2WC2A

Nmr structure of catabolite activator protein in the unliganded state
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
209
structure length
209
Chain Sequence
VLGKPQTDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYGTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Camp-Mediated Allosteric Control of the Catabolite Activator Protein.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription regulator
molecule keywords CATABOLITE GENE ACTIVATOR
total genus 38
structure length 209
sequence length 209
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2wc2A02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2wc2A01
2FRHA 4ON0A 3OF1A 4WVZA 3LAJA 1ZAOA 2C0ZA 2JZYA 2QZ8A 1I1SA 2GQQA 2P6TA 4M73A 4X6RB 1IN6A 2PAKA 4XFGA 4PCQA 4WXHA 1ZREA 3OGJA 1O3RA 4YSFA 1XGNA 2Z69A 2D40A 5DCFA 1VTNC 4KMUX 4UXNA 1R22A 2YX7A 3TKYA 5D1IA 2QYOA 3ZMDA 1BN5A 2OA2A 4HF2A 3GFLA 2UY9A 1LR5A 1RZ4A 4HX8A 1FSHA 2QVSB 2MHFA 4LJZF 5E1XA 2CGPA 1IF1A 2Y0OA 1B4AA 3M1EA 4AWXB 1ZN2A 1FP2A 4JVAA 2YU3A 4L18B 4R79A 5DEQA 4L11A 3BDDA 2D5FA 3P7NA 4CDGA 4MEYF 5ICGA 1ZLKA 3R0AA 3UKVA 3ABUA 2PHLA 2D45A 5AONA 1EV7A 4ZU7A 2Y0MA 2QJVA 3VFZA 2P17A 3BCWA 2JT1A 1F1ZA 3EQLF 4IVNA 3GLXA 4FAGA 3QAHA 4XEZA 1Z9CA 3BALA 5KHKA 1U5TB 4IXAA 1YFHA 3KP6A 2O8XA 4JTNA 3FWEA 4LLLA 1F5TA 1KU9A 1Q1HA 4YYOA 5I0RA 2PG4A 3HRMA 2ET1A 4GXOA 2XL9A 4YFKF 3C3VA 2FSWA 4Y17A 4HX7A 1CAUA 2DQRA 4XFIA 3WW1A 5HS7A 1PP8F 4XBFA 2K4JA 5JSRA 5D6EA 4RS8A 3K2ZA 4D7SA 1SAXA 4MTDA 3J81Z 1STZA 5ICEA 1ZZ8A 4G9YA 4TLFA 4WBBA 3PFIA 3BY6A 4UVBA 2YX4A 5CADA 1FC3A 4QWQA 3FHIB 1G3SA 2ZCWA 5F64A 1RL3A 2L4MA 3MDPA 3WTXC 5L3GA 4XFHA 5FQ0B 5KHIA 3LOIA 4EGYA 2DQLA 1D3YA 3L09A 4UXAA 4LA3A 4A2UA 4XSXF 4ZYDA 2O61A 1X8EA 3OV8A 4IEOA 4U7BA 5BS6A 1UHMA 5HDGA 2K02A 2P5KA 1CF7A 4RB3C 1HKTA 4BQAA 4XLNF 2W84A 2XLAA 4BNCA 2V1XA 3QACA 5D5UB 3I58A 1XCBA 3MWMA 1XCVA 2IA2A 3GZ5A 2ZBKA 4LD5A 2EV0A 1WKMA 3O14A 4KT5C 3KFWX 3HUGA 3LQRA 4P96A 2GAUA 3NVCA 3RYRA 4QLCU 1AOYA 3SZPA 3GBFA 1R00A 1J3RA 5LRSA 1R1VA 4Y15A 3SFZA 4IRGA 5HLIA 1SD6A 1Y9QA 4QMAA 1IUYA 4HDVA 3RYKA 2V9VA 4AVPA 3KLOA 4XFFA 3DN7A 3I54A 4J1WA 4PGHA 3M3IA 3SHRA 1T98A 1HW2A 3OCPA 3TO9A 1FT9A 1BM9A 4E2GA 3M70A 4KIBA 4HQMA 4KWKA 1IRFA 4EGZA 1KU3A 5C6CA 2KIUA 3ZMZA 4EJOA 1Y0UA 3D82A 1MKMA 1Y3TA 2VXZA 2QENA 2P6SA 4RD7A 3E5XA 4QGLA 2PFBA 3N4MA 5HI0A 2EA2A 3KMHA 2OZ6A 1VJ2A 3IDCB 1DGWA 3NKTA 4MUVA 5CVJA 3CEWA 2LDUA 2XAJA 4P55A 1EH7A 1OPCA 2VOPA 1E2XA 1PDNC 2G7UA 1YW7A 4Q0QA 4HDUA 2VT3A 4UV9A 1W7PA 2JPBA 1YIOA 4WXDA 4HSLA 2W24A 3I53A 1W5SA 1LKNA 1XGOA 2GA1A 5E1RA 1QPMA 2DPDA 3GYDA 1T38A 3QU6A 4CHUA 2KXLA 1S29A 3KGZA 4O9GA 4HW0A 1F9NA 1JE8A 4Z2YA 5JHUA 1QNTA 1ODDA 3CUOA 1OD5A 5CVRA 1I27A 1T6SA 3SQNA 2NNYA 4S04A 3F8FA 2NYXA 2HFHA 5IT9K 3KEQA 5BQTA 1XMKA 1A04A 4AVBA 2IW5A 1B9MA 4ZH4F 2HWVA 2VC1A 1YS7A 3T5XA 3IWZA 2RDPA 5IT3A 4IEVA 2L54A 5BV6A 1BBYA 2K9ZA 2OAZA 3ZDSA 4DNCA 3WGGA 2ESNA 3ROUA 2O03A 2PBIA 3K1PA 3EJKA 4N9HA 2PQQA 2P4WA 3GEZA 2HKXA 1U3EM 2HDCA 5IT9Z 2Q1ZB 1Z1DA 3BPXA 1U5TA 4KUMA 5I91A 3UKTA 4A0YA 5DYMA 2GH2A 3LAGA 1FY7A 2EWNA 2ISZA 1IPKA 2Q8KA 4ENMA 4KDPA 4AIJA 3C7JA 4K2EA 1T2KA 1I5ZA 3O2PE 4L9VA 4ENNA 4KNYA 4K8FA 2E7WA 1SMYF 2VBZA 3VHRA 2E1CA 5HDNA 1V3FA 3FM3A 2UXNA 2O0YA 5EZWA 2FU4A 