1C8NA

Tobacco necrosis virus
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
189
structure length
189
Chain Sequence
b'NSTVVSNSELILNLTPIALAYTVQSLPLIATQPAWLGTIADNYSKWRWVSLRIIYSPKCPTTTSGTVAMCLSYDRNDVAPGSRVQLSQTYKAINFPPYAGYDGAAILNTDVTPTSAIYVDVDVTRFDKAWYSTIGTAAFAALTAFDQNQFCPCTVHIGSDGGPAVAVPPGDIFFKYVIELIEPINPTMN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COAT PROTEIN
publication title Crystal structure of tobacco necrosis virus at 2.25 A resolution.
pubmed doi rcsb
molecule tags Virus
total genus 41
structure length 189
sequence length 189
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2000-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00729 Viral_coat Viral coat protein (S domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1c8nA00
1EAH2 4GMP0 1QJX3 1ZBE2 5ACA3 3JD72 4RS5A 1FMD1 1SMVA 1FPN2 4Q4W3 1RUE1 3VBFC 3DPRC 2PLV1 1R082 5C8CA 1ND3A 3ZFFB 4Q4V3 1RMU1 2MEV1 1RUH1 1TME1 2HWC1 1VBB1 3J8F3 5DDJ2 1RUG1 2RS13 3VDDC 1IHMA 1K5MA 1PO21 1VBE2 1ND2A 1Z7S3 4FTBA 2XPJA 3IDEA 2FZ2A 1RVF2 1HX6A 4GB31 2WFF3 1RHI1 1PO13 1FOD3 1AR61 1EAH3 1QJU2 1HXS1 3ZFFA 1VBD3 1BEV3 1NCRC 4QPIC 3CJIC 1RUE2 4PDWC 1AR71 4JGZC 1NCRB 2PLV2 1MQTB 1C8M1 1RMU2 2XBO3 2MEV2 1NCQC 1RUH2 1TME2 2HWC2 2X5IB 1VBB2 1X33A 3VBOB 2BPA2 5BNNA 1AYM3 3S6PA 1RUG2 4CDXC 2RS51 4GH4B 4RHV1 4AEDC 5BNOA 3JBG1 1COV3 4GB32 5A33B 1AYN3 4AEDB 1MQTA 1RHI2 4CDUB 4GMP1 1VBE3 1AR62 1HXS2 3M8LA 2R061 1HRI1 1RUD1 1BBT3 1RVF3 2X5IA 4IV1B 4CDWA 2FZ1A 5FOJB 1VBA2 1AR72 4CEWB 4QPGB 1QJU3 3VBOA 2DF7A 1AR91 1C8M2 1R091 4GH4A 4BCUA 5C4WC 1X36A 5C9AA 3LOBA 4WM7B 5A33A 1R1A1 2RMU3 4CDUA 2WLPA 1PVC3 1AL23 2RS52 4RS5C 1ZBA3 2GH8A 1PIV1 4RHV2 3VBSA 4IV1A 5JZGB 3JBG2 1VBC3 4CEWA 4QPGA 4CEYB 5C8CC 2HWB1 1ND3C 3TN93 2R062 4FTEA 3ZXAC 1OOPA 1D4M3 2HWF3 4WM7A 1R092 1K5MC 4EJRA 1VBA3 5AC93 1CD3G 2RM21 3ZFGA 2R072 1AR82 1K5MB 1ND2C 1NA1A 5JZGA 2BFUS 1ND2B 2WS91 2RR13 1R1A2 1E57A 1VRH1 2VQ0A 4YVWB 4N53B 4CEYA 3ZFFC 4Q4Y3 3JB8A 1V9U3 1PIV2 1QJY3 2RS31 4Y4YA 2HWB2 1F2NA 3FBMA 1HRV3 1POV3 1VB4A 4IV3B 5K0UB 2ZTNA 5FMOL 1EV13 2WZR1 5BNNC 1RB8G 4Q4X3 1RUI3 1RUF1 4YVWA 4N53A 5BNNB 2RM22 4JGYA 5BNOC 5GKAC 4NWWA 1ZBE3 2WS92 1FMD2 3JD73 1MQTC 1VRH2 3JB4C 5BNOB 2R073 1AR83 3HAGA 4N43B 4IV3A 1NG0A 2X5IC 4CDWC 5K0UA 5CFDA 1FPN3 1RUC1 1ASJ1 1OHFA 4CDWB 3VBOC 1R083 1PIV3 5L7OB 1MEC1 4GH4C 2R041 1RUJ1 5BNPB 5C9AC 1QJX1 2WZR2 5ACA1 1PO22 3VBHB 3VBUB 5C9AB 1RUF2 5DDJ3 1DDLA 4CDUC 4LLFA 2QQPA 1VB2A 4N43A 3VBSC 4IV1C 4CDQA 1M06G 4Q4W1 1HQNA 5J96B 3VBSB 4WM8A 4CEWC 4QPGC 1WCDJ 1OPOA 4Q4V1 5L7OA 1BMV1 2ZAHA 2WS93 1FMD3 1VRH3 5BNPA 1OOPC 1RUE3 1ASJ2 2PLV3 3J8F1 3VBHA 2RS11 1OOPB 4WM7C 3VBUA 1MEC2 4QPIA 5ABJB 1RMU3 2MEV3 2R042 1RUH3 1RUJ2 1TME3 2HWC3 4NWVA 3ZFGC 1Z7S1 1QJX2 1VBB3 1NA1C 2IZWA 3ZFGB 5ACA2 5JZGC 1NCQA 2TBVA 2WFF1 1RUG3 4CEYC 1NA1B 1FOD1 1EAH1 3VBRA 3ZFEB 4RR3B 5D8AB 1VBD1 1BEV1 1TMF1 5CFCB 1GFF2 1PO23 2HWD1 4Q4W2 1HRI2 1AUYA 1RUD2 4GB33 4YVSB 5A32B 1RHI3 2BUKA 1AR63 2XBO1 5ABJA 1HXS3 5LK7B 1BMV2 1AR92 1AR73 1AYM1 2RS12 1QQP1 1B35A 4YVWC 1C8M3 4N53C 3ZFEA 1AL0G 4RR3A 5D8AA 1Z7S2 4JGYC 5CFCA 4FTSA 4RQPA 1VAKA 1COV1 1POV0 4JGYB 4YVSA 1AYN1 5A32A 1FOD2 1VBE1 2RS53 3NAPB 1VBD2 1BEV2 1TMF2 4IV3C 2GSYA 4RHV3 1BBT1 1RVF1 5K0UC 2HWD2 1QJZA 5CFDC 3JBG3 1QJU1 5CFDB 4GMP3 2XBO2 2R063 1HRI3 2HWE1 1F8VA 1RUD3 3VBFB 1H8TA 1PGW1 1PGL1 3DPRB 1AYM2 1CJDA 1QQP2 1AR93 2RMU1 1R093 1PVC1 1AL21 1ZBA1 3NAPA 4N43C 4CDQC 1COV2 1VBC1 4WM8C 1AYN2 4CDQB 4SBVA 2RS32 1R1A3 3VDDB 3TN91 4WM8B 5L7OC 1BBT2 2ZZQA 4Z92B 5BNPC 3VBFA 3DPRA 1D4M1 2HWB3 3VBHC 1TMF3 2HWF1 3VBUC 2HWD3 1VBA1 5AC91 2WWSA 2HWE2 5J98B 4QPIB 3CJIB 4PDWB 4Y5Z0 1PGW2 4JGZB 1PGL2 1NOVA 2RR11 2RMU2 2BBVA 3VDDA 1PVC2 1AL22 4Q4Y1 1C8NA 1ZBA2 1NCQB 3VBRC 1V9U1 2RM23 1QJY1 1QQP3 3VBRB 1NY71 1VBC2 2BFUL 3TN92 4CDXB 1RUC2 1HRV1 5ABJC 1POV1 1NCRA 2RS33 3CJIA 4PDWA 5FMOS 1EV11 4JGZA 1D4M2 4Q4X1 1RUI1 2HWF2 1B35C 2Y26A 5AC92 4RFT0 3ZFEC 1B35B 4RR3C 5D8AC 1PO11 5CFCC 4RQPC 2WZR3 1ZBE1 2RR12 4YVSC 2HWE3 3JD71 4RQPB 1RUF3 2R071 1AR81 4CDXA 4Q4Y2 5C4WB 1V9U2 1QJY2 1A6CA 4Q4V2 1NY72 4AEDA 1FPN1 4FSJA 1R081 1HRV2 4RS5B 3J8F2 1W39A 1H8TC 1RUC3 1EV12 1ASJ3 4Q4X2 5C8CB 1RUI2 1ND3B 5DDJ1 1H8TB 1MEC3 2WFF2 5C4WA 3NAPC 2R043 1RUJ3 1PO12
chains in the Genus database with same CATH superfamily
2GC1A 1MS9A 5FZ8A 3HN3A 1JU4A 4IE5A 4RFRB 5G05L 2CL2A 2VZQA 3PDQA 3ST7A 2F6BA 3ZDVA 2VOXA 4AQTA 1YLLA 1V0AA 3CHXA 3FL7A 1YIFA 5CKMA 1TVGA 5DAPA 4XMAA 2YHJA 3WUCA 2BBAA 5DPNA 3HIFA 2CGNA 1A8MA 3WY6A 2PLV1 4XBQA 5IK4A 1H9PA 3AJYA 1LHNA 4L0PA 4UI9L 1ND3A 4ES8A 1NE6A 1IZ3A 4XAEA 3ZFFB 4Q4V3 1G9AA 5LA2A 1W2TA 3WF1A 4BK5A 3M3EA 3KCXA 3POGA 2RE9A 3BOPA 2A6XA 4QXBA 3RYKA 4LKSA 3S7EA 2OZJA 3PTYA 3P6BA 4D94A 1IPJA 4LT5A 3J8F3 2NMNA 1RUG1 1H1IA 5DDJ2 2ZEYA 3HT1A 1JYXA 4HETA 5L9RA 2QTWB 1XYNA 2WINB 1Q56A 1IOAA 1SBDA 1CAVB 1PO21 1ND2A 3AXEA 3KLSA 4AFDA 4B3NA 4FTBA 1GOGA 2GP5A 5FO8B 3IDEA 3IIIA 5HPOA 3U10A 2HEYF 3AYCA 3N4MA 1HX6A 2BGCA 2WFF3 3C7FA 1GLHA 1K5JA 1GUIA 1RHI1 2YY1A 4LE3A 4DUWA 1AR61 1EAH3 2WNVB 1HXS1 4NIAA 3ZFFA 2JIJA 1QH6A 4NROA 