFBA 1O3RA 5BNPC 3WQ7A 1GLHA 1AYN1 2DVGA 2D6PA 5CYYA 2W92A 5FV3A 5HV0A 1E5RA 2V4AA 3EB7A 4I09A 4PQ9A 2OX0A 2QQUA 3U37A 1OH4A 5ACA3 1C8NA 1JZ4A 2DU1A 1JUIA 1ZBE3 3WNNA 5C3OA 1CX1A 2NZ9A 3O1TA 2WWJA 5AVAA 4FOYA 1AZDA 4EN7B 1OOPC 2EXHA 5CG9A 1GBGA 3FZ3A 3HAGA 2FMDA 2X10A 3WNOA 2P34A 1YQCA 3D6EA 5CFCA 4E8DA 1VIWB 1QOOA 3T2QA 3N7LA 2VZRA 4HPKA 4MGTA 3OGRA 4XJWA 3THDA 3ZFFB 2XL9A 1KGYA 4NRPA 3ZN6B 2CL2A 1T2XA 3ZFEB 4Y1ZA 3RI9A 1D4VB 3SXWA 4FFHA 2QQOA 1NZIA 2WC2A 1OLMA 1OC1A 2W52A 3J8F3 3CLPA 4UBGA 4UYBA 4FPLA 3W5NA 3HNYM 1K5MA 4Q5OA 2JXAA 2D5FA 3VDDA 1ENXA 2VMHA 1PO21 3SC7X 2UURA 2WO1A 4AGGA 3C7OA 3CMGA 3IPVA 4Q29A 1G9DA 4M4PA 5D8AA 4KNCA 4W50A 3I59B 3H9AA 4WVVA 5F5QA 3DKQA 1UO9A 4UFKA 1IPJA 2Q8CA 4CXXA 1ODNA 2XWBB 2NLRA 4LUKA 3VBFB 3NNGA 3WDTA 2VW0A 4D6QA 4Y20B 1YFUA 3KV5A 1V6OA 3RWKX 4QB1A 5DG1A 1STMA 1XYOA 1SCSA 2ZJCA 4GH4C 1IS6A 1SFNA 4L99A 2YC0A 4JGZA 4M3CF 4DY5A 4EQVA 1LOFC 2RS13 3FLPA 1AYM2 1RHI2 3FHIB 3VZLA 4ATEA 2FBEA 2VE1A 2GN3A 1PIV2 1SBFA 4A4AA 3NAPA 4RQPC 2QNKA 2HWD2 5FBZA 1ND2B 1U5IA 1WMDA 3ZVXA 3PJQA 4CPBD 4Y22A 1BK1A 1BVVA 2ETEA 3U07A 1GR3A 1WCSA 2WJSA 4JV4A 4NROA 1KRIA 3U4XA 4OYUA 3POBA 5F2SA 5F5IA 3WG3A 5DN2A 1BBT2 3RZGA 1W0NA 4XFGA 1RUI1 1RUNA 1BKZA 3GCXA 3J7MA 1DGRA 1KXGA 4XFHA 1CAVB 1GQPA 4CU6A 4Q8KA 2VOWA 5L9VA 4LBQD 5A33B 2ZABA 1VLNA 3WZ1A 4YLZA 1OQ1A 2K0GA 1OQEA 4RHV1 3VBOB 1QJZA 4CDWA 2EIEA 3VB9A 3LCPA 1NA1C 2NMNA 3ME2A 2LM3A 5A6ZA 1ZZ7A 2D5HA 1GP4A 2ZX4A 2VZQA 4RYDA 1FMD3 4CUBA 2FDGA 4B1LA 2WO2A 1HV0A 4L2NA 1UN1A 2P37A 5J96B 2W2IA 4IW3A 1MPXA 3KCCA 1HIXA 1S0IA 2HWF3 1ZM1A 4N43B 1FNYA 1RUD1 4NAMA 2NN8A 4GH4B 4TXWA 4Z2AA 4GAZA 4XMAA 2HWB2 2OUJA 4A2UA 3ACHA 1HB3A 1ND3B 1VBA2 3MGUA 4EN8B 1ZYBA 1UY3A 3FLRA 1V6LA 4XTMA 2ET7A 4ZONA 3JBG2 2IXIA 2BZDA 2OQ6A 5DABA 4E2GA 1BMV1 3A21A 4AW7A 5IK5A 4CCLA 1VAVA 4A44A 2RM22 2VAUA 1LHUA 3RSJA 4PQQA 1OLQA 2W1WA 2AUYA 4B8EA 4BQ3A 4IGQA 2JB4A 5L36A 5I0UA 2VGDA 4AF9A 4YVSB 1HXS2 2X29A 2ZOEB 4BQ2A 2ZKLA 5FFOC 4D69A 2VTFA 1I5PA 3N36A 4CDXC 4M0HA 2P3IA 3QBQA 1GWKA 1LGNA 4OUEA 4IQPA 1QJFA 2R063 1XSRA 2BWCA 4AE2A 2VZPA 4HSLA 4MGQA 4F8AA 3KCXA 1VBB1 4RFRB 4YNIA 4LIUA 1SBDA 4HMZA 4ONUA 3OSDA 4BWOA 1IOAA 1XRUA 3O7OA 3OTFA 5GLVA 3RGBA 5FCCA 3ZKUA 5HCAA 4YM2A 3DPRC 1KS5A 4FOQA 4LPLA 3MFCA 3VBRA 4QPIC 2WS93 3ZXLA 1POQA 3OEBA 4F3JA 4MX3A 3HJRA 4ASMB 1HRI1 1QOTA 3MIHA 3ZMOA 1ZBA1 4QQ2A 1GANA 3VD4A 4XUQA 3EBRA 1L7LA 1ALYA 2P5BA 2PTMA 1HRV3 3PUHA 1QHDA 2HWE2 4NWVA 1H2NA 1R083 1QJY3 2NM1A 1WLDA 2SBAA 1KS4A 4QB6A 3RWNA 3VD9A 5LZ6A 3V0BB 2BPA2 1H4HA 2RJKA 3G6JB 3JD73 2DUPA 4K8RB 2VW2A 1ENQA 1YNAA 2PELA 3J4UH 5FKCA 1EPZA 1N47A 2UY8A 4QHBA 4QPWA 4YGBA 5KXCA 1VJ2A 2CAVA 1DLLA 3UK9A 5KHHA 1CPNA 4KQ7A 3AFKA 3FHAA 4MZUA 3WP5A 5FTTC 1PX3A 3HR9A 4NOTA 4XFAA 4BISA 2VZUA 1A8DA 4QDQA 5JDBA 1NXMA 5FO8B 1UXZA 3ASIA 5FQ0B 2XQRA 4CP0A 1LEMA 1JZ8A 4CDXB 5FZ4A 1VBD1 1REEA 1LOAA 4NN0A 1D4M3 5E1RA 1LENA 4A7ZA 4TYSA 1I5ZA 2O14A 3VKNA 4LKSA 1YQ2A 4QGLA 2W91A 1UX7A 5IVBA 1WMEA 2VUAA 3KV9A 2QZ3A 5FJHA 1JMUB 2ZHKA 4IEZA 5JIAA 3DPRB 3N3HA 2ZPXA 2RS31 4QPIB 3OGGA 1US3A 1HX6A 1R092 2TEPA 3M3OA 1R1A1 1FOD2 3IMNA 5A1LA 4UWDA 1S4CA 1JZ6A 3H8OA 3C2UA 3NVCA 4YG6A 3VKMA 1E57A 2W87A 2XGXA 2EIDA 3NNMA 4LNVA 4YVWA 3KV6A 2XVGA 2DF7A 1FAYA 1UY2A 3VBHB 3ZSJA 1GOHA 4GWIA 1QQP1 1GZ9A 1HQWA 5FYYA 3AKRA 5F2WA 1K42A 4PF5A 1W6NB 1H30A 1J84A 1V9U2 2GC3A 1O4ZA 4QGMA 3PVBB 1SPPA 3AKPA 2NMOA 4FFGA 4JKKA 5A7NA 3TRSB 4C1XA 3H1WA 5I0DA 1W05A 2RV9A 1PVXA 4XOGA 2VH9A 2H0BA 1PMIA 3KVBA 4NPRA 4NWWA 5LBFA 4Q4W1 4IE7A 2LS6A 2WBKA 5C6CA 2D40A 4GXLA 4Q4V3 1AL22 1RUC3 3I97A 3KT7A 3J9SA 2XJUA 4NIHA 1QJU3 2A1XA 1UMIA 5B4XA 3CL1A 2B42B 1F4HA 3FN9A 2ZZQA 2D6LX 2W9XA 3UGGA 2OXBA 2VVDA 2D44A 5HBAA 3WUCA 3BB6A 1Z0HA 2G9ZA 4XURA 2XBO1 1VBC3 3K4DA 4HPKB 1JYNA 2EVXA 3PMSA 5SV8A 1VMHA 2FDKA 3KGZA 3OYWB 4WM7A 5FZCA 1QJX1 1W6QA 2PHDA 1OF4A 2VVEA 5EPAA 3IIAA 4HSJA 3MICA 2Z42A 2EALA 5FZ6A 3PL0A 4LMFA 4BQWA 4C1WA 5J09A 4FP2A 1AR63 4WZFA 1K5MB 1UIJA 2DTYA 3PLQA 3VDDB 3C7GA 2EIBA 4K21A 2KXLA 3TEYA 1MZEA 1ZA4A 4CDWC 4IEVA 3DCQA 4QXKA 1W06A 3NMBA 2D6KA 2VM9A 3IM0A 4PT6A 1O5UA 5JPNB 1KFUL 2HH9A 2BOJA 2J1TA 2YXSA 4GJZA 1OVPA 1Q5OA 2BGPA 1PGW2 3DEMA 4XVHA 4RD7A 5FPAA 3T0BA 1ONAA 1TE1B 2JEMA 2WNUC 1WA6X 4OI4A 3ZMNA 4BB3A 3UKVA 3B69A 3ELNA 3ZOIA 1Z7S1 3LFMA 4UXAA 4E2SA 1BEV1 1NCRC 3T30A 3HIFA 2AEYA 4U2AA 1O59A 3H50A 4KWKA 2OKXA 4UW4A 5A7WA 3PVEA 4JGZB 1EAH1 1TMF1 3AVRA 2FQPA 3RJ2X 2ZGNA 