3K77A

X-ray crystal structure of xrcc1
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
152
structure length
152
Chain Sequence
PEIRLRHVVSCSSQDSTHCAENLLKADTYRKWRAAKAGEKTISVVLQLEKEEQIHSVDIGNDGSAFVEVLVGSSAGGAGEQDYEVLLVTSSFMSPSESRSGSNPNRVRMFGPDKLVRAAAEKRWDRVKIVCSQPYSKDSPFGLSFVRFHSPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA repair protein XRCC1
publication title Oxidation state of the XRCC1 N-terminal domain regulates DNA polymerase beta binding affinity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 34
structure length 152
sequence length 152
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2009-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01834 XRCC1_N XRCC1 N terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 3k77A00
1SDDB 3AC0A 1XNAA 4XUQA 1US3A 1US2A 2Y6JA 3DYPA 3NQHA 1ULPA 4JKKA 3WF1A 3T2QA 2X05A 1NAEA 5LA1A 4PQQA 3IIIA 3PUHA 2CDOA 1RYYA 3C7EA 1F4HA 3HNMA 5C70A 2V5DA 4P02B 1UZ0A 2VQTA 4BJ0A 1W9WA 2BGOA 3UETA 4MO3M 2ZEXA 1JYWA 3OEBA 3T0BA 3ETPA 3FHAA 2ZEZA 1TVGA 1UYYA 5A1AA 2J22A 2Y6KA 2VCAA 2Y64A 4DXSA 2QQJA 4KI5M 3DYOA 2W1QA 3CQOA 3WNKA 3DECA 3T2PA 2QQNA 3OEAA 1W8NA 1EUUA 5DMYA 2ZEYA 3VDBA 3WNPA 4JHZA 1UY1A 3OGVA 4LQRA 2E26A 2X10A 5J1XA 3P1IA 1JU3A 1PX4A 1UXZA 2JD9A 4CUBA 3E1F1 3T0AA 1CIYA 4UAPA 1UYZA 2ORZA 2VR4A 2J1TA 3NJVA 2QQMA 4GZ9A 4UI9L 2WZEA 1H6YA 2HYXA 1XNTA 4LHSA 3VDAA 5HPOA 4QB6A 3K77A 2VZ3A 3MV11 3OGRA 1SHWB 1JZ4A 1UWWA 2B4KA 3HNBM 1TG7A 5IFTA 1CZSA 3I2JA 1IQDC 1T2XA 4BK5A 2VJXA 4ARYA 3C7HA 3I3EA 3VD3A 2W92A 2LW8A 2QQLA 4P00B 1UY3A 4OYUA 2W95A 4DXTA 1H6XA 2WAAA 4P08A 4QDRA 1GUIA 1GQPA 4DUVA 4MGQA 1J84A 4XVHA 5JR2A 3MV01 4ARXA 3D3AA 2R7EB 1PX3A 3IB3A 2WABA 4MADA 4FI9A 2RJ2A 1K42A 3NRUA 2DCKA 2J1SA 3HPNA 4E8CA 2KD7A 1O8PA 4XUTA 4GWIA 3I97A 3WF4A 3IDAA 1F4AA 2E31A 3SKVA 2DCJA 4QX2A 2YG0A 3OG2A 3HNYM 2EIBA 4A44A 3EB7A 4QX3A 5DN2A 1JZ5A 2PQSA 3WF0A 4PT6A 1JI6A 1GNYA 3LQCA 3GGLA 2W5FA 2BBAA 1UXXX 4CU6A 2YFZA 3MUY1 2HLEA 5JXGA 3ACHA 3FHQA 2BGPA 3K4AA 4CVUA 2WQ8A 3I2FA 3WNOA 2XONA 3I2KA 5IJRA 3T08A 2VL4A 3FN9A 3I2GA 3ABZA 4OMDA 3NJXA 2WN3A 2BERA 3HJRA 3ZM8A 3ACFA 3LPFA 4BK4A 1GU3A 2VZUA 3A21A 4QDQA 3WSOA 3IAPA 5JXHA 4W50A 2V72A 2W9XA 5G05L 2DDUA 2Z4FA 4M4PA 1UMHA 2W1WA 1NUKA 1W9TA 3LEKA 2J1AA 5B4NA 4CUAA 2VCCA 2ZXQA 4JX0A 3MBWA 3U37A 3WEZA 4Z2AA 3JXSA 4OUEA 4DUXA 2OKXA 3I3BA 2EIDA 2W91A 4W4ZA 2J1RA 3W5MA 3VD4A 3T0DA 1XC6A 4A6OA 4XZUG 1OD3A 2YB7A 1JYVA 3HN3A 2YFUA 2C9KA 3GXUA 1CX1A 2Y6GA 3T2OA 2WZ8A 1JZ2A 2VZQA 2BZDA 4AG4A 3WNLA 3CKHA 5JXJA 2WDBA 4QPWA 2VZRA 2J1EA 1CZVA 4UOJA 3WF2A 2ZEWA 3BGAA 1L7RA 3CZJA 5EJZB 2VOTA 4D8MA 4A3ZA 3VD7A 1NX9A 4QX0A 2WN2A 2JDAA 2EICA 1W99A 1JZ6A 5EJ1B 3SEEA 1GOFA 4OZOA 1W0NA 3LEIA 3EYPA 4QB1A 3NNGA 4DUWA 4D0QA 2VC9A 2VTFA 4ZZ5A 1UMIA 3CIHA 3MO4A 2VMDA 3VD5A 2VO5A 2J1UA 1DYOA 3CMGA 2X09A 4PF1A 1PMHX 3VDCA 1LNSA 1JYNA 2WO3A 4DEQA 1JZ7A 2VZOA 3WQBA 3K4ZA 3HOBA 1L7QA 5JMOA 4ZY9A 3J7HA 3UNPA 4QX1A 4A42A 4A45A 3K4DA 4RN5A 2XHNA 5C71A 1UY2A 1JHJA 2QQOA 1JZ8A 2VZSA 2WO1A 2YC4A 4A41A 3ECQA 3WNNA 3IAQA 1WKYA 5I0DA 4TTGA 5EIYB 1W9SA 3A22A 1UX7A 4GWJA 2WO2A 2VMEA 2YC2A 4AAXA 4LKSA 2B9VA 2VM9A 4MGSA 3K75B 4CUCA 5HXMA 2Y6HA 4JKMA 4KMQA 3P6BA 2E33A 3PUIA 4ZXEA 2QQIA 2V4VA 2QBXA 3BN6A 4QAWA 4L0PA 5IHRA 3I2HA 1UYXA 2Y6LA 2WYSA 4DEVA 4BDVB 1KGYA 1UY0A 5CYYA 2JKXA 1CZTA 4KWUA 1OH4A 4CU8A 3THDA 4ET7A 1JYXA 5LA0A 4HG6B 2W1UA 4XUOA 4XURA 3LPGA 3C7GA 3LE0A 2VQUA 1W8OA 3K46A 1MPXA 1EUTA 4JKLA 4E8DA 1BHGA 1ULOA 3C7FA 1SG3A 3WF3A 4BXSV 3OBAA 4TXWA 2Y8KA 4RYDA 4MOAA 1R64A 5FUIA 4P5YA 5G04L 3UESA 3GM8A 1NKGA 2W47A 3OB8A 5DPNA 3VD9A 4M4RA 2RV9A 3C8XA 2VZVA 1GOGA 3CZUA 2C4XA 2JE8A 5JUVA 2RVAA 5C7GA 1K3IA 3F2ZA 2C26A 2ORXA 4ZZ8A 5JXIA 3HEIA 1DP0A 2VCBA 1K12A 2W87A 2L9LA 2XQXA 4DXRA 5IFPA 3I3DA 3I2IA 1D7PM 3W5NA 3T09A 4W8JA 3THCA 4CU9A 1OT5A 2WAOA 2VZTA 1YQ2A 2VMCA 1XPWA 4IUGA 3CDZB 4XUPA 3GDBA 5LCWL 1JU4A 3A23A 1UY4A 4OMCA 3OGSA 2VMFA 2XOMA 2J1VA 2WUHA 2EIEA 3WNMA 2W46A 1O8SA 5B4XA 3LEGA 1KEXA 2W1SA 1DLCA 2VZ1A 2QQKA 1GOHA 5IYYA 5DQ0A 4YPJA 3MUZ1 1HN1A 2J7MA 4CU7A 5F7UA 2W94A 4QDSA 3SKJE 4QB2A 3FL7A 5LA2A 3A7QA 1WCQA 1O59A 2LS6A 1OF3A 4A4AA 1I5PA 2VZPA 2W3JA 4XUNA 1GMMA 4LPLA 2CDPA 3DYMA 3C7OA 1PMJX 3ACGA 3SEPA 1JZ3A 1OF4A 2ID4A 5CZKA 2WBKA 1P8JA 1K45A 2E32A 3ACIA 1J83A
chains in the Genus database with same CATH superfamily
3J8F2 1IG3A 3N36A 5APAA 1IZ3A 1BXHA 3AC0A 5A1FA 3ZYGA 3RMYA 5JVVA 1US2A 5FBJA 1BMV1 3JUUA 4LE3A 1ULPA 3H1MA 2GMMA 3OYWA 4JKKA 4MUVA 5FP9A 3WF1A 1LULA 3T2QA 1NAEA 5LA1A 4XOGA 5KXCA 1RUNA 2Z79A 3PUHA 5K0UB 1W0PA 5E89A 1H2NA 4HT1T 5FZOA 1XNDA 1UKRA 1BZWA 1EV13 1F35A 3B3QE 3RJRA 2JKBA 1REDA 2ZAAA 3WV6A 4C8DA 2V5DA 3DPRB 4P02B 5FMOL 1SLLA 2R043 4BQ3A 2GC0A 1NLQA 4TLFA 1SFNA 4WM7A 5L9VA 3B7MA 1A78A 4K40A 2VOWA 3UETA 1S0BA 2ZEXA 2HEYF 4RFRB 5FZ6A 4PDWA 3OEBA 3WT3A 4AGRA 3T0BA 5JSOA 1G9DA 3S5AA 1PGL1 1UD1A 1V6MA 1ZZ7A 2XGXA 2Y6FA 3BPZA 4XQDA 4URTA 2BOJA 3OY8B 1AYN2 2Y60A 4XIKA 3V0AB 4BLIA 3MIFA 1GZTA 4LBNA 1QF3A 2Y64A 3RI8A 5C8CC 1OOPA 3I59A 3DYOA 4PQ9A 1DZRA 3R6SA 3WNKA 3T2PA 2QQNA 5E6HA 1W8NA 4QXBA 2MHFA 4H2AA 2R062 5LZ6A 2JDYA 1W8HA 3IT8A 4AQ2A 1UY1A 1GZCA 2WNUB 3UYJA 5FTTC 4LQRA 4BQ5A 3EXUA 1S55A 2WR9A 3PJQA 1ZZCA 4NRMA 4CDWA 2AENA 1KD7A 5FZKA 3M8LA 4NHXA 2Q8CA 4UAPA 1PM7A 4Q29A 1SEFA 1BBT3 1QJFA 1C5IA 4KWLA 1ND2C 1REEA 1UYZA 1HQLA 3EO6A 4CCNA 1KRIA 2WZEA 1SACA 1AYM1 2KM2A 2F6BA 3UKVA 2HWD1 5HPOA 1PNGA 1BVP1 1RVF1 2JB8A 1LOFA 1RMU1 2DBIA 2G9FA 4QM9A 2O0OA 3MV11 5ANQA 5F6KA 2WT0A 1UWWA 2YHJA 1A3KA 1KFXL 4ZHNA 2UY8A 4Q1PA 1VBD1 5D2AA 5FXVA 3ES1A 1U0AA 2ZGUA 1SLAA 2XUEA 1IPJA 2R071 3DUIA 3VL9A 3AFKA 1N3PA 4Y22A 4IE5A 2IXLA 5FYTA 5FZDA 4BK5A 2P3KA 3H42B 5EXOA 1UOGA 3C7HA 2I74A 3K3NA 3ME2A 2BGCA 4CRQA 3MF6A 1ODMA 1G9CA 4E4SA 3WDVA 3ZFEA 3R05A 3AMPA 3I49A 4P00B 1ULEA 2O8QA 3LAGA 4CDUB 4YFZA 2W95A 1WD3A 5IVCA 1BEV1 3OUJA 3QOPA 3CJIB 3SISA 5ABJB 1JOBA 3LZZA 4FPLA 3D3AA 2R7EB 5A7SA 1UOFA 2JICA 2PA7A 3BYWA 2WABA 2MPFA 5E1RA 1H1IA 4XHXA 3NRUA 2J1SA 4UW5A 1UW8A 3HPNA 4XDQA 3SMHA 1QNYA 3SLIA 4GMP3 1LGCA 1HQWA 1UU5A 2WT2A 3N4MA 4IL7A 5DAQA 1QU0A 1LOEA 1NXD1 4NROA 2FDJA 2LM3A 3W20A 1PNFA 3WF4A 1HRV3 4EZHA 1RUJ3 1PO13 5LY2A 5IVVA 2Y0OA 3BTYA 1J3PA 4RGGA 3NV1A 4CEWC 3OPZA 5FZAA 1TNFA 3SKVA 5GLWA 4N8MA 4QX2A 2X5IA 1COV2 3OYWB 1SDWA 2YG0A 2YXSA 5HCAA 3ILFA 2VQAA 1JW6A 1RXFA 3VDDA 3VZNA 2EIBA 4A44A 4Q4W2 3X29B 4K8RB 1QQP3 3TEWA 1WCDJ 2LTNA 4COUA 1M4WA 3AP9A 1ENXA 1MS0A 2VMHA 2GC3A 4H3WA 3UJOA 3VBHA 1R1A1 4YVSA 4ZS3A 1F31A 5FZ8A 4W65A 2D5HA 4AEMA 3PHMA 1OVPA 4GWMA 5EQUA 3K3OA 2XPJA 1UXXX 2GSYA 4EWDA 5A3PA 1W6NB 4CU6A 5J36A 1DQ5A 2DF7A 4GH4C 3SH4A 1VAVA 3UGGA 2JDHA 2JG8B 3MUY1 2NZ9A 5JXGA 5K8SA 4HL0A 1YUDA 2BYVE 2DVFA 5FO7B 1HB2A 3FHQA 2AYHA 3K4AA 3BOPA 2HWC2 4EJRA 1W6OA 3I2FA 3ZXDA 5CNAA 4YM0A 4XJWA 1HJGA 4Q4V1 3U07A 3FN9A 5BUVA 2O14A 3D4KA 2Y38A 4YWAA 4JHTA 1OOPB 3O1VA 5FKBA 4WZFA 1UX6A 2SLIA 3H7YA 2Q1ZB 5F2WA 2MNGA 2YBSA 2DV9A 4BK4A 2YBKA 4B1MA 5JXHA 3POJA 2X8KA 2WFF2 3AYEA 4WM8C 4FFGA 1VLNA 1UCXA 4OHXA 2QQWA 2DDUA 2Z4FA 4CDWB 3WW4A 3RZJA 1TME3 5BNNC 4B29A 4B3NA 2JG9C 3LIGA 1GZWB 1CAWB 1OA3A 3KF5A 4CUAA 3I2OA 3M3OA 2VCCA 1W9FA 2EAKA 1XJAA 2XVKA 4CSWA 3MBWA 2ZGRA 4FAHA 5H9PA 1IPKA 4V2WA 2P5BA 4LOSA 4EYUA 5J37A 1RUD2 3BTAA 3I3BA 1F15A 4K1ZA 4UFLA 5C8CB 2W91A 1CJPA 4PBOA 1YWKA 4GXLA 5C9AC 4HOOA 4YVWA 5JWPA 2YU1A 4B7KA 2RMU3 5FYUA 2YUEA 2D6KA 2Q30A 2YB7A 3ZYHA 3OUIA 4LK6A 1RUG3 2VBDA 4LULA 1CX1A 5ERLA 3D82A 4GB33 3NO8A 4OI4A 2CYFA 1AL0G 1HRI2 3PNAA 4CPBA 4GAZA 1QJU3 4X8PA 2ZMNA 1HXS2 1VRBA 1QEXA 3TBDA 3RFRA 1OQEA 4CP0A 1FT9A 3Q8EA 2C0ZA 4QPWA 4XBNA 5FXXA 1ND2B 2C1FA 3SXWA 1W6MB 3O1MA 3H3LA 2VNOA 3NL1A 3WF2A 3WZ1A 4RQPA 2RS13 5JOYA 5K9YA 1RUE2 1L7RA 5FZBA 2XMLA 4NVPA 1ZRDA 4K21A 2VU9A 3GBGA 1JXNA 1NX9A 4ZPIA 3T30A 1PVC3 2YPJA 5FJHA 5KXBA 2CWSA 4Y4RA 5FP4A 3AZYA 3WCRA 2GU9A 2JDAA 1JZ6A 1W99A 2XBO3 4DQAA 3ZPYA 3QBQA 1J1LA 4NHYA 1V9U1 1VBB2 4UFHA 3SEEA 4B4RA 4LJHA 4YZ3A 4OZOA 5ACA1 3VBUC 1W0NA 3FX3A 4XETA 1LU2A 1YYNA 5FBZA 2P3IA 4DUWA 4LNVA 5J09A 2VTFA 1VIWB 2W08A 1GICA 4ZZ5A 1QXJA 1UMIA 3CIHA 2BNNA 4MGTA 3NJYA 3RVHA 4YRDA 2PHFA 1C5HA 1UAIA 2PLV3 3AVSA 1XRUA 1CIWA 5C4WA 2WZR3 4CP1A 4QGLA 4XMAA 4DOUA 3H0OA 4GULA 4FPCA 2JDZA 3WQ7A 5CFCA 3RZLA 3OD0A 4NAMA 5CA6A 5FPUA 1JYNA 1KJLA 2WO3A 4AEDA 2QZ2A 3ZSMA 1C8M1 1R1ZA 4PIZA 3AMQA 2Q8DA 2V09A 1MS1A 1SFPA 3K4ZA 2GNTA 5AC92 1L7QA 5JMOA 1FNYA 1MVEA 1UNBA 3IWZA 3S0MA 3B01A 3K4DA 4RN5A 5A7PA 3VGIA 4BE3A 1YJLA 1TMF1 2VE1A 1MS5A 1UY2A 4YW2A 1S2KA 3FUOA 2VZSA 4UFJA 4YGCA 4X8NA 4KQ7A 3VHNA 3I7DA 2JE9A 3ECQA 4PCRA 1PGL2 4XZPA 4MV2A 4N53C 2WNOA 5FY4A 3RG0A 4ZU4A 1AR61 1DBNA 2WS91 1AL21 1R082 2RHPA 2OQ6A 1YC61 4GIQA 4Z82A 5FY1A 3TWIA 4M0NA 1OFSA 3THTA 4ATFA 1FAYA 1OLME 3I2DA 3MIGA 2YC2A 5GZDA 4HLTA 4XHBA 4LKSA 1Z78A 2VM9A 3HT1A 3IIAA 3K75B 1GYKA 4TYSA 5CFDA 3KM5A 4ZXEA 4MGKE 5A3OA 2VULA 4LBMA 3IPVB 2QQIA 3VBSA 3M2MA 4IEZA 1Q8OA 4D7SA 4GH4B 3AKRA 2Y6LA 3GHNA 5L7OB 1GP4A 4PI0A 3BVCA 4CEYC 1XE0A 4OVEA 3GNEA 2QDNA 4QPGC 3W21A 5T5LA 2ZACA 1J3QA 4I3PA 5CYYA 1S0EA 1YIPA 3THDA 4ET7A 1MR5A 5I91A 4XUOA 1BK1A 3VB9A 3VBOC 3P5BA 2VQUA 4LA2A 3J8F1 1W8OA 3POIA 1RVF2 1NQDA 3K46A 4IE6A 4XYXA 2BFUL 2P3YA 1CX4A 2WSUA 1B09A 4QGNA 1X33A 4JGZA 3KHCA 3PUAA 2JB4A 4R9CA 1XYPA 1VBC1 2WWJA 3VLBB 1ULOA 3PDQA 5FXZA 5BNNB 4RHV3 2AEYA 4C0HA 3D0SA 1W06A 4MVTA 4XC9A 3HAGA 4WVMA 4DRVA 5FMDA 4TXWA 5DG1A 1SLTA 1V6LA 1W2AX 2FDFA 4BIOA 4Y20A 5EPAA 4P5YA 5FUIA 5G04L 2VY0A 5DUUA 3FFZA 3RRDA 4E9KA 2WNVC 1IG0A 1YCIA 2ZHMA 2C5DA 2XKOA 2IXCA 3H50A 2ZGKA 1C4RA 4AI8A 5LWBA 4XXPA 3VHPA 1LRHA 2VOXA 1BYHA 1LEDA 2ZHKA 3AYDA 1Y7BA 5IVYA 2RV9A 2VZVA 1GOGA 2C4XA 5C3SA 5JUVA 4AL9A 1N1SA 4HSJA 4P9YA 1LOCA 1RJ8A 2P17A 4J25A 1VBE2 4BM8A 1YEWA 2C26A 1ASJ3 2QQPA 1Q3EA 3HEIA 4JGYC 1QWRA 3WCSA 1AYN1 3KMHA 4Q4Y3 3GZAA 4GQ7A 3ZFGC 2XH6A 1I9RA 1K12A 2O1QA 1X8MA 3KVAA 2L9LA 4UW4A 5IK4A 3BTXA 3FE5A 1VR3A 4DXRA 3M7AA 3KQ4B 3AMHA 1GFF2 2D6LX 1RUF2 1ZZBA 2IXKA 3I3DA 4RFT0 5IFPA 1OLRA 1C8NA 4MGYE 4YW3A 3W5NA 2PAEA 3T09A 1A8DA 4WV8A 1NCRB 2IFWA 2HWB2 1OKQA 2OYZA 2YROA 3HMYA 2OX0A 4CP9A 3JBG3 3OSDA 1V6NA 3CDZB 4FOQA 5A32B 1URXA 2KA3A 3MGUA 1S0DA 4KBBA 3LSDA 4RS5A 4XUPA 4FOVA 3V56A 5LCWL 5DZFA 1K5MA 3QH7A 1DHKB 4HKOA 1LESA 3LSEA 3TAYA 4A7ZA 4HPKA 2CSGA 2Q8EA 1SCRA 3FLRA 1WLTA 2VPVA 4L8QA 1NYWA 3RZGA 1XOYA 3VBUB 4H7LA 5C3OA 2E63A 3WDYA 2VMIA 4CTEA 1EPWA 5D8AC 1GQHA 3LEGA 3NKGA 3NNJA 1GOHA 5FYZA 2FMYA 3NAPA 2FD8A 1Q5OA 1HN1A 1PZ9A 3RS6A 4LR4A 3FWEA 3KHBA 1E57A 5LEJA 3SKJE 3LDKA 4UF0B 