2WC2A

Nmr structure of catabolite activator protein in the unliganded state
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
209
structure length
209
Chain Sequence
VLGKPQTDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYGTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords CATABOLITE GENE ACTIVATOR
publication title Structural Basis for Camp-Mediated Allosteric Control of the Catabolite Activator Protein.
pubmed doi rcsb
source organism Escherichia coli
total genus 38
structure length 209
sequence length 209
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2wc2A02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2wc2A01
2ZMEA 3M70A 3DPLC 2PMHA 2P6SA 4EJVA 1ZRRA 4XBFA 4HV5A 2IJLA 2DAOA 1G3SA 4UXNA 3S7IA 2QYOA 2PBIA 5A2QK 1MKMA 2PHDA 4MEYF 1QNTA 2IW5A 3CLPA 5JFRA 1IPJA 1XGMA 2Q8KA 1GQGA 4FBFA 3CUQC 4LD5A 3GYDA 2ZKZA 3ABUA 5J7MA 3IIAA 1CF7B 4UNOA 4EV0A 3USSA 2OZUA 1I27A 4GGGA 4LLGF 2DI3A 4EROA 4IEZA 1QZZA 4EGZA 2WC2A 2XASA 4HA8A 3TO7A 3HOTA 2CYYA 4M6YA 1RNLA 1ZAOA 2J5OA 2V1XA 1S8NA 1IN6A 1GHCA 2P6TA 3NKTA 2OQRA 2DK8A 4IRHA 2DK5A 1VJ2A 3FE5A 3QP5A 4HN0A 2K4JA 1ZRFA 1YW8A 1RL3A 2B8MA 3TO6A 5BV6A 4RGSA 3R6SA 4Z82A 3MWMA 4JBAA 3DKWA 3Q9SA 4M72A 1JE8A 3H1YA 2H6CA 2O8XA 2ELHA 2D5FA 1IPKA 4I0BA 1CF7A 1O4TA 4KYWA 3CJNA 3RIRA 4PDKA 2OPKA 1ZLKA 1ZHFA 5CYVA 5J8FA 3NJZA 1R5GA 3E6MA 4LUMA 4QX5A 4NVPA 4CGZA 4LG0B 2GXGA 2W57A 2GC3A 2NRAC 2XL7A 5LHGA 4OIPF 1T0FA 1L3JA 4P96A 4HVRA 2NNYA 1TQPA 1L3LA 2D1VA 1BC7C 4JTOA 1O3TA 1IXSB 4G8XA 2H09A 3G7DA 3P9KA 1Z1DA 2D5HA 2EA7A 4UHTA 2CFXA 5I91A 2WV0A 4M9SA 3HUGA 5LEKA 2MC3A 4AD9A 3WW2A 1FYLA 1BIBA 1O57A 1QXJA 2HS5A 4Q0VA 3IBMA 3GYHX 1IF1A 3IDBB 3WGIA 3QU3A 2PFBA 1QPMA 2VT3A 4S04A 4LG0A 1MD0A 3L7WA 2L01A 1H1IA 1LB2A 2HWVA 3KFWX 1RZ4A 3JSPA 2P5LC 3GEZA 1GVJA 4MTDA 4I09A 4R1HA 2QWWA 2DQLA 5K8SA 1KU2A 3WTUC 4IEVA 3IWFA 4P9FA 3DN7A 3HOSA 1OYIA 1YFXA 4ON0A 4MHGA 1EPZA 1IN7A 3F72A 5E20A 3E6BA 3GUDA 1GQHA 3RNSA 5DCFA 3RKXA 5T3NA 3WODF 1XDUA 4ZYEA 1FC3A 1VTNC 3BPZA 1QBJA 3FZ3A 1FXZA 4PIXA 2OU2A 4BHCA 2JT1A 4L9VA 2ESHA 4LLNA 1BI2A 3PLQA 2GC2A 2EB7A 1BJAA 4TV7A 1ZYRF 1IN4A 2FMLA 1ZG3A 2OQGA 3Q5FA 4EJUA 3KGLA 4A0YA 3WTSC 1TBXA 3M1EA 1ZZ8A 2W25A 3HSFA 4LB6B 3CO7C 3I54A 5C8WA 2PFWA 4KL1A 4P55A 2QLZA 3OV8A 3QRFF 1J59A 4RAYA 5HI0A 1SFNA 1J3QA 4BXUA 2ISZA 3J7AO 4HOBA 2EA2A 2QQAA 1YWKA 3KP6A 5BY5A 4RGRA 5I0SA 3IL2A 3P7NA 4IETA 2P5VA 2HYFA 2WTEA 3HHGA 3WG9A 5ICCA 1F1ZA 1SMTA 5F64A 5K1YA 2AXLA 3G73A 3I59A 3V8KA 4LB5A 2HZTA 1H0MA 4D0PA 3QPHA 1I6XA 3CO2A 2UXXA 4QXKA 3N4MA 5BS6A 3UKVA 3KEQA 1SAXA 2B9UA 4EWDA 4YYOA 2V79A 2HTJA 2HKOA 3JSOA 2QCSB 2ETEA 3I4PA 4O6JA 2DO7A 4BH9A 3KEOA 3H9AA 2Y0MA 5ILUA 1F5TA 2HKXA 3H1WA 3KZYA 2XAQA 1FT9A 5D5WB 3ZQ7A 1IW7F 5FD5A 1QY4A 2VQAA 4OOIA 2D40A 5AIQA 3CF6E 1HSTA 2Z99A 1XSDA 5IT3A 3EUHA 3S7EA 2H94A 3F22A 2D1HA 1SD4A 2DFIA 2M45A 3GW2A 2KIMA 2P8TA 3L09A 1S29A 2DQRA 3WW3A 2F5CA 2QQBA 3BDDA 4LA2A 3VHRA 1KGSA 2FU4A 2X0LA 3CUQB 4Y17A 3BJOA 2PG4A 4L9NA 5K5RA 4EJWA 1K79A 1S7AA 3DP7A 3ZMZA 2XVCA 1Z7UA 3F23A 3ZPLA 3QOPA 1SD7A 1QXRA 4M71A 2Q4SA 4YFXF 1ZH5A 5FLIA 2CAUA 4X6QB 3ZMVA 3K1MA 3FJSA 2F5FA 1HKSA 2FXAA 3MDPA 4MGKE 4CZZA 2MLKA 2HQNA 3JTGA 5AVPA 2P4WA 1RUOA 4MGIE 3T8RA 2M30A 2K02A 4EVIA 4QLCU 2LDUA 1BOAA 4P9GA 2PN6A 1XCVA 1R00A 3F6VA 3ZMUA 4WX9A 5HDGA 4YSFA 4HF0A 2V1UA 2VN2A 5CLSA 5J6XA 2K0GA 1O7FA 2FRHA 2IXHA 2GIVA 3F21A 4XFCA 3CUQA 3F3XA 1XMKA 3KLOA 1FBUA 3KP3A 2STWA 3VB2A 1CX4A 1W5TA 4LMYA 4FX0A 1JXSA 4LUKA 2RVCA 4UV8A 4HVQA 4ESJA 5K5QA 4HDUA 3KLNA 3DL3A 1J3RA 4QMAA 1QQIA 1DUXC 4ZZDA 2IVMA 4YIFA 1ZRCA 1U5TC 2QM3A 1ODDA 2CW0F 4G7ZF 2HQRA 4IF4A 3KP7A 1JHHA 1WRJA 4LK1F 2HGCA 4AIHA 2DW4A 1U12A 1CAWB 1J5YA 3M8EA 3F8CA 1PM7A 1QO0D 3HTSB 3FHIB 3RPUA 4QWQA 2AS5F 1TQMA 1J2XA 1U3EM 1P2FA 3V7SA 1TQ5A 5DD4A 2EFQA 3JW4A 2A61A 2PHLA 2FBKA 2RKHA 2RDPA 4XFIA 2GAUA 2YPRA 5I93A 4U0WA 1QZYA 4A0ZA 3O3KA 4D7TA 5CVUA 3ELNA 3F8MA 5LEJA 1D3YA 5BQTA 2M87A 3H50A 1KQ0A 4XSZF 1ON2A 5E17F 4U7DA 3KSCA 1EV7A 1CAWA 2UZKA 4J1WA 3T1BA 4E2GA 3RYKA 4QGMA 3EHKA 6PAXA 3WTZA 1BBYA 2MD5A 4EM2A 3H3UA 2XLAA 2IXKA 5FGMA 5BUVA 3SZTA 4JTNA 4ESFA 3ABTA 2IT0A 2XHKA 2NYXA 5E1RA 4UBGA 3U9GA 1LDKB 4MGZE 2K7LA 1Z6TA 2PAKA 4M9ZA 2YU3A 4AIKA 3MYXA 4WF2A 3ELKA 4WK8F 2K9ZA 1YS6A 1H9TA 2O1QA 5E18F 3C3WA 1NXMA 3CJXA 3ROUA 1DDNA 3K0LA 2DBBA 1WKMA 3WE2A 5KHHA 5FDBA 1XE7A 3LA3A 2IXCA 1B4AA 1DGRA 3GF2A 1GXQA 4UVBA 2QVSB 3EQLF 1DP7P 1I1SA 2LSOA 2F4PA 4KWKA 4U88A 2GC1A 4OIOF 3WW1A 5ED4A 1DPUA 5KK1A 4KN4X 5CVVA 2JSCA 3M7GA 1DZRA 4WVZA 1SMYF 3WTWC 4MV2A 1OR7A 3L9FA 3BJ6A 4HLTA 4RGXA 3KETA 4OMYA 3RZZA 5DUKA 4AWXB 4CXFA 4U0YA 1ZN2A 5DYMA 2VECA 5LGUA 4EGYA 1U2WA 2H27A 3VFZA 4BHBA 5BMZA 2P5KA 2GZWA 3Q9VA 3BPVA 4LJZF 4Q5SF 5HOOA 4OFGA 1FOKA 4UVAA 5FLHA 2VXZA 1RC6A 1FLIA 1OYYA 4XFAA 1MJAA 4JVAA 3IC7A 4I02A 2VBXA 1J3PA 4KU7A 4L5JA 1HW1A 1OI6A 2Y75A 3U0ZA 5JI6A 4OIRF 2KXLA 2PEXA 4EMSA 1O3SA 3LQQA 4Q0PA 3NQOA 4BNCA 2GQQA 4HSLA 5EEHA 4CO8A 2FA5A 3L2CA 2QDRA 1TW3A 1XGSA 2QBYB 4ZZLA 1YFUA 4ETSA 5C6CA 1J58A 4GXOA 1LEAA 1K7AA 3OTFA 3L2HA 3FXUA 3I53A 4DQ2A 5LHIA 