1PO22 2ENRA 4GWJA 1W2TA 3ZPYA 2DCTA 4AAXA 1H1MA 1X8MA 3CJIC 3USUA 4FOVA 1AXZA 4L9BA 4Y1XA 5LBCA 4CYDA 3WCRA 1RJ7A 3NAPB 1SLTA 2WZEA 2WYFA 2ZHMA 4JTOA 1XBFA 4UBHA 4D6RA 5DDJ3 1RUG1 3VKOA 2WFF2 3GHMA 3AJZA 1VBE1 4G4FA 4Y22B 4FOWA 4JX0A 2PHXA 2DV9A 3M4FA 3KQ4B 3NV3A 2OT7A 2X09A 5EQUA 4IV3A 1UCXA 5JOZA 4P14A 1BQPA 1VALA 2A73B 2FZ1A 3THCA 3HEIA 1VMFA 4LBQA 4EN0A 2XXZA 1V70A 2C9KA 2BBAA 1NCQC 3PUIA 1VMJA 4NAOA 4CDWB 3NKGA 3TYJA 2XUMA 3AK0A 1W6MA 4IE5A 1AR93 4Q27A 2ZGTA 2VUDA 2X05A 1H8VA 3S7EA 2Y6HA 2VBBA 3VBRC 1SACA 2B7YA 4BJ0A 2X5IA 4XCAA 4JGYC 3VHOA 4Z92B 3S30A 4ZU5A 1UZWA 4LO7A 1QNWA 4Y33A 1HB4A 1Q8QA 4JTNA 4LBOA 4XQWA 5DZFA 1W2NA 2BERA 1JH5A 3AZWA 1NCRB 1YIPA 1H0BA 1XJAA 1RMU2 4XPVA 4GALA 5FMBA 4A7KA 2O1QA 2ZKNA 4LA2A 1O5LA 3DV8A 3H1MA 3POSA 2CTVA 1W3VA 2WDBA 4J6GA 1PK6A 4DRRA 1XE7A 5F32A 3K46A 4AEMA 3CJIB 4TZDA 1OUXA 4SLIA 5CNAA 4QGNA 4COUA 2A7AA 4YZ2A 1G9FA 3WEZA 4ORFA 4COWA 1NY71 1ZRRA 3AP6A 1OKOA 4YGDA 3S5AA 3Q9OA 1QGLA 4UF0A 5A3WA 1CN1A 5KBFA 3O1RA 1NUKA 4MGIE 4XC9A 1S0DA 5A7QA 1JHNA 4WBBA 3Q8BA 4Y5Z0 4D6SA 2ZEXA 4GWNA 1J1TA 5BNQA 3L2YA 1QWRA 1D0GA 2ZCWA 1RUD2 4COZA 2RDRA 4WM8C 3GM8A 4XFCA 3WNLA 1FPN3 5DAQA 3OD0A 2IFRA 1AF9A 2BDRA 4IV1C 4CEWA 2XJPA 4MH0E 5FYBA 5KHGA 5M0TA 2VQAA 5IFPA 5C8CC 3UJOA 1UYXA 4FXKB 4Q4Y3 1O7FA 4LUMA 3ST7A 1LR5A 5I0RA 5IWFA 5HXVA 1J59A 1HDKA 1BHGA 1XU1A 2QJVA 3AP4A 3H7JA 4XTPA 5IW0A 3ZDVA 4CCDA 3VBRB 5AC93 3BOWA 1ENRA 5F3EA 4JGYB 3ZXEA 5DAWA 3ABZA 1H2MA 5CU1A 5BY5A 3GALA 1PMJX 1LJ7A 1XNBA 5AFBA 1TME3 4AI9A 4KU8A 5L19A 1OI6A 3GF6A 4CXYA 1MEC3 4DQAA 3WNXA 5LA2A 3WW1A 1SLAA 3PVNA 4QPYA 4Q0QA 3OBZA 1IQDC 4XF4A 4AHYA 1ASJ1 2IUWA 3TN91 4B4RA 2WT0A 1VRH1 3KT4A 4FFFA 3ZSEA 3MIBA 1VBB2 1UD1A 4FP3A 2YC2A 2AACA 1RVF1 3LIHA 3HNBM 4XDOA 1PM7A 5FZ9A 2RR11 3LEMA 2R073 5L7OC 2VTXA 4BQ5A 1F4AA 5DUVA 4MUVA 5FWEA 4Z1VA 1RUF3 4AZZA 5A6XA 3H42B 2GNMA 4XUPA 3GDBA 5ERLA 3OPZA 4JZRA 2ZTNA 1HRI2 4L97A 4CDQC 1OLRA 5ISLA 1A34A 1ZBA2 1ZZ9A 4FPFA 5F1RA 5JSPA 1PO11 2R1DA 2R30A 4OUMA 4WM8B 1CAXA 2J1SA 1LTEA 2AREA 1L7QA 4AAPA 5FKBA 4IV1B 2XLAA 5ABJA 1URXA 4N90A 3N7MA 3ZR6A 4CXWA 3U11A 5C8CB 3IZOA 2BNMA 2R49A 3I2IA 2VQ0A 3O1MA 4NHMA 2H0VA 4BH9A 5A3NA 1GICA 4GA9A 1AR81 1PMHX 1ZVFA 2F4PA 4WM7C 5GZDA 3B9IA 3CF6E 3ILNA 4F83A 5C70A 5FREA 3RDIA 3AC0A 1N1YA 4DB5A 4IE6A 1LOBA 5FPBA 2G9FA 4H55A 1WW7A 3ACIA 5F6KA 4FXGB 3ZYBA 3RZKA 2E7QA 1RTVA 3OPTA 3IB3A 3PDQA 4KGGA 1OFSA 4XCBA 4XFFA 5J36A 4YVWB 2WO3A 3B3QE 4HBNA 4IESA 1DGRN 1VBD2 3INAA 1WCDJ 3MBWA 5FYZA 1GNZA 3KD4A 1QIQA 1W03A 4HN0A 3IWZA 3LB9A 3THPA 4AHWA 2CAUA 1KFXL 3ZXJA 4HVOA 1T6BX 4XABA 2JE7A 1QKQA 4DUVA 1RUJ2 5FYMA 5FO9B 3SLIA 5IAXA 1MS3A 3I2KA 2Y34A 4H7MA 1JYWA 3W9AA 1R1A2 3D8CA 5A32A 5FY1A 3RMYA 3WF2A 3TWIA 4URAA 3WHUA 4XQ4A 2Y33A 4Y1VA 2QQIA 4CDUA 4MADA 1O8SA 1JZ7A 3B02A 1W8OA 2GNDA 2Q1FA 2VZ3A 5JZGA 4O9GA 2WA3A 2A6YA 2XWJB 4XJZA 1ZBE1 5FRAA 1DQ2A 1O4TA 2B5HA 2WO7A 1WW5A 1ENSA 3WR0A 3LEGA 3CEWA 1W6QB 4WM7B 3AMNA 4LBMA 1JYXA 2E33A 2VOXA 1LHOA 1AYM3 1RHI3 2WA4A 4DZGA 2SLIA 1B35A 2A5ZA 2JDNA 2VC9A 3AVSA 1PIV3 2QQLA 1OD5A 4QKBA 4OI1A 3EHKA 3AP5A 3V0AA 2XVLA 3I4IA 4YW5A 5T52A 3RZZA 4RR3A 1Y7BA 2C1FA 3WT3A 5BNOC 3FWEA 3VBSA 4IEPA 3JZVA 4YG0A 4PDWA 4DINB 2IXLA 3EJKA 3H3LA 4EE2A 1PVC2 3J8F1 3QH6A 4P9GA 5FZFA 1LODA 1S2KA 5FMDA 4NRMA 1NAEA 4YARA 2XLGA 4UW6A 5A3LA 3EO6A 1Q8VA 4JDMA 3VDCA 2X8KA 5I91A 3VZMA 4AGRA 2VMCA 2ZX1A 2A71A 2VZ1A 1OA4A 2WQ8A 3DYOA 4QM8A 1HQLA 4LBKA 3NQHA 4OHWA 2EA7A 1ULGA 4LKFA 2O0OA 4OUSA 1PHMA 2XH6A 2RG4A 5FY8A 1WCUA 2I45A 2WUHA 2GNTA 1BCXA 3KQRA 2XJTA 1REFA 4YZ3A 3USUB 4DUXA 2YUEA 4XUTA 4I01A 4FPJA 4AHZA 2CHHA 2WABA 4KBBA 2A6ZA 1CVNA 4UAPA 3SMHA 4L0PA 2PFWA 4OHVA 5FR3A 2ZAAA 3R0RA 4NIAA 4MLOA 3ZFFC 3H8RA 3WQBA 2PXJA 3BU0A 1CJPA 2HWB3 2J1VA 2JG8C 3VLBB 4Z2WA 1VBA3 1BEV2 1K5JA 3B94A 5LWBA 3DL3A 4KL1A 3AZVA 3LKJA 4QQLA 4UW3A 3JBG3 4IXLA 4P9LA 4H2AA 2ZMLA 5JI9A 2ZA9A 2Z5WA 1V6MA 3Q8FA 1XOYA 4GMP3 2QQKA 3QD6A 4LBQB 3BU7A 5IVJA 3E6CC 2D6OX 3BTXA 3QLQA 2Q0AA 4ATFA 5BNOB 4ZZ5A 2GALA 4BPZA 1K12A 3ACFA 3AYCA 2RM23 2FDFA 1X9TA 3AYAA 1W6MB 2ZHNA 5DZEA 2VW1A 4RS5A 1OMIA 2XJRA 3H1YA 2DCZA 1N3QA 3B7MA 5F5AA 2B45X 1RUG2 5GALA 4HANA 5ANQA 3CJXA 4K7JA 1VBE2 1DZQA 1C8M2 2X5IB 4QX1A 5I0TA 5C5TA 4Q8LA 1OPMA 5KHJA 2E32A 3G7DA 3WDWA 5LW9A 2VO5A 4R52A 4AI0A 2JKBA 1H2LA 2IXHA 4TWTA 4JRLA 1UYPA 4YFWA 3HQXA 1FMD1 5K4LA 3MF9A 4OCTA 4OLLA 3A4UA 1YCIA 2CV6A 4CU9A 1N1SA 4NHXA 3SCGA 4HK9A 3ECQA 3O0WA 2MPFA 