1AR82 5JOXA 1D4M2 4Q4X2 4XABA 3EQEA 5CIRA 3ZN4A 3EHKA 5EHDA 3SQOA 2NN8A 3PMEA 1HLCA 1F8VA 1UIJA 3FL7A 3L9JT 4IESA 3N9OA 5GM0A 1QOSA 2DUQA 4JTNA 2MEV2 4AFDA 1RHI2 4XIOA 2HWC3 3HN1A 2LS6A 4WVZA 5AVAA 4A4AA 4EWEA 2VZPA 3VHRA 1G9AA 2ZHNA 2PHLA 4ASMB 3DEMA 5A3MA 2A1XA 2CDPA 2A6YA 4ASLA 3PJYA 3DYMA 2D3PA 5FZ9A 3ACGA 1JZ3A 1VMFA 2P3JA 2V4AA 5EWSA 3TB0A 3VKOA 4WVWA 5CZKA 5J3UA 5K0UC 1RUH2 5C3RA 1RTVA 5KXDA 2HBTA 4UT5A 1DYKA 2W0XA 4N53B 3DPRC 4YZ4A 1QDCA 4XUQA 3DYPA 4BZ4A 1OKOA 3ZR5A 4AW7A 4HVOA 4CXWA 4TZDA 3ZXEA 1YI9A 4YW5A 1LENA 3KQRA 3NNFA 4QX5A 5FPVA 5FXWA 4I3GA 3USSA 1S2EA 4LBQB 4WVVA 1FX5A 1FOD3 2HYKA 2Y33A 4NIDA 2GN7A 1RYYA 3C7EA 3DN7A 1ALYA 1ZBE1 1COV1 4LEJA 4XAEA 3W59A 1LEMA 5C70A 3KCXA 3VZOA 4LORA 4AVVA 4HVQA 2EALA 4Q4W1 4WVMB 2VW1A 5LRSA 5GZFA 1NE4A 3O1PA 2Q4SA 5A6XA 4CA9A 4CEYB 1NCQB 3GZTB 4QPGB 4F7ZA 4HXCA 3J7MA 2BNMA 3ETPA 3S7EA 3ES4A 1O3RA 4XFAA 4QKBA 1LHOA 3IN9A 4Q26A 5FV3A 3KB5A 1UYYA 3HIFA 4JV4A 2XL9A 4CP2A 3AX4A 2J22A 3VHOA 1HXS3 4AOCA 3KV6A 1SBFA 3VBOB 1SBDA 1S0CA 2CY6A 3ST7A 4DXSA 4KI5M 3DKQA 4FPYA 2IFRA 3CQOA 3OPWA 4XFBA 3MI8A 4P9WA 1E5HA 5JOWA 3POGA 2HWF3 4M01A 1EUUA 3M3CA 4NHLA 4LHNA 5FYSA 3HQRA 3SITA 3VZKA 2AEZA 5IWFA 4P9IA 3UKTA 5BNPA 2DVGA 1AR92 1V9U2 2X10A 3N9NA 5BV6A 4MGZE 1OPMA 3ZN6B 5BNOA 1KJRA 3AJYA 1UXZA 4CUBA 3E1F1 3T0AA 3GALA 3OOXA 2WNVB 4LLFA 3VBRC 1VBA3 5F3CA 2IUWA 1X9TA 2WFF1 4CP9B 2ORZA 3WW2A 1ONAA 2W2IA 5AFEA 2V5YA 2VAUA 3ELNA 2QQMA 1A6CA 4PIXA 1OMIA 5L7OC 4N43A 5GZCA 5KHIA 4LHSA 5CB7A 2XJVA 4QB6A 3BB6A 3RQ0A 4W6WA 1XYOA 3IM0A 1XNBA 4HPKB 2VZ3A 2RR11 4JGYB 4EN8B 4ES9A 4LBJA 2B4KA 2WRAA 2WWUA 1RUD1 3M1HA 4XJ8A 5FY5A 1XE7A 1XE8A 5FZ0A 1XYNA 1YRZA 1TG7A 2WJSA 5C9AB 1CZSA 2RS53 1KDMA 1CN1A 3I2JA 1VJ2A 3IKWA 4NN0A 2ZZJA 1LODA 1QIQA 2VJXA 3B9CA 4NRPA 4YFWA 2YY1A 1FMD2 5ABJC 1WW7A 2JENA 3I3EA 4QQPA 3WX5A 2BDRA 2A71A 2W92A 4G9SB 1HRI1 2QQLA 2WA3A 3MIBA 1UY3A 2UURA 2WQZC 4ZU7A 4LO7A 1H6XA 4P08A 4QDRA 4RR3C 4Y26A 2D7FA 1AL22 2WS92 4XVHA 2XG3A 4Q0PA 4A3XA 4LUKA 1PX3A 2ZBJA 5LK5A 2VG9A 1YQ6A 1FV3A 2FQPA 3IB3A 2XDVA 2BNOA 4NE9A 1RUE1 2GALA 2KD7A 4UBHA 1HQNA 4FP3A 4JVAA 5JIAA 4G3YC 1WMDA 1CGPA 5F5IA 4IETA 3I97A 2WLQA 4QQLA 4LIVA 4HN1A 3IDAA 1NOVA 1QJY1 1Q56A 1QJX3 3N35A 5F3GA 5BPXA 5LASA 3GJBA 2NLRA 1BLZA 1C57A 1IPSA 1CAVB 4RL7A 4MZUA 4CCCA 1ZA4A 2EF6A 4WM7C 2VGDA 3AKPA 3LA2A 2I2SA 2ENRA 4D94A 3DGTA 5F39A 2A6XA 2WT1A 4L99A 4PBPA 1DQ1A 1YFUA 3KGLA 2UY9A 4NO4A 4QGMA 5FYIA 1C28A 2ZHLA 5KBFA 2NYYA 4CXXA 1JZ5A 1Z7S2 2PQSA 2WA4A 2WYFA 4AQTA 4COWA 4QX7A 5JLVA 5KC6A 5F32A 2X29A 1GNYA 4M3CE 4AVTA 5EFUA 3J7NA 1CONA 3THPA 1VBC2 3LQCA 1AYM3 2RS31 5J7MA 1OOPC 2W5FA 2HWD3 4TN7A 3CO2A 2JDNA 1KDKA 5A70A 4YGBA 2YFZA 1RMU3 2ET7A 2BTVC 2PHRA 3BU7A 1Q8QA 3KLSA 3URFA 1DQ2A 2GNMA 3KGZA 5I8YA 3ACHA 4BIFA 5AC91 4BCUA 1CESA 2D6PA 4XACA 1VBD3 4CVUA 3WNOA 1DZQA 1REFA 2XONA 3I2KA 4O65A 5FZ1A 3UKNA 2R073 1Q8VA 4CDWC 3TYJA 1ENSA 4META 2WC2A 5FO8B 3ABZA 3JB8A 4ZKTB 4H55A 1VRH1 2WLPA 4IGQA 4MSVA 4MG2A 1DG6A 2WN3A 3ZM8A 1RINA 3K2OA 5IATA 2TNFA 3LWCA 2VZUA 3A21A 3WSOA 3IAPA 1K5JA 3O14A 1R081 2V72A 1QDOA 4AEKA 3JD72 1YFWA 2Y26A 1J3RA 4U36A 5E16A 4IEOA 5GLUA 4JDMA 4UYBA 1BEV3 2D93A 4XPVA 2QZ3A 3HQUA 5F5QA 4BLJA 2J1AA 4YW4A 4AGGA 4CCEA 1W6QA 1JUIA 2ZXQA 2JXAA 4Q0SA 4RGKA 2HEWF 4QKFA 4W6XA 1SFYA 3JXSA 4OUEA 1RITA 3FLPA 4M0HA 2EIDA 1MQTA 1XU1A 4R9DA 3DL3A 3GCXA 4QPIA 1QNWA 1JYTA 3AVRA 4YG3A 4XZUG 1RL3A 4IEQA 3ZFEC 4BQ1A 3WQ1A 3RZKA 1JYVA 1X9PA 4Y3OA 5K4LA 1L3JA 1LHUA 1YQCA 1S4CA 2C9KA 2ZGNA 1JOJA 3E6DA 3PVEA 4Y1YA 3T2OA 2VZQA 4AVBA 2BZDA 1AUYA 1YQ5A 4IV3A 1AVBA 3SH5A 2BEOA 4FPOB 2D40A 3IMNA 3VBRB 2WIIB 4X6QB 5JXJA 2WDBA 4IEYA 4OCTA 3KT7A 1LCLA 1R1A3 4UOJA 5JPNB 4IW3A 2XKPA 4UW3A 5EYYA 2GC2A 4YG0A 5BNQA 3BGAA 1O91A 3H7JA 1XXNA 1ZX5A 3ENRA 3O12A 2PN5A 3POFA 3CZJA 3TNPB 4BQXA 4QWNA 2AC1A 2BV4A 4YM3A 1OLMA 3PVOA 1W8UA 2GP3A 4I01A 4QX0A 2R30A 1C1FA 4DS0A 2LROA 1IS3A 3WP5A 2X5IC 2B39A 2WN2A 4UFIA 4A6SA 3E6CC 4R4ZA 1EAH2 2FHRA 4Q4V3 1ZZ6A 3I3MA 1EV11 2DURA 2SBAA 3RJ2X 1GOFA 3VDDC 4P9GA 2ADDA 5CKMA 1VBE1 4XJ9A 2DUOA 3LEIA 3MW2A 4QB1A 3Q8CA 3NNGA 4AXOA 1AXKA 2CHHA 3OPTA 4D0QA 3HBZA 3VBHC 4YVSC 5I8SA 4NWWA 5FYCA 1WD4A 1LR5A 1OA2A 4EROA 1XU2A 2VMDA 1ND3A 3CL1A 2VTXJ 4RR3B 1RUF1 1H9WA 2J1UA 1DYOA 1W04A 4OHYA 5LB6A 1QH7A 4PF1A 1OA4A 3LD8A 1JHNA 2A3WA 5IVBA 1EPZA 4OI0A 1MEC2 2HWB1 3DCQA 4DIQA 3WHUA 3Q8AA 1EY2A 2CNAA 2VZOA 3B5LB 3N7LA 4FFHA 1ZBE2 1CAXA 3LKJA 2GMPA 4Q0UA 3WQBA 3B00A 4YZ5A 2VH9A 4AFMA 1JYCA 2OT7A 2YGMA 3CEWA 3OD4A 3MIHA 4KH9A 3UNPA 3Q8BA 5H9QA 1W90A 2UWBA 5FZOB 5FAXA 1OSGA 3GBWA 2XHNA 5C71A 1QOTA 2E7AA 5B2GB 4JZRA 2HBUA 4FPGA 1W6PA 1OLQA 4WM7B 1POV0 2O8OA 1LECA 3IAQA 4YZ1A 2YU2A 1UZYA 3BPSA 4IV1A 1PK6A 1RUI2 5FZCA 4TTGA 2CAUA 1W9SA 1UU4A 2OVUA 3EBRA 3KV4A 3WD5A 3S57A 4E4ZA 3A22A 3UT0A 2EXIA 2VUAA 3S6PA 4PDWB 1MZEA 1XSRA 4LBOA 1NE6A 5T52A 4AAXA 2N7GA 2CWMA 4MGSA 4LXLA 3MHZA 3N7MA 4LOTA 5HXMA 1TQ5A 1WCKA 1HKDA 2EIGA 1AR81 3PUIA 1D4M1 3NV3A 4Q4X1 4IEPA 4AK3A 2QBXA 3BN6A 2VMGA 3R4UA 3I59B 4AQSA 4YVWC 2MEV1 2CV6A 1DQ4A 1RHI1 4DEVA 3CLPA 4AHZA 1W6QB 4KU7A 2D5FA 2QVSB 2OIIA 5DUWA 2I45A 2UWAA 3SCGA 3POYA 5DUVA 4CUGA 1UY0A 1H2LA 2JKXA 3ILNA 1V9U3 1OH4A 4KWUA 4XF4A 1B35A 5ACA3 3POSA 2JDPA 2CL2A 1MQTB 4CCMA 1RUH1 1CPMA 2W1UA 3CBNA 3C7GA 1ULCA 2ES3A 3LE0A 1JBCA 1FPN1 4EN6B 2NMOA 3AYAA 1MS9A 2JD4A 4CCLA 1LOAA 1MPXA 4QD2A 4NIIA 5LW9A 4RQPC 1H2KA 2RR12 4YW6A 3TN92 2DFCA 4EWAA 2P4EA 2Z69A 4W6YA 4XQWA 1BHGA 2OUJA 3WP6A 1DZTA 1I5ZA 2EXHA 4DFSA 3GHMA 2JEMA 2VOKA 2UWCA 1UZWA 3OBAA 2BW8A 3T1LA 4QU1A 5FOBB 4N7IA 2ZMKA 3RWNA 4RYDA 1C8M3 1PMIA 1PZ7A 2ZKNA 3VBFA 4UFMA 2Z5WA 1QH6A 3SNMA 1SQ4A 2VNVA 1FV2A 1ZRRA 4FPKA 1GWKA 3OB8A 3VD9A 4Y22B 5DDJ2 5KR7A 4GJZA 1OBNA 4C90A 1TMF3 4C1WA 3LOBA 4S2DA 3ZFEB 1NCRC 2ORXA 3ALQA 3NSTA 2RM22 2EVXA 3NJZA 1H4GA 3AXEA 1APNA 4BQYA 4D7TA 3TEYA 1DP0A 3Q8FA 3ZDSA 4PF5A 1FXZA 2CGOA 5C4WC 1AR63 2IWGB 2WS93 1AL23 5FZIA 3SC7X 2B5HA 5CFCC 3HT2A 2WO7A 4Z92B 3O1RA 4KGQA 2RG4A 1VP6A 2C24A 1WCSA 2H6CA 3H1YA 4AEDC 1D7PM 1QJY2 3AMNA 3N3HA 4YNIA 4Q1RA 4D6QA 4E4HA 4UBGA 5DUXA 1BVVA 1X50A 5GALA 4R8HA 3L2YA 5KHGA 3THCA 1MS3A 1AR91 3QACA 3PLQA 1AR71 1LHVA 2GC1A 2VZTA 3AZWA 3H3ZA 5CADA 2WWSA 1W8WA 1XPWA 1O7FA 3ZIWA 2FDGA 1R092 1ZVFA 3O1OA 3BUCA 5FOJB 1JU4A 1ENRA 2JDKA 4AAPA 3QH6A 3MLLA 3OGSA 1AHSA 2X5IB 2JE7A 1H1AA 1PIV2 1PO22 2XOMA 4XFIA 3KVBA 2R6QA 4ORFA 1ULFA 2WKKA 3VDDB 3ROUA 1O6UA 3BKZA 2RS32 2W46A 2YBPA 2BP6A 1V70A 4B7EA 5B4XA 4M00A 3J8F3 5EP9A 1IS6A 2HWE1 2VECA 3A4UA 3OGGA 4LLOA 1WW6A 4MLOA 4YVSB 3VBHB 3LF7A 5CFDC 3B9IA 4FPJA 4XF9A 4MYEA 2F4PA 3RWKX 4C0BA 3VBSC 1OXCA 3H3UA 3M3QA 4IV1B 5FZ7A 3USUA 1PK6B 5IUQA 3MLKA 3WQ0A 1GV9A 1O4YA 3NMBA 4IEXA 2XLGA 2OZ6A 3LA3A 5FKCA 1OHFA 1ZBA1 1WA4A 4S2FA 1FMD1 3VKMA 1MACA 3P3NA 2ZAHA 4PHZA 3VZLA 2IVJA 4XTPA 1JUHA 4IXLA 1VRH2 4N90A 4GMP0 3TOJA 1W6OB 1VAKA 3M3IA 1ZRIA 4QPYA 4TWTA 4BMEA 4LT5A 2IXJA 3J7LA 3KD4A 2JIGA 4I0BA 4XUNA 1YFYA 3WG2A 4BA6A 5CISA 5LBBA 4YM2A 4DINB 5FQ0A 3NKTA 3C7OA 3MPPG 2FDKA 4TLGA 4L92A 4OI1A 4HK8A 5LATA 1RUC2 1S2BA 4QT6A 3U0ZA 3H8OA 4MXWA 2E32A 1PVXA 5GLTA 1AYN3 1TNRA 1H8VA 5FYYA 5JMCA 1U5IA 4XF0A 5ISLA 1PM4A 1XNAA 3O1SA 1US3A 3NQHA 4LA3A 3NWKA 1I1EA 2FCUA 3AL5A 3WVJA 2ETEA 4BQWA 2ZTNA 2X05A 4JQRA 5A7WA 3ZR6A 3IIIA 1RGSA 1SCSA 2CDOA 2R063 3KV9A 2PAKA 5T5JA 5JIUA 1NCQC 4FO9A 4OI2A 3ZN5A 1F4HA 4DRRA 5JSRA 5A33A 4UW6A 2P37A 4CCJA 1PGSA 3IDBB 3FJSA 1UZ0A 1H2MA 4AFCA 5FPZA 1NZCA 5T5OA 4YVWB 4D3WA 1YHFA 4LIUA 3WP4A 5E88A 4BJ0A 1W9WA 1Z7S1 2BGOA 4FCAA 4MO3M 1U12A 1WMFA 4DZGA 1IKQA 4CDQA 1Y4WA 3O1UA 2G19A 3FHAA 1LAJA 2PMWB 3ZMOA 1TVGA 4K6BA 3WDXA 1W8TA 1E5RA 5A1AA 1U5ZA 3MFCA 5IAXA 4QHZA 3LOIA 2XVLA 3O0XA 4V1PA 2WZR1 4OQ8A 4CDXA 3DECA 1ZA7A 4D6SA 4RQPB 4XF1A 5FMCA 4EN9B 5DMYA 2FDIA 2ZEYA 3VDBA 3I3QA 4ITCA 4RS5C 3OGVA 1EV12 4LO6B 1K5MC 3PUSA 1N3OA 5J1XA 1ZZ8A 2E9QA 1YO8A 4Z8BA 4MGIE 4FPFA 2JD9A 2R042 4HONA 3AP4A 5FWJA 4CYDA 5C33A 4I2OA 2KXLA 1CIYA 5E8AA 3ZYFA 3FZ3A 2DCZA 4DO0A 3W58A 2YZ4A 3HWJA 3U4SA 3JD71 4LMFA 2OUHA 2VOVA 3NJVA 2JECA 4GWNA 4R9BA 5A3NA 4GZ9A 2A7AA 2ZGMA 3LA7A 4ATEA 4A7KA 2Z42A 2HYXA 3HBKA 3VDAA 3NAPC 1HX6A 4QHOA 4HKLA 5FMOS 4LO5B 4P5HA 2PHTA 2XJSA 4AI1A 4M3CA 3AP6A 5FUPA 2XUMA 2GH8A 4KWKA 5C4WB 3HNBM 2C9AA 2E6VA 3ZYRA 4URAA 3ZMNA 3GZUC 5FYBA 5CFCB 1GP6A 5IFTA 1XNCA 4Y4YA 1O4ZA 4AEDB 2AACA 1SMVA 4XBLA 4ARYA 2ZGQA 1ZBE3 1COV3 4JQTA 4AHYA 4J6GA 1VAMA 2JDUA 3FBYA 4FXGB 5F37A 3MDPA 4L11A 3USUB 4AHXA 4QM8A 2XJUA 1BBT2 4OYUA 4Q4W3 2B45X 2WAAA 4DXTA 1NT0A 1GQPA 1Z0HA 4RA0A 2A3YA 1J84A 1LOGA 4MGQA 4IE4A 4CCKA 4SLIA 5C3PA 4MADA 4XFCA 4FI9A 1K42A 2DCKA 1NZIA 4E8CA 1UO9A 4QHBA 1VB4A 2OPWA 2PHDA 4XUTA 3N9PA 4GWIA 1JODA 1DGRN 2IZWA 1RJ7A 4MXWB 4FOYA 5CFDB 3O7OA 4BISA 1VALA 3ILRA 1GP5A 1F4AA 4I02A 3WXPA 4ES8A 4YSFA 1EAH1 3VBSB 2Y0IA 2E53A 2GNDA 4FFIA 5A3WA 1GLHA 1HDKA 2DCJA 1QXRA 1Y9MA 4KGGA 5T54A 4K1YA 2VUJA 1H8TA 2JX9A 3INAA 4JC1A 3IMMA 3OG2A 2W52A 4JTOA 1W2UA 3MW4A 3HNYM 5FZFA 4QXHA 3WG3A 5CG8A 4XDOA 1KS4A 2D3SA 1BK0A 3EB7A 1FPN2 5DABA 5FZ3A 2WFF3 1ENQA 3WF0A 4PT6A 1AJOA 4LKFA 2OZJA 1GQGA 2ZABA 3GGLA 1D4VB 2DUPA 3JQWA 1W8ZA 4LBLA 1LHWA 3H8UA 4FVVA 1MEC1 4F3JA 2YMZA 5LEKA 5FZ4A 4B1LA 1DIWA 1SLBA 2HLEA 3ATGA 4AI2A 3RYPA 3U14A 4JGZB 2K46A 3LB9A 2W39A 2R1BA 4Q0QA 3WHTA 5H9SA 5HCHA 3F95A 3WG4A 1RUD3 5BNPC 5DAXA 5KHKA 3T1MA 1LJ7A 1VB2A 3GJAA 1HRV2 4BXFA 1RUJ2 1PO12 5IJRA 5CVRA 2ZX2A 2VL4A 3WLUA 5BNOC 5JI9A 3BU0A 1MZ6A 1O5UA 3PUQA 4Y20B 3JBG1 1RIRA 3BODA 1I6XA 1V6JA 2Q1FA 2TEPA 3SH3A 4OMDA 1AX1A 4COZA 4A7YA 2XWBB 3ACFA 2ARCA 5I0SA 1S0IA 1HRI3 4LE4A 2ZOEB 1QQP2 1RUI1 5DAWA 4N43C 1J59A 5IVJA 2W9XA 3VKLA 1V0AA 4XAAA 3J4UH 4FSJA 1G9FA 1RC6A 2BWCA 4M4PA 5TSWA 2WZPP 3B93A 1W9TA 3GF6A 3LEKA 3NNMA 5AVPA 3VL8A 4EN0A 5B4NA 5M0TA 2AZ5A 2RE9A 3DKWA 4EZ4A 1DQ0A 4I30A 1S0GA 1RUE3 3U37A 3WEZA 3IBMA 4Z2AA 3LCPA 4I0WB 2XHKA 4XFGA 1AR72 3E6BA 4Q5OA 4E2QA 5LBCA 4BHPA 3ZFFA 4DUXA 5LY1A 5FP8A 3ETQA 2YGLA 3QD6A 4R4XA 5FJKA 1QJY3 3OBTA 3RDIA 2A6WA 2VD7A 1UF2C 2XLAA 3DV8A 3VD4A 1T6GC 4BU2A 4HN0A 4BPZA 1XC6A 4AHWA 1D2QA 3KT1A 4LKEA 1VBB3 3GYDA 4MX3A 4Y1VA 4K7JA 3GXUA 4RS5B 3WY6A 2D98A 2Y6GA 5A7NA 3JCIA 4NIGA 3UL2A 3VV1A 1K5MB 1W2TA 5JPMB 2HJIA 2GH2A 3CHXA 3OY8A 4AG4A 3V0AA 5LBFA 3BALA 3D6EA 2JDMA 2HWE2 3CKHA 1GANA 3TN91 3WNLA 2VZRA 1QMJA 4AFAA 1TME2 1ZNPA 2J1EA 2P6CA 4FPEA 4RSUA 3UGHA 1H0BA 1CZVA 1UQXA 3N9QA 4OUMA 3LGRA 3DF0A 2EXJA 2ADEA 2ZEWA 1YXWA 5DZGA 3P3PA 2RS33 5GLZA 4O7XA 4Z2WA 5L19A 3N7KA 4D8MA 2BQPA 1ZBA2 3NAPB 4A3ZA 2PTMA 2WNUA 3VD7A 1D2SA 3BI3A 2AREA 3H8RA 1MVQA 1ZREA 