3K77A

X-ray crystal structure of xrcc1
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
152
structure length
152
Chain Sequence
b'PEIRLRHVVSCSSQDSTHCAENLLKADTYRKWRAAKAGEKTISVVLQLEKEEQIHSVDIGNDGSAFVEVLVGSSAGGAGEQDYEVLLVTSSFMSPSESRSGSNPNRVRMFGPDKLVRAAAEKRWDRVKIVCSQPYSKDSPFGLSFVRFHSPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA repair protein XRCC1
publication title Oxidation state of the XRCC1 N-terminal domain regulates DNA polymerase beta binding affinity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 34
structure length 152
sequence length 152
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2009-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01834 XRCC1_N XRCC1 N terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 3k77A00
2ORZA 4D0QA 3WNNA 2EIBA 3AC0A 3CDZB 1JU4A 4ZZ8A 3T2QA 3NJVA 5G04L 2J1TA 3T0AA 2W94A 3FHAA 5LCWL 1JU3A 3T0BA 2LW8A 3WNMA 3VDBA 1JZ7A 2DCJA 2LS6A 3W5NA 2J1RA 4A4AA 1GOFA 1SG3A 3ABZA 1XC6A 3VD5A 1NKGA 1OD3A 4BJ0A 1SDDB 3SKVA 5JUVA 3K4AA 4ZY9A 3ACFA 4MOAA 3JXSA 2EIEA 4CU9A 3VD7A 2VMEA 2OKXA 2YC4A 3HNMA 2WO3A 2W3JA 4LKSA 3DYPA 2VCCA 3T2OA 4XZUG 1UYYA 4A3ZA 4BDVB 3EB7A 1OT5A 2J1SA 3DYMA 5HXMA 1L7QA 3HNYM 5EJ1B 4W50A 2QQMA 3SKJE 2B4KA 1UY2A 2VZ3A 4MO3M 1OH4A 2VZOA 4QDQA 5JXGA 2XOMA 4AAXA 1US2A 4QX1A 1NUKA 2VZSA 4QB2A 3J7HA 4LPLA 4ARXA 3UESA 4AG4A 1EUUA 1DLCA 2EICA 1BHGA 2QQOA 1K3IA 4A45A 3ACIA 2WUHA 4P5YA 5LA0A 3WF2A 3I2IA 4MGQA 3I2JA 2E26A 4JX0A 5JMOA 2W1WA 5EJZB 2C9KA 1J83A 2QQJA 2ZEYA 2HLEA 5CZKA 5DQ0A 2ORXA 3I3EA 2VMFA 2W1QA 2WDBA 4XUTA 2VC9A 4DXTA 2VM9A 3K46A 5IHRA 2CDPA 5IJRA 3WF1A 2WN2A 2JKXA 2CDOA 1P8JA 1HN1A 4E8DA 2JE8A 3K77A 2RVAA 2W1UA 2VQUA 1O59A 2W1SA 1UMIA 3I97A 3OB8A 3ZM8A 3C7EA 3T08A 1WCQA 5B4NA 4OUEA 2DDUA 2YFUA 3FHQA 1W9SA 3I3BA 3BN6A 2ZEZA 4QB6A 2W5FA 2BGOA 2QBXA 2Y64A 5C7GA 3FL7A 4DUXA 4JKKA 4CU6A 2VZVA 4M4RA 1W0NA 3T0DA 3OEBA 2YG0A 1TVGA 4CVUA 2B9VA 3UETA 2X10A 1GU3A 1JZ5A 1UYZA 4P02B 2ID4A 4P08A 3SEEA 1NAEA 2E31A 4BXSV 5JR2A 2W47A 3HJRA 1PX4A 2Y6GA 3NJXA 1TG7A 1H6XA 1GMMA 1XPWA 1F4HA 4KMQA 3GXUA 4P00B 3HEIA 3I2KA 3I2HA 1GQPA 4RN5A 4CU8A 2QQNA 4LHSA 1US3A 1GNYA 3LEIA 5I0DA 4Z2AA 5DMYA 2Y6JA 4DEVA 2ZXQA 3K4ZA 2VOTA 4KWUA 4XUOA 3MUZ1 2J1UA 3ETPA 4GWIA 3C8XA 5JXHA 3GGLA 4OMDA 2RJ2A 2VZPA 1JZ6A 3I3DA 3NQHA 1H6YA 1IQDC 1MPXA 1PX3A 1W8NA 3WSOA 1UY3A 4A41A 3A7QA 1JI6A 3IIIA 4QDSA 4QDRA 4OMCA 2V72A 4QX3A 1SHWB 1DYOA 5B4XA 3THCA 5CYYA 4E8CA 2VR4A 2VZRA 1XNTA 5IFPA 1W99A 4OZOA 1ULPA 4DXSA 1K42A 3A23A 4W8JA 2X05A 3T09A 5C71A 4XUPA 1GUIA 4LQRA 2JD9A 4CUCA 4D8MA 4XURA 3BGAA 3ECQA 3HOBA 2QQLA 1F4AA 4TTGA 2WQ8A 3CMGA 2VQTA 3P6BA 4A6OA 4DUWA 1RYYA 2W87A 1O8PA 3CKHA 2E32A 3MO4A 3LEGA 2ZEWA 1UY1A 3UNPA 2BERA 4JHZA 1EUTA 1XNAA 3NRUA 3IDAA 3WNKA 3VD3A 2C4XA 5DN2A 3T2PA 2V5DA 5A1AA 3WQBA 3VDCA 3PUIA 3SEPA 1K45A 4OYUA 2VMCA 3HNBM 2Y6LA 2XQXA 3CIHA 3WEZA 1T2XA 2VCAA 5J1XA 2VZTA 4L0PA 4BK4A 2J7MA 2J1VA 4A42A 1J84A 3ACHA 1WKYA 5IFTA 2VCBA 2Y6HA 3IAPA 3OG2A 3CZUA 1UZ0A 4JKLA 3FN9A 1K12A 1O8SA 2W9XA 2QQIA 4M4PA 1JZ2A 3OGRA 2ZEXA 5JXJA 3F2ZA 2BZDA 5IYYA 1PMJX 2W46A 2XONA 2YB7A 1YQ2A 4ZXEA 3WNLA 2WABA 3LE0A 2WBKA 2PQSA 3MV01 5F7UA 3LPFA 1PMHX 2RV9A 4FI9A 4UI9L 1UXXX 1NX9A 1JHJA 2VZ1A 2HYXA 3IB3A 3C7FA 1W9WA 4KI5M 2W91A 4RYDA 3WNOA 2VZQA 3P1IA 3GDBA 3VD9A 4UAPA 1I5PA 4QX0A 3D3AA 1UWWA 3LEKA 3NNGA 5DPNA 2Y6KA 4QB1A 1JZ8A 2VL4A 1GOGA 1CZSA 3I2GA 4ZZ5A 3MV11 1D7PM 2WZEA 3W5MA 2JDAA 1CZTA 3EYPA 2YC2A 2J22A 2W95A 3K75B 4XUNA 5C70A 2DCKA 4BK5A 3THDA 2KD7A 4YPJA 3MUY1 1UX7A 2WAOA 3OEAA 4CUBA 1W8OA 1DP0A 4CU7A 3K4DA 4ET7A 1CIYA 2C26A 3CZJA 1W9TA 1UMHA 4QAWA 3U37A 1LNSA 2V4VA 5LA2A 5LA1A 4ARYA 5G05L 3C7GA 4MADA 5EIYB 4DXRA 2VTFA 2W92A 4CUAA 3OGSA 2X09A 1KGYA 2VMDA 1JYNA 3PUHA 1JYVA 3I2FA 4TXWA 3WF4A 4DEQA 3DYOA 3ACGA 3LQCA 4UOJA 2WAAA 2WYSA 2QQKA 3WF3A 3GM8A 5FUIA 2J1EA 3WF0A 1JYWA 4PF1A 3A21A 3E1F1 1GOHA 4PQQA 3MBWA 3HN3A 2J1AA 3OGVA 5HPOA 3C7HA 3C7OA 2VZUA 1JZ4A 2WO1A 3VD4A 2Y8KA 4XVHA 1ULOA 3DECA 2Z4FA 3IAQA 4GWJA 2L9LA 1OF3A 2VO5A 1R64A 4IUGA 4MGSA 4HG6B 4XUQA 1JYXA 3A22A 2YFZA 1UY0A 1UY4A 2WN3A 3OBAA 5JXIA 3CQOA 2WZ8A 4QX2A 4PT6A 2VJXA 2EIDA 3VDAA 2BBAA 2WO2A 2R7EB 4A44A 1CX1A 2XHNA 4GZ9A 1JZ3A 4QPWA 1L7RA 1CZVA 2BGPA 4JKMA 3LPGA 1UXZA 4W4ZA 3HPNA 2E33A 1OF4A 1KEXA 4DUVA 1UYXA 3WNPA
chains in the Genus database with same CATH superfamily
3ZXAC 4FFIA 3J26N 4IV3B 1LESA 4FTEA 1G6NA 2HWD1 2EIBA 2R063 4D7TA 1F5JA 2C9AA 2XR4A 4LO6B 3CEWA 4LK6A 5C8WA 3NJVA 4AL9A 2BJSA 1WLTA 5FLJA 1Y7BA 3FHAA 4PDWB 4XHXA 4RHV1 3T0BA 2LW8A 4PJYA 4QPYA 1DU3D 1REFA 4GD4A 4QPGA 5SV5A 3AP4A 2PAMA 1EAH1 1TZOA 1QOSA 3AL5A 3W5NA 2GNDA 4ZS3A 1KXGA 4A4AA 2ZGUA 3AKTA 1W2UA 4M00A 2D6NA 5IK5A 2XJVA 5CEHA 1VR3A 1O3SA 1NKGA 1OD3A 5JUVA 2ARXA 1S0DA 4FO9A 3M8LA 4S2HA 4QXCA 3VKLA 3AYDA 3QLQA 4HMZA 4MOAA 1B35A 2B45X 2RMU3 1JTZX 3U07A 2A70A 2YC4A 3D5OA 4NPMA 5FFOC 1NCRC 1D4M2 2GALA 1C1FA 2DVBA 2X5IC 5ANNA 1QJY1 2GMPA 3OTFA 3NL1A 1H9PA 3POFA 4LKSA 5FZ6A 2G9GA 3T2OA 1UYYA 1Q8QA 1AXZA 3EO6A 5J98B 4HSJA 1DYKA 4A3ZA 4TWTA 3E5QA 3EB7A 1RUI1 1OPOA 1OT5A 2J1SA 2O0OA 3SLIA 5JZGA 3DYMA 1H4HA 4QU2A 3WHTA 2HEVF 5JOZA 1L7QA 5EJ1B 4WVMA 3O1RA 2QQMA 3SKJE 3AJZA 2VCMA 3I8TA 3EMRA 2B4KA 5L9BA 4AGGA 5EPAA 1ZRIA 2VW0A 5I8TA 4QDQA 2ZZJA 3MGUA 4RFT0 3E97A 3POGA 2Z79A 4GH4C 1EV13 1V00A 1NUKA 5A7WA 3ZN5A 1F5FA 3IMMA 5DZGA 1A34A 5DG1A 4LPLA 3PUAA 1LR5A 2DVFA 2ZGKA 3OBRA 3R4UA 2ZGOA 4MXWB 1REEA 5FYUA 3UESA 4AG4A 1RVF3 3OYWA 4ARXA 4FXKB 1WLCA 1JUIA 5FREA 3ZYHA 2EAAA 5DXDA 4Q26A 3WP4A 4CDXC 3H7YA 4LHLA 4A45A 3PURA 3CU7A 1QH7A 2HBUA 4WZFA 5EFUA 2DTYA 3VL9A 1ZBA1 5DUWA 4NO4A 5JMOA 4NHXA 5J37A 2VUAA 1SCSA 2WNVA 4RD7A 1LGCA 4OQ8A 3KB5A 2QQJA 3VBFC 4DY3A 1YFWA 2ZEYA 4N53B 4PLOA 4XF3A 5F2SA 3DPRC 2I74A 3IPVB 5FZDA 5JVVA 5EQUA 4DB5A 1QQP3 2VMFA 2XDVA 2EALA 2FMYA 2WZR3 2VM9A 3PJYA 1HJFA 1UQXA 1UZVA 3K46A 5IVEA 5KHGA 3BTXA 3WF1A 1WW7A 2G19A 2WKKA 2WZPP 4PDWA 3WCSA 1W8WA 3MIHA 4JDMA 1ZREA 1HQWA 2RVAA 2VXJA 2XKPA 4QD2A 4XE9A 4AVVA 1O5LA 4IE6A 4S2DA 1RXGA 1AR73 4FP3A 4EWEA 1IS4A 1XQNA 4WV8A 5JAXA 5D21A 1JYCA 2KR2A 2PHFA 4OLLA 2DVDA 1SZBA 2R042 5KHIA 5FWEA 4GWMA 3U78A 4KBZA 3SC7X 4OUEA 4LBKA 4YW6A 4AVSA 5JPMB 2YV8A 4U2AA 5A7NA 3T4VA 2WA3A 4IE7A 3I3BA 2DVGA 4I30A 4Q4X2 1V6JA 2HWC3 3NV4A 3LB9A 4UFMA 4JRLA 1NA1C 2IXIA 1VBA2 3VZKA 1JMUB 2BGOA 2WRAA 2E7TA 5BNPB 3FL7A 4FBFA 1AR93 2NMOA 2PHUA 3IM0A 3NNJA 3VKMA 3WCRA 3ZXJA 3HN1A 2XWJB 3HQRA 4M4RA 3SH4A 2FCUA 3WQ0A 2PMWB 3PUQA 3T0DA 3AMPA 4AFAA 1POQA 1TVGA 4YZ3A 1BZWA 3WP6A 3LCPA 4TZDA 3PTRB 4DPNA 4H7LA 3IMNA 2HWB3 1UYZA 2NLRA 3ZSEA 4P08A 3A0KA 3SEEA 3BCWA 2E31A 3JCIA 2CYFA 4ISRA 2CV6A 2PAKA 5C3RA 3M3OA 2VULA 3N7KA 3VN4A 3JQXA 4EZHA 1AX2A 1TME1 4MHUA 5IATA 1H6XA 3PTYA 4RSUA 5C3PA 4JGYB 5DAPA 4KMQA 3GXUA 2AREA 2GP5A 4EN9B 2Q0AA 1S0IA 4N90A 4OQ9A 5HCAA 3CLPA 4MXWA 5DAXA 3BU0A 1VBD1 1LRHA 3KT7A 3RGBA 2KXLA 5BYNA 1K5MC 1WCSA 2VOVA 4QM8A 1SMVA 3LEIA 4CE8A 2WYFA 4JC1A 2UWAA 2XBO2 1NCQB 5I0DA 5JPNB 2Y6JA 4D7SA 2GN3A 1AL21 1IPKA 2UYAA 4KWUA 3MPPG 4OZXA 4XUOA 4BQYA 3AJYA 4Q4W2 5CG9A 2FZ1A 2J1UA 3MIDA 1JXNA 4QPIC 3OGGA 1S0BA 2HWE1 4Y24A 4RL7A 3JU9A 2ILMA 2IZWA 4V2WA 4FTSA 4FPEA 2RJ2A 2Z69A 4D94A 2MEV2 4N53A 4MG2A 4HT1T 1AX1A 3IPVA 3O0WA 3AMHA 2GU9A 4BLIA 4MV2A 1MPXA 3N9LA 3NNFA 4JCKA 5TSWA 4M0NA 4FPFA 2RS32 5FBZA 3ATGA 2DCTA 5A6XA 4A41A 1BK1A 4F7ZA 4MXVA 1YI9A 4CPBA 3GBFA 1YHFA 1C8M1 4XC9A 4YZ2A 2OX0A 2RS13 2VVEA 2JDNA 4LHKA 4QX3A 4Z07A 5B4XA 3WDUA 4CDWB 4DIQA 3THCA 1DGWA 4H14A 4AI1A 2C0ZA 2X29A 3QCWA 3VGIA 4E8CA 1RUH3 1UOJA 4XFIA 5T5LA 2YGMA 4K9SA 1ND2C 2VR4A 1V9U2 4ZHNA 3OUHA 3DKQA 4GIQA 5IFPA 2Z42A 3POYA 3Q8FA 4OZOA 2Q8DA 2TBVA 1GKBA 3KS7A 3A23A 2Q8CA 3W9AA 1VBC2 4QHOA 1GUIA 2FMDA 4LQRA 5I93A 1LENA 2OQ6A 1COV3 1F4AA 4I02A 4IXLA 4XQWA 4TTGA 3CMGA 2VQTA 4FPJA 3WDYA 4E4HA 1X9TA 5J7MA 2D6LX 1NY72 4O7XA 1ZRFA 5EZWA 2DFCA 1WLDA 5BNPA 1AYN3 1H30A 3VHNA 4AQTA 2E32A 3N3HA 4CUGA 3SNMA 1D2QA 4CCLA 1QOTA 1X33A 2RMU1 4Y5TA 2ZEWA 2BVBA 1UY1A 5T54A 5LASA 4AQ6A 1FMD2 3B00A 1XNAA 3CJIC 3S30A 3RI9A 2RR13 3S57A 2RJLA 4AHWA 3KWVA 4AI2A 5DN2A 3HIFA 3GHNA 3AKQA 5IWFA 4LBQB 1YFUA 5FJHA 3R4SA 4UFIA 2XUMA 3VDCA 5A6YA 2ZAAA 2LALA 2QQWA 2PLV3 3PUIA 2FDKA 3SEPA 1JHNA 1K45A 4NJ4A 4OYUA 2VMCA 4Q8LA 4JGYA 4QKDA 2JECA 2O1QA 1UU5A 2VCAA 5T5OA 4Z1VA 1O3QA 3BKZA 3KGZA 5GKAC 4NMIA 4BK4A 2XVLA 1H2KA 1W2NA 3ACHA 4Q1RA 4XPVA 1KJRA 4M0HA 1NCQA 2EXJA 1EV11 4RR3B 1LULA 3MI8A 1A3KA 1QJU2 1Y3TA 2AZ5A 2F6BA 2Y0IA 3N7MA 1BLZA 1D2SA 4JKLA 5HV4A 1HB3A 1RVF1 2W9XA 3HQXA 2PHDA 2QQIA 3I59A 4LO5B 4F3JA 2D3RA 1ZBE1 2ZGRA 4R9CA 4WVWA 4BQ2A 5JXJA 3GBWA 3P5BA 1MVEA 3RYRA 4Y1ZA 1PZ8A 1SFPA 2BYVE 4XF9A 3B94A 3K51A 4RFRB 2ZX4A 3P3PA 1KITA 5EP9A 4ZXEA 4RQPA 4AEDB 2XJQA 5E1RA 3ZDSA 2WABA 3LE0A 1LU1A 2VMIA 4XFBA 2QE3A 2CSGA 3LPFA 4PBOA 3I2DA 2VMHA 5AVPA 4Q29A 2LUWA 2GDFA 3B9CA 1W3VA 4YVWB 4QQPA 5HCFA 3R05A 1POV3 2XMLA 4Q4Y3 3JQWA 1J1TA 1RXFA 2RE9A 3LDBA 3NAPC 4MGKE 1VJ2A 2UWBA 2V09A 5L36A 1GLHA 1W28A 4C90A 4UW6A 3RZLA 4KI5M 2ZGMA 2Y6FA 3AP5A 4IEXA 2ZGTA 3WQ1A 1EY2A 1GZTA 4LKDA 1QDOA 5FPAA 3VL8A 2VZQA 4COZA 1PO13 3GDBA 1RB8G 2XJRA 4FSJA 1RUC2 1J3QA 1I3HA 4DQAA 2GNTA 2GMMA 1U0AA 3NNGA 4GKXA 2ET7A 2Y6KA 2AH2A 5E88A 3X29B 2WT2A 5IVFA 2VBBA 3AYEA 3I2GA 4YW7A 1YXWA 4ZZ5A 1ULGA 3AX4A 5IUQA 4AQ2A 5JSRA 4AF9A 4WM7B 1QJFA 1QXPA 4N9HA 2BP6A 4Y5Z0 1W2OA 2HWC1 1A6CA 1TNFA 2JDAA 3W5MA 2A75A 4JGZB 3ORJA 1Q56A 3VZLA 4ES9A 1A78A 2ZX3A 1QJEA 1CAUB 1LHVA 2UY9A 3ZXKA 3I7DA 2YC2A 3FZ3A 2J22A 4FTBA 3K75B 5C70A 1YI7A 4NRMA 1GSLA 3TRSB 1BVVA 5KXDA 4MYEA 1G7YA 4UFLA 5I8SA 4LBQA 2JG8B 3GNEA 1IPSA 1ZA4A 4IGPA 4RHV2 1NXMA 1VBB3 1CJDA 4UFKA 2VXRA 3IDEA 3Q8AA 3VDDC 1U5IA 2D44A 1MS4A 2RDSA 3OEAA 2HWB1 3C3VA 3LOIA 4L99A 2K46A 3FWEA 5FYMA 3T30A 1Q3EA 1W9TA 5FR3A 4IE5A 2ARAA 4QAWA 1RHI3 5LA1A 2YGLA 5FY4A 3NO8A 2WFF1 4CEYB 4RR3A 3HT2A 1SLAA 1NE6A 3EHKA 4C0HA 5FO8B 1NLRA 1XU2A 3THTA 1HRI2 4CDUB 3AMQA 2GC1A 1QH6A 4AFMA 4AGVA 2IUWA 4BQXA 3KZ4C 3MICA 4LUKA 5IK8A 3LF7A 2WNUB 2XWBB 3OCPA 4OVEA 4XW3A 5BV6A 2RS51 5F3GA 1PGL2 5J48A 4DEQA 1URXA 2YUEA 3JBG2 1OA2A 4YGBA 5F3EA 2A71A 3ES4A 1VAKA 1HRV3 5BNNA 5GJ6A 3UKTA 4AEDA 1PK6B 5FUIA 2J1EA 1PZ7A 1MS9A 3WF0A 2ZOEB 2ZHMA 3J7NA 2XQRA 1JYWA 1IS5A 4R4XA 4ASMB 4GB32 4K40A 2EXHA 2ZX1A 3BODA 1AUYA 3MBWA 4PQQA 5F37A 4COYA 4YVWA 2FZ2A 5KXEA 3C7HA 4IEZA 1WD4A 3WDTA 5JLVA 4ZU7A 4H2AA 5JI9A 2JDUA 2DCYA 3DXUA 5FYIA 3O1UA 5FMCA 2R6QA 1PGW1 2VNRA 3AKPA 3IAQA 1YFXA 3PJQA 3RQ0A 2P3KA 4YW1A 2RS11 1OMIA 2XJSA 4FOVA 1R64A 4MGSA 2JDKA 4D6QA 4Q0PA 3ZLIA 3W21A 2IFRA 