2VXRA 5DUWA 1AR73 5LBBA 2V09A 2YGLA 2HWF1 1DYPA 2YHJA 4FPKA 5EYXA 3MF6A 3IMMA 3KVAA 3OOXA 3RG0A 1DDLA 2TUNA 3J7NA 1MACA 4B7EA 3TNQA 1W2AX 3PURA 4UF0B 5CKQA 4AFAA 5IAVA 1GV9A 1ND2C 3WW3A 2G1MA 2Z69A 4J1WA 4B29A 3RNSA 2HWE3 3POIA 5H9RA 3SKJE 3ZSMA 2JG8B 1UQXA 5KWRA 4D8MA 2DUOA 3OY8A 2WYSA 2YBPA 3UETA 2VMFA 3W20A 1GQGA 1NLSA 4BLJA 2VECA 2KM2A 1LHWA 5F3CA 4CP9A 1AXKA 4Q4X2 3LQCA 1IQAA 4CEWB 4DPNA 2YDEA 1V6NA 1LOCA 2E7AA 4K40A 5A1FA 2ZGUA 1LGBA 1C28A 5FYVA 1CIWA 2DVAA 1ULFA 1GOGA 1YQ5A 2HYKA 3VBOC 1XPWA 4W65A 1O8PA 1JN2P 1XB9A 3N9OA 3NJXA 4I0BA 4AI3A 4GULA 5FLJA 1RITA 3CZJA 5GLTA 2R061 1ST8A 2XHKA 4HFSA 5CEHA 4P9JA 3KWVA 3S5QA 2WINB 4NE9A 5FZLA 3DXTA 3GYDA 1WA4A 4N43C 4R9DA 3AMHA 1HB1A 1ULCA 3KLSA 4WVMA 5BXXA 1PGSA 3ZXFA 2QFEA 3ZR5A 2WS91 3V56A 5FOBB 1JTZX 1OH3A 1ND3C 1GZTA 4M0NA 5CAZA 1XE8A 1ZZ6A 1DQ1A 2J1EA 1KDMA 4QXCA 3NJZA 1TEIA 4CUCA 1R093 1JOPA 3DF0A 3MLKA 1HJGA 1HRV1 1YI7A 1MS5A 3I2HA 5DZGA 1R081 3TBDA 1QJY1 4ZXEA 3POFA 3T4VA 3OGSA 1D2SA 4BXFA 2H6CA 1ZNPA 1RB8G 3FE5A 3FLTA 3POJA 4NIGA 4HVQA 3JD71 3CO2A 5D21A 4YVSC 3NV4A 3I2GA 1JYIA 4QMAA 3SNMA 4JQTA 4K8FA 2UY9A 2BEOA 1V9U3 3DN7A 5B2GB 3VV1A 5ABJB 3JCIA 5JZGC 4YW4A 4NRQA 5LEJA 1ASJ2 3LPFA 2RVAA 4W6XA 3TN92 5C8WA 2D3RA 1JYCA 1UY1A 2W1UA 3M70A 4CRQA 1J58A 3BTZA 2DURA 1ZZCA 4LO4B 1D4M1 3N9NA 3OGJA 4OQ8A 2W3JA 1H4GA 4HONA 5FDBA 2W68A 4QT6A 3TNPB 2RE9A 1GKBA 3RZHA 4LBJA 2ZGLA 4ARXA 3L2HA 3WF0A 1DZTA 2EXJA 1DQ6A 4PIXA 1OXCA 2AEZA 3F95A 4GKXA 2RS51 2LROA 4XE9A 4G3YC 3DGTA 4Y4YA 1UMHA 1AVBA 2EF6A 2F6BA 1I6XA 4XBLA 3ROUA 3T09A 4ZHNA 1Y9MA 1AR82 2ZMKA 5F3IA 3S6PA 4AXOA 1OQDA 2F4LA 3MEPA 4KMQA 3O1OA 2IXCA 4AEDA 3HQUA 5BNNA 4OI0A 1IS3A 4DEQA 1VP6A 1Y4WA 2VY0A 4EN6B 1SLIA 3O14A 4N53A 3RQ0A 2UU8A 4P02B 3K4ZA 3UV9A 2A70A 2D3PA 3LDBA 2W39A 4CDUB 2XB6C 1ULEA 1T6GC 3OUHA 1SDWA 3V65A 1ZX5A 5IATA 1F2NA 2CWMA 3LDKA 2J7MA 5JZGB 2W1SA 1DGWX 3GZTB 1VAKA 1BK0A 2RMU1 3MUZ1 4XHBA 5FZGA 3UGFA 4Q4V1 4AVAA 1PGL2 3LSDA 1GP5A 1HLCA 1RUC1 1YJKA 4Q1PA 1QJU1 4XJAA 3GNEA 4AVSA 2PAEA 3VBUC 2OYZA 5FZDA 1OSGA 2Y64A 2FD8A 1PO23 1YFWA 5EZWA 1B35B 5DUXA 1BVP1 2BYVE 1SFYA 1HV1A 1QEXA 1Y9GA 1VBC1 3KHBA 4ZU4A 4DO0A 1LCLA 1GWMA 3AZYA 4Z07A 2BQPA 1WBFA 5LASA 4RR3B 4A42A 4LHNA 1O4YA 1FYUA 1OVSA 2WFF3 4IERA 4UFMA 5FZMA 3O1VA 2D6NA 4R9AA 2WZR2 2FCTA 3FC0A 4PLOA 4RS5C 4Y4RA 5F7UA 2XHNA 3VBHC 2GAUA 2ZMNA 1DYOA 3SCHA 1AR61 4CCNA 2UWAA 3WG1A 3KF5A 4GQ7A 2P1BA 3TOJA 5C7GA 1JODA 4AOCA 1AXYA 1RINA 3VZOA 3VZKA 4AQTA 5JR2A 4ARYA 4INDA 4CE8A 5KR7A 4QDRA 1PZ7A 2ZHLA 4HVRA 2DVDA 4FTSA 2HEWF 3BIEA 1MS0A 4XW3A 4D7SA 1YJLA 5JMCA 4IE4A 4O9EA 2EIGA 5CISA 2ADDA 1JOBA 2KD7A 2WWUA 4OMCA 1GNHA 2IC1A 2ZEYA 3MLJA 5E88A 5LK5A 4QX2A 2CGOA 5HXMA 2BBVA 1H6XA 5CFCC 2WN3A 4EN9B 3I2OA 1Z78A 1NQJA 2JDUA 4FPHA 5LB6A 4PBPA 1XU2A 1RMU3 5CADA 4QAWA 3ZFGA 4KI5M 3VBUB 2VZOA 1U12A 1A3KA 5FY7A 3HQRA 1IS4A 1GWLA 4RFT0 5DDJ1 2ZGMA 3I3DA 1S0CA 1K5MC 2R041 3VDDC 2LTNA 4AGVA 1KD7A 3BPSA 3SCFA 2D98A 4NVPA 4NIDA 4JKMA 4JHTA 1F31A 3I3QA 1JZ3A 3RZMA 2JDKA 5D8AC 1NE6A 4FFIA 4RS5B 4AI1A 2ZGKA 4AK3A 4M3CE 1I3HA 2VOVA 2YROA 2ZGOA 1RJ8A 3IBMA 1RUD3 3IT8A 4XHXA 3WUDA 1UOGA 4F7ZA 4Y3OA 4DOUA 1YI9A 4K9SA 2B39A 5F6LB 3VGIA 3RZLA 5A6QA 5HCHA 5CG8A 1W8HA 1JHJA 3T08A 1J3QA 2OW4A 4FPEA 2N7GA 2PHLA 1AR91 2VQUA 3AMQA 2VD7A 4BQYA 2R6QA 4Y5TA 3D5OA 2HWC3 5E89A 1E5SA 3VDBA 1CAWA 1NT0A 5IYYA 5EJZB 2GSYA 5FYHA 3DXUA 4JGZC 1YFXA 3AMPA 4W6WA 1D0HA 1S1AA 5K8SA 5DQ0A 2LRPA 3GJBA 5SV5A 3BPZA 2ADEA 4NIIA 4D94A 2PLV1 1M4WA 1ZRIA 1X36A 2PQQA 2Q4SA 3POEA 1SMVA 2UYAA 4MGYE 3N7JA 3NAPC 5CFCB 1HJFA 4JC1A 1MZ5A 2AYHA 2P6HA 3CIHA 1GFF2 3I49A 4QQOA 2JKXA 1S0GA 2GMPA 2Z79A 3MPPG 1BXHA 5C4WA 1UAIA 4CCJA 4V2WA 4TTGA 5IK4A 5EYYA 1AYN2 3M7AA 5A3PA 3CDZB 1EYBA 2G19A 3KT1A 4GB31 1FMD2 1VBB3 1X82A 1XE0A 1W9WA 2J1UA 5FPLA 2YPJA 4CP9B 4BA6A 4W6YA 3U10A 3AB0A 1ZRCA 2R0HA 5IFTA 1O6UA 2QDRA 1G86A 3R6SA 4CP2A 3LOBA 4PF1A 2HWF2 4YW2A 3IPVB 5FYTA 5E16A 2VNOA 3WF1A 1C1LA 2BU9A 5D8AB 3PUQA 4XZUG 4UFHA 1FPN1 4E9KA 4Q0VA 5T3NA 1ZBA3 3L9JT 4QXBA 1RGSA 1RUH3 1VRBA 1XSQA 2ZX2A 3FMGA 4GJYA 4YGCA 4A3ZA 3ES4A 3OJBA 1DGLA 1HN0A 4QXHA 1X33A 3ENRA 5K7PA 2B9UA 1JU3A 3WF4A 4MGKE 3K48A 4GMP0 1MQTA 4X8NA 4ZKTB 5J1XA 2QQMA 2NP0A 1SLBA 2HYXA 3KGLA 3WCSA 5AC91 2VCCA 1LB2A 3UGHA 1N3PA 1G7YA 1OD3A 2ILMA 1IZ3A 2VUJA 2VL4A 3JUUA 3UL2A 1WLTA 1MVQA 2E6VA 4JCKA 1TME1 2GMEA 1O3SA 1EY2A 5FP7A 1GUIA 5JXJA 1MEC1 4XJUA 1OKQA 1XYPA 1NXD1 2DWRA 2GP5A 4CVUA 2XMLA 