2WC2A

Nmr structure of catabolite activator protein in the unliganded state
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
209
structure length
209
Chain Sequence
VLGKPQTDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYGTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CATABOLITE GENE ACTIVATOR
publication title Structural Basis for Camp-Mediated Allosteric Control of the Catabolite Activator Protein.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription regulator
total genus 38
structure length 209
sequence length 209
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2wc2A02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2wc2A01
5CJ9A 1T2KA 3KLNA 5K8SA 2K86A 3WODF 4KMUX 4MZUA 2V79A 3MPBA 3G3ZA 4CGZA 1GQHA 4NQWA 4RB0A 2GXBA 4FAHA 1P4WA 5FQ0A 3CUQB 2QBYA 2QVSB 1XSVA 2NNYA 1S7OA 4JVAA 2H27A 4O9GA 5BPIA 2DFIA 3CTAA 2OU2A 3D0JA 5CVVA 3FHIB 3LSTA 1J5YA 3MCZA 2DI3A 5L3EA 4PDKA 4XFHA 3HSEA 4AIHA 3GW2A 3E97A 2EK5A 3P9KA 3RKYA 4ZYGA 2VXZA 5D8LB 5BQTA 2BNOA 1LNWA 5JR7B 1KQ0A 4IEOA 5HI0A 3O3KA 2W25A 4WXHA 1XSDA 1JHHA 4MH0E 1A04A 1ZRFA 1STZA 2AS5F 1HKTA 4HDUA 3HT1A 2BNNA 3RNSA 2ZXJA 4XETA 2PI0A 3QRFF 1HW1A 1WA4A 1P6RA 3H50A 2EVXA 2NRAC 4HVOA 2HTJA 2IPQX 2B9UA 4JTNA 5IT3A 1YFHA 4KN4X 3G7DA 4G7ZF 2HOEA 2UXNA 4ASNA 3CEWA 5JSPA 4WCGA 5KHHA 2Q4SA 3VB2A 2VODA 3SXWA 4RB1A 4CDGA 1Z9CA 4P9UA 1TNTA 1P4AA 2GA2A 2PFBA 1WRJA 2BBYA 1XMAA 1XCVA 2D2WA 1XDUA 1IXRC 3EO6A 3TQNA 3TO9A 2PAKA 2XL9A 1ZG5A 2D45A 1YS7A 3IHUA 2VPVA 2K7LA 1HBXG 3KZYA 1XRUA 1XCBA 4A6DA 3SCGA 3EQEA 2EFOA 2ESHA 1H1IA 4FX4A 1XB4A 4UHTA 5K5OA 1BC7C 4WX9A 1MD0A 1GVJA 1ZH5A 3KEQA 4OINF 1U8RA 3BPZA 1WI9A 1QZZA 5EEGA 3C18A 4XFGA 4CO8A 3SCHA 5IT9Z 1OR7A 1UFMA 3GLXA 1TQIA 1D5VA 2K9ZA 3U9GA 3BJOA 4QGNA 2GXGA 4IEZA 2VONA 2F5DA 1HXDA 2NAZA 1Y0UA 1U5TB 4HF1A 2OZ6A 4Q47A 3ERED 1S6LA 3QPTA 4L0YB 3CUQA 4CXFA 2HZTA 2QYOA 1ZZCA 4U0YA 4XLNF 5IT9K 2EA7A 2Z3YA 2RKHA 3RKXA 2W85A 2PLYA 3KCCA 2ZMEB 3IBMA 3SHFA 4PGGA 4YSFA 3KLOA 3E5XA 2GU9A 4G6QA 2K0GA 2VN2A 4PIYA 3O6BB 5I0UA 4GYIA 1Y9QA 3O14A 2JT1A 3HT2A 2M30A 4PJYA 2WV0A 1E2XA 2HS5A 4YFXF 1RGSA 1MJAA 1QPMA 2BGCA 5F1RA 1FBSA 3R4KA 2W84A 5DUIA 3LQRA 2OQRA 4JV4A 4Q0PA 1ULYA 2L54A 3MDPA 2XVCA 3OV8A 3H3UA 1JE8A 2ZKZA 4OOIA 1PP8F 1BC8C 5CU1A 3WGGA 2H94A 1ZLKA 1BBYA 2P17A 4PIZA 3QPHA 1FZPB 3Q9SA 4HAMA 4G7HF 1X8EA 4Y15A 4AD9A 4XFCA 3HSFA 2IXHA 4LEJA 1J2XA 4IEWA 1DPRA 3BOQA 2MNGA 3KGLA 1ZREA 5FPZA 2RNJA 1ZGAA 4M71A 3J7AO 1X3UA 4DQ2A 3OD0A 5JR3A 2BV6A 1USSA 4LA2A 1K7AA 4Q0SA 3HRUA 2ZJ2A 5ED4A 4HLTA 5BXXA 1LDDA 1J9IA 4Y13A 4EWEA 3M70A 3NRVA 5ICGA 4LA3A 2XAQA 4U0WA 2VC0A 1O3SA 4IHSA 4R1HA 2GC2A 4OMZA 2CWEA 5LGUA 4MX3A 2EA2A 4IRHA 1F4KA 3F8MA 1VTNC 1ODDA 1TQMA 5BOXA 2IT0A 2CFXA 2XKPA 1QGPA 1YQAA 1C0WA 1QO0D 5KHGA 1HKSA 3ZMVA 3F21A 2DQLA 4UBGA 2B8MA 5ILSA 2ZBKA 5BY5A 3KFWX 1YLLA 5ILVA 1YW8A 1IUYA 3EYYA 4MGIE 5DV5A 3HIFA 2IVMA 5D8KB 2HKOA 1Q1HA 4OLLA 4PZJA 3M8EA 1R23A 5JAXA 4XBFA 1YLFA 2Q0OA 4YIFA 5JCTA 1LRHA 2Z99A 4I2OA 2O8QA 3ZMSA 4R52A 1K79A 3WE3A 3K9TA 1BIBA 2IA1A 2QLZA 3BJ6A 3H3ZA 2HDCA 4Q29A 2ISYA 5K1YA 3T1BA 1RIOH 3BDDA 3H1WA 2MBFA 1X7NA 3UKTA 2FU4A 5CVIA 1VP6A 4ESFA 3WTYC 3I58A 3VEPA 2FE3A 2Z9OA 3ULQB 2PA7A 2UYBA 3IDCB 4XF9A 4UVCA 1CF7B 2CSOA 1MJBA 3CO2A 2O61A 1OYIA 3CUOA 3I54A 4IEQA 4G9YA 2K4BA 3GYDA 2HFHA 1J58A 3S2WA 2C6YA 1OKRA 1IPKA 1SD5A 2OQGA 2YX7A 4R79A 4BNCA 3D5LA 3F8NA 4LUKA 2HWVA 3Q9VA 4DNCA 1AOYA 4LGWA 1X82A 2GC0A 2R3SA 4KICA 4I3PA 5FQ0B 4BQAA 2QBYB 3HTUA 1YS6A 2VOOA 4OIQF 2VT3A 1R36A 4LULA 1ZYRF 2XASA 2PEXA 3BWGA 3ZP5A 5BV6A 3DPTA 5HLHA 3TOAA 4ORFA 1FX7A 1DZRA 1B4AA 4IESA 4KFCA 3FXQA 5L3DA 4ESBA 1B59A 1XMKA 3CO7C 4GXOA 3CF6E 2D5FA 1SEFA 3V4GA 2EFQA 4LMYA 1J59A 1IN7A 3F8FA 1ZARA 1ZHFA 2JZYA 1G6NA 1ZG1A 2A61A 3ECHA 4A0XA 2EV0A 1G3TA 2F4PA 1J3RA 1ZAOA 2DCTA 2A3SA 2A6EF 5CVUA 4UV9A 5FFZA 4CICA 4LG0A 1O3QA 4P96A 3ZN0A 4KYWA 3RTRA 4D7SA 3IRRA 4AQ6A 5J6XA 4ZH4F 3HRMA 5FDBA 2JPCA 3DV8A 4AIJA 5FCCA 2P6SA 2V9VA 4AWXB 1Z7UA 3V7CA 3ETQA 3M8FA 4O9EA 2QNKA 4KIBA 5AONA 2KJCA 4E70A 2WFPA 5CYVA 3L2CA 4M74A 2WC2A 2CW0F 4IETA 4WBBA 3R6SA 2JTVA 1EH7A 3ISPA 2EV5A 1FXZA 4XFIA 2EJRA 5L3GA 4ENMA 1USTA 4MQVA 1DUXC 2TDXA 1LQ1A 1FSHA 2B5HA 2ACJA 4META 4AVBA 1J1LA 4LK0F 1FP1D 5FO5A 2G7HA 2KIFA 3IKTA 4ONUA 4JK1X 4KA4A 2G7UA 5I91A 1NZCA 2XAHA 1P92A 1WGPA 4EWAA 1YYVA 5D4RA 3W6JB 5EFUA 1W4MA 4QLCU 2OYZA 3BALA 3IDBB 2M87A 1YHFA 3QP5A 2XKOA 2O0YA 3MZYA 3QU6A 1IW7F 1YFWA 4EM0B 3C3VA 3GX4X 4MHGA 2IXLA 4LFUA 3R61A 2Y48A 3SFZA 1ON1A 1S8NA 1RZ4A 4MTDA 2E7XA 3ES4A 3FXRA 4HQEA 5D5VB 4KWKA 2XL7A 1I5ZA 3JSPA 3BY6A 4LK1F 4GCVA 4XLPF 4IEVA 4EGZA 3U10A 1F1ZA 4U0VA 3C7JA 1MGTA 5CLSA 1MKMA 1PDNC 2RGVA 4HMZA 1XGOA 1PP7U 5L3BA 3H1MA 4MUVA 1E17A 5J3UA 3CDHA 3I71A 2DLLA 4L0ZB 3VOEA 5BS6A 4KWJA 1W5SA 1D3YA 1XGNA 3GYHX 1U2WA 2STWA 1F9NA 2FBKA 5BMZA 2FEZA 1ZZBA 2FBIA 2EFNA 3ABUA 4RS8A 2A6HF 5DDGA 3T0YA 4BIFA 5DCMB 4MGKE 1JHFA 5J48A 3ZMDA 4RAZA 3HHHA 3D0SA 1IXCA 5D1IA 5F6FA 2UWMA 1SMTA 1BI0A 3TDZC 2UXXA 2IJLA 1H9TA 2DO7A 4BHCA 1O5LA 3LAGA 3E5UA 4AVPA 5FLXK 4IRIA 1CAVA 2LF8A 3U1DA 3SZTA 