3K77A

X-ray crystal structure of xrcc1
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
152
structure length
152
Chain Sequence
PEIRLRHVVSCSSQDSTHCAENLLKADTYRKWRAAKAGEKTISVVLQLEKEEQIHSVDIGNDGSAFVEVLVGSSAGGAGEQDYEVLLVTSSFMSPSESRSGSNPNRVRMFGPDKLVRAAAEKRWDRVKIVCSQPYSKDSPFGLSFVRFHSPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Oxidation state of the XRCC1 N-terminal domain regulates DNA polymerase beta binding affinity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords DNA repair protein XRCC1
total genus 34
structure length 152
sequence length 152
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2009-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01834 XRCC1_N XRCC1 N terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 3k77A00
3VDAA 3HNYM 1UY1A 2YC2A 4UI9L 3BGAA 2W92A 4CU6A 3ACIA 4P00B 2J1UA 4ZZ5A 4PQQA 5JXGA 1GOGA 2Y6HA 2Z4FA 3ETPA 1O8SA 2DCKA 4LQRA 3W5NA 1OF3A 2ZXQA 3A21A 4KMQA 3WF2A 1W0NA 1P8JA 3A22A 3OG2A 3VD9A 4DUXA 1XNTA 1H6YA 1ULOA 2LS6A 3IDAA 5DQ0A 3MV11 3U37A 3OGVA 3I2FA 1BHGA 3W5MA 2WN3A 4XZUG 5A1AA 1JZ3A 2Y6GA 1NX9A 4CU7A 2PQSA 3UNPA 1EUTA 2VMCA 4MADA 1CZVA 4RN5A 4BK4A 3ACFA 1GNYA 3FHAA 4DUWA 2W3JA 2QQMA 3IAQA 2YB7A 4PT6A 2KD7A 5DMYA 3LPFA 4OMDA 3DECA 4E8CA 3MUY1 2Y6LA 2W5FA 3DYPA 3SKJE 1GQPA 3EYPA 3C7HA 2W94A 1MPXA 2JKXA 3D3AA 1K12A 4QX0A 2VOTA 5J1XA 3MBWA 2VO5A 3I3BA 2VJXA 2J1SA 2V4VA 2ZEXA 3OGRA 2V72A 1SG3A 4HG6B 2E31A 4BJ0A 4M4RA 1YQ2A 3FL7A 5LA2A 4AAXA 1KGYA 2VL4A 1F4HA 4ARYA 5HPOA 5IHRA 5JMOA 4KWUA 4P08A 3HN3A 3WQBA 3VD7A 5DN2A 2Y6KA 2BGOA 2QQJA 2B9VA 3HPNA 1GOHA 3ZM8A 2VM9A 4E8DA 1O8PA 2VZOA 4A4AA 4XURA 1NAEA 3K46A 2QQKA 3PUIA 5CZKA 1W8NA 4Z2AA 2W47A 3P6BA 3ECQA 5DPNA 1DP0A 2VZ3A 1J83A 3OGSA 3P1IA 5LCWL 4PF1A 1UXXX 1CZTA 2HYXA 4CUBA 4LKSA 1TVGA 2J1VA 2VZ1A 2RV9A 2EICA 3IIIA 1K45A 5LA1A 3IB3A 1OD3A 2JDAA 3K77A 3T0BA 3I97A 4BK5A 4GWJA 5JXHA 2BERA 4XUOA 3PUHA 2YFUA 4GZ9A 1JZ7A 3WF3A 4DXTA 1UY2A 1JU3A 4BDVB 1JYWA 1R64A 2C9KA 2WO3A 2WN2A 3I2GA 2EIDA 1DYOA 2L9LA 4OZOA 3IAPA 4XVHA 4JKKA 4QDSA 2VMEA 1JYXA 2VZPA 3CQOA 2VTFA 1W99A 2VZSA 4QB1A 2WZEA 1UMIA 2VCBA 4UAPA 1J84A 3HEIA 3MO4A 4XUNA 2R7EB 3K4DA 1SDDB 2VZVA 4L0PA 4ET7A 4ZZ8A 2QBXA 2WUHA 2VR4A 4IUGA 3VDBA 1XNAA 3C7FA 2Y64A 4XUTA 1GUIA 2DCJA 1JHJA 3JXSA 1CZSA 3NRUA 1I5PA 4QDQA 1D7PM 1L7QA 3VD4A 3ACHA 1JZ2A 2ORZA 2ZEZA 2EIEA 5EJZB 4MGSA 2X09A 4RYDA 2W1SA 4FI9A 3WEZA 3WNPA 2J1TA 4A6OA 4QAWA 1NKGA 2V5DA 2RJ2A 2W1QA 2ZEWA 4DUVA 4XUPA 1IQDC 3T2OA 3C8XA 2E26A 4TTGA 3ACGA 1NUKA 3LEGA 2E32A 4QX1A 3LPGA 1JYNA 3NNGA 3THCA 1K42A 1K3IA 1KEXA 1W9WA 3VDCA 3CMGA 3EB7A 1OF4A 3MV01 1DLCA 1UZ0A 4D8MA 2QQOA 3J7HA 3HNBM 4JHZA 4QB6A 1GU3A 1JZ6A 1CX1A 4CU8A 5B4XA 1UYYA 3BN6A 3THDA 4MO3M 3T0DA 4A41A 2YFZA 3LEKA 4A44A 4MOAA 2ZEYA 2VQTA 4OUEA 3NQHA 4W50A 3GDBA 4QB2A 1HN1A 1UYZA 4CVUA 4QPWA 5JUVA 2VQUA 5JR2A 2W1WA 3WSOA 2X10A 2WAAA 4UOJA 3T09A 5C71A 1PX4A 4TXWA 3K75B 1JYVA 2J7MA 2VMDA 3C7EA 2RVAA 3WNMA 5C70A 3LE0A 1US2A 1W9TA 3LQCA 2BGPA 5HXMA 3I2IA 2DDUA 2W91A 1OH4A 1UWWA 2JE8A 4ZXEA 4BXSV 4QX2A 2XONA 2WABA 3C7GA 3I2KA 2XHNA 1RYYA 3OB8A 2C4XA 5FUIA 3GGLA 2WAOA 3HNMA 4P5YA 3C7OA 3CZJA 4M4PA 2J1AA 3A23A 1PMHX 3WNLA 2VCCA 3T08A 3WF0A 4OYUA 1UXZA 2XQXA 2W46A 3T2PA 4OMCA 5F7UA 2VMFA 4LHSA 3FN9A 2E33A 5IFTA 4JKMA 4CUAA 3ABZA 4ZY9A 3T0AA 2VZQA 3CKHA 1UYXA 2JD9A 3I3EA 1XC6A 2VC9A 4MGQA 4AG4A 1LNSA 3WF1A 1W8OA 3WNKA 3K4AA 3AC0A 3SEEA 1US3A 3E1F1 4QX3A 4P02B 5JXJA 4LPLA 2HLEA 1PMJX 3OEAA 1JZ5A 5G04L 2W9XA 1JZ8A 3WF4A 1XPWA 2J1EA 2ORXA 2YG0A 2W87A 3NJVA 2XOMA 2WQ8A 4CU9A 1L7RA 2WZ8A 3K4ZA 3NJXA 2X05A 3WNOA 1CIYA 4DEVA 3MUZ1 4DEQA 1H6XA 5B4NA 2C26A 4W4ZA 5I0DA 1UY4A 2QQLA 2Y8KA 1WKYA 1W9SA 2VZTA 1UMHA 3SKVA 3WNNA 2WO1A 2W1UA 2Y6JA 3DYMA 4QDRA 2WYSA 4JKLA 3VD3A 1EUUA 2BBAA 1TG7A 2WDBA 1UY0A 2QQNA 5JXIA 2VZUA 5G05L 3CIHA 1SHWB 4GWIA 3HOBA 5EJ1B 1T2XA 3I2JA 5IYYA 4A45A 3I2HA 2W95A 4A3ZA 5EIYB 3F2ZA 4JX0A 3CZUA 4XUQA 3GM8A 3UESA 1OT5A 3GXUA 3CDZB 4DXRA 2BZDA 4CUCA 1JZ4A 3OEBA 3T2QA 1UX7A 4A42A 1O59A 1PX3A 2YC4A 3OBAA 2OKXA 3VD5A 3SEPA 2J1RA 3A7QA 2CDOA 2VZRA 1F4AA 1JU4A 3FHQA 4W8JA 3UETA 5C7GA 1UY3A 2CDPA 3DYOA 4D0QA 1GMMA 2B4KA 4KI5M 2VCAA 2WBKA 4DXSA 5IFPA 2J22A 3I3DA 5CYYA 2QQIA 4YPJA 5IJRA 4ARXA 1ULPA 2LW8A 3HJRA 3LEIA 1JI6A 2EIBA 1WCQA 5LA0A 2WO2A 2ID4A 1GOFA
chains in the Genus database with same CATH superfamily
4I09A 3HNYM 5E8AA 2PAKA 4META 5FZLA 4UI9L 4BH9A 2VMGA 2ZBJA 3NW4A 2IC1A 4QKDA 3BGAA 3OD4A 1MS0A 2ZGMA 4CU6A 2PTMA 4LIUA 2YPJA 3O1OA 4ZZ5A 4PQQA 4AHWA 5A7PA 4A7ZA 2JE9A 3VLBB 1SCSA 4P9GA 4XF4A 5FP9A 4AVBA 3U07A 3GBWA 4GMP3 4Q26A 5FK7A 4CP0A 1MVEA 1QQP3 1V00A 1YC61 3AZZA 1MR5A 3K3OA 3HQUA 4D7SA 5AFEA 2RS52 1RC6A 4CDUB 1BCXA 4H55A 2WWJA 4K3UA 1UOGA 3JB4C 4IGOA 5FIXA 5CG8A 4DUXA 1XNTA 2WQZC 1H6YA 1LB2A 4LBQD 4EZHA 1IS5A 2D3RA 5I93A 2LS6A 3IDAA 5H9RA 3UT0A 1QOTA 3VHPA 4CCKA 3KCYA 2OW4A 4NHMA 2WN3A 3POFA 1ODNA 1LECA 4C0HA 3RZHA 2JG8B 4GD4A 2ARBA 4RHV2 4DMIA 5AC92 2B8MA 4L8QA 1XSQA 1OOPA 2I74A 3WP5A 5CBLA 1IS6A 5FPLA 1DQ2A 1REFA 1WCUA 4RHV1 5AC91 2XL7A 1CJPA 1JXNA 2V4AA 5FREA 3OD0A 1RUE3 4Y5Z0 1TNFA 1WCDJ 2PQSA 2XG3A 1W28A 2VOXA 3UNPA 4MADA 1OKOA 3RSJA 4QPGC 3HWJA 4BK4A 3OBTA 1Q43A 3EBRA 2JDZA 5FZ8A 4I0WB 4LUMA 4N8MA 5A3WA 3BU0A 2JDPA 1HXS1 5BNNA 2ZX2A 2YU2A 1GP4A 1RUD2 2QQUA 5BNOA 2KD7A 4NRQA 1OI6A 1GQGA 2IVIB 3LPFA 3DECA 4KBZA 4OMDA 3ZPOA 4B4RA 3AYEA 3RWKX 2O1QA 3A0NA 4HK8A 3DYPA 4Q2FA 2Q4SA 3MFAA 3SKJE 3ZYBA 2B5HA 3UJOA 4GIQA 5FY1A 1YI7A 4JGYB 1Y9QA 4Y1VA 4N53C 2PHTA 4HN0A 4RQPA 1LHUA 2W68A 1W8TA 1YQ5A 2P6HA 2NQYA 2DURA 2CGNA 1DF0A 1MPXA 1YNAA 1MZEA 3JD71 3MYXA 4IEUA 4PF5A 1AR92 1IS4A 1LODA 1N1VA 1H30A 1LU2A 1RMU3 1AXKA 2O0OA 4WZCA 4XW3A 5C33A 2VOTA 4PJYA 1SBDA 5J1XA 2AREA 3D6EA 1W6OA 5A3MA 5GLUA 3AXEA 1J1LA 2ZEXA 2E31A 3GALA 5IK8A 1WLWA 1H2MA 1YQ2A 4X8NA 4M3CF 3HVDA 4RR3A 2VL4A 4MUVA 5HXVA 3W59A 1ASJ3 3F95A 3RNSA 3ZFGB 4MHRA 4KWUA 4B3NA 3POGA 5DN2A 1GNHA 3MPPG 1POV3 2Q0AA 3ITQA 5FP4A 4CEYC 3AJYA 1W6MA 1YRZA 1H8VA 3B3QE 1HLCA 2B9VA 2CTVA 1Q8PA 3GYDA 4QQHA 1REDA 2Q8CA 1YHFA 1GOHA 1LU1A 3H3UA 2A6VA 2ETEA 1O8PA 4TYSA 1EPZA 1NAEA 2V5YA 4Y5SA 3USSA 3PUIA 1W8NA 1RUC1 2R32A 5FZHA 1JYCA 5T52A 4LKFA 2LUWA 1XYPA 2P5BA 4CP2A 3FHIB 2WZR3 1PGW1 1VBD3 3S30A 3I2DA 4R9AA 1JUIA 4FFIA 5LCWL 3VBHC 4XBNA 5K8SA 1CZTA 1HN0A 4MLOA 1W3XA 2A6ZA 4LKSA 1SLAA 1ZRIA 1OFSA 2VZ1A 2RV9A 3HQXA 1F8VA 1CAWB 1OQ1A 1S0IA 2EICA 1OA3A 3OYWB 5EV7A 1QEXA 3W9AA 4LITA 3H50A 3NAPC 3S57A 1ZZ8A 3WDXA 1HRI3 3FE5A 4XETA 3T0BA 4E4HA 4JTOA 4CRQA 4C91A 5CFCB 4CCJA 3H7YA 1FV3A 1PNGA 2YU1A 4QPIB 1UZYA 2YFUA 2PHFA 3INAA 3WF3A 3ZKUA 1N47A 5DUVA 5DZEA 4XJZA 4DXTA 1AYM3 3VDDC 5CISA 2NLRA 3W20A 4CXYA 4B4PA 2XBO1 4PIYA 2WN2A 4YFWA 5CFDB 2AEZA 1CAWA 2EIDA 5FLHA 4AFCA 4C0BA 4OZOA 3ZYHA 2VVFA 5FWEA 5FO7B 4QPIA 5FUNA 1V6MA 5EYXA 2P6CA 2VMEA 2RMU2 2Q8EA 3VB9A 2PLV3 5ACA2 3J9SA 1S0BA 4IEPA 5GLZA 4CP9A 1UMIA 2XKOA 3UKTA 1RHI3 2VCBA 3BODA 2D44A 3EO6A 1HRV1 4XUNA 1S0JA 5L7OC 2E51A 2R063 1PO12 4ZONA 3WDWA 5FZ1A 4AR2A 1OPMA 1LEDA 3X29B 3M3CA 5FZOA 3WW1A 2QBXA 2WUHA 4N7IA 4ET7A 3J7NA 1XNCA 3VBRB 4ZZ8A 3VDBA 1XNAA 4RFRB 1NQJA 1PZ8A 4XUTA 2OQ6A 2RS33 2X5IC 1AR62 3BOPA 1ZBE2 3IIAA 3M3IA 1RUC3 2GSYA 5LBBA 4ZHNA 1E57A 5A33B 4XF3A 3NV3A 1RUD1 1QJU3 3NKTA 3NRUA 1I5PA 3O1VA 4LIVA 5IWFA 3RWNA 4I30A 5F39A 3VD4A 3E5QA 1OD5A 4MGSA 2X09A 4E27A 5ISLA 4AQSA 1Y4WA 2NYYA 1AR71 3WEZA 1UZZA 1PM4A 5FY9A 4LO6B 2JEMA 4IV1A 1YUDA 1NQDA 2Q1FA 4QU1A 2EXJA 3E5XA 4BQ4A 1BZWA 3LKJA 1ND2C 2VECA 2RR12 2ZGQA 2GN3A 3WW4A 3ETQA 1TZOA 3AFGA 1K5MA 3C8XA 4AVTA 1O91A 1QDCA 2QNKA 4UW6A 2IFRA 5I0UA 3ZSJA 5EHDA 1A3KA 3LEGA 2I2SA 3M4FA 2WRAA 4LT5A 2ZKNA 1NXD1 2IUWA 1RMU2 1AYM1 4XFFA 1RTVA 1ACCA 1OHFA 1QJX2 1M06G 5F8PA 2XUEA 3KQRA 2XBO3 5EP9A 2WNOA 3VDCA 5C3RA 3B00A 2GU9A 3POBA 5A1LA 2DWRA 4FP2A 1AR61 5IVCA 1DLLA 4QKFA 5F2WA 4BPZA 2AZ5A 4DXZA 3P3NA 1UZ0A 1CR7A 3BOWA 4IV3A 4AYUA 2DFCA 4U36A 3LD8A 4QB6A 1RINA 2WNUB 4AF9A 4XAAA 3SXWA 1AR83 3MZHA 5A7QA 4CCLA 4NAOA 1UU6A 4CEYB 1H1MA 5FJHA 5A3UA 1L3JA 1FOD1 1KXGA 3H1MA 3K48A 4MO3M 4YZ5A 4A44A 2GALA 4OLLA 2JDHA 2ZEYA 4UW4A 3GBGA 2YXSA 2C9AA 4OUEA 4MGZE 3GDBA 2EXIA 5FMBA 5A6YA 4QB2A 3MIFA 5KHKA 1GR3A 2IXLA 2WT0A 3OTFA 4IEOA 4QPWA 4UFKA 3BTZA 1PO11 1YO8A 4Q1RA 1ZRFA 3CBNA 2DV9A 4QHBA 1I1EA 2VUDA 1GKBA 4CE8A 3VBSB 2ADEA 5ABJA 1EV11 1PX4A 2WFF2 4TXWA 4XZPA 1BVVA 1QMJA 1ZBE3 2J7MA 3BPZA 5AVPA 4Z8BA 2AACA 3PVOA 4XFIA 3LE0A 3OSDA 4HN1A 4F7ZA 2LRPA 4XIOA 2A70A 2W39A 4N53B 3UYJA 4HETA 2W91A 1OH4A 2JE8A 4LBQB 3USUA 3BCWA 3RZZA 2JDMA 1OUSA 4QXCA 1B09A 4W65A 5CFCA 2BTVC 2Q1ZB 4XBQA 1YCIA 3OB8A 3KT4A 2YY1A 1JYWA 4URTA 4V2WA 3C7OA 1RVF1 2HEWF 4BQYA 3AFKA 4DY3A 5C4WC 5KXEA 5CEHA 4OVEA 4A2UA 1D2QA 4IE5A 5FPVA 3VBSA 4ZU7A 4WM7B 1X36A 2DF7A 3A23A 3WNLA 4XDQA 1QWRA 2EIGA 4CCMA 5LRSA 1QJZA 4Q8KA 1LTEA 2DFBA 2XQXA 4QD2A 5EZWA 3ACLA 4TN7A 1O4TA 3MIDA 5L36A 1PM7A 3RI8A 5FZBA 3OOXA 2FDIA 3QOPA 1U12A 4YYOA 2YZ4A 1WMFA 3AKQA 1JTZX 5A6ZA 3FN9A 5H9QA 1YI9A 5F9TA 2WNEA 5IFTA 5FDBA 2Z42A 3DXTA 4ZY9A 1AZDA 2P1BA 2JG8C 2XGXA 2YC0A 2YV8A 5JI7A 1O5LA 2CWMA 1UYXA 2IXKA 4MGQA 1QJX1 1BJQA 2DUPA 3VBOA 2D6NA 4RL7A 1KDKA 1GQHA 2XH6A 3WNKA 3K4AA 4E4SA 4Q4V1 3AC0A 4CDXC 5HBAA 5KC6A 3SEEA 1XNKA 4CCEA 1XYNA 2DUOA 3C2UA 4OI0A 1LR5A 3RPQA 2B46X 1US3A 3O5SA 3EHKA 4IV3B 4L99A 5A33A 3VBRC 4B29A 4CCOA 3BTXA 1F9KA 1XE0A 4DFSA 3O1UA 3PL0A 2BFUS 3M7AA 1OQEA 4YRDA 1MEC2 1RUJ1 2CWSA 1HQWA 2QZ3A 1OVSA 4XDPA 2ET1A 2G9GA 3J8F1 4XYXA 3NKGA 2CL2A 5F2SA 5FWJA 3KF3A 5FZ7A 3OPWA 2D6LX 1H1IA 3NJVA 2E63A 3UV9A 4NUBA 1VALA 4WBBA 2WQ8A 3O7OA 2EVXA 3ZN6B 4CU9A 2D6MA 2ES3A 3WNOA 3JCIA 4DEVA 3WUCA 3AL6A 4EV0A 4CSWA 4UXAA 2GP5A 4GMP0 2K9ZA 3IPVA 5DG2A 4RSUA 3ME2A 4I02A 4MV2A 1V6KA 2QQLA 4DINB 4E9KA 4Z92B 4GWNA 1WKYA 2JE7A 1VBA2 2VZTA 2GC3A 3SKVA 3A0KA 5FO8B 4TSVA 2E9QA 1OBNA 4QDRA 4FTBA 2WYSA 3KHCA 3VZJA 1DQ6A 4JKLA 2XLFA 5BNNB 2BQPA 3QH7A 1TG7A 1UY0A 5JXIA 4NWVA 2HWC2 5LATA 1W8WA 4EROA 5F1RA 5FKBA 4CPBA 4FPJA 3NNJA 1AR93 4ITCA 4FTEA 1KRIA 4Y1YA 2FMDA 3PNAA 3SITA 4A3ZA 5A1FA 1UQXA 3CZUA 1LESA 4XUQA 3B9IA 4E4ZA 1TMF3 2AC1A 1PVC2 2LTNA 2NM1A 2RM21 3UKVA 2FCVA 1OMIA 4RFT0 5C9AB 4PDWB 3I49A 1R083 3TEXA 3ZFFA 2R042 1SMVA 3VBHB 2YDEA 1KQRA 1QXPA 2Q30A 3DN7A 4EN8B 1ZX5A 1W03A 3KCXA 3DEMA 4CUCA 2VNRA 5FZCA 1JZ4A 3OEBA 1VBB2 4UWDA 4AFMA 3T2QA 5A3TA 4YGCA 1W6QB 4I0BA 2G9ZA 4OI1A 2ILMA 4ES8A 2XXZA 1WD3A 3A7QA 5F6LB 5GLVA 2VZRA 2Y26A 1F4AA 3AKRA 3VZNA 1VAVA 4W8JA 1VB2A 5C7GA 1UY3A 5C8CB 2A75A 1ULGA 3DYOA 2RS51 4J1WA 4N43B 2B4KA 5A7WB 3WDYA 4BB3A 4LBQA 2WBKA 3USUB 