3K77A

X-ray crystal structure of xrcc1
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
152
structure length
152
Chain Sequence
PEIRLRHVVSCSSQDSTHCAENLLKADTYRKWRAAKAGEKTISVVLQLEKEEQIHSVDIGNDGSAFVEVLVGSSAGGAGEQDYEVLLVTSSFMSPSESRSGSNPNRVRMFGPDKLVRAAAEKRWDRVKIVCSQPYSKDSPFGLSFVRFHSPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Oxidation state of the XRCC1 N-terminal domain regulates DNA polymerase beta binding affinity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords DNA repair protein XRCC1
total genus 34
structure length 152
sequence length 152
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2009-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01834 XRCC1_N XRCC1 N terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 3k77A00
4IUGA 2ID4A 1UXZA 3OB8A 1LNSA 2WZEA 1W9WA 3FHQA 2LS6A 2J1VA 4P5YA 3J7HA 2X09A 2J1UA 2C4XA 2WBKA 1CZVA 2VMEA 1K12A 4DXSA 1HN1A 1K42A 2QQNA 2YFZA 1WCQA 1NUKA 2L9LA 4MO3M 4P08A 3VD4A 1PX3A 4ZY9A 4UAPA 2W47A 2VMCA 3I2JA 2J1RA 2W1WA 1UY2A 1XPWA 2VMFA 1GMMA 2VZTA 4DEVA 5G04L 2W95A 4DUWA 4GZ9A 2X10A 1CIYA 2OKXA 3HNMA 1F4HA 2HYXA 2W1SA 3SEPA 5DN2A 5EJZB 2JKXA 3ACIA 3IDAA 2VC9A 4QB6A 4CUAA 2QQOA 2VCAA 3ABZA 3LQCA 4XUTA 3SKJE 3A7QA 1K45A 3I3BA 1UYYA 1UZ0A 3MV11 4E8CA 1GOFA 4W4ZA 3I2IA 4MOAA 3T09A 4BJ0A 2WO2A 3EB7A 3LPFA 4CU8A 1ULOA 2VL4A 5IFPA 2WAOA 3WF1A 3WNLA 1OD3A 5CYYA 1W8OA 1DP0A 2ZEYA 3T0AA 3HN3A 4DXRA 1W9TA 4LKSA 5I0DA 1K3IA 4XVHA 3CZUA 3BN6A 4BK4A 4XUQA 2YG0A 3CQOA 2Z4FA 3ACFA 2WQ8A 3C7OA 2YC4A 2VZOA 2VMDA 4DUXA 3C8XA 3K4AA 2VZUA 3ACGA 1EUTA 4A6OA 4LPLA 4MADA 2QQLA 3FN9A 4BDVB 5JR2A 3HOBA 1J83A 2BZDA 4JKLA 4CU6A 4JKKA 4JKMA 1BHGA 2QQMA 1UY4A 2BGOA 2RVAA 3I2HA 4UOJA 1CZTA 4DEQA 3W5MA 2Y6JA 1GQPA 1L7QA 3K46A 2Y8KA 2J1EA 3WEZA 2CDPA 3C7GA 2JE8A 4QB1A 3MO4A 2J1AA 3BGAA 2ORXA 4QX0A 3ECQA 2E26A 1JYWA 2WZ8A 3T0BA 3FL7A 4XURA 3WNOA 1JZ5A 4Z2AA 3CZJA 3DYPA 2VQUA 5C70A 3IAQA 4L0PA 1TVGA 2VTFA 4PQQA 2WABA 3T2PA 1JZ3A 2DCKA 3OG2A 2VR4A 1SG3A 3GDBA 1OF3A 3C7EA 2HLEA 4QX3A 3OEBA 4W50A 2C9KA 1GUIA 1H6XA 3I3DA 4HG6B 1J84A 2VZ1A 5IHRA 3SEEA 4UI9L 3LEGA 5DPNA 5LA2A 4QX2A 3OGSA 2BGPA 1W8NA 4XUNA 2DDUA 5JMOA 3UNPA 2ZEXA 1UY0A 2WO3A 3CMGA 4BK5A 1L7RA 1UYXA 1CZSA 1F4AA 1H6YA 1UMIA 3P6BA 3U37A 5C71A 4P00B 3IIIA 1YQ2A 3I97A 2Y6LA 2JD9A 5F7UA 1DLCA 1UWWA 3LEIA 4MGQA 2W9XA 4PF1A 3VDBA 2B4KA 3WNMA 1JZ7A 3WNNA 4A41A 1SHWB 1US2A 4PT6A 2W1UA 3MUZ1 5FUIA 3K75B 1JZ8A 1CX1A 2VM9A 4M4RA 3OEAA 2Y6KA 2VOTA 4RN5A 3WQBA 3HJRA 2ZXQA 1TG7A 3DECA 4TXWA 2W3JA 2VO5A 4M4PA 2XOMA 3LE0A 3HNYM 1OF4A 1GU3A 1JZ4A 3DYMA 2E32A 1SDDB 1JU4A 3ZM8A 1GNYA 1KGYA 4CUCA 4XZUG 4OMDA 3GGLA 2QQIA 4GWIA 3A22A 2VZVA 2E31A 1JU3A 3NQHA 2V72A 5DQ0A 4D0QA 1XNTA 3OGVA 2QQJA 4A45A 1GOHA 4W8JA 1ULPA 3OGRA 1O8SA 5C7GA 1XNAA 3ETPA 2XQXA 3AC0A 2W1QA 4LQRA 4CU7A 4QDQA 2W87A 2BBAA 4D8MA 2EIEA 3HEIA 1GOGA 3WF2A 1RYYA 2VZPA 2RV9A 3A23A 2JDAA 2X05A 2WN2A 4DUVA 2J1TA 3WF0A 2W91A 5B4XA 5EJ1B 4JX0A 2KD7A 2VZSA 5G05L 3ACHA 3CKHA 1O8PA 3NRUA 4QX1A 4LHSA 3HPNA 2YC2A 5JXJA 5DMYA 1O59A 4QAWA 3PUHA 4ET7A 1JZ2A 4YPJA 1IQDC 2XHNA 3T2QA 4CU9A 3NJXA 4AG4A 2W5FA 2VQTA 2EIBA 4E8DA 3F2ZA 3I2FA 3C7HA 3CDZB 3VD3A 4ZZ8A 2WUHA 3C7FA 5EIYB 2DCJA 2V4VA 1WKYA 4OYUA 3P1IA 2VZ3A 1UX7A 4QB2A 2LW8A 4GWJA 2WDBA 4JHZA 3MUY1 1P8JA 5A1AA 2ORZA 4KWUA 4TTGA 1T2XA 1MPXA 2WN3A 2E33A 5JXIA 2Y6HA 2V5DA 3HNBM 2YFUA 2PQSA 2W46A 2Y64A 2EIDA 1D7PM 3OBAA 3CIHA 3UESA 1W0NA 4QDSA 1PMHX 3SKVA 5JXHA 1JYNA 3WF3A 3VD9A 2QBXA 1JHJA 2RJ2A 1UMHA 1NKGA 3IAPA 5HXMA 4DXTA 2WAAA 4A44A 2VZQA 2Y6GA 4OUEA 2EICA 5IFTA 2VZRA 5LCWL 4A3ZA 4RYDA 2C26A 2J22A 3THDA 3A21A 3K4DA 1W9SA 3T08A 3WF4A 3E1F1 2ZEWA 3PUIA 5LA0A 3K4ZA 5B4NA 2J1SA 3MBWA 5IYYA 3WSOA 4QDRA 3T0DA 3JXSA 5HPOA 3T2OA 1PMJX 1JZ6A 2B9VA 2W94A 4BXSV 3WNKA 4XUPA 4KMQA 2W92A 4MGSA 3UETA 4XUOA 1EUUA 2VCBA 3I2GA 4QPWA 4P02B 5LA1A 4OZOA 3MV01 2WO1A 3WNPA 5JUVA 2QQKA 5IJRA 2J7MA 2BERA 4ZZ5A 3LPGA 3VDAA 3IB3A 1UXXX 1DYOA 2VCCA 2XONA 1UY1A 3DYOA 4OMCA 4ZXEA 1US3A 3I2KA 5CZKA 1JYVA 1OT5A 4AAXA 3NNGA 2WYSA 3FHAA 3GXUA 5JXGA 1XC6A 3LEKA 4A4AA 5J1XA 4FI9A 1UY3A 1JI6A 1W99A 4KI5M 3NJVA 1NAEA 2VJXA 4ARXA 1KEXA 2R7EB 1PX4A 3K77A 1UYZA 4A42A 3THCA 3W5NA 1I5PA 2ZEZA 3VD7A 3I3EA 4ARYA 3EYPA 1JYXA 4CVUA 1NX9A 2YB7A 3GM8A 3VD5A 4CUBA 2CDOA 1R64A 3D3AA 1OH4A 3VDCA
chains in the Genus database with same CATH superfamily
3ON7A 4GQ7A 1O6UA 3BIWE 4Q4W1 2WS92 1V70A 1ZZ9A 1UXZA 4XFCA 5KHHA 3NL1A 2VD7A 4B7KA 1AR62 4JGZB 2YU1A 3GBGA 1IKQA 2DBNA 1RVF1 2J1VA 2JJ6A 4HKOA 4P5YA 5FTTC 4XBNA 2VMIA 4BIFA 3EHKA 3D82A 3VBUB 1ONAA 1OLME 2R041 2WBKA 4C1XA 1YJKA 2JWPA 1YLLA 2ZA9A 1UL9A 1QIQA 2VW1A 2YFZA 1WCQA 2HWD1 3ZKUA 1NUKA 4HN0A 4JGZA 4MO3M 4UFKA 4YW3A 1J3PA 5FREA 1MZ5A 1RUH2 1PX3A 3DKQA 1B35C 1K5JA 2W1WA 1AR91 1O5LA 2GN7A 4CEYC 2VU9A 3FX3A 1VBA2 2D5HA 4QPGB 4YW2A 3WV6A 4XFAA 5JAXA 5KXDA 2Y34A 1LGCA 4E27A 4Q0VA 4UW4A 4C1WA 4META 4DUWA 4GZ9A 1W6NB 4N9IA 4Q8KA 4LA2A 3JD73 1J1TA 1Q5OA 1TME1 3OBRA 5FKBA 4ATFA 5JI9A 2PLV1 2E51A 2RS11 1H4HA 2TEPA 1OC1A 4GWNA 2ZZQA 3SEPA 5T50A 1DQ1A 3MIFA 5FZ4A 4AR2A 5L19A 2BW8A 1JOPA 2NYYA 1BQPA 3IDAA 2OA2A 2H6CA 1KDMA 2QQOA 2DWRA 2AZ5A 3MF6A 3EQEA 4HK9A 1W6NA 3MI8A 2NM1A 3ABZA 1GYKA 1SEFA 1GZWB 3LQCA 4CDUC 4E2SA 1MZ6A 3TNPB 1OLMA 3M2MA 4J1WA 1GP6A 3QOPA 5FZ6A 4Q0QA 3VLBB 1BXHA 4FQZA 5J48A 1FOD2 4Q4V3 2B42B 1D4M1 3I7DA 4BJ0A 3H1WA 1O3TA 1IGOA 3HT2A 3ZX7A 4OULA 3ZSMA 3OY8B 2IFRA 2ARBA 2Y0IA 3GF6A 3QCWA 3TN92 5KR7A 3RI9A 1NE6A 2TNFA 4PDWA 2YZ4A 5CYYA 3AYEA 4CDWA 1DP0A 2B7YA 4LHLA 4S2HA 3CNAA 2WIIB 3T0AA 5AC93 3WDYA 3DUIA 4DXRA 4B4RA 2OYZA 4D7TA 1MEC2 4YARA 1RUI1 4XVHA 2MPFA 2XJVA 1NE4A 1RHI1 2XJUA 2XJTA 2P4EA 5I0TA 1ZA7A 5ACA1 1GQGA 3C7OA 1JOJA 3KSCA 3NNLA 2D6KA 4C91A 5I8TA 1H9WA 5FOJB 3AZZA 3KT1A 2ZMLA 3K4AA 4Z8BA 3WHTA 2VZUA 4CDXB 4A6OA 4HL0A 2WFF3 4LPLA 1WZXA 4HONA 5LEKA 3NKTA 4NE9A 4I09A 5EQUA 2QQLA 1KFXL 4P9GA 3FN9A 2WLPA 5FY4A 4BDVB 5HXVA 4NPLA 1C8M3 5EWSA 3ZYPA 1J83A 2OPWA 4CU6A 2Y33A 4EWEA 4FPKA 2E7AA 4FTBA 4QX8A 1W8WA 1HLCA 4Q4W3 2PHLA 4Y5SA 2Z69A 1VPHA 2VVEA 1NA1B 4LO6B 4YW1A 4DEQA 4OHYA 1QJU1 2VULA 4NOTA 2Y6JA 3LFMA 1W03A 5EFUA 3OBTA 1OFSA 2FDHA 1NCQC 4AQSA 2ERFA 3CJIA 5A32A 2O1QA 2AEZA 3M1HA 3WEZA 4CDQB 4E4ZA 3RJ2X 2PHDA 3KVAA 3MO4A 4FPOB 3N4MA 1HB4A 3BGAA 1RUC1 2PAEA 4FFHA 4HMZA 1DGWA 1VRH3 3ACLA 2EXKA 2NZ9A 1OQ1A 2ZAHA 5A3NA 2IFWA 5E88A 2WINB 2JB8A 3ZN4A 5ANQA 5M0TA 4FTEA 3ZMOA 2JEMA 1SDWA 3CEWA 3LCPA 4Q1PA 5C70A 2PXJA 4KWLA 3TEWA 4MGTA 4JDNA 3FE5A 3J7NA 1HV0A 1H8VA 2DCKA 2Q1MA 4HKWA 2A6YA 3GDBA 2JDKA 4N43A 2HLEA 2HYKA 4Q1RA 5JOWA 5FMBA 5DAVA 1RUC3 3OD4A 1ASJ1 1HW5A 5HV4A 1AX1A 2VZ1A 4NIHA 3SEEA 5L9VA 3MLLA 4ISQA 4WV8A 3J8F1 5KXBA 1D2SA 3NNMA 4QQ2A 4IV1A 4AYUA 3KB5A 3H3UA 5DPNA 4QX2A 3MF9A 3OGSA 1LAJA 4Q4X2 3LOBA 2R062 4Q0SA 4NHYA 1ND2B 2ZBJA 4LHKA 3N35A 5H9QA 3ZFEC 1W8NA 4L11A 4LBQD 4UFLA 5H9SA 1Q8PA 2QUOA 1PIV2 2GSYA 3KZ4C 3T1LA 3KT4A 2BNOA 1PGW2 1H4GA 2WO3A 4YM2A 1L7RA 5FQ0A 4OQ9A 4FOYA 3VBUA 4E9KA 1HV1A 4PQ9A 3WG2A 5L9RA 1F4AA 5FPLA 3WX5A 3M3IA 3R4UA 3AKTA 5AC92 1QJFA 2NQYA 4OUMA 1CESA 4I0AA 3U37A 2ENRA 2C6SA 2ZHLA 3EO6A 3GZEA 4TN7A 4XDPA 5CG9A 1WA4A 2XQRA 3NAPB 2NMOA 4H55A 4A7YA 3ZIXA 5KC5A 2Y6LA 2VOXA 2AR6A 1OVSA 5BYNA 2W9XA 3AKRA 2VTXJ 1AR81 2FHRA 3DXTA 3AK0A 2WQ4A 1VRH1 4NVPA 2ZGTA 2B4KA 2VVDA 3NNFA 1SPPB 1BEV2 1XYOA 4DZGA 3LA7A 2DYCA 5DUVA 3RZHA 4ZONA 1EAH2 4COWA 1LB2A 1US2A 1N1TA 4Q8LA 4CXXA 5FP7A 1QJX3 2DF7A 4HSLA 3I3MA 4IESA 3R05A 5F3IA 2VM9A 2JG8B 2GC1A 1REFA 2PTMA 4NPMA 3LAGA 3HJRA 2VAUA 4KGQA 1UQXA 4LBLA 3AP9A 3VN4A 4GJZA 2YC0A 5FLHA 2C1FA 1YCIA 4M4PA 5F5CA 1C8M1 1RUE3 3MW4A 3LE0A 4DRVA 1DQ6A 1VBC2 2DTYA 4LT5A 1GU3A 1LU2A 2R16A 4FTSA 3ZSKA 1AYN2 2HJIA 4YZ5A 1JTZX 2O8QA 5APAA 2WFF1 4XOGA 3OY8A 5FMDA 1GNYA 1KGYA 3V56A 5BUVA 5GZDA 2XUEA 3JQWA 5A33A 4CUCA 4LBMA 4XZUG 1HN0A 1REDA 2VY0A 3GGLA 1XSRA 4GWIA 1UKRA 4E2QA 5JSPA 4JTNA 1MS5A 5D8AA 1RHI3 5FAXA 5ACA3 2NN8A 2WNUA 3EMRA 5K4LA 1NXD1 4BU2A 1RUI3 1AR61 2G9GA 3VZKA 4FAGA 2DFBA 1UD1A 2V72A 5DQ0A 5LW9A 2UU8A 1RVF2 3KHBA 1GOHA 3DPRC 2D7FA 4LIUA 1IG0A 1F35A 2ZGRA 3ZMNA 4LOTA 4W8JA 4LUMA 4CP1A 3OGRA 1O8SA 4YVWA 5LBFA 3HMYA 2WA4A 4RGAA 2OUJA 5KC6A 1QH7A 1LOFC 2DVGA 4YGCA 4BM8A 4RA0A 4JGYA 5LK7B 2VG9A 1S2BA 1NQDA 1X8EA 3TRSB 2XQXA 5EJ3A 1DGRN 2EAKA 1CR7A 4BQ4A 1O4YA 2ET7A 4NIAA 5L7OC 5FMOS 2BVVA 3T1MA 4BA6A 1QXRA 1RVF3 3AKPA 1H8TC 2RG4A 1V6KA 4D8MA 5A6ZA 2BVBA 1EYBA 2A70A 1IKPA 2ZX0A 1HB2A 2XVGA 3NW4A 1RUE1 2TUNA 1PNFA 4K1YA 5JDBA 2VZPA 5FZDA 1HQNA 3F95A 4LLFA 5JIAA 2X05A 3ZO0B 2OXBA 1UIJA 5IK5A 2CV6A 1VE0A 2D3PA 3WF0A 5JSOA 4NIDA 5EJ1B 4AEDB 2VZSA 1TME3 4Y4RA 1FNYA 2QQUA 3RI8A 2TBVA 4B29A 2HEYF 2UWAA 4F3JA 1RC6A 3RMYA 1V00A 1Y7BA 2WL1A 3GZAA 4GALA 4QQPA 5EHDA 5CISA 1T6GC 1DDLA 1JODA 4GMP1 3USUB 2QJVA 3NRUA 2ZGUA 4LHSA 1YHFA 3HPNA 4QM9A 1E57A 5FO8B 2ARXA 2RMU1 2XVLA 3H3ZA 5FPAA 3USSA 1W2AX 1UO9A 1S0CA 4ET7A 1JZ2A 3Q9OA 4XF3A 3T2QA 3JD72 4CU9A 1W3VA 4TWTA 1NT0A 5LZ6A 2EIBA 5IVEA 2R043 5CAZA 3HVDA 3ENRA 2OPKA 4Q26A 3UKNA 3F2ZA 3I2FA 3RYKA 3DKWA 3CDZB 2RS33 5CFDB 4MG2A 5CFCB 1OKQA 1POV0 4AI0A 1F5FA 1HXS2 2W2IA 5C9AB 1RUD1 1UOFA 3C7FA 2KXLA 5C3QA 5A70A 2E6VA 2WSVA 3NO8A 3CU7A 2VNOA 3M8LA 3IMMA 3P1IA 5LATA 1ZNPA 4AHZA 2WS91 1S1AA 4FFGA 2F4PA 1O91A 2FDGA 4QPGA 2CYFA 1BK0A 5A7NA 4GWJA 5C8CC 4UF0B 1YO8A 5C4WC 5KXEA 2WDBA 1HRI2 4GKYA 1LOAA 1NZIA 2G1MA 3MUY1 1P8JA 2ORZA 1LKNA 2VW2A 4TTGA 1T2XA 1WW5A 2VUJA 2WN3A 4BQ1A 2UYBA 2Y6HA 2D6OX 1SBDA 5F5IA 2F4LA 4CDWB 4EYUA 1SFNA 5FK7A 2WZR2 3SNMA 1ZA4A 4LK6A 3O0XA 5F5QA 5A3UA 3WCRA 3MYXA 1ZREA 4QDSA 1PMHX 5FZIA 1UF2C 3SKVA 3MW3A 1I1EA 4FAHA 1DQ4A 3SXWA 3KM5A 4LIVA 1PVXA 2VBBA 5HXMA 4DXTA 3TAYA 2WAAA 1TQ5A 3PVBB 1PVC1 2QVSB 2P17A 1UU5A 3WUDA 1YQCA 2E7QA 4G9SB 3WDXA 4N90A 2VZRA 5JPNB 4A3ZA 4RQPB 1OH3A 2WNEA 4YG3A 5FFOC 4EJRA 4FXGB 4IEPA 4RYDA 3N7MA 4PDWB 4PLNA 5FWEA 4H14A 1NCQB 1NXMA 1BVP1 2J22A 4N53B 3A21A 4Y1XA 4JTOA 1GZ9A 3LA2A 5L73A 3RZZA 4LE3A 1U5XA 4HT1T 1VBB3 2E53A 4YFZA 4XBLA 3AYCA 5IYYA 5FXWA 3DPRB 1AR71 4QDRA 4ONUA 4CDQA 5IVVA 3O0VA 3T2OA 5HPOA 2A75A 1Y43B 4YW4A 3O1TA 3AMQA 2GNBA 5I8SA 1LGNA 1JZ6A 3N9QA 2XBO3 5BNPC 3AP6A 4BXSV 1LOBA 4YW7A 4XUPA 1XNKA 3FLRA 2PYTA 1DZQA 4Y20B 1G9AA 2W92A 2R30A 1QOOA 3V64A 5A33B 1NCRC 2JG8C 1JXNA 2UWCA 1LJ7A 1XRUA 1AYM2 4YVSC 5B2GB 3I49A 1CX4A 2LRPA 3PVEA 4GA9A 2VOVA 4EWDA 3H8OA 1VBD2 2YYOA 1IS5A 1PO22 5FDBA 1QMJA 5CADA 5IJRA 3NVCA 4XAEA 1LULA 1RMU1 4R52A 3AKQA 5GZCA 5K0UC 4JAAA 1C5IA 1AJKA 1HB1A 4DINB 2GU9A 3IB3A 4BZ4A 2IUWA 1DYOA 1RXGA 1MS4A 1YJLA 2XONA 1UY1A 3B5LB 4NN0A 4CCLA 