5GKAC 2DVAA 3L2HA 2DVDA 1UPSA 2BWAA 1TEIA 3ZYJB 4ASKA 5AC93 1WMEA 2F4LA 2IC1A 2EICA 2RMU2 3B02A 1NA1A 5DDJ1 3C2UA 3PVBB 1JN2P 1WUVA 3PU3A 1JMUB 1RUG2 2D6NA 1YIFA 4GB32 1VRH3 4CE8A 2OQ7A 3K51A 4QXKA 3MW3A 3ZYPA 3H9AA 5F3IA 3UGFA 2RM21 4U2AA 5IK8A 2VC9A 1QJU2 5L73A 2OS2A 2PELA 4Y5Z0 1NLRA 1EP0A 1LOBA 1R083 4BQ4A 4MH0E 4LUMA 2VUDA 4FFFA 3VD5A 5HV0A 1LTEA 3H1WA 3CMGA 2X09A 3AM2A 4PIYA 2ILMA 1PMHX 2NMNA 4FXKB 1AF9A 4Y5TA 1LNSA 2Q0AA 4C1XA 1W3XA 1F5FA 4DEQA 5C5UA 1JZ7A 4AI0A 3TRSB 4HK9A 1PVC2 4FBFA 1W2NA 2ZJCA 5DG2A 1R091 3ORJA 2HWF1 3AKQA 4D6RA 4F83A 4NMIA 3AZZA 3N9MA 2KR2A 4NHMA 4QX1A 4XJZA 4ZY9A 2VCMA 1KFUL 3VZMA 2XBO2 4CDUA 4UXAA 4A45A 4PDWC 5DXDA 1OPOA 3QCWA 1QJEA 1PIV1 1DFQA 1PO21 1G9BA 2QQOA 3MF9A 3CJIA 5ABJA 2WO1A 1OFNA 3APBA 4XBQA 5F3EA 3RSJA 3WNNA 5FZEA 1VE0A 5BYNA 5I0DA 3ZOIA 3ZXGA 5EIYB 3HD8B 1RVF3 2ZX0A 3ZXKA 5JZGA 2ZX4A 3ZKUA 5IT6A 4NAOA 1G6NA 2A6VA 1POQA 2OA2A 1OURA 1D0GA 5FYHA 2PLV2 4GWJA 5D21A 3LIHA 1SPPA 2WZR2 1HB1A 3OUHA 2B9VA 5GJ6A 5FRAA 1IHMA 4COYA 4DMIA 4CUCA 2Y6HA 4IDZA 2B7YA 5I0TA 5FZLA 1E5IA 2V4VA 1VMJA 1Y9QA 5A80A 3RMXA 4FTEA 1MQTC 2D97A 4CXYA 5IHRA 2XVGA 3I2HA 4QPIC 2AGSA 1X36A 3Q9OA 5FZMA 5KXEA 2IXIA 2RS51 4JDNA 3MLJA 3J26N 4KNCA 1KGYA 4P14A 4QKNA 1HV1A 1N3QA 4YG6A 5BNPB 1ZRFA 5I8TA 3UK9A 3ZFFB 1A34A 4AVSA 1JYXA 5BNOB 4Y5SA 1VPHA 4IV3C 5KC5A 4IGOA 1IS5A 5FP7A 1RUC1 1LOFC 1VBE3 4L97A 2QQVA 4XURA 1GSLA 3LPGA 1AJKA 4IEWA 1AZDA 2FBEA 4XW3A 4B8EA 1OQ1A 5L9BA 1W6NA 4LKDA 4CCDA 2VVEA 4BWOA 1EUTA 4LITA 1UKGA 2JG8A 1YFXA 4JKLA 4FPHA 3U11A 4N43B 4E8DA 3VUOA 2R32A 1GBGA 2BRTA 5SV8A 1RUF3 3CJXA 2JWPA 4D69A 1MS4A 2AH2A 1SG3A 5IW0A 5HI0A 2G9ZA 5GZGA 4AYUA 5ANNA 2HWB3 2VNRA 2Y8KA 5A7OA 1POV1 1R64A 2A73B 4MOAA 1OVSA 3ITQA 3WDUA 5F6LB 1QJX1 3GM8A 1OH3A 3FC0A 5GLVA 4GKYA 2OPKA 3J9SA 1H4HA 3RI9A 3EMRA 3WDTA 4YARA 1NKGA 1XQNA 2W47A 2WSVA 4IEUA 5L36A 4AFBA 3C8XA 3NV4A 3CZUA 3MPBA 2RVAA 2PHWA 2DVBA 2PHUA 3FUQA 3PU8A 1PGW1 2ET1A 3LEMA 2ZX1A 4LTAA 4YGEA 1K3IA 1GZ9A 3F2ZA 4OQ9A 3BIEA 3AZVA 1GZWA 1CAWA 1NA1B 1ND3C 5IK7A 5A3UA 3WINE 3WP3A 5FLHA 4KBZA 4O61A 3E5XA 1BQPA 1H30A 1W3VA 1UIKA 2ARXA 2PXJA 4IE0A 5FFOC 4AI9A 4FOWA 4OHVA 5J48A 4QXCA 2BUKA 3V0BA 3I2IA 4ZONA 5C8CA 3AK0A 4K8FA 4RHV2 3R4DB 1KXGA 2DCYA 3DXTA 2QDRA 4W8JA 1AR83 3D8CA 1D4M3 4Q4X3 4HSLA 1OT5A 2WAOA 1E5SA 4HMZA 4NJ4A 1SLCA 1PHMA 4E27A 1Q43A 4IUGA 2G1MA 2BFUS 4KWJA 2R041 2MEV3 1RHI3 2VW2A 3WW3A 4BMBA 1DDLA 1UY4A 3UV9A 1UPIA 2WNEA 1LGBA 3VN4A 5IVFA 1DLLA 1UYPA 2UYBA 3R0RA 1DGWX 2VBPA 4IV1C 2CGPA 2ARAA 1OUXA 1PK6C 1ASJ2 1ND2A 3E5UA 1W6MA 1O5LA 2VQ0A 1RUH3 2EIEA 3WNMA 5KHJA 2DBNA 4ZXKA 4Q4Y2 4UFKA 3KWVA 4Y24A 2ERFA 1FPN3 1J1TA 4LO4B 2VZ1A 1V00A 2P1BA 1W8FA 1L7LA 4HZFA 5DQ0A 1RB8G 5FK7A 4YPJA 5EYXA 3AB0A 4C91A 2DCTA 1KITA 1G7YA 3ZXLA 2J7MA 4QQOA 3AMMA 4CU7A 5FMBA 4DY5A 2PQQA 2W94A 3N9LA 4IGPA 5JZGB 1OD5A 3PURA 3RPQA 1N1YA 1Q8SA 2VNGA 3JBG2 1V6KA 3PIJA 1SPPB 5LA2A 5SV5A 4MHRA 4PJYA 3A7QA 1WCQA 4FQZA 3POEA 4XMIA 1OF3A 1I5PA 2W3JA 2DTWA 1BBT1 4YM1A 4OULA 1B35C 1O3SA 1AXZA 1GMMA 1HB4A 4KG8A 4LPLA 4MXVA 2RDSA 1PMJX 1T6BX 3G7DA 2YV8A 1OF4A 3AP5A 4JRLA 4XE9A 3S5QA 4GJYA 2WBKA 2ZZQA 1P8JA 1K45A 2GAUA 1F9KA 4BH9A 2BOIA 5T50A 1OI6A 1SDDB 1CD3G 3LFIA 3OBRA 2D43A 5C6CA 1JYIA 1NQJA 1UU6A 2Y6JA 2VXJA 2BJSA 3ZO0B 5F2SA 5HCFA 3ZSEA 2CU5A 2VBBA 2K9ZA 3PL0A 4COVA 1W0OA 2XJRA 2NP0A 3MYXA 3OCPA 4PQQA 3VBFC 1G86A 1GWLA 4UWDA 4OHWA 1DGWA 3O1TA 1XNKA 3AYCA 2XLFA 1AR93 3BOWA 3HNMA 5F5AA 1AR73 1S1AA 2BVVA 4LK7A 3WUCA 4CEWA 3AZXA 1RXGA 4JAAA 1KS5A 5FR3A 3SHRA 1ZRCA 1YI7A 2A6ZA 2VQTA 4Q27A 2H0BA 4QPIB 1Y9GA 5J98B 5FZHA 4A2UA 4Z1VA 5LBEA 4AGVA 2ZGOA 1JYWA 2ATFA 3ZXAC 2WL1A 5HCBA 4P9LA 3DXUA 4R52A 2ZEZA 2Y34A 4IV3B 4LBKA 3S30A 3HR9A 3KV5A 4R9AA 3VZJA 4GMP1 4OHZA 1WW5A 2Y6KA 2VCAA 1UOJA 1CJDA 5I0UA 3IPVA 4KL1A 2HWE3 1Q8PA 1YQ8A 2QQJA 4HBNA 4Q8LA 4XJUA 5FYMA 3ZSKA 2W1QA 2Q1MA 1N1VA 2C6SA 2RJKA 1ODNA 2BVBA 4GH4A 1HRV1 3OEAA 1RUJ1 1PO11 4QU2A 1LHNA 4O9GA 1FOD2 4JRAA 3WNPA 4JHZA 1ZM1A 4HKWA 4FAGA 5FY7A 3ZLIA 1MZFA 1S0JA 1ZBA3 3FHIB 5K7PA 1FMD3 2E26A 3M4FA 5IK5A 3P1IA 3V0BB 1JU3A 1PX4A 1W03A 2OW4A 3NNLA 4J1WA 3RZHA 3T3YA 4JCKA 2K0GA 1QQP1 2RDRA 4EV0A 5CKQA 1M06G 5CG9A 1NLSA 3JU9A 4B4PA 2VR4A 2J1TA 2G4IA 1QGLA 4UI9L 4NWVA 2GP5A 4WM8A 4XF3A 3GBFA 1H6YA 2R1DA 1XNTA 5LRRA 3O5SA 2BU9A 2QJVA 5BXXA 3K77A 4Q0VA 5BNNA 4YGDA 2JG9A 2XJPA 2ZX3A 3OGRA 1SHWB 1JZ4A 1ND3B 2D3RA 4LHKA 3T4VA 2RDQA 2HWF2 4WZCA 2VUCA 2ZGPA 3HQXA 3I54A 1HIXA 1IQDC 1T2XA 4DB5A 4RD7A 3K48A 4CPBD 1CAXB 1IKPA 1EYBA 5C9AA 3VD3A 5FPLA 1WLWA 5C8WA 3ASIA 4J1XA 2LW8A 1Y3TA 4XCAA 3ZYIB 1VBA2 2J42A 2NM1A 4Y1XA 5JAXA 2EA7A 3RZMA 1MZ5A 2P34A 1GUIA 1NY72 2R0HA 1ULGA 4ZU5A 4DUVA 1BCXA 3KF3A 1Z7S3 5JR2A 3MV01 1HB3A 1TME1 3MEPA 4WBBA 4ARXA 1WW4A 5FCCA 1W6PB 3B94A 1VBC3 2RJ2A 3S7IA 5FPBA 3MICA 2A5ZA 1W2OA 1NCRA 3U1XA 1QHDA 1O8PA 2UU8A 2XB6C 4DY3A 2D6MA 1CAUA 2EAAA 2PYTA 2ZGLA 3CF6E 4XILA 4BB3A 1MS8A 1BMV2 4LHLA 5FUNA 2ZMLA 4N7UA 5A32A 1DGRA 4AQ6A 1IQAA 1WZXA 4FT8A 2E7TA 2RS52 3TEXA 5A6QA 1SLIA 4G4FA 2RMU1 3RYKA 4KG0A 4OFGA 3KT4A 2E31A 4AI3A 5GZEA 1HN0A 2PAMA 1PZ8A 1RUG1 1UZVA 1IS4A 5C5TA 4GB31 3U4XA 4XJAA 4XCBA 1QJU1 4CDQC 3VBUA 4JGZC 4ISQA 4QX3A 5DN2A 3ON7A 5FPXA 5JDBA 3AXDA 1JI6A 1B35B 3JD73 4CEWB 4D7YA 2YC0A 2R16A 1H9PA 2DU1A 2F17A 2GNBA 1CWPA 3O0WA 2RS11 5CBLA 4NPLA 1UN1A 5FP3A 2BBAA 4CDXC 4UF0A 3U78A 3POBA 3KCCA 4IERA 1PVC1 4E2SA 4NHKA 2HEVF 2DTYA 1CVNA 1QJX2 1CQ9A 2BGPA 2QUOA 1I3HA 2WQ8A 4XFFA 5KWRA 4QKDA 3PVNA 2A3XA 2XBO1 1O4TA 3T08A 4Y1ZA 3ZXJA 1JS9A 3C3VA 3I2GA 3IZOA 4ONUA 4X6RB 5FWEA 3VBFB 5C3QA 4AE2A 1N47A 4HETA 4V2VA 4S2GA 4DNYA 1PGW2 1UL9A 3NJXA 2BERA 3HJRA 3OBZA 4QQ2A 5FO9B 5EJ3A 4PLOA 3LPFA 2XWJB 1GU3A 3D0JA 3MFAA 2TBVA 4QDQA 1FI2A 5T3NA 2VVFA 5I93A 4W50A 3PTRB 2X53S 4BOWA 3TNQA 4N53A 5G05L 1H1MA 2PLV1 3V65A 2V73A 2DFBA 4Y1UA 1UMHA 1XSQA 2W1WA 2HKXA 3JB4C 1NUKA 5D1IA 4BQ2A 1AYM2 2H6BA 2IVIB 1U5YA 3V64A 2FMDA 2HWD2 4Y33A 3VKFC 1W28A 4LBQA 3WDWA 3FBMA 4JX0A 4K20A 1RMU2 4FTSA 4NR1A 3T2TA 1YJKA 1LGNA 4WM8B 1ULDA 3PIGA 2OKXA 1VBD2 4IQPA 5JOZA 4W4ZA 4XFHA 3WG1A 1BKZA 2J1RA 2R072 5CAZA 4F8AA 2JG9B 3W5MA 4TSVA 3T0DA 1DGLA 1AX0A 1EAH3 4A6OA 3R4SA 1OD3A 3KCYA 5A6YA 4LBQD 3BIWE 3HN3A 4OZXA 3UJQA 2YFUA 4CEYA 1NCQA 1VMHA 4PI2A 4QPGA 2R49A 2DWRA 2WZ8A 1JZ2A 4P9JA 5DZEA 5FZGA 5T5PA 3IDCB 5DAPA 2K2SA 4P9XA 5L9RA 1SZBA 1O3TA 4GKXA 4XTMA 1X7NA 1V6IA 2FCVA 4N9IA 3ZVXA 3VBOA 1BEV2 3RZZA 3JQXA 4EE2A 1WCUA 2QE3A 4L9BA 2I07B 3U75A 3LDRA 5FPAA 2R0FA 2FZ2A 3GZEA 1GKBA 1ST8A 5DAVA 3WW1A 5EJZB 1MEC3 1OUSA 2VOTA 4AEJA 2LALA 3M70A 4LO8A 5HXVA 1OC1A 2XQRA 3OF1A 2NPIA 5FIXA 2ZGTA 1AX2A 1CPNA 5H9RA 3ZN6A 4B4QA 2H0VA 3KZ4C 2R061 3LDBA 5KHHA 3FFQA 1TE1B 3GCWA 2WNVA 1H8TC 5F5CA 3D5OA 2EXKA 5EJ1B 2GDFA 2XR4A 1CAUB 3AP7A 3A0KA 1JOPA 1JH5A 3EJKA 3HVDA 5FLJA 2QFEA 4I09A 3BTZA 2E7QA 3EYPA 2JIJA 3W9AA 4SBVA 3WUDA 1WBLA 2PFWA 2RJLA 2VW0A 3PTYA 4YW7A 5FQ0B 1RUI3 4NPMA 4AVCA 3O0VA 1HW5A 3MO4A 3MIDA 4JGYA 1DU3D 4DXZA 2B46X 1R1A2 3KS7A 2VO5A 3ZFGA 4S2HA 1J58A 2GN3A 2VTXA 2QQUA 1C3HA 3CNAA 4FQ4A 3ZDVA 4RHV1 2P2KA 3NW4A 1WGPA 2B42B 2WFPA 5FYVA 3VDCA 1DQ6A 4K3UA 5FDBA 3OTFA 2YYOA 3MIEA 3AKTA 1QY4A 3E97A 1WA6X 3HOBA 2BPA2 1RUOA 2D44A 3J7HA 5A7WB 3WR0A 4A42A 2WQ4A 1ZZ9A 5FY0A 4Q4V2 2FCTA 5F1RA 3WNXA 1LB2A 4QX8A 5JI7A 3ZSJA 2XL7A 1UZZA 1F5JA 2ZPXA 5A33B 5I0RA 1JHJA 5JCTA 4MHUA 3RYRA 1JZ8A 5JR7B 1U5XA 1ASJ1 2YC4A 2UYAA 1UMZA 2A75A 2CAVA 4NIAA 4A41A 4Q4Y1 2NQYA 1WKYA 4CZSA 3IDEA 2BBVA 4CDQB 5F8PA 4EQVA 2RR13 1UX7A 1BJQA 1JTZX 1A8MA 2WO2A 1OQDA 3NVCA 2VMEA 5D8AA 3SCHA 3TN93 3ZX7A 4AZZA 4M3CF 1TZOA 4OUSA 4YLZA 4JKMA 4KMQA 5EZWA 3P6BA 2E33A 3OGJA 2ZKLA 3ZFFC 1QOOA 1CAVA 1FNZA 4QAWA 5JSPA 2RDNA 2GMEA 3I8TA 4L0PA 4GA9A 4CCOA 4CDXB 4DPNA 2HH9A 5A6ZA 1UYXA 1WMXA 2WYSA 3NV2A 3CU7A 4E4DX 1QKQA 4BDVB 2IXHA 4QQHA 2AUYA 4PLNA 5DDJ3 3H8XA 1CZTA 4CU8A 5LA0A 2A70A 4Q8KA 4HG6B 5FY9A 2RM23 1X82A 4Z07A 4BYYA 5BY5A 5K0UA 2GZWA 1CR7A 1N1TA 3C7FA 3DPRA 3AJZA 2WNUC 3ACLA 3OJBA 3WF3A 4BXSV 1SBEA 5A7QA 1F2NA 2D6OX 4M3CB 5J96B 1STMA 2DU0A 2FZ1A 1S0FA 4IE7A 1Y43B 3UESA 2HWC1 1NA1C 1R093 1X8EA 1G8WA 2E51A 3QLQA 3SCFA 4ISRA 5HV4A 5DPNA 4M4RA 4PLMA 3AKSA 2ZA9A 2AR6A 1D0HA 4JDOA 4OLLA 3MZHA 3U10A 4ZS2A 3FMGA 4H7MA 2JE8A 4AR2A 3ZPOA 4NUBA 5ACA2 3POWA 1PIV3 1PO23 1XBFA 4NIHA 5C7GA 2Z2SB 1WWYA 2QKDA 3A0NA 2FDHA 2WINB 4IEVA 1YLLA 4ZZ8A 5JXIA 2ZCWA 1QJZA 1IOAA 3LFMA 4RGAA 3ZKYA 4H14A 2VCBA 3AFGA 2W87A 3G6JB 5LK7B 2XQXA 5A3LA 5IVEA 3N7JA 1WLCA 4HVRA 5FLIA 1GWMA 5AFBA 2Q5TA 1GR3A 5CU1A 3WOGA 1GNHA 1FOD1 2XXZA 4NRQA 2XJQA 2B9UA 3FLTA 3PMSA 3I4IA 2VVDA 4CU9A 2ZGSA 1C8M2 4HFSA 5FY8A 2QNKA 1DF0A 1DYPA 1YQ2A 2VMCA 3ZFGB 5A3TA 2B8MA 1V6OA 4CDUC 1AXYA 4GD4A 5FK8A 2VXRA 3GDBA 3E5QA 3A23A 4XXAA 5T55A 4K9SA 4OMCA 3ZIXA 3CJIC 3ZSLA 1W05A 3ZYBA 5FREA 1UOBA 2LRPA 1W9YA 2VMFA 1NXMA 5CKNA 2TUNA 3BCWA 1TMF2 3VBRA 5IAVA 1H8TB 1NG0A 5A1LA 1HJFA 5JZGC 2JJ6A 1RUC3 4XQ4A 2J1VA 2WUHA 2RS12 5L7OA 3M3EA 1HXS1 1KQRA 1O8SA 3ZXFA 2G9GA 4L2NA 1C1LA 1KEXA 2W1SA 3RNSA 1DLCA 1AR62 2QQKA 4AWDA 5IYYA 2PHXA 2CTVA 4QMAA 3MUZ1 2ARBA 2QTWB 2YDEA 4YW1A 3T4HB 3AL6A 5F7UA 2QCSB 4QDSA 1ACCA 3RGBA 3KSCA 4XEZA 4QB2A 1QXPA 2DYCA 4HANA 4NOTA 1ZYBA 5CEHA 1O3QA 5D8AB 4FP2A 1POV3 4INDA 1XB9A 5HBAA 2YPDA 1W39A 1WLDA 1YNAA 2CGNA 2LUWA 1HV0A 1O59A 1WBFA 3JZVA 4EN7B 1VBA1 2XJTA 4O9EA 4YZ2A 1FYUA 1GNZA 4XDPA 1DCSA 1LU1A 1NY71 4I0AA 1VBB1 4NPRA 3SEPA 3B69A 4AVAA 5F9TA 3VKNA 5EV7A 4YYOA 5LA9A 2ID4A 1IGOA 4RR3A 4Q2FA 4E2GA 2ZS6B 1LKNA 2P6HA 2W68A 4N9HA 3TEZA 4FTBA 1FATA 2Q8OA 2JG8C 4AF9A 4GALA 4KU8A 3ACIA 2OXBA 1J83A
chains in the Genus database with same CATH topology