2GP3A 1Q8PA 1W3XA 1YCIA 5C33A 4ARYA 4EN9B 4DEVA 4Y26A 3AFKA 4HMZA 5F39A 5DUXA 1ULGA 5F3EA 4YZ2A 1STMA 1A78A 1ZZBA 2DVGA 5ANQA 1BZWA 3LA7A 4OHWA 2R49A 3ES1A 1GICA 3NV1A 3LKJA 1OH4A 3KB5A 5I0SA 2XBO3 2AREA 3POBA 4BQ4A 4QX0A 4QX7A 1TME2 1WWYA 2HWC2 4BOWA 3M1HA 3N9MA 4EQVA 1JW6A 1VBB2 2G19A 3BU7A 3VBOB 1NLRA 3C8XA 3T08A 1KS4A 2QZ2A 4UW6A 3THPA 5JI7A 2HH9A 3H8UA 4W65A 1ONAA 2BYVE 1YJKA 3N9NA 3RMYA 4PHZA 5FY1A 2PN5A 3NKGA 4Y1ZA 3ZYIB 1JYCA 2W92A 1PZ8A 4G9SB 3JBG1 4GB32 3F2ZA 1O3RA 3PJYA 3DCQA 1YI7A 4GMP1 2DU0A 4DXRA 3PNAA 3UNPA 4YGCA 2GNBA 1HRI1 4K20A 1BBT3 1RVF3 4QX3A 2OVUA 5HV4A 5FIXA 1AR72 2VZUA 4KU8A 3VD3A 5C71A 3H8XA 1PK6C 5FV3A 4CEWB 3VBOA 5FYTA 3KT1A 2BWAA 3ETQA 1AR91 4E2GA 1SLLA 1OA3A 1R091 1H2LA 2AEYA 3VD5A 5A1FA 4Q1RA 1ZZ6A 1N3PA 5FYZA 4JV4A 2ADEA 3C7OA 5C9AA 2FDHA 3ZXGA 1J59A 3U37A 4WM7B 2OQ6A 1M4WA 5FJHA 2WLPA 4OHYA 2RS52 2GAUA 1H6XA 1D2SA 3KT7A 5I91A 2QNKA 2QQLA 3EMRA 1H2KA 5KC6A 1JI6A 3HPNA 4YW6A 4UAPA 4RL7A 1VIWB 4Q1PA 3WNLA 4FQ4A 4M3CF 3G7DA 4CUBA 3HNYM 1HN0A 5JZGB 1X82A 3SITA 1CX1A 4ATFA 2OW4A 4CEWA 1LNSA 2HWB1 2D40A 3TN93 1UXZA 3V0BB 3DGTA 4K8FA 2EXJA 3BOWA 5H9SA 1QDOA 4HVQA 3P5BA 4YYOA 3ZSMA 2P2KA 1CZVA 4QXHA 2JWPA 3FHIB 2VW1A 3PTRB 4W8JA 1LAJA 4LBKA 4WM7A 3D6EA 5EFUA 3NVCA 4OYUA 4D7SA 4ZY9A 1VBA3 2J22A 4LO5B 4A41A 2RM21 5L9VA 1LEDA 1K5MB 4LULA 1G9DA 3K2OA 2VQAA 5IFTA 4OUMA 5A3MA 2EXHA 2V5DA 4M4PA 5JZGA 2BFUS 1L3JA 2WS91 1R1A2 2A3WA 1VRH1 2E51A 3IMMA 2PMWB 4KL1A 2GALA 2V72A 1WZXA 2N7GA 5LW9A 1S4CA 3N7JA 4Q27A 2QJVA 4HK9A 3AZVA 3R4UA 2XLGA 5JDBA 5HCHA 2WN3A 2YB7A 1UKGA 1I3HA 4BLJA 1DLLA 3ECQA 3FBMA 4MZUA 1JMUB 3AFGA 1W0NA 1POV3 2ATFA 4META 1F15A 4IV3B 4XJUA 5F2SA 3T09A 1HQLA 3SCFA 2FCUA 3AL6A 3I2OA 1NLSA 3SH3A 1H0BA 1OA4A 2VOWA 1EV13 3VHPA 5JAXA 3UGHA 1UMHA 2VZTA 4FCAA 2UWAA 1QKQA 2D6MA 4XF0A 5BNNB 4I3PA 4CTEA 5I8YA 3AB0A 5IUQA 5GJ6A 4A7KA 2P5BA 2CSGA 2K2SA 5GKAC 5HXMA 1IKPA 4NIHA 3V65A 4NPLA 1JN2P 1VE0A 3K77A 1FMD2 1JYNA 3B02A 1MQTC 3JD73 3LF7A 1AR83 2MNGA 3WHUA 3S5QA 3T2QA 3FFQA 1BHGA 2QQKA 4IV3A 1DYPA 1GWKA 2E7AA 3OUJA 1FPN3 4MSVA 4X8NA 2VOTA 4N90A 3UKNA 4CDWB 1AXKA 4U2AA 1R083 1C57A 3IDBB 2Q8OA 4DQAA 2Q8DA 3E5XA 5L7OB 4CU7A 4B29A 4E2SA 4R4XA 2EALA 2R0HA 1CX4A 1RUJ1 3DXUA 3V0AB 3K4DA 3J7NA 1MS3A 4NIDA 1YI9A 2ZGSA 3ORJA 1DDLA 3LDKA 4CDUC 1U0AA 1WCUA 4HVOA 2DVAA 4BK4A 1Q5OA 4FPHA 5EPAA 1ZREA 3OJBA 3TOJA 1NKGA 2QQNA 2P17A 3FX3A 3NJZA 5SV5A 1AXYA 3VBSC 5IVVA 2VH9A 1IS3A 4GZ9A 5LRRA 3D0SA 4Q4W1 4Z82A 4CDQA 2JG9B 3QH6A 3POJA 1OQDA 1WMXA 1NUKA 3OPWA 4R4ZA 4YZ4A 1RTVA 2ARAA 2AEZA 2A6WA 3POYA 2VZVA 4K8RB 3VKOA 2WDBA 2QVSB 3OPZA 3WEZA 5F7UA 5L7OA 3AYDA 4R8HA 4GQ7A 4YW2A 3M70A 4WBBA 3GALA 1S2EA 4WZCA 3CLPA 3BTZA 2HEVF 3V0AA 5FPLA 2PLV3 2WO2A 3MLKA 4O7XA 4EN8B 1ZRDA 1QXJA 2RHPA 3K4AA 1NLQA 4L9BA 5CVRA 3C2UA 5FZBA 4BM8A 5I0TA 4NWVA 1BQPA 2LTNA 4HSLA 1L7RA 3H42B 1FYUA 1NA1C 1W6PB 3ZFGB 4WVWA 3SEEA 3PMEA 1NCQA 3M4FA 5JXJA 1SACA 1RUG3 3VHNA 2G4IA 4CEYC 3W20A 2ZMLA 1WLTA 3CKHA 5HXVA 2WZ8A 1P8JA 4LBQB 1AF9A 2PA7A 5CFCB 1PO23 3PVBB 3USUA 2ZX1A 4LR4A 2JE7A 3VHOA 1XXNA 2ZA9A 3PHMA 5D21A 1RUD2 4YVSB 4KH9A 1LTEA 2JJ6A 2ES3A 1RHI3 1WBLA 5JOWA 2A75A 3WG2A 4CP1A 1AR63 1O4YA 2WC2A 1HXS3 3PUIA 4YGBA 1IPKA 3NJVA 4NIIA 1BMV2 3QCWA 4GD4A 4N9HA 2CNAA 2PXJA 4OHVA 3S57A 1X8MA 2Y6FA 4PJYA 2R1DA 1YQ8A 1W6PA 2OXBA 2XUEA 4KGQA 1AYM1 1ZZ8A 4LXLA 1ZYBA 1B35A 2SLIA 3OBZA 4FPLA 1O5LA 1U12A 2D3SA 4YVWC 5JI9A 3AYEA 2A5ZA 3K48A 3FUQA 5IAXA 4LBQA 5CFCA 3POWA 2W39A 5FZ1A 3NSTA 5A7SA 5KXEA 3I3MA 2BNNA 5HI0A 3FC0A 2R30A 4XUOA 1VAKA 2UURA 1POV0 2IXLA 4JGYB 2H6BA 4YVSA 3K3OA 1KXGA 5E89A 4A2UA 3AMQA 4WV8A 1VPHA 2WT1A 4CCDA 3LOIA 4IE7A 5FQ0B 1LU1A 1XNAA 3NAPB 1MR5A 1TMF2 1FI2A 3WW2A 5KHIA 1CONA 3UKTA 2B5HA 5K0UC 2HWD2 4GKYA 5CFDC 2B39A 3OB8A 4AI0A 3JBG3 4GAZA 5A7WB 3WG1A 5FZIA 3FMGA 3GBGA 2ZGPA 2VJXA 1HB1A 2UY9A 2X09A 4GMP3 2VZOA 4OVEA 2XBO2 3KMHA 3VKLA 4ASLA 3ZIWA 1HRI3 2Y6HA 4IXLA 1F8VA 4EZ4A 2QKDA 4K9SA 4QAWA 2B7YA 2Q8CA 3FE5A 3AP7A 5LEJA 1CJDA 1UY3A 1REFA 1AR93 2RMU1 2DCJA 1GZCA 4DS0A 3WP6A 1R093 5FXWA 1KITA 2WLQA 2X05A 5FQ0A 1ZBA1 2XLFA 3NAPA 1VP6A 4P9YA 4DB5A 4P9WA 2ENRA 1UY2A 1XNKA 4W4ZA 3RVHA 1LOAA 1HDKA 4WM8C 3RDIA 5A7WA 4KWUA 3AKPA 3MZHA 4MUVA 5FZOB 3BTYA 5GZEA 2EVXA 2O14A 2XGXA 1KGYA 4NUBA 4P5YA 4QPYA 4UWDA 4QB2A 1BBT2 2JECA 1OT5A 2ZZQA 3AZYA 3MLLA 4MHRA 2D6NA 5T5LA 5IK5A 1UWWA 3MW2A 3M2MA 3LFIA 4UFKA 3CEWA 4MX3A 4AE2A 4LBOA 4KWLA 4HKOA 4GWIA 2HWB3 2GC0A 3AVRA 2ARCA 4BJ0A 1Y4WA 3CL1A 3B7MA 5AC91 1OFNA 3ON7A 2YGLA 3O0WA 5DUWA 5KXDA 1Y7BA 5T50A 3AL5A 4LO4B 5G04L 1PGL2 4NHXA 4NRMA 1V6NA 1CAXB 1QHDA 1F4AA 1WCKA 1YC61 3DN7A 4LBMA 3T1MA 3O1SA 4DRVA 1G7YA 1V70A 2J1UA 3GJBA 1O6UA 2R6QA 2ERFA 4Q4Y1 3RG0A 2LUWA 1ZA7A 1H1MA 1V9U1 2D6LX 2RM23 1QJY1 1LOFC 2VW2A 2X10A 3I3BA 1NY71 5M0TA 2ET7A 4YWAA 4OI0A 3BU0A 2BFUL 1J3PA 3KQRA 5FY9A 4GULA 3TN92 2OPWA 2IXKA 1JHJA 4ASMB 4AOCA 4LKEA 5FYIA 4BQWA 5J37A 4BXSV 5C6CA 5FBZA 1PVXA 2QQVA 2VZ1A 1GNHA 2BVBA 1DCSA 2NPIA 4YM3A 1CAXA 2WT0A 1LCLA 5K9YA 1UKRA 5FUPA 3H8OA 3CDZB 4P9JA 3ZN5A 3UJQA 2Z2SB 2VVEA 5JR7B 3ZFEC 2NN8A 2QBXA 1H1AA 2Y0OA 2AUYA 4RQPC 2PHRA 1UZVA 1ZBE1 