3WTZA 1UW8A 2K0GA 3WU1B 3RKWA 2ETEA 4G7ZF 1LDKB 1ZGAA 4KFCA 1XB4A 2GC3A 1D5VA 1CAUB 3ZN0A 1NZCA 1QGPA 2A6HF 4E2QA 4UBHA 3BP8A 1E17A 4ESFA 3BOQA 4HBNA 4EWAA 1ULYA 3RDIA 3HT2A 2CAUA 3KP5A 1U2WA 4HLXA 2VC0A 1U78A 3FE5A 2VT2A 4WWCA 1YQAA 1CX4A 4M6YA 2LNBA 5JAXA 5K5OA 4IESA 4R1HA 1ZH5A 1ZVFA 2QM3A 1YS6A 1K79A 2J5OA 4F7ZA 4IEUA 5E8GA 4PDKA 3F3XA 2D5HA 3NSTA 2P8TA 2FQ3A 4KICA 4HLYA 3HSFA 1WQ2A 1WA4A 5FLXZ 1PMIA 2PHDA 2BNMA 2E1NA 4EWEA 4MGRA 4HF1A 3MZHA 1YFYA 2DK5A 1ZZ6A 1DDNA 3SCHA 4EJVA 2XV4S 1OKRA 4B09A 4PJYA 3DKWA 3TO6A 2QLZA 4U88A 3DPLC 5A2QK 4G8XA 1NE4A 4Q0UA 3DQVC 3H92A 4IEZA 4RAYA 5BPIA 5BMZA 3H8UA 4CXFA 2ADUA 5K5RA 1PUEE 5JSPA 4XETA 2UXXA 3HTUA 3QP6A 3GFMA 3J7AO 3H3ZA 1LEAA 2GIVA 4LUMA 4PGGA 2Z5UA 3EDPA 3GWZA 1L3LA 4Q0SA 1IN4A 3GYHX 5D8LB 1IZ1A 1B9NA 1G6NA 4UV8A 4MX3A 2CAVA 3GF2A 1GXPA 3DP7A 3QP5A 3K69A 2D1VA 1XGSA 1ZHFA 5L3DA 3KSCA 3DV8A 4RGSA 2Q0AA 1YLLA 2M87A 4D0PA 4O9EA 1W7PD 3PNAA 2Q30A 1R1UA 3R60A 2QQAA 3E5UA 4MH0E 1TLHB 3C3WA 3R61A 1CAXA 2LKPA 1JUHA 1YFXA 1TNTA 2E9QA 2XUBA 4YIIA 1OFNA 3NRVA 4HSJA 2ELHA 4B8XA 1EYBA 3BWGA 2FBIA 4HX4A 3ZMVA 4UVCA 3H50A 2DBBA 2H94A 4LTAA 2PN6A 2ZKZA 3MCZA 5FQ0A 2HYFA 1ZX5A 1DZRA 4ORFA 3FZVA 3PLQA 1O4TA 2Q2EA 3EYIA 3PQKA 4MGIE 3RKXA 3BJOA 2PA7A 4CZZA 3OOPA 3FXRA 1LEBA 1OR7A 2PEXA 2V1DA 4YIFA 4KIFA 2XHKA 4MGYE 4NB5A 1SD4A 4R52A 1HSTA 1GQHA 4UHTA 3VOEA 4PIXA 1BJAA 1OYYA 1HKSA 5AIQA 4JV4A 1MDMA 1BI1A 4META 4IF4A 2OZJA 1O7FA 2O8QA 1YTYA 4S05A 3S2WA 4IEPA 4Z82A 4XFCA 4L9NA 1ZARA 2FQPA 2DPUA 1ZYRF 4EJTA 1W5TA 2HZTA 4HZFA 2VBWA 3WGIA 2IC1A 3SCFA 1F4KA 2XAHA 4OIPF 2FMLA 3FHZA 3ACLA 4I98B 3GO5A 1ZG5A 5F1RA 1TW3A 3F22A 1B59A 4I09A 2M8EA 1J7KA 3WTYC 2A69F 3FXUA 3TNQA 4HA8A 3RKYA 1SFUA 2PQ8A 1KA8A 3E97A 4MV2A 5I0UA 1CAVA 1O57A 1XMAA 1EH6A 2XLFA 3M9AA 3JAMK 4BAYA 1CAWA 4O5VA 4BIFA 1HQCA 1IW7F 4RB2C 1GHCA 4XSZF 4KL1A 2V1UA 4XF3A 5ILSA 4L0YB 5FD6A 1YO5C 3UKNA 5AVPA 3O6BB 1J1LA 2Q4SA 3J81K 2XKPA 1IPJA 3GFJA 5FGMA 2Z9OA 2FA5A 2IXJA 5DV5A 5FPZA 1FSEA 4LEJA 2VQAA 1OMIA 3TGNA 2I45A 3C18A 1MJBA 4G6QA 5L3CA 2DK8A 2MC3A 5BUVA 5H6RA 3MYXA 2MA3A 1WWXA 2B8MA 1J58A 1UIJA 2TDXA 2CYYA 2ZKLA 4EM2A 3WE2A 1ZRDA 3FXQA 2BV6A 3KETA 4KN4X 2IXLA 5HOOA 5J8CA 5J48A 2EFQA 2DTRA 3JW4A 5BXXA 2CW0F 2JPCA 2X4HA 5EEGA 3FMRA 4OLLA 2Z2SB 1DP7P 2GXGA 4MEXF 3S0MA 2BE5F 3J80K 2C6YA 4XF4A 1UFMA 3KE2A 1R36A 4WZCA 2RC4A 4UNOA 3RTRA 5DD8A 1FYMA 5JCTA 1ZZ9A 1S6LA 5I8YA 4QGMA 3ZMTA 2QQ9A 4ENKA 1SQ4A 3JSPA 3FZ3A 3FX3A 4Q0VA 1Z6TA 1R5HA 5CJ9A 2ACJA 3V7CA 2HTJA 2FNAA 3H3UA 2A61A 1J5YA 2K4BA 2VBYA 4PZJA 4EMSA 5FCCA 5E20A 3ERED 3S7IA 1ZGJA 3KP3A 3OD0A 3FMSA 2EVXA 5T3NA 2QBYB 5ICFA 5I8SA 2F4PA 1JXSA 3CUQA 4P5OA 3RIRA 3IHUA 2VE9A 5I8TA 1PM7A 4D7TA 1RTVA 5CYVA 1QXRA 3BU7A 4ZU5A 1LRHA 4E70A 4OIRF 1FXZA 3RYPA 2KJBA 4FX4A 2Q0OA 2XIGA 2AXLA 3P9CA 4EJWA 2DT5A 5FO5A 5LHHA 4LA2A 2IA0A 3MQ0A 2PYTA 1Q3EA 4XF9A 3U10A 4LUKA 4ENJA 1EY2A 2YPRA 3DXJF 4I02A 2IXHA 2B0LA 3M7GA 1YFWA 5D8KB 1MGTA 4IEWA 3TNPB 4HN0A 4MTEA 2H6BA 5FLJA 1J2XA 2R3SA 4MHGA 4KN7X 2MH2A 1R1TA 3BPZA 1FNNA 1TW2A 2COMA 3HSRA 1U12A 5DUKA 1OYIA 4HAMA 1RGSA 4HMZA 2ZFWA 5LGUA 2IXCA 5FB2A 2ZMEA 4FHTA 4MZUA 5FD5A 5A2QZ 1SD5A 2CO5A 3GVAA 4XFAA 1K78B 1AWCA 3BPVA 2O1QA 3R6SA 2KJCA 2L4AA 2F5FA 2IXKA 4WK8F 4MGZE 3LSTA 3NEUA 3H1MA 