2A69F 5J8CA 3LWCA 4IESA 1IRGA 4PGGA 1FBSA 4K2EA 3FM3A 3WE3A 2GA1A 5JAXA 3ZMDA 3NL1A 4D7SA 1YFWA 3RI4A 5H6QA 4Z2YA 3LFKA 2XUBA 4EM0B 2FNAA 5D5UB 3IKTA 5JSOA 1ZG5A 2XAFA 4KU8A 4KICA 2MPFA 3K9TA 4LLOA 1ZRDA 2QUFA 1YS7A 4AVAA 4NHJA 3FXRA 3HT2A 3TQNA 4WCGA 2XV4S 1P92A 5ILVA 5I0UA 4KIGA 2QBYA 1FP2A 2HDCA 4WXHA 5ICEA 2UWMA 2ZKLA 1D8KA 1X7NA 1TLHB 3S2WA 1Z9CA 3I64A 4HX7A 2OA4A 2XKPA 2ETHA 3ST7A 1W7PB 3HRMA 3RDIA 1PMIA 1CGPA 3SCHA 3M8FA 3BCWA 4O5VA 1U5TB 3IHUA 2EFPA 4B09A 1Q3EA 1X8MA 1FSEA 2MH9A 3R0JA 5L3GA 2D45A 3FMRA 1V4RA 3EYYA 3QU6A 1XN7A 3SCGA 4AQ6A 1FY7A 5F1RA 1BI0A 2PQQA 1FX7A 3O14A 2R7FA 3J81Z 3ZMSA 4WZCA 4XLPF 2ZO4A 3WU0A 3GBFA 2CWEA 1KYWA 4WBBA 3ZN1A 3WTXC 3ES1A 3GFIA 1U8RA 1W7PA 4KT5C 3U10A 2EJRA 2EK5A 5BPXA 4EJOA 2BNMA 2Z5UA 3E6DA 2O8QA 4YFNF 2JPCA 4A0XA 3OD0A 4I98B 2E9QA 2BBYA 2XRNA 2H0VA 1U5TA 1B9NA 2VC0A 2UY9A 5CU1A 4YARA 2WFPA 5KHIA 4HF2A 5KBFA 4HZFA 3P9IA 3SCFA 4BAYA 2VPVA 4E2QA 4LA3A 1P4XA 4QGLA 4AXOA 2KJBA 1R1UA 4ENMA 2GC0A 3D0JA 5HVQC 2EV0A 2X4HA 4WXCA 5HLHA 1YYVA 4HAMA 1RTVA 1XCBA 1XE8A 3V7RA 3U11A 1B59A 4OU0A 2VBYA 3V8JA 1WQ2A 3TDUC 4BQAA 1WGPA 1R5HA 1Y0UA 2F5DA 5L3CA 4DINB 2MLGA 3SHFA 2BE5F 1S7OA 1ZARA 2ACJA 1IXRC 2JTVA 2LF8A 5DUIA 1R7JA 2N7GA 2A07F 2IC1A 2IXIA 3ZP5A 5IT9Z 2STTA 1FPQA 1OPCA 1TW2A 2OAZA 3GFMA 3F6OA 2RQPA 1OKRA 4Y15A 4QM8A 1WWXA 2FF4A 3LA2A 3E5XA 3KMHA 1Q1HA 4I2OA 3TKYA 2B5HA 5EFUA 1E17A 4META 4XEZA 3H7JA 3KCCA 2EWNA 3V7CA 1UD1A 5LRRA 2XGXA 5I0TA 3ZN0A 2XKOA 3BB6A 4ZU4A 2FOKA 4G6DA 3LQRA 2KIFA 5FQ0B 1X3UA 3FZVA 4BYYA 4ZU5A 1IRFA 1XDSA 4MQVA 4Z07A 2Z2SB 5E1WA 1J1LA 4JQFA 3I7DA 5HS7A 3E97A 4ZU7A 2V6CA 3J81K 1YIOA 2Q0OA 3NW4A 2IXLA 1R36A 2DT5A 2M1BA 4FHTA 1PP8F 1LRHA 1Q5OA 4GYIA 1T39A 2P7CB 3M9AA 2ZNYA 1IZ1A 4HLYA 3RKWA 3UKTA 1X8EA 1W4MA 3MEXA 1IXCA 3D0SA 1UHWA 2I45A 4YG2F 3I5UA 4I3PA 4HBLA 3VODA 3ECOA 4DNCA 2OZ6A 1RI7A 4LULA 3M3IA 1X82A 1O5LA 2EV6A 2ET7A 3MPBA 1BM9A 3ACLA 4IEPA 2E1NA 4LTAA 2C0ZA 4L9JA 5FQ0A 4JV4A 1JHFA 1ZGJA 4L9TA 3ES4A 2VC1A 3HRTA 1FWZA 1OD5A 1Y9QA 5DDGA 3KP5A 4IJAA 1OFNA 2MHFA 1B6AA 3G3ZA 3W6KB 1A04A 5ERIA 4XSXF 1EY2A 1ZX5A 4N9IA 4XLNF 5D4SA 1LQ1A 2VBZA 3FMSA 2CAVA 1U6GA 4IVNA 1YO5C 1NZCA 4KNYA 2BGCA 1R23A 2Y0OA 2QENA 2GA2A 2FE3A 2XAHA 1KYZA 4F8AA 4HYEA 3V4GA 5IT9K 2DLLA 1CAXB 4IRGA 4PIZA 5KHJA 5FPZA 4XFBA 4XF3A 2YR2A 4HV6A 4G6QA 5CADA 4RB1A 3CTAA 4UUVA 4AIJA 1SD5A 3GFLA 4AVCA 3SZPA 3E5UA 4N9HA 1IAWA 1B9MA 4HMZA 1XD7A 3I58A 4I7HA 3JTHA 4KIBA 1REPC 1VR3A 4I01A 1HBXG 2VE8A 3COAC 5TJJA 4KWJA 5BPIA 2V9VA 4UV9A 1EYBA 1P4AA 3GFJA 1FSHA 1IN5A 4XETA 3BY6A 5E8IA 5E8GA 3HT1A 1I5ZA 2ZFWA 5F6FA 4AVPA 4JK1X 3ZDSA 5ICFA 2V09A 3SMHA 1FBQA 4ZYGA 3FHZA 1YLFA 5BXXA 3H3ZA 5J3UA 5FFXA 5DV5A 1CAXA 5DCMB 3DXJF 4ONUA 1ZZBA 2JPBA 3DEUA 4LGWA 3KP4A 1BIAA 3P9CA 4KMUX 1MJBA 4EM1A 1NE6A 4UXAA 1G6NA 2FNPA 4L5IA 1H9GA 1O7LA 3F8NA 5ICGA 3H1MA 5DD8A 2ISYA 4TLFA 4B8XA 5CVIA 1IN8A 3ML6A 2LKPA 3NVCA 1YG2A 2O6GE 3CDHA 4XF0A 3LAGA 5E1XA 4ASNA 1W5SA 3C18A 4MEXF 4IEOA 1R1VA 2FBIA 3HQXA 1ZNPA 2HR3A 3R61A 3F8FA 1DZTA 2ET1A 3MFKA 4HSJA 2VODA 4ESBA 4A2UA 3WU1B 2FQPA 4XF1A 2XAJA 1W7PD 3LAPA 2ADUA 2W85A 2E1CA 2G9WA 5DCMA 2PLYA 2RN7A 3SXYA 1T98A 2RNJA 3NSTA 1WLTA 1WI9A 4KDPA 3GVAA 4UBHA 1WA4A 3DFGA 3EJKA 4IEXA 5H20A 3HTUA 4WWCA 1EH6A 3D5LA 1KQ8A 3NRVA 5HS8A 4MH0E 5JR3A 3HRUA 3N97A 3RKYA 3WTVC 1SFEA 3OGJA 2A5YB 3BROA 3RPQA 4KMFA 2PTMA 1LDJA 2RC4A 1SD6A 5FCCA 4G9YA 3NEUA 4Q4ZF 4MUVA 3B02A 4IERA 1NE4A 2GH2A 3QACA 1SFUA 1K6OA 3SXWA 4KN7X 3R4KA 2NS0A 3OF1A 4N0BA 2DU9A 5I0RA 2D2WA 1YW7A 3CO6C 2PYTA 4MX3A 3OOPA 3GLXA 1BN5A 2G7UA 3BJAA 1YQAA 3K2ZA 4E70A 1PDNC 4ZYHA 3ETQA 1WSUA 1RUNA 2BEOA 4LEJA 4NB5A 4GYGA 2VT2A 2QZ8A 2KJCA 3KGZA 4IHSA 3C7JA 4QM9A 2BNOA 4MTEA 5LLQA 1LNWA 2Q2EA 2O0YA 1Y3TA 3MZHA 1T38A 2NAZA 4X6RB 5KVRA 3J80Z 2PJPA 5J48A 4OMZA 4A5MA 4OINF 4ENJA 2PMUA 4KIFA 5KHKA 3GXOA 3IRRA 5FLXZ 4FT8A 4HLXA 1BI3A 3K69A 1K78B 2BV6A 5EEGA 4U0VA 2A3SA 2IRFG 5D1IA 2M8EA 4RAZA 4KWLA 2B0LA 2FEZA 5FLJA 3H8UA 2YSRA 1GXPA 3HHHA 4YNIA 2IXJA 4EWEA 1CAVB 5I8YA 2G7HA 4IRIA 1JGSA 3BOQA 1BI1A 4ZH4F 1PP7U 4RB2C 3SFZA 4XFGA 1TQIA 1UCXA 1TNTA 5AONA 3E3VA 1XMAA 3FF5A 4M73A 4G7OF 1YFYA 2ZJ2A 3OCPA 1ON1A 3S0MA 3WW4A 4QGNA 5HDKA 3CUOA 1T2KA 4HF1A 3BPXA 2IP2A 1D8JA 5LHHA 5I8TA 1HW5A 2P7VB 3QAHA 5FPXA 2MA3A 5D8KB 1K78A 5HDNA 3H92A 3RJPA 1EH8A 4O3MA 2DCTA 3CL1A 5L3FA 5DEQA 5JVTA 4A12A 2COMA 3SQNA 2EAAA 2O3FA 4HW0A 3T5XA 1SQ4A 1CAVA 5D4RA 3F8BA 3GWZA 1ZG1A 1ZZ9A 5JR7B 1G4DA 2ZXJA 1XSVA 3ZMTA 2XIGA 2EFOA 3U1DA 1P6RA 2FQ3A 2CSOA 1UW8A 3L00A 4XF9A 3WTTC 1O3RA 5D5XB 2KKOA 4R79A 4MGRA 4O9EA 2QVOA 2Z33A 1ZGAA 3PQJA 4M6XA 1BC8C 3EYIA 4HQEA 3IRQA 5ILSA 3J80K 4PJYA 5D8LB 2EFNA 1KU7A 3H7YA 5FO5A 1UPIA 1LJ9A 2HYGD 3W6JB 5FLXK 2FSWA 3DPTA 3EBRA 2IA2A 2GXBA 3WGHA 2IPQX 5D5VB 2XROA 3EETA 3BZ6A 5LGNA 1QWRA 1ZZ7A 5K5OA 2CG4A 5JSRA 1J0RA 2K86A 2EVXA 3IDCB 2C6YA 3C3VA 5LGTA 3EQEA 3ECHA 3HSEA 4R52A 2P17A 2DPDA 4G94A 4L18B 2HOEA 2A6EF 1E2XA 1B1BA 4KA4A 1S6LA 1V70A 3REOA 1YHFA 1Z05A 1C0WA 1EP0A 1JUHA 3PVBB 3QP6A 3LAJA 2DPUA 2CGPA 2OD5A 3I71A 2GU9A 2EA4A 1LDDA 3EDPA 1UCRA 1YFHA 3BP8A 4IEUA 