1ZLJA 3TNPB 3REOA 2N7GA 3L9FA 3VFZA 2DAOA 3GUDA 4Y17A 3LOIA 3I64A 3F8CA 4A0ZA 4ZYHA 4L9TA 4KL1A 2OA2A 1R22A 5E1ZB 4IF4A 4XF0A 2PFWA 3LWFA 2O1QA 4E2QA 2A68F 5ERIA 1ONVA 1W5TA 1KQ9A 1U12A 2PQQA 4ESJA 2BEOA 3EBRA 3SZPA 3TO6A 3FX3A 3FE5A 2F2EA 3SQNA 1T6SA 2MA3A 3RYKA 3HRSA 1HSTA 3JSOA 1SMYF 5BUVA 3DEUA 3DKWA 3ZMUA 4RB2C 4HYEA 2JRTA 3FXUA 3WTZA 1MDMA 2VBZA 4Q5SF 4MGYE 4HN0A 2WTEA 5KHJA 1D8KA 1B9MA 1TQPA 4MNUA 1CAWA 2J5PA 2IRFG 2H6CA 1EV7A 2PHLA 3BPXA 2I45A 5J8FA 4Z07A 2HJIA 1KYZA 4RGUA 3M1EA 2OZUA 1XE7A 1ZVFA 4JBAA 3GF2A 3SHRA 1KU2A 2RVCA 4HA8A 3FZVA 1G3SA 4Q4ZF 4O5VA 1FBUA 1KU9A 4YG2F 5LHHA 1WLTA 1Y3TA 4EJWA 4OMYA 3H7JA 3GO5A 2F5EA 4L9VA 1IXSB 1ZNPA 1FT9A 3RI4A 2STTA 3GFMA 1CX4A 5HS7A 1FLIA 5DCMA 2DK8A 3RDIA 3DF8A 4R8HA 1IN6A 3ABTA 5HOOA 3O2PE 4D0PA 4O3MA 3GZ6A 1V70A 3EYIA 2RQPA 3OCPA 4UUVA 2UY8A 4TLFA 2QZ8A 1PM7A 1UIJA 3LZZA 3J80Z 1GQGA 2IXJA 1W7PD 3KP2A 5LGNA 5D6FA 2DPDA 3GXOA 2RDPA 2M1BA 4ON0A 2M8EA 3I53A 4MV2A 1TW2A 2PN6A 2CQKA 1ZG3A 1CAUA 4HLYA 2NYXA 3N4MA 2FSWA 5H20A 1X8MA 2PYTA 5LHGA 1GXQA 5CVRA 4IHTA 2EFWA 1AWCA 1YG2A 3FM3A 3K2ZA 3HHGA 1WKMA 3NW4A 3TGNA 3B73A 3J80K 4EJTA 3ML6A 3E6BA 3WU0A 4XRFA 2QM3A 1TTYA 3BROA 1P2FA 1DGWA 3DL3A 2PBIA 1R1UA 3WU1B 3WTTC 3BJAA 1RNLA 3WTVC 3KE2A 3B02A 4MGZE 2Y0MA 2DU9A 1WQ2A 1BI2A 1KQ8A 4JTOA 2EWNA 2O03A 2ESNA 4J1XA 2IC1A 3L09A 3E6MA 2VECA 3GFJA 3ECOA 4EJOA 1JGSA 2XAFA 2FBHA 4OIPF 5D4SA 5KHIA 1T39A 4XFBA 4F8AA 1SAXA 1YFUA 3GEZA 2ZNZA 4A12A 4J1WA 4S04A 1SFXA 3MZHA 1KYWA 1WWXA 2B0LA 4XF1A 2OA4A 4ZZLA 5JFRA 1PUEE 2E1NA 4HX4A 3CLPA 5KHKA 2K27A 5LRSA 1FYMA 4HVQA 1UIKA 2O3FA 5KK1A 4LG0B 2VBWA 4YFKF 4EROA 3V8LA 3V7SA 2D1VA 2W57A 3F72A 3T8TA 3F22A 3RYPA 4HV6A 4TV7A 4UXNA 3DPLC 5HLGA 1HSJA 3TKYA 2L4MA 1JUHA 2MHFA 2A07F 5CVJA 4D7TA 1EPZA 1CAXB 3MQ0A 3KEOA 2UYAA 1QXJA 4CYDA 3RIRA 2VE9A 3IIAA 1NE6A 2EA4A 1DZTA 2E7WA 5DCFA 1U3EM 2XHKA 1F5TA 1FC3A 4AVCA 2EFPA 2VOPA 5LEKA 3ES1A 4YFNF 4HOBA 2J5OA 5HDKA 1L0OC 3BU7A 5DD8A 4KIGA 1IN4A 2CG4A 1UCRA 1QNTA 4CHUA 3DQVC 1UCXA 4AIKA 4M6YA 4IEYA 4A0YA 3F23A 3M7GA 1O3RA 5TJJA 2A5YB 3E5QA 2FRHA 1HKQA 4GGGA 2E9QA 2ZO4A 2FXAA 2R7FA 4AQ2A 1O5UA 3Q5FA 5CADA 4AXOA 1V3FA 3R60A 1EP0A 1R1TA 4H0EA 5BPDA 2HYGD 1P4XA 5LEJA 4WF2A 5E1XA 2EAAA 2O8XA 3FMSA 1B6AA 2ZNYA 1EH6A 1ZGJA 5E17F 1OI6A 2V6CA 3PFIA 4HSLA 4KIFA 3KETA 2YU3A 4EVIA 3GBFA 1NE4A 3K1NA 3K69A 4MEXF 3P9IA 3MFKA 1IRFA 2MLGA 4YIIA 4HZFA 2Z33A 4G7OF 3J81K 3NQOA 2IA2A 1R7JA 1DP7P 1J3PA 3M3IA 2KIUA 2PHDA 4EM2A 1LB2A 2GIVA 4F7ZA 4K2EA 3EUHA 3FMRA 3PQJA 1K78B 5LLQA 4M6XA 3H1YA 3WW4A 1D8JA 3G73A 3JTGA 4EWDA 4I7HA 4XEZA 3H92A 4S05A 1BN5A 4U88A 3RPUA 2FNPA 2FMLA 3K1PA 2L01A 3PLQA 1R5GA 5JHUA 1LDJA 1QQIA 1FYKA 5FFXA 3FMQA 4AVAA 5JSRA 2P6TA 4B29A 5I0SA 1LEAA 1RC6A 5E8GA 4MQ9F 1ZRDA 2BE5F 2X4HA 4BXUA 2VBXA 3KP4A 1FWZA 3V7RA 3GFIA 1CAVB 2GQQA 4ZU5A 1H1MA 3DXJF 2YR2A 1K6OA 1OFNA 3LA3A 1CAXA 1BI3A 4ZU4A 3MWMA 1GXPA 1YUDA 2H0VA 3KGZA 5D5WB 1BOAA 3U0ZA 2V1DA 4XF4A 2XLAA 4LUMA 4RB3C 2LDUA 3EETA 1IN5A 1ZX5A 2Y75A 1RUNA 3VODA 2Y0OA 5E20A 5FD6A 2OPKA 2Q8KA 5I0RA 3LA7A 3BB6A 4M9SA 4A5NA 4CZZA 3JAMZ 4L2NA 1KU7A 4Z82A 1NHAA 5LHIA 4KU8A 4XFFA 3CL1A 4QGLA 2EV6A 3JW4A 4G8XA 4HDVA 1S29A 4PGHA 3NSTA 1MDMB 2PG4A 5EEHA 4A5MA 4UXAA 1YIOA 5L3FA 4LLGF 1DDNA 3BCWA 3WW3A 3LAJA 4KNYA 1O7LA 1CAWB 2HTSA 3MYXA 3JAMK 2FQPA 3IWZA 2HGCA 1BI1A 1FNNA 1L3LA 4UVBA 4L5JA 3F3XA 3AAFA 5FPXA 3T5XA 1EYBA 5T3NA 3FZ3A 4Q0QA 4JQFA 1RUOA 2D93A 3NJZA 1I1SA 1EY2A 1Z6TA 2MPFA 4LB6B 4EJVA 4G6DA 3LFKA 1I1GA 3V8KA 1K78A 2C0ZA 1YTYA 2CAVA 4QGMA 4QXKA 5I8YA 5DUKA 1TLHB 3F6VA 5FLXZ 1LR5A 3SXYA 2Z5UA 5LRRA 2IW5A 1FPQA 1OMIA 5JSOA 4HF2A 5HDNA 5C8WA 2V1UA 2JPBA 1VJ2A 2D40A 1IF1A 5E18F 2P8TA 2QQ9A 3PQKA 4GULA 3WG9A 2NS0A 1R5HA 2H09A 2XRNA 2QWWA 4BHPA 2LF7A 3N97A 1VR3A 4XSXF 3WTXC 4EV0A 3NL1A 2QENA 3WTUC 2QJVA 3LWCA 2PJPA 1ZRCA 2RC4A 3WW1A 2COMA 5DD4A 4ENKA 4IXAA 2MLKA 1H9GA 5E8IA 1XE8A 4Q0UA 2VBYA 2YSRA 4LLNA 4WXDA 1CAUB 2ATFA 3IC7A 3TOBA 1TBXA 1TNSA 2Q0AA 3VHRA 1U6GA 4X6QB 4FBFA 1ON2A 3BP8A 2E1CA 5A2QZ 1BJAA 3HTSB 4HV5A 2UY9A 3ELKA 1ZZ7A 2FNAA 5FB2A 1RTVA 3C1DA 2KKOA 2Z2SB 2PAEA 6PAXA 1XD7A 2RN7A 4X6RB 3QU3A 4RGXA 3KSCA 4YNIA 2L02A 3V8JA 3I59B 1RI7A 5A2QK 5LBQA 2Q2EA 3HYIA 3W6KB 5H6RA 1G3YA 1HQCA 1S3JA 4BH9A 2GA1A 3WGIA 3WE2A 2MC3A 4QWQA 2AXLA 4M9ZA 4WXCA 3H9AA 1S7AA 4LJZF 2QUFA 4N0BA 5F64A 2XV4S 3QOPA 5BPXA 2KXLA 3I4PA 5ICCA 1DGRA 4BHBA 1ZN2A 5HLIA 4M9XA 1W7PB 3L2HA 4EMSA 2F5FA 3L7WA 3HRTA 3E3VA 3HUGA 4YRDA 4BYYA 3COAC 3TDUC 3IKVA 3ELNA 3ZMTA 3C3WA 2D5HA 1OPCA 1FYLA 3P7NA 3S7IA 4EJUA 1IPJA 2DW4A 4FX0A 3UKNA 5HDGA 1ZZ9A 2CYYA 2ISZA 2IXIA 4MGRA 3K0LA 3ST7A 5LGTA 1WSUA 2P7VB 1UW8A 3NEUA 4HBLA 1Q3EA 2EB7A 3LAPA 5TRDA 2X0LA 2YPRA 4YYOA 5E1RA 4QM8A 1FSEA 2XUBA 4FT8A 1MZBA 4L9NA 2HR3A 1YW9A 4B09A 4RD7A 5K5RA 2LKPA 1Q5OA 1XGMA 3EJKA 1SD7A 3FJSA 3OF1A 4HX8A 2KIMA 5HS8A 1SFNA 1SFUA 1XN7A 1V4RA 1FI2A 2IA0A 2PQ8A 1FP2A 1T98A 3LQQA 4OU0A 1FOKA 3F6OA 3KP7A 5DEQA 4FAGA 2G9WA 1LVAA 2QQBA 2ZKLA 5K5QA 2DPUA 3FFQA 1LEBA 2XLFA 3PNAA 2VQAA 4ZYEA 2XIGA 3FF5A 5H6QA 1DPUA 3MEXA 4WZCA 1UPIA 1H0MA 1J3QA 3I0TA 1LKNA 3GWZA 3E6CC 