5AC91 1JN2P 5CZKA 5LRRA 1AR63 2IVIB 2P1BA 4EE2A 3RYRA 4AAXA 1BKZA 4Z82A 3JBG1 1LEMA 3FHAA 4M00A 4AVTA 3QLQA 4A4AA 2BWCA 5D21A 5J1XA 2ARAA 2IVJA 1DG6A 1D4M3 5C33A 1W99A 4NUBA 2XWJB 1FYUA 1OI6A 2Z42A 3GCWA 1LESA 2VMGA 3NJVA 4KI5M 5JI7A 3UGHA 3ZSLA 4ARXA 4FBFA 4QHOA 3GCXA 2GDFA 3WLUA 1KEXA 4CDQC 3RWKX 2PAKA 1BEV1 2P6CA 4D94A 3V0AB 1ZVFA 1A8MA 1HJFA 1JYIA 2HWB2 3W5NA 2ZEZA 3VD7A 4XDOA 4XTPA 4Z07A 2NP0A 1PMIA 4UFJA 4QM8A 3RGBA 4AFAA 2WO7A 4MX3A 1SLLA 1O4ZA 4PCRA 5LASA 2BOJA 3AL6A 4IUGA 5F2SA 4D7YA 1CAVB 1R082 3LA3A 3VDDC 3OPZA 1QJX1 4ISRA 2Q0AA 4KQ7A 4R4XA 1AL22 4QXKA 4W65A 1XE8A 5JSRA 4AVAA 2KR2A 1A78A 1YFWA 1W9WA 1FAYA 2LS6A 2QTWB 4LBNA 2JDUA 1TZOA 1U5ZA 2X09A 1QXPA 4MUVA 2JB4A 2WWSA 1AR83 2R072 2Y38A 1CZVA 2JE9A 2VMEA 4D6RA 4DXSA 1HN1A 1W2NA 2HWD3 2QQNA 3J9SA 2YHJA 2BEOA 1A8DA 4D69A 1QDCA 3RJRA 4RS5A 3DV8A 2JIJA 1QOSA 3KGLA 3VD4A 5GLZA 3KVBA 5E6HA 2F6BA 1XJAA 2VH9A 3I2JA 4J6GA 2J1RA 1NY72 2SBAA 4UW3A 1XPWA 2VMFA 1GMMA 4MXWA 2VZTA 5I0RA 5DAPA 1BZWA 1W6PB 2RS51 2YY1A 3H7YA 5C4WA 2QQWA 2XWBB 4UWDA 4CSWA 1S55A 3NWKA 1W39A 3L2YA 1X82A 3HNMA 2CGPA 4K21A 3ZSEA 4AEDC 1CAWA 3WT3A 3IPVA 2XJQA 4K20A 1DGWX 1RUJ3 3D0JA 3C3VA 3ZDVA 2BGCA 5LY2A 3UYJA 5DN2A 1QOTA 2JKXA 5EJZB 3CLPA 3ACIA 5SV8A 5EV7A 2BV4A 2VC9A 3D4KA 4QB6A 1MVEA 4ZXKA 2VCAA 4CUAA 1SLBA 2DUOA 3AVSA 1D0GA 2VPVA 2ADEA 1UOBA 3SKJE 1ZYBA 5KHJA 3A7QA 2XXZA 1L3JA 1K5MA 1UYYA 2WS93 3HT1A 4YZ3A 1UZ0A 4G3YC 3O1OA 4MGKE 4EN7B 1SLTA 1H1AA 3I59B 3MV11 4FPFA 1FMD1 3I2IA 5ABJC 4OZXA 2CGNA 1Y9GA 3LPFA 4YSFA 4WM7B 4CU8A 3IBMA 4WVMB 2D5FA 1ULOA 2VL4A 3Q8FA 4JGYB 4OFGA 1B35B 1AL0G 4ZS2A 5FWJA 2WAOA 3VHPA 1K5MB 1NCRA 2OIIA 2W0XA 4I30A 2WA3A 1NCQA 1Q43A 1W8OA 4PBOA 1WGPA 3Q8EA 1UOGA 3IM0A 5GALA 2Q8OA 4ITCA 4LKSA 1Z7S2 4BE3A 2RR11 1GQHA 3CBNA 5DAXA 2K9ZA 3BN6A 4W6WA 1DYPA 5FZMA 3PIGA 4BK4A 4WM7C 1Y9QA 3H0OA 3ZYRA 2HBUA 2WQ8A 3PIJA 4AGVA 1YIPA 5ABJB 4PI2A 2YC4A 4NAOA 2CY6A 3QH7A 4IEQA 4MVTA 3C8XA 5FMOL 1BCXA 1Z7S3 3DF0A 5F6KA 2JDYA 3ZYGA 1YFYA 4CRQA 4NWWA 4QQOA 5FJHA 1WW7A 4CDUB 3S30A 1Q8QA 4FPCA 5ISLA 1GWMA 5CA6A 2IXIA 2BZDA 1DGRA 3D6EA 4JKKA 3FBMA 4JKMA 1BHGA 3U78A 1FXZA 5GZFA 5T52A 1RUOA 1O3SA 5DUUA 1RUF2 1OVPA 3ZXFA 1NA1C 3W5MA 1D0HA 3LF7A 3SMHA 4EQVA 1VBA3 1X7NA 1GQPA 1ODNA 5KHKA 2Y8KA 3ZKYA 1OKOA 4R8HA 4Y5Z0 4BPZA 4IEZA 3VKNA 3KCCA 4LUKA 3TEZA 4V1PA 3LIGA 1YI9A 3NV3A 3M70A 2UY8A 4QX0A 2XL7A 4YGBA 2E26A 4XQWA 2ZX3A 2XKPA 3V65A 5IVJA 5FMCA 1W6QB 1YYNA 3AP4A 3KHCA 5FUPA 2WC2A 1JZ5A 1F5JA 1I6XA 3FL7A 1LCLA 5DG1A 3WP5A 2QDNA 4K6BA 5LEJA 3DYPA 1AX0A 3VBSB 4ATEA 1PM7A 1Q8SA 4M0HA 5FY9A 4BQ5A 3B02A 4L0PA 3RYPA 1C1LA 1COV1 3I3QA 3V0BB 2VTFA 2WABA 2B9UA 4QPYA 1BK1A 3E6CC 5A7WA 2PHXA 1JH5A 3A4UA 3QACA 4AI8A 2AACA 5I0SA 3DN7A 1ULCA 2JE7A 2UWBA 1FI2A 3D8CA 2NPIA 3N9NA 3OGGA 5T54A 4BLIA 4HG6B 1J84A 4TLGA 3NJYA 3V0BA 1YQ5A 5SV5A 4B1LA 2RDQA 2B46X 4UI9L 4ASKA 1OA3A 1OOPA 1TNRA 2GH2A 5A1FA 4I01A 1DLLA 1KITA 4LO5B 4XJAA 4XUNA 3WP6A 1NYWA 3OUIA 2DV9A 3UGFA 3JD71 4XMAA 5FPXA 3B00A 3MPBA 3U11A 1CZSA 3DEMA 5LBCA 1UMIA 1I9RA 3LSDA 3KMHA 1EY2A 4BWOA 5HBAA 3FZ3A 3PU3A 1REEA 3IIIA 2BQPA 1AJOA 4FFFA 4LLOA 2WFPA 5CNAA 1APNA 1VAKA 2CAVA 1MACA 1RMU2 2YBPA 3I97A 4K7JA 5FY1A 3N9MA 5BV6A 5F7UA 3VGIA 1UWWA 3UJOA 2R32A 3SISA 4MGQA 2CSGA 4PF1A 5I91A 1UN1A 3APBA 3POWA 1D4M2 1UZVA 2AUYA 2ATFA 1H8TA 1CAWB 3OBZA 3WNNA 5A32B 4LO7A 4SLIA 4Q4Y1 3LWCA 2BP6A 2YPJA 5KWRA 3VHOA 1O3RA 5FZAA 3ZXEA 1QXJA 2F17A 2JDHA 4XFHA 3GZUC 4IETA 3AJYA 1GWKA 3MUZ1 4M3CB 4B4QA 1LOEA 5FUIA 1CPMA 1X8MA 2A6ZA 2IC1A 3K75B 4PF5A 5FYHA 4N43C 3RZKA 1RTVA 1PZ8A 2IXHA 3OEAA 2C9AA 2ET1A 2ZXQA 4YVWC 1H8TB 1TG7A 2I74A 2ZKLA 5FZ1A 2G4IA 3DPRA 2VO5A 3LFIA 4M3CA 1ASJ3 2RDSA 1PVC2 3FLTA 2ZGLA 3BOWA 4FXKB 3SCFA 2P3JA 4COVA 3AB0A 2WNUC 5DUWA 3RVHA 3U75A 2E32A 1AYN3 4NRPA 4NRQA 5IAXA 1W05A 1HIXA 2R042 1OPMA 1YI7A 4EROA 4XMIA 1PZ7A 2QQIA 2A6VA 4YGEA 5FXVA 3ZYHA 3RZMA 3A22A 3SCHA 5FZOB 5A6XA 2XPJA 3TNQA 3AXEA 3KT7A 3VL8A 1JU3A 1PM4A 2HWD2 2JXAA 3ZOIA 1D4VB 2OZJA 2C24A 4URTA 1W9YA 2VQ0A 4XF0A 2XR4A 3NQHA 1XB9A 1XNTA 3V0AA 4YYOA 2QQJA 4ZU4A 4OUSA 2BRTA 2VTXA 2RDNA 2A6WA 4KU7A 4FCAA 2HWE3 3VZNA 3BALA 4HANA 1SLAA 5LBEA 1MQTA 1A6CA 3MFCA 5C7GA 1X50A 3WD5A 4L8QA 4P9IA 3S7IA 1DZTA 4DFSA 2RS12 2DUPA 4I3GA 2HWF3 4O61A 3AC0A 3MGUA 1IPJA 3MIBA 4SBVA 2ZHKA 3ZYBA 1POQA 1RUNA 1CPNA 1WW4A 4LBJA 3VBHB 1WLTA 2W87A 2BBAA 5C3PA 1MQTB 2ZMNA 1PO21 4HFSA 1R093 5FBZA 1CJDA 3E5UA 3IDEA 5IW0A 3H8RA 3WF2A 4Z2WA 2RV9A 4OI2A 3KQRA 4LBQB 4NAMA 1RUG3 4HVOA 4DUVA 2J1TA 4QD2A 4CP2A 4OHWA 5FYTA 3ZFGB 4GAZA 2OQ7A 5IVBA 1PIV3 1PZ9A 5FIXA 5G05L 1V0AA 4COUA 5FO9B 2HBTA 1W6QA 1MZFA 1VAMA 3RNSA 3T4HB 2YMZA 3KV5A 1C8NA 3VBSC 1QQP2 1O8PA 2VBPA 4HETA 1RGSA 1FATA 1W6PA 2H6BA 3VBSA 3UGGA 4ZKTB 2P3IA 4QX1A 1ODMA 1ZX5A 2RDRA 1QJZA 2R061 2YC2A 3PUAA 3PTYA 1FMD2 5DMYA 4QAWA 4LKEA 5BY5A 2CU5A 2XHNA 3SHRA 1Y3TA 2X53S 2DURA 4AG4A 1C57A 3U14A 2VQTA 2JIGA 4EN9B 2YU2A 1PGSA 2IXKA 1XE0A 4JQTA 4ORFA 4E8DA 4UF0A 1UZZA 5CG8A 4B3NA 1AYM3 3OCPA 2ZGKA 3N3HA 2XDVA 5CFDC 2ZHNA 1F9KA 2EVXA 3ZR5A 1GZWA 1YXWA 2MHFA 2OQ6A 5EIYB 4XAAA 4CXWA 3Q8AA 2V4VA 4OYUA 3VBOC 1R081 4YGDA 3BI3A 1OLRA 2VQAA 3POEA 1AX2A 1UX7A 3VDDB 3VZLA 3HIFA 4QB2A 4MH0E 3I59A 5BNPB 4LOSA 2LW8A 5C4WB 1S0GA 4KWKA 2CGOA 2WLQA 1SMVA 4WM7A 3VL9A 3WW2A 1G9BA 2XLAA 4KWUA 1H1IA 4Q27A 1MPXA 2GNMA 5LK5A 5HCHA 2E33A 2P5BA 3C2UA 3LD8A 5T3NA 5JXIA 2E63A 3ZVXA 4KU8A 3UKTA 2CHHA 2HWF2 4QQHA 2RS13 3W59A 1AL23 2D6NA 1ENRA 2VECA 5IVFA 3KD4A 4CCNA 1IS3A 4RGKA 4ZPIA 5D1IA 5DZFA 1D7PM 3ZFFB 3CIHA 4QPIB 3UESA 4UBHA 1JYNA 3H3LA 5FPVA 1VMFA 3WF3A 4DY5A 5HCFA 1SFPA 3SQOA 3AX4A 5ABJA 1OPOA 2DTWA 3H9AA 1NKGA 2DVAA 2DVBA 3JQXA 1Z0HA 1VBC1 4D3WA 3RG0A 5KHIA 3KF3A 5A7OA 4A44A 4ASLA 2Y6GA 4XJWA 4M01A 2H0BA 4YM1A 1LRHA 5LCWL 4IEYA 1ZBA2 4B1MA 3M3QA 1MS1A 3P3PA 3WP4A 4Y1ZA 5FZKA 4OI1A 2WZR3 3KF5A 4MV2A 4S2FA 1PK6A 2ZEWA 4E2GA 1E5HA 3W21A 1V9U2 1Y9MA 3PUIA 5LY1A 1S4CA 1ZM1A 4MGZE 3MZHA 1IPKA 3VUOA 2FDJA 1QGLA 1J1LA 1QEXA 1PMJX 3WW1A 5FR3A 3WHUA 2QZ2A 4CCEA 1ULFA 1KFUL 1JBCA 2W94A 4BH9A 4HVRA 3WNKA 1UIKA 4XQ4A 4AGGA 3EJKA 2VNRA 2FMDA 4MGSA 4Q29A 1LHNA 5EZWA 3TEYA 5IVCA 1VBD3 2VCMA 4RS5C 4XYXA 2DFCA 1A3KA 3I2GA 3WDUA 3QD6A 5FBJA 1J58A 1CAXB 1ND3A 2W08A 3FLPA 4H3WA 4U2AA 1DQ0A 4WM8C 5GZGA 4P02B 1W0PA 1W8TA 3O1MA 4OZOA 4COYA 4FO9A 3MV01 3OSDA 2Q30A 3WNPA 1IQAA 3OTFA 1L7LA 1FV2A 4RGGA 1J59A 2HKXA 2VVFA 4Y26A 3I2OA 3FUQA 2XJRA 3K3OA 2E9QA 1LU1A 2XBO2 3QH6A 3SLIA 1CAXA 1AR82 3LPGA 1HKDA 1UX6A 3DCQA 2VCCA 3LEMA 1VRH2 3WW4A 1UPSA 2WYFA 1JYCA 2A71A 2D98A 2XKOA 3DL3A 3ETQA 1ZBE1 2D44A 1AXKA 1YEWA 2JECA 4N7IA 4OMCA 4ZXEA 1CIWA 1US3A 4NIGA 2NMNA 1SBFA 2XB6C 1OOPC 1RXFA 1S0IA 2JDZA 3B9CA 1XC6A 3LEKA 3OGJA 4XDQA 3WDTA 2LROA 1YWKA 3VBFC 4AW7A 3FJSA 5C6CA 4P9WA 5F3GA 3KCXA 3AMHA 4Y22A 5T5OA 4BQ2A 3ZXJA 1NOVA 4EZ4A 1N47A 4IGQA 2ARCA 5FRAA 2R7EB 5FYSA 1PX4A 4CEYA 1C8M2 1DQ2A 3HQXA 4OHVA 4W6XA 3BU0A 4WVZA 3PNAA 4MHRA 4Q5OA 3ZFGA 1ENXA 3FHIB 3I3EA 5FZ8A 3BVCA 2R49A 4QKFA 5FP4A 1OHFA 2BJSA 1C3HA 5DABA 5TSWA 4QX7A 5C5UA 4CUBA 1LTEA 1W6MA 3D3AA 3VHNA 1XSQA 1OH4A 4UW5A 3VDCA 2ID4A 3N7LA 4TZDA 1H1MA 1ZZ6A 3ALQA 3ELNA 3POSA 1W6OB 1VJ2A 3OB8A 5AVPA 2R0HA 3O0WA 2WZEA 4OHZA 3ST7A 4RS5B 2SLIA 1COV2 4B7EA 3J7HA 3B94A 1BBT3 2C4XA 4MXWB 5DUXA 2GMPA 5K0UB 1K12A 2CL2A 1K42A 1WMDA 1KRIA 1NA1A 5EXOA 3GHNA 4P08A 3QBQA 5I93A 4C90A 4UAPA 2W47A 3O1SA 2VMCA 3WZ1A 4QGNA 2YUEA 2X8KA 5BNPA 4XFIA 4MHUA 4LR4A 1RUF3 3PVNA 5A7SA 3FC0A 3SITA 3S57A 1RUE2 2OKXA 1CIYA 3TEXA 4K9SA 4ZU7A 2Y26A 3KWVA 1FPN3 4AFCA 2YROA 1G9DA 3BOPA 2W1SA 5GLWA 2DCYA 3PURA 5K7PA 1EP0A 2ZABA 5IVYA 1PHMA 1S0FA 5D8AB 4WBBA 5BNQA 2BFUL 3OOXA 4WZCA 2GH8A 2ZGPA 4C0HA 5KBFA 1EAH3 4XUTA 1K45A 2Z2SB 3N7JA 4LITA 3PLQA 1GZTA 4UBGA 1ZRCA 4HN1A 5JOZA 4NROA 2BFUS 3TOJA 4XF9A 1FV3A 2PA7A 2CAUA 4YG6A 1PGL1 1GOFA 1W9FA 2WR9A 4W4ZA 4MOAA 5F3EA 3T09A 1FPN1 2WO2A 3EB7A 3BTYA 4JQRA 2HH9A 4QWNA 1AXZA 3WUCA 2RJLA 3CJIC 3MIGA 3MW2A 3WW3A 3T0DA 1LHUA 4AXOA 4COZA 1QQP1 2DBIA 1OD3A 2X5IA 2FBEA 5FZOA 1XU2A 1YFUA 3URFA 5LBBA 1W9TA 1HXS1 1AUYA 3MLJA 4YM3A 4Y24A 3O1PA 2P6HA 4NHMA 2ZS6B 4GXLA 5JOYA 1W8ZA 3HWJA 2YG0A 2Z4FA 5HCBA 3VZOA 1WMFA 4JV4A 4Y1YA 4PIZA 2VMDA 3NAPC 5GLUA 2QQVA 2R063 2Q8DA 3ACGA 1CJPA 2ZAAA 2O14A 5F2WA 1UOJA 1OFNA 4XF4A 2JG9C 3JZVA 4MADA 4EN6B 1WCDJ 1TMF1 1ULEA 3GNEA 5FYBA 2IXCA 1POV3 2ADDA 2XLGA 2YBSA 1QJY1 2OZ6A 2YGMA 4K8RB 4NR1A 4RHV1 3JCIA 4UFIA 3T30A 3HOBA 4JKLA 3USUA 3S5QA 4RR3C 2QQMA 3VBHA 4IEWA 5A3LA 2BGOA 2R0FA 2ZJCA 4N7UA 4BHPA 4AI3A 4FOWA 3I2HA 4MYEA 1CZTA 1FOD3 2P2KA 4Q4V2 4UOJA 1XNBA 1R1A3 1C4RA 1WBLA 3AZVA 4FFIA 4AI9A 4B4PA 1W28A 1L7QA 3K46A 5EYYA 3AFGA 4K8FA 5HI0A 4GB33 2PHFA 3MFAA 2CDPA 3C7GA 2HWB1 1UZWA 4XHBA 2JE8A 2JD4A 3M4FA 4LE4A 4QB1A 2J1AA 4DMIA 4FT8A 1XE7A 2ORXA 4R9BA 4GULA 3ECQA 3LDBA 2V5YA 2K46A 2PHUA 3TB0A 1JYWA 3OPWA 3UT0A 5BNNB 2CNAA 4X6RB 2WZ8A 2R073 2WNVC 4IV3A 1FNZA 1WLCA 3T0BA 4XURA 1XBFA 1FT9A 3NV2A 4LK7A 3VDDA 1PNGA 3CZJA 1MS3A 1QJX2 2VQUA 3R0RA 4J25A 4LBKA 2A1XA 5L7OB 2Q4SA 2R1DA 3E5QA 3FBYA 2J42A 3IAQA 4Y22B 1UZYA 1VMHA 4EN8B 3BYWA 2D6MA 3E97A 4MSVA 1ZBE3 2Y6FA 3LGRA 4PQQA 3T2PA 2HWC3 3N36A 4PJYA 4CEYB 1JZ3A 1ZBA1 3VZMA 2VR4A 3KQ4B 4Y1UA 2B8MA 3EBRA 4CCOA 4K3UA 3B93A 5H9PA 3ILFA 4Y4YA 5L7OA 3OEBA 4W50A 2UYAA 5LWBA 3DXUA 2Z5WA 4L97A 4P5HA 1V9U1 3I3DA 1MQTC 1HRV3 2HWB3 1FMD3 4JVAA 3BU7A 1EV11 3U0ZA 1LOFA 1B35A 1IPSA 1B09A 1NY71 3A0KA 3LEGA 3N7KA 2O0OA 4A2UA 5JCTA 2MNGA 3N9LA 3FFZA 3BTZA 3AVRA 1AHSA 4H7LA 1SLIA 1VBD1 4BQYA 5BNOB 3UNPA 2ZEXA 4EN0A 3IDCB 3T3YA 1UY0A 3HBKA 1UAIA 2GP3A 2ZX1A 4BK5A 5IAVA 2ZMKA 5FOBB 1WCUA 3ORJA 4DIQA 4J1XA 2Y0OA 5F39A 1H6YA 4RFRB 3P6BA 4AFDA 1N1SA 3B7MA 2EF6A 5F1RA 4UFMA 1BMV2 1R1ZA 3NV4A 5J3UA 2D6LX 1UU4A 1YQ2A 2RS53 4RL7A 3M3OA 1H2NA 1QNYA 3S0MA 2HEWF 5DDJ3 5J96B 4PIYA 5FY8A 4W6YA 2ZKNA 3POIA 2WT1A 3KCYA 1HXS3 1G9CA 5FP3A 3BUCA 3BIEA 1ZBE2 3WNMA 3KV9A 3AMNA 1JZ7A 4F8AA 2ES3A 2XL9A 5A3OA 1MS8A 1SHWB 2CWSA 4JCKA 3GZTB 1UNBA 5FUNA 3ZFFC 1V6LA 1J3RA 1KQRA 1JZ8A 2W52A 1CX1A 1T6BX 4XIOA 1PK6B 4M4RA 5BNOC 1ALYA 2VOTA 1WW6A 3H7JA 3WQBA 4XPVA 4QHBA 1S2KA 1IHMA 2EXHA 4A7ZA 4XBQA 1W8UA 4P9YA 4XFGA 2UURA 1OQEA 3ATGA 4CCCA 5FLIA 1M06G 1AL21 4RHV3 3T4VA 4CEWA 3WG1A 2RM22 3ZN5A 1OF4A 3HNYM 2DU0A 1STMA 1W90A 3W20A 2I07B 4YFWA 2YV8A 1ZZBA 1TE1B 3EXUA 3U10A 1ZRFA 3HD8B 1SQ4A 1WA6X 3P3NA 4AF9A 4CUGA 3DGTA 4O9EA 4OMDA 1VLNA 3JB4C 3HN1A 3ZFEB 3RZJA 2VZVA 3K3NA 4N43B 4AVSA 2E31A 4L92A 1VMJA 3O14A 2A6XA 5A1LA 1DYKA 1IG3A 3VBUC 3LB9A 1RUF1 2QZ3A 4AVVA 2A3YA 4D0QA 3OGVA 1NQJA 4A45A 5F37A 1QQP3 4QHZA 3ZFEA 