5FD6A 1HSJA 2Z3YA 5L3DA 2PAMA 4H0EA 4MQ9F 2QJVA 2RV8A 2UYAA 3MZYA 4ENKA 4P9UA 4EJTA 4MZUA 4G7HF 1O5UA 3EO6A 4ORFA 3JAMZ 3WGGA 3TGNA 2A6HF 3U2RA 2DTRA 2LF7A 4Q0SA 4PZJA 3I59B 4GCVA 1G3WA 2GWRA 4EWAA 1DPRA 4O9GA 4M74A 4ZYDA 1QGPA 4BHPA 5KHGA 4PIYA 3GX4X 2L3DA 3TNQA 1MDMB 4XRFA 5E1ZB 4RS8A 2KIUA 5CJ9A 1UIKA 4H7LA 1NHAA 3LZZA 4L11A 4RB0A 4IEQA 5H6RA 4IXAA 4L0ZB 1Z91A 1RGSA 4HBNA 4Q0UA 1YTYA 1U78A 1CAUB 1VP6A 1Z6RA 4Q0QA 2MBFA 4XF4A 4MGYE 5TRDA 1MGTA 2JRTA 2QQ9A 4OLLA 1S3JA 2UYBA 2KRFA 4LK0F 4F7ZA 2O61A 2D93A 4HVOA 3KP2A 3LWFA 2R7DA 4XFFA 3DF8A 2TDXA 5LRSA 4CHUA 1YUDA 1KA8A 1USTA 3FMQA 2Q30A 3TDZC 4FX4A 4A5NA 2XL9A 1FZPB 2MNGA 3DQVC 1J75A 3E5QA 2ZCWA 5CVRA 1MDMA 2HFHA 3DV8A 3PFIA 3TOAA 2CO5A 3GO5A 2UXNA 3FWEA 3BALA 1ZZ6A 3K1PA 2ESNA 4KUMA 2Y48A 1J9IA 4YFKF 2HEOA 3HRSA 1CAUA 2Q0AA 5BPDA 2F5EA 2OYZA 4LFUA 3WTYC 5JSPA 3SHRA 1OMIA 1XSXA 5JCTA 1TNSA 2EV5A 1FYMA 4IEWA 1R1TA 2BNNA 4XFHA 3HYIA 2Q1ZB 1KU9A 3VOEA 2PA7A 2W24A 2HTSA 2K4BA 4U7BA 1D5VA 3PQKA 3JAMK 5JHUA 1RIOH 3R0AA 2PAEA 3CEWA 2NNNA 2VOOA 2OBPA 4HQMA 3I0TA 2YX4A 1AWCA 4L2NA 3LA7A 1HW2A 2OZJA 3B73A 1KQ9A 4B29A 2CQKA 3PNAA 4L0YB 4MNUA 4AVBA 4IEYA 4Q29A 1I1GA 5I8SA 3TNPB 4CDGA 1T6SA 1Q43A 1FNNA 3IWZA 1V3FA 1FI2A 2IA0A 2R3SA 2LNBA 2PI0A 3K1NA 2Z69A 5HS9A 3GZ5A 1YLLA 2OA2A 2L54A 4ENNA 4WXDA 4KFCA 1XGNA 2O03A 1ZZCA 2M5WA 2XLFA 4RB3C 3BWGA 4M9XA 1F9NA 3RTRA 5AIPA 3MQ0A 1J7KA 1AOYA 1HKTA 4NQWA 1UFMA 1UIJA 2HJIA 1PUEE 1KU3A 1P4WA 2E7WA 2Z9OA 3FX3A 4YIIA 3GZ6A 1ZLJA 3FFQA 1R58A 1UB9A 3E6CC 2VONA 5BOXA 3ERED 3KE2A 1XB4A 3QPTA 1LEBA 1G3TA 4IPAA 2FMYA 1YW9A 1OYWA 4A6DA 2E7XA 4RD7A 1ONVA 2K27A 4AQ2A 1DGWA 4RGUA 5D6EA 1XGOA 2H6BA 1LKNA 3O6BB 3TO9A 1L0OC 2BYVE 3RYPA 1O3QA 3AAFA 3JZVA 4P5OA 1TTYA 2J5PA 5A2QZ 1EH7A 1ULYA 1STZA 2FBHA 2MH2A 5HLIA 4Q47A 1F4KA 4Y13A 4K8FA 1ZVFA 2ATFA 3IKVA 1FYKA 3HIFA 5L3BA 2XAGA 4CICA 3R60A 1MJ9A 3D82A 2A68F 4UVCA 2F2EA 4FAHA 4S05A 1SFXA 1IUYA 3FM5A 2VOPA 4YRDA 2VE9A 1HKQA 5CVJA 1LVAA 3TOBA 1LR5A 2XLGA 4J1XA 5FFZA 3CLOA 2ZNZA 5E16A 5LBQA 3VEPA 4PGHA 1HQCA 3RYRA 2WWYA 4LLLA 2L4AA 4I0AA 4HX4A 2YX7A 3MAJA 4OIQF 4IHTA 2IA1A 3MCZA 1XRUA 3V8LA 3BU7A 2ZMEB 2EFWA 2RGVA 4FAGA 1NYWA 1UHMA 4E2SA 3HSRA 2QNKA 4R8HA 3ISPA 3LOIA 4Q48A 4HDVA 4HX8A 3O2PE 1ZREA 5D6FA 1R22A 2CV6A 1HXDA 4HN1A 3T0YA 4BIFA 4EQQA 2V1DA 5L3EA 3LSTA 3T8TA 5EZWA 2ZBKA 4GO1A 2L02A 1H1MA 2UY8A 2L4MA 3UKNA 5FB2A 1G3YA 4CYDA 2PQ8A 3C1DA 4A6EA 4PCQA 3KZZA 4GULA 3FXQA 1USSA 2W84A 1SEFA 2VBWA 3ULQB 1MZBA 5HLGA 1FP1D 2JZYA
chains in the Genus database with same CATH superfamily
1YHQI 4KG0A 3T30A 3AB0A 3K77A 1E3PA 4IL6C 1E3OC 2IJLA 4V2FA 1COV1 4UXNA 2GOMA 2QYOA 2JE7A 2PBIA 1MKMA 1BVVA 1QDOA 1GFF2 1XGMA 2RMU2 3H0GJ 2OX0A 1GQGA 4JRAA 3CUQC 1LOFA 3ABUA 1T08B 4QX0A 4RYDA 3VSKA 3IIAA 2BDRA 3NWTA 4UNOA 1DU0A 4EV0A 4GGGA 4LLGF 4ZYAA 2DFBA 4IEZA 4EGZA 4A3BJ 2WINB 3CP8A 1OOPB 4CEWB 1A36A 3TO7A 3ILNA 2K9NA 2CYYA 1RNLA 2Z1DA 2JK3A 3U75A 1F4AA 2VQGA 2UWAA 1QH6A 4QB2A 2DK5A 5C9AC 3QP5A 3SEQA 2VNVA 3N05A 4I76A 1ASJ2 2QFEA 2YGMA 2IS1A 3T08A 1RL3A 5IYDJ 1HQLA 1PX3A 1BR4A 3R6SA 4YZ5A 2J1RA 3CCVI 2VZ1A 3MWMA 4EYUA 1DIWA 1JE8A 4UUTA 1QJEA 5E79C 2RS53 4PDKA 4LT5A 2IZWA 1XSQA 1ZLKA 2QQMA 3NJZA 1R5GA 4QX5A 1UMIA 2P0WA 4LG0B 1SC7A 2XL7A 3JCIA 3MFAA 3VBHA 4QB6A 3VN4A 1GSLA 2ARBA 2NNYA 5FKKA 5IAXA 1TQPA 2VCAA 3MLJA 3IDEA 4B4RA 1FATA 4Y20B 4XCAA 4JTOA 2X6OA 1IXSB 1VBE2 1I3QJ 2H09A 4XJZA 2Y8KA 1POV0 2EA7A 2JVGA 1W9WA 2WV0A 2KA3A 1PUFA 5LEKA 3AG2H 2R061 2I5UA 2K2SA 1AHSA 2HS5A 3BG7A 4BBRJ 4F92B 3S5QA 3IBMA 3I97A 5IVBA 1QPMA 3DCQA 3L7WA 1ENRA 2HWVA 1WZ2A 2P5LC 2A6YA 3T2OA 3POIA 2GBYA 4DXTA 4I09A 4R1HA 3G6EI 5FZMA 3HEIA 4IEVA 3PURA 4Z2WA 4P9FA 3DN7A 2XG3A 3HOSA 2LBFA 1OYIA 3E0JB 1YFXA 4MHGA 4LJHA 2FCTA 1IN7A 1MSFC 3E6BA 2YMZA 4XL9A 3RKXA 1W2TA 2RAEA 2VBPA 3WODF 1MS0A 3CMAI 2HVSA 1VTNC 5L7OC 4LNVA 1FXZA 4NMIA 5C4WA 4DYQA 3KT1A 1R64A 1CQ9A 4BHCA 1F31A 1TWFJ 3JU9A 4L9VA 2ESHA 4LLNA 1JOPA 4M6VA 5IP6A 4URTA 1JKQC 2X6YA 1G9CA 2GC2A 3OY8B 2ZJPF 5FRAA 3FK7A 2FMLA 5C8CB 4W6WA 3ILRA 1W03A 4URAA 3ZMOA 3POWA 3SKJE 2OQGA 3WHTA 1VRH3 4UUSB 3KGLA 4YZ1A 1XMXA 3WTSC 1F36A 1TBXA 3M1EA 4X8PA 1NOVA 3G6JB 1QU3A 3ACFA 4EJRA 3POFA 2HWE3 1J59A 4YG0A 3OBRA 4B7KA 1J3QA 1Y4WA 1WLWA 3J7AO 2FDKA 1GP6A 4KT6A 4FO9A 4LE4A 1WKYA 1NX9A 2PXJA 2M3AA 3KP6A 5GJ6A 5CA6A 1OJLA 3BC8A 2HQ5A 1QIQA 1US2A 2HYFA 1QJZA 3WG9A 1ZRIA 4NN0A 3QOEA 2VUDA 2I8DA 2VJ5A 5F64A 1HXS2 2AXLA 2VUCA 4LB5A 3QPHA 1WD3A 4GAZA 4EN8B 3WLUA 4DZPA 1AYM3 2ADDA 4LBJA 1VBC1 1WI3A 2CV0A 2HKOA 2W68A 4LO7A 3DEEA 1AYN2 1SLLA 4AVVA 2PHUA 1QHHD 1QJU3 1C3HA 2W95A 3BCAA 3PUHA 5ILUA 2HKXA 2RREA 3WINE 2XAQA 4SLIA 4Q27A 4C0BA 1OVPA 1QY4A 4YW6A 3AG1H 1SVLA 3NKGA 4K40A 1X2MA 4J6GA 4ZS2A 4OYUA 1TWAJ 3VYUB 3S7EA 2LUWA 2DFIA 4CXWA 3SEZA 4GB32 2P8TA 3L09A 3PL0A 2R7XA 4CDXB 1QKQA 2D97A 3BDDA 4AK3A 1OCRH 1SEUA 2D6PA 3CUQB 3W2AA 1UU5A 2EIKH 4L9NA 4GQ7A 4EJWA 2IAIA 1TP4A 5FZAA 5GADJ 3ZPLA 3N7JA 4KJZA 3GNEA 4FFHA 5EYRA 1K3IA 4D7MA 4X6QB 4GD4A 1HKSA 2WIIB 2VKHA 4MGKE 2A6VA 1PO11 2PLV2 4RL7A 5AVPA 1RUOA 4MGIE 2M30A 4QLCU 2WLPA 3TBDA 2AR6A 5C9AB 1AR63 