4LLLA 2KRFA 3K1MA 3P9CA 3I7DA 3CLOA 4LD5A 1YWKA 2PMHA 4UNOA 2VC1A 4E2SA 5AVPA 2XLGA 4UVAA 2P5VA 2QCSB 1O3TA 3WTWC 4WK8F 3CO6C 4P5OA 4B8XA 2HQRA 3I59A 4HLXA 4Q0VA 1BIAA 2L4AA 1G3WA 5KVRA 4KT5C 4XFAA 2BNMA 2GC1A 3H7YA 5I8TA 3UKVA 1MJ9A 1UHMA 4N9HA 2OD5A 4U7BA 3BPVA 4A2UA 2IXKA 3CUQC 1LJ9A 1Z1DA 3RJPA 4ENJA 2CAUA 4RAYA 2MH9A 3H8UA 2YX4A 4DINB 2NNNA 2V09A 3JZVA 4Q48A 3TO7A 1Q43A 2VT2A 4NHJA 4L11A 2K02A 4E2GA 3WTSC 3LA2A 1QBJA 1Z6RA 4N9IA 3HQXA 3M9AA 3KZZA 1GHCA 1TQ5A 4HBNA 4NVPA 1FY7A 4PCQA 1W7PA 2GAUA 2HKXA 3JTHA 4UV8A 3R0AA 1T38A 4KU7A 4QMAA 2ETEA 4WVZA 5FLIA 5JVTA 2O6GE 4EM1A 5I0TA 1Z05A 1J7KA 2FMYA 2HYFA 4OFGA 3WGHA 4IEXA 2DT5A 1KA8A 1U5TA 5JI6A 2FQ3A 4IEUA 1LDKB 4KN7X 4I09A 4I02A 2OBPA 4LLOA 3ZN1A 4P55A 2HEOA 1QXRA 3TNQA 4KUMA 4BAYA 5FLJA 1B1BA 1OYWA 2XGXA 1YO5C 4KDPA 4MEYF 3RZZA 2ZMEA 1SD6A 5DYMA 1SQ4A 2ZCWA 1J0RA 3IL2A 3U11A 1IZ1A 4ZZDA 5ICEA 1O57A 2DQRA 2VE8A 4IEPA 3NVCA 2DK5A 5ICFA 5HS9A 2GZWA 4FHTA 4WWCA 5E16A 4I01A 2GC3A 4HW0A 3IRQA 1YW7A 1ZRRA 4GYGA 1R58A 1IN8A 1OD5A 3EQLF 3J81Z 1NXMA 4K8FA 3L00A 2BYVE 2PMUA 1R00A 2LNBA 2XROA 1UHWA 1YFXA 2W24A 4P9FA 4HVRA 3DP7A 4U7DA 4OIOF 2CO5A 4QM9A 1UB9A 3RYRA 3U2RA 2UZKA 3RKWA 3I5UA 4MTEA 2D1HA 1HW2A 1O7FA 1KGSA 4ZYDA 3GZ5A 3S0MA 1XSXA 4L9JA 2GH2A 2OAZA 4ENNA 4HX7A 2Z69A 5E1WA 1TW3A 5C6CA 4GO1A 2ADUA 3ZMZA 2PAMA 2ET7A 4I0BA 5J8CA 4PIXA 3OOPA 2L3DA 4XF3A 4HSJA 4NB5A 4P9GA 1U78A 1U5TC 3KP5A 3DFGA 4H7LA 3USSA 2XAGA 1B9NA 4IERA 2KJBA 4LB5A 1R1VA 4EGYA 4IJAA 3ZPLA 3FM5A 2JSCA 3HSRA 3MAJA 1RL3A 5FD5A 1NYWA 2OZJA 2Q30A 5FGMA 2V1XA 5I8SA 1HW5A 1PMIA 2ET1A 4UBHA 1XGSA 5FLHA 3ZQ7A 2WWYA 2P5KA 4KMFA 3IWFA 1T0FA 2M45A 1OYYA 2QQAA 3KP3A 4QX5A 1Z91A 2FF4A 5HVQC 3SCFA 4RGRA 3RPQA 4IPAA 4M73A 1BM9A 3T8RA 3ACLA 3WW2A 4Z2YA 5L3CA 2ZFWA 1J75A 1L3JA 3EDPA 2Q1ZB 3OTFA 1QY4A 2GWRA 1REPC 1O4TA 3FWEA 3GFLA 3HOSA 1XDSA 3OGJA 2FA5A 2PTMA 3DN7A 5J7MA 5AIQA 2FOKA 1QWRA 2DTRA 1YFYA 5ILUA 2A69F 4L18B 3CJXA 2K4JA 4ZU7A 2R7DA 2P5LC 4RGSA 3PVBB 3QACA 2CGPA 5D6EA 3R0JA 2MD5A 3F8BA 1ZZ8A 2DBBA 5D5UB 3D82A 2H6BA 3GVAA 5AIPA 4KWLA 3SMHA 2RV8A 4ETSA 1QZYA 3KP6A 3NKTA 1I6XA 3S7EA 2XAJA 1IAWA 1IRGA 4I98B 5I93A 4HQMA 1ZZ6A 4IVNA 3QP6A 4OIRF 1I27A 2F5CA 2ETHA 4O6JA 5KBFA 3ZDSA 2IXCA 3EHKA 3ROUA 4HF0A 3E6DA 4M72A 1CGPA 4L5IA 2LSOA 1UD1A 2ELHA 5EZWA 5D5XB 4HN1A 1G4DA 3BZ6A 1KU3A 1CF7A 2CV6A 2MH2A 2P7CB 2IP2A 2M5WA 3KMHA 4YARA 4IRGA 4I0AA 4LTAA 1SFEA 3FHZA 2P4WA 2QDRA 1EH8A 1FBQA 4EQQA 4XSZF 3HOTA 2HQNA 3QAHA 1JXSA 3CJNA 2QVOA 4A6EA 1SD4A 4G94A
chains in the Genus database with same CATH superfamily
2UU8A 2YHJA 4FI9A 1HDPA 3H3LA 2JG9B 3E1F1 3PMSA 3WODF 4MZUA 1A8DA 3G3ZA 4CGZA 2A73B 3WP6A 4I3GA 4N7IA 2GXBA 3POJA 2HWF2 1P4WA 3ZYHA 3CUQB 2QBYA 2DFBA 2NNYA 4CDWC 2DFIA 3CTAA 2JICA 2QSHX 4B4CA 5D2AA 1J5YA 1D4M3 2DI3A 1EAH2 3BI3A 5KC6A 4U87A 2ARBA 4X6AJ 2WLPA 1RUE1 4AHYA 3QH6A 2EK5A 3AP6A 3RKYA 3MW4A 3A22A 2BNOA 2W1WA 2FDIA 1KQ0A 5HI0A 3VDDA 3GZAA 4UF0B 2DCJA 5EGOB 5HBAA 1F4AA 1YQ5A 4LNVA 4MH0E 1UYYA 1QJX3 1ZRFA 3USUB 2AS5F 3HT1A 5BNNA 1VALA 2BNNA 1WW7A 1PUFB 3KB5A 3VBRC 3NWTA 2PI0A 5EV7A 1WA4A 1SLBA 1XMXA 2V26A 4LOTA 2NRAC 1TZLA 2JENA 2B9UA 1YRNA 1OA3A 1AR61 4XMYA 3I2JA 5AVAA 3G7DA 2HOEA 1OLMA 2Z79A 3CJIB 3CEWA 2A3XA 2VODA 1WGXA 2GMPA 4P9UA 1P4AA 4LO5B 5IFPA 5IAVA 4A7ZA 3ZIWA 5GJ6A 1JZ6A 3QD6A 4UY8I 1UKGA 1OCRH 3EO6A 4LITA 9ANTA 1PVC1 1QNYA 2F17A 4AEDC 1CESA 1UKRA 1YS7A 5IK8A 3IHUA 2VPVA 3LNQA 1HBXG 1XRUA 2IWGB 3I2DA 3EUKL 1OA4A 4FX4A 3OUIA 1XB4A 4UHTA 1F9KA 1Y43B 3S14J 3T0DA 2ZXWH 3WCRA 2ILMA 4XFGA 3VDDC 5IT9Z 3HBZA 1OR7A 3GLXA 1TQIA 3TL4X 2GXGA 2DOFA 2F5DA 1D4M1 5BNNC 1JODA 2E1MC 3BTLA 2H1KA 4HF1A 3LD8A 3QPTA 1VBD1 2IFRA 3W21A 4RQPA 5E3NA 1A5JA 1HJGA 1ND3B 1UOJA 2CGOA 4XN3A 4BLJA 1B72A 2ORZA 2WUHA 1QJX1 3R05A 2AEZA 4ZY9A 1X1PA 3KCCA 2ZMEB 1LEMA 4YSFA 3GF6A 3KLOA 5CQEA 4G6QA 1CPNA 3FBMA 3AYAA 1DYKA 4PIYA 5B3SH 4BK4A 4DEQA 1SLTA 4GYIA 4NO4A 1Y9QA 3PNYA 3SEQA 3HT2A 2M30A 1VPHA 5LBCA 3DBLB 1JN2P 1QPMA 2QQKA 3J8F2 3M3CA 2COBA 1IDZA 5DUIA 3LQRA 1E5SA 3ZQHA 4JV4A 3OPZA 4N43B 2XQRA 2L54A 4JDMA 4CDUB 3U4SA 1BEV3 2WL1A 3FFZA 3MGUA 3O5SA 2CH0A 1PP8F 5FBZA 1PGSA 1OR7C 4AFAA 2Y0SN 1B8IA 1BBYA 1RC9A 1IG7A 1WI3A 2TUNA 4HAMA 4G7HF 5E3OA 1HQNA 2IS2A 3IKWA 5JXGA 2EIBA 2IVJA 3BGAA 4FQGA 2M4KA 5K7ZA 4AD9A 2M34A 5C4XJ 2IXHA 2M3AA 4YW4A 2BHZA 4UUSB 2MNGA 3PNVA 2RNJA 4YIRX 1X3UA 2RMU2 3PM1A 5JR3A 4CCOA 5JLXA 3VKFC 2JJ7A 1GV9A 4HPQA 2KRCA 5ED4A 1JOJA 4EWEA 3NRVA 5ICGA 1OFSA 2CU5A 2VC0A 1O3SA 4IHSA 5CFDA 2JDYA 2HBUA 2EA2A 1F4KA 5JOWA 1C1FA 5CFCA 3MIEA 2IT0A 1G59A 2CFXA 2XBO2 1RETA 2BY0A 1V0AA 2JUCA 2X29A 3VDXA 1MBHA 3KT4A 4I0WB 4RL7A 1JT0A 5ILVA 1D1AA 1YW8A 2ZACA 5DV5A 3PU3A 1O4ZA 2YUSA 4ZXKA 4AF9A 2MG4A 4Y22A 1HLCA 2LYCA 1ULGA 2WV1A 4J25A 1XU1A 1Z0HA 1PIV2 1KD7A 4BQ5A 1AR92 2XVLA 2R16A 3LSKA 3K4AA 1HDKA 3RPUD 5DABA 2IA1A 3S32A 4BQYA 1Y8QB 2HDCA 5FXXA 3T1BA 5FZ4A 2JA6J 3UKTA 4YM2A 1S7EA 4BE2A 3BQYA 3ERMA 4ESFA 3WTYC 3I58A 2MEV2 2VUMJ 2FE3A 5D8AB 2Z9OA 2CSOA 3I3BA 1OYIA 2W39A 3I54A 3J7LA 4IEQA 1D0HA 2K4BA 1KRIA 3IT8A 1Z7S2 3S2WA 1K6YA 4B7KA 5FYHA 3ZXDA 2OQGA 1UY1A 5CKNA 