4CDXC 4UYBA 2X29A 1W06A 1VB2A 1LR5A 1ULPA 4GD4A 4IE5A 5BPXA 5DAQA 1OQDA 4IW3A 4AHYA 2LALA 1OLQA 1OXCA 1G7YA 1UW8A 1UPIA 4N9HA 4IGPA 1VBE2 5J37A 4HVQA 1VAVA 4K40A 2W1QA 4LQRA 1BBT1 1QU0A 1WCKA 2PELA 2ZGNA 5E1RA 3RFRA 4IEXA 2QKDA 4AAPA 2XJSA 4RD7A 3PJQA 4NPRA 1LOGA 1X33A 4ZHNA 2JDMA 4QDQA 4RFT0 1HRI3 1LECA 2Y60A 2EIEA 5T5LA 1GOGA 1MZEA 5A3TA 2Q1FA 1JS9A 5FYZA 3UK9A 3J26N 1RYYA 1WD3A 3A23A 5DAWA 1KD7A 2PLV2 4FPHA 2WN2A 1RL3A 4XABA 2W91A 4QKNA 3VBRB 3ZLIA 1ND2C 1WMEA 1WWYA 1OSGA 4CP0A 4JX0A 2KD7A 3PHMA 4N53A 1RUG1 5IK8A 1GLHA 4GJYA 4AE2A 2VUCA 5GJ6A 3AMPA 4JHTA 1SPPA 5L9BA 3ILNA 5BNNA 4QGLA 1E5RA 2RM23 2BYVE 4MGYE 3CKHA 1XQNA 2AREA 1F31A 2KA3A 4TLFA 3G7DA 3IMNA 3PMEA 4NMIA 5A3WA 1MS0A 4CTEA 4D6SA 1W6OA 2AEYA 1Z7S1 2XH6A 4EZHA 5JXJA 1PGL2 2JG8A 5DDJ1 1H2MA 1O59A 3E6DA 4HPKA 5E8AA 5EP9A 5FZ0A 1KJLA 5FZFA 3GBWA 3A0NA 3ZXLA 1PO12 1GBGA 3MIHA 4LEJA 3RSJA 3WR0A 4BQWA 4F7ZA 2W5FA 4AVCA 1VP6A 3TN91 1CAUB 3AYAA 2RR13 4GB32 3RS6A 1W2TA 1GFF2 3MHZA 3Q8CA 2MEV1 3VD3A 5FP8A 3GALA 1S0DA 4ZZ8A 2R6QA 3B01A 4Y33A 1R1A2 4H7MA 2PAMA 1PVC3 2H0VA 3LDKA 3WG4A 1UKGA 2D6PA 2DCJA 1Q8OA 3UJQA 1NLQA 4Q4W2 4BQXA 2XGXA 1JOBA 3MEPA 4RSUA 1ZZCA 3BTXA 1OA4A 4XEZA 3S7EA 2NLRA 3B69A 1S0BA 4XJ8A 2BWAA 5FXZA 1M4WA 3LIHA 1W3XA 4GMP0 4IE7A 4JHZA 1KS4A 4N8MA 1QH6A 4WVMA 2AC1A 5FYIA 5FYMA 3AJZA 3OUJA 4YWAA 4XC9A 3AMMA 4ES9A 3AL5A 3ZDSA 4CE8A 2W46A 2Y64A 1AXYA 4LO4B 4AEJA 5FYVA 4WZFA 4PDWC 1GP4A 2QFEA 3PVOA 4DXZA 3U1XA 1QJU2 5DZGA 2A7AA 3WY6A 5JXHA 3VD9A 2QBXA 3GBFA 4Q4X3 1AR92 1HX6A 1BJQA 5JMCA 4D7SA 3O7OA 3PTRB 1EPZA 1K5MC 1LHVA 2WRAA 3I4IA 4XF1A 5BNNC 5A7PA 3TN93 1HRV2 2RE9A 2BDRA 4CCKA 2EXJA 2A3WA 2VZQA 1GKBA 1RUC2 3NKGA 4HSJA 5CIRA 5FV3A 5LB6A 1UYPA 4N53C 4QXBA 2RS31 1Y4WA 4XXPA 5IFTA 2LTNA 3PMSA 2VW0A 4AZZA 4XW3A 4OI0A 1H2KA 3H8UA 3ZXDA 2GMEA 2X5IB 4DB5A 2HWC2 3J7MA 3THDA 4QPGC 5K9YA 4AEDA 2FQPA 3OJBA 2JICA 2PN5A 4Y3OA 4EV0A 5LA0A 4LORA 1VBC3 4LTAA 4PLMA 4TYSA 4UFHA 3UKVA 1SCRA 3W58A 4CZSA 2P34A 4KG0A 1C28A 2J1SA 4OVEA 1JHNA 1MR5A 4WVWA 3KGZA 4JDMA 4Q0PA 4NHLA 5ANNA 4DY3A 3H1YA 5FP9A 3RPQA 1V6NA 4CA9A 5C8WA 1ND3B 1FOD1 2GALA 3LZZA 5EPAA 5C3SA 3O1RA 2B9VA 5DXDA 2Q5TA 1FPN2 4P9LA 4AOCA 3SH4A 1QJY3 3BB6A 1OMIA 3VKOA 4GWMA 1EUUA 1UMZA 3J8F2 5JPMB 4S2DA 2B5HA 2BUKA 2PHTA 1NLSA 4KWJA 4BIOA 5JOXA 5LA1A 3AP5A 4KNCA 3POYA 1W8FA 2C0ZA 1MEC1 2IXJA 2OW4A 2V73A 5FZBA 3ZXAC 4XCAA 2WO1A 3PDQA 4YLZA 3I8TA 5JUVA 3LOIA 3RRDA 3ZYJB 5AFBA 5HCAA 1QJEA 2G9ZA 1RITA 5BXXA 3ES4A 3KV6A 2D3SA 4PIXA 4ZZ5A 1WMXA 4FPLA 3VDAA 1GNZA 3CL1A 3O5SA 4HK8A 4KGGA 3DYOA 4MGIE 4AI2A 3H42B 3I2KA 4Q4Y2 1QY4A 3FWEA 4V2VA 3IT8A 1OT5A 2Q1ZB 4CEWC 3NNGA 2WYSA 3IN9A 4PHZA 1QWRA 1JYVA 2OS2A 3M3EA 3TBDA 1U5IA 3LSEA 4NJ4A 1UY3A 4QKBA 4XIKA 1OA2A 4I0BA 4LO8A 4NHXA 5BNOA 2VJXA 1MEC3 4AL9A 3K48A 1XYNA 2VXJA 4JGYC 3WQ1A 2GNDA 4X8PA 1RMU3 2VNGA 3G6JB 1EAH1 1NCRB 3ZYFA 4A42A 1C5HA 3THCA 2FDIA 1I5PA 4DNYA 5LA9A 2O8OA 4LHNA 5FZLA 4RR3B 1O4TA 4IERA 1VALA 2YB7A 3GM8A 4DOUA 4EWAA 2AH2A 2VE1A 1R64A 4A7KA 2VOKA 2D93A 4DQAA 3INAA 4H2AA 4ZS3A 1YQ6A 3NV1A 5FZEA 1OUSA 5K0UA 5D8AC 3WQ7A 1R083 3BKZA 4CP9B 1QDOA 1LNSA 1ZZ8A 4O7XA 2WQZC 2D40A 3JB8A 2WZPP 4R9AA 1D2QA 3FHQA 4QKDA 4E4DX 1XNCA 3ZXKA 3Q8BA 4O65A 4S2GA 2J1UA 4YVSA 3ME2A 2IZWA 4FP2A 4V2WA 2QNKA 3E5XA 1ZRRA 2HWF1 3W9AA 2ILMA 4BMEA 2JENA 3OUHA 3NMBA 4CPBD 4PBPA 1S0JA 4AHWA 1N3QA 3J7LA 2L9LA 3M7AA 5CB7A 5FZ7A 4ZY9A 1BLZA 4XCBA 4QGMA 1UY2A 1V6JA 2DVFA 4JC1A 5D2AA 4DEVA 3L9JT 4Q4X1 3OYWB 3AM2A 3PU8A 2FD8A 1URXA 4AI1A 5FZGA 4FP3A 5G04L 1JUHA 2W95A 2WSUA 5F5AA 3SH5A 2ZPXA 1G9FA 1AZDA 1VRBA 2X10A 3KLSA 1PIV1 2AYHA 2JDPA 3ITQA 4QU1A 3WDVA 4M0NA 1WUVA 2K2SA 1F4HA 2HYXA 4PI0A 2HEVF 5J09A 1XNDA 2V09A 3ZXGA 4L2NA 1X9PA 1IZ3A 1BMV1 1LENA 2VUDA 4AFMA 3AXDA 5C9AA 4CXYA 1DBNA 2FDKA 4YZ4A 3X29B 5CU1A 3IIAA 1ENQA 5J36A 1U5YA 3I3BA 4IE6A 5T55A 4I2OA 1CQ9A 4CEWB 4E8CA 4YW6A 2Q8CA 4L9BA 4XTMA 1YQ8A 4KG8A 3MLKA 5DG2A 2MEV3 2A73B 2XVKA 4G4FA 2WNVB 5IFPA 3RZLA 1H0BA 1ZRIA 2DVDA 1E5IA 1JYTA 4LMFA 4NWVA 3WF1A 1N1YA 2FZ1A 3PJYA 2XG3A 1RUD3 3WNLA 1BYHA 2VMHA 2ZEYA 4NHKA 3HN3A 2JG9B 1ND2A 1QKQA 2GNTA 4I0WB 4XJUA 4FPYA 3SCGA 5F3CA 5I0DA 2ZHMA 1K3IA 2XLFA 2WNOA 2DUQA 3CZUA 1SBEA 2DCTA 5I0UA 4A3XA 5C8CA 4WM8B 4XUQA 2D43A 3CQOA 4M3CF 4QXCA 4X6QB 1SZBA 1CAVA 3ACFA 5CVRA 5CFCC 1F2NA 4CCMA 1YUDA 3VBRA 2RM21 1Q8VA 1GNHA 2VZOA 4KL1A 2VGDA 3CF6E 4GB31 4KBBA 1WD4A 5FXXA 4DUXA 1WCSA 2JG9A 3O1UA 1AYN1 1EUTA 4FPEA 5KXCA 5F9TA 1R1A1 3NAPA 1RUD2 1OD5A 5C8CB 2V4AA 4AGRA 5JR2A 4XACA 2B45X 2GMMA 2PMWB 2XJPA 4Q2FA 2FZ2A 1UY4A 3ILRA 4CYDA 2XMLA 2BTVC 2FCTA 4YZ2A 1ZRDA 4CDXA 4HXCA 2RVAA 3BTAA 5A6QA 3M3CA 5FYCA 4JGZC 1HRI1 1YFXA 4UW6A 4LNVA 3BPSA 4IV3B 2X5IC 2J1EA 1CGPA 2RHPA 4YZ1A 2G19A 1Q56A 4HZFA 4IEOA 4BOWA 2QE3A 1VB4A 2GC2A 4AEKA 1F15A 4YW5A 2JKBA 1GP5A 2WKKA 2WZR1 4FVVA 5CEHA 1U0AA 2JDNA 4LJHA 1SLCA 3K2OA 2AENA 5F32A 4ASMB 1RB8G 1BBT2 1W8HA 3CJIB 3ZPYA 5C9AC 3WNOA 4Z2AA 2ZOEB 4U36A 1YNAA 1COV3 4AVBA 2W68A 1DIWA 4AK3A 5FY7A 2BOIA 4L99A 2DU1A 1G6NA 3WNXA 4LULA 3AYDA 4HPKB 1KS5A 4ZU5A 1TVGA 5ERLA 3VV1A 5H9RA 2RS32 1RIRA 3RWNA 5I8YA 3OD0A 3OG2A 3WDWA 1DFQA 1SG3A 1CAUA 3D5OA 1OF3A 4E4SA 3C7EA 4BCUA 4M3CE 1RUG2 2GP5A 2P3YA 4QX3A 1W04A 2GZWA 3HQRA 3ZFFA 1KDKA 4QPIA 3GJAA 3N9OA 2C9KA 2BU9A 1GUIA 2A5ZA 1H6XA 1O5UA 1LEDA 1R092 5IHRA 1V6OA 5CKMA 4YG0A 5JZGB 1LOCA 5AVAA 1XU1A 3BCWA 1HQWA 1TNFA 4X8NA 1C1FA 1AR72 3R6SA 1OBNA 5FYUA 3SH3A 5FJKA 5LA2A 5JIUA 3VBOB 1DU3D 5JWPA 1VBA1 1WLWA 1VBB2 2RMU2 1V6IA 1LODA 2BGPA 2YDEA 3WQ0A 2DDUA 3K51A 5JMOA 5IUQA 1DGLA 2I45A 5IT6A 3CMGA 3R4DB 4IGOA 4YVSB 4AQTA 2PHWA 1X36A 3MIEA 2XBO1 3PUQA 1UYXA 3VKMA 4A6SA 3THPA 5F8PA 2HWE2 1MS9A 4BISA 2YGLA 3B3QE 2PLV3 3JUUA 1AYM1 4HKLA 5FKCA 1U12A 5C71A 4P00B 2BNNA 5J98B 4WVVA 4IDZA 4CDUA 1N3PA 2OX0A 1LHWA 5A6YA 2JD9A 3HR9A 1DLCA 3LEIA 4XFFA 3ES1A 2BBVA 2UY9A 5FPZA 2WT2A 3ZPOA 4QU2A 3OF1A 4JZRA 2YBKA 4IXLA 3VDBA 4Z92B 4O9GA 1AF9A 4OI4A 1OURA 2OT7A 2FDFA 1YRZA 2AGSA 4A41A 4OCTA 1NZCA 2PQQA 3JBG2 4PT6A 4NIIA 2W1UA 3GHMA 3VKFC 1GSLA 1E5SA 2E7TA 4DRRA 2IWGB 4FOVA 1A34A 2EAAA 3U07A 2C5DA 2OVUA 2Y6KA 4RN5A 4INDA 1RUI2 1LHOA 1RUJ2 1SACA 1W2UA 3WXPA 3DECA 3NNJA 4TXWA 3H8XA 2W3JA 5CKQA 1W0OA 5C5TA 3PUSA 2XOMA 1EV13 3WCSA 1CD3G 1PO23 3POBA 1HRV1 3P5BA 4PLOA 3AFKA 1JZ4A 1V9U3 5EYXA 3BPZA 4HOOA 3IKWA 5FZ3A 3VBFB 3DYMA 3THTA 5AFEA 4P9JA 4B8EA 4URAA 1SDDB 1JU4A 3ZM8A 5CBLA 2WNVA 4IV3C 4Y5TA 3IPVB 3J8F3 1G86A 1DZRA 2W39A 1ZBA3 4RHV2 1G8WA 3AKSA 2HWC1 1Q3EA 4P9XA 4AWDA 5DZEA 1GR3A 5J7MA 1HQLA 5FCCA 4BMBA 2FMYA 4BLJA 5FY5A 2EA7A 2WJSA 4E4HA 4CCDA 2LUWA 1VR3A 3ZSJA 1RUH1 5IK4A 1ND3C 3AZWA 4WM8A 3VB9A 1J3QA 4Q0UA 4FQ4A 3NSTA 2ETEA 4IV1C 1OOPB 1UU6A 2R071 2ZGMA 4K1ZA 2PFWA 3ROUA 2GC0A 4P14A 4XJ9A 2WWUA 4KBZA 4RR3A 3RMXA 1XNAA 3ZIWA 1SCSA 1TME2 5FY0A 3MICA 4UT5A 3ETPA 2VNVA 5A80A 2ZGQA 2ZZJA 3AP7A 3FUOA 1ULGA 2KM2A 4IEUA 5FZ9A 3IZOA 4AQ2A 4CU7A 1Z78A 1WBFA 2RS52 5FZCA 3U4SA 4JRLA 5JR7B 4XXAA 3ZN6A 3HEIA 2I2SA 1PK6C 4FPGA 4DPNA 4HLTA 5FPBA 1YIFA 1TEIA 3POFA 4JRAA 1AVBA 4RQPA 4IQPA 2JDAA 3SC7X 2VBDA 2YXSA 3ASIA 1BVVA 1H30A 1POV1 1QJU3 5B4XA 1TMF3 1HDKA 3E6BA 1S0EA 5GLVA 3ZN6B 3HAGA 4BQ3A 4F83A 4DS0A 3ACHA 1ACCA 1CONA 1S2EA 4Q4Y3 2GAUA 5E89A 1LGBA 3L2HA 3OYWA 4FPJA 5IWFA 2VXRA 4GH4C 4CP9A 4OHXA 3ZR6A 3R4SA 3B9IA 3PUHA 3LKJA 1WLDA 3PL0A 1RHI2 3N9PA 4YPJA 1IQDC 3IDBB 5ACA2 5FK8A 1DQ5A 5GLTA 1PGW1 4MZUA 3NJXA 1H9PA 3KV4A 3FFQA 3JBG3 1NG0A 3TYJA 5CKNA 1IOAA 1ULDA 2YPDA 4GKXA 4RQPC 4YRDA 3C7HA 3VKLA 2WT0A 3ZYIB 4QQLA 5A3MA 1TMF2 3H1MA 3OPTA 2WUHA 4LXLA 5IATA 2B39A 3U4XA 1QJY2 1I3HA 1WKYA 2N7GA 4ES8A 3O1VA 4IV1B 1GZCA 4IL7A 2VZ3A 1N3OA 3VBOA 3LDRA 3VBRC 4AFBA 5CFDA 4Q4V1 2P3KA 2EXIA 5CFCA 1NLRA 4FSJA 4MXVA 1O3QA 4QMAA 5A1AA 3O12A 1DHKB 4LA3A 5L36A 3I2DA 1OUXA 2FCVA 3WINE 4CDWC 2V5DA 3HNBM 4FOQA 4XJZA 1HB3A 5A7WB 2IXLA 4BB3A 4C8DA 2YFUA 3BODA 2PQSA 3RQ0A 1I5ZA 1XYPA 5LRSA 1BEV3 4XE9A 2DCZA 4D6QA 2BNMA 2EIDA 3D0SA 3JU9A 3AZYA 3OBAA 1W0NA 2FCUA 1UCXA 4UXAA 2QQPA 1DF0A 2ZCWA 2D97A 3WG3A 1IS6A 3MIDA 1IS4A 4GIQA 1JHJA 1CVNA 2RJ2A 1AR73 1UMHA 1EPWA 1V6MA 1SFYA 1VIWB 3GYDA 3IAPA 1W2OA 1F8VA 4R9DA 2G9FA 4QT6A 4OUEA 3MPPG 1W6MB 1JUIA 2EICA 1AR93 2WFF2 5GZEA 3VBHC 4Y1VA 2GC3A 4LBQA 3HBZA 3VZJA 5FQ0B 3S6PA 2GN3A 3HQUA 5JLVA 2C26A 2ZGSA 3T2TA 3AZXA 3WF4A 3K4DA 3ZFGC 1GICA 1W9SA 4XFBA 3E1F1 2D3RA 3T08A 1KJRA 3GJBA 1ASJ2 4XILA 4XZPA 3K4ZA 4IE0A 5B4NA 1EV12 1RINA 4DO0A 3MBWA 3RDIA 3WSOA 5K8SA 3CJXA 2JX9A 4AQ6A 3JXSA 5FPUA 1GV9A 5JVVA 1RJ8A 2EIGA 4CCJA 2WWJA 4OLLA 3S5AA 1X9TA 2XHKA 5FO7B 2CWMA 2QCSB 2ZX4A 4I3PA 3VBFA 2LM3A 4LKFA 4KMQA 3VHRA 2Z79A 1R091 5GKAC 3UETA 3UV9A 1VBE1 4XUOA 4BYYA 2VCBA 3POJA 4LBOA 1CN1A 1O7FA 1ZZ7A 4QPWA 4QXHA 5FZHA 3WP3A 1KXGA 4GH4A 1FX5A 3RZGA 4HBNA 2QDRA 1DCSA 1VBB1 2WNUB 3I54A 3J4UH 4KH9A 5F6LB 1H2LA 1ST8A 5FYYA 2RR12 3IWZA 1YC61 3POGA 4R4ZA 1MVQA 1GWLA 5HV0A 4TSVA 4XHXA 3WVJA 5C3OA 2QQKA 4XQDA 2ZACA 4Y20A 1JW6A 1PO13 1QHDA 2VOWA 4IE4A 3UL2A 2J7MA 3KS7A 2XUMA 4MLOA 5GM0A 4CPBA 4IEVA 5T5JA 1N1VA 2BERA 4GH4B 5JZGC 2HWE1 1CWPA 3MDPA 4YVWB 1UXXX 4NO4A 4QX5A 1GANA 4C0BA 4XETA 2OUHA 2A3XA 5A3PA 3FMGA 2BPA2 4I02A 1XXNA 4AEMA 1QNWA 3GXUA 1ENSA 5JXGA 4OQ8A 2ZGOA 5A7QA 4JDOA 2R1BA 4FI9A 3TWIA 2VUAA 1JI6A 4NRMA 2K0GA 2P37A 4AHXA 1NAEA 2RMU3 1RUH3 4QPIC 3NJZA 5DDJ2 2Q8EA 5KHGA 2EALA 4GMP3 2CTVA 1PO11 3K77A 4Z1VA 1QF3A 1UYZA 1JMUB 1HJGA 2ZX2A 3CO2A 5E16A 5FLJA 2PHRA 3H50A 4BXFA 5T5PA 4YNIA 2RJKA 4YM0A 2ZTNA 4ARYA 3EYPA 1RJ7A 5C3RA 4CVUA 1JYXA 5IK7A 2MEV2 3WOGA 1NX9A 4LKDA 3CHXA 1XOYA 3VD5A 2CDOA 1RUJ1 1VBE3 5JZGA 4R9CA
chains in the Genus database with same CATH topology