2JD4A 2CU5A 2ET1A 3LD8A 2R062 3ZPOA 4CPBA 4PHZA 4FAGA 4EROA 2QQJA 1C5HA 2BV4A 4QPGA 1REDA 1POV3 5DG2A 3ZDSA 3ZYHA 1MS8A 1W8UA 4JDOA 3PU8A 3ON7A 3IN9A 5JXHA 2R071 5AVPA 1OF3A 3C7HA 4KWUA 1K3IA 1RUJ3 2VTXJ 2WS92 3D3AA 4PIZA 1RUF1 2PHFA 1UY4A 2BWAA 3HN1A 4J1XA 2PYTA 2XLFA 2ZS6B 5IVEA 2QQVA 2YY1A 5A7SA 4EZHA 4AVTA 2Q5TA 1R1A3 3W59A 2VBDA 1DCSA 1OPOA 1S0JA 5FLHA 4AFMA 4AG4A 3K75B 5EXOA 5FPUA 1FT9A 3NWKA 2FHRA 5JPMB 5JUVA 1SBEA 3JD72 3KCYA 3ZXAC 1UMZA 2J1AA 4A6SA 4B4QA 3ZYPA 4GD4A 3R4SA 2EXIA 3O1SA 4IEOA 4A41A 2BFUL 1RUI2 5J37A 1GU3A 4CCMA 2D6MA 4X6QB 3WD5A 4XAAA 3NNLA 5FMCA 4HXCA 4P5HA 4PLMA 5DAXA 4RHV2 2W08A 4AWDA 5JAXA 4QDSA 4V2VA 2A3YA 4TSVA 1OT5A 3I2JA 4XEZA 2FCUA 2VQTA 2ZAHA 3LPGA 4RA0A 3P3NA 5C9AA 1KEXA 2C4XA 1HN1A 4AEDB 5BNNB 2V5DA 1ZZ8A 2D43A 2OVUA 3E5QA 1QU0A 3SH3A 4N53B 2XKPA 4DS0A 2MEV1 2CDPA 4V1PA 1U5ZA 1PVC3 1W90A 4L92A 2RS52 3MW3A 5JVVA 3ZKYA 2XQXA 5HV4A 1WD3A 2Y0OA 2BRTA 2VUCA 2BTVC 3LF7A 4B7KA 4BK5A 2YG0A 1QF3A 3E6DA 4LE4A 3PUAA 3GHNA 2WRAA 3TB0A 5LY2A 3WDVA 2XUEA 4LO5B 2Z2SB 1BMV2 1Y43B 1JS9A 3LSEA 1AJKA 4QHOA 3T2OA 4CTEA 1H1AA 5EWSA 4MXVA 5FXZA 4AI8A 1BZWA 2YBSA 1DP0A 4BQ1A 4HKWA 3ZFEA 2PAKA 3UKTA 3N9MA 4BDVB 4BU2A 4XFIA 4PLNA 2WNEA 2R16A 2NQYA 3NO8A 2HLEA 4YVWC 5T5LA 5LY1A 1UZZA 3MV11 1COV3 1NE4A 4XF9A 3OBRA 1AYM1 3UNPA 3DUIA 4IEQA 4AFBA 4I0WB 3E1F1 5FZIA 5A3MA 1A8MA 2RMU2 5FK8A 1JI6A 1PIV1 4CEYA 5GZGA 1BEV3 2EAAA 2EXKA 3HNMA 3I59A 1TNRA 3P3PA 2IXJA 5A3TA 3IDEA 4IETA 5I93A 1QJU2 1UX6A 1UOJA 1UL9A 4MXWA 1GQHA 1TNFA 3BALA 4BYYA 1JYVA 3VBFA 1CESA 3ZIXA 1BJQA 5FP4A 5BNPA 5FMOL 4IDZA 3VDAA 4JQRA 4Q0SA 5KXDA 1HB2A 2YYOA 2ZGQA 3CQOA 3BGAA 3WDYA 2HKXA 3D4KA 4XUOA 4YZ5A 3MIFA 1RUG3 1EV13 2LUWA 3D0SA 4N9IA 4I2OA 1VBE3 1C8M3 3E5XA 4CA9A 3O5SA 1UU4A 2WWSA 1E5IA 4UW5A 2OZ6A 5C3RA 2V5YA 1I1EA 2CY6A 4XMIA 1OOPA 5FYIA 3GBFA 3LEKA 5JLVA 5JMOA 2P4EA 4BZ4A 2WT1A 3ZFGB 1XXNA 4BIFA 4AYUA 5F9TA 5BV6A 2QE3A 2CDOA 5IVCA 3DYPA 5LA0A 1F5FA 4XACA 1NZCA 2DCKA 4AQ2A 5F5CA 5A3UA 2VMEA 4RGKA 4XJ8A 5HPOA 4XDQA 2BUKA 2HWB1 1CAVA 1YFYA 5LRSA 2WNVA 3KF3A 1VBA1 3BKZA 1RUE1 1QXJA 3MW4A 4ZPIA 4CU8A 5T5OA 4QX7A 4Q2FA 5IVFA 1DFQA 1MZ6A 2UWCA 3T2TA 4GMP1 4WVZA 3ZN5A 2VBPA 2D97A 5L9RA 1F35A 1SPPB 4D7TA 1LEDA 3B9CA 4LORA 1Y3TA 3ETPA 4Q4X3 5HCBA 1TQ5A 4C0BA 5CIRA 3HWJA 1C1FA 1CD3G 2B9VA 2OS2A 2RS32 3FFZA 3FFQA 5AFEA 5I8TA 1CAWB 2K46A 1G8WA 3NKTA 1D7PM 1AX0A 2AR6A 4ZY9A 2XJQA 2R042 4GH4A 4PI2A 3BOPA 1UOFA 4FCAA 4RN5A 5FUIA 3VKFC 4R8HA 4E2QA 1VPHA 3B93A 4KWLA 4YSFA 2CYFA 2A6XA 2ZEZA 3T4HB 1YXWA 1LOFA 3JU9A 4K1YA 3MDPA 5FZAA 2W95A 2DVBA 3GCWA 3ZYFA 1X9PA 2JDAA 4HK8A 4DXRA 1QQP2 5ACA1 2GNBA 5FLIA 1S55A 4K3UA 3WLUA 1XNAA 4HG6B 3H7YA 4RQPA 1AR71 1F8VA 1FATA 4A3XA 4YW7A 1PNFA 3GJAA 4G9SB 4RGGA 1JW6A 1S2BA 4IV3C 4AEKA 4MHUA 4XXAA 4Q4W2 5JOXA 5FPZA 2W5FA 1IPKA 5C5UA 4NJ4A 4OHXA 3SITA 3WP3A 3MUY1 3WY6A 2ATFA 4JHZA 3OG2A 3OPWA 4LA3A 2HWE1 1QY4A 3K2OA 2Z4FA 2GN7A 4BQXA 5CKNA 5HCFA 2HWD3 2PLV2 3RYKA 3CHXA 1J3PA 1LNSA 3O1UA 2ZGRA 1TVGA 3WG4A 1WMXA 3QACA 2PMWB 1QH6A 1UKGA 4CCOA 4QX0A 2XBO2 1NA1A 3ZYIB 1ZRDA 2GH8A 4LO8A 4Y1UA 1AUYA 1HQNA 4LJHA 3UT0A 2X5IC 1BBT3 4LTAA 5K0UA 1H1IA 3OUIA 4CUAA 1QJX2 1YUDA 3NSTA 4UOJA 1G6NA 1MQTB 1ASJ3 2JE9A 4Y26A 5BPXA 3ZX7A 2QQPA 2ARXA 1WWYA 1UPSA 1W9FA 4GB32 5FJKA 1OBNA 3ZYJB 1J1LA 5A7WB 2R0FA 4LHSA 5TSWA 2QVSB 4ET7A 5CBLA 1PK6C 2W94A 4P00B 4R4XA 1ULOA 1APNA 3TAYA 1H9PA 2OZJA 4HZFA 1RXGA 4I0AA 2P3YA 3RYPA 2PN5A 4H7LA 2B4KA 4QQPA 1QOSA 1XNKA 5FXVA 2ORXA 3O12A 2GC2A 2JICA 4AVCA 2E26A 2RS11 4Q0PA 3BUCA 2YMZA 3NRUA 1XNCA 2XR4A 2EAKA 3OUJA 5E8AA 3U4SA 1LGCA 1R091 2C6SA 1Z7S2 4URTA 4XQDA 4EWEA 4IV3B 2XVKA 4ES8A 4LE3A 4PI0A 5AC92 2MHFA 2R1BA 2XKOA 5FY4A 2G4IA 5T54A 5FQ0A 1AR83 5JCTA 1EAH2 1S0BA 3K3OA 3NL1A 1TMF2 1YHFA 5DUUA 2JWPA 1LRHA 3WDUA 4CEWC 4LXLA 1WUVA 3B00A 3CU7A 1GNYA 2V72A 4ISRA 4IEUA 4HKLA 4KU7A 5DAPA 1H8TA 5T5JA 3GZAA 1V9U1 1HXS3 2AZ5A 2VULA 3C7EA 5EJ3A 1W8NA 2DCYA 4UI9L 5BUVA 5JR7B 1JXNA 3S7IA 3FBYA 1WCKA 3DPRA 4HT1T 4DXSA 4MO3M 4LO6B 2CGNA 4A45A 3ZYGA 3HMYA 3JQXA 4QPIA 3PJYA 4HN1A 4XZPA 4LKEA 3ZXGA 4E4HA 5H9SA 3RMXA 1JBCA 2V4VA 5IK7A 1H2KA 2GC0A 2Y0IA 4NPMA 1MR5A 4FPYA 5KHIA 1PK6B 3ACLA 1SCRA 2WNOA 2YV8A 2NYYA 2ARCA 1BLZA 1H6YA 3OF1A 4JVAA 2DTWA 2JG9A 5FZ8A 5F37A 1LULA 4XXPA 1V00A 3RVHA 5C9AB 1AX2A 3WQ0A 5J98B 4LITA 4UFLA 5FP3A 1SDDB 3AYEA 4XJ9A 5FPVA 3POWA 1YQ8A 2DVFA 3X29B 2O8QA 3T1MA 1O3QA 1V6JA 3JXSA 2Q8EA 4M00A 2WZR3 4TN7A 4AFDA 3O0VA 