3K77A

X-ray crystal structure of xrcc1
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
152
structure length
152
Chain Sequence
PEIRLRHVVSCSSQDSTHCAENLLKADTYRKWRAAKAGEKTISVVLQLEKEEQIHSVDIGNDGSAFVEVLVGSSAGGAGEQDYEVLLVTSSFMSPSESRSGSNPNRVRMFGPDKLVRAAAEKRWDRVKIVCSQPYSKDSPFGLSFVRFHSPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA repair protein XRCC1
publication title Oxidation state of the XRCC1 N-terminal domain regulates DNA polymerase beta binding affinity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 34
structure length 152
sequence length 152
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2009-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01834 XRCC1_N XRCC1 N terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 3k77A00
3BGAA 3WF4A 3MUY1 3A21A 3C7GA 3P1IA 2WN2A 5DMYA 1IQDC 2B4KA 3T0AA 2E26A 4QDSA 3VD3A 2J7MA 2VC9A 4P5YA 2E31A 2J1UA 2VZQA 2R7EB 3THCA 3WNMA 3T0DA 1JZ5A 3W5NA 1GMMA 2EIBA 3I2HA 4XUTA 3WSOA 5DPNA 2J1AA 3D3AA 3F2ZA 2VZ1A 2W47A 1ULPA 2BERA 1DYOA 2W3JA 3WQBA 2J22A 4W50A 4AG4A 4P02B 4BK4A 1NX9A 3ECQA 2ZEZA 3VD7A 4KMQA 1CZTA 4A6OA 3OGSA 1H6XA 2JD9A 3I3DA 4FI9A 2W92A 3E1F1 4QX1A 3LQCA 4UAPA 5LA0A 4JX0A 2WUHA 3AC0A 5F7UA 3MV01 3C7EA 2W5FA 5LCWL 1T2XA 1XPWA 1W99A 4XURA 3IDAA 3NJVA 5B4XA 3GGLA 2VZOA 4QAWA 3I2IA 5C71A 4PF1A 4W8JA 5IHRA 1EUTA 2YB7A 3I3EA 2J1VA 3FHQA 2VMFA 1UMIA 1YQ2A 2PQSA 4XUPA 3A22A 3I2GA 3K4DA 5EIYB 3CKHA 2VO5A 2VTFA 1L7RA 5EJ1B 4TXWA 1WKYA 3FL7A 4BJ0A 2VZ3A 3SKJE 1SHWB 2VL4A 3IAPA 3HOBA 5JR2A 3OGRA 4QX2A 3ACIA 2CDOA 1JI6A 4CU7A 2W1QA 1LNSA 3I2FA 3C8XA 3K75B 3IIIA 4HG6B 1RYYA 3VDAA 2XHNA 2RV9A 3FN9A 4PQQA 1D7PM 1GOFA 3T2OA 4ZY9A 5JXHA 2Y6GA 2B9VA 2WZEA 3LEIA 4L0PA 1US2A 3BN6A 3U37A 5IFPA 4PT6A 5JXGA 2VMCA 4MGSA 2YFUA 1UZ0A 4QDRA 1K45A 3T08A 2X10A 2V72A 1K3IA 2HYXA 3GM8A 3K46A 5B4NA 2W87A 4LKSA 3JXSA 2WYSA 3ABZA 2XQXA 3A23A 4ET7A 1TVGA 1J84A 2QQIA 4MOAA 1K42A 3WEZA 2DCKA 1GUIA 4IUGA 2VMEA 1JZ6A 2QQKA 2ZEYA 3VD4A 2WABA 1OF3A 1PMJX 2L9LA 2VZRA 3OB8A 3C7HA 1XC6A 1UYYA 3A7QA 1UY2A 1UXZA 3WNOA 5IYYA 2VQTA 4M4RA 3WNNA 1W9TA 1XNAA 1K12A 1CZSA 4P08A 2VZVA 1NKGA 5CYYA 2VOTA 3HN3A 4A41A 3WF0A 2DCJA 4D0QA 4LHSA 1JYNA 3W5MA 2WO2A 4JKLA 1GQPA 1P8JA 3I2KA 1CX1A 1F4HA 3HNYM 4QB1A 3CIHA 4BK5A 2ID4A 1JHJA 1CIYA 4E8CA 4DXTA 4QDQA 2HLEA 1H6YA 4A45A 3LEGA 4A3ZA 3I97A 1O59A 2Y6KA 2VM9A 1ULOA 4QX0A 4A4AA 2WO1A 2ORZA 2WBKA 4D8MA 3THDA 3C7OA 3CDZB 2VJXA 5HXMA 2Y6HA 1SG3A 4CVUA 5LA1A 3T0BA 3WF2A 1GOHA 2BGOA 2J1TA 2QQJA 1W8NA 1WCQA 2VCAA 4CUCA 5HPOA 2QQNA 2E32A 1JZ3A 1W0NA 3EB7A 2W95A 3MBWA 1JYXA 1UX7A 3K4AA 1XNTA 2WDBA 2J1RA 4CUBA 2RVAA 4JKKA 2W46A 4MGQA 4CUAA 1F4AA 2VCBA 2ORXA 2EICA 2VZUA 4ARXA 1UY0A 3VD5A 1OH4A 5JXIA 3WF3A 1UY4A 3UESA 1O8SA 3I2JA 3SKVA 2JKXA 2E33A 3HEIA 3C7FA 1PX4A 2VZTA 2DDUA 3VDCA 4QB6A 4OMCA 3T09A 3WNLA 2RJ2A 3HPNA 3K4ZA 2KD7A 3HNMA 4UOJA 2YG0A 3T2QA 1L7QA 2VCCA 3LE0A 2WO3A 4GWJA 4XUNA 5EJZB 2C4XA 1PX3A 2V4VA 2Y8KA 1GU3A 3ACGA 2Y6LA 4DXRA 2CDPA 4CU8A 4RYDA 2ZEXA 3ACHA 3MO4A 2W9XA 5C70A 4DUXA 2JE8A 5G05L 4QX3A 2ZEWA 5I0DA 3DYOA 2EIEA 2YFZA 4E8DA 1PMHX 1JU3A 1JZ2A 1HN1A 3HJRA 4DEVA 2XOMA 1JYWA 1DP0A 1GOGA 4Z2AA 4QPWA 2BGPA 4MADA 2X05A 2J1EA 2XONA 2OKXA 5C7GA 2ZXQA 2W91A 4DXSA 1J83A 4UI9L 1O8PA 4OUEA 3WNKA 1JZ4A 3PUIA 2X09A 4DUWA 1R64A 1OF4A 2WN3A 4GZ9A 1GNYA 1KEXA 2WAOA 4XUQA 5IFTA 3I3BA 4ZZ5A 4JHZA 1UYZA 1NAEA 3DECA 2VMDA 2QQLA 3OGVA 3UETA 1MPXA 2JDAA 1CZVA 3UNPA 4XZUG 4GWIA 3CMGA 3J7HA 2Z4FA 2WZ8A 2QBXA 1UWWA 1BHGA 3IAQA 2W94A 3ZM8A 1UY3A 3GDBA 5LA2A 4CU6A 5JUVA 2V5DA 4ZZ8A 4QB2A 2BZDA 2VZPA 1EUUA 2Y64A 3OEAA 1UYXA 5IJRA 1NUKA 3OG2A 3NNGA 3MUZ1 5JMOA 4TTGA 3WNPA 1UMHA 4XVHA 3ACFA 1KGYA 2C9KA 4BDVB 4BXSV 2W1SA 3K77A 4OYUA 1OT5A 2YC2A 3VDBA 1I5PA 3NQHA 4AAXA 1JU4A 2W1WA 4P00B 5FUIA 4LQRA 3VD9A 2W1UA 2J1SA 1JYVA 2WQ8A 4CU9A 3GXUA 4W4ZA 4ARYA 1UXXX 4A42A 4YPJA 1JZ7A 2WAAA 3LEKA 5A1AA 1W8OA 1W9SA 2LS6A 2VQUA 1TG7A 5DN2A 4RN5A 3ETPA 4DEQA 3HNBM 4XUOA 2VZSA 5J1XA 3NJXA 1US3A 4LPLA 2BBAA 5JXJA 2LW8A 1UY1A 1SDDB 3P6BA 4OMDA 3CZUA 3DYPA 4OZOA 3OBAA 2EIDA 3IB3A 3PUHA 1OD3A 3NRUA 4MO3M 3FHAA 2C26A 4ZXEA 2YC4A 3CQOA 1JZ8A 3DYMA 4KWUA 3EYPA 3CZJA 4KI5M 5G04L 4A44A 1W9WA 4DUVA 2QQOA 3WF1A 3OEBA 4M4PA 3SEEA 5DQ0A 3T2PA 2VR4A 3SEPA 3MV11 4JKMA 5CZKA 2QQMA 3LPFA 1DLCA 2Y6JA 3LPGA
chains in the Genus database with same CATH superfamily
4IV3B 1RUI1 4AHZA 3NV3A 2WLPA 3ILRA 4FP3A 4Q4V1 3A21A 3C7GA 4CDUA 1SBFA 1IQDC 1RUOA 2WYFA 4UT5A 4YVWC 4HONA 1RUF1 1RVF2 4XHBA 4Y1YA 5A33A 5JWPA 2VBBA 4P5YA 1W3XA 2E31A 4KL1A 1SLTA 3WUCA 2VG9A 4CP2A 4DMIA 5FMBA 5IK8A 3T0DA 4JVAA 1WA6X 4QKBA 2P3IA 5BPXA 4XUTA 4CDWC 5JOYA 3H8UA 5DPNA 4D69A 4YFWA 3ZFFB 3LWCA 1D4M3 1MVQA 1PIV2 3Q8FA 3AXEA 5FKCA 5J3UA 1C5HA 1PK6A 2JIGA 1ULPA 1BXHA 1ZBE1 2QFEA 2W3JA 3JUUA 2F6BA 1Q8QA 1ZA4A 1M4WA 1AL0G 3CJXA 5GALA 3WQBA 4FSJA 1OQ1A 2RDRA 3DKQA 4AG4A 1ST8A 3U78A 5A6XA 3D0SA 5L36A 2FZ1A 3CL1A 3N7MA 1W6MA 4QPIC 3T2TA 3VD7A 4YM3A 2FDHA 1I6XA 1CZTA 4IGQA 2Q8EA 3CNAA 5F5QA 1E5SA 2ZZQA 5FPUA 1ZYBA 3W9AA 1KS5A 1VBB2 4QX1A 4Q1PA 2BOJA 2VVFA 4XE9A 4AVTA 4BH9A 1WW5A 2LUWA 1ZRRA 3ITQA 4EWAA 4LJHA 5FPVA 5IVFA 1R092 2OPKA 2GZWA 2VOKA 3Q9OA 2UY9A 2FQPA 5FZ9A 3KGLA 4LA3A 5JCTA 3MICA 3GCXA 5FZBA 1HXS3 1N1YA 1QOTA 2IXCA 2JDMA 2UURA 3MV01 3VBFB 1I9RA 4KBBA 4LULA 3JQWA 2W5FA 5F32A 3LA7A 2VNRA 4H2AA 3WDTA 4JQRA 5DZGA 3IDAA 2PA7A 2C1FA 3EMRA 4QAWA 1H9WA 2RR11 4KGQA 4U2AA 5FAXA 3MW2A 3LA2A 2IXJA 2XLAA 2A73B 1BEV2 2Y0OA 3E5UA 4YZ4A 3IM0A 5JSPA 2VBPA 1DZRA 3HMYA 3UL2A 1W2NA 5F3GA 1U5YA 2HWD2 3MF6A 3WW2A 2CSGA 2J1VA 2PAKA 5T5LA 1V6IA 1S0IA 3BPZA 5I0TA 2JDKA 4GMP3 4YVSA 5AVPA 3GF6A 3HQRA 1LEDA 3HR9A 2HJIA 4GJYA 1AR71 1GP4A 3Q8AA 3RYPA 2DU1A 4NHLA 5L7OA 1ULDA 1M06G 1C8M2 1QJX1 2WWUA 3EQEA 2FD8A 4RR3A 2W68A 3FL7A 3POBA 4CEYC 2YGMA 4CSWA 3AVSA 3SKJE 4BQWA 1SHWB 2F4PA 4E4HA 4LT5A 3K3OA 3PUSA 4DRVA 2JG9A 5JR2A 4NMIA 3FFQA 2Q1MA 2PLV3 2E7AA 4DIQA 1BK0A 1CAXA 4HANA 2CDOA 1JI6A 3BTAA 4BLIA 5C8CA 1HW5A 3I2FA 2JG8C 3K3NA 4OHZA 1NZCA 2ZX4A 4AW7A 1K5MC 5DUUA 3O1SA 5JI9A 5FP3A 2RV9A 5FPBA 3WQ1A 2V5YA 4OULA 1G9DA 1GOFA 1OA2A 1LB2A 1AXZA 3T2OA 1SBEA 2JD4A 2MPFA 2JIJA 3K2OA 4CCKA 5I93A 5FRAA 2BGCA 1L7LA 1GZWA 3O1MA 4BQ2A 2Y34A 2ZGKA 5JXGA 1FPN2 1VAVA 3GZAA 1NA1A 3B3QE 1QJY2 4QDRA 2RS31 2PAMA 3HQXA 2VMGA 5J37A 3NNLA 4Y5TA 2C6SA 3AM2A 1K3IA 2A6VA 1EV11 2ARXA 4LO6B 4PLMA 5C8CB 5I91A 4BQXA 4B4QA 2R061 3K46A 4XF1A 1FAYA 3ABZA 3A23A 4Z1VA 2WFF2 2NZ9A 1AZDA 1AX0A 1J84A 4MOAA 2OA2A 5CIRA 4YW6A 5LBBA 1GUIA 3WEZA 4CPBD 3ZXAC 1ZREA 5FOBB 5FZCA 2NLRA 5CNAA 4D7TA 1HX6A 4LHNA 2D7FA 2IXIA 5IVCA 3AB0A 1RMU2 1U5IA 1AR61 2RM22 3B93A 2XBO2 3TN92 1TMF2 3N3HA 1RGSA 3H1MA 2QDNA 3BOPA 4XF3A 5C3QA 5JZGA 1ZZ7A 5H9SA 2Q8OA 3OB8A 4YZ1A 4CUGA 3H8RA 1JTZX 3T1LA 5J09A 4F8AA 5C9AA 2R32A 1NY72 1W6OB 4WVZA 5F2WA 4BB3A 4KWLA 1YUDA 4YZ5A 1ASJ3 1QH7A 2PHDA 4PBOA 1S0BA 3S6PA 3FBMA 3SCGA 1UKGA 2VNVA 2VTXA 1VRH1 4OI2A 1W8ZA 4CCJA 2DU0A 1AR92 5DAWA 3WX5A 4P08A 4AYUA 5LATA 1ZBA1 4MV2A 3MI8A 1XNBA 4A41A 3WF0A 5EYXA 2KR2A 2CWSA 2QE3A 1GBGA 1HB3A 3W5MA 1LEMA 2WO2A 2D93A 3F95A 1GQPA 5FJHA 1P8JA 4ZPIA 4ZS2A 4DFSA 5K0UA 2YPDA 5CKMA 1NXD1 4Y4RA 2JWPA 5GZDA 4S2FA 1PZ7A 2IFRA 2P4EA 2YC0A 3LB9A 3WQ0A 1QJU2 1PGW1 3P5BA 4F3JA 1XBFA 2XLGA 2ID4A 4G9SB 2ZGPA 1LOGA 1CIYA 4CDXA 3EJKA 1YEWA 3THTA 4DXTA 5HCHA 1F15A 1H6YA 4P5HA 2G9FA 5GZFA 4A45A 4Q4W1 1R083 4HPKA 3I97A 3RZHA 1JN2P 3LSEA 5C4WB 3E6CC 1EPZA 1BBT2 5T52A 1Y9MA 4LBMA 1PGSA 1WBLA 1RJ7A 2PHFA 4XOGA 4EN9B 3DXTA 2WA4A 1YXWA 3I54A 1WMFA 4NPLA 4Q4Y1 4AQSA 4WZCA 1PO21 1RHI2 5AVAA 2IVJA 2VY0A 2WBKA 5HCBA 3ZFGC 1OH3A 5HXMA 1BMV2 3H1WA 3ZIWA 2YY1A 3J7MA 3OSDA 2O14A 2BJSA 3T0BA 4MXWB 4ONUA 5BNOA 2BGOA 4D7SA 1QQP1 1AF9A 5A7QA 4CUCA 4M3CE 5LK5A 2JDZA 3WZ1A 4W65A 3AMQA 5FZLA 1JZ3A 1JYXA 4YVWB 3VDDA 4IL7A 4Z07A 2FMDA 2GNBA 3LEMA 2VQ0A 1S2KA 5FZ1A 5L73A 3R6SA 4CCCA 2RM23 4WM8C 1S0CA 4GQ7A 4LIUA 4XETA 2P17A 5DDJ2 3KCYA 1PM7A 3NW4A 1SLAA 2RMU2 2K9ZA 3U07A 1LGBA 2BOIA 3DPRB 4N53C 2R16A 2ENRA 3GZTB 2ORXA 3ORJA 5JR7B 1FYUA 2EICA 2VZUA 4H7MA 3WW3A 4NN0A 4O7XA 1W2AX 3ATGA 2HWB1 1OKOA 1UY4A 3UESA 4AE2A 1O8SA 5FBJA 1UU5A 2VGDA 3H3ZA 3DUIA 4JV4A 1SBDA 1A8MA 1XNDA 1JUHA 5CBLA 1NQJA 1QJFA 4QPIB 4FQZA 2DDUA 4YNIA 2R1DA 4CDQB 4FXKB 4CP1A 4QB6A 3APBA 3WNLA 4ORFA 4AVAA 4X6RB 3LDRA 3OGGA 3N7LA 4XDPA 2YG0A 3T2QA 1L7QA 1Z7S1 4JRLA 5KHGA 1J3RA 3NNJA 1DF0A 5EJZB 1HB2A 1O5UA 4XMIA 1PX3A 4O9GA 4Y5SA 5L19A 3PU8A 4MVTA 5DZEA 4HN0A 1BQPA 3AK0A 4Q4X2 1DQ5A 3ZXDA 3NV4A 2Y6LA 3ES4A 4WZFA 1RITA 1UIKA 2CDPA 1AR82 1SFNA 2QJVA 2X29A 4XCBA 3MO4A 3NL1A 4AQTA 2IXKA 2W9XA 1VR3A 1IHMA 4YZ2A 4CRQA 5HCAA 4HN1A 4MYEA 2VOXA 1YQCA 4DPNA 2P3JA 2HWF2 2AACA 2CAUA 4PIXA 4AEDB 4QX3A 1RUC2 2C0ZA 4Y5Z0 2YV8A 5T5OA 3KHCA 1S2EA 3A0NA 5FZAA 5I0DA 3ENRA 2EIEA 4XBQA 4QXBA 2QKDA 1HN1A 1OOPB 1UO9A 1AXKA 2ZMLA 5GKAC 3VHOA 5FUPA 1UN1A 1CAWB 4QQOA 4DEVA 1X7NA 4GA9A 1B09A 3AL6A 2GNMA 3ILNA 1AYN1 4QPWA 3B00A 4XFIA 2ZKNA 4WVMA 4Y1UA 1GLHA 1COV2 1RUI3 2PQQA 5CKQA 3NNMA 4TLGA 2X05A 3VBFA 1R1ZA 2V09A 4Q4V3 3JD72 2DCZA 5D1IA 2W91A 4DXSA 5KHKA 1QMJA 1W8FA 1O8PA 2TNFA 4UI9L 5K4LA 5LWBA 1RUF3 1JZ4A 3OBTA 4HKWA 2FDIA 4NIDA 3GJAA 3AYDA 1UW8A 3DN7A 2NM1A 3VBSB 4LKEA 1SFYA 3URFA 1QXJA 2HEWF 4AHXA 5A3OA 2Q1ZB 1D2QA 1OF4A 1K5MB 3OGJA 4FPFA 4IE6A 4PQ9A 1LOBA 4NAMA 1QKQA 4Q0VA 5KXDA 2WAOA 4M0NA 2VCMA 4JHZA 4UYBA 4N90A 5A7PA 1ZBE3 3E97A 3DECA 4NWWA 5BNPB 4W6WA 2EF6A 5D8AB 2E51A 3UETA 5CAZA 1WD3A 4CEWC 4EWDA 2JDAA 2A7AA 3ZSKA 3SC7X 2WR9A 3U75A 2E7TA 3LOBA 4DNYA 5CEHA 5DUVA 1CVNA 4IEWA 3P3PA 4YZ3A 3VLBB 3MIFA 2WZ8A 3R05A 4RQPA 3TYJA 2D3RA 2BW8A 1UCXA 1BHGA 3IAQA 5SV5A 5LY2A 3OUHA 3VB9A 3ZM8A 1VBA1 1RUJ2 4QGMA 3AJZA 3GDBA 3O14A 5LA2A 4Q0UA 1QXRA 4YFZA 3FFZA 3C2UA 1BVP1 1UNBA 3KQRA 1J1LA 2AGSA 2V5DA 4FPHA 4XYXA 3VDDC 5B2GB 1H30A 1Q8PA 3ZSEA 4KG8A 1U5XA 3G6JB 1WW7A 1UYXA 1YNAA 4JDNA 5DAQA 3POJA 1NUKA 3PUAA 1VBC1 2I74A 3TWIA 5IVBA 5J7MA 4AOCA 3IBMA 5JMOA 2B45X 1DQ4A 3PVNA 1TE1B 2RR13 2TUNA 4IE4A 4GKXA 4QQLA 4Y4YA 4ZU7A 2WT0A 1KGYA 3R0RA 4TN7A 1Y7BA 1CR7A 4BDVB 5FY9A 1RINA 2D40A 4BXSV 4FTSA 5FY7A 1OT5A 1O91A 3VDBA 1VBD2 2WSUA 4HKOA 4IV3C 3AYEA 3VZOA 1GZCA 3MLKA 2EAAA 1S4CA 3RNSA 4BE3A 1RIRA 1F5JA 3OOXA 2VPVA 1QJX3 4XFGA 1RVF1 5FWEA 5IT6A 1IPJA 5CB7A 3GZEA 5KHJA 3QLQA 1APNA 4ISRA 1KJRA 4KWJA 3JD73 4LTAA 4W6YA 3RWNA 5DUWA 1VB2A 3Q8BA 2GC0A 2H6BA 1LHWA 3H7JA 1REEA 3BU7A 4CU9A 4YARA 4YSFA 4QKFA 3VN4A 1HQNA 2NN8A 3ZFFC 1C1FA 1UXXX 1H2KA 2PN5A 1UZVA 1HRI2 5FYSA 1PIV1 2ILMA 1JZ7A 3LEKA 2WIIB 4QT6A 2ZHLA 3SXWA 1CJPA 3IPVB 1KRIA 4QGNA 