1SDDB 3AC0A 1XNAA 4XUQA 1US3A 1US2A 2Y6JA 3DYPA 3NQHA 1ULPA 4JKKA 3WF1A 3T2QA 2X05A 1NAEA 5LA1A 4PQQA 3IIIA 3PUHA 2CDOA 1RYYA 3C7EA 1F4HA 3HNMA 5C70A 2V5DA 4P02B 1UZ0A 2VQTA 4BJ0A 1W9WA 2BGOA 3UETA 4MO3M 2ZEXA 1JYWA 3OEBA 3T0BA 3ETPA 3FHAA 2ZEZA 1TVGA 1UYYA 5A1AA 2J22A 2Y6KA 2VCAA 2Y64A 4DXSA 2QQJA 4KI5M 3DYOA 2W1QA 3CQOA 3WNKA 3DECA 3T2PA 2QQNA 3OEAA 1W8NA 1EUUA 5DMYA 2ZEYA 3VDBA 3WNPA 4JHZA 1UY1A 3OGVA 4LQRA 2E26A 2X10A 5J1XA 3P1IA 1JU3A 1PX4A 1UXZA 2JD9A 4CUBA 3E1F1 3T0AA 1CIYA 4UAPA 1UYZA 2ORZA 2VR4A 2J1TA 3NJVA 2QQMA 4GZ9A 4UI9L 2WZEA 1H6YA 2HYXA 1XNTA 4LHSA 3VDAA 5HPOA 4QB6A 3K77A 2VZ3A 3MV11 3OGRA 1SHWB 1JZ4A 1UWWA 2B4KA 3HNBM 1TG7A 5IFTA 1CZSA 3I2JA 1IQDC 1T2XA 4BK5A 2VJXA 4ARYA 3C7HA 3I3EA 3VD3A 2W92A 2LW8A 2QQLA 4P00B 1UY3A 4OYUA 2W95A 4DXTA 1H6XA 2WAAA 4P08A 4QDRA 1GUIA 1GQPA 4DUVA 4MGQA 1J84A 4XVHA 5JR2A 3MV01 4ARXA 3D3AA 2R7EB 1PX3A 3IB3A 2WABA 4MADA 4FI9A 2RJ2A 1K42A 3NRUA 2DCKA 2J1SA 3HPNA 4E8CA 2KD7A 1O8PA 4XUTA 4GWIA 3I97A 3WF4A 3IDAA 1F4AA 2E31A 3SKVA 2DCJA 4QX2A 2YG0A 3OG2A 3HNYM 2EIBA 4A44A 3EB7A 4QX3A 5DN2A 1JZ5A 2PQSA 3WF0A 4PT6A 1JI6A 1GNYA 3LQCA 3GGLA 2W5FA 2BBAA 1UXXX 4CU6A 2YFZA 3MUY1 2HLEA 5JXGA 3ACHA 3FHQA 2BGPA 3K4AA 4CVUA 2WQ8A 3I2FA 3WNOA 2XONA 3I2KA 5IJRA 3T08A 2VL4A 3FN9A 3I2GA 3ABZA 4OMDA 3NJXA 2WN3A 2BERA 3HJRA 3ZM8A 3ACFA 3LPFA 4BK4A 1GU3A 2VZUA 3A21A 4QDQA 3WSOA 3IAPA 5JXHA 4W50A 2V72A 2W9XA 5G05L 2DDUA 2Z4FA 4M4PA 1UMHA 2W1WA 1NUKA 1W9TA 3LEKA 2J1AA 5B4NA 4CUAA 2VCCA 2ZXQA 4JX0A 3MBWA 3U37A 3WEZA 4Z2AA 3JXSA 4OUEA 4DUXA 2OKXA 3I3BA 2EIDA 2W91A 4W4ZA 2J1RA 3W5MA 3VD4A 3T0DA 1XC6A 4A6OA 4XZUG 1OD3A 2YB7A 1JYVA 3HN3A 2YFUA 2C9KA 3GXUA 1CX1A 2Y6GA 3T2OA 2WZ8A 1JZ2A 2VZQA 2BZDA 4AG4A 3WNLA 3CKHA 5JXJA 2WDBA 4QPWA 2VZRA 2J1EA 1CZVA 4UOJA 3WF2A 2ZEWA 3BGAA 1L7RA 3CZJA 5EJZB 2VOTA 4D8MA 4A3ZA 3VD7A 1NX9A 4QX0A 2WN2A 2JDAA 2EICA 1W99A 1JZ6A 5EJ1B 3SEEA 1GOFA 4OZOA 1W0NA 3LEIA 3EYPA 4QB1A 3NNGA 4DUWA 4D0QA 2VC9A 2VTFA 4ZZ5A 1UMIA 3CIHA 3MO4A 2VMDA 3VD5A 2VO5A 2J1UA 1DYOA 3CMGA 2X09A 4PF1A 1PMHX 3VDCA 1LNSA 1JYNA 2WO3A 4DEQA 1JZ7A 2VZOA 3WQBA 3K4ZA 3HOBA 1L7QA 5JMOA 4ZY9A 3J7HA 3UNPA 4QX1A 4A42A 4A45A 3K4DA 4RN5A 2XHNA 5C71A 1UY2A 1JHJA 2QQOA 1JZ8A 2VZSA 2WO1A 2YC4A 4A41A 3ECQA 3WNNA 3IAQA 1WKYA 5I0DA 4TTGA 5EIYB 1W9SA 3A22A 1UX7A 4GWJA 2WO2A 2VMEA 2YC2A 4AAXA 4LKSA 2B9VA 2VM9A 4MGSA 3K75B 4CUCA 5HXMA 2Y6HA 4JKMA 4KMQA 3P6BA 2E33A 3PUIA 4ZXEA 2QQIA 2V4VA 2QBXA 3BN6A 4QAWA 4L0PA 5IHRA 3I2HA 1UYXA 2Y6LA 2WYSA 4DEVA 4BDVB 1KGYA 1UY0A 5CYYA 2JKXA 1CZTA 4KWUA 1OH4A 4CU8A 3THDA 4ET7A 1JYXA 5LA0A 4HG6B 2W1UA 4XUOA 4XURA 3LPGA 3C7GA 3LE0A 2VQUA 1W8OA 3K46A 1MPXA 1EUTA 4JKLA 4E8DA 1BHGA 1ULOA 3C7FA 1SG3A 3WF3A 4BXSV 3OBAA 4TXWA 2Y8KA 4RYDA 4MOAA 1R64A 5FUIA 4P5YA 5G04L 3UESA 3GM8A 1NKGA 2W47A 3OB8A 5DPNA 3VD9A 4M4RA 2RV9A 3C8XA 2VZVA 1GOGA 3CZUA 2C4XA 2JE8A 5JUVA 2RVAA 5C7GA 1K3IA 3F2ZA 2C26A 2ORXA 4ZZ8A 5JXIA 3HEIA 1DP0A 2VCBA 1K12A 2W87A 2L9LA 2XQXA 4DXRA 5IFPA 3I3DA 3I2IA 1D7PM 3W5NA 3T09A 4W8JA 3THCA 4CU9A 1OT5A 2WAOA 2VZTA 1YQ2A 2VMCA 1XPWA 4IUGA 3CDZB 4XUPA 3GDBA 5LCWL 1JU4A 3A23A 1UY4A 4OMCA 3OGSA 2VMFA 2XOMA 2J1VA 2WUHA 2EIEA 3WNMA 2W46A 1O8SA 5B4XA 3LEGA 1KEXA 2W1SA 1DLCA 2VZ1A 2QQKA 1GOHA 5IYYA 5DQ0A 4YPJA 3MUZ1 1HN1A 2J7MA 4CU7A 5F7UA 2W94A 4QDSA 3SKJE 4QB2A 3FL7A 5LA2A 3A7QA 1WCQA 1O59A 2LS6A 1OF3A 4A4AA 1I5PA 2VZPA 2W3JA 4XUNA 1GMMA 4LPLA 2CDPA 3DYMA 3C7OA 1PMJX 3ACGA 3SEPA 1JZ3A 1OF4A 2ID4A 5CZKA 2WBKA 1P8JA 1K45A 2E32A 3ACIA 1J83A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SDD B;  3AC0 A;  1XNA A;  4XUQ A;  1US3 A;  1US2 A;  2Y6J A;  3DYP A;  3NQH A;  1ULP A;  4JKK A;  3WF1 A;  3T2Q A;  2X05 A;  1NAE A;  5LA1 A;  4PQQ A;  3III A;  3PUH A;  2CDO A;  1RYY A;  3C7E A;  1F4H A;  3HNM A;  5C70 A;  2V5D A;  4P02 B;  1UZ0 A;  2VQT A;  4BJ0 A;  1W9W A;  2BGO A;  3UET A;  4MO3 M;  2ZEX A;  1JYW A;  3OEB A;  3T0B A;  3ETP A;  3FHA A;  2ZEZ A;  1TVG A;  1UYY A;  5A1A A;  2J22 A;  2Y6K A;  2VCA A;  2Y64 A;  4DXS A;  2QQJ A;  4KI5 M;  3DYO A;  2W1Q A;  3CQO A;  3WNK A;  3DEC A;  3T2P A;  2QQN A;  3OEA A;  1W8N A;  1EUU A;  5DMY A;  2ZEY A;  3VDB A;  3WNP A;  4JHZ A;  1UY1 A;  3OGV A;  4LQR A;  2E26 A;  2X10 A;  5J1X A;  3P1I A;  1JU3 A;  1PX4 A;  1UXZ A;  2JD9 A;  4CUB A;  3E1F 1;  3T0A A;  1CIY A;  4UAP A;  1UYZ A;  2ORZ A;  2VR4 A;  2J1T A;  3NJV A;  2QQM A;  4GZ9 A;  4UI9 L;  2WZE A;  1H6Y A;  2HYX A;  1XNT A;  4LHS A;  3VDA A;  5HPO A;  4QB6 A;  3K77 A;  2VZ3 A;  3MV1 1;  3OGR A;  1SHW B;  1JZ4 A;  1UWW A;  2B4K A;  3HNB M;  1TG7 A;  5IFT A;  1CZS A;  3I2J A;  1IQD C;  1T2X A;  4BK5 A;  2VJX A;  4ARY A;  3C7H A;  3I3E A;  3VD3 A;  2W92 A;  2LW8 A;  2QQL A;  4P00 B;  1UY3 A;  4OYU A;  2W95 A;  4DXT A;  1H6X A;  2WAA A;  4P08 A;  4QDR A;  1GUI A;  1GQP A;  4DUV A;  4MGQ A;  1J84 A;  4XVH A;  5JR2 A;  3MV0 1;  4ARX A;  3D3A A;  2R7E B;  1PX3 A;  3IB3 A;  2WAB A;  4MAD A;  4FI9 A;  2RJ2 A;  1K42 A;  3NRU A;  2DCK A;  2J1S A;  3HPN A;  4E8C A;  2KD7 A;  1O8P A;  4XUT A;  4GWI A;  3I97 A;  3WF4 A;  3IDA A;  1F4A A;  2E31 A;  3SKV A;  2DCJ A;  4QX2 A;  2YG0 A;  3OG2 A;  3HNY M;  2EIB A;  4A44 A;  3EB7 A;  4QX3 A;  5DN2 A;  1JZ5 A;  2PQS A;  3WF0 A;  4PT6 A;  1JI6 A;  1GNY A;  3LQC A;  3GGL A;  2W5F A;  2BBA A;  1UXX X;  4CU6 A;  2YFZ A;  3MUY 1;  2HLE A;  5JXG A;  3ACH A;  3FHQ A;  2BGP A;  3K4A A;  4CVU A;  2WQ8 A;  3I2F A;  3WNO A;  2XON A;  3I2K A;  5IJR A;  3T08 A;  2VL4 A;  3FN9 A;  3I2G A;  3ABZ A;  4OMD A;  3NJX A;  2WN3 A;  2BER A;  3HJR A;  3ZM8 A;  3ACF A;  3LPF A;  4BK4 A;  1GU3 A;  2VZU A;  3A21 A;  4QDQ A;  3WSO A;  3IAP A;  5JXH A;  4W50 A;  2V72 A;  2W9X A;  5G05 L;  2DDU A;  2Z4F A;  4M4P A;  1UMH A;  2W1W A;  1NUK A;  1W9T A;  3LEK A;  2J1A A;  5B4N A;  4CUA A;  2VCC A;  2ZXQ A;  4JX0 A;  3MBW A;  3U37 A;  3WEZ A;  4Z2A A;  3JXS A;  4OUE A;  4DUX A;  2OKX A;  3I3B A;  2EID A;  2W91 A;  4W4Z A;  2J1R A;  3W5M A;  3VD4 A;  3T0D A;  1XC6 A;  4A6O A;  4XZU G;  1OD3 A;  2YB7 A;  1JYV A;  3HN3 A;  2YFU A;  2C9K A;  3GXU A;  1CX1 A;  2Y6G A;  3T2O A;  2WZ8 A;  1JZ2 A;  2VZQ A;  2BZD A;  4AG4 A;  3WNL A;  3CKH A;  5JXJ A;  2WDB A;  4QPW A;  2VZR A;  2J1E A;  1CZV A;  4UOJ A;  3WF2 A;  2ZEW A;  3BGA A;  1L7R A;  3CZJ A;  5EJZ B;  2VOT A;  4D8M A;  4A3Z A;  3VD7 A;  1NX9 A;  4QX0 A;  2WN2 A;  2JDA A;  2EIC A;  1W99 A;  1JZ6 A;  5EJ1 B;  3SEE A;  1GOF A;  4OZO A;  1W0N A;  3LEI A;  3EYP A;  4QB1 A;  3NNG A;  4DUW A;  4D0Q A;  2VC9 A;  2VTF A;  4ZZ5 A;  1UMI A;  3CIH A;  3MO4 A;  2VMD A;  3VD5 A;  2VO5 A;  2J1U A;  1DYO A;  3CMG A;  2X09 A;  4PF1 A;  1PMH X;  3VDC A;  1LNS A;  1JYN A;  2WO3 A;  4DEQ A;  1JZ7 A;  2VZO A;  3WQB A;  3K4Z A;  3HOB A;  1L7Q A;  5JMO A;  4ZY9 A;  3J7H A;  3UNP A;  4QX1 A;  4A42 A;  4A45 A;  3K4D A;  4RN5 A;  2XHN A;  5C71 A;  1UY2 A;  1JHJ A;  2QQO A;  1JZ8 A;  2VZS A;  2WO1 A;  2YC4 A;  4A41 A;  3ECQ A;  3WNN A;  3IAQ A;  1WKY A;  5I0D A;  4TTG A;  5EIY B;  1W9S A;  3A22 A;  1UX7 A;  4GWJ A;  2WO2 A;  2VME A;  2YC2 A;  4AAX A;  4LKS A;  2B9V A;  2VM9 A;  4MGS A;  3K75 B;  4CUC A;  5HXM A;  2Y6H A;  4JKM A;  4KMQ A;  3P6B A;  2E33 A;  3PUI A;  4ZXE A;  2QQI A;  2V4V A;  2QBX A;  3BN6 A;  4QAW A;  4L0P A;  5IHR A;  3I2H A;  1UYX A;  2Y6L A;  2WYS A;  4DEV A;  4BDV B;  1KGY A;  1UY0 A;  5CYY A;  2JKX A;  1CZT A;  4KWU A;  1OH4 A;  4CU8 A;  3THD A;  4ET7 A;  1JYX A;  5LA0 A;  4HG6 B;  2W1U A;  4XUO A;  4XUR A;  3LPG A;  3C7G A;  3LE0 A;  2VQU A;  1W8O A;  3K46 A;  1MPX A;  1EUT A;  4JKL A;  4E8D A;  1BHG A;  1ULO A;  3C7F A;  1SG3 A;  3WF3 A;  4BXS V;  3OBA A;  4TXW A;  2Y8K A;  4RYD A;  4MOA A;  1R64 A;  5FUI A;  4P5Y A;  5G04 L;  3UES A;  3GM8 A;  1NKG A;  2W47 A;  3OB8 A;  5DPN A;  3VD9 A;  4M4R A;  2RV9 A;  3C8X A;  2VZV A;  1GOG A;  3CZU A;  2C4X A;  2JE8 A;  5JUV A;  2RVA A;  5C7G A;  1K3I A;  3F2Z A;  2C26 A;  2ORX A;  4ZZ8 A;  5JXI A;  3HEI A;  1DP0 A;  2VCB A;  1K12 A;  2W87 A;  2L9L A;  2XQX A;  4DXR A;  5IFP A;  3I3D A;  3I2I A;  1D7P M;  3W5N A;  3T09 A;  4W8J A;  3THC A;  4CU9 A;  1OT5 A;  2WAO A;  2VZT A;  1YQ2 A;  2VMC A;  1XPW A;  4IUG A;  3CDZ B;  4XUP A;  3GDB A;  5LCW L;  1JU4 A;  3A23 A;  1UY4 A;  4OMC A;  3OGS A;  2VMF A;  2XOM A;  2J1V A;  2WUH A;  2EIE A;  3WNM A;  2W46 A;  1O8S A;  5B4X A;  3LEG A;  1KEX A;  2W1S A;  1DLC A;  2VZ1 A;  2QQK A;  1GOH A;  5IYY A;  5DQ0 A;  4YPJ A;  3MUZ 1;  1HN1 A;  2J7M A;  4CU7 A;  5F7U A;  2W94 A;  4QDS A;  3SKJ E;  4QB2 A;  3FL7 A;  5LA2 A;  3A7Q A;  1WCQ A;  1O59 A;  2LS6 A;  1OF3 A;  4A4A A;  1I5P A;  2VZP A;  2W3J A;  4XUN A;  1GMM A;  4LPL A;  2CDP A;  3DYM A;  3C7O A;  1PMJ X;  3ACG A;  3SEP A;  1JZ3 A;  1OF4 A;  2ID4 A;  5CZK A;  2WBK A;  1P8J A;  1K45 A;  2E32 A;  3ACI A;  1J83 A; 
#chains in the Genus database with same CATH topology
 3J8F 2;  1IG3 A;  3N36 A;  5APA A;  1IZ3 A;  1BXH A;  3AC0 A;  5A1F A;  3ZYG A;  3RMY A;  5JVV A;  1US2 A;  5FBJ A;  1BMV 1;  3JUU A;  4LE3 A;  1ULP A;  3H1M A;  2GMM A;  3OYW A;  4JKK A;  4MUV A;  5FP9 A;  3WF1 A;  1LUL A;  3T2Q A;  1NAE A;  5LA1 A;  4XOG A;  5KXC A;  1RUN A;  2Z79 A;  3PUH A;  5K0U B;  1W0P A;  5E89 A;  1H2N A;  4HT1 T;  5FZO A;  1XND A;  1UKR A;  1BZW A;  1EV1 3;  1F35 A;  3B3Q E;  3RJR A;  2JKB A;  1RED A;  2ZAA A;  3WV6 A;  4C8D A;  2V5D A;  3DPR B;  4P02 B;  5FMO L;  1SLL A;  2R04 3;  4BQ3 A;  2GC0 A;  1NLQ A;  4TLF A;  1SFN A;  4WM7 A;  5L9V A;  3B7M A;  1A78 A;  4K40 A;  2VOW A;  3UET A;  1S0B A;  2ZEX A;  2HEY F;  4RFR B;  5FZ6 A;  4PDW A;  3OEB A;  3WT3 A;  4AGR A;  3T0B A;  5JSO A;  1G9D A;  3S5A A;  1PGL 1;  1UD1 A;  1V6M A;  1ZZ7 A;  2XGX A;  2Y6F A;  3BPZ A;  4XQD A;  4URT A;  2BOJ A;  3OY8 B;  1AYN 2;  2Y60 A;  4XIK A;  3V0A B;  4BLI A;  3MIF A;  1GZT A;  4LBN A;  1QF3 A;  2Y64 A;  3RI8 A;  5C8C C;  1OOP A;  3I59 A;  3DYO A;  4PQ9 A;  1DZR A;  3R6S A;  3WNK A;  3T2P A;  2QQN A;  5E6H A;  1W8N A;  4QXB A;  2MHF A;  4H2A A;  2R06 2;  5LZ6 A;  2JDY A;  1W8H A;  3IT8 A;  4AQ2 A;  1UY1 A;  1GZC A;  2WNU B;  3UYJ A;  5FTT C;  4LQR A;  4BQ5 A;  3EXU A;  1S55 A;  2WR9 A;  3PJQ A;  1ZZC A;  4NRM A;  4CDW A;  2AEN A;  1KD7 A;  5FZK A;  3M8L A;  4NHX A;  2Q8C A;  4UAP A;  1PM7 A;  4Q29 A;  1SEF A;  1BBT 3;  1QJF A;  1C5I A;  4KWL A;  1ND2 C;  1REE A;  1UYZ A;  1HQL A;  3EO6 A;  4CCN A;  1KRI A;  2WZE A;  1SAC A;  1AYM 1;  2KM2 A;  2F6B A;  3UKV A;  2HWD 1;  5HPO A;  1PNG A;  1BVP 1;  1RVF 1;  2JB8 A;  1LOF A;  1RMU 1;  2DBI A;  2G9F A;  4QM9 A;  2O0O A;  3MV1 1;  5ANQ A;  5F6K A;  2WT0 A;  1UWW A;  2YHJ A;  1A3K A;  1KFX L;  4ZHN A;  2UY8 A;  4Q1P A;  1VBD 1;  5D2A A;  5FXV A;  3ES1 A;  1U0A A;  2ZGU A;  1SLA A;  2XUE A;  1IPJ A;  2R07 1;  3DUI A;  3VL9 A;  3AFK A;  1N3P A;  4Y22 A;  4IE5 A;  2IXL A;  5FYT A;  5FZD A;  4BK5 A;  2P3K A;  3H42 B;  5EXO A;  1UOG A;  3C7H A;  2I74 A;  3K3N A;  3ME2 A;  2BGC A;  4CRQ A;  3MF6 A;  1ODM A;  1G9C A;  4E4S A;  3WDV A;  3ZFE A;  3R05 A;  3AMP A;  3I49 A;  4P00 B;  1ULE A;  2O8Q A;  3LAG A;  4CDU B;  4YFZ A;  2W95 A;  1WD3 A;  5IVC A;  1BEV 1;  3OUJ A;  3QOP A;  3CJI B;  3SIS A;  5ABJ B;  1JOB A;  3LZZ A;  4FPL A;  3D3A A;  2R7E B;  5A7S A;  1UOF A;  2JIC A;  2PA7 A;  3BYW A;  2WAB A;  2MPF A;  5E1R A;  1H1I A;  4XHX A;  3NRU A;  2J1S A;  4UW5 A;  1UW8 A;  3HPN A;  4XDQ A;  3SMH A;  1QNY A;  3SLI A;  4GMP 3;  1LGC A;  1HQW A;  1UU5 A;  