1B35C 1R082 1Z0HA 3WW2A 2YROA 4CTEA 4DXSA 2ENRA 2JB8A 4NAMA 4UFIA 2A1XA 1V9U3 1DGLA 2RS12 4OUSA 2YYOA 4YPJA 1W2UA 4CA9A 5JZGC 2WFF3 2D7FA 1SPPB 2BFUL 3SCFA 2LW8A 3OY8A 3T1LA 3OPZA 5FQ0A 4XFBA 2VG9A 3W21A 4XMAA 2EIBA 5KXBA 1PGL1 4LBMA 3R4DB 3LSDA 3V0AA 1YFWA 5BY5A 2AYHA 4DOUA 1YJKA 1UU5A 1RUI2 4QPGA 1GOFA 1WW7A 5L9RA 1AX0A 5I0RA 3TNPB 1RXFA 3RGBA 1UY1A 2YC2A 1GYKA 1NLQA 3NL1A 3BKZA 2WINB 1R091 4K1YA 2BNOA 2WWUA 3ACIA 5IAXA 4QMAA 3QD6A 3ALQA 4IQPA 4RGKA 1ULFA 1GOGA 4K8RB 2R061 5FZ4A 4LR4A 1DQ4A 2DCKA 1SLLA 1GZWB 1QXRA 3B94A 4XFHA 2ZXQA 4EZ4A 3ILNA 4FPHA 4L9BA 4COWA 2P17A 2OPWA 2JIGA 4ZPIA 4YVSA 1TMF1 1MS3A 5CVRA 2D40A 3HN1A 4LBNA 3A22A 4KWJA 4QXHA 4WM8C 1DQ0A 1R081 2JICA 3GZTB 4S2FA 1OLME 1C8M3 4QHOA 1RUD3 1CONA 1ULOA 4Y22B 3AMHA 2B39A 4QGLA 3I2FA 1BQPA 3AXDA 4V1PA 1VPHA 2Z69A 4JGZB 1W6NA 2D43A 2JJ6A 4U2AA 2QFEA 5FP3A 4FTSA 5A1AA 1ZZ9A 1MS1A 4EE2A 3GZAA 4IW3A 4FPOB 1HRV2 4XJ8A 4I2OA 2Y6GA 4OHZA 1UU4A 1OLRA 5A3NA 1NCQA 4OHWA 2PHDA 4Q8LA 4BQ2A 2VMCA 1CZVA 3WHUA 2AEYA 1EAH1 3DCQA 4JTNA 2ZZQA 3ACFA 3FHAA 5D1IA 1ZZ6A 3KGLA 2W3JA 2Y0IA 5I91A 1LENA 4HT1T 3UGGA 3VGIA 1OUXA 2YB7A 4UYBA 1GZ9A 3W58A 4PT6A 1NLRA 1UO9A 4FAHA 1W2OA 4XF1A 4K7JA 2W5FA 5LEJA 1RUNA 1AR63 2RS32 4LO4B 4CEWB 1S0DA 1WGPA 5FAXA 2WNUC 1GQPA 1HB2A 2HWC3 1AR91 1EYBA 1AYN2 1COV1 1BLZA 2UWBA 2VBBA 2XB6C 4NWWA 2W94A 2BOJA 1IG0A 2VUAA 3D82A 4WV8A 5DAPA 2JKXA 2OIIA 3D3AA 4QX0A 1CQ9A 1PVXA 2JG8A 2DCTA 3GBFA 3PUQA 2VO5A 3N9PA 4COVA 4HVRA 4XFAA 2J1SA 4WVVA 4YZ4A 2A6XA 1V70A 1TME2 2YPDA 3OGRA 2PHWA 1SG3A 4N7UA 3VKNA 2E53A 2Y60A 5LA2A 1F4HA 1VMJA 5HPOA 2E7AA 3H8UA 5IHRA 1VBC2 4FFGA 4YW3A 3TOJA 3VD7A 4QX7A 4XTPA 3VBSC 3G7DA 2Y6KA 4OQ8A 4ZU5A 1LCLA 2GZWA 3NNMA 1ND3B 5JPNB 2UY8A 3HBKA 4KWKA 4PQ9A 5FOBB 1HB3A 4W6YA 2ZGPA 1C57A 3FJSA 3FX3A 3AKPA 1SACA 3HMYA 3FFZA 3QCWA 2VM9A 3ZM8A 3ZDVA 1RGSA 1XNBA 1OKQA 2HWE3 1X50A 2R0FA 4Q29A 4RGGA 1HQLA 2RS11 1SFYA 1SFNA 3CU7A 1HRI2 1PGW2 4Z2AA 4P14A 4BHPA 1Q8VA 5HI0A 3ORJA 3VN4A 2VH9A 2VNVA 2XHKA 5DPNA 2GC2A 5D2AA 4HVQA 1ZVFA 1FOD2 1ST8A 4CUGA 2PLV2 3OGSA 2HWD1 1D4M2 3P1IA 4HPKA 2HYXA 4XXAA 5JOZA 3ILFA 3JBG1 2BVBA 1FMD2 4FBFA 4URAA 1JODA 2YUEA 1PZ7A 5D8AC 4G9SB 1Q56A 4HOOA 2YMZA 1GANA 2VW0A 1YIPA 3VZLA 1IS3A 5BV6A 5FXXA 3IIIA 1K45A 4JGZA 3TEWA 1HV1A 5F5QA 1XBFA 3L9JT 3OUHA 5SV8A 5L9BA 4MYEA 3CJIA 3ES1A 5L9VA 5JXHA 2JG9B 3PJYA 1RUH2 2QDNA 5FK8A 5KC5A 1OXCA 1JZ7A 2DVFA 3IDBB 4YFZA 3Q8EA 3WD5A 1O4YA 3E6DA 2D98A 5JAXA 1JU3A 2BYVE 1DQ1A 2H0VA 4GWMA 1SZBA 2XJTA 1V6JA 1W2NA 1R64A 3D0SA 1RL3A 2P37A 3D4KA 2UYAA 3OCPA 4PDWC 5K4LA 3V65A 5LRRA 3ZSKA 1H9WA 2L9LA 5GZCA 3WCRA 2JDKA 3ZSLA 3KZ4C 3U75A 4AOCA 5FZOB 2IZWA 2YBKA 4AFAA 4AZZA 3CQOA 1VJ2A 3TEYA 4P9WA 3AMPA 1W99A 4O9GA 2JKBA 5H9SA 5JIUA 4HBNA 1KJRA 1N3OA 2FMYA 4IERA 5FR3A 3IPVB 1CAUB 5KBFA 4GALA 2R7EB 2D97A 3O12A 4LJHA 1F2NA 4AEDB 3IDCB 3AP5A 4JGZC 4HONA 1Y9MA 4YGEA 5JDBA 1F35A 3C7FA 3NV4A 4CP1A 1GUIA 1JHNA 2VAUA 1QJFA 3H3ZA 1XRUA 1W6NB 1QF3A 1CAVA 1VBC1 2W2IA 4AEMA 3MGUA 4G3YC 4B1MA 3IT8A 4CDWC 3ZYGA 2DVAA 5IVYA 1ENXA 5CNAA 5FXWA 1S0EA 4B7KA 1D7PM 4LOSA 2ZEZA 3B01A 3UGFA 2GNTA 3V56A 2PMWB 2X5IA 4I0AA 2CY6A 2KM2A 3LDRA 2W1SA 4FI9A 4GB32 3VBUB 1O3RA 2VUJA 3JBG3 3R4SA 3WNPA 2J1TA 3AP7A 4A6OA 2WS93 1RHI2 1IOAA 2BOIA 3M1HA 1CAUA 3OUIA 1LOFA 5C3PA 2GC1A 2XJSA 2A7AA 1RUE2 2RJ2A 2W1QA 2ZEWA 4B7EA 4F3JA 2ZKLA 1DIWA 1LGBA 2C24A 4XUPA 4UF0B 3BB6A 1QOSA 3ZXLA 1ZA4A 2OQ7A 1OOPB 3S7EA 2DBNA 2ZAHA 4NO4A 2OZ6A 1W06A 4RHV3 4CPBD 1JMUB 2RR11 5AC93 4XHBA 1GFF2 1N1SA 4QQLA 3KSCA 3PTYA 3AMQA 4NMIA 1AYM2 1YWKA 4Y20B 5FPAA 1JYNA 4YM3A 5C9AC 1CPNA 4Y4RA 3AP4A 3ZX7A 3QACA 2HEYF 1S55A 1KEXA 1W9WA 5JWPA 4OHVA 1Y43B 2YBSA 2DCZA 4CDUA 2QKDA 4R4ZA 1FI2A 5JR7B 5DUXA 3WP4A 1RJ8A 4AGRA 2QQOA 3URFA 1LGNA 1OVPA 4JHZA 1GU3A 1JZ6A 1ND2B 5FY0A 3ZFEA 3KLSA 4CU8A 2KXLA 3POSA 4FOWA 5F3GA 3ZKYA 2HJIA 1UNBA 3N9OA 1BKZA 1QJY2 2E7QA 1WMXA 2WR9A 2WWSA 1MVQA 4PLNA 3BN6A 3UJQA 4UFMA 4ZKTB 2C0ZA 3JZVA 3THDA 3AP9A 4C1XA 2UURA 4YLZA 2VW2A 4GKXA 1CAXA 2YFZA 2OS2A 1QY4A 4FPKA 1I5ZA 1U0AA 5DDJ2 2VQTA 2WZPP 2PHRA 3BTYA 4KG0A 5CIRA 3RJ2X 3KD4A 4DY5A 2HWD3 2F17A 2VOKA 3KMHA 2JDNA 1OPOA 4K8FA 5JUVA 1ULCA 2VQUA 5DG1A 2ZX3A 1IPKA 5A3OA 2NMNA 3O14A 3RG0A 4JZRA 4UOJA 3ZFEB 3GNEA 4FSJA 3APBA 3K75B 4XACA 5F3EA 5HCAA 5A70A 2ZHKA 4BQXA 4J1XA 1W9TA 2PXJA 5D8AB 2VVEA 3WXPA 2BV4A 2BGPA 3JUUA 1QNWA 3I2IA 3GF6A 3LSEA 4QWNA 2FDHA 5FYCA 1WLDA 3DKQA 2JIJA 3JQWA 4W6XA 4YW1A 3ZR6A 3DF0A 2A3YA 4BXSV 3C7GA 3OGGA 2ADDA 3QBQA 1OURA 2GC0A 3EQEA 3MLJA 5JOXA 4NJ4A 1RYYA 5IVFA 5IATA 3AKSA 5FUIA 2WAOA 2Y34A 4GQ7A 3CZJA 5LWBA 4XCBA 5JVVA 4AEKA 3WZ1A 1J58A 3VUOA 2IXIA 3UK9A 4EN0A 4E2SA 1GSLA 1C8M2 4ZS3A 1PMHX 3T08A 3WF0A 3Q8FA 4OYUA 2R6QA 1UXZA 3JB8A 5FXZA 2CAUA 5A7NA 5SV5A 3T2PA 1A34A 1BMV2 4RD7A 3FZ3A 2ZZJA 3PVNA 3IWZA 3H9AA 4H7MA 3N9MA 5DZGA 5BPXA 4DNYA 3OF1A 5IVJA 4XTMA 1BMV1 1POV0 4L92A 3ES4A 4OHXA 2OT7A 4IE4A 1AUYA 4YW2A 4PLOA 1TQ5A 4CUAA 4NHKA 2ZMLA 2VZQA 3T0AA 2RDQA 4IDZA 1HJFA 5T3NA 2DU1A 1VBA1 1DCSA 4YGBA 3I3EA 1PO23 4GB33 5C4WA 1WZXA 4NIAA 1LNSA 1XU2A 3OY8B 2GP3A 2WA3A 2C6SA 2MPFA 1SBFA 4WM7A 3VHNA 4LA2A 4AVVA 4Y26A 4N53A 2JDUA 3BIEA 3I8TA 2VQ0A 3CEWA 3WHTA 5JXJA 1LOCA 3WQ1A 5IW0A 4WM7C 3HR9A 1I3HA 1PMJX 1S2BA 1U5IA 3OEAA 1EAH3 3M3QA 4XJAA 4DZGA 2W9XA 4GH4C 5AFBA 2XVLA 1GWKA 1QJU2 2RDNA 4AHZA 2J1EA 2ORXA 4NRMA 2G19A 2PHXA 1OOPC 4LXLA 2CYFA 3OUJA 2XOMA 3VBUC 4CEWC 1X7NA 5BUVA 4IEYA 4YZ3A 4NIIA 4R8HA 1DGWA 3K4ZA 1HJGA 3KT7A 1CIYA 3MUZ1 2MEV1 3JU9A 4MG2A 5B4NA 5F3CA 1DG6A 2RJKA 3LFMA 3VZMA 4FXGB 2C26A 4MGYE 4PI2A 4W4ZA 4CDXB 1UYPA 1RUF1 3AZXA 1UY4A 4K9SA 5GKAC 3VL9A 3DPRC 1KDMA 2HWF3 5E6HA 1W9SA 2FDGA 4YVWB 5EWSA 2B7YA 4LBKA 1WD4A 3RZJA 2W1UA 3J8F3 4AI3A 3N9LA 3WOGA 2Y6JA 4HL0A 1YFXA 5JI9A 1W6PB 4OQ9A 4NN0A 1AL0G 2CHHA 4Q4Y2 3ZXAC 2R072 1EUUA 2HEVF 2WDBA 5C8WA 4Q0VA 2BVVA 5A6QA 5A80A 2CV6A 2VZUA 3IN9A 3WNXA 3MF6A 5M0TA 5G05L 1AR73 4LEJA 1SHWB 4JRAA 1TMF2 4AVAA 4W6WA 4Q4X3 1T2XA 1AL23 3I2JA 3AYCA 4AQ6A 2I07B 3POWA 3E97A 5ANNA 2IXJA 4MXWB 4QX8A 2R0HA 1UD1A 5EIYB 1AXZA 3KHBA 4QT6A 3V0BA 1FMD3 1J1TA 1DYPA 2RM22 3DV8A 3M2MA 4HFSA 5LY2A 2HWE1 3MF9A 3H8RA 5FYMA 3WCSA 1QDOA 3GHMA 4KGGA 3RRDA 4JDOA 4PI0A 2K0GA 3WV6A 1W04A 2WNVB 3AP6A 1ZRRA 3AL5A 5FP8A 3FLRA 2QUOA 1TME1 4B1LA 3AVSA 3WR0A 1K5MC 5BNPA 4OCTA 4HVOA 1H8TA 3PIGA 4K40A 3MEPA 4PBPA 4JGYA 4Q27A 3PUAA 1VRH2 3U0ZA 1PX3A 1N1TA 3MDPA 4Q4X2 2J1RA 2PAMA 2CDOA 3NO8A 1QH6A 2LM3A 1Z78A 3HIFA 1AR81 1JU4A 1W8FA 3KS7A 3FHQA 4Z1VA 1Z7S1 4Q4Y1 1W8HA 4YVSC 3BI3A 3CO2A 5J96B 1URXA 2B45X 3VBOB 1GMMA 2A3WA 1QU0A 4KI5M 4D0QA 1LAJA 4GKYA 1VMFA 3H8XA 1Z7S2 4IEWA 2JDYA 2D5HA 1Y7BA 4XEZA 1O3QA 3VBHA 1S2KA 3N7MA 1LOEA 4HKWA 5IFPA 2FHRA 1PIV1 1DZRA 1XNDA 3MIGA 5CYYA 1UZWA 1DQ5A 1RXGA 2X53S 5IJRA 1G9FA 3ASIA 2N7GA 5FMOL 1H8TB 2Y0OA 3GCXA 1QHDA 3ZFGA 1QQP2 3PTRB 2AENA 3HJRA 4Z82A 3LEIA 4OULA 1WCQA 1X8EA 3R0RA 4COUA 1IQAA 4XOGA 4EWDA 2PN5A 2WO2A 5LBEA 3D0JA 3KVAA 3WT3A 3ZXJA 1KS5A 1IZ3A 5IK4A 5CFDA 1LKNA 1YIFA 1H4GA 3PJQA 3VDAA 2D3SA 2A6YA 1X8MA 3RZKA 2BNMA 3GJAA 2RMU3 2HWB2 3ZXGA 2J1UA 3VDDA 1AX1A 1RIRA 2O8OA 3RS6A 2Y6HA 1GLHA 1O8SA 3ETPA 4LQRA 1LHWA 3W5NA 1LJ7A 2SLIA 1NA1B 2QQWA 4ASMB 3JD73 1PGSA 5FYUA 2ZGOA 1CWPA 3WW3A 1YYNA 3TNQA 1ENQA 2D6KA 2CAVA 2P3JA 2VOVA 1VAKA 1BK0A 3OG2A 3TN92 3L2HA 1ZBA3 1BBT3 3RZLA 3H7JA 1WMDA 4PCRA 1IKQA 5EXOA 4NIDA 5DQ0A 3MV11 1SFPA 1X9PA 3ZYRA 3T4VA 2FBEA 4DO0A 4GH4B 1VP6A 4J6GA 5ACA1 1VBB3 4WM8A 1FYUA 1PGL2 4DPNA 4AE2A 4BIFA 1H1AA 5LW9A 1JZ3A 2MEV3 4IV3C 4YNIA 4B4QA 5GJ6A 1XE8A 4Q4V3 3ZFFB 4BCUA 5KXCA 3O1RA 2X8KA 3VKMA 2NP0A 3B9CA 4CU7A 3K51A 4FO9A 1LOGA 4IESA 3POIA 4NE9A 1FPN3 3RVHA 1NZCA 2IXCA 1CESA 4NPMA 1GZTA 1GNYA 4IL7A 3RZMA 1UX6A 2NPIA 1RITA 4EWEA 2WZR1 1G86A 2VUCA 1S0CA 4XBLA 1QJEA 2AGSA 2QCSB 2QQMA 3DPRB 2GNMA 1VB4A 2Z79A 3N9NA 4FPLA 5IVEA 4FPYA 5DMYA 1H2NA 1BXHA 1O4ZA 2BDRA 2EALA 1HXS2 1PK6B 4E8CA 3MUY1 4LHKA 1NOVA 1WLCA 3WDVA 2Z2SB 2GMPA 3ZVXA 1RUOA 2ARAA 4ORFA 1IPJA 2VCMA 1AL21 1RUI3 2BRTA 3EYPA 4JDMA 5C8CC 1LOBA 3NNFA 4LORA 4XHXA 3RJRA 1KJLA 1W90A 1K5JA 2F4PA 3LAGA 3PLQA 3T4HB 1FMD1 1F5JA 1K12A 1XXNA 4ATFA 1VR3A 3MBWA 4YW5A 4TLGA 1SPPA 3I3BA 1NT0A 2VJXA 4BMEA 2WIIB 3TEZA 2V4VA 3FMGA 3I2OA 5KXDA 1UCXA 2V72A 5J37A 4HG6B 5T55A 5K9YA 2GAUA 4FPCA 1VMHA 3IMNA 1XQNA 1KGYA 4M00A 4UFLA 4XFCA 4AAXA 5FKCA 1OA2A 5K0UB 1BVP1 1E5HA 3KB5A 2OA2A 3HN3A 4RQPC 2XR4A 3D5OA 2R062 3HD8B 5BNOC 1SLCA 1COV3 5EJ3A 2GDFA 4LK7A 4O61A 2QQJA 3ZFGC 1GZWA 1AXYA 2PA7A 4Q4Y3 1HRV3 5ACA3 2VZOA 4A4AA 2ZACA 1BBT2 3KV4A 2OYZA 3CLPA 4PHZA 2QQKA 1HV0A 2VD7A 5CZKA 5FY5A 4BXFA 4IEXA 3P6BA 5FCCA 5LK5A 3SH3A 5E89A 1MS9A 5A32A 4XIKA 3VBOC 2RDRA 3B5LB 4LHLA 1AL22 1X33A 4ZU4A 1DP0A 2VZ3A 5HCBA 2BP6A 3U78A 1F5FA 3ZMNA 1J83A 1PVC3 2H0BA 1BEV3 1GV9A 1YQ6A 1IPSA 1UXXX 1A8MA 1UIKA 1QH7A 5FYZA 3RYPA 4CYDA 4YSFA 1QGLA 4CUBA 5GZDA 2VVDA 1J3PA 2Q8DA 5J36A 4IEZA 1FAYA 2ZGRA 1TVGA 2J1VA 3KT1A 1NCRB 4N9HA 4P9XA 5J3UA 4O7XA 3B7MA 4UW3A 2GH8A 3IB3A 1OD3A 4ISRA 1IG3A 2JDAA 1SCRA 3K77A 4XF0A 2TBVA 4BK5A 1FNZA 1WWYA 3HAGA 4GWJA 2VMHA 2KR2A 4AFBA 5FZ3A 3LB9A 3SCHA 2WFPA 1F15A 3NAPB 1LRHA 4Q4W1 4FQZA 2RS53 4GZ9A 4LHNA 4NPLA 4QM9A 2ZGLA 1AYN3 3BALA 4M3CB 4H7LA 5F5IA 4GB31 1U5YA 2ZA9A 4BDVB 1MS8A 3TN91 1UIJA 2YGLA 3ZSMA 3KV5A 1JYTA 3I4IA 3I2GA 5HV0A 1DYOA 1NCRA 2JWPA 1QOOA 2VTXJ 3IBMA 3QLQA 2FZ2A 3SH4A 4WVWA 4XVHA 2VNGA 4JRLA 4JKKA 1W8ZA 1W2TA 4QDSA 4QQPA 2VZPA 4S2HA 3O0VA 1REEA 4MGTA 2ZABA 2ZJCA 1FATA 4EJRA 2VZSA 4QB1A 3I59B 4R4XA 2OXBA 5DDJ1 1G7YA 2WZEA 4PDWA 5C9AA 3HT2A 4QU2A 4UAPA 1J84A 5CADA 4ISQA 3LA7A 3MO4A 5C5TA 1T6GC 2CGPA 4N90A 3K4DA 2OPKA 3IDEA 4YARA 1CD3G 1PNFA 4L0PA 4DB5A 4KQ7A 4CEYA 2VR4A 4IUGA 1NZIA 1UF2C 3I7DA 1ZYBA 2Y64A 3SHRA 3AZWA 3BTAA 1CN1A 1TEIA 1C8NA 1VBE3 3JXSA 4Y4YA 5C3OA 1FOD3 5F5CA 1VLNA 1WA4A 4JVAA 2RDSA 4YVWC 1CZSA 3V64A 1L7QA 1JZ2A 4WZFA 5K0UA 5EJZB 5C3QA 3MW2A 4XE9A 3LDBA 1GZCA 2QTWB 4RYDA 3WY6A 3BUCA 5DAXA 1N3QA 2FCTA 1YXWA 2GMEA 1W0OA 4IEQA 1HRI1 2VW1A 1XSRA 4R9BA 1NKGA 2D6OX 3FUOA 1NA1A 2V5DA 3THTA 3ZOIA 4AGGA 4CDQB 1UOFA 1G8WA 3PHMA 2PHLA 3ON7A 1IQDC 1V6OA 3ATGA 3N3HA 1CJDA 1G6NA 1VBC3 2E26A 3LOIA 5I8YA 5F32A 5FMCA 3P5BA 4Y24A 5JSPA 3ZN6A 3WQ7A 4UFHA 4CDWB 4EN7B 2I45A 1O6UA 3E5UA 5EPAA 2E32A 4LBJA 4QX1A 1WW6A 5FXVA 2P2KA 3SISA 3THCA 2VY0A 3S5AA 5IK7A 1JOPA 1NCQC 2QQVA 4AEJA 3S0MA 2WNVC 1UZVA 2GNBA 4GJYA 2KA3A 3CMGA 2PQQA 2ZS6B 3ZIXA 3SH5A 5FO9B 2DVGA 3EB7A 2R30A 3ELNA 1OF4A 2XJVA 3KF5A 5ANQA 2ZPXA 5K0UC 4MH0E 1DGRA 1H2LA 3J7HA 2XQRA 5DDJ3 2DU0A 4NRPA 2HWC1 3OYWA 3MI8A 1RVF2 2ARXA 3FLPA 4GULA 4Z2WA 