3SCHA 2VQUA 1TG7A 1W6OA 2NP0A 1IZ3A 4ZHNA 1MZ6A 1L3JA 4LPLA 1US3A 4CTEA 5FDBA 4XQDA 3AZWA 1LU2A 1NOVA 3CJIB 3ZYHA 2WS92 1HV0A 5CA6A 4M3CA 2CGNA 3CZUA 5GLTA 3ZSLA 3BTXA 5BYNA 2RS33 2JXAA 1R091 3PUHA 2ZOEB 4XZPA 3W59A 1QGLA 2A3XA 2C26A 4ZXEA 2ARCA 1LJ7A 2B5HA 4QHZA 4BCUA 4C1XA 1EV13 4CP9B 5FYMA 5A70A 1UYPA 5DG2A 1KQRA 4MUVA 4CP0A 3ZFGB 2R063 3AKQA 5G04L 2QQOA 4M4PA 2YGLA 4PLNA 2XDVA 5FZ3A 4NVPA 1NLSA 3N9QA 3MV11 2RHPA 1BEV1 4XTMA 4QGLA 5JMCA 5CZKA 1RTVA 2HWD1 5C4WA 1H8TB 3V64A 2CWMA 2QQMA 5EPAA 3RMXA 1HQWA 2C9AA 2GDFA 1SLLA 1F31A 1V6JA 1XJAA 2DUPA 1MR5A 3EHKA 1AR63 3PLQA 4IGOA 2XVLA 4AVVA 2Y0IA 4N53B 1RUE3 4QDSA 2J7MA 2DVFA 3U0ZA 1GWLA 4ZU4A 2PFWA 3UJQA 3HQUA 5F3IA 4MXWA 3ZKUA 1JZ5A 3W5NA 1VRH3 1GMMA 3B69A 2EIBA 4K9SA 3I2HA 3WSOA 1YRZA 1DGRN 1ZBA3 2J1AA 3OCPA 5A7NA 4AVSA 5JLVA 4YVWA 5CKNA 1AVBA 1ULEA 4NUBA 5C3OA 1BLZA 1DDLA 2BERA 2IUWA 3B94A 4V2WA 3AKTA 1YQ8A 2G9GA 3NJYA 3I4IA 3ZX7A 3BIEA 5LBFA 2GMPA 1IQAA 4P02B 5CFDB 3OJBA 2WLQA 4CDWA 1J3QA 5C3SA 5I0SA 2OIIA 5A3WA 2JD9A 4FI9A 3OD0A 3GJBA 4AI1A 2CYFA 1FPN1 3AKPA 2GC1A 5FPXA 2CU5A 3HN1A 3QH7A 1QJY1 3LOIA 5JIAA 5D21A 5IUQA 2LRPA 2XWBB 2ZABA 3KV4A 5FO9B 1F5FA 4LK6A 4QXHA 4JX0A 5A6YA 4QPIA 2I07B 4CDQA 2G9ZA 5C8CC 1PM4A 1RUG2 1YC61 3C7EA 1F35A 3BVCA 4FFFA 5KWRA 1PO23 4QXKA 1T2XA 3O5SA 2B46X 5AC92 4LBQD 3VHNA 3J8F2 2WA3A 2WFF1 3SH3A 1UIJA 3BOWA 2P5BA 3TEWA 2ET1A 3UJOA 5C71A 4PF1A 3SISA 2QCSB 1GFF2 4W8JA 3S5AA 4LA2A 4B3NA 3RFRA 1MZEA 1F9KA 1KDMA 1QQP3 3JU9A 3Q8EA 2K0GA 2WKKA 3AL5A 3EO6A 4XQ4A 4BM8A 2PQSA 1RMU1 2RM21 4XUPA 2D6LX 2XBO1 1WCSA 1TMF1 3A22A 3I3QA 4OZXA 3TN91 5EIYB 3JCIA 4Z82A 1U12A 2VUAA 2AZ5A 2D6NA 1PVC3 1L7RA 1DLLA 1YO8A 2QQWA 4YRDA 5FXXA 4AEDA 4XABA 1VMJA 3VKOA 4BJ0A 1NY71 1YQ6A 2FBEA 3KT4A 4E9KA 4XACA 4FTBA 2ZA9A 5LK7B 1OOPA 4RS5B 4OHYA 1CAWA 1DQ2A 2RG4A 3ZYGA 4JRAA 2D6OX 2VOVA 3GHNA 4UW3A 1AR91 4CU7A 5A32B 5C3PA 1YIFA 3K75B 3H7YA 5DAPA 4XCAA 4PIZA 5FKBA 1XSQA 2LM3A 4GULA 4IEZA 4CEWB 1XNCA 2O1QA 3FN9A 2VH9A 4L11A 2BP6A 1D7PM 5C3RA 1UQXA 3AZZA 3N7KA 5I8TA 4XQWA 1VIWB 3VBSA 1QJU1 2B9VA 4LBLA 3LEIA 4L99A 4PBPA 2CHHA 3FC0A 4NO4A 1AJOA 4M01A 4GMP0 1K5MA 3BN6A 1E57A 1WUVA 3DKWA 4PT6A 4Q0SA 5IFPA 2ZGNA 3TNQA 4XJUA 2YFUA 1UZ0A 1GP5A 1ND2B 1W28A 1K45A 4OHWA 5C4WC 3SLIA 2YMZA 5BNNC 3W58A 2V72A 1JBCA 4LMFA 1BBT1 5ACA2 1R1A3 1NYWA 5GLVA 4CXWA 4YW4A 2HYXA 3RZLA 2XMLA 3MIGA 5FOJB 5B4NA 1RHI1 2W87A 2VOWA 2VUDA 3D4KA 5D2AA 2WYSA 4XJZA 3AP6A 2XQXA 4ET7A 1RC6A 2QQIA 1BMV1 4LBQA 4OI4A 3OD4A 4XW3A 2FCTA 1JZ6A 4YWAA 2EXIA 2X5IC 5FXVA 4ZKTB 3BALA 2WABA 1AYN3 4JDOA 3I3MA 2FMYA 5JSOA 4RFT0 4IEYA 2FDKA 2ARBA 3LKJA 3RZMA 2R042 1KJLA 3AYCA 3WV6A 5M0TA 1WWYA 4RHV2 1RUD3 2P3KA 1JYVA 1NLQA 3A7QA 1GZTA 1UXZA 1DZQA 4M4RA 1QOOA 3GHMA 3POYA 5DDJ1 3LFIA 5EWSA 3ZXGA 3DPRC 1JW6A 3LD8A 3O0XA 2RMU1 2ES3A 2HBTA 3FBYA 5F5CA 4B7KA 3H3LA 1XNAA 3N36A 3NAPB 1OURA 2VW2A 3HD8B 3N9LA 1K12A 1LOEA 3M4FA 2DVAA 2AR6A 2ZGOA 3V0AB 2Z42A 1N3QA 5C33A 1JMUB 1QDCA 3QCWA 4H14A 4C91A 4D0QA 1JYNA 1GICA 4LHSA 5GZEA 5F8PA 2XJQA 2G1MA 3NV1A 4JKLA 4CDQC 3BODA 3M3QA 4OUMA 1LENA 2Y38A 4OHXA 2YUEA 3CIHA 4COUA 3RYKA 5FZ4A 4YGEA 3ZIXA 3VKMA 5F39A 4MGIE 1JHJA 3FLRA 2KA3A 3SH4A 4LLFA 3MIHA 2HLEA 1V6NA 3GBFA 3SITA 2XXZA 3M3CA 3FZ3A 3PMSA 4Q4X1 1VBA3 1AR81 2BVVA 4BMEA 2C24A 2ZMKA 2NMNA 3H3UA 3IPVA 4URTA 1WMEA 1LODA 1MS5A 2D43A 2Y6KA 2VM9A 4I30A 4N7UA 3RSJA 3QBQA 1UZYA 2XGXA 4WM7C 2CGPA 1NCQC 2WO1A 4AEDC 4TZDA 1W2OA 5IK4A 2HWF1 3CJIA 1RUC1 2IFWA 1WCDJ 1VBC3 4D8MA 3UT0A 5FY8A 1OOPC 3S30A 4DINB 1LECA 2Y6HA 3Q8CA 1SG3A 3ZYIB 2D97A 1GR3A 2BFUS 2P34A 2J1TA 1OQDA 2JDPA 4A3XA 2V4AA 2VCAA 1FMD2 1H2NA 4KU7A 3WNXA 1X8EA 2RS52 1COV1 2XHKA 3MBWA 2PTMA 4PLOA 2Z5WA 1C5IA 1W39A 3ZFGA 3RZGA 3JD71 4BU2A 4C8DA 4DOUA 4TLFA 2Z2SB 1UX6A 5LW9A 3M7AA 1RVF3 1O4YA 4CUBA 5JIUA 2JDYA 4JKKA 2W46A 3FLTA 3PVBB 4JGZC 4MGQA 4XDOA 4Y22B 3VBSC 2ZTNA 4CUAA 2JECA 1RUH2 4N7IA 1DBNA 1F4AA 1O4TA 5FYZA 4XMAA 1YI9A 4EV0A 5FO8B 3WP5A 2P1BA 1H8TA 3VD5A 4SLIA 5JXIA 1ZZ6A 4FPYA 5HI0A 1J59A 1RXGA 3I2JA 4XTPA 1H4GA 1PIV3 1UKRA 2E33A 1Q8VA 2K2SA 2IZWA 2UY8A 3HEIA 4WM8A 1JS9A 5BNPC 2WFPA 3UKVA 1CX4A 2GALA 5D8AC 3A4UA 5E6HA 2R1BA 4DQAA 4N53A 1FV2A 1TNFA 2J42A 4K8RB 3T3YA 3X29B 2RJ2A 4OHVA 1ENQA 2KD7A 4EQVA 5K8SA 4IEOA 2DUOA 4UOJA 5CADA 4L2NA 5FZGA 3LE0A 3MZHA 2RJLA 2FDGA 1CAVB 1SFPA 1QH6A 1VBB3 2C4XA 4K6BA 4PI2A 5FY4A 4COVA 3B02A 1D4VB 4H7LA 4FCAA 1MQTB 3S0MA 3ACGA 1R093 1W2UA 3KVAA 4CU8A 1H8VA 3TRSB 3WCSA 1RUJ1 1Q8SA 3HBKA 2B39A 2ZEXA 5EXOA 1ZRFA 2OPWA 3S5QA 2GAUA 3POIA 1MS1A 1SPPB 4I0BA 4JGYC 5CFDA 5JOWA 2D6MA 5FP8A 1MZ5A 4MHRA 4N8MA 1XYPA 4Q1RA 2VNGA 4LHLA 4XAAA 1W05A 5IAXA 1MS9A 2ZEWA 3I59B 3DYOA 3TOJA 5FZ0A 1G9BA 4OQ8A 1HIXA 4MSVA 1JZ2A 2YDEA 4LR4A 1BEV3 5EHDA 4N43C 1NZIA 1GOGA 2HWD3 1G6NA 3RRDA 5CG9A 4BQYA 5ERLA 1A8DA 1VBD1 4BISA 4EE2A 5FREA 3ES1A 1JOPA 3N4MA 1VMHA 2ZX0A 1RUE1 2J1EA 2XONA 4LOTA 1NLRA 2EIGA 2BBVA 5FMOS 2GH2A 1VBE2 2WJSA 4OUEA 1C8M3 5FR3A 1ENXA 5FO7B 4XJ9A 1JOBA 3BKZA 4RGKA 3JQXA 5J98B 2OVUA 3PU3A 1DU3D 1UZWA 3ZN6B 1WLDA 3MPBA 3B9IA 1QF3A 2R0HA 1MEC2 1RUH3 4XFCA 2WN3A 3WP6A 1HRI1 4GZ9A 3VBUC 4UW5A 1GNYA 2QDRA 2XVKA 4ZZ5A 3OY8B 3M1HA 1TEIA 2WQ4A 3KLSA 4X8PA 3V56A 3OPZA 2QQLA 4FOVA 1IOAA 3E6DA 3O12A 4UFLA 3AZYA 3ZN4A 3HT2A 1OFNA 5DUXA 3D8CA 3CJIC 4RS5A 1GP6A 1DGWA 4QPYA 1BYHA 1W04A 4I3GA 2UYAA 2WS91 5LRSA 4NPMA 3J7HA 4BWOA 1FPN3 5BNNB 5A32A 2VE1A 2N7GA 5CVRA 2QBXA 1QJY3 3WY6A 4Q8LA 5IVVA 4FFGA 2MNGA 1UY3A 1YI7A 4CEWA 4UW6A 3IT8A 3BTZA 1CPNA 5FYBA 1H9PA 4CU6A 2VMIA 3MF9A 4IEPA 1BVVA 2WZR2 1NQDA 2BZDA 3MIEA 4TYSA 3IDEA 4BHPA 2Y64A 3WD5A 4L8QA 3R4UA 3IMMA 2AC1A 3GNEA 1AJKA 2YHJA 2WFF3 5T54A 2X5IB 3MUZ1 4CPBA 3I2OA 1UMHA 1ALYA 2PHUA 1ND2A 4XVHA 4KGGA 2FDJA 4AF9A 3VV1A 1H8TC 4HSLA 4IE5A 2ZGQA 2A3YA 3K77A 4OYUA 4QPGB 1PVC1 5JI7A 3MW3A 1HRV2 1WCKA 1RMU3 3VGIA 3TN93 1VP6A 4IEUA 2XBO3 5A3NA 1TMF3 2VMHA 1LU1A 4UFHA 4AAXA 1A6CA 2CY6A 1BKZA 1JU4A 1W06A 2E53A 1H2MA 4NROA 2GH8A 1SLIA 5FZEA 1ZZBA 1N47A 3VD9A 2YPJA 4NIGA 4V1PA 2W1UA 3KMHA 1OI6A 4I3PA 4IV3A 5FPZA 5T55A 4A7ZA 4FBFA 1JYTA 3GXUA 4JDMA 1TQ5A 1KFUL 4GXLA 1AR93 1S0DA 2ZCWA 3CLPA 1S0GA 1PO12 1YLLA 4J25A 4S2GA 5FP4A 1E5HA 4YPJA 5FV3A 2YROA 3FWEA 2UU8A 4AR2A 1W9SA 3R4SA 3U14A 1RL3A 3IZOA 4D3WA 3DXUA 2WT1A 5DN2A 4RN5A 1POQA 5CFDC 2ZX2A 1V6OA 2W2IA 3UGFA 1W6PB 3VHRA 1PNFA 2VZSA 4Y1VA 1V9U2 5J1XA 1QJU3 2WWSA 3NJXA 4QQ2A 4PIYA 2ZX3A 3UGHA 1OUSA 4NWVA 3ZFFA 2VVEA 4ATFA 4CA9A 2HH9A 4YM1A 4GALA 3NAPA 1UY1A 4IETA 1N1VA 1V0AA 5FPAA 3KZ4C 1R1A1 1MS0A 3KCCA 3V0AA 4O61A 1X9PA 1W9YA 3OUJA 3OBAA 3NRUA 1H0BA 3FHAA 1KITA 5E89A 1VAKA 5FYVA 1BBT3 1ACCA 4PI0A 4WM7B 5A7SA 2YC4A 5BNQA 4XXAA 3U4XA 1NCQB 2OUJA 3O1TA 3ZR6A 1RUG1 1OFSA 4A44A 4K7JA 1W9WA 1RHI3 3AJYA 3BIWE 3WF1A 4MXVA 3WR0A 2QNKA 2RS12 3J8F1 4PDWC 1LOCA 2VUJA 1V6LA 4HZFA 3INAA 3T2PA 4ES9A 1O3SA 3KD4A 4K40A 4NE9A 5FPLA 3W20A 4JQTA 4Q27A 3MHZA 3ZLIA 5J48A 2PHXA 4WVVA 3AYAA 3JB4C 4Q8KA 5ABJB 1RUD1 1NE6A 1SDDB 2Y6JA 3IKWA 1FOD2 2P2KA 4CE8A 3NNFA 1YJLA 3BGAA 4A2UA 1W8TA 3FUOA 3P1IA 3WLUA 1WZXA 2WN2A 4KH9A 3SMHA 4JGZB 5DMYA 2JKBA 3PIJA 2XJUA 3T0AA 1HRV3 1JOJA 1HB4A 3SCFA 1DFQA 1MS8A 1A3KA 5DDJ3 3D0JA 2HKXA 3POEA 1SEFA 1QHDA 1AR72 1X8MA 3MFCA 2J1UA 4WVWA 3SQOA 4RS5C 1AXYA 2RMU3 2ZAAA 3ZXKA 3THCA 1ODMA 1UZZA 5APAA 1ODNA 3GBWA 3J9SA 4N9IA 3RQ0A 3K48A 1MS3A 2ETEA 1W8UA 3D3AA 3N35A 2ZAHA 3F2ZA 2R6QA 2HYKA 2VZ1A 4GB32 2Q8CA 2W47A 4Z2WA 2VNOA 4XAEA 4NRQA 3UKTA 3WOGA 3AMHA 1IKQA 3POFA 4Y22A 2JEMA 3RG0A 2CAVA 2GSYA 1NX9A 4DO0A 2ZEZA 3PHMA 2QVSB 4JCKA 2B8MA 4LHKA 3ROUA 2WL1A 4LKFA 3SH5A 5KHHA 1JODA 2BNNA 2XR4A 3I3DA 1YWKA 2W92A 2VAUA 2WNUC 3E1F1 2QZ2A 3GALA 3MFAA 4ZXKA 1ND2C 4L97A 1ZRCA 2XUMA 2X8KA 3HBZA 4HXCA 2A5ZA 2DUQA 4Q4X3 5LA0A 1ZVFA 1AR83 2AUYA 2YBPA 5CU1A 4KU8A 2H0BA 4JGYB 1EYBA 3T4HB 5ACA1 2WUHA 5IK5A 5F7UA 1HN0A 4QQPA 5FZMA 4Z8BA 4LO7A 4QQHA 1N3PA 4HFSA 3ZXJA 2WNVB 1DYPA 3NO8A 3PMEA 5DABA 4P14A 1XPWA 4QD2A 2XH6A 2HWF3 1G7YA 4XURA 3T30A 4BA6A 1RUC3 3NJVA 5B4XA 5FLHA 3RZZA 3GGLA 4N43B 2VZOA 1CAVA 5LB6A 1T6BX 2G19A 1OQEA 4I02A 1WW4A 1GKBA 4AHYA 1CONA 5A33B 1XE7A 3QD6A 2AEZA 3USSA 1AYM2 1O7FA 1YCIA 2YB7A 4MG2A 2OQ6A 4DS0A 5IK7A 3FHQA 5I0RA 1UMIA 1YQ2A 4FOYA 5A6ZA 4R9BA 5BV6A 1COV3 4LBKA 1SPPA 5SV8A 1XNKA 3I2GA 4AFMA 3QOPA 4BIFA 5F3CA 1OA4A 2XJTA 2R041 2W52A 4HVOA 3CKHA 3AXDA 3ZVXA 4RHV1 4LBOA 2VTFA 3DL3A 5EJ1B 1G9AA 1WKYA 2XG3A 5EYYA 2A75A 4CCLA 1W8WA 4HKLA 5KC5A 3TEYA 2XB6C 1UU4A 2ZS6B 2HWE2 3ZDVA 2VZ3A 3PJQA 4EZHA 3I59A 3KT7A 2Q4SA 1PK6B 4QM8A 4NHYA 5A1LA 3IAPA 3HOBA 3MLLA 3ZSMA 3NAPC 5GLZA 2BFUL 2RJKA 1XOYA 1DCSA 5FYHA 4QX2A 3AVRA 2OS2A 3S7IA 3VBUB 4MGTA 1GYKA 3ST7A 2D3SA 2ZPXA 3RMYA 2OUHA 4URAA 5A6QA 3CHXA 4OQ9A 2ATFA 3ZFEB 4KQ7A 4AEKA 4HG6B 3SHRA 2AENA 1MACA 2XHNA 3BTYA 3B5LB 5HCFA 3LDKA 4PQQA 4IEVA 1STMA 4Y26A 5IWFA 4ZY9A 1VBB1 3CO2A 5T50A 5JXHA 1LCLA 5F9TA 4MGZE 1US2A 4XHXA 3U37A 2Y60A 2B42B 2IWGB 1SMVA 4Y24A 2VMCA 3JBG2 3WG1A 1WCUA 2D98A 1WD4A 3LIGA 3AP4A 5JAXA 2X10A 4XDQA 4B4PA 3WDUA 1GQGA 2PELA 3OY8A 4AEMA 1CJDA 1RUJ3 1HJFA 3S57A 3BUCA 2W0XA 4COWA 3POGA 4P9WA 3OUIA 1Y3TA 4AGVA 5C8WA 5FY1A 1DG6A 5C6CA 4IV1B 3VBRB 2ZX1A 1QJZA 3LCPA 3VBOC 3ZXEA 5BNNA 4EZ4A 1K42A 3KV5A 3DV8A 1MZFA 5KC6A 1JXNA 2GMMA 5L7OB 2VMEA 3VL9A 5FYCA 4NPRA 3VBHC 1J3PA 2IXHA 2QQKA 1URXA 4Q0QA 4YW7A 3D6EA 4JTNA 1FMD1 4FPLA 1VBD3 1C8M1 2EXKA 4CCOA 3PUQA 2L9LA 4GIQA 5A7WB 3J4UH 3WP4A 1GNZA 1POV1 2TBVA 4E2GA 3IDBB 1SDWA 5L9BA 1CAXB 1QY4A 3OPWA 3C7HA 1CD3G 1XC6A 3WNOA 2VQTA 4XIKA 1F8VA 1ZA7A 3I8TA 3HT1A 2X5IA 2IVIB 2MEV2 5GZCA 3OPTA 1RUH1 2OX0A 3CU7A 2BEOA 4YM0A 4P9XA 5CFCC 4FOWA 4BLJA 3VZMA 1A34A 1CZSA 4AVCA 1FNZA 2JDNA 1NKGA 1HRI3 1W0PA 1YJKA 3GYDA 1BJQA 5CYYA 2VOTA 3RZJA 4B8EA 2ERFA 3HN3A 4E27A 1O4ZA 2DCJA 2ZMNA 1GZWB 4XFFA 1E5IA 4YW2A 2HWB2 2HWC2 3DPRA 4QWNA 1HB1A 2A71A 1CX1A 4WV8A 4QB1A 4B1MA 4FQ4A 2PAEA 4OLLA 1W6NB 3HWJA 3WXPA 5FMCA 4K20A 3RGBA 1X36A 4G3YC 5LBCA 3W21A 2DFCA 4C0HA 4EN7B 3NSTA 1UOFA 1XQNA 2WS93 2XJPA 5GM0A 3U4SA 1MQTC 3M8LA 3MGUA 1OA3A 4HVQA 5A3PA 2H0VA 1LOFC 3KT1A 2XLFA 1UOJA 3LEGA 4A3ZA 1EAH2 4E2SA 2R072 3GBGA 4UBHA 2GN3A 5IVJA 3L2HA 1O59A 3R4DB 4XJWA 1UOGA 1W6PA 2Q0AA 4PDWB 1ULOA 2UYBA 4QX0A 5FJKA 3FE5A 1AL22 2ORZA 4HBNA 4KG0A 1GWMA 5DAVA 3IN9A 3THDA 3C7OA 1D0HA 2VJXA 3KGZA 4FPEA 5EZWA 4AI0A 5A3MA 5JZGB 3O1UA 4FPKA 2JE7A 5C9AB 2ARAA 3WQ7A 1GOHA 2DBNA 2QQJA 1H1MA 1WCQA 4WM7A 4LXLA 1V70A 5HPOA 1XB9A 2E32A 2QQNA 1NCQA 5EV7A 5H9RA 1W0NA 3ZN5A 1H2LA 1PGL2 1UX7A 4FXGB 5E16A 4S2HA 3K4AA 3WVJA 4XJAA 1DZTA 2P6HA 3V0BB 1VBE1 2PHTA 1OD5A 5C5UA 1CN1A 1N3OA 3IIAA 4XBLA 