3HOUJ 5TSWA 4IZZA 4F92B 1MQTB 4JRLA 1W6PB 3LSHA 3O8GA 4LK7A 1T8IA 3Q9VA 3LSPA 4AFMA 3LGRA 1AOYA 3JXSA 4FETA 2HXOA 3P6BA 3SEPA 2GC0A 4BQAA 1YS6A 1A8MA 2VT3A 1FIAA 3BWGA 1UOGA 5BNQA 3DPTA 5HLHA 4ORFA 2CGNA 3OY8B 4IESA 2VQCA 2HEWF 4BCUA 5L3DA 4ESBA 1XMKA 2ZC2A 3VB9A 2VUAA 4GXOA 1CWPA 3MEPA 2EFQA 2DTYA 2YC2A 1IN7A 1ZARA 1G6NA 2A61A 2F4PA 4A0XA 3KEYA 4MXVA 3N7LA 1MEC2 4P9XA 2ZX3A 2A3SA 3BR3A 4UV9A 4F93B 5GADJ 4BWOA 2C5DA 2WZEA 3EUAA 4KYWA 2X51A 3RTRA 4D7SA 2X6XA 4E7ZA 5FY7A 1POGA 2E7QA 3DV8A 5GZEA 2NVQJ 2VB6A 2P3JA 3HQRA 2ID4A 2DDUA 1GLHA 1UNBA 2V9PA 2Y0SA 2QNKA 3S15J 1WMFA 2CW0F 2P6CA 5FZAA 4WBBA 3QQAA 3CCLI 2VJIA 5CKQA 5A6ZA 5C8CC 4V2VA 3N05A 2B5HA 2HVQA 2CV0A 2ACJA 4AVBA 3CZ6A 4LK0F 1LHNA 5FO5A 4PUSA 3OYJA 1QJU3 4ONUA 2G7UA 1U5XA 5LY1A 3M4FA 2CV2A 1WGPA 3BR0A 5GPAA 1YYVA 4AI2A 4EWAA 4HG2A 2J7MA 5FKCA 2VOKA 3SEZA 1X2NA 5FZIA 2XKOA 4YW7A 3MZYA 3DYOA 4X8NA 3QU6A 4Y5SA 1YFWA 4XBLA 4CUBA 4D5CA 3C3VA 2H0BA 5DAQA 3GX4X 2IXLA 4LFUA 2EZHA 1DGLA 1PO21 4MTDA 4ASMB 3ES4A 1R081 2WS92 5D5VB 1UX7A 3I8TA 1PMJX 3KT7A 4OHWA 1OQ1A 4RR3A 3U10A 1EUTA 4HRIA 1LE8B 1ZRIA 5CLSA 1AYM1 2YUEA 2RGVA 3MV01 4BUPA 5FP3A 5EP9A 3WDYA 3NO8A 3CDHA 4FXGB 3I71A 4V2GA 2DLLA 2QCOA 5L73A 1OVPA 3K4LA 3TRSB 4CTEA 4AGRA 3ZFFB 1JHNA 1ETKA 2DYSH 3UYJA 2ENRA 1D3YA 1XGNA 4XKCA 3V0BA 4AUXA 1VFCA 2FEZA 2LY1A 4RS8A 1OT5A 1XYPA 4X1EA 4RS5B 4RAZA 1AXYA 4YVSA 4JDNA 2XC7A 1PK6B 2UWMA 1MMDA 2UXXA 4XHBA 2WDBA 1H9TA 4BHCA 3AYDA 5KC5A 1O5LA 1SLLA 1AR71 5FY1A 3E5UA 2ZGMA 2DMNA 1V5EA 4IE0A 2N7GA 4IHVA 3VFZA 2DAOA 4Y17A 1IC8A 1JZ5A 3NJVA 3WV6A 3F8CA 3AP7A 4A0ZA 4ZYHA 3LIHA 3HBLA 1ITYA 5FY8A 4L9TA 1SPPA 1Z78A 4TWTA 4IL6C 3A01B 4C1XA 2MSYA 4BJ5C 4RR3C 2PFWA 3MIDA 1YXWA 2YU9J 3DPRB 4E2QA 3P3NA 5ERIA 2XOMA 1KQ9A 1U12A 3Q8AA 2LG4A 3N9OA 4A6SA 3FE5A 3WF3A 4ET7A 5FO9B 3RYKA 2VJ4A 2YPDA 1HRV3 5DPNA 3AM2A 1V9U3 2QQPA 3ZMUA 4RB2C 5TISC 3M1CA 4Y1ZA 4CA9A 4Q5SF 1G9DA 4YVSC 1C8NA 4HN0A 2WTEA 5KHJA 3VPRA 2WAEA 2IRFG 2H6CA 2BU9A 2PHLA 2YBPA 5J8FA 2HJIA 5F8PA 2PHWA 3RS6A 2BWAA 1SAUA 1Y1WJ 2V1NA 4JBAA 1F35A 3SHRA 4H7MA 3UETA 3BG5A 1G3SA 1H4HA 1LAJA 5FKNA 1SDDB 5A32B 1FV3A 1JI8A 1E5RA 2ECBA 3OSFA 4IXLA 5LHHA 4XDOA 3PUAA 1Y3TA 3KV5A 3H7JA 1WJEA 4K7JA 2F5EA 4L9VA 2DBIA 4OUEA 3BTYA 4IQJA 4W6XA 5FZMA 4BGDA 2XG3A 5DCMA 4AFDA 4CVUA 2Y31A 3RDIA 2DXIA 4FQZA 2CDPA 4R8HA 2WZR3 2HYXA 5HOOA 1AJOA 4D0PA 2WT2A 5HCFA 3GZ6A 1AKHB 1AL0G 5IP7J 4UUVA 1BYHA 2AZ5A 2QZ8A 1PM7A 1UIJA 4KI5M 1VBE2 1PZ7A 5M5YJ 2X8KA 3BTCA 1GQGA 1W7PD 5D6FA 5HV4A 4IHYA 5EJ3A 2RDPA 4YZ5A 4XKWA 2KM2A 3QOEA 1CAUA 4HLYA 3C2UA 5FZEA 2HWC3 2VZSA 2PYTA 4ZS2A 5H9PA 1OVSA 2WB1A 3VD4A 3D3AA 2ZTNA 3GM8A 3K2ZA 2R1DA 5K7FA 1X9TA 3UESA 1W9FA 3B73A 3SKVA 3J80K 2JDPA 2VI6A 4AQTA 4EJTA 5C5TA 3DU5A 1G8WA 4UFJA 2M8GX 3BROA 3OYGA 1FOYA 1DGWA 3WTTC 4YFWA 3HN3A 5IYBJ 4ES9A 1DGWY 3ZOIA 2NMOA 4JTOA 3WHTA 3UNPA 2ZJQF 4J1XA 1HB2A 4CP1A 4BK5A 3H0GJ 5J98B 2VECA 2WNVC 4XQDA 5KHIA 1T39A 4FE7A 5J4VA 1YFUA 3GEZA 1IQDC 4J1WA 3KV9A 4E7KA 1KYWA 1WWXA 2OA4A 5JFRA 3VYTB 4IOCF 2DYRH 3NV1A 4PFPA 1FYMA 2ZGPA 1UIKA 2VBWA 4HNVA 4BXXJ 2XAUA 3K4KA 3U37A 3V8LA 3WXPA 3D4KA 4NIHA 2D1VA 3T8TA 1IDYA 3RYPA 4PBOA 5KCMA 4W8JA 3DPLC 5FXWA 1JUHA 5CVJA 1H88C 2ICWG 2UYAA 4CYDA 3VKMA 3CF2A 2VE9A 2B63J 2EXHA 4XCAA 4Q1RA 2E7WA 4NRMA 4XAEA 5F39A 2R92J 2I2SA 2EZLA 3MKWB 3TEDA 3BU7A 2B46X 3AVSA 5DD8A 1UZ0A 2XXZA 3N9LA 3C2BA 2R072 5GLWA 3D5RC 3DQVC 2J1SA 5GP9A 3UJQA 1TME2 1O3RA 1S0EA 3NQHA 2A5YB 4XTMA 2FRHA 1QJFA 1LOBA 4GGGA 2ZO4A 3RQ0A 1JXNA 2ZGNA 3K70C 4XC9A 2IFWA 1XYNA 1G9CA 2DWRA 2G0EA 2RS13 3NMBA 1R1TA 2LMDA 5BPDA 2YS9A 2HYGD 1COV3 1PO12 4IOAF 1C5IA 2O8XA 3KS7A 5F3IA 3G4SI 2ZNYA 2P3IA 3ASNH 5E88A 2ZKNA 3VBSA 3UNGC 1N77A 3GBFA 1NE4A 3K1NA 3TEYA 1W99A 4HXCA 4M3EA 4G7OF 4UFMA 4BY1J 1GP5A 2C6SA 5FMDA 5IFTA 4PJJA 2KIUA 1LHWA 2WFF1 3MI8A 4UB8C 2GIVA 3J7ZI 4Y5Z0 2ECCA 1LPQA 3PQJA 4M6XA 3H1YA 3BZCA 3ORJA 4I7HA 2HWE1 1QIQA 4X8PA 2HQ5A 1UO9A 3BR2A 1QA6A 1YI9A 2L01A 3FL7A 3H8OA 2ZHMA 2QSFX 3GDBA 4E8DA 1OOPB 5FFXA 3JUUA 4XUOA 1H8TA 1S2BA 2P6TA 1J83A 3WCSA 3J7YJ 3CCJI 1GKBA 1FWZA 2RQQA 3V7RA 4Y5TA 1K6OA 3TAYA 1OFNA 3TMOA 2DCYA 5M3FJ 1RESA 4ZU4A 1P7IA 1SDWA 2P81A 3VKOA 1YUDA 5CQGA 4DRRA 4FFHA 2R041 5B1AH 4KH9A 1BLZA 3VBSC 1CVNA 1IN5A 1ZX5A 3WG1A 2Y75A 2RM21 5E20A 2Q8KA 5BNOC 2IZWA 3LA7A 1NXD1 4V1PA 3W6VA 5FP4A 5FRNA 4XJUA 2D98A 4L2NA 1NHAA 4XZPA 3MFAA 1JW6A 3G2BA 5JR2A 3JW4A 4LO6B 4ZYAA 5IT6A 4C0BA 3BYWA 3A4UA 4UXAA 3WF0A 1SVOA 1OURA 2D3RA 3AG2H 1HN0A 1DDNA 2BOJA 3LAJA 1GOHA 1H8TC 4HKOA 4EZ4A 3IWZA 2VVEA 1WD4A 4CCMA 2KP6A 4PI2A 1L3LA 1U5YA 1LOAA 3DLLF 2W95A 3AAFA 3ZRGA 1ENHA 1EYBA 4LJHA 3Q0VA 1ASJ1 1UZVA 4BMBA 1S72I 5GZGA 4Q4W2 4BQ1A 5M0TA 1JYIA 1VQ4I 3O1RA 3ONQA 1W6OA 4N8MA 1J1TA 1CR7A 5C9AA 3KYCB 4E4SA 2CAVA 3F6VA 2W91A 2IW5A 3IMNA 2L9VA 1YYNA 2D40A 1ZTRA 1HXS3 3FC0A 4GULA 2E7TA 2GSYA 2H09A 2XRNA 4UFIA 1U5IA 2HZDA 4XOPA 3SNMA 3V42A 4Z1VA 3N97A 4XSXF 1UJ8A 3NL1A 2QENA 2A6WA 1MIJA 4JGYB 4IDZA 1ZRCA 4QQPA 4ENKA 4IXAA 1JJ8C 2FBEA 3VBOB 4F52A 2Z4FA 1XG1A 1XE8A 4LLNA 1XBFA 4Y33A 2ATFA 1C8M2 2R1BA 3SITA 1I5PA 3KM5A 1OBNA 2Q0AA 3GJBA 