2WT2 A;  3N4M A;  4IL7 A;  5DAQ A;  1QU0 A;  1LOE A;  1NXD 1;  4NRO A;  2FDJ A;  2LM3 A;  3W20 A;  1PNF A;  3WF4 A;  1HRV 3;  4EZH A;  1RUJ 3;  1PO1 3;  5LY2 A;  5IVV A;  2Y0O A;  3BTY A;  1J3P A;  4RGG A;  3NV1 A;  4CEW C;  3OPZ A;  5FZA A;  1TNF A;  3SKV A;  5GLW A;  4N8M A;  4QX2 A;  2X5I A;  1COV 2;  3OYW B;  1SDW A;  2YG0 A;  2YXS A;  5HCA A;  3ILF A;  2VQA A;  1JW6 A;  1RXF A;  3VDD A;  3VZN A;  2EIB A;  4A44 A;  4Q4W 2;  3X29 B;  4K8R B;  1QQP 3;  3TEW A;  1WCD J;  2LTN A;  4COU A;  1M4W A;  3AP9 A;  1ENX A;  1MS0 A;  2VMH A;  2GC3 A;  4H3W A;  3UJO A;  3VBH A;  1R1A 1;  4YVS A;  4ZS3 A;  1F31 A;  5FZ8 A;  4W65 A;  2D5H A;  4AEM A;  3PHM A;  1OVP A;  4GWM A;  5EQU A;  3K3O A;  2XPJ A;  1UXX X;  2GSY A;  4EWD A;  5A3P A;  1W6N B;  4CU6 A;  5J36 A;  1DQ5 A;  2DF7 A;  4GH4 C;  3SH4 A;  1VAV A;  3UGG A;  2JDH A;  2JG8 B;  3MUY 1;  2NZ9 A;  5JXG A;  5K8S A;  4HL0 A;  1YUD A;  2BYV E;  2DVF A;  5FO7 B;  1HB2 A;  3FHQ A;  2AYH A;  3K4A A;  3BOP A;  2HWC 2;  4EJR A;  1W6O A;  3I2F A;  3ZXD A;  5CNA A;  4YM0 A;  4XJW A;  1HJG A;  4Q4V 1;  3U07 A;  3FN9 A;  5BUV A;  2O14 A;  3D4K A;  2Y38 A;  4YWA A;  4JHT A;  1OOP B;  3O1V A;  5FKB A;  4WZF A;  1UX6 A;  2SLI A;  3H7Y A;  2Q1Z B;  5F2W A;  2MNG A;  2YBS A;  2DV9 A;  4BK4 A;  2YBK A;  4B1M A;  5JXH A;  3POJ A;  2X8K A;  2WFF 2;  3AYE A;  4WM8 C;  4FFG A;  1VLN A;  1UCX A;  4OHX A;  2QQW A;  2DDU A;  2Z4F A;  4CDW B;  3WW4 A;  3RZJ A;  1TME 3;  5BNN C;  4B29 A;  4B3N A;  2JG9 C;  3LIG A;  1GZW B;  1CAW B;  1OA3 A;  3KF5 A;  4CUA A;  3I2O A;  3M3O A;  2VCC A;  1W9F A;  2EAK A;  1XJA A;  2XVK A;  4CSW A;  3MBW A;  2ZGR A;  4FAH A;  5H9P A;  1IPK A;  4V2W A;  2P5B A;  4LOS A;  4EYU A;  5J37 A;  1RUD 2;  3BTA A;  3I3B A;  1F15 A;  4K1Z A;  4UFL A;  5C8C B;  2W91 A;  1CJP A;  4PBO A;  1YWK A;  4GXL A;  5C9A C;  4HOO A;  4YVW A;  5JWP A;  2YU1 A;  4B7K A;  2RMU 3;  5FYU A;  2YUE A;  2D6K A;  2Q30 A;  2YB7 A;  3ZYH A;  3OUI A;  4LK6 A;  1RUG 3;  2VBD A;  4LUL A;  1CX1 A;  5ERL A;  3D82 A;  4GB3 3;  3NO8 A;  4OI4 A;  2CYF A;  1AL0 G;  1HRI 2;  3PNA A;  4CPB A;  4GAZ A;  1QJU 3;  4X8P A;  2ZMN A;  1HXS 2;  1VRB A;  1QEX A;  3TBD A;  3RFR A;  1OQE A;  4CP0 A;  1FT9 A;  3Q8E A;  2C0Z A;  4QPW A;  4XBN A;  5FXX A;  1ND2 B;  2C1F A;  3SXW A;  1W6M B;  3O1M A;  3H3L A;  2VNO A;  3NL1 A;  3WF2 A;  3WZ1 A;  4RQP A;  2RS1 3;  5JOY A;  5K9Y A;  1RUE 2;  1L7R A;  5FZB A;  2XML A;  4NVP A;  1ZRD A;  4K21 A;  2VU9 A;  3GBG A;  1JXN A;  1NX9 A;  4ZPI A;  3T30 A;  1PVC 3;  2YPJ A;  5FJH A;  5KXB A;  2CWS A;  4Y4R A;  5FP4 A;  3AZY A;  3WCR A;  2GU9 A;  2JDA A;  1JZ6 A;  1W99 A;  2XBO 3;  4DQA A;  3ZPY A;  3QBQ A;  1J1L A;  4NHY A;  1V9U 1;  1VBB 2;  4UFH A;  3SEE A;  4B4R A;  4LJH A;  4YZ3 A;  4OZO A;  5ACA 1;  3VBU C;  1W0N A;  3FX3 A;  4XET A;  1LU2 A;  1YYN A;  5FBZ A;  2P3I A;  4DUW A;  4LNV A;  5J09 A;  2VTF A;  1VIW B;  2W08 A;  1GIC A;  4ZZ5 A;  1QXJ A;  1UMI A;  3CIH A;  2BNN A;  4MGT A;  3NJY A;  3RVH A;  4YRD A;  2PHF A;  1C5H A;  1UAI A;  2PLV 3;  3AVS A;  1XRU A;  1CIW A;  5C4W A;  2WZR 3;  4CP1 A;  4QGL A;  4XMA A;  4DOU A;  3H0O A;  4GUL A;  4FPC A;  2JDZ A;  3WQ7 A;  5CFC A;  3RZL A;  3OD0 A;  4NAM A;  5CA6 A;  5FPU A;  1JYN A;  1KJL A;  2WO3 A;  4AED A;  2QZ2 A;  3ZSM A;  1C8M 1;  1R1Z A;  4PIZ A;  3AMQ A;  2Q8D A;  2V09 A;  1MS1 A;  1SFP A;  3K4Z A;  2GNT A;  5AC9 2;  1L7Q A;  5JMO A;  1FNY A;  1MVE A;  1UNB A;  3IWZ A;  3S0M A;  3B01 A;  3K4D A;  4RN5 A;  5A7P A;  3VGI A;  4BE3 A;  1YJL A;  1TMF 1;  2VE1 A;  1MS5 A;  1UY2 A;  4YW2 A;  1S2K A;  3FUO A;  2VZS A;  4UFJ A;  4YGC A;  4X8N A;  4KQ7 A;  3VHN A;  3I7D A;  2JE9 A;  3ECQ A;  4PCR A;  1PGL 2;  4XZP A;  4MV2 A;  4N53 C;  2WNO A;  5FY4 A;  3RG0 A;  4ZU4 A;  1AR6 1;  1DBN A;  2WS9 1;  1AL2 1;  1R08 2;  2RHP A;  2OQ6 A;  1YC6 1;  4GIQ A;  4Z82 A;  5FY1 A;  3TWI A;  4M0N A;  1OFS A;  3THT A;  4ATF A;  1FAY A;  1OLM E;  3I2D A;  3MIG A;  2YC2 A;  5GZD A;  4HLT A;  4XHB A;  4LKS A;  1Z78 A;  2VM9 A;  3HT1 A;  3IIA A;  3K75 B;  1GYK A;  4TYS A;  5CFD A;  3KM5 A;  4ZXE A;  4MGK E;  5A3O A;  2VUL A;  4LBM A;  3IPV B;  2QQI A;  3VBS A;  3M2M A;  4IEZ A;  1Q8O A;  4D7S A;  4GH4 B;  3AKR A;  2Y6L A;  3GHN A;  5L7O B;  1GP4 A;  4PI0 A;  3BVC A;  4CEY C;  1XE0 A;  4OVE A;  3GNE A;  2QDN A;  4QPG C;  3W21 A;  5T5L A;  2ZAC A;  1J3Q A;  4I3P A;  5CYY A;  1S0E A;  1YIP A;  3THD A;  4ET7 A;  1MR5 A;  5I91 A;  4XUO A;  1BK1 A;  3VB9 A;  3VBO C;  3P5B A;  2VQU A;  4LA2 A;  3J8F 1;  1W8O A;  3POI A;  1RVF 2;  1NQD A;  3K46 A;  4IE6 A;  4XYX A;  2BFU L;  2P3Y A;  1CX4 A;  2WSU A;  1B09 A;  4QGN A;  1X33 A;  4JGZ A;  3KHC A;  3PUA A;  2JB4 A;  4R9C A;  1XYP A;  1VBC 1;  2WWJ A;  3VLB B;  1ULO A;  3PDQ A;  5FXZ A;  5BNN B;  4RHV 3;  2AEY A;  4C0H A;  3D0S A;  1W06 A;  4MVT A;  4XC9 A;  3HAG A;  4WVM A;  4DRV A;  5FMD A;  4TXW A;  5DG1 A;  1SLT A;  1V6L A;  1W2A X;  2FDF A;  4BIO A;  4Y20 A;  5EPA A;  4P5Y A;  5FUI A;  5G04 L;  2VY0 A;  5DUU A;  3FFZ A;  3RRD A;  4E9K A;  2WNV C;  1IG0 A;  1YCI A;  2ZHM A;  2C5D A;  2XKO A;  2IXC A;  3H50 A;  2ZGK A;  1C4R A;  4AI8 A;  5LWB A;  4XXP A;  3VHP A;  1LRH A;  2VOX A;  1BYH A;  1LED A;  2ZHK A;  3AYD A;  1Y7B A;  5IVY A;  2RV9 A;  2VZV A;  1GOG A;  2C4X A;  5C3S A;  5JUV A;  4AL9 A;  1N1S A;  4HSJ A;  4P9Y A;  1LOC A;  1RJ8 A;  2P17 A;  4J25 A;  1VBE 2;  4BM8 A;  1YEW A;  2C26 A;  1ASJ 3;  2QQP A;  1Q3E A;  3HEI A;  4JGY C;  1QWR A;  3WCS A;  1AYN 1;  3KMH A;  4Q4Y 3;  3GZA A;  4GQ7 A;  3ZFG C;  2XH6 A;  1I9R A;  1K12 A;  2O1Q A;  1X8M A;  3KVA A;  2L9L A;  4UW4 A;  5IK4 A;  3BTX A;  3FE5 A;  1VR3 A;  4DXR A;  3M7A A;  3KQ4 B;  3AMH A;  1GFF 2;  2D6L X;  1RUF 2;  1ZZB A;  2IXK A;  3I3D A;  4RFT 0;  5IFP A;  1OLR A;  1C8N A;  4MGY E;  4YW3 A;  3W5N A;  2PAE A;  3T09 A;  1A8D A;  4WV8 A;  1NCR B;  2IFW A;  2HWB 2;  1OKQ A;  2OYZ A;  2YRO A;  3HMY A;  2OX0 A;  4CP9 A;  3JBG 3;  3OSD A;  1V6N A;  3CDZ B;  4FOQ A;  5A32 B;  1URX A;  2KA3 A;  3MGU A;  1S0D A;  4KBB A;  3LSD A;  4RS5 A;  4XUP A;  4FOV A;  3V56 A;  5LCW L;  5DZF A;  1K5M A;  3QH7 A;  1DHK B;  4HKO A;  1LES A;  3LSE A;  3TAY A;  4A7Z A;  4HPK A;  2CSG A;  2Q8E A;  1SCR A;  3FLR A;  1WLT A;  2VPV A;  4L8Q A;  1NYW A;  3RZG A;  1XOY A;  3VBU B;  4H7L A;  5C3O A;  2E63 A;  3WDY A;  2VMI A;  4CTE A;  1EPW A;  5D8A C;  1GQH A;  3LEG A;  3NKG A;  3NNJ A;  1GOH A;  5FYZ A;  2FMY A;  3NAP A;  2FD8 A;  1Q5O A;  1HN1 A;  1PZ9 A;  3RS6 A;  4LR4 A;  3FWE A;  3KHB A;  1E57 A;  5LEJ A;  3SKJ E;  3LDK A;  4UF0 B;  1AR8 2;  5JOX A;  1D4M 2;  4Q4X 2;  4XAB A;  3EQE A;  5CIR A;  3ZN4 A;  3EHK A;  5EHD A;  3SQO A;  2NN8 A;  3PME A;  1HLC A;  1F8V A;  1UIJ A;  3FL7 A;  3L9J T;  4IES A;  3N9O A;  5GM0 A;  1QOS A;  2DUQ A;  4JTN A;  2MEV 2;  4AFD A;  1RHI 2;  4XIO A;  2HWC 3;  3HN1 A;  2LS6 A;  4WVZ A;  5AVA A;  4A4A A;  4EWE A;  2VZP A;  3VHR A;  1G9A A;  2ZHN A;  2PHL A;  4ASM B;  3DEM A;  5A3M A;  2A1X A;  2CDP A;  2A6Y A;  4ASL A;  3PJY A;  3DYM A;  2D3P A;  5FZ9 A;  3ACG A;  1JZ3 A;  1VMF A;  2P3J A;  2V4A A;  5EWS A;  3TB0 A;  3VKO A;  4WVW A;  5CZK A;  5J3U A;  5K0U C;  1RUH 2;  5C3R A;  1RTV A;  5KXD A;  2HBT A;  4UT5 A;  1DYK A;  2W0X A;  4N53 B;  3DPR C;  4YZ4 A;  1QDC A;  4XUQ A;  3DYP A;  4BZ4 A;  1OKO A;  3ZR5 A;  4AW7 A;  4HVO A;  4CXW A;  4TZD A;  3ZXE A;  1YI9 A;  4YW5 A;  1LEN A;  3KQR A;  3NNF A;  4QX5 A;  5FPV A;  5FXW A;  4I3G A;  3USS A;  1S2E A;  4LBQ B;  4WVV A;  1FX5 A;  1FOD 3;  2HYK A;  2Y33 A;  4NID A;  2GN7 A;  1RYY A;  3C7E A;  3DN7 A;  1ALY A;  1ZBE 1;  1COV 1;  4LEJ A;  4XAE A;  3W59 A;  1LEM A;  5C70 A;  3KCX A;  3VZO A;  4LOR A;  4AVV A;  4HVQ A;  2EAL A;  4Q4W 1;  4WVM B;  2VW1 A;  5LRS A;  5GZF A;  1NE4 A;  3O1P A;  2Q4S A;  5A6X A;  4CA9 A;  4CEY B;  1NCQ B;  3GZT B;  4QPG B;  4F7Z A;  4HXC A;  3J7M A;  2BNM A;  3ETP A;  3S7E A;  3ES4 A;  1O3R A;  4XFA A;  4QKB A;  1LHO A;  3IN9 A;  4Q26 A;  5FV3 A;  3KB5 A;  1UYY A;  3HIF A;  4JV4 A;  2XL9 A;  4CP2 A;  3AX4 A;  2J22 A;  3VHO A;  1HXS 3;  4AOC A;  3KV6 A;  1SBF A;  3VBO B;  1SBD A;  1S0C A;  2CY6 A;  3ST7 A;  4DXS A;  4KI5 M;  3DKQ A;  4FPY A;  2IFR A;  3CQO A;  3OPW A;  4XFB A;  3MI8 A;  4P9W A;  1E5H A;  5JOW A;  3POG A;  2HWF 3;  4M01 A;  1EUU A;  3M3C A;  4NHL A;  4LHN A;  5FYS A;  3HQR A;  3SIT A;  3VZK A;  2AEZ A;  5IWF A;  4P9I A;  3UKT A;  5BNP A;  2DVG A;  1AR9 2;  1V9U 2;  2X10 A;  3N9N A;  5BV6 A;  4MGZ E;  1OPM A;  3ZN6 B;  5BNO A;  1KJR A;  3AJY A;  1UXZ A;  4CUB A;  3E1F 1;  3T0A A;  3GAL A;  3OOX A;  2WNV B;  4LLF A;  3VBR C;  1VBA 3;  5F3C A;  2IUW A;  1X9T A;  2WFF 1;  4CP9 B;  2ORZ A;  3WW2 A;  1ONA A;  2W2I A;  5AFE A;  2V5Y A;  2VAU A;  3ELN A;  2QQM A;  1A6C A;  4PIX A;  1OMI A;  5L7O C;  4N43 A;  5GZC A;  5KHI A;  4LHS A;  5CB7 A;  2XJV A;  4QB6 A;  3BB6 A;  3RQ0 A;  4W6W A;  1XYO A;  3IM0 A;  1XNB A;  4HPK B;  2VZ3 A;  2RR1 1;  4JGY B;  4EN8 B;  4ES9 A;  4LBJ A;  2B4K A;  2WRA A;  2WWU A;  1RUD 1;  3M1H A;  4XJ8 A;  5FY5 A;  1XE7 A;  1XE8 A;  5FZ0 A;  1XYN A;  1YRZ A;  1TG7 A;  2WJS A;  5C9A B;  1CZS A;  2RS5 3;  1KDM A;  1CN1 A;  3I2J A;  1VJ2 A;  3IKW A;  4NN0 A;  2ZZJ A;  1LOD A;  1QIQ A;  2VJX A;  3B9C A;  4NRP A;  4YFW A;  2YY1 A;  1FMD 2;  5ABJ C;  1WW7 A;  2JEN A;  3I3E A;  4QQP A;  3WX5 A;  2BDR A;  2A71 A;  2W92 A;  4G9S B;  1HRI 1;  2QQL A;  2WA3 A;  3MIB A;  1UY3 A;  2UUR A;  2WQZ C;  4ZU7 A;  4LO7 A;  1H6X A;  4P08 A;  4QDR A;  4RR3 C;  4Y26 A;  2D7F A;  1AL2 2;  2WS9 2;  4XVH A;  2XG3 A;  4Q0P A;  4A3X A;  4LUK A;  1PX3 A;  2ZBJ A;  5LK5 A;  2VG9 A;  1YQ6 A;  1FV3 A;  2FQP A;  3IB3 A;  2XDV A;  2BNO A;  4NE9 A;  1RUE 1;  2GAL A;  2KD7 A;  4UBH A;  1HQN A;  4FP3 A;  4JVA A;  5JIA A;  4G3Y C;  1WMD A;  1CGP A;  5F5I A;  4IET A;  3I97 A;  2WLQ A;  4QQL A;  4LIV A;  4HN1 A;  3IDA A;  1NOV A;  1QJY 1;  1Q56 A;  1QJX 3;  3N35 A;  5F3G A;  5BPX A;  5LAS A;  3GJB A;  2NLR A;  1BLZ A;  1C57 A;  1IPS A;  1CAV B;  4RL7 A;  4MZU A;  4CCC A;  1ZA4 A;  2EF6 A;  4WM7 C;  2VGD A;  3AKP A;  3LA2 A;  2I2S A;  2ENR A;  4D94 A;  3DGT A;  5F39 A;  2A6X A;  2WT1 A;  4L99 A;  4PBP A;  1DQ1 A;  1YFU A;  3KGL A;  2UY9 A;  4NO4 A;  4QGM A;  5FYI A;  1C28 A;  2ZHL A;  5KBF A;  2NYY A;  4CXX A;  1JZ5 A;  1Z7S 2;  2PQS A;  2WA4 A;  2WYF A;  4AQT A;  4COW A;  4QX7 A;  5JLV A;  5KC6 A;  5F32 A;  2X29 A;  1GNY A;  4M3C E;  4AVT A;  5EFU