3K0LA 4KIGA 4G7OF 1V70A 1WGPA 4IETA 1LB2A 3V8KA 1KQ8A 2ZNYA 1G3YA 2FOKA 2P7CB 2VOOA 1Z91A 1FYLA 4LB5A 1H1MA 4M74A 3ETQA 1P2FA 1LDDA 2QBYA 4G94A 2J5PA 1SFXA 1IN5A 2DW4A 3KLNA 1ZZCA 5AIPA 5E16A 5E8IA 4BYYA 1UIKA 5K1YA 4OFGA 5ILUA 1LDJA 2VBXA 1HXDA 3RZZA 2H6CA 5LGNA 3ECOA 4KWLA 4QXKA 2F5CA 1DUXC 1LNWA 4MGKE 4HV5A 2O6GE 5D5XB 5D5VB 4EV0A 4HYEA 2N7GA 1KQ0A 1XN7A 2IPQX 3EO6A 4B29A 1XDUA 4IERA 3D0SA 2OD5A 1YLFA 4RGRA 3D5LA 1P6RA 4JQFA 2W25A 4GYIA 5LLQA 5I0TA 5LEJA 2VN2A 4FT8A 2MNGA 3NW4A 3TDUC 1J3QA 2V6CA 3V7SA 5L3BA 1SMTA 1SD7A 4I0BA 2JSCA 3L7WA 1J9IA 5JFRA 4GGGA 4AIHA 3NQOA 2W85A 1U8RA 1J75A 2VE8A 3ML6A 1YG2A 4M9XA 3DPTA 2EFOA 5KHJA 4XRFA 1P4AA 2RNJA 1FLIA 2R7FA 3QPHA 2RV8A 4HF0A 1K78A 2UYAA 3CLPA 4A5MA 4DQ2A 1BI0A 4JK1X 2HGCA 4Y13A 3K9TA 4KA4A 1DPRA 3U0ZA 4IHSA 3L2HA 4NQWA 2STTA 3VB2A 4A6DA 5K5QA 4I7HA 1XSDA 2KIMA 4GYGA 1X7NA 3I71A 1CAVB 3MFKA 3QPTA 3WGHA 2V09A 2O3FA 5JVTA 2PJPA 1FX7A 1XSVA 1DPUA 1ZRCA 2DO7A 4AQ2A 4O6JA 4OOIA 3EHKA 1O5UA 2BGCA 2B5HA 2V79A 1J59A 5ICCA 3ZMUA 1P4XA 3LQQA 1RUOA 4LLOA 3SCGA 2QNKA 2A3SA 4BHPA 3IIAA 4OMYA 3N97A 1I1GA 1RIOH 3V8JA 3CLOA 3F8MA 2RQPA 1JGSA 1P4WA 2OA4A 3WTSC 3IRRA 1XRUA 2XLGA 3WW4A 1Z05A 3E6BA 3I64A 3IRQA 4MQ9F 3BZ6A 3TO7A 3JTGA 1WLTA 4YFNF 2DLLA 1Z6RA 3ISPA 4CGZA 3LWCA 4E2SA 2UYBA 3V4GA 1NHAA 5KK1A 3I7DA 2WV0A 2VONA 4ASNA 1UPIA 1HSJA 1QO0D 1GXQA 2QWWA 4IPAA 1X8MA 1YWKA 3ZQ7A 1KYZA 4Q5SF 2DU9A 2KKOA 4WF2A 3W6JB 5LHIA 3EETA 2HR3A 2WTEA 4LB6B 4ZYEA 4N9IA 4FAHA 1Z7UA 2L3DA 5KVRA 3JTHA 2CG4A 2EFWA 1TQPA 2QCSB 2M30A 2PMHA 2ZNZA 5FLXK 1S3JA 1R58A 1CAXB 3U11A 1QZYA 2EAAA 2VODA 4HBLA 4RGXA 2L02A 2P5VA 3BJAA 3V8LA 1RI7A 1USTA 1KU7A 1H1IA 1GQGA 1FPQA 3H1WA 3FFQA 4OIQF 3GZ6A 2ZJ2A 5BY5A 4IEXA 5E18F 3HHHA 3I0TA 4G7HF 2PMUA 1S8NA 1LVAA 2ESHA 4H0EA 4M71A 1PP7U 4A0XA 1MZBA 4EWDA 4LLNA 2MPFA 5E17F 1U6GA 3KP2A 3Q9SA 3CDHA 3CUQB 3SMHA 5KHGA 4H7LA 3COAC 3NL1A 1MJ9A 3GUDA 3HSEA 4KMFA 4UVAA 4R8HA 5CVUA 3KCCA 1W4MA 5CU1A 2Y48A 3P9IA 4IRHA 3R0JA 1L0OC 3Q9VA 5EFUA 3O3KA 3HHGA 3FMQA 2IA1A 2XAFA 3G3ZA 4HVOA 4EROA 3E6CC 2OQGA 2LF7A 3RPQA 2CV6A 5C8WA 5FPXA 1CF7B 2UWMA 4LLGF 2QQBA 4L2NA 2H27A 3CTAA 3CL1A 3HTSB 2PFWA 4A0ZA 1ZZ7A 3DEUA 1HW5A 4I3PA 4FX0A 4QGNA 2M5WA 3EUHA 1C0WA 3F8NA 1O3QA 1FYKA 2E7XA 3CJXA 4OINF 2HJIA 3CO7C 2RGVA 1BI2A 3B73A 3U9GA 3F6OA 1XSXA 1UD1A 2GC0A 4LULA 5BOXA 4U0VA 1X3UA 1T39A 5FLHA 2XGXA 2G9WA 1UB9A 2XAGA 2STWA 4Z07A 2HS5A 1NXMA 1B1BA 1L3JA 4LK1F 2XRNA 4A5NA 3KEOA 3LWFA 1G3WA 3SXWA 2ZMEB 2FMYA 4FBFA 3CUQC 4GCVA 3TOAA 2NNNA 2YR2A 4LGWA 3WTTC 4BH9A 1WI9A 1NYWA 1Q43A 3GFIA 3FF5A 2XL7A 3HYIA 2Y75A 1X82A 5LRRA 1Q5OA 3KP7A 4ESBA 1EH8A 1ZNPA 1KU2A 1FP1D 2WC2A 4O3MA 3ZN1A 2F5DA 4ZYHA 5L3EA 3E5QA 1U5TC 1XGMA 1I6XA 1YUDA 3LAPA 1ZZBA 5EEHA 3LA3A 5CVVA 3Q5FA 2F5EA 3ELNA 3OTFA 3E6DA 1FWZA 4OMZA 3LZZA 1H0MA 5I93A 1ZRRA 2PI0A 3MPBA 2Z3YA 1ZG1A 3ES4A 3JSOA 5H6QA 1KQ9A 4EM0B 4YG2F 4G6DA 3NJZA 3P9KA 4ETSA 3I59B 3DF8A 5CVIA 3HRTA 2ET7A 2A68F 2OZUA 4IJAA 2EFNA 4HLTA 2IRFG 2CFXA 4XF1A 3ZMSA 3F72A 1O3SA 3REOA 3I5UA 3GX4X 3CF6E 4TV7A 4AIKA 2GWRA 4WCGA 4HOBA 3M8EA 5FFZA 1QQIA 4Q47A 1XD7A 2CQKA 1K7AA 2HYGD 4JTOA 1R7JA 4ESJA 5LHGA 2ZO4A 3KZYA 3WU0A 2PTMA 1B6AA 5ERIA 3M8FA 2ATFA 4KU7A 3F23A 3LA7A 2EV6A 2FBHA 2FF4A 4LG0A 2GXBA 3K1MA 5D5WB 3ELKA 4BHCA 