2RE9A 5BNOB 3IZOA 4BQ3A 1UYYA 3BVCA 2VMIA 3HT1A 3CL1A 4OI4A 5CA6A 3CJIB 4A3XA 3ZFFC 4D69A 3WP6A 2BPA2 3LEKA 4MOAA 1GBGA 2ZX4A 4KGQA 2RJLA 4Y20A 3ZXDA 5CB7A 3LIGA 2JB4A 2VBDA 3NQHA 4W50A 4HSJA 4K21A 2W52A 4M01A 3DGTA 5A32B 1HN1A 3AZVA 3I59A 2MEV2 1PVC1 1VBE1 5BNPB 5L19A 3MIEA 3V0AB 1MEC3 3PVBB 1DZTA 1EV12 3TYJA 1IKPA 1NY72 2VBPA 4IGQA 4Y33A 5JR2A 4DRVA 1C1LA 5I8TA 2FDFA 3WSOA 2LALA 2WAAA 4FXKB 4UF0A 1V0AA 3T09A 1PK6C 5C71A 2FD8A 3MLLA 2XVGA 4KU8A 1JYVA 5K7PA 3C7EA 2RVAA 3WNMA 2O8QA 3KV9A 4RS5B 3RMXA 1US2A 3LQCA 3WVJA 1TNRA 5HXMA 3PU8A 4WVZA 3PIJA 1UWWA 4JAAA 4KG8A 4IE7A 4NVPA 4ZXEA 3GZUC 4GA9A 2XONA 5JIAA 3I2KA 1M4WA 3DL3A 3POEA 2BWAA 2VOWA 5DZFA 2GNDA 4Y1ZA 4BQWA 2B42B 5LBFA 3GGLA 3HNMA 1AR72 3LDKA 4JDNA 3WQ0A 4RS5A 4AAPA 2O14A 3K3NA 2UWCA 3Q8CA 1OFNA 1ZZ7A 3AJZA 4WVMA 5FPBA 5T5OA 3UL2A 1QJY1 2J1AA 1C5IA 1B35A 3WG4A 2DVDA 5JOWA 2VCCA 3AVRA 1TE1B 5C4WB 4INDA 4J25A 2W46A 4OMCA 5F7UA 2ARCA 3VBFB 3ZFEC 1S0GA 4YW7A 4BLJA 4I01A 2VMFA 2G4IA 4FQ4A 3E6CC 4H3WA 1VBD2 5A7OA 4JKMA 1RUF2 5GLWA 4IEVA 5J48A 3ABZA 3ZO0B 4IV1B 4NHYA 1DGRN 2R16A 2ZAAA 4LE3A 2SBAA 2XJPA 2VC9A 1D0GA 1VBB1 5FYHA 4D7TA 3OGJA 4K20A 1SLBA 1HB4A 2HWB1 2QZ2A 1FT9A 3ILRA 1MACA 4OZXA 4JQTA 4QXKA 2XUMA 1HDKA 1R1A2 4FT8A 4YG3A 1FPN2 1SLIA 3LFIA 1RUG3 1DHKB 1KS4A 3T3YA 2HLEA 2IFWA 1LOFC 4I3PA 1G9DA 3U4SA 4SBVA 5G04L 4XMIA 2CGOA 3O0WA 4X8PA 3WF4A 5GM0A 1MEC1 1RUJ2 1XPWA 3RZGA 2BUKA 1S0FA 3FLTA 1YFUA 2YG0A 2RG4A 3O1TA 2DBIA 3RI9A 1LHNA 1N1YA 2XJRA 3AX4A 3LIHA 1Q8QA 1CAVB 1PO21 4JHTA 1ZA7A 4Y1XA 1GNZA 4P5HA 1JOJA 3ZYPA 1D2SA 5LY1A 2WZ8A 3NVCA 1PO22 1HB1A 3NJXA 4PLMA 1E5SA 4ONUA 4QQOA 4OFGA 3M3EA 4JGYC 4HPKB 4C8DA 2VGDA 1RUI1 5FRAA 3ZDSA 1ENSA 1RMU1 5KWRA 1UKGA 3SC7X 2XWJB 4CDQA 1UOJA 1R1ZA 2FDJA 2TEPA 5FY7A 1CAXB 1UMHA 3WNNA 2WO1A 4M3CA 1V9U1 4D6SA 4DQAA 3DYMA 2BWCA 3R4UA 5F6KA 1ASJ1 3KQ4B 1MS5A 1Q8OA 3N9QA 3DPRA 5GALA 2BBAA 1HIXA 5FY4A 2P3YA 2Q5TA 2QQNA 5LEKA 3M8LA 2BGCA 2YHJA 4OI2A 4ATEA 4DRRA 4FCAA 3JQXA 1JUHA 2DTWA 3HOBA 2WS91 4GWIA 1U5XA 4R52A 5EJ1B 5BNNC 5FYYA 2DCYA 1EY2A 4A45A 3ROUA 3I2HA 5LA9A 2C5DA 4CZSA 5LASA 1T6BX 1XYOA 3MLKA 2ZGUA 4BM8A 2RR13 3F2ZA 2A71A 3K2OA 2PYTA 1VIWB 4JV4A 3GM8A 1C1FA 1S2EA 4BISA 3U4XA 1GWLA 1KITA 3UESA 3WUDA 4E2QA 4GH4A 3ZN5A 2VXJA 4MZUA 1RUJ3 3CJIC 2Q8OA 3GXUA 4AVSA 1UAIA 1VBD1 3LF7A 4K1ZA 5JOYA 2HWE2 5C3SA 2QQPA 2Q1MA 1H4HA 2AH2A 2ZHNA 4XFGA 1XU1A 2VNOA 2HBUA 1RUG1 4FPFA 2BZDA 5LB6A 1O7FA 2CU5A 1JS9A 4Q4X1 4Z07A 4LNVA 2CSGA 3M70A 1UX7A 1JBCA 2WC2A 4A42A 4PIZA 2XPJA 1O59A 2YC4A 1V9U2 2P34A 3OBAA 2AUYA 4N43C 3SEPA 4RR3C 3AK0A 3H0OA 4CDQC 3KGZA 3NNLA 4NR1A 1R1A1 2R1BA 3IKWA 2MHFA 3UETA 3WDUA 5BNQA 3N4MA 1A78A 4FOYA 5CAZA 1YQ8A 2FDKA 2RHPA 3HQRA 3U14A 2R49A 4HKLA 5A3PA 5TSWA 2XL9A 3N35A 4Q0QA 3S6PA 3PVEA 2J22A 5IK5A 1Q5OA 4ASLA 1BYHA 1QKQA 2QQIA 4Q4W3 1WCSA 4Q5OA 3H1WA 3IMMA 1W6OB 5JLVA 4ARXA 1AYN1 1COV2 4XJWA 4CDWA 1ULPA 1NCQB 4TLFA 4QHZA 1DU3D 3NV2A 2BU9A 2PFWA 4HMZA 1C4RA 1JI6A 3VDDB 2PLV1 4XC9A 5LA0A 4AEDA 1K5MB 3PMEA 3DKWA 2Y33A 3WG3A 1W2AX 2ID4A 3TBDA 2QDRA 1C28A 4K6BA 4YM0A 4CCCA 5DUWA 4IE6A 5T5PA 3CF6E 5ABJC 3D8CA 3KCCA 3ZMOA 2W92A 5FYBA 3J4UH 2WA4A 4P00B 3WG2A 1PIV3 3SLIA 5JXGA 2WL1A 2R073 1ALYA 1VRH1 4IV1C 2Z4FA 2WKKA 1NXMA 1XB9A 3TB0A 1FPN1 1AJOA 1OF3A 5J7MA 5E1RA 5FZ6A 4NIGA 3C3VA 2A6WA 5F5AA 3A21A 4KMQA 3WF2A 4YZ2A 1H8TC 4COYA 1GP5A 4LOTA 1QJU1 2X5IB 1CVNA 1W0NA 2VQAA 1P8JA 4QPYA 1S1AA 5KHJA 3VD9A 3LA2A 4C1WA 1G9AA 4AQTA 1ZM1A 3EMRA 1WCKA 5IVVA 3LA3A 3H42B 4JQRA 5T54A 4QXBA 3U37A 3VZOA 3OGVA 3LZZA 1BHGA 5FPUA 2RMU1 1X82A 4LO8A 2GMMA 4LULA 4BIOA 3W5MA 1UPSA 4XZUG 1WW4A 1W05A 2G1MA 5FZIA 3MIHA 1OA4A 2WSUA 1S4CA 1UMZA 4X6QB 2VTXA 4EN9B 3V0BB 3KM5A 5FUPA 2B9UA 4MXVA 4LUKA 3ZIWA 1CX4A 3GJBA 3A4UA 4Q1PA 4AI1A 1NX9A 3RYRA 3EXUA 2RS13 5FYVA 1EUTA 1W0PA 4FVVA 4RN5A 2E6VA 4BE3A 5FV3A 1U5ZA 4QM8A 1PK6A 4DUWA 3ZYFA 1OLQA 1O3SA 4UFJA 3J7LA 4AXOA 3IAQA 5FPZA 2EF6A 4F8AA 5A6XA 5CKMA 4S2GA 5J09A 1ZREA 1J59A 3AKTA 5FZDA 2Y6LA 1A8DA 1LGCA 5FYIA 4PBOA 4XPVA 2WLPA 5D21A 4NPRA 3R05A 3ZYIB 4NIHA 1ONAA 1W6QA 5L7OB 2YGMA 1HW5A 2GN7A 2ZX0A 3JD72 4KL1A 5J98B 3C7HA 4Q0UA 1D4VB 1UL9A 2C1FA 1W6PA 1MQTB 2UYBA 1ZRDA 5EQUA 2VXRA 4AW7A 4XCAA 1EP0A 1ZZCA 3WP3A 2W08A 5ERLA 1MZ6A 2OX0A 2BEOA 2R1DA 3O1MA 4AI0A 3VKFC 2WT2A 5DAVA 4BJ0A 4M4RA 2X29A 3J26N 2ZX1A 3VBUA 5BNPC 3MICA 3FL7A 5FP7A 1R092 2WSVA 4ES9A 5BYNA 1OQDA 1ZBA2 4ARYA 5FMDA 1EV13 4AL9A 2DUQA 5JMOA 5LZ6A 3WQBA 1ZBE1 4P08A 5FBZA 3RQ0A 1AR82 4Q4W2 1QIQA 2VULA 2WNUA 3I3QA 4XF9A 4P9JA 3TAYA 1W3VA 2WJSA 3CHXA 2BGOA 2WZR2 1JN2P 4COZA 2XDVA 3HPNA 2UWAA 4YZ1A 5APAA 5CFCC 1O5UA 4E8DA 3G6JB 1UKRA 2R043 4RR3B 4XURA 3K46A 2VE1A 3FC0A 4QKBA 2FZ1A 3NSTA 1OLMA 2W47A 3FUQA 3NMBA 2WO7A 4L97A 2A3XA 3FBYA 3ECQA 4FFHA 1FXZA 1RVF3 2HWD2 4MX3A 4NROA 5I0TA 4BQ1A 3LOBA 1YJLA 3AZYA 4LBOA 1W9YA 2NZ9A 3CJXA 4V2VA 4D94A 4PF1A 3T1MA 2OUHA 4GJZA 2ZGNA 4IXLA 3QH6A 1WW5A 1D4M1 4LA3A 3ZXEA 4AI9A 1QJY3 1TME3 3B69A 3HBZA 2IVJA 4H2AA 2E7TA 4RQPB 4XQDA 5HCFA 3VBFC 1YFYA 2BW8A 4CCDA 1AJKA 1AX2A 1MZFA 4YVSB 3ZR5A 5LA1A 4QKNA 2HBTA 5I8SA 1G9BA 5F37A 3I97A 4O9EA 1CIWA 2DTYA 2XKPA 4MGKE 1NE4A 5E16A 3AM2A 3VL8A 5FPXA 1GWMA 1E5IA 1Z7S3 2BERA 1MS4A 3AMMA 4XUOA 4G4FA 3PUHA 2ZHLA 1DBNA 1QXJA 2XMLA 1UY2A 1Y9GA 1CPMA 1N3PA 2JG9C 4HZFA 4L11A 3ST7A 2UU8A 2XJQA 2C9KA 2WO3A 3POYA 2V09A 5FBJA 5FZAA 2RS31 4L2NA 1I6XA 4YW4A 1RUH3 1AVBA 3IAPA 2TNFA 2XBO2 2JG9A 3I54A 4BA6A 5KR7A 2PHUA 1JYXA 4UW5A 4OHYA 2EAAA 1O3TA 2K2SA 2VTFA 4XAEA 2WNVA 3BYWA 5FQ0B 3H8OA 2HYKA 1ULDA 3EJKA 3N7JA 2V73A 4MVTA 5FY8A 4AEDC 4Y5TA 4E2GA 5GZFA 1UOBA 1NG0A 3HEIA 1H9PA 4YG0A 4QQ2A 1VBE2 2ZGKA 4N9IA 4QGMA 3WDTA 5KHGA 3VHOA 3OJBA 2ZCWA 2VPVA 1FV2A 4FFFA 2JX9A 4UBGA 4GMP1 1SDDB 2VZVA 3DXUA 1NA1C 1X9TA 1YEWA 2ERFA 2JXAA 4UBHA 4AI8A 5JZGA 3WLUA 1AHSA 3TN93 2DCJA 3BIWE 5KHIA 1ND2A 3S5QA 1JHJA 1H0BA 1DDLA 2VU9A 3OBRA 2WQ4A 4PIXA 4KWLA 3UGHA 1UN1A 4MHUA 3AYAA 3FBMA 1WBFA 2A5ZA 2JD4A 4QDQA 5FZMA 3U10A 5JMCA 3ACHA 2ORZA 4GXLA 2EIEA 1PZ9A 5DABA 3SCGA 5C8CA 4AVCA 3PURA 3NWKA 1BBT1 5FFOC 5DAWA 1C3HA 3PUSA 2ZGSA 1RUC2 4YVWA 2WYFA 4QAWA 5FZGA 4BYYA 1BK1A 4D6QA 3J7MA 3B93A 3MW3A 4LK6A 3UKNA 1LOAA 4OUMA 3VV1A 2DVBA 4DUVA 5ABJB 2P4EA 5IVBA 4MSVA 3T2OA 1RUE1 5FMOS 2G9FA 1MQTA 2DYCA 5FLJA 4TTGA 2IXHA 1AF9A 3WX5A 3IM0A 3ACGA 5JPMB 3FFQA 1NUKA 1VRBA 3LWCA 4E4DX 1DZQA 3LPGA 1HXS3 1MQTC 2ZHMA 1E5RA 4QPGB 3NNGA 3ZN4A 4FOVA 3NJZA 4BLIA 1K42A 1K3IA 1PMIA 4ZXKA 3N7LA 3ZYJB 2XJUA 4XABA 2ZTNA 3SMHA 3VZKA 2PAEA 1SQ4A 2XLGA 4BU2A 4D3WA 4F83A 1RUH1 4P9LA 5KHHA 2YBPA 4WVMB 1J3RA 5BXXA 5T5JA 1NCRC 2JENA 3LCPA 1KD7A 4JC1A 4NHXA 3S7IA 3MV01 4HKOA 1DLCA 1W6MB 4D8MA 4AK3A 3VKOA 5FYSA 3HNBM 4LO7A 5FZ9A 1CX1A 2FCUA 3NAPA 5B4XA 1KFXL 1MZ5A 1JH5A 3ZSEA 3P3PA 3WINE 1BEV2 2W0XA 3GCWA 5B2GB 4EN6B 1XOYA 3AMNA 4LKEA 4JCKA 4A41A 3T0DA 2HKXA 1F31A 4LMFA 5GZEA 3BPSA 4HANA 2D93A 3JBG2 4Q0SA 4Y1UA 1EPWA 4FP3A 1LEMA 2HH9A 1UYZA 4CDUC 4Y3OA 4CVUA 4Y22A 1W9FA 1QNYA 3N7KA 3Q8BA 4YG6A 3T2TA 3WG1A 4BQ5A 5JZGB 2TUNA 1H2KA 3ZPYA 4EQVA 1OH3A 2W1WA 4MXWA 1HQNA 2X10A 4AFDA 3PDQA 5IAVA 1RUG2 2VMDA 4DIQA 1ND3A 1STMA 2Y38A 2DDUA 3RDIA 4YWAA 3RYKA 2Y6FA 1DYKA 1WA6X 4DS0A 4QX2A 1G9CA 2HWB3 1Y3TA 2WABA 4LLFA 4KBBA 5AVAA 1NLSA 5JCTA 2XHNA 4HSLA 1IGOA 2C4XA 4Q0PA 3J8F2 4P5YA 3VHRA 5JSOA 3L2YA 4XQWA 3MW4A 1VRH3 2HWF2 1RUF3 2PELA 4M4PA 1VAMA 2BNNA 5DUUA 4RA0A 1DFQA 4CDXA 1A6CA 2WLQA 3DUIA 2D5FA 1BEV1 2QVSB 1ZZBA 5LK7B 4A6SA 1PHMA 3GZEA 5EFUA 4B8EA 1C8M1 1PO13 1ULEA 3CNAA 4XXPA 4CXWA 3OPTA 1XE7A 4HK9A 1SBEA 4X6RB 3VKLA 3O1PA 4WM8B 3RMYA 2LROA 1WLTA 1RJ7A 1KFUL 4LHSA 3Q8AA 2E33A 1RB8G 5EYYA 1ODMA 1OSGA 2ZMNA 1ZNPA 3CKHA 4BWOA 5IUQA 5C6CA 3O0XA 5CKQA 5GZGA 2BBVA 4AHXA 4BZ4A 2JD9A 2GH2A 4Q4V2 1XC6A 3GHNA 4M3CE 4AG4A 4N43A 3Q9OA 5A7WA 3WF1A 5CU1A 3TRSB 4R9CA 1B35B 1W8OA 3RFRA 3KV6A 4LE4A 1HX6A 4NOTA 4AWDA 3PMSA 1FX5A 2FQPA 4GAZA 4KU7A 3MPBA 3E1F1 4QX3A 4YM2A 4P02B 3E6BA 2F4LA 4AQ2A 2J42A 1XJAA 3ENRA 4P9YA 1GP6A 2D6PA 2WS92 2ZMKA 4LPLA 1JYIA 1JW6A 5HV4A 2NN8A 1UW8A 3ZXKA 5FTTC 2OVUA 1RHI1 1JZ5A 4YW6A 3I3MA 1JZ8A 4TZDA 1YQCA 3KWVA 4LKDA 3U1XA 4AGVA 2W87A 4FPEA 4SLIA 4LLOA 5F3IA 5A7SA 1VE0A 1FNYA 1V6NA 2NMOA 4ASKA 5L73A 1L7RA 5HCHA 2X05A 2P3IA 4D7YA 4DEQA 2AR6A 1H6XA 3SNMA 1LULA 1IHMA 5IT6A 2MNGA 2OUJA 1W8UA 4YGDA 5T5LA 4A7KA 1QJX3 1YLLA 2ET7A 2XVKA 5FOJB 5I0DA 4EWAA 2XWBB 4LTAA 4D6RA 3THPA 2Y8KA 1DGWX 3FWEA 4CP9B 4QGNA 4XJUA 3VBFA 5A3LA 4QX5A 4CXXA 3AB0A 4H14A 5C70A 3LGRA 2IWGB 1EAH2 2EXHA 3MHZA 1SDWA 2BJSA 5FZFA 2D3PA 4O65A 3VD3A 3H3LA 1ZRCA 4CEWA 2XLAA 2K46A 3CIHA 5DAQA 4AI2A 5D8AA 1GICA 3U11A 5I0SA 1SEFA 1VBA3 4A7YA 1WBLA 4IETA 1Q8SA 4IGPA 1NYWA 4LO5B 4S2DA 2F6BA 5H9PA 1Q3EA 2A73B 5IYYA 5LBCA 3ZLIA 4NHLA 1WMEA 2UY9A 1ENRA 2W95A 4HLTA 1ND3C 5GLTA 1QQP1 5E88A 2H6BA 2H6CA 4JX0A 1I9RA 4XDOA 3SQOA 4AHYA 4CCNA 3AYDA 1APNA 1D0HA 1NE6A 1UPIA 4XQ4A 4RGAA 4XILA 2R041 3MFCA 3MIBA 5T50A 1OT5A 5FZEA 4BMBA 5CFDC 3CDZB 3PU3A 1NY71 4ZS2A 4EYUA 4MGIE 2QE3A 4YM1A 4C90A 4DXRA 4HXCA 2WFF1 2ZGTA 4FAGA 4M0HA 2EA7A 5JSRA 3LEMA 3M3OA 2JECA 1POV1 1ZBA1 2EAKA 3B02A 1D4M3 2OKXA 3VD5A 1SLTA 1V6IA 1POQA 1ASJ2 1OC1A 2WT1A 4KH9A 3TWIA 2R071 4LBLA 2CDPA 5FYTA 1PIV2 2VCAA 4I3GA 4TWTA 1R093 1WUVA 4IE0A 4M0NA 2HWF1 5FJKA 5CG9A 4FOQA 1LHOA 4XJ9A 1LHVA 1J3QA 4P9IA 4R9DA 3I3DA 5C5UA 5FLIA 4BOWA 2QJVA 3ZXFA 2ATFA 5FZKA 2Z5WA 1HKDA 4UT5A 2EXKA 2P3KA 2RM23 5FZ0A 3H1YA 3KVBA 3T30A 1V6LA 2CNAA 3VBRA 1JOBA 1L7LA 3NV1A 4RS5C 3R6SA 3OBZA 3POJA 5CKNA 3N36A 4KNCA 4FPGA 1W39A 1R1A3 2OZJA 5L7OA 3BU7A 3NJYA 3O1SA 2ZOEB 1CGPA 5DXDA 4QPIC 1C5HA
chains in the Genus database with same CATH topology