1U6GA 2XJSA 1VRBA 3SC7X 3BP8A 2E1CA 1C57A 3K3OA 1GBGA 4HK9A 3JRHA 5FYMA 3LSMA 3AL5A 1ZZ7A 2BY2A 4ANJA 4JKLA 2KKOA 2PAEA 5KXEA 1DLCA 1VBA3 2B45X 1ERDA 1XD7A 1F5JA 2KZGA 3O0XA 2NVTJ 2RN7A 2WN3A 5IJRA 4PT6A 1TNRA 3ZQQA 3U78A 3L2UA 3I59B 2BW8A 3AL0C 5C9AC 5KWRA 5KXBA 5LBQA 1WCQA 2DUOA 4IV1B 5IVJA 4XJAA 4CDQA 1GWKA 4TTGA 1S3JA 3WGIA 1IS5A 1L7RA 3B5LB 2NVXJ 1AR83 4QWQA 4QX7A 3Q0WA 4H3WA 3H5NA 4BM8A 4CRQA 4N0BA 2FCVA 4GKXA 4BHBA 1ZN2A 5HLIA 1DQUA 1W7PB 1HQWA 5JOXA 2BHYA 1WJFA 2JDNA 1BVVA 3IKVA 3ELNA 5DXDA 3ZMTA 4PDWB 2JE8A 2D5HA 2QQWA 1FYLA 3P7NA 2DW4A 4FX0A 5JI7A 3BCBA 5HDGA 1ZZ9A 4KISA 1PGW2 2LFBA 3ST7A 5LGTA 2P7VB 1VBC2 2O14A 1UW8A 1K4SA 1GP6A 4BDVB 3L2QA 4YGEA 2FX0A 4F91B 2SBAA 3HWJA 5E1RA 4XHXA 4FOWA 4L9NA 4UWDA 3KCYA 2X1EA 1LU1A 4OYUA 3CD6I 3PIPF 2ZEYA 4OMDA 1Q56A 1VRH1 1V4RA 2MD0A 4OU0A 2CQXA 4CDQC 2AQEA 3KP7A 1MMGA 2CQQA 3VYRB 2RHPA 2VBPA 2ZKLA 4QTRA 3FFQA 3ZKYA 3OYHA 1ZBA3 3PNAA 5C3RA 2K3PA 5H6QA 1R1A3 3MEXA 4HNUA 2HWF3 4Q4Y3 1J3QA 4YZ1A 3I0TA 4NIAA 5FJKA 1QQP1 1YRZA 5L7OB 2VZPA 4NBQA 3I7DA 4NAOA 1FOXA 1SBDA 4LD5A 1CZTA 4JDOA 2PMHA 4M4PA 1AR81 5AVPA 4D0QA 1FMD1 4KMQA 4E27A 3WTWC 4WK8F 3CO6C 3S30A 1PM4A 4Q0VA 3I2OA 4KT5C 4AHZA 2BNMA 3UKVA 2WAQN 1N1SA 2BV4A 1RUE2 1KJRA 1YIJI 3ZXAC 2DMTA 2E32A 3CHXA 2X85A 4E7IA 3RJPA 2V9KA 1UELB 3LSIA 1Q8PA 4ENJA 2XB6C 4ZC3A 2CAUA 2HWB3 2CQNA 4XOGA 1S0FA 4BQ2A 2HQAA 2V09A 4G6TB 4ARXA 2EIDA 1PYVA 4Q48A 2K02A 2A5ZA 3LA2A 3AMPA 3GLLA 3L9JT 1HLVA 1XNCA 4N9IA 1VMJA 2ZHLA 2WLQA 4NVPA 4HBNA 2GAUA 3JTHA 3CIHA 2VBDA 3VZKA 4N90A 3ZFEB 4KU7A 2GN7A 5JVTA 5GKAC 4EM1A 3LEIA 1J7KA 4DUWA 3DKYA 2MGQA 2BGPA 3VGIA 4M3CA 3WGHA 3MLKA 3ATGA 2VMIA 4YW2A 2AUYA 5JI6A 2FQ3A 4BQWA 3VBHB 4YM3A 4I02A 5EJCA 4QU2A 4P55A 3WVJA 3CF5F 3PNTA 1PVC2 2JA8J 1HDDC 4LKDA 5EZHA 1B1BA 1OYWA 2R49A 3V64A 2EH3A 2ZJCA 3WQ7A 1ZBA1 1MS9A 2G19A 1R1A1 4ZZDA 1O57A 4YGDA 3CMGA 3NVCA 4Z2AA 4SLIA 5HS9A 2W7NA 4Q4Y1 4URAA 1C3HA 1NLRA 4WWCA 1FJLA 3VL9A 2NN8A 1NA1B 2GC3A 1EJ9A 5A3LA 3IRQA 1YW7A 4GYGA 1SFKA 1GNZA 3HXLA 2E51A 4DJAA 4COVA 2CUEA 5LB6A 3L00A 1BJZA 1S1AA 3EYPA 3SEEA 4BQQA 4OUSA 4D7YA 3P1IA 2XH6A 5A1FA 2Y30A 5DZFA 2P3YA 2VQHA 4U7DA 4CUAA 2CO5A 4QM9A 1UB9A 1D4M2 3RYRA 5T52A 4DOZA 1KGSA 1A34A 1VBD2 3S0MA 2VZVA 1XSXA 3GCMA 3CP8A 4A3EJ 3DKQA 1FATA 4HX7A 2HWB1 3D6EA 5E1WA 4BEHA 1AF9A 4AR2A 2DN0A 1VB2A 4NC6A 3E0JB 3ZMZA 2VR4A 1QJX2 3I4NJ 2JB4A 2NMNA 3WP3A 2NQYA 3BN6A 4NB5A 2R6QA 2VY0A 2VJJA 4H7LA 1B35A 1GZWB 2OX0A 1A35A 2LD5A 2OCEA 1R1VA 1W9TA 3TBDA 4CEYC 3MAJA 1TC3C 1NYWA 2OZJA 2WQ4A 1XPWA 3J8F3 1PMIA 4XLFA 1ULFA 4HPKA 5D21A 2JXAA 3UGFA 5JXJA 3ZQ7A 2KPMA 1VB4A 4C0HA 3CCSI 4NE9A 1VF9A 3HM5A 1RIRA 4LK6A 1LGCA 3OS1A 2ZGLA 2PHFA 2WA4A 1Z91A 2FF4A 1V6JA 3LE0A 2WY8Q 1ZM1A 2ZXHA 4M73A 3WW2A 4Z2YA 1XQNA 3EDPA 4Q27A 1QY4A 2GWRA 1O4TA 2OXBA 1MACA 1JMUB 2VCCA 3VDCA 1AX2A 4UUTA 2UUZA 2DTRA 2RMU3 5IOZA 1W6QB 4NDLA 2ZEZA 2R7DA 4RDUA 2P5LC 3QACA 2MD5A 2IS4A 1H2MA 3VZOA 1T33A 1JBCA 2BZDA 4LHKA 2WAQA 3H9QA 4ETSA 1QZYA 2CMPA 1B35C 4KWUA 2ZPXA 1MMSA 2VZUA 3EXUA 4I98B 1ZZ6A 2UWAA 3QP6A 5A33A 2XBO3 3FBYA 4OIRF 1I27A 3ALQA 3N9NA 5B1BH 1MS8A 3VBUA 4HF0A 4QPOA 3ROUA 3EB7A 1CGPA 4NHMA 2LSOA 2DMUA 5EZWA 3BTXA 2Y6FA 4XN0A 4QQHA 4IEJA 2MH2A 2M5WA 2NOJB 1QJY3 1W0UA 2GOXB 4CXYA 4CDXA 2X1CA 4I0AA 4XW3A 5JXHA 3GTQJ 3HOTA 4XSZF 4IX7A 1JXSA 3PURA 2LVSA 5FZDA 4A6EA 5CJ9A 4G3YC 1T2KA 1AR93 4O61A 3JR9A 2V79A 3MPBA 1GQHA 2IS6A 4COUA 2C26A 2UWCA 3UT0A 2X1DA 4GWNA 5FQ0A 4HFSA 2QVSB 1XSVA 1N78A 3AMNA 2FHRA 4M00A 1CQ9A 1Z0XA 2DV9A 1JZ3A 3O0WA 1YNAA 3LSTA 3KX2A 3B93A 4P00B 2F6CA 4PDKA 1VNDA 4AI3A 3BTIA 3AVRA 4AIHA 3GW2A 3E97A 3P9KA 2VXZA 5BQTA 2ZGTA 5JR7B 1JKPC 1UYZA 4BBSJ 3WD5A 1YQ8A 1WZXA 2GM4A 1JHHA 2CUZA 2DTWA 1Z7S3 3MLJA 1STZA 4UT5A 4DPNA 1IG0A 3HJEA 1VMHA 4HDUA 3RNSA 4XETA 5LK7B 2JG8A 3JBG3 2EVXA 3PO2J 2HTJA 2KDZA 3S5QA 1U5ZA 2VMGA 3OEBA 1RPWA 3H1CA 3RSJA 4CDXC 4W97A 1W2OA 2Q4SA 3VB2A 3QPSA 1Z9CA 1TNTA 1STMA 2NS8A 3OYEA 5E3LA 2GA2A 1OCTC 2YBKA 4GJZA 1XMAA 1CD3G 3IB3A 2XF7A 2D2WA 1APNA 1PNFA 4GMP0 1XDUA 4IV3A 4LKSA 2PLV1 1ZG5A 5GPCA 1MEC3 3CQZJ 4CP9A 2FDHA 4FPHA 1H8VA 1HV0A 3KZYA 2YY1A 3ZXFA 4A6DA 3EQEA 2EFOA 2KIQA 2R93J 1UZZA 2P3KA 1UU6A 1Y4WA 2IGMA 3U1XA 2ZX4A 1GVJA 2K9SA 2VLAA 4Y24A 4BJ6C 5LWBA 1U8RA 2Y0IA 2ZGOA 1WI9A 5EEGA 4XACA 3C18A 3HJRA 5FPBA 1UZWA 2LK2A 4N53B 2L9NA 2DODA 2PHXA 1UFMA 1D5VA 2VOXA 3U9GA 1HRI1 1CIWA 1RUI1 3BJOA 2BBAA 4IEZA 4QGNA 2XHNA 4NPLA 2JIJA 3LPGA 2DA4A 1Y0UA 3AKSA 4KG8A 3TP3A 4Y20B 1U5TB 2JG8C 2OZ6A 1ND2C 3CUQA 4CXFA 5LW9A 1UPSA 2W68A 2QYOA 1ZZCA 4U0YA 3CCUI 4A4AA 3C7GA 2WWUA 2W85A 3RSNA 4PGGA 4BQXA 1NCRA 3JBG1 1D2QA 3H5RA 2ZZQA 1RHI3 4UF0A 4IV3C 3TB0A 4PJYA 5FJHA 1JYNA 5EYYA 3VD7A 2BERA 1MPXA 2HS5A 4EQVA 3GCWA 2JECA 1I39A 1RGSA 2HEVF 3GHMA 1PO22 4Y26A 5FYTA 2BGCA 2ZGRA 1R082 2W84A 3C7HA 2AXTC 2DFHA 4AOCA 2OQRA 1OD3A 4Q0PA 4CCDA 2JMWA 2XVCA 3H8XA 3ZMOA 2KA3A 3GALA 2ZKZA 1URXA 2J42A 2H94A 5EDNA 2D43A 2HXIA 2JDHA 3LEKA 3Q9SA 4II2A 1OKOA 3UR3C 4Q4X1 4Y15A 1WD3A 3C8XA 3SQOA 4XFCA 4XICA 3HSFA 2ARAA 1W06A 2QFEA 4XK4A 5A3OA 1OCZH 2Q8CA 3KGLA 4E4HA 3AYCA 1ZGAA 4M71A 3IDAA 3W9AA 