1WJEA 2OTLI 4WM8A 3EMRA 4WX9A 1RC9A 4A3CJ 3ZFFA 2V1UA 5KXCA 5FYCA 2FRHA 1M06G 2MABA 3KLOA 2K9SA 3ZOIA 3KP3A 1OLQA 2STWA 3URFA 3C7OA 1CX4A 1COV3 3O0XA 4IOCF 4CRQA 4ISRA 1YRZA 3KLNA 2VMIA 4YIFA 4KBZA 4WM7A 4XDOA 4CU9A 4D1QA 2QM3A 1ODDA 1V00A 4IF4A 1RUG1 4WZFA 1DLCA 5FMOS 3WZ1A 1JTZX 4LK1F 2Y0SA 5C4XJ 2KMUA 1J83A 4AIHA 4UY8I 5DDJ3 3GTQJ 3ZN5A 4ARXA 2PHTA 1J5YA 3M8EA 3F8CA 5KR7A 3RZDJ 5J3LA 3NWKA 2JENA 2X29A 3BZCA 3ZQCA 2AS5F 1NA1C 2BGOA 3FN9A 1U3EM 1P2FA 2HWD1 5DD4A 5FYUA 2XXZA 3O7OA 2EFQA 2PHLA 1XYPA 2FBKA 1XU2A 1OPMA 2L9NA 2AHQA 1QZYA 2XC7A 2PMZA 4D7TA 2Y2ZA 5GLTA 4UW6A 1L7LA 2A6XA 3TEWA 2YFZA 2VMCA 4XOPA 2M87A 3PVEA 3BTZA 4HFSA 4PJMA 1ON2A 4I6ZA 1QJX2 1EV7A 1CAWA 4CEYA 3OBZA 2UZKA 1S0GA 3IB3A 4J1WA 4QGMA 1A78A 4HSRA 1BBYA 2MD5A 1GKBA 1HB3A 4EM2A 1REEA 4BWOA 3SZTA 4IE0A 5EWSA 4JTNA 4ESFA 4XMYA 2NYXA 1DQ2A 1OQ1A 5J1XA 5L7OB 1SHWB 1YRNA 2GMEA 1RUH1 4ZDLA 4XDPA 2YU3A 4AIKA 4E7ZA 3CZJA 1Y6IA 5BNNC 2YC2A 1YS6A 5EJ3A 2VVEA 2XAUA 5E18F 4CE8A 5DXDA 1NXMA 1QF3A 2R063 3CJXA 3ROUA 3POJA 1HCRA 4P08A 4KH9A 2M8GX 1BA5A 3P5BA 5FY0A 4IXLA 1IS4A 2IXCA 2RJLA 2W3JA 2VG9A 1GXQA 4CUGA 2HH9A 1OA3A 5JZGA 3VDDC 2LSOA 1GU3A 2F4PA 1RUF2 4W8JA 1UKGA 3ZKUA 1VLNA 5EGOB 3HNMA 5CVVA 1RINA 2XF7A 2JSCA 3M7GA 1DZRA 2VOVA 1JI6A 3WTWC 5L9RA 3OEBA 2NYYA 2VC9A 2XPWA 3H36A 4FXGB 1D4M3 4C2TA 1APNA 2WBKA 3LE0A 1D5YA 1RUI1 4U0YA 4CCEA 3PU8A 1N1SA 2R072 3I3QA 1ZN2A 2R7WA 3DYPA 4PLMA 5C7GA 1GT0C 5FY1A 1IDZA 5JLWA 1XE0A 3D4KA 1U2WA 3M8JA 4BHBA 5BMZA 2P5KA 2GZWA 1UL9A 5IVYA 2VXZA 1RC6A 1OQYA 1FLIA 4E8CA 4JVAA 1J3PA 2JX9A 2VUJA 3R05A 4OIRF 2XR4A 4EMSA 1O3SA 3LQQA 3AKPA 4Q0PA 3Q8AA 1ZGWA 3DXUA 3NQOA 3T1MA 1L7QA 3ZIWA 2FA5A 5J47A 2WS91 3CC4I 2BGPA 3FKJA 1K61A 4Y3OA 3BR5A 2LG4A 4FPYA 2V7FA 5C6CA 4G12A 2QA4I 3OTFA 4J19A 1POQA 5FWJA 2JIJA 3LDRA 1H8TA 1WCDJ 3KYCB 4D6QA 4DO0A 4K8RB 3LWCA 3JBG1 2VZUA 3NNJA 1RUJ2 1FBSA 4K2EA 1R091 1VPHA 3D5RC 2HXOA 1AXKA 3ZMDA 1YFWA 3RI4A 1D4VB 5H6QA 4EM0B 2XUBA 3DCFA 1Y56A 2OVUA 4KU8A 1RR7A 3K9TA 1SLBA 1LOEA 4A3DJ 1U9OA 4WVWA 3W5NA 1Y0NA 2QUFA 4AVAA 3A0BC 4ABZA 2FCUA 2D3SA 3FXRA 2V26A 3TQNA 2L0KA 1AXYA 1S2EA 2KRCA 1P92A 1YJWI 2QZ2A 1RHI2 5FZOB 5I0UA 3V64A 1GVDA 2QBYA 2MEV2 1X7NA 2R93J 2PHXA 3TW7A 4D94A 1Z9CA 2AQFA 5IFPA 3B94A 5LWBA 2VTFA 1ND2A 5JXJA 1SPPA 3SCHA 1J1TA 2NLRA 4O5VA 1DQUA 3DF0A 2WNOA 3MLKA 4AI2A 4B09A 1OXCA 4PI0A 4BOWA 5CB7A 3SDBA 3BYWA 1X8MA 1X9TA 1H8VA 5L3GA 1V4RA 1N1TA 1LFBA 3QU6A 1XN7A 4AQ6A 1FY7A 4XXPA 2CV2A 3B5LB 1PK6C 2PQQA 4NIIA 4QX2A 1PO13 1Q8SA 4IO9F 2CWEA 3H8OA 4WBBA 1NA1B 2KM2A 5F04A 3ZN1A 3KCYA 4XN0A 3ES1A 2CUJA 4KT5C 4XUPA 5BPXA 1ITYA 3DBHB 3VSLA 1YI2I 2H0VA 4YARA 4N43A 2HDDA 2VMFA 3Q0UA 3FLRA 4BAYA 2DA6A 3M1CA 1Z3XA 1O8SA 4KGQA 5A32B 3RGBA 1GV9A 2D6MA 2COBA 2JIGA 4HAMA 3S16J 4NROA 4QPIC 1C28A 2VU9A 2VCCA 3U11A 4OU0A 2VBYA 4Y1YA 3TDUC 5A3PA 5HV0A 1SVMA 4BMEA 4BQAA 3AXDA 1HDPA 1UZYA 4DINB 1OLMA 3ZXDA 2BE5F 2VZOA 1ZARA 2GP3A 1GICA 2DV9A 2XJUA 5L9BA 4C90A 1G59A 3DTEA 2IC1A 3H42B 5IT9Z 2STTA 5BNNB 2MW8A 3QH6A 1RUC2 1W36D 2IS6A 2YPJA 1NY72 3ECQA 4AGGA 3LA2A 5DAXA 3KMHA 1Q1HA 4CCKA 3A01B 1E17A 4META 4E4HA 1RKWA 3H7JA 3KCCA 1PO21 1UD1A 2CV1A 1X1CA 3ZN0A 3MMYB 1O91A 1LE8B 4CPBD 3T1LA 3FZVA 4BY1J 4ES8A 3VDDB 4OI2A 4ZU5A 3VD5A 1IRFA 1G8WA 3DXTA 1OPOA 4A3MJ 3E97A 4QQLA 4PQ9A 3J81K 2Y6LA 1QU0A 1YIOA 4C9YA 2IXLA 2DT5A 2M1BA 1PP8F 1LRHA 2ZNYA 3OUJA 1IZ1A 5KC6A 2I45A 5DG1A 2NN8A 2E19A 2E7QA 2OZ6A 3M3IA 1SFOJ 2WQ8A 1VBA1 1BM9A 3ACLA 5CG9A 2RM21 1IQDC 4OCTA 4IV3A 2C0ZA 4LTAA 1ENXA 4E27A 4JV4A 1ZGJA 3ES4A 5FYMA 1FWZA 4W50A 1OD5A 1Y9QA 5DDGA 5GKAC 3KP5A 2L7ZA 4NNJA 1HIXA 2MHFA 4M3EA 3AC0A 4E4SA 3OUIA 3PL8A 1TWHJ 1ZX5A 4N9IA 4W4ZA 2BOIA 5D4SA 5FYSA 3FMSA 3C7EA 2IGNA 1X4OA 1NZCA 2LY2A 5FKBA 1S5LC 1R23A 1W9FA 1POV1 4QU2A 2GA2A 4U2AA 1W90A 4S0HB 5A3MA 2XAHA 4BK4A 1PHMA 4PIZA 1WW5A 4BA6A 4XJAA 4AIDA 1TC3C 4XF3A 3UT0A 3I9V2 4G6QA 3J4UH 3O1OA 1W06A 3GFLA 3SZPA 1W8OA 3UK9A 3I58A 3FHNA 4KIBA 1WCUA 3JD71 1VR3A 1HBXG 2VE8A 3COAC 1VRBA 5FKLA 4Z6YA 5HODA 1AJOA 4UV9A 4E6KG 1P4AA 1EYBA 4XETA 5E8IA 1I5ZA 2CU7A 4AVPA 5ICFA 3SMHA 4FOVA 3PJRA 2JDKA 4K20A 4FFFA 1HKDA 1CAXA 3I49A 5CFCA 5DCMB 3AYAA 4DUXA 2JPBA 5CAZA 4LGWA 1IS5A 1BIAA 1XNCA 2M4GA 2CYFA 4AC0A 4A3LJ 2ZHNA 1DDLA 4RN5A 5T52A 4O65A 4QWNA 3CJIC 2WBMA 2OQ7A 4TLFA 2FX0A 3C2UA 5EEAA 3VDBA 2ZABA 2LKPA 3ZKYA 3GJAA 4XF0A 5K0UC 4XMAA 1W5SA 2FBIA 3SZGA 3KQ4B 5FYZA 2NMOA 1ZNPA 4LBMA 3BPSA 3R61A 1R093 2E7TA 3F8FA 3MPPG 3MFKA 1XYNA 4HSJA 2VODA 5BNQA 5GLZA 1PK6B 2D7FA 2XAJA 2XWJB 1SLTA 5A7PA 3A22A 3HOWJ 5J1UA 1BK1A 1JHJA 1CVNA 2RNJA 1KDMA 4IHVA 2Y69H 4UBHA 4C1WA 1TNFA 5J37A 4WWCA 3ORJA 5F5AA 2OS2A 3V0AA 3D5LA 2EXKA 4HK8A 1H30A 1FNZA 3LSDA 2WA3A 1GMMA 3VBRA 4MH0E 5IPAA 3HRUA 2Q2EB 3RKYA 3WTVC 2P2KA 4MOAA 3HPNA 2RC4A 3MN2A 1R6RA 1PVC1 2JICA 4A3JJ 4IERA 2WO7A 4QPIB 1NE4A 4CZCA 3CZUA 1JTXA 2Y31A 4DQAA 2CHHA 1HDKA 4KN7X 3R4KA 4LOTA 2D2WA 3CO6C 3AKTA 4K6BA 1K5MA 3ON7A 3OOPA 3KYDB 2HWB2 3BJAA 1XQNA 1PDNC 4AYUA 3AG3H 5IOZA 1GP5A 4ISQA 3OIPA 2WFF1 3MKYB 3CCJI 3K4DA 1GOFA 3KGZA 4C3IJ 4QM9A 3WNOA 1AU7A 1JI8A 1Y3TA 3NRUA 3OYFA 4FETA 4BY7J 