5HDKA 5JI6A 1LJ9A 2NRAC 3CO2A 4KYWA 3S7EA 5HVQC 4U7DA 3WTUC 1DGRA 1FI2A 2BNOA 1XE8A 3F21A 3SHFA 3ES1A 2GA2A 2RKHA 4RB1A 3EBRA 2PAMA 2K27A 1TQ5A 5K8SA 5DDGA 3KZZA 1TNSA 3QOPA 4Q0PA 4M9ZA 5E1WA 1BIBA 1H9GA 2QVOA 2D93A 3H7JA 4LG0B 5CLSA 3W6KB 1CGPA 2IT0A 4AQ6A 1MDMB 2ETHA 3WTVC 1YW9A 5F6FA 4L9JA 2NS0A 2OPKA 2D2WA 2A6EF 2MLKA 2EA7A 3ST7A 2HQNA 5JSOA 3FJSA 4IHTA 1ZG3A 3IKVA 3ECHA 4L5JA 3H9AA 1K6OA 4JBAA 5KHHA 1SFNA 1RNLA 2DFIA 1G4DA 1UCRA 2ZXJA 2XVCA 4U0YA 1O7LA 3LFKA 4CO8A 2MH9A 3VEPA 1BC7C 4XF0A 5L3FA 1RUNA 2VECA 2LF8A 1DZTA 5J3UA 4N0BA 2RN7A 1OI6A 5HS8A 4QM8A 2UZKA 3WTWC 2KRFA 5LEKA 3J80Z 2JRTA 1ZLJA 3PVBB 2HOEA 2HEOA 3DFGA 1BC8C 2IP2A 1S7AA 3SXYA 2IJLA 3GW2A 4M72A 2AS5F 4I01A 1QXJA 4I2OA 4A6EA 2IVMA 1YHFA 3I4PA 4UUVA 2EJRA 1EP0A 2M45A 3IBMA 4ZZDA 2A5YB 2G7HA 5DCMB 5HLHA 3HOTA 4AD9A 1UHWA 5DUIA 4HVQA 3ABTA 1TQMA 3T0YA 3LA2A 3F6VA 2MD5A 1IAWA 2K7LA 5HLGA 3PQJA 1P92A 4IEYA 4EQQA 2K86A 1VR3A 3U2RA 1YW8A 1QWRA 4Q48A 1EPZA 4YNIA 3BJ6A 2EK5A 4KU8A 6PAXA 3CJNA 1XDSA 2NAZA 2WWYA 3IL2A 1D8KA 2GC1A 4WXCA 1KYWA 2FXAA 4GULA 1MJAA 4KWJA 1BIAA 2JTVA 1FBUA 3WG9A 3IKTA 2FE3A 2OBPA 4AVCA 4LFUA 2Z99A 1LQ1A 3TDZC 1YFUA 4MQVA 1QBJA 2EA4A 3KP4A 3MZYA 3FM5A 4MNUA 3JZVA 2D1HA 3L2CA 3F8BA 3HRSA 2VPVA 2P7VB 4XLPF 1J3PA 4BHBA 3H7YA 1WSUA 2BBYA 4NVPA 2WFPA 3T8TA 4YARA 3B02A 4OIOF 3V7RA 5DD4A 1D8JA 2L01A 2IXIA 4EVIA 2DI3A 2QDRA 3RJPA 1BI3A 3TOBA 5FLIA 1S7OA 3RNSA 2H09A 4QM9A 3VODA 3IC7A 1FBQA 3WW2A 3R4KA 5LGTA 3E6MA 3WODF 1V4RA 2LSOA 2FEZA 1KGSA 1REPC 1ZRFA 3WW3A 1IXCA 5ILVA 1J0RA 1TTYA 1O5LA 3L9FA 2XAQA 2GC2A 1OYWA 2EV5A 2X0LA 4OU0A 5DCMA 2FNPA 2DCTA 3C1DA 4GO1A 3ZP5A 4J1XA 5E1ZB 3ULQB 4NHJA 1TQIA 3GXOA 4WX9A 3RI4A 3EQEA 5FFXA 4P9GA 1SEFA 4UBGA 1ON2A 4AXOA 4ZU4A 5ED4A 1SFEA 2MBFA 2F2EA 1RC6A 5TRDA 1WRJA 1IXSB 5FDBA 4RB0A 3HOSA 1NE6A 3L00A 4LMYA 2A07F 4ZZLA 4A12A 4L5IA 4Q29A 3SZTA 3AAFA 2FBKA 3D0JA 5BPXA 5J6XA 1TBXA 2OU2A 3G73A 4YFXF 2R7DA 4CICA 2XKOA 3U1DA 3MEXA 4HV6A 3IWFA 2Z33A 2ISYA 2XROA 2OYZA 4P9FA 1T0FA 1GVJA 4LK0F 3KGLA 4XFBA 3QU3A 2RVCA 4RAZA 1HBXG 2EB7A 3DL3A 5D6FA 2GU9A 3HQXA 3IDBB 1JHFA 4Q4ZF 1IRGA 4EM1A 1QY4A 4YRDA 5D4SA 4BXUA 1YYVA 3TQNA 1O3TA 2BYVE 5LBQA 3HIFA 1BOAA 4HN1A 1HKQA 1USSA 4QX5A 4U0WA 3EYYA 2CWEA 4P9UA 3I59A 5J8FA 3BROA 4M9SA 4X6QB 5D4RA 3JAMZ 3RPUA 2QUFA 5JR7B 4HQEA 2GZWA 5I0SA 4I0AA 4ZYGA 1HW1A 1MD0A 2KIFA 4PIYA 4RGUA 5JR3A 3CO6C 3H1YA 3T8RA 2OQRA 1H9TA 1ON1A 2P5LC 4AVAA 2UY8A 1FOKA 3E3VA 2HKOA 2EFPA 1FBSA 2PLYA 2PAEA 3WE3A 1R5GA 5KBFA 3ZPLA 5HS9A 4L0ZB 5J7MA 1W7PB 2M1BA 1ONVA 4IRIA 3USSA 3MAJA 3BB6A 4L9TA 4PIZA 3K1NA 1JHHA 1QZZA 3G7DA 4M6XA 1IN8A 4HVRA 2W57A 2MLGA 3HRUA 1UCXA 5TJJA 1G3TA 2YSRA 2HTSA 2XASA 2CSOA 4EJUA 1IN7A 1IXRC 3T1BA 1VP6A 2BNNA 1XE7A 1CAWB 2HQRA 4F8AA 3QRFF 4IEQA 1R23A 4CYDA 3HT1A 1FZPB 2H0VA 5H20A 2B9UA 4ONUA 5BPDA 3F8CA 4DINB 2DAOA 2BEOA
chains in the Genus database with same CATH superfamily