3J7AO 3OD0A 2BV6A 4DZGA 3F2ZA 1GFF2 5J36A 2XGCA 1HIXA 2ZJ2A 1VQ8I 1AR72 3OBZA 2MW8A 1NCRC 2TEPA 4LA3A 4FPOB 1V6KA 4U0WA 2A5WA 1KGYA 5LGUA 4IRHA 3T1LA 3FHNA 2Q8OA 2VQLA 3U4XA 1WJCA 4W1UA 2VMEA 1C0WA 1X1AA 4CYCA 2DVFA 4MGQA 3HDDA 3JRCA 4UFKA 2BPA2 2ZBKA 4II3A 3VBOC 3KFWX 2CWSA 1NAEA 2XF6A 2UV1A 4LHLA 4CDWB 3BLYA 1HV1A 3VZLA 1UYXA 3RZGA 4NIGA 3M8EA 1R23A 1CZVA 1LGBA 2WADA 1FYUA 2CHHA 4YIFA 4P9LA 1LRHA 3ZX7A 2O8QA 2R5ZA 1DLLA 3DXUA 4NN0A 1K79A 3RZHA 4NIIA 3WE3A 3JRAA 3THDA 4NHXA 3BJ6A 3H3ZA 3RCOA 1O6UA 1YE9A 3IAM2 4Q29A 4Z6YA 1RIOH 3MLLA 3BDDA 1PGL1 3H1WA 1Z21A 4XYXA 2MBFA 2DVDA 5CVIA 2CUJA 1TWAJ 3VBRB 4RBOA 1QVUA 2Y6KA 3KPHA 4DBRA 2E63A 5EIYB 3DLAA 3ULQB 2PA7A 4XF9A 4UVCA 1CF7B 3CDIA 3H8RA 4RGKA 2O61A 2I74A 2DA5A 1TL8A 5A7PA 3TW6A 2W1OA 1LCLA 2HFHA 2VNOA 4DS0A 2C6YA 2WSVA 1OKRA 3RQ4A 2M0MA 1SD5A 4XR6A 1KS4A 2ARXA 4XUQA 3GGLA 1R71A 2HWVA 4DNCA 4D3WA 5FV3A 5CA6A 2NVYJ 4LGWA 2R3SA 2VNRA 3M3OA 4KICA 2Q8EA 2QBYB 3HTUA 2VOOA 2XWJB 1R36A 4LULA 2XASA 3I56I 1WBFA 4ASLA 3K4CA 5HXMA 1WW5A 1MNMC 3ZP5A 3GTJJ 4DY3A 1FX7A 4JP0A 5IP6A 1OC1A 4KNCA 5FROA 1VQOI 1DZRA 2D6OX 3CJTB 2L7FP 2NPIA 3WNPA 2E19A 3HOZJ 4IGQA 3POGA 3NNGA 1XJAA 1W36C 3V4GA 4LMYA 3OYIA 2A05A 3VDDB 3ZLIA 2XB5A 1J3RA 2RDRA 1GUUA 5ISLA 5FFZA 4CICA 1I50J 4LG0A 1MS5A 1O3QA 4XXAA 5BNNB 3N9PA 3I3QA 2E1MB 4AQ6A 4ZH4F 3HRMA 2G9FA 5FDBA 2JPCA 4U2AA 3AZVA 3BG3A 2R063 1ZBE3 4AIJA 2OQ7A 5FCCA 1UXXX 1E3OC 4AHXA 3VZMA 3ETQA 1RJ8A 1POV3 3M8FA 4KIBA 3U75A 4E70A 2YG0A 5CYVA 5LFAA 1WJ5A 3DECA 4YG0A 1NZIA 3R6SA 4QB1A 2EV5A 1FXZA 4RLQA 1USTA 4MQVA 1DUXC 2TDXA 1FSHA 4K1ZA 3PDQA 1FP1D 1R64A 2G7HA 2VD7A 1JUPA 2L9RA 1IS3A 5I91A 2XAHA 1MSFC 2OC6A 3KD4A 5D4RA 5AC93 1TE1B 2E5NA 5EFUA 3POIA 5FYCA 2XWBB 3IDBB 2M87A 2O0YA 2X09A 1O8SA 4YFZA 1BOBA 2IXSA 2Y48A 1ON1A 3R61A 4D69A 4K21A 5A6YA 2NP0A 2YFUA 3FXRA 5FZ3A 3UGGA 4HQEA 2BVBA 2JEMA 4A44A 3CCRI 3BY6A 4GCVA 4XIOA 4XLPF 4WM7C 1DZQA 1F1ZA 1XC6A 5CAZA 1Y0NA 2ZGKA 3C7JA 1T2XA 1XGOA 4XLCA 3NAPA 2DA2A 4YLZA 2KLOA 1B72B 2R7EB 3LSRA 1LVKA 1U2WA 1T95A 1F9NA 2FBKA 5BMZA 2AEYA 1ZZBA 4BIFA 3A02A 2R061 1PO13 1ZBE1 1QHHD 2ZMLA 3NWSA 3HHHA 5D1IA 2P4EA 2QQJA 1US2A 1IV6A 2IJLA 4AG4A 2B9SA 2WZPP 2DOAA 2DYCA 4BE0A 4IGPA 3ZPYA 4AVPA 3D5SC 1NA1C 4OUMA 1VI0A 1CAVA 4JKMA 2D7FA 3VZNA 4PI0A 3U1DA 4Q4V1 2XF5A 3CCYA 4M01A 3L9FA 3GUDA 4AK3A 3KZIC 3ABZA 4B48A 2WFF2 2O0OA 4PK4A 2A6XA 1B8IB 1LJ7A 2GALA 5AC91 3FXLA 1RUJ1 2W1QA 5IYYA 4QXHA 4FCAA 2Y38A 4LIUA 3NNFA 2O1QA 2HWE2 1DHKB 2K5CA 5IAXA 1SHWB 2KQRA 2A68F 2ZGUA 4AW7A 2E7AA 3PUHA 1ONVA 1UY0A 3N9QA 3NAPC 3KVAA 2J1TA 4AYBN 3B01A 3GTOJ 1ZA4A 2KDOA 2MA3A 4QSHA 4BQ3A 1HSTA 1SLIA 4PJLA 3DKXA 3DEUA 5EHDA 3ABKH 4HYEA 5DG1A 2JRTA 4YZ2A 5FMBA 3WTZA 1MDMA 2VBZA 4DFSA 1GV5A 4D6RA 1AVBA 1V00A 4NR1A 3PUIA 1NY71 4NUBA 1B9MA 4MNUA 1CAWA 4Y4RA 2BFUS 3LSGA 3K75B 4H55A 3BPXA 2I45A 2R042 1Z77A 3ACHA 3W59A 1XE7A 4H2AA 5LCWL 1ULCA 3VHPA 4LIVA 1K5MA 1KU2A 4HA8A 1R4NB 4XMAA 4DO0A 4ZDLA 2VULA 3X2QH 4Q4ZF 3JRGA 1D0XA 2VZ3A 4YG2F 3GNEA 1COV2 3NARA 1WLTA 4Y22B 4OMYA 3IV5A 4LG3A 3GO5A 1JUIA 2VMFA 4M6VA 3SKJE 2STTA 3K70D 4EN0A 3T2QA 1UN1A 2PHUA 2HNHA 1N1YA 4RS5A 2QQIA 3DF8A 2E26A 4H4KC 3ABTA 3O2PE 4O3MA 3EYIA 4NWVA 1XC5A 4QPGA 3AX4A 3QBQA 3GZTB 1TP4A 2E60A 1D5YA 3GXOA 2M8EA 4MV2A 4RFT0 2CU7A 4MYEA 2PN6A 2CQKA 1ZG3A 2WAAA 3MUY1 2E34A 1ASJ2 2H8RA 4IHTA 3O8HA 1AWCA 3WNKA 3WDUA 1YG2A 3FM3A 4Q1PA 1N3PA 4WVVA 4FSJA 4DUVA 3NW4A 5ANQA 3FDYA 3L2RA 4CSWA 1WCKA 1SCRA 1SFYA 1W9SA 2Y64A 3E6BA 3A0BC 1PVXA 5FZBA 4XRFA 4DUXA 2QM3A 4W4ZA 4A69C 2VUCA 1UG0A 2PBIA 3WU1B 1MBFA 5C8CB 1K5MC 3QYBA 1RNLA 4JGZA 3WTVC 3KE2A 3B02A 4BQOA 4MGZE 5M5XJ 2DU9A 3WHBA 1FTZA 1KQ8A 1F8VA 2EWNA 5F08A 4QQLA 1MZ5A 5C3EJ 4D9JA 3E6MA 3GFJA 2XAFA 1LOGA 5D4SA 3S3MA 1OUSA 3WDXA 1FMVA 3DGTA 4NIDA 1C8M3 1H4GA 4A12A 3BC8A 1SFXA 3MZHA 3NKGA 5EG0A 1X2MA 4XF1A 3JRBA 3ZXKA 5JDBA 1GMMA 1QU0A 1X1DA 5KHKA 5J1YA 3OYWA 4QPGC 2KFDA 2JDAA 4HVQA 5KK1A 4Z92B 3ZKUA 2AR6A 4JRAA 5FKBA 3V7SA 3F72A 3F22A 1IJWC 5FZOA 2ZX1A 5B2GB 4C2UA 5HLGA 1YC61 3K4ZA 4QPWA 4UFHA 2MHFA 3HC7A 1T08B 1EPZA 2K3FA 3MQ0A 2A6TA 4XURA 1QXJA 3MW3A 2G1MA 1NE6A 3AKRA 4K3UA 5DCFA 1U3EM 5C70A 1F5TA 1FC3A 3ME2A 4AVCA 3ZXJA 2VOPA 3T4HB 1GOGA 3PSIA 5DAXA 4BU2A 4I76A 5HDKA 1L0OC 2VM9A 4YGBA 4NPMA 4AEKA 1IGOA 1QNTA 4JGZC 3BOPA 4QQOA 2ZMKA 2X10A 1EAH1 1ALYA 4DYQA 3KYDB 5CKTA 1NK2P 1HKQA 1TT0A 1D7PM 4E4DX 1SLCA 2R7FA 1AZDA 1FV2A 2E31A 4SBVA 1O5UA 4AXOA 3R60A 3CCEI 2ZX0A 1HXS2 1P4XA 5LEJA 4WF2A 5IVFA 3LF7A 1I3AA 5T5PA 3FHAA 5L9VA 1B6AA 1VBC3 3S57A 4PLMA 3IH3A 1OI6A 1SLAA 4HSLA 3CZJA 2CY6A 2YU3A 3OIOA 5C71A 3K69A 2AYHA 4MEXF 3PVNA 3W20A 5HODA 3P9IA 1P8JA 3OBAA 4RR3B 5FP7A 1A31A 2MLGA 1UX6A 3OOXA 4XCBA 3M3IA 3HNYM 3AB0A 1X3ZB 4EM2A 4XIDA 1LB2A 3C2GA 4F7ZA 4JC1A 4K2EA 3FMRA 3M2MA 1K78B 2WSUA 4H14A 1WCSA 2YGMA 5A1LA 3WW4A 3G73A 1VRH2 4EZHA 5A3NA 1NCQA 5FY9A 3ZSLA 3AKZA 5A7NA 2VQGA 4S05A 5KNLA 3DTKA 3RPUA 2FMLA 2QZ3A 5JVVA 1WH5A 4QPQA 3PLQA 4YVSB 2MYSA 1SVMA 1QQIA 5T5LA 3FMQA 5I0SA 1K42A 5E8GA 1DGRN 1DBNA 1MBJA 5G04L 3DU6A 1ZRDA 1DG6A 2RV9A 4CCLA 3VV1A 3GFIA 1E5IA 4XNFA 1UOBA 1H1MA 1PZ8A 