A;  3J7N A;  1CON A;  3THP A;  1VBC 2;  3LQC A;  1AYM 3;  2RS3 1;  5J7M A;  1OOP C;  2W5F A;  2HWD 3;  4TN7 A;  3CO2 A;  2JDN A;  1KDK A;  5A70 A;  4YGB A;  2YFZ A;  1RMU 3;  2ET7 A;  2BTV C;  2PHR A;  3BU7 A;  1Q8Q A;  3KLS A;  3URF A;  1DQ2 A;  2GNM A;  3KGZ A;  5I8Y A;  3ACH A;  4BIF A;  5AC9 1;  4BCU A;  1CES A;  2D6P A;  4XAC A;  1VBD 3;  4CVU A;  3WNO A;  1DZQ A;  1REF A;  2XON A;  3I2K A;  4O65 A;  5FZ1 A;  3UKN A;  2R07 3;  1Q8V A;  4CDW C;  3TYJ A;  1ENS A;  4MET A;  2WC2 A;  5FO8 B;  3ABZ A;  3JB8 A;  4ZKT B;  4H55 A;  1VRH 1;  2WLP A;  4IGQ A;  4MSV A;  4MG2 A;  1DG6 A;  2WN3 A;  3ZM8 A;  1RIN A;  3K2O A;  5IAT A;  2TNF A;  3LWC A;  2VZU A;  3A21 A;  3WSO A;  3IAP A;  1K5J A;  3O14 A;  1R08 1;  2V72 A;  1QDO A;  4AEK A;  3JD7 2;  1YFW A;  2Y26 A;  1J3R A;  4U36 A;  5E16 A;  4IEO A;  5GLU A;  4JDM A;  4UYB A;  1BEV 3;  2D93 A;  4XPV A;  2QZ3 A;  3HQU A;  5F5Q A;  4BLJ A;  2J1A A;  4YW4 A;  4AGG A;  4CCE A;  1W6Q A;  1JUI A;  2ZXQ A;  2JXA A;  4Q0S A;  4RGK A;  2HEW F;  4QKF A;  4W6X A;  1SFY A;  3JXS A;  4OUE A;  1RIT A;  3FLP A;  4M0H A;  2EID A;  1MQT A;  1XU1 A;  4R9D A;  3DL3 A;  3GCX A;  4QPI A;  1QNW A;  1JYT A;  3AVR A;  4YG3 A;  4XZU G;  1RL3 A;  4IEQ A;  3ZFE C;  4BQ1 A;  3WQ1 A;  3RZK A;  1JYV A;  1X9P A;  4Y3O A;  5K4L A;  1L3J A;  1LHU A;  1YQC A;  1S4C A;  2C9K A;  2ZGN A;  1JOJ A;  3E6D A;  3PVE A;  4Y1Y A;  3T2O A;  2VZQ A;  4AVB A;  2BZD A;  1AUY A;  1YQ5 A;  4IV3 A;  1AVB A;  3SH5 A;  2BEO A;  4FPO B;  2D40 A;  3IMN A;  3VBR B;  2WII B;  4X6Q B;  5JXJ A;  2WDB A;  4IEY A;  4OCT A;  3KT7 A;  1LCL A;  1R1A 3;  4UOJ A;  5JPN B;  4IW3 A;  2XKP A;  4UW3 A;  5EYY A;  2GC2 A;  4YG0 A;  5BNQ A;  3BGA A;  1O91 A;  3H7J A;  1XXN A;  1ZX5 A;  3ENR A;  3O12 A;  2PN5 A;  3POF A;  3CZJ A;  3TNP B;  4BQX A;  4QWN A;  2AC1 A;  2BV4 A;  4YM3 A;  1OLM A;  3PVO A;  1W8U A;  2GP3 A;  4I01 A;  4QX0 A;  2R30 A;  1C1F A;  4DS0 A;  2LRO A;  1IS3 A;  3WP5 A;  2X5I C;  2B39 A;  2WN2 A;  4UFI A;  4A6S A;  3E6C C;  4R4Z A;  1EAH 2;  2FHR A;  4Q4V 3;  1ZZ6 A;  3I3M A;  1EV1 1;  2DUR A;  2SBA A;  3RJ2 X;  1GOF A;  3VDD C;  4P9G A;  2ADD A;  5CKM A;  1VBE 1;  4XJ9 A;  2DUO A;  3LEI A;  3MW2 A;  4QB1 A;  3Q8C A;  3NNG A;  4AXO A;  1AXK A;  2CHH A;  3OPT A;  4D0Q A;  3HBZ A;  3VBH C;  4YVS C;  5I8S A;  4NWW A;  5FYC A;  1WD4 A;  1LR5 A;  1OA2 A;  4ERO A;  1XU2 A;  2VMD A;  1ND3 A;  3CL1 A;  2VTX J;  4RR3 B;  1RUF 1;  1H9W A;  2J1U A;  1DYO A;  1W04 A;  4OHY A;  5LB6 A;  1QH7 A;  4PF1 A;  1OA4 A;  3LD8 A;  1JHN A;  2A3W A;  5IVB A;  1EPZ A;  4OI0 A;  1MEC 2;  2HWB 1;  3DCQ A;  4DIQ A;  3WHU A;  3Q8A A;  1EY2 A;  2CNA A;  2VZO A;  3B5L B;  3N7L A;  4FFH A;  1ZBE 2;  1CAX A;  3LKJ A;  2GMP A;  4Q0U A;  3WQB A;  3B00 A;  4YZ5 A;  2VH9 A;  4AFM A;  1JYC A;  2OT7 A;  2YGM A;  3CEW A;  3OD4 A;  3MIH A;  4KH9 A;  3UNP A;  3Q8B A;  5H9Q A;  1W90 A;  2UWB A;  5FZO B;  5FAX A;  1OSG A;  3GBW A;  2XHN A;  5C71 A;  1QOT A;  2E7A A;  5B2G B;  4JZR A;  2HBU A;  4FPG A;  1W6P A;  1OLQ A;  4WM7 B;  1POV 0;  2O8O A;  1LEC A;  3IAQ A;  4YZ1 A;  2YU2 A;  1UZY A;  3BPS A;  4IV1 A;  1PK6 A;  1RUI 2;  5FZC A;  4TTG A;  2CAU A;  1W9S A;  1UU4 A;  2OVU A;  3EBR A;  3KV4 A;  3WD5 A;  3S57 A;  4E4Z A;  3A22 A;  3UT0 A;  2EXI A;  2VUA A;  3S6P A;  4PDW B;  1MZE A;  1XSR A;  4LBO A;  1NE6 A;  5T52 A;  4AAX A;  2N7G A;  2CWM A;  4MGS A;  4LXL A;  3MHZ A;  3N7M A;  4LOT A;  5HXM A;  1TQ5 A;  1WCK A;  1HKD A;  2EIG A;  1AR8 1;  3PUI A;  1D4M 1;  3NV3 A;  4Q4X 1;  4IEP A;  4AK3 A;  2QBX A;  3BN6 A;  2VMG A;  3R4U A;  3I59 B;  4AQS A;  4YVW C;  2MEV 1;  2CV6 A;  1DQ4 A;  1RHI 1;  4DEV A;  3CLP A;  4AHZ A;  1W6Q B;  4KU7 A;  2D5F A;  2QVS B;  2OII A;  5DUW A;  2I45 A;  2UWA A;  3SCG A;  3POY A;  5DUV A;  4CUG A;  1UY0 A;  1H2L A;  2JKX A;  3ILN A;  1V9U 3;  1OH4 A;  4KWU A;  4XF4 A;  1B35 A;  5ACA 3;  3POS A;  2JDP A;  2CL2 A;  1MQT B;  4CCM A;  1RUH 1;  1CPM A;  2W1U A;  3CBN A;  3C7G A;  1ULC A;  2ES3 A;  3LE0 A;  1JBC A;  1FPN 1;  4EN6 B;  2NMO A;  3AYA A;  1MS9 A;  2JD4 A;  4CCL A;  1LOA A;  1MPX A;  4QD2 A;  4NII A;  5LW9 A;  4RQP C;  1H2K A;  2RR1 2;  4YW6 A;  3TN9 2;  2DFC A;  4EWA A;  2P4E A;  2Z69 A;  4W6Y A;  4XQW A;  1BHG A;  2OUJ A;  3WP6 A;  1DZT A;  1I5Z A;  2EXH A;  4DFS A;  3GHM A;  2JEM A;  2VOK A;  2UWC A;  1UZW A;  3OBA A;  2BW8 A;  3T1L A;  4QU1 A;  5FOB B;  4N7I A;  2ZMK A;  3RWN A;  4RYD A;  1C8M 3;  1PMI A;  1PZ7 A;  2ZKN A;  3VBF A;  4UFM A;  2Z5W A;  1QH6 A;  3SNM A;  1SQ4 A;  2VNV A;  1FV2 A;  1ZRR A;  4FPK A;  1GWK A;  3OB8 A;  3VD9 A;  4Y22 B;  5DDJ 2;  5KR7 A;  4GJZ A;  1OBN A;  4C90 A;  1TMF 3;  4C1W A;  3LOB A;  4S2D A;  3ZFE B;  1NCR C;  2ORX A;  3ALQ A;  3NST A;  2RM2 2;  2EVX A;  3NJZ A;  1H4G A;  3AXE A;  1APN A;  4BQY A;  4D7T A;  3TEY A;  1DP0 A;  3Q8F A;  3ZDS A;  4PF5 A;  1FXZ A;  2CGO A;  5C4W C;  1AR6 3;  2IWG B;  2WS9 3;  1AL2 3;  5FZI A;  3SC7 X;  2B5H A;  5CFC C;  3HT2 A;  2WO7 A;  4Z92 B;  3O1R A;  4KGQ A;  2RG4 A;  1VP6 A;  2C24 A;  1WCS A;  2H6C A;  3H1Y A;  4AED C;  1D7P M;  1QJY 2;  3AMN A;  3N3H A;  4YNI A;  4Q1R A;  4D6Q A;  4E4H A;  4UBG A;  5DUX A;  1BVV A;  1X50 A;  5GAL A;  4R8H A;  3L2Y A;  5KHG A;  3THC A;  1MS3 A;  1AR9 1;  3QAC A;  3PLQ A;  1AR7 1;  1LHV A;  2GC1 A;  2VZT A;  3AZW A;  3H3Z A;  5CAD A;  2WWS A;  1W8W A;  1XPW A;  1O7F A;  3ZIW A;  2FDG A;  1R09 2;  1ZVF A;  3O1O A;  3BUC A;  5FOJ B;  1JU4 A;  1ENR A;  2JDK A;  4AAP A;  3QH6 A;  3MLL A;  3OGS A;  1AHS A;  2X5I B;  2JE7 A;  1H1A A;  1PIV 2;  1PO2 2;  2XOM A;  4XFI A;  3KVB A;  2R6Q A;  4ORF A;  1ULF A;  2WKK A;  3VDD B;  3ROU A;  1O6U A;  3BKZ A;  2RS3 2;  2W46 A;  2YBP A;  2BP6 A;  1V70 A;  4B7E A;  5B4X A;  4M00 A;  3J8F 3;  5EP9 A;  1IS6 A;  2HWE 1;  2VEC A;  3A4U A;  3OGG A;  4LLO A;  1WW6 A;  4MLO A;  4YVS B;  3VBH B;  3LF7 A;  5CFD C;  3B9I A;  4FPJ A;  4XF9 A;  4MYE A;  2F4P A;  3RWK X;  4C0B A;  3VBS C;  1OXC A;  3H3U A;  3M3Q A;  4IV1 B;  5FZ7 A;  3USU A;  1PK6 B;  5IUQ A;  3MLK A;  3WQ0 A;  1GV9 A;  1O4Y A;  3NMB A;  4IEX A;  2XLG A;  2OZ6 A;  3LA3 A;  5FKC A;  1OHF A;  1ZBA 1;  1WA4 A;  4S2F A;  1FMD 1;  3VKM A;  1MAC A;  3P3N A;  2ZAH A;  4PHZ A;  3VZL A;  2IVJ A;  4XTP A;  1JUH A;  4IXL A;  1VRH 2;  4N90 A;  4GMP 0;  3TOJ A;  1W6O B;  1VAK A;  3M3I A;  1ZRI A;  4QPY A;  4TWT A;  4BME A;  4LT5 A;  2IXJ A;  3J7L A;  3KD4 A;  2JIG A;  4I0B A;  4XUN A;  1YFY A;  3WG2 A;  4BA6 A;  5CIS A;  5LBB A;  4YM2 A;  4DIN B;  5FQ0 A;  3NKT A;  3C7O A;  3MPP G;  2FDK A;  4TLG A;  4L92 A;  4OI1 A;  4HK8 A;  5LAT A;  1RUC 2;  1S2B A;  4QT6 A;  3U0Z A;  3H8O A;  4MXW A;  2E32 A;  1PVX A;  5GLT A;  1AYN 3;  1TNR A;  1H8V A;  5FYY A;  5JMC A;  1U5I A;  4XF0 A;  5ISL A;  1PM4 A;  1XNA A;  3O1S A;  1US3 A;  3NQH A;  4LA3 A;  3NWK A;  1I1E A;  2FCU A;  3AL5 A;  3WVJ A;  2ETE A;  4BQW A;  2ZTN A;  2X05 A;  4JQR A;  5A7W A;  3ZR6 A;  3III A;  1RGS A;  1SCS A;  2CDO A;  2R06 3;  3KV9 A;  2PAK A;  5T5J A;  5JIU A;  1NCQ C;  4FO9 A;  4OI2 A;  3ZN5 A;  1F4H A;  4DRR A;  5JSR A;  5A33 A;  4UW6 A;  2P37 A;  4CCJ A;  1PGS A;  3IDB B;  3FJS A;  1UZ0 A;  1H2M A;  4AFC A;  5FPZ A;  1NZC A;  5T5O A;  4YVW B;  4D3W A;  1YHF A;  4LIU A;  3WP4 A;  5E88 A;  4BJ0 A;  1W9W A;  1Z7S 1;  2BGO A;  4FCA A;  4MO3 M;  1U12 A;  1WMF A;  4DZG A;  1IKQ A;  4CDQ A;  1Y4W A;  3O1U A;  2G19 A;  3FHA A;  1LAJ A;  2PMW B;  3ZMO A;  1TVG A;  4K6B A;  3WDX A;  1W8T A;  1E5R A;  5A1A A;  1U5Z A;  3MFC A;  5IAX A;  4QHZ A;  3LOI A;  2XVL A;  3O0X A;  4V1P A;  2WZR 1;  4OQ8 A;  4CDX A;  3DEC A;  1ZA7 A;  4D6S A;  4RQP B;  4XF1 A;  5FMC A;  4EN9 B;  5DMY A;  2FDI A;  2ZEY A;  3VDB A;  3I3Q A;  4ITC A;  4RS5 C;  3OGV A;  1EV1 2;  4LO6 B;  1K5M C;  3PUS A;  1N3O A;  5J1X A;  1ZZ8 A;  2E9Q A;  1YO8 A;  4Z8B A;  4MGI E;  4FPF A;  2JD9 A;  2R04 2;  4HON A;  3AP4 A;  5FWJ A;  4CYD A;  5C33 A;  4I2O A;  2KXL A;  1CIY A;  5E8A A;  3ZYF A;  3FZ3 A;  2DCZ A;  4DO0 A;  3W58 A;  2YZ4 A;  3HWJ A;  3U4S A;  3JD7 1;  4LMF A;  2OUH A;  2VOV A;  3NJV A;  2JEC A;  4GWN A;  4R9B A;  5A3N A;  4GZ9 A;  2A7A A;  2ZGM A;  3LA7 A;  4ATE A;  4A7K A;  2Z42 A;  2HYX A;  3HBK A;  3VDA A;  3NAP C;  1HX6 A;  4QHO A;  4HKL A;  5FMO S;  4LO5 B;  4P5H A;  2PHT A;  2XJS A;  4AI1 A;  4M3C A;  3AP6 A;  5FUP A;  2XUM A;  2GH8 A;  4KWK A;  5C4W B;  3HNB M;  2C9A A;  2E6V A;  3ZYR A;  4URA A;  3ZMN A;  3GZU C;  5FYB A;  5CFC B;  1GP6 A;  5IFT A;  1XNC A;  4Y4Y A;  1O4Z A;  4AED B;  2AAC A;  1SMV A;  4XBL A;  4ARY A;  2ZGQ A;  1ZBE 3;  1COV 3;  4JQT A;  4AHY A;  4J6G A;  1VAM A;  2JDU A;  3FBY A;  4FXG B;  5F37 A;  3MDP A;  4L11 A;  3USU B;  4AHX A;  4QM8 A;  2XJU A;  1BBT 2;  4OYU A;  4Q4W 3;  2B45 X;  2WAA A;  4DXT A;  1NT0 A;  1GQP A;  1Z0H A;  4RA0 A;  2A3Y A;  1J84 A;  1LOG A;  4MGQ A;  4IE4 A;  4CCK A;  4SLI A;  5C3P A;  4MAD A;  4XFC A;  4FI9 A;  1K42 A;  2DCK A;  1NZI A;  4E8C A;  1UO9 A;  4QHB A;  1VB4 A;  2OPW A;  2PHD A;  4XUT A;  3N9P A;  4GWI A;  1JOD A;  1DGR N;  2IZW A;  1RJ7 A;  4MXW B;  4FOY A;  5CFD B;  3O7O A;  4BIS A;  1VAL A;  3ILR A;  1GP5 A;  1F4A A;  4I02 A;  3WXP A;  4ES8 A;  4YSF A;  1EAH 1;  3VBS B;  2Y0I A;  2E53 A;  2GND A;  4FFI A;  5A3W A;  1GLH A;  1HDK A;  2DCJ A;  1QXR A;  1Y9M A;  4KGG A;  5T54 A;  4K1Y A;  2VUJ A;  1H8T A;  2JX9 A;  3INA A;  4JC1 A;  3IMM A;  3OG2 A;  2W52 A;  4JTO A;  1W2U A;  3MW4 A;  3HNY M;  5FZF A;  4QXH A;  3WG3 A;  5CG8 A;  4XDO A;  1KS4 A;  2D3S A;  1BK0 A;  3EB7 A;  1FPN 2;  5DAB A;  5FZ3 A;  2WFF 3;  1ENQ A;  3WF0 A;  4PT6 A;  1AJO A;  4LKF A;  2OZJ A;  1GQG A;  2ZAB A;  3GGL A;  1D4V B;  2DUP A;  3JQW A;  1W8Z A;  4LBL A;  1LHW A;  3H8U A;  4FVV A;  1MEC 1;  4F3J A;  2YMZ A;  5LEK A;  5FZ4 A;  4B1L A;  1DIW A;  1SLB A;  2HLE A;  3ATG A;  4AI2 A;  3RYP A;  3U14 A;  4JGZ B;  2K46 A;  3LB9 A;  2W39 A;  2R1B A;  4Q0Q A;  3WHT A;  5H9S A;  5HCH A;  3F95 A;  3WG4 A;  1RUD 3;  5BNP C;  5DAX A;  5KHK A;  3T1M A;  1LJ7 A;  1VB2 A;  3GJA A;  1HRV 2;  4BXF A;  1RUJ 2;  1PO1 2;  5IJR A;  5CVR A;  2ZX2 A;  2VL4 A;  3WLU A;  5BNO C;  5JI9 A;  3BU0 A;  1MZ6 A;  1O5U A;  3PUQ A;  4Y20 B;  3JBG 1;  1RIR A;  3BOD A;  1I6X A;  1V6J A;  2Q1F A;  2TEP A;  3SH3 A;  4OMD A;  1AX1 A;  4COZ A;  4A7Y A;  2XWB B;  3ACF A;  2ARC A;  5I0S A;  1S0I A;  1HRI 3;  4LE4 A;  2ZOE B;  1QQP 2;  1RUI 1;  5DAW A;  4N43 C;  1J59 A;  5IVJ A;  2W9X A;  3VKL A;  