5IAVA 2J1RA 2YXSA 2RVAA 3D82A 2D5FA 2DVBA 3UGGA 3DEMA 3U11A 1GANA 3NJZA 1WLCA 5K0UB 4DXRA 3O1VA 1UY0A 4J1XA 1MEC1 5ABJA 1OH4A 4FAGA 3WF3A 3I49A 1D4M2 3AZXA 2ZACA 3SKVA 2JKXA 3UYJA 1YFXA 3C7FA 1KDKA 1H1IA 1PX4A 4JGZA 3MW4A 1H4HA 2VZTA 2WNEA 1LR5A 4AFBA 1T6GC 1FXZA 1FNYA 1TNRA 3E5QA 4IW3A 4OMCA 3FLPA 3ZPYA 4OI1A 3MIBA 3HPNA 4RA0A 1SQ4A 2JICA 2WNUB 2UWAA 2VD7A 5E88A 2RDNA 2BWCA 1OLMA 2VCCA 1DGWX 1FT9A 3O0VA 3VHPA 5LEJA 5FZKA 1V6MA 5BNPA 2V4VA 3G7DA 4YGDA 4EN8B 2Y8KA 5D8AA 4CXXA 2ZJCA 1W0OA 2I45A 4K21A 3VL8A 2JX9A 3WDVA 2DWRA 1ZZCA 3UK9A 1HXS2 2YBKA 2WZR1 5C70A 1RUG3 4DUXA 4DY5A 2XKPA 3TEZA 1I1EA 4JZRA 4CCMA 4NHXA 1XE0A 2I2SA 5AC93 3J8F3 4EN0A 3KVBA 5A1FA 4E8DA 2YFZA 4Y1XA 1PMHX 1HQLA 1JU3A 5A3UA 1KS4A 3HJRA 3ZO0B 2XOMA 1DP0A 4MH0E 1Q56A 4QPGC 1LGNA 5GJ6A 3WG2A 5FWJA 4JGYA 1NCRC 1PNGA 4XIOA 1O3QA 1HRV1 3ASIA 2BGPA 2Z69A 4HL0A 4ZS3A 5LZ6A 2D6KA 2P37A 2VW0A 3VZJA 3BPSA 4C1WA 2CNAA 4CCDA 1QEXA 5C7GA 2ZXQA 5FFOC 1YFWA 3AP7A 1UPIA 1J83A 3H0OA 2E63A 3LGRA 4GH4C 4OCTA 4R4XA 4G4FA 1ULGA 2GC2A 3KHBA 2Q8DA 3WUDA 4K8FA 5FCCA 4N43A 4FFHA 3DF0A 2RE9A 2O0OA 3WCRA 1Q5OA 4B29A 4DUWA 1R64A 1SACA 1DQ1A 4LO4B 2PLV2 1GQHA 2MHFA 4KBZA 3WG3A 4B4RA 1LHOA 2YZ4A 1VRBA 5FYTA 3U10A 1PO11 1VB4A 4O65A 4QX7A 4XFHA 4XUQA 1G8WA 3OYWB 3I3BA 4HMZA 3VZKA 4AHWA 2DTYA 1UYZA 1NAEA 3N7JA 1U0AA 4ZU5A 2BPA2 2HEVF 5FMDA 5T5JA 3AP5A 3LF7A 3OGVA 3ETQA 3AZVA 2JB4A 1V9U1 1MPXA 1VMFA 3NMBA 1ND3B 3UNPA 4HSJA 3VBUA 1WLWA 3E5XA 3KB5A 3VKFC 5KXBA 3CMGA 1GNHA 2Z4FA 3IWZA 3TEXA 3E6BA 1UWWA 3PVOA 3ZFEA 3ZYPA 1OLRA 4NAOA 3O0WA 1D2SA 2AREA 4YW1A 1POV0 4PCRA 2V73A 3B01A 5ACA3 5GZGA 4W6XA 2RDSA 3LSDA 4P9YA 1HLCA 5EQUA 3UKNA 3WW1A 5JUVA 4AI2A 2BQPA 2DV9A 4QB2A 3WT3A 2VZPA 4BMBA 1ULCA 3VBOB 1SLCA 1OPMA 4BQ3A 3OEAA 3MLJA 2SBAA 1AX1A 4WVMB 1MVEA 5IJRA 2RS11 1PMIA 1B35C 3OG2A 3NNGA 3VBHB 4R9AA 4TTGA 1XRUA 3WNPA 1J58A 2P3YA 4L92A 1YFUA 1Z0HA 3TBDA 1UOBA 4CP9A 3ACFA 1QWRA 2C9KA 3L2YA 3T4VA 4FPJA 5ABJC 1MS4A 2YC2A 1SCRA 3KF5A 4FOQA 1D0GA 4AK3A 1FOD1 1JUIA 2VU9A 1S1AA 3O1RA 5E1RA 2ZGTA 4UBGA 4NIHA 1N1SA 2R043 4NHKA 5FUNA 4RHV3 2W1WA 1Q3EA 4RGAA 3IMNA 4IV1A 2X53S 3VBRA 4E2QA 3RPQA 1ZX5A 4FPOB 4WBBA 5CFCB 1IS4A 1LULA 4LQRA 1IGOA 3AFGA 3ACLA 4HOOA 1ASJ2 3LZZA 4ES8A 2J1SA 3LA3A 2D5HA 4ZONA 4MGKE 4DRRA 4UWDA 5HXVA 1PHMA 1ZZ9A 2AH2A 4ARYA 5DAXA 2BRTA 2HEYF 2W39A 5FY5A 5LY1A 3PTYA 2DURA 4DY3A 5A7WA 3TAYA 4QKNA 3CBNA 5A3LA 4GB31 2WAAA 5F6LB 1K5JA 5A1AA 4YLZA 5KHIA 1W8OA 1QNWA 2ADDA 1XYNA 1LHNA 4U36A 4Y20B 1TME2 2ZHMA 3RI8A 4RQPB 4DEQA 4AL9A 4XUOA 4AEJA 1CGPA 1V00A 4RD7A 4V2VA 5IATA 3QACA 3VZNA 4IGPA 3BI3A 5CISA 2LW8A 1BZWA 2Z79A 2WWJA 2ZGRA 3NVCA 3P6BA 1CWPA 4Q26A 5FZ6A 3GZUC 4OMDA 2AEYA 2JJ6A 4AZZA 3DYPA 4AFAA 1OD3A 1R082 2DF7A 5LRRA 4LEJA 4AGGA 3PDQA 1WGPA 5IVYA 4XPVA 1OHFA 3KM5A 5FQ0B 4HT1T 4QX5A 2R0FA 2P6CA 1XE8A 3CQOA 3LIHA 4D6QA 5FZOB 1LAJA 3KV6A 2WNVC 4BPZA 4KWUA 3EYPA 1CESA 4UFIA 4IQPA 5FP9A 2EXHA 5FY0A 3RDIA 1W6NA 4INDA 3ZYFA 4AWDA 4DUVA 3B9CA 2CL2A 3AFKA 4E4DX 3OEBA 1OVSA 4Q29A 2ZZJA 4ISQA 4H3WA 1QOSA 3H8OA 2UWCA 4ATEA 4CDUC 4A7YA 2VR4A 1A78A 3I7DA 3SEPA 4K1ZA 5LASA 5FZDA 2FDFA 1DIWA 1IS5A 1AYM1 4QU1A 1FMD3 2RS53 4X6QB 2WZPP 2DTWA 4R9CA 1ENSA 1POV3 1JYIA 3WF4A 3MUY1 4PDWA 2QQUA 5A80A 2B4KA 2BUKA 2JDHA 3SNMA 1GWKA 5DG1A 1PK6C 2E26A 2HWE1 1F2NA 3VD3A 2VC9A 1LTEA 2PYTA 2VZQA 3WP3A 3MYXA 2R7EB 3WNMA 2E7QA 1XSRA 2Y33A 4XEZA 5LBEA 1W9FA 3V65A 1WA4A 2VUCA 5I8SA 1VJ2A 2NQYA 2DCYA 3ZFEC 3ZMOA 4BXFA 5F5IA 4S2DA 4HLTA 2E6VA 4E4SA 4M3CF 3N9MA 4J1WA 3OBZA 1C28A 4GWMA 5FLJA 1HJGA 4CYDA 3V0BA 3POWA 2YYOA 1DYOA 1HV1A 3PTRB 5FZ8A 2XJSA 4M3CB 2XQRA 5AFBA 5BY5A 2ET7A 2J22A 1FV3A 2WT2A 4HK8A 3BYWA 5FZFA 4W50A 1I3HA 4QU2A 2W08A 1DYKA 4BK4A 4EN6B 3ECQA 4KMQA 5EP9A 1TME3 4EWEA 4A6OA 3OGSA 1H6XA 2EAKA 1NE4A 3TNPB 4LBJA 3JBG1 3LQCA 1EPWA 4UAPA 1ZM1A 4R8HA 4P9IA 1AUYA 3MPPG 3ZYJB 1OC1A 4IE0A 3HIFA 3HVDA 4OVEA 4CCNA 4D6SA 2QZ3A 3AC0A 1KFXL 4XF9A 4OFGA 4LITA 3VKLA 4MLOA 3BCWA 1QNYA 5KR7A 5KBFA 2WNUA 4NHMA 4P9GA 4IV1C 3VBRC 4YVSC 5LCWL 1W99A 1XYOA 1XXNA 3LFMA 3OBRA 4META 1JHNA 1REDA 4NJ4A 1VE0A 2GMEA 3DCQA 5L7OC 1ENRA 2DBIA 4RR3C 3I2IA 2EXJA 3ZDSA 4XILA 2WNOA 1NCRB 4YGCA 4MZUA 3OTFA 3ZXLA 1W8HA 5A7OA 1EUTA 5F2SA 4AI8A 5IHRA 1QIQA 3I3EA 1YYNA 2JG9C 2VMFA 1EP0A 4Q5OA 3ZYRA 3M3OA 1RUI2 4GH4B 4BQ4A 3K4DA 4Q4V2 1EY2A 4KNCA 4GD4A 4Y3OA 2VO5A 2YBSA 1VBE3 1VPHA 3USUB 3AX4A 2FCUA 2VQAA 4TXWA 1RUF2 3C3VA 1O5LA 3BB6A 1VALA 4C90A 1ZRIA 2D6PA 2VL4A 1YFYA 1OBNA 2MEV1 5JDBA 2WC2A 3ZKYA 2HBUA 3P3NA 3OGRA 1OKQA 1WMXA 3ME2A 2VTXJ 1MEC3 3ACIA 3ZMNA 3O1PA 2W1QA 1LNSA 1W90A 3C8XA 4CDWB 5KXCA 3D5OA 4LO8A 4PHZA 5FK7A 3L9JT 3IIIA 4LKDA 3OF1A 1RYYA 3VDAA 5FXZA 1NA1C 2HWC1 1ZBE2 1YIPA 2XVGA 3PL0A 3ILFA 5JOXA 2NPIA 3QH6A 1ZZ8A 1CAUB 2ZGSA 2Y6GA 2WZEA 3FMGA 1OPOA 2VECA 2F4LA 4L0PA 4M00A 4R52A 3BU0A 3N9OA 5I0UA 5DZFA 3THPA 4AQ2A 1E5RA 1Y43B 2C5DA 1WBFA 2BDRA 3H9AA 3KV9A 4MGSA 3PURA 5E8AA 3T08A 4Q0PA 3OYWA 3FJSA 1EAH1 5JVVA 2D44A 1LHVA 1OLQA 2R071 2VBDA 4Y1ZA 4AVBA 5AC91 4FO9A 5ANNA 5BXXA 5FZIA 4DB5A 2WZR3 4LUMA 4F83A 1PVXA 1B35B 3GM8A 1WMDA 3MDPA 1G9FA 3M3EA 4XFAA 4LKSA 3JXSA 1AL21 3CF6E 1ND3A 1W6QB 2BYVE 4MGYE 5JZGC 1TVGA 5FYIA 2RR12 2DCKA 4I0AA 4AFDA 1IG0A 4IUGA 5C9AC 1DQ6A 2VW1A 5FYUA 4M0HA 2VULA 3LDBA 1C1LA 1UF2C 2ZEYA 3AKSA 4IE7A 3VD4A 1OF3A 4C0BA 1PMJX 2GC3A 1Z78A 2DVGA 2A3WA 4JTOA 2UWBA 2VZRA 2BVBA 2ZGUA 1RB8G 1PGL1 3N9NA 3VBOA 3AMMA 3RZKA 1AX2A 4COZA 4CXYA 2FHRA 1QJX2 4COYA 1UYYA 5IYYA 1UY2A 4NRPA 3WINE 1RJ8A 1LOAA 2A6XA 2Q5TA 4LOSA 1OUXA 1CPMA 3VBHA 4CEYB 3WNNA 2LALA 4AGRA 3KSCA 3H50A 1W9TA 5K0UC 3RJ2X 3I2DA 5CG8A 5FTTC 4J6GA 2B7YA 4ASKA 1TZOA 1U5ZA 2JE9A 2PHWA 1O3RA 2Y26A 5ANQA 1CQ9A 2VZVA 1G86A 1D4M1 1PO13 3EBRA 1JH5A 2JG8B 2D3PA 4CDXC 1S0EA 4YGBA 1OSGA 2DFBA 3B7MA 4CCEA 5F6KA 4UF0B 1UL9A 3I2KA 1F4HA 3HNYM 4YG3A 1SZBA 1KD7A 5TSWA 2BU9A 5CFCA 4L9BA 4LORA 1O3TA 3M70A 4QHBA 1V9U3 4BK5A 2A1XA 1BK1A 2OW4A 4FPCA 5J36A 4RSUA 1W3VA 1J1TA 1PZ8A 4QM9A 4E8CA 3NKGA 2XL7A 4QDQA 3N9PA 2PHLA 3KS7A 4RL7A 5F3EA 2RS32 4FAHA 2OT7A 4IEQA 4Y20A 2ZHKA 1BCXA 3NWKA 1DGLA 4LBQB 1IKPA 1EV12 4PF5A 5BNOC 1HXS1 2QQPA 2ZGLA 1WW6A 2QUOA 1REFA 3ELNA 2H6CA 1QJEA 3RI9A 2R062 4CDUB 4A4AA 2PXJA 1PZ9A 1MQTA 1OLME 2WSVA 2E9QA 2VVDA 3NKTA 4I09A 2EA7A 2RS13 1LOFA 3CDZB 2GP3A 4LBNA 4TWTA 4CVUA 2NYYA 4KWKA 5LA1A 3WF2A 3J7NA 3NV2A 5FBZA 4XF4A 1W8NA 2LROA 1C3HA 5FQ0A 4GMP1 4AAPA 5FZOA 3EB7A 1FOD3 2W95A 1AR62 3T1MA 4D7YA 4D94A 3AMPA 1XNTA 2ZGMA 3PIGA 4PJYA 2K46A 1RXFA 2OZ6A 1W03A 2VXJA 1NG0A 2WDBA 3JB8A 1RUE2 5FP7A 1GZ9A 2O8QA 1AR73 1W6MB 5IVEA 1NXMA 3AMNA 2VCBA 5LA9A 2R49A 2VXRA 5F1RA 2PLV1 1VRH2 4R9DA 4ARXA 3A0KA 3O7OA 4IDZA 1ZBA2 2XWJB 4A6SA 5T3NA 3M2MA 4NR1A 4GB33 3GCWA 5J96B 4XJ8A 1C57A 5KXEA 4YYOA 4CZSA 3ZN6A 3DGTA 3PJYA 2JB8A 4AFCA 3VDCA 2OZJA 1UAIA 3T09A 4AXOA 5GLUA 2EVXA 3K4ZA 1PGW2 3HNMA 1ND3C 3WDYA 3FUQA 5DXDA 4BYYA 1S55A 4NIAA 5ISLA 2GN7A 2WO3A 2BV4A 4GWJA 1HKDA 4XUNA 1X9TA 2DVDA 2O8OA 3ZYBA 3FX3A 1KXGA 3RWKX 4A7KA 1GU3A 5EJ3A 4Q4W2 3EXUA 1O6UA 2ADEA 4RYDA 3ACHA 3MEPA 3LAGA 2A70A 4LLOA 4IXLA 4YVSB 4P9LA 1SCSA 2BTVC 4LE3A 1S2BA 5HV0A 2JE8A 5G05L 1OMIA 1OVPA 4Q4Y2 2FZ2A 1PO22 3RYRA 1IPSA 2PMWB 4RR3B 4BIOA 3VBFC 4MX3A 4LO5B 4FPGA 1WLTA 1GV9A 5A3TA 2IXLA 4GKYA 4B7EA 4UXAA 4EROA 1SLBA 2RS51 4BQ5A 3ZXFA 5JSRA 2JG9B 3ZPOA 1JYWA 3WG4A 5HV4A 1X50A 4LK7A 1AYM3 1QQP2 4Z2AA 4YW3A 1CIWA 2A6ZA 2Y6FA 4LIVA 4NRMA 4MADA 2OKXA 1FI2A 2JENA 5FK8A 1OXCA 4UFJA 1PVC2 2WRAA 4YM2A 3M3IA 2OYZA 2PHRA 4YG0A 3WNKA 2CTVA 5K9YA 2HWE3 1RUNA 1DHKB 4QPGA 4WM8B 3PUIA 3H42B 2X09A 2SLIA 3TB0A 1ASJ1 2AYHA 1NCRA 5FYYA 3UV9A 4JHTA 1QU0A 5T5PA 2F17A 2QTWB 1YHFA 5FMOL 4K1YA 1ONAA 3U1XA 1LKNA 1LRHA 4IESA 3ON7A 1ZRDA 1NA1B 2JDUA 4UFMA 4GH4A 4Y33A 2FCVA 1KEXA 3AP9A 5IFTA 5C5TA 4RQPC 2QQVA 3USUA 1TME1 5FZ7A 2GU9A 2VMDA 4XFBA 2TEPA 3KWVA 3J7LA 4AI3A 2Q30A 4SBVA 1NT0A 5EFUA 5FXWA 5H9QA 5L9RA 3J26N 2GNDA 4DXZA 3WDXA 1CZVA 1DGRA 1Z7S2 1LESA 4I01A 4XZUG 1Q8OA 1YQ5A 4GWIA 4Z92B 3O1OA 3JBG3 3ZOIA 2A6YA 2XPJA 4RFRB 1VLNA 2NMOA 2W94A 1R081 2ZKLA 4BQ1A 3KQ4B 3H1YA 4QKDA 4IEXA 1R1A2 3VUOA 4H55A 4FFIA 1I5ZA 2OXBA 3MIDA 4JC1A 1DQ0A 1VAMA 4MHUA 4Q4W3 3ZSJA 1CAUA 4ZZ8A 1Y9QA 5JPNB 1EUUA 1IS3A 1Q43A 2DYCA 2LTNA 5L9VA 4ITCA 1UMZA 4EJRA 4I0WB 4D6RA 4QHOA 4NIIA 4AQ6A 2XKOA 4N9HA 4Q4Y3 4QMAA 2ZHNA 2G4IA 4RGGA 2YU2A 3S7EA 2W1SA 5H9PA 3POSA 1AYN2 4DZGA 1I5PA 4B1LA 1AHSA 1FX5A 1FATA 5JPMB 3NQHA 4QXCA 5F37A 1B35A 1XU2A 4I2OA 2R30A 4HVRA 4YG6A 1RUD2 5HBAA 1QDOA 1IS6A 4EYUA 1W6QA 2Q1FA 4P00B 3WHUA 1HDKA 3FHIB 5FUIA 1X33A 5LEKA 1ZNPA 2MEV3 4GAZA 4F7ZA 3ALQA 5F5AA 5FZHA 3AKRA 1LHUA 2WQ8A 4BOWA 1QXPA 2CGOA 2XJVA 4W4ZA 2KXLA 4CDXB 4K3UA 3H8XA 4NOTA 1C4RA 2BWAA 4A42A 3ZR5A 1UPSA 1N1TA 1UU6A 4YW5A 4HPKB 4E4ZA 2HWC3 2HWB3 2XJRA 4X8NA 4FP2A 2LS6A 4LNVA 1GSLA 3ETPA 1Y4WA 3CEWA 4CEYA 3HNBM 1Y9GA 4BZ4A 4JAAA 3HAGA 3IDCB 4LE4A 2WINB 2OQ7A 5JOZA 2BBAA 3VZLA 5JXJA 2B9UA 3PVEA 1UD1A 4XXPA 2EALA 2IC1A 4HK9A 5GLWA 1IG3A 3K51A 2KM2A 1C8NA 3RVHA 4OI0A 5AFEA 1S0FA 4OZOA 2JG8A 2RDQA 4XC9A 1Z7S3 2EIDA 3IB3A 4GJZA 4MO3M 4QX8A 4FT8A 1VBA2 1EAH3 4UW4A 5BNOB 3RS6A 2R073 1ULFA 2XL9A 2BNMA 4UFKA 2YU1A 4UF0A 5IW0A 1S0JA 4LUKA 4Q2FA 1JZ8A 3DYMA 3VDDB 4KI5M 3CZJA 3RJRA 1XU1A 1W2TA 5I8YA 3KCXA 3JZVA 4TSVA 3WW4A 1IPKA 1H1AA 3PNAA 4XBNA 1AL23 2XUEA 4HETA 1VBC2 1X82A 4GWNA 1LGCA 4ASMB 1G9CA 3SEEA 2WO7A 5DQ0A 2ZBJA 4IERA 2DCTA 3VKNA 4FTEA 2GP5A 5BUVA 4JKMA 4R4ZA 4AI9A 2BNOA 2WQZC 4ASLA 4O9EA 5FIXA 5K7PA 3KF3A 2WNVA 2A6WA 2CV6A 3LPFA 1DLCA 1JYCA 4P9JA 4XF0A 3WDWA 4OUSA 3WHTA 4FVVA 2GNTA 5FLIA 1V6KA 3LPGA
chains in the Genus database with same CATH topology