1W8WA 2QTWB 4FTBA 4S2GA 1YO8A 1IPSA 3EYPA 4MVTA 2W47A 4YZ1A 4RSUA 1J83A 5ABJC 2BGCA 2FDHA 2ZX0A 4IGPA 4CCEA 5FZ1A 1LU2A 4COVA 3NV2A 4KG0A 3M3IA 3WX5A 3M3EA 2P3KA 2ZZJA 3EQEA 1NY72 1PGW1 2VVFA 4YPJA 3KZ4C 4BMBA 1POV0 3T0AA 1OLME 4XIKA 2JECA 3OYWA 2OPWA 4AQSA 4BMEA 4QX3A 4YYOA 2MEV2 1UXXX 4JDNA 5GJ6A 4NO4A 4D7YA 3ZM8A 1X50A 1W6OA 1Q56A 3A22A 1G9CA 4OZOA 2C9AA 1N3OA 2YFZA 2WNVC 5T50A 4YM3A 1YIFA 2BOIA 4KBZA 2I2SA 2Q8DA 4CEYB 2HJIA 1WLWA 3EXUA 1VR3A 4O7XA 2RDQA 2Q8OA 5IHRA 3K4AA 4FO9A 2AGSA 4ZXKA 1G9AA 1W8FA 3ES1A 3MFAA 4MXWB 5JI7A 1FOD3 2WFF1 5JSRA 4P9WA 3SHRA 2ZACA 2BNOA 3AXEA 4LK7A 1NKGA 5BNPB 1WKYA 5IVYA 4DEVA 2WLPA 4B3NA 3Q8AA 3K77A 1IKQA 2VPVA 3M2MA 4MSVA 3OB8A 3D82A 4YW1A 5C3SA 3GXUA 3O0XA 1UU5A 4LR4A 3HOBA 1CAXB 4CDUC 1W6PA 5A1AA 4RGAA 4NHLA 2JB8A 2EICA 1DG6A 2VCAA 3BN6A 3IDBB 1V0AA 5D1IA 5DMYA 5I8YA 4R9CA 2OQ7A 1MS4A 3FUQA 5GZEA 3ZXDA 1VRH2 1OOPB 1YC61 4K6BA 2J42A 4NUBA 3ZIWA 2RDSA 5FZKA 4A6OA 4RL7A 3H8XA 2CGPA 1LECA 4YRDA 5DXDA 4H3WA 1RVF2 4QKDA 2RR12 3WV6A 5IK8A 3WINE 3LWCA 3UKNA 1AL23 4ZZ8A 1W28A 1X8EA 5T5PA 1M06G 3HT2A 3BTYA 3DYMA 1B35C 2VR4A 2PA7A 2VZSA 1SQ4A 3AKQA 2VNRA 1RMU1 1OHFA 3FX3A 4YWAA 1IS5A 1PO12 3PMEA 4RR3C 4X6RB 1W9TA 2WNVB 3VBSC 4EJRA 3FL7A 4PDWC 5KC6A 4BCUA 1AYN3 1CZSA 3URFA 2FDJA 5K0UC 5J7MA 5APAA 1D2QA 5IVVA 3AKTA 2WNUA 2B46X 3R05A 4LEJA 2WIIB 1G9BA 2JDMA 4NHYA 1F15A 2BNNA 2GZWA 4QWNA 4S2DA 5A32B 3SEPA 3ZSKA 3LGRA 3DKWA 1NCRA 2K9ZA 3DECA 3WXPA 2WQZC 1FV2A 1CWPA 1DLCA 3AL6A 4FT8A 1RUE2 2BGOA 3WQ1A 1DU3D 5A7OA 4L8QA 5I8SA 2HWC1 3CJIA 4BE3A 2B8MA 4PBOA 1SLCA 2I07B 4RQPB 1XC6A 2QUOA 4U36A 3BYWA 3NNFA 4XETA 5D2AA 3PUSA 2NPIA 1WGPA 3VKLA 3S0MA 2F17A 3N35A 2VMDA 2IVJA 3B5LB 4C90A 3NNJA 3U14A 1Y9QA 2AC1A 4JRAA 4Q1RA 3PNAA 2J1RA 3POYA 4QX8A 4CCCA 1JZ2A 3V0AB 1KJRA 5FXWA 2IFWA 4XUNA 1KJLA 2AENA 3VBSB 3WP6A 3P6BA 1UYZA 4PDWB 4YW3A 1ULPA 5GKAC 1NCQA 1H8TC 1SG3A 3LA7A 3MO4A 2JENA 4ISQA 1CQ9A 1LKNA 5ACA2 1NA1B 5GM0A 3PU3A 1ZBE2 4BLIA 5JXIA 2HEVF 2D93A 2IXKA 4TLFA 4DFSA 5JOWA 1W39A 2VZTA 1AR72 3AP9A 3AYDA 1UU6A 4K1ZA 1ZA7A 5FZBA 5K0UB 1IGOA 3SQOA 1W9YA 2Y6GA 4JGYA 4R4ZA 4IL7A 3H8UA 4MGZE 3N4MA 2QKDA 4W4ZA 3UESA 1QJEA 1DHKB 2C24A 1RUH1 2WSUA 1JU4A 1V6KA 4N7UA 5FK7A 3MLLA 2DBIA 4FI9A 2WFPA 4AVVA 2XG3A 2JG9C 4JKLA 5FY0A 4AFCA 4DMIA 4CZSA 2G9GA 1Q43A 5GZCA 1EUUA 3J8F2 3QOPA 5F8PA 3AP7A 1JYTA 1IHMA 4GZ9A 2XJSA 2XL7A 4I3PA 1S0FA 3WNPA 2QBXA 2DDUA 3I2FA 3SKVA 4DNYA 4PJYA 1RUI3 3LFIA 1Q8PA 3K51A 2K2SA 4ITCA 3R4DB 3U0ZA 2ARBA 5KXBA 3T1LA 1JUHA 1Q3EA 2E63A 4HOOA 4XILA 1PZ9A 4P9IA 4RHV3 3CNAA 2GU9A 3AJYA 4P08A 3M1HA 4C91A 4O61A 2GH2A 2JX9A 4WM8A 4OHZA 3HD8B 4FQZA 1DQ0A 1UZYA 1W8ZA 3P5BA 3TEXA 4XBQA 1POV1 5FXXA 1WZXA 4IV1A 1OURA 3LA3A 4LOTA 4C0HA 5C8CA 1H8TB 3RI8A 1LU1A 1GZCA 2WT2A 5LK7B 2P6CA 2VNVA 3VN4A 2VCMA 1Q8OA 1NQDA 2JJ6A 3FBMA 1CPMA 1ODMA 1RUJ1 1S2EA 4YZ4A 1JZ5A 1C3HA 2RS53 2HBUA 4M3CA 2YFUA 4CU7A 2RS12 1WW6A 2QDNA 3RZJA 2ZXQA 1NG0A 3R4UA 3WG2A 3C3VA 2RJLA 1DBNA 1SFPA 2FMYA 4AI2A 4ZU7A 4META 5L73A 1YQ6A 3JB8A 3E97A 1CR7A 3C7FA 5LRRA 1RUOA 1FV3A 5FZHA 2E51A 3SEEA 5LEKA 3KB5A 4LIVA 2QQNA 4Q0UA 5EV7A 1K45A 2JG9B 3S57A 4W8JA 1L7RA 4I3GA 4OFGA 4X8PA 4BXSV 1A78A 1DIWA 3F2ZA 3IDCB 3OD4A 4FVVA 4DIQA 2YB7A 3FHQA 4MYEA 1GSLA 3N7KA 5C33A 3M3QA 3N9LA 1FXZA 4OVEA 5C71A 4HLTA 4C8DA 2CSGA 5L7OA 2DUQA 2PQSA 5GLZA 3OY8B 3WW2A 1LHNA 1YYNA 1VE0A 3U1XA 2RMU3 1TZOA 1C4RA 3ATGA 3LOIA 1PZ8A 2BFUS 2ZGSA 4CDQA 1V6IA 3ITQA 4LK6A 5CFDA 1ZREA 2JDYA 4TLGA 1RXFA 1XQNA 3J7LA 3VZJA 1QXPA 4QKNA 4DUWA 2VMGA 1F9KA 1QDCA 2W46A 3POGA 3RJRA 3I2DA 1PVC1 3OGVA 3H3UA 4LULA 1RIRA 3VHNA 4HKOA 3PIGA 3MV01 1CIYA 1EP0A 2VG9A 3AX4A 1YRZA 1HRI3 2BJSA 4AL9A 2ZBJA 2A75A 2OPKA 2R32A 2ZX3A 5J3UA 1YLLA 3ZYRA 5FZ7A 2Q30A 1L3JA 3AKSA 1WD4A 1EUTA 3JQWA 4Q4Y1 5FWJA 5L9BA 3WDXA 4E27A 1W6OB 4LLFA 2ES3A 4O65A 4IEXA 3H3ZA 5IT6A 1S0EA 4WVMB 3IDAA 4GWMA 4AEJA 2DFBA 5CZKA 1AJOA 4Z82A 3W21A 5FOJB 2YU2A 3USSA 1U0AA 2WQ4A 4GIQA 5FO7B 4QKFA 3PTRB 4YM0A 3MIDA 5ANNA 2IZWA 4ASLA 1GZWA 2HBTA 1NYWA 3CBNA 1QDOA 4GKYA 3AFGA 2XOMA 4B4PA 5EIYB 5CVRA 5FUNA 2Q1MA 2IVIB 4I30A 1COV1 1LOEA 4K20A 4R9BA 4AEDC 4IGOA 1QMJA 5BNNC 4NPLA 1VBD3 1UF2C 4OZXA 4N53C 4Y24A 1CAUA 1XNDA 2OA2A 3LDRA 4COYA 3N9PA 4DXZA 3O1PA 1CZVA 2QCSB 4MG2A 3MYXA 1W6PB 4CUGA 3ETQA 4EWDA 2WN2A 5IJRA 1UWWA 1I9RA 2PHWA 4KWJA 1YEWA 5LATA 1W2UA 4XBNA 4XDPA 4YGEA 3MW2A 3BIWE 1IG3A 2YC4A 2E9QA 1ACCA 1J3RA 2H6BA 3NV1A 4XF0A 4EWAA 4EZ4A 2RS33 1NLQA 