1VQNI 5LASA 5IY5H 1O4XA 1AU7A 2ZJCA 1ZAOA 1ND3B 2JZYA 2QZ8A 4GKYA 2YBPA 5KAFC 2P6TA 3ZOIA 4M73A 4L0PA 4TWTA 3I3QA 1MMSA 1ZREA 3OGJA 1IDYA 5JZGB 2HYJA 5GZEA 1XGNA 2Z69A 5DCFA 1VTNC 3PJQA 2YX7A 2QYOA 3NWSA 1O4YA 1BN5A 2OA2A 3SITA 1B72B 3GFLA 4NPMA 4E7SA 1NCRC 2NOJB 2OJED 2CGPA 2VCAA 4CP9B 1US2A 2Y0OA 3H5NA 4CCDA 4JVAA 4L18B 4R79A 1JUSA 4L11A 1EV12 5C71A 3R0AA 1W2AX 3UKVA 5F39A 2XG3A 2PHLA 3H35A 1WI3A 3FKIJ 2LK2A 3HDDA 2Y38A 3H36A 4IVNA 1MS9A 1YE9A 1MVEA 3PSIA 5DG1A 1GVDA 4HANA 1JZ4A 4M3GA 2WADA 1WW7A 3HRMA 2Y64A 4ITCA 3WDVA 3QH6A 4Y17A 2D44A 1CAUA 1PP8F 4RS8A 3K2ZA 1Z7S3 2CU5A 4AHZA 4W6WA 4XLHA 2P37A 1ZZ8A 1W39A 3PFIA 2JDHA 3VBRC 5CADA 2ZX0A 4QWQA 2HWB2 3FHIB 4RGGA 4CXYA 3ZFFB 1G3SA 2W68A 5F64A 4QSHA 2IFWA 4D6SA 1VBA1 4QAWA 2RMU1 5KHIA 1OVSA 2ORXA 2DQLA 1V9U1 1D3YA 3L09A 1JYIA 4UXAA 5FZMA 2AEZA 1E3HA 4A2UA 4XSXF 4ZDPA 4D94A 4RM3A 3VD4A 5BS6A 2K02A 1KFUL 2VCBA 3MV11 1AYM1 3WR0A 3B69A 1POV0 4R9BA 5J1YA 4DYCA 1HKTA 4QPIC 4KT6A 1UZZA 2RS12 4JHTA 5FMDA 2W84A 1SLLA 4LKFA 2L7MP 4BB3A 4LORA 1WKMA 1R6RA 4IQ4A 3B93A 4P96A 3A01A 2L0KA 1WCKA 2VUCA 3V0BB 4OAZA 4EEFG 5EXOA 3RYRA 4Q4V1 2Y8KA 2R5YB 2VTXA 1J3RA 1R1VA 4IEJA 2MC4A 1VRH2 1YQ6A 1Q8SA 3SFZA 3HOZJ 1IUYA 3RYKA 2VKHA 1AR71 5GTHC 4XFFA 3I54A 1SACA 1LULA 1HW2A 2LC2A 3ZOBA 3D5RC 2RJLA 3GTKJ 3N9PA 3PVNA 4E2GA 4BJ0A 5GAHJ 1IRFA 4G3YC 4NHXA 5C6CA 5C4XJ 1Y0UA 1MKMA 2VXZA 1H6XA 4RD7A 4F52A 3FLTA 2PFBA 3N4MA 2EA2A 4MOAA 2RMU2 3S1NJ 4YVWA 4Q8LA 2LDUA 2XAJA 4CP0A 1OPCA 1E2XA 2ZGMA 3I56I 1RUG3 4UV9A 1W7PA 5E79C 3I53A 2GA1A 3LPFA 2KQRA 1E57A 3GYDA 3CMYA 5F6KA 3PIGA 3V42A 2DF7A 2WZ8A 4O9GA 5FMOS 4HW0A 2XJVA 5GLZA 4KH9A 1G7YA 1T6SA 2HYXA 4D69A 2HFHA 2ZX1A 5T54A 3HGYA 4A3CJ 3KEQA 4UW4A 4HT1T 4XCAA 1LE8B 2VC1A 1L7QA 4L99A 3KIOA 4P08A 4UUSB 4B47A 3DBLB 3NV3A 3KX2A 4LLFA 1BBYA 4FPFA 3KF3A 3CF5F 1FOD2 1K5MA 4DNCA 2DTWA 2ESNA 3ROUA 2DA3A 2Y0IA 2PBIA 3EJKA 1PGW2 5IAXA 2OS2A 2EAKA 1ITYA 3OEAA 2VMEA 1SLTA 1U5TA 2W1QA 2LBFB 4A0YA 5DYMA 2GH2A 5A3NA 2EWNA 1YX5A 2X6XA 5FZ9A 5IVFA 3C7JA 1LOFC 1T2KA 1I5ZA 4C0BA 1FOWA 3O2PE 2JG8B 4ENNA 1T33A 4KNYA 2KPMA 2E7WA 1JMUB 4K1ZA 2E1CA 3POEA 1GWKA 4QIWN 4RBOA 1DGLA 3HN1A 2K0GA 2QE3A 1LDKB 4YW4A 1AA7A 2WFF1 4GWJA 3LPGA 1XB4A 2C6SA 2W4SA 3OB8A 3HGGA 4HXCA 3UV9A 2WR9A 1JZ7A 2A6HF 4HK8A 1QJX2 1NCQB 4UBHA 1ZBE2 2E36A 3H5AA 1XC6A 2B42B 4LO8A 4ESFA 3BTCA 3UESA 3BOQA 4HBNA 5IOYA 4EWAA 1ULYA 2EXIA 1WJ5A 3LSHA 3RI9A 3EUKL 1U78A 1FV2A 4WWCA 1CX4A 1D1AA 1JUPA 1RUE1 3ZFGB 4FPCA 1ZH5A 4YM1A 1S0JA 1YS6A 4QPQA 3K51A 3S5AA 2Q2EB 4N8MA 1W8WA 3NSTA 1OCTC 2FQ3A 4HLYA 2WAEA 1VF9A 2JX9A 1CIWA 3DF0A 1PUFA 2EZHA 1HB4A 2PHDA 4FPHA 1PO13 5GLTA 1TT5B 1NA1A 4DXZA 2R043 5FTTC 4EWEA 4D3WA 2CUFA 3FXLA 3ZN6A 1YFYA 1XU2A 1DDNA 1FIAA 4R9DA 5AC92 4ZXKA 2XV4S 1POV1 2JDYA 4PQQA 1POGA 5F2WA 3DQVC 2WA0A 3OYCA 4RAYA 1H30A 5BPIA 1HQNA 4C91A 1W8OA 2R7SA 3O7OA 2PMZN 1PUEE 2UXXA 4MLOA 5B1AH 2P1BA 1LEAA 1PGSA 2HQAA 1PGW1 3AMPA 4K1YA 4LUMA 3OYKA 4JX6A 3RZDJ 4J25A 2A6VA 4Q0SA 5C3SA 1IN4A 1IZ1A 1HQWA 2V7FA 3OYBA 1B9NA 2M4GA 2ARAA 1G6NA 4Y24A 5IATA 4RYDA 5FR3A 2BFUS 4EN9B 1F4HA 5EV7A 1GXPA 3QP5A 5CG8A 5EHDA 2M2EA 1XGSA 1JKQC 1ZHFA 1ENSA 3W2AA 3DV8A 4RGSA 2M87A 1Z7LA 1OKOA 1EPWA 3PNAA 3LSIA 3IDAA 4GAZA 2VKVA 3TEYA 3APBA 1D5YA 5EQUA 3C3WA 3NNFA 2UUZA 5GADJ 3U1KA 3SQOA 2VQUA 2JN6A 4A93J 2XUBA 4HSJA 2ERFA 4BZ4A 5GLUA 1EYBA 1IO2A 1RUI1 3I49A 3F95A 4PBPA 1VRH3 1HB1A 2V26A 4S2DA 5JWPA 1CIYA 1HJFA 3MCZA 4A69C 4Q4W2 2W9XA 1ZX5A 3JD72 3PMEA 3CJRB 2BERA 1XNAA 4RGKA 1EAH2 2E35A 5BNGA 4MVTA 5C5UA 1HIXA 1F4AA 3BVCA 3PJYA 4LO7A 2W2IA 2VM9A 3RKXA 4CDQA 2PA7A 4CZZA 3ZQGA 3FXRA 1OR7A 2XHKA 1UMIA 1IQDC 4BKXA 