2HWE2 3X2QH 3ATGA 4ES9A 1JMUB 2WSVA 4ENJA 3AVSA 3BODA 5KHKA 3RQ4A 2VXRA 1RKTA 2ZX1A 1BI3A 2BV6A 5EEGA 2EZKA 2A3SA 4RDUA 1NLSA 3PUQA 2M8EA 2EPFA 4MLOA 3H8UA 2PHRA 1GXPA 3HHHA 5B3SH 2IXJA 4YNIA 1UXXX 4CZSA 5I8YA 2G7HA 2Y64A 3BOQA 4IDZA 3WNLA 3WU2C 1Z78A 4RB2C 2HWF1 1UCXA 1XMAA 2BTVC 2GH8A 1ST8A 1QQP1 4G7OF 1YFYA 4OUSA 4DS0A 3OCPA 3S0MA 1N25A 4QGNA 4AWDA 5HDKA 2QQ8A 2KHMA 4E7LA 1RB8G 2MD0A 2DCJA 3POBA 2IP2A 3K6GA 1Q1VA 4GWJA 4DZGA 2XUEA 2AGSA 3T3YA 5HNHA 2G19A 3IAM2 2GNDA 2DOEA 4O3MA 4IGQA 2BY0A 2R4GA 2JVHA 4I0WB 2TBVA 3K3OA 3LB9A 1SQ4A 4HW0A 1ZBE2 5FREA 1H8AC 3GWZA 2ZXIA 2ZXJA 1VBD3 1HQWA 4DUVA 1HF0A 1UW8A 3QODA 3L00A 4N7UA 4YZ3A 3H9JA 4Y26A 1AKHB 1O3RA 2CQ7A 4MGRA 2BBAA 5FZIA 2JA5J 2HWC1 3PQJA 2TUNA 5DM7F 1AA7A 3J80K 5LBEA 2ZGTA 4XORA 1VBA3 5AFEA 5F08A 3H7YA 2PELA 3W6JB 3JRGA 4N4NB 5CKMA 1C5HA 3DPTA 1BEV1 1JJ8C 2FDFA 1DFQA 3EETA 5EJCA 3BZ6A 3T0AA 1EPWA 1W05A 5CG8A 3PO3J 5JSRA 1W2AX 4YLZA 5DS9A 3GGLA 1PIV1 1NG7A 2C6YA 5C70A 5FZ3A 1COV2 5E3MA 3EQEA 2I74A 3HSEA 3IH4A 1ND3C 1UY0A 4G94A 5C3SA 5LBCA 5JLXA 1S6LA 3VZNA 3REOA 3CJIB 1XNKA 2LS6A 3ZYGA 1YHFA 2JXAA 1OLME 1Z05A 1R71A 1C0WA 1EP0A 1B8IB 1MS4A 3PIGA 3PVBB 2V73A 1IRZA 1IS3A 1SANA 2OD5A 3I71A 4I30A 3EDPA 2VBDA 5K0UB 5FD6A 4A42A 4X0GA 4AFBA 2KDOA 2OPWA 3ZFEA 2QJVA 4OUEA 1AF9A 3M4OJ 1Y39A 3JD73 1LODA 1C8M1 1UU4A 3CBNA 2TCTA 3WG7H 3WGGA 2LW8A 2H8RA 3W59A 2MG4A 2WKKA 5F2WA 2LF7A 1XNAA 3F95A 4KWUA 4PZJA 2CUEA 2JB4A 1G3WA 2E1OA 2CDPA 2DA4A 4O9GA 4AM3A 4QHOA 2ZPXA 1UF2C 5F0HA 1WPKA 1C8NA 4BQ2A 2L3DA 4L9BA 2Q8EA 1LKXA 4CA9A 1LOFC 2OUJA 2E51A 4IEQA 4GWMA 1ACCA 1Z91A 4HBNA 2HBTA 4Q0UA 3WHUA 5FY4A 3PUIA 2JDNA 4Q0QA 2QKMB 5A3LA 1W2UA 1MGTA 5JHFA 3OS2A 2QQ9A 1LEMA 4PSWA 2OCEA 3Q8CA 4XQ4A 3IP4B 5JXGA 2D93A 4CXXA 5M5YJ 3LWFA 2R7DA 3LDKA 5HCFA 3IPVB 4QQPA 2Q8OA 4QPQA 2Q30A 3FMQA 3PNVA 4XR6A 4FX4A 1NK2P 3NAUA 4A5NA 4FPKA 1FZPB 4Q1PA 2VKDA 2DF7A 4LOCA 4XC9A 3ZXLA 1QJY1 3FLPA 5CBLA 2VZPA 2UXNA 3K1PA 1IG7A 1OBNA 1T56A 3O12A 4KUMA 3ZRGA 2HEOA 2R7SA 2Q0AA 2OYZA 3ZXEA 3DPRB 2BVMA 4AEKA 5JVVA 3WQ0A 5JCTA 1BL0A 3VBHC 2BNNA 4QPGB 5M5XJ 3HYIA 2Q1ZB 1KU9A 4UFHA 2W24A 2HTSA 4L5EA 1HLVA 3I3DA 4DXRA 4GALA 3S3NA 4XUTA 4A3ZA 1R083 1D5VA 3MUY1 5JHUA 1TEIA 2PAEA 5J98B 2NNNA 4YW2A 1LAJA 5IOYA 5CISA 1S0BA 3LA7A 1UMQA 2EH3A 1D0HA 5IP9J 2Y9ZA 4MIMA 1RMU2 4EQVA 3LSGA 1VBB3 1OF4A 4CDQA 1SFKA 1FIPA 3MHZA 2WFF3 1AR71 4MNUA 5H9RA 4OZXA 1I1GA 4RBOA 3I3EA 3RZHA 3QYFA 4XRMA 4CH7A 1QOTA 1FNNA 1V3FA 2GM4A 2B63J 2VOKA 2O8KA 4YGDA 2R3SA 1K4TA 3DEMA 2KL4A 2L54A 3ASIA 4ENNA 4AU7A 3I2HA 2O03A 1OA4A 1YJLA 1RYYA 2KIQA 1QPIA 2XLFA 2YUEA 3TN93 5TGTA 4DPNA 4OHXA 2MSYA 4Q1RA 4DIQA 3N7MA 4D3WA 2ME6A 5JOXA 5IT6A 5C4WC 1V6NA 1P4WA 5E3OA 2YUSA 4X1EA 1BJQA 3GZ6A 1ZLJA 3FFQA 1VBC2 2VMGA 1X3ZB 1W6PB 4DY5A 1QQP3 2NOGA 3QPTA 2QQIA 1G3TA 1KZHA 1U9NA 2YY1A 2FMYA 1YW9A 4DOZA 2IFRA 1OYWA 3WG3A 2AACA 4A41A 3OIOA 4M3CB 4AQ2A 1DGWA 4RGUA 1XC5A 5FMOL 1LKNA 2W48A 3O6BB 3TO9A 2VQCA 2P6CA 3S3OA 4P5OA 5JOZA 3J9SA 1CZTA 3VKLA 5AFBA 2FBHA 1QHDA 2WZ8A 5FP3A 5HLIA 1R1ZA 2CUFA 1PMHX 1T2XA 1W1WE 3L2QA 4P02B 3OGSA 4HPKA 5L3BA 2Y6FA 2W1OA 2CWMA 3T0DA 3FBNB 1BW5A 4S05A 1IUYA 1HKQA 3TOBA 1UZ0A 3I2IA 3CLOA 2C1FA 5LBQA 2LD5A 5FOBB 1JN2P 3VEPA 2HWC3 3KLSA 4B3XA 4LLLA 2HQAA 4I0AA 2YX7A 2VQHA 3J7ZI 3OYAA 4C2MJ 3V8LA 3BU7A 1WW7A 1XNBA 1MS8A 4MADA 5GP9A 2C4XA 2QNKA 4Z8BA 2IEKA 4HDVA 1ETWA 2XBO1 3UV9A 1ZREA 5ACA1 3JXSA 3QPLA 3G1MA 3LSEA 1PIV3 4HN1A 4M4RA 3LNQA 4RAFA 2BU9A 3OPWA 4NO4A 1FOD1 5FAXA 3NJYA 1DYOA 1LEDA 4GO1A 2L02A 2W1SA 5F0FA 2DMPA 1LESA 2IGKA 4AI9A 2PQ8A 2W87A 1W6QA 2J22A 4QX7A 2VPLA 4FSJA 2Y9YA 2KZGA 1USSA 1RUG2 1UMZA 3ULQB 5F5CA 5HLGA 4AAPA 2VASA 2ZMEA 3OYHA 3M70A 4PF5A 1UJ8A 2DCKA 5LA0A 2AC1A 2JB8A 5GM0A 2V72A 1ZRRA 2KFDA 2VQ0A 4QX1A 3GBGA 3H5NA 3K4KA 1C8M3 3ZO0B 2PHDA 3DKXA 4NHKA 3MW4A 4WM8C 4MEYF 2HWD2 3ZFFC 3SITA 1IPJA 2Q8KA 4FBFA 3OL4A 4LD5A 3I2JA 3LEIA 2X85A 5J09A 5J7MA 1ENHA 1BQPA 3KZ4C 3AP7A 1I9RA 5LBFA 4HA8A 2C6SA 4WM7C 4M6YA 3VBHB 2J5OA 2EXJA 4HOOA 4MO3M 2V1XA 3C2HA 1S8NA 3WHBA 1UOJA 1OQEA 4BGDA 2OQRA 2DK8A 4IRHA 1VJ2A 4HT1T 4HN0A 5EV7A 3PMSA 4AFMA 3OPTA 3ILFA 2RS13 1OQDA 1YW8A 4XTMA 3MI8A 5BNPA 5BV6A 1CESA 4RGSA 5SV5A 4Z82A 1WGXA 1PUFB 4JBAA 1RUH2 3Q9SA 3H1YA 2H6CA 2O8XA 3VZMA 2ELHA 2Y38A 4C30A 3CCQI 4I0BA 1CF7A 3VHPA 3U78A 3FXLA 3RIRA 5IHRA 3G1LA 1VQ9I 5JDBA 2B9SA 3E6MA 4LUMA 3B69A 4IQPA 4PJNA 2W57A 2GC3A 1PVEA 1LOGA 1XJAA 4OIPF 4HNVA 3FFZA 2DMQA 4HVRA 3W6VA 5FLMJ 1QDCA 2GIZA 2VPRA 1MEC3 4P5HA 3AMQA 2D5HA 2LBFB 1FOYA 4EZHA 1AZDA 4M9SA 2VY0A 3HUGA 2RS31 2LTNA 4YVWA 2P5BA 3MIGA 3S93A 2DFCA 3OYJA 1FYLA 1FX5A 3M1HA 5GZFA 1CZSA 1O57A 1QXJA 2EZLA 1KFUL 4XW3A 1MH3A 3GYHX 5C4WB 3WGIA 3QU3A 2VT3A 2WA4A 1RUI2 1E5HA 4L97A 4S2DA 1JZ7A 5FYIA 1Y8QB 2DYRH 5F5IA 1RZ4A 1HV1A 3K51A 1JYTA 1CX1A 2DU0A 2XF6A 2DQLA 5K8SA 4AUXA 3OYGA 1KFXL 1VQKI 3IWFA 3HGYA 1UHSA 4GJYA 3IV5A 4IKFA 1JKOC 3F72A 2E5ZA 1D0ZA 5JZGC 1DYKA 3CP2A 1YX5A 2LVSA 4K1YA 2WAOA 1UY3A 3QH7A 5T3NA 5DM6F 1S0JA 3UGFA 2Y0SN 1QBJA 4JKKA 4PIXA 2OU2A 3H0DA 1W6OA 2WS92 3V65A 1GZCA 3BTAA 2EIGA 1RVF1 3LMMA 2OF7A 4TV7A 2DA2A 