3BGAA 3WF4A 3MUY1 3A21A 3C7GA 3P1IA 2WN2A 5DMYA 1IQDC 2B4KA 3T0AA 2E26A 4QDSA 3VD3A 2J7MA 2VC9A 4P5YA 2E31A 2J1UA 2VZQA 2R7EB 3THCA 3WNMA 3T0DA 1JZ5A 3W5NA 1GMMA 2EIBA 3I2HA 4XUTA 3WSOA 5DPNA 2J1AA 3D3AA 3F2ZA 2VZ1A 2W47A 1ULPA 2BERA 1DYOA 2W3JA 3WQBA 2J22A 4W50A 4AG4A 4P02B 4BK4A 1NX9A 3ECQA 2ZEZA 3VD7A 4KMQA 1CZTA 4A6OA 3OGSA 1H6XA 2JD9A 3I3DA 4FI9A 2W92A 3E1F1 4QX1A 3LQCA 4UAPA 5LA0A 4JX0A 2WUHA 3AC0A 5F7UA 3MV01 3C7EA 2W5FA 5LCWL 1T2XA 1XPWA 1W99A 4XURA 3IDAA 3NJVA 5B4XA 3GGLA 2VZOA 4QAWA 3I2IA 5C71A 4PF1A 4W8JA 5IHRA 1EUTA 2YB7A 3I3EA 2J1VA 3FHQA 2VMFA 1UMIA 1YQ2A 2PQSA 4XUPA 3A22A 3I2GA 3K4DA 5EIYB 3CKHA 2VO5A 2VTFA 1L7RA 5EJ1B 4TXWA 1WKYA 3FL7A 4BJ0A 2VZ3A 3SKJE 1SHWB 2VL4A 3IAPA 3HOBA 5JR2A 3OGRA 4QX2A 3ACIA 2CDOA 1JI6A 4CU7A 2W1QA 1LNSA 3I2FA 3C8XA 3K75B 3IIIA 4HG6B 1RYYA 3VDAA 2XHNA 2RV9A 3FN9A 4PQQA 1D7PM 1GOFA 3T2OA 4ZY9A 5JXHA 2Y6GA 2B9VA 2WZEA 3LEIA 4L0PA 1US2A 3BN6A 3U37A 5IFPA 4PT6A 5JXGA 2VMCA 4MGSA 2YFUA 1UZ0A 4QDRA 1K45A 3T08A 2X10A 2V72A 1K3IA 2HYXA 3GM8A 3K46A 5B4NA 2W87A 4LKSA 3JXSA 2WYSA 3ABZA 2XQXA 3A23A 4ET7A 1TVGA 1J84A 2QQIA 4MOAA 1K42A 3WEZA 2DCKA 1GUIA 4IUGA 2VMEA 1JZ6A 2QQKA 2ZEYA 3VD4A 2WABA 1OF3A 1PMJX 2L9LA 2VZRA 3OB8A 3C7HA 1XC6A 1UYYA 3A7QA 1UY2A 1UXZA 3WNOA 5IYYA 2VQTA 4M4RA 3WNNA 1W9TA 1XNAA 1K12A 1CZSA 4P08A 2VZVA 1NKGA 5CYYA 2VOTA 3HN3A 4A41A 3WF0A 2DCJA 4D0QA 4LHSA 1JYNA 3W5MA 2WO2A 4JKLA 1GQPA 1P8JA 3I2KA 1CX1A 1F4HA 3HNYM 4QB1A 3CIHA 4BK5A 2ID4A 1JHJA 1CIYA 4E8CA 4DXTA 4QDQA 2HLEA 1H6YA 4A45A 3LEGA 4A3ZA 3I97A 1O59A 2Y6KA 2VM9A 1ULOA 4QX0A 4A4AA 2WO1A 2ORZA 2WBKA 4D8MA 3THDA 3C7OA 3CDZB 2VJXA 5HXMA 2Y6HA 1SG3A 4CVUA 5LA1A 3T0BA 3WF2A 1GOHA 2BGOA 2J1TA 2QQJA 1W8NA 1WCQA 2VCAA 4CUCA 5HPOA 2QQNA 2E32A 1JZ3A 1W0NA 3EB7A 2W95A 3MBWA 1JYXA 1UX7A 3K4AA 1XNTA 2WDBA 2J1RA 4CUBA 2RVAA 4JKKA 2W46A 4MGQA 4CUAA 1F4AA 2VCBA 2ORXA 2EICA 2VZUA 4ARXA 1UY0A 3VD5A 1OH4A 5JXIA 3WF3A 1UY4A 3UESA 1O8SA 3I2JA 3SKVA 2JKXA 2E33A 3HEIA 3C7FA 1PX4A 2VZTA 2DDUA 3VDCA 4QB6A 4OMCA 3T09A 3WNLA 2RJ2A 3HPNA 3K4ZA 2KD7A 3HNMA 4UOJA 2YG0A 3T2QA 1L7QA 2VCCA 3LE0A 2WO3A 4GWJA 4XUNA 5EJZB 2C4XA 1PX3A 2V4VA 2Y8KA 1GU3A 3ACGA 2Y6LA 4DXRA 2CDPA 4CU8A 4RYDA 2ZEXA 3ACHA 3MO4A 2W9XA 5C70A 4DUXA 2JE8A 5G05L 4QX3A 2ZEWA 5I0DA 3DYOA 2EIEA 2YFZA 4E8DA 1PMHX 1JU3A 1JZ2A 1HN1A 3HJRA 4DEVA 2XOMA 1JYWA 1DP0A 1GOGA 4Z2AA 4QPWA 2BGPA 4MADA 2X05A 2J1EA 2XONA 2OKXA 5C7GA 2ZXQA 2W91A 4DXSA 1J83A 4UI9L 1O8PA 4OUEA 3WNKA 1JZ4A 3PUIA 2X09A 4DUWA 1R64A 1OF4A 2WN3A 4GZ9A 1GNYA 1KEXA 2WAOA 4XUQA 5IFTA 3I3BA 4ZZ5A 4JHZA 1UYZA 1NAEA 3DECA 2VMDA 2QQLA 3OGVA 3UETA 1MPXA 2JDAA 1CZVA 3UNPA 4XZUG 4GWIA 3CMGA 3J7HA 2Z4FA 2WZ8A 2QBXA 1UWWA 1BHGA 3IAQA 2W94A 3ZM8A 1UY3A 3GDBA 5LA2A 4CU6A 5JUVA 2V5DA 4ZZ8A 4QB2A 2BZDA 2VZPA 1EUUA 2Y64A 3OEAA 1UYXA 5IJRA 1NUKA 3OG2A 3NNGA 3MUZ1 5JMOA 4TTGA 3WNPA 1UMHA 4XVHA 3ACFA 1KGYA 2C9KA 4BDVB 4BXSV 2W1SA 3K77A 4OYUA 1OT5A 2YC2A 3VDBA 1I5PA 3NQHA 4AAXA 1JU4A 2W1WA 4P00B 5FUIA 4LQRA 3VD9A 2W1UA 2J1SA 1JYVA 2WQ8A 4CU9A 3GXUA 4W4ZA 4ARYA 1UXXX 4A42A 4YPJA 1JZ7A 2WAAA 3LEKA 5A1AA 1W8OA 1W9SA 2LS6A 2VQUA 1TG7A 5DN2A 4RN5A 3ETPA 4DEQA 3HNBM 4XUOA 2VZSA 5J1XA 3NJXA 1US3A 4LPLA 2BBAA 5JXJA 2LW8A 1UY1A 1SDDB 3P6BA 4OMDA 3CZUA 3DYPA 4OZOA 3OBAA 2EIDA 3IB3A 3PUHA 1OD3A 3NRUA 4MO3M 3FHAA 2C26A 4ZXEA 2YC4A 3CQOA 1JZ8A 3DYMA 4KWUA 3EYPA 3CZJA 4KI5M 5G04L 4A44A 1W9WA 4DUVA 2QQOA 3WF1A 3OEBA 4M4PA 3SEEA 5DQ0A 3T2PA 2VR4A 3SEPA 3MV11 4JKMA 5CZKA 2QQMA 3LPFA 1DLCA 2Y6JA 3LPGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BGA A;  3WF4 A;  3MUY 1;  3A21 A;  3C7G A;  3P1I A;  2WN2 A;  5DMY A;  1IQD C;  2B4K A;  3T0A A;  2E26 A;  4QDS A;  3VD3 A;  2J7M A;  2VC9 A;  4P5Y A;  2E31 A;  2J1U A;  2VZQ A;  2R7E B;  3THC A;  3WNM A;  3T0D A;  1JZ5 A;  3W5N A;  1GMM A;  2EIB A;  3I2H A;  4XUT A;  3WSO A;  5DPN A;  2J1A A;  3D3A A;  3F2Z A;  2VZ1 A;  2W47 A;  1ULP A;  2BER A;  1DYO A;  2W3J A;  3WQB A;  2J22 A;  4W50 A;  4AG4 A;  4P02 B;  4BK4 A;  1NX9 A;  3ECQ A;  2ZEZ A;  3VD7 A;  4KMQ A;  1CZT A;  4A6O A;  3OGS A;  1H6X A;  2JD9 A;  3I3D A;  4FI9 A;  2W92 A;  3E1F 1;  4QX1 A;  3LQC A;  4UAP A;  5LA0 A;  4JX0 A;  2WUH A;  3AC0 A;  5F7U A;  3MV0 1;  3C7E A;  2W5F A;  5LCW L;  1T2X A;  1XPW A;  1W99 A;  4XUR A;  3IDA A;  3NJV A;  5B4X A;  3GGL A;  2VZO A;  4QAW A;  3I2I A;  5C71 A;  4PF1 A;  4W8J A;  5IHR A;  1EUT A;  2YB7 A;  3I3E A;  2J1V A;  3FHQ A;  2VMF A;  1UMI A;  1YQ2 A;  2PQS A;  4XUP A;  3A22 A;  3I2G A;  3K4D A;  5EIY B;  3CKH A;  2VO5 A;  2VTF A;  1L7R A;  5EJ1 B;  4TXW A;  1WKY A;  3FL7 A;  4BJ0 A;  2VZ3 A;  3SKJ E;  1SHW B;  2VL4 A;  3IAP A;  3HOB A;  5JR2 A;  3OGR A;  4QX2 A;  3ACI A;  2CDO A;  1JI6 A;  4CU7 A;  2W1Q A;  1LNS A;  3I2F A;  3C8X A;  3K75 B;  3III A;  4HG6 B;  1RYY A;  3VDA A;  2XHN A;  2RV9 A;  3FN9 A;  4PQQ A;  1D7P M;  1GOF A;  3T2O A;  4ZY9 A;  5JXH A;  2Y6G A;  2B9V A;  2WZE A;  3LEI A;  4L0P A;  1US2 A;  3BN6 A;  3U37 A;  5IFP A;  4PT6 A;  5JXG A;  2VMC A;  4MGS A;  2YFU A;  1UZ0 A;  4QDR A;  1K45 A;  3T08 A;  2X10 A;  2V72 A;  1K3I A;  2HYX A;  3GM8 A;  3K46 A;  5B4N A;  2W87 A;  4LKS A;  3JXS A;  2WYS A;  3ABZ A;  2XQX A;  3A23 A;  4ET7 A;  1TVG A;  1J84 A;  2QQI A;  4MOA A;  1K42 A;  3WEZ A;  2DCK A;  1GUI A;  4IUG A;  2VME A;  1JZ6 A;  2QQK A;  2ZEY A;  3VD4 A;  2WAB A;  1OF3 A;  1PMJ X;  2L9L A;  2VZR A;  3OB8 A;  3C7H A;  1XC6 A;  1UYY A;  3A7Q A;  1UY2 A;  1UXZ A;  3WNO A;  5IYY A;  2VQT A;  4M4R A;  3WNN A;  1W9T A;  1XNA A;  1K12 A;  1CZS A;  4P08 A;  2VZV A;  1NKG A;  5CYY A;  2VOT A;  3HN3 A;  4A41 A;  3WF0 A;  2DCJ A;  4D0Q A;  4LHS A;  1JYN A;  3W5M A;  2WO2 A;  4JKL A;  1GQP A;  1P8J A;  3I2K A;  1CX1 A;  1F4H A;  3HNY M;  4QB1 A;  3CIH A;  4BK5 A;  2ID4 A;  1JHJ A;  1CIY A;  4E8C A;  4DXT A;  4QDQ A;  2HLE A;  1H6Y A;  4A45 A;  3LEG A;  4A3Z A;  3I97 A;  1O59 A;  2Y6K A;  2VM9 A;  1ULO A;  4QX0 A;  4A4A A;  2WO1 A;  2ORZ A;  2WBK A;  4D8M A;  3THD A;  3C7O A;  3CDZ B;  2VJX A;  5HXM A;  2Y6H A;  1SG3 A;  4CVU A;  5LA1 A;  3T0B A;  3WF2 A;  1GOH A;  2BGO A;  2J1T A;  2QQJ A;  1W8N A;  1WCQ A;  2VCA A;  4CUC A;  5HPO A;  2QQN A;  2E32 A;  1JZ3 A;  1W0N A;  3EB7 A;  2W95 A;  3MBW A;  1JYX A;  1UX7 A;  3K4A A;  1XNT A;  2WDB A;  2J1R A;  4CUB A;  2RVA A;  4JKK A;  2W46 A;  4MGQ A;  4CUA A;  1F4A A;  2VCB A;  2ORX A;  2EIC A;  2VZU A;  4ARX A;  1UY0 A;  3VD5 A;  1OH4 A;  5JXI A;  3WF3 A;  1UY4 A;  3UES A;  1O8S A;  3I2J A;  3SKV A;  2JKX A;  2E33 A;  3HEI A;  3C7F A;  1PX4 A;  2VZT A;  2DDU A;  3VDC A;  4QB6 A;  4OMC A;  3T09 A;  3WNL A;  2RJ2 A;  3HPN A;  3K4Z A;  2KD7 A;  3HNM A;  4UOJ A;  2YG0 A;  3T2Q A;  1L7Q A;  2VCC A;  3LE0 A;  2WO3 A;  4GWJ A;  4XUN A;  5EJZ B;  2C4X A;  1PX3 A;  2V4V A;  2Y8K A;  1GU3 A;  3ACG A;  2Y6L A;  4DXR A;  2CDP A;  4CU8 A;  4RYD A;  2ZEX A;  3ACH A;  3MO4 A;  2W9X A;  5C70 A;  4DUX A;  2JE8 A;  5G05 L;  4QX3 A;  2ZEW A;  5I0D A;  3DYO A;  2EIE A;  2YFZ A;  4E8D A;  1PMH X;  1JU3 A;  1JZ2 A;  1HN1 A;  3HJR A;  4DEV A;  2XOM A;  1JYW A;  1DP0 A;  1GOG A;  4Z2A A;  4QPW A;  2BGP A;  4MAD A;  2X05 A;  2J1E A;  2XON A;  2OKX A;  5C7G A;  2ZXQ A;  2W91 A;  4DXS A;  1J83 A;  4UI9 L;  1O8P A;  4OUE A;  3WNK A;  1JZ4 A;  3PUI A;  2X09 A;  4DUW A;  1R64 A;  1OF4 A;  2WN3 A;  4GZ9 A;  1GNY A;  1KEX A;  2WAO A;  4XUQ A;  5IFT A;  3I3B A;  4ZZ5 A;  4JHZ A;  1UYZ A;  1NAE A;  3DEC A;  2VMD A;  2QQL A;  3OGV A;  3UET A;  1MPX A;  2JDA A;  1CZV A;  3UNP A;  4XZU G;  4GWI A;  3CMG A;  3J7H A;  2Z4F A;  2WZ8 A;  2QBX A;  1UWW A;  1BHG A;  3IAQ A;  2W94 A;  3ZM8 A;  1UY3 A;  3GDB A;  5LA2 A;  4CU6 A;  5JUV A;  2V5D A;  4ZZ8 A;  4QB2 A;  2BZD A;  2VZP A;  1EUU A;  2Y64 A;  3OEA A;  1UYX A;  5IJR A;  1NUK A;  3OG2 A;  3NNG A;  3MUZ 1;  5JMO A;  4TTG A;  3WNP A;  1UMH A;  4XVH A;  3ACF A;  1KGY A;  2C9K A;  4BDV B;  4BXS V;  2W1S A;  3K77 A;  4OYU A;  1OT5 A;  2YC2 A;  3VDB A;  1I5P A;  3NQH A;  4AAX A;  1JU4 A;  2W1W A;  4P00 B;  5FUI A;  4LQR A;  3VD9 A;  2W1U A;  2J1S A;  1JYV A;  2WQ8 A;  4CU9 A;  3GXU A;  4W4Z A;  4ARY A;  1UXX X;  4A42 A;  4YPJ A;  1JZ7 A;  2WAA A;  3LEK A;  5A1A A;  1W8O A;  1W9S A;  2LS6 A;  2VQU A;  1TG7 A;  5DN2 A;  4RN5 A;  3ETP A;  4DEQ A;  3HNB M;  4XUO A;  2VZS A;  5J1X A;  3NJX A;  1US3 A;  4LPL A;  2BBA A;  5JXJ A;  2LW8 A;  1UY1 A;  1SDD B;  3P6B A;  4OMD A;  3CZU A;  3DYP A;  4OZO A;  3OBA A;  2EID A;  3IB3 A;  3PUH A;  1OD3 A;  3NRU A;  4MO3 M;  3FHA A;  2C26 A;  4ZXE A;  2YC4 A;  3CQO A;  1JZ8 A;  3DYM A;  4KWU A;  3EYP A;  3CZJ A;  4KI5 M;  5G04 L;  4A44 A;  1W9W A;  4DUV A;  2QQO A;  3WF1 A;  3OEB A;  4M4P A;  3SEE A;  5DQ0 A;  3T2P A;  2VR4 A;  3SEP A;  3MV1 1;  4JKM A;  5CZK A;  2QQM A;  3LPF A;  1DLC A;  2Y6J A;  3LPG A; 
#chains in the Genus database with same CATH topology
 4IV3 B;  1RUI 1;  4AHZ A;  3NV3 A;  2WLP A;  3ILR A;  4FP3 A;  4Q4V 1;  3A21 A;  3C7G A;  4CDU A;  1SBF A;  1IQD C;  1RUO A;  2WYF A;  4UT5 A;  4YVW C;  4HON A;  1RUF 1;  1RVF 2;  4XHB A;  4Y1Y A;  5A33 A;  5JWP A;  2VBB A;  4P5Y A;  1W3X A;  2E31 A;  4KL1 A;  1SLT A;  3WUC A;  2VG9 A;  4CP2 A;  4DMI A;  5FMB A;  5IK8 A;  3T0D A;  4JVA A;  1WA6 X;  4QKB A;  2P3I A;  5BPX A;  4XUT A;  4CDW C;  5JOY A;  3H8U A;  5DPN A;  4D69 A;  4YFW A;  3ZFF B;  3LWC A;  1D4M 3;  1MVQ A;  1PIV 2;  3Q8F A;  3AXE A;  5FKC A;  5J3U A;  1C5H A;  1PK6 A;  2JIG A;  1ULP A;  1BXH A;  1ZBE 1;  2QFE A;  2W3J A;  3JUU A;  2F6B A;  1Q8Q A;  1ZA4 A;  1M4W A;  1AL0 G;  3CJX A;  5GAL A;  3WQB A;  4FSJ A;  1OQ1 A;  2RDR A;  3DKQ A;  4AG4 A;  1ST8 A;  3U78 A;  5A6X A;  3D0S A;  5L36 A;  2FZ1 A;  3CL1 A;  3N7M A;  1W6M A;  4QPI C;  3T2T A;  3VD7 A;  4YM3 A;  2FDH A;  1I6X A;  1CZT A;  4IGQ A;  2Q8E A;  3CNA A;  5F5Q A;  1E5S A;  2ZZQ A;  5FPU A;  1ZYB A;  3W9A A;  1KS5 A;  1VBB 2;  4QX1 A;  4Q1P A;  2BOJ A;  2VVF A;  4XE9 A;  4AVT A;  4BH9 A;  1WW5 A;  2LUW A;  1ZRR A;  3ITQ A;  4EWA A;  4LJH A;  5FPV A;  5IVF A;  1R09 2;  2OPK A;  2GZW A;  2VOK A;  3Q9O A;  2UY9 A;  2FQP A;  5FZ9 A;  3KGL A;  4LA3 A;  5JCT A;  3MIC A;  3GCX A;  5FZB A;  1HXS 3;  1N1Y A;  1QOT A;  2IXC A;  2JDM A;  2UUR A;  3MV0 1;  3VBF B;  1I9R A;  4KBB A;  4LUL A;  3JQW A;  2W5F A;  5F32 A;  3LA7 A;  2VNR A;  4H2A A;  3WDT A;  4JQR A;  5DZG A;  3IDA A;  2PA7 A;  2C1F A;  3EMR A;  4QAW A;  1H9W A;  2RR1 1;  4KGQ A;  4U2A A;  5FAX A;  3MW2 A;  3LA2 A;  2IXJ A;  2XLA A;  2A73 B;  1BEV 2;  2Y0O A;  3E5U A;  4YZ4 A;  3IM0 A;  5JSP A;  2VBP A;  1DZR A;  3HMY A;  3UL2 A;  1W2N A;  5F3G A;  1U5Y A;  2HWD 2;  3MF6 A;  3WW2 A;  2CSG A;  2J1V A;  2PAK A;  5T5L A;  1V6I A;  1S0I A;  3BPZ A;  5I0T A;  2JDK A;  4GMP 3;  4YVS A;  5AVP A;  3GF6 A;  3HQR A;  1LED A;  3HR9 A;  2HJI A;  4GJY A;  1AR7 1;  1GP4 A;  3Q8A A;  3RYP A;  2DU1 A;  4NHL A;  5L7O A;  1ULD A;  1M06 G;  1C8M 2;  1QJX 1;  2WWU A;  3EQE A;  2FD8 A;  4RR3 A;  2W68 A;  3FL7 A;  3POB A;  4CEY C;  2YGM A;  4CSW A;  3AVS A;  3SKJ E;  4BQW A;  1SHW B;  2F4P A;  4E4H A;  4LT5 A;  3K3O A;  3PUS A;  4DRV A;  2JG9 A;  5JR2 A;  4NMI A;  3FFQ A;  2Q1M A;  2PLV 3;  2E7A A;  4DIQ A;  1BK0 A;  1CAX A;  4HAN A;  2CDO A;  1JI6 A;  3BTA A;  4BLI A;  5C8C A;  1HW5 A;  3I2F A;  2JG8 C;  3K3N A;  4OHZ A;  1NZC A;  2ZX4 A;  4AW7 A;  1K5M C;  5DUU A;  3O1S A;  5JI9 A;  5FP3 A;  2RV9 A;  5FPB A;  3WQ1 A;  2V5Y A;  4OUL A;  1G9D A;  