2QQMA 4RGKA 3OEAA 2HWE3 4QQOA 1QOTA 3ALQA 4XQWA 4CCCA 3MGUA 1A34A 3AP5A 1QU0A 2RV9A 2B42B 4P02B 2FCTA 1OXCA 2JDMA 1LULA 2V5YA 4CCMA 5FPUA 2BP6A 5FP3A 5K4LA 4B1LA 2GU9A 4FSJA 1WMDA 1W06A 3DECA 3N7MA 2DYCA 2NQYA 4UW5A 2R7EB 1RL3A 4UT5A 3GJAA 2ZJCA 3TYJA 3BYWA 4I0WB 3RFRA 4CPBA 1EV12 3SH5A 1OLME 1PK6A 1SLTA 3AJZA 3OUHA 5DQ0A 5DAXA 1H8TB 2VNGA 4LTAA 4QKFA 3WDTA 2ZHLA 5CAZA 5KHKA 4Y20B 4IUGA 2JD4A 1WCSA 1AX1A 2XLAA 5FLJA 1RUJ3 4BIFA 4NRPA 3INAA 4XETA 4GMP0 1HW5A 3WNNA 5LK5A 1KJLA 3T0BA 1GP4A 3A4UA 2BOJA 1SDDB 2A71A 3MI8A 3JD72 5DMYA 4DXTA 3O1OA 3KD4A 3ZYJB 1JOJA 3GHNA 3GM8A 1K3IA 4NAOA 4XF9A 4KNCA 1HJFA 2BQPA 3ZR5A 4DPNA 4AFCA 1FPN2 4Q4W3 3VBFC 4CRQA 1LHVA 1N1SA 3DYOA 3TNQA 5FZ9A 1R082 3LPFA 3O5SA 4MGKE 4IGPA 3ZN4A 4XACA 3AYAA 2CWMA 4J1WA 4XUQA 1RMU1 3MIBA 4Y20A 4KG8A 4MG2A 3I2KA 1GZTA 5HV0A 4Y3OA 1RIRA 1JODA 2V73A 4ZXKA 1FNZA 1VAVA 2VXJA 5CBLA 4JZRA 2VL4A 1KFXL 4LHNA 4LBLA 2R16A 5DXDA 4B4PA 1K42A 2JB4A 2IVIB 4KQ7A 4MOAA 3U4XA 4YW4A 4JDNA 4YW7A 5A3UA 1VBE2 1UD1A 3HEIA 4UW4A 2VAUA 2WSUA 4ATEA 1PM7A 2QZ3A 4Q0QA 3C7EA 4XJAA 5JXGA 3ASIA 4HN0A 5FZ0A 1Y9QA 3I3EA 3E97A 2PHTA 2IXIA 1GV9A 2WN2A 1S55A 4INDA 2VTXA 1QJU2 1Y9GA 1EP0A 2ID4A 1VLNA 1QIQA 1NCRC 3CBNA 3MIDA 2IVJA 1TG7A 1XC6A 2Q0AA 4GXLA 5JMCA 4PDWC 1D0HA 3O0VA 1PMJX 3PMSA 4G3YC 4JGZC 2PLV2 3ZYGA 3VZKA 2B45X 4DXSA 3ZN6B 1MQTB 1UAIA 5EJZB 4D6RA 1C8M1 4DUXA 2ET1A 1NCQC 3B9CA 5EYXA 4AL9A 5LBEA 1W05A 1QH7A 2ZABA 2FDJA 1GNZA 2XVLA 1AYM3 4AYUA 4PBOA 1N47A 1RUG2 4Z8BA 3MFAA 3PURA 4QHOA 5A6QA 5LCWL 2P6CA 4OZOA 4HBNA 3OGVA 4FXKB 4NJ4A 3HQUA 4AEDC 4HT1T 4CXYA 3I3DA 1NZCA 4XOGA 1ULPA 4CP9A 4ONUA 3MEPA 2Z5WA 1MQTA 1RHI2 3WR0A 3ZN6A 4CDUB 5J1XA 2HEWF 2UYBA 1AR62 1GQHA 1XU1A 1HXS2 1I5ZA 2BZDA 3E1F1 2WABA 3MHZA 1OC1A 1H2MA 2R061 2WNUC 4BQ1A 1W90A 1BVP1 4OI1A 4CUCA 5FOJB 2JE8A 5H9QA 5FYCA 1W8HA 4JTNA 5I8TA 5CKQA 5T5OA 1I9RA 2DF7A 2WO3A 3AMNA 3WP5A 1QXRA 2ZGMA 1REDA 4HZFA 5FY4A 5LBCA 2BWCA 4HLTA 2VM9A 3VUOA 3BN6A 3ITQA 3ZXKA 1C1LA 1X36A 3ACFA 4IGOA 4AEMA 2GN7A 5IW0A 4ZONA 4Y33A 1SFYA 4LO8A 1EUUA 5FXXA 5EV7A 3RI9A 1C3HA 2AH2A 4XFCA 5GLUA 2RMU3 1VALA 1DYOA 1W2AX 4CDUA 5KC5A 4QKBA 3WDYA 1GZWB 3AM2A 4RS5C 1DZTA 1SBEA 1ZBA3 4YLZA 1GOFA 5D2AA 4XCAA 3VBSA 4LNVA 3NV4A 4YG3A 2BEOA 4IERA 4JQRA 4XFIA 1XYPA 5LB6A 4PQ9A 3JBG2 1DU3D 1OH3A 5IK7A 4CEYB 5C8CC 3WW1A 1LRHA 3A22A 5A3PA 1S0CA 4QM9A 5F32A 1UZWA 2ORXA 2IWGB 4XJWA 5FYMA 1XYOA 3VD7A 2VMGA 4MGYE 4XHXA 4JC1A 4HN1A 4UFHA 2ZGNA 4D6SA 4YZ5A 2ZGUA 2DCKA 3NRUA 4AVAA 3B00A 2J1TA 3X29B 1DQ6A 1R092 4IETA 3ZVXA 5AC93 1CD3G 1GZWA 2XB6C 4B7KA 3BGAA 3PU8A 5EHDA 3ZMNA 1ODNA 3ZXEA 2R072 1ULFA 4OMDA 1O7FA 4DO0A 1NA1A 2QFEA 2FMDA 1ND2B 5DABA 3TEXA 2Q5TA 4CEYA 4YVWB 1GWLA 2OA2A 2UWCA 1RINA 5GLTA 4XF3A 1UZ0A 4Q4Y3 1OQEA 4YNIA 3GBWA 1CIWA 4UFIA 1V9U3 3M3CA 3EO6A 4GWJA 4XZPA 1QJY3 4QX1A 2BU9A 2W46A 3ATGA 4Y4YA 4A42A 2ZMNA 2ZEZA 1LECA 4EWDA 1LEMA 2HWB2 5F8PA 3VDAA 1JUIA 2Z79A 1W3VA 4Q26A 2CDPA 4PIXA 2PYTA 1VB4A 4P08A 1VMFA 4QKDA 5K0UB 4B4RA 4Q8KA 3O0XA 2VG9A 2GZWA 1JH5A 3NJXA 3G6JB 5FFOC 1I1EA 1QNWA 2OIIA 1RUF1 4YVWA 4AI8A 1WA4A 3D5OA 1LOCA 4V2VA 4IEQA 3UGGA 5BYNA 2C9AA 3BCWA 1QGLA 2RM22 5GZDA 3TWIA 4E4DX 3JQWA 2F4PA 2JKBA 1MZ5A 5BNOC 4NWWA 4YGDA 1OURA 1ZBE3 2WS92 3N9QA 1NZIA 2VCAA 1VRH2 3VKNA 2YYOA 1RYYA 4PQQA 2VCBA 4AHYA 5HCAA 5JVVA 2Q1ZB 1N1TA 3VDCA 2XJRA 1CGPA 2GMMA 4CXXA 2VMEA 4YW5A 3ZR6A 5K0UA 3BI3A 2WL1A 2J1AA 2WSVA 3IBMA 1PMIA 1CN1A 1RUC1 2Q1FA 3FLTA 4LO7A 1ASJ1 1OHFA 3D3AA 4OLLA 5FZFA 2DCYA 3E5QA 1RXGA 1PIV3 3TEZA 2IXHA 1F5JA 1MEC1 2RG4A 4XVHA 1ENRA 4BLIA 2BOIA 5FUIA 2R041 3ZXJA 4FPOB 1VJ2A 5CIRA 1US3A 2VZPA 1QJX1 2WJSA 3Q9OA 5FK8A 3A0NA 1W8TA 4QPWA 2B46X 2ORZA 4AAPA 1I5PA 2J1VA 4FO9A 3WQBA 5C9AB 1J3RA 1S0GA 5E6HA 2DFBA 4XURA 5KHHA 4LLFA 1YQCA 2PQSA 2BERA 4BYYA 3GXUA 1VB2A 1UOJA 1IS5A 4LPLA 4IV1C 2YDEA 4XHBA 3RPQA 1M06G 5J96B 3MW3A 4BU2A 4WM8A 3KSCA 5T54A 3AP9A 5FPZA 2DUPA 2ZACA 3MV11 2JXAA 4LK7A 1H4HA 3IDCB 1ZZ9A 1EYBA 5DG2A 4CUGA 1O4TA 2GMPA 2XJUA 1DQ4A 1OOPC 3VGIA 5FOBB 2RDNA 2RS11 5C3QA 2F4LA 1PM4A 3H1MA 1RMU3 5EP9A 3HVDA 4UW3A 5KHGA 1RUJ2 2VECA 4XUNA 2DDUA 2DUOA 2Q4SA 3DKWA 4JKMA 4QX2A 4QU1A 1Y3TA 4FP3A 4HK8A 3W59A 3MO4A 5CKNA 5BXXA 1W8UA 5IVJA 1F9KA 1O8SA 2AGSA 1DIWA 1FOD1 4TZDA 3RZJA 1ST8A 3GDBA 5F5IA 3ZFEB 1J3QA 4ZZ8A 1BEV1 1Q8QA 5EJ1B 4AQSA 1JUHA 4ASKA 1LOFA 3CQOA 3KVBA 3E6BA 3M7AA 1W6MB 4FPCA 4KI5M 4Q4W2 5FBJA 1T6BX 3U14A 1JYTA 3LEKA 3VZLA 1NAEA 5L73A 2JDNA 3AXDA 5JSRA 1QWRA 1X9PA 3PVOA 3PIGA 5FZDA 2GN3A 4CCEA 4JKKA 5AVAA 3SEPA 3KHBA 2VPVA 4YM1A 5FZLA 3LA3A 5T55A 1YEWA 1JZ6A 3LE0A 1V00A 1XU2A 1A8DA 4AEJA 4AI3A 4FAHA 3FUOA 2ZEWA 3J26N 4QGNA 1UPIA 1MACA 2VOVA 3T4HB 4BHPA 3ZYRA 1C8M3 4N53C 3DYPA 2DVBA 2Y6JA 3KGZA 3LD8A 4XC9A 1ZRCA 5GZCA 5FMBA 4GJYA 3ZFEA 4EWAA 4E8DA 1V6MA 3Q8CA 5FY8A 1Q8SA 1RJ7A 4HXCA 4RQPA 3HQXA 3P1IA 1W6MA 2D6PA 3BODA 2CTVA 1COV1 4BQYA 2WQZC 4IEYA 2A3YA 5F3IA 1BYHA 1S2BA 4AXOA 1GP5A 4FPGA 1FV3A 4XDQA 2GC3A 3OPTA 5FPBA 2G1MA 2GSYA 5JXIA 4ZPIA 2QDNA 1KS5A 5F3GA 3PVEA 2ARBA 4PLMA 3ZYBA 4BISA 3WLUA 5EWSA 4MGTA 2YGMA 1WLDA 1K12A 1WUVA 3CZUA 2R063 2HWE1 2ZX3A 3AZXA 2ZAAA 4I30A 1XB9A 3JU9A 