2DVDA 2RR11 2XVGA 4RS5A 2D6OX 3T0BA 1ZG3A 2WJSA 2CMPA 2Q1FA 4X6AJ 1TMF1 3JBG2 1U5ZA 4A0YA 1R092 3D3AA 2NVTJ 4COWA 3WF4A 2WNEA 1ZZ8A 2DVAA 2DYCA 4CXYA 1WMEA 3HSFA 2DFHA 2XOMA 2VTXJ 5H9QA 1U0AA 3B6AA 3OV8A 3AMMA 3QWLA 1SFNA 2ISZA 5FZ6A 4HOBA 3BIWE 1OCZH 2QQAA 1PJRA 4JX0A 3UJOA 1K12A 1RESA 2E32A 4OULA 4XNFA 4RGRA 3C7HA 4BLJA 3IL2A 5M3MJ 1RUE1 2WTEA 3I59A 2DT7B 1H0MA 4QXKA 5HCHA 2VVFA 5A7WA 5JLVA 5BS6A 2UWCA 3UKVA 1SAXA 5EQUA 2B9UA 2WL1A 4BQYA 3RI9A 3G71I 2V79A 3BR6A 4FCAA 2J1VA 3T09A 4RQPA 2V4JC 5B1AH 3KEOA 1H8TC 2ZGOA 3KZYA 1HA8A 3F9KA 1WZXA 2XONA 5D5WB 3BR0A 3ZQ7A 1IW7F 2VKVA 2HNHA 5FPBA 3LD8A 1YXWA 2HEVF 2ZXQA 1UY1A 2D98A 1XSDA 5DMYA 4HETA 2H94A 2X1DA 3F22A 4OQ9A 3Q8FA 2D1HA 1SD4A 2NZ9A 3ZQGA 3GW2A 2KIMA 4WM8B 2WSUA 4QT6A 2IUWA 3WW3A 2F5CA 3ZFFB 3VHRA 5FKCA 5F1JA 2X0LA 1GOHA 2F48A 3NO8A 3L1PA 3HNYM 1JZ2A 2XVCA 3F23A 3QOPA 5BNGA 1ULDA 5LK5A 2ZJRF 1QXRA 4M71A 1ND2C 2Q4SA 3LSIA 3K1MA 4YRVA 1KD7A 3ZR6A 5LFAA 1FOD3 4OUMA 3I2DA 3AL0C 4WM7B 1O6UA 1FPN1 3MBWA 3FBMA 1FYUA 1NH3A 5IYYA 3A23A 3T8RA 3ACHA 1P7IA 3ZPOA 3FXOA 1TL8A 1XCVA 1R00A 2D6KA 3PUBA 2E2IJ 5F0CA 4YSFA 4HF0A 1AR83 5CLSA 5J6XA 4AW7A 1O7FA 5K7FA 3F21A 4XFCA 2LFBA 4XTPA 4BJ5C 1S7EA 2VNGA 4NHXA 2VUAA 4N8MA 1W0OA 1JXSA 2HOSA 3OGRA 2DT6A 3B7MA 4H7MA 2NVXJ 4QMAA 1QQIA 1Y7BA 1ZRCA 2R0HA 1PO22 4N43C 3KP7A 1JHHA 1WRJA 4XQDA 3K4LA 4MGSA 2DW4A 1LTEA 1CAWB 1S2KA 3NNFA 3HOYJ 2Q5TA 1PM7A 4DYRA 1JYXA 1H6XA 5F8PA 3RPUA 2PJRA 4QWQA 4YW3A 3KB5A 1MR5A 2LH9A 3V7SA 2DUPA 5LCWL 2CNAA 4RAGA 3JW4A 1YRNB 2RDPA 2IS2A 2YPRA 3WOGA 4KBBA 3O3KA 3ELNA 3F8MA 1JUIA 3JQXA 5FJHA 3IMNA 1HRI1 2RM22 5BQTA 2JDHA 3H50A 1KQ0A 4QTRA 1W9YA 4XSZF 3K3NA 1DQ1A 4HG6B 5GPAA 4GWIA 4OI1A 1B72B 5FPVA 1NG6A 2WQ4A 1I3AA 3H3UA 5JZGB 1ZA4A 3UJQA 2P34A 3ZCOA 2XHKA 2XSDC 3OBAA 2ECBA 4A3FJ 4BBSJ 3PUAA 5GZGA 2A3XA 3RQ0A 3HEFA 4WK8F 3BUCA 2O1QA 1W8NA 2DVFA 3C3WA 2G9FA 2RS33 1HV0A 1CPNA 3AYCA 4OI4A 3WQ7A 2YU9J 2JDZA 5LB6A 1IG3A 5FDBA 2X53S 2JDAA 3VYSB 1VQ5I 3PU3A 1DGRA 3DBLB 2XB6C 1CD3G 4JC1A 2LLKA 4IV3C 1CZVA 2BW3A 4XACA 2BWAA 3ZN6A 4XXAA 2G0EA 4KWKA 3LOCA 4E8DA 1NCQB 3W3CA 4YGEA 3E1F1 4RHV1 4F93B 1X3WB 1Y9GA 4NC7A 2K85A 2L9RA 2JRMA 2ME0A 4RGXA 4OMYA 5DUKA 2VXJA 2CTVA 4CXFA 2JA8J 1NT0A 2VL4A 4PJ0C 3CCYA 1F35A 2XSJC 4PDWA 3S2HJ 5LGUA 4EGYA 2H27A 4AEJA 3AFHA 1RVF3 3IKWA 3Q9VA 1FMVA 1H8TB 2ZXWH 4RA0A 5LZ6A 2V6EA 2J1AA 1MBKA 4UF0A 4XFAA 1MJAA 2JQ7A 3IC7A 4E9KA 2RDNA 2KP6A 4Y33A 4YM2A 2Y75A 3AMHA 2QZ3A 3AMPA 1N47A 2DDBA 2OJED 4W6XA 1BJZA 5GLVA 3BOPA 4BNCA 3ZXAC 3LSPA 2JEMA 3L2CA 5JIAA 3ZLIA 1TW3A 1XGSA 2QBYB 2VMDA 5CFCC 1YFUA 4Q4W1 1J58A 1EV11 5FUPA 5A1FA 1QVUA 3L2HA 3I53A 2ELKA 2CL2A 4IESA 3GZEA 1ND2B 1IRGA 3FM3A 4M3FA 2LKXA 3GHNA 4YPJA 2QQOA 1N1YA 5FO7B 3CC7I 3AL0B 1PVC2 3H8XA 2FNAA 5D5UB 2YG0A 2XAFA 2FDIA 1MMAA 4KICA 2DXIA 2V5DA 4LLOA 1ZRDA 1YS7A 4NHJA 2CW7A 4WCGA 1GZWA 2XV4S 3VZOA 5HCAA 3ZFGA 5FOJB 1V55H 4WXHA 4Q4X3 2BXZA 3IH3A 2VI6A 4HX7A 2WV1A 4H3WA 3ST7A 2WFF2 3I56I 4A3GJ 1PMIA 4HONA 4QX8A 3WP3A 3BCWA 2J1EA 3AYDA 3H5AA 4N43B 5IP7J 4Z1VA 1Z7S3 1AR93 3VBRC 2MH9A 3R0JA 2D45A 4A7ZA 2Y6HA 1IKPA 1V9U1 4FVVA 1N77A 3M3OA 4P9YA 4QD2A 2F6CA 2NS7A 1FX7A 1VE0A 2ZHLA 3J81Z 4BISA 1JZ5A 3TEDA 5SV8A 4WZCA 1FPN3 4PK4A 1AL21 4JP0A 1RUD1 5FLVA 2RDSA 3MF6A 1NTCA 3GCMA 3AZWA 5DQ0A 3EUAA 1U5YA 4R9CA 3GCWA 4GRIA 1W8ZA 1K5MC 1W7PA 1OFCX 2EJRA 2W08A 2BNMA 2Z5UA 4QPOA 1JHNA 4I98B 2HWF2 1DYPA 1XXNA 1U5TA 1B9NA 2VC0A 2UY9A 2WFPA 3V0BA 2MYSA 2LC2A 5KBFA 3H3LA 3MD2A 5C5TA 1WFXA 3H5RA 4AXOA 2KJBA 4XYXA 1R1UA 4UFJA 3MO4A 4B3AA 1PZ9A 5LW9A 2XGCA 3D0JA 5HVQC 1GYKA 2EV0A 1YYVA 5KHDA 2R7ZJ 3R0RA 1RTVA 3DYOA 2Y60A 1XE8A 4XILA 4I99C 4IE4A 1TME1 3GXUA 3OBTA 4FI9A 3C7GA 2QQPA 3V56A 1WGPA 1R5HA 1Y0UA 2B46X 5L3CA 2MLGA 1S7OA 4HKWA 2ACJA 2JD9A 2GDFA 1T6BX 4FISA 2WYSA 3WVJA 3ACIA 3RZKA 1R7JA 4BDVB 2A07F 1D2SA 1NUKA 2IXIA 3N35A 4XMIA 3ZP5A 5IUQA 2A5ZA 1OPCA 3F2ZA 2WA0A 1ONAA 1AX0A 2W5FA 3F6OA 1LVKA 1OKRA 1XG1A 2CW8A 2QKLB 3DBRB 3K2AA 2B5HA 4YFWA 4JHTA 3S5AA 1W8TA 2EWNA 5LRRA 5I0TA 2L9SA 4BKXA 2HWC2 2XKOA 3BB6A 4ZU4A 3M2MA 1W39A 4B1RA 4IE5A 2FOKA 2XPVA 3JUUA 3VL9A 4UB6C 2KRHA 1P8JA 2WLQA 1XDSA 5IFTA 2LMDA 1E5SA 4MQVA 4Z07A 4ET7A 1A6QA 3SH4A 5E1WA 5IYCJ 2B7EA 1MNEA 2Y6KA 1YC61 3WF3A 4FTBA 5KXDA 1BEV2 3I7DA 4JGYA 1W8WA 5ANQA 1R36A 4FHTA 2JG8A 4GYIA 2HI3A 3M9AA 1FMD1 3RKWA 3VKMA 1X8EA 5KXBA 3TEZA 3HJEA 4ARYA 1W4MA 1AJKA 1KRIA 3D0SA 1UHWA 1V6LA 4I3PA 4HBLA 4BL0B 4DNCA 1LHVA 3WCRA 2V1NA 1PZ7A 1VALA 1W0UA 1JZ6A 3MPBA 5GAEJ 2ZZQA 3GF6A 4H2AA 1HJGA 3I4MJ 3HRTA 1U5XA 2DJIA 1X1DA 1ULPA 3O1MA 4IJAA 1Q8PA 1B6AA 1H2LA 3G3ZA 3DKYA 5H9SA 1EY2A 4XN3A 3J8F3 2C5DA 4FFGA 1LQ1A 2CY6A 3OOXA 2CAVA 5GLUA 1REFA 2J7MA 4ZS3A 4BXXJ 3RMXA 1U6GA 4IVNA 4FOYA 3VBUA 3NAPA 4AYBA 1ZYBA 4KNYA 5D2AA 5CKQA 2FE3A 1KYZA 2QQVA 4A44A 2FD8A 4CDXA 1CAXB 4IRGA 4KMQA 5CFCB 2QF7A 4XFBA 5DTDA 4K3UA 2YR2A 4RB1A 1Q8VA 2I10A 4UUVA 4AIJA 4R4ZA 3IAS2 2ZX3A 2QE3A 1UOFA 2VM9A 2E36A 3ZVXA 2XB5A 2GN3A 2EQRA 3FC0A 1SACA 4N53B 4I01A 1O4ZA 1BXHA 5TJJA 4ZKTB 4G9SB 3DWLE 4NIAA 2V9VA 3GFJA 3VV1A 1IN5A 2X6WA 3ZFEC 2JDMA 2WZR1 3P5JA 4XBNA 1C5IA 1YLFA 