1HSTA 1UXZA 1FOYA 1HKSA 5AIQA 4JV4A 3JXSA 4META 2BOIA 2Z16A 1YTYA 3S2WA 4IEPA 3I8TA 1ZARA 1WW6A 2BY3A 3HMYA 1ZYRF 3GF6A 4Q4Y1 5FYHA 3U07A 1FMD3 2XWBB 1RR8C 1RIRA 5KNLA 2YG0A 4IQJA 2PQ8A 3E97A 4LOTA 5I0UA 2XLFA 3M9AA 3TW7A 4BAYA 3JAMK 1CAWA 1HQCA 4KITB 4Z2AA 1IW7F 4RB2C 1GHCA 3TP3A 2WNVC 4KL1A 3H5RA 2AO9A 3BR0A 4XF3A 2DTYA 1J83A 3L2QA 2VUDA 4OAYA 2ZGNA 2WFF2 4W97A 4GH4C 3TN91 3JB4C 3W6VA 2PLV3 4ZS3A 1BOBA 3TBDA 4RS5C 2Z9OA 1FSEA 3JD71 2VNVA 2I45A 3K4MA 2ZACA 2V5DA 2M4KA 3DPRC 1BVVA 2QQPA 4G6QA 1W3XA 3FXOA 3VYTB 5DUUA 2MC3A 4IHXA 2TDXA 2CYYA 5IVJA 2ZFUA 1OHFA 4AU7A 5HLTA 3WE2A 4NIDA 3CLQA 1ZRDA 2J1EA 1Y6IA 1G2HA 2JDKA 5HOOA 1X1AA 3ZPYA 2CMPA 2L9LA 4B4CA 2L7KA 5L9RA 3POIA 2DTRA 2I2SA 1JTYA 2WWJA 5EEGA 3FMRA 2TUNA 3MFAA 2OV7A 3WCRA 2BE5F 3J80K 2CV0A 2W08A 5A3MA 1R36A 4WZCA 4U2AA 3JRBA 3G1OA 1H0BA 2QQ9A 3A0HC 1GICA 1LVKA 2ZPXA 1PZ8A 2HWF1 3P6BA 2ACJA 2VIXA 2BZDA 5L19A 4QX3A 4W6YA 3H3UA 2WO2A 3OL3A 3CNAA 2N8GA 4E4ZA 3OGSA 5FCCA 1BVP1 3OD0A 2EVXA 5T3NA 4HETA 1ASJ3 1HA8A 4BJ5C 3SKJE 4FI9A 3OYLA 4AOCA 4I30A 3DPRB 1PM7A 4D7TA 1RTVA 3BU7A 4E6KG 2BY0A 2XPUA 1RHI2 3OYNA 2KJBA 4FX4A 2YC0A 5G04L 4Q4W1 2Q0OA 2AXLA 3P9CA 1KGYA 5FZOB 3B3QE 2ZX4A 3IH2A 3VYSB 4EJWA 2XBO1 3ZFGA 3A4UA 5EZHA 1S0BA 3MQ0A 1WJAA 3QD6A 2ZTNA 1BHGA 1JBCA 4XF9A 3U10A 3OBZA 2YPRA 3N9OA 2JD9A 4XIKA 4YW5A 5F3GA 5D8KB 1IS6A 1BXHA 4M3EA 4FO9A 3O1UA 3LEGA 1J2XA 4LBOA 3FLRA 2D98A 1MZ5A 1OYIA 4BDYA 4IHYA 4AI3A 1DQ1A 5JPMB 5FB2A 3CDZB 2OC6A 2ZMEA 4C3IJ 5FZGA 3I3MA 2JDZA 3ACGA 1W9YA 5A2QZ 1SD5A 2M34A 3ZFGC 1K78B 1N78A 3H8RA 3R6SA 1DP0A 5HBAA 4MGZE 3POGA 4ZY9A 4IDZA 5GPAA 5EYYA 4CP9A 3N7LA 3FIWA 1UMHA 4LHNA 4G7OF 3AZWA 3A7QA 1WGPA 1VBB3 2KRHA 4TYSA 2Q8EA 2UU8A 2VOOA 2FOKA 2X48A 3B7MA 1A31A 3ETQA 3BGAA 1LDDA 2QBYA 4G94A 1CWPA 2DW4A 1ZZCA 4JP0A 5AIPA 4XAEA 4W6XA 1LOFA 1Z21A 2A6WA 4OFGA 4M3CB 4B1LA 3OBTA 4AW7A 2H1LA 2W3JA 1MR5A 2RS13 2GP5A 4KWLA 4QXKA 2C4XA 3M3CA 1YRNB 2EZIA 3PJRA 3IKWA 2F6BA 4MGKE 1JGGA 2Y6HA 4M3BA 1ENQA 1UAIA 2N7GA 5JDBA 1XN7A 5DAXA 5F08A 1VBA2 1XDUA 3B6CA 4IERA 3JQWA 5C9AB 5JXGA 2YGLA 4CU8A 4K3UA 4JQFA 2W25A 5I0TA 3MUZ1 4EN8B 4NRMA 2VN2A 2MNGA 3GNEA 3ZQFA 1PMJX 3A0BC 3KHBA 3A1YA 3L7WA 4WM8C 3BZCA 1RUJ1 1ZR4A 4AIHA 5FZIA 2W85A 1U8RA 2Q8CA 4Y1YA 1WMEA 4RLQA 4C30A 3HJRA 4M9XA 3DPTA 5BNOB 2EFOA 2J7MA 4NHYA 1P4AA 2RNJA 3CJQB 2A3YA 3QPHA 1SVOA 2UYAA 1QXPA 4QT6A 1BEV3 2HGCA 2VH9A 3L2RA 1R091 2HWD3 3K9TA 4KA4A 1DPRA 4IHSA 3L2HA 4RS5A 4NQWA 1HOMA 5F2SA 5J4YA 4I7HA 1BJZA 2KIMA 4GYGA 5IVYA 5ABJB 1PM4A 2WUHA 5IP9J 1V6KA 2IGOA 1G59A 3DKQA 2V09A 2YC4A 2O14A 4F92B 3MW3A 1UYYA 1D4VB 1LECA 1XE0A 3AG4H 4DO0A 2J1TA 4WZFA 4AQ2A 4O6JA 3EHKA 1O5UA 2V79A 1REDA 5ICCA 3Q0UA 1HV0A 1P4XA 4FQZA 1RUOA 5TISC 4LLOA 1H9WA 3IIAA 4OMYA 4CDUC 1ZTRA 4UFLA 4DY5A 3F8MA 3ILRA 5DS9A 4C1WA 3AXEA 4BL0B 3ZLIA 1X36A 4C9YA 5F1JA 1X4OA 1WPKA 2HWC2 1ODNA 3WW4A 4BA6A 3I64A 1KD7A 1IQAA 4ZTFA 1JOJA 2NVUB 1N25A 2DA1A 4CGZA 3P1IA 4XDPA 3U75A 4QHBA 3I7DA 2WV0A 1W8HA 3AP6A 4LJHA 2A5ZA 4RQPB 2QWWA 3JBG2 2WABA 4W50A 1YWKA 3RKQA 3ZQ7A 1GYKA 3CDLA 2KKOA 4WF2A 1WCSA 1RMU2 3OBAA 3GALA 5L36A 4MFDA 5JXIA 2HR3A 1UHSA 5JI7A 4HNTA 4FAHA 1Z7UA 2EILH 5KVRA 1MS4A 2KZGA 2CG4A 4RAFA 4QPIA 1TQPA 1KDMA 1V6OA 2QCSB 1HXS1 3JD73 1JN2P 2E5ZA 2VODA 1RETA 2BEOA 