3VDAA 3HNYM 1UY1A 2YC2A 4UI9L 3BGAA 2W92A 4CU6A 3ACIA 4P00B 2J1UA 4ZZ5A 4PQQA 5JXGA 1GOGA 2Y6HA 2Z4FA 3ETPA 1O8SA 2DCKA 4LQRA 3W5NA 1OF3A 2ZXQA 3A21A 4KMQA 3WF2A 1W0NA 1P8JA 3A22A 3OG2A 3VD9A 4DUXA 1XNTA 1H6YA 1ULOA 2LS6A 3IDAA 5DQ0A 3MV11 3U37A 3OGVA 3I2FA 1BHGA 3W5MA 2WN3A 4XZUG 5A1AA 1JZ3A 2Y6GA 1NX9A 4CU7A 2PQSA 3UNPA 1EUTA 2VMCA 4MADA 1CZVA 4RN5A 4BK4A 3ACFA 1GNYA 3FHAA 4DUWA 2W3JA 2QQMA 3IAQA 2YB7A 4PT6A 2KD7A 5DMYA 3LPFA 4OMDA 3DECA 4E8CA 3MUY1 2Y6LA 2W5FA 3DYPA 3SKJE 1GQPA 3EYPA 3C7HA 2W94A 1MPXA 2JKXA 3D3AA 1K12A 4QX0A 2VOTA 5J1XA 3MBWA 2VO5A 3I3BA 2VJXA 2J1SA 2V4VA 2ZEXA 3OGRA 2V72A 1SG3A 4HG6B 2E31A 4BJ0A 4M4RA 1YQ2A 3FL7A 5LA2A 4AAXA 1KGYA 2VL4A 1F4HA 4ARYA 5HPOA 5IHRA 5JMOA 4KWUA 4P08A 3HN3A 3WQBA 3VD7A 5DN2A 2Y6KA 2BGOA 2QQJA 2B9VA 3HPNA 1GOHA 3ZM8A 2VM9A 4E8DA 1O8PA 2VZOA 4A4AA 4XURA 1NAEA 3K46A 2QQKA 3PUIA 5CZKA 1W8NA 4Z2AA 2W47A 3P6BA 3ECQA 5DPNA 1DP0A 2VZ3A 1J83A 3OGSA 3P1IA 5LCWL 4PF1A 1UXXX 1CZTA 2HYXA 4CUBA 4LKSA 1TVGA 2J1VA 2VZ1A 2RV9A 2EICA 3IIIA 1K45A 5LA1A 3IB3A 1OD3A 2JDAA 3K77A 3T0BA 3I97A 4BK5A 4GWJA 5JXHA 2BERA 4XUOA 3PUHA 2YFUA 4GZ9A 1JZ7A 3WF3A 4DXTA 1UY2A 1JU3A 4BDVB 1JYWA 1R64A 2C9KA 2WO3A 2WN2A 3I2GA 2EIDA 1DYOA 2L9LA 4OZOA 3IAPA 4XVHA 4JKKA 4QDSA 2VMEA 1JYXA 2VZPA 3CQOA 2VTFA 1W99A 2VZSA 4QB1A 2WZEA 1UMIA 2VCBA 4UAPA 1J84A 3HEIA 3MO4A 4XUNA 2R7EB 3K4DA 1SDDB 2VZVA 4L0PA 4ET7A 4ZZ8A 2QBXA 2WUHA 2VR4A 4IUGA 3VDBA 1XNAA 3C7FA 2Y64A 4XUTA 1GUIA 2DCJA 1JHJA 3JXSA 1CZSA 3NRUA 1I5PA 4QDQA 1D7PM 1L7QA 3VD4A 3ACHA 1JZ2A 2ORZA 2ZEZA 2EIEA 5EJZB 4MGSA 2X09A 4RYDA 2W1SA 4FI9A 3WEZA 3WNPA 2J1TA 4A6OA 4QAWA 1NKGA 2V5DA 2RJ2A 2W1QA 2ZEWA 4DUVA 4XUPA 1IQDC 3T2OA 3C8XA 2E26A 4TTGA 3ACGA 1NUKA 3LEGA 2E32A 4QX1A 3LPGA 1JYNA 3NNGA 3THCA 1K42A 1K3IA 1KEXA 1W9WA 3VDCA 3CMGA 3EB7A 1OF4A 3MV01 1DLCA 1UZ0A 4D8MA 2QQOA 3J7HA 3HNBM 4JHZA 4QB6A 1GU3A 1JZ6A 1CX1A 4CU8A 5B4XA 1UYYA 3BN6A 3THDA 4MO3M 3T0DA 4A41A 2YFZA 3LEKA 4A44A 4MOAA 2ZEYA 2VQTA 4OUEA 3NQHA 4W50A 3GDBA 4QB2A 1HN1A 1UYZA 4CVUA 4QPWA 5JUVA 2VQUA 5JR2A 2W1WA 3WSOA 2X10A 2WAAA 4UOJA 3T09A 5C71A 1PX4A 4TXWA 3K75B 1JYVA 2J7MA 2VMDA 3C7EA 2RVAA 3WNMA 5C70A 3LE0A 1US2A 1W9TA 3LQCA 2BGPA 5HXMA 3I2IA 2DDUA 2W91A 1OH4A 1UWWA 2JE8A 4ZXEA 4BXSV 4QX2A 2XONA 2WABA 3C7GA 3I2KA 2XHNA 1RYYA 3OB8A 2C4XA 5FUIA 3GGLA 2WAOA 3HNMA 4P5YA 3C7OA 3CZJA 4M4PA 2J1AA 3A23A 1PMHX 3WNLA 2VCCA 3T08A 3WF0A 4OYUA 1UXZA 2XQXA 2W46A 3T2PA 4OMCA 5F7UA 2VMFA 4LHSA 3FN9A 2E33A 5IFTA 4JKMA 4CUAA 3ABZA 4ZY9A 3T0AA 2VZQA 3CKHA 1UYXA 2JD9A 3I3EA 1XC6A 2VC9A 4MGQA 4AG4A 1LNSA 3WF1A 1W8OA 3WNKA 3K4AA 3AC0A 3SEEA 1US3A 3E1F1 4QX3A 4P02B 5JXJA 4LPLA 2HLEA 1PMJX 3OEAA 1JZ5A 5G04L 2W9XA 1JZ8A 3WF4A 1XPWA 2J1EA 2ORXA 2YG0A 2W87A 3NJVA 2XOMA 2WQ8A 4CU9A 1L7RA 2WZ8A 3K4ZA 3NJXA 2X05A 3WNOA 1CIYA 4DEVA 3MUZ1 4DEQA 1H6XA 5B4NA 2C26A 4W4ZA 5I0DA 1UY4A 2QQLA 2Y8KA 1WKYA 1W9SA 2VZTA 1UMHA 3SKVA 3WNNA 2WO1A 2W1UA 2Y6JA 3DYMA 4QDRA 2WYSA 4JKLA 3VD3A 1EUUA 2BBAA 1TG7A 2WDBA 1UY0A 2QQNA 5JXIA 2VZUA 5G05L 3CIHA 1SHWB 4GWIA 3HOBA 5EJ1B 1T2XA 3I2JA 5IYYA 4A45A 3I2HA 2W95A 4A3ZA 5EIYB 3F2ZA 4JX0A 3CZUA 4XUQA 3GM8A 3UESA 1OT5A 3GXUA 3CDZB 4DXRA 2BZDA 4CUCA 1JZ4A 3OEBA 3T2QA 1UX7A 4A42A 1O59A 1PX3A 2YC4A 3OBAA 2OKXA 3VD5A 3SEPA 2J1RA 3A7QA 2CDOA 2VZRA 1F4AA 1JU4A 3FHQA 4W8JA 3UETA 5C7GA 1UY3A 2CDPA 3DYOA 4D0QA 1GMMA 2B4KA 4KI5M 2VCAA 2WBKA 4DXSA 5IFPA 2J22A 3I3DA 5CYYA 2QQIA 4YPJA 5IJRA 4ARXA 1ULPA 2LW8A 3HJRA 3LEIA 1JI6A 2EIBA 1WCQA 5LA0A 2WO2A 2ID4A 1GOFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VDA A;  3HNY M;  1UY1 A;  2YC2 A;  4UI9 L;  3BGA A;  2W92 A;  4CU6 A;  3ACI A;  4P00 B;  2J1U A;  4ZZ5 A;  4PQQ A;  5JXG A;  1GOG A;  2Y6H A;  2Z4F A;  3ETP A;  1O8S A;  2DCK A;  4LQR A;  3W5N A;  1OF3 A;  2ZXQ A;  3A21 A;  4KMQ A;  3WF2 A;  1W0N A;  1P8J A;  3A22 A;  3OG2 A;  3VD9 A;  4DUX A;  1XNT A;  1H6Y A;  1ULO A;  2LS6 A;  3IDA A;  5DQ0 A;  3MV1 1;  3U37 A;  3OGV A;  3I2F A;  1BHG A;  3W5M A;  2WN3 A;  4XZU G;  5A1A A;  1JZ3 A;  2Y6G A;  1NX9 A;  4CU7 A;  2PQS A;  3UNP A;  1EUT A;  2VMC A;  4MAD A;  1CZV A;  4RN5 A;  4BK4 A;  3ACF A;  1GNY A;  3FHA A;  4DUW A;  2W3J A;  2QQM A;  3IAQ A;  2YB7 A;  4PT6 A;  2KD7 A;  5DMY A;  3LPF A;  4OMD A;  3DEC A;  4E8C A;  3MUY 1;  2Y6L A;  2W5F A;  3DYP A;  3SKJ E;  1GQP A;  3EYP A;  3C7H A;  2W94 A;  1MPX A;  2JKX A;  3D3A A;  1K12 A;  4QX0 A;  2VOT A;  5J1X A;  3MBW A;  2VO5 A;  3I3B A;  2VJX A;  2J1S A;  2V4V A;  2ZEX A;  3OGR A;  2V72 A;  1SG3 A;  4HG6 B;  2E31 A;  4BJ0 A;  4M4R A;  1YQ2 A;  3FL7 A;  5LA2 A;  4AAX A;  1KGY A;  2VL4 A;  1F4H A;  4ARY A;  5HPO A;  5IHR A;  5JMO A;  4KWU A;  4P08 A;  3HN3 A;  3WQB A;  3VD7 A;  5DN2 A;  2Y6K A;  2BGO A;  2QQJ A;  2B9V A;  3HPN A;  1GOH A;  3ZM8 A;  2VM9 A;  4E8D A;  1O8P A;  2VZO A;  4A4A A;  4XUR A;  1NAE A;  3K46 A;  2QQK A;  3PUI A;  5CZK A;  1W8N A;  4Z2A A;  2W47 A;  3P6B A;  3ECQ A;  5DPN A;  1DP0 A;  2VZ3 A;  1J83 A;  3OGS A;  3P1I A;  5LCW L;  4PF1 A;  1UXX X;  1CZT A;  2HYX A;  4CUB A;  4LKS A;  1TVG A;  2J1V A;  2VZ1 A;  2RV9 A;  2EIC A;  3III A;  1K45 A;  5LA1 A;  3IB3 A;  1OD3 A;  2JDA A;  3K77 A;  3T0B A;  3I97 A;  4BK5 A;  4GWJ A;  5JXH A;  2BER A;  4XUO A;  3PUH A;  2YFU A;  4GZ9 A;  1JZ7 A;  3WF3 A;  4DXT A;  1UY2 A;  1JU3 A;  4BDV B;  1JYW A;  1R64 A;  2C9K A;  2WO3 A;  2WN2 A;  3I2G A;  2EID A;  1DYO A;  2L9L A;  4OZO A;  3IAP A;  4XVH A;  4JKK A;  4QDS A;  2VME A;  1JYX A;  2VZP A;  3CQO A;  2VTF A;  1W99 A;  2VZS A;  4QB1 A;  2WZE A;  1UMI A;  2VCB A;  4UAP A;  1J84 A;  3HEI A;  3MO4 A;  4XUN A;  2R7E B;  3K4D A;  1SDD B;  2VZV A;  4L0P A;  4ET7 A;  4ZZ8 A;  2QBX A;  2WUH A;  2VR4 A;  4IUG A;  3VDB A;  1XNA A;  3C7F A;  2Y64 A;  4XUT A;  1GUI A;  2DCJ A;  1JHJ A;  3JXS A;  1CZS A;  3NRU A;  1I5P A;  4QDQ A;  1D7P M;  1L7Q A;  3VD4 A;  3ACH A;  1JZ2 A;  2ORZ A;  2ZEZ A;  2EIE A;  5EJZ B;  4MGS A;  2X09 A;  4RYD A;  2W1S A;  4FI9 A;  3WEZ A;  3WNP A;  2J1T A;  4A6O A;  4QAW A;  1NKG A;  2V5D A;  2RJ2 A;  2W1Q A;  2ZEW A;  4DUV A;  4XUP A;  1IQD C;  3T2O A;  3C8X A;  2E26 A;  4TTG A;  3ACG A;  1NUK A;  3LEG A;  2E32 A;  4QX1 A;  3LPG A;  1JYN A;  3NNG A;  3THC A;  1K42 A;  1K3I A;  1KEX A;  1W9W A;  3VDC A;  3CMG A;  3EB7 A;  1OF4 A;  3MV0 1;  1DLC A;  1UZ0 A;  4D8M A;  2QQO A;  3J7H A;  3HNB M;  4JHZ A;  4QB6 A;  1GU3 A;  1JZ6 A;  1CX1 A;  4CU8 A;  5B4X A;  1UYY A;  3BN6 A;  3THD A;  4MO3 M;  3T0D A;  4A41 A;  2YFZ A;  3LEK A;  4A44 A;  4MOA A;  2ZEY A;  2VQT A;  4OUE A;  3NQH A;  4W50 A;  3GDB A;  4QB2 A;  1HN1 A;  1UYZ A;  4CVU A;  4QPW A;  5JUV A;  2VQU A;  5JR2 A;  2W1W A;  3WSO A;  2X10 A;  2WAA A;  4UOJ A;  3T09 A;  5C71 A;  1PX4 A;  4TXW A;  3K75 B;  1JYV A;  2J7M A;  2VMD A;  3C7E A;  2RVA A;  3WNM A;  5C70 A;  3LE0 A;  1US2 A;  1W9T A;  3LQC A;  2BGP A;  5HXM A;  3I2I A;  2DDU A;  2W91 A;  1OH4 A;  1UWW A;  2JE8 A;  4ZXE A;  4BXS V;  4QX2 A;  2XON A;  2WAB A;  3C7G A;  3I2K A;  2XHN A;  1RYY A;  3OB8 A;  2C4X A;  5FUI A;  3GGL A;  2WAO A;  3HNM A;  4P5Y A;  3C7O A;  3CZJ A;  4M4P A;  2J1A A;  3A23 A;  1PMH X;  3WNL A;  2VCC A;  3T08 A;  3WF0 A;  4OYU A;  1UXZ A;  2XQX A;  2W46 A;  3T2P A;  4OMC A;  5F7U A;  2VMF A;  4LHS A;  3FN9 A;  2E33 A;  5IFT A;  4JKM A;  4CUA A;  3ABZ A;  4ZY9 A;  3T0A A;  2VZQ A;  3CKH A;  1UYX A;  2JD9 A;  3I3E A;  1XC6 A;  2VC9 A;  4MGQ A;  4AG4 A;  1LNS A;  3WF1 A;  1W8O A;  3WNK A;  3K4A A;  3AC0 A;  3SEE A;  1US3 A;  3E1F 1;  4QX3 A;  4P02 B;  5JXJ A;  4LPL A;  2HLE A;  1PMJ X;  3OEA A;  1JZ5 A;  5G04 L;  2W9X A;  1JZ8 A;  3WF4 A;  1XPW A;  2J1E A;  2ORX A;  2YG0 A;  2W87 A;  3NJV A;  2XOM A;  2WQ8 A;  4CU9 A;  1L7R A;  2WZ8 A;  3K4Z A;  3NJX A;  2X05 A;  3WNO A;  1CIY A;  4DEV A;  3MUZ 1;  4DEQ A;  1H6X A;  5B4N A;  2C26 A;  4W4Z A;  5I0D A;  1UY4 A;  2QQL A;  2Y8K A;  1WKY A;  1W9S A;  2VZT A;  1UMH A;  3SKV A;  3WNN A;  2WO1 A;  2W1U A;  2Y6J A;  3DYM A;  4QDR A;  2WYS A;  4JKL A;  3VD3 A;  1EUU A;  2BBA A;  1TG7 A;  2WDB A;  1UY0 A;  2QQN A;  5JXI A;  2VZU A;  5G05 L;  3CIH A;  1SHW B;  4GWI A;  3HOB A;  5EJ1 B;  1T2X A;  3I2J A;  5IYY A;  4A45 A;  3I2H A;  2W95 A;  4A3Z A;  5EIY B;  3F2Z A;  4JX0 A;  3CZU A;  4XUQ A;  3GM8 A;  3UES A;  1OT5 A;  3GXU A;  3CDZ B;  4DXR A;  2BZD A;  4CUC A;  1JZ4 A;  3OEB A;  3T2Q A;  1UX7 A;  4A42 A;  1O59 A;  1PX3 A;  2YC4 A;  3OBA A;  2OKX A;  3VD5 A;  3SEP A;  2J1R A;  3A7Q A;  2CDO A;  2VZR A;  1F4A A;  1JU4 A;  3FHQ A;  4W8J A;  3UET A;  5C7G A;  1UY3 A;  2CDP A;  3DYO A;  4D0Q A;  1GMM A;  2B4K A;  4KI5 M;  2VCA A;  2WBK A;  4DXS A;  5IFP A;  2J22 A;  3I3D A;  5CYY A;  2QQI A;  4YPJ A;  5IJR A;  4ARX A;  1ULP A;  2LW8 A;  3HJR A;  3LEI A;  1JI6 A;  2EIB A;  1WCQ A;  5LA0 A;  2WO2 A;  2ID4 A;  1GOF A; 
#chains in the Genus database with same CATH topology
 4I09 A;  3HNY M;  5E8A A;  2PAK A;  4MET A;  5FZL A;  4UI9 L;  4BH9 A;  2VMG A;  2ZBJ A;  3NW4 A;  2IC1 A;  4QKD A;  3BGA A;  3OD4 A;  1MS0 A;  2ZGM A;  4CU6 A;  2PTM A;  4LIU A;  2YPJ A;  3O1O A;  4ZZ5 A;  4PQQ A;  4AHW A;  5A7P A;  4A7Z A;  2JE9 A;  3VLB B;  1SCS A;  4P9G A;  4XF4 A;  5FP9 A;  4AVB A;  3U07 A;  3GBW A;  4GMP 3;  4Q26 A;  5FK7 A;  4CP0 A;  1MVE A;  1QQP 3;  1V00 A;  1YC6 1;  3AZZ A;  1MR5 A;  3K3O A;  3HQU A;  4D7S A;  5AFE A;  2RS5 2;  1RC6 A;  4CDU B;  1BCX A;  4H55 A;  2WWJ A;  4K3U A;  1UOG A;  3JB4 C;  4IGO A;  5FIX A;  5CG8 A;  4DUX A;  1XNT A;  2WQZ C;  1H6Y A;  1LB2 A;  4LBQ D;  4EZH A;  1IS5 A;  2D3R A;  5I93 A;  2LS6 A;  3IDA A;  5H9R A;  3UT0 A;  1QOT A;  3VHP A;  4CCK A;  3KCY A;  2OW4 A;  4NHM A;  2WN3 A;  3POF A;  1ODN A;  1LEC A;  4C0H A;  3RZH A;  2JG8 B;  4GD4 A;  2ARB A;  4RHV 2;  4DMI A;  5AC9 2;  2B8M A;  4L8Q A;  1XSQ A;  1OOP A;  2I74 A;  3WP5 A;  5CBL A;  1IS6 A;  5FPL A;  1DQ2 A;  1REF A;  1WCU A;  4RHV 1;  5AC9 1;  2XL7 A;  1CJP A;  1JXN A;  2V4A A;  5FRE A;  3OD0 A;  1RUE 3;  4Y5Z 0;  1TNF A;  1WCD J;  2PQS A;  2XG3 A;  1W28 A;  2VOX A;  3UNP A;  4MAD A;  1OKO A;  3RSJ A;  4QPG C;  3HWJ A;  4BK4 A;  3OBT A;  1Q43 A;  3EBR A;  2JDZ A;  5FZ8 A;  4I0W B;  4LUM A;  4N8M A;  5A3W A;  3BU0 A;  2JDP A;  1HXS 1;  5BNN A;  2ZX2 A;  2YU2 A;  1GP4 A;  1RUD 2;  2QQU A;  5BNO A;  2KD7 A;  4NRQ A;  1OI6 A;  1GQG A;  2IVI B;  3LPF A;  3DEC A;  4KBZ A;  4OMD A;  3ZPO A;  4B4R A;  3AYE A;  3RWK X;  2O1Q A;  3A0N A;  4HK8 A;  3DYP A;  4Q2F A;  2Q4S A;  3MFA A;  3SKJ E;  3ZYB A;  2B5H A;  3UJO A;  4GIQ A;  5FY1 A;  1YI7 A;  4JGY B;  1Y9Q A;  4Y1V A;  4N53 C;  2PHT A;  4HN0 A;  4RQP A;  1LHU A;  2W68 A;  1W8T A;  1YQ5 A;  2P6H A;  2NQY A;  2DUR A;  2CGN A;  1DF0 A;  1MPX A;  1YNA A;  1MZE A;  3JD7 1;  3MYX A;  4IEU A;  4PF5 A;  1AR9 2;  1IS4 A;  1LOD A;  1N1V A;  1H30 A;  1LU2 A;  1RMU 3;  1AXK A;  2O0O A;  4WZC A;  4XW3 A;  5C33 A;  2VOT A;  4PJY A;  1SBD A;  5J1X A;  2ARE A;  3D6E A;  1W6O A;  5A3M A;  5GLU A;  3AXE A;  1J1L A;  2ZEX A;  2E31 A;  3GAL A;  5IK8 A;  1WLW A;  1H2M A;  1YQ2 A;  4X8N A;  4M3C F;  3HVD A;  4RR3 A;  2VL4 A;  4MUV A;  5HXV A;  3W59 A;  1ASJ 3;  3F95 A;  3RNS A;  3ZFG B;  4MHR A;  4KWU A;  4B3N A;  3POG A;  5DN2 A;  1GNH A;  3MPP G;  1POV 3;  2Q0A A;  3ITQ A;  5FP4 A;  4CEY C;  3AJY A;  1W6M A;  1YRZ A;  1H8V A;  3B3Q E;  1HLC A;  2B9V A;  2CTV A;  1Q8P A;  3GYD A;  4QQH A;  1RED A;  2Q8C A;  1YHF A;  1GOH A;  1LU1 A;  3H3U A;  2A6V A;  2ETE A;  