1GOF A;  1OA2 A;  1LB2 A;  1AXZ A;  3T2O A;  1SBE A;  2JD4 A;  2MPF A;  2JIJ A;  3K2O A;  4CCK A;  5I93 A;  5FRA A;  2BGC A;  1L7L A;  1GZW A;  3O1M A;  4BQ2 A;  2Y34 A;  2ZGK A;  5JXG A;  1FPN 2;  1VAV A;  3GZA A;  1NA1 A;  3B3Q E;  1QJY 2;  4QDR A;  2RS3 1;  2PAM A;  3HQX A;  2VMG A;  5J37 A;  3NNL A;  4Y5T A;  2C6S A;  3AM2 A;  1K3I A;  2A6V A;  1EV1 1;  2ARX A;  4LO6 B;  4PLM A;  5C8C B;  5I91 A;  4BQX A;  4B4Q A;  2R06 1;  3K46 A;  4XF1 A;  1FAY A;  3ABZ A;  3A23 A;  4Z1V A;  2WFF 2;  2NZ9 A;  1AZD A;  1AX0 A;  1J84 A;  4MOA A;  2OA2 A;  5CIR A;  4YW6 A;  5LBB A;  1GUI A;  3WEZ A;  4CPB D;  3ZXA C;  1ZRE A;  5FOB B;  5FZC A;  2NLR A;  5CNA A;  4D7T A;  1HX6 A;  4LHN A;  2D7F A;  2IXI A;  5IVC A;  3AB0 A;  1RMU 2;  1U5I A;  1AR6 1;  2RM2 2;  3B93 A;  2XBO 2;  3TN9 2;  1TMF 2;  3N3H A;  1RGS A;  3H1M A;  2QDN A;  3BOP A;  4XF3 A;  5C3Q A;  5JZG A;  1ZZ7 A;  5H9S A;  2Q8O A;  3OB8 A;  4YZ1 A;  4CUG A;  3H8R A;  1JTZ X;  3T1L A;  5J09 A;  4F8A A;  5C9A A;  2R32 A;  1NY7 2;  1W6O B;  4WVZ A;  5F2W A;  4BB3 A;  4KWL A;  1YUD A;  4YZ5 A;  1ASJ 3;  1QH7 A;  2PHD A;  4PBO A;  1S0B A;  3S6P A;  3FBM A;  3SCG A;  1UKG A;  2VNV A;  2VTX A;  1VRH 1;  4OI2 A;  1W8Z A;  4CCJ A;  2DU0 A;  1AR9 2;  5DAW A;  3WX5 A;  4P08 A;  4AYU A;  5LAT A;  1ZBA 1;  4MV2 A;  3MI8 A;  1XNB A;  4A41 A;  3WF0 A;  5EYX A;  2KR2 A;  2CWS A;  2QE3 A;  1GBG A;  1HB3 A;  3W5M A;  1LEM A;  2WO2 A;  2D93 A;  3F95 A;  1GQP A;  5FJH A;  1P8J A;  4ZPI A;  4ZS2 A;  4DFS A;  5K0U A;  2YPD A;  5CKM A;  1NXD 1;  4Y4R A;  2JWP A;  5GZD A;  4S2F A;  1PZ7 A;  2IFR A;  2P4E A;  2YC0 A;  3LB9 A;  3WQ0 A;  1QJU 2;  1PGW 1;  3P5B A;  4F3J A;  1XBF A;  2XLG A;  2ID4 A;  4G9S B;  2ZGP A;  1LOG A;  1CIY A;  4CDX A;  3EJK A;  1YEW A;  3THT A;  4DXT A;  5HCH A;  1F15 A;  1H6Y A;  4P5H A;  2G9F A;  5GZF A;  4A45 A;  4Q4W 1;  1R08 3;  4HPK A;  3I97 A;  3RZH A;  1JN2 P;  3LSE A;  5C4W B;  3E6C C;  1EPZ A;  1BBT 2;  5T52 A;  1Y9M A;  4LBM A;  1PGS A;  1WBL A;  1RJ7 A;  2PHF A;  4XOG A;  4EN9 B;  3DXT A;  2WA4 A;  1YXW A;  3I54 A;  1WMF A;  4NPL A;  4Q4Y 1;  4AQS A;  4WZC A;  1PO2 1;  1RHI 2;  5AVA A;  2IVJ A;  2VY0 A;  2WBK A;  5HCB A;  3ZFG C;  1OH3 A;  5HXM A;  1BMV 2;  3H1W A;  3ZIW A;  2YY1 A;  3J7M A;  3OSD A;  2O14 A;  2BJS A;  3T0B A;  4MXW B;  4ONU A;  5BNO A;  2BGO A;  4D7S A;  1QQP 1;  1AF9 A;  5A7Q A;  4CUC A;  4M3C E;  5LK5 A;  2JDZ A;  3WZ1 A;  4W65 A;  3AMQ A;  5FZL A;  1JZ3 A;  1JYX A;  4YVW B;  3VDD A;  4IL7 A;  4Z07 A;  2FMD A;  2GNB A;  3LEM A;  2VQ0 A;  1S2K A;  5FZ1 A;  5L73 A;  3R6S A;  4CCC A;  2RM2 3;  4WM8 C;  1S0C A;  4GQ7 A;  4LIU A;  4XET A;  2P17 A;  5DDJ 2;  3KCY A;  1PM7 A;  3NW4 A;  1SLA A;  2RMU 2;  2K9Z A;  3U07 A;  1LGB A;  2BOI A;  3DPR B;  4N53 C;  2R16 A;  2ENR A;  3GZT B;  2ORX A;  3ORJ A;  5JR7 B;  1FYU A;  2EIC A;  2VZU A;  4H7M A;  3WW3 A;  4NN0 A;  4O7X A;  1W2A X;  3ATG A;  2HWB 1;  1OKO A;  1UY4 A;  3UES A;  4AE2 A;  1O8S A;  5FBJ A;  1UU5 A;  2VGD A;  3H3Z A;  3DUI A;  4JV4 A;  1SBD A;  1A8M A;  1XND A;  1JUH A;  5CBL A;  1NQJ A;  1QJF A;  4QPI B;  4FQZ A;  2DDU A;  4YNI A;  2R1D A;  4CDQ B;  4FXK B;  4CP1 A;  4QB6 A;  3APB A;  3WNL A;  4ORF A;  4AVA A;  4X6R B;  3LDR A;  3OGG A;  3N7L A;  4XDP A;  2YG0 A;  3T2Q A;  1L7Q A;  1Z7S 1;  4JRL A;  5KHG A;  1J3R A;  3NNJ A;  1DF0 A;  5EJZ B;  1HB2 A;  1O5U A;  4XMI A;  1PX3 A;  4O9G A;  4Y5S A;  5L19 A;  3PU8 A;  4MVT A;  5DZE A;  4HN0 A;  1BQP A;  3AK0 A;  4Q4X 2;  1DQ5 A;  3ZXD A;  3NV4 A;  2Y6L A;  3ES4 A;  4WZF A;  1RIT A;  1UIK A;  2CDP A;  1AR8 2;  1SFN A;  2QJV A;  2X29 A;  4XCB A;  3MO4 A;  3NL1 A;  4AQT A;  2IXK A;  2W9X A;  1VR3 A;  1IHM A;  4YZ2 A;  4CRQ A;  5HCA A;  4HN1 A;  4MYE A;  2VOX A;  1YQC A;  4DPN A;  2P3J A;  2HWF 2;  2AAC A;  2CAU A;  4PIX A;  4AED B;  4QX3 A;  1RUC 2;  2C0Z A;  4Y5Z 0;  2YV8 A;  5T5O A;  3KHC A;  1S2E A;  3A0N A;  5FZA A;  5I0D A;  3ENR A;  2EIE A;  4XBQ A;  4QXB A;  2QKD A;  1HN1 A;  1OOP B;  1UO9 A;  1AXK A;  2ZML A;  5GKA C;  3VHO A;  5FUP A;  1UN1 A;  1CAW B;  4QQO A;  4DEV A;  1X7N A;  4GA9 A;  1B09 A;  3AL6 A;  2GNM A;  3ILN A;  1AYN 1;  4QPW A;  3B00 A;  4XFI A;  2ZKN A;  4WVM A;  4Y1U A;  1GLH A;  1COV 2;  1RUI 3;  2PQQ A;  5CKQ A;  3NNM A;  4TLG A;  2X05 A;  3VBF A;  1R1Z A;  2V09 A;  4Q4V 3;  3JD7 2;  2DCZ A;  5D1I A;  2W91 A;  4DXS A;  5KHK A;  1QMJ A;  1W8F A;  1O8P A;  2TNF A;  4UI9 L;  5K4L A;  5LWB A;  1RUF 3;  1JZ4 A;  3OBT A;  4HKW A;  2FDI A;  4NID A;  3GJA A;  3AYD A;  1UW8 A;  3DN7 A;  2NM1 A;  3VBS B;  4LKE A;  1SFY A;  3URF A;  1QXJ A;  2HEW F;  4AHX A;  5A3O A;  2Q1Z B;  1D2Q A;  1OF4 A;  1K5M B;  3OGJ A;  4FPF A;  4IE6 A;  4PQ9 A;  1LOB A;  4NAM A;  1QKQ A;  4Q0V A;  5KXD A;  2WAO A;  4M0N A;  2VCM A;  4JHZ A;  4UYB A;  4N90 A;  5A7P A;  1ZBE 3;  3E97 A;  3DEC A;  4NWW A;  5BNP B;  4W6W A;  2EF6 A;  5D8A B;  2E51 A;  3UET A;  5CAZ A;  1WD3 A;  4CEW C;  4EWD A;  2JDA A;  2A7A A;  3ZSK A;  3SC7 X;  2WR9 A;  3U75 A;  2E7T A;  3LOB A;  4DNY A;  5CEH A;  5DUV A;  1CVN A;  4IEW A;  3P3P A;  4YZ3 A;  3VLB B;  3MIF A;  2WZ8 A;  3R05 A;  4RQP A;  3TYJ A;  2D3R A;  2BW8 A;  1UCX A;  1BHG A;  3IAQ A;  5SV5 A;  5LY2 A;  3OUH A;  3VB9 A;  3ZM8 A;  1VBA 1;  1RUJ 2;  4QGM A;  3AJZ A;  3GDB A;  3O14 A;  5LA2 A;  4Q0U A;  1QXR A;  4YFZ A;  3FFZ A;  3C2U A;  1BVP 1;  1UNB A;  3KQR A;  1J1L A;  2AGS A;  2V5D A;  4FPH A;  4XYX A;  3VDD C;  5B2G B;  1H30 A;  1Q8P A;  3ZSE A;  4KG8 A;  1U5X A;  3G6J B;  1WW7 A;  1UYX A;  1YNA A;  4JDN A;  5DAQ A;  3POJ A;  1NUK A;  3PUA A;  1VBC 1;  2I74 A;  3TWI A;  5IVB A;  5J7M A;  4AOC A;  3IBM A;  5JMO A;  2B45 X;  1DQ4 A;  3PVN A;  1TE1 B;  2RR1 3;  2TUN A;  4IE4 A;  4GKX A;  4QQL A;  4Y4Y A;  4ZU7 A;  2WT0 A;  1KGY A;  3R0R A;  4TN7 A;  1Y7B A;  1CR7 A;  4BDV B;  5FY9 A;  1RIN A;  2D40 A;  4BXS V;  4FTS A;  5FY7 A;  1OT5 A;  1O91 A;  3VDB A;  1VBD 2;  2WSU A;  4HKO A;  4IV3 C;  3AYE A;  3VZO A;  1GZC A;  3MLK A;  2EAA A;  1S4C A;  3RNS A;  4BE3 A;  1RIR A;  1F5J A;  3OOX A;  2VPV A;  1QJX 3;  4XFG A;  1RVF 1;  5FWE A;  5IT6 A;  1IPJ A;  5CB7 A;  3GZE A;  5KHJ A;  3QLQ A;  1APN A;  4ISR A;  1KJR A;  4KWJ A;  3JD7 3;  4LTA A;  4W6Y A;  3RWN A;  5DUW A;  1VB2 A;  3Q8B A;  2GC0 A;  2H6B A;  1LHW A;  3H7J A;  1REE A;  3BU7 A;  4CU9 A;  4YAR A;  4YSF A;  4QKF A;  3VN4 A;  1HQN A;  2NN8 A;  3ZFF C;  1C1F A;  1UXX X;  1H2K A;  2PN5 A;  1UZV A;  1HRI 2;  5FYS A;  1PIV 1;  2ILM A;  1JZ7 A;  3LEK A;  2WII B;  4QT6 A;  2ZHL A;  3SXW A;  1CJP A;  3IPV B;  1KRI A;  4QGN A;  3SCH A;  2VQU A;  1TG7 A;  1W6O A;  2NP0 A;  1IZ3 A;  4ZHN A;  1MZ6 A;  1L3J A;  4LPL A;  1US3 A;  4CTE A;  5FDB A;  4XQD A;  3AZW A;  1LU2 A;  1NOV A;  3CJI B;  3ZYH A;  2WS9 2;  1HV0 A;  5CA6 A;  4M3C A;  2CGN A;  3CZU A;  5GLT A;  3ZSL A;  3BTX A;  5BYN A;  2RS3 3;  2JXA A;  1R09 1;  3PUH A;  2ZOE B;  4XZP A;  3W59 A;  1QGL A;  2A3X A;  2C26 A;  4ZXE A;  2ARC A;  1LJ7 A;  2B5H A;  4QHZ A;  4BCU A;  4C1X A;  1EV1 3;  4CP9 B;  5FYM A;  5A70 A;  1UYP A;  5DG2 A;  1KQR A;  4MUV A;  4CP0 A;  3ZFG B;  2R06 3;  3AKQ A;  5G04 L;  2QQO A;  4M4P A;  2YGL A;  4PLN A;  2XDV A;  5FZ3 A;  4NVP A;  1NLS A;  3N9Q A;  3MV1 1;  2RHP A;  1BEV 1;  4XTM A;  4QGL A;  5JMC A;  5CZK A;  1RTV A;  2HWD 1;  5C4W A;  1H8T B;  3V64 A;  2CWM A;  2QQM A;  5EPA A;  3RMX A;  1HQW A;  2C9A A;  2GDF A;  1SLL A;  1F31 A;  1V6J A;  1XJA A;  2DUP A;  1MR5 A;  3EHK A;  1AR6 3;  3PLQ A;  4IGO A;  2XVL A;  4AVV A;  2Y0I A;  4N53 B;  1RUE 3;  4QDS A;  2J7M A;  2DVF A;  3U0Z A;  1GWL A;  4ZU4 A;  2PFW A;  3UJQ A;  3HQU A;  5F3I A;  4MXW A;  3ZKU A;  1JZ5 A;  3W5N A;  1VRH 3;  1GMM A;  3B69 A;  2EIB A;  4K9S A;  3I2H A;  3WSO A;  1YRZ A;  1DGR N;  1ZBA 3;  2J1A A;  3OCP A;  5A7N A;  4AVS A;  5JLV A;  4YVW A;  5CKN A;  1AVB A;  1ULE A;  4NUB A;  5C3O A;  1BLZ A;  1DDL A;  2BER A;  2IUW A;  3B94 A;  4V2W A;  3AKT A;  1YQ8 A;  2G9G A;  3NJY A;  3I4I A;  3ZX7 A;  3BIE A;  5LBF A;  2GMP A;  1IQA A;  4P02 B;  5CFD B;  3OJB A;  2WLQ A;  4CDW A;  1J3Q A;  5C3S A;  5I0S A;  2OII A;  5A3W A;  2JD9 A;  4FI9 A;  3OD0 A;  3GJB A;  4AI1 A;  2CYF A;  1FPN 1;  3AKP A;  2GC1 A;  5FPX A;  2CU5 A;  3HN1 A;  3QH7 A;  1QJY 1;  3LOI A;  5JIA A;  5D21 A;  5IUQ A;  2LRP A;  2XWB B;  2ZAB A;  3KV4 A;  5FO9 B;  1F5F A;  4LK6 A;  4QXH A;  4JX0 A;  5A6Y A;  4QPI A;  2I07 B;  4CDQ A;  2G9Z A;  5C8C C;  1PM4 A;  1RUG 2;  1YC6 1;  3C7E A;  1F35 A;  3BVC A;  4FFF A;  5KWR A;  1PO2 3;  4QXK A;  1T2X A;  3O5S A;  2B46 X;  5AC9 2;  4LBQ D;  3VHN A;  3J8F 2;  2WA3 A;  2WFF 1;  3SH3 A;  1UIJ A;  3BOW A;  2P5B A;  3TEW A;  2ET1 A;  3UJO A;  5C71 A;  4PF1 A;  3SIS A;  2QCS B;  1GFF 2;  4W8J A;  3S5A A;  4LA2 A;  4B3N A;  3RFR A;  1MZE A;  1F9K A;  1KDM A;  1QQP 3;  3JU9 A;  3Q8E A;  2K0G A;  2WKK A;  3AL5 A;  3EO6 A;  4XQ4 A;  4BM8 A;  2PQS A;  1RMU 1;  2RM2 1;  4XUP A;  2D6L X;  2XBO 1;  1WCS A;  1TMF 1;  3A22 A;  3I3Q A;  4OZX A;  3TN9 1;  5EIY B;  3JCI A;  4Z82 A;  1U12 A;  2VUA A;  2AZ5 A;  2D6N A;  1PVC 3;  1L7R A;  1DLL A;  1YO8 A;  2QQW A;  4YRD A;  5FXX A;  4AED A;  4XAB A;  1VMJ A;  3VKO A;  4BJ0 A;  1NY7 1;  1YQ6 A;  2FBE A;  3KT4 A;  4E9K A;  4XAC A;  4FTB A;  2ZA9 A;  5LK7 B;  1OOP A;  4RS5 B;  4OHY A;  1CAW A;  1DQ2 A;  2RG4 A;  3ZYG A;  4JRA A;  2D6O X;  2VOV A;  3GHN A;  4UW3 A;  1AR9 1;  4CU7 A;  5A32 B;  5C3P A;  1YIF A;  3K75 B;  3H7Y A;  5DAP A;  4XCA A;  4PIZ A;  5FKB A;  1XSQ A;  2LM3 A;  4GUL A;  4IEZ A;  4CEW B;  1XNC A;  2O1Q A;  3FN9 A;  2VH9 A;  4L11 A;  2BP6 A;  1D7P M;  5C3R A;  1UQX A;  3AZZ A;  3N7K A;  5I8T A;  4XQW A;  1VIW B;  3VBS A;  1QJU 1;  2B9V A;  4LBL A;  3LEI A;  4L99 A;  4PBP A;  2CHH A;  3FC0 A;  4NO4 A;  1AJO A;  4M01 A;  4GMP 0;  1K5M A;  3BN6 A;  1E57 A;  1WUV A;  3DKW A;  4PT6 A;  4Q0S A;  5IFP A;  2ZGN A;  3TNQ A;  4XJU A;  2YFU A;  1UZ0 A;  1GP5 A;  1ND2 B;  1W28 A;  1K45 A;  4OHW A;  5C4W C;  3SLI A;  2YMZ A;  5BNN C;  3W58 A;  2V72 A;  1JBC A;  4LMF A;  1BBT 1;  5ACA 2;  1R1A 3;  1NYW A;  5GLV A;  4CXW A;  4YW4 A;  2HYX A;  3RZL A;  2XML A;  3MIG A;  5FOJ B;  5B4N A;  1RHI 1;  2W87 A;  2VOW A;  2VUD A;  3D4K A;  5D2A A;  2WYS A;  4XJZ A;  3AP6 A;  2XQX A;  4ET7 A;  1RC6 A;  2QQI A;  1BMV 1;  4LBQ A;  4OI4 A;  3OD4 A;  4XW3 A;  2FCT A;  1JZ6 A;  4YWA A;  2EXI A;  2X5I C;  5FXV A;  4ZKT B;  3BAL A;  2WAB A;  1AYN 3;  4JDO A;  3I3M A;  2FMY