1UAIA 2DU0A 4HG6B 3U10A 5L7OA 1RUH1 1AYM2 2JG9C 1WCDJ 4JZRA 1PHMA 3BIWE 4BHPA 5F5IA 3MFCA 5LEKA 3U4SA 1UMZA 3KV5A 4A7ZA 3TAYA 4AK3A 4YW5A 1E57A 5JXIA 2HWF1 3RWKX 1OLMA 3POIA 2E51A 2WA4A 3KM5A 3IWZA 3IZOA 1J59A 3H8XA 4LOTA 1YIPA 3VBOB 4A2UA 4CEWC 1XRUA 4Q0SA 5FY0A 1IHMA 1LHWA 4MLOA 4WM7A 4A44A 4WZCA 1C5IA 2BW8A 4E4DX 2PQQA 4R9AA 4JGZA 4QPWA 1L7RA 4TN7A 2CWMA 5FP4A 5FWJA 3S0MA 1TMF1 3GJBA 5A7SA 3EQEA 1OLRA 1Q8VA 1R1A1 1FOD3 1OKOA 2QFEA 4JKMA 1N3QA 4NIGA 3I3QA 1BEV3 4Q4V2 5FXVA 3BTZA 1F8VA 2E33A 1BBT3 1BQPA 5JSOA 1LJ7A 2N7GA 3BPZA 4YGDA 1VMHA 2H6CA 4IV1B 5J3UA 4B1LA 3OPWA 3VBRB 2JG8A 4I3PA 1SPPB 4MO3M 4NWWA 5FY9A 1H8TC 3WNPA 1RUD3 2ORZA 4D0QA 5T5PA 1XOYA 1NYWA 3N9NA 2GNBA 4ZZ8A 4LE3A 4W6YA 3R0RA 2VW2A 1WGPA 4XAAA 4XETA 4AE2A 1AR83 1XU1A 4CDQC 1R082 2AENA 2PLV1 3T0AA 1O4ZA 4AQSA 4LLOA 3AYAA 4CEYA 1JU3A 2F4PA 5CFDB 3ZKYA 5LA9A 3CL1A 1HXS2 1N3OA 1UOFA 1JZ7A 2D6KA 4CDUA 3QBQA 4GALA 1GWLA 1Y9MA 2J1RA 5FY7A 4LHNA 3KSCA 2AGSA 3T3YA 1RUF1 4BA6A 4RA0A 3RI8A 4DMIA 3RZHA 3ABZA 1XC6A 2PELA 2WNUA 3S5AA 3AP9A 1ZRCA 4YG0A 5L73A 4EV0A 4FAGA 1EPWA 3MYXA 2WSUA 3H3UA 1RUE1 1UKGA 2Q5TA 3ACFA 4ZY9A 2ERFA 2OUHA 1VBE3 4IEUA 3TEZA 1PK6A 1LOCA 3HT1A 1MEC3 2K0GA 2PHWA 2OKXA 4YSFA 2A7AA 4META 4B4RA 1V6IA 1AJKA 3R4DB 2XJPA 1PVC2 2R071 2B9UA 4WVVA 2WS93 3MLLA 2GC0A 4ZPIA 1JOPA 3UKNA 2VVDA 3KD4A 2W3JA 3ZFFC 3ASIA 4XMAA 1TNRA 4PHZA 5LRSA 2A1XA 2TEPA 4CTEA 4XZUG 4B4QA 4EJRA 4MGTA 4COVA 3QH7A 2PAEA 2G1MA 1PM4A 1JODA 2P4EA 4QGLA 1POV1 5FYVA 4Q4Y1 2DV9A 4O61A 3RYPA 2BTVC 4IL7A 1XNCA 4FFHA 4NVPA 4UBGA 1IS6A 1K5JA 3VBSC 5FZ9A 1AL22 4HN1A 4NIDA 5GLWA 1OH4A 2VZOA 2GZWA 5FKBA 5JXGA 2XOMA 4AAXA 4JTNA 4K8RB 1AR63 2HWE2 5E6HA 4QB2A 4N43B 3J7HA 4CPBD 5FY1A 1PO11 5D8AC 3O1VA 1HN0A 3VBOA 5C9AB 2ZHKA 1QWRA 2R49A 1B35C 1EUUA 4EROA 1DLCA 2EICA 4AHYA 4BQ1A 4QM9A 4XMIA 1K3IA 3GCXA 3AP6A 2AEZA 2WUHA 5FPVA 5LA0A 4INDA 1HV1A 4KWJA 3SXWA 3WF2A 3AKSA 2OZ6A 3I2IA 4MGQA 3U0ZA 1GWMA 2PA7A 3M1HA 4NHMA 1V6KA 3WVJA 1C8M2 5JR7B 1C28A 2YPDA 3MF6A 3FFQA 3O1SA 5A3WA 4XQDA 3OUJA 1CN1A 1XNBA 1FATA 3VBRA 1SPPA 2HLEA 4JRAA 5CZKA 1W6OB 2OQ7A 5DQ0A 4M3CB 4ASLA 4OHVA 1KQRA 1AF9A 2CGOA 3OF1A 2MPFA 1W9YA 4IERA 2W1QA 3B9IA 3ZVXA 1MS8A 2YBSA 2VG9A 2WDBA 2XVGA 3T1MA 2P6CA 2XLFA 5FZEA 2WT0A 4XIKA 2OZJA 3WD5A 2CDPA 1VBB1 4LJHA 2CDOA 3N9OA 1ULCA 1KD7A 1OLME 3B3QE 1G9DA 3PU3A 1OXCA 3K77A 5C6CA 2VQUA 5C8CB 2ZA9A 1PIV1 3J8F3 5CFDA 3OPZA 1NQDA 1U12A 4LO7A 1O59A 4BYYA 2W1SA 1GYKA 2BOJA 1RHI1 1UMIA 3AB0A 3BPSA 1O6UA 1OQEA 3OB8A 4JVAA 1UOBA 3ZR5A 3C7EA 5HI0A 3T08A 1WCQA 4OULA 1IKQA 3WX5A 5B4NA 1OQ1A 2B46X 3A4UA 4FPGA 3UGFA 3BYWA 2VTXJ 4FPYA 3OBTA 5HCBA 4MUVA 1AL0G 1LOGA 2PN5A 3BN6A 3LDRA 1ENXA 5K0UB 1FAYA 1ULFA 4QB6A 4ZONA 1DLLA 1YCIA 4X6RB 4QGNA 2Y64A 3QH6A 5C7GA 2XB6C 1I9RA 2DFBA 3LA3A 4IV3C 5D1IA 5KC5A 1HRV1 4DUXA 1DFQA 1HQNA 2BV4A 4JKKA 1M4WA 1STMA 4XOGA 5ACA2 1DF0A 4QKNA 3VZJA 1W0NA 2W0XA 4CP0A 4LT5A 5ABJA 2ZBJA 4YFZA 2ARCA 2MHFA 4CVUA 5BNOB 5DZFA 4B4PA 3UETA 4AVAA 2X10A 3CBNA 3IIAA 4P02B 2ID4A 3VBHB 3RJ2X 2Q30A 3Q8BA 3O1MA 4NPLA 3NMBA 2Y6GA 4IESA 2G9FA 4AVTA 5ANQA 2DBIA 4WVZA 4COUA 4OFGA 1VRH3 1ZBE2 4D6RA 4PIXA 2QTWB 4N43A 5FXWA 3FJSA 4C0BA 3FFZA 2I07B 4V1PA 5C9AA 4HVRA 2HJIA 1SLCA 2D97A 4KU7A 4TLFA 3VBUC 4B8EA 4Z2AA 5DMYA 2D3PA 2VNOA 1S0JA 3ZFEC 1SEFA 1WW6A 4DEVA 4C91A 1ONAA 3K4ZA 5EYYA 5FK8A 3M3EA 3AM2A 2BUKA 1TE1B 1Q5OA 2VD7A 2QZ2A 1G9CA 3B02A 4XJAA 3C8XA 4ES8A 5F39A 2W39A 3AZXA 2QCSB 5JXHA 4QXBA 2D5FA 4S2GA 4AZZA 2VZPA 4P9XA 3QACA 1FPN3 4XJUA 3SITA 4AHZA 1W03A 2NQYA 3NQHA 5BNOA 1H6YA 1W6OA 3ZIWA 1IQDC 4M3CA 1FOD1 1BVP1 2BVVA 4JHTA 4LA2A 4UW3A 1UZZA 1BEV1 2A6WA 5DAQA 1WMXA 4KG8A 1QHDA 1PO23 1V6OA 2PYTA 5FUPA 2ZX2A 1S0GA 3A7QA 3H3LA 3IIIA 1UF2C 4QDRA 1ZZ7A 3PL0A 4LBMA 4QWNA 4N8MA 1N1SA 4XDOA 2VUCA 1R093 2EA7A 3AVSA 5FZMA 5C8CA 1OSGA 3VKNA 3T1LA 5H9QA 4AI0A 4KWLA 5FUNA 3AXEA 1MS3A 5FXZA 4E9KA 5F9TA 1W6NB 3PIGA 2X5IB 1DQ5A 2XGXA 4B3NA 5JIUA 4PBPA 3WOGA 4LBQD 5CNAA 1VMFA 2ZGNA 1MZEA 3LSDA 5I0SA 2JD9A 4CUCA 3BGAA 5JSPA 2GH2A 3WG3A 4D69A 2YXSA 2ZZQA 4IEVA 2WQ8A 2Y26A 3S5QA 4DUWA 2X53S 3ST7A 2QJVA 1RUG2 1RYYA 4HPKB 5K0UA 1VE0A 3H1YA 1JS9A 5FLIA 1KS4A 4G4FA 4DXZA 2GN7A 4OI2A 4IGQA 4A6SA 4GH4B 3LEGA 1CAXB 1VBE1 5ERLA 3VB9A 1QXRA 4FT8A 2BU9A 3ZOIA 1PM7A 4QMAA 2QUOA 4YVSB 4YARA 3UNPA 1YWKA 3ELNA 1EUTA 4M01A 1G8WA 4C1WA 2XUEA 3H7JA 5H9PA 4CDXB 1S4CA 1QNWA 2C4XA 3NKTA 5HBAA 2WFF2 3VBHA 5GLZA 4BU2A 3WW1A 1GP4A 3KQ4B 1MQTC 5FYTA 5A1FA 3TN91 4DZGA 2VVFA 3HNBM 1RMU2 2Y6LA 3LWCA 3VBFB 3MIEA 1D4M3 1OFSA 2CL2A 5J1XA 3K48A 1GNZA 1CJPA 1GANA 2RS52 3GZAA 2J7MA 4P9YA 2J1VA 1SDWA 1J84A 1WKYA 3W58A 5IFTA 4GAZA 3PU8A 1YJLA 1N1TA 1AR61 3IT8A 1LCLA 4AAPA 2ZPXA 5F6LB 3LFIA 2EVXA 5BNPC 5FZCA 2RM22 2FHRA 4A7KA 1BCXA 5EJ3A 1K12A 4QHBA 3SMHA 1W9FA 2BDRA 4M4PA 4XCAA 5F1RA 3OGRA 4BQ4A 5C4WC 2QDNA 1W0PA 3EJKA 3F2ZA 2BZDA 4NAOA 5APAA 3PMEA 3PDQA 1PMJX 1LOFC 1S0FA 4E4ZA 4HANA 3WLUA 4BWOA 1W8TA 3J7LA 2PXJA 2YC0A 5FDBA 1WMFA 4QQOA 4LNVA 3DGTA 3VUOA 2PQSA 2RS12 3D4KA 5F7UA 4OI0A 3LFMA 1F15A 1C4RA 2BWCA 4BE3A 1JYIA 1IPJA 2XJUA 5CKNA 2V73A 2VZ1A 4HXCA 1D0HA 5T50A 1DGWX 2HWF2 1F9KA 2AEYA 2A3YA 4Q27A 5CKQA 1BMV2 2FCTA 3C7FA 1W6NA 2X5IA 3WINE 4W65A 5F5QA 1KDKA 3LOBA 3MLJA 4A7YA 3WNOA 3J8F1 3KT1A 4I0WB 3DXTA 4R52A 4P14A 2R32A 4K3UA 1VAVA 1TMF2 1H1MA 3I59B 1R1A2 4Y26A 2DBNA 3O0XA 1LODA 1JZ8A 2VL4A 4HPKA 3AZVA 4QHZA 4COWA 3MEPA 1GOGA 4M3CE 4K6BA 2ADDA 4GMP3 5JWPA 4AEJA 1YQ8A 2CU5A 1D7PM 1RJ7A 3GF6A 2WZEA 1V6NA 3H8UA 3HBZA 3MW2A 4GH4A 1CAXA 1LU2A 5A80A 4XFAA 4RQPB 3GZUC 4EYUA 3CNAA 4YVSA 2RHPA 2DWRA 2RDQA 4I0AA 3EYPA 1Z7S2 4MX3A 4FCAA 3KV9A 1N3PA 4QX8A 1K5MB 2FDIA 3GALA 1HB2A 2R043 3JUUA 4CDWC 4Y20A 4CDXA 4P9JA 4XXPA 1C8NA 5FIXA 4QQHA 3F95A 2R061 2VOKA 3B01A 4P9IA 4Q4X3 4YPJA 3FBMA 4IW3A 3RJRA 2P34A 4QPIB 4XHBA 1UX7A 3M70A 1PZ9A 1VBA3 1O5UA 1QJZA 5AC93 5GALA 3W59A 3RZJA 3VBFA 2C26A 1RUF2 4P9LA 3CZJA 4J25A 1PNFA 4CCMA 3U37A 3O7OA 1YLLA 4ARYA 4KWKA 1Y4WA 4AVBA 1O7FA 1RUE2 2G4IA 1VRH1 4QX5A 3JD72 2E7QA 2JX9A 4AWDA 3D82A 5KWRA 4DOUA 2AR6A 2JDHA 1MVQA 4PI0A 4CUAA 3OGSA 1KGYA 2R072 4FPOB 1RGSA 2JENA 1GWKA 1JYNA 3O1PA 3PUHA 4YW4A 1SLLA 2OYZA 1JYVA 1ND2B 1DBNA 3I2FA 1ZRDA 4UOJA 3ACGA 3LQCA 2R30A 3M3CA 2IXHA 1J3RA 2R0FA 5M0TA 3RMXA 4DRVA 1ZZ6A 5GZCA 1FPN1 2XBO3 2NP0A 5I0TA 3E1F1 1GOHA 2WLPA 1W8FA 3KT4A 3CF6E 4AOCA 3UJOA 3C7OA 1OKQA 4Q4W3 2IXJA 4QGMA 3AK0A 2OT7A 4WBBA 5A70A 2WO1A 2XL9A 2ZABA 5CFCC 1PO21 2Y8KA 2E7AA 2ZCWA 3PNAA 4XVHA 3PHMA 2Z4FA 2MEV3 1F35A 3D6EA 4GWJA 4UBHA 2L9LA 5LY1A 1CGPA 3LZZA 1ASJ2 1NQJA 4RS5C 3U1XA 5JCTA 3O1TA 4IUGA 3I2OA 4FAHA 1UIJA 1NLSA 2FDGA 3CJIB 4ORFA 4XUQA 5JI7A 2RS33 5E8AA 3A22A 4NN0A 3ILFA 1X8MA 1T6BX 1OURA 2VOXA 3TEWA 2HBTA 4KGGA 1AHSA 2PHXA 3CQOA 3IKWA 3MLKA 4HONA 4QX2A 4G3YC 3ZSMA 5A3TA 1GNHA 4JDOA 2P3IA 2VJXA 1VALA 3E6DA 3VZMA 4GMP0 5GLUA 4AR2A 2OIIA 3N7LA 1HX6A 4D7YA 5DG2A 5BNNB 1V9U3 2XHNA 5FOBB 4Z2WA 2R16A 5JDBA 1JZ3A 2DUOA 1A8DA 1CZVA 1XXNA 4NHLA 3OPTA 1NXD1 4EWDA 1IZ3A 3DUIA 1VBC3 4XDQA 1K5MA 4DY5A 4YRDA 4I09A 5KHHA 5A3UA 1UXZA 4W4ZA 1IOAA 5FPZA 1OBNA 4LKFA 1KEXA 1QQP1 1S2BA 1H9WA 2VAUA 3KMHA 1HJGA 2WT1A 3KVAA 4LULA 2AACA 2WZR1 1PIV2 1RUJ2 3ZKUA 3Q8CA 4K1ZA 4QPIA 3WNNA 4UW4A 4EN0A 4NPRA 3B5LB 1LEMA 1JU4A 1VPHA 2VW1A 1ND3C 1GFF2 4IE4A 4URTA 3ILRA 4Y1UA 5F32A 1FT9A 3T2QA 4CCDA 2YY1A 5A6QA 5L7OB 2CTVA 4YM1A 4I2OA 3M7AA 1FX5A 5T52A 1AR71 3NVCA 1FMD3 4XBNA 5LCWL 1D4M1 5FBJA 3WNMA 1RC6A 2JDPA 3D8CA 3KF3A 4KH9A 3FLRA 5FP3A 3UGGA 2VMGA 4Y4RA 3T2TA 2DCJA 2IXKA 3NKGA 4XDPA 1SG3A 3NAPB 3VD5A 2VNGA 3H0OA 4EE2A 1OFNA 1WBFA 1ND2A 1QJX3 1YQCA 2HWD2 2JKBA 3OBZA 4PF5A 5FXXA 3SKVA 1IG0A 2C6SA 1WBLA 2VOWA 3OY8B 2ZX0A 1AR91 4YZ4A 5FJKA 4H7MA 1UL9A 3M2MA 4CU9A 4HK9A 3ES1A 1H0BA 4L97A 5IVBA 3H8RA 3K3NA 4QQLA 1SACA 4YM0A 3DF0A 1QJU3 2KM2A 2WO3A 1IG3A 1EAH2 2JDMA 1LOEA 1FXZA 1SBEA 5FZFA 4KGQA 3S7IA 4RGKA 1RIRA 3SHRA 3I3MA 2VCCA 3PVOA 3LD8A 4PIZA 1G9AA 1DQ4A 5FZGA 4P9WA 2QNKA 1W90A 2GP3A 2VECA 4W50A 3AFGA 4JV4A 2OUJA 3FUOA 3CJIA 1UY2A 4CP1A 1AVBA 3FBYA 3E6CC 2QQUA 5J36A 2VZSA 4XJ8A 2D7FA 2ZHLA 1QJY2 1W05A 1O91A 1T6GC 5LBFA 1EPZA 1RTVA 4WM8C 2F4LA 5FP8A 3USSA 1FOD2 5IVVA 4HLTA 1UZYA 2SBAA 4K8FA 3AZWA 4P5YA 1RUI2 4AFDA 4HSLA 5FYCA 2E53A 1LECA 3AZYA 4Q0UA 4GMP1 5LB6A 1QKQA 5A3PA 4XQ4A 5FZOB 2VGDA 4JX0A 4IEWA 1F31A 2W1WA 2VUDA 4C8DA 5EJZB 1CWPA 1RUC3 3O12A 4YW2A 5LATA 3BIEA 1W3XA 5HCHA 1J83A 3H42B 4FFGA 1WA6X 5A3NA 3TNPB 2PHRA 1ZM1A 2BFUS 2GNMA 3BB6A 5JIAA 2CHHA 4BPZA 1C5HA 1H4GA 4XIOA 3NV3A 2VC9A 1QNYA 2A73B 3E5UA 4UYBA 4Q4X1 1QXJA 2WN2A 2JB4A 3BOWA 3DL3A 4BIFA 1HN1A 1P8JA 1UZWA 1H1IA 1GBGA 2RDNA 1OUSA 1VBA1 2JE8A 2WR9A 5FZKA 4E8DA 2JDYA 5AC91 3BUCA 1OH3A 2P1BA 4HOOA 5AVAA 1ZBA2 2CGNA 2JJ6A 5FV3A 2W1UA 1ZA7A 5GLTA 5FLHA 1LB2A 4BQ5A 4LBOA 2G9ZA 1GQHA 1E5IA 2ZGLA 3N35A 3KHCA 5EYXA 3MIGA 2B8MA 3I97A 4RHV3 4LO4B 3WP3A 1SFNA 1COV1 4EN7B 1OA3A 5FAXA 3Q8EA 3NAPA 5FCCA 5LY2A 1OPMA 1V6LA 4AXOA 5GLVA 1QOOA 5FYZA 5FOJB 3PVBB 3ON7A 1AYN1 1W9SA 3KLSA 3OY8A 4IV1C 3RS6A 1W8UA 2ZEZA 1YC61 2VBDA 2W5FA 4UXAA 5CVRA 3VBRC 2JG9B 1X36A 3ZMOA 5IVYA 3IBMA 2ATFA 4AGRA 1S1AA 4XABA 1MS5A 3OOXA 1HRI3 2RR11 5F2WA 3THPA 4CU6A 1CVNA 2VZVA 3TN92 2ZACA 4CCCA 4XF1A 3ZYBA 3OEBA 2XBO1 4IEYA 2YG0A 1J58A 1DCSA 2B9VA 3FHIB 2ZHNA 4CEWB 4E2SA 1RUNA 2ZMNA 1GU3A 4FVVA 4CXXA 4PLNA 2P37A 1V0AA 3JBG3 4Q4W1 5BNQA 3NSTA 1G9BA 2W68A 2W47A 3HJRA 2PHTA 3JZVA 4AEMA 1PX4A 4BH9A 1YIFA 2P5BA 1W39A 5T5JA 3ZPOA 2OA2A 1GMMA 1KRIA 1GP5A 1I6XA 4EN8B 4GKYA 4CP9B 4GB33 3W20A 5F3CA 2WNOA 4P00B 4IEPA 3HEIA 3O1OA 1L7LA 4SLIA 5A32B 3I2KA 1H8TB 3I2HA 1OOPC 1GQPA 4GJZA 4RN5A 2B42B 2QDRA 5B2GB 1UOGA 3VDDA 4CU8A 5H9RA 1Q8OA 1N1YA 2EAKA 4L9BA 3ZXDA 4EWAA 5A3MA 3RZZA 3KHBA 4F83A 3G6JB 4X8PA 4QU1A 4BB3A 2ZXQA 3POWA 4RGGA 4CDQB 3MUZ1 2JE7A 3CHXA 3KF5A 3GBGA 1FV2A 4MZUA 4GWIA 5FZOA 3UYJA 3VHOA 4BM8A 5I0RA 1AYM3 2YDEA 3BALA 1CX4A 2P6HA 4OMDA 1TME2 3LAGA 4BISA 1X9PA 1Y9GA 3AXDA 3OUIA 5ABJB 3WDXA 1VBC1 1V6MA 3QD6A 1PX3A 1WD3A 3ILNA 1W8NA 4V2VA 2Q1MA 4HFSA 1VBD2 2WQZC 4C1XA 1SLBA 4YWAA 3WSOA 4QPGC 3S7EA 1B09A 1XNKA 2RJKA 1M06G 5FK7A 1JI6A 4E27A 1IKPA 1NY71 3IDCB 3ZSLA 1CONA 1GQGA 2V72A 4BZ4A 1DYPA 1SHWB 1DYOA 5FZ7A 4LO8A 1R1ZA 1DQ2A 5C5TA 4Q4V3 3SCGA 4Z92B 1GV9A 5J96B 4NWVA 4FFFA 2VZRA 2E63A 2Q4SA 1ST8A 1W99A 2W52A 5EHDA 1IQAA 3PIJA 4FXGB 1FMD1 1K42A 3KGLA 3T09A 4W8JA 2HH9A 4LE4A 4XUPA 5BXXA 4D3WA 1WCUA 4D8MA 3ECQA 1WMDA 3HOBA 2WQ4A 3POJA 1C1LA 3ZFGB 1BJQA 3P6BA 4OI4A 4Y22B 3FLTA 1JBCA 2D5HA 2LROA 2UY8A 1R083 5IK4A 3LIHA 3ZYIB 3CKHA 4LMFA 2JG9A 3VBSB 1QJX1 2R062 4UF0B 3MO4A 3U11A 5JZGC 