4IUGA 2ID4A 1UXZA 3OB8A 1LNSA 2WZEA 1W9WA 3FHQA 2LS6A 2J1VA 4P5YA 3J7HA 2X09A 2J1UA 2C4XA 2WBKA 1CZVA 2VMEA 1K12A 4DXSA 1HN1A 1K42A 2QQNA 2YFZA 1WCQA 1NUKA 2L9LA 4MO3M 4P08A 3VD4A 1PX3A 4ZY9A 4UAPA 2W47A 2VMCA 3I2JA 2J1RA 2W1WA 1UY2A 1XPWA 2VMFA 1GMMA 2VZTA 4DEVA 5G04L 2W95A 4DUWA 4GZ9A 2X10A 1CIYA 2OKXA 3HNMA 1F4HA 2HYXA 2W1SA 3SEPA 5DN2A 5EJZB 2JKXA 3ACIA 3IDAA 2VC9A 4QB6A 4CUAA 2QQOA 2VCAA 3ABZA 3LQCA 4XUTA 3SKJE 3A7QA 1K45A 3I3BA 1UYYA 1UZ0A 3MV11 4E8CA 1GOFA 4W4ZA 3I2IA 4MOAA 3T09A 4BJ0A 2WO2A 3EB7A 3LPFA 4CU8A 1ULOA 2VL4A 5IFPA 2WAOA 3WF1A 3WNLA 1OD3A 5CYYA 1W8OA 1DP0A 2ZEYA 3T0AA 3HN3A 4DXRA 1W9TA 4LKSA 5I0DA 1K3IA 4XVHA 3CZUA 3BN6A 4BK4A 4XUQA 2YG0A 3CQOA 2Z4FA 3ACFA 2WQ8A 3C7OA 2YC4A 2VZOA 2VMDA 4DUXA 3C8XA 3K4AA 2VZUA 3ACGA 1EUTA 4A6OA 4LPLA 4MADA 2QQLA 3FN9A 4BDVB 5JR2A 3HOBA 1J83A 2BZDA 4JKLA 4CU6A 4JKKA 4JKMA 1BHGA 2QQMA 1UY4A 2BGOA 2RVAA 3I2HA 4UOJA 1CZTA 4DEQA 3W5MA 2Y6JA 1GQPA 1L7QA 3K46A 2Y8KA 2J1EA 3WEZA 2CDPA 3C7GA 2JE8A 4QB1A 3MO4A 2J1AA 3BGAA 2ORXA 4QX0A 3ECQA 2E26A 1JYWA 2WZ8A 3T0BA 3FL7A 4XURA 3WNOA 1JZ5A 4Z2AA 3CZJA 3DYPA 2VQUA 5C70A 3IAQA 4L0PA 1TVGA 2VTFA 4PQQA 2WABA 3T2PA 1JZ3A 2DCKA 3OG2A 2VR4A 1SG3A 3GDBA 1OF3A 3C7EA 2HLEA 4QX3A 3OEBA 4W50A 2C9KA 1GUIA 1H6XA 3I3DA 4HG6B 1J84A 2VZ1A 5IHRA 3SEEA 4UI9L 3LEGA 5DPNA 5LA2A 4QX2A 3OGSA 2BGPA 1W8NA 4XUNA 2DDUA 5JMOA 3UNPA 2ZEXA 1UY0A 2WO3A 3CMGA 4BK5A 1L7RA 1UYXA 1CZSA 1F4AA 1H6YA 1UMIA 3P6BA 3U37A 5C71A 4P00B 3IIIA 1YQ2A 3I97A 2Y6LA 2JD9A 5F7UA 1DLCA 1UWWA 3LEIA 4MGQA 2W9XA 4PF1A 3VDBA 2B4KA 3WNMA 1JZ7A 3WNNA 4A41A 1SHWB 1US2A 4PT6A 2W1UA 3MUZ1 5FUIA 3K75B 1JZ8A 1CX1A 2VM9A 4M4RA 3OEAA 2Y6KA 2VOTA 4RN5A 3WQBA 3HJRA 2ZXQA 1TG7A 3DECA 4TXWA 2W3JA 2VO5A 4M4PA 2XOMA 3LE0A 3HNYM 1OF4A 1GU3A 1JZ4A 3DYMA 2E32A 1SDDB 1JU4A 3ZM8A 1GNYA 1KGYA 4CUCA 4XZUG 4OMDA 3GGLA 2QQIA 4GWIA 3A22A 2VZVA 2E31A 1JU3A 3NQHA 2V72A 5DQ0A 4D0QA 1XNTA 3OGVA 2QQJA 4A45A 1GOHA 4W8JA 1ULPA 3OGRA 1O8SA 5C7GA 1XNAA 3ETPA 2XQXA 3AC0A 2W1QA 4LQRA 4CU7A 4QDQA 2W87A 2BBAA 4D8MA 2EIEA 3HEIA 1GOGA 3WF2A 1RYYA 2VZPA 2RV9A 3A23A 2JDAA 2X05A 2WN2A 4DUVA 2J1TA 3WF0A 2W91A 5B4XA 5EJ1B 4JX0A 2KD7A 2VZSA 5G05L 3ACHA 3CKHA 1O8PA 3NRUA 4QX1A 4LHSA 3HPNA 2YC2A 5JXJA 5DMYA 1O59A 4QAWA 3PUHA 4ET7A 1JZ2A 4YPJA 1IQDC 2XHNA 3T2QA 4CU9A 3NJXA 4AG4A 2W5FA 2VQTA 2EIBA 4E8DA 3F2ZA 3I2FA 3C7HA 3CDZB 3VD3A 4ZZ8A 2WUHA 3C7FA 5EIYB 2DCJA 2V4VA 1WKYA 4OYUA 3P1IA 2VZ3A 1UX7A 4QB2A 2LW8A 4GWJA 2WDBA 4JHZA 3MUY1 1P8JA 5A1AA 2ORZA 4KWUA 4TTGA 1T2XA 1MPXA 2WN3A 2E33A 5JXIA 2Y6HA 2V5DA 3HNBM 2YFUA 2PQSA 2W46A 2Y64A 2EIDA 1D7PM 3OBAA 3CIHA 3UESA 1W0NA 4QDSA 1PMHX 3SKVA 5JXHA 1JYNA 3WF3A 3VD9A 2QBXA 1JHJA 2RJ2A 1UMHA 1NKGA 3IAPA 5HXMA 4DXTA 2WAAA 4A44A 2VZQA 2Y6GA 4OUEA 2EICA 5IFTA 2VZRA 5LCWL 4A3ZA 4RYDA 2C26A 2J22A 3THDA 3A21A 3K4DA 1W9SA 3T08A 3WF4A 3E1F1 2ZEWA 3PUIA 5LA0A 3K4ZA 5B4NA 2J1SA 3MBWA 5IYYA 3WSOA 4QDRA 3T0DA 3JXSA 5HPOA 3T2OA 1PMJX 1JZ6A 2B9VA 2W94A 4BXSV 3WNKA 4XUPA 4KMQA 2W92A 4MGSA 3UETA 4XUOA 1EUUA 2VCBA 3I2GA 4QPWA 4P02B 5LA1A 4OZOA 3MV01 2WO1A 3WNPA 5JUVA 2QQKA 5IJRA 2J7MA 2BERA 4ZZ5A 3LPGA 3VDAA 3IB3A 1UXXX 1DYOA 2VCCA 2XONA 1UY1A 3DYOA 4OMCA 4ZXEA 1US3A 3I2KA 5CZKA 1JYVA 1OT5A 4AAXA 3NNGA 2WYSA 3FHAA 3GXUA 5JXGA 1XC6A 3LEKA 4A4AA 5J1XA 4FI9A 1UY3A 1JI6A 1W99A 4KI5M 3NJVA 1NAEA 2VJXA 4ARXA 1KEXA 2R7EB 1PX4A 3K77A 1UYZA 4A42A 3THCA 3W5NA 1I5PA 2ZEZA 3VD7A 3I3EA 4ARYA 3EYPA 1JYXA 4CVUA 1NX9A 2YB7A 3GM8A 3VD5A 4CUBA 2CDOA 1R64A 3D3AA 1OH4A 3VDCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IUG A;  2ID4 A;  1UXZ A;  3OB8 A;  1LNS A;  2WZE A;  1W9W A;  3FHQ A;  2LS6 A;  2J1V A;  4P5Y A;  3J7H A;  2X09 A;  2J1U A;  2C4X A;  2WBK A;  1CZV A;  2VME A;  1K12 A;  4DXS A;  1HN1 A;  1K42 A;  2QQN A;  2YFZ A;  1WCQ A;  1NUK A;  2L9L A;  4MO3 M;  4P08 A;  3VD4 A;  1PX3 A;  4ZY9 A;  4UAP A;  2W47 A;  2VMC A;  3I2J A;  2J1R A;  2W1W A;  1UY2 A;  1XPW A;  2VMF A;  1GMM A;  2VZT A;  4DEV A;  5G04 L;  2W95 A;  4DUW A;  4GZ9 A;  2X10 A;  1CIY A;  2OKX A;  3HNM A;  1F4H A;  2HYX A;  2W1S A;  3SEP A;  5DN2 A;  5EJZ B;  2JKX A;  3ACI A;  3IDA A;  2VC9 A;  4QB6 A;  4CUA A;  2QQO A;  2VCA A;  3ABZ A;  3LQC A;  4XUT A;  3SKJ E;  3A7Q A;  1K45 A;  3I3B A;  1UYY A;  1UZ0 A;  3MV1 1;  4E8C A;  1GOF A;  4W4Z A;  3I2I A;  4MOA A;  3T09 A;  4BJ0 A;  2WO2 A;  3EB7 A;  3LPF A;  4CU8 A;  1ULO A;  2VL4 A;  5IFP A;  2WAO A;  3WF1 A;  3WNL A;  1OD3 A;  5CYY A;  1W8O A;  1DP0 A;  2ZEY A;  3T0A A;  3HN3 A;  4DXR A;  1W9T A;  4LKS A;  5I0D A;  1K3I A;  4XVH A;  3CZU A;  3BN6 A;  4BK4 A;  4XUQ A;  2YG0 A;  3CQO A;  2Z4F A;  3ACF A;  2WQ8 A;  3C7O A;  2YC4 A;  2VZO A;  2VMD A;  4DUX A;  3C8X A;  3K4A A;  2VZU A;  3ACG A;  1EUT A;  4A6O A;  4LPL A;  4MAD A;  2QQL A;  3FN9 A;  4BDV B;  5JR2 A;  3HOB A;  1J83 A;  2BZD A;  4JKL A;  4CU6 A;  4JKK A;  4JKM A;  1BHG A;  2QQM A;  1UY4 A;  2BGO A;  2RVA A;  3I2H A;  4UOJ A;  1CZT A;  4DEQ A;  3W5M A;  2Y6J A;  1GQP A;  1L7Q A;  3K46 A;  2Y8K A;  2J1E A;  3WEZ A;  2CDP A;  3C7G A;  2JE8 A;  4QB1 A;  3MO4 A;  2J1A A;  3BGA A;  2ORX A;  4QX0 A;  3ECQ A;  2E26 A;  1JYW A;  2WZ8 A;  3T0B A;  3FL7 A;  4XUR A;  3WNO A;  1JZ5 A;  4Z2A A;  3CZJ A;  3DYP A;  2VQU A;  5C70 A;  3IAQ A;  4L0P A;  1TVG A;  2VTF A;  4PQQ A;  2WAB A;  3T2P A;  1JZ3 A;  2DCK A;  3OG2 A;  2VR4 A;  1SG3 A;  3GDB A;  1OF3 A;  3C7E A;  2HLE A;  4QX3 A;  3OEB A;  4W50 A;  2C9K A;  1GUI A;  1H6X A;  3I3D A;  4HG6 B;  1J84 A;  2VZ1 A;  5IHR A;  3SEE A;  4UI9 L;  3LEG A;  5DPN A;  5LA2 A;  4QX2 A;  3OGS A;  2BGP A;  1W8N A;  4XUN A;  2DDU A;  5JMO A;  3UNP A;  2ZEX A;  1UY0 A;  2WO3 A;  3CMG A;  4BK5 A;  1L7R A;  1UYX A;  1CZS A;  1F4A A;  1H6Y A;  1UMI A;  3P6B A;  3U37 A;  5C71 A;  4P00 B;  3III A;  1YQ2 A;  3I97 A;  2Y6L A;  2JD9 A;  5F7U A;  1DLC A;  1UWW A;  3LEI A;  4MGQ A;  2W9X A;  4PF1 A;  3VDB A;  2B4K A;  3WNM A;  1JZ7 A;  3WNN A;  4A41 A;  1SHW B;  1US2 A;  4PT6 A;  2W1U A;  3MUZ 1;  5FUI A;  3K75 B;  1JZ8 A;  1CX1 A;  2VM9 A;  4M4R A;  3OEA A;  2Y6K A;  2VOT A;  4RN5 A;  3WQB A;  3HJR A;  2ZXQ A;  1TG7 A;  3DEC A;  4TXW A;  2W3J A;  2VO5 A;  4M4P A;  2XOM A;  3LE0 A;  3HNY M;  1OF4 A;  1GU3 A;  1JZ4 A;  3DYM A;  2E32 A;  1SDD B;  1JU4 A;  3ZM8 A;  1GNY A;  1KGY A;  4CUC A;  4XZU G;  4OMD A;  3GGL A;  2QQI A;  4GWI A;  3A22 A;  2VZV A;  2E31 A;  1JU3 A;  3NQH A;  2V72 A;  5DQ0 A;  4D0Q A;  1XNT A;  3OGV A;  2QQJ A;  4A45 A;  1GOH A;  4W8J A;  1ULP A;  3OGR A;  1O8S A;  5C7G A;  1XNA A;  3ETP A;  2XQX A;  3AC0 A;  2W1Q A;  4LQR A;  4CU7 A;  4QDQ A;  2W87 A;  2BBA A;  4D8M A;  2EIE A;  3HEI A;  1GOG A;  3WF2 A;  1RYY A;  2VZP A;  2RV9 A;  3A23 A;  2JDA A;  2X05 A;  2WN2 A;  4DUV A;  2J1T A;  3WF0 A;  2W91 A;  5B4X A;  5EJ1 B;  4JX0 A;  2KD7 A;  2VZS A;  5G05 L;  3ACH A;  3CKH A;  1O8P A;  3NRU A;  4QX1 A;  4LHS A;  3HPN A;  2YC2 A;  5JXJ A;  5DMY A;  1O59 A;  4QAW A;  3PUH A;  4ET7 A;  1JZ2 A;  4YPJ A;  1IQD C;  2XHN A;  3T2Q A;  4CU9 A;  3NJX A;  4AG4 A;  2W5F A;  2VQT A;  2EIB A;  4E8D A;  3F2Z A;  3I2F A;  3C7H A;  3CDZ B;  3VD3 A;  4ZZ8 A;  2WUH A;  3C7F A;  5EIY B;  2DCJ A;  2V4V A;  1WKY A;  4OYU A;  3P1I A;  2VZ3 A;  1UX7 A;  4QB2 A;  2LW8 A;  4GWJ A;  2WDB A;  4JHZ A;  3MUY 1;  1P8J A;  5A1A A;  2ORZ A;  4KWU A;  4TTG A;  1T2X A;  1MPX A;  2WN3 A;  2E33 A;  5JXI A;  2Y6H A;  2V5D A;  3HNB M;  2YFU A;  2PQS A;  2W46 A;  2Y64 A;  2EID A;  1D7P M;  3OBA A;  3CIH A;  3UES A;  1W0N A;  4QDS A;  1PMH X;  3SKV A;  5JXH A;  1JYN A;  3WF3 A;  3VD9 A;  2QBX A;  1JHJ A;  2RJ2 A;  1UMH A;  1NKG A;  3IAP A;  5HXM A;  4DXT A;  2WAA A;  4A44 A;  2VZQ A;  2Y6G A;  4OUE A;  2EIC A;  5IFT A;  2VZR A;  5LCW L;  4A3Z A;  4RYD A;  2C26 A;  2J22 A;  3THD A;  3A21 A;  3K4D A;  1W9S A;  3T08 A;  3WF4 A;  3E1F 1;  2ZEW A;  3PUI A;  5LA0 A;  3K4Z A;  5B4N A;  2J1S A;  3MBW A;  5IYY A;  3WSO A;  4QDR A;  3T0D A;  3JXS A;  5HPO A;  3T2O A;  1PMJ X;  1JZ6 A;  2B9V A;  2W94 A;  4BXS V;  3WNK A;  4XUP A;  4KMQ A;  2W92 A;  4MGS A;  3UET A;  4XUO A;  1EUU A;  2VCB A;  3I2G A;  4QPW A;  4P02 B;  5LA1 A;  4OZO A;  3MV0 1;  2WO1 A;  3WNP A;  5JUV A;  2QQK A;  5IJR A;  2J7M A;  2BER A;  4ZZ5 A;  3LPG A;  3VDA A;  3IB3 A;  1UXX X;  1DYO A;  2VCC A;  2XON A;  1UY1 A;  3DYO A;  4OMC A;  4ZXE A;  1US3 A;  3I2K A;  5CZK A;  1JYV A;  1OT5 A;  4AAX A;  3NNG A;  2WYS A;  3FHA A;  3GXU A;  5JXG A;  1XC6 A;  3LEK A;  4A4A A;  5J1X A;  4FI9 A;  1UY3 A;  1JI6 A;  1W99 A;  4KI5 M;  3NJV A;  1NAE A;  2VJX A;  4ARX A;  1KEX A;  2R7E B;  1PX4 A;  3K77 A;  1UYZ A;  4A42 A;  3THC A;  3W5N A;  1I5P A;  2ZEZ A;  3VD7 A;  3I3E A;  4ARY A;  3EYP A;  1JYX A;  4CVU A;  1NX9 A;  2YB7 A;  3GM8 A;  3VD5 A;  4CUB A;  2CDO A;  1R64 A;  3D3A A;  1OH4 A;  3VDC A; 
#chains in the Genus database with same CATH topology
 3ON7 A;  4GQ7 A;  1O6U A;  3BIW E;  4Q4W 1;  2WS9 2;  1V70 A;  1ZZ9 A;  1UXZ A;  4XFC A;  5KHH A;  3NL1 A;  2VD7 A;  4B7K A;  1AR6 2;  4JGZ B;  2YU1 A;  3GBG A;  1IKQ A;  2DBN A;  1RVF 1;  2J1V A;  2JJ6 A;  4HKO A;  4P5Y A;  5FTT C;  4XBN A;  2VMI A;  4BIF A;  3EHK A;  3D82 A;  3VBU B;  1ONA A;  1OLM E;  2R04 1;  2WBK A;  4C1X A;  1YJK A;  2JWP A;  1YLL A;  2ZA9 A;  1UL9 A;  1QIQ A;  2VW1 A;  2YFZ A;  1WCQ A;  2HWD 1;  3ZKU A;  1NUK A;  4HN0 A;  4JGZ A;  4MO3 M;  4UFK A;  4YW3 A;  1J3P A;  5FRE A;  1MZ5 A;  1RUH 2;  1PX3 A;  3DKQ A;  1B35 C;  1K5J A;  2W1W A;  1AR9 1;  1O5L A;  2GN7 A;  4CEY C;  2VU9 A;  3FX3 A;  1VBA 2;  2D5H A;  4QPG B;  4YW2 A;  3WV6 A;  4XFA A;  5JAX A;  5KXD A;  2Y34 A;  1LGC A;  4E27 A;  4Q0V A;  4UW4 A;  4C1W A;  4MET A;  4DUW A;  4GZ9 A;  1W6N B;  4N9I A;  4Q8K A;  4LA2 A;  3JD7 3;  1J1T A;  1Q5O A;  1TME 1;  3OBR A;  5FKB A;  4ATF A;  5JI9 A;  2PLV 1;  2E51 A;  2RS1 1;  1H4H A;  2TEP A;  1OC1 A;  4GWN A;  2ZZQ A;  3SEP A;  5T50 A;  1DQ1 A;  3MIF A;  5FZ4 A;  4AR2 A;  5L19 A;  2BW8 A;  1JOP A;  2NYY A;  1BQP A;  3IDA A;  2OA2 A;  2H6C A;  1KDM A;  2QQO A;  2DWR A;  2AZ5 A;  3MF6 A;  3EQE A;  4HK9 A;  1W6N A;  3MI8 A;  2NM1 A;  3ABZ A;  1GYK A;  1SEF A;  1GZW B;  3LQC A;  4CDU C;  4E2S A;  1MZ6 A;  3TNP B;  1OLM A;  3M2M A;  4J1W A;  1GP6 A;  3QOP A;  5FZ6 A;  4Q0Q A;  3VLB B;  1BXH A;  4FQZ A;  5J48 A;  1FOD 2;  4Q4V 3;  2B42 B;  1D4M 1;  3I7D A;  4BJ0 A;  3H1W A;  1O3T A;  1IGO A;  3HT2 A;  3ZX7 A;  4OUL A;  3ZSM A;  3OY8 B;  2IFR A;  2ARB A;  2Y0I A;  3GF6 A;  3QCW A;  3TN9 2;  5KR7 A;  3RI9 A;  1NE6 A;  2TNF A;  4PDW A;  2YZ4 A;  5CYY A;  3AYE A;  4CDW A;  1DP0 A;  2B7Y A;  4LHL A;  4S2H A;  3CNA A;  2WII B;  3T0A A;  5AC9 3;  3WDY A;  3DUI A;  4DXR A;  4B4R A;  2OYZ A;  4D7T A;  1MEC 2;  4YAR A;  1RUI 1;  4XVH A;  2MPF A;  2XJV A;  1NE4 A;  1RHI 1;  2XJU A;  2XJT A;  2P4E A;  5I0T A;  1ZA7 A;  5ACA 1;  1GQG A;  3C7O A;  1JOJ A;  3KSC A;  3NNL A;  2D6K A;  4C91 A;  5I8T A;  1H9W A;  5FOJ B;  3AZZ A;  3KT1 A;  2ZML A;  3K4A A;  4Z8B A;  3WHT A;  2VZU A;  4CDX B;  4A6O A;  4HL0 A;  2WFF 3;  4LPL A;  1WZX A;  4HON A;  5LEK A;  3NKT A;  4NE9 A;  4I09 A;  5EQU A;  2QQL A;  1KFX L;  4P9G A;  3FN9 A;  2WLP A;  5FY4 A;  4BDV B;  5HXV A;  4NPL A;  1C8M 3;  5EWS A;  3ZYP A;  1J83 A;  2OPW A;  4CU6 A;  2Y33 A;  4EWE A;  4FPK A;  2E7A A;  4FTB A;  4QX8 A;  1W8W A;  1HLC A;  4Q4W 3;  2PHL A;  4Y5S A;  2Z69 A;  1VPH A;  2VVE A;  1NA1 B;  4LO6 B;  4YW1 A;  4DEQ A;  4OHY A;  1QJU 1;  