A;  5JSO A;  4RFT 0;  4IEY A;  2FDK A;  2ARB A;  3LKJ A;  3RZM A;  2R04 2;  1KJL A;  3AYC A;  3WV6 A;  5M0T A;  1WWY A;  4RHV 2;  1RUD 3;  2P3K A;  1JYV A;  1NLQ A;  3A7Q A;  1GZT A;  1UXZ A;  1DZQ A;  4M4R A;  1QOO A;  3GHM A;  3POY A;  5DDJ 1;  3LFI A;  5EWS A;  3ZXG A;  3DPR C;  1JW6 A;  3LD8 A;  3O0X A;  2RMU 1;  2ES3 A;  2HBT A;  3FBY A;  5F5C A;  4B7K A;  3H3L A;  1XNA A;  3N36 A;  3NAP B;  1OUR A;  2VW2 A;  3HD8 B;  3N9L A;  1K12 A;  1LOE A;  3M4F A;  2DVA A;  2AR6 A;  2ZGO A;  3V0A B;  2Z42 A;  1N3Q A;  5C33 A;  1JMU B;  1QDC A;  3QCW A;  4H14 A;  4C91 A;  4D0Q A;  1JYN A;  1GIC A;  4LHS A;  5GZE A;  5F8P A;  2XJQ A;  2G1M A;  3NV1 A;  4JKL A;  4CDQ C;  3BOD A;  3M3Q A;  4OUM A;  1LEN A;  2Y38 A;  4OHX A;  2YUE A;  3CIH A;  4COU A;  3RYK A;  5FZ4 A;  4YGE A;  3ZIX A;  3VKM A;  5F39 A;  4MGI E;  1JHJ A;  3FLR A;  2KA3 A;  3SH4 A;  4LLF A;  3MIH A;  2HLE A;  1V6N A;  3GBF A;  3SIT A;  2XXZ A;  3M3C A;  3FZ3 A;  3PMS A;  4Q4X 1;  1VBA 3;  1AR8 1;  2BVV A;  4BME A;  2C24 A;  2ZMK A;  2NMN A;  3H3U A;  3IPV A;  4URT A;  1WME A;  1LOD A;  1MS5 A;  2D43 A;  2Y6K A;  2VM9 A;  4I30 A;  4N7U A;  3RSJ A;  3QBQ A;  1UZY A;  2XGX A;  4WM7 C;  2CGP A;  1NCQ C;  2WO1 A;  4AED C;  4TZD A;  1W2O A;  5IK4 A;  2HWF 1;  3CJI A;  1RUC 1;  2IFW A;  1WCD J;  1VBC 3;  4D8M A;  3UT0 A;  5FY8 A;  1OOP C;  3S30 A;  4DIN B;  1LEC A;  2Y6H A;  3Q8C A;  1SG3 A;  3ZYI B;  2D97 A;  1GR3 A;  2BFU S;  2P34 A;  2J1T A;  1OQD A;  2JDP A;  4A3X A;  2V4A A;  2VCA A;  1FMD 2;  1H2N A;  4KU7 A;  3WNX A;  1X8E A;  2RS5 2;  1COV 1;  2XHK A;  3MBW A;  2PTM A;  4PLO A;  2Z5W A;  1C5I A;  1W39 A;  3ZFG A;  3RZG A;  3JD7 1;  4BU2 A;  4C8D A;  4DOU A;  4TLF A;  2Z2S B;  1UX6 A;  5LW9 A;  3M7A A;  1RVF 3;  1O4Y A;  4CUB A;  5JIU A;  2JDY A;  4JKK A;  2W46 A;  3FLT A;  3PVB B;  4JGZ C;  4MGQ A;  4XDO A;  4Y22 B;  3VBS C;  2ZTN A;  4CUA A;  2JEC A;  1RUH 2;  4N7I A;  1DBN A;  1F4A A;  1O4T A;  5FYZ A;  4XMA A;  1YI9 A;  4EV0 A;  5FO8 B;  3WP5 A;  2P1B A;  1H8T A;  3VD5 A;  4SLI A;  5JXI A;  1ZZ6 A;  4FPY A;  5HI0 A;  1J59 A;  1RXG A;  3I2J A;  4XTP A;  1H4G A;  1PIV 3;  1UKR A;  2E33 A;  1Q8V A;  2K2S A;  2IZW A;  2UY8 A;  3HEI A;  4WM8 A;  1JS9 A;  5BNP C;  2WFP A;  3UKV A;  1CX4 A;  2GAL A;  5D8A C;  3A4U A;  5E6H A;  2R1B A;  4DQA A;  4N53 A;  1FV2 A;  1TNF A;  2J42 A;  4K8R B;  3T3Y A;  3X29 B;  2RJ2 A;  4OHV A;  1ENQ A;  2KD7 A;  4EQV A;  5K8S A;  4IEO A;  2DUO A;  4UOJ A;  5CAD A;  4L2N A;  5FZG A;  3LE0 A;  3MZH A;  2RJL A;  2FDG A;  1CAV B;  1SFP A;  1QH6 A;  1VBB 3;  2C4X A;  4K6B A;  4PI2 A;  5FY4 A;  4COV A;  3B02 A;  1D4V B;  4H7L A;  4FCA A;  1MQT B;  3S0M A;  3ACG A;  1R09 3;  1W2U A;  3KVA A;  4CU8 A;  1H8V A;  3TRS B;  3WCS A;  1RUJ 1;  1Q8S A;  3HBK A;  2B39 A;  2ZEX A;  5EXO A;  1ZRF A;  2OPW A;  3S5Q A;  2GAU A;  3POI A;  1MS1 A;  1SPP B;  4I0B A;  4JGY C;  5CFD A;  5JOW A;  2D6M A;  5FP8 A;  1MZ5 A;  4MHR A;  4N8M A;  1XYP A;  4Q1R A;  2VNG A;  4LHL A;  4XAA A;  1W05 A;  5IAX A;  1MS9 A;  2ZEW A;  3I59 B;  3DYO A;  3TOJ A;  5FZ0 A;  1G9B A;  4OQ8 A;  1HIX A;  4MSV A;  1JZ2 A;  2YDE A;  4LR4 A;  1BEV 3;  5EHD A;  4N43 C;  1NZI A;  1GOG A;  2HWD 3;  1G6N A;  3RRD A;  5CG9 A;  4BQY A;  5ERL A;  1A8D A;  1VBD 1;  4BIS A;  4EE2 A;  5FRE A;  3ES1 A;  1JOP A;  3N4M A;  1VMH A;  2ZX0 A;  1RUE 1;  2J1E A;  2XON A;  4LOT A;  1NLR A;  2EIG A;  2BBV A;  5FMO S;  2GH2 A;  1VBE 2;  2WJS A;  4OUE A;  1C8M 3;  5FR3 A;  1ENX A;  5FO7 B;  4XJ9 A;  1JOB A;  3BKZ A;  4RGK A;  3JQX A;  5J98 B;  2OVU A;  3PU3 A;  1DU3 D;  1UZW A;  3ZN6 B;  1WLD A;  3MPB A;  3B9I A;  1QF3 A;  2R0H A;  1MEC 2;  1RUH 3;  4XFC A;  2WN3 A;  3WP6 A;  1HRI 1;  4GZ9 A;  3VBU C;  4UW5 A;  1GNY A;  2QDR A;  2XVK A;  4ZZ5 A;  3OY8 B;  3M1H A;  1TEI A;  2WQ4 A;  3KLS A;  4X8P A;  3V56 A;  3OPZ A;  2QQL A;  4FOV A;  1IOA A;  3E6D A;  3O12 A;  4UFL A;  3AZY A;  3ZN4 A;  3HT2 A;  1OFN A;  5DUX A;  3D8C A;  3CJI C;  4RS5 A;  1GP6 A;  1DGW A;  4QPY A;  1BYH A;  1W04 A;  4I3G A;  2UYA A;  2WS9 1;  5LRS A;  4NPM A;  3J7H A;  4BWO A;  1FPN 3;  5BNN B;  5A32 A;  2VE1 A;  2N7G A;  5CVR A;  2QBX A;  1QJY 3;  3WY6 A;  4Q8L A;  5IVV A;  4FFG A;  2MNG A;  1UY3 A;  1YI7 A;  4CEW A;  4UW6 A;  3IT8 A;  3BTZ A;  1CPN A;  5FYB A;  1H9P A;  4CU6 A;  2VMI A;  3MF9 A;  4IEP A;  1BVV A;  2WZR 2;  1NQD A;  2BZD A;  3MIE A;  4TYS A;  3IDE A;  4BHP A;  2Y64 A;  3WD5 A;  4L8Q A;  3R4U A;  3IMM A;  2AC1 A;  3GNE A;  1AJK A;  2YHJ A;  2WFF 3;  5T54 A;  2X5I B;  3MUZ 1;  4CPB A;  3I2O A;  1UMH A;  1ALY A;  2PHU A;  1ND2 A;  4XVH A;  4KGG A;  2FDJ A;  4AF9 A;  3VV1 A;  1H8T C;  4HSL A;  4IE5 A;  2ZGQ A;  2A3Y A;  3K77 A;  4OYU A;  4QPG B;  1PVC 1;  5JI7 A;  3MW3 A;  1HRV 2;  1WCK A;  1RMU 3;  3VGI A;  3TN9 3;  1VP6 A;  4IEU A;  2XBO 3;  5A3N A;  1TMF 3;  2VMH A;  1LU1 A;  4UFH A;  4AAX A;  1A6C A;  2CY6 A;  1BKZ A;  1JU4 A;  1W06 A;  2E53 A;  1H2M A;  4NRO A;  2GH8 A;  1SLI A;  5FZE A;  1ZZB A;  1N47 A;  3VD9 A;  2YPJ A;  4NIG A;  4V1P A;  2W1U A;  3KMH A;  1OI6 A;  4I3P A;  4IV3 A;  5FPZ A;  5T55 A;  4A7Z A;  4FBF A;  1JYT A;  3GXU A;  4JDM A;  1TQ5 A;  1KFU L;  4GXL A;  1AR9 3;  1S0D A;  2ZCW A;  3CLP A;  1S0G A;  1PO1 2;  1YLL A;  4J25 A;  4S2G A;  5FP4 A;  1E5H A;  4YPJ A;  5FV3 A;  2YRO A;  3FWE A;  2UU8 A;  4AR2 A;  1W9S A;  3R4S A;  3U14 A;  1RL3 A;  3IZO A;  4D3W A;  3DXU A;  2WT1 A;  5DN2 A;  4RN5 A;  1POQ A;  5CFD C;  2ZX2 A;  1V6O A;  2W2I A;  3UGF A;  1W6P B;  3VHR A;  1PNF A;  2VZS A;  4Y1V A;  1V9U 2;  5J1X A;  1QJU 3;  2WWS A;  3NJX A;  4QQ2 A;  4PIY A;  2ZX3 A;  3UGH A;  1OUS A;  4NWV A;  3ZFF A;  2VVE A;  4ATF A;  4CA9 A;  2HH9 A;  4YM1 A;  4GAL A;  3NAP A;  1UY1 A;  4IET A;  1N1V A;  1V0A A;  5FPA A;  3KZ4 C;  1R1A 1;  1MS0 A;  3KCC A;  3V0A A;  4O61 A;  1X9P A;  1W9Y A;  3OUJ A;  3OBA A;  3NRU A;  1H0B A;  3FHA A;  1KIT A;  5E89 A;  1VAK A;  5FYV A;  1BBT 3;  1ACC A;  4PI0 A;  4WM7 B;  5A7S A;  2YC4 A;  5BNQ A;  4XXA A;  3U4X A;  1NCQ B;  2OUJ A;  3O1T A;  3ZR6 A;  1RUG 1;  1OFS A;  4A44 A;  4K7J A;  1W9W A;  1RHI 3;  3AJY A;  3BIW E;  3WF1 A;  4MXV A;  3WR0 A;  2QNK A;  2RS1 2;  3J8F 1;  4PDW C;  1LOC A;  2VUJ A;  1V6L A;  4HZF A;  3INA A;  3T2P A;  4ES9 A;  1O3S A;  3KD4 A;  4K40 A;  4NE9 A;  5FPL A;  3W20 A;  4JQT A;  4Q27 A;  3MHZ A;  3ZLI A;  5J48 A;  2PHX A;  4WVV A;  3AYA A;  3JB4 C;  4Q8K A;  5ABJ B;  1RUD 1;  1NE6 A;  1SDD B;  2Y6J A;  3IKW A;  1FOD 2;  2P2K A;  4CE8 A;  3NNF A;  1YJL A;  3BGA A;  4A2U A;  1W8T A;  3FUO A;  3P1I A;  3WLU A;  1WZX A;  2WN2 A;  4KH9 A;  3SMH A;  4JGZ B;  5DMY A;  2JKB A;  3PIJ A;  2XJU A;  3T0A A;  1HRV 3;  1JOJ A;  1HB4 A;  3SCF A;  1DFQ A;  1MS8 A;  1A3K A;  5DDJ 3;  3D0J A;  2HKX A;  3POE A;  1SEF A;  1QHD A;  1AR7 2;  1X8M A;  3MFC A;  2J1U A;  4WVW A;  3SQO A;  4RS5 C;  1AXY A;  2RMU 3;  2ZAA A;  3ZXK A;  3THC A;  1ODM A;  1UZZ A;  5APA A;  1ODN A;  3GBW A;  3J9S A;  4N9I A;  3RQ0 A;  3K48 A;  1MS3 A;  2ETE A;  1W8U A;  3D3A A;  3N35 A;  2ZAH A;  3F2Z A;  2R6Q A;  2HYK A;  2VZ1 A;  4GB3 2;  2Q8C A;  2W47 A;  4Z2W A;  2VNO A;  4XAE A;  4NRQ A;  3UKT A;  3WOG A;  3AMH A;  1IKQ A;  3POF A;  4Y22 A;  2JEM A;  3RG0 A;  2CAV A;  2GSY A;  1NX9 A;  4DO0 A;  2ZEZ A;  3PHM A;  2QVS B;  4JCK A;  2B8M A;  4LHK A;  3ROU A;  2WL1 A;  4LKF A;  3SH5 A;  5KHH A;  1JOD A;  2BNN A;  2XR4 A;  3I3D A;  1YWK A;  2W92 A;  2VAU A;  2WNU C;  3E1F 1;  2QZ2 A;  3GAL A;  3MFA A;  4ZXK A;  1ND2 C;  4L97 A;  1ZRC A;  2XUM A;  2X8K A;  3HBZ A;  4HXC A;  2A5Z A;  2DUQ A;  4Q4X 3;  5LA0 A;  1ZVF A;  1AR8 3;  2AUY A;  2YBP A;  5CU1 A;  4KU8 A;  2H0B A;  4JGY B;  1EYB A;  3T4H B;  5ACA 1;  2WUH A;  5IK5 A;  5F7U A;  1HN0 A;  4QQP A;  5FZM A;  4Z8B A;  4LO7 A;  4QQH A;  1N3P A;  4HFS A;  3ZXJ A;  2WNV B;  1DYP A;  3NO8 A;  3PME A;  5DAB A;  4P14 A;  1XPW A;  4QD2 A;  2XH6 A;  2HWF 3;  1G7Y A;  4XUR A;  3T30 A;  4BA6 A;  1RUC 3;  3NJV A;  5B4X A;  5FLH A;  3RZZ A;  3GGL A;  4N43 B;  2VZO A;  1CAV A;  5LB6 A;  1T6B X;  2G19 A;  1OQE A;  4I02 A;  1WW4 A;  1GKB A;  4AHY A;  1CON A;  5A33 B;  1XE7 A;  3QD6 A;  2AEZ A;  3USS A;  1AYM 2;  1O7F A;  1YCI A;  2YB7 A;  4MG2 A;  2OQ6 A;  4DS0 A;  5IK7 A;  3FHQ A;  5I0R A;  1UMI A;  1YQ2 A;  4FOY A;  5A6Z A;  4R9B A;  5BV6 A;  1COV 3;  4LBK A;  1SPP A;  5SV8 A;  1XNK A;  3I2G A;  4AFM A;  3QOP A;  4BIF A;  5F3C A;  1OA4 A;  2XJT A;  2R04 1;  2W52 A;  4HVO A;  3CKH A;  3AXD A;  3ZVX A;  4RHV 1;  4LBO A;  2VTF A;  3DL3 A;  5EJ1 B;  1G9A A;  1WKY A;  2XG3 A;  5EYY A;  2A75 A;  4CCL A;  1W8W A;  4HKL A;  5KC5 A;  3TEY A;  2XB6 C;  1UU4 A;  2ZS6 B;  2HWE 2;  3ZDV A;  2VZ3 A;  3PJQ A;  4EZH A;  3I59 A;  3KT7 A;  2Q4S A;  1PK6 B;  4QM8 A;  4NHY A;  5A1L A;  3IAP A;  3HOB A;  3MLL A;  3ZSM A;  3NAP C;  5GLZ A;  2BFU L;  2RJK A;  1XOY A;  1DCS A;  5FYH A;  4QX2 A;  3AVR A;  2OS2 A;  3S7I A;  3VBU B;  4MGT A;  1GYK A;  3ST7 A;  2D3S A;  2ZPX A;  3RMY A;  2OUH A;  4URA A;  5A6Q A;  3CHX A;  4OQ9 A;  2ATF A;  3ZFE B;  4KQ7 A;  4AEK A;  4HG6 B;  3SHR A;  2AEN A;  1MAC A;  2XHN A;  3BTY A;  3B5L B;  5HCF A;  3LDK A;  4PQQ A;  4IEV A;  1STM A;  4Y26 A;  5IWF A;  4ZY9 A;  1VBB 1;  3CO2 A;  5T50 A;  5JXH A;  1LCL A;  5F9T A;  4MGZ E;  1US2 A;  4XHX A;  3U37 A;  2Y60 A;  2B42 B;  2IWG B;  1SMV A;  4Y24 A;  2VMC A;  3JBG 2;  3WG1 A;  1WCU A;  2D98 A;  1WD4 A;  3LIG A;  3AP4 A;  5JAX A;  2X10 A;  4XDQ A;  4B4P A;  3WDU A;  1GQG A;  2PEL A;  3OY8 A;  4AEM A;  1CJD A;  1RUJ 3;  1HJF A;  3S57 A;  3BUC A;  2W0X A;  4COW A;  3POG A;  4P9W A;  3OUI A;  1Y3T A;  4AGV A;  5C8W A;  5FY1 A;  1DG6 A;  5C6C A;  4IV1 B;  3VBR B;  2ZX1 A;  1QJZ A;  3LCP A;  3VBO C;  3ZXE A;  5BNN A;  4EZ4 A;  1K42 A;  3KV5 A;  3DV8 A;  1MZF A;  5KC6 A;  1JXN A;  2GMM A;  5L7O B;  2VME A;  3VL9 A;  5FYC A;  4NPR A;  3VBH C;  1J3P A;  2IXH A;  2QQK A;  1URX A;  4Q0Q A;  4YW7 A;  3D6E A;  4JTN A;  1FMD 1;  4FPL A;  1VBD 3;  1C8M 1;  2EXK A;  4CCO A;  3PUQ A;  2L9L A;  4GIQ A;  5A7W B;  3J4U H;  3WP4 A;  1GNZ A;  1POV 1;  2TBV A;  4E2G A;  3IDB B;  1SDW A;  5L9B A;  1CAX B;  1QY4 A;  3OPW A;  3C7H A;  1CD3 G;  1XC6 A;  3WNO A;  2VQT A;  4XIK A;  1F8V A;  1ZA7 A;  3I8T A;  3HT1 A;  2X5I A;  2IVI B;  2MEV 2;  5GZC A;  3OPT A;  1RUH 1;  2OX0 A;  3CU7 A;  2BEO A;  4YM0 A;  4P9X A;  5CFC C;  4FOW A;  4BLJ A;  3VZM A;  1A34 A;  1CZS A;  4AVC A;  1FNZ A;  2JDN A;  1NKG A;  