3V64A 2WL1A 2YBKA 3AZXA 1NOVA 5FZOA 1EV11 4Q26A 1HRV2 3GBWA 4CP1A 1R082 1C8M1 1QJY2 3IAQA 1C57A 2R043 5FZEA 3VUOA 2WAOA 1VB2A 5F39A 4QM9A 5FMOS 5CKMA 2W1QA 1VB4A 3WNKA 1W2OA 3ACGA 1QQP3 3D0JA 4NR1A 4IEYA 2LW8A 2BVVA 3BTAA 5EJ1B 2PAMA 3MZHA 1KDKA 2Y6LA 4I02A 3M8LA 3ZO0B 3ZSLA 1C5IA 3I3BA 5EP9A 4DY3A 5BNOA 1VAMA 3TEZA 1MS9A 1R64A 3VHPA 4B1MA 1FI2A 2Y26A 4QD2A 3CZUA 3WVJA 1NLRA 2QZ2A 2P3JA 4Q4W3 4QU2A 1A6CA 1D4M2 2JDZA 3SH4A 2WNUB 3CKHA 4LLOA 2FDIA 2JD9A 3I3MA 3MHZA 4YW6A 1US2A 2ZGPA 4FTEA 2PLV3 4QB2A 5FZ3A 5IUQA 3ILFA 5FP9A 3WW4A 2GC1A 2RHPA 5GLUA 1XNTA 4P9XA 3GBGA 4Q4X1 2XBO3 5DPNA 1GYKA 2Y60A 3A7QA 1HKDA 2VNGA 5FPXA 2TNFA 4LHLA 3WP4A 2BW8A 1QJX3 1SLLA 5I0SA 3RYRA 4GB33 4IUGA 3T3YA 3ZFGC 2VOKA 3OEAA 1UW8A 3A0NA 3KMHA 1DQ5A 3C8XA 2BP6A 3BVCA 5FZ0A 3NJVA 2O8OA 4M4RA 2WSVA 1IG0A 3ZFFA 3ZN6A 2KR2A 3LEIA 2DBNA 2JG8A 1W04A 4WZCA 4E4ZA 5JOYA 2BVBA 3HPNA 4D3WA 3J26N 3PHMA 1GMMA 5BYNA 5EHDA 5FUPA 4E4SA 3KHCA 3RS6A 1R1ZA 1TG7A 3KV4A 2A6VA 4KH9A 4JAAA 5FP8A 1NCQB 2RDNA 2FZ2A 1RHI1 2HWC2 4J25A 2W0XA 2Y6FA 3ZN4A 5FBJA 1WCQA 4Q4V2 5LCWL 1Z7S3 1ULDA 4XYXA 3NW4A 1RUC2 1OUSA 5LA1A 4LT5A 2P2KA 1MVEA 2C26A 2HWD1 3LAGA 4NMIA 4AVBA 1EAH3 1W0PA 2PHUA 4A7YA 1TMF3 3UJQA 4UT5A 1P8JA 5JXGA 4BOWA 4QU1A 3Q8CA 4Y20A 1SHWB 3B01A 4KGQA 1VBC2 1KQRA 4P9YA 4N8MA 2DCJA 4OI2A 4L11A 1O3TA 1BBT1 3HBKA 4D0QA 4EYUA 4HETA 2Y6KA 3PTYA 3ILRA 3OBAA 3I8TA 1U5YA 4FSJA 2OUHA 2GMMA 2VCBA 1UIKA 2C5DA 3E5UA 5H9PA 1DF0A 2P17A 3BODA 3VL9A 1RYYA 1AR62 5C4WC 3UYJA 2JIJA 3ZXKA 5KXEA 4LBLA 4MGSA 2CWSA 3MIEA 5CA6A 4AQ6A 2A3XA 4S2FA 4M01A 4UFIA 1ND2A 5GLWA 2TBVA 3ZLIA 1ZRFA 1XYNA 4S2HA 2JDHA 3JB4C 5G04L 4N9HA 1RUH2 3HN3A 3VZNA 5CFDC 1PX4A 1AHSA 1W99A 3GZEA 1IKPA 2IWGB 2ERFA 3OCPA 4OULA 5F3GA 5LBEA 1YWKA 2PHRA 4LKDA 5KHKA 2V73A 5FYSA 5A33A 3BCWA 4BHPA 5B4NA 1Q8SA 1DYKA 2C0ZA 4OQ9A 1OA3A 2UYBA 2A6WA 4ZS2A 3VBOA 3JBG1 4N7IA 2KA3A 5A6YA 3RRDA 5A80A 2XJVA 4M3CB 5GZFA 5LA9A 4WV8A 3U75A 4Z8BA 5C3QA 5FYUA 1KITA 2RM21 4CCKA 1MQTC 1LOGA 3H0OA 3VD7A 4AHXA 4PCRA 4DXTA 1HXS1 3K3NA 1W3XA 5DDJ2 3WSOA 4N43A 4QHZA 3ORJA 2MNGA 2JDPA 4QX5A 3AL5A 1WW4A 2WR9A 5A3OA 1ZZBA 5CB7A 4BIOA 3ALQA 3HVDA 4YM1A 1JOJA 1ND3A 3HT1A 1NX9A 1PGL1 3A0KA 4XF1A 2WKKA 2MEV3 5K9YA 1UYYA 4FPGA 3AXDA 3Q8EA 1MZFA 5C4WB 3THTA 1W8TA 4XF3A 3WHTA 5L7OB 1GP6A 1LAJA 2VZVA 4QPGC 2E53A 3WOGA 1CX4A 3LIGA 2AH2A 1AR92 2ID4A 2XONA 4YG3A 3RFRA 4CDQB 4YVSA 3MI8A 1X7NA 4P5YA 3RPQA 3SISA 2PHTA 5CFDB 1UZVA 1AX1A 5G05L 4BK4A 4EV0A 3MPBA 5DAVA 4MOAA 3TEWA 4E8CA 3FUOA 4LBNA 1MS1A 1N1TA 2GP3A 2VJXA 1UNBA 1H9WA 2DYCA 2ORZA 2WZR1 1UPIA 3IAPA 2UWBA 2D7FA 2L9LA 5FAXA 2VOTA 3NJYA 3P1IA 5A7PA 1BYHA 1UOBA 3LE0A 2YGMA 2I74A 2RJ2A 3E6BA 3A23A 1PNGA 1LHVA 3KS7A 2VXJA 4DRVA 2E31A 4HL0A 4FBFA 2VU9A 3W58A 3AZZA 4FQ4A 4MHRA 2ARAA 2LALA 3VHRA 1SZBA 1WBLA 4ASKA 2YPDA 3APBA 3TN93 5JWPA 1VRH3 4IEWA 4PIYA 5H9QA 2DFCA
chains in the Genus database with same CATH topology
1N1VA 1W0OA 1QNYA 1RVF3 1CJDA 5T55A 2RR13 3QH7A 1GZWB 2X53S 4KG8A 5JIUA 4XIOA 4FPOB 5JSOA 3KM5A 3V0BA 2E7TA 5C9AC 1FPN2 2OIIA 3LA2A 3IKWA 4FPCA 1RL3A 1PO13 3GZUC 4QQHA 1EPWA 4Y1YA 1CAUB 4QPGB 4WVWA 1AL0G 1QH7A 4NHKA 4Q4Y2 4FAHA 1DQ4A 1FOD1 1OA2A 5J48A 2YZ4A 4CDXA 2GDFA 1F5JA 4SBVA 4E4DX 1QXRA 1TME2 2Q1ZB 1U5XA 1CONA 1MEC2 2Y38A 3M3CA 3AM2A 4ES9A 1CGPA 1COV2 3OBTA 3LZZA 3ZFEC 2WLQA 3FJSA 5EFUA 3VBUA 5HI0A 1FX5A 1RUE3 4H14A 1UKRA 3I54A 4YFZA 1WLCA 2CNAA 3AMMA 3SH5A 2HEYF 2XPJA 2R072 3HBZA 4BM8A 4OHYA 3I7DA 1AL21 5KC5A 1FNZA 2A3WA 1SEFA 2VMIA 2WZPP 1RUF2 4MV2A 4LHKA 2DU0A 4CEYC 3KSCA 3PVOA 1B09A 3MIGA 3VBHA 1OFNA 1RC6A 2D3SA 1WMFA 3QCWA 1EV12 1LESA 1DGWA 3VL8A 1O91A 1DZRA 1W6NA 3VBFC 1HW5A 4XFBA 1O3RA 5BNPC 3WQ7A 1GLHA 1AYN1 2DVGA 2D6PA 4I09A 4PQ9A 5ACA3 1C8NA 2DU1A 1JUIA 1ZBE3 2NZ9A 5AVAA 4FOYA 1AZDA 4EN7B 1OOPC 2EXHA 5CG9A 1GBGA 3FZ3A 3HAGA 2FMDA 2P34A 3D6EA 5CFCA 1VIWB 1QOOA 3N7LA 4HPKA 4XJWA 3ZFFB 2XL9A 3ZN6B 2CL2A 3ZFEB 4Y1ZA 3RI9A 1D4VB 3SXWA 2WC2A 2W52A 3J8F3 3CLPA 4UBGA 4FPLA 1K5MA 2JXAA 2D5FA 3VDDA 1ENXA 2VMHA 1PO21 2UURA 4AGGA 3IPVA 4Q29A 1G9DA 5D8AA 4KNCA 4WVVA 3I59B 3H9AA 5F5QA 1IPJA 2XWBB 2NLRA 4LUKA 3VBFB 3WDTA 2VW0A 4Y20B 1YFUA 1V6OA 5DG1A 1XYOA 1SCSA 2ZJCA 4GH4C 1IS6A 1SFNA 4L99A 2YC0A 4JGZA 4M3CF 4DY5A 1LOFC 2RS13 3FLPA 1AYM2 1RHI2 3FHIB 3VZLA 4ATEA 2FBEA 2GN3A 1PIV2 1SBFA 3NAPA 4RQPC 2QNKA 2HWD2 5FBZA 1ND2B 1U5IA 1WMDA 3ZVXA 3PJQA 4Y22A 1BK1A 1BVVA 2ETEA 3U07A 1GR3A 1WCSA 2WJSA 4JV4A 1KRIA 3U4XA 