2VUL A;  4NOT A;  2Y6J A;  3LFM A;  1W03 A;  5EFU A;  3OBT A;  1OFS A;  2FDH A;  1NCQ C;  4AQS A;  2ERF A;  3CJI A;  5A32 A;  2O1Q A;  2AEZ A;  3M1H A;  3WEZ A;  4CDQ B;  4E4Z A;  3RJ2 X;  2PHD A;  3KVA A;  3MO4 A;  4FPO B;  3N4M A;  1HB4 A;  3BGA A;  1RUC 1;  2PAE A;  4FFH A;  4HMZ A;  1DGW A;  1VRH 3;  3ACL A;  2EXK A;  2NZ9 A;  1OQ1 A;  2ZAH A;  5A3N A;  2IFW A;  5E88 A;  2WIN B;  2JB8 A;  3ZN4 A;  5ANQ A;  5M0T A;  4FTE A;  3ZMO A;  2JEM A;  1SDW A;  3CEW A;  3LCP A;  4Q1P A;  5C70 A;  2PXJ A;  4KWL A;  3TEW A;  4MGT A;  4JDN A;  3FE5 A;  3J7N A;  1HV0 A;  1H8V A;  2DCK A;  2Q1M A;  4HKW A;  2A6Y A;  3GDB A;  2JDK A;  4N43 A;  2HLE A;  2HYK A;  4Q1R A;  5JOW A;  5FMB A;  5DAV A;  1RUC 3;  3OD4 A;  1ASJ 1;  1HW5 A;  5HV4 A;  1AX1 A;  2VZ1 A;  4NIH A;  3SEE A;  5L9V A;  3MLL A;  4ISQ A;  4WV8 A;  3J8F 1;  5KXB A;  1D2S A;  3NNM A;  4QQ2 A;  4IV1 A;  4AYU A;  3KB5 A;  3H3U A;  5DPN A;  4QX2 A;  3MF9 A;  3OGS A;  1LAJ A;  4Q4X 2;  3LOB A;  2R06 2;  4Q0S A;  4NHY A;  1ND2 B;  2ZBJ A;  4LHK A;  3N35 A;  5H9Q A;  3ZFE C;  1W8N A;  4L11 A;  4LBQ D;  4UFL A;  5H9S A;  1Q8P A;  2QUO A;  1PIV 2;  2GSY A;  3KZ4 C;  3T1L A;  3KT4 A;  2BNO A;  1PGW 2;  1H4G A;  2WO3 A;  4YM2 A;  1L7R A;  5FQ0 A;  4OQ9 A;  4FOY A;  3VBU A;  4E9K A;  1HV1 A;  4PQ9 A;  3WG2 A;  5L9R A;  1F4A A;  5FPL A;  3WX5 A;  3M3I A;  3R4U A;  3AKT A;  5AC9 2;  1QJF A;  2NQY A;  4OUM A;  1CES A;  4I0A A;  3U37 A;  2ENR A;  2C6S A;  2ZHL A;  3EO6 A;  3GZE A;  4TN7 A;  4XDP A;  5CG9 A;  1WA4 A;  2XQR A;  3NAP B;  2NMO A;  4H55 A;  4A7Y A;  3ZIX A;  5KC5 A;  2Y6L A;  2VOX A;  2AR6 A;  1OVS A;  5BYN A;  2W9X A;  3AKR A;  2VTX J;  1AR8 1;  2FHR A;  3DXT A;  3AK0 A;  2WQ4 A;  1VRH 1;  4NVP A;  2ZGT A;  2B4K A;  2VVD A;  3NNF A;  1SPP B;  1BEV 2;  1XYO A;  4DZG A;  3LA7 A;  2DYC A;  5DUV A;  3RZH A;  4ZON A;  1EAH 2;  4COW A;  1LB2 A;  1US2 A;  1N1T A;  4Q8L A;  4CXX A;  5FP7 A;  1QJX 3;  2DF7 A;  4HSL A;  3I3M A;  4IES A;  3R05 A;  5F3I A;  2VM9 A;  2JG8 B;  2GC1 A;  1REF A;  2PTM A;  4NPM A;  3LAG A;  3HJR A;  2VAU A;  4KGQ A;  1UQX A;  4LBL A;  3AP9 A;  3VN4 A;  4GJZ A;  2YC0 A;  5FLH A;  2C1F A;  1YCI A;  4M4P A;  5F5C A;  1C8M 1;  1RUE 3;  3MW4 A;  3LE0 A;  4DRV A;  1DQ6 A;  1VBC 2;  2DTY A;  4LT5 A;  1GU3 A;  1LU2 A;  2R16 A;  4FTS A;  3ZSK A;  1AYN 2;  2HJI A;  4YZ5 A;  1JTZ X;  2O8Q A;  5APA A;  2WFF 1;  4XOG A;  3OY8 A;  5FMD A;  1GNY A;  1KGY A;  3V56 A;  5BUV A;  5GZD A;  2XUE A;  3JQW A;  5A33 A;  4CUC A;  4LBM A;  4XZU G;  1HN0 A;  1RED A;  2VY0 A;  3GGL A;  1XSR A;  4GWI A;  1UKR A;  4E2Q A;  5JSP A;  4JTN A;  1MS5 A;  5D8A A;  1RHI 3;  5FAX A;  5ACA 3;  2NN8 A;  2WNU A;  3EMR A;  5K4L A;  1NXD 1;  4BU2 A;  1RUI 3;  1AR6 1;  2G9G A;  3VZK A;  4FAG A;  2DFB A;  1UD1 A;  2V72 A;  5DQ0 A;  5LW9 A;  2UU8 A;  1RVF 2;  3KHB A;  1GOH A;  3DPR C;  2D7F A;  4LIU A;  1IG0 A;  1F35 A;  2ZGR A;  3ZMN A;  4LOT A;  4W8J A;  4LUM A;  4CP1 A;  3OGR A;  1O8S A;  4YVW A;  5LBF A;  3HMY A;  2WA4 A;  4RGA A;  2OUJ A;  5KC6 A;  1QH7 A;  1LOF C;  2DVG A;  4YGC A;  4BM8 A;  4RA0 A;  4JGY A;  5LK7 B;  2VG9 A;  1S2B A;  1NQD A;  1X8E A;  3TRS B;  2XQX A;  5EJ3 A;  1DGR N;  2EAK A;  1CR7 A;  4BQ4 A;  1O4Y A;  2ET7 A;  4NIA A;  5L7O C;  5FMO S;  2BVV A;  3T1M A;  4BA6 A;  1QXR A;  1RVF 3;  3AKP A;  1H8T C;  2RG4 A;  1V6K A;  4D8M A;  5A6Z A;  2BVB A;  1EYB A;  2A70 A;  1IKP A;  2ZX0 A;  1HB2 A;  2XVG A;  3NW4 A;  1RUE 1;  2TUN A;  1PNF A;  4K1Y A;  5JDB A;  2VZP A;  5FZD A;  1HQN A;  3F95 A;  4LLF A;  5JIA A;  2X05 A;  3ZO0 B;  2OXB A;  1UIJ A;  5IK5 A;  2CV6 A;  1VE0 A;  2D3P A;  3WF0 A;  5JSO A;  4NID A;  5EJ1 B;  4AED B;  2VZS A;  1TME 3;  4Y4R A;  1FNY A;  2QQU A;  3RI8 A;  2TBV A;  4B29 A;  2HEY F;  2UWA A;  4F3J A;  1RC6 A;  3RMY A;  1V00 A;  1Y7B A;  2WL1 A;  3GZA A;  4GAL A;  4QQP A;  5EHD A;  5CIS A;  1T6G C;  1DDL A;  1JOD A;  4GMP 1;  3USU B;  2QJV A;  3NRU A;  2ZGU A;  4LHS A;  1YHF A;  3HPN A;  4QM9 A;  1E57 A;  5FO8 B;  2ARX A;  2RMU 1;  2XVL A;  3H3Z A;  5FPA A;  3USS A;  1W2A X;  1UO9 A;  1S0C A;  4ET7 A;  1JZ2 A;  3Q9O A;  4XF3 A;  3T2Q A;  3JD7 2;  4CU9 A;  1W3V A;  4TWT A;  1NT0 A;  5LZ6 A;  2EIB A;  5IVE A;  2R04 3;  5CAZ A;  3HVD A;  3ENR A;  2OPK A;  4Q26 A;  3UKN A;  3F2Z A;  3I2F A;  3RYK A;  3DKW A;  3CDZ B;  2RS3 3;  5CFD B;  4MG2 A;  5CFC B;  1OKQ A;  1POV 0;  4AI0 A;  1F5F A;  1HXS 2;  2W2I A;  5C9A B;  1RUD 1;  1UOF A;  3C7F A;  2KXL A;  5C3Q A;  5A70 A;  2E6V A;  2WSV A;  3NO8 A;  3CU7 A;  2VNO A;  3M8L A;  3IMM A;  3P1I A;  5LAT A;  1ZNP A;  4AHZ A;  2WS9 1;  1S1A A;  4FFG A;  2F4P A;  1O91 A;  2FDG A;  4QPG A;  2CYF A;  1BK0 A;  5A7N A;  4GWJ A;  5C8C C;  4UF0 B;  1YO8 A;  5C4W C;  5KXE A;  2WDB A;  1HRI 2;  4GKY A;  1LOA A;  1NZI A;  2G1M A;  3MUY 1;  1P8J A;  2ORZ A;  1LKN A;  2VW2 A;  4TTG A;  1T2X A;  1WW5 A;  2VUJ A;  2WN3 A;  4BQ1 A;  2UYB A;  2Y6H A;  2D6O X;  1SBD A;  5F5I A;  2F4L A;  4CDW B;  4EYU A;  1SFN A;  5FK7 A;  2WZR 2;  3SNM A;  1ZA4 A;  4LK6 A;  3O0X A;  5F5Q A;  5A3U A;  3WCR A;  3MYX A;  1ZRE A;  4QDS A;  1PMH X;  5FZI A;  1UF2 C;  3SKV A;  3MW3 A;  1I1E A;  4FAH A;  1DQ4 A;  3SXW A;  3KM5 A;  4LIV A;  1PVX A;  2VBB A;  5HXM A;  4DXT A;  3TAY A;  2WAA A;  1TQ5 A;  3PVB B;  1PVC 1;  2QVS B;  2P17 A;  1UU5 A;  3WUD A;  1YQC A;  2E7Q A;  4G9S B;  3WDX A;  4N90 A;  2VZR A;  5JPN B;  4A3Z A;  4RQP B;  1OH3 A;  2WNE A;  4YG3 A;  5FFO C;  4EJR A;  4FXG B;  4IEP A;  4RYD A;  3N7M A;  4PDW B;  4PLN A;  5FWE A;  4H14 A;  1NCQ B;  1NXM A;  1BVP 1;  2J22 A;  4N53 B;  3A21 A;  4Y1X A;  4JTO A;  1GZ9 A;  3LA2 A;  5L73 A;  3RZZ A;  4LE3 A;  1U5X A;  4HT1 T;  1VBB 3;  2E53 A;  4YFZ A;  4XBL A;  3AYC A;  5IYY A;  5FXW A;  3DPR B;  1AR7 1;  4QDR A;  4ONU A;  4CDQ A;  5IVV A;  3O0V A;  3T2O A;  5HPO A;  2A75 A;  1Y43 B;  4YW4 A;  3O1T A;  3AMQ A;  2GNB A;  5I8S A;  1LGN A;  1JZ6 A;  3N9Q A;  2XBO 3;  5BNP C;  3AP6 A;  4BXS V;  1LOB A;  4YW7 A;  4XUP A;  1XNK A;  3FLR A;  2PYT A;  1DZQ A;  4Y20 B;  1G9A A;  2W92 A;  2R30 A;  1QOO A;  3V64 A;  5A33 B;  1NCR C;  2JG8 C;  1JXN A;  2UWC A;  1LJ7 A;  1XRU A;  1AYM 2;  4YVS C;  5B2G B;  3I49 A;  1CX4 A;  2LRP A;  3PVE A;  4GA9 A;  2VOV A;  4EWD A;  3H8O A;  1VBD 2;  2YYO A;  1IS5 A;  1PO2 2;  5FDB A;  1QMJ A;  5CAD A;  5IJR A;  3NVC A;  4XAE A;  1LUL A;  1RMU 1;  4R52 A;  3AKQ A;  5GZC A;  5K0U C;  4JAA A;  1C5I A;  1AJK A;  1HB1 A;  4DIN B;  2GU9 A;  3IB3 A;  4BZ4 A;  2IUW A;  1DYO A;  1RXG A;  1MS4 A;  1YJL A;  2XON A;  1UY1 A;  3B5L B;  4NN0 A;  4CCL A;  5AC9 1;  1JN2 P;  5CZK A;  5LRR A;  1AR6 3;  2IVI B;  2P1B A;  4EE2 A;  3RYR A;  4AAX A;  1BKZ A;  4Z82 A;  3JBG 1;  1LEM A;  3FHA A;  4M00 A;  4AVT A;  3QLQ A;  4A4A A;  2BWC A;  5D21 A;  5J1X A;  2ARA A;  2IVJ A;  1DG6 A;  1D4M 3;  5C33 A;  1W99 A;  4NUB A;  2XWJ B;  1FYU A;  1OI6 A;  2Z42 A;  3GCW A;  1LES A;  2VMG A;  3NJV A;  4KI5 M;  5JI7 A;  3UGH A;  3ZSL A;  4ARX A;  4FBF A;  4QHO A;  3GCX A;  2GDF A;  3WLU A;  1KEX A;  4CDQ C;  3RWK X;  2PAK A;  1BEV 1;  2P6C A;  4D94 A;  3V0A B;  1ZVF A;  1A8M A;  1HJF A;  1JYI A;  2HWB 2;  3W5N A;  2ZEZ A;  3VD7 A;  4XDO A;  4XTP A;  4Z07 A;  2NP0 A;  1PMI A;  4UFJ A;  4QM8 A;  3RGB A;  4AFA A;  2WO7 A;  4MX3 A;  1SLL A;  1O4Z A;  4PCR A;  5LAS A;  2BOJ A;  3AL6 A;  4IUG A;  5F2S A;  4D7Y A;  1CAV B;  1R08 2;  3LA3 A;  3VDD C;  3OPZ A;  1QJX 1;  4ISR A;  2Q0A A;  4KQ7 A;  4R4X A;  1AL2 2;  4QXK A;  4W65 A;  1XE8 A;  5JSR A;  4AVA A;  2KR2 A;  1A78 A;  1YFW A;  1W9W A;  1FAY A;  2LS6 A;  2QTW B;  4LBN A;  2JDU A;  1TZO A;  1U5Z A;  2X09 A;  1QXP A;  4MUV A;  2JB4 A;  2WWS A;  1AR8 3;  2R07 2;  2Y38 A;  1CZV A;  2JE9 A;  2VME A;  4D6R A;  4DXS A;  1HN1 A;  1W2N A;  2HWD 3;  2QQN A;  3J9S A;  2YHJ A;  2BEO A;  1A8D A;  4D69 A;  1QDC A;  3RJR A;  4RS5 A;  3DV8 A;  2JIJ A;  1QOS A;  3KGL A;  3VD4 A;  5GLZ A;  3KVB A;  5E6H A;  2F6B A;  1XJA A;  2VH9 A;  3I2J A;  4J6G A;  2J1R A;  1NY7 2;  2SBA A;  4UW3 A;  1XPW A;  2VMF A;  1GMM A;  4MXW A;  2VZT A;  5I0R A;  5DAP A;  1BZW A;  1W6P B;  2RS5 1;  2YY1 A;  3H7Y A;  5C4W A;  2QQW A;  2XWB B;  4UWD A;  4CSW A;  1S55 A;  3NWK A;  1W39 A;  3L2Y A;  1X82 A;  3HNM A;  2CGP A;  4K21 A;  3ZSE A;  4AED C;  1CAW A;  3WT3 A;  3IPV A;  2XJQ A;  4K20 A;  1DGW X;  1RUJ 3;  3D0J A;  3C3V A;  3ZDV A;  2BGC A;  5LY2 A;  3UYJ A;  5DN2 A;  1QOT A;  2JKX A;  5EJZ B;  3CLP A;  3ACI A;  5SV8 A;  5EV7 A;  2BV4 A;  2VC9 A;  3D4K A;  4QB6 A;  1MVE A;  4ZXK A;  2VCA A;  4CUA A;  1SLB A;  2DUO A;  3AVS A;  1D0G A;  2VPV A;  2ADE A;  1UOB A;  3SKJ E;  1ZYB A;  5KHJ A;  3A7Q A;  2XXZ A;  1L3J A;  1K5M A;  1UYY A;  2WS9 3;  3HT1 A;  4YZ3 A;  1UZ0 A;  4G3Y C;  3O1O A;  4MGK E;  4EN7 B;  1SLT A;  1H1A A;  3I59 B;  3MV1 1;  4FPF A;  1FMD 1;  3I2I A;  5ABJ C;  4OZX A;  2CGN A;  1Y9G A;  3LPF A;  4YSF A;  4WM7 B;  4CU8 A;  3IBM A;  4WVM B;  2D5F A;  1ULO A;  2VL4 A;  3Q8F A;  4JGY B;  4OFG A;  1B35 B;  1AL0 G;  4ZS2 A;  5FWJ A;  2WAO A;  3VHP A;  1K5M B;  1NCR A;  2OII A;  2W0X A;  4I30 A;  2WA3 A;  1NCQ A;  1Q43 A;  1W8O A;  4PBO A;  1WGP A;  3Q8E A;  1UOG A;  3IM0 A;  5GAL A;  2Q8O A;  4ITC A;  4LKS A;  1Z7S 2;  4BE3 A;  2RR1 1;  1GQH A;  3CBN A;  5DAX A;  2K9Z A;  3BN6 A;  4W6W A;  1DYP A;  5FZM A;  3PIG A;  4BK4 A;  4WM7 C;  1Y9Q A;  3H0O A;  3ZYR A;  2HBU A;  2WQ8 A;  3PIJ A;  4AGV A;  1YIP A;  5ABJ B;  4PI2 A;  2YC4 A;  4NAO A;  2CY6 A;  3QH7 A;  4IEQ A;  4MVT A;  3C8X A;  5FMO L;  1BCX A;  1Z7S 3;  3DF0 A;  5F6K A;  2JDY A;  3ZYG A;  1YFY A;  4CRQ A;  4NWW A;  4QQO A;  5FJH A;  1WW7 A;  4CDU B;  3S30 A;  1Q8Q A;  4FPC A;  5ISL A;  1GWM A;  5CA6 A;  2IXI A;  2BZD A;  1DGR A;  3D6E A;  4JKK A;  3FBM A;  4JKM A;  1BHG A;  3U78 A;  1FXZ A;  5GZF A;  5T52 A;  1RUO A;  1O3S A;  5DUU A;  1RUF 2;  1OVP A;  3ZXF A;  1NA1 C;  3W5M A;  1D0H A;  3LF7 A;  3SMH A;  4EQV A;  1VBA 3;  1X7N A;  1GQP A;  1ODN A;  5KHK A;  2Y8K A;  3ZKY A;  1OKO A;  4R8H A;  4Y5Z 0;  4BPZ A;  4IEZ A;  3VKN A;  3KCC A;  4LUK A;  3TEZ A;  4V1P A;  3LIG A;  1YI9 A;  3NV3 A;  3M70 A;  2UY8 A;  4QX0 A;  2XL7 A;  4YGB A;  2E26 A;  4XQW A;  2ZX3 A;  2XKP A;  3V65 A;  5IVJ A;  5FMC A;  1W6Q B;  1YYN A;  3AP4 A;  3KHC A;  5FUP A;  2WC2 A;  1JZ5 A;  1F5J A;  1I6X A;  3FL7 A;  1LCL A;  5DG1 A;  3WP5 A;  2QDN A;  4K6B A;  5LEJ A;  3DYP A;  1AX0 A;  3VBS B;  4ATE A;  1PM7 A;  1Q8S A;  4M0H A;  5FY9 