4YW7A 4Q4Y3 5FBJA 3H3ZA 5J3UA 5DV5A 3SEPA 2C9KA 5BYNA 1VRH1 4ONUA 1REDA 5IVCA 4KMUX 4GKXA 1WCMJ 1NE6A 1X1BA 5J36A 5EHDA 4LMFA 4FQZA 3EYPA 1QJY2 2XHNA 2ISYA 5FP8A 1YO8A 3V0AB 1SCRA 4RGAA 3NVCA 2O6GE 4Q4W3 3ZIXA 1FOWA 5T54A 1NCRA 3LSRA 1EV13 1NKGA 3VBRB 1MBGA 5E1XA 2K46A 2V4VA 4ASNA 3QBQA 1R1VA 2R16A 2E26A 3ZYJB 4CCNA 3O8HA 4IX7A 1JYCA 2HR3A 4Y52J 2ET1A 5FXVA 3JRHA 1VI0A 4A2UA 3WU1B 4M0NA 1V6OA 3UGHA 4Z92B 2ADUA 4OVEA 2G9WA 4II3A 2RN7A 1WLTA 3JRCA 4PI2A 1YJKA 4KDPA 1QJU1 1K5MB 1I1EA 3GVAA 1JKRC 1WA4A 4B4QA 3A4UA 3S1RJ 3EJKA 5H20A 3HTUA 1EH6A 5EJZB 5DUWA 4ZZ5A 2VQLA 4C3JJ 1ULCA 1SLIA 5HS8A 4OHWA 4DXZA 5JR3A 4CYCA 3N97A 4CUAA 2A5YB 3BROA 4KMFA 1AR72 5FZKA 4AFCA 5FCCA 5DG2A 2J1UA 3ZYBA 2OKXA 2BP6A 1LOAA 3QACA 2GP5A 4BACA 4IOAF 2GNBA 2NS0A 3FKIJ 2IGOA 4N0BA 2DU9A 5IK4A 2VNRA 1YW7A 1V9U3 4XPVA 3GLXA 3OSFA 4FTEA 2JN6A 1YQAA 3K2ZA 4ZYHA 4AZZA 4LHLA 1ETKA 4LEJA 2NVUB 2VT2A 1RUD3 4XIDA 4IHSA 5GAGJ 2LRPA 5IK7A 1SBFA 4GA9A 4XUQA 1LNWA 3CIHA 2O0YA 5EP9A 3MZHA 3WDVA 2CQNA 4K1ZA 2CQQA 1HB1A 1AR61 4J01A 4X6RB 3J80Z 4LO5B 3U1KA 3HB9A 5ERLA 1D0GA 4CDQC 2FD5A 3SYTA 1M4WA 2YDEA 4BE3A 4OMZA 2HZDA 4KIFA 3GXOA 3TL4X 4FT8A 4HLXA 2L9LA 4D6RA 3TEXA 2BY1A 1OISA 4B44A 2ZGKA 4JX4A 1H4HA 1RITA 1QEXA 4L8QA 4KWLA 1LGNA 1KJLA 2YSRA 1TME3 3TP0A 4Y1XA 4MXWB 3JRIA 2PQSA 1KEXA 1UAAA 1WCKA 4EE2A 5LK7B 4XFGA 1TNTA 3KM5A 2ZSHB 2AENA 2VR4A 3AXEA 5DDJ1 2CWSA 3TRSB 3WW4A 1T2KA 3S17J 3PTRB 3ENRA 3AG4H 3GZUC 5DUXA 4FP2A 3MW3A 2P7VB 4PJLA 4CP1A 3QAHA 2MA3A 5D8KB 1K78A 5HDNA 1AX2A 2HXIA 4FPHA 1VB2A 5DEQA 5JVTA 3BQYA 2NPIA 4XLAA 2YBSA 4A12A 3BQZA 2COMA 5A3NA 2O3FA 1CAVA 4BEHA 4ITVA 4FQ4A 1ZG1A 5JR7B 3N7KA 3FISA 4IV1B 3LEKA 3JRBA 3OYKA 3KT4A 1XSVA 2ILMA 2O8OA 2DA1A 3U1DA 4LO6B 1P6RA 2FQ3A 2XBO2 4XF9A 4IHWA 2XJSA 1WJAA 5ACA2 3S30A 3ZMNA 5D5XB 4R79A 3W5MA 2QVOA 5C3EJ 1ZBA1 1SLAA 1FMD3 3TW6A 4NBQA 5JIUA 2BUKA 1FOD2 1BC8C 5IJRA 2WO2A 3AP4A 3PVOA 3EYIA 4HQEA 1X4PA 3IRQA 5ILSA 3PSIA 1ULEA 4V1PA 5KNLA 3S8PA 2BOJA 1ZELA 4AQTA 4JYKA 4BMBA 3VD4A 2HYGD 1FTTA 1UYZA 3ZFEB 5FLXK 3EBRA 3ABKH 1APLC 1ORKA 5D5VB 1WLCA 1QWRA 1ZZ7A 2V4AA 1S0FA 5FPUA 1PM4A 1J0RA 3IDCB 5FBZA 3TOJA 1ETQA 2ZGMA 3HC7A 3HKZN 2JSPA 3K70D 1NQDA 4CDUA 4L18B 2HOEA 5DABA 4KGGA 2A6EF 2VBBA 2XQRA 4CP2A 4LBQA 4OAZA 3VDCA 3ZYIB 1LCLA 9ANTA 4H55A 3KV6A 1MW7A 1EJ9A 3BR1A 4IQ4A 2GU9A 3GZTB 1LDDA 1YFHA 1E5IA 1HSJA 5L3DA 2XJPA 4H0EA 1D4M1 2UYAA 5AC92 5C4JJ 4B4CA 4C0HA 3N9MA 5LA9A 2BW8A 4XHXA 3EO6A 1FEXA 2ZMKA 2ZMEC 4FASD 1ZM1A 2A6HF 2JJ6A 3U2RA 3RI8A 2A6WA 3MUZ1 2WZR3 3IUOA 3VUOA 4R4XA 1YX3A 5GTHC 4NWVA 1DPRA 5K4LA 4ZZ8A 2NP0A 4BHPA 2M34A 3JRDA 3BT9A 4PIYA 1VIWB 4U87A 3FK6A 4MFEA 5CJ9A 1UIKA 4H7LA 1Q8QA 4L11A 1SDWA 2DN0A 4SBVA 3FBYA 4L0ZB 5EXOA 1RGSA 4BK5A 4Q8LA 2R7OA 2RMU3 1BKZA 2HU9A 2P3JA 1Z6RA 2F17A 4ZTJA 2NMNA 4AL9A 1KQRA 4E4DX 1B09A 3D5SC 3AKZA 4GKYA 3P3PA 4HVOA 3KP2A 1T95A 2M9HA 3DF8A 4IE7A 2CUZA 1UY2A 3IAPA 3WCSA 4UB8C 5E8AA 1D2QA 2XL9A 3DQVC 1J75A 2ZCWA 4RM2A 3CF2A 3CJRB 5BNPC 2HFHA 3TOAA 4QKBA 3LSMA 3KZIC 1K83J 1UN1A 1UELB 3BALA 4XAAA 4YM0A 3SISA 1J9IA 1OHFA 4YFKF 2XDVA 1BBT1 2ES3A 3A0HC 1CAUA 5BPDA 2F5EA 4LFUA 4A69C 3AJYA 5JSPA 4XIOA 1OMIA 1XSXA 1TNSA 1FYMA 1LE8A 1R1TA 2R5YA 3UKGA 1MZFA 4DGWB 1GUIA 2F4MB 2K4BA 3MZ8A 1OURA 3PNYA 2AH2A 1MBFA 2ENRA 4AR2A 5F3IA 2OBPA 2B45X 1XC6A 5M0TA 4XKCA 1NQJA 1AWCA 4R9AA 5F6KA 5A6YA 3OPZA 2NS8A 4L2NA 4YVWC 1HW2A 1VBE3 1US3A 4QDSA 2OZJA 3ZSJA 3LFIA 2CQKA 3PNAA 3M7AA 4LKSA 2WABA 1LU1A 1VAKA 1K4SA 2RR12 4IEYA 4Y1UA 1MMDA 4Q29A 2RHPA 2Y33A 1T6SA 1TMF2 3IWZA 1UWWA 3NJXA 2K9QA 2EIMH 2LNBA 3IAQA 3K1NA 3M3EA 2Z69A 5HS9A 1YLLA 1FJLA 4YVSA 3O0VA 3WG1A 4WXDA 1BYHA 2BVVA 3FUOA 3SDGA 1X58A 4RB3C 2K5CA 3BWGA 3D1NI 1RUE2 4M9XA 5A80A 2FHRA 1F9NA 1GBGA 1GNYA 1XSRA 1ENQA 2G4IA 4NC6A 1W2NA 4COYA 4QAWA 3ASNH 4NQWA 1UFMA 2P3KA 3K4JA 4ASLA 3L2YA 1CONA 4YWAA 4YIIA 1RR8C 1G2HA 1R58A 3E6CC 2R071 2VONA 5BOXA 3KE2A 5HXVA 4HPKB 4UWDA 4RS5C 2JMWA 4ZDOA 4IPAA 3WSOA 4A93J 2E7XA 2WO3A 5F3GA 3HOUJ 3ZGKA 2ZB9A 4M3CE 3C8XA 1XGOA 1JZ4A 4D8MA 1HRV1 3VBSA 1L0OC 2BYVE 3RYPA 4BJ0A 3RZGA 3WNKA 5F9TA 2RVAA 1H6YA 2J5PA 5FYHA 4II2A 1PGW1 4XZUG 4A45A 1UZWA 1ZKGA 3AL5A 3OGVA 3D6EA 3T2TA 1F4KA 4K8FA 2CU5A 5FPAA 5DZGA 2OCCH 1EUTA 2ATFA 1FYKA 4YIRX 3Q0VA 1FV3A 1PMJX 2XAGA 5I0DA 2IXSA 2R32A 3D82A 2A68F 4P9LA 1TE1B 2M7BA 4E7KA 2HVQA 3J7NA 4QDRA 3O8GA 3K4CA 1SFXA 4YRDA 4LOSA 2VE9A 1HXS3 5CVJA 1LVAA 2XLGA 5C3QA 1ZBA3 5H2FC 2RE9A 1XOYA 1RUJ1 4RQPC 1W0PA 2ZJQF 3VBFC 3MVPA 2XJRA 1RPWA 1LFPA 3MAJA 3CCEI 2ZMEB 2EFWA 1NYWA 3A4CA 1OLRA 1IC8A 3OYIA 3RZLA 2XMLA 2FDJA 2E33A 2ZGPA 5KC5A 3UR3C 2CV6A 1GWLA 1QOOA 3LCPA 3ACGA 3LSTA 1FMWA 3FUQA 4Q4V2 1WWYA 4A3XA 3N36A 4NPRA 2ZBKA 2HBUA 2UY8A 2L4MA 5FB2A 4CYDA 3HN3A 3C1DA 1G8XA 2K9LA 4A6EA 4PCQA 3KZZA 3FXQA 1X36A 1FP1D 1IGOA 1FAYA 5KAFC 5LATA 3DPLC 1FTZA 3I4IA 2P6SA 4EJVA 4IZZA 3OL3A 4XBFA 3WG4A 4PQQA 3H0OA 2R042 1KDKA 1G3SA 3T2PA 3CMYA 4F55A 3NJVA 2WAFA 3S7IA 4TN7A 2PLV3 1QNTA 3CLPA 5JFRA 5BNPB 3GYDA 1R4NB 4DXSA 3PUSA 5IVVA 1V6KA 4FQGA 2E34A 1O8PA 1CF7B 3BTXA 1N3PA 3BI3A 4IW3A 4LQRA 2OZUA 1I27A 5B4NA 1QZZA 1HRI2 