1HXS3 3POSA 2FCVA 5LRRA 4OUMA 2AUYA 3RDIA 2AC1A 4OHYA 4AHXA 2WIIB 5D8AB 4S2FA 4JHZA 1CIWA 1YJKA 2ZKLA 4AI9A 4M3CF 5E89A 1QJU1 4CEWA 1S55A 4D6SA 2XLGA 3WNKA 5FRAA 3NNMA 5JOWA 1I5ZA 3N9QA 2V5DA 4Y33A 2MNGA 1ACCA 4KNCA 5EXOA 3HMYA 2XLAA 4AI3A 5A1AA 5LWBA 2VUJA 4XF0A 5HV0A 1YYNA 4L2NA 2FQPA 1N1VA 2EXKA 1ZX5A 4CP9A 2XQXA 1T2XA 1PVC3 4XZPA 1QU0A 1ZZCA 4ITCA 5CAZA 2P3JA 5A32A 1H8TA 2RMU2 2VZTA 3INAA 4L0PA 1W2AX 1C3HA 1A8MA 2DUPA 4XYXA 2CAUA 5K4LA 3JB4C 2IC1A 2VCBA 5FZ0A 2BPA2 1GZWB 3A0NA 2WNVC 1WA4A 2Y6HA 5EV7A 4XBQA 3IAPA 4KBBA 3J4UH 4CDQA 1UZ0A 3ZIXA 1WUVA 1KFXL 2D98A 1O8SA 1XE7A 1JZ2A 3V0BB 1KS5A 3EBRA 4DO0A 1RITA 2IVJA 4W6WA 5LW9A 1AL23 4ISQA 2ZMKA 5IYYA 5IT6A 4XAEA 4AW7A 4XILA 4MHRA 2HWE3 2YB7A 1PO22 1W8ZA 4A3XA 5LZ6A 4PDWC 1RUC1 2ZGQA 2WBKA 1VB4A 3K3OA 4QQ2A 2RV9A 1EV12 2XH6A 1XB9A 3LKJA 4LK7A 2OW4A 4CCKA 1NZCA 2HEWF 4UI9L 1DZRA 2W2IA 1YUDA 4AEKA 4HZFA 1HLCA 1RVF2 1UXXX 1JHJA 1UU6A 2HYXA 1I1EA 1C8M3 5KHJA 3G7DA 4DS0A 3HBKA 3WUCA 2WC2A 4XCBA 5A7PA 1W9WA 2HYKA 5CB7A 3ZFFA 1UKRA 1YEWA 2DTWA 3I4IA 4TYSA 1XYNA 4YM3A 4CXYA 3VD9A 1I5PA 2WFPA 2DCZA 1W04A 3V56A 5FO7B 2DU1A 1GP6A 3ZSJA 1XYOA 4FOQA 3ZFGA 4Y22A 4ASKA 1QF3A 4AYUA 3M4FA 1OVPA 4QB1A 3VV1A 1NOVA 4GWNA 3ZYPA 1QQP2 1X50A 1CZSA 4IDZA 3APBA 3VBSA 3TWIA 2GC2A 2Z2SB 3MV11 2WWSA 2WZR2 4JAAA 4UF0A 3SH3A 2WWJA 4PQ9A 5A33B 1MZ5A 1U5XA 3ZPYA 1MS0A 1AX0A 5KR7A 2QVSB 1BBT1 5D8AA 1JYTA 1JUHA 1W6QB 1ALYA 1VLNA 3FMGA 2VTXA 3PUSA 4Y5SA 3VBUB 4NE9A 4XUNA 3RNSA 1RUD1 5FYHA 1HRI1 2XPJA 2WLQA 2DVAA 5DDJ3 3ZFEB 1UYPA 1AR72 3MIFA 2BRTA 4CCNA 3THDA 2C24A 4HKWA 4L11A 3AFKA 3NNLA 3NV1A 2A5ZA 2ZS6B 1NCRB 2XHKA 1AR81 1ZRRA 5FMOS 2YPJA 4O65A 2CWSA 3UK9A 4CUBA 3NJZA 4NIAA 1PGL1 1W8OA 2OPKA 3JBG1 4QKFA 4ZU4A 4R4ZA 2ZGSA 4ET7A 2K9ZA 3ZO0B 2D40A 2JXAA 2R1BA 3NWKA 1Z78A 4CCEA 5ACA3 3RYKA 2XXZA 2V4VA 2HWC2 2E9QA 2PHLA 3C7GA 1EP0A 1FV3A 2NN8A 1GZWA 3LDKA 1BK0A 4GB31 2P3YA 2H0VA 5EIYB 1LTEA 1AR92 1Z0HA 4DXRA 2VTFA 4N53C 4LIVA 4UWDA 2CNAA 4E2GA 4LBNA 5CKMA 5C3QA 1MZ6A 3V0BA 1S0EA 1UNBA 1GR3A 3O5SA 4GA9A 1OC1A 4HKLA 4Q0VA 4YVSC 3DCQA 3U75A 1JW6A 3GHMA 2DURA 1MEC1 2HWB2 3D0SA 3WF4A 4DNYA 5KBFA 1ZBE3 3B7MA 4HBNA 5FP7A 2WYSA 3MHZA 2QQKA 1QDCA 3TEYA 1AYM1 4MGIE 3H8OA 4LITA 1J3PA 3GM8A 3AMMA 4Y20B 2WS91 3ZN6A 3U4XA 4Y4YA 2I2SA 3TNQA 3N9MA 2IFWA 4MGYE 5FZ4A 3A21A 3GYDA 4H3WA 3RPQA 1CESA 1UU4A 3FLPA 2J1AA 3RZGA 4AFCA 2V4AA 1DGLA 2KA3A 4IQPA 4K1YA 1VIWB 1JZ4A 4HETA 1GZ9A 4GJYA 3VD4A 1VAMA 3MFAA 4DFSA 3KCXA 4IV3A 1ULOA 3DPRB 5GM0A 1UCXA 3AP7A 3K2OA 4W6XA 3WDWA 4YM2A 5LBCA 4I01A 2LM3A 5IK7A 2VO5A 5JOYA 1NE4A 2Y0OA 1HW5A 3WG1A 4Q4V1 1X82A 2X8KA 5IVJA 1JYXA 4I3GA 3HR9A 4OHWA 2NZ9A 2YFZA 1UY0A 4L92A 2O8OA 2YZ4A 5F6KA 1DZQA 1Y43B 3NJYA 5A7OA 4R9BA 3H3ZA 1BXHA 3OBAA 4Z82A 3RZMA 4YLZA 3H50A 3KCCA 2WZ8A 3MIBA 4LORA 1H2NA 1LKNA 1LHNA 1MACA 1ZZ9A 3CJXA 4GXLA 5FY8A 4CCOA 1S0CA 1MQTB 2EIDA 2B39A 1CPMA 1W0OA 1SCRA 2WO2A 5A33A 1PGW2 1CX1A 2FBEA 3SH5A 1R081 4PI2A 3UL2A 1RUOA 3OD4A 5FZAA 2YYOA 5IVCA 3PVEA 1W6QA 3BVCA 4YGCA 5GZGA 3LPGA 1SBFA 4BCUA 1HXS1 3VBUA 1RUH2 1QY4A 1DIWA 1TEIA 4JGYC 5DAWA 4NHKA 1Y9QA 5DAVA 5FY5A 3ZFEA 4DUVA 5AC92 5I8YA 3E5XA 1NA1B 1RUG3 3OGJA 3ZN4A 1D4VB 1NCRA 1UX6A 5C4WB 2O14A 5FZ3A 3AC0A 3CDZB 1NCQC 1FNYA 1COV2 4XFFA 2YU1A 1WCKA 5G04L 4ATEA 2J1TA 3CO2A 1HIXA 1JH5A 2W94A 3WQ7A 5D2AA 3I54A 1AYN2 3KV4A 4NRQA 1PVC1 1XE0A 1LGNA 1HQLA 3VDBA 3NV2A 3ZYGA 1DG6A 4XXAA 2LS6A 1NG0A 2WFF3 1UO9A 5FPBA 4LXLA 2Y60A 5C3OA 2QQPA 1W2TA 1GOFA 4LLFA 4RQPC 4YYOA 5FPXA 4X6QB 2RR12 1NLQA 4J1XA 4NAMA 4B1MA 5BUVA 1KDMA 4BJ0A 1RMU3 1SDDB 4P5HA 2R0HA 4KQ7A 4BQ3A 3K4AA 1ZNPA 2RS53 5IAXA 2ZAHA 1OQDA 1QGLA 4KL1A 3JXSA 4B7KA 5DUVA 2EIEA 2PLV2 1MZFA 4HVOA 1H2MA 2VMEA 3VD7A 4NHYA 5DZEA 4FPKA 1E5SA 5FTTC 3HNMA 4LR4A 4MVTA 5KC6A 3LA7A 3RRDA 2RM23 2A6XA 4SBVA 1APNA 3WHUA 5FQ0B 3DYPA 2VY0A 3IDBB 4BDVB 1IS3A 2Y38A 2WJSA 3DPRA 3E6BA 1EYBA 5FO9B 1W6MB 5HXMA 3FE5A 1CAWB 1CR7A 1LOBA 1U5YA 1ULDA 3HNYM 4TSVA 2A6VA 3ZXEA 3ZYJB 3ZYFA 2VZ3A 5FZ1A 4MH0E 2GMEA 3L9JT 1S2KA 4OUSA 4XBLA 1US2A 4QT6A 4QX1A 2K2SA 3R6SA 2A6ZA 4FOWA 5JOXA 3N4MA 1MQTA 1J1LA 3ZXGA 2HWF3 4PCRA 1BHGA 1GZCA 1H8VA 2QQOA 3AKRA 4IE0A 4OHZA 3KQRA 3BTAA 2ADEA 3ACIA 2JEMA 4ATFA 1CPNA 2YMZA 1SBDA 4Q0QA 4Q4Y2 5K7PA 3I2JA 2E26A 1OLQA 4IETA 3VLBB 3WY6A 4ZXKA 2RDRA 2E6VA 5FZ8A 2C9KA 2Q1ZB 3AMNA 1TMF3 4R9DA 2WO7A 1R1A3 5A6ZA 1G86A 2ENRA 1NA1A 2ORXA 3I3EA 5T3NA 3SISA 1GICA 1XE8A 3HVDA 1LAJA 4XTPA 4YFWA 1PO12 5J09A 5C4WA 5DDJ1 3NW4A 3AZZA 4RR3C 2XJTA 4XUTA 3WUDA 3V0AB 3WNXA 4BIOA 4DXTA 3N9PA 1LOFA 1OI6A 1R091 4UFHA 5IJRA 5IHRA 2JKXA 2H0BA 4P9GA 2B5HA 2YHJA 3ACLA 3H9AA 2CGPA 4RGAA 2D43A 1Z7S3 2XVKA 3C2UA 2XG3A 3JB8A 2EXIA 1UD1A 1OVSA 3O0VA 2VQAA 5BPXA 4K7JA 1UPSA 5ACA1 3I49A 5LBEA 1QJX2 2PTMA 1LHOA 3ZM8A 5FMBA 5SV8A 5BNNC 5A3LA 4HVQA 5KXCA 2YROA 4AEDC 3RG0A 5CFCB 5C33A 4YZ5A 4ONUA 2F17A 5F8PA 5LK5A 2DDUA 2YFUA 5CG8A 1RUF3 1XSQA 4Q5OA 3FHQA 4RS5B 4TLGA 1Q8PA 2TNFA 4YVWC 5GZFA 4CRQA 1VBB2 4N7UA 2LTNA 5F5CA 3RWNA 3ZYRA 1ENSA 2QBXA 5KHKA 1RUE3 3SQOA 2O8QA 3JD73 3LGRA 5C5UA 3HQUA 2FDHA 5I91A 4Q1PA 2YBKA 2BFUL 1RHI2 2NMNA 3DEMA 1SFYA 4LOSA 5L7OC 3WG4A 4BMEA 2EIGA 5FQ0A 3WW2A 2R073 4LTAA 1DZTA 1DDLA 5FYSA 1W6MA 4LEJA 4AFBA 1XSRA 3TEXA 5DUXA 4ZS2A 4NOTA 1JZ5A 3ZX7A 1CAWA 4XFCA 1NAEA 5JR2A 4BXSV 1ENQA 5FZBA 1YQ5A 1H2LA 3HWJA 3MDPA 2IVIB 3NJXA 1LOAA 4J6GA 1ZZBA 2DUQA 1TG7A 4JQTA 1XPWA 4LIUA 4CDWA 2ARBA 4HL0A 3FC0A 4XJ9A 1F4HA 4WM7C 5C3SA 1X8EA 2GSYA 2P17A 1VB2A 4XTMA 5KXBA 5DUUA 4OHXA 1HRV2 2NYYA 4JGZC 4HK8A 4MGZE 2CY6A 5CU1A 1BKZA 2Q8EA 3BI3A 1AXKA 3VHRA 3L2YA 1RINA 2IWGB 2LRPA 2QQNA 1F2NA 2VH9A 1CAVB 1GNYA 1US3A 4FQZA 4LHSA 4N9IA 4URAA 2ZGPA 3M3IA 4CCJA 3M3QA 1ND3B 3RZKA 4NIHA 4LA3A 3GZTB 2VOTA 2FDFA 1ASJ3 2JG8C 5A7QA 1UN1A 4Y3OA 2BWAA 3ETPA 4CSWA 2WL1A 4MSVA 1ULEA 3U14A 1WMEA 5A1LA 4QX7A 2JB8A 3GGLA 3UT0A 4BOWA 1RL3A 1JZ6A 1HB4A 4PLMA 3I3DA 2ZTNA 5LK7B 1KFUL 3PVNA 3ROUA 3UJQA 3B69A 4LBLA 3MF9A 1O4YA 3WW4A 2D6PA 2WNEA 2BNOA 5F3IA 1WW5A 3WW3A 4EN6B 5DABA 4CEYC 4Z8BA 1UY3A 4O9GA 3V0AA 4J1WA 1LGBA 5FP9A 4CP2A 3LEMA 3VKFC 4BMBA 4CDUC 1RUG1 2WINB 4QDSA 1NT0A 1TQ5A 4OMCA 3V64A 1JN2P 3RVHA 2DF7A 3TYJA 4U36A 4XFGA 2WNUC 1DGRA 5CYYA 4B7EA 5JMCA 1O3TA 2A3WA 3ZSKA 2AYHA 4FQ4A 3VZOA 2BBVA 1D0GA 1VMJA 1XNTA 4IEOA 1ULPA 4DXSA 3VDDB 4L8QA 1LHUA 1MS1A 1PIV3 1RUJ3 4EQVA 2X05A 2B7YA 1PK6C 4NUBA 1E5RA 1XNDA 2XKOA 1SQ4A 5C71A 5CFCA 3N36A 3GZEA 1BEV2 3GJAA 4FPLA 1UPIA 4XURA 5FPLA 1BBT2 3ZR6A 5CISA 2QQLA 3ZXLA 5ISLA 2FDJA 4XJZA 3TBDA 3POEA 5FZLA 3ZDVA 3LIGA 4RS5A 4A6OA 3WDVA 4QXKA 4NIIA 2CAVA 4Y1VA 3DV8A 1RUD2 2RG4A 4QXHA 2W87A 1O8PA 1U5ZA 3HAGA 1PMIA 1QIQA 1RMU1 2D3SA 5H9SA 4BLJA 1QMJA 3MW3A 4XFHA 2R041 1AR82 4YW3A 4IGOA 1UW8A 4UT5A 1O3RA 2BERA 4KG0A 3V65A 1OUXA 2Y33A 2VE1A 3NRUA 4WM8B 1AXYA 3USUB 3IDAA 2RM21 2HWD3 3VD3A 2XL7A 1QEXA 3T2PA 1OD5A 5FZIA 2D6MA 3WQBA 2I45A 2ZMLA 5GZDA 5FKCA 3VBOC 1W6PB 1JOBA 2JIGA 4BQWA 1BYHA 1POV0 3CIHA 3L2HA 2WWUA 3B93A 3OJBA 3WEZA 2UWCA 2SLIA 4NROA 1O4TA 2HKXA 2QQVA 1ODNA 1W06A 1EAH3 1UIKA 3EXUA 1VBE2 4CXWA 4A42A 2NPIA 1MEC2 1CAVA 4LKEA 4K20A 2BOIA 2UYBA 4Y1YA 1ND3A 3PMSA 2TUNA 3AL6A 3OG2A 2ETEA 3CZUA 1AJOA 2WS92 2GC3A 4NR1A 5E16A 2ES3A 1YFYA 4Q2FA 4Y1XA 3FN9A 4FP2A 5CIRA 1N47A 3ENRA 5CBLA 2BNMA 5LBBA 1RJ8A 3RMYA 1LEDA 2ZEXA 1BMV1 3KVBA 1JOJA 4CYDA 3S6PA 5IW0A 1HKDA 2W46A 3FUQA 3ZMNA 5BY5A 2XONA 4JQRA 1YQ2A 3WNLA 1QJY3 2Q8OA 3MV01 1CAUA 3VHPA 5CFDC 1PMHX 4FI9A 1AR62 1RUI3 3N7JA 2MEV1 3WZ1A 5L19A 1NX9A 2ET1A 4YG6A 4LBJA 5K9YA 4H55A 3IB3A 2BEOA 2DYCA 2Z5WA 4FPCA 2QKDA 2RS31 2W91A 4B29A 3FX3A 4I0BA 1Z7S1 3SCFA 4ZKTB 3BU7A 4GULA 4OCTA 3WV6A 1WW4A 4RYDA 5I0UA 1SLTA 3P1IA 4ZU5A 1MR5A 2Y34A 4UAPA 5CA6A 4QX0A 3DN7A 2OVUA 3D3AA 1UWWA 3LEKA 5DPNA 3POBA 5GZEA 3J9SA 2R1DA 1PGSA 2OXBA 1V9U1 3AVRA 3LA2A 3UV9A 5ABJC 1YNAA 1ZBA3 1FYUA 1YRZA 1W8HA 5FZHA 1V70A 4X8NA 2VNVA 5FPUA 1DQ1A 1WLWA 1CZTA 3GCWA 2IXLA 1OOPB 2VU9A 4XEZA 3WT3A 4BXFA 1NZIA 2W08A 3WR0A 2UURA 1SLIA 3LSEA 4YNIA 2W95A 3JD71 3J8F2 4WM8A 3UGHA 3USUA 2JE9A 5T55A 4F8AA 2D93A 2DCKA 1DQ6A 3RSJA 3OSDA 2OPWA 4BK5A 4CA9A 1ZYBA 4N43C 2KD7A 3MUY1 1DGRN 3ETQA 1ZZ8A 5C9AC 1W6PA 1ENRA 2WAOA 2VQ0A 1DHKB 2A3XA 4YZ1A 5FMDA 2J42A 1DP0A 5K8SA 4CU7A 4E2QA 3K4DA 3TB0A 1CIYA 1OHFA 1ZVFA 4NRPA 3ZFFB 4FOYA 5L9RA 4XF4A 1UMHA 5CADA 5HXVA 3TN93 1LNSA 4LUMA 5LA2A 1YO8A 3ZFGC 2Q1FA 4YG3A 4O9EA 5G05L 5AFBA 5IAVA 2YU2A 4MADA 4QPGB 3WP5A 1H1AA 4K21A 4CZSA 3MZHA 2A6YA 2W92A 5BNOC 1REDA 4Q8KA 1ODMA 2EF6A 5F5AA 1XYPA 4E4SA 3IN9A 3P3NA 4YGEA 2D6OX 2X09A 3ITQA 2VMDA 2BGCA 1CD3G 1ASJ1 2ZKNA 4TXWA 3DYOA 2WAAA 4AI8A 3H1WA 3AYCA 3WF3A 1B35B 4JDNA 2GAUA 1FI2A 4HN0A 3T4HB 4UFJA 5C8CC 4XJWA 4PF1A 1AZDA 4UW5A 3ZXFA 3ME2A 4IEQA 3WG2A 1VRH2 1YQ6A 1CQ9A 2V5YA 2WSVA 2JIJA 3HN3A 3OGVA 4OI1A 5HPOA 5FYYA 4IV1A 3MW4A 5FYBA 2NM1A 3WXPA 3DKWA 2VZUA 4R8HA 4QKBA 5FMOL 3HD8B 4EZ4A 1DQ0A 1TME3 3DECA 3OD0A 5AFEA 5JZGB 4KU8A 4GQ7A 2FD8A 2BNNA 1OF3A 4FPHA 1Q43A 1IGOA 1WZXA 4N7IA 4PIYA 4WVMB 2GH8A 4AVCA 5K0UC 1G9FA 4XACA 1C57A 1S2EA 1VBD3 3O14A 2BQPA 2VPVA 5EWSA 1E5HA 2OS2A 1UY4A 3VKOA 2PFWA 1WWYA 2WN3A 1FPN2 2JICA 3KV6A 4HKOA 4DINB 4DRRA 1RUJ1 1HDKA 2VBPA 3ALQA 3J7MA 3MPBA 5A7WB 5LEJA 1VP6A 3VZNA 1Q8SA 2JDZA 3H1MA 4PT6A 3URFA 3BOPA 1PVXA 3OYWB 1VRBA 3PLQA 3D0JA 3VDAA 1HV0A 2HEYF 2QZ3A 2BBAA 2YBPA 1KJLA 3QOPA 2R7EB 3TOJA 5L9VA 3BTYA 1PNGA 1L3JA 1XBFA 2ZJCA 4GZ9A 3UKVA 5DDJ2 3VBHC 2UU8A 3ZN6B 2P2KA 1OOPA 1X7NA 3SCHA 3Q9OA 4G9SB 5A3OA 1OA4A 2BGPA 1R092 2JD4A 1XJAA 2WNVB 3HPNA 2H6BA 1OF4A 2C1FA 2JWPA 3KCYA 2C5DA 2IXCA 4JTOA 3RFRA 1FNZA 1HB1A 1UYXA
chains in the Genus database with same CATH topology