5KAFC 2YR2A 5L9BA 3LA3A 2A6ZA 1BI3A 1AR82 1AL21 2H0VA 2K9LA 3KGZA 3LEMA 1AYN1 1BOAA 1RUE3 2R7OA 3WNLA 2OUHA 2WQZC 1SPPB 3AFGA 2ZEXA 3T30A 3H3VK 1S0JA 3JB8A 3ZSEA 4J00A 2VZQA 5FD6A 3KHCA 5I0RA 5LD2C 3BG9A 1N3QA 2R7ZJ 1OF3A 3FXMA 2BXYA 2JWPA 4A5NA 3JAMZ 4MADA 4Y4YA 4GFBA 2ZAAA 1ZR2A 2OUMA 2Q8DA 3AJZA 1AR63 4XFFA 4QDSA 4QGLA 2EV6A 4G8XA 1S29A 4PGHA 5EEHA 4QPIA 1YIOA 4COYA 4TYSA 5FMOS 1NK3P 2LH9A 4KNYA 4LO8A 2HTSA 3G6EI 1K3IA 5F7UA 2IBDA 2MFZA 4HKLA 5LASA 1PVC3 2YPJA 2WA3A 4UVBA 1GDTA 3AP5A 3F3XA 1XNKA 1JTZX 5DAVA 3GJAA 2E1OA 4Q0QA 1RUOA 1EY2A 4CEWA 3TEZA 1DQ4A 5A7WA 1ZBA2 3ZDVA 1R1A2 1YTYA 3LPFA 2WNVB 4QGMA 5I8YA 5DUKA 3IH2A 2Z5UA 5LRRA 2M0CA 3SXYA 1FOD3 2YV8A 1OMIA 4LE4A 1QOTA 4A3CJ 4Q4Y2 4HG6B 3LDKA 1VJ2A 2LC2A 2XONA 2NS0A 1R5HA 4AFBA 4BHPA 1LOEA 5BNPA 3AC0A 3K4DA 3K7AJ 4DYCA 1GUIA 1MH3A 2RC4A 3WG2A 3WW1A 3ZVXA 1VBD3 5LBBA 1BCXA 4B3AA 1SZBA 3P5BA 2MLKA 1H9GA 5F1JA 3FKIJ 2VBYA 3OYLA 1CAUB 4GWIA 2M4GA 5CISA 3TOBA 4DIQA 3FN9A 2KD7A 2HWB2 3VHRA 5DUWA 2AO9A 3AMHA 1QJZA 2K2SA 5K4LA 5GM0A 1EF4A 3ZN5A 1MZFA 3ELKA 2FNAA 2XPVA 3PJQA 1RTVA 2B42B 2Z2SB 2VQ0A 1RRJA 2PN5A 2VCMA 4CEWC 3N7KA 4DW6A 2L02A 1PIV1 1VQ7I 4XBQA 3V8JA 1WMDA 4M3GA 1RI7A 1BW5A 2PJRA 5A2QK 1UMZA 3L1PA 3HYIA 2QTWB 1G3YA 3DEEA 4YW5A 4P9WA 4FPEA 2HVRA 2MC3A 3OBTA 3M8JA 2LY9A 4B4QA 4M9ZA 4WXCA 1U0JA 1S7AA 4LJZF 3QOPA 1UL9A 2KXLA 3I4PA 2QQLA 3DYPA 2MEV1 1KS5A 1DGRA 1ORKA 4M9XA 3CCMI 4JX6A 2YZ4A 1FOD1 2F5FA 2GMEA 2CDOA 3TDUC 2OPWA 4ITCA 1V6LA 4FOQA 2D5VA 2IGOA 3S7IA 1IPJA 2VJXA 1KFXL 4IUGA 2CYYA 4A3KJ 2IXIA 2HBTA 3K0LA 3KT1A 1W8TA 3K10A 4A3GJ 3NEUA 2R0QC 1KITA 3LMMA 1HC8A 2X0LA 2VZ1A 4YYOA 2JVHA 1FSEA 1WCUA 2XUBA 4FT8A 2RDQA 2B7YA 1AHDP 2HR3A 4BIOA 4B09A 2ZBJA 1GSLA 5FWJA 4ES8A 2LKPA 1A3KA 3S1RJ 4DXZA 3DCFA 3FJSA 3OF1A 5HS8A 1SFUA 1W3XA 2IA0A 2PQ8A 1T98A 2KHMA 1I6HJ 1FOKA 3J7MA 3F6OA 3HBKA 1BR2A 4ZDOA 3AXDA 5DEQA 2X48A 2G9WA 5E79C 3VSLA 2CJJA 2AENA 3RMXA 1TT5B 2WJSA 4LBQD 2GIZA 4ZYEA 3FF5A 3GBWA 4WZCA 1VLNA 4TSVA 4LOSA 4NPRA 1WW6A 3VBSB 1DDLA 5HNFA 3E6CC 2V6EA 2VZTA 3K1MA 1G9BA 3CLOA 2JUGA 1KZHA 2TNFA 3LCPA 4PJNA 5CIRA 5BNOB 4UNOA 5C4WA 2XLGA 4EN8B 2NVUB 3ZXLA 3V56A 2P5VA 2TRTA 4B8XA 3I59A 2YMZA 1BR1A 1W2AX 1BIAA 3Q8CA 1G3WA 4CA0A 2OD5A 3AXEA 3ZM8A 3K4MA 4RQPC 2C9AA 1L7QA 4DINB 1JGGA 2FZ2A 4L11A 1W9YA 1KONA 1EV11 3HQXA 1H8TB 2L9LA 4IHXA 3KZZA 1TQ5A 4N7UA 1W7PA 4P1WA 4LKFA 1ST8A 3S3NA 1T38A 3ECQA 4WVZA 4HSTA 1MH4A 4IE7A 4AEJA 1VMFA 2O6GE 2Y8KA 2M2EA 5HCBA 4QAWA 2LBFA 2HYFA 1VQMI 4JX0A 1OXCA 2CTVA 3OIPA 2J1VA 4W65A 2DT5A 1KA8A 1REDA 1ENSA 2V7FA 4O65A 2PX9A 1LDKB 1WVRA 1TMF3 3IZOA 3JD71 4LLOA 4W6WA 4EN9B 4W6YA 1QJY2 5FLJA 3WDWA 4ISRA 4XM3A 2PLV2 2XGXA 2YXSA 4KBZA 2QGUA 1D1CA 5F3GA 4AWDA 4DEVA 3RZZA 1SD6A 5C4WC 1SQ4A 3Q8EA 2ZCWA 3ZQLA 3IL2A 4QX3A 5DTDA 4XABA 1M1EB 4M3BA 4GWMA 5HXVA 5A3MA 1WH7A 2OTJI 5ICFA 1ODMA 2GZWA 4FHTA 3RWNA 5E16A 3X29B 4I99C 5HV0A 4AGVA 3OWTA 1GVDA 5FO8B 1GZCA 1OD5A 3OL4A 4D7MA 2WT1A 1XNAA 3M1HA 4LE3A 4NHYA 3AL6A 4WVMA 3THTA 2P0WA 5LA2A 1R00A 2LNBA 5K0UA 4P9FA 3NV4A 2E53A 1RUI2 1HRI2 5JXIA 1T6BX 4AEMA 3DP7A 2RJ2A 4OMCA 3TW7A 1O4YA 4MTEA 2D1HA 1HW2A 5LA1A 1O7FA 2WR9A 1LULA 3ZYPA 4ZYDA 5LZ6A 5FUIA 1UMQA 5B66C 3WZ1A 4ENNA 5CFDC 5C7GA 4AVVA 2V4AA 1ZA7A 3T2TA 5CFCC 2ET7A 4YZ4A 2A1XA 3OOPA 4Y1XA 4XF3A 4HSJA 4P9GA 3AL0B 5C9AB 3JB4C 3UL2A 3KP5A 4WM8A 3DFGA 1UY3A 3MD2A 3JBG2 1B9NA 4IERA 2VUDA 4IJAA 3ZPLA 4LPLA 4PJ0C 5L9RA 4YEJA 2ZZJA 4HT1T 2DDBA 2TBVA 3HSRA 1PO23 2D6PA 3NV2A 4A6OA 3CU7A 1R083 5I8SA 2QE3A 1R4MB 2FUG2 1SANA 1W0TA 1XGSA 1ULDA 2WWYA 1TMF1 1AYM3 1YJLA 4KMFA 3O12A 1X58A 3OYAA 2D6NA 1OYYA 3KP3A 3O1MA 5HVQC 4RGRA 4COWA 1ENQA 1GANA 5K0UC 4P5YA 4MLOA 4GIQA 5L3CA 1J75A 3MF9A 4FO9A 2P2KA 4QD2A 3OTFA 2E36A 3Q8FA 1UXZA 3FWEA 2X5IA 4GKYA 3HOSA 3U21A 2WYSA 3OGJA 5E89A 3AKPA 2FOKA 4J19A 3CCVI 5EXOA 2VKDA 4AVSA 2A69F 3PFYA 3SJMA 3CJXA 2K4JA 4RGSA 5DS9A 1AR73 3HNBM 1XU2A 3F8BA 1IPSA 1IV8A 1T56A 2Y2ZA 2H6BA 3GVAA 5AIPA 4KWLA 4WM8C 4XVHA 3SMHA 4OHXA 4CDQB 2ZSIB 3LDRA 1I6XA 5C3OA 1DU0A 2XAJA 3TWIA 4HQMA 4IVNA 3WINE 2ZEWA 2X53S 3P5JA 4LHSA 1OQDA 2G4IA 3KIOA 2F48A 4L5IA 5JWPA 1UD1A 1ENRA 2DFFA 1OJLA 1KU3A 4LMFA 2CV6A 2P7CB 4YARA 4J01A 4IRGA 3WP5A 3GZNB 4ZTFA 4LTAA 2K9MA 3FHZA 1RHI2 4DBQA 4A3JJ 2PMZN 4EQQA 1SFPA 4XOTA 1D0YA 1QDCA 1YJWI 4OI0A 2BY3A 5F3CA 5FK8A 2B9VA 1VQNI 4NQWA 1W9WA 5ANNA 1W6MA 4HOOA 4FAHA 3WF2A 2X5IC 3OR2C 1S7OA 4JVAA 1U0AA 2H27A 4CE8A 2OU2A 5CVVA 3FHIB 4FOYA 4OCTA 2QA4I 2CL2A 1PGL2 3MCZA 3OR1C 3HSEA 3MN2A 2XQXA 3AK0A 1PZ9A 4ZYGA 3WDVA 2WZ8A 4X0GA 1LNWA 4GAZA 3T09A 4IEOA 3LDBA 2RAEA 4GB31 3RJRA 4WXHA 4OI4A 2D97A 4QX0A 4MXWA 5F3EA 4PHZA 4GH4A 3HOYJ 1HB1A 3H50A 1P6RA 3QLQA 1S9HA 2BW3A 2VNGA 4L0PA 4HVOA 2IPQX 1MBEA 3LFIA 5IT3A 1YFHA 4JTNA 4KN4X 5SV8A 1RUC3 5IOYA 3NNLA 2UXNA 1OCOH 4WCGA 5IYCJ 2GNDA 5KHHA 2QQ8A 4RB1A 3RZOJ 5J1RA 1IRXA 2PFBA 5FY5A 4ZXEA 1JI6A 1WRJA 2BBYA 3ZR8X 3ZSMA 1XCVA 1OA2A 1IXRC 3VUOA 3TO9A 4R9BA 2XL9A 2D45A 3NRUA 2R071 2K7LA 4Y1VA 2QQOA 1XCBA 2LM3A 3SCGA 5IPAA 1TME1 3GZEA 3I2GA 3HOXJ 1MD0A 1OHFA 4TLGA 2R5YA 4AE2A 2F4MB 4OINF 3BPZA 1W04A 2VW1A 5IUQA 3ZFGA 