1FOD1 2L02A 3AYCA 1W0PA 1H1IA 1FPQA 2QEXI 3MUY1 1UQXA 3ZYFA 4OIQF 3GZ6A 4XDOA 5BY5A 2EIKH 2JSPA 4PFPA 5CFDB 1K4TA 4AVVA 3CMGA 1OJLA 5J4VA 2GOXB 2QA4I 1LVAA 2ESHA 3G1LA 4M71A 3RZGA 4D5FA 2ZABA 5K7ZA 5E17F 3LEIA 1U6GA 3Q9SA 4GJYA 1US3A 5A1LA 5ANNA 3ZXKA 4AI0A 3QH7A 4KMFA 3KCCA 1W4MA 1AL0G 1NTCA 4WM8B 1AXYA 5LB6A 1K61A 3NWTA 4KMQA 1QMJA 2XDVA 1FIPA 2DCKA 3O3KA 2BW8A 2GMPA 4DRVA 2DDUA 4HVOA 3BR6A 2XVGA 2CV6A 2C24A 1W6MB 2X10A 1ONAA 4GMP3 4MXVA 1NG6A 1G9AA 3ATGA 4QDRA 1WLCA 5CZKA 2JA2A 2H27A 5ERLA 1HRI3 3NNMA 4FPYA 3VBHC 1NUKA 1B09A 1QOSA 3C7OA 2M5WA 3LSGA 5FZOA 4XKCA 1O3QA 5LCWL 3RZLA 3FXMA 3RCOA 1FYKA 5A1AA 3T4VA 1OFSA 2X6WA 1VBC1 2WSUA 1R4MB 2O9LA 3O8GA 1UD1A 2RR13 5FIXA 3CQZJ 4JRAA 1CZTA 3SKVA 4CUBA 1A36A 4XQFA 5FLHA 2XGXA 4ABZA 1UXXX 2DCYA 1L3JA 2XRNA 4UB8C 4YM3A 3LWFA 1G3WA 3SXWA 2VI6A 2ZMEB 5JHFA 3RSJA 3CUQC 4OHWA 3RGBA 1ETYA 4BH9A 5B2GB 2Q1FA 2ZOEB 1CD3G 1Q43A 3KYDB 3GFIA 2BRTA 2XL7A 3HYIA 1AHSA 5GZCA 1COV2 4BACA 3AP7A 1X82A 1OOPA 3CCVI 3MIDA 1Q5OA 2UWAA 3KP7A 3VD7A 3AL5A 3MBWA 4JQRA 4W65A 4MGQA 4I99C 3A2KA 5EDNA 2F5DA 1HV1A 5L3EA 1U5TC 1XGMA 5C44J 3LAPA 3ECQA 1JU3A 5CVVA 4CSWA 2GMMA 4OCTA 2K5CA 2BWCA 1ZRRA 4C2UA 4BQ3A 2ZBJA 3MPBA 5GAGJ 4AHYA 4IL7A 3OUIA 5AC91 1Q56A 1K5MC 4I76A 3JSOA 3CESA 4NMIA 3HD8B 4G6DA 4BJ6C 3P9KA 1IRXA 4Y1XA 2EH3A 5A7WB 1RR7A 3VBFA 2YS9A 3I97A 4AQSA 2OZUA 2W95A 4IJAA 2EFNA 5F8PA 2IRFG 4XF1A 4Z6YA 1O3SA 2I07B 3REOA 3VD9A 3PNTA 4TV7A 2WNUB 3SC7X 3M8EA 3ZCOA 1SLIA 2CQKA 3D6EA 3Q9OA 3WNMA 3K4AA 4JTOA 2P3IA 1VQMI 4FFIA 1FOXA 2CJJA 4LG0A 4EZ4A 2GXBA 3K1MA 3WUDA 5LK7B 3OOUA 5HDKA 3OUJA 2NRAC 4KYWA 5A7SA 4ET7A 3NJVA 3WTUC 1SBFA 4AL9A 1XX5A 1XE8A 2G0EA 3F21A 1QJY3 4TSVA 1RITA 2BV4A 1TQ5A 5K8SA 2XVKA 1ETKA 4XM3A 1SLAA 2HWE3 2EIEA 2WT0A 3VDDA 2VW2A 1MH3A 4RLFA 3ZYHA 2QVOA 2D93A 3W6KB 1F36A 3PTYA 1YW9A 5JOWA 5GTIC 2NS0A 2OPKA 2D2WA 5HCBA 1Z3XA 4QPGB 1ALYA 1QA6A 2YPJA 2HQNA 4F93B 1ZG3A 3IKVA 1SLCA 4YG0A 3LB9A 3WOGA 2KM2A 2VVFA 5FK8A 1K12A 1MVQA 3K4LA 2LROA 1D1CA 2DFIA 1X2MA 1VBA3 2RHPA 3VYRB 3S6PA 4AG4A 1O7LA 4AUXA 1XSRA 2MH9A 3KS7A 3VEPA 2VLAA 1BC7C 1RUNA 2LF8A 2ARXA 1OI6A 2RN7A 5FZDA 5HS8A 2Y26A 3CZJA 1JODA 3NO8A 3OY8B 2KRFA 3J80Z 1MNMC 1WJBA 4ASMB 1ZLJA 3DEEA 2WIIB 3VKFC 5K7PA 2IP2A 2D6NA 4UW3A 2VOKA 1K6YA 2M3AA 3SXYA 3U4XA 3C2HA 4M72A 2AS5F 1PUFB 4I2OA 2WNUC 3C7HA 1ZGWA 3HVDA 1NA1B 4K21A 3IBMA 2DU1A 2W7NA 4A44A 3W5MA 5M3MJ 3VZJA 3AMNA 2LREA 2E7AA 1UHWA 4IOAF 1G9DA 1NT0A 1TQMA 1ACIA 1GDTA 4NRQA 3CMMA 3T0YA 1IAWA 2K7LA 2VMGA 5HLGA 4LOCA 3GJBA 2PQSA 1URXA 4IEYA 4XQDA 4PJMA 4Y33A 1BQPA 5L7OA 4C1XA 2F4OB 3K7AJ 3GZUC 2ZHMA 1EPZA 2R49A 2FBEA 2EK5A 5FP9A 3JRFA 3CJNA 3A02A 2WWYA 2BY1A 4Q1PA 1LTEA 4HPQA 3BI3A 1GFF2 4GULA 1MJAA 2E71A 1AR83 2FE3A 3IKTA 3KPHA 4BIOA 2YXSA 4LFUA 4MQVA 3FM5A 4MNUA 4XKBA 1YHQI 3JZVA 1GNZA 1TC3C 2D1HA 3FC0A 1VQ6I 5IPAA 1D1BA 4BHBA 1WSUA 2JIGA 5C9AC 2YB7A 2QQNA 2WA3A 3B02A 2QQLA 1D8JA 3HOXJ 1TME3 3B01A 4ANJA 1BI3A 1WHUA 4XACA 5J1RA 4AE2A 2W1OA 2WFF3 2IXSA 3IH3A 3VODA 1QOTA 3J7MA 1V6LA 3R4KA 3KB5A 4Y5TA 3VN4A 4V2WA 1EF4A 1JKPC 1ND3C 2DN0A 2VQTA 1V4RA 1KGSA 1REPC 1IXCA 2VKEA 5T5LA 1YXWA 1U9OA 1GOFA 2X0LA 4OU0A 3C1DA 3B5LB 5E1ZB 5HCHA 3H1CA 3NKGA 1TQIA 3BG9A 1SEFA 4UBGA 1ON2A 1A8MA 5K0UC 5H9SA 4AXOA 4YW3A 1ETOA 4JQTA 1RC6A 