4OMCA 3H1WA 1IPSA 3SNMA 3U4SA 1Y9MA 1YYNA 4HPKB 1APNA 1ALYA 1PGW1 2CYFA 2IUWA 2ZEXA 2ZZJA 1AYM2 4X6QB 3TB0A 4XYXA 4GJZA 3T0AA 2GNMA 1PVC1 1AL21 4QWNA 1OLMA 1RGSA 2ZHMA 4ZZ5A 3GHMA 2WKKA 2MPFA 4RYDA 4N43C 2O0OA 3OD0A 3KZ4C 4XUPA 2IFRA 3S5AA 1H8VA 1JZ2A 4HONA 1SHWB 5C7GA 5E1RA 1VBC1 2ZCWA 4D7YA 2LALA 4NR1A 4CDQB 2BTVC 2RS32 3GBFA 3R6SA 4B4QA 2W87A 3SCHA 2NLRA 4N8MA 2D98A 2IC1A 3VZJA 4TYSA 1WW7A 3PVNA 3WNMA 3KWVA 3AX4A 4Z92B 5FO7B 3VBFA 2D5HA 3H3LA 4HPKA 5LBFA 2KR2A 2QQWA 4J6GA 5C5TA 2W0XA 5HCBA 2Y8KA 3VBHC 5LA0A 2JDHA 4BQ3A 4BIOA 1OF3A 1SCRA 5EZWA 4CCKA 2VMDA 3GYDA 1DQ2A 5J98B 3FFZA 3SMHA 4YFZA 2YU1A 5FREA 3I49A 4JCKA 3TBDA 4LITA 4PDWB 4ITCA 4JGZB 1NOVA 5LRSA 2A6YA 4MV2A 5I0UA 1ZZ7A 1ULEA 1W8ZA 2P37A 2RMU2 3I2DA 4MO3M 1NYWA 2BBVA 1NE4A 3OOXA 3PJQA 2O8QA 3RSJA 1ZBA2 3VBRC 1NCQB 4E4SA 3TEWA 4H55A 1QQP3 4AR2A 3RZHA 4BWOA 1WBFA 4CU6A 3OBTA 1CIYA 3USUB 1QXPA 2ZMKA 1OSGA 3QOPA 4AQ6A 4BE3A 1VR3A 3DEMA 1A3KA 1GKBA 3ZYHA 4K21A 2ETEA 2EIBA 1NCRA 4JKLA 4HFSA 4QT6A 4PDWA 5FPVA 2EIGA 4JGZA 2PTMA 4JRAA 4YARA 4Q4X1 3I54A 3KV9A 3VZNA 2OKXA 3L2YA 2JEMA 4BQ2A 1C4RA 4FPEA 4XDPA 4JVAA 4M3CE 2Y26A 5FRAA 4AFMA 5AC92 1J84A 1S2KA 2WNUB 1FNYA 1B35B 4NHKA 4RR3C 2VY0A 4Q5OA 4RD7A 4ZS3A 3WCRA 1FX5A 1SPPB 3MV01 3WDWA 4ZS2A 1GP6A 2YMZA 3L2HA 4N9IA 2AC1A 5BY5A 4LBNA 1RUF3 4FBFA 1YNAA 4QGMA 3RNSA 4OCTA 4Q4Y2 4IW3A 3MIHA 1V9U2 1V6IA 3ES4A 3SC7X 5CA6A 1QJY2 1W6OA 4A3XA 2K46A 4LUKA 4Q4V2 5IFPA 1NY72 4AEDA 1UIJA 3H7YA 5A3LA 1JU3A 4IE0A 1KQRA 1LGBA 2XHNA 2GC2A 2C5DA 4IEOA 4RS5B 2HBTA 3ENRA 2I74A 4CVUA 1DGRA 3J8F2 3A0KA 2H6CA 2FCVA 2WNUA 4FQZA 3WDVA 3WG3A 1SFPA 1QOSA 4K1ZA 1SPPA 1RUC3 1YO8A 1ASJ3 1MPXA 1UYYA 1DZRA 2YUEA 3J4UH 3VV1A 5C8CB 3FHQA 4YPJA 2CGPA 3THDA 3AKRA 2WA3A 1MEC3 4EE2A 1JHNA 1JZ7A 5C70A 2WFF2 2XL9A 2R043 4AQ2A 3HN1A 4EN0A 2XJPA 3ZIXA 3POIA 1EAH2 1S0IA 1QJX3 3K46A 3VHRA 1EUTA 1E5IA 4Z1VA 4AI2A 4O61A 1ZBE2 1JZ3A 4R9AA 2UWBA 1V6JA 1MS1A 3PUAA 5F5QA 2BRTA 2OQ7A 4Y24A 3I2GA 2VW0A 3NV2A 2Z4FA 4RS5A 5F3CA 1XNDA 4PI2A 3K75B 2FD8A 1WCQA 1FMD1 1SMVA 4CA9A 3ZDSA 4COWA 1RUE1 3RWNA 4B1MA 4NAMA 1XPWA 1F5FA 1FATA 2YFUA 5C8CA 4AW7A 3O12A 1IQDC 4EV0A 4GWNA 2I2SA 2MEV1 1RUH1 5E88A 3BVCA 3NQHA 3UJOA 1J83A 3CMGA 3ZO0B 3GZUC 3VL8A 2RDQA 4OZXA 4FOYA 2OZ6A 4IL7A 3BPSA 2EIDA 1KJRA 3I7DA 5J09A 2RS13 5FPAA 4BH9A 4COVA 4L2NA 5A1AA 1UU5A 5TSWA 5T52A 1IHMA 2QQOA 3KT4A 3LCPA 1JYVA 1ZZCA 4D69A 5AFEA 3NMBA 2R32A 2BGOA 3J7HA 5BNQA 4IQPA 2XPJA 2TEPA 4C1XA 4OI2A 1AX0A 4XF4A 5H9PA 5FKCA 1RVF2 2P34A 2WNVC 2YFZA 3OTFA 3WCSA 4OUEA 5A3NA 1PO13 2PELA 1FOD3 3O14A 3U78A 1GZ9A 5HBAA 2JDZA 1SFNA 2C1FA 2DTYA 4FFHA 3WDUA 1BEV3 5C3RA 5EXOA 1HKDA 1J58A 5J3UA 4MADA 3SKJE 1HIXA 5F2WA 4COYA 1S0JA 4FP2A 4XFFA 4HVRA 3AMMA 5APAA 4WZFA 1G9BA 1LOBA 3OBRA 1RMU2 1W99A 4YM0A 1W2UA 3E6CC 2RVAA 5DG1A 3RJ2X 1ZRRA 2JD9A 3U07A 1R1ZA 4LOTA 3K51A 1Y43B 4X6RB 4D0QA 4BQ5A 2B9VA 2E7QA 2E9QA 1IS6A 1SCSA 4XUTA 2B8MA 1CAUA 3LEMA 3S6PA 2K0GA 2QQJA 2Q8EA 5JWPA 2VZ3A 1UYZA 3DUIA 3NO8A 1AVBA 2YZ4A 3WV6A 4RA0A 1DQ5A 4RHV1 3WQ7A 5LASA 3WNKA 3RZKA 2FDFA 3ACLA 4I09A 4PLNA 3NW4A 5BNOA 1UZZA 2P3IA 3B01A 3MBWA 1COV3 1J1LA 5A33B 4F8AA 3RZLA 3A23A 3CNAA 4HOOA 1EPWA 3ZPYA 1UNBA 2PHXA 3EJKA 3M8LA 3NWKA 3VLBB 3ZX7A 4AI1A 2E53A 3EXUA 5FYYA 1RUD1 4IV1B 2FZ1A 1VBA2 2XMLA 3LWCA 1XE8A 2VXRA 1ENSA 4IESA 1UL9A 4CZSA 4COZA 3IKWA 1C8M2 5I0RA 3BIEA 1PK6B 1O8PA 4A3ZA 5C4WC 1TEIA 1YXWA 2G9GA 5FZ6A 3IIAA 1L7QA 4GALA 4UXAA 4PF1A 2YU2A 4QD2A 3LOBA 3LDRA 1C5IA 5A33A 3TRSB 1I6XA 1JXNA 2XJQA 2A1XA 1PVC3 1AL23 2VTFA 3GCXA 2JIGA 5HCFA 2GH8A 1PIV1 1PZ7A 4G4FA 4IV1A 4XFAA 2VZSA 2WAOA 1KDMA 3NNLA 4OI4A 1GR3A 1VBC3 1N3OA 4B7EA 5ISLA 4IEPA 1SLAA 4QKNA 2W1UA 5IWFA 3BTXA 2P3YA 2V4AA 3C7HA 2R062 2E32A 3N3HA 4FPJA 4XPVA 1ULCA 3ROUA 3RMXA 3ZXAC 2QQUA 2YPJA 4EN7B 1OOPA 1QNYA 5DAQA 1X7NA 1BK0A 1DGRN 2NM1A 3LFMA 2VMFA 4PIYA 1VAMA 1IG3A 1XNCA 4ET7A 2E63A 4YRDA 1K5MC 2RJ2A 4EJRA 2NP0A 1DYKA 3WNPA 1WD4A 2P1BA 1AR82 3N36A 1RXFA 2XOMA 1FV2A 3KV6A 1SBFA 1W8NA 3CF6E 3SQOA 5B4NA 3MICA 1RUNA 2W1WA 1FT9A 4V2WA 3F95A 4L92A 1SDWA 2PAMA 2VQ0A 3MIFA 4FPYA 2RDSA 4N53B 5LA1A 2VCCA 3LEGA 1UPSA 2W1SA 4LJHA 2X8KA 3O1MA 3JB8A 3NNGA 2XVKA 4P14A 4MGSA 1OKOA 2Y34A 5C3OA 2VMCA 1YUDA 2YC2A 2ZGOA 2DCZA 2ZOEB 1U5ZA 4LLOA 1RUOA 4XW3A 4AWDA 1REEA 4XE9A 4TWTA 3IB3A 5FP4A 3OEBA 2DTWA 1PNGA 2IFWA 4JX0A 3Q8EA 4ZU7A 3R0RA 4YFWA 5GM0A 2ZKNA 2ZTNA 3AKQA 5K8SA 3C3VA 3OGSA 1ZX5A 1D0GA 4UFMA 2WZR1 3T4VA 4KMQA 3OSDA 5BNNC 4Q4X3 1QJFA 2VVDA 3DV8A 3GZAA 1RB8G 5FYBA 4UF0B 4UFLA 4P9XA 3SKVA 3KF5A 4N53A 3VB9A 5IYYA 3H1YA 4ARXA 4W6XA 3AZWA 2W68A 1QY4A 5FYVA 4AAXA 4Q0VA 5KXBA 3WF4A 3CIHA 2VCMA 2YBPA 3U0ZA 3IT8A 4S2HA 4PCRA 5FP9A 3LB9A 3PUQA 4LBQD 1PMHX 3ILRA 4CP9B 2SBAA 3LIGA 5CNAA 3PUSA 4N43B 3FWEA 4PLOA 3WHTA 1NG0A 3E5UA 2X5IC 2QDRA 4CDWC 4LMFA 3Q8FA 1AZDA 2BJSA 1HJGA 1OLQA 2DURA 3H50A 2XVGA 4O9EA 2JG8C 3POEA 1RJ8A 5CFDA 2W95A 2E33A 5FXZA 3QH7A 3FLRA 3VL9A 1BLZA 1CAWB 3NNMA 4MGZE 4N7UA 3OUIA 4UF0A 1L7LA 2EAAA 5FP7A 1UMIA 4GH4C 2JX9A 3PUHA 4QXCA 1UCXA 2CWSA 2XL7A 5GLWA 3U75A 5LY2A 5JCTA 4KWJA 4S2DA 1GYKA 4QDSA 5ACA1 1PO22 3VBHB 4MVTA 4Q0UA 3ZOIA 1RUF2 