2ORZA 4D0QA 3WNNA 2EIBA 3AC0A 3CDZB 1JU4A 4ZZ8A 3T2QA 3NJVA 5G04L 2J1TA 3T0AA 2W94A 3FHAA 5LCWL 1JU3A 3T0BA 2LW8A 3WNMA 3VDBA 1JZ7A 2DCJA 2LS6A 3W5NA 2J1RA 4A4AA 1GOFA 1SG3A 3ABZA 1XC6A 3VD5A 1NKGA 1OD3A 4BJ0A 1SDDB 3SKVA 5JUVA 3K4AA 4ZY9A 3ACFA 4MOAA 3JXSA 2EIEA 4CU9A 3VD7A 2VMEA 2OKXA 2YC4A 3HNMA 2WO3A 2W3JA 4LKSA 3DYPA 2VCCA 3T2OA 4XZUG 1UYYA 4A3ZA 4BDVB 3EB7A 1OT5A 2J1SA 3DYMA 5HXMA 1L7QA 3HNYM 5EJ1B 4W50A 2QQMA 3SKJE 2B4KA 1UY2A 2VZ3A 4MO3M 1OH4A 2VZOA 4QDQA 5JXGA 2XOMA 4AAXA 1US2A 4QX1A 1NUKA 2VZSA 4QB2A 3J7HA 4LPLA 4ARXA 3UESA 4AG4A 1EUUA 1DLCA 2EICA 1BHGA 2QQOA 1K3IA 4A45A 3ACIA 2WUHA 4P5YA 5LA0A 3WF2A 3I2IA 4MGQA 3I2JA 2E26A 4JX0A 5JMOA 2W1WA 5EJZB 2C9KA 1J83A 2QQJA 2ZEYA 2HLEA 5CZKA 5DQ0A 2ORXA 3I3EA 2VMFA 2W1QA 2WDBA 4XUTA 2VC9A 4DXTA 2VM9A 3K46A 5IHRA 2CDPA 5IJRA 3WF1A 2WN2A 2JKXA 2CDOA 1P8JA 1HN1A 4E8DA 2JE8A 3K77A 2RVAA 2W1UA 2VQUA 1O59A 2W1SA 1UMIA 3I97A 3OB8A 3ZM8A 3C7EA 3T08A 1WCQA 5B4NA 4OUEA 2DDUA 2YFUA 3FHQA 1W9SA 3I3BA 3BN6A 2ZEZA 4QB6A 2W5FA 2BGOA 2QBXA 2Y64A 5C7GA 3FL7A 4DUXA 4JKKA 4CU6A 2VZVA 4M4RA 1W0NA 3T0DA 3OEBA 2YG0A 1TVGA 4CVUA 2B9VA 3UETA 2X10A 1GU3A 1JZ5A 1UYZA 4P02B 2ID4A 4P08A 3SEEA 1NAEA 2E31A 4BXSV 5JR2A 2W47A 3HJRA 1PX4A 2Y6GA 3NJXA 1TG7A 1H6XA 1GMMA 1XPWA 1F4HA 4KMQA 3GXUA 4P00B 3HEIA 3I2KA 3I2HA 1GQPA 4RN5A 4CU8A 2QQNA 4LHSA 1US3A 1GNYA 3LEIA 5I0DA 4Z2AA 5DMYA 2Y6JA 4DEVA 2ZXQA 3K4ZA 2VOTA 4KWUA 4XUOA 3MUZ1 2J1UA 3ETPA 4GWIA 3C8XA 5JXHA 3GGLA 4OMDA 2RJ2A 2VZPA 1JZ6A 3I3DA 3NQHA 1H6YA 1IQDC 1MPXA 1PX3A 1W8NA 3WSOA 1UY3A 4A41A 3A7QA 1JI6A 3IIIA 4QDSA 4QDRA 4OMCA 2V72A 4QX3A 1SHWB 1DYOA 5B4XA 3THCA 5CYYA 4E8CA 2VR4A 2VZRA 1XNTA 5IFPA 1W99A 4OZOA 1ULPA 4DXSA 1K42A 3A23A 4W8JA 2X05A 3T09A 5C71A 4XUPA 1GUIA 4LQRA 2JD9A 4CUCA 4D8MA 4XURA 3BGAA 3ECQA 3HOBA 2QQLA 1F4AA 4TTGA 2WQ8A 3CMGA 2VQTA 3P6BA 4A6OA 4DUWA 1RYYA 2W87A 1O8PA 3CKHA 2E32A 3MO4A 3LEGA 2ZEWA 1UY1A 3UNPA 2BERA 4JHZA 1EUTA 1XNAA 3NRUA 3IDAA 3WNKA 3VD3A 2C4XA 5DN2A 3T2PA 2V5DA 5A1AA 3WQBA 3VDCA 3PUIA 3SEPA 1K45A 4OYUA 2VMCA 3HNBM 2Y6LA 2XQXA 3CIHA 3WEZA 1T2XA 2VCAA 5J1XA 2VZTA 4L0PA 4BK4A 2J7MA 2J1VA 4A42A 1J84A 3ACHA 1WKYA 5IFTA 2VCBA 2Y6HA 3IAPA 3OG2A 3CZUA 1UZ0A 4JKLA 3FN9A 1K12A 1O8SA 2W9XA 2QQIA 4M4PA 1JZ2A 3OGRA 2ZEXA 5JXJA 3F2ZA 2BZDA 5IYYA 1PMJX 2W46A 2XONA 2YB7A 1YQ2A 4ZXEA 3WNLA 2WABA 3LE0A 2WBKA 2PQSA 3MV01 5F7UA 3LPFA 1PMHX 2RV9A 4FI9A 4UI9L 1UXXX 1NX9A 1JHJA 2VZ1A 2HYXA 3IB3A 3C7FA 1W9WA 4KI5M 2W91A 4RYDA 3WNOA 2VZQA 3P1IA 3GDBA 3VD9A 4UAPA 1I5PA 4QX0A 3D3AA 1UWWA 3LEKA 3NNGA 5DPNA 2Y6KA 4QB1A 1JZ8A 2VL4A 1GOGA 1CZSA 3I2GA 4ZZ5A 3MV11 1D7PM 2WZEA 3W5MA 2JDAA 1CZTA 3EYPA 2YC2A 2J22A 2W95A 3K75B 4XUNA 5C70A 2DCKA 4BK5A 3THDA 2KD7A 4YPJA 3MUY1 1UX7A 2WAOA 3OEAA 4CUBA 1W8OA 1DP0A 4CU7A 3K4DA 4ET7A 1CIYA 2C26A 3CZJA 1W9TA 1UMHA 4QAWA 3U37A 1LNSA 2V4VA 5LA2A 5LA1A 4ARYA 5G05L 3C7GA 4MADA 5EIYB 4DXRA 2VTFA 2W92A 4CUAA 3OGSA 2X09A 1KGYA 2VMDA 1JYNA 3PUHA 1JYVA 3I2FA 4TXWA 3WF4A 4DEQA 3DYOA 3ACGA 3LQCA 4UOJA 2WAAA 2WYSA 2QQKA 3WF3A 3GM8A 5FUIA 2J1EA 3WF0A 1JYWA 4PF1A 3A21A 3E1F1 1GOHA 4PQQA 3MBWA 3HN3A 2J1AA 3OGVA 5HPOA 3C7HA 3C7OA 2VZUA 1JZ4A 2WO1A 3VD4A 2Y8KA 4XVHA 1ULOA 3DECA 2Z4FA 3IAQA 4GWJA 2L9LA 1OF3A 2VO5A 1R64A 4IUGA 4MGSA 4HG6B 4XUQA 1JYXA 3A22A 2YFZA 1UY0A 1UY4A 2WN3A 3OBAA 5JXIA 3CQOA 2WZ8A 4QX2A 4PT6A 2VJXA 2EIDA 3VDAA 2BBAA 2WO2A 2R7EB 4A44A 1CX1A 2XHNA 4GZ9A 1JZ3A 4QPWA 1L7RA 1CZVA 2BGPA 4JKMA 3LPGA 1UXZA 4W4ZA 3HPNA 2E33A 1OF4A 1KEXA 4DUVA 1UYXA 3WNPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ORZ A;  4D0Q A;  3WNN A;  2EIB A;  3AC0 A;  3CDZ B;  1JU4 A;  4ZZ8 A;  3T2Q A;  3NJV A;  5G04 L;  2J1T A;  3T0A A;  2W94 A;  3FHA A;  5LCW L;  1JU3 A;  3T0B A;  2LW8 A;  3WNM A;  3VDB A;  1JZ7 A;  2DCJ A;  2LS6 A;  3W5N A;  2J1R A;  4A4A A;  1GOF A;  1SG3 A;  3ABZ A;  1XC6 A;  3VD5 A;  1NKG A;  1OD3 A;  4BJ0 A;  1SDD B;  3SKV A;  5JUV A;  3K4A A;  4ZY9 A;  3ACF A;  4MOA A;  3JXS A;  2EIE A;  4CU9 A;  3VD7 A;  2VME A;  2OKX A;  2YC4 A;  3HNM A;  2WO3 A;  2W3J A;  4LKS A;  3DYP A;  2VCC A;  3T2O A;  4XZU G;  1UYY A;  4A3Z A;  4BDV B;  3EB7 A;  1OT5 A;  2J1S A;  3DYM A;  5HXM A;  1L7Q A;  3HNY M;  5EJ1 B;  4W50 A;  2QQM A;  3SKJ E;  2B4K A;  1UY2 A;  2VZ3 A;  4MO3 M;  1OH4 A;  2VZO A;  4QDQ A;  5JXG A;  2XOM A;  4AAX A;  1US2 A;  4QX1 A;  1NUK A;  2VZS A;  4QB2 A;  3J7H A;  4LPL A;  4ARX A;  3UES A;  4AG4 A;  1EUU A;  1DLC A;  2EIC A;  1BHG A;  2QQO A;  1K3I A;  4A45 A;  3ACI A;  2WUH A;  4P5Y A;  5LA0 A;  3WF2 A;  3I2I A;  4MGQ A;  3I2J A;  2E26 A;  4JX0 A;  5JMO A;  2W1W A;  5EJZ B;  2C9K A;  1J83 A;  2QQJ A;  2ZEY A;  2HLE A;  5CZK A;  5DQ0 A;  2ORX A;  3I3E A;  2VMF A;  2W1Q A;  2WDB A;  4XUT A;  2VC9 A;  4DXT A;  2VM9 A;  3K46 A;  5IHR A;  2CDP A;  5IJR A;  3WF1 A;  2WN2 A;  2JKX A;  2CDO A;  1P8J A;  1HN1 A;  4E8D A;  2JE8 A;  3K77 A;  2RVA A;  2W1U A;  2VQU A;  1O59 A;  2W1S A;  1UMI A;  3I97 A;  3OB8 A;  3ZM8 A;  3C7E A;  3T08 A;  1WCQ A;  5B4N A;  4OUE A;  2DDU A;  2YFU A;  3FHQ A;  1W9S A;  3I3B A;  3BN6 A;  2ZEZ A;  4QB6 A;  2W5F A;  2BGO A;  2QBX A;  2Y64 A;  5C7G A;  3FL7 A;  4DUX A;  4JKK A;  4CU6 A;  2VZV A;  4M4R A;  1W0N A;  3T0D A;  3OEB A;  2YG0 A;  1TVG A;  4CVU A;  2B9V A;  3UET A;  2X10 A;  1GU3 A;  1JZ5 A;  1UYZ A;  4P02 B;  2ID4 A;  4P08 A;  3SEE A;  1NAE A;  2E31 A;  4BXS V;  5JR2 A;  2W47 A;  3HJR A;  1PX4 A;  2Y6G A;  3NJX A;  1TG7 A;  1H6X A;  1GMM A;  1XPW A;  1F4H A;  4KMQ A;  3GXU A;  4P00 B;  3HEI A;  3I2K A;  3I2H A;  1GQP A;  4RN5 A;  4CU8 A;  2QQN A;  4LHS A;  1US3 A;  1GNY A;  3LEI A;  5I0D A;  4Z2A A;  5DMY A;  2Y6J A;  4DEV A;  2ZXQ A;  3K4Z A;  2VOT A;  4KWU A;  4XUO A;  3MUZ 1;  2J1U A;  3ETP A;  4GWI A;  3C8X A;  5JXH A;  3GGL A;  4OMD A;  2RJ2 A;  2VZP A;  1JZ6 A;  3I3D A;  3NQH A;  1H6Y A;  1IQD C;  1MPX A;  1PX3 A;  1W8N A;  3WSO A;  1UY3 A;  4A41 A;  3A7Q A;  1JI6 A;  3III A;  4QDS A;  4QDR A;  4OMC A;  2V72 A;  4QX3 A;  1SHW B;  1DYO A;  5B4X A;  3THC A;  5CYY A;  4E8C A;  2VR4 A;  2VZR A;  1XNT A;  5IFP A;  1W99 A;  4OZO A;  1ULP A;  4DXS A;  1K42 A;  3A23 A;  4W8J A;  2X05 A;  3T09 A;  5C71 A;  4XUP A;  1GUI A;  4LQR A;  2JD9 A;  4CUC A;  4D8M A;  4XUR A;  3BGA A;  3ECQ A;  3HOB A;  2QQL A;  1F4A A;  4TTG A;  2WQ8 A;  3CMG A;  2VQT A;  3P6B A;  4A6O A;  4DUW A;  1RYY A;  2W87 A;  1O8P A;  3CKH A;  2E32 A;  3MO4 A;  3LEG A;  2ZEW A;  1UY1 A;  3UNP A;  2BER A;  4JHZ A;  1EUT A;  1XNA A;  3NRU A;  3IDA A;  3WNK A;  3VD3 A;  2C4X A;  5DN2 A;  3T2P A;  2V5D A;  5A1A A;  3WQB A;  3VDC A;  3PUI A;  3SEP A;  1K45 A;  4OYU A;  2VMC A;  3HNB M;  2Y6L A;  2XQX A;  3CIH A;  3WEZ A;  1T2X A;  2VCA A;  5J1X A;  2VZT A;  4L0P A;  4BK4 A;  2J7M A;  2J1V A;  4A42 A;  1J84 A;  3ACH A;  1WKY A;  5IFT A;  2VCB A;  2Y6H A;  3IAP A;  3OG2 A;  3CZU A;  1UZ0 A;  4JKL A;  3FN9 A;  1K12 A;  1O8S A;  2W9X A;  2QQI A;  4M4P A;  1JZ2 A;  3OGR A;  2ZEX A;  5JXJ A;  3F2Z A;  2BZD A;  5IYY A;  1PMJ X;  2W46 A;  2XON A;  2YB7 A;  1YQ2 A;  4ZXE A;  3WNL A;  2WAB A;  3LE0 A;  2WBK A;  2PQS A;  3MV0 1;  5F7U A;  3LPF A;  1PMH X;  2RV9 A;  4FI9 A;  4UI9 L;  1UXX X;  1NX9 A;  1JHJ A;  2VZ1 A;  2HYX A;  3IB3 A;  3C7F A;  1W9W A;  4KI5 M;  2W91 A;  4RYD A;  3WNO A;  2VZQ A;  3P1I A;  3GDB A;  3VD9 A;  4UAP A;  1I5P A;  4QX0 A;  3D3A A;  1UWW A;  3LEK A;  3NNG A;  5DPN A;  2Y6K A;  4QB1 A;  1JZ8 A;  2VL4 A;  1GOG A;  1CZS A;  3I2G A;  4ZZ5 A;  3MV1 1;  1D7P M;  2WZE A;  3W5M A;  2JDA A;  1CZT A;  3EYP A;  2YC2 A;  2J22 A;  2W95 A;  3K75 B;  4XUN A;  5C70 A;  2DCK A;  4BK5 A;  3THD A;  2KD7 A;  4YPJ A;  3MUY 1;  1UX7 A;  2WAO A;  3OEA A;  4CUB A;  1W8O A;  1DP0 A;  4CU7 A;  3K4D A;  4ET7 A;  1CIY A;  2C26 A;  3CZJ A;  1W9T A;  1UMH A;  4QAW A;  3U37 A;  1LNS A;  2V4V A;  5LA2 A;  5LA1 A;  4ARY A;  5G05 L;  3C7G A;  4MAD A;  5EIY B;  4DXR A;  2VTF A;  2W92 A;  4CUA A;  3OGS A;  2X09 A;  1KGY A;  2VMD A;  1JYN A;  3PUH A;  1JYV A;  3I2F A;  4TXW A;  3WF4 A;  4DEQ A;  3DYO A;  3ACG A;  3LQC A;  4UOJ A;  2WAA A;  2WYS A;  2QQK A;  3WF3 A;  3GM8 A;  5FUI A;  2J1E A;  3WF0 A;  1JYW A;  4PF1 A;  3A21 A;  3E1F 1;  1GOH A;  4PQQ A;  3MBW A;  3HN3 A;  2J1A A;  3OGV A;  5HPO A;  3C7H A;  3C7O A;  2VZU A;  1JZ4 A;  2WO1 A;  3VD4 A;  2Y8K A;  4XVH A;  1ULO A;  3DEC A;  2Z4F A;  3IAQ A;  4GWJ A;  2L9L A;  1OF3 A;  2VO5 A;  1R64 A;  4IUG A;  4MGS A;  4HG6 B;  4XUQ A;  1JYX A;  3A22 A;  2YFZ A;  1UY0 A;  1UY4 A;  2WN3 A;  3OBA A;  5JXI A;  3CQO A;  2WZ8 A;  4QX2 A;  4PT6 A;  2VJX A;  2EID A;  3VDA A;  2BBA A;  2WO2 A;  2R7E B;  4A44 A;  1CX1 A;  2XHN A;  4GZ9 A;  1JZ3 A;  4QPW A;  1L7R A;  1CZV A;  2BGP A;  4JKM A;  3LPG A;  1UXZ A;  4W4Z A;  3HPN A;  2E33 A;  1OF4 A;  1KEX A;  4DUV A;  1UYX A;  3WNP A; 
#chains in the Genus database with same CATH topology
 3ZXA C;  4FFI A;  3J26 N;  4IV3 B;  1LES A;  4FTE A;  1G6N A;  2HWD 1;  2EIB A;  2R06 3;  4D7T A;  1F5J A;  2C9A A;  2XR4 A;  4LO6 B;  3CEW A;  4LK6 A;  5C8W A;  3NJV A;  4AL9 A;  2BJS A;  1WLT A;  5FLJ A;  1Y7B A;  3FHA A;  4PDW B;  4XHX A;  4RHV 1;  3T0B A;  2LW8 A;  4PJY A;  4QPY A;  1DU3 D;  1REF A;  4GD4 A;  4QPG A;  5SV5 A;  3AP4 A;  2PAM A;  1EAH 1;  1TZO A;  1QOS A;  3AL5 A;  3W5N A;  2GND A;  4ZS3 A;  1KXG A;  4A4A A;  2ZGU A;  3AKT A;  1W2U A;  4M00 A;  2D6N A;  5IK5 A;  2XJV A;  5CEH A;  1VR3 A;  1O3S A;  1NKG A;  1OD3 A;  5JUV A;  2ARX A;  1S0D A;  4FO9 A;  3M8L A;  4S2H A;  4QXC A;  3VKL A;  3AYD A;  3QLQ A;  4HMZ A;  4MOA A;  1B35 A;  2B45 X;  2RMU 3;  1JTZ X;  3U07 A;  2A70 A;  2YC4 A;  3D5O A;  4NPM A;  5FFO C;  1NCR C;  1D4M 2;  2GAL A;  1C1F A;  2DVB A;  2X5I C;  5ANN A;  1QJY 1;  2GMP A;  3OTF A;  3NL1 A;  1H9P A;  3POF A;  4LKS A;  5FZ6 A;  2G9G A;  3T2O A;  1UYY A;  1Q8Q A;  1AXZ A;  3EO6 A;  5J98 B;  4HSJ A;  1DYK A;  4A3Z A;  4TWT A;  3E5Q A;  3EB7 A;  1RUI 1;  1OPO A;  1OT5 A;  2J1S A;  2O0O A;  3SLI A;  5JZG A;  3DYM A;  1H4H A;  4QU2 A;  3WHT A;  2HEV F;  5JOZ A;  1L7Q A;  5EJ1 B;  4WVM A;  3O1R A;  2QQM A;  3SKJ E;  3AJZ A;  2VCM A;  3I8T A;  3EMR A;  2B4K A;  5L9B A;  4AGG A;  5EPA A;  1ZRI A;  2VW0 A;  5I8T A;  4QDQ A;  2ZZJ A;  3MGU A;  4RFT 0;  3E97 A;  3POG A;  2Z79 A;  4GH4 C;  1EV1 3;  1V00 A;  1NUK A;  5A7W A;  3ZN5 A;  1F5F A;  3IMM A;  5DZG A;  1A34 A;  5DG1 A;  4LPL A;  3PUA A;  1LR5 A;  2DVF A;  2ZGK A;  3OBR A;  3R4U A;  2ZGO A;  4MXW B;  1REE A;  5FYU A;  3UES A;  4AG4 A;  1RVF 3;  3OYW A;  4ARX A;  4FXK B;  1WLC A;  1JUI A;  5FRE A;  3ZYH A;  2EAA A;  5DXD A;  4Q26 A;  3WP4 A;  4CDX C;  3H7Y A;  4LHL A;  4A45 A;  3PUR A;  3CU7 A;  1QH7 A;  2HBU A;  4WZF A;  5EFU A;  2DTY A;  3VL9 A;  1ZBA 1;  5DUW A;  4NO4 A;  5JMO A;  4NHX A;  5J37 A;  2VUA A;  1SCS A;  2WNV A;  4RD7 A;  1LGC A;  4OQ8 A;  3KB5 A;  2QQJ A;  3VBF C;  4DY3 A;  1YFW A;  2ZEY A;  4N53 B;  4PLO A;  4XF3 A;  5F2S A;  3DPR C;  2I74 A;  3IPV B;  5FZD A;  5JVV A;  5EQU A;  4DB5 A;  1QQP 3;  2VMF A;  2XDV A;  2EAL A;  2FMY A;  2WZR 3;  2VM9 A;  3PJY A;  1HJF A;  1UQX A;  1UZV A;  3K46 A;  5IVE A;  5KHG A;  3BTX A;  3WF1 A;  1WW7 A;  2G19 A;  2WKK A;  2WZP P;  4PDW A;  3WCS A;  1W8W A;  3MIH A;  4JDM A;  1ZRE A;  1HQW A;  2RVA A;  2VXJ A;  2XKP A;  4QD2 A;  4XE9 A;  4AVV A;  1O5L A;  4IE6 A;  4S2D A;  1RXG A;  1AR7 3;  4FP3 A;  4EWE A;  1IS4 A;  1XQN A;  4WV8 A;  5JAX A;  5D21 A;  1JYC A;  2KR2 A;  