2A3XA 3ZKYA 5FK7A 2CWMA 2BPA2 1MEC2 4WVMB 5FDBA 1XNCA 2QTWB 3L00A 2TEPA 2CRGA 1HRI1 2E60A 5EG0B 3KWVA 1BCXA 1IS4A 5DUVA 5J6XA 1TBXA 3G73A 4O61A 2P3JA 3GCWA 2XKOA 3U1DA 2GALA 3PUBA 2ZGOA 2YGMA 3PUHA 2OYZA 1T0FA 1GVJA 4LK0F 5J98B 1W99A 3QU3A 4RAZA 3DL3A 2CW7A 5B1BH 2Y0SA 2GU9A 3HQXA 3SEEA 1WZXA 3IDBB 1QY4A 4YRDA 1W06A 1F15A 1RUD3 2ZXQA 4S2FA 3CBNA 1OCOH 4M3DA 4M6VA 2XGCA 3AP5A 5A33B 1WUVA 2ZMNA 3MF9A 1WJDA 2Z4FA 4X6QB 1Y7BA 4Y4RA 4UUSA 2QUFA 5JR7B 1X4PA 1WVRA 1SC7A 1LHNA 4RGUA 3CO6C 1K5MB 1H9TA 1MW7A 3HAGA 1ON1A 3MZ8A 4ARYA 3PIOF 4RSUA 3V0BA 1G9CA 3U4SA 1FOKA 2HKOA 1OCCH 4Q4X3 3B94A 4MO7A 3WE3A 3WG7H 3ZPLA 3ZXGA 5HS9A 2XPVA 3TEDA 5J7MA 2FDJA 1PNFA 4BQWA 3BR5A 4P9JA 3VD3A 3MAJA 1PGL2 3BODA 1BR4A 2EIDA 4MADA 4A6SA 4H4KC 1AL23 4HVRA 5F04A 4BLIA 2R7XA 3HRUA 1UCXA 1F9KA 4GFBA 1KJRA 1PVXA 5JMCA 1IN7A 1W05A 2DDBA 4F8AA 2WBMA 5EYRA 4IEQA 3HT1A 3DTIA 1FZPB 4XAAA 1W9SA 3WHCA 1UAAA 3O0XA 4DOZA 4ZS2A 3NNGA 3H42B 1S2EA 1WCDJ 2YDEA 2OUMA 4N4OB 3RMYA 2V4JC 4RR3B 1I1SA 5F9TA 1UOBA 4AEDC 2TNFA 2PAKA 4XFGA 1GV9A 1Z3YA 4AGRA 4H14A 1IG7A 2WO3A 4KMUX 1CPMA 3IT8A 4L97A 3TKYA 4AEMA 1JH5A 2WS91 1FSHA 1JT6A 4LJZF 2DJNA 1BBT3 5EIYB 1C8NA 3FMGA 3MLKA 3OIOA 1OLTA 5C5TA 2YU3A 4S2GA 3RS6A 3BDDA 4CDGA 5ICGA 2PHXA 2QKMB 3ABUA 3I2FA 5FO8B 4AAXA 3WG3A 1ND2A 2QJVA 2WNVB 4CUCA 1DFQA 2C26A 3JUUA 5A6QA 3GLXA 4FAGA 4XEZA 3ZO0B 3BALA 3K10A 4AI9A 3BYWA 1U5TB 4IXAA 1YFHA 4MO3M 3KP6A 2O8XA 4IHWA 1NK3P 3FWEA 4UWDA 4C0HA 2YFUA 4QD2A 2HYKA 1O8PA 2XL9A 4YFKF 4LO5B 2FSWA 4LKEA 4XFIA 5HS7A 2K4JA 1KS4A 1FMD2 1Y9GA 3K4DA 1H2KA 1HRI2 1SAXA 4Q1RA 4QX1A 3J81Z 1STZA 5ICEA 4GA9A 4G9YA 2XJQA 2YX4A 4PJNA 5TSWA 3IN9A 5C3RA 4XTMA 4A4AA 3N7KA 2Y33A 4QPGC 4QQHA 2EINH 5L3GA 1IG3A 1MIJA 3DU5A 4XFHA 2IEKA 1QH6A 2RJKA 2ZGKA 2Y34A 2WS92 3HG9A 4PBOA 2DFCA 2PLV1 1FTTA 1WBLA 2LY9A 2P5KA 5JLWA 2JA8J 1JW6A 1LEMA 1W6NB 2D3RA 3TYJA 1H88C 4XLNF 3VDDC 2XLAA 1T2XA 3S57A 2M0CA 3MWMA 3JCUC 3RZJA 1XCVA 3GZ5A 3PL8A 4XLEA 5FY0A 2EV0A 3O14A 1L7RA 3LQRA 2JJ6A 5A7WA 2VZUA 1WLWA 5FZ0A 2HH9A 3IAS2 1QJY1 3NAUA 4URTA 2AUYA 1R081 1S72I 1QQP3 2ZAHA 3GBFA 4XW3A 2A3WA 1SD6A 3I2KA 4YVWB 4XVHA 3VKNA 3J7ZI 1T98A 1W6MA 1RHI1 1HRV2 1VQKI 2JDPA 2CV2A 1EV11 5J47A 1GANA 4LBJA 1Y8QB 4CCCA 1RXFA 4EGZA 3ZMZA 4EJOA 4YGEA 3CCLI 1YIPA 2QENA 1OUXA 5IK4A 3ABLH 3OIPA 3AJYA 4QGLA 3AYDA 4FPGA 5FJHA 5LBFA 3KMHA 2W1WA 1VJ2A 4DOUA 1NQJA 1DGWA 3NKTA 4MUVA 3FUQA 5CVJA 4LT5A 3DKXA 1F43A 4C3HJ 5M5WJ 5DDJ1 4FSJA 1LE8A 5JVVA 4Q0QA 1YW7A 4HDUA 3SLIA 5EG0A 3ASIA 2R5YA 1YQ2A 1YIOA 4HSLA 1OQDA 3PVOA 1XGOA 5E1RA 1JOBA 4BWOA 4XN0A 4B48A 3PMSA 3QU6A 3GZNB 5FP3A 2W1UA 2G9ZA 1HX6A 4NPRA 2QQUA 4FTEA 3ZFEA 2B39A 3USUB 3VBOA 1UMZA 1JE8A 1QNTA 1ODDA 3CUOA 1I27A 4NO4A 4DY3A 4S04A 2XC7A 2NYXA 4QKNA 5IT9K 1KEXA 1XMKA 1A04A 2IW5A 4UB6C 4ZH4F 2P6CA 1YS7A 3T5XA 5IT3A 1DYPA 1CQTA 3DPUA 2OAZA 2E34A 2D7FA 3ZDSA 4TTGA 4L92A 3CC4I 4KG0A 1EJ9A 1YQCA 2O03A 5DAQA 3CF2A 4DXRA 2OUHA 2JUGA 3GEZA 5D8AA 2HKXA 4IE4A 5LW9A 4Y1ZA 1U3EM 1COV1 3WV6A 4GALA 3LAGA 3WQ1A 5A7QA 4KDPA 4AIJA 2FZ1A 4K2EA 5APAA 2RS33 1YI9A 1OC1A 1MZ6A 1SMYF 4GDFA 2VBZA 3VHRA 4LIUA 1V3FA 3ZM8A 5BNOA 5EZWA 1W36C 1RB8G 2ETEA 4CEWC 1ZGAA 2VY0A 3LEKA 2VUMJ 2VNOA 2DOEA 1MS3A 1LEDA 5FPUA 4PLNA 3Q8FA 3N35A 5IVEA 1I6HJ 1QQP2 2NMNA 4BE2A 4IGQA 