1O8P A;  4TYS A;  1EPZ A;  1NAE A;  2V5Y A;  4Y5S A;  3USS A;  3PUI A;  1W8N A;  1RUC 1;  2R32 A;  5FZH A;  1JYC A;  5T52 A;  4LKF A;  2LUW A;  1XYP A;  2P5B A;  4CP2 A;  3FHI B;  2WZR 3;  1PGW 1;  1VBD 3;  3S30 A;  3I2D A;  4R9A A;  1JUI A;  4FFI A;  5LCW L;  3VBH C;  4XBN A;  5K8S A;  1CZT A;  1HN0 A;  4MLO A;  1W3X A;  2A6Z A;  4LKS A;  1SLA A;  1ZRI A;  1OFS A;  2VZ1 A;  2RV9 A;  3HQX A;  1F8V A;  1CAW B;  1OQ1 A;  1S0I A;  2EIC A;  1OA3 A;  3OYW B;  5EV7 A;  1QEX A;  3W9A A;  4LIT A;  3H50 A;  3NAP C;  3S57 A;  1ZZ8 A;  3WDX A;  1HRI 3;  3FE5 A;  4XET A;  3T0B A;  4E4H A;  4JTO A;  4CRQ A;  4C91 A;  5CFC B;  4CCJ A;  3H7Y A;  1FV3 A;  1PNG A;  2YU1 A;  4QPI B;  1UZY A;  2YFU A;  2PHF A;  3INA A;  3WF3 A;  3ZKU A;  1N47 A;  5DUV A;  5DZE A;  4XJZ A;  4DXT A;  1AYM 3;  3VDD C;  5CIS A;  2NLR A;  3W20 A;  4CXY A;  4B4P A;  2XBO 1;  4PIY A;  2WN2 A;  4YFW A;  5CFD B;  2AEZ A;  1CAW A;  2EID A;  5FLH A;  4AFC A;  4C0B A;  4OZO A;  3ZYH A;  2VVF A;  5FWE A;  5FO7 B;  4QPI A;  5FUN A;  1V6M A;  5EYX A;  2P6C A;  2VME A;  2RMU 2;  2Q8E A;  3VB9 A;  2PLV 3;  5ACA 2;  3J9S A;  1S0B A;  4IEP A;  5GLZ A;  4CP9 A;  1UMI A;  2XKO A;  3UKT A;  1RHI 3;  2VCB A;  3BOD A;  2D44 A;  3EO6 A;  1HRV 1;  4XUN A;  1S0J A;  5L7O C;  2E51 A;  2R06 3;  1PO1 2;  4ZON A;  3WDW A;  5FZ1 A;  4AR2 A;  1OPM A;  1LED A;  3X29 B;  3M3C A;  5FZO A;  3WW1 A;  2QBX A;  2WUH A;  4N7I A;  4ET7 A;  3J7N A;  1XNC A;  3VBR B;  4ZZ8 A;  3VDB A;  1XNA A;  4RFR B;  1NQJ A;  1PZ8 A;  4XUT A;  2OQ6 A;  2RS3 3;  2X5I C;  1AR6 2;  3BOP A;  1ZBE 2;  3IIA A;  3M3I A;  1RUC 3;  2GSY A;  5LBB A;  4ZHN A;  1E57 A;  5A33 B;  4XF3 A;  3NV3 A;  1RUD 1;  1QJU 3;  3NKT A;  3NRU A;  1I5P A;  3O1V A;  4LIV A;  5IWF A;  3RWN A;  4I30 A;  5F39 A;  3VD4 A;  3E5Q A;  1OD5 A;  4MGS A;  2X09 A;  4E27 A;  5ISL A;  4AQS A;  1Y4W A;  2NYY A;  1AR7 1;  3WEZ A;  1UZZ A;  1PM4 A;  5FY9 A;  4LO6 B;  2JEM A;  4IV1 A;  1YUD A;  1NQD A;  2Q1F A;  4QU1 A;  2EXJ A;  3E5X A;  4BQ4 A;  1BZW A;  3LKJ A;  1ND2 C;  2VEC A;  2RR1 2;  2ZGQ A;  2GN3 A;  3WW4 A;  3ETQ A;  1TZO A;  3AFG A;  1K5M A;  3C8X A;  4AVT A;  1O91 A;  1QDC A;  2QNK A;  4UW6 A;  2IFR A;  5I0U A;  3ZSJ A;  5EHD A;  1A3K A;  3LEG A;  2I2S A;  3M4F A;  2WRA A;  4LT5 A;  2ZKN A;  1NXD 1;  2IUW A;  1RMU 2;  1AYM 1;  4XFF A;  1RTV A;  1ACC A;  1OHF A;  1QJX 2;  1M06 G;  5F8P A;  2XUE A;  3KQR A;  2XBO 3;  5EP9 A;  2WNO A;  3VDC A;  5C3R A;  3B00 A;  2GU9 A;  3POB A;  5A1L A;  2DWR A;  4FP2 A;  1AR6 1;  5IVC A;  1DLL A;  4QKF A;  5F2W A;  4BPZ A;  2AZ5 A;  4DXZ A;  3P3N A;  1UZ0 A;  1CR7 A;  3BOW A;  4IV3 A;  4AYU A;  2DFC A;  4U36 A;  3LD8 A;  4QB6 A;  1RIN A;  2WNU B;  4AF9 A;  4XAA A;  3SXW A;  1AR8 3;  3MZH A;  5A7Q A;  4CCL A;  4NAO A;  1UU6 A;  4CEY B;  1H1M A;  5FJH A;  5A3U A;  1L3J A;  1FOD 1;  1KXG A;  3H1M A;  3K48 A;  4MO3 M;  4YZ5 A;  4A44 A;  2GAL A;  4OLL A;  2JDH A;  2ZEY A;  4UW4 A;  3GBG A;  2YXS A;  2C9A A;  4OUE A;  4MGZ E;  3GDB A;  2EXI A;  5FMB A;  5A6Y A;  4QB2 A;  3MIF A;  5KHK A;  1GR3 A;  2IXL A;  2WT0 A;  3OTF A;  4IEO A;  4QPW A;  4UFK A;  3BTZ A;  1PO1 1;  1YO8 A;  4Q1R A;  1ZRF A;  3CBN A;  2DV9 A;  4QHB A;  1I1E A;  2VUD A;  1GKB A;  4CE8 A;  3VBS B;  2ADE A;  5ABJ A;  1EV1 1;  1PX4 A;  2WFF 2;  4TXW A;  4XZP A;  1BVV A;  1QMJ A;  1ZBE 3;  2J7M A;  3BPZ A;  5AVP A;  4Z8B A;  2AAC A;  3PVO A;  4XFI A;  3LE0 A;  3OSD A;  4HN1 A;  4F7Z A;  2LRP A;  4XIO A;  2A70 A;  2W39 A;  4N53 B;  3UYJ A;  4HET A;  2W91 A;  1OH4 A;  2JE8 A;  4LBQ B;  3USU A;  3BCW A;  3RZZ A;  2JDM A;  1OUS A;  4QXC A;  1B09 A;  4W65 A;  5CFC A;  2BTV C;  2Q1Z B;  4XBQ A;  1YCI A;  3OB8 A;  3KT4 A;  2YY1 A;  1JYW A;  4URT A;  4V2W A;  3C7O A;  1RVF 1;  2HEW F;  4BQY A;  3AFK A;  4DY3 A;  5C4W C;  5KXE A;  5CEH A;  4OVE A;  4A2U A;  1D2Q A;  4IE5 A;  5FPV A;  3VBS A;  4ZU7 A;  4WM7 B;  1X36 A;  2DF7 A;  3A23 A;  3WNL A;  4XDQ A;  1QWR A;  2EIG A;  4CCM A;  5LRS A;  1QJZ A;  4Q8K A;  1LTE A;  2DFB A;  2XQX A;  4QD2 A;  5EZW A;  3ACL A;  4TN7 A;  1O4T A;  3MID A;  5L36 A;  1PM7 A;  3RI8 A;  5FZB A;  3OOX A;  2FDI A;  3QOP A;  1U12 A;  4YYO A;  2YZ4 A;  1WMF A;  3AKQ A;  1JTZ X;  5A6Z A;  3FN9 A;  5H9Q A;  1YI9 A;  5F9T A;  2WNE A;  5IFT A;  5FDB A;  2Z42 A;  3DXT A;  4ZY9 A;  1AZD A;  2P1B A;  2JG8 C;  2XGX A;  2YC0 A;  2YV8 A;  5JI7 A;  1O5L A;  2CWM A;  1UYX A;  2IXK A;  4MGQ A;  1QJX 1;  1BJQ A;  2DUP A;  3VBO A;  2D6N A;  4RL7 A;  1KDK A;  1GQH A;  2XH6 A;  3WNK A;  3K4A A;  4E4S A;  4Q4V 1;  3AC0 A;  4CDX C;  5HBA A;  5KC6 A;  3SEE A;  1XNK A;  4CCE A;  1XYN A;  2DUO A;  3C2U A;  4OI0 A;  1LR5 A;  3RPQ A;  2B46 X;  1US3 A;  3O5S A;  3EHK A;  4IV3 B;  4L99 A;  5A33 A;  3VBR C;  4B29 A;  4CCO A;  3BTX A;  1F9K A;  1XE0 A;  4DFS A;  3O1U A;  3PL0 A;  2BFU S;  3M7A A;  1OQE A;  4YRD A;  1MEC 2;  1RUJ 1;  2CWS A;  1HQW A;  2QZ3 A;  1OVS A;  4XDP A;  2ET1 A;  2G9G A;  3J8F 1;  4XYX A;  3NKG A;  2CL2 A;  5F2S A;  5FWJ A;  3KF3 A;  5FZ7 A;  3OPW A;  2D6L X;  1H1I A;  3NJV A;  2E63 A;  3UV9 A;  4NUB A;  1VAL A;  4WBB A;  2WQ8 A;  3O7O A;  2EVX A;  3ZN6 B;  4CU9 A;  2D6M A;  2ES3 A;  3WNO A;  3JCI A;  4DEV A;  3WUC A;  3AL6 A;  4EV0 A;  4CSW A;  4UXA A;  2GP5 A;  4GMP 0;  2K9Z A;  3IPV A;  5DG2 A;  4RSU A;  3ME2 A;  4I02 A;  4MV2 A;  1V6K A;  2QQL A;  4DIN B;  4E9K A;  4Z92 B;  4GWN A;  1WKY A;  2JE7 A;  1VBA 2;  2VZT A;  2GC3 A;  3SKV A;  3A0K A;  5FO8 B;  4TSV A;  2E9Q A;  1OBN A;  4QDR A;  4FTB A;  2WYS A;  3KHC A;  3VZJ A;  1DQ6 A;  4JKL A;  2XLF A;  5BNN B;  2BQP A;  3QH7 A;  1TG7 A;  1UY0 A;  5JXI A;  4NWV A;  2HWC 2;  5LAT A;  1W8W A;  4ERO A;  5F1R A;  5FKB A;  4CPB A;  4FPJ A;  3NNJ A;  1AR9 3;  4ITC A;  4FTE A;  1KRI A;  4Y1Y A;  2FMD A;  3PNA A;  3SIT A;  4A3Z A;  5A1F A;  1UQX A;  3CZU A;  1LES A;  4XUQ A;  3B9I A;  4E4Z A;  1TMF 3;  2AC1 A;  1PVC 2;  2LTN A;  2NM1 A;  2RM2 1;  3UKV A;  2FCV A;  1OMI A;  4RFT 0;  5C9A B;  4PDW B;  3I49 A;  1R08 3;  3TEX A;  3ZFF A;  2R04 2;  1SMV A;  3VBH B;  2YDE A;  1KQR A;  1QXP A;  2Q30 A;  3DN7 A;  4EN8 B;  1ZX5 A;  1W03 A;  3KCX A;  3DEM A;  4CUC A;  2VNR A;  5FZC A;  1JZ4 A;  3OEB A;  1VBB 2;  4UWD A;  4AFM A;  3T2Q A;  5A3T A;  4YGC A;  1W6Q B;  4I0B A;  2G9Z A;  4OI1 A;  2ILM A;  4ES8 A;  2XXZ A;  1WD3 A;  3A7Q A;  5F6L B;  5GLV A;  2VZR A;  2Y26 A;  1F4A A;  3AKR A;  3VZN A;  1VAV A;  4W8J A;  1VB2 A;  5C7G A;  1UY3 A;  5C8C B;  2A75 A;  1ULG A;  3DYO A;  2RS5 1;  4J1W A;  4N43 B;  2B4K A;  5A7W B;  3WDY A;  4BB3 A;  4LBQ A;  2WBK A;  3USU B;  1B35 C;  1R08 2;  1Z0H A;  3WW2 A;  2YRO A;  4CTE A;  4DXS A;  2ENR A;  2JB8 A;  4NAM A;  4UFI A;  2A1X A;  1V9U 3;  1DGL A;  2RS1 2;  4OUS A;  2YYO A;  4YPJ A;  1W2U A;  4CA9 A;  5JZG C;  2WFF 3;  2D7F A;  1SPP B;  2BFU L;  3SCF A;  2LW8 A;  3OY8 A;  3T1L A;  3OPZ A;  5FQ0 A;  4XFB A;  2VG9 A;  3W21 A;  4XMA A;  2EIB A;  5KXB A;  1PGL 1;  4LBM A;  3R4D B;  3LSD A;  3V0A A;  1YFW A;  5BY5 A;  2AYH A;  4DOU A;  1YJK A;  1UU5 A;  1RUI 2;  4QPG A;  1GOF A;  1WW7 A;  5L9R A;  1AX0 A;  5I0R A;  3TNP B;  1RXF A;  3RGB A;  1UY1 A;  2YC2 A;  1GYK A;  1NLQ A;  3NL1 A;  3BKZ A;  2WIN B;  1R09 1;  4K1Y A;  2BNO A;  2WWU A;  3ACI A;  5IAX A;  4QMA A;  3QD6 A;  3ALQ A;  4IQP A;  4RGK A;  1ULF A;  1GOG A;  4K8R B;  2R06 1;  5FZ4 A;  4LR4 A;  1DQ4 A;  2DCK A;  1SLL A;  1GZW B;  1QXR A;  3B94 A;  4XFH A;  2ZXQ A;  4EZ4 A;  3ILN A;  4FPH A;  4L9B A;  4COW A;  2P17 A;  2OPW A;  2JIG A;  4ZPI A;  4YVS A;  1TMF 1;  1MS3 A;  5CVR A;  2D40 A;  3HN1 A;  4LBN A;  3A22 A;  4KWJ A;  4QXH A;  4WM8 C;  1DQ0 A;  1R08 1;  2JIC A;  3GZT B;  4S2F A;  1OLM E;  1C8M 3;  4QHO A;  1RUD 3;  1CON A;  1ULO A;  4Y22 B;  3AMH A;  2B39 A;  4QGL A;  3I2F A;  1BQP A;  3AXD A;  4V1P A;  1VPH A;  2Z69 A;  4JGZ B;  1W6N A;  2D43 A;  2JJ6 A;  4U2A A;  2QFE A;  5FP3 A;  4FTS A;  5A1A A;  1ZZ9 A;  1MS1 A;  4EE2 A;  3GZA A;  4IW3 A;  4FPO B;  1HRV 2;  4XJ8 A;  4I2O A;  2Y6G A;  4OHZ A;  1UU4 A;  1OLR A;  5A3N A;  1NCQ A;  4OHW A;  2PHD A;  4Q8L A;  4BQ2 A;  2VMC A;  1CZV A;  3WHU A;  2AEY A;  1EAH 1;  3DCQ A;  4JTN A;  2ZZQ A;  3ACF A;  3FHA A;  5D1I A;  1ZZ6 A;  3KGL A;  2W3J A;  2Y0I A;  5I91 A;  1LEN A;  4HT1 T;  3UGG A;  3VGI A;  1OUX A;  2YB7 A;  4UYB A;  1GZ9 A;  3W58 A;  4PT6 A;  1NLR A;  1UO9 A;  4FAH A;  1W2O A;  4XF1 A;  4K7J A;  2W5F A;  5LEJ A;  1RUN A;  1AR6 3;  2RS3 2;  4LO4 B;  4CEW B;  1S0D A;  1WGP A;  5FAX A;  2WNU C;  1GQP A;  1HB2 A;  2HWC 3;  1AR9 1;  1EYB A;  1AYN 2;  1COV 1;  1BLZ A;  2UWB A;  2VBB A;  2XB6 C;  4NWW A;  2W94 A;  2BOJ A;  1IG0 A;  2VUA A;  3D82 A;  4WV8 A;  5DAP A;  2JKX A;  2OII A;  3D3A A;  4QX0 A;  1CQ9 A;  1PVX A;  2JG8 A;  2DCT A;  3GBF A;  3PUQ A;  2VO5 A;  3N9P A;  4COV A;  4HVR A;  4XFA A;  2J1S A;  4WVV A;  4YZ4 A;  2A6X A;  1V70 A;  1TME 2;  2YPD A;  3OGR A;  2PHW A;  1SG3 A;  4N7U A;  3VKN A;  2E53 A;  2Y60 A;  5LA2 A;  1F4H A;  1VMJ A;  5HPO A;  2E7A A;  3H8U A;  5IHR A;  1VBC 2;  4FFG A;  4YW3 A;  3TOJ A;  3VD7 A;  4QX7 A;  4XTP A;  3VBS C;  3G7D A;  2Y6K A;  4OQ8 A;  4ZU5 A;  1LCL A;  2GZW A;  3NNM A;  1ND3 B;  5JPN B;  2UY8 A;  3HBK A;  4KWK A;  4PQ9 A;  5FOB B;  1HB3 A;  4W6Y A;  2ZGP A;  1C57 A;  3FJS A;  3FX3 A;  3AKP A;  1SAC A;  3HMY A;  3FFZ A;  3QCW A;  2VM9 A;  3ZM8 A;  3ZDV A;  1RGS A;  1XNB A;  1OKQ A;  2HWE 3;  1X50 A;  2R0F A;  4Q29 A;  4RGG A;  1HQL A;  2RS1 1;  1SFY A;  1SFN A;  3CU7 A;  1HRI 2;  1PGW 2;  4Z2A A;  4P14 A;  4BHP A;  1Q8V A;  5HI0 A;  3ORJ A;  3VN4 A;  2VH9 A;  2VNV A;  2XHK A;  5DPN A;  2GC2 A;  5D2A A;  4HVQ A;  1ZVF A;  1FOD 2;  1ST8 A;  4CUG A;  2PLV 2;  3OGS A;  2HWD 1;  1D4M 2;  3P1I A;  4HPK A;  2HYX A;  4XXA A;  5JOZ A;  3ILF A;  3JBG 1;  2BVB A;  1FMD 2;  4FBF A;  4URA A;  1JOD A;  2YUE A;  1PZ7 A;  5D8A C;  4G9S B;  1Q56 A;  4HOO A;  2YMZ A;  1GAN A;  2VW0 A;  1YIP A;  3VZL A;  1IS3 A;  5BV6 A;  5FXX A;  3III A;  1K45 A;  4JGZ A;  3TEW A;  1HV1 A;  5F5Q A;  1XBF A;  3L9J T;  3OUH A;  5SV8 A;  5L9B A;  4MYE A;  3CJI A;  3ES1 A;  5L9V A;  5JXH A;  2JG9 B;  3PJY A;  1RUH 2;  2QDN A;  5FK8 A;  5KC5 A;  1OXC A;  1JZ7 A;  2DVF A;  3IDB B;  4YFZ A;  3Q8E A;  3WD5 A;  1O4Y A;  3E6D A;  2D98 A;  5JAX A;  1JU3 A;  2BYV E;  1DQ1 A;  2H0V A;  4GWM A;  1SZB A;  2XJT A;  1V6J A;  1W2N A;  1R64 A;  3D0S A;  1RL3 A;  2P37 A;  3D4K A;  2UYA A;  3OCP A;  4PDW C;  5K4L A;  3V65 A;  5LRR