1V0A A;  4XAA A;  3J4U H;  4FSJ A;  1G9F A;  1RC6 A;  2BWC A;  4M4P A;  5TSW A;  2WZP P;  3B93 A;  1W9T A;  3GF6 A;  3LEK A;  3NNM A;  5AVP A;  3VL8 A;  4EN0 A;  5B4N A;  5M0T A;  2AZ5 A;  2RE9 A;  3DKW A;  4EZ4 A;  1DQ0 A;  4I30 A;  1S0G A;  1RUE 3;  3U37 A;  3WEZ A;  3IBM A;  4Z2A A;  3LCP A;  4I0W B;  2XHK A;  4XFG A;  1AR7 2;  3E6B A;  4Q5O A;  4E2Q A;  5LBC A;  4BHP A;  3ZFF A;  4DUX A;  5LY1 A;  5FP8 A;  3ETQ A;  2YGL A;  3QD6 A;  4R4X A;  5FJK A;  1QJY 3;  3OBT A;  3RDI A;  2A6W A;  2VD7 A;  1UF2 C;  2XLA A;  3DV8 A;  3VD4 A;  1T6G C;  4BU2 A;  4HN0 A;  4BPZ A;  1XC6 A;  4AHW A;  1D2Q A;  3KT1 A;  4LKE A;  1VBB 3;  3GYD A;  4MX3 A;  4Y1V A;  4K7J A;  3GXU A;  4RS5 B;  3WY6 A;  2D98 A;  2Y6G A;  5A7N A;  3JCI A;  4NIG A;  3UL2 A;  3VV1 A;  1K5M B;  1W2T A;  5JPM B;  2HJI A;  2GH2 A;  3CHX A;  3OY8 A;  4AG4 A;  3V0A A;  5LBF A;  3BAL A;  3D6E A;  2JDM A;  2HWE 2;  3CKH A;  1GAN A;  3TN9 1;  3WNL A;  2VZR A;  1QMJ A;  4AFA A;  1TME 2;  1ZNP A;  2J1E A;  2P6C A;  4FPE A;  4RSU A;  3UGH A;  1H0B A;  1CZV A;  1UQX A;  3N9Q A;  4OUM A;  3LGR A;  3DF0 A;  2EXJ A;  2ADE A;  2ZEW A;  1YXW A;  5DZG A;  3P3P A;  2RS3 3;  5GLZ A;  4O7X A;  4Z2W A;  5L19 A;  3N7K A;  4D8M A;  2BQP A;  1ZBA 2;  3NAP B;  4A3Z A;  2PTM A;  2WNU A;  3VD7 A;  1D2S A;  3BI3 A;  2ARE A;  3H8R A;  1MVQ A;  1ZRE A;  5GKA C;  2DVA A;  3L2H A;  2DVD A;  1UPS A;  2BWA A;  1TEI A;  3ZYJ B;  4ASK A;  5AC9 3;  1WME A;  2F4L A;  2IC1 A;  2EIC A;  2RMU 2;  3B02 A;  1NA1 A;  5DDJ 1;  3C2U A;  3PVB B;  1JN2 P;  1WUV A;  3PU3 A;  1JMU B;  1RUG 2;  2D6N A;  1YIF A;  4GB3 2;  1VRH 3;  4CE8 A;  2OQ7 A;  3K51 A;  4QXK A;  3MW3 A;  3ZYP A;  3H9A A;  5F3I A;  3UGF A;  2RM2 1;  4U2A A;  5IK8 A;  2VC9 A;  1QJU 2;  5L73 A;  2OS2 A;  2PEL A;  4Y5Z 0;  1NLR A;  1EP0 A;  1LOB A;  1R08 3;  4BQ4 A;  4MH0 E;  4LUM A;  2VUD A;  4FFF A;  3VD5 A;  5HV0 A;  1LTE A;  3H1W A;  3CMG A;  2X09 A;  3AM2 A;  4PIY A;  2ILM A;  1PMH X;  2NMN A;  4FXK B;  1AF9 A;  4Y5T A;  1LNS A;  2Q0A A;  4C1X A;  1W3X A;  1F5F A;  4DEQ A;  5C5U A;  1JZ7 A;  4AI0 A;  3TRS B;  4HK9 A;  1PVC 2;  4FBF A;  1W2N A;  2ZJC A;  5DG2 A;  1R09 1;  3ORJ A;  2HWF 1;  3AKQ A;  4D6R A;  4F83 A;  4NMI A;  3AZZ A;  3N9M A;  2KR2 A;  4NHM A;  4QX1 A;  4XJZ A;  4ZY9 A;  2VCM A;  1KFU L;  3VZM A;  2XBO 2;  4CDU A;  4UXA A;  4A45 A;  4PDW C;  5DXD A;  1OPO A;  3QCW A;  1QJE A;  1PIV 1;  1DFQ A;  1PO2 1;  1G9B A;  2QQO A;  3MF9 A;  3CJI A;  5ABJ A;  2WO1 A;  1OFN A;  3APB A;  4XBQ A;  5F3E A;  3RSJ A;  3WNN A;  5FZE A;  1VE0 A;  5BYN A;  5I0D A;  3ZOI A;  3ZXG A;  5EIY B;  3HD8 B;  1RVF 3;  2ZX0 A;  3ZXK A;  5JZG A;  2ZX4 A;  3ZKU A;  5IT6 A;  4NAO A;  1G6N A;  2A6V A;  1POQ A;  2OA2 A;  1OUR A;  1D0G A;  5FYH A;  2PLV 2;  4GWJ A;  5D21 A;  3LIH A;  1SPP A;  2WZR 2;  1HB1 A;  3OUH A;  2B9V A;  5GJ6 A;  5FRA A;  1IHM A;  4COY A;  4DMI A;  4CUC A;  2Y6H A;  4IDZ A;  2B7Y A;  5I0T A;  5FZL A;  1E5I A;  2V4V A;  1VMJ A;  1Y9Q A;  5A80 A;  3RMX A;  4FTE A;  1MQT C;  2D97 A;  4CXY A;  5IHR A;  2XVG A;  3I2H A;  4QPI C;  2AGS A;  1X36 A;  3Q9O A;  5FZM A;  5KXE A;  2IXI A;  2RS5 1;  4JDN A;  3MLJ A;  3J26 N;  4KNC A;  1KGY A;  4P14 A;  4QKN A;  1HV1 A;  1N3Q A;  4YG6 A;  5BNP B;  1ZRF A;  5I8T A;  3UK9 A;  3ZFF B;  1A34 A;  4AVS A;  1JYX A;  5BNO B;  4Y5S A;  1VPH A;  4IV3 C;  5KC5 A;  4IGO A;  1IS5 A;  5FP7 A;  1RUC 1;  1LOF C;  1VBE 3;  4L97 A;  2QQV A;  4XUR A;  1GSL A;  3LPG A;  1AJK A;  4IEW A;  1AZD A;  2FBE A;  4XW3 A;  4B8E A;  1OQ1 A;  5L9B A;  1W6N A;  4LKD A;  4CCD A;  2VVE A;  4BWO A;  1EUT A;  4LIT A;  1UKG A;  2JG8 A;  1YFX A;  4JKL A;  4FPH A;  3U11 A;  4N43 B;  4E8D A;  3VUO A;  2R32 A;  1GBG A;  2BRT A;  5SV8 A;  1RUF 3;  3CJX A;  2JWP A;  4D69 A;  1MS4 A;  2AH2 A;  1SG3 A;  5IW0 A;  5HI0 A;  2G9Z A;  5GZG A;  4AYU A;  5ANN A;  2HWB 3;  2VNR A;  2Y8K A;  5A7O A;  1POV 1;  1R64 A;  2A73 B;  4MOA A;  1OVS A;  3ITQ A;  3WDU A;  5F6L B;  1QJX 1;  3GM8 A;  1OH3 A;  3FC0 A;  5GLV A;  4GKY A;  2OPK A;  3J9S A;  1H4H A;  3RI9 A;  3EMR A;  3WDT A;  4YAR A;  1NKG A;  1XQN A;  2W47 A;  2WSV A;  4IEU A;  5L36 A;  4AFB A;  3C8X A;  3NV4 A;  3CZU A;  3MPB A;  2RVA A;  2PHW A;  2DVB A;  2PHU A;  3FUQ A;  3PU8 A;  1PGW 1;  2ET1 A;  3LEM A;  2ZX1 A;  4LTA A;  4YGE A;  1K3I A;  1GZ9 A;  3F2Z A;  4OQ9 A;  3BIE A;  3AZV A;  1GZW A;  1CAW A;  1NA1 B;  1ND3 C;  5IK7 A;  5A3U A;  3WIN E;  3WP3 A;  5FLH A;  4KBZ A;  4O61 A;  3E5X A;  1BQP A;  1H30 A;  1W3V A;  1UIK A;  2ARX A;  2PXJ A;  4IE0 A;  5FFO C;  4AI9 A;  4FOW A;  4OHV A;  5J48 A;  4QXC A;  2BUK A;  3V0B A;  3I2I A;  4ZON A;  5C8C A;  3AK0 A;  4K8F A;  4RHV 2;  3R4D B;  1KXG A;  2DCY A;  3DXT A;  2QDR A;  4W8J A;  1AR8 3;  3D8C A;  1D4M 3;  4Q4X 3;  4HSL A;  1OT5 A;  2WAO A;  1E5S A;  4HMZ A;  4NJ4 A;  1SLC A;  1PHM A;  4E27 A;  1Q43 A;  4IUG A;  2G1M A;  2BFU S;  4KWJ A;  2R04 1;  2MEV 3;  1RHI 3;  2VW2 A;  3WW3 A;  4BMB A;  1DDL A;  1UY4 A;  3UV9 A;  1UPI A;  2WNE A;  1LGB A;  3VN4 A;  5IVF A;  1DLL A;  1UYP A;  2UYB A;  3R0R A;  1DGW X;  2VBP A;  4IV1 C;  2CGP A;  2ARA A;  1OUX A;  1PK6 C;  1ASJ 2;  1ND2 A;  3E5U A;  1W6M A;  1O5L A;  2VQ0 A;  1RUH 3;  2EIE A;  3WNM A;  5KHJ A;  2DBN A;  4ZXK A;  4Q4Y 2;  4UFK A;  3KWV A;  4Y24 A;  2ERF A;  1FPN 3;  1J1T A;  4LO4 B;  2VZ1 A;  1V00 A;  2P1B A;  1W8F A;  1L7L A;  4HZF A;  5DQ0 A;  1RB8 G;  5FK7 A;  4YPJ A;  5EYX A;  3AB0 A;  4C91 A;  2DCT A;  1KIT A;  1G7Y A;  3ZXL A;  2J7M A;  4QQO A;  3AMM A;  4CU7 A;  5FMB A;  4DY5 A;  2PQQ A;  2W94 A;  3N9L A;  4IGP A;  5JZG B;  1OD5 A;  3PUR A;  3RPQ A;  1N1Y A;  1Q8S A;  2VNG A;  3JBG 2;  1V6K A;  3PIJ A;  1SPP B;  5LA2 A;  5SV5 A;  4MHR A;  4PJY A;  3A7Q A;  1WCQ A;  4FQZ A;  3POE A;  4XMI A;  1OF3 A;  1I5P A;  2W3J A;  2DTW A;  1BBT 1;  4YM1 A;  4OUL A;  1B35 C;  1O3S A;  1AXZ A;  1GMM A;  1HB4 A;  4KG8 A;  4LPL A;  4MXV A;  2RDS A;  1PMJ X;  1T6B X;  3G7D A;  2YV8 A;  1OF4 A;  3AP5 A;  4JRL A;  4XE9 A;  3S5Q A;  4GJY A;  2WBK A;  2ZZQ A;  1P8J A;  1K45 A;  2GAU A;  1F9K A;  4BH9 A;  2BOI A;  5T50 A;  1OI6 A;  1SDD B;  1CD3 G;  3LFI A;  3OBR A;  2D43 A;  5C6C A;  1JYI A;  1NQJ A;  1UU6 A;  2Y6J A;  2VXJ A;  2BJS A;  3ZO0 B;  5F2S A;  5HCF A;  3ZSE A;  2CU5 A;  2VBB A;  2K9Z A;  3PL0 A;  4COV A;  1W0O A;  2XJR A;  2NP0 A;  3MYX A;  3OCP A;  4PQQ A;  3VBF C;  1G86 A;  1GWL A;  4UWD A;  4OHW A;  1DGW A;  3O1T A;  1XNK A;  3AYC A;  2XLF A;  1AR9 3;  3BOW A;  3HNM A;  5F5A A;  1AR7 3;  1S1A A;  2BVV A;  4LK7 A;  3WUC A;  4CEW A;  3AZX A;  1RXG A;  4JAA A;  1KS5 A;  5FR3 A;  3SHR A;  1ZRC A;  1YI7 A;  2A6Z A;  2VQT A;  4Q27 A;  2H0B A;  4QPI B;  1Y9G A;  5J98 B;  5FZH A;  4A2U A;  4Z1V A;  5LBE A;  4AGV A;  2ZGO A;  1JYW A;  2ATF A;  3ZXA C;  2WL1 A;  5HCB A;  4P9L A;  3DXU A;  4R52 A;  2ZEZ A;  2Y34 A;  4IV3 B;  4LBK A;  3S30 A;  3HR9 A;  3KV5 A;  4R9A A;  3VZJ A;  4GMP 1;  4OHZ A;  1WW5 A;  2Y6K A;  2VCA A;  1UOJ A;  1CJD A;  5I0U A;  3IPV A;  4KL1 A;  2HWE 3;  1Q8P A;  1YQ8 A;  2QQJ A;  4HBN A;  4Q8L A;  4XJU A;  5FYM A;  3ZSK A;  2W1Q A;  2Q1M A;  1N1V A;  2C6S A;  2RJK A;  1ODN A;  2BVB A;  4GH4 A;  1HRV 1;  3OEA A;  1RUJ 1;  1PO1 1;  4QU2 A;  1LHN A;  4O9G A;  1FOD 2;  4JRA A;  3WNP A;  4JHZ A;  1ZM1 A;  4HKW A;  4FAG A;  5FY7 A;  3ZLI A;  1MZF A;  1S0J A;  1ZBA 3;  3FHI B;  5K7P A;  1FMD 3;  2E26 A;  3M4F A;  5IK5 A;  3P1I A;  3V0B B;  1JU3 A;  1PX4 A;  1W03 A;  2OW4 A;  3NNL A;  4J1W A;  3RZH A;  3T3Y A;  4JCK A;  2K0G A;  1QQP 1;  2RDR A;  4EV0 A;  5CKQ A;  1M06 G;  5CG9 A;  1NLS A;  3JU9 A;  4B4P A;  2VR4 A;  2J1T A;  2G4I A;  1QGL A;  4UI9 L;  4NWV A;  2GP5 A;  4WM8 A;  4XF3 A;  3GBF A;  1H6Y A;  2R1D A;  1XNT A;  5LRR A;  3O5S A;  2BU9 A;  2QJV A;  5BXX A;  3K77 A;  4Q0V A;  5BNN A;  4YGD A;  2JG9 A;  2XJP A;  2ZX3 A;  3OGR A;  1SHW B;  1JZ4 A;  1ND3 B;  2D3R A;  4LHK A;  3T4V A;  2RDQ A;  2HWF 2;  4WZC A;  2VUC A;  2ZGP A;  3HQX A;  3I54 A;  1HIX A;  1IQD C;  1T2X A;  4DB5 A;  4RD7 A;  3K48 A;  4CPB D;  1CAX B;  1IKP A;  1EYB A;  5C9A A;  3VD3 A;  5FPL A;  1WLW A;  5C8W A;  3ASI A;  4J1X A;  2LW8 A;  1Y3T A;  4XCA A;  3ZYI B;  1VBA 2;  2J42 A;  2NM1 A;  4Y1X A;  5JAX A;  2EA7 A;  3RZM A;  1MZ5 A;  2P34 A;  1GUI A;  1NY7 2;  2R0H A;  1ULG A;  4ZU5 A;  4DUV A;  1BCX A;  3KF3 A;  1Z7S 3;  5JR2 A;  3MV0 1;  1HB3 A;  1TME 1;  3MEP A;  4WBB A;  4ARX A;  1WW4 A;  5FCC A;  1W6P B;  3B94 A;  1VBC 3;  2RJ2 A;  3S7I A;  5FPB A;  3MIC A;  2A5Z A;  1W2O A;  1NCR A;  3U1X A;  1QHD A;  1O8P A;  2UU8 A;  2XB6 C;  4DY3 A;  2D6M A;  1CAU A;  2EAA A;  2PYT A;  2ZGL A;  3CF6 E;  4XIL A;  4BB3 A;  1MS8 A;  1BMV 2;  4LHL A;  5FUN A;  2ZML A;  4N7U A;  5A32 A;  1DGR A;  4AQ6 A;  1IQA A;  1WZX A;  4FT8 A;  2E7T A;  2RS5 2;  3TEX A;  5A6Q A;  1SLI A;  4G4F A;  2RMU 1;  3RYK A;  4KG0 A;  4OFG A;  3KT4 A;  2E31 A;  4AI3 A;  5GZE A;  1HN0 A;  2PAM A;  1PZ8 A;  1RUG 1;  1UZV A;  1IS4 A;  5C5T A;  4GB3 1;  3U4X A;  4XJA A;  4XCB A;  1QJU 1;  4CDQ C;  3VBU A;  4JGZ C;  4ISQ A;  4QX3 A;  5DN2 A;  3ON7 A;  5FPX A;  5JDB A;  3AXD A;  1JI6 A;  1B35 B;  3JD7 3;  4CEW B;  4D7Y A;  2YC0 A;  2R16 A;  1H9P A;  2DU1 A;  2F17 A;  2GNB A;  1CWP A;  3O0W A;  2RS1 1;  5CBL A;  4NPL A;  1UN1 A;  5FP3 A;  2BBA A;  4CDX C;  4UF0 A;  3U78 A;  3POB A;  3KCC A;  4IER A;  1PVC 1;  4E2S A;  4NHK A;  2HEV F;  2DTY A;  1CVN A;  1QJX 2;  1CQ9 A;  2BGP A;  2QUO A;  1I3H A;  2WQ8 A;  4XFF A;  5KWR A;  4QKD A;  3PVN A;  2A3X A;  2XBO 1;  1O4T A;  3T08 A;  4Y1Z A;  3ZXJ A;  1JS9 A;  3C3V A;  3I2G A;  3IZO A;  4ONU A;  4X6R B;  5FWE A;  3VBF B;  5C3Q A;  4AE2 A;  1N47 A;  4HET A;  4V2V A;  4S2G A;  4DNY A;  1PGW 2;  1UL9 A;  3NJX A;  2BER A;  3HJR A;  3OBZ A;  4QQ2 A;  5FO9 B;  5EJ3 A;  4PLO A;  3LPF A;  2XWJ B;  1GU3 A;  3D0J A;  3MFA A;  2TBV A;  4QDQ A;  1FI2 A;  5T3N A;  2VVF A;  5I93 A;  4W50 A;  3PTR B;  2X53 S;  4BOW A;  3TNQ A;  4N53 A;  5G05 L;  1H1M A;  2PLV 1;  3V65 A;  2V73 A;  2DFB A;  4Y1U A;  1UMH A;  1XSQ A;  2W1W A;  2HKX A;  3JB4 C;  1NUK A;  5D1I A;  4BQ2 A;  1AYM 2;  2H6B A;  2IVI B;  1U5Y A;  3V64 A;  2FMD A;  2HWD 2;  4Y33 A;  3VKF C;  1W28 A;  4LBQ A;  3WDW A;  3FBM A;  4JX0 A;  4K20 A;  1RMU 2;  4FTS A;  4NR1 A;  3T2T A;  1YJK A;  1LGN A;  4WM8 B;  1ULD A;  3PIG A;  2OKX A;  1VBD 2;  4IQP A;  5JOZ A;  4W4Z A;  4XFH A;  3WG1 A;  1BKZ A;  2J1R A;  2R07 2;  5CAZ A;  4F8A A;  2JG9 