2PHF A;  4OLL A;  2DVD A;  1SZB A;  2R04 2;  5KHI A;  5FWE A;  4GWM A;  3U78 A;  4KBZ A;  3SC7 X;  4OUE A;  4LBK A;  4YW6 A;  4AVS A;  5JPM B;  2YV8 A;  4U2A A;  5A7N A;  3T4V A;  2WA3 A;  4IE7 A;  3I3B A;  2DVG A;  4I30 A;  4Q4X 2;  1V6J A;  2HWC 3;  3NV4 A;  3LB9 A;  4UFM A;  4JRL A;  1NA1 C;  2IXI A;  1VBA 2;  3VZK A;  1JMU B;  2BGO A;  2WRA A;  2E7T A;  5BNP B;  3FL7 A;  4FBF A;  1AR9 3;  2NMO A;  2PHU A;  3IM0 A;  3NNJ A;  3VKM A;  3WCR A;  3ZXJ A;  3HN1 A;  2XWJ B;  3HQR A;  4M4R A;  3SH4 A;  2FCU A;  3WQ0 A;  2PMW B;  3PUQ A;  3T0D A;  3AMP A;  4AFA A;  1POQ A;  1TVG A;  4YZ3 A;  1BZW A;  3WP6 A;  3LCP A;  4TZD A;  3PTR B;  4DPN A;  4H7L A;  3IMN A;  2HWB 3;  1UYZ A;  2NLR A;  3ZSE A;  4P08 A;  3A0K A;  3SEE A;  3BCW A;  2E31 A;  3JCI A;  2CYF A;  4ISR A;  2CV6 A;  2PAK A;  5C3R A;  3M3O A;  2VUL A;  3N7K A;  3VN4 A;  3JQX A;  4EZH A;  1AX2 A;  1TME 1;  4MHU A;  5IAT A;  1H6X A;  3PTY A;  4RSU A;  5C3P A;  4JGY B;  5DAP A;  4KMQ A;  3GXU A;  2ARE A;  2GP5 A;  4EN9 B;  2Q0A A;  1S0I A;  4N90 A;  4OQ9 A;  5HCA A;  3CLP A;  4MXW A;  5DAX A;  3BU0 A;  1VBD 1;  1LRH A;  3KT7 A;  3RGB A;  2KXL A;  5BYN A;  1K5M C;  1WCS A;  2VOV A;  4QM8 A;  1SMV A;  3LEI A;  4CE8 A;  2WYF A;  4JC1 A;  2UWA A;  2XBO 2;  1NCQ B;  5I0D A;  5JPN B;  2Y6J A;  4D7S A;  2GN3 A;  1AL2 1;  1IPK A;  2UYA A;  4KWU A;  3MPP G;  4OZX A;  4XUO A;  4BQY A;  3AJY A;  4Q4W 2;  5CG9 A;  2FZ1 A;  2J1U A;  3MID A;  1JXN A;  4QPI C;  3OGG A;  1S0B A;  2HWE 1;  4Y24 A;  4RL7 A;  3JU9 A;  2ILM A;  2IZW A;  4V2W A;  4FTS A;  4FPE A;  2RJ2 A;  2Z69 A;  4D94 A;  2MEV 2;  4N53 A;  4MG2 A;  4HT1 T;  1AX1 A;  3IPV A;  3O0W A;  3AMH A;  2GU9 A;  4BLI A;  4MV2 A;  1MPX A;  3N9L A;  3NNF A;  4JCK A;  5TSW A;  4M0N A;  4FPF A;  2RS3 2;  5FBZ A;  3ATG A;  2DCT A;  5A6X A;  4A41 A;  1BK1 A;  4F7Z A;  4MXV A;  1YI9 A;  4CPB A;  3GBF A;  1YHF A;  1C8M 1;  4XC9 A;  4YZ2 A;  2OX0 A;  2RS1 3;  2VVE A;  2JDN A;  4LHK A;  4QX3 A;  4Z07 A;  5B4X A;  3WDU A;  4CDW B;  4DIQ A;  3THC A;  1DGW A;  4H14 A;  4AI1 A;  2C0Z A;  2X29 A;  3QCW A;  3VGI A;  4E8C A;  1RUH 3;  1UOJ A;  4XFI A;  5T5L A;  2YGM A;  4K9S A;  1ND2 C;  2VR4 A;  1V9U 2;  4ZHN A;  3OUH A;  3DKQ A;  4GIQ A;  5IFP A;  2Z42 A;  3POY A;  3Q8F A;  4OZO A;  2Q8D A;  2TBV A;  1GKB A;  3KS7 A;  3A23 A;  2Q8C A;  3W9A A;  1VBC 2;  4QHO A;  1GUI A;  2FMD A;  4LQR A;  5I93 A;  1LEN A;  2OQ6 A;  1COV 3;  1F4A A;  4I02 A;  4IXL A;  4XQW A;  4TTG A;  3CMG A;  2VQT A;  4FPJ A;  3WDY A;  4E4H A;  1X9T A;  5J7M A;  2D6L X;  1NY7 2;  4O7X A;  1ZRF A;  5EZW A;  2DFC A;  1WLD A;  5BNP A;  1AYN 3;  1H30 A;  3VHN A;  4AQT A;  2E32 A;  3N3H A;  4CUG A;  3SNM A;  1D2Q A;  4CCL A;  1QOT A;  1X33 A;  2RMU 1;  4Y5T A;  2ZEW A;  2BVB A;  1UY1 A;  5T54 A;  5LAS A;  4AQ6 A;  1FMD 2;  3B00 A;  1XNA A;  3CJI C;  3S30 A;  3RI9 A;  2RR1 3;  3S57 A;  2RJL A;  4AHW A;  3KWV A;  4AI2 A;  5DN2 A;  3HIF A;  3GHN A;  3AKQ A;  5IWF A;  4LBQ B;  1YFU A;  5FJH A;  3R4S A;  4UFI A;  2XUM A;  3VDC A;  5A6Y A;  2ZAA A;  2LAL A;  2QQW A;  2PLV 3;  3PUI A;  2FDK A;  3SEP A;  1JHN A;  1K45 A;  4NJ4 A;  4OYU A;  2VMC A;  4Q8L A;  4JGY A;  4QKD A;  2JEC A;  2O1Q A;  1UU5 A;  2VCA A;  5T5O A;  4Z1V A;  1O3Q A;  3BKZ A;  3KGZ A;  5GKA C;  4NMI A;  4BK4 A;  2XVL A;  1H2K A;  1W2N A;  3ACH A;  4Q1R A;  4XPV A;  1KJR A;  4M0H A;  1NCQ A;  2EXJ A;  1EV1 1;  4RR3 B;  1LUL A;  3MI8 A;  1A3K A;  1QJU 2;  1Y3T A;  2AZ5 A;  2F6B A;  2Y0I A;  3N7M A;  1BLZ A;  1D2S A;  4JKL A;  5HV4 A;  1HB3 A;  1RVF 1;  2W9X A;  3HQX A;  2PHD A;  2QQI A;  3I59 A;  4LO5 B;  4F3J A;  2D3R A;  1ZBE 1;  2ZGR A;  4R9C A;  4WVW A;  4BQ2 A;  5JXJ A;  3GBW A;  3P5B A;  1MVE A;  3RYR A;  4Y1Z A;  1PZ8 A;  1SFP A;  2BYV E;  4XF9 A;  3B94 A;  3K51 A;  4RFR B;  2ZX4 A;  3P3P A;  1KIT A;  5EP9 A;  4ZXE A;  4RQP A;  4AED B;  2XJQ A;  5E1R A;  3ZDS A;  2WAB A;  3LE0 A;  1LU1 A;  2VMI A;  4XFB A;  2QE3 A;  2CSG A;  3LPF A;  4PBO A;  3I2D A;  2VMH A;  5AVP A;  4Q29 A;  2LUW A;  2GDF A;  3B9C A;  1W3V A;  4YVW B;  4QQP A;  5HCF A;  3R05 A;  1POV 3;  2XML A;  4Q4Y 3;  3JQW A;  1J1T A;  1RXF A;  2RE9 A;  3LDB A;  3NAP C;  4MGK E;  1VJ2 A;  2UWB A;  2V09 A;  5L36 A;  1GLH A;  1W28 A;  4C90 A;  4UW6 A;  3RZL A;  4KI5 M;  2ZGM A;  2Y6F A;  3AP5 A;  4IEX A;  2ZGT A;  3WQ1 A;  1EY2 A;  1GZT A;  4LKD A;  1QDO A;  5FPA A;  3VL8 A;  2VZQ A;  4COZ A;  1PO1 3;  3GDB A;  1RB8 G;  2XJR A;  4FSJ A;  1RUC 2;  1J3Q A;  1I3H A;  4DQA A;  2GNT A;  2GMM A;  1U0A A;  3NNG A;  4GKX A;  2ET7 A;  2Y6K A;  2AH2 A;  5E88 A;  3X29 B;  2WT2 A;  5IVF A;  2VBB A;  3AYE A;  3I2G A;  4YW7 A;  1YXW A;  4ZZ5 A;  1ULG A;  3AX4 A;  5IUQ A;  4AQ2 A;  5JSR A;  4AF9 A;  4WM7 B;  1QJF A;  1QXP A;  4N9H A;  2BP6 A;  4Y5Z 0;  1W2O A;  2HWC 1;  1A6C A;  1TNF A;  2JDA A;  3W5M A;  2A75 A;  4JGZ B;  3ORJ A;  1Q56 A;  3VZL A;  4ES9 A;  1A78 A;  2ZX3 A;  1QJE A;  1CAU B;  1LHV A;  2UY9 A;  3ZXK A;  3I7D A;  2YC2 A;  3FZ3 A;  2J22 A;  4FTB A;  3K75 B;  5C70 A;  1YI7 A;  4NRM A;  1GSL A;  3TRS B;  1BVV A;  5KXD A;  4MYE A;  1G7Y A;  4UFL A;  5I8S A;  4LBQ A;  2JG8 B;  3GNE A;  1IPS A;  1ZA4 A;  4IGP A;  4RHV 2;  1NXM A;  1VBB 3;  1CJD A;  4UFK A;  2VXR A;  3IDE A;  3Q8A A;  3VDD C;  1U5I A;  2D44 A;  1MS4 A;  2RDS A;  3OEA A;  2HWB 1;  3C3V A;  3LOI A;  4L99 A;  2K46 A;  3FWE A;  5FYM A;  3T30 A;  1Q3E A;  1W9T A;  5FR3 A;  4IE5 A;  2ARA A;  4QAW A;  1RHI 3;  5LA1 A;  2YGL A;  5FY4 A;  3NO8 A;  2WFF 1;  4CEY B;  4RR3 A;  3HT2 A;  1SLA A;  1NE6 A;  3EHK A;  4C0H A;  5FO8 B;  1NLR A;  1XU2 A;  3THT A;  1HRI 2;  4CDU B;  3AMQ A;  2GC1 A;  1QH6 A;  4AFM A;  4AGV A;  2IUW A;  4BQX A;  3KZ4 C;  3MIC A;  4LUK A;  5IK8 A;  3LF7 A;  2WNU B;  2XWB B;  3OCP A;  4OVE A;  4XW3 A;  5BV6 A;  2RS5 1;  5F3G A;  1PGL 2;  5J48 A;  4DEQ A;  1URX A;  2YUE A;  3JBG 2;  1OA2 A;  4YGB A;  5F3E A;  2A71 A;  3ES4 A;  1VAK A;  1HRV 3;  5BNN A;  5GJ6 A;  3UKT A;  4AED A;  1PK6 B;  5FUI A;  2J1E A;  1PZ7 A;  1MS9 A;  3WF0 A;  2ZOE B;  2ZHM A;  3J7N A;  2XQR A;  1JYW A;  1IS5 A;  4R4X A;  4ASM B;  4GB3 2;  4K40 A;  2EXH A;  2ZX1 A;  3BOD A;  1AUY A;  3MBW A;  4PQQ A;  5F37 A;  4COY A;  4YVW A;  2FZ2 A;  5KXE A;  3C7H A;  4IEZ A;  1WD4 A;  3WDT A;  5JLV A;  4ZU7 A;  4H2A A;  5JI9 A;  2JDU A;  2DCY A;  3DXU A;  5FYI A;  3O1U A;  5FMC A;  2R6Q A;  1PGW 1;  2VNR A;  3AKP A;  3IAQ A;  1YFX A;  3PJQ A;  3RQ0 A;  2P3K A;  4YW1 A;  2RS1 1;  1OMI A;  2XJS A;  4FOV A;  1R64 A;  4MGS A;  2JDK A;  4D6Q A;  4Q0P A;  3ZLI A;  3W21 A;  2IFR A;  1UAI A;  2DU0 A;  4HG6 B;  3U10 A;  5L7O A;  1RUH 1;  1AYM 2;  2JG9 C;  1WCD J;  4JZR A;  1PHM A;  3BIW E;  4BHP A;  5F5I A;  3MFC A;  5LEK A;  3U4S A;  1UMZ A;  3KV5 A;  4A7Z A;  3TAY A;  4AK3 A;  4YW5 A;  1E57 A;  5JXI A;  2HWF 1;  3RWK X;  1OLM A;  3POI A;  2E51 A;  2WA4 A;  3KM5 A;  3IWZ A;  3IZO A;  1J59 A;  3H8X A;  4LOT A;  1YIP A;  3VBO B;  4A2U A;  4CEW C;  1XRU A;  4Q0S A;  5FY0 A;  1IHM A;  1LHW A;  4MLO A;  4WM7 A;  4A44 A;  4WZC A;  1C5I A;  2BW8 A;  4E4D X;  2PQQ A;  4R9A A;  4JGZ A;  4QPW A;  1L7R A;  4TN7 A;  2CWM A;  5FP4 A;  5FWJ A;  3S0M A;  1TMF 1;  3GJB A;  5A7S A;  3EQE A;  1OLR A;  1Q8V A;  1R1A 1;  1FOD 3;  1OKO A;  2QFE A;  4JKM A;  1N3Q A;  4NIG A;  3I3Q A;  1BEV 3;  4Q4V 2;  5FXV A;  3BTZ A;  1F8V A;  2E33 A;  1BBT 3;  1BQP A;  5JSO A;  1LJ7 A;  2N7G A;  3BPZ A;  4YGD A;  1VMH A;  2H6C A;  4IV1 B;  5J3U A;  4B1L A;  3OPW A;  3VBR B;  2JG8 A;  4I3P A;  1SPP B;  4MO3 M;  4NWW A;  5FY9 A;  1H8T C;  3WNP A;  1RUD 3;  2ORZ A;  4D0Q A;  5T5P A;  1XOY A;  1NYW A;  3N9N A;  2GNB A;  4ZZ8 A;  4LE3 A;  4W6Y A;  3R0R A;  2VW2 A;  1WGP A;  4XAA A;  4XET A;  4AE2 A;  1AR8 3;  1XU1 A;  4CDQ C;  1R08 2;  2AEN A;  2PLV 1;  3T0A A;  1O4Z A;  4AQS A;  4LLO A;  3AYA A;  4CEY A;  1JU3 A;  2F4P A;  5CFD B;  3ZKY A;  5LA9 A;  3CL1 A;  1HXS 2;  1N3O A;  1UOF A;  1JZ7 A;  2D6K A;  4CDU A;  3QBQ A;  4GAL A;  1GWL A;  1Y9M A;  2J1R A;  5FY7 A;  4LHN A;  3KSC A;  2AGS A;  3T3Y A;  1RUF 1;  4BA6 A;  4RA0 A;  3RI8 A;  4DMI A;  3RZH A;  3ABZ A;  1XC6 A;  2PEL A;  2WNU A;  3S5A A;  3AP9 A;  1ZRC A;  4YG0 A;  5L73 A;  4EV0 A;  4FAG A;  1EPW A;  3MYX A;  2WSU A;  3H3U A;  1RUE 1;  1UKG A;  2Q5T A;  3ACF A;  4ZY9 A;  2ERF A;  2OUH A;  1VBE 3;  4IEU A;  3TEZ A;  1PK6 A;  1LOC A;  3HT1 A;  1MEC 3;  2K0G A;  2PHW A;  2OKX A;  4YSF A;  2A7A A;  4MET A;  4B4R A;  1V6I A;  1AJK A;  3R4D B;  2XJP A;  1PVC 2;  2R07 1;  2B9U A;  4WVV A;  2WS9 3;  3MLL A;  2GC0 A;  4ZPI A;  1JOP A;  3UKN A;  2VVD A;  3KD4 A;  2W3J A;  3ZFF C;  3ASI A;  4XMA A;  1TNR A;  4PHZ A;  5LRS A;  2A1X A;  2TEP A;  4CTE A;  4XZU G;  4B4Q A;  4EJR A;  4MGT A;  4COV A;  3QH7 A;  2PAE A;  2G1M A;  1PM4 A;  1JOD A;  2P4E A;  4QGL A;  1POV 1;  5FYV A;  4Q4Y 1;  2DV9 A;  4O61 A;  3RYP A;  2BTV C;  4IL7 A;  1XNC A;  4FFH A;  4NVP A;  4UBG A;  1IS6 A;  1K5J A;  3VBS C;  5FZ9 A;  1AL2 2;  4HN1 A;  4NID A;  5GLW A;  1OH4 A;  2VZO A;  2GZW A;  5FKB A;  5JXG A;  2XOM A;  4AAX A;  4JTN A;  4K8R B;  1AR6 3;  2HWE 2;  5E6H A;  4QB2 A;  4N43 B;  3J7H A;  4CPB D;  5FY1 A;  1PO1 1;  5D8A C;  3O1V A;  1HN0 A;  3VBO A;  5C9A B;  2ZHK A;  1QWR A;  2R49 A;  1B35 C;  1EUU A;  4ERO A;  1DLC A;  2EIC A;  4AHY A;  4BQ1 A;  4QM9 A;  4XMI A;  1K3I A;  3GCX A;  3AP6 A;  2AEZ A;  2WUH A;  5FPV A;  5LA0 A;  4IND A;  1HV1 A;  4KWJ A;  3SXW A;  3WF2 A;  3AKS A;  2OZ6 A;  3I2I A;  4MGQ A;  3U0Z A;  1GWM A;  2PA7 A;  3M1H A;  4NHM A;  1V6K A;  3WVJ A;  1C8M 2;  5JR7 B;  1C28 A;  2YPD A;  3MF6 A;  3FFQ A;  3O1S A;  5A3W A;  4XQD A;  3OUJ A;  1CN1 A;  1XNB A;  1FAT A;  3VBR A;  1SPP A;  2HLE A;  4JRA A;  5CZK A;  1W6O B;  2OQ7 A;  5DQ0 A;  4M3C B;  4ASL A;  4OHV A;  1KQR A;  1AF9 A;  2CGO A;  3OF1 A;  2MPF A;  1W9Y A;  4IER A;  2W1Q A;  3B9I A;  3ZVX A;  1MS8 A;  2YBS A;  2VG9 A;  2WDB A;  2XVG A;  3T1M A;  2P6C A;  2XLF A;  5FZE A;  2WT0 A;  4XIK A;  2OZJ A;  3WD5 A;  2CDP A;  1VBB 1;  4LJH A;  2CDO A;  3N9O A;  1ULC A;  1KD7 A;  1OLM E;  3B3Q E;  1G9D A;  3PU3 A;  1OXC A;  3K77 A;  5C6C A;  2VQU A;  5C8C B;  2ZA9 A;  1PIV 1;  3J8F 3;  5CFD A;  3OPZ A;  1NQD A;  1U12 A;  4LO7 A;  1O59 A;  4BYY A;  2W1S A;  1GYK A;  2BOJ A;  1RHI 1;  1UMI A;  3AB0 A;  3BPS A;  1O6U A;  1OQE A;  3OB8 A;  4JVA A;  1UOB A;  3ZR5 A;  3C7E A;  5HI0 A;  3T08 A;  1WCQ A;  4OUL A;  1IKQ A;  3WX5 A;  5B4N A;  1OQ1 A;  2B46 