1UY0A 3KVAA 3PIJA 5I93A 5I8SA 2J1SA 5FYSA 3H7JA 4CU9A 3LA2A 2Z69A 2JG9C 4N43A 1N3QA 5E8AA 2D3RA 2WWUA 3VBSB 2NZ9A 2WT2A 2PHLA 4QPGC 4LA2A 5F6LB 1CAWA 1WKYA 3HR9A 1GANA 2IXJA 4CCNA 3ZPOA 1ULDA 3I8TA 4IGQA 4HKLA 4TXWA 5JIAA 4AVBA 4AVTA 2ZAHA 5A6ZA 1FMD3 5FZCA 3ME2A 5LWBA 4FPKA 3VD4A 1RUE3 1ASJ2 3ACIA 4AFBA 5FZ3A 1BXHA 4LOSA 3VBHA 5IATA 2E26A 1MEC2 2F17A 3DYMA 4QPIA 3D0JA 5FK7A 4DEQA 3ZKUA 4S2FA 1B09A 4A7ZA 1UF2C 5J36A 2MEV3 2R042 1RUH3 4R9DA 5FZGA 2A6VA 4MH0E 3ZFGC 4F7ZA 4OUSA 1Z7S1 1WA6X 2VUCA 1QJX2 3IMNA 3LPGA 3NV3A 5J7MA 1AJKA 1JOBA 1UX7A 2IZWA 4HG6B 4IEUA 4MLOA 2KD7A 2FDIA 4Y1VA 4CXWA 2DBIA 2TBVA 3S0MA 3LSDA 5C8WA 1NA1B 2CGOA 5DZGA 1JZ8A 3VBRA 4TSVA 3JXSA 4RR3B 4IEWA 1VBD1 5I0DA 4P9GA 1K45A 2B4KA 1X50A 1WLWA 5CG8A 2JENA 1HRI2 4AHXA 2IXCA 4ZU4A 4URAA 4D8MA 5LZ6A 2FDGA 4XTMA 5A32B 2L9LA 4DRRA 4WVMA 3N35A 4RGGA 3WX5A 5DZEA 4YGEA 5A7PA 3CO2A 1W0OA 1XBFA 3CZJA 4R9CA 2VO5A 4FFGA 4C90A 1AR92 3ELNA 4QHBA 5EIYB 4IE4A 1RC6A 4L8QA 3LQCA 5A80A 4DNYA 2WYSA 3NNJA 3HQRA 2RS12 1QQP1 1IQAA 2K9ZA 1Z0HA 4H2AA 3GF6A 4YZ1A 4RR3A 1ZA4A 4Y22B 4JGYC 1SLCA 4LA3A 3SCGA 3J7MA 4FTSA 2WZPP 4M3CA 4QQPA 4JTOA 3W5MA 1MZEA 2O8OA 1AYN1 5A32A 1FOD2 1VBE1 2VNRA 4IEZA 3JQXA 2J7MA 5A6XA 1BEV2 1QMJA 1YFUA 1JYIA 4RHV3 2WAAA 4OQ9A 3SLIA 4E4ZA 5GZGA 5IVCA 5A7OA 1UY1A 4XEZA 4UOJA 1JYWA 2TNFA 3QD6A 4NPRA 1QJU1 2D97A 2ZS6B 3ETPA 1BKZA 2RDRA 4R52A 3EB7A 5CFDB 2G9FA 2FHRA 2W5FA 4URTA 1VRBA 3RZMA 2PHDA 3TNPB 1RUD3 2MHFA 5FR3A 4DXZA 4Y22A 2D93A 1SEFA 4XJ9A 5CEHA 2EF6A 1CPMA 2XJSA 1W2NA 4BDVB 2Y33A 2DFCA 3I97A 2VQTA 3WOGA 5L19A 4AGVA 1OI6A 2HYKA 1MS0A 2VVFA 3R05A 2WFPA 3H0OA 2WBKA 3UETA 3D82A 4CPBD 5LY1A 4QGLA 2BGPA 3V56A 2W47A 1LGCA 3WF3A 3W58A 1O5UA 2P4EA 4NN0A 4COUA 4EYUA 5LBBA 1AXZA 1COV2 4GIQA 1Q8VA 1LHUA 4SBVA 4DFSA 4A6SA 1YIPA 1G86A 2WR9A 2YXSA 5GZFA 4WM8B 1ZRFA 3RS6A 3UL2A 4A7YA 2KA3A 2PHUA 1OUSA 4FPFA 3WDXA 4XXPA 3KV4A 4K1YA 4OULA 5BNPC 1WW6A 3UYJA 1LHOA 3M3QA 3FN9A 2B9UA 1D4M1 1C5HA 1TMF3 2HWF1 3VBUC 2J1RA 2HKXA 3BPZA 3LZZA 4YW3A 1UZYA 2JDUA 3ZXDA 2HWD3 1JOPA 2VQUA 2A73B 1UIKA 2WWSA 1PZ9A 2HWE2 1XSRA 2GMEA 2HLEA 2QE3A 4MXWB 3RJRA 3DL3A 4NE9A 1G9CA 2OPKA 1GQGA 1PGW2 3ACHA 4TTGA 2EA7A 4JRLA 1TZOA 3N9OA 4SLIA 3CJXA 1BVVA 1H4GA 2RR11 1W6NB 3LSEA 4IDZA 4AVCA 2C4XA 2VZRA 1W9FA 1PVC2 1AL22 1CAVA 5C3SA 2EICA 4NIGA 1BJQA 1UO9A 1OQ1A 1YQ5A 5FZAA 5JOXA 4LIUA 2WQ4A 3IAPA 4K40A 5A7QA 1EPZA 3B5LB 2UY8A 1VBC2 2FDKA 1E5HA 3I59B 1HLCA 2WNVA 1S0BA 2ZX4A 4CUAA 3APBA 1X9TA 3AMPA 3UGFA 4CSWA 4DZGA 4RN5A 1HRV1 1LOEA 5ABJC 2ILMA 3HD8B 4KBBA 3ZXFA 1H30A 2OX0A 3JZVA 2X53S 4MXWA 4QXKA 3ZSEA 4BB3A 3O1VA 2ZGKA 2VUJA 2XQRA 4S2GA 2A70A 4QDQA 4LIVA 5FMOS 3VZOA 4D3WA 5LATA 1RUI1 5D1IA 2YROA 1W6NA 1W9TA 1ENQA 3P3PA 3T30A 1F35A 5D8AC 4QB1A 1PO11 4Y1YA 3SXWA 4A45A 2I45A 5JR2A 1UXXX 1W8FA 1VMJA 2WZR3 1SLIA 2FQPA 1C28A 3I59A 1US2A 3UT0A 4IEVA 4RQPB 4BA6A 2R071 3I4IA 4AHWA 4FT8A 4XFGA 5C4WB 2CU5A 3AK0A 3POFA 4ISRA 4EN6B 1A6CA 4QU2A 4UBHA 5FDBA 1FXZA 1O3TA 3WW3A 1E5SA 1UYXA 5FMDA 4I0BA 3WVJA 3BUCA 4LKDA 2OS2A 4I0AA 2JICA 1HV1A 4I3GA 4PBPA 4AEKA 1OMIA 2EAKA 1YFWA 3WINE 2C9KA 3K3NA 1W39A 1DF0A 2RJLA 5FYHA 2D43A 3QBQA 1H8TC 2ADDA 2DCTA 2Q30A 4Q4X2 4UYBA 2DU1A 3THTA 1KEXA 4NHYA 3W21A 4DUVA 3RI8A 5DDJ1 1FAYA 1CESA 1DLCA 5FYUA 1W9YA 3K4ZA 4ZXEA 3RGBA 2VNOA 4CCLA 5A70A 3RWKX 5C4WA 3T1LA 4QQLA 2Y6LA 3NJYA 3DF0A 1XJAA 1IGOA 2O1QA 4JQTA 4XZUG 1YRZA 2XG3A 3A21A 5ACA3 1O91A 4JDOA 2YV8A 3JUUA 1HN1A 4KG0A 4EWEA 4CCJA 3KCCA 4IE6A 3O1PA 1JBCA 1GSLA 1KDKA 2DVDA 2E31A 1UX6A 2VR4A 4L97A 5ERLA 5LA9A 3FJSA 2GH2A 1KD7A 3HNBM 3WF2A 5F5AA 3LEIA 3V0BA 4XTPA 1OD3A 1SQ4A 3DPRC 3SH4A 4M0HA 1UYPA 3USSA 1GBGA 2XWBB 3B3QE 1HV0A 4LKFA 2W3JA 3I2HA 3OCPA 1TME1 1GNYA 2HWC1 4Z2AA 4FOVA 1VMHA 4TN7A 2VBDA 1W8WA 1VBB1 2HJIA 1T6GC 1OVPA 1HB4A 2EXKA 4NRQA 5T3NA 5C3PA 1DQ0A 4BXFA 1S1AA 1NX9A 1F31A 3MFCA 4KWKA 3VDDC 3KHCA 3WUDA 3TEYA 1K5MA 4Q0PA 4GKXA 4AG4A 2WO1A 5FAXA 1YWKA 1S0DA 3KM5A 3UV9A 3HOBA 5F9TA 1KFUL 1OF4A 1Z7S3 4ZU5A 4YZ3A 1W9SA 4DY3A 2WQ8A 3WD5A 3LDBA 3GGLA 4LUMA 2OT7A 4AK3A 2FZ2A 2ZGRA 3OG2A 2ZGTA 1XQNA 4GB31 5DZFA 4XAAA 3WW4A 2FBEA 3I3QA 5IT6A 5A6YA 1UMZA 4MYEA 4BPZA 2EIEA 3OGRA 4KU7A 3ZKYA 1VBD3 5JPMB 2YPDA 1LODA 2NMOA 3PU3A 4QPIC 1N1YA 1W9WA 1RUE2 3CJIC 2W91A 1AR71 1NCRB 1ZM1A 1TNRA 4JAAA 3AC0A 1IKQA 1CZTA 3HWJA 4A4AA 4XFBA 1F4HA 4K6BA 3UESA 2VGDA 1TNFA 1XNTA 2MEV2 1RUH2 2X5IB 2R0FA 2BW8A 1D4VB 5FLIA 1XRUA 2P3JA 2JG8B 3ILNA 1GOHA 3MIEA 1X33A 3BKZA 3I2IA 1W0PA 2BPA2 1WW5A 4PIZA 4QM8A 2A3XA 5BNNA 5LEKA 5JSPA 1DGWA 4M01A 3J9SA 2H0BA 3AKSA 4CDXC 3EHKA 5CYYA 5A3TA 2AENA 2RS51 4GH4B 1YFXA 2A7AA 4I2OA 2WIIB 3OGGA 2RJKA 4M0NA 4XCBA 1O3SA 4K7JA 1OA2A 2CY6A 1DBNA 1W6OB 5GLZA 4Z07A 5FPXA 1W28A 4A44A 1AYN3 1XE7A 3WP4A 1S0EA 4AEDB 5FLHA 3KCYA 5JSOA 1VBE3 3IN9A 3MW4A 4XILA 2WNEA 2XDVA 1UU4A 4E9KA 2VMHA 2X5IA 4CDWA 1UW8A 3FZ3A 4M4RA 2JG8A 3HBKA 4QPGB 1QJU3 5GLVA 1WLCA 1LHWA 2CV6A 4CP2A 1OPMA 4Z2WA 1UQXA 3LGRA 5KBFA 5GALA 1PHMA 4HL0A 1XOYA 2HBUA 4GH4A 5FZKA 4BCUA 2TUNA 2HYXA 5C5UA 1V6LA 4XIKA 5F37A 4ZHNA 2UU8A 5FZMA 1JTZX 4GWMA 4AGGA 4I01A 2W1QA 4CP0A 2VMIA 4XBNA 1R1A1 3S30A 2YBKA 