1LECA 2WC2A 1ZR4A 1SVOA 2XASA 3PIOF 2TNFA 1ZAOA 3VZLA 4BB3A 2ZX0A 1S0EA 5M5WJ 4B43A 3VB9A 2P6TA 2BQPA 1K42A 3FE5A 3ZM8A 3POGA 2FMDA 2K4JA 1ZRFA 2BVBA 2C9AA 2VQUA 2B8MA 2YYOA 3MLLA 3DU5A 1OC1A 2M2EA 1OKQA 2NM1A 4XDQA 2VUMJ 4XRSG 2A3WA 5FKMA 3HUGB 3DKWA 4P5YA 4YVWB 1UZZA 1ULFA 4XAEA 2W1UA 5E89A 1O4TA 3WR0A 4MSVA 3K70C 1IDYA 5CYVA 5J8FA 1NY71 4L92A 1BMV1 4NVPA 3HOXJ 4CGZA 3OD4A 2GXGA 1KONA 5LHGA 1YEWA 2X1CA 2Y34A 3NNMA 3OYEA 1L3JA 3LGRA 5CPRB 1BBT3 1L3LA 1LU2A 2R7RA 5A1AA 3VYTB 3U1XA 1UZVA 3P9KA 1Z1DA 4YGBA 1JYVA 4QSHA 1IV8A 2BRTA 5GZCA 2CFXA 1QJX3 1MNMC 4RHV2 3LFMA 3WW2A 3BCBA 3WT3A 1DP0A 2OUMA 4HSTA 3PVNA 1C1LA 3AFKA 3IDBB 1IF1A 4S04A 1MD0A 1ULGA 1W6OB 5GAHJ 4V2WA 1LB2A 1UZCA 4BU2A 5ISLA 2QUOA 2XB0X 3JSPA 2EXHA 4MTDA 4RS5B 4FCYA 3MFCA 3Q3SA 4Y5SA 1JJ6C 2ZGNA 3GJBA 2WWUA 1EPZA 5E20A 2DCYA 3GUDA 1GQHA 4MHUA 5DCFA 3OYNA 3CQZJ 4ZYEA 4AE2A 2YBPA 4CDWA 1VQPI 4XURA 3BPZA 3FZ3A 2XVLA 1XNTA 1RUF3 4YZ4A 2JT1A 1BR2A 4HXCA 2BV4A 2HYKA 1H89C 1EA3A 2WY8Q 3CCMI 3ZYPA 3ZQLA 4Q4W2 4A6SA 3GTLJ 3DPUA 1ZYRF 1EV12 1IN4A 3BTCA 4B1LA 4AI0A 4PFPA 3DYMA 4XZPA 4PDWC 2WWSA 5FTTC 4S2FA 1SFYA 1LHNA 4RQPB 2R073 3VBFB 5C8WA 4KL1A 3M3YJ 3JQWA 4P55A 2QLZA 5HI0A 4RAYA 2CDOA 5LD2C 1JGGA 1XTAA 4V2VA 1JXNA 2EA2A 4M01A 2D6LX 1YWKA 4DEVA 5BY5A 3MEPA 5I0SA 3CMEI 4IETA 3N3HA 2P5VA 3O1SA 4TYSA 5ICCA 3AP5A 1HRV3 2BHYA 3A7QA 1SMTA 4JKMA 3V8KA 4B8EA 2WNVA 2UXXA 4NUBA 3UESA 2ICWG 3NV1A 4CVUA 1VZ0A 2WWJA 1X50A 4KQ7A 2QCSB 2ETEA 3I4PA 1OUSA 2DO7A 1A8MA 2JG9A 4BH9A 3W9AA 1VBD1 3H9AA 2Y0MA 3A03A 3H1WA 1FT9A 3LPFA 3WDTA 4V19K 1S55A 3O0WA 5FD5A 3RKQA 2R92J 3ZXGA 2VQAA 4OOIA 3CHXA 2R7VA 2WAQN 1DQ4A 2WUHA 4CSWA 3CF6E 1RUJ3 1DGRN 1HSTA 2Z99A 1HB4A 5IT3A 3RSJA 3EUHA 2VZQA 1DLLA 3RCOA 3U4XA 2WYFA 1AL22 4LG3A 3IPVA 4QDQA 1NLQA 2M45A 1X1PA 2CS3A 1QOSA 5L36A 4P14A 3O1PA 2DQRA 5C5UA 2QQBA 3ZFGC 1UXZA 4CU6A 4QB1A 2FU4A 2ID6A 3O5SA 2PG4A 3E7LA 2OQ6A 4B3NA 2EINH 1RHI3 3DP7A 3ZMZA 1Z7UA 4I3GA 2LR8A 4MXVA 1SD7A 1IHMA 2JDPA 5FIXA 2MEV3 3AZXA 3OIQA 4YFXF 2H1LA 2CAUA 3ZMVA 3FJSA 3PO2J 1FOXA 1CPMA 2FXAA 3DPRA 2HLEA 3MDPA 1H2NA 3JTGA 2VZSA 3A02A 2P4WA 3BN6A 2ORXA 1WJFA 2K02A 4EVIA 2LDUA 1ALYA 3SH3A 4QPGA 5A1LA 1TME2 1WW6A 3HGGA 4LE3A 2HYXA 4BE0A 3WP4A 2WN2A 2VN2A 1GR3A 2IXHA 2GIVA 4QXCA 2PJRB 1HLCA 1XMKA 1FBUA 2HWB1 3JREA 3GDBA 4UFKA 1JBCA 1DGLA 4LMYA 2AO9A 4AVZA 4YG6A 2L7MP 4UV8A 2XGDA 4ESJA 2WT1A 5K5QA 4HDUA 1J3RA 5DZFA 5FFOC 1DUXC 4ZZDA 3LQCA 2CFOA 1U5TC 2CW0F 2HQRA 1SAUA 2J1SA 3HOVJ 3A2KA 2E6VA 5K9YA 1PYVA 3IT8A 2M4KA 2YFUA 2A70A 1U12A 2D44A 4FTHA 1PGL1 1MQTA 2E53A 3RZOJ 2RS52 1HC8A 4JDOA 4OMDA 3WNXA 1JTYA 4N4OB 1G7YA 5J4YA 3HTSB 3FHIB 2HEYF 2YB7A 5A3UA 1J2XA 3FXMA 4E7IA 3OY9A 1BW6A 1TQ5A 2UWBA 2A61A 2RKHA 4XFIA 2GAUA 1RXGA 1C57A 2WB1N 5DN2A 4Y7NJ 3WQ1A 2M0MA 4TWTA 1QHGA 3G1OA 2W82A 3R4DB 4U7DA 3DU6A 3JRAA 3T1BA 4E2GA 2VE1A 3RYKA 3N9OA 3EHKA 4KITB 2BW3B 2R0FA 3RS6A 2XLAA 3ZN6B 5FGMA 1MBHA 3ABTA 2IT0A 2ZZJA 3U07A 3USUA 3LEGA 3WF1A 3U9GA 1LDKB 2ADEA 4JGYC 1GDTA 2PAKA 4QKDA 4XICA 5EYYA 2K9ZA 4AGVA 1H9TA 2JG8C 1EAH1 1DGRM 4O7XA 1DDNA 4PFOA 3K0LA 2DBBA 3WE2A 4WVMA 1XE7A 3BG5A 1OUXA 1B4AA 3GF2A 1R081 2JA2A 3H3VK 2XJVA 1OVSA 4PDWB 2ZHMA 3KYLA 2QVSB 3EQLF 1DP7P 2EZHA 2GMPA 4UF0B 2LREA 4U88A 2GC1A 4QHZA 2A75A 1ACIA 1DPUA 5KK1A 4CPBA 1VBB1 1SDDB 2K40A 4BCUA 4WVZA 3A0NA 4C3HJ 1OR7A 4FP3A 4MV2A 4LHKA 5DPNA 3L2WA 4BXSV 3VBUC 3NAPC 3P3NA 5A7OA 4BDYA 5CQEA 1VRH2 3RZZA 4C1XA 1ETVA 4AWXB 3SC7X 2DMUA 2ZAAA 2VCBA 3X29B 1GUUA 2JDUA 4CDXC 5DYMA 3THTA 4CP9A 2X8KA 2W39A 1UKRA 4LJZF 3RSNA 4Q5SF 5HOOA 4OFGA 1FOKA 4UVAA 3TN91 1TNRA 5FLHA 3AFGA 1AHDP 1OYYA 2DVGA 4NAMA 4CCCA 5B5EC 4L5JA 1HW1A 4LIUA 3TP3A 3W20A 3W58A 3U0ZA 5JI6A 2PEXA 1NLRA 4NAOA 4E7JA 1X2NA 1AYM2 2R1DA 1KGYA 5EDNA 2WQZC 2QQKA 5F2SA 2GQQA 1GZWB 4HSLA 4CO8A 4NIDA 5DAWA 1YIFA 2QDRA 3ZFGB 1QJU2 1MZ5A 5EG0A 5DAVA 1XX5A 4ZZLA 3GLLA 2VO5A 2CQXA 3HOBA 1FV2A 2BPA2 4ETSA 3OYWA 3KVAA 3TBIA 1LEAA 1K7AA 3K75B 5GLWA 4PBPA 3FXUA 2F4IA 3M4FA 1Q8OA 4DQ2A 3O1VA 3HAGA 2A69F 4Q5OA 2BY2A 3ZXFA 3S1QJ 5FRNA 1LJ7A 1W99A 4QX3A 3ZPYA 4PGGA 3WE3A 2Z42A 1MZEA 1MPXA 4IUGA 2GA1A 4IQJA 3ZR5A 4JCKA 2CGOA 1JOBA 1WBLA 1WJBA 4Z2YA 3LFKA 1NCRC 2I2SA 3I8TA 2QQLA 5JSOA 1ZG5A 4D6SA 3ZXKA 1GNZA 3CNAA 1XNDA 2UURA 1MS5A 4PCRA 5FROA 3HG9A 3HT2A 3LKJA 2G9GA 4XM3A 5A33A 1V5EA 4F83A 4KIGA 1MS9A 4DY3A 4IEJA 5ICEA 2UWMA 2ZKLA 5HLTA 3OEAA 1TLHB 1W3VA 4XOGA 3A21A 1AX1A 2XKPA 4IHXA 1W7PB 3HRMA 1VQ8I 4AYBN 1CGPA 1JODA 1E3HA 1Z21A 1U5TB 3IHUA 2F4LA 2EFPA 4L0PA 1AR62 3V0BB 2JWTA 1H1AA 2EIDA 1OCTC 2VOXA 1D7PM 4RLFA 3SCGA 3K48A 2Q8DA 1TWCJ 5GZDA 3M07A 3THPA 1I39A 2WT2A 1BI0A 3ITQA 4LBLA 4AEDC 2R7FA 3ZMSA 3OSDA 3J7AY 4R9BA 2ZO4A 3WU0A 3GBFA 3PJYA 1KYWA 5FO8B 2DOAA 4G4FA 2MC4A 3GFIA 1U8RA 2KPMA 4EJOA 2LRDA 2JPCA 2BBYA 2HPIA 1ETOA 2XRNA 3TWIA 1L7RA 5KHIA 5DDJ2 2HWB3 2R7EB 1DP3A 3SCFA 2VPVA 1RMU1 3KF5A 1WJ5A 3SFIA 2XUMA 4COUA 4E2QA 4E7SA 4LA3A 1DBNA 3GTOJ 2CSGA 1U8BA 4AHWA 2EXIA 2GC0A 3J7LA 5LA2A 5HLHA 1GZ9A 4MYEA 2DCEA 2BZDA 3EUKL 2A73B 1WQ2A 3K46A 1MS1A 2F5DA 3VZJA 1IKQA 4S2HA 4S2GA 2JTVA 2LF8A 4JGYB 5DUIA 4LBKA 1DGWY 3Q8EA