X;  3A4U A;  4FPG A;  3UGF A;  3BYW A;  2VTX J;  4FPY A;  3OBT A;  5HCB A;  4MUV A;  1AL0 G;  1LOG A;  2PN5 A;  3BN6 A;  3LDR A;  1ENX A;  5K0U B;  1FAY A;  1ULF A;  4QB6 A;  4ZON A;  1DLL A;  1YCI A;  4X6R B;  4QGN A;  2Y64 A;  3QH6 A;  5C7G A;  2XB6 C;  1I9R A;  2DFB A;  3LA3 A;  4IV3 C;  5D1I A;  5KC5 A;  1HRV 1;  4DUX A;  1DFQ A;  1HQN A;  2BV4 A;  4JKK A;  1M4W A;  1STM A;  4XOG A;  5ACA 2;  1DF0 A;  4QKN A;  3VZJ A;  1W0N A;  2W0X A;  4CP0 A;  4LT5 A;  5ABJ A;  2ZBJ A;  4YFZ A;  2ARC A;  2MHF A;  4CVU A;  5BNO B;  5DZF A;  4B4P A;  3UET A;  4AVA A;  2X10 A;  3CBN A;  3IIA A;  4P02 B;  2ID4 A;  3VBH B;  3RJ2 X;  2Q30 A;  3Q8B A;  3O1M A;  4NPL A;  3NMB A;  2Y6G A;  4IES A;  2G9F A;  4AVT A;  5ANQ A;  2DBI A;  4WVZ A;  4COU A;  4OFG A;  1VRH 3;  1ZBE 2;  4D6R A;  4PIX A;  2QTW B;  4N43 A;  5FXW A;  3FJS A;  4C0B A;  3FFZ A;  2I07 B;  4V1P A;  5C9A A;  4HVR A;  2HJI A;  1SLC A;  2D97 A;  4KU7 A;  4TLF A;  3VBU C;  4B8E A;  4Z2A A;  5DMY A;  2D3P A;  2VNO A;  1S0J A;  3ZFE C;  1SEF A;  1WW6 A;  4DEV A;  4C91 A;  1ONA A;  3K4Z A;  5EYY A;  5FK8 A;  3M3E A;  3AM2 A;  2BUK A;  1TE1 B;  1Q5O A;  2VD7 A;  2QZ2 A;  1G9C A;  3B02 A;  4XJA A;  3C8X A;  4ES8 A;  5F39 A;  2W39 A;  3AZX A;  2QCS B;  5JXH A;  4QXB A;  2D5F A;  4S2G A;  4AZZ A;  2VZP A;  4P9X A;  3QAC A;  1FPN 3;  4XJU A;  3SIT A;  4AHZ A;  1W03 A;  2NQY A;  3NQH A;  5BNO A;  1H6Y A;  1W6O A;  3ZIW A;  1IQD C;  4M3C A;  1FOD 1;  1BVP 1;  2BVV A;  4JHT A;  4LA2 A;  4UW3 A;  1UZZ A;  1BEV 1;  2A6W A;  5DAQ A;  1WMX A;  4KG8 A;  1QHD A;  1PO2 3;  1V6O A;  2PYT A;  5FUP A;  2ZX2 A;  1S0G A;  3A7Q A;  3H3L A;  3III A;  1UF2 C;  4QDR A;  1ZZ7 A;  3PL0 A;  4LBM A;  4QWN A;  4N8M A;  1N1S A;  4XDO A;  2VUC A;  1R09 3;  2EA7 A;  3AVS A;  5FZM A;  5C8C A;  1OSG A;  3VKN A;  3T1L A;  5H9Q A;  4AI0 A;  4KWL A;  5FUN A;  3AXE A;  1MS3 A;  5FXZ A;  4E9K A;  5F9T A;  1W6N B;  3PIG A;  2X5I B;  1DQ5 A;  2XGX A;  4B3N A;  5JIU A;  4PBP A;  3WOG A;  4LBQ D;  5CNA A;  1VMF A;  2ZGN A;  1MZE A;  3LSD A;  5I0S A;  2JD9 A;  4CUC A;  3BGA A;  5JSP A;  2GH2 A;  3WG3 A;  4D69 A;  2YXS A;  2ZZQ A;  4IEV A;  2WQ8 A;  2Y26 A;  3S5Q A;  4DUW A;  2X53 S;  3ST7 A;  2QJV A;  1RUG 2;  1RYY A;  4HPK B;  5K0U A;  1VE0 A;  3H1Y A;  1JS9 A;  5FLI A;  1KS4 A;  4G4F A;  4DXZ A;  2GN7 A;  4OI2 A;  4IGQ A;  4A6S A;  4GH4 B;  3LEG A;  1CAX B;  1VBE 1;  5ERL A;  3VB9 A;  1QXR A;  4FT8 A;  2BU9 A;  3ZOI A;  1PM7 A;  4QMA A;  2QUO A;  4YVS B;  4YAR A;  3UNP A;  1YWK A;  3ELN A;  1EUT A;  4M01 A;  1G8W A;  4C1W A;  2XUE A;  3H7J A;  5H9P A;  4CDX B;  1S4C A;  1QNW A;  2C4X A;  3NKT A;  5HBA A;  2WFF 2;  3VBH A;  5GLZ A;  4BU2 A;  3WW1 A;  1GP4 A;  3KQ4 B;  1MQT C;  5FYT A;  5A1F A;  3TN9 1;  4DZG A;  2VVF A;  3HNB M;  1RMU 2;  2Y6L A;  3LWC A;  3VBF B;  3MIE A;  1D4M 3;  1OFS A;  2CL2 A;  5J1X A;  3K48 A;  1GNZ A;  1CJP A;  1GAN A;  2RS5 2;  3GZA A;  2J7M A;  4P9Y A;  2J1V A;  1SDW A;  1J84 A;  1WKY A;  3W58 A;  5IFT A;  4GAZ A;  3PU8 A;  1YJL A;  1N1T A;  1AR6 1;  3IT8 A;  1LCL A;  4AAP A;  2ZPX A;  5F6L B;  3LFI A;  2EVX A;  5BNP C;  5FZC A;  2RM2 2;  2FHR A;  4A7K A;  1BCX A;  5EJ3 A;  1K12 A;  4QHB A;  3SMH A;  1W9F A;  2BDR A;  4M4P A;  4XCA A;  5F1R A;  3OGR A;  4BQ4 A;  5C4W C;  2QDN A;  1W0P A;  3EJK A;  3F2Z A;  2BZD A;  4NAO A;  5APA A;  3PME A;  3PDQ A;  1PMJ X;  1LOF C;  1S0F A;  4E4Z A;  4HAN A;  3WLU A;  4BWO A;  1W8T A;  3J7L A;  2PXJ A;  2YC0 A;  5FDB A;  1WMF A;  4QQO A;  4LNV A;  3DGT A;  3VUO A;  2PQS A;  2RS1 2;  3D4K A;  5F7U A;  4OI0 A;  3LFM A;  1F15 A;  1C4R A;  2BWC A;  4BE3 A;  1JYI A;  1IPJ A;  2XJU A;  5CKN A;  2V73 A;  2VZ1 A;  4HXC A;  1D0H A;  5T50 A;  1DGW X;  2HWF 2;  1F9K A;  2AEY A;  2A3Y A;  4Q27 A;  5CKQ A;  1BMV 2;  2FCT A;  3C7F A;  1W6N A;  2X5I A;  3WIN E;  4W65 A;  5F5Q A;  1KDK A;  3LOB A;  3MLJ A;  4A7Y A;  3WNO A;  3J8F 1;  3KT1 A;  4I0W B;  3DXT A;  4R52 A;  4P14 A;  2R32 A;  4K3U A;  1VAV A;  1TMF 2;  1H1M A;  3I59 B;  1R1A 2;  4Y26 A;  2DBN A;  3O0X A;  1LOD A;  1JZ8 A;  2VL4 A;  4HPK A;  3AZV A;  4QHZ A;  4COW A;  3MEP A;  1GOG A;  4M3C E;  4K6B A;  2ADD A;  4GMP 3;  5JWP A;  4AEJ A;  1YQ8 A;  2CU5 A;  1D7P M;  1RJ7 A;  3GF6 A;  2WZE A;  1V6N A;  3H8U A;  3HBZ A;  3MW2 A;  4GH4 A;  1CAX A;  1LU2 A;  5A80 A;  4XFA A;  4RQP B;  3GZU C;  4EYU A;  3CNA A;  4YVS A;  2RHP A;  2DWR A;  2RDQ A;  4I0A A;  3EYP A;  1Z7S 2;  4MX3 A;  4FCA A;  3KV9 A;  1N3P A;  4QX8 A;  1K5M B;  2FDI A;  3GAL A;  1HB2 A;  2R04 3;  3JUU A;  4CDW C;  4Y20 A;  4CDX A;  4P9J A;  4XXP A;  1C8N A;  5FIX A;  4QQH A;  3F95 A;  2R06 1;  2VOK A;  3B01 A;  4P9I A;  4Q4X 3;  4YPJ A;  3FBM A;  4IW3 A;  3RJR A;  2P34 A;  4QPI B;  4XHB A;  1UX7 A;  3M70 A;  1PZ9 A;  1VBA 3;  1O5U A;  1QJZ A;  5AC9 3;  5GAL A;  3W59 A;  3RZJ A;  3VBF A;  2C26 A;  1RUF 2;  4P9L A;  3CZJ A;  4J25 A;  1PNF A;  4CCM A;  3U37 A;  3O7O A;  1YLL A;  4ARY A;  4KWK A;  1Y4W A;  4AVB A;  1O7F A;  1RUE 2;  2G4I A;  1VRH 1;  4QX5 A;  3JD7 2;  2E7Q A;  2JX9 A;  4AWD A;  3D82 A;  5KWR A;  4DOU A;  2AR6 A;  2JDH A;  1MVQ A;  4PI0 A;  4CUA A;  3OGS A;  1KGY A;  2R07 2;  4FPO B;  1RGS A;  2JEN A;  1GWK A;  1JYN A;  3O1P A;  3PUH A;  4YW4 A;  1SLL A;  2OYZ A;  1JYV A;  1ND2 B;  1DBN A;  3I2F A;  1ZRD A;  4UOJ A;  3ACG A;  3LQC A;  2R30 A;  3M3C A;  2IXH A;  1J3R A;  2R0F A;  5M0T A;  3RMX A;  4DRV A;  1ZZ6 A;  5GZC A;  1FPN 1;  2XBO 3;  2NP0 A;  5I0T A;  3E1F 1;  1GOH A;  2WLP A;  1W8F A;  3KT4 A;  3CF6 E;  4AOC A;  3UJO A;  3C7O A;  1OKQ A;  4Q4W 3;  2IXJ A;  4QGM A;  3AK0 A;  2OT7 A;  4WBB A;  5A70 A;  2WO1 A;  2XL9 A;  2ZAB A;  5CFC C;  1PO2 1;  2Y8K A;  2E7A A;  2ZCW A;  3PNA A;  4XVH A;  3PHM A;  2Z4F A;  2MEV 3;  1F35 A;  3D6E A;  4GWJ A;  4UBH A;  2L9L A;  5LY1 A;  1CGP A;  3LZZ A;  1ASJ 2;  1NQJ A;  4RS5 C;  3U1X A;  5JCT A;  3O1T A;  4IUG A;  3I2O A;  4FAH A;  1UIJ A;  1NLS A;  2FDG A;  3CJI B;  4ORF A;  4XUQ A;  5JI7 A;  2RS3 3;  5E8A A;  3A22 A;  4NN0 A;  3ILF A;  1X8M A;  1T6B X;  1OUR A;  2VOX A;  3TEW A;  2HBT A;  4KGG A;  1AHS A;  2PHX A;  3CQO A;  3IKW A;  3MLK A;  4HON A;  4QX2 A;  4G3Y C;  3ZSM A;  5A3T A;  1GNH A;  4JDO A;  2P3I A;  2VJX A;  1VAL A;  3E6D A;  3VZM A;  4GMP 0;  5GLU A;  4AR2 A;  2OII A;  3N7L A;  1HX6 A;  4D7Y A;  5DG2 A;  5BNN B;  1V9U 3;  2XHN A;  5FOB B;  4Z2W A;  2R16 A;  5JDB A;  1JZ3 A;  2DUO A;  1A8D A;  1CZV A;  1XXN A;  4NHL A;  3OPT A;  1NXD 1;  4EWD A;  1IZ3 A;  3DUI A;  1VBC 3;  4XDQ A;  1K5M A;  4DY5 A;  4YRD A;  4I09 A;  5KHH A;  5A3U A;  1UXZ A;  4W4Z A;  1IOA A;  5FPZ A;  1OBN A;  4LKF A;  1KEX A;  1QQP 1;  1S2B A;  1H9W A;  2VAU A;  3KMH A;  1HJG A;  2WT1 A;  3KVA A;  4LUL A;  2AAC A;  2WZR 1;  1PIV 2;  1RUJ 2;  3ZKU A;  3Q8C A;  4K1Z A;  4QPI A;  3WNN A;  4UW4 A;  4EN0 A;  4NPR A;  3B5L B;  1LEM A;  1JU4 A;  1VPH A;  2VW1 A;  1ND3 C;  1GFF 2;  4IE4 A;  4URT A;  3ILR A;  4Y1U A;  5F32 A;  1FT9 A;  3T2Q A;  4CCD A;  2YY1 A;  5A6Q A;  5L7O B;  2CTV A;  4YM1 A;  4I2O A;  3M7A A;  1FX5 A;  5T52 A;  1AR7 1;  3NVC A;  1FMD 3;  4XBN A;  5LCW L;  1D4M 1;  5FBJ A;  3WNM A;  1RC6 A;  2JDP A;  3D8C A;  3KF3 A;  4KH9 A;  3FLR A;  5FP3 A;  3UGG A;  2VMG A;  4Y4R A;  3T2T A;  2DCJ A;  2IXK A;  3NKG A;  4XDP A;  1SG3 A;  3NAP B;  3VD5 A;  2VNG A;  3H0O A;  4EE2 A;  1OFN A;  1WBF A;  1ND2 A;  1QJX 3;  1YQC A;  2HWD 2;  2JKB A;  3OBZ A;  4PF5 A;  5FXX A;  3SKV A;  1IG0 A;  2C6S A;  1WBL A;  2VOW A;  3OY8 B;  2ZX0 A;  1AR9 1;  4YZ4 A;  5FJK A;  4H7M A;  1UL9 A;  3M2M A;  4CU9 A;  4HK9 A;  3ES1 A;  1H0B A;  4L97 A;  5IVB A;  3H8R A;  3K3N A;  4QQL A;  1SAC A;  4YM0 A;  3DF0 A;  1QJU 3;  2KM2 A;  2WO3 A;  1IG3 A;  1EAH 2;  2JDM A;  1LOE A;  1FXZ A;  1SBE A;  5FZF A;  4KGQ A;  3S7I A;  4RGK A;  1RIR A;  3SHR A;  3I3M A;  2VCC A;  3PVO A;  3LD8 A;  4PIZ A;  1G9A A;  1DQ4 A;  5FZG A;  4P9W A;  2QNK A;  1W90 A;  2GP3 A;  2VEC A;  4W50 A;  3AFG A;  4JV4 A;  2OUJ A;  3FUO A;  3CJI A;  1UY2 A;  4CP1 A;  1AVB A;  3FBY A;  3E6C C;  2QQU A;  5J36 A;  2VZS A;  4XJ8 A;  2D7F A;  2ZHL A;  1QJY 2;  1W05 A;  1O91 A;  1T6G C;  5LBF A;  1EPZ A;  1RTV A;  4WM8 C;  2F4L A;  5FP8 A;  3USS A;  1FOD 2;  5IVV A;  4HLT A;  1UZY A;  2SBA A;  4K8F A;  3AZW A;  4P5Y A;  1RUI 2;  4AFD A;  4HSL A;  5FYC A;  2E53 A;  1LEC A;  3AZY A;  4Q0U A;  4GMP 1;  5LB6 A;  1QKQ A;  5A3P A;  4XQ4 A;  5FZO B;  2VGD A;  4JX0 A;  4IEW A;  1F31 A;  2W1W A;  2VUD A;  4C8D A;  5EJZ B;  1CWP A;  1RUC 3;  3O12 A;  4YW2 A;  5LAT A;  3BIE A;  1W3X A;  5HCH A;  1J83 A;  3H42 B;  4FFG A;  1WA6 X;  5A3N A;  3TNP B;  2PHR A;  1ZM1 A;  2BFU S;  2GNM A;  3BB6 A;  5JIA A;  2CHH A;  4BPZ A;  1C5H A;  1H4G A;  4XIO A;  3NV3 A;  2VC9 A;  1QNY A;  2A73 B;  3E5U A;  4UYB A;  4Q4X 1;  1QXJ A;  2WN2 A;  2JB4 A;  3BOW A;  3DL3 A;  4BIF A;  1HN1 A;  1P8J A;  1UZW A;  1H1I A;  1GBG A;  2RDN A;  1OUS A;  1VBA 1;  2JE8 A;  2WR9 A;  5FZK A;  4E8D A;  2JDY A;  5AC9 1;  3BUC A;  1OH3 A;  2P1B A;  4HOO A;  5AVA A;  1ZBA 2;  2CGN A;  2JJ6 A;  5FV3 A;  2W1U A;  1ZA7 A;  5GLT A;  5FLH A;  1LB2 A;  4BQ5 A;  4LBO A;  2G9Z A;  1GQH A;  1E5I A;  2ZGL A;  3N35 A;  3KHC A;  5EYX A;  3MIG A;  2B8M A;  3I97 A;  4RHV 3;  4LO4 B;  3WP3 A;  1SFN A;  1COV 1;  4EN7 B;  1OA3 A;  5FAX A;  3Q8E A;  3NAP A;  5FCC A;  5LY2 A;  1OPM A;  1V6L A;  4AXO A;  5GLV A;  1QOO A;  5FYZ A;  5FOJ B;  3PVB B;  3ON7 A;  1AYN 1;  1W9S A;  3KLS A;  3OY8 A;  4IV1 C;  3RS6 A;  1W8U A;  2ZEZ A;  1YC6 1;  2VBD A;  2W5F A;  4UXA A;  5CVR A;  3VBR C;  2JG9 B;  1X36 A;  3ZMO A;  5IVY A;  3IBM A;  2ATF A;  4AGR A;  1S1A A;  4XAB A;  1MS5 A;  3OOX A;  1HRI 3;  2RR1 1;  5F2W A;  3THP A;  4CU6 A;  1CVN A;  2VZV A;  3TN9 2;  2ZAC A;  4CCC A;  4XF1 A;  3ZYB A;  3OEB A;  2XBO 1;  4IEY A;  2YG0 A;  1J58 A;  1DCS A;  2B9V A;  3FHI B;  2ZHN A;  4CEW B;  4E2S A;  1RUN A;  2ZMN A;  1GU3 A;  4FVV A;  4CXX A;  4PLN A;  2P37 A;  1V0A A;  3JBG 3;  4Q4W 1;  5BNQ A;  3NST A;  1G9B A;  2W68 A;  2W47 A;  3HJR A;  2PHT A;  3JZV A;  4AEM A;  1PX4 A;  4BH9 A;  1YIF A;  2P5B A;  1W39 A;  5T5J A;  3ZPO A;  2OA2 A;  1GMM A;  1KRI A;  1GP5 A;  1I6X A;  4EN8 B;  4GKY A;  4CP9 B;  4GB3 3;  3W20 A;  5F3C A;  2WNO A;  4P00 B;  4IEP A;  3HEI A;  3O1O A;  1L7L A;  4SLI A;  5A32 B;  3I2K A;  1H8T B;  3I2H A;  1OOP C;  1GQP A;  4GJZ A;  4RN5 A;  2B42 B;  2QDR A;  5B2G B;  1UOG A;  3VDD A;  4CU8 A;  5H9R A;  1Q8O A;  