3WG3A 1BBT2 1RUNA 4XFGA 1RUI1 1BKZA 1DGRA 1KXGA 4XFHA 1CAVB 4Q8KA 2VOWA 4LBQD 5A33B 2ZABA 1VLNA 3WZ1A 4YLZA 1OQ1A 2K0GA 1OQEA 4RHV1 3VBOB 1QJZA 4CDWA 3LCPA 1NA1C 2NMNA 3ME2A 2LM3A 1ZZ7A 2D5HA 2ZX4A 1FMD3 1HV0A 4L2NA 1UN1A 2P37A 5J96B 3KCCA 1HIXA 1S0IA 2HWF3 1ZM1A 4N43B 1FNYA 1RUD1 2NN8A 4GH4B 4XMAA 2HWB2 2OUJA 4A2UA 1ND3B 1VBA2 3MGUA 4EN8B 1ZYBA 3FLRA 1V6LA 4XTMA 2ET7A 3JBG2 2IXIA 1BMV1 4E2GA 4AW7A 5IK5A 1VAVA 2RM22 3RSJA 1LHUA 1OLQA 2AUYA 4B8EA 5L36A 5I0UA 2VGDA 4AF9A 4YVSB 1HXS2 2X29A 2ZOEB 2ZKLA 5FFOC 4D69A 3N36A 4CDXC 4M0HA 2P3IA 3QBQA 1LGNA 4IQPA 2R063 2BWCA 4AE2A 4HSLA 4F8AA 3KCXA 1VBB1 4YNIA 4ONUA 1SBDA 4HMZA 4BWOA 1IOAA 1XRUA 3O7OA 3OTFA 5GLVA 5HCAA 5FCCA 4YM2A 3DPRC 1KS5A 4FOQA 3MFCA 3VBRA 4QPIC 2WS93 3ZXLA 4F3JA 4MX3A 4ASMB 1HRI1 1QOTA 3MIHA 3ZMOA 1ZBA1 4QQ2A 1GANA 3EBRA 1ALYA 2PTMA 1HRV3 4NWVA 1QHDA 2HWE2 1H2NA 1R083 1QJY3 2NM1A 1WLDA 2SBAA 1KS4A 3RWNA 3V0BB 2BPA2 1H4HA 2RJKA 3G6JB 3JD73 2DUPA 2VW2A 1ENQA 1YNAA 2PELA 3J4UH 1EPZA 1N47A 2UY8A 4QHBA 4YGBA 5KXCA 1VJ2A 2CAVA 1DLLA 3UK9A 5KHHA 1CPNA 4KQ7A 3AFKA 4MZUA 3WP5A 5FTTC 3HR9A 4NOTA 4XFAA 1A8DA 5JDBA 1NXMA 5FO8B 3ASIA 5FQ0B 4CP0A 1LEMA 4CDXB 1VBD1 1REEA 1LOAA 4NN0A 1D4M3 5E1RA 1LENA 4A7ZA 4TYSA 1I5ZA 3VKNA 4QGLA 1WMEA 2VUAA 2QZ3A 4IEZA 2ZHKA 5JIAA 3DPRB 3N3HA 2ZPXA 2RS31 4QPIB 3OGGA 1HX6A 1R092 2TEPA 3M3OA 1R1A1 1FOD2 3IMNA 3C2UA 3NVCA 4YG6A 3VKMA 1E57A 2XGXA 4YVWA 4LNVA 2XVGA 2DF7A 1FAYA 3VBHB 3ZSJA 1QQP1 1GZ9A 1HQWA 3AKRA 4PF5A 1W6NB 1H30A 1V9U2 2GC3A 1O4ZA 4QGMA 3PVBB 4C1XA 3AKPA 2NMOA 3TRSB 3H1WA 1PVXA 4XOGA 2VH9A 2H0BA 1PMIA 4NPRA 4NWWA 4Q4W1 5C6CA 2D40A 4GXLA 4Q4V3 1AL22 1RUC3 3KT7A 3J9SA 2XJUA 1QJU3 3CL1A 2B42B 2ZZQA 2D6LX 2VVDA 2D44A 5HBAA 3WUCA 3BB6A 1Z0HA 2XBO1 1VBC3 4HPKB 2EVXA 3PMSA 5SV8A 3KGZA 3OYWB 4WM7A 1QJX1 1W6QA 2PHDA 2VVEA 3IIAA 4HSJA 3MICA 2Z42A 2EALA 4C1WA 5J09A 4FP2A 1AR63 4WZFA 1K5MB 1UIJA 2DTYA 3PLQA 3VDDB 4K21A 2KXLA 1MZEA 1ZA4A 4CDWC 4IEVA 4QXKA 2D6KA 3IM0A 1O5UA 5JPNB 1KFUL 2YXSA 1Q5OA 1PGW2 4RD7A 1ONAA 1TE1B 2JEMA 2WNUC 4OI4A 3ZMNA 3UKVA 3B69A 3ELNA 1Z7S1 4UXAA 4E2SA 1BEV1 1NCRC 3HIFA 4U2AA 3H50A 4KWKA 4UW4A 3PVEA 4JGZB 1EAH1 1TMF1 2FQPA 3RJ2X 2ZGNA 1PO22 2ENRA 3ZPYA 2DCTA 1H1MA 1X8MA 3CJIC 3USUA 4FOVA 1AXZA 4L9BA 4Y1XA 4CYDA 3WCRA 1RJ7A 3NAPB 1SLTA 2ZHMA 4JTOA 4UBHA 5DDJ3 1RUG1 3VKOA 2WFF2 3GHMA 3AJZA 1VBE1 4G4FA 4Y22B 4FOWA 2PHXA 2DV9A 3M4FA 3NV3A 4IV3A 1UCXA 5JOZA 4P14A 1BQPA 1VALA 2A73B 2FZ1A 4LBQA 4EN0A 1V70A 1NCQC 4CDWB 3NKGA 3TYJA 2XUMA 3AK0A 1W6MA 4Q27A 1AR93 2ZGTA 1H8VA 3S7EA 3VBRC 1SACA 2B7YA 2X5IA 4Z92B 4JGYC 3VHOA 3S30A 4ZU5A 4LO7A 1QNWA 4LBOA 1Q8QA 4JTNA 4XQWA 5DZFA 1JH5A 3AZWA 1NCRB 1YIPA 1H0BA 4XPVA 1RMU2 4A7KA 4GALA 2O1QA 2ZKNA 4LA2A 1O5LA 3DV8A 3H1MA 3POSA 2CTVA 4J6GA 1PK6A 4DRRA 1XE7A 4AEMA 3CJIB 4TZDA 4SLIA 5CNAA 4QGNA 4COUA 2A7AA 4YZ2A 1G9FA 4COWA 4ORFA 1NY71 1ZRRA 3AP6A 4YGDA 3Q9OA 1QGLA 1CN1A 5KBFA 4MGIE 1S0DA 1JHNA 4WBBA 4Y5Z0 4GWNA 1J1TA 5BNQA 3L2YA 1QWRA 1D0GA 2ZCWA 1RUD2 4COZA 4WM8C 4XFCA 1FPN3 3OD0A 2IFRA 1AF9A 4IV1C 4CEWA 2XJPA 4MH0E 5KHGA 2VQAA 5C8CC 3UJOA 4FXKB 4Q4Y3 1O7FA 4LUMA 3ST7A 1LR5A 5I0RA 5HXVA 1J59A 1HDKA 1XU1A 3AP4A 2QJVA 3H7JA 4XTPA 3VBRB 5AC93 3BOWA 1ENRA 4JGYB 3ZXEA 1H2MA 5CU1A 5BY5A 3GALA 1LJ7A 1XNBA 5AFBA 1TME3 4KU8A 5L19A 1OI6A 3GF6A 1MEC3 4DQAA 3WNXA 3WW1A 1SLAA 3PVNA 4QPYA 4Q0QA 4AHYA 4XF4A 1ASJ1 3TN91 4B4RA 2WT0A 1VRH1 3KT4A 3ZSEA 3MIBA 1VBB2 1UD1A 4FP3A 1RVF1 1PM7A 2RR11 2R073 5L7OC 5DUVA 4MUVA 4Z1VA 1RUF3 2GNMA 3OPZA 2ZTNA 1HRI2 4L97A 4CDQC 1OLRA 1ZBA2 1ZZ9A 4FPFA 5F1RA 5JSPA 1PO11 2R1DA 2R30A 4OUMA 4WM8B 1CAXA 1LTEA 2AREA 4IV1B 2XLAA 5ABJA 1URXA 4N90A 3N7MA 3U11A 5C8CB 2BNMA 2R49A 2VQ0A 4NHMA 2H0VA 4BH9A 1GICA 4GA9A 1AR81 1ZVFA 2F4PA 4WM7C 5GZDA 3B9IA 3CF6E 3ILNA 4F83A 5FREA 3RDIA 1N1YA 4DB5A 1LOBA 2G9FA 4H55A 1WW7A 5F6KA 4FXGB 2E7QA 1RTVA 4KGGA 1OFSA 4XFFA 5J36A 4YVWB 4IESA 3B3QE 4HBNA 1DGRN 1VBD2 3INAA 1WCDJ 1GNZA 3KD4A 4HN0A 3IWZA 3LB9A 3THPA 4AHWA 2CAUA 1KFXL 3ZXJA 4HVOA 2JE7A 1QKQA 1RUJ2 5FO9B 3SLIA 1MS3A 4H7MA 3W9AA 1R1A2 3D8CA 5A32A 3RMYA 3TWIA 3WHUA 4XQ4A 4Y1VA 4CDUA 3B02A 2GNDA 5JZGA 4O9GA 2WA3A 2A6YA 2XWJB 4XJZA 1ZBE1 5FRAA 1DQ2A 1O4TA 2B5HA 1WW5A 1ENSA 3WR0A 4WM7B 3CEWA 1W6QB 3AMNA 4LBMA 2VOXA 1LHOA 2WA4A 1AYM3 1RHI3 4DZGA 2SLIA 1B35A 2A5ZA 1PIV3 1OD5A 4OI1A 3EHKA 3AP5A 3V0AA 2XVLA 3I4IA 4YW5A 5T52A 3RZZA 4RR3A 1Y7BA 2C1FA 3WT3A 5BNOC 3FWEA 3VBSA 4IEPA 3JZVA 4YG0A 4PDWA 4DINB 2IXLA 