2ZHNA 5BPXA 3BALA 4LBJA 4XQDA 3RYPA 4LQRA 2JG9A 2P6HA 4RHV2 4P00B 3H3ZA 2LW8A 1ENXA 1NT0A 2OUJA 1OVSA 2ZKLA 2GDFA 3T2OA 2J42A 4H3WA 4QPGA 3B94A 1ND3C 4LORA 3QACA 5JIUA 3T2TA 1QEXA 3GZEA 2VBPA 4LK6A 3VDBA 2ZX2A 3S7IA 4XFHA 2R1BA 4FTEA 3NL1A 2XR4A 4J25A 2A6ZA 3MIGA 5JXHA 3CU7A 1D4M3 3GZTB 2W08A 4YG6A 5B4XA 1G9FA 5KWRA 2HWF3 3O1RA 1YFYA 2G9ZA 2PHWA 5FY5A 1CWPA 1LENA 1ZRIA 4F3JA 5JMOA 3HNMA 5FY0A 3ZFGA 4K3UA 1H2NA 1ND2C 4HSJA 2VOKA 3T2PA 4NMIA 3BB6A 1TQ5A 5FCCA 4J1XA 2VULA 4JHTA 2BNOA 1U5XA 2RR13 3O7OA 1E57A 4N7IA 5EYYA 3N7KA 1GWMA 3N9LA 3ZFFC 2VNVA 4I02A 1PIV2 4XABA 3MPBA 2XJTA 2RS31 3M3IA 3OY8B 1SG3A 3OD4A 4LEJA 3N9PA 1ACCA 1UN1A 2NYYA 1F2NA 5IVYA 4AF9A 2QUOA 1Q8OA 5FP8A 4LHLA 3EQEA 1HRV3 3KF3A 3WZ1A 1NXD1 1RITA 5FKBA 4XF1A 5FO9B 4FI9A 2KM2A 3KQ4B 1DP0A 2CDOA 2LM3A 5IAVA 5T5JA 1QJEA 3E6DA 5FMOL 1NXMA 1D2QA 2V09A 3V64A 1LR5A 1RUI3 2Y0IA 1EY2A 2XONA 4QQ2A 4DY5A 3IAQA 3AVSA 4Q2FA 3MPPG 1CAUB 2JDAA 3WF0A 2XQXA 2Y64A 4JGYA 4NOTA 5FWJA 3W5NA 2AR6A 5CADA 4U36A 5JUVA 3OY8A 2AZ5A 4Q29A 2C24A 2W94A 3ZMOA 1CVNA 3IZOA 5FUNA 4EZHA 3ACGA 2WZEA 3JB4C 5BNOB 4OHZA 2R073 3FHAA 3HAGA 2WNOA 4B8EA 5T5PA 3U11A 3T3YA 2C6SA 2QQIA 5EQUA 4BMBA 1CR7A 3VBOC 2JDYA 5DUVA 1MS4A 2ARXA 3WNXA 1ZVFA 4YM2A 2D6KA 4E2QA 1AHSA 5JOZA 3SISA 2W52A 4BZ4A 3MF6A 3LIHA 1POQA 5DUUA 4XQ4A 1GMMA 5AVPA 5F1RA 2J1EA 5BNPB 3SHRA 3OF1A 5C9AC 2ZXQA 2C0ZA 3RRDA 4Q8LA 1JZ4A 2WZR2 5JLVA 3VN4A 3P3NA 2XH6A 2VE1A 3RQ0A 3VBUB 4LE4A 5IVBA 3PLQA 5DDJ3 5FZ4A 2BDRA 4YW1A 3ZYPA 3O1TA 4NVPA 2QQPA 1UY4A 1W6QB 1OFSA 4L99A 4Q0SA 3IWZA 1HB3A 5KHJA 3AKTA 3ABZA 5FWEA 5A1LA 1LOGA 1HQNA 4QDRA 3UKVA 2AYHA 2ZHKA 5FZOA 3H8RA 1ZNPA 4P9LA 1WCDJ 5L9BA 4CEWC 1OPOA 5JOYA 5IVFA 1DGLA 2FMYA 2VBBA 3T0DA 3WQ1A 1U5IA 4Q4V1 1GU3A 4NO4A 5A3OA 1Q3EA 2JDKA 2XHKA 5CU1A 1BMV1 4C1WA 4C91A 1XSQA 1OKQA 2WS93 1VRH3 5BNPA 2LS6A 4AHZA 1BK1A 2WUHA 4E27A 4NPMA 4P9IA 4YSFA 3URFA 3AP6A 5FY7A 2DUQA 3OGJA 3DKQA 3J8F1 3POSA 1OOPB 4WM7C 3VBUA 2VUDA 4XJZA 5ABJB 4D6QA 4Y5TA 1W6QA 1TME3 2HWC3 4QMAA 5B2GB 2JDPA 2WO7A 2LRPA 4LHKA 4LHSA 1VBB3 4M00A 2BV4A 3B93A 5ACA2 1H6YA 3FLPA 5JZGC 2WFF1 3IDAA 1J1TA 1Z78A 1EAH1 2VUAA 5D8AB 2ZPXA 1TMF1 1GQPA 2VD7A 1GFF2 3A7QA 3EBRA 4UFJA 5FTTC 1MS5A 4ZKTB 4C0BA 1LGNA 2HWD1 2ZGQA 1AUYA 4FVVA 4UBGA 4GB33 3HBZA 1HB2A 3N7LA 5FZ7A 4DMIA 4AI9A 2D44A 2D5FA 1WW4A 2BUKA 1DZQA 3WXPA 3MYXA 4AZZA 2XBO1 3TAYA 5ABJA 5LK7B 4O65A 3O1UA 4MGIE 2P3KA 4E8CA 5F5CA 1SZBA 4A6OA 4ES9A 3ZSKA 2I07B 1IS4A 1CQ9A 2KXLA 2JKXA 3MDPA 1PX3A 3ZM8A 3B69A 1AR73 4CCOA 4DINB 3WNOA 4AVSA 2XJVA 3HMYA 2VU9A 1WD3A 3W9AA 2CHHA 2Q1MA 3ZLIA 5SV8A 2PFWA 1AL0G 3KGLA 4F83A 1JZ5A 5D8AA 3RYRA 1PGSA 1W04A 4R9BA 1Z7S2 5L36A 2C26A 1LJ7A 1LKNA 1OLRA 2JB8A 3LAGA 1TE1B 4MXVA 4KBZA 2YC0A 1DFQA 2YC4A 4BMEA 1DG6A 3R4DB 5F6KA 4XXAA 2D3PA 1R64A 2RS53 5EJ3A 1VBD2 4IV3C 2GNDA 3Q8BA 3Q8AA 1BBT1 1RVF1 5DAWA 2BNMA 1QJZA 4OFGA 3IM0A 3VD9A 4QX8A 5BUVA 1N1VA 4ISQA 1OD5A 2WWJA 3UK9A 4DOUA 1WMEA 2Y38A 2PAKA 4Y4RA 5FMCA 3ILFA 1OBNA 1Q43A 1O4ZA 4Y1XA 2E7TA 3R4SA 1AJOA 5IK8A 4HANA 2XKPA 5H9RA 1H8TA 1X8EA 5A7NA 1MS8A 3DPRB 1T2XA 5KR7A 5IJRA 1PGL1 1KRIA 4H7LA 3H3UA 1QQP2 3HJRA 4NHMA 2OUHA 1JS9A 4MHUA 2AACA 1C1FA 3VKMA 1DHKB 4XDOA 1LB2A 2DWRA 1MZFA 4FFIA 4EROA 3I2JA 4FOQA 4CDQC 4LO6B 1QF3A 2XKOA 1HQWA 3HT2A 3AZZA 1AYN2 3ZXLA 3WT3A 4PI0A 1R1A3 3VDDB 3TN91 2Y6KA 4OHXA 5L7OC 3AP4A 1G8WA 4BQXA 1UU6A 1BCXA 2WYFA 3GCWA 3L9JT 1WGPA 2UYAA 1ULOA 2X29A 2Y6GA 2H0VA 3DXTA 2PHFA 5IHRA 3BTAA 2JE9A 3DPRA 4QB6A 4ORFA 1H9WA 2XXZA 2YBSA 3PL0A 4QQHA 4CU8A 2PAEA 1QDCA 3GNEA 4XIOA 1V6OA 1W03A 4H7MA 1IG0A 4O9GA 1VBA1 1ODMA 4E4HA 5JPNB 2Y60A 5FXVA 4PT6A 4JDMA 4QPIB 4Y1UA 2DV9A 5J48A 2ZX0A 3CJIB 1G6NA 3KV5A 3AMHA 4Y5Z0 4H14A 4X8PA 1YQ6A 2XWJB 3MLJA 2QCSB 3RZGA 1MVQA 2WRAA 1W8OA 3MUY1 5BV6A 3C7GA 1UOBA 3VDDA 3BIWE 1UOFA 3OYWB 1C8NA 4IEXA 3QLQA 5E16A 2DBNA 2Z42A 2W2IA 3IPVB 1E5RA 3KS7A 4JHZA 4P5HA 3VBRB 5ANNA 5FZEA 1D7PM 4FFFA 4W6WA 4C8DA 4NHLA 3EYPA 3MUZ1 4AGRA 3NKTA 3FBYA 4V1PA 3WSOA 1RUC2 4CDXB 1O3QA 4W6YA 1CJPA 1SLBA 1POV1 4HKWA 4WVMB 1W2OA 4FOWA 1V6KA 4QHZA 1YHFA 2BVVA 3H9AA 2ZBJA 3THCA 1DQ1A 2RS33 3RZZA 1XNBA 3CJIA 3ZSJA 4AVVA 1EV11 3VZMA 5A3WA 1D4M2 1O59A 3NNFA 5K7PA 5DAVA 4WVVA 1U5YA 2HWF2 3M3OA 2W9XA 1B35C 1YQ2A 1YJLA 2VC9A 5IVEA 4XJ8A 1NQDA 1UOGA 1S0FA 3OYWA 4RFT0 5DN2A 4KGGA 1NQJA 4WVZA 2YG0A 2OYZA 5CFCC 4DIQA 4RSUA 3IPVA 2E6VA 2EXIA 1URXA 4W50A 3OBAA 3VKFC 1XE0A 1PX4A 2RR12 4YVSC 2WA4A 1LU2A 3JD71 4M3CB 4CE8A 1WMFA 4FXGB 4RGAA 1AR81 2GNTA 4CDXA 5AFBA 1QOOA 2D7FA 4TLFA 2LROA 4GA9A 1DGWX 3U1XA 5FZHA 5KXCA 3JCIA 3B9IA 1AX2A 4XBLA 2PQQA 3WG4A 3ZYFA 1FPN1 5CB7A 2XUMA 2D6OX 4FAGA 1CPNA 1LESA 1R081 3VBFB 4Y5SA 1CZSA 4QX5A 1HRV2 4YG0A 4CYDA 1MZ6A 1MVEA 2CAUA 4L11A 2DVFA 3I2FA 2CAVA 5FJKA 3D8CA 5CG9A 2VTXJ 3MF9A 4D7TA 4PF5A 1RUI2 3ZSLA 1ND3B 3WP3A 2ZGLA 4MGQA 4TLGA 5CZKA 4AFAA 3J7LA 1PNFA 4C0HA 2V4VA 5CISA 3NAPC 3WQ0A 1PO12 4OQ8A 4XMIA 3D4KA 1OUXA
chains in the Genus database with same CATH topology