1N1Y A;  2EAK A;  4L9B A;  3ZXD A;  4EWA A;  5A3M A;  3RZZ A;  3KHB A;  4F83 A;  3G6J B;  4X8P A;  4QU1 A;  4BB3 A;  2ZXQ A;  3POW A;  4RGG A;  4CDQ B;  3MUZ 1;  2JE7 A;  3CHX A;  3KF5 A;  3GBG A;  1FV2 A;  4MZU A;  4GWI A;  5FZO A;  3UYJ A;  3VHO A;  4BM8 A;  5I0R A;  1AYM 3;  2YDE A;  3BAL A;  1CX4 A;  2P6H A;  4OMD A;  1TME 2;  3LAG A;  4BIS A;  1X9P A;  1Y9G A;  3AXD A;  3OUI A;  5ABJ B;  3WDX A;  1VBC 1;  1V6M A;  3QD6 A;  1PX3 A;  1WD3 A;  3ILN A;  1W8N A;  4V2V A;  2Q1M A;  4HFS A;  1VBD 2;  2WQZ C;  4C1X A;  1SLB A;  4YWA A;  3WSO A;  4QPG C;  3S7E A;  1B09 A;  1XNK A;  2RJK A;  1M06 G;  5FK7 A;  1JI6 A;  4E27 A;  1IKP A;  1NY7 1;  3IDC B;  3ZSL A;  1CON A;  1GQG A;  2V72 A;  4BZ4 A;  1DYP A;  1SHW B;  1DYO A;  5FZ7 A;  4LO8 A;  1R1Z A;  1DQ2 A;  5C5T A;  4Q4V 3;  3SCG A;  4Z92 B;  1GV9 A;  5J96 B;  4NWV A;  4FFF A;  2VZR A;  2E63 A;  2Q4S A;  1ST8 A;  1W99 A;  2W52 A;  5EHD A;  1IQA A;  3PIJ A;  4FXG B;  1FMD 1;  1K42 A;  3KGL A;  3T09 A;  4W8J A;  2HH9 A;  4LE4 A;  4XUP A;  5BXX A;  4D3W A;  1WCU A;  4D8M A;  3ECQ A;  1WMD A;  3HOB A;  2WQ4 A;  3POJ A;  1C1L A;  3ZFG B;  1BJQ A;  3P6B A;  4OI4 A;  4Y22 B;  3FLT A;  1JBC A;  2D5H A;  2LRO A;  2UY8 A;  1R08 3;  5IK4 A;  3LIH A;  3ZYI B;  3CKH A;  4LMF A;  2JG9 A;  3VBS B;  1QJX 1;  2R06 2;  4UF0 B;  3MO4 A;  3U11 A;  5JZG C;  1HXS 3;  3POS A;  2FCV A;  5LRR A;  4OUM A;  2AUY A;  3RDI A;  2AC1 A;  4OHY A;  4AHX A;  2WII B;  5D8A B;  4S2F A;  4JHZ A;  1CIW A;  1YJK A;  2ZKL A;  4AI9 A;  4M3C F;  5E89 A;  1QJU 1;  4CEW A;  1S55 A;  4D6S A;  2XLG A;  3WNK A;  5FRA A;  3NNM A;  5JOW A;  1I5Z A;  3N9Q A;  2V5D A;  4Y33 A;  2MNG A;  1ACC A;  4KNC A;  5EXO A;  3HMY A;  2XLA A;  4AI3 A;  5A1A A;  5LWB A;  2VUJ A;  4XF0 A;  5HV0 A;  1YYN A;  4L2N A;  2FQP A;  1N1V A;  2EXK A;  1ZX5 A;  4CP9 A;  2XQX A;  1T2X A;  1PVC 3;  4XZP A;  1QU0 A;  1ZZC A;  4ITC A;  5CAZ A;  2P3J A;  5A32 A;  1H8T A;  2RMU 2;  2VZT A;  3INA A;  4L0P A;  1W2A X;  1C3H A;  1A8M A;  2DUP A;  4XYX A;  2CAU A;  5K4L A;  3JB4 C;  2IC1 A;  2VCB A;  5FZ0 A;  2BPA 2;  1GZW B;  3A0N A;  2WNV C;  1WA4 A;  2Y6H A;  5EV7 A;  4XBQ A;  3IAP A;  4KBB A;  3J4U H;  4CDQ A;  1UZ0 A;  3ZIX A;  1WUV A;  1KFX L;  2D98 A;  1O8S A;  1XE7 A;  1JZ2 A;  3V0B B;  1KS5 A;  3EBR A;  4DO0 A;  1RIT A;  2IVJ A;  4W6W A;  5LW9 A;  1AL2 3;  4ISQ A;  2ZMK A;  5IYY A;  5IT6 A;  4XAE A;  4AW7 A;  4XIL A;  4MHR A;  2HWE 3;  2YB7 A;  1PO2 2;  1W8Z A;  4A3X A;  5LZ6 A;  4PDW C;  1RUC 1;  2ZGQ A;  2WBK A;  1VB4 A;  3K3O A;  4QQ2 A;  2RV9 A;  1EV1 2;  2XH6 A;  1XB9 A;  3LKJ A;  4LK7 A;  2OW4 A;  4CCK A;  1NZC A;  2HEW F;  4UI9 L;  1DZR A;  2W2I A;  1YUD A;  4AEK A;  4HZF A;  1HLC A;  1RVF 2;  1UXX X;  1JHJ A;  1UU6 A;  2HYX A;  1I1E A;  1C8M 3;  5KHJ A;  3G7D A;  4DS0 A;  3HBK A;  3WUC A;  2WC2 A;  4XCB A;  5A7P A;  1W9W A;  2HYK A;  5CB7 A;  3ZFF A;  1UKR A;  1YEW A;  2DTW A;  3I4I A;  4TYS A;  1XYN A;  4YM3 A;  4CXY A;  3VD9 A;  1I5P A;  2WFP A;  2DCZ A;  1W04 A;  3V56 A;  5FO7 B;  2DU1 A;  1GP6 A;  3ZSJ A;  1XYO A;  4FOQ A;  3ZFG A;  4Y22 A;  4ASK A;  1QF3 A;  4AYU A;  3M4F A;  1OVP A;  4QB1 A;  3VV1 A;  1NOV A;  4GWN A;  3ZYP A;  1QQP 2;  1X50 A;  1CZS A;  4IDZ A;  3APB A;  3VBS A;  3TWI A;  2GC2 A;  2Z2S B;  3MV1 1;  2WWS A;  2WZR 2;  4JAA A;  4UF0 A;  3SH3 A;  2WWJ A;  4PQ9 A;  5A33 B;  1MZ5 A;  1U5X A;  3ZPY A;  1MS0 A;  1AX0 A;  5KR7 A;  2QVS B;  1BBT 1;  5D8A A;  1JYT A;  1JUH A;  1W6Q B;  1ALY A;  1VLN A;  3FMG A;  2VTX A;  3PUS A;  4Y5S A;  3VBU B;  4NE9 A;  4XUN A;  3RNS A;  1RUD 1;  5FYH A;  1HRI 1;  2XPJ A;  2WLQ A;  2DVA A;  5DDJ 3;  3ZFE B;  1UYP A;  1AR7 2;  3MIF A;  2BRT A;  4CCN A;  3THD A;  2C24 A;  4HKW A;  4L11 A;  3AFK A;  3NNL A;  3NV1 A;  2A5Z A;  2ZS6 B;  1NCR B;  2XHK A;  1AR8 1;  1ZRR A;  5FMO S;  2YPJ A;  4O65 A;  2CWS A;  3UK9 A;  4CUB A;  3NJZ A;  4NIA A;  1PGL 1;  1W8O A;  2OPK A;  3JBG 1;  4QKF A;  4ZU4 A;  4R4Z A;  2ZGS A;  4ET7 A;  2K9Z A;  3ZO0 B;  2D40 A;  2JXA A;  2R1B A;  3NWK A;  1Z78 A;  4CCE A;  5ACA 3;  3RYK A;  2XXZ A;  2V4V A;  2HWC 2;  2E9Q A;  2PHL A;  3C7G A;  1EP0 A;  1FV3 A;  2NN8 A;  1GZW A;  3LDK A;  1BK0 A;  4GB3 1;  2P3Y A;  2H0V A;  5EIY B;  1LTE A;  1AR9 2;  1Z0H A;  4DXR A;  2VTF A;  4N53 C;  4LIV A;  4UWD A;  2CNA A;  4E2G A;  4LBN A;  5CKM A;  5C3Q A;  1MZ6 A;  3V0B A;  1S0E A;  1UNB A;  1GR3 A;  3O5S A;  4GA9 A;  1OC1 A;  4HKL A;  4Q0V A;  4YVS C;  3DCQ A;  3U75 A;  1JW6 A;  3GHM A;  2DUR A;  1MEC 1;  2HWB 2;  3D0S A;  3WF4 A;  4DNY A;  5KBF A;  1ZBE 3;  3B7M A;  4HBN A;  5FP7 A;  2WYS A;  3MHZ A;  2QQK A;  1QDC A;  3TEY A;  1AYM 1;  4MGI E;  3H8O A;  4LIT A;  1J3P A;  3GM8 A;  3AMM A;  4Y20 B;  2WS9 1;  3ZN6 A;  3U4X A;  4Y4Y A;  2I2S A;  3TNQ A;  3N9M A;  2IFW A;  4MGY E;  5FZ4 A;  3A21 A;  3GYD A;  4H3W A;  3RPQ A;  1CES A;  1UU4 A;  3FLP A;  2J1A A;  3RZG A;  4AFC A;  2V4A A;  1DGL A;  2KA3 A;  4IQP A;  4K1Y A;  1VIW B;  1JZ4 A;  4HET A;  1GZ9 A;  4GJY A;  3VD4 A;  1VAM A;  3MFA A;  4DFS A;  3KCX A;  4IV3 A;  1ULO A;  3DPR B;  5GM0 A;  1UCX A;  3AP7 A;  3K2O A;  4W6X A;  3WDW A;  4YM2 A;  5LBC A;  4I01 A;  2LM3 A;  5IK7 A;  2VO5 A;  5JOY A;  1NE4 A;  2Y0O A;  1HW5 A;  3WG1 A;  4Q4V 1;  1X82 A;  2X8K A;  5IVJ A;  1JYX A;  4I3G A;  3HR9 A;  4OHW A;  2NZ9 A;  2YFZ A;  1UY0 A;  4L92 A;  2O8O A;  2YZ4 A;  5F6K A;  1DZQ A;  1Y43 B;  3NJY A;  5A7O A;  4R9B A;  3H3Z A;  1BXH A;  3OBA A;  4Z82 A;  3RZM A;  4YLZ A;  3H50 A;  3KCC A;  2WZ8 A;  3MIB A;  4LOR A;  1H2N A;  1LKN A;  1LHN A;  1MAC A;  1ZZ9 A;  3CJX A;  4GXL A;  5FY8 A;  4CCO A;  1S0C A;  1MQT B;  2EID A;  2B39 A;  1CPM A;  1W0O A;  1SCR A;  2WO2 A;  5A33 A;  1PGW 2;  1CX1 A;  2FBE A;  3SH5 A;  1R08 1;  4PI2 A;  3UL2 A;  1RUO A;  3OD4 A;  5FZA A;  2YYO A;  5IVC A;  3PVE A;  1W6Q A;  3BVC A;  4YGC A;  5GZG A;  3LPG A;  1SBF A;  4BCU A;  1HXS 1;  3VBU A;  1RUH 2;  1QY4 A;  1DIW A;  1TEI A;  4JGY C;  5DAW A;  4NHK A;  1Y9Q A;  5DAV A;  5FY5 A;  3ZFE A;  4DUV A;  5AC9 2;  5I8Y A;  3E5X A;  1NA1 B;  1RUG 3;  3OGJ A;  3ZN4 A;  1D4V B;  1NCR A;  1UX6 A;  5C4W B;  2O14 A;  5FZ3 A;  3AC0 A;  3CDZ B;  1NCQ C;  1FNY A;  1COV 2;  4XFF A;  2YU1 A;  1WCK A;  5G04 L;  4ATE A;  2J1T A;  3CO2 A;  1HIX A;  1JH5 A;  2W94 A;  3WQ7 A;  5D2A A;  3I54 A;  1AYN 2;  3KV4 A;  4NRQ A;  1PVC 1;  1XE0 A;  1LGN A;  1HQL A;  3VDB A;  3NV2 A;  3ZYG A;  1DG6 A;  4XXA A;  2LS6 A;  1NG0 A;  2WFF 3;  1UO9 A;  5FPB A;  4LXL A;  2Y60 A;  5C3O A;  2QQP A;  1W2T A;  1GOF A;  4LLF A;  4RQP C;  4YYO A;  5FPX A;  4X6Q B;  2RR1 2;  1NLQ A;  4J1X A;  4NAM A;  4B1M A;  5BUV A;  1KDM A;  4BJ0 A;  1RMU 3;  1SDD B;  4P5H A;  2R0H A;  4KQ7 A;  4BQ3 A;  3K4A A;  1ZNP A;  2RS5 3;  5IAX A;  2ZAH A;  1OQD A;  1QGL A;  4KL1 A;  3JXS A;  4B7K A;  5DUV A;  2EIE A;  2PLV 2;  1MZF A;  4HVO A;  1H2M A;  2VME A;  3VD7 A;  4NHY A;  5DZE A;  4FPK A;  1E5S A;  5FTT C;  3HNM A;  4LR4 A;  4MVT A;  5KC6 A;  3LA7 A;  3RRD A;  2RM2 3;  2A6X A;  4SBV A;  1APN A;  3WHU A;  5FQ0 B;  3DYP A;  2VY0 A;  3IDB B;  4BDV B;  1IS3 A;  2Y38 A;  2WJS A;  3DPR A;  3E6B A;  1EYB A;  5FO9 B;  1W6M B;  5HXM A;  3FE5 A;  1CAW B;  1CR7 A;  1LOB A;  1U5Y A;  1ULD A;  3HNY M;  4TSV A;  2A6V A;  3ZXE A;  3ZYJ B;  3ZYF A;  2VZ3 A;  5FZ1 A;  4MH0 E;  2GME A;  3L9J T;  1S2K A;  4OUS A;  4XBL A;  1US2 A;  4QT6 A;  4QX1 A;  2K2S A;  3R6S A;  2A6Z A;  4FOW A;  5JOX A;  3N4M A;  1MQT A;  1J1L A;  3ZXG A;  2HWF 3;  4PCR A;  1BHG A;  1GZC A;  1H8V A;  2QQO A;  3AKR A;  4IE0 A;  4OHZ A;  3KQR A;  3BTA A;  2ADE A;  3ACI A;  2JEM A;  4ATF A;  1CPN A;  2YMZ A;  1SBD A;  4Q0Q A;  4Q4Y 2;  5K7P A;  3I2J A;  2E26 A;  1OLQ A;  4IET A;  3VLB B;  3WY6 A;  4ZXK A;  2RDR A;  2E6V A;  5FZ8 A;  2C9K A;  2Q1Z B;  3AMN A;  1TMF 3;  4R9D A;  2WO7 A;  1R1A 3;  5A6Z A;  1G86 A;  2ENR A;  1NA1 A;  2ORX A;  3I3E A;  5T3N A;  3SIS A;  1GIC A;  1XE8 A;  3HVD A;  1LAJ A;  4XTP A;  4YFW A;  1PO1 2;  5J09 A;  5C4W A;  5DDJ 1;  3NW4 A;  3AZZ A;  4RR3 C;  2XJT A;  4XUT A;  3WUD A;  3V0A B;  3WNX A;  4BIO A;  4DXT A;  3N9P A;  1LOF A;  1OI6 A;  1R09 1;  4UFH A;  5IJR A;  5IHR A;  2JKX A;  2H0B A;  4P9G A;  2B5H A;  2YHJ A;  3ACL A;  3H9A A;  2CGP A;  4RGA A;  2D43 A;  1Z7S 3;  2XVK A;  3C2U A;  2XG3 A;  3JB8 A;  2EXI A;  1UD1 A;  1OVS A;  3O0V A;  2VQA A;  5BPX A;  4K7J A;  1UPS A;  5ACA 1;  3I49 A;  5LBE A;  1QJX 2;  2PTM A;  1LHO A;  3ZM8 A;  5FMB A;  5SV8 A;  5BNN C;  5A3L A;  4HVQ A;  5KXC A;  2YRO A;  4AED C;  3RG0 A;  5CFC B;  5C33 A;  4YZ5 A;  4ONU A;  2F17 A;  5F8P A;  5LK5 A;  2DDU A;  2YFU A;  5CG8 A;  1RUF 3;  1XSQ A;  4Q5O A;  3FHQ A;  4RS5 B;  4TLG A;  1Q8P A;  2TNF A;  4YVW C;  5GZF A;  4CRQ A;  1VBB 2;  4N7U A;  2LTN A;  5F5C A;  3RWN A;  3ZYR A;  1ENS A;  2QBX A;  5KHK A;  1RUE 3;  3SQO A;  2O8Q A;  3JD7 3;  3LGR A;  5C5U A;  3HQU A;  2FDH A;  5I91 A;  4Q1P A;  2YBK A;  2BFU L;  1RHI 2;  2NMN A;  3DEM A;  1SFY A;  4LOS A;  5L7O C;  3WG4 A;  4BME A;  2EIG A;  5FQ0 A;  3WW2 A;  2R07 3;  4LTA A;  1DZT A;  1DDL A;  5FYS A;  1W6M A;  4LEJ A;  4AFB A;  1XSR A;  3TEX A;  5DUX A;  4ZS2 A;  4NOT A;  1JZ5 A;  3ZX7 A;  1CAW A;  4XFC A;  1NAE A;  5JR2 A;  4BXS V;  1ENQ A;  5FZB A;  1YQ5 A;  1H2L A;  3HWJ A;  3MDP A;  2IVI B;  3NJX A;  1LOA A;  4J6G A;  1ZZB A;  2DUQ A;  1TG7 A;  4JQT A;  1XPW A;  4LIU A;  4CDW A;  2ARB A;  4HL0 A;  3FC0 A;  4XJ9 A;  1F4H A;  4WM7 C;  5C3S A;  1X8E A;  2GSY A;  2P17 A;  1VB2 A;  4XTM A;  5KXB A;  5DUU A;  4OHX A;  1HRV 2;  2NYY A;  4JGZ C;  4HK8 A;  4MGZ E;  2CY6 A;  5CU1 A;  1BKZ A;  2Q8E A;  3BI3 A;  1AXK A;  3VHR A;  3L2Y A;  1RIN A;  2IWG B;  2LRP A;  2QQN A;  1F2N A;  2VH9 A;  1CAV B;  1GNY A;  1US3 A;  4FQZ A;  4LHS A;  4N9I A;  4URA A;  2ZGP A;  3M3I A;  4CCJ A;  3M3Q A;  1ND3 B;  3RZK A;  4NIH A;  4LA3 A;  3GZT B;  2VOT A;  2FDF A;  1ASJ 3;  2JG8 C;  5A7Q A;  1UN1 A;  4Y3O A;  2BWA A;  3ETP A;  4CSW A;  2WL1 A;  4MSV A;  1ULE A;  3U14 A;  1WME A;  5A1L A;  4QX7 A;  2JB8 A;  3GGL A;  3UT0 A;  4BOW A;  1RL3 A;  1JZ6 A;  1HB4 A;  4PLM A;  3I3D A;  2ZTN A;  5LK7 B;  1KFU L;  3PVN A;  3ROU A;  3UJQ A;  3B69 A;  4LBL A;  3MF9 A;  1O4Y A;  3WW4 A;  2D6P A;  2WNE A;  2BNO A;  5F3I A;  1WW5 A;  3WW3 A;  4EN6 B;  5DAB A;  4CEY C;  4Z8B A;  1UY3 A;  4O9G A;  3V0A A;  4J1W A;  1LGB A;  5FP9 A;  4CP2 A;  3LEM A;  3VKF C;  4BMB A;  4CDU C;  1RUG 1;  2WIN B;  4QDS A;  1NT0 A;  1TQ5 