A;  4BQ5 A;  3B02 A;  4L0P A;  3RYP A;  1C1L A;  1COV 1;  3I3Q A;  3V0B B;  2VTF A;  2WAB A;  2B9U A;  4QPY A;  1BK1 A;  3E6C C;  5A7W A;  2PHX A;  1JH5 A;  3A4U A;  3QAC A;  4AI8 A;  2AAC A;  5I0S A;  3DN7 A;  1ULC A;  2JE7 A;  2UWB A;  1FI2 A;  3D8C A;  2NPI A;  3N9N A;  3OGG A;  5T54 A;  4BLI A;  4HG6 B;  1J84 A;  4TLG A;  3NJY A;  3V0B A;  1YQ5 A;  5SV5 A;  4B1L A;  2RDQ A;  2B46 X;  4UI9 L;  4ASK A;  1OA3 A;  1OOP A;  1TNR A;  2GH2 A;  5A1F A;  4I01 A;  1DLL A;  1KIT A;  4LO5 B;  4XJA A;  4XUN A;  3WP6 A;  1NYW A;  3OUI A;  2DV9 A;  3UGF A;  3JD7 1;  4XMA A;  5FPX A;  3B00 A;  3MPB A;  3U11 A;  1CZS A;  3DEM A;  5LBC A;  1UMI A;  1I9R A;  3LSD A;  3KMH A;  1EY2 A;  4BWO A;  5HBA A;  3FZ3 A;  3PU3 A;  1REE A;  3III A;  2BQP A;  1AJO A;  4FFF A;  4LLO A;  2WFP A;  5CNA A;  1APN A;  1VAK A;  2CAV A;  1MAC A;  1RMU 2;  2YBP A;  3I97 A;  4K7J A;  5FY1 A;  3N9M A;  5BV6 A;  5F7U A;  3VGI A;  1UWW A;  3UJO A;  2R32 A;  3SIS A;  4MGQ A;  2CSG A;  4PF1 A;  5I91 A;  1UN1 A;  3APB A;  3POW A;  1D4M 2;  1UZV A;  2AUY A;  2ATF A;  1H8T A;  1CAW B;  3OBZ A;  3WNN A;  5A32 B;  4LO7 A;  4SLI A;  4Q4Y 1;  3LWC A;  2BP6 A;  2YPJ A;  5KWR A;  3VHO A;  1O3R A;  5FZA A;  3ZXE A;  1QXJ A;  2F17 A;  2JDH A;  4XFH A;  3GZU C;  4IET A;  3AJY A;  1GWK A;  3MUZ 1;  4M3C B;  4B4Q A;  1LOE A;  5FUI A;  1CPM A;  1X8M A;  2A6Z A;  2IC1 A;  3K75 B;  4PF5 A;  5FYH A;  4N43 C;  3RZK A;  1RTV A;  1PZ8 A;  2IXH A;  3OEA A;  2C9A A;  2ET1 A;  2ZXQ A;  4YVW C;  1H8T B;  1TG7 A;  2I74 A;  2ZKL A;  5FZ1 A;  2G4I A;  3DPR A;  2VO5 A;  3LFI A;  4M3C A;  1ASJ 3;  2RDS A;  1PVC 2;  3FLT A;  2ZGL A;  3BOW A;  4FXK B;  3SCF A;  2P3J A;  4COV A;  3AB0 A;  2WNU C;  5DUW A;  3RVH A;  3U75 A;  2E32 A;  1AYN 3;  4NRP A;  4NRQ A;  5IAX A;  1W05 A;  1HIX A;  2R04 2;  1OPM A;  1YI7 A;  4ERO A;  4XMI A;  1PZ7 A;  2QQI A;  2A6V A;  4YGE A;  5FXV A;  3ZYH A;  3RZM A;  3A22 A;  3SCH A;  5FZO B;  5A6X A;  2XPJ A;  3TNQ A;  3AXE A;  3KT7 A;  3VL8 A;  1JU3 A;  1PM4 A;  2HWD 2;  2JXA A;  3ZOI A;  1D4V B;  2OZJ A;  2C24 A;  4URT A;  1W9Y A;  2VQ0 A;  4XF0 A;  2XR4 A;  3NQH A;  1XB9 A;  1XNT A;  3V0A A;  4YYO A;  2QQJ A;  4ZU4 A;  4OUS A;  2BRT A;  2VTX A;  2RDN A;  2A6W A;  4KU7 A;  4FCA A;  2HWE 3;  3VZN A;  3BAL A;  4HAN A;  1SLA A;  5LBE A;  1MQT A;  1A6C A;  3MFC A;  5C7G A;  1X50 A;  3WD5 A;  4L8Q A;  4P9I A;  3S7I A;  1DZT A;  4DFS A;  2RS1 2;  2DUP A;  4I3G A;  2HWF 3;  4O61 A;  3AC0 A;  3MGU A;  1IPJ A;  3MIB A;  4SBV A;  2ZHK A;  3ZYB A;  1POQ A;  1RUN A;  1CPN A;  1WW4 A;  4LBJ A;  3VBH B;  1WLT A;  2W87 A;  2BBA A;  5C3P A;  1MQT B;  2ZMN A;  1PO2 1;  4HFS A;  1R09 3;  5FBZ A;  1CJD A;  3E5U A;  3IDE A;  5IW0 A;  3H8R A;  3WF2 A;  4Z2W A;  2RV9 A;  4OI2 A;  3KQR A;  4LBQ B;  4NAM A;  1RUG 3;  4HVO A;  4DUV A;  2J1T A;  4QD2 A;  4CP2 A;  4OHW A;  5FYT A;  3ZFG B;  4GAZ A;  2OQ7 A;  5IVB A;  1PIV 3;  1PZ9 A;  5FIX A;  5G05 L;  1V0A A;  4COU A;  5FO9 B;  2HBT A;  1W6Q A;  1MZF A;  1VAM A;  3RNS A;  3T4H B;  2YMZ A;  3KV5 A;  1C8N A;  3VBS C;  1QQP 2;  1O8P A;  2VBP A;  4HET A;  1RGS A;  1FAT A;  1W6P A;  2H6B A;  3VBS A;  3UGG A;  4ZKT B;  2P3I A;  4QX1 A;  1ODM A;  1ZX5 A;  2RDR A;  1QJZ A;  2R06 1;  2YC2 A;  3PUA A;  3PTY A;  1FMD 2;  5DMY A;  4QAW A;  4LKE A;  5BY5 A;  2CU5 A;  2XHN A;  3SHR A;  1Y3T A;  2X53 S;  2DUR A;  4AG4 A;  1C57 A;  3U14 A;  2VQT A;  2JIG A;  4EN9 B;  2YU2 A;  1PGS A;  2IXK A;  1XE0 A;  4JQT A;  4ORF A;  4E8D A;  4UF0 A;  1UZZ A;  5CG8 A;  4B3N A;  1AYM 3;  3OCP A;  2ZGK A;  3N3H A;  2XDV A;  5CFD C;  2ZHN A;  1F9K A;  2EVX A;  3ZR5 A;  1GZW A;  1YXW A;  2MHF A;  2OQ6 A;  5EIY B;  4XAA A;  4CXW A;  3Q8A A;  2V4V A;  4OYU A;  3VBO C;  1R08 1;  4YGD A;  3BI3 A;  1OLR A;  2VQA A;  3POE A;  1AX2 A;  1UX7 A;  3VDD B;  3VZL A;  3HIF A;  4QB2 A;  4MH0 E;  3I59 A;  5BNP B;  4LOS A;  2LW8 A;  5C4W B;  1S0G A;  4KWK A;  2CGO A;  2WLQ A;  1SMV A;  4WM7 A;  3VL9 A;  3WW2 A;  1G9B A;  2XLA A;  4KWU A;  1H1I A;  4Q27 A;  1MPX A;  2GNM A;  5LK5 A;  5HCH A;  2E33 A;  2P5B A;  3C2U A;  3LD8 A;  5T3N A;  5JXI A;  2E63 A;  3ZVX A;  4KU8 A;  3UKT A;  2CHH A;  2HWF 2;  4QQH A;  2RS1 3;  3W59 A;  1AL2 3;  2D6N A;  1ENR A;  2VEC A;  5IVF A;  3KD4 A;  4CCN A;  1IS3 A;  4RGK A;  4ZPI A;  5D1I A;  5DZF A;  1D7P M;  3ZFF B;  3CIH A;  4QPI B;  3UES A;  4UBH A;  1JYN A;  3H3L A;  5FPV A;  1VMF A;  3WF3 A;  4DY5 A;  5HCF A;  1SFP A;  3SQO A;  3AX4 A;  5ABJ A;  1OPO A;  2DTW A;  3H9A A;  1NKG A;  2DVA A;  2DVB A;  3JQX A;  1Z0H A;  1VBC 1;  4D3W A;  3RG0 A;  5KHI A;  3KF3 A;  5A7O A;  4A44 A;  4ASL A;  2Y6G A;  4XJW A;  4M01 A;  2H0B A;  4YM1 A;  1LRH A;  5LCW L;  4IEY A;  1ZBA 2;  4B1M A;  3M3Q A;  1MS1 A;  3P3P A;  3WP4 A;  4Y1Z A;  5FZK A;  4OI1 A;  2WZR 3;  3KF5 A;  4MV2 A;  4S2F A;  1PK6 A;  2ZEW A;  4E2G A;  1E5H A;  3W21 A;  1V9U 2;  1Y9M A;  3PUI A;  5LY1 A;  1S4C A;  1ZM1 A;  4MGZ E;  3MZH A;  1IPK A;  3VUO A;  2FDJ A;  1QGL A;  1J1L A;  1QEX A;  1PMJ X;  3WW1 A;  5FR3 A;  3WHU A;  2QZ2 A;  4CCE A;  1ULF A;  1KFU L;  1JBC A;  2W94 A;  4BH9 A;  4HVR A;  3WNK A;  1UIK A;  4XQ4 A;  4AGG A;  3EJK A;  2VNR A;  2FMD A;  4MGS A;  4Q29 A;  1LHN A;  5EZW A;  3TEY A;  5IVC A;  1VBD 3;  2VCM A;  4RS5 C;  4XYX A;  2DFC A;  1A3K A;  3I2G A;  3WDU A;  3QD6 A;  5FBJ A;  1J58 A;  1CAX B;  1ND3 A;  2W08 A;  3FLP A;  4H3W A;  4U2A A;  1DQ0 A;  4WM8 C;  5GZG A;  4P02 B;  1W0P A;  1W8T A;  3O1M A;  4OZO A;  4COY A;  4FO9 A;  3MV0 1;  3OSD A;  2Q30 A;  3WNP A;  1IQA A;  3OTF A;  1L7L A;  1FV2 A;  4RGG A;  1J59 A;  2HKX A;  2VVF A;  4Y26 A;  3I2O A;  3FUQ A;  2XJR A;  3K3O A;  2E9Q A;  1LU1 A;  2XBO 2;  3QH6 A;  3SLI A;  1CAX A;  1AR8 2;  3LPG A;  1HKD A;  1UX6 A;  3DCQ A;  2VCC A;  3LEM A;  1VRH 2;  3WW4 A;  1UPS A;  2WYF A;  1JYC A;  2A71 A;  2D98 A;  2XKO A;  3DL3 A;  3ETQ A;  1ZBE 1;  2D44 A;  1AXK A;  1YEW A;  2JEC A;  4N7I A;  4OMC A;  4ZXE A;  1CIW A;  1US3 A;  4NIG A;  2NMN A;  1SBF A;  2XB6 C;  1OOP C;  1RXF A;  1S0I A;  2JDZ A;  3B9C A;  1XC6 A;  3LEK A;  3OGJ A;  4XDQ A;  3WDT A;  2LRO A;  1YWK A;  3VBF C;  4AW7 A;  3FJS A;  5C6C A;  4P9W A;  5F3G A;  3KCX A;  3AMH A;  4Y22 A;  5T5O A;  4BQ2 A;  3ZXJ A;  1NOV A;  4EZ4 A;  1N47 A;  4IGQ A;  2ARC A;  5FRA A;  2R7E B;  5FYS A;  1PX4 A;  4CEY A;  1C8M 2;  1DQ2 A;  3HQX A;  4OHV A;  4W6X A;  3BU0 A;  4WVZ A;  3PNA A;  4MHR A;  4Q5O A;  3ZFG A;  1ENX A;  3FHI B;  3I3E A;  5FZ8 A;  3BVC A;  2R49 A;  4QKF A;  5FP4 A;  1OHF A;  2BJS A;  1C3H A;  5DAB A;  5TSW A;  4QX7 A;  5C5U A;  4CUB A;  1LTE A;  1W6M A;  3D3A A;  3VHN A;  1XSQ A;  1OH4 A;  4UW5 A;  3VDC A;  2ID4 A;  3N7L A;  4TZD A;  1H1M A;  1ZZ6 A;  3ALQ A;  3ELN A;  3POS A;  1W6O B;  1VJ2 A;  3OB8 A;  5AVP A;  2R0H A;  3O0W A;  2WZE A;  4OHZ A;  3ST7 A;  4RS5 B;  2SLI A;  1COV 2;  4B7E A;  3J7H A;  3B94 A;  1BBT 3;  2C4X A;  4MXW B;  5DUX A;  2GMP A;  5K0U B;  1K12 A;  2CL2 A;  1K42 A;  1WMD A;  1KRI A;  1NA1 A;  5EXO A;  3GHN A;  4P08 A;  3QBQ A;  5I93 A;  4C90 A;  4UAP A;  2W47 A;  3O1S A;  2VMC A;  3WZ1 A;  4QGN A;  2YUE A;  2X8K A;  5BNP A;  4XFI A;  4MHU A;  4LR4 A;  1RUF 3;  3PVN A;  5A7S A;  3FC0 A;  3SIT A;  3S57 A;  1RUE 2;  2OKX A;  1CIY A;  3TEX A;  4K9S A;  4ZU7 A;  2Y26 A;  3KWV A;  1FPN 3;  4AFC A;  2YRO A;  1G9D A;  3BOP A;  2W1S A;  5GLW A;  2DCY A;  3PUR A;  5K7P A;  1EP0 A;  2ZAB A;  5IVY A;  1PHM A;  1S0F A;  5D8A B;  4WBB A;  5BNQ A;  2BFU L;  3OOX A;  4WZC A;  2GH8 A;  2ZGP A;  4C0H A;  5KBF A;  1EAH 3;  4XUT A;  1K45 A;  2Z2S B;  3N7J A;  4LIT A;  3PLQ A;  1GZT A;  4UBG A;  1ZRC A;  4HN1 A;  5JOZ A;  4NRO A;  2BFU S;  3TOJ A;  4XF9 A;  1FV3 A;  2PA7 A;  2CAU A;  4YG6 A;  1PGL 1;  1GOF A;  1W9F A;  2WR9 A;  4W4Z A;  4MOA A;  5F3E A;  3T09 A;  1FPN 1;  2WO2 A;  3EB7 A;  3BTY A;  4JQR A;  2HH9 A;  4QWN A;  1AXZ A;  3WUC A;  2RJL A;  3CJI C;  3MIG A;  3MW2 A;  3WW3 A;  3T0D A;  1LHU A;  4AXO A;  4COZ A;  1QQP 1;  2DBI A;  1OD3 A;  2X5I A;  2FBE A;  5FZO A;  1XU2 A;  1YFU A;  3URF A;  5LBB A;  1W9T A;  1HXS 1;  1AUY A;  3MLJ A;  4YM3 A;  4Y24 A;  3O1P A;  2P6H A;  4NHM A;  2ZS6 B;  4GXL A;  5JOY A;  1W8Z A;  3HWJ A;  2YG0 A;  2Z4F A;  5HCB A;  3VZO A;  1WMF A;  4JV4 A;  4Y1Y A;  4PIZ A;  2VMD A;  3NAP C;  5GLU A;  2QQV A;  2R06 3;  2Q8D A;  3ACG A;  1CJP A;  2ZAA A;  2O14 A;  5F2W A;  1UOJ A;  1OFN A;  4XF4 A;  2JG9 C;  3JZV A;  4MAD A;  4EN6 B;  1WCD J;  1TMF 1;  1ULE A;  3GNE A;  5FYB A;  2IXC A;  1POV 3;  2ADD A;  2XLG A;  2YBS A;  1QJY 1;  2OZ6 A;  2YGM A;  4K8R B;  4NR1 A;  4RHV 1;  3JCI A;  4UFI A;  3T30 A;  3HOB A;  4JKL A;  3USU A;  3S5Q A;  4RR3 C;  2QQM A;  3VBH A;  4IEW A;  5A3L A;  2BGO A;  2R0F A;  2ZJC A;  4N7U A;  4BHP A;  4AI3 A;  4FOW A;  3I2H A;  4MYE A;  1CZT A;  1FOD 3;  2P2K A;  4Q4V 2;  4UOJ A;  1XNB A;  1R1A 3;  1C4R A;  1WBL A;  3AZV A;  4FFI A;  4AI9 A;  4B4P A;  1W28 A;  1L7Q A;  3K46 A;  5EYY A;  3AFG A;  4K8F A;  5HI0 A;  4GB3 3;  2PHF A;  3MFA A;  2CDP A;  3C7G A;  2HWB 1;  1UZW A;  4XHB A;  2JE8 A;  2JD4 A;  3M4F A;  4LE4 A;  4QB1 A;  2J1A A;  4DMI A;  4FT8 A;  1XE7 A;  2ORX A;  4R9B A;  4GUL A;  3ECQ A;  3LDB A;  2V5Y A;  2K46 A;  2PHU A;  3TB0 A;  1JYW A;  3OPW A;  3UT0 A;  5BNN B;  2CNA A;  4X6R B;  2WZ8 A;  2R07 3;  2WNV C;  4IV3 A;  1FNZ A;  1WLC A;  3T0B A;  4XUR A;  1XBF A;  1FT9 A;  3NV2 A;  4LK7 A;  3VDD A;  1PNG A;  3CZJ A;  1MS3 A;  1QJX 2;  2VQU A;  3R0R A;  4J25 A;  4LBK A;  2A1X A;  5L7O B;  2Q4S A;  2R1D A;  3E5Q A;  3FBY A;  2J42 A;  3IAQ A;  4Y22 B;  1UZY A;  1VMH A;  4EN8 B;  3BYW A;  2D6M A;  3E97 A;  4MSV A;  1ZBE 3;  2Y6F A;  3LGR A;  4PQQ A;  3T2P A;  2HWC 3;  3N36 A;  4PJY A;  4CEY B;  1JZ3 A;  1ZBA 1;  3VZM A;  2VR4 A;  3KQ4 B;  4Y1U A;  2B8M A;  3EBR A;  4CCO A;  4K3U A;  3B93 A;  5H9P A;  3ILF A;  4Y4Y A;  5L7O A;  3OEB A;  4W50 A;  2UYA A;  5LWB A;  3DXU A;  2Z5W A;  4L97 A;  4P5H A;  1V9U 1;  3I3D A;  1MQT C;  1HRV 3;  2HWB 3;  1FMD 3;  4JVA A;  3BU7 A;  1EV1 1;  3U0Z A;  1LOF A;  1B35 A;  1IPS A;  1B09 A;  1NY7 1;  3A0K A;  3LEG A;  3N7K A;  2O0O A;  4A2U A;  5JCT A;  2MNG A;  3N9L A;  3FFZ A;  3BTZ A;  3AVR A;  1AHS A;  4H7L A;  1SLI A;  1VBD 1;  4BQY A;  5BNO B;  3UNP A;  2ZEX A;  4EN0 A;  3IDC B;  3T3Y A;  1UY0 A;  3HBK A;  1UAI A;  2GP3 A;  2ZX1 A;  4BK5 A;  5IAV A;  2ZMK A;  5FOB B;  1WCU A;  3ORJ A;  4DIQ A;  4J1X A;  2Y0O A;  5F39 A;  1H6Y A;  4RFR B;  