A;  3ZSK A;  1H9W A;  2L9L A;  5GZC A;  3WCR A;  2JDK A;  3ZSL A;  3KZ4 C;  3U75 A;  4AOC A;  5FZO B;  2IZW A;  2YBK A;  4AFA A;  4AZZ A;  3CQO A;  1VJ2 A;  3TEY A;  4P9W A;  3AMP A;  1W99 A;  4O9G A;  2JKB A;  5H9S A;  5JIU A;  4HBN A;  1KJR A;  1N3O A;  2FMY A;  4IER A;  5FR3 A;  3IPV B;  1CAU B;  5KBF A;  4GAL A;  2R7E B;  2D97 A;  3O12 A;  4LJH A;  1F2N A;  4AED B;  3IDC B;  3AP5 A;  4JGZ C;  4HON A;  1Y9M A;  4YGE A;  5JDB A;  1F35 A;  3C7F A;  3NV4 A;  4CP1 A;  1GUI A;  1JHN A;  2VAU A;  1QJF A;  3H3Z A;  1XRU A;  1W6N B;  1QF3 A;  1CAV A;  1VBC 1;  2W2I A;  4AEM A;  3MGU A;  4G3Y C;  4B1M A;  3IT8 A;  4CDW C;  3ZYG A;  2DVA A;  5IVY A;  1ENX A;  5CNA A;  5FXW A;  1S0E A;  4B7K A;  1D7P M;  4LOS A;  2ZEZ A;  3B01 A;  3UGF A;  2GNT A;  3V56 A;  2PMW B;  2X5I A;  4I0A A;  2CY6 A;  2KM2 A;  3LDR A;  2W1S A;  4FI9 A;  4GB3 2;  3VBU B;  1O3R A;  2VUJ A;  3JBG 3;  3R4S A;  3WNP A;  2J1T A;  3AP7 A;  4A6O A;  2WS9 3;  1RHI 2;  1IOA A;  2BOI A;  3M1H A;  1CAU A;  3OUI A;  1LOF A;  5C3P A;  2GC1 A;  2XJS A;  2A7A A;  1RUE 2;  2RJ2 A;  2W1Q A;  2ZEW A;  4B7E A;  4F3J A;  2ZKL A;  1DIW A;  1LGB A;  2C24 A;  4XUP A;  4UF0 B;  3BB6 A;  1QOS A;  3ZXL A;  1ZA4 A;  2OQ7 A;  1OOP B;  3S7E A;  2DBN A;  2ZAH A;  4NO4 A;  2OZ6 A;  1W06 A;  4RHV 3;  4CPB D;  1JMU B;  2RR1 1;  5AC9 3;  4XHB A;  1GFF 2;  1N1S A;  4QQL A;  3KSC A;  3PTY A;  3AMQ A;  4NMI A;  1AYM 2;  1YWK A;  4Y20 B;  5FPA A;  1JYN A;  4YM3 A;  5C9A C;  1CPN A;  4Y4R A;  3AP4 A;  3ZX7 A;  3QAC A;  2HEY F;  1S55 A;  1KEX A;  1W9W A;  5JWP A;  4OHV A;  1Y43 B;  2YBS A;  2DCZ A;  4CDU A;  2QKD A;  4R4Z A;  1FI2 A;  5JR7 B;  5DUX A;  3WP4 A;  1RJ8 A;  4AGR A;  2QQO A;  3URF A;  1LGN A;  1OVP A;  4JHZ A;  1GU3 A;  1JZ6 A;  1ND2 B;  5FY0 A;  3ZFE A;  3KLS A;  4CU8 A;  2KXL A;  3POS A;  4FOW A;  5F3G A;  3ZKY A;  2HJI A;  1UNB A;  3N9O A;  1BKZ A;  1QJY 2;  2E7Q A;  1WMX A;  2WR9 A;  2WWS A;  1MVQ A;  4PLN A;  3BN6 A;  3UJQ A;  4UFM A;  4ZKT B;  2C0Z A;  3JZV A;  3THD A;  3AP9 A;  4C1X A;  2UUR A;  4YLZ A;  2VW2 A;  4GKX A;  1CAX A;  2YFZ A;  2OS2 A;  1QY4 A;  4FPK A;  1I5Z A;  1U0A A;  5DDJ 2;  2VQT A;  2WZP P;  2PHR A;  3BTY A;  4KG0 A;  5CIR A;  3RJ2 X;  3KD4 A;  4DY5 A;  2HWD 3;  2F17 A;  2VOK A;  3KMH A;  2JDN A;  1OPO A;  4K8F A;  5JUV A;  1ULC A;  2VQU A;  5DG1 A;  2ZX3 A;  1IPK A;  5A3O A;  2NMN A;  3O14 A;  3RG0 A;  4JZR A;  4UOJ A;  3ZFE B;  3GNE A;  4FSJ A;  3APB A;  3K75 B;  4XAC A;  5F3E A;  5HCA A;  5A70 A;  2ZHK A;  4BQX A;  4J1X A;  1W9T A;  2PXJ A;  5D8A B;  2VVE A;  3WXP A;  2BV4 A;  2BGP A;  3JUU A;  1QNW A;  3I2I A;  3GF6 A;  3LSE A;  4QWN A;  2FDH A;  5FYC A;  1WLD A;  3DKQ A;  2JIJ A;  3JQW A;  4W6X A;  4YW1 A;  3ZR6 A;  3DF0 A;  2A3Y A;  4BXS V;  3C7G A;  3OGG A;  2ADD A;  3QBQ A;  1OUR A;  2GC0 A;  3EQE A;  3MLJ A;  5JOX A;  4NJ4 A;  1RYY A;  5IVF A;  5IAT A;  3AKS A;  5FUI A;  2WAO A;  2Y34 A;  4GQ7 A;  3CZJ A;  5LWB A;  4XCB A;  5JVV A;  4AEK A;  3WZ1 A;  1J58 A;  3VUO A;  2IXI A;  3UK9 A;  4EN0 A;  4E2S A;  1GSL A;  1C8M 2;  4ZS3 A;  1PMH X;  3T08 A;  3WF0 A;  3Q8F A;  4OYU A;  2R6Q A;  1UXZ A;  3JB8 A;  5FXZ A;  2CAU A;  5A7N A;  5SV5 A;  3T2P A;  1A34 A;  1BMV 2;  4RD7 A;  3FZ3 A;  2ZZJ A;  3PVN A;  3IWZ A;  3H9A A;  4H7M A;  3N9M A;  5DZG A;  5BPX A;  4DNY A;  3OF1 A;  5IVJ A;  4XTM A;  1BMV 1;  1POV 0;  4L92 A;  3ES4 A;  4OHX A;  2OT7 A;  4IE4 A;  1AUY A;  4YW2 A;  4PLO A;  1TQ5 A;  4CUA A;  4NHK A;  2ZML A;  2VZQ A;  3T0A A;  2RDQ A;  4IDZ A;  1HJF A;  5T3N A;  2DU1 A;  1VBA 1;  1DCS A;  4YGB A;  3I3E A;  1PO2 3;  4GB3 3;  5C4W A;  1WZX A;  4NIA A;  1LNS A;  1XU2 A;  3OY8 B;  2GP3 A;  2WA3 A;  2C6S A;  2MPF A;  1SBF A;  4WM7 A;  3VHN A;  4LA2 A;  4AVV A;  4Y26 A;  4N53 A;  2JDU A;  3BIE A;  3I8T A;  2VQ0 A;  3CEW A;  3WHT A;  5JXJ A;  1LOC A;  3WQ1 A;  5IW0 A;  4WM7 C;  3HR9 A;  1I3H A;  1PMJ X;  1S2B A;  1U5I A;  3OEA A;  1EAH 3;  3M3Q A;  4XJA A;  4DZG A;  2W9X A;  4GH4 C;  5AFB A;  2XVL A;  1GWK A;  1QJU 2;  2RDN A;  4AHZ A;  2J1E A;  2ORX A;  4NRM A;  2G19 A;  2PHX A;  1OOP C;  4LXL A;  2CYF A;  3OUJ A;  2XOM A;  3VBU C;  4CEW C;  1X7N A;  5BUV A;  4IEY A;  4YZ3 A;  4NII A;  4R8H A;  1DGW A;  3K4Z A;  1HJG A;  3KT7 A;  1CIY A;  3MUZ 1;  2MEV 1;  3JU9 A;  4MG2 A;  5B4N A;  5F3C A;  1DG6 A;  2RJK A;  3LFM A;  3VZM A;  4FXG B;  2C26 A;  4MGY E;  4PI2 A;  4W4Z A;  4CDX B;  1UYP A;  1RUF 1;  3AZX A;  1UY4 A;  4K9S A;  5GKA C;  3VL9 A;  3DPR C;  1KDM A;  2HWF 3;  5E6H A;  1W9S A;  2FDG A;  4YVW B;  5EWS A;  2B7Y A;  4LBK A;  1WD4 A;  3RZJ A;  2W1U A;  3J8F 3;  4AI3 A;  3N9L A;  3WOG A;  2Y6J A;  4HL0 A;  1YFX A;  5JI9 A;  1W6P B;  4OQ9 A;  4NN0 A;  1AL0 G;  2CHH A;  4Q4Y 2;  3ZXA C;  2R07 2;  1EUU A;  2HEV F;  2WDB A;  5C8W A;  4Q0V A;  2BVV A;  5A6Q A;  5A80 A;  2CV6 A;  2VZU A;  3IN9 A;  3WNX A;  3MF6 A;  5M0T A;  5G05 L;  1AR7 3;  4LEJ A;  1SHW B;  4JRA A;  1TMF 2;  4AVA A;  4W6W A;  4Q4X 3;  1T2X A;  1AL2 3;  3I2J A;  3AYC A;  4AQ6 A;  2I07 B;  3POW A;  3E97 A;  5ANN A;  2IXJ A;  4MXW B;  4QX8 A;  2R0H A;  1UD1 A;  5EIY B;  1AXZ A;  3KHB A;  4QT6 A;  3V0B A;  1FMD 3;  1J1T A;  1DYP A;  2RM2 2;  3DV8 A;  3M2M A;  4HFS A;  5LY2 A;  2HWE 1;  3MF9 A;  3H8R A;  5FYM A;  3WCS A;  1QDO A;  3GHM A;  4KGG A;  3RRD A;  4JDO A;  4PI0 A;  2K0G A;  3WV6 A;  1W04 A;  2WNV B;  3AP6 A;  1ZRR A;  3AL5 A;  5FP8 A;  3FLR A;  2QUO A;  1TME 1;  4B1L A;  3AVS A;  3WR0 A;  1K5M C;  5BNP A;  4OCT A;  4HVO A;  1H8T A;  3PIG A;  4K40 A;  3MEP A;  4PBP A;  4JGY A;  4Q27 A;  3PUA A;  1VRH 2;  3U0Z A;  1PX3 A;  1N1T A;  3MDP A;  4Q4X 2;  2J1R A;  2PAM A;  2CDO A;  3NO8 A;  1QH6 A;  2LM3 A;  1Z78 A;  3HIF A;  1AR8 1;  1JU4 A;  1W8F A;  3KS7 A;  3FHQ A;  4Z1V A;  1Z7S 1;  4Q4Y 1;  1W8H A;  4YVS C;  3BI3 A;  3CO2 A;  5J96 B;  1URX A;  2B45 X;  3VBO B;  1GMM A;  2A3W A;  1QU0 A;  4KI5 M;  4D0Q A;  1LAJ A;  4GKY A;  1VMF A;  3H8X A;  1Z7S 2;  4IEW A;  2JDY A;  2D5H A;  1Y7B A;  4XEZ A;  1O3Q A;  3VBH A;  1S2K A;  3N7M A;  1LOE A;  4HKW A;  5IFP A;  2FHR A;  1PIV 1;  1DZR A;  1XND A;  3MIG A;  5CYY A;  1UZW A;  1DQ5 A;  1RXG A;  2X53 S;  5IJR A;  1G9F A;  3ASI A;  2N7G A;  5FMO L;  1H8T B;  2Y0O A;  3GCX A;  1QHD A;  3ZFG A;  1QQP 2;  3PTR B;  2AEN A;  3HJR A;  4Z82 A;  3LEI A;  4OUL A;  1WCQ A;  1X8E A;  3R0R A;  4COU A;  1IQA A;  4XOG A;  4EWD A;  2PN5 A;  2WO2 A;  5LBE A;  3D0J A;  3KVA A;  3WT3 A;  3ZXJ A;  1KS5 A;  1IZ3 A;  5IK4 A;  5CFD A;  1LKN A;  1YIF A;  1H4G A;  3PJQ A;  3VDA A;  2D3S A;  2A6Y A;  1X8M A;  3RZK A;  2BNM A;  3GJA A;  2RMU 3;  2HWB 2;  3ZXG A;  2J1U A;  3VDD A;  1AX1 A;  1RIR A;  2O8O A;  3RS6 A;  2Y6H A;  1GLH A;  1O8S A;  3ETP A;  4LQR A;  1LHW A;  3W5N A;  1LJ7 A;  2SLI A;  1NA1 B;  2QQW A;  4ASM B;  3JD7 3;  1PGS A;  5FYU A;  2ZGO A;  1CWP A;  3WW3 A;  1YYN A;  3TNQ A;  1ENQ A;  2D6K A;  2CAV A;  2P3J A;  2VOV A;  1VAK A;  1BK0 A;  3OG2 A;  3TN9 2;  3L2H A;  1ZBA 3;  1BBT 3;  3RZL A;  3H7J A;  1WMD A;  4PCR A;  1IKQ A;  5EXO A;  4NID A;  5DQ0 A;  3MV1 1;  1SFP A;  1X9P A;  3ZYR A;  3T4V A;  2FBE A;  4DO0 A;  4GH4 B;  1VP6 A;  4J6G A;  5ACA 1;  1VBB 3;  4WM8 A;  1FYU A;  1PGL 2;  4DPN A;  4AE2 A;  4BIF A;  1H1A A;  5LW9 A;  1JZ3 A;  2MEV 3;  4IV3 C;  4YNI A;  4B4Q A;  5GJ6 A;  1XE8 A;  4Q4V 3;  3ZFF B;  4BCU A;  5KXC A;  3O1R A;  2X8K A;  3VKM A;  2NP0 A;  3B9C A;  4CU7 A;  3K51 A;  4FO9 A;  1LOG A;  4IES A;  3POI A;  4NE9 A;  1FPN 3;  3RVH A;  1NZC A;  2IXC A;  1CES A;  4NPM A;  1GZT A;  1GNY A;  4IL7 A;  3RZM A;  1UX6 A;  2NPI A;  1RIT A;  4EWE A;  2WZR 1;  1G86 A;  2VUC A;  1S0C A;  4XBL A;  1QJE A;  2AGS A;  2QCS B;  2QQM A;  3DPR B;  2GNM A;  1VB4 A;  2Z79 A;  3N9N A;  4FPL A;  5IVE A;  4FPY A;  5DMY A;  1H2N A;  1BXH A;  1O4Z A;  2BDR A;  2EAL A;  1HXS 2;  1PK6 B;  4E8C A;  3MUY 1;  4LHK A;  1NOV A;  1WLC A;  3WDV A;  2Z2S B;  2GMP A;  3ZVX A;  1RUO A;  2ARA A;  4ORF A;  1IPJ A;  2VCM A;  1AL2 1;  1RUI 3;  2BRT A;  3EYP A;  4JDM A;  5C8C C;  1LOB A;  3NNF A;  4LOR A;  4XHX A;  3RJR A;  1KJL A;  1W90 A;  1K5J A;  2F4P A;  3LAG A;  3PLQ A;  3T4H B;  1FMD 1;  1F5J A;  1K12 A;  1XXN A;  4ATF A;  1VR3 A;  3MBW A;  4YW5 A;  4TLG A;  1SPP A;  3I3B A;  1NT0 A;  2VJX A;  4BME A;  2WII B;  3TEZ A;  2V4V A;  3FMG A;  3I2O A;  5KXD A;  1UCX A;  2V72 A;  5J37 A;  4HG6 B;  5T55 A;  5K9Y A;  2GAU A;  4FPC A;  1VMH A;  3IMN A;  1XQN A;  1KGY A;  4M00 A;  4UFL A;  4XFC A;  4AAX A;  5FKC A;  1OA2 A;  5K0U B;  1BVP 1;  1E5H A;  3KB5 A;  2OA2 A;  3HN3 A;  4RQP C;  2XR4 A;  3D5O A;  2R06 2;  3HD8 B;  5BNO C;  1SLC A;  1COV 3;  5EJ3 A;  2GDF A;  4LK7 A;  4O61 A;  2QQJ A;  3ZFG C;  1GZW A;  1AXY A;  2PA7 A;  4Q4Y 3;  1HRV 3;  5ACA 3;  2VZO A;  4A4A A;  2ZAC A;  1BBT 2;  3KV4 A;  2OYZ A;  3CLP A;  4PHZ A;  2QQK A;  1HV0 A;  2VD7 A;  5CZK A;  5FY5 A;  4BXF A;  4IEX A;  3P6B A;  5FCC A;  5LK5 A;  3SH3 A;  5E89 A;  1MS9 A;  5A32 A;  4XIK A;  3VBO C;  2RDR A;  3B5L B;  4LHL A;  1AL2 2;  1X33 A;  4ZU4 A;  1DP0 A;  2VZ3 A;  5HCB A;  2BP6 A;  3U78 A;  1F5F A;  3ZMN A;  1J83 A;  1PVC 3;  2H0B A;  1BEV 3;  1GV9 A;  1YQ6 A;  1IPS A;  1UXX X;  1A8M A;  1UIK A;  1QH7 A;  5FYZ A;  3RYP A;  4CYD A;  4YSF A;  1QGL A;  4CUB A;  5GZD A;  2VVD A;  1J3P A;  2Q8D A;  5J36 A;  4IEZ A;  1FAY A;  2ZGR A;  1TVG A;  2J1V A;  3KT1 A;  1NCR B;  4N9H A;  4P9X A;  5J3U A;  4O7X A;  3B7M A;  4UW3 A;  2GH8 A;  3IB3 A;  1OD3 A;  4ISR A;  1IG3 A;  2JDA A;  1SCR A;  3K77 A;  4XF0 A;  2TBV A;  4BK5 A;  1FNZ A;  1WWY A;  3HAG A;  4GWJ A;  2VMH A;  2KR2 A;  4AFB A;  5FZ3 A;  3LB9 A;  3SCH A;  2WFP A;  1F15 A;  3NAP B;  1LRH A;  4Q4W 1;  4FQZ A;  2RS5 3;  4GZ9 A;  4LHN A;  4NPL A;  4QM9 A;  2ZGL A;  1AYN 3;  3BAL A;  4M3C B;  4H7L A;  5F5I A;  4GB3 1;  1U5Y A;  2ZA9 A;  4BDV B;  1MS8 A;  3TN9 1;  1UIJ A;  2YGL A;  3ZSM A;  3KV5 A;  1JYT A;  3I4I A;  3I2G A;  5HV0 A;  1DYO A;  1NCR A;  2JWP A;  1QOO A;  2VTX J;  3IBM A;  3QLQ A;  2FZ2 A;  3SH4 A;  4WVW A;  4XVH A;  2VNG A;  4JRL A;  4JKK A;  1W8Z A;  1W2T A;  4QDS A;  4QQP A;  2VZP A;  4S2H A;  3O0V A;  1REE A;  4MGT A;  2ZAB A;  2ZJC A;  1FAT A;  4EJR A;  2VZS A;  4QB1 A;  3I59 B;  4R4X A;  2OXB A;  5DDJ 1;  1G7Y A;  2WZE A;  4PDW A;  5C9A A;  3HT2 A;  4QU2 A;  4UAP A;  1J84 A;  5CAD A;  4ISQ A;  3LA7 A;  3MO4 A;  5C5T A;  1T6G C;  2CGP A;  4N90 A;  3K4D A;  2OPK A;  3IDE A;  4YAR A;  1CD3 G;  1PNF A;  4L0P A;  