A;  4OMC A;  3V64 A;  1JN2 P;  3RVH A;  2DF7 A;  3TYJ A;  4U36 A;  4XFG A;  2WNU C;  1DGR A;  5CYY A;  4B7E A;  5JMC A;  1O3T A;  2A3W A;  3ZSK A;  2AYH A;  4FQ4 A;  3VZO A;  2BBV A;  1D0G A;  1VMJ A;  1XNT A;  4IEO A;  1ULP A;  4DXS A;  3VDD B;  4L8Q A;  1LHU A;  1MS1 A;  1PIV 3;  1RUJ 3;  4EQV A;  2X05 A;  2B7Y A;  1PK6 C;  4NUB A;  1E5R A;  1XND A;  2XKO A;  1SQ4 A;  5C71 A;  5CFC A;  3N36 A;  3GZE A;  1BEV 2;  3GJA A;  4FPL A;  1UPI A;  4XUR A;  5FPL A;  1BBT 2;  3ZR6 A;  5CIS A;  2QQL A;  3ZXL A;  5ISL A;  2FDJ A;  4XJZ A;  3TBD A;  3POE A;  5FZL A;  3ZDV A;  3LIG A;  4RS5 A;  4A6O A;  3WDV A;  4QXK A;  4NII A;  2CAV A;  4Y1V A;  3DV8 A;  1RUD 2;  2RG4 A;  4QXH A;  2W87 A;  1O8P A;  1U5Z A;  3HAG A;  1PMI A;  1QIQ A;  1RMU 1;  2D3S A;  5H9S A;  4BLJ A;  1QMJ A;  3MW3 A;  4XFH A;  2R04 1;  1AR8 2;  4YW3 A;  4IGO A;  1UW8 A;  4UT5 A;  1O3R A;  2BER A;  4KG0 A;  3V65 A;  1OUX A;  2Y33 A;  2VE1 A;  3NRU A;  4WM8 B;  1AXY A;  3USU B;  3IDA A;  2RM2 1;  2HWD 3;  3VD3 A;  2XL7 A;  1QEX A;  3T2P A;  1OD5 A;  5FZI A;  2D6M A;  3WQB A;  2I45 A;  2ZML A;  5GZD A;  5FKC A;  3VBO C;  1W6P B;  1JOB A;  2JIG A;  4BQW A;  1BYH A;  1POV 0;  3CIH A;  3L2H A;  2WWU A;  3B93 A;  3OJB A;  3WEZ A;  2UWC A;  2SLI A;  4NRO A;  1O4T A;  2HKX A;  2QQV A;  1ODN A;  1W06 A;  1EAH 3;  1UIK A;  3EXU A;  1VBE 2;  4CXW A;  4A42 A;  2NPI A;  1MEC 2;  1CAV A;  4LKE A;  4K20 A;  2BOI A;  2UYB A;  4Y1Y A;  1ND3 A;  3PMS A;  2TUN A;  3AL6 A;  3OG2 A;  2ETE A;  3CZU A;  1AJO A;  2WS9 2;  2GC3 A;  4NR1 A;  5E16 A;  2ES3 A;  1YFY A;  4Q2F A;  4Y1X A;  3FN9 A;  4FP2 A;  5CIR A;  1N47 A;  3ENR A;  5CBL A;  2BNM A;  5LBB A;  1RJ8 A;  3RMY A;  1LED A;  2ZEX A;  1BMV 1;  3KVB A;  1JOJ A;  4CYD A;  3S6P A;  5IW0 A;  1HKD A;  2W46 A;  3FUQ A;  3ZMN A;  5BY5 A;  2XON A;  4JQR A;  1YQ2 A;  3WNL A;  1QJY 3;  2Q8O A;  3MV0 1;  1CAU A;  3VHP A;  5CFD C;  1PMH X;  4FI9 A;  1AR6 2;  1RUI 3;  3N7J A;  2MEV 1;  3WZ1 A;  5L19 A;  1NX9 A;  2ET1 A;  4YG6 A;  4LBJ A;  5K9Y A;  4H55 A;  3IB3 A;  2BEO A;  2DYC A;  2Z5W A;  4FPC A;  2QKD A;  2RS3 1;  2W91 A;  4B29 A;  3FX3 A;  4I0B A;  1Z7S 1;  3SCF A;  4ZKT B;  3BU7 A;  4GUL A;  4OCT A;  3WV6 A;  1WW4 A;  4RYD A;  5I0U A;  1SLT A;  3P1I A;  4ZU5 A;  1MR5 A;  2Y34 A;  4UAP A;  5CA6 A;  4QX0 A;  3DN7 A;  2OVU A;  3D3A A;  1UWW A;  3LEK A;  5DPN A;  3POB A;  5GZE A;  3J9S A;  2R1D A;  1PGS A;  2OXB A;  1V9U 1;  3AVR A;  3LA2 A;  3UV9 A;  5ABJ C;  1YNA A;  1ZBA 3;  1FYU A;  1YRZ A;  1W8H A;  5FZH A;  1V70 A;  4X8N A;  2VNV A;  5FPU A;  1DQ1 A;  1WLW A;  1CZT A;  3GCW A;  2IXL A;  1OOP B;  2VU9 A;  4XEZ A;  3WT3 A;  4BXF A;  1NZI A;  2W08 A;  3WR0 A;  2UUR A;  1SLI A;  3LSE A;  4YNI A;  2W95 A;  3JD7 1;  3J8F 2;  4WM8 A;  3UGH A;  3USU A;  2JE9 A;  5T55 A;  4F8A A;  2D93 A;  2DCK A;  1DQ6 A;  3RSJ A;  3OSD A;  2OPW A;  4BK5 A;  4CA9 A;  1ZYB A;  4N43 C;  2KD7 A;  3MUY 1;  1DGR N;  3ETQ A;  1ZZ8 A;  5C9A C;  1W6P A;  1ENR A;  2WAO A;  2VQ0 A;  1DHK B;  2A3X A;  4YZ1 A;  5FMD A;  2J42 A;  1DP0 A;  5K8S A;  4CU7 A;  4E2Q A;  3K4D A;  3TB0 A;  1CIY A;  1OHF A;  1ZVF A;  4NRP A;  3ZFF B;  4FOY A;  5L9R A;  4XF4 A;  1UMH A;  5CAD A;  5HXV A;  3TN9 3;  1LNS A;  4LUM A;  5LA2 A;  1YO8 A;  3ZFG C;  2Q1F A;  4YG3 A;  4O9E A;  5G05 L;  5AFB A;  5IAV A;  2YU2 A;  4MAD A;  4QPG B;  3WP5 A;  1H1A A;  4K21 A;  4CZS A;  3MZH A;  2A6Y A;  2W92 A;  5BNO C;  1RED A;  4Q8K A;  1ODM A;  2EF6 A;  5F5A A;  1XYP A;  4E4S A;  3IN9 A;  3P3N A;  4YGE A;  2D6O X;  2X09 A;  3ITQ A;  2VMD A;  2BGC A;  1CD3 G;  1ASJ 1;  2ZKN A;  4TXW A;  3DYO A;  2WAA A;  4AI8 A;  3H1W A;  3AYC A;  3WF3 A;  1B35 B;  4JDN A;  2GAU A;  1FI2 A;  4HN0 A;  3T4H B;  4UFJ A;  5C8C C;  4XJW A;  4PF1 A;  1AZD A;  4UW5 A;  3ZXF A;  3ME2 A;  4IEQ A;  3WG2 A;  1VRH 2;  1YQ6 A;  1CQ9 A;  2V5Y A;  2WSV A;  2JIJ A;  3HN3 A;  3OGV A;  4OI1 A;  5HPO A;  5FYY A;  4IV1 A;  3MW4 A;  5FYB A;  2NM1 A;  3WXP A;  3DKW A;  2VZU A;  4R8H A;  4QKB A;  5FMO L;  3HD8 B;  4EZ4 A;  1DQ0 A;  1TME 3;  3DEC A;  3OD0 A;  5AFE A;  5JZG B;  4KU8 A;  4GQ7 A;  2FD8 A;  2BNN A;  1OF3 A;  4FPH A;  1Q43 A;  1IGO A;  1WZX A;  4N7I A;  4PIY A;  4WVM B;  2GH8 A;  4AVC A;  5K0U C;  1G9F A;  4XAC A;  1C57 A;  1S2E A;  1VBD 3;  3O14 A;  2BQP A;  2VPV A;  5EWS A;  1E5H A;  2OS2 A;  1UY4 A;  3VKO A;  2PFW A;  1WWY A;  2WN3 A;  1FPN 2;  2JIC A;  3KV6 A;  4HKO A;  4DIN B;  4DRR A;  1RUJ 1;  1HDK A;  2VBP A;  3ALQ A;  3J7M A;  3MPB A;  5A7W B;  5LEJ A;  1VP6 A;  3VZN A;  1Q8S A;  2JDZ A;  3H1M A;  4PT6 A;  3URF A;  3BOP A;  1PVX A;  3OYW B;  1VRB A;  3PLQ A;  3D0J A;  3VDA A;  1HV0 A;  2HEY F;  2QZ3 A;  2BBA A;  2YBP A;  1KJL A;  3QOP A;  2R7E B;  3TOJ A;  5L9V A;  3BTY A;  1PNG A;  1L3J A;  1XBF A;  2ZJC A;  4GZ9 A;  3UKV A;  5DDJ 2;  3VBH C;  2UU8 A;  3ZN6 B;  2P2K A;  1OOP A;  1X7N A;  3SCH A;  3Q9O A;  4G9S B;  5A3O A;  1OA4 A;  2BGP A;  1R09 2;  2JD4 A;  1XJA A;  2WNV B;  3HPN A;  2H6B A;  1OF4 A;  2C1F A;  2JWP A;  3KCY A;  2C5D A;  2IXC A;  4JTO A;  3RFR A;  1FNZ A;  1HB1 A;  1UYX A; 
#chains in the Genus database with same CATH homology
 2ORZ A;  4D0Q A;  3WNN A;  2EIB A;  3AC0 A;  3CDZ B;  1JU4 A;  4ZZ8 A;  3T2Q A;  3NJV A;  5G04 L;  2J1T A;  3T0A A;  2W94 A;  3FHA A;  5LCW L;  1JU3 A;  3T0B A;  2LW8 A;  3WNM A;  3VDB A;  1JZ7 A;  2DCJ A;  2LS6 A;  3W5N A;  2J1R A;  4A4A A;  1GOF A;  1SG3 A;  3ABZ A;  1XC6 A;  3VD5 A;  1NKG A;  1OD3 A;  4BJ0 A;  1SDD B;  3SKV A;  5JUV A;  3K4A A;  4ZY9 A;  3ACF A;  4MOA A;  3JXS A;  2EIE A;  4CU9 A;  3VD7 A;  2VME A;  2OKX A;  2YC4 A;  3HNM A;  2WO3 A;  2W3J A;  4LKS A;  3DYP A;  2VCC A;  3T2O A;  4XZU G;  1UYY A;  4A3Z A;  4BDV B;  3EB7 A;  1OT5 A;  2J1S A;  3DYM A;  5HXM A;  1L7Q A;  3HNY M;  5EJ1 B;  4W50 A;  2QQM A;  3SKJ E;  2B4K A;  1UY2 A;  2VZ3 A;  4MO3 M;  1OH4 A;  2VZO A;  4QDQ A;  5JXG A;  2XOM A;  4AAX A;  1US2 A;  4QX1 A;  1NUK A;  2VZS A;  4QB2 A;  3J7H A;  4LPL A;  4ARX A;  3UES A;  4AG4 A;  1EUU A;  1DLC A;  2EIC A;  1BHG A;  2QQO A;  1K3I A;  4A45 A;  3ACI A;  2WUH A;  4P5Y A;  5LA0 A;  3WF2 A;  3I2I A;  4MGQ A;  3I2J A;  2E26 A;  4JX0 A;  5JMO A;  2W1W A;  5EJZ B;  2C9K A;  1J83 A;  2QQJ A;  2ZEY A;  2HLE A;  5CZK A;  5DQ0 A;  2ORX A;  3I3E A;  2VMF A;  2W1Q A;  2WDB A;  4XUT A;  2VC9 A;  4DXT A;  2VM9 A;  3K46 A;  5IHR A;  2CDP A;  5IJR A;  3WF1 A;  2WN2 A;  2JKX A;  2CDO A;  1P8J A;  1HN1 A;  4E8D A;  2JE8 A;  3K77 A;  2RVA A;  2W1U A;  2VQU A;  1O59 A;  2W1S A;  1UMI A;  3I97 A;  3OB8 A;  3ZM8 A;  3C7E A;  3T08 A;  1WCQ A;  5B4N A;  4OUE A;  2DDU A;  2YFU A;  3FHQ A;  1W9S A;  3I3B A;  3BN6 A;  2ZEZ A;  4QB6 A;  2W5F A;  2BGO A;  2QBX A;  2Y64 A;  5C7G A;  3FL7 A;  4DUX A;  4JKK A;  4CU6 A;  2VZV A;  4M4R A;  1W0N A;  3T0D A;  3OEB A;  2YG0 A;  1TVG A;  4CVU A;  2B9V A;  3UET A;  2X10 A;  1GU3 A;  1JZ5 A;  1UYZ A;  4P02 B;  2ID4 A;  4P08 A;  3SEE A;  1NAE A;  2E31 A;  4BXS V;  5JR2 A;  2W47 A;  3HJR A;  1PX4 A;  2Y6G A;  3NJX A;  1TG7 A;  1H6X A;  1GMM A;  1XPW A;  1F4H A;  4KMQ A;  3GXU A;  4P00 B;  3HEI A;  3I2K A;  3I2H A;  1GQP A;  4RN5 A;  4CU8 A;  2QQN A;  4LHS A;  1US3 A;  1GNY A;  3LEI A;  5I0D A;  4Z2A A;  5DMY A;  2Y6J A;  4DEV A;  2ZXQ A;  3K4Z A;  2VOT A;  4KWU A;  4XUO A;  3MUZ 1;  2J1U A;  3ETP A;  4GWI A;  3C8X A;  5JXH A;  3GGL A;  4OMD A;  2RJ2 A;  2VZP A;  1JZ6 A;  3I3D A;  3NQH A;  1H6Y A;  1IQD C;  1MPX A;  1PX3 A;  1W8N A;  3WSO A;  1UY3 A;  4A41 A;  3A7Q A;  1JI6 A;  3III A;  4QDS A;  4QDR A;  4OMC A;  2V72 A;  4QX3 A;  1SHW B;  1DYO A;  5B4X A;  3THC A;  5CYY A;  4E8C A;  2VR4 A;  2VZR A;  1XNT A;  5IFP A;  1W99 A;  4OZO A;  1ULP A;  4DXS A;  1K42 A;  3A23 A;  4W8J A;  2X05 A;  3T09 A;  5C71 A;  4XUP A;  1GUI A;  4LQR A;  2JD9 A;  4CUC A;  4D8M A;  4XUR A;  3BGA A;  3ECQ A;  3HOB A;  2QQL A;  1F4A A;  4TTG A;  2WQ8 A;  3CMG A;  2VQT A;  3P6B A;  4A6O A;  4DUW A;  1RYY A;  2W87 A;  1O8P A;  3CKH A;  2E32 A;  3MO4 A;  3LEG A;  2ZEW A;  1UY1 A;  3UNP A;  2BER A;  4JHZ A;  1EUT A;  1XNA A;  3NRU A;  3IDA A;  3WNK A;  3VD3 A;  2C4X A;  5DN2 A;  3T2P A;  2V5D A;  5A1A A;  3WQB A;  3VDC A;  3PUI A;  3SEP A;  1K45 A;  4OYU A;  2VMC A;  3HNB M;  2Y6L A;  2XQX A;  3CIH A;  3WEZ A;  1T2X A;  2VCA A;  5J1X A;  2VZT A;  4L0P A;  4BK4 A;  2J7M A;  2J1V A;  4A42 A;  1J84 A;  3ACH A;  1WKY A;  5IFT A;  2VCB A;  2Y6H A;  3IAP A;  3OG2 A;  3CZU A;  1UZ0 A;  4JKL A;  3FN9 A;  1K12 A;  1O8S A;  2W9X A;  2QQI A;  4M4P A;  1JZ2 A;  3OGR A;  2ZEX A;  5JXJ A;  3F2Z A;  2BZD A;  5IYY A;  1PMJ X;  2W46 A;  2XON A;  2YB7 A;  1YQ2 A;  4ZXE A;  3WNL A;  2WAB A;  3LE0 A;  2WBK A;  2PQS A;  3MV0 1;  5F7U A;  3LPF A;  1PMH X;  2RV9 A;  4FI9 A;  4UI9 L;  1UXX X;  1NX9 A;  1JHJ A;  2VZ1 A;  2HYX A;  3IB3 A;  3C7F A;  1W9W A;  4KI5 M;  2W91 A;  4RYD A;  3WNO A;  2VZQ A;  3P1I A;  3GDB A;  3VD9 A;  4UAP A;  1I5P A;  4QX0 A;  3D3A A;  1UWW A;  3LEK A;  3NNG A;  5DPN A;  2Y6K A;  4QB1 A;  1JZ8 A;  2VL4 A;  1GOG A;  1CZS A;  3I2G A;  4ZZ5 A;  3MV1 1;  1D7P M;  2WZE A;  3W5M A;  2JDA A;  1CZT A;  3EYP A;  2YC2 A;  2J22 A;  2W95 A;  3K75 B;  4XUN A;  5C70 A;  2DCK A;  4BK5 A;  3THD A;  2KD7 A;  4YPJ A;  3MUY 1;  1UX7 A;  2WAO A;  3OEA A;  4CUB A;  1W8O A;  1DP0 A;  4CU7 A;  3K4D A;  4ET7 A;  1CIY A;  2C26 A;  3CZJ A;  1W9T A;  1UMH A;  4QAW A;  3U37 A;  1LNS A;  2V4V A;  5LA2 A;  5LA1 A;  4ARY A;  5G05 L;  3C7G A;  4MAD A;  5EIY B;  4DXR A;  2VTF A;  2W92 A;  4CUA A;  3OGS A;  2X09 A;  1KGY A;  2VMD A;  1JYN A;  3PUH A;  1JYV A;  3I2F A;  4TXW A;  3WF4 A;  4DEQ A;  3DYO A;  3ACG A;  3LQC A;  4UOJ A;  2WAA A;  2WYS A;  2QQK A;  3WF3 A;  3GM8 A;  5FUI A;  2J1E A;  3WF0 A;  1JYW A;  4PF1 A;  3A21 A;  3E1F 1;  1GOH A;  4PQQ A;  3MBW A;  3HN3 A;  2J1A A;  3OGV A;  5HPO A;  3C7H A;  3C7O A;  2VZU A;  1JZ4 A;  2WO1 A;  3VD4 A;  2Y8K A;  4XVH A;  1ULO A;  3DEC A;  2Z4F A;  3IAQ A;  4GWJ A;  2L9L A;  1OF3 A;  2VO5 A;  1R64 A;  4IUG A;  4MGS A;  4HG6 B;  4XUQ A;  1JYX A;  3A22 A;  2YFZ A;  1UY0 A;  1UY4 A;  2WN3 A;  3OBA A;  5JXI A;  3CQO A;  2WZ8 A;  4QX2 A;  4PT6 A;  2VJX A;  2EID A;  3VDA A;  2BBA A;  2WO2 A;  2R7E B;  4A44 A;  1CX1 A;  2XHN A;  4GZ9 A;  1JZ3 A;  4QPW A;  1L7R A;  1CZV A;  2BGP A;  4JKM A;  3LPG A;  1UXZ A;  4W4Z A;  3HPN A;  2E33 A;  1OF4 A;  1KEX A;  4DUV A;  1UYX A;  3WNP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...