3P6B A;  4AFD A;  1N1S A;  3B7M A;  2EF6 A;  5F1R A;  4UFM A;  1BMV 2;  1R1Z A;  3NV4 A;  5J3U A;  2D6L X;  1UU4 A;  1YQ2 A;  2RS5 3;  4RL7 A;  3M3O A;  1H2N A;  1QNY A;  3S0M A;  2HEW F;  5DDJ 3;  5J96 B;  4PIY A;  5FY8 A;  4W6Y A;  2ZKN A;  3POI A;  2WT1 A;  3KCY A;  1HXS 3;  1G9C A;  5FP3 A;  3BUC A;  3BIE A;  1ZBE 2;  3WNM A;  3KV9 A;  3AMN A;  1JZ7 A;  4F8A A;  2ES3 A;  2XL9 A;  5A3O A;  1MS8 A;  1SHW B;  2CWS A;  4JCK A;  3GZT B;  1UNB A;  5FUN A;  3ZFF C;  1V6L A;  1J3R A;  1KQR A;  1JZ8 A;  2W52 A;  1CX1 A;  1T6B X;  4XIO A;  1PK6 B;  4M4R A;  5BNO C;  1ALY A;  2VOT A;  1WW6 A;  3H7J A;  3WQB A;  4XPV A;  4QHB A;  1S2K A;  1IHM A;  2EXH A;  4A7Z A;  4XBQ A;  1W8U A;  4P9Y A;  4XFG A;  2UUR A;  1OQE A;  3ATG A;  4CCC A;  5FLI A;  1M06 G;  1AL2 1;  4RHV 3;  3T4V A;  4CEW A;  3WG1 A;  2RM2 2;  3ZN5 A;  1OF4 A;  3HNY M;  2DU0 A;  1STM A;  1W90 A;  3W20 A;  2I07 B;  4YFW A;  2YV8 A;  1ZZB A;  1TE1 B;  3EXU A;  3U10 A;  1ZRF A;  3HD8 B;  1SQ4 A;  1WA6 X;  3P3N A;  4AF9 A;  4CUG A;  3DGT A;  4O9E A;  4OMD A;  1VLN A;  3JB4 C;  3HN1 A;  3ZFE B;  3RZJ A;  2VZV A;  3K3N A;  4N43 B;  4AVS A;  2E31 A;  4L92 A;  1VMJ A;  3O14 A;  2A6X A;  5A1L A;  1DYK A;  1IG3 A;  3VBU C;  3LB9 A;  1RUF 1;  2QZ3 A;  4AVV A;  2A3Y A;  4D0Q A;  3OGV A;  1NQJ A;  4A45 A;  5F37 A;  1QQP 3;  4QHZ A;  3ZFE A;  4CDX C;  4UYB A;  2X29 A;  1W06 A;  1VB2 A;  1LR5 A;  1ULP A;  4GD4 A;  4IE5 A;  5BPX A;  5DAQ A;  1OQD A;  4IW3 A;  4AHY A;  2LAL A;  1OLQ A;  1OXC A;  1G7Y A;  1UW8 A;  1UPI A;  4N9H A;  4IGP A;  1VBE 2;  5J37 A;  4HVQ A;  1VAV A;  4K40 A;  2W1Q A;  4LQR A;  1BBT 1;  1QU0 A;  1WCK A;  2PEL A;  2ZGN A;  5E1R A;  3RFR A;  4IEX A;  2QKD A;  4AAP A;  2XJS A;  4RD7 A;  3PJQ A;  4NPR A;  1LOG A;  1X33 A;  4ZHN A;  2JDM A;  4QDQ A;  4RFT 0;  1HRI 3;  1LEC A;  2Y60 A;  2EIE A;  5T5L A;  1GOG A;  1MZE A;  5A3T A;  2Q1F A;  1JS9 A;  5FYZ A;  3UK9 A;  3J26 N;  1RYY A;  1WD3 A;  3A23 A;  5DAW A;  1KD7 A;  2PLV 2;  4FPH A;  2WN2 A;  1RL3 A;  4XAB A;  2W91 A;  4QKN A;  3VBR B;  3ZLI A;  1ND2 C;  1WME A;  1WWY A;  1OSG A;  4CP0 A;  4JX0 A;  2KD7 A;  3PHM A;  4N53 A;  1RUG 1;  5IK8 A;  1GLH A;  4GJY A;  4AE2 A;  2VUC A;  5GJ6 A;  3AMP A;  4JHT A;  1SPP A;  5L9B A;  3ILN A;  5BNN A;  4QGL A;  1E5R A;  2RM2 3;  2BYV E;  4MGY E;  3CKH A;  1XQN A;  2ARE A;  1F31 A;  2KA3 A;  4TLF A;  3G7D A;  3IMN A;  3PME A;  4NMI A;  5A3W A;  1MS0 A;  4CTE A;  4D6S A;  1W6O A;  2AEY A;  1Z7S 1;  2XH6 A;  4EZH A;  5JXJ A;  1PGL 2;  2JG8 A;  5DDJ 1;  1H2M A;  1O59 A;  3E6D A;  4HPK A;  5E8A A;  5EP9 A;  5FZ0 A;  1KJL A;  5FZF A;  3GBW A;  3A0N A;  3ZXL A;  1PO1 2;  1GBG A;  3MIH A;  4LEJ A;  3RSJ A;  3WR0 A;  4BQW A;  4F7Z A;  2W5F A;  4AVC A;  1VP6 A;  3TN9 1;  1CAU B;  3AYA A;  2RR1 3;  4GB3 2;  3RS6 A;  1W2T A;  1GFF 2;  3MHZ A;  3Q8C A;  2MEV 1;  3VD3 A;  5FP8 A;  3GAL A;  1S0D A;  4ZZ8 A;  2R6Q A;  3B01 A;  4Y33 A;  1R1A 2;  4H7M A;  2PAM A;  1PVC 3;  2H0V A;  3LDK A;  3WG4 A;  1UKG A;  2D6P A;  2DCJ A;  1Q8O A;  3UJQ A;  1NLQ A;  4Q4W 2;  4BQX A;  2XGX A;  1JOB A;  3MEP A;  4RSU A;  1ZZC A;  3BTX A;  1OA4 A;  4XEZ A;  3S7E A;  2NLR A;  3B69 A;  1S0B A;  4XJ8 A;  2BWA A;  5FXZ A;  1M4W A;  3LIH A;  1W3X A;  4GMP 0;  4IE7 A;  4JHZ A;  1KS4 A;  4N8M A;  1QH6 A;  4WVM A;  2AC1 A;  5FYI A;  5FYM A;  3AJZ A;  3OUJ A;  4YWA A;  4XC9 A;  3AMM A;  4ES9 A;  3AL5 A;  3ZDS A;  4CE8 A;  2W46 A;  2Y64 A;  1AXY A;  4LO4 B;  4AEJ A;  5FYV A;  4WZF A;  4PDW C;  1GP4 A;  2QFE A;  3PVO A;  4DXZ A;  3U1X A;  1QJU 2;  5DZG A;  2A7A A;  3WY6 A;  5JXH A;  3VD9 A;  2QBX A;  3GBF A;  4Q4X 3;  1AR9 2;  1HX6 A;  1BJQ A;  5JMC A;  4D7S A;  3O7O A;  3PTR B;  1EPZ A;  1K5M C;  1LHV A;  2WRA A;  3I4I A;  4XF1 A;  5BNN C;  5A7P A;  3TN9 3;  1HRV 2;  2RE9 A;  2BDR A;  4CCK A;  2EXJ A;  2A3W A;  2VZQ A;  1GKB A;  1RUC 2;  3NKG A;  4HSJ A;  5CIR A;  5FV3 A;  5LB6 A;  1UYP A;  4N53 C;  4QXB A;  2RS3 1;  1Y4W A;  4XXP A;  5IFT A;  2LTN A;  3PMS A;  2VW0 A;  4AZZ A;  4XW3 A;  4OI0 A;  1H2K A;  3H8U A;  3ZXD A;  2GME A;  2X5I B;  4DB5 A;  2HWC 2;  3J7M A;  3THD A;  4QPG C;  5K9Y A;  4AED A;  2FQP A;  3OJB A;  2JIC A;  2PN5 A;  4Y3O A;  4EV0 A;  5LA0 A;  4LOR A;  1VBC 3;  4LTA A;  4PLM A;  4TYS A;  4UFH A;  3UKV A;  1SCR A;  3W58 A;  4CZS A;  2P34 A;  4KG0 A;  1C28 A;  2J1S A;  4OVE A;  1JHN A;  1MR5 A;  4WVW A;  3KGZ A;  4JDM A;  4Q0P A;  4NHL A;  5ANN A;  4DY3 A;  3H1Y A;  5FP9 A;  3RPQ A;  1V6N A;  4CA9 A;  5C8W A;  1ND3 B;  1FOD 1;  2GAL A;  3LZZ A;  5EPA A;  5C3S A;  3O1R A;  2B9V A;  5DXD A;  2Q5T A;  1FPN 2;  4P9L A;  4AOC A;  3SH4 A;  1QJY 3;  3BB6 A;  1OMI A;  3VKO A;  4GWM A;  1EUU A;  1UMZ A;  3J8F 2;  5JPM B;  4S2D A;  2B5H A;  2BUK A;  2PHT A;  1NLS A;  4KWJ A;  4BIO A;  5JOX A;  5LA1 A;  3AP5 A;  4KNC A;  3POY A;  1W8F A;  2C0Z A;  1MEC 1;  2IXJ A;  2OW4 A;  2V73 A;  5FZB A;  3ZXA C;  4XCA A;  2WO1 A;  3PDQ A;  4YLZ A;  3I8T A;  5JUV A;  3LOI A;  3RRD A;  3ZYJ B;  5AFB A;  5HCA A;  1QJE A;  2G9Z A;  1RIT A;  5BXX A;  3ES4 A;  3KV6 A;  2D3S A;  4PIX A;  4ZZ5 A;  1WMX A;  4FPL A;  3VDA A;  1GNZ A;  3CL1 A;  3O5S A;  4HK8 A;  4KGG A;  3DYO A;  4MGI E;  4AI2 A;  3H42 B;  3I2K A;  4Q4Y 2;  1QY4 A;  3FWE A;  4V2V A;  3IT8 A;  1OT5 A;  2Q1Z B;  4CEW C;  3NNG A;  2WYS A;  3IN9 A;  4PHZ A;  1QWR A;  1JYV A;  2OS2 A;  3M3E A;  3TBD A;  1U5I A;  3LSE A;  4NJ4 A;  1UY3 A;  4QKB A;  4XIK A;  1OA2 A;  4I0B A;  4LO8 A;  4NHX A;  5BNO A;  2VJX A;  1MEC 3;  4AL9 A;  3K48 A;  1XYN A;  2VXJ A;  4JGY C;  3WQ1 A;  2GND A;  4X8P A;  1RMU 3;  2VNG A;  3G6J B;  1EAH 1;  1NCR B;  3ZYF A;  4A42 A;  1C5H A;  3THC A;  2FDI A;  1I5P A;  4DNY A;  5LA9 A;  2O8O A;  4LHN A;  5FZL A;  4RR3 B;  1O4T A;  4IER A;  1VAL A;  2YB7 A;  3GM8 A;  4DOU A;  4EWA A;  2AH2 A;  2VE1 A;  1R64 A;  4A7K A;  2VOK A;  2D93 A;  4DQA A;  3INA A;  4H2A A;  4ZS3 A;  1YQ6 A;  3NV1 A;  5FZE A;  1OUS A;  5K0U A;  5D8A C;  3WQ7 A;  1R08 3;  3BKZ A;  4CP9 B;  1QDO A;  1LNS A;  1ZZ8 A;  4O7X A;  2WQZ C;  2D40 A;  3JB8 A;  2WZP P;  4R9A A;  1D2Q A;  3FHQ A;  4QKD A;  4E4D X;  1XNC A;  3ZXK A;  3Q8B A;  4O65 A;  4S2G A;  2J1U A;  4YVS A;  3ME2 A;  2IZW A;  4FP2 A;  4V2W A;  2QNK A;  3E5X A;  1ZRR A;  2HWF 1;  3W9A A;  2ILM A;  4BME A;  2JEN A;  3OUH A;  3NMB A;  4CPB D;  4PBP A;  1S0J A;  4AHW A;  1N3Q A;  3J7L A;  2L9L A;  3M7A A;  5CB7 A;  5FZ7 A;  4ZY9 A;  1BLZ A;  4XCB A;  4QGM A;  1UY2 A;  1V6J A;  2DVF A;  4JC1 A;  5D2A A;  4DEV A;  3L9J T;  4Q4X 1;  3OYW B;  3AM2 A;  3PU8 A;  2FD8 A;  1URX A;  4AI1 A;  5FZG A;  4FP3 A;  5G04 L;  1JUH A;  2W95 A;  2WSU A;  5F5A A;  3SH5 A;  2ZPX A;  1G9F A;  1AZD A;  1VRB A;  2X10 A;  3KLS A;  1PIV 1;  2AYH A;  2JDP A;  3ITQ A;  4QU1 A;  3WDV A;  4M0N A;  1WUV A;  2K2S A;  1F4H A;  2HYX A;  4PI0 A;  2HEV F;  5J09 A;  1XND A;  2V09 A;  3ZXG A;  4L2N A;  1X9P A;  1IZ3 A;  1BMV 1;  1LEN A;  2VUD A;  4AFM A;  3AXD A;  5C9A A;  4CXY A;  1DBN A;  2FDK A;  4YZ4 A;  3X29 B;  5CU1 A;  3IIA A;  1ENQ A;  5J36 A;  1U5Y A;  3I3B A;  4IE6 A;  5T55 A;  4I2O A;  1CQ9 A;  4CEW B;  4E8C A;  4YW6 A;  2Q8C A;  4L9B A;  4XTM A;  1YQ8 A;  4KG8 A;  3MLK A;  5DG2 A;  2MEV 3;  2A73 B;  2XVK A;  4G4F A;  2WNV B;  5IFP A;  3RZL A;  1H0B A;  1ZRI A;  2DVD A;  1E5I A;  1JYT A;  4LMF A;  4NWV A;  3WF1 A;  1N1Y A;  2FZ1 A;  3PJY A;  2XG3 A;  1RUD 3;  3WNL A;  1BYH A;  2VMH A;  2ZEY A;  4NHK A;  3HN3 A;  2JG9 B;  1ND2 A;  1QKQ A;  2GNT A;  4I0W B;  4XJU A;  4FPY A;  3SCG A;  5F3C A;  5I0D A;  2ZHM A;  1K3I A;  2XLF A;  2WNO A;  2DUQ A;  3CZU A;  1SBE A;  2DCT A;  5I0U A;  4A3X A;  5C8C A;  4WM8 B;  4XUQ A;  2D43 A;  3CQO A;  4M3C F;  4QXC A;  4X6Q B;  1SZB A;  1CAV A;  3ACF A;  5CVR A;  5CFC C;  1F2N A;  4CCM A;  1YUD A;  3VBR A;  2RM2 1;  1Q8V A;  1GNH A;  2VZO A;  4KL1 A;  2VGD A;  3CF6 E;  4GB3 1;  4KBB A;  1WD4 A;  5FXX A;  4DUX A;  1WCS A;  2JG9 A;  3O1U A;  1AYN 1;  1EUT A;  4FPE A;  5KXC A;  5F9T A;  1R1A 1;  3NAP A;  1RUD 2;  1OD5 A;  5C8C B;  2V4A A;  4AGR A;  5JR2 A;  4XAC A;  2B45 X;  2GMM A;  2PMW B;  2XJP A;  4Q2F A;  2FZ2 A;  1UY4 A;  3ILR A;  4CYD A;  2XML A;  2BTV C;  2FCT A;  4YZ2 A;  1ZRD A;  4CDX A;  4HXC A;  2RVA A;  3BTA A;  5A6Q A;  3M3C A;  5FYC A;  4JGZ C;  1HRI 1;  1YFX A;  4UW6 A;  4LNV A;  3BPS A;  4IV3 B;  2X5I C;  2J1E A;  1CGP A;  2RHP A;  4YZ1 A;  2G19 A;  1Q56 A;  4HZF A;  4IEO A;  4BOW A;  2QE3 A;  1VB4 A;  2GC2 A;  4AEK A;  1F15 A;  4YW5 A;  2JKB A;  1GP5 A;  2WKK A;  2WZR 1;  4FVV A;  5CEH A;  1U0A A;  2JDN A;  4LJH A;  1SLC A;  3K2O A;  2AEN A;  5F32 A;  4ASM B;  1RB8 G;  1BBT 2;  1W8H A;  3CJI B;  3ZPY A;  5C9A C;  3WNO A;  4Z2A A;  2ZOE B;  4U36 A;  1YNA A;  1COV 3;  4AVB A;  2W68 A;  1DIW A;  4AK3 A;  5FY7 A;  2BOI A;  4L99 A;  2DU1 A;  1G6N A;  3WNX A;  4LUL A;  3AYD A;  4HPK B;  1KS5 A;  4ZU5 A;  1TVG A;  5ERL A;  3VV1 A;  5H9R A;  2RS3 2;  1RIR A;  3RWN A;  5I8Y A;  3OD0 A;  3OG2 A;  3WDW A;  1DFQ A;  1SG3 A;  1CAU A;  3D5O A;  1OF3 A;  4E4S A;  3C7E A;  4BCU A;  4M3C E;  1RUG 2;  2GP5 A;  2P3Y A;  4QX3 A;  1W04 A;  2GZW A;  3HQR A;  3ZFF A;  1KDK A;  4QPI A;  3GJA A;  3N9O A;  2C9K A;  2BU9 A;  1GUI A;  2A5Z A;  1H6X A;  1O5U A;  1LED A;  1R09 2;  5IHR A;  1V6O A;  5CKM A;  4YG0 A;  5JZG B;  1LOC A;  5AVA A;  1XU1 A;  3BCW A;  1HQW A;  1TNF A;  4X8N A;  1C1F A;  1AR7 2;  3R6S A;  1OBN A;  5FYU A;  3SH3 A;  5FJK A;  5LA2 A;  5JIU A;  3VBO B;  1DU3 D;  5JWP A;  1VBA 1;  1WLW A;  1VBB 2;  2RMU 2;  1V6I A;  1LOD A;  2BGP A;  2YDE A;  3WQ0 A;  2DDU A;  3K51 A;  5JMO A;  5IUQ A;  1DGL A;  2I45 A;  5IT6 A;  3CMG A;  3R4D B;  4IGO A;  4YVS B;  4AQT A;  2PHW A;  1X36 A;  3MIE A;  2XBO 1;  3PUQ A;  1UYX A;  3VKM A;  4A6S A;  3THP A;  5F8P A;  2HWE 2;  1MS9 A;  4BIS A;  2YGL A;  3B3Q E;  2PLV 3;  3JUU A;  1AYM 1;  4HKL A;  5FKC A;  1U12 A;  5C71 A;  4P00 B;  2BNN A;  5J98 B;  4WVV A;  4IDZ A;  4CDU A;  1N3P A;  2OX0 A;  1LHW A;  5A6Y A;  2JD9 A;  3HR9 A;  1DLC A;  3LEI A;  4XFF A;  3ES1 A;  2BBV A;  2UY9 A;  5FPZ A;  2WT2 A;  3ZPO A;  4QU2 A;  3OF1 A;  4JZR A;  2YBK A;  4IXL A;  3VDB A;  4Z92 B;  4O9G A;  1AF9 A;  4OI4 A;  1OUR A;  2OT7 A;  2FDF A;  1YRZ A;  2AGS A;  4A41 A;  4OCT A;  1NZC A;  2PQQ A;  3JBG 2;  4PT6 A;  4NII A;  2W1U A;  3GHM A;  3VKF C;  1GSL A;  1E5S A;  2E7T A;  4DRR A;  2IWG B;  4FOV A;  1A34 A;  2EAA A;  3U07 A;  2C5D A;  2OVU A;  2Y6K A;  4RN5 A;  4IND