B;  3W5M A;  4TSV A;  3T0D A;  1DGL A;  1AX0 A;  1EAH 3;  4A6O A;  3R4S A;  1OD3 A;  3KCY A;  5A6Y A;  4LBQ D;  3BIW E;  3HN3 A;  4OZX A;  3UJQ A;  2YFU A;  4CEY A;  1NCQ A;  1VMH A;  4PI2 A;  4QPG A;  2R49 A;  2DWR A;  2WZ8 A;  1JZ2 A;  4P9J A;  5DZE A;  5FZG A;  5T5P A;  3IDC B;  5DAP A;  2K2S A;  4P9X A;  5L9R A;  1SZB A;  1O3T A;  4GKX A;  4XTM A;  1X7N A;  1V6I A;  2FCV A;  4N9I A;  3ZVX A;  3VBO A;  1BEV 2;  3RZZ A;  3JQX A;  4EE2 A;  1WCU A;  2QE3 A;  4L9B A;  2I07 B;  3U75 A;  3LDR A;  5FPA A;  2R0F A;  2FZ2 A;  3GZE A;  1GKB A;  1ST8 A;  5DAV A;  3WW1 A;  5EJZ B;  1MEC 3;  1OUS A;  2VOT A;  4AEJ A;  2LAL A;  3M70 A;  4LO8 A;  5HXV A;  1OC1 A;  2XQR A;  3OF1 A;  2NPI A;  5FIX A;  2ZGT A;  1AX2 A;  1CPN A;  5H9R A;  3ZN6 A;  4B4Q A;  2H0V A;  3KZ4 C;  2R06 1;  3LDB A;  5KHH A;  3FFQ A;  1TE1 B;  3GCW A;  2WNV A;  1H8T C;  5F5C A;  3D5O A;  2EXK A;  5EJ1 B;  2GDF A;  2XR4 A;  1CAU B;  3AP7 A;  3A0K A;  1JOP A;  1JH5 A;  3EJK A;  3HVD A;  5FLJ A;  2QFE A;  4I09 A;  3BTZ A;  2E7Q A;  3EYP A;  2JIJ A;  3W9A A;  4SBV A;  3WUD A;  1WBL A;  2PFW A;  2RJL A;  2VW0 A;  3PTY A;  4YW7 A;  5FQ0 B;  1RUI 3;  4NPM A;  4AVC A;  3O0V A;  1HW5 A;  3MO4 A;  3MID A;  4JGY A;  1DU3 D;  4DXZ A;  2B46 X;  1R1A 2;  3KS7 A;  2VO5 A;  3ZFG A;  4S2H A;  1J58 A;  2GN3 A;  2VTX A;  2QQU A;  1C3H A;  3CNA A;  4FQ4 A;  3ZDV A;  4RHV 1;  2P2K A;  3NW4 A;  1WGP A;  2B42 B;  2WFP A;  5FYV A;  3VDC A;  1DQ6 A;  4K3U A;  5FDB A;  3OTF A;  2YYO A;  3MIE A;  3AKT A;  1QY4 A;  3E97 A;  1WA6 X;  3HOB A;  2BPA 2;  1RUO A;  2D44 A;  3J7H A;  5A7W B;  3WR0 A;  4A42 A;  2WQ4 A;  1ZZ9 A;  5FY0 A;  4Q4V 2;  2FCT A;  5F1R A;  3WNX A;  1LB2 A;  4QX8 A;  5JI7 A;  3ZSJ A;  2XL7 A;  1UZZ A;  1F5J A;  2ZPX A;  5A33 B;  5I0R A;  1JHJ A;  5JCT A;  4MHU A;  3RYR A;  1JZ8 A;  5JR7 B;  1U5X A;  1ASJ 1;  2YC4 A;  2UYA A;  1UMZ A;  2A75 A;  2CAV A;  4NIA A;  4A41 A;  4Q4Y 1;  2NQY A;  1WKY A;  4CZS A;  3IDE A;  2BBV A;  4CDQ B;  5F8P A;  4EQV A;  2RR1 3;  1UX7 A;  1BJQ A;  1JTZ X;  1A8M A;  2WO2 A;  1OQD A;  3NVC A;  2VME A;  5D8A A;  3SCH A;  3TN9 3;  3ZX7 A;  4AZZ A;  4M3C F;  1TZO A;  4OUS A;  4YLZ A;  4JKM A;  4KMQ A;  5EZW A;  3P6B A;  2E33 A;  3OGJ A;  2ZKL A;  3ZFF C;  1QOO A;  1CAV A;  1FNZ A;  4QAW A;  5JSP A;  2RDN A;  2GME A;  3I8T A;  4L0P A;  4GA9 A;  4CCO A;  4CDX B;  4DPN A;  2HH9 A;  5A6Z A;  1UYX A;  1WMX A;  2WYS A;  3NV2 A;  3CU7 A;  4E4D X;  1QKQ A;  4BDV B;  2IXH A;  4QQH A;  2AUY A;  4PLN A;  5DDJ 3;  3H8X A;  1CZT A;  4CU8 A;  5LA0 A;  2A70 A;  4Q8K A;  4HG6 B;  5FY9 A;  2RM2 3;  1X82 A;  4Z07 A;  4BYY A;  5BY5 A;  5K0U A;  2GZW A;  1CR7 A;  1N1T A;  3C7F A;  3DPR A;  3AJZ A;  2WNU C;  3ACL A;  3OJB A;  3WF3 A;  4BXS V;  1SBE A;  5A7Q A;  1F2N A;  2D6O X;  4M3C B;  5J96 B;  1STM A;  2DU0 A;  2FZ1 A;  1S0F A;  4IE7 A;  1Y43 B;  3UES A;  2HWC 1;  1NA1 C;  1R09 3;  1X8E A;  1G8W A;  2E51 A;  3QLQ A;  3SCF A;  4ISR A;  5HV4 A;  5DPN A;  4M4R A;  4PLM A;  3AKS A;  2ZA9 A;  2AR6 A;  1D0H A;  4JDO A;  4OLL A;  3MZH A;  3U10 A;  4ZS2 A;  3FMG A;  4H7M A;  2JE8 A;  4AR2 A;  3ZPO A;  4NUB A;  5ACA 2;  3POW A;  1PIV 3;  1PO2 3;  1XBF A;  4NIH A;  5C7G A;  2Z2S B;  1WWY A;  2QKD A;  3A0N A;  2FDH A;  2WIN B;  4IEV A;  1YLL A;  4ZZ8 A;  5JXI A;  2ZCW A;  1QJZ A;  1IOA A;  3LFM A;  4RGA A;  3ZKY A;  4H14 A;  2VCB A;  3AFG A;  2W87 A;  3G6J B;  5LK7 B;  2XQX A;  5A3L A;  5IVE A;  3N7J A;  1WLC A;  4HVR A;  5FLI A;  1GWM A;  5AFB A;  2Q5T A;  1GR3 A;  5CU1 A;  3WOG A;  1GNH A;  1FOD 1;  2XXZ A;  4NRQ A;  2XJQ A;  2B9U A;  3FLT A;  3PMS A;  3I4I A;  2VVD A;  4CU9 A;  2ZGS A;  1C8M 2;  4HFS A;  5FY8 A;  2QNK A;  1DF0 A;  1DYP A;  1YQ2 A;  2VMC A;  3ZFG B;  5A3T A;  2B8M A;  1V6O A;  4CDU C;  1AXY A;  4GD4 A;  5FK8 A;  2VXR A;  3GDB A;  3E5Q A;  3A23 A;  4XXA A;  5T55 A;  4K9S A;  4OMC A;  3ZIX A;  3CJI C;  3ZSL A;  1W05 A;  3ZYB A;  5FRE A;  1UOB A;  2LRP A;  1W9Y A;  2VMF A;  1NXM A;  5CKN A;  2TUN A;  3BCW A;  1TMF 2;  3VBR A;  5IAV A;  1H8T B;  1NG0 A;  5A1L A;  1HJF A;  5JZG C;  2JJ6 A;  1RUC 3;  4XQ4 A;  2J1V A;  2WUH A;  2RS1 2;  5L7O A;  3M3E A;  1HXS 1;  1KQR A;  1O8S A;  3ZXF A;  2G9G A;  4L2N A;  1C1L A;  1KEX A;  2W1S A;  3RNS A;  1DLC A;  1AR6 2;  2QQK A;  4AWD A;  5IYY A;  2PHX A;  2CTV A;  4QMA A;  3MUZ 1;  2ARB A;  2QTW B;  2YDE A;  4YW1 A;  3T4H B;  3AL6 A;  5F7U A;  2QCS B;  4QDS A;  1ACC A;  3RGB A;  3KSC A;  4XEZ A;  4QB2 A;  1QXP A;  2DYC A;  4HAN A;  4NOT A;  1ZYB A;  5CEH A;  1O3Q A;  5D8A B;  4FP2 A;  1POV 3;  4IND A;  1XB9 A;  5HBA A;  2YPD A;  1W39 A;  1WLD A;  1YNA A;  2CGN A;  2LUW A;  1HV0 A;  1O59 A;  1WBF A;  3JZV A;  4EN7 B;  1VBA 1;  2XJT A;  4O9E A;  4YZ2 A;  1FYU A;  1GNZ A;  4XDP A;  1DCS A;  1LU1 A;  1NY7 1;  4I0A A;  1VBB 1;  4NPR A;  3SEP A;  3B69 A;  4AVA A;  5F9T A;  3VKN A;  5EV7 A;  4YYO A;  5LA9 A;  2ID4 A;  1IGO A;  4RR3 A;  4Q2F A;  4E2G A;  2ZS6 B;  1LKN A;  2P6H A;  2W68 A;  4N9H A;  3TEZ A;  4FTB A;  1FAT A;  2Q8O A;  2JG8 C;  4AF9 A;  4GAL A;  4KU8 A;  3ACI A;  2OXB A;  1J83 A; 
#chains in the Genus database with same CATH homology
 1SDD B;  3AC0 A;  1XNA A;  4XUQ A;  1US3 A;  1US2 A;  2Y6J A;  3DYP A;  3NQH A;  1ULP A;  4JKK A;  3WF1 A;  3T2Q A;  2X05 A;  1NAE A;  5LA1 A;  4PQQ A;  3III A;  3PUH A;  2CDO A;  1RYY A;  3C7E A;  1F4H A;  3HNM A;  5C70 A;  2V5D A;  4P02 B;  1UZ0 A;  2VQT A;  4BJ0 A;  1W9W A;  2BGO A;  3UET A;  4MO3 M;  2ZEX A;  1JYW A;  3OEB A;  3T0B A;  3ETP A;  3FHA A;  2ZEZ A;  1TVG A;  1UYY A;  5A1A A;  2J22 A;  2Y6K A;  2VCA A;  2Y64 A;  4DXS A;  2QQJ A;  4KI5 M;  3DYO A;  2W1Q A;  3CQO A;  3WNK A;  3DEC A;  3T2P A;  2QQN A;  3OEA A;  1W8N A;  1EUU A;  5DMY A;  2ZEY A;  3VDB A;  3WNP A;  4JHZ A;  1UY1 A;  3OGV A;  4LQR A;  2E26 A;  2X10 A;  5J1X A;  3P1I A;  1JU3 A;  1PX4 A;  1UXZ A;  2JD9 A;  4CUB A;  3E1F 1;  3T0A A;  1CIY A;  4UAP A;  1UYZ A;  2ORZ A;  2VR4 A;  2J1T A;  3NJV A;  2QQM A;  4GZ9 A;  4UI9 L;  2WZE A;  1H6Y A;  2HYX A;  1XNT A;  4LHS A;  3VDA A;  5HPO A;  4QB6 A;  3K77 A;  2VZ3 A;  3MV1 1;  3OGR A;  1SHW B;  1JZ4 A;  1UWW A;  2B4K A;  3HNB M;  1TG7 A;  5IFT A;  1CZS A;  3I2J A;  1IQD C;  1T2X A;  4BK5 A;  2VJX A;  4ARY A;  3C7H A;  3I3E A;  3VD3 A;  2W92 A;  2LW8 A;  2QQL A;  4P00 B;  1UY3 A;  4OYU A;  2W95 A;  4DXT A;  1H6X A;  2WAA A;  4P08 A;  4QDR A;  1GUI A;  1GQP A;  4DUV A;  4MGQ A;  1J84 A;  4XVH A;  5JR2 A;  3MV0 1;  4ARX A;  3D3A A;  2R7E B;  1PX3 A;  3IB3 A;  2WAB A;  4MAD A;  4FI9 A;  2RJ2 A;  1K42 A;  3NRU A;  2DCK A;  2J1S A;  3HPN A;  4E8C A;  2KD7 A;  1O8P A;  4XUT A;  4GWI A;  3I97 A;  3WF4 A;  3IDA A;  1F4A A;  2E31 A;  3SKV A;  2DCJ A;  4QX2 A;  2YG0 A;  3OG2 A;  3HNY M;  2EIB A;  4A44 A;  3EB7 A;  4QX3 A;  5DN2 A;  1JZ5 A;  2PQS A;  3WF0 A;  4PT6 A;  1JI6 A;  1GNY A;  3LQC A;  3GGL A;  2W5F A;  2BBA A;  1UXX X;  4CU6 A;  2YFZ A;  3MUY 1;  2HLE A;  5JXG A;  3ACH A;  3FHQ A;  2BGP A;  3K4A A;  4CVU A;  2WQ8 A;  3I2F A;  3WNO A;  2XON A;  3I2K A;  5IJR A;  3T08 A;  2VL4 A;  3FN9 A;  3I2G A;  3ABZ A;  4OMD A;  3NJX A;  2WN3 A;  2BER A;  3HJR A;  3ZM8 A;  3ACF A;  3LPF A;  4BK4 A;  1GU3 A;  2VZU A;  3A21 A;  4QDQ A;  3WSO A;  3IAP A;  5JXH A;  4W50 A;  2V72 A;  2W9X A;  5G05 L;  2DDU A;  2Z4F A;  4M4P A;  1UMH A;  2W1W A;  1NUK A;  1W9T A;  3LEK A;  2J1A A;  5B4N A;  4CUA A;  2VCC A;  2ZXQ A;  4JX0 A;  3MBW A;  3U37 A;  3WEZ A;  4Z2A A;  3JXS A;  4OUE A;  4DUX A;  2OKX A;  3I3B A;  2EID A;  2W91 A;  4W4Z A;  2J1R A;  3W5M A;  3VD4 A;  3T0D A;  1XC6 A;  4A6O A;  4XZU G;  1OD3 A;  2YB7 A;  1JYV A;  3HN3 A;  2YFU A;  2C9K A;  3GXU A;  1CX1 A;  2Y6G A;  3T2O A;  2WZ8 A;  1JZ2 A;  2VZQ A;  2BZD A;  4AG4 A;  3WNL A;  3CKH A;  5JXJ A;  2WDB A;  4QPW A;  2VZR A;  2J1E A;  1CZV A;  4UOJ A;  3WF2 A;  2ZEW A;  3BGA A;  1L7R A;  3CZJ A;  5EJZ B;  2VOT A;  4D8M A;  4A3Z A;  3VD7 A;  1NX9 A;  4QX0 A;  2WN2 A;  2JDA A;  2EIC A;  1W99 A;  1JZ6 A;  5EJ1 B;  3SEE A;  1GOF A;  4OZO A;  1W0N A;  3LEI A;  3EYP A;  4QB1 A;  3NNG A;  4DUW A;  4D0Q A;  2VC9 A;  2VTF A;  4ZZ5 A;  1UMI A;  3CIH A;  3MO4 A;  2VMD A;  3VD5 A;  2VO5 A;  2J1U A;  1DYO A;  3CMG A;  2X09 A;  4PF1 A;  1PMH X;  3VDC A;  1LNS A;  1JYN A;  2WO3 A;  4DEQ A;  1JZ7 A;  2VZO A;  3WQB A;  3K4Z A;  3HOB A;  1L7Q A;  5JMO A;  4ZY9 A;  3J7H A;  3UNP A;  4QX1 A;  4A42 A;  4A45 A;  3K4D A;  4RN5 A;  2XHN A;  5C71 A;  1UY2 A;  1JHJ A;  2QQO A;  1JZ8 A;  2VZS A;  2WO1 A;  2YC4 A;  4A41 A;  3ECQ A;  3WNN A;  3IAQ A;  1WKY A;  5I0D A;  4TTG A;  5EIY B;  1W9S A;  3A22 A;  1UX7 A;  4GWJ A;  2WO2 A;  2VME A;  2YC2 A;  4AAX A;  4LKS A;  2B9V A;  2VM9 A;  4MGS A;  3K75 B;  4CUC A;  5HXM A;  2Y6H A;  4JKM A;  4KMQ A;  3P6B A;  2E33 A;  3PUI A;  4ZXE A;  2QQI A;  2V4V A;  2QBX A;  3BN6 A;  4QAW A;  4L0P A;  5IHR A;  3I2H A;  1UYX A;  2Y6L A;  2WYS A;  4DEV A;  4BDV B;  1KGY A;  1UY0 A;  5CYY A;  2JKX A;  1CZT A;  4KWU A;  1OH4 A;  4CU8 A;  3THD A;  4ET7 A;  1JYX A;  5LA0 A;  4HG6 B;  2W1U A;  4XUO A;  4XUR A;  3LPG A;  3C7G A;  3LE0 A;  2VQU A;  1W8O A;  3K46 A;  1MPX A;  1EUT A;  4JKL A;  4E8D A;  1BHG A;  1ULO A;  3C7F A;  1SG3 A;  3WF3 A;  4BXS V;  3OBA A;  4TXW A;  2Y8K A;  4RYD A;  4MOA A;  1R64 A;  5FUI A;  4P5Y A;  5G04 L;  3UES A;  3GM8 A;  1NKG A;  2W47 A;  3OB8 A;  5DPN A;  3VD9 A;  4M4R A;  2RV9 A;  3C8X A;  2VZV A;  1GOG A;  3CZU A;  2C4X A;  2JE8 A;  5JUV A;  2RVA A;  5C7G A;  1K3I A;  3F2Z A;  2C26 A;  2ORX A;  4ZZ8 A;  5JXI A;  3HEI A;  1DP0 A;  2VCB A;  1K12 A;  2W87 A;  2L9L A;  2XQX A;  4DXR A;  5IFP A;  3I3D A;  3I2I A;  1D7P M;  3W5N A;  3T09 A;  4W8J A;  3THC A;  4CU9 A;  1OT5 A;  2WAO A;  2VZT A;  1YQ2 A;  2VMC A;  1XPW A;  4IUG A;  3CDZ B;  4XUP A;  3GDB A;  5LCW L;  1JU4 A;  3A23 A;  1UY4 A;  4OMC A;  3OGS A;  2VMF A;  2XOM A;  2J1V A;  2WUH A;  2EIE A;  3WNM A;  2W46 A;  1O8S A;  5B4X A;  3LEG A;  1KEX A;  2W1S A;  1DLC A;  2VZ1 A;  2QQK A;  1GOH A;  5IYY A;  5DQ0 A;  4YPJ A;  3MUZ 1;  1HN1 A;  2J7M A;  4CU7 A;  5F7U A;  2W94 A;  4QDS A;  3SKJ E;  4QB2 A;  3FL7 A;  5LA2 A;  3A7Q A;  1WCQ A;  1O59 A;  2LS6 A;  1OF3 A;  4A4A A;  1I5P A;  2VZP A;  2W3J A;  4XUN A;  1GMM A;  4LPL A;  2CDP A;  3DYM A;  3C7O A;  1PMJ X;  3ACG A;  3SEP A;  1JZ3 A;  1OF4 A;  2ID4 A;  5CZK A;  2WBK A;  1P8J A;  1K45 A;  2E32 A;  3ACI A;  1J83 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...