1HRI 3;  1W0P A;  1YJK A;  3GYD A;  1BJQ A;  5CYY A;  2VOT A;  3RZJ A;  4B8E A;  2ERF A;  3HN3 A;  4E27 A;  1O4Z A;  2DCJ A;  2ZMN A;  1GZW B;  4XFF A;  1E5I A;  4YW2 A;  2HWB 2;  2HWC 2;  3DPR A;  4QWN A;  1HB1 A;  2A71 A;  1CX1 A;  4WV8 A;  4QB1 A;  4B1M A;  4FQ4 A;  2PAE A;  4OLL A;  1W6N B;  3HWJ A;  3WXP A;  5FMC A;  4K20 A;  3RGB A;  1X36 A;  4G3Y C;  5LBC A;  3W21 A;  2DFC A;  4C0H A;  4EN7 B;  3NST A;  1UOF A;  1XQN A;  2WS9 3;  2XJP A;  5GM0 A;  3U4S A;  1MQT C;  3M8L A;  3MGU A;  1OA3 A;  4HVQ A;  5A3P A;  2H0V A;  1LOF C;  3KT1 A;  2XLF A;  1UOJ A;  3LEG A;  4A3Z A;  1EAH 2;  4E2S A;  2R07 2;  3GBG A;  4UBH A;  2GN3 A;  5IVJ A;  3L2H A;  1O59 A;  3R4D B;  4XJW A;  1UOG A;  1W6P A;  2Q0A A;  4PDW B;  1ULO A;  2UYB A;  4QX0 A;  5FJK A;  3FE5 A;  1AL2 2;  2ORZ A;  4HBN A;  4KG0 A;  1GWM A;  5DAV A;  3IN9 A;  3THD A;  3C7O A;  1D0H A;  2VJX A;  3KGZ A;  4FPE A;  5EZW A;  4AI0 A;  5A3M A;  5JZG B;  3O1U A;  4FPK A;  2JE7 A;  5C9A B;  2ARA A;  3WQ7 A;  1GOH A;  2DBN A;  2QQJ A;  1H1M A;  1WCQ A;  4WM7 A;  4LXL A;  1V70 A;  5HPO A;  1XB9 A;  2E32 A;  2QQN A;  1NCQ A;  5EV7 A;  5H9R A;  1W0N A;  3ZN5 A;  1H2L A;  1PGL 2;  1UX7 A;  4FXG B;  5E16 A;  4S2H A;  3K4A A;  3WVJ A;  4XJA A;  1DZT A;  2P6H A;  3V0B B;  1VBE 1;  2PHT A;  1OD5 A;  5C5U A;  1CN1 A;  1N3O A;  3IIA A;  4XBL A;  5IAV A;  2J1R A;  2YXS A;  2RVA A;  3D82 A;  2D5F A;  2DVB A;  3UGG A;  3DEM A;  3U11 A;  1GAN A;  3NJZ A;  1WLC A;  5K0U B;  4DXR A;  3O1V A;  1UY0 A;  4J1X A;  1MEC 1;  5ABJ A;  1OH4 A;  4FAG A;  3WF3 A;  3I49 A;  1D4M 2;  3AZX A;  2ZAC A;  3SKV A;  2JKX A;  3UYJ A;  1YFX A;  3C7F A;  1KDK A;  1H1I A;  1PX4 A;  4JGZ A;  3MW4 A;  1H4H A;  2VZT A;  2WNE A;  1LR5 A;  4AFB A;  1T6G C;  1FXZ A;  1FNY A;  1TNR A;  3E5Q A;  4IW3 A;  4OMC A;  3FLP A;  3ZPY A;  4OI1 A;  3MIB A;  3HPN A;  4RA0 A;  1SQ4 A;  2JIC A;  2WNU B;  2UWA A;  2VD7 A;  5E88 A;  2RDN A;  2BWC A;  1OLM A;  2VCC A;  1DGW X;  1FT9 A;  3O0V A;  3VHP A;  5LEJ A;  5FZK A;  1V6M A;  5BNP A;  2V4V A;  3G7D A;  4YGD A;  4EN8 B;  2Y8K A;  5D8A A;  4CXX A;  2ZJC A;  1W0O A;  2I45 A;  4K21 A;  3VL8 A;  2JX9 A;  3WDV A;  2DWR A;  1ZZC A;  3UK9 A;  1HXS 2;  2YBK A;  2WZR 1;  5C70 A;  1RUG 3;  4DUX A;  4DY5 A;  2XKP A;  3TEZ A;  1I1E A;  4JZR A;  4CCM A;  4NHX A;  1XE0 A;  2I2S A;  5AC9 3;  3J8F 3;  4EN0 A;  3KVB A;  5A1F A;  4E8D A;  2YFZ A;  4Y1X A;  1PMH X;  1HQL A;  1JU3 A;  5A3U A;  1KS4 A;  3HJR A;  3ZO0 B;  2XOM A;  1DP0 A;  4MH0 E;  1Q56 A;  4QPG C;  1LGN A;  5GJ6 A;  3WG2 A;  5FWJ A;  4JGY A;  1NCR C;  1PNG A;  4XIO A;  1O3Q A;  1HRV 1;  3ASI A;  2BGP A;  2Z69 A;  4HL0 A;  4ZS3 A;  5LZ6 A;  2D6K A;  2P37 A;  2VW0 A;  3VZJ A;  3BPS A;  4C1W A;  2CNA A;  4CCD A;  1QEX A;  5C7G A;  2ZXQ A;  5FFO C;  1YFW A;  3AP7 A;  1UPI A;  1J83 A;  3H0O A;  2E63 A;  3LGR A;  4GH4 C;  4OCT A;  4R4X A;  4G4F A;  1ULG A;  2GC2 A;  3KHB A;  2Q8D A;  3WUD A;  4K8F A;  5FCC A;  4N43 A;  4FFH A;  3DF0 A;  2RE9 A;  2O0O A;  3WCR A;  1Q5O A;  4B29 A;  4DUW A;  1R64 A;  1SAC A;  1DQ1 A;  4LO4 B;  2PLV 2;  1GQH A;  2MHF A;  4KBZ A;  3WG3 A;  4B4R A;  1LHO A;  2YZ4 A;  1VRB A;  5FYT A;  3U10 A;  1PO1 1;  1VB4 A;  4O65 A;  4QX7 A;  4XFH A;  4XUQ A;  1G8W A;  3OYW B;  3I3B A;  4HMZ A;  3VZK A;  4AHW A;  2DTY A;  1UYZ A;  1NAE A;  3N7J A;  1U0A A;  4ZU5 A;  2BPA 2;  2HEV F;  5FMD A;  5T5J A;  3AP5 A;  3LF7 A;  3OGV A;  3ETQ A;  3AZV A;  2JB4 A;  1V9U 1;  1MPX A;  1VMF A;  3NMB A;  1ND3 B;  3UNP A;  4HSJ A;  3VBU A;  1WLW A;  3E5X A;  3KB5 A;  3VKF C;  5KXB A;  3CMG A;  1GNH A;  2Z4F A;  3IWZ A;  3TEX A;  3E6B A;  1UWW A;  3PVO A;  3ZFE A;  3ZYP A;  1OLR A;  4NAO A;  3O0W A;  1D2S A;  2ARE A;  4YW1 A;  1POV 0;  4PCR A;  2V73 A;  3B01 A;  5ACA 3;  5GZG A;  4W6X A;  2RDS A;  3LSD A;  4P9Y A;  1HLC A;  5EQU A;  3UKN A;  3WW1 A;  5JUV A;  4AI2 A;  2BQP A;  2DV9 A;  4QB2 A;  3WT3 A;  2VZP A;  4BMB A;  1ULC A;  3VBO B;  1SLC A;  1OPM A;  4BQ3 A;  3OEA A;  3MLJ A;  2SBA A;  1AX1 A;  4WVM B;  1MVE A;  5IJR A;  2RS1 1;  1PMI A;  1B35 C;  3OG2 A;  3NNG A;  3VBH B;  4R9A A;  4TTG A;  1XRU A;  3WNP A;  1J58 A;  2P3Y A;  4L92 A;  1YFU A;  1Z0H A;  3TBD A;  1UOB A;  4CP9 A;  3ACF A;  1QWR A;  2C9K A;  3L2Y A;  3T4V A;  4FPJ A;  5ABJ C;  1MS4 A;  2YC2 A;  1SCR A;  3KF5 A;  4FOQ A;  1D0G A;  4AK3 A;  1FOD 1;  1JUI A;  2VU9 A;  1S1A A;  3O1R A;  5E1R A;  2ZGT A;  4UBG A;  4NIH A;  1N1S A;  2R04 3;  4NHK A;  5FUN A;  4RHV 3;  2W1W A;  1Q3E A;  4RGA A;  3IMN A;  4IV1 A;  2X53 S;  3VBR A;  4E2Q A;  3RPQ A;  1ZX5 A;  4FPO B;  4WBB A;  5CFC B;  1IS4 A;  1LUL A;  4LQR A;  1IGO A;  3AFG A;  3ACL A;  4HOO A;  1ASJ 2;  3LZZ A;  4ES8 A;  2J1S A;  3LA3 A;  2D5H A;  4ZON A;  4MGK E;  4DRR A;  4UWD A;  5HXV A;  1PHM A;  1ZZ9 A;  2AH2 A;  4ARY A;  5DAX A;  2BRT A;  2HEY F;  2W39 A;  5FY5 A;  5LY1 A;  3PTY A;  2DUR A;  4DY3 A;  5A7W A;  3TAY A;  4QKN A;  3CBN A;  5A3L A;  4GB3 1;  2WAA A;  5F6L B;  1K5J A;  5A1A A;  4YLZ A;  5KHI A;  1W8O A;  1QNW A;  2ADD A;  1XYN A;  1LHN A;  4U36 A;  4Y20 B;  1TME 2;  2ZHM A;  3RI8 A;  4RQP B;  4DEQ A;  4AL9 A;  4XUO A;  4AEJ A;  1CGP A;  1V00 A;  4RD7 A;  4V2V A;  5IAT A;  3QAC A;  3VZN A;  4IGP A;  3BI3 A;  5CIS A;  2LW8 A;  1BZW A;  2Z79 A;  2WWJ A;  2ZGR A;  3NVC A;  3P6B A;  1CWP A;  4Q26 A;  5FZ6 A;  3GZU C;  4OMD A;  2AEY A;  2JJ6 A;  4AZZ A;  3DYP A;  4AFA A;  1OD3 A;  1R08 2;  2DF7 A;  5LRR A;  4LEJ A;  4AGG A;  3PDQ A;  1WGP A;  5IVY A;  4XPV A;  1OHF A;  3KM5 A;  5FQ0 B;  4HT1 T;  4QX5 A;  2R0F A;  2P6C A;  1XE8 A;  3CQO A;  3LIH A;  4D6Q A;  5FZO B;  1LAJ A;  3KV6 A;  2WNV C;  4BPZ A;  4KWU A;  3EYP A;  1CES A;  4UFI A;  4IQP A;  5FP9 A;  2EXH A;  5FY0 A;  3RDI A;  1W6N A;  4IND A;  3ZYF A;  4AWD A;  4DUV A;  3B9C A;  2CL2 A;  3AFK A;  4E4D X;  3OEB A;  1OVS A;  4Q29 A;  2ZZJ A;  4ISQ A;  4H3W A;  1QOS A;  3H8O A;  2UWC A;  4ATE A;  4CDU C;  4A7Y A;  2VR4 A;  1A78 A;  3I7D A;  3SEP A;  4K1Z A;  5LAS A;  5FZD A;  2FDF A;  1DIW A;  1IS5 A;  1AYM 1;  4QU1 A;  1FMD 3;  2RS5 3;  4X6Q B;  2WZP P;  2DTW A;  4R9C A;  1ENS A;  1POV 3;  1JYI A;  3WF4 A;  3MUY 1;  4PDW A;  2QQU A;  5A80 A;  2B4K A;  2BUK A;  2JDH A;  3SNM A;  1GWK A;  5DG1 A;  1PK6 C;  2E26 A;  2HWE 1;  1F2N A;  3VD3 A;  2VC9 A;  1LTE A;  2PYT A;  2VZQ A;  3WP3 A;  3MYX A;  2R7E B;  3WNM A;  2E7Q A;  1XSR A;  2Y33 A;  4XEZ A;  5LBE A;  1W9F A;  3V65 A;  1WA4 A;  2VUC A;  5I8S A;  1VJ2 A;  2NQY A;  2DCY A;  3ZFE C;  3ZMO A;  4BXF A;  5F5I A;  4S2D A;  4HLT A;  2E6V A;  4E4S A;  4M3C F;  3N9M A;  4J1W A;  3OBZ A;  1C28 A;  4GWM A;  5FLJ A;  1HJG A;  4CYD A;  3V0B A;  3POW A;  2YYO A;  1DYO A;  1HV1 A;  3PTR B;  5FZ8 A;  2XJS A;  4M3C B;  2XQR A;  5AFB A;  5BY5 A;  2ET7 A;  2J22 A;  1FV3 A;  2WT2 A;  4HK8 A;  3BYW A;  5FZF A;  4W50 A;  1I3H A;  4QU2 A;  2W08 A;  1DYK A;  4BK4 A;  4EN6 B;  3ECQ A;  4KMQ A;  5EP9 A;  1TME 3;  4EWE A;  4A6O A;  3OGS A;  1H6X A;  2EAK A;  1NE4 A;  3TNP B;  4LBJ A;  3JBG 1;  3LQC A;  1EPW A;  4UAP A;  1ZM1 A;  4R8H A;  4P9I A;  1AUY A;  3MPP G;  3ZYJ B;  1OC1 A;  4IE0 A;  3HIF A;  3HVD A;  4OVE A;  4CCN A;  4D6S A;  2QZ3 A;  3AC0 A;  1KFX L;  4XF9 A;  4OFG A;  4LIT A;  3VKL A;  4MLO A;  3BCW A;  1QNY A;  5KR7 A;  5KBF A;  2WNU A;  4NHM A;  4P9G A;  4IV1 C;  3VBR C;  4YVS C;  5LCW L;  1W99 A;  1XYO A;  1XXN A;  3LFM A;  3OBR A;  4MET A;  1JHN A;  1RED A;  4NJ4 A;  1VE0 A;  2GME A;  3DCQ A;  5L7O C;  1ENR A;  2DBI A;  4RR3 C;  3I2I A;  2EXJ A;  3ZDS A;  4XIL A;  2WNO A;  1NCR B;  4YGC A;  4MZU A;  3OTF A;  3ZXL A;  1W8H A;  5A7O A;  1EUT A;  5F2S A;  4AI8 A;  5IHR A;  1QIQ A;  3I3E A;  1YYN A;  2JG9 C;  2VMF A;  1EP0 A;  4Q5O A;  3ZYR A;  3M3O A;  1RUI 2;  4GH4 B;  4BQ4 A;  3K4D A;  4Q4V 2;  1EY2 A;  4KNC A;  4GD4 A;  4Y3O A;  2VO5 A;  2YBS A;  1VBE 3;  1VPH A;  3USU B;  3AX4 A;  2FCU A;  2VQA A;  4TXW A;  1RUF 2;  3C3V A;  1O5L A;  3BB6 A;  1VAL A;  4C90 A;  1ZRI A;  2D6P A;  2VL4 A;  1YFY A;  1OBN A;  2MEV 1;  5JDB A;  2WC2 A;  3ZKY A;  2HBU A;  3P3N A;  3OGR A;  1OKQ A;  1WMX A;  3ME2 A;  2VTX J;  1MEC 3;  3ACI A;  3ZMN A;  3O1P A;  2W1Q A;  1LNS A;  1W90 A;  3C8X A;  4CDW B;  5KXC A;  3D5O A;  4LO8 A;  4PHZ A;  5FK7 A;  3L9J T;  3III A;  4LKD A;  3OF1 A;  1RYY A;  3VDA A;  5FXZ A;  1NA1 C;  2HWC 1;  1ZBE 2;  1YIP A;  2XVG A;  3PL0 A;  3ILF A;  5JOX A;  2NPI A;  3QH6 A;  1ZZ8 A;  1CAU B;  2ZGS A;  2Y6G A;  2WZE A;  3FMG A;  1OPO A;  2VEC A;  2F4L A;  4L0P A;  4M00 A;  4R52 A;  3BU0 A;  3N9O A;  5I0U A;  5DZF A;  3THP A;  4AQ2 A;  1E5R A;  1Y43 B;  2C5D A;  1WBF A;  2BDR A;  3H9A A;  3KV9 A;  4MGS A;  3PUR A;  5E8A A;  3T08 A;  4Q0P A;  3OYW A;  3FJS A;  1EAH 1;  5JVV A;  2D44 A;  1LHV A;  1OLQ A;  2R07 1;  2VBD A;  4Y1Z A;  4AVB A;  5AC9 1;  4FO9 A;  5ANN A;  5BXX A;  5FZI A;  4DB5 A;  2WZR 3;  4LUM A;  4F83 A;  1PVX A;  1B35 B;  3GM8 A;  1WMD A;  3MDP A;  1G9F A;  3M3E A;  4XFA A;  4LKS A;  3JXS A;  1AL2 1;  3CF6 E;  1ND3 A;  1W6Q B;  2BYV E;  4MGY E;  5JZG C;  1TVG A;  5FYI A;  2RR1 2;  2DCK A;  4I0A A;  4AFD A;  1IG0 A;  4IUG A;  5C9A C;  1DQ6 A;  2VW1 A;  5FYU A;  4M0H A;  2VUL A;  3LDB A;  1C1L A;  1UF2 C;  2ZEY A;  3AKS A;  4IE7 A;  3VD4 A;  1OF3 A;  4C0B A;  1PMJ X;  2GC3 A;  1Z78 A;  2DVG A;  2A3W A;  4JTO A;  2UWB A;  2VZR A;  2BVB A;  2ZGU A;  1RB8 G;  1PGL 1;  3N9N A;  3VBO A;  3AMM A;  3RZK A;  1AX2 A;  4COZ A;  4CXY A;  2FHR A;  1QJX 2;  4COY A;  1UYY A;  5IYY A;  1UY2 A;  4NRP A;  3WIN E;  1RJ8 A;  1LOA A;  2A6X A;  2Q5T A;  4LOS A;  1OUX A;  1CPM A;  3VBH A;  4CEY B;  3WNN A;  2LAL A;  4AGR A;  3KSC A;  3H50 A;  1W9T A;  5K0U C;  3RJ2 X;  3I2D A;  5CG8 A;  5FTT C;  4J6G A;  2B7Y A;  4ASK A;  1TZO A;  1U5Z A;  2JE9 A;  2PHW A;  1O3R A;  2Y26 A;  5ANQ A;  1CQ9 A;  2VZV A;  1G86 A;  1D4M 1;  1PO1 3;  3EBR A;  1JH5 A;  2JG8 B;  2D3P A;  4CDX C;  1S0E A;  4YGB A;  1OSG A;  2DFB A;  3B7M A;  4CCE A;  5F6K A;  4UF0 B;  1UL9 A;  3I2K A;  1F4H A;  3HNY M;  4YG3 A;  1SZB A;  1KD7 A;  5TSW A;  2BU9 A;  5CFC A;  4L9B A;  4LOR A;  1O3T A;  3M70 A;  4QHB A;  1V9U 3;  4BK5 A;  2A1X A;  1BK1 A;  2OW4 A;  4FPC A;  5J36 A;  4RSU A;  1W3V A;  1J1T A;  1PZ8 A;  4QM9 A;  4E8C A;  3NKG A;  2XL7 A;  4QDQ A;  3N9P A;  2PHL A;  3KS7 A;  4RL7 A;  5F3E A;  2RS3 2;  4FAH A;  2OT7 A;  4IEQ A;  4Y20 A;  2ZHK A;  1BCX A;  3NWK A;  1DGL A;  4LBQ B;  1IKP A;  1EV1 2;  4PF5 A;  5BNO C;  1HXS 