A;  1RUI 2;  1LHO A;  1RUJ 2;  1SAC A;  1W2U A;  3WXP A;  3DEC A;  3NNJ A;  4TXW A;  3H8X A;  2W3J A;  5CKQ A;  1W0O A;  5C5T A;  3PUS A;  2XOM A;  1EV1 3;  3WCS A;  1CD3 G;  1PO2 3;  3POB A;  1HRV 1;  3P5B A;  4PLO A;  3AFK A;  1JZ4 A;  1V9U 3;  5EYX A;  3BPZ A;  4HOO A;  3IKW A;  5FZ3 A;  3VBF B;  3DYM A;  3THT A;  5AFE A;  4P9J A;  4B8E A;  4URA A;  1SDD B;  1JU4 A;  3ZM8 A;  5CBL A;  2WNV A;  4IV3 C;  4Y5T A;  3IPV B;  3J8F 3;  1G86 A;  1DZR A;  2W39 A;  1ZBA 3;  4RHV 2;  1G8W A;  3AKS A;  2HWC 1;  1Q3E A;  4P9X A;  4AWD A;  5DZE A;  1GR3 A;  5J7M A;  1HQL A;  5FCC A;  4BMB A;  2FMY A;  4BLJ A;  5FY5 A;  2EA7 A;  2WJS A;  4E4H A;  4CCD A;  2LUW A;  1VR3 A;  3ZSJ A;  1RUH 1;  5IK4 A;  1ND3 C;  3AZW A;  4WM8 A;  3VB9 A;  1J3Q A;  4Q0U A;  4FQ4 A;  3NST A;  2ETE A;  4IV1 C;  1OOP B;  1UU6 A;  2R07 1;  2ZGM A;  4K1Z A;  2PFW A;  3ROU A;  2GC0 A;  4P14 A;  4XJ9 A;  2WWU A;  4KBZ A;  4RR3 A;  3RMX A;  1XNA A;  3ZIW A;  1SCS A;  1TME 2;  5FY0 A;  3MIC A;  4UT5 A;  3ETP A;  2VNV A;  5A80 A;  2ZGQ A;  2ZZJ A;  3AP7 A;  3FUO A;  1ULG A;  2KM2 A;  4IEU A;  5FZ9 A;  3IZO A;  4AQ2 A;  4CU7 A;  1Z78 A;  1WBF A;  2RS5 2;  5FZC A;  3U4S A;  4JRL A;  5JR7 B;  4XXA A;  3ZN6 A;  3HEI A;  2I2S A;  1PK6 C;  4FPG A;  4DPN A;  4HLT A;  5FPB A;  1YIF A;  1TEI A;  3POF A;  4JRA A;  1AVB A;  4RQP A;  4IQP A;  2JDA A;  3SC7 X;  2VBD A;  2YXS A;  3ASI A;  1BVV A;  1H30 A;  1POV 1;  1QJU 3;  5B4X A;  1TMF 3;  1HDK A;  3E6B A;  1S0E A;  5GLV A;  3ZN6 B;  3HAG A;  4BQ3 A;  4F83 A;  4DS0 A;  3ACH A;  1ACC A;  1CON A;  1S2E A;  4Q4Y 3;  2GAU A;  5E89 A;  1LGB A;  3L2H A;  3OYW A;  4FPJ A;  5IWF A;  2VXR A;  4GH4 C;  4CP9 A;  4OHX A;  3ZR6 A;  3R4S A;  3B9I A;  3PUH A;  3LKJ A;  1WLD A;  3PL0 A;  1RHI 2;  3N9P A;  4YPJ A;  1IQD C;  3IDB B;  5ACA 2;  5FK8 A;  1DQ5 A;  5GLT A;  1PGW 1;  4MZU A;  3NJX A;  1H9P A;  3KV4 A;  3FFQ A;  3JBG 3;  1NG0 A;  3TYJ A;  5CKN A;  1IOA A;  1ULD A;  2YPD A;  4GKX A;  4RQP C;  4YRD A;  3C7H A;  3VKL A;  2WT0 A;  3ZYI B;  4QQL A;  5A3M A;  1TMF 2;  3H1M A;  3OPT A;  2WUH A;  4LXL A;  5IAT A;  2B39 A;  3U4X A;  1QJY 2;  1I3H A;  1WKY A;  2N7G A;  4ES8 A;  3O1V A;  4IV1 B;  1GZC A;  4IL7 A;  2VZ3 A;  1N3O A;  3VBO A;  3LDR A;  3VBR C;  4AFB A;  5CFD A;  4Q4V 1;  2P3K A;  2EXI A;  5CFC A;  1NLR A;  4FSJ A;  4MXV A;  1O3Q A;  4QMA A;  5A1A A;  3O12 A;  1DHK B;  4LA3 A;  5L36 A;  3I2D A;  1OUX A;  2FCV A;  3WIN E;  4CDW C;  2V5D A;  3HNB M;  4FOQ A;  4XJZ A;  1HB3 A;  5A7W B;  2IXL A;  4BB3 A;  4C8D A;  2YFU A;  3BOD A;  2PQS A;  3RQ0 A;  1I5Z A;  1XYP A;  5LRS A;  1BEV 3;  4XE9 A;  2DCZ A;  4D6Q A;  2BNM A;  2EID A;  3D0S A;  3JU9 A;  3AZY A;  3OBA A;  1W0N A;  2FCU A;  1UCX A;  4UXA A;  2QQP A;  1DF0 A;  2ZCW A;  2D97 A;  3WG3 A;  1IS6 A;  3MID A;  1IS4 A;  4GIQ A;  1JHJ A;  1CVN A;  2RJ2 A;  1AR7 3;  1UMH A;  1EPW A;  1V6M A;  1SFY A;  1VIW B;  3GYD A;  3IAP A;  1W2O A;  1F8V A;  4R9D A;  2G9F A;  4QT6 A;  4OUE A;  3MPP G;  1W6M B;  1JUI A;  2EIC A;  1AR9 3;  2WFF 2;  5GZE A;  3VBH C;  4Y1V A;  2GC3 A;  4LBQ A;  3HBZ A;  3VZJ A;  5FQ0 B;  3S6P A;  2GN3 A;  3HQU A;  5JLV A;  2C26 A;  2ZGS A;  3T2T A;  3AZX A;  3WF4 A;  3K4D A;  3ZFG C;  1GIC A;  1W9S A;  4XFB A;  3E1F 1;  2D3R A;  3T08 A;  1KJR A;  3GJB A;  1ASJ 2;  4XIL A;  4XZP A;  3K4Z A;  4IE0 A;  5B4N A;  1EV1 2;  1RIN A;  4DO0 A;  3MBW A;  3RDI A;  3WSO A;  5K8S A;  3CJX A;  2JX9 A;  4AQ6 A;  3JXS A;  5FPU A;  1GV9 A;  5JVV A;  1RJ8 A;  2EIG A;  4CCJ A;  2WWJ A;  4OLL A;  3S5A A;  1X9T A;  2XHK A;  5FO7 B;  2CWM A;  2QCS B;  2ZX4 A;  4I3P A;  3VBF A;  2LM3 A;  4LKF A;  4KMQ A;  3VHR A;  2Z79 A;  1R09 1;  5GKA C;  3UET A;  3UV9 A;  1VBE 1;  4XUO A;  4BYY A;  2VCB A;  3POJ A;  4LBO A;  1CN1 A;  1O7F A;  1ZZ7 A;  4QPW A;  4QXH A;  5FZH A;  3WP3 A;  1KXG A;  4GH4 A;  1FX5 A;  3RZG A;  4HBN A;  2QDR A;  1DCS A;  1VBB 1;  2WNU B;  3I54 A;  3J4U H;  4KH9 A;  5F6L B;  1H2L A;  1ST8 A;  5FYY A;  2RR1 2;  3IWZ A;  1YC6 1;  3POG A;  4R4Z A;  1MVQ A;  1GWL A;  5HV0 A;  4TSV A;  4XHX A;  3WVJ A;  5C3O A;  2QQK A;  4XQD A;  2ZAC A;  4Y20 A;  1JW6 A;  1PO1 3;  1QHD A;  2VOW A;  4IE4 A;  3UL2 A;  2J7M A;  3KS7 A;  2XUM A;  4MLO A;  5GM0 A;  4CPB A;  4IEV A;  5T5J A;  1N1V A;  2BER A;  4GH4 B;  5JZG C;  2HWE 1;  1CWP A;  3MDP A;  4YVW B;  1UXX X;  4NO4 A;  4QX5 A;  1GAN A;  4C0B A;  4XET A;  2OUH A;  2A3X A;  5A3P A;  3FMG A;  2BPA 2;  4I02 A;  1XXN A;  4AEM A;  1QNW A;  3GXU A;  1ENS A;  5JXG A;  4OQ8 A;  2ZGO A;  5A7Q A;  4JDO A;  2R1B A;  4FI9 A;  3TWI A;  2VUA A;  1JI6 A;  4NRM A;  2K0G A;  2P37 A;  4AHX A;  1NAE A;  2RMU 3;  1RUH 3;  4QPI C;  3NJZ A;  5DDJ 2;  2Q8E A;  5KHG A;  2EAL A;  4GMP 3;  2CTV A;  1PO1 1;  3K77 A;  4Z1V A;  1QF3 A;  1UYZ A;  1JMU B;  1HJG A;  2ZX2 A;  3CO2 A;  5E16 A;  5FLJ A;  2PHR A;  3H50 A;  4BXF A;  5T5P A;  4YNI A;  2RJK A;  4YM0 A;  2ZTN A;  4ARY A;  3EYP A;  1RJ7 A;  5C3R A;  4CVU A;  1JYX A;  5IK7 A;  2MEV 2;  3WOG A;  1NX9 A;  4LKD A;  3CHX A;  1XOY A;  3VD5 A;  2CDO A;  1RUJ 1;  1VBE 3;  5JZG A;  4R9C A; 
#chains in the Genus database with same CATH homology
 4IUG A;  2ID4 A;  1UXZ A;  3OB8 A;  1LNS A;  2WZE A;  1W9W A;  3FHQ A;  2LS6 A;  2J1V A;  4P5Y A;  3J7H A;  2X09 A;  2J1U A;  2C4X A;  2WBK A;  1CZV A;  2VME A;  1K12 A;  4DXS A;  1HN1 A;  1K42 A;  2QQN A;  2YFZ A;  1WCQ A;  1NUK A;  2L9L A;  4MO3 M;  4P08 A;  3VD4 A;  1PX3 A;  4ZY9 A;  4UAP A;  2W47 A;  2VMC A;  3I2J A;  2J1R A;  2W1W A;  1UY2 A;  1XPW A;  2VMF A;  1GMM A;  2VZT A;  4DEV A;  5G04 L;  2W95 A;  4DUW A;  4GZ9 A;  2X10 A;  1CIY A;  2OKX A;  3HNM A;  1F4H A;  2HYX A;  2W1S A;  3SEP A;  5DN2 A;  5EJZ B;  2JKX A;  3ACI A;  3IDA A;  2VC9 A;  4QB6 A;  4CUA A;  2QQO A;  2VCA A;  3ABZ A;  3LQC A;  4XUT A;  3SKJ E;  3A7Q A;  1K45 A;  3I3B A;  1UYY A;  1UZ0 A;  3MV1 1;  4E8C A;  1GOF A;  4W4Z A;  3I2I A;  4MOA A;  3T09 A;  4BJ0 A;  2WO2 A;  3EB7 A;  3LPF A;  4CU8 A;  1ULO A;  2VL4 A;  5IFP A;  2WAO A;  3WF1 A;  3WNL A;  1OD3 A;  5CYY A;  1W8O A;  1DP0 A;  2ZEY A;  3T0A A;  3HN3 A;  4DXR A;  1W9T A;  4LKS A;  5I0D A;  1K3I A;  4XVH A;  3CZU A;  3BN6 A;  4BK4 A;  4XUQ A;  2YG0 A;  3CQO A;  2Z4F A;  3ACF A;  2WQ8 A;  3C7O A;  2YC4 A;  2VZO A;  2VMD A;  4DUX A;  3C8X A;  3K4A A;  2VZU A;  3ACG A;  1EUT A;  4A6O A;  4LPL A;  4MAD A;  2QQL A;  3FN9 A;  4BDV B;  5JR2 A;  3HOB A;  1J83 A;  2BZD A;  4JKL A;  4CU6 A;  4JKK A;  4JKM A;  1BHG A;  2QQM A;  1UY4 A;  2BGO A;  2RVA A;  3I2H A;  4UOJ A;  1CZT A;  4DEQ A;  3W5M A;  2Y6J A;  1GQP A;  1L7Q A;  3K46 A;  2Y8K A;  2J1E A;  3WEZ A;  2CDP A;  3C7G A;  2JE8 A;  4QB1 A;  3MO4 A;  2J1A A;  3BGA A;  2ORX A;  4QX0 A;  3ECQ A;  2E26 A;  1JYW A;  2WZ8 A;  3T0B A;  3FL7 A;  4XUR A;  3WNO A;  1JZ5 A;  4Z2A A;  3CZJ A;  3DYP A;  2VQU A;  5C70 A;  3IAQ A;  4L0P A;  1TVG A;  2VTF A;  4PQQ A;  2WAB A;  3T2P A;  1JZ3 A;  2DCK A;  3OG2 A;  2VR4 A;  1SG3 A;  3GDB A;  1OF3 A;  3C7E A;  2HLE A;  4QX3 A;  3OEB A;  4W50 A;  2C9K A;  1GUI A;  1H6X A;  3I3D A;  4HG6 B;  1J84 A;  2VZ1 A;  5IHR A;  3SEE A;  4UI9 L;  3LEG A;  5DPN A;  5LA2 A;  4QX2 A;  3OGS A;  2BGP A;  1W8N A;  4XUN A;  2DDU A;  5JMO A;  3UNP A;  2ZEX A;  1UY0 A;  2WO3 A;  3CMG A;  4BK5 A;  1L7R A;  1UYX A;  1CZS A;  1F4A A;  1H6Y A;  1UMI A;  3P6B A;  3U37 A;  5C71 A;  4P00 B;  3III A;  1YQ2 A;  3I97 A;  2Y6L A;  2JD9 A;  5F7U A;  1DLC A;  1UWW A;  3LEI A;  4MGQ A;  2W9X A;  4PF1 A;  3VDB A;  2B4K A;  3WNM A;  1JZ7 A;  3WNN A;  4A41 A;  1SHW B;  1US2 A;  4PT6 A;  2W1U A;  3MUZ 1;  5FUI A;  3K75 B;  1JZ8 A;  1CX1 A;  2VM9 A;  4M4R A;  3OEA A;  2Y6K A;  2VOT A;  4RN5 A;  3WQB A;  3HJR A;  2ZXQ A;  1TG7 A;  3DEC A;  4TXW A;  2W3J A;  2VO5 A;  4M4P A;  2XOM A;  3LE0 A;  3HNY M;  1OF4 A;  1GU3 A;  1JZ4 A;  3DYM A;  2E32 A;  1SDD B;  1JU4 A;  3ZM8 A;  1GNY A;  1KGY A;  4CUC A;  4XZU G;  4OMD A;  3GGL A;  2QQI A;  4GWI A;  3A22 A;  2VZV A;  2E31 A;  1JU3 A;  3NQH A;  2V72 A;  5DQ0 A;  4D0Q A;  1XNT A;  3OGV A;  2QQJ A;  4A45 A;  1GOH A;  4W8J A;  1ULP A;  3OGR A;  1O8S A;  5C7G A;  1XNA A;  3ETP A;  2XQX A;  3AC0 A;  2W1Q A;  4LQR A;  4CU7 A;  4QDQ A;  2W87 A;  2BBA A;  4D8M A;  2EIE A;  3HEI A;  1GOG A;  3WF2 A;  1RYY A;  2VZP A;  2RV9 A;  3A23 A;  2JDA A;  2X05 A;  2WN2 A;  4DUV A;  2J1T A;  3WF0 A;  2W91 A;  5B4X A;  5EJ1 B;  4JX0 A;  2KD7 A;  2VZS A;  5G05 L;  3ACH A;  3CKH A;  1O8P A;  3NRU A;  4QX1 A;  4LHS A;  3HPN A;  2YC2 A;  5JXJ A;  5DMY A;  1O59 A;  4QAW A;  3PUH A;  4ET7 A;  1JZ2 A;  4YPJ A;  1IQD C;  2XHN A;  3T2Q A;  4CU9 A;  3NJX A;  4AG4 A;  2W5F A;  2VQT A;  2EIB A;  4E8D A;  3F2Z A;  3I2F A;  3C7H A;  3CDZ B;  3VD3 A;  4ZZ8 A;  2WUH A;  3C7F A;  5EIY B;  2DCJ A;  2V4V A;  1WKY A;  4OYU A;  3P1I A;  2VZ3 A;  1UX7 A;  4QB2 A;  2LW8 A;  4GWJ A;  2WDB A;  4JHZ A;  3MUY 1;  1P8J A;  5A1A A;  2ORZ A;  4KWU A;  4TTG A;  1T2X A;  1MPX A;  2WN3 A;  2E33 A;  5JXI A;  2Y6H A;  2V5D A;  3HNB M;  2YFU A;  2PQS A;  2W46 A;  2Y64 A;  2EID A;  1D7P M;  3OBA A;  3CIH A;  3UES A;  1W0N A;  4QDS A;  1PMH X;  3SKV A;  5JXH A;  1JYN A;  3WF3 A;  3VD9 A;  2QBX A;  1JHJ A;  2RJ2 A;  1UMH A;  1NKG A;  3IAP A;  5HXM A;  4DXT A;  2WAA A;  4A44 A;  2VZQ A;  2Y6G A;  4OUE A;  2EIC A;  5IFT A;  2VZR A;  5LCW L;  4A3Z A;  4RYD A;  2C26 A;  2J22 A;  3THD A;  3A21 A;  3K4D A;  1W9S A;  3T08 A;  3WF4 A;  3E1F 1;  2ZEW A;  3PUI A;  5LA0 A;  3K4Z A;  5B4N A;  2J1S A;  3MBW A;  5IYY A;  3WSO A;  4QDR A;  3T0D A;  3JXS A;  5HPO A;  3T2O A;  1PMJ X;  1JZ6 A;  2B9V A;  2W94 A;  4BXS V;  3WNK A;  4XUP A;  4KMQ A;  2W92 A;  4MGS A;  3UET A;  4XUO A;  1EUU A;  2VCB A;  3I2G A;  4QPW A;  4P02 B;  5LA1 A;  4OZO A;  3MV0 1;  2WO1 A;  3WNP A;  5JUV A;  2QQK A;  5IJR A;  2J7M A;  2BER A;  4ZZ5 A;  3LPG A;  3VDA A;  3IB3 A;  1UXX X;  1DYO A;  2VCC A;  2XON A;  1UY1 A;  3DYO A;  4OMC A;  4ZXE A;  1US3 A;  3I2K A;  5CZK A;  1JYV A;  1OT5 A;  4AAX A;  3NNG A;  2WYS A;  3FHA A;  3GXU A;  5JXG A;  1XC6 A;  3LEK A;  4A4A A;  5J1X A;  4FI9 A;  1UY3 A;  1JI6 A;  1W99 A;  4KI5 M;  3NJV A;  1NAE A;  2VJX A;  4ARX A;  1KEX A;  2R7E B;  1PX4 A;  3K77 A;  1UYZ A;  4A42 A;  3THC A;  3W5N A;  1I5P A;  2ZEZ A;  3VD7 A;  3I3E A;  4ARY A;  3EYP A;  1JYX A;  4CVU A;  1NX9 A;  2YB7 A;  3GM8 A;  3VD5 A;  4CUB A;  2CDO A;  1R64 A;  3D3A A;  1OH4 A;  3VDC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...