2GC1A 1MS9A 2CL2A 3ST7A 2F6BA 2VOXA 4AQTA 1YLLA 1YIFA 4XMAA 2YHJA 3WUCA 3HIFA 2CGNA 1A8MA 3WY6A 2PLV1 4XBQA 5IK4A 1H9PA 3AJYA 1LHNA 1ND3A 4ES8A 1NE6A 1IZ3A 3ZFFB 1G9AA 4Q4V3 3M3EA 3KCXA 2RE9A 3BOPA 2A6XA 4D94A 3RYKA 3S7EA 2OZJA 3PTYA 1IPJA 4LT5A 3J8F3 2NMNA 1RUG1 1H1IA 5DDJ2 3HT1A 4HETA 1XYNA 2WINB 1Q56A 1IOAA 1SBDA 1CAVB 1PO21 1ND2A 3AXEA 3KLSA 4AFDA 4B3NA 4FTBA 5FO8B 3IDEA 3U10A 2HEYF 3AYCA 3N4MA 1HX6A 2BGCA 2WFF3 1GLHA 1RHI1 2YY1A 4LE3A 1AR61 1EAH3 2WNVB 1HXS1 3ZFFA 1QH6A 1Q8PA 1YCIA 5C33A 4EN9B 4Y26A 3AFKA 4HMZA 5DUXA 1ULGA 4YZ2A 1A78A 1ZZBA 2DVGA 1BZWA 3LA7A 4OHWA 2R49A 3ES1A 1GICA 3NV1A 3LKJA 3KB5A 5I0SA 2XBO3 2AREA 1TME2 2HWC2 4BOWA 3M1HA 1JW6A 1VBB2 3BU7A 3VBOB 1NLRA 1KS4A 2QZ2A 4UW6A 3THPA 5JI7A 3H8UA 4W65A 1ONAA 2BYVE 1YJKA 3RMYA 2PN5A 3NKGA 4Y1ZA 3ZYIB 1JYCA 1PZ8A 4G9SB 3JBG1 4GB32 1O3RA 3PJYA 1YI7A 4GMP1 2DU0A 3PNAA 4YGCA 2GNBA 1HRI1 4K20A 1BBT3 1RVF3 2OVUA 1AR72 4KU8A 1PK6C 4CEWB 3VBOA 3KT1A 2BWAA 3ETQA 1AR91 4E2GA 1SLLA 1OA3A 1R091 1H2LA 4Q1RA 1ZZ6A 1N3PA 4JV4A 5C9AA 3ZXGA 1J59A 4WM7B 1M4WA 2WLPA 4OHYA 2RS52 2GAUA 5I91A 1D2SA 3KT7A 2QNKA 1H2KA 5KC6A 4RL7A 1VIWB 4Q1PA 4FQ4A 4M3CF 3G7DA 5JZGB 1X82A 3SITA 4ATFA 2OW4A 4CEWA 2HWB1 2D40A 3TN93 3V0BB 3DGTA 4K8FA 2EXJA 3BOWA 5H9SA 1QDOA 4HVQA 4YYOA 3ZSMA 2P2KA 3FHIB 2VW1A 4LBKA 4WM7A 3D6EA 5EFUA 3NVCA 4D7SA 1VBA3 4LO5B 2RM21 1G9DA 1LEDA 1K5MB 4LULA 2VQAA 4OUMA 5A3MA 2EXHA 5JZGA 2BFUS 1L3JA 2WS91 1R1A2 2A3WA 1VRH1 2E51A 4KL1A 2GALA 2N7GA 3N7JA 4Q27A 2QJVA 4HK9A 3AZVA 3R4UA 2XLGA 5JDBA 1UKGA 1I3HA 4BLJA 1DLLA 3ECQA 3FBMA 4MZUA 3AFGA 2ATFA 1POV3 4META 4IV3B 4XJUA 1HQLA 3SCFA 1NLSA 3SH3A 1H0BA 2VOWA 1OA4A 1EV13 3VHPA 5JAXA 4FCAA 2UWAA 1QKQA 2D6MA 4XF0A 5BNNB 4I3PA 4CTEA 5I8YA 3AB0A 5IUQA 5GJ6A 4A7KA 2K2SA 5GKAC 1IKPA 3V65A 1JN2P 1FMD2 3B02A 1MQTC 3JD73 1AR83 2MNGA 3WHUA 3FFQA 4IV3A 1DYPA 2E7AA 1FPN3 4MSVA 4X8NA 3UKNA 4N90A 4CDWB 1AXKA 4U2AA 1R083 1C57A 3IDBB 2Q8OA 4DQAA 3E5XA 5L7OB 4B29A 4E2SA 4R4XA 2EALA 2R0HA 1CX4A 1RUJ1 3V0AB 1MS3A 1YI9A 2ZGSA 1DDLA 4CDUC 1U0AA 4HVOA 2DVAA 1Q5OA 4FPHA 1ZREA 3OJBA 3TOJA 3FX3A 3NJZA 2P17A 3VBSC 5SV5A 1AXYA 2VH9A 1IS3A 5LRRA 4CDQA 3D0SA 4Q4W1 4Z82A 2JG9B 3QH6A 1OQDA 4R4ZA 4YZ4A 1RTVA 2A6WA 3POYA 3VKOA 3OPZA 2QVSB 5L7OA 3AYDA 4R8HA 4GQ7A 4YW2A 3M70A 4WBBA 3GALA 4WZCA 3CLPA 2HEVF 3V0AA 2PLV3 3MLKA 4EN8B 1ZRDA 1QXJA 2RHPA 4L9BA 5CVRA 3C2UA 4BM8A 5I0TA 4NWVA 1BQPA 2LTNA 4HSLA 1FYUA 1NA1C 1W6PB 3ZFGB 4WVWA 3PMEA 1NCQA 3M4FA 1SACA 1RUG3 3VHNA 2G4IA 4CEYC 2ZMLA 1WLTA 5HXVA 4LBQB 1AF9A 2PA7A 5CFCB 1PO23 3PVBB 3USUA 2ZX1A 4LR4A 2JE7A 3VHOA 1XXNA 2ZA9A 3PHMA 1RUD2 4YVSB 4KH9A 1LTEA 2JJ6A 2ES3A 1RHI3 1WBLA 5JOWA 2A75A 3WG2A 4CP1A 1AR63 1O4YA 2WC2A 1HXS3 4YGBA 1IPKA 1BMV2 3QCWA 4N9HA 2CNAA 4OHVA 1X8MA 4PJYA 2R1DA 1W6PA 4KGQA 1AYM1 1ZZ8A 1ZYBA 2SLIA 1B35A 4FPLA 4YVWC 1O5LA 1U12A 2D3SA 5JI9A 3AYEA 2A5ZA 3K48A 3FUQA 4LBQA 5CFCA 3POWA 2W39A 3NSTA 5KXEA 2BNNA 5HI0A 3FC0A 2R30A 1VAKA 2UURA 1POV0 2IXLA 4JGYB 2H6BA 4YVSA 1KXGA 5E89A 4A2UA 3AMQA 4WV8A 2WT1A 3LOIA 5FQ0B 1LU1A 3NAPB 1MR5A 1TMF2 1FI2A 3WW2A 5KHIA 1CONA 3UKTA 2B5HA 5K0UC 2HWD2 4GKYA 5CFDC 2B39A 4AI0A 3JBG3 3WG1A 3FMGA 3GBGA 2ZGPA 2UY9A 4GMP3 4OVEA 2XBO2 3KMHA 3VKLA 4ASLA 3ZIWA 1HRI3 4IXLA 1F8VA 2QKDA 4K9SA 2B7YA 3FE5A 3AP7A 5LEJA 1CJDA 1REFA 1AR93 2RMU1 2DCJA 1GZCA 4DS0A 3WP6A 1R093 1KITA 2WLQA 5FQ0A 1ZBA1 2XLFA 3NAPA 1VP6A 4P9YA 4DB5A 4P9WA 2ENRA 1XNKA 1LOAA 1HDKA 4WM8C 3RDIA 3AKPA 3MZHA 4MUVA 5GZEA 2EVXA 4QPYA 2XGXA 1BBT2 2JECA 3AZYA 2ZZQA 3MLLA 2D6NA 5T5LA 5IK5A 3MW2A 3M2MA 4AE2A 3CEWA 4MX3A 4LBOA 4KWLA 4HKOA 2HWB3 2GC0A 3CL1A 3B7MA 5AC91 1OFNA 2YGLA 3O0WA 5DUWA 5KXDA 1Y7BA 5T50A 4LO4B 1PGL2 1V6NA 1CAXB 1QHDA 1WCKA 3DN7A 4LBMA 3T1MA 4DRVA 1G7YA 1V70A 2R6QA 4Q4Y1 2ERFA 3RG0A 2LUWA 1H1MA 1V9U1 2D6LX 2RM23 1QJY1 1LOFC 2VW2A 1NY71 2ET7A 4OI0A 2BFUL 1J3PA 3KQRA 4GULA 3TN92 2IXKA 4ASMB 5J37A 5C6CA 5FBZA 1PVXA 1GNHA 2BVBA 2NPIA 4YM3A 1CAXA 2WT0A 1LCLA 5K9YA 1UKRA 3ZN5A 4P9JA 3UJQA 2Z2SB 2VVEA 5JR7B 3ZFEC 2NN8A 1H1AA 2Y0OA 2AUYA 4RQPC 2PHRA 1ZBE1 2HWE3 4QQOA 1QOTA 3ALQA 4XQWA 3MGUA 3AP5A 1QU0A 2B42B 1LULA 2V5YA 2GU9A 4FSJA 1WMDA 3N7MA 2DYCA 2NQYA 4UW5A 1RL3A 2ZJCA 3TYJA 4I0WB 1EV12 3SH5A 1PK6A 1SLTA 3AJZA 5CAZA 1H8TB 2VNGA 4LTAA 3WDTA 5KHKA 2ZHLA 4Y20B 2JD4A 1WCSA 1AX1A 2XLAA 5FLJA 1RUJ3 4BIFA 3INAA 4XETA 4GMP0 1HW5A 5LK5A 1KJLA 3A4UA 2A71A 3MI8A 3JD72 3KD4A 3ZYJB 1JOJA 3GHNA 4XF9A 4KNCA 2BQPA 4DPNA 4AFCA 1FPN2 4Q4W3 3VBFC 4CRQA 1LHVA 1N1SA 3TNQA 1R082 3O5SA 4MGKE 3ZN4A 3AYAA 2CWMA 4J1WA 1RMU1 3MIBA 4Y20A 4KG8A 1RIRA 2V73A 4ZXKA 1FNZA 1VAVA 5CBLA 1KFXL 4LHNA 4LBLA 2R16A 5DXDA 4B4PA 4KQ7A 3U4XA 4YW4A 4JDNA 1VBE2 1UD1A 4UW4A 2WSUA 4ATEA 1PM7A 2QZ3A 4Q0QA 4XJAA 3ASIA 4HN0A 1Y9QA 3E97A 2PHTA 2IXIA 1GV9A 4INDA 1S55A 1QJU2 1EP0A 1VLNA 1NCRC 3MIDA 2Q0AA 4GXLA 5JMCA 4PDWC 1D0HA 3O0VA 3PMSA 4G3YC 4JGZC 2PLV2 3ZYGA 3VZKA 2B45X 3ZN6B 1MQTB 1UAIA 1C8M1 2ET1A 1NCQC 3B9CA 5EYXA 1QH7A 2ZABA 1GNZA 2XVLA 1AYM3 4AYUA 4PBOA 1N47A 1RUG2 4Z8BA 3MFAA 4HBNA 4FXKB 4AEDC 4HT1T 1NZCA 4XOGA 4ONUA 3MEPA 2Z5WA 1MQTA 1RHI2 3WR0A 3ZN6A 4CDUB 2HEWF 2UYBA 1AR62 1GQHA 1XU1A 1HXS2 1I5ZA 1H2MA 2R061 2WNUC 4BQ1A 1BVP1 4OI1A 5FOJB 5H9QA 4JTNA 5I8TA 5T5OA 1I9RA 2DF7A 3AMNA 3WP5A 1QXRA 2ZGMA 1REDA 4HZFA 2BWCA 4HLTA 3VUOA 3ZXKA 