1;  2QQP A;  2ZGL A;  1WW6 A;  2QUO A;  1REF A;  3ELN A;  2H6C A;  1QJE A;  3RI9 A;  2R06 2;  4CDU B;  4A4A A;  2PXJ A;  1PZ9 A;  1MQT A;  1OLM E;  2WSV A;  2E9Q A;  2VVD A;  3NKT A;  4I09 A;  2EA7 A;  2RS1 3;  1LOF A;  3CDZ B;  2GP3 A;  4LBN A;  4TWT A;  4CVU A;  2NYY A;  4KWK A;  5LA1 A;  3WF2 A;  3J7N A;  3NV2 A;  5FBZ A;  4XF4 A;  1W8N A;  2LRO A;  1C3H A;  5FQ0 A;  4GMP 1;  4AAP A;  5FZO A;  3EB7 A;  1FOD 3;  2W95 A;  1AR6 2;  3T1M A;  4D7Y A;  4D94 A;  3AMP A;  1XNT A;  2ZGM A;  3PIG A;  4PJY A;  2K46 A;  1RXF A;  2OZ6 A;  1W03 A;  2VXJ A;  1NG0 A;  2WDB A;  3JB8 A;  1RUE 2;  5FP7 A;  1GZ9 A;  2O8Q A;  1AR7 3;  1W6M B;  5IVE A;  1NXM A;  3AMN A;  2VCB A;  5LA9 A;  2R49 A;  2VXR A;  5F1R A;  2PLV 1;  1VRH 2;  4R9D A;  4ARX A;  3A0K A;  3O7O A;  4IDZ A;  1ZBA 2;  2XWJ B;  4A6S A;  5T3N A;  3M2M A;  4NR1 A;  4GB3 3;  3GCW A;  5J96 B;  4XJ8 A;  1C57 A;  5KXE A;  4YYO A;  4CZS A;  3ZN6 A;  3DGT A;  3PJY A;  2JB8 A;  4AFC A;  3VDC A;  2OZJ A;  1UAI A;  3T09 A;  4AXO A;  5GLU A;  2EVX A;  3K4Z A;  1PGW 2;  3HNM A;  1ND3 C;  3WDY A;  3FUQ A;  5DXD A;  4BYY A;  1S55 A;  4NIA A;  5ISL A;  2GN7 A;  2WO3 A;  2BV4 A;  4GWJ A;  1HKD A;  4XUN A;  1X9T A;  2DVD A;  2O8O A;  3ZYB A;  3FX3 A;  1KXG A;  3RWK X;  4A7K A;  1GU3 A;  5EJ3 A;  4Q4W 2;  3EXU A;  1O6U A;  2ADE A;  4RYD A;  3ACH A;  3MEP A;  3LAG A;  2A70 A;  4LLO A;  4IXL A;  4YVS B;  4P9L A;  1SCS A;  2BTV C;  4LE3 A;  1S2B A;  5HV0 A;  2JE8 A;  5G05 L;  1OMI A;  1OVP A;  4Q4Y 2;  2FZ2 A;  1PO2 2;  3RYR A;  1IPS A;  2PMW B;  4RR3 B;  4BIO A;  3VBF C;  4MX3 A;  4LO5 B;  4FPG A;  1WLT A;  1GV9 A;  5A3T A;  2IXL A;  4GKY A;  4B7E A;  4UXA A;  4ERO A;  1SLB A;  2RS5 1;  4BQ5 A;  3ZXF A;  5JSR A;  2JG9 B;  3ZPO A;  1JYW A;  3WG4 A;  5HV4 A;  1X50 A;  4LK7 A;  1AYM 3;  1QQP 2;  4Z2A A;  4YW3 A;  1CIW A;  2A6Z A;  2Y6F A;  4LIV A;  4NRM A;  4MAD A;  2OKX A;  1FI2 A;  2JEN A;  5FK8 A;  1OXC A;  4UFJ A;  1PVC 2;  2WRA A;  4YM2 A;  3M3I A;  2OYZ A;  2PHR A;  4YG0 A;  3WNK A;  2CTV A;  5K9Y A;  2HWE 3;  1RUN A;  1DHK B;  4QPG A;  4WM8 B;  3PUI A;  3H42 B;  2X09 A;  2SLI A;  3TB0 A;  1ASJ 1;  2AYH A;  1NCR A;  5FYY A;  3UV9 A;  4JHT A;  1QU0 A;  5T5P A;  2F17 A;  2QTW B;  1YHF A;  5FMO L;  4K1Y A;  1ONA A;  3U1X A;  1LKN A;  1LRH A;  4IES A;  3ON7 A;  1ZRD A;  1NA1 B;  2JDU A;  4UFM A;  4GH4 A;  4Y33 A;  2FCV A;  1KEX A;  3AP9 A;  5IFT A;  5C5T A;  4RQP C;  2QQV A;  3USU A;  1TME 1;  5FZ7 A;  2GU9 A;  2VMD A;  4XFB A;  2TEP A;  3KWV A;  3J7L A;  4AI3 A;  2Q30 A;  4SBV A;  1NT0 A;  5EFU A;  5FXW A;  5H9Q A;  5L9R A;  3J26 N;  2GND A;  4DXZ A;  3WDX A;  1CZV A;  1DGR A;  1Z7S 2;  1LES A;  4I01 A;  4XZU G;  1Q8O A;  1YQ5 A;  4GWI A;  4Z92 B;  3O1O A;  3JBG 3;  3ZOI A;  2A6Y A;  2XPJ A;  4RFR B;  1VLN A;  2NMO A;  2W94 A;  1R08 1;  2ZKL A;  4BQ1 A;  3KQ4 B;  3H1Y A;  4QKD A;  4IEX A;  1R1A 2;  3VUO A;  4H55 A;  4FFI A;  1I5Z A;  2OXB A;  3MID A;  4JC1 A;  1DQ0 A;  1VAM A;  4MHU A;  4Q4W 3;  3ZSJ A;  1CAU A;  4ZZ8 A;  1Y9Q A;  5JPN B;  1EUU A;  1IS3 A;  1Q43 A;  2DYC A;  2LTN A;  5L9V A;  4ITC A;  1UMZ A;  4EJR A;  4I0W B;  4D6R A;  4QHO A;  4NII A;  4AQ6 A;  2XKO A;  4N9H A;  4Q4Y 3;  4QMA A;  2ZHN A;  2G4I A;  4RGG A;  2YU2 A;  3S7E A;  2W1S A;  5H9P A;  3POS A;  1AYN 2;  4DZG A;  1I5P A;  4B1L A;  1AHS A;  1FX5 A;  1FAT A;  5JPM B;  3NQH A;  4QXC A;  5F37 A;  1B35 A;  1XU2 A;  4I2O A;  2R30 A;  4HVR A;  4YG6 A;  1RUD 2;  5HBA A;  1QDO A;  1IS6 A;  4EYU A;  1W6Q A;  2Q1F A;  4P00 B;  3WHU A;  1HDK A;  3FHI B;  5FUI A;  1X33 A;  5LEK A;  1ZNP A;  2MEV 3;  4GAZ A;  4F7Z A;  3ALQ A;  5F5A A;  5FZH A;  3AKR A;  1LHU A;  2WQ8 A;  4BOW A;  1QXP A;  2CGO A;  2XJV A;  4W4Z A;  2KXL A;  4CDX B;  4K3U A;  3H8X A;  4NOT A;  1C4R A;  2BWA A;  4A42 A;  3ZR5 A;  1UPS A;  1N1T A;  1UU6 A;  4YW5 A;  4HPK B;  4E4Z A;  2HWC 3;  2HWB 3;  2XJR A;  4X8N A;  4FP2 A;  2LS6 A;  4LNV A;  1GSL A;  3ETP A;  1Y4W A;  3CEW A;  4CEY A;  3HNB M;  1Y9G A;  4BZ4 A;  4JAA A;  3HAG A;  3IDC B;  4LE4 A;  2WIN B;  2OQ7 A;  5JOZ A;  2BBA A;  3VZL A;  5JXJ A;  2B9U A;  3PVE A;  1UD1 A;  4XXP A;  2EAL A;  2IC1 A;  4HK9 A;  5GLW A;  1IG3 A;  3K51 A;  2KM2 A;  1C8N A;  3RVH A;  4OI0 A;  5AFE A;  1S0F A;  4OZO A;  2JG8 A;  2RDQ A;  4XC9 A;  1Z7S 3;  2EID A;  3IB3 A;  4GJZ A;  4MO3 M;  4QX8 A;  4FT8 A;  1VBA 2;  1EAH 3;  4UW4 A;  5BNO B;  3RS6 A;  2R07 3;  1ULF A;  2XL9 A;  2BNM A;  4UFK A;  2YU1 A;  4UF0 A;  5IW0 A;  1S0J A;  4LUK A;  4Q2F A;  1JZ8 A;  3DYM A;  3VDD B;  4KI5 M;  3CZJ A;  3RJR A;  1XU1 A;  1W2T A;  5I8Y A;  3KCX A;  3JZV A;  4TSV A;  3WW4 A;  1IPK A;  1H1A A;  3PNA A;  4XBN A;  1AL2 3;  2XUE A;  4HET A;  1VBC 2;  1X82 A;  4GWN A;  1LGC A;  4ASM B;  1G9C A;  3SEE A;  2WO7 A;  5DQ0 A;  2ZBJ A;  4IER A;  2DCT A;  3VKN A;  4FTE A;  2GP5 A;  5BUV A;  4JKM A;  4R4Z A;  4AI9 A;  2BNO A;  2WQZ C;  4ASL A;  4O9E A;  5FIX A;  5K7P A;  3KF3 A;  2WNV A;  2A6W A;  2CV6 A;  3LPF A;  1DLC A;  1JYC A;  4P9J A;  4XF0 A;  3WDW A;  4OUS A;  3WHT A;  4FVV A;  2GNT A;  5FLI A;  1V6K A;  3LPG A; 
#chains in the Genus database with same CATH homology
 3BGA A;  3WF4 A;  3MUY 1;  3A21 A;  3C7G A;  3P1I A;  2WN2 A;  5DMY A;  1IQD C;  2B4K A;  3T0A A;  2E26 A;  4QDS A;  3VD3 A;  2J7M A;  2VC9 A;  4P5Y A;  2E31 A;  2J1U A;  2VZQ A;  2R7E B;  3THC A;  3WNM A;  3T0D A;  1JZ5 A;  3W5N A;  1GMM A;  2EIB A;  3I2H A;  4XUT A;  3WSO A;  5DPN A;  2J1A A;  3D3A A;  3F2Z A;  2VZ1 A;  2W47 A;  1ULP A;  2BER A;  1DYO A;  2W3J A;  3WQB A;  2J22 A;  4W50 A;  4AG4 A;  4P02 B;  4BK4 A;  1NX9 A;  3ECQ A;  2ZEZ A;  3VD7 A;  4KMQ A;  1CZT A;  4A6O A;  3OGS A;  1H6X A;  2JD9 A;  3I3D A;  4FI9 A;  2W92 A;  3E1F 1;  4QX1 A;  3LQC A;  4UAP A;  5LA0 A;  4JX0 A;  2WUH A;  3AC0 A;  5F7U A;  3MV0 1;  3C7E A;  2W5F A;  5LCW L;  1T2X A;  1XPW A;  1W99 A;  4XUR A;  3IDA A;  3NJV A;  5B4X A;  3GGL A;  2VZO A;  4QAW A;  3I2I A;  5C71 A;  4PF1 A;  4W8J A;  5IHR A;  1EUT A;  2YB7 A;  3I3E A;  2J1V A;  3FHQ A;  2VMF A;  1UMI A;  1YQ2 A;  2PQS A;  4XUP A;  3A22 A;  3I2G A;  3K4D A;  5EIY B;  3CKH A;  2VO5 A;  2VTF A;  1L7R A;  5EJ1 B;  4TXW A;  1WKY A;  3FL7 A;  4BJ0 A;  2VZ3 A;  3SKJ E;  1SHW B;  2VL4 A;  3IAP A;  3HOB A;  5JR2 A;  3OGR A;  4QX2 A;  3ACI A;  2CDO A;  1JI6 A;  4CU7 A;  2W1Q A;  1LNS A;  3I2F A;  3C8X A;  3K75 B;  3III A;  4HG6 B;  1RYY A;  3VDA A;  2XHN A;  2RV9 A;  3FN9 A;  4PQQ A;  1D7P M;  1GOF A;  3T2O A;  4ZY9 A;  5JXH A;  2Y6G A;  2B9V A;  2WZE A;  3LEI A;  4L0P A;  1US2 A;  3BN6 A;  3U37 A;  5IFP A;  4PT6 A;  5JXG A;  2VMC A;  4MGS A;  2YFU A;  1UZ0 A;  4QDR A;  1K45 A;  3T08 A;  2X10 A;  2V72 A;  1K3I A;  2HYX A;  3GM8 A;  3K46 A;  5B4N A;  2W87 A;  4LKS A;  3JXS A;  2WYS A;  3ABZ A;  2XQX A;  3A23 A;  4ET7 A;  1TVG A;  1J84 A;  2QQI A;  4MOA A;  1K42 A;  3WEZ A;  2DCK A;  1GUI A;  4IUG A;  2VME A;  1JZ6 A;  2QQK A;  2ZEY A;  3VD4 A;  2WAB A;  1OF3 A;  1PMJ X;  2L9L A;  2VZR A;  3OB8 A;  3C7H A;  1XC6 A;  1UYY A;  3A7Q A;  1UY2 A;  1UXZ A;  3WNO A;  5IYY A;  2VQT A;  4M4R A;  3WNN A;  1W9T A;  1XNA A;  1K12 A;  1CZS A;  4P08 A;  2VZV A;  1NKG A;  5CYY A;  2VOT A;  3HN3 A;  4A41 A;  3WF0 A;  2DCJ A;  4D0Q A;  4LHS A;  1JYN A;  3W5M A;  2WO2 A;  4JKL A;  1GQP A;  1P8J A;  3I2K A;  1CX1 A;  1F4H A;  3HNY M;  4QB1 A;  3CIH A;  4BK5 A;  2ID4 A;  1JHJ A;  1CIY A;  4E8C A;  4DXT A;  4QDQ A;  2HLE A;  1H6Y A;  4A45 A;  3LEG A;  4A3Z A;  3I97 A;  1O59 A;  2Y6K A;  2VM9 A;  1ULO A;  4QX0 A;  4A4A A;  2WO1 A;  2ORZ A;  2WBK A;  4D8M A;  3THD A;  3C7O A;  3CDZ B;  2VJX A;  5HXM A;  2Y6H A;  1SG3 A;  4CVU A;  5LA1 A;  3T0B A;  3WF2 A;  1GOH A;  2BGO A;  2J1T A;  2QQJ A;  1W8N A;  1WCQ A;  2VCA A;  4CUC A;  5HPO A;  2QQN A;  2E32 A;  1JZ3 A;  1W0N A;  3EB7 A;  2W95 A;  3MBW A;  1JYX A;  1UX7 A;  3K4A A;  1XNT A;  2WDB A;  2J1R A;  4CUB A;  2RVA A;  4JKK A;  2W46 A;  4MGQ A;  4CUA A;  1F4A A;  2VCB A;  2ORX A;  2EIC A;  2VZU A;  4ARX A;  1UY0 A;  3VD5 A;  1OH4 A;  5JXI A;  3WF3 A;  1UY4 A;  3UES A;  1O8S A;  3I2J A;  3SKV A;  2JKX A;  2E33 A;  3HEI A;  3C7F A;  1PX4 A;  2VZT A;  2DDU A;  3VDC A;  4QB6 A;  4OMC A;  3T09 A;  3WNL A;  2RJ2 A;  3HPN A;  3K4Z A;  2KD7 A;  3HNM A;  4UOJ A;  2YG0 A;  3T2Q A;  1L7Q A;  2VCC A;  3LE0 A;  2WO3 A;  4GWJ A;  4XUN A;  5EJZ B;  2C4X A;  1PX3 A;  2V4V A;  2Y8K A;  1GU3 A;  3ACG A;  2Y6L A;  4DXR A;  2CDP A;  4CU8 A;  4RYD A;  2ZEX A;  3ACH A;  3MO4 A;  2W9X A;  5C70 A;  4DUX A;  2JE8 A;  5G05 L;  4QX3 A;  2ZEW A;  5I0D A;  3DYO A;  2EIE A;  2YFZ A;  4E8D A;  1PMH X;  1JU3 A;  1JZ2 A;  1HN1 A;  3HJR A;  4DEV A;  2XOM A;  1JYW A;  1DP0 A;  1GOG A;  4Z2A A;  4QPW A;  2BGP A;  4MAD A;  2X05 A;  2J1E A;  2XON A;  2OKX A;  5C7G A;  2ZXQ A;  2W91 A;  4DXS A;  1J83 A;  4UI9 L;  1O8P A;  4OUE A;  3WNK A;  1JZ4 A;  3PUI A;  2X09 A;  4DUW A;  1R64 A;  1OF4 A;  2WN3 A;  4GZ9 A;  1GNY A;  1KEX A;  2WAO A;  4XUQ A;  5IFT A;  3I3B A;  4ZZ5 A;  4JHZ A;  1UYZ A;  1NAE A;  3DEC A;  2VMD A;  2QQL A;  3OGV A;  3UET A;  1MPX A;  2JDA A;  1CZV A;  3UNP A;  4XZU G;  4GWI A;  3CMG A;  3J7H A;  2Z4F A;  2WZ8 A;  2QBX A;  1UWW A;  1BHG A;  3IAQ A;  2W94 A;  3ZM8 A;  1UY3 A;  3GDB A;  5LA2 A;  4CU6 A;  5JUV A;  2V5D A;  4ZZ8 A;  4QB2 A;  2BZD A;  2VZP A;  1EUU A;  2Y64 A;  3OEA A;  1UYX A;  5IJR A;  1NUK A;  3OG2 A;  3NNG A;  3MUZ 1;  5JMO A;  4TTG A;  3WNP A;  1UMH A;  4XVH A;  3ACF A;  1KGY A;  2C9K A;  4BDV B;  4BXS V;  2W1S A;  3K77 A;  4OYU A;  1OT5 A;  2YC2 A;  3VDB A;  1I5P A;  3NQH A;  4AAX A;  1JU4 A;  2W1W A;  4P00 B;  5FUI A;  4LQR A;  3VD9 A;  2W1U A;  2J1S A;  1JYV A;  2WQ8 A;  4CU9 A;  3GXU A;  4W4Z A;  4ARY A;  1UXX X;  4A42 A;  4YPJ A;  1JZ7 A;  2WAA A;  3LEK A;  5A1A A;  1W8O A;  1W9S A;  2LS6 A;  2VQU A;  1TG7 A;  5DN2 A;  4RN5 A;  3ETP A;  4DEQ A;  3HNB M;  4XUO A;  2VZS A;  5J1X A;  3NJX A;  1US3 A;  4LPL A;  2BBA A;  5JXJ A;  2LW8 A;  1UY1 A;  1SDD B;  3P6B A;  4OMD A;  3CZU A;  3DYP A;  4OZO A;  3OBA A;  2EID A;  3IB3 A;  3PUH A;  1OD3 A;  3NRU A;  4MO3 M;  3FHA A;  2C26 A;  4ZXE A;  2YC4 A;  3CQO A;  1JZ8 A;  3DYM A;  4KWU A;  3EYP A;  3CZJ A;  4KI5 M;  5G04 L;  4A44 A;  1W9W A;  4DUV A;  2QQO A;  3WF1 A;  3OEB A;  4M4P A;  3SEE A;  5DQ0 A;  3T2P A;  2VR4 A;  3SEP A;  3MV1 1;  4JKM A;  5CZK A;  2QQM A;  3LPF A;  1DLC A;  2Y6J A;  3LPG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...