3EJKA 1PVC2 3J8F1 3QH6A 4P9GA 1LODA 1S2KA 5A3LA 4YARA 2XLGA 4UW6A 3EO6A 1Q8VA 4JDMA 5I91A 2X8KA 3VZMA 4AGRA 2ZX1A 2A71A 1OA4A 4QM8A 1HQLA 4LBKA 4OHWA 2EA7A 1ULGA 2O0OA 4OUSA 1PHMA 2XH6A 2I45A 2GNTA 1BCXA 3KQRA 2XJTA 1REFA 4YZ3A 3USUB 2YUEA 4I01A 4FPJA 4AHZA 4KBBA 2A6ZA 1CVNA 3SMHA 2PFWA 4OHVA 2ZAAA 3R0RA 4MLOA 3ZFFC 1CJPA 2HWB3 2JG8C 3VLBB 4Z2WA 1VBA3 1BEV2 3B94A 3DL3A 4KL1A 3AZVA 3LKJA 4QQLA 4UW3A 3JBG3 4IXLA 4P9LA 2ZMLA 5JI9A 2ZA9A 2Z5WA 1V6MA 4GMP3 4LBQB 3QD6A 3E6CC 3BU7A 2D6OX 3QLQA 2Q0AA 4ATFA 5BNOB 2GALA 4BPZA 3AYCA 2RM23 3AYAA 1W6MB 2ZHNA 5DZEA 2VW1A 4RS5A 1OMIA 2XJRA 3H1YA 2DCZA 1N3QA 3B7MA 2B45X 1RUG2 5GALA 4HANA 3CJXA 4K7JA 1VBE2 1DZQA 1C8M2 2X5IB 5I0TA 4Q8LA 1OPMA 5KHJA 3G7DA 3WDWA 4R52A 4AI0A 2JKBA 1H2LA 2IXHA 4TWTA 4JRLA 4YFWA 3HQXA 1FMD1 3MF9A 4OLLA 3A4UA 1YCIA 2CV6A 1N1SA 3SCGA 4HK9A 3ECQA 3O0WA 2MPFA 2VXRA 5DUWA 1AR73 2V09A 2YGLA 2HWF1 1DYPA 2YHJA 4FPKA 5EYXA 3MF6A 1DDLA 3RG0A 2TUNA 1MACA 4B7EA 3TNQA 4AFAA 1GV9A 1ND2C 3WW3A 2Z69A 4J1WA 4B29A 3RNSA 2HWE3 5H9RA 3ZSMA 2JG8B 5KWRA 2DUOA 3OY8A 1GQGA 1NLSA 4BLJA 2VECA 2KM2A 1LHWA 1AXKA 4Q4X2 1IQAA 4CEWB 4DPNA 2YDEA 1V6NA 1LOCA 2E7AA 4K40A 2ZGUA 1LGBA 1C28A 1CIWA 2DVAA 1ULFA 2HYKA 3VBOC 4W65A 1JN2P 4I0BA 4AI3A 4GULA 5FLJA 1RITA 5GLTA 2R061 2XHKA 4HFSA 4P9JA 2WINB 3GYDA 1WA4A 4N43C 4R9DA 3AMHA 1ULCA 3KLSA 4WVMA 5BXXA 1PGSA 3ZXFA 2QFEA 2WS91 3V56A 5FOBB 1JTZX 1ND3C 4M0NA 5CAZA 1XE8A 1ZZ6A 1DQ1A 1KDMA 3NJZA 1TEIA 1R093 3DF0A 3MLKA 1HRV1 1YI7A 1MS5A 3TBDA 5DZGA 1R081 1QJY1 1D2SA 2H6CA 1ZNPA 1RB8G 3FE5A 3FLTA 4HVQA 3JD71 3CO2A 4YVSC 3NV4A 1JYIA 4QMAA 3SNMA 4K8FA 2UY9A 2BEOA 1V9U3 3DN7A 5B2GB 3VV1A 5ABJB 3JCIA 5JZGC 4YW4A 5LEJA 1ASJ2 3TN92 4W6XA 5C8WA 2D3RA 1JYCA 3M70A 4CRQA 1J58A 2DURA 1ZZCA 4LO4B 1D4M1 3OGJA 1H4GA 5FDBA 2W68A 4QT6A 3TNPB 2RE9A 1GKBA 4LBJA 2ZGLA 3L2HA 1DZTA 2EXJA 1DQ6A 4PIXA 4GKXA 2RS51 4XE9A 4G3YC 3DGTA 4Y4YA 1AVBA 2EF6A 2F6BA 1I6XA 4XBLA 3ROUA 1AR82 2ZMKA 3S6PA 4AXOA 1OQDA 3MEPA 2IXCA 4AEDA 5BNNA 4OI0A 1IS3A 1VP6A 2VY0A 4EN6B 1SLIA 3O14A 4N53A 3RQ0A 2UU8A 3UV9A 2A70A 2D3PA 2W39A 4CDUB 2XB6C 1ULEA 1T6GC 1SDWA 3V65A 1ZX5A 1F2NA 2CWMA 5JZGB 1DGWX 3GZTB 1VAKA 2RMU1 4XHBA 1PGL2 4Q4V1 4AVAA 3LSDA 1HLCA 1RUC1 1YJKA 4Q1PA 1QJU1 4XJAA 3GNEA 4AVSA 2PAEA 3VBUC 2OYZA 1OSGA 1PO23 1YFWA 5EZWA 1B35B 5DUXA 1BVP1 1SFYA 2BYVE 1HV1A 4ZU4A 1VBC1 1LCLA 3AZYA 4Z07A 2BQPA 1WBFA 4RR3B 4LHNA 1O4YA 1FYUA 2WFF3 4IERA 2D6NA 4R9AA 2WZR2 3FC0A 4PLOA 4RS5C 3VBHC 2GAUA 2ZMNA 3SCHA 1AR61 2UWAA 3WG1A 4GQ7A 3TOJA 1AXYA 1RINA 3VZOA 3VZKA 4AQTA 4INDA 1PZ7A 2ZHLA 4HVRA 2DVDA 4FTSA 2HEWF 1MS0A 4XW3A 4D7SA 1YJLA 5JMCA 4O9EA 2EIGA 1GNHA 2IC1A 3MLJA 5LK5A 5E88A 2CGOA 2BBVA 5CFCC 4EN9B 1Z78A 1NQJA 4FPHA 4PBPA 1XU2A 1RMU3 5CADA 3ZFGA 3VBUB 1U12A 1A3KA 1IS4A 4RFT0 5DDJ1 2ZGMA 1S0CA 1K5MC 2R041 3VDDC 2LTNA 4AGVA 1KD7A 3SCFA 2D98A 4NVPA 1F31A 5D8AC 1NE6A 4RS5B 4AI1A 2ZGKA 4AK3A 4M3CE 1I3HA 2VOVA 2YROA 2ZGOA 1RJ8A 3IBMA 1RUD3 3IT8A 4XHXA 3WUDA 4F7ZA 4DOUA 1YI9A 4K9SA 2B39A 5F6LB 3VGIA 5CG8A 1J3QA 2OW4A 4FPEA 2N7GA 2PHLA 1AR91 3AMQA 2R6QA 3D5OA 2HWC3 5E89A 1CAWA 2GSYA 4JGZC 1YFXA 3AMPA 4W6WA 1D0HA 1S1AA 5K8SA 5SV5A 3BPZA 4D94A 2PLV1 1M4WA 1X36A 2PQQA 2Q4SA 1SMVA 2UYAA 4MGYE 3N7JA 3NAPC 5CFCB 4JC1A 1MZ5A 2AYHA 1GFF2 4QQOA 2Z79A 1S0GA 2GMPA 3MPPG 1BXHA 5C4WA 1UAIA 5IK4A 5EYYA 1AYN2 3M7AA 1EYBA 3KT1A 4GB31 1FMD2 1VBB3 1X82A 2YPJA 4BA6A 4W6YA 3U10A 3AB0A 1ZRCA 2R0HA 3R6SA 2QDRA 1G86A 4CP2A 3LOBA 2HWF2 4YW2A 3IPVB 5E16A 2VNOA 1C1LA 5D8AB 1FPN1 4E9KA 4Q0VA 5T3NA 1ZBA3 3L9JT 1RGSA 1RUH3 2ZX2A 3FMGA 4YGCA 3ES4A 3OJBA 1DGLA 1X33A 3ENRA 2B9UA 4MGKE 3K48A 4GMP0 1MQTA 4X8NA 4ZKTB 2NP0A 1SLBA 3WCSA 3KGLA 5AC91 1LB2A 1N3PA 1G7YA 2ILMA 1IZ3A 2VUJA 3JUUA 3UL2A 1WLTA 1MVQA 2E6VA 4JCKA 1TME1 2GMEA 1O3SA 1EY2A 1MEC1 4XJUA 1OKQA 1XYPA 1NXD1 2DWRA 2JD4A 2ET1A 2R062 4FAGA 4EROA 1C5HA 4QPGA 1REDA 1POV3 5DG2A 3ZDSA 1MS8A 4JDOA 3IN9A 2R071 5AVPA 1RUJ3 2WS92 4PIZA 1RUF1 2PHFA 3HN1A 2BWAA 4J1XA 2PYTA 2XLFA 2ZS6B 2YY1A 4AVTA 2Q5TA 1R1A3 3W59A 1S0JA 1OPOA 4AFMA 5FLHA 4AG4A 5EXOA 1FT9A 3NWKA 2FHRA 5JPMB 1SBEA 3JD72 3KCYA 3ZXAC 1UMZA 4B4QA 3ZYPA 3R4SA 2EXIA 4IEOA 2BFUL 1RUI2 5J37A 2D6MA 4X6QB 3WD5A 4P5HA 4PLMA 4RHV2 2W08A 4AWDA 5JAXA 2A3YA 4TSVA 4XEZA 2ZAHA 4RA0A 3P3NA 5C9AA 4AEDB 5BNNB 1ZZ8A 2D43A 2OVUA 3E5QA 1QU0A 3SH3A 4N53B 2XKPA 4DS0A 2MEV1 4V1PA 1U5ZA 1PVC3 4L92A 2RS52 3MW3A 5JVVA 1WD3A 2Y0OA 2BTVC 4B7KA 1QF3A 3E6DA 4LE4A 3GHNA 3TB0A