1C1LA 1X36A 4AEMA 2GN7A 1SFYA 4LO8A 5EV7A 3RI9A 1C3HA 2AH2A 4XFCA 5GLUA 2RMU3 1VALA 4CDUA 5KC5A 3WDYA 1GZWB 3AM2A 4RS5C 1DZTA 1SBEA 1ZBA3 4YLZA 3VBSA 4LNVA 3NV4A 4YG3A 2BEOA 4IERA 4JQRA 4XFIA 1XYPA 4PQ9A 3JBG2 1DU3D 5IK7A 4CEYB 5C8CC 3WW1A 1LRHA 1S0CA 4QM9A 2IWGB 4XJWA 1XYOA 2VMGA 4MGYE 4XHXA 4JC1A 4HN1A 2ZGNA 4YZ5A 2ZGUA 2DCKA 4AVAA 3B00A 3X29B 1DQ6A 1R092 4IETA 3ZVXA 5AC93 1CD3G 1GZWA 2XB6C 4B7KA 3ZMNA 3ZXEA 2R072 1ULFA 1O7FA 1NA1A 2QFEA 2FMDA 1ND2B 2Q5TA 4CEYA 4YVWB 2OA2A 2UWCA 1RINA 5GLTA 4XF3A 4Q4Y3 1OQEA 4YNIA 3GBWA 1CIWA 1V9U3 3M3CA 3EO6A 4XZPA 1QJY3 3ATGA 4Y4YA 2ZMNA 1LECA 4EWDA 1LEMA 2HWB2 1JUIA 2Z79A 4Q26A 4PIXA 2PYTA 1VB4A 5K0UB 4B4RA 4Q8KA 3O0XA 2VG9A 2GZWA 1JH5A 3G6JB 5FFOC 1I1EA 1QNWA 2OIIA 1RUF1 4YVWA 4AI8A 1WA4A 3D5OA 1LOCA 4IEQA 5BYNA 2C9AA 3BCWA 1QGLA 2RM22 5GZDA 3TWIA 4E4DX 3JQWA 2F4PA 2JKBA 1MZ5A 5BNOC 4NWWA 4YGDA 1ZBE3 2WS92 1VRH2 3VKNA 2YYOA 4AHYA 5HCAA 5JVVA 2Q1ZB 1N1TA 1CGPA 2XJRA 2GMMA 4YW5A 5K0UA 2WL1A 2WSVA 3IBMA 1PMIA 1CN1A 1RUC1 3FLTA 4LO7A 5CFDA 1ASJ1 1OHFA 4OLLA 2DCYA 3E5QA 1PIV3 2IXHA 1F5JA 1MEC1 1ENRA 4BLIA 2R041 3ZXJA 4FPOB 1VJ2A 5CIRA 1QJX1 2WJSA 3Q9OA 3A0NA 2B46X 4FO9A 5C9AB 1J3RA 1S0GA 2DFBA 5KHHA 4LLFA 4BYYA 1VB2A 1IS5A 4IV1C 2YDEA 4XHBA 3RPQA 1M06G 5J96B 3MW3A 4WM8A 3KSCA 5T54A 3AP9A 5FPZA 2DUPA 2ZACA 2JXAA 1H4HA 3IDCB 1ZZ9A 1EYBA 5DG2A 1O4TA 2GMPA 2XJUA 1DQ4A 1OOPC 3VGIA 5FOBB 2RS11 3H1MA 1RMU3 4UW3A 5KHGA 1RUJ2 2VECA 2DUOA 2Q4SA 3DKWA 1Y3TA 4FP3A 4HK8A 3W59A 5BXXA 1F9KA 2AGSA 1DIWA 1FOD1 4TZDA 3ZFEB 1J3QA 1BEV1 1Q8QA 4AQSA 1JUHA 1LOFA 3E6BA 3M7AA 1W6MB 4FPCA 4Q4W2 3VZLA 5L73A 3AXDA 5JSRA 1QWRA 3PVOA 2GN3A 5AVAA 4YM1A 2VPVA 3LA3A 5T55A 1V00A 1XU2A 1A8DA 4AEJA 4AI3A 4FAHA 3FUOA 4QGNA 3J26N 1UPIA 2VOVA 1MACA 4BHPA 3ZYRA 1C8M3 4N53C 2DVBA 3KGZA 1ZRCA 5GZCA 3ZFEA 4EWAA 1V6MA 1Q8SA 1RJ7A 4RQPA 3HQXA 1W6MA 2D6PA 3BODA 2CTVA 1COV1 2WQZC 4IEYA 2A3YA 1BYHA 1S2BA 4AXOA 4FPGA 4XDQA 1FV3A 2GC3A 2GSYA 2QDNA 1KS5A 3PVEA 2ARBA 4PLMA 3WLUA 5EWSA 2YGMA 1WLDA 1WUVA 2R063 2HWE1 2ZX3A 3AZXA 2ZAAA 4I30A 3JU9A 3H1WA 3SNMA 3VBFB 1YYNA 4HPKB 1APNA 1ALYA 1PGW1 2CYFA 4X6QB 2ZZJA 3TB0A 1AYM2 4XYXA 2GNMA 1PVC1 1AL21 2ZHMA 1RGSA 3GHMA 2WKKA 2MPFA 4N43C 2O0OA 3OD0A 3KZ4C 2IFRA 1H8VA 5E1RA 1VBC1 2ZCWA 4D7YA 2LALA 4NR1A 4CDQB 2BTVC 2RS32 3GBFA 3R6SA 4B4QA 3SCHA 2NLRA 2D98A 2IC1A 3VZJA 4TYSA 1WW7A 3PVNA 3AX4A 4Z92B 5FO7B 3VBFA 2D5HA 4HPKA 4J6GA 2W0XA 5HCBA 3VBHC 4BIOA 1SCRA 5EZWA 3GYDA 1DQ2A 5J98B 3FFZA 3SMHA 4YFZA 5FREA 4JCKA 3TBDA 4PDWB 4ITCA 4JGZB 1NOVA 5LRSA 2A6YA 4MV2A 5I0UA 1ULEA 1ZZ7A 2P37A 2RMU2 3I2DA 2BBVA 1NYWA 1NE4A 3PJQA 2O8QA 3RSJA 1ZBA2 3VBRC 1NCQB 4E4SA 4H55A 1QQP3 4BWOA 1WBFA 3OBTA 3USUB 1QXPA 2ZMKA 1OSGA 3QOPA 4AQ6A 4BE3A 1VR3A 1A3KA 1GKBA 4K21A 2ETEA 1NCRA 4HFSA 4QT6A 4PDWA 2EIGA 4JGZA 2PTMA 4JRAA 4YARA 4Q4X1 3I54A 3VZNA 3L2YA 2JEMA 1C4RA 4FPEA 4JVAA 4M3CE 2Y26A 5FRAA 4AFMA 5AC92 1S2KA 2WNUB 4NHKA 1FNYA 1B35B 4RR3C 2VY0A 4RD7A 3WCRA 1FX5A 3WDWA 2YMZA 3L2HA 4N9IA 5BY5A 4LBNA 1RUF3 4FBFA 1YNAA 4QGMA 3RNSA 4Q4Y2 3MIHA 1V9U2 1V6IA 3ES4A 5CA6A 1QJY2 1W6OA 4A3XA 4LUKA 4Q4V2 1NY72 4AEDA 1UIJA 3H7YA 5A3LA 1KQRA 1LGBA 2GC2A 2C5DA 4IEOA 4RS5B 3ENRA 2I74A 1DGRA 3J8F2 3A0KA 2H6CA 4FQZA 2WNUA 3WDVA 3WG3A 4K1ZA 1QOSA 1RUC3 1YO8A 1ASJ3 3J4UH 3VV1A 1DZRA 2YUEA 5C8CB 2CGPA 3AKRA 2WA3A 1MEC3 1JHNA 2WFF2 2XL9A 2R043 4AQ2A 3HN1A 4EN0A 2XJPA 3ZIXA 1EAH2 1S0IA 1QJX3 4Z1VA 3VHRA 4AI2A 1ZBE2 4R9AA 2UWBA 1V6JA 1MS1A 5F5QA 4Y24A 2VW0A 3NV2A 4RS5A 1XNDA 1FMD1 1SMVA 3ZDSA 4COWA 1RUE1 3RWNA 1F5FA 1FATA 5C8CA 4AW7A 3O12A 4EV0A 4GWNA 2I2SA 2MEV1 1RUH1 5E88A 3UJOA 3ZO0B 3GZUC 3VL8A 4OZXA 4FOYA 2OZ6A 4IL7A 1KJRA 3I7DA 5J09A 2RS13 4COVA 4BH9A 4L2NA 1UU5A 5TSWA 5T52A 1IHMA 3KT4A 3LCPA 1ZZCA 4D69A 5AFEA 5BNQA 2R32A 4IQPA 2XPJA 2TEPA 4C1XA 4OI2A 1AX0A 4XF4A 5H9PA 1RVF2 2P34A 2WNVC 3OTFA 3WCSA 1PO13 2PELA 1FOD3 3O14A 1GZ9A 5HBAA 2JDZA 1SFNA 2C1FA 2DTYA 3WDUA 1BEV3 5EXOA 1HKDA 1J58A 5J3UA 4COYA 1HIXA 1S0JA 4FP2A 4XFFA 4HVRA 3AMMA 4WZFA 1G9BA 1LOBA 3OBRA 1RMU2 4YM0A 1W2UA 3E6CC 5DG1A 3RJ2X 1ZRRA 3U07A 1R1ZA 3K51A 1Y43B 4X6RB 2E7QA 2E9QA 1IS6A 1SCSA 2B8MA 1CAUA 3S6PA 2K0GA 5JWPA 3DUIA 3NO8A 1AVBA 2YZ4A 3WV6A 4RA0A 1DQ5A 4RHV1 3WQ7A 3ACLA 4I09A 4PLNA 3NW4A 5BNOA 1UZZA 2P3IA 3B01A 1COV3 1J1LA 5A33B 4F8AA 3CNAA 1EPWA 3ZPYA 2PHXA 3EJKA 3M8LA 3NWKA 3VLBB 3ZX7A 4AI1A 2E53A 3EXUA 1RUD1 4IV1B 2FZ1A 1VBA2 3LWCA 1XE8A 2VXRA 1ENSA 4IESA 1UL9A 4CZSA 4COZA 3IKWA 1C8M2 5I0RA 1PK6B 5C4WC 1TEIA 1YXWA 2G9GA 3IIAA 4GALA 4UXAA 4QD2A 3LOBA 1C5IA 5A33A 3TRSB 1I6XA 1JXNA 2XJQA 1PVC3 1AL23 5HCFA 2GH8A 1PIV1 1PZ7A 4G4FA 4IV1A 4XFAA 1KDMA 4OI4A 1GR3A 1VBC3 1N3OA 4B7EA 4IEPA 1SLAA 2R062 3N3HA 4FPJA 4XPVA 1ULCA 3ROUA 3RMXA 3ZXAC 2YPJA 4EN7B 1OOPA 1QNYA 1X7NA 1DGRN 2NM1A 4PIYA 1VAMA 1XNCA 2E63A 4YRDA 1K5MC 4EJRA 2NP0A 1DYKA 1WD4A 1AR82 3N36A 1FV2A 1SBFA 3CF6E 1RUNA 3MICA 1FT9A 4L92A 1SDWA 2PAMA 2VQ0A 3MIFA 4FPYA 4N53B 1UPSA 2X8KA 3JB8A 2XVKA 4P14A 1YUDA 2ZGOA 2DCZA 2ZOEB 1U5ZA 4LLOA 1RUOA 4XW3A 4AWDA 1REEA 4XE9A 4TWTA 2DTWA 1PNGA 2IFWA 4ZU7A 3R0RA 4YFWA 5GM0A 2ZKNA 2ZTNA 3AKQA 5K8SA 3C3VA 1ZX5A 1D0GA 2WZR1