3CMYA 1K4TA 2HOSA 3THPA 5DM6F 4CO8A 4EJRA 3WG7H 2LS6A 2BGOA 4LBQB 2VONA 4M3CB 4NNJA 2NAZA 2BFUL 4QX8A 3OUHA 3HPHA 4GH4C 1RUH1 1S6LA 3IP4B 1AXKA 5DUXA 1IKQA 5E6HA 2ZXIA 4E6KG 1Y9MA 2HZTA 1F36A 3RG0A 4D6SA 2XJVA 1E5HA 5FR3A 4XLNF 5IVBA 1VQLI 3ZN6B 5IT9K 4CEYB 3MIBA 1QRYA 2CW8A 2EA7A 5FK7A 2RKHA 1Y9GA 3W2AA 2PLYA 3IBMA 2WIIB 1ETVA 4NC8A 1XYOA 3E5XA 2W46A 5FPAA 2K0GA 5FZ0A 5FO7B 3OBRA 4C2MJ 5FFOC 3O14A 2JT1A 1RUC1 2CW7A 2WV0A 4CPBD 1E2XA 3BOWA 3HOWJ 1WHUA 5GLUA 2QEXI 3H0OA 5EWSA 4YFXF 1IQAA 3S3OA 1OLME 1FBSA 4FCYA 2BY1A 3PO3J 3CDZB 1CX1A 2ID3A 3R4KA 4HKWA 3M8LA 4BJTA 1BBT1 1DU3D 3POBA 5FY4A 3ZYIB 1X33A 3K77A 4B1LA 5JZGA 3ZFGC 2YB7A 3POFA 2AH2A 3LSDA 1JE8A 1YOVB 3WLUA 5F0HA 1WA6X 4OOIA 3JREA 1BC8C 5KHDA 3ZOBA 5AFBA 2P17A 3O1VA 4PIZA 3QPHA 1FZPB 2RS33 1WWYA 2I5UA 3J4UH 1X8EA 3KF5A 5HLTA 4YG3A 1WLDA 3I3EA 3FXKA 1B35B 2CS3A 2LROA 4LEJA 2DDAA 2R062 3FK7A 1ZBE2 1DPRA 2OPTA 3RJ2X 3BOQA 3HQUA 3JCIA 3N7MA 1ZREA 3HL2A 3G1LA 3R4SA 3RI8A 4DQ2A 2XR4A 1LGNA 1USSA 4LA2A 2R7XA 1K7AA 4Q0SA 3HRUA 5GLVA 4GZ9A 4HPKB 3PMEA 2CUFA 1J9IA 4Y13A 3CLQA 3M70A 4BXSV 1KQRA 4R1HA 2WFF3 2GC2A 3MKYB 4OMZA 3HEFA 4Q4V2 2VOVA 3A0HC 4QKBA 2KR2A 1ODDA 1TQMA 5BOXA 4K8RB 4P9IA 3T08A 5JLWA 2QZ2A 3GBGA 4FPYA 1JKQC 1YQAA 1X1CA 4K9SA 1MR5A 5KHGA 4E7JA 1HKSA 3F21A 4B44A 1IZ3A 4OHVA 4UBGA 2HWE3 5ILSA 2OTLI 5AC92 1XNBA 5BY5A 1YLLA 3I3MA 1XS9A 3OYKA 1IUYA 4AI1A 2ID6A 4MGIE 3HIFA 2IVMA 5JZGC 4FPJA 3OYMA 2FMDA 5D8KB 2HKOA 5F9TA 1MS1A 3JRDA 2J22A 4PZJA 2F5VA 5JAXA 2Q0OA 4B3XA 3H35A 3ZMSA 1Y56A 4R52A 4C1WA 1W8WA 4XLEA 1F31A 3S8PA 4QKDA 1ONAA 2QLZA 4E7LA 3S16J 5K1YA 5LBEA 1N1TA 5A33B 2R043 1X7NA 2FU4A 4RHV1 1VP6A 3PTYA 3VBUB 2RS31 3VEPA 1V5FA 1YO8A 3G1OA 3OMYA 2RM23 4OVEA 1R093 1O59A 1VBB1 3ABLH 3ITQA 5JIUA 1MJBA 3CO2A 2D6LX 4CDXB 2LRPA 4TZDA 3ASIA 4G9YA 4NMIA 4B1RA 1H2KA 1O91A 1IPKA 4R79A 3JRFA 3TYJA 1H9WA 3F8NA 5FKLA 2CV1A 3DWLE 2HDWA 1RJ7A 1X82A 3FLPA 4CUCA 3HMYA 1BK0A 4I3PA 5FQ0B 1G7YA 4OIQF 5J3LA 4GJYA 1DF0A 3SH3A 5BV6A 1WCDJ 3TOAA 5JLVA 4G12A 2PXJA 4PSWA 4KQ7A 2EPFA 1QH7A 4R9DA 1AJKA 1RB8G 1W05A 3CO7C 2XJTA 4FXKB 3CF6E 4COZA 2JDZA 5JPNB 2WBKA 3K48A 2D5FA 4E7SA 4B7EA 1R5ID 1ASJ3 4BMEA 3F8FA 5GLTA 3IPVA 4YELA 1ZHFA 4QX1A 3ECHA 1G3TA 1ZAOA 2DCTA 2HYKA 5CVUA 4ASKA 3V0AA 4C90A 1GR3A 4AL9A 1GOFA 5IATA 3IRRA 2RR11 2JG8B 3K4BA 3DTEA 1FPN1 1ND2B 5F5IA 4FOVA 5C4JJ 5FZ6A 1WW4A 2V9VA 4Q8KA 5JI9A 4CDWA 4AWXB 2W1SA 3IAPA 4O9EA 4F3QA 4AHWA 4TN7A 1ZELA 4IETA 1R091 1POQA 3ABMH 4XFIA 5L3GA 4IV3B 1VIWB 1RR7A 1LQ1A 3JQWA 4RYDA 2FCTA 1J1LA 1DFQA 3CC2I 3IKTA 4JK1X 2DA1A 3L2WA 2RE9A 1N75A 5A3TA 4RA2A 3W6JB 2L5QA 1W4MA 5FUPA 2OYZA 3S17J 2JJ6A 3LSJA 4JHZA 3QP5A 1IW7F 4EM0B 4AAPA 2L9SA 2JE7A 1U8BA 5JVGF 3VD9A 5KR7A 2JE9A 1S0DA 1RZ4A 1XXNA 2WO3A 1XSQA 5FMOL 3WQBA 4DY5A 4KWKA 2XL7A 3AP9A 3JSPA 4LK1F 3T0AA 2RJLA 4LHNA 4IEVA 4EGZA 5T5JA 3JQXA 4AEDA 1MGTA 2ZAHA 4HMZA 1PP7U 4LORA 2BUKA 4XJ9A 4MUVA 1X4OA 1E17A 3I49A 2VZOA 5J3UA 2D3SA 1G86A 5BS6A 2RG4A 1W5SA 4KWJA 5FY0A 1X4PA 4D1QA 1RMU1 4V2WA 3GYHX 3HOVJ 1KXGA 2STWA 3VWBA 4C91A 1OH4A 2FBIA 2EFNA 4NRQA 2A6HF 3T0YA 1NCRB 4A42A 4MGKE 1Y1VJ 5DDJ1 3ZPOA 5F6LB 2XUMA 3POSA 1BI0A 3DPUA 2BDRA 1CQTA 2LR8A 1HB4A 5M3MJ 2DO7A 1UQXA 5A6QA 1IUFA 3OY9A 3LAGA 5FLXK 4IRIA 4OHZA 1JYVA 2OW4A 2GDFA 1W8UA 5ABJA 3HPGA 3SZTA 1W6NA 2EF6A 3REOA 1ETWA 2Y33A 5GTIC 1DGRM 1HN1A 3LOIA 5J40A 1ETXA 2Q5TA 3VBFA 3NWKA 3CQOA 3TN91 1VRH3 2OA2A 3OGVA 1R22A 5E1ZB 4MO7A 4XF0A 1EKEA 1A36A 2JA5J 1YEWA 2C4XA 3LWFA 3SZGA 2R7TA 1MS4A 4OZOA 2OT7A 5KAIC 3HZJA 4ESJA 3SZPA 4C3IJ 1Z3XA 2XPWA 2JDKA 4G4FA 4S2FA 4I30A 1O4XA 2XSJC 1QQP3 3DKWA 2E2JJ 4PQQA 3FXUA 2WNEA 2E2HJ 1FMD3 4AAXA 2M7BA 3KQ4B 2YDEA 1D8KA 1TQPA 1IG3A 1NOVA 4URTA 1AL22 1UZCA 1EV7A 2Y34A 2YYOA 3JU9A 1AYN2 1CZSA 3FBNB 1FNYA 2BP6A 1KYZA 2CYFA 5FOJB 2OZUA 2SLIA 4CYCB 1ZVFA 4CU6A 3GF2A 2PHTA 1KJLA 2GH8A 4AVZA 5ABJC 4OHYA 1XTAA 3N7JA 1H6XA 1W2UA 2W4SA 3VBFC 1ZNPA 3RMYA 1FT9A 2X6OA 4XJWA 2FOWA 3GFMA 5HS7A 1JTYA 1FLIA 3PUFA 3J9SA 4P08A 2R5ZB 2DVAA 5EEAA 4ABZA 2AHQA 2WWSA 1AXZA 1IS6A 4DMIA 2RQPA 1UY4A 3OCPA 3LZZA 3J80Z 2C1FA 1MVEA 5LGNA 2M1BA 1JUMA 4ON0A 3I53A 1TW2A 4AI9A 2WNUA 5L36A 3I4MJ 2NYXA 3CBNA 3WOGA 3VSKA 4OQ8A 5F2WA 1TWHJ 1GXQA 1BKZA 4CXXA 1W8FA 4UW6A 1LHVA 2XPJA 2WA0A 1ULPA 3TGNA 1POV0 3S1NJ 2W87A 2GNBA 4QXCA 2L7KA 2BJSA 3ZSJA 1H0BA 1ETYA 3WU0A 2W52A 2DBNA 1TTYA 2DJNA 1V6MA 2NYYA 1P2FA 2FDKA 1R1UA 3I2IA 3BJAA 1NT0A 4Y7NJ 1W2TA 1NH3A 1RUD3 1HA8A 5CPRB 4FPKA 1WQ2A 3PUSA 1BI2A 2M7AA 2O03A 2EICA 2ESNA 4GALA 2IC1A 3L09A 1RXFA 1FOWA 3ECOA 1JGSA 4LKEA 4JX5A 2ES3A 4XFBA 1RVF3 5IHRA 2LOOA 1SAXA 3A4CA 1AHSA 2ZNZA 4Y1YA 4S04A 3APBA 1T6GC 4XQ4A 2B0LA 3WF4A 4YM1A 1TWCJ 3OS2A 1YHQI 1PUEE 1UG2A 3OGRA 2E1NA 2VE1A 4HX4A 3CLPA 5LRSA 2EXIA 3OPTA 4QB2A 5FIXA 2P6HA 5FYIA 2O9LA 4LG0B 5JIAA 2A75A 1GWLA 1V55H 4YPJA 4EROA 4WM7B 4HV6A 4TV7A 1SBEA 5ACA3 1AR62 1EA3A 1HSJA 4B43A 5J47A 2L4MA 2A07F 2WNUC 1TG7A 4O7XA 4D7TA 5CEHA 1CAXB 2E5ZA 3KEOA 4XLHA 3ENRA 1REEA 2KT0A 3B6CA 2ORXA 4Q8LA 5GAHJ 5DZEA 2R7RA 4XXPA 5E8AA 4A41A 2EA4A 1D0GA 2CNAA 1DZTA 5HCHA 4Q26A 2A71A 3ZXSA 1OQEA 4A7YA 5FZGA