4DB5 A;  4KQ7 A;  4CEY A;  2VR4 A;  4IUG A;  1NZI A;  1UF2 C;  3I7D A;  1ZYB A;  2Y64 A;  3SHR A;  3AZW A;  3BTA A;  1CN1 A;  1TEI A;  1C8N A;  1VBE 3;  3JXS A;  4Y4Y A;  5C3O A;  1FOD 3;  5F5C A;  1VLN A;  1WA4 A;  4JVA A;  2RDS A;  4YVW C;  1CZS A;  3V64 A;  1L7Q A;  1JZ2 A;  4WZF A;  5K0U A;  5EJZ B;  5C3Q A;  3MW2 A;  4XE9 A;  3LDB A;  1GZC A;  2QTW B;  4RYD A;  3WY6 A;  3BUC A;  5DAX A;  1N3Q A;  2FCT A;  1YXW A;  2GME A;  1W0O A;  4IEQ A;  1HRI 1;  2VW1 A;  1XSR A;  4R9B A;  1NKG A;  2D6O X;  3FUO A;  1NA1 A;  2V5D A;  3THT A;  3ZOI A;  4AGG A;  4CDQ B;  1UOF A;  1G8W A;  3PHM A;  2PHL A;  3ON7 A;  1IQD C;  1V6O A;  3ATG A;  3N3H A;  1CJD A;  1G6N A;  1VBC 3;  2E26 A;  3LOI A;  5I8Y A;  5F32 A;  5FMC A;  3P5B A;  4Y24 A;  5JSP A;  3ZN6 A;  3WQ7 A;  4UFH A;  4CDW B;  4EN7 B;  2I45 A;  1O6U A;  3E5U A;  5EPA A;  2E32 A;  4LBJ A;  4QX1 A;  1WW6 A;  5FXV A;  2P2K A;  3SIS A;  3THC A;  2VY0 A;  3S5A A;  5IK7 A;  1JOP A;  1NCQ C;  2QQV A;  4AEJ A;  3S0M A;  2WNV C;  1UZV A;  2GNB A;  4GJY A;  2KA3 A;  3CMG A;  2PQQ A;  2ZS6 B;  3ZIX A;  3SH5 A;  5FO9 B;  2DVG A;  3EB7 A;  2R30 A;  3ELN A;  1OF4 A;  2XJV A;  3KF5 A;  5ANQ A;  2ZPX A;  5K0U C;  4MH0 E;  1DGR A;  1H2L A;  3J7H A;  2XQR A;  5DDJ 3;  2DU0 A;  4NRP A;  2HWC 1;  3OYW A;  3MI8 A;  1RVF 2;  2ARX A;  3FLP A;  4GUL A;  4Z2W A;  2RE9 A;  5BNO B;  3IZO A;  4BQ3 A;  1UYY A;  3BVC A;  2VMI A;  3HT1 A;  3CL1 A;  4OI4 A;  5CA6 A;  3CJI B;  4A3X A;  3ZFF C;  4D69 A;  3WP6 A;  2BPA 2;  3LEK A;  4MOA A;  1GBG A;  2ZX4 A;  4KGQ A;  2RJL A;  4Y20 A;  3ZXD A;  5CB7 A;  3LIG A;  2JB4 A;  2VBD A;  3NQH A;  4W50 A;  4HSJ A;  4K21 A;  2W52 A;  4M01 A;  3DGT A;  5A32 B;  1HN1 A;  3AZV A;  3I59 A;  2MEV 2;  1PVC 1;  1VBE 1;  5BNP B;  5L19 A;  3MIE A;  3V0A B;  1MEC 3;  3PVB B;  1DZT A;  1EV1 2;  3TYJ A;  1IKP A;  1NY7 2;  2VBP A;  4IGQ A;  4Y33 A;  5JR2 A;  4DRV A;  1C1L A;  5I8T A;  2FDF A;  3WSO A;  2LAL A;  2WAA A;  4FXK B;  4UF0 A;  1V0A A;  3T09 A;  1PK6 C;  5C71 A;  2FD8 A;  3MLL A;  2XVG A;  4KU8 A;  1JYV A;  5K7P A;  3C7E A;  2RVA A;  3WNM A;  2O8Q A;  3KV9 A;  4RS5 B;  3RMX A;  1US2 A;  3LQC A;  3WVJ A;  1TNR A;  5HXM A;  3PU8 A;  4WVZ A;  3PIJ A;  1UWW A;  4JAA A;  4KG8 A;  4IE7 A;  4NVP A;  4ZXE A;  3GZU C;  4GA9 A;  2XON A;  5JIA A;  3I2K A;  1M4W A;  3DL3 A;  3POE A;  2BWA A;  2VOW A;  5DZF A;  2GND A;  4Y1Z A;  4BQW A;  2B42 B;  5LBF A;  3GGL A;  3HNM A;  1AR7 2;  3LDK A;  4JDN A;  3WQ0 A;  4RS5 A;  4AAP A;  2O14 A;  3K3N A;  2UWC A;  3Q8C A;  1OFN A;  1ZZ7 A;  3AJZ A;  4WVM A;  5FPB A;  5T5O A;  3UL2 A;  1QJY 1;  2J1A A;  1C5I A;  1B35 A;  3WG4 A;  2DVD A;  5JOW A;  2VCC A;  3AVR A;  1TE1 B;  5C4W B;  4IND A;  4J25 A;  2W46 A;  4OMC A;  5F7U A;  2ARC A;  3VBF B;  3ZFE C;  1S0G A;  4YW7 A;  4BLJ A;  4I01 A;  2VMF A;  2G4I A;  4FQ4 A;  3E6C C;  4H3W A;  1VBD 2;  5A7O A;  4JKM A;  1RUF 2;  5GLW A;  4IEV A;  5J48 A;  3ABZ A;  3ZO0 B;  4IV1 B;  4NHY A;  1DGR N;  2R16 A;  2ZAA A;  4LE3 A;  2SBA A;  2XJP A;  2VC9 A;  1D0G A;  1VBB 1;  5FYH A;  4D7T A;  3OGJ A;  4K20 A;  1SLB A;  1HB4 A;  2HWB 1;  2QZ2 A;  1FT9 A;  3ILR A;  1MAC A;  4OZX A;  4JQT A;  4QXK A;  2XUM A;  1HDK A;  1R1A 2;  4FT8 A;  4YG3 A;  1FPN 2;  1SLI A;  3LFI A;  1RUG 3;  1DHK B;  1KS4 A;  3T3Y A;  2HLE A;  2IFW A;  1LOF C;  4I3P A;  1G9D A;  3U4S A;  4SBV A;  5G04 L;  4XMI A;  2CGO A;  3O0W A;  4X8P A;  3WF4 A;  5GM0 A;  1MEC 1;  1RUJ 2;  1XPW A;  3RZG A;  2BUK A;  1S0F A;  3FLT A;  1YFU A;  2YG0 A;  2RG4 A;  3O1T A;  2DBI A;  3RI9 A;  1LHN A;  1N1Y A;  2XJR A;  3AX4 A;  3LIH A;  1Q8Q A;  1CAV B;  1PO2 1;  4JHT A;  1ZA7 A;  4Y1X A;  1GNZ A;  4P5H A;  1JOJ A;  3ZYP A;  1D2S A;  5LY1 A;  2WZ8 A;  3NVC A;  1PO2 2;  1HB1 A;  3NJX A;  4PLM A;  1E5S A;  4ONU A;  4QQO A;  4OFG A;  3M3E A;  4JGY C;  4HPK B;  4C8D A;  2VGD A;  1RUI 1;  5FRA A;  3ZDS A;  1ENS A;  1RMU 1;  5KWR A;  1UKG A;  3SC7 X;  2XWJ B;  4CDQ A;  1UOJ A;  1R1Z A;  2FDJ A;  2TEP A;  5FY7 A;  1CAX B;  1UMH A;  3WNN A;  2WO1 A;  4M3C A;  1V9U 1;  4D6S A;  4DQA A;  3DYM A;  2BWC A;  3R4U A;  5F6K A;  1ASJ 1;  3KQ4 B;  1MS5 A;  1Q8O A;  3N9Q A;  3DPR A;  5GAL A;  2BBA A;  1HIX A;  5FY4 A;  2P3Y A;  2Q5T A;  2QQN A;  5LEK A;  3M8L A;  2BGC A;  2YHJ A;  4OI2 A;  4ATE A;  4DRR A;  4FCA A;  3JQX A;  1JUH A;  2DTW A;  3HOB A;  2WS9 1;  4GWI A;  1U5X A;  4R52 A;  5EJ1 B;  5BNN C;  5FYY A;  2DCY A;  1EY2 A;  4A45 A;  3ROU A;  3I2H A;  5LA9 A;  2C5D A;  4CZS A;  5LAS A;  1T6B X;  1XYO A;  3MLK A;  2ZGU A;  4BM8 A;  2RR1 3;  3F2Z A;  2A71 A;  3K2O A;  2PYT A;  1VIW B;  4JV4 A;  3GM8 A;  1C1F A;  1S2E A;  4BIS A;  3U4X A;  1GWL A;  1KIT A;  3UES A;  3WUD A;  4E2Q A;  4GH4 A;  3ZN5 A;  2VXJ A;  4MZU A;  1RUJ 3;  3CJI C;  2Q8O A;  3GXU A;  4AVS A;  1UAI A;  1VBD 1;  3LF7 A;  4K1Z A;  5JOY A;  2HWE 2;  5C3S A;  2QQP A;  2Q1M A;  1H4H A;  2AH2 A;  2ZHN A;  4XFG A;  1XU1 A;  2VNO A;  2HBU A;  1RUG 1;  4FPF A;  2BZD A;  5LB6 A;  1O7F A;  2CU5 A;  1JS9 A;  4Q4X 1;  4Z07 A;  4LNV A;  2CSG A;  3M70 A;  1UX7 A;  1JBC A;  2WC2 A;  4A42 A;  4PIZ A;  2XPJ A;  1O59 A;  2YC4 A;  1V9U 2;  2P34 A;  3OBA A;  2AUY A;  4N43 C;  3SEP A;  4RR3 C;  3AK0 A;  3H0O A;  4CDQ C;  3KGZ A;  3NNL A;  4NR1 A;  1R1A 1;  2R1B A;  3IKW A;  2MHF A;  3UET A;  3WDU A;  5BNQ A;  3N4M A;  1A78 A;  4FOY A;  5CAZ A;  1YQ8 A;  2FDK A;  2RHP A;  3HQR A;  3U14 A;  2R49 A;  4HKL A;  5A3P A;  5TSW A;  2XL9 A;  3N35 A;  4Q0Q A;  3S6P A;  3PVE A;  2J22 A;  5IK5 A;  1Q5O A;  4ASL A;  1BYH A;  1QKQ A;  2QQI A;  4Q4W 3;  1WCS A;  4Q5O A;  3H1W A;  3IMM A;  1W6O B;  5JLV A;  4ARX A;  1AYN 1;  1COV 2;  4XJW A;  4CDW A;  1ULP A;  1NCQ B;  4TLF A;  4QHZ A;  1DU3 D;  3NV2 A;  2BU9 A;  2PFW A;  4HMZ A;  1C4R A;  1JI6 A;  3VDD B;  2PLV 1;  4XC9 A;  5LA0 A;  4AED A;  1K5M B;  3PME A;  3DKW A;  2Y33 A;  3WG3 A;  1W2A X;  2ID4 A;  3TBD A;  2QDR A;  1C28 A;  4K6B A;  4YM0 A;  4CCC A;  5DUW A;  4IE6 A;  5T5P A;  3CF6 E;  5ABJ C;  3D8C A;  3KCC A;  3ZMO A;  2W92 A;  5FYB A;  3J4U H;  2WA4 A;  4P00 B;  3WG2 A;  1PIV 3;  3SLI A;  5JXG A;  2WL1 A;  2R07 3;  1ALY A;  1VRH 1;  4IV1 C;  2Z4F A;  2WKK A;  1NXM A;  1XB9 A;  3TB0 A;  1FPN 1;  1AJO A;  1OF3 A;  5J7M A;  5E1R A;  5FZ6 A;  4NIG A;  3C3V A;  2A6W A;  5F5A A;  3A21 A;  4KMQ A;  3WF2 A;  4YZ2 A;  1H8T C;  4COY A;  1GP5 A;  4LOT A;  1QJU 1;  2X5I B;  1CVN A;  1W0N A;  2VQA A;  1P8J A;  4QPY A;  1S1A A;  5KHJ A;  3VD9 A;  3LA2 A;  4C1W A;  1G9A A;  4AQT A;  1ZM1 A;  3EMR A;  1WCK A;  5IVV A;  3LA3 A;  3H42 B;  4JQR A;  5T54 A;  4QXB A;  3U37 A;  3VZO A;  3OGV A;  3LZZ A;  1BHG A;  5FPU A;  2RMU 1;  1X82 A;  4LO8 A;  2GMM A;  4LUL A;  4BIO A;  3W5M A;  1UPS A;  4XZU G;  1WW4 A;  1W05 A;  2G1M A;  5FZI A;  3MIH A;  1OA4 A;  2WSU A;  1S4C A;  1UMZ A;  4X6Q B;  2VTX A;  4EN9 B;  3V0B B;  3KM5 A;  5FUP A;  2B9U A;  4MXV A;  4LUK A;  3ZIW A;  1CX4 A;  3GJB A;  3A4U A;  4Q1P A;  4AI1 A;  1NX9 A;  3RYR A;  3EXU A;  2RS1 3;  5FYV A;  1EUT A;  1W0P A;  4FVV A;  4RN5 A;  2E6V A;  4BE3 A;  5FV3 A;  1U5Z A;  4QM8 A;  1PK6 A;  4DUW A;  3ZYF A;  1OLQ A;  1O3S A;  4UFJ A;  3J7L A;  4AXO A;  3IAQ A;  5FPZ A;  2EF6 A;  4F8A A;  5A6X A;  5CKM A;  4S2G A;  5J09 A;  1ZRE A;  1J59 A;  3AKT A;  5FZD A;  2Y6L A;  1A8D A;  1LGC A;  5FYI A;  4PBO A;  4XPV A;  2WLP A;  5D21 A;  4NPR A;  3R05 A;  3ZYI B;  4NIH A;  1ONA A;  1W6Q A;  5L7O B;  2YGM A;  1HW5 A;  2GN7 A;  2ZX0 A;  3JD7 2;  4KL1 A;  5J98 B;  3C7H A;  4Q0U A;  1D4V B;  1UL9 A;  2C1F A;  1W6P A;  1MQT B;  2UYB A;  1ZRD A;  5EQU A;  2VXR A;  4AW7 A;  4XCA A;  1EP0 A;  1ZZC A;  3WP3 A;  2W08 A;  5ERL A;  1MZ6 A;  2OX0 A;  2BEO A;  2R1D A;  3O1M A;  4AI0 A;  3VKF C;  2WT2 A;  5DAV A;  4BJ0 A;  4M4R A;  2X29 A;  3J26 N;  2ZX1 A;  3VBU A;  5BNP C;  3MIC A;  3FL7 A;  5FP7 A;  1R09 2;  2WSV A;  4ES9 A;  5BYN A;  1OQD A;  1ZBA 2;  4ARY A;  5FMD A;  1EV1 3;  4AL9 A;  2DUQ A;  5JMO A;  5LZ6 A;  3WQB A;  1ZBE 1;  4P08 A;  5FBZ A;  3RQ0 A;  1AR8 2;  4Q4W 2;  1QIQ A;  2VUL A;  2WNU A;  3I3Q A;  4XF9 A;  4P9J A;  3TAY A;  1W3V A;  2WJS A;  3CHX A;  2BGO A;  2WZR 2;  1JN2 P;  4COZ A;  2XDV A;  3HPN A;  2UWA A;  4YZ1 A;  5APA A;  5CFC C;  1O5U A;  4E8D A;  3G6J B;  1UKR A;  2R04 3;  4RR3 B;  4XUR A;  3K46 A;  2VE1 A;  3FC0 A;  4QKB A;  2FZ1 A;  3NST A;  1OLM A;  2W47 A;  3FUQ A;  3NMB A;  2WO7 A;  4L97 A;  2A3X A;  3FBY A;  3ECQ A;  4FFH A;  1FXZ A;  1RVF 3;  2HWD 2;  4MX3 A;  4NRO A;  5I0T A;  4BQ1 A;  3LOB A;  1YJL A;  3AZY A;  4LBO A;  1W9Y A;  2NZ9 A;  3CJX A;  4V2V A;  4D94 A;  4PF1 A;  3T1M A;  2OUH A;  4GJZ A;  2ZGN A;  4IXL A;  3QH6 A;  1WW5 A;  1D4M 1;  4LA3 A;  3ZXE A;  4AI9 A;  1QJY 3;  1TME 3;  3B69 A;  3HBZ A;  2IVJ A;  4H2A A;  2E7T A;  4RQP B;  4XQD A;  5HCF A;  3VBF C;  1YFY A;  2BW8 A;  4CCD A;  1AJK A;  1AX2 A;  1MZF A;  4YVS B;  3ZR5 A;  5LA1 A;  4QKN A;  2HBT A;  5I8S A;  1G9B A;  5F37 A;  3I97 A;  4O9E A;  1CIW A;  2DTY A;  2XKP A;  4MGK E;  1NE4 A;  5E16 A;  3AM2 A;  3VL8 A;  5FPX A;  1GWM A;  1E5I A;  1Z7S 3;  2BER A;  1MS4 A;  3AMM A;  4XUO A;  4G4F A;  3PUH A;  2ZHL A;  1DBN A;  1QXJ A;  2XML A;  1UY2 A;  1Y9G A;  1CPM A;  1N3P A;  2JG9 C;  4HZF A;  4L11 A;  3ST7 A;  2UU8 A;  2XJQ A;  2C9K A;  2WO3 A;  3POY A;  2V09 A;  5FBJ A;  5FZA A;  2RS3 1;  4L2N A;  1I6X A;  4YW4 A;  1RUH 3;  1AVB A;  3IAP A;  2TNF A;  2XBO 2;  2JG9 A;  3I54 A;  4BA6 A;  5KR7 A;  2PHU A;  1JYX A;  4UW5 A;  4OHY A;  2EAA A;  1O3T A;  2K2S A;  2VTF A;  4XAE A;  2WNV A;  3BYW A;  5FQ0 B;  3H8O A;  2HYK A;  1ULD A;  3EJK A;  3N7J A;  2V73 A;  4MVT A;  5FY8 A;  4AED C;  4Y5T A;  4E2G A;  5GZF A;  1UOB A;  1NG0 A;  3HEI A;  1H9P A;  4YG0 A;  4QQ2 A;  1VBE 2;  2ZGK A;  4N9I A;  4QGM A;  3WDT A;  5KHG A;  3VHO A;  3OJB A;  2ZCW A;  2VPV A;  1FV2 A;  4FFF A;  2JX9 A;  4UBG A;  4GMP 1;  1SDD B;  2VZV A;  3DXU A;  1NA1 C;  1X9T A;  1YEW A;  2ERF A;  2JXA A;  4UBH A;  4AI8 A;  5JZG A;  3WLU A;  1AHS A;  3TN9 3;  2DCJ A;  3BIW E;  5KHI A;  1ND2 A;  3S5Q A;  1JHJ A;  1H0B A;  1DDL A;  2VU9 A;  3OBR A;  2WQ4 A;  4PIX A;  4KWL A;  3UGH A;  1UN1 A;  4MHU A;  3AYA A;  3FBM A;  1WBF A;  2A5Z A;  2JD4 A;  4QDQ A;  5FZM A;  3U10 A;  5JMC A;  3ACH A;  2ORZ A;  4GXL A;  2EIE A;  1PZ9 A;  5DAB A;  3SCG A;  5C8C A;  4AVC A;  3PUR A;  3NWK A;  1BBT 1;  5FFO C;  5DAW A;  1C3H A;  3PUS A;  2ZGS A;  1RUC 2;  4YVW A;  2WYF A;  4QAW A;  5FZG A;  4BYY A;  1BK1 A;  4D6Q A;  3J7M A;  3B93 A;  3MW3 A;  4LK6 A;  3UKN A;  1LOA A;  4OUM A;  3VV1 A;  2DVB A;  4DUV A;  5ABJ B;  2P4E A;  5IVB A;  4MSV A;  3T2O A;  1RUE 1;  5FMO S;  2G9F A;  1MQT A;  2DYC A;  5FLJ A;  4TTG A;  2IXH A;  1AF9 A;  3WX5 A;  3IM0 A;  3ACG A;  5JPM B;  3FFQ A;  1NUK A;  1VRB A;  3LWC A;  4E4D X;  1DZQ A;  3LPG A;  1HXS 3;  1MQT C;  2ZHM A;  1E5R A;  4QPG B;  3NNG A;  3ZN4 A;  4FOV A;  3NJZ A;  4BLI A;  1K42 A;  1K3I A;  1PMI A;  4ZXK A;  3N7L A;  3ZYJ B;  2XJU A;  4XAB A;  2ZTN A;  3SMH A;  3VZK A;  2PAE A;  1SQ4 A;  2XLG A;  4BU2 A;  4D3W A;  4F83 A;  1RUH 1;  4P9L A;  5KHH A;  2YBP A;  4WVM B;  1J3R A;  5BXX A;  5T5J A;  1NCR C;  2JEN A;  3LCP A;  1KD7 A;  4JC1 A;  4NHX A;  3S7I A;  3MV0 1;  4HKO A;  1DLC A;  1W6M B;  4D8M A;  4AK3 A;  3VKO A;  5FYS A;  3HNB M;  4LO7 A;  5FZ9 A;  1CX1 A;  2FCU A;  3NAP A;  5B4X A;  1KFX L;  1MZ5 A;  1JH5 A;  3ZSE A;  3P3P A;  3WIN E;  1BEV 2;  2W0X A;  3GCW A;  5B2G B;  4EN6 B;  1XOY A;  3AMN A;  4LKE A;  4JCK A;  4A41 A;  3T0D A;  2HKX A;  1F31 A;  4LMF A;  5GZE A;  3BPS A;  4HAN A;  2D93 A;  3JBG 2;  4Q0S A;  4Y1U A;  1EPW A;  4FP3 A;  1LEM A;  2HH9 A;  1UYZ A;  4CDU C;  4Y3O A;  4CVU A;  4Y22 A;  1W9F A;  1QNY A;  3N7K A;  3Q8B A;  4YG6 A;  3T2T A;  3WG1 A;  4BQ5 A;  5JZG B;  2TUN A;  1H2K A;  3ZPY A;  4EQV A;  1OH3 A;  2W1W A;  4MXW A;  1HQN A;  2X10 A;  4AFD A;  3PDQ A;  5IAV A;  1RUG 2;  2VMD A;  4DIQ A;  1ND3 A;  1STM A;  2Y38 A;  2DDU A;  3RDI A;  4YWA A;  3RYK A;  2Y6F A;  1DYK A;  1WA6 X;  4DS0 A;  4QX2 A;  1G9C A;  2HWB 3;  1Y3T A;  2WAB A;  4LLF A;  4KBB A;  5AVA A;  1NLS A;  5JCT A;  2XHN A;  4HSL A;  1IGO A;  2C4X A;  4Q0P A;  3J8F 2;  4P5Y A;  3VHR A;  5JSO A;  3L2Y A;  4XQW A;  3MW4 A;  1VRH 3;  2HWF 2;  1RUF 3;  2PEL A;  4M4P A;  1VAM A;  2BNN A;  5DUU A;  4RA0 A;  1DFQ A;  4CDX A;  1A6C A;  2WLQ A;  3DUI A;  2D5F A;  1BEV 1;  2QVS B;  1ZZB A;  5LK7 B;  4A6S A;  1PHM A;  3GZE A;  5EFU A;  4B8E A;  1C8M 1;  1PO1 3;  1ULE A;  3CNA A;  4XXP A;  4CXW A;  3OPT A;  1XE7 A;  4HK9 A;  1SBE A;  4X6R B;  3VKL A;  3O1P A;  4WM8 B;  3RMY A;  2LRO A;  1WLT A;  1RJ7 A;  1KFU L;  4LHS A;  3Q8A A;  2E33 A;  1RB8 G;  5EYY A;  1ODM A;  1OSG A;  2ZMN A;  1ZNP A;  3CKH A;  4BWO A;  5IUQ A;  5C6C A;  3O0X A;  5CKQ A;  5GZG A;  2BBV A;  4AHX A;  4BZ4 A;  2JD9 A;  2GH2 A;  4Q4V 2;  1XC6 A;  3GHN A;  4M3C E;  4AG4 A;  4N43 A;  3Q9O A;  5A7W A;  3WF1 A;  5CU1 A;  3TRS B;  4R9C A;  1B35 B;  1W8O A;  3RFR A;  3KV6 A;  4LE4 A;  1HX6 A;  4NOT A;  4AWD A;  3PMS A;  1FX5 A;  2FQP A;  4GAZ A;  4KU7 A;  3MPB A;  3E1F 1;  4QX3 A;  4YM2 A;  4P02 B;  3E6B A;  2F4L A;  4AQ2 A;  2J42 A;  1XJA A;  3ENR A;  4P9Y A;  1GP6 A;  2D6P A;  2WS9 2;  2ZMK A;  4LPL A;  1JYI A;  1JW6 A;  5HV4 A;  2NN8 A;  1UW8 A;  3ZXK A;  5FTT C;  2OVU A;  1RHI 1;  1JZ5 A;  4YW6 A;  3I3M A;  1JZ8 A;  4TZD A;  1YQC A;  3KWV A;  4LKD A;  3U1X A;  4AGV A;  2W87 A;  4FPE A;  4SLI A;  4LLO A;  5F3I A;  5A7S A;  1VE0 A;  1FNY A;  1V6N A;  2NMO A;  4ASK A;  5L73 A;  1L7R A;  5HCH A;  2X05 A;  2P3I A;  4D7Y A;  4DEQ A;  2AR6 A;  1H6X A;  3SNM A;  1LUL A;  1IHM A;  5IT6 A;  2MNG A;  2OUJ A;  1W8U A;  4YGD A;  5T5L A;  4A7K A;  1QJX 3;  1YLL A;  2ET7 A;  2XVK A;  5FOJ B;  5I0D A;  4EWA A;  2XWB B;  4LTA A;  4D6R A;  3THP A;  2Y8K A;  1DGW X;  3FWE A;  4CP9 B;  4QGN A;  4XJU A;  3VBF A;  5A3L A;  4QX5 A;  4CXX A;  3AB0 A;  4H14 A;  5C70 A;  3LGR A;  2IWG B;  1EAH 2;  2EXH A;  3MHZ A;  1SDW A;  2BJS A;  5FZF A;  2D3P A;  4O65 A;  3VD3 A;  3H3L A;  1ZRC A;  4CEW A;  2XLA A;  2K46 A;  3CIH A;  5DAQ A;  4AI2 A;  5D8A A;  1GIC A;  3U11 A;  5I0S A;  1SEF A;  1VBA 3;  4A7Y A;  1WBL A;  4IET A;  1Q8S A;  4IGP A;  1NYW A;  4LO5 B;  4S2D A;  2F6B A;  5H9P A;  1Q3E A;  2A73 B;  5IYY A;  5LBC A;  3ZLI A;  4NHL A;  1WME A;  2UY9 A;  1ENR A;  2W95 A;  4HLT A;  1ND3 C;  5GLT A;  1QQP 1;  5E88 A;  2H6B A;  2H6C A;  4JX0 A;  1I9R A;  4XDO A;  3SQO A;  4AHY A;  4CCN A;  3AYD A;  1APN A;  1D0H A;  1NE6 A;  1UPI A;  4XQ4 A;  4RGA A;  4XIL A;  2R04 1;  3MFC A;  3MIB A;  5T50 A;  1OT5 A;  5FZE A;  4BMB A;  5CFD C;  3CDZ B;  3PU3 A;  1NY7 1;  4ZS2 A;  4EYU A;  4MGI E;  2QE3 A;  4YM1 A;  4C90 A;  4DXR A;  4HXC A;  2WFF 1;  2ZGT A;  4FAG A;  4M0H A;  2EA7 A;  5JSR A;  3LEM A;  3M3O A;  2JEC A;  1POV 1;  1ZBA 1;  2EAK A;  3B02 A;  1D4M 3;  2OKX A;  3VD5 A;  1SLT A;  1V6I A;  1POQ A;  1ASJ 2;  1OC1 A;  2WT1 A;  4KH9 A;  3TWI A;  2R07 1;  4LBL A;  2CDP A;  5FYT A;  1PIV 2;  2VCA A;  4I3G A;  4TWT A;  1R09 3;  1WUV A;  4IE0 A;  4M0N A;  2HWF 1;  5FJK A;  5CG9 A;  4FOQ A;  1LHO A;  4XJ9 A;  1LHV A;  1J3Q A;  4P9I A;  4R9D A;  3I3D A;  5C5U A;  5FLI A;  4BOW A;  2QJV A;  3ZXF A;  2ATF A;  5FZK A;  2Z5W A;  1HKD A;  4UT5 A;  2EXK A;  2P3K A;  2RM2 3;  5FZ0 A;  3H1Y A;  3KVB A;  3T30 A;  1V6L A;  2CNA A;  3VBR A;  1JOB A;  1L7L A;  3NV1 A;  4RS5 C;  3R6S A;  3OBZ A;  3POJ A;  5CKN A;  3N36 A;  4KNC A;  4FPG A;  1W39 A;  1R1A 3;  2OZJ A;  5L7O A;  3BU7 A;  3NJY A;  3O1S A;  2ZOE B;  1CGP A;  5DXD A;  4QPI C;  1C5H A; 
#chains in the Genus database with same CATH homology
 3VDA A;  3HNY M;  1UY1 A;  2YC2 A;  4UI9 L;  3BGA A;  2W92 A;  4CU6 A;  3ACI A;  4P00 B;  2J1U A;  4ZZ5 A;  4PQQ A;  5JXG A;  1GOG A;  2Y6H A;  2Z4F A;  3ETP A;  1O8S A;  2DCK A;  4LQR A;  3W5N A;  1OF3 A;  2ZXQ A;  3A21 A;  4KMQ A;  3WF2 A;  1W0N A;  1P8J A;  3A22 A;  3OG2 A;  3VD9 A;  4DUX A;  1XNT A;  1H6Y A;  1ULO A;  2LS6 A;  3IDA A;  5DQ0 A;  3MV1 1;  3U37 A;  3OGV A;  3I2F A;  1BHG A;  3W5M A;  2WN3 A;  4XZU G;  5A1A A;  1JZ3 A;  2Y6G A;  1NX9 A;  4CU7 A;  2PQS A;  3UNP A;  1EUT A;  2VMC A;  4MAD A;  1CZV A;  4RN5 A;  4BK4 A;  3ACF A;  1GNY A;  3FHA A;  4DUW A;  2W3J A;  2QQM A;  3IAQ A;  2YB7 A;  4PT6 A;  2KD7 A;  5DMY A;  3LPF A;  4OMD A;  3DEC A;  4E8C A;  3MUY 1;  2Y6L A;  2W5F A;  3DYP A;  3SKJ E;  1GQP A;  3EYP A;  3C7H A;  2W94 A;  1MPX A;  2JKX A;  3D3A A;  1K12 A;  4QX0 A;  2VOT A;  5J1X A;  3MBW A;  2VO5 A;  3I3B A;  2VJX A;  2J1S A;  2V4V A;  2ZEX A;  3OGR A;  2V72 A;  1SG3 A;  4HG6 B;  2E31 A;  4BJ0 A;  4M4R A;  1YQ2 A;  3FL7 A;  5LA2 A;  4AAX A;  1KGY A;  2VL4 A;  1F4H A;  4ARY A;  5HPO A;  5IHR A;  5JMO A;  4KWU A;  4P08 A;  3HN3 A;  3WQB A;  3VD7 A;  5DN2 A;  2Y6K A;  2BGO A;  2QQJ A;  2B9V A;  3HPN A;  1GOH A;  3ZM8 A;  2VM9 A;  4E8D A;  1O8P A;  2VZO A;  4A4A A;  4XUR A;  1NAE A;  3K46 A;  2QQK A;  3PUI A;  5CZK A;  1W8N A;  4Z2A A;  2W47 A;  3P6B A;  3ECQ A;  5DPN A;  1DP0 A;  2VZ3 A;  1J83 A;  3OGS A;  3P1I A;  5LCW L;  4PF1 A;  1UXX X;  1CZT A;  2HYX A;  4CUB A;  4LKS A;  1TVG A;  2J1V A;  2VZ1 A;  2RV9 A;  2EIC A;  3III A;  1K45 A;  5LA1 A;  3IB3 A;  1OD3 A;  2JDA A;  3K77 A;  3T0B A;  3I97 A;  4BK5 A;  4GWJ A;  5JXH A;  2BER A;  4XUO A;  3PUH A;  2YFU A;  4GZ9 A;  1JZ7 A;  3WF3 A;  4DXT A;  1UY2 A;  1JU3 A;  4BDV B;  1JYW A;  1R64 A;  2C9K A;  2WO3 A;  2WN2 A;  3I2G A;  2EID A;  1DYO A;  2L9L A;  4OZO A;  3IAP A;  4XVH A;  4JKK A;  4QDS A;  2VME A;  1JYX A;  2VZP A;  3CQO A;  2VTF A;  1W99 A;  2VZS A;  4QB1 A;  2WZE A;  1UMI A;  2VCB A;  4UAP A;  1J84 A;  3HEI A;  3MO4 A;  4XUN A;  2R7E B;  3K4D A;  1SDD B;  2VZV A;  4L0P A;  4ET7 A;  4ZZ8 A;  2QBX A;  2WUH A;  2VR4 A;  4IUG A;  3VDB A;  1XNA A;  3C7F A;  2Y64 A;  4XUT A;  1GUI A;  2DCJ A;  1JHJ A;  3JXS A;  1CZS A;  3NRU A;  1I5P A;  4QDQ A;  1D7P M;  1L7Q A;  3VD4 A;  3ACH A;  1JZ2 A;  2ORZ A;  2ZEZ A;  2EIE A;  5EJZ B;  4MGS A;  2X09 A;  4RYD A;  2W1S A;  4FI9 A;  3WEZ A;  3WNP A;  2J1T A;  4A6O A;  4QAW A;  1NKG A;  2V5D A;  2RJ2 A;  2W1Q A;  2ZEW A;  4DUV A;  4XUP A;  1IQD C;  3T2O A;  3C8X A;  2E26 A;  4TTG A;  3ACG A;  1NUK A;  3LEG A;  2E32 A;  4QX1 A;  3LPG A;  1JYN A;  3NNG A;  3THC A;  1K42 A;  1K3I A;  1KEX A;  1W9W A;  3VDC A;  3CMG A;  3EB7 A;  1OF4 A;  3MV0 1;  1DLC A;  1UZ0 A;  4D8M A;  2QQO A;  3J7H A;  3HNB M;  4JHZ A;  4QB6 A;  1GU3 A;  1JZ6 A;  1CX1 A;  4CU8 A;  5B4X A;  1UYY A;  3BN6 A;  3THD A;  4MO3 M;  3T0D A;  4A41 A;  2YFZ A;  3LEK A;  4A44 A;  4MOA A;  2ZEY A;  2VQT A;  4OUE A;  3NQH A;  4W50 A;  3GDB A;  4QB2 A;  1HN1 A;  1UYZ A;  4CVU A;  4QPW A;  5JUV A;  2VQU A;  5JR2 A;  2W1W A;  3WSO A;  2X10 A;  2WAA A;  4UOJ A;  3T09 A;  5C71 A;  1PX4 A;  4TXW A;  3K75 B;  1JYV A;  2J7M A;  2VMD A;  3C7E A;  2RVA A;  3WNM A;  5C70 A;  3LE0 A;  1US2 A;  1W9T A;  3LQC A;  2BGP A;  5HXM A;  3I2I A;  2DDU A;  2W91 A;  1OH4 A;  1UWW A;  2JE8 A;  4ZXE A;  4BXS V;  4QX2 A;  2XON A;  2WAB A;  3C7G A;  3I2K A;  2XHN A;  1RYY A;  3OB8 A;  2C4X A;  5FUI A;  3GGL A;  2WAO A;  3HNM A;  4P5Y A;  3C7O A;  3CZJ A;  4M4P A;  2J1A A;  3A23 A;  1PMH X;  3WNL A;  2VCC A;  3T08 A;  3WF0 A;  4OYU A;  1UXZ A;  2XQX A;  2W46 A;  3T2P A;  4OMC A;  5F7U A;  2VMF A;  4LHS A;  3FN9 A;  2E33 A;  5IFT A;  4JKM A;  4CUA A;  3ABZ A;  4ZY9 A;  3T0A A;  2VZQ A;  3CKH A;  1UYX A;  2JD9 A;  3I3E A;  1XC6 A;  2VC9 A;  4MGQ A;  4AG4 A;  1LNS A;  3WF1 A;  1W8O A;  3WNK A;  3K4A A;  3AC0 A;  3SEE A;  1US3 A;  3E1F 1;  4QX3 A;  4P02 B;  5JXJ A;  4LPL A;  2HLE A;  1PMJ X;  3OEA A;  1JZ5 A;  5G04 L;  2W9X A;  1JZ8 A;  3WF4 A;  1XPW A;  2J1E A;  2ORX A;  2YG0 A;  2W87 A;  3NJV A;  2XOM A;  2WQ8 A;  4CU9 A;  1L7R A;  2WZ8 A;  3K4Z A;  3NJX A;  2X05 A;  3WNO A;  1CIY A;  4DEV A;  3MUZ 1;  4DEQ A;  1H6X A;  5B4N A;  2C26 A;  4W4Z A;  5I0D A;  1UY4 A;  2QQL A;  2Y8K A;  1WKY A;  1W9S A;  2VZT A;  1UMH A;  3SKV A;  3WNN A;  2WO1 A;  2W1U A;  2Y6J A;  3DYM A;  4QDR A;  2WYS A;  4JKL A;  3VD3 A;  1EUU A;  2BBA A;  1TG7 A;  2WDB A;  1UY0 A;  2QQN A;  5JXI A;  2VZU A;  5G05 L;  3CIH A;  1SHW B;  4GWI A;  3HOB A;  5EJ1 B;  1T2X A;  3I2J A;  5IYY A;  4A45 A;  3I2H A;  2W95 A;  4A3Z A;  5EIY B;  3F2Z A;  4JX0 A;  3CZU A;  4XUQ A;  3GM8 A;  3UES A;  1OT5 A;  3GXU A;  3CDZ B;  4DXR A;  2BZD A;  4CUC A;  1JZ4 A;  3OEB A;  3T2Q A;  1UX7 A;  4A42 A;  1O59 A;  1PX3 A;  2YC4 A;  3OBA A;  2OKX A;  3VD5 A;  3SEP A;  2J1R A;  3A7Q A;  2CDO A;  2VZR A;  1F4A A;  1JU4 A;  3FHQ A;  4W8J A;  3UET A;  5C7G A;  1UY3 A;  2CDP A;  3DYO A;  4D0Q A;  1GMM A;  2B4K A;  4KI5 M;  2VCA A;  2WBK A;  4DXS A;  5IFP A;  2J22 A;  3I3D A;  5CYY A;  2QQI A;  4YPJ A;  5IJR A;  4ARX A;  1ULP A;  2LW8 A;  3HJR A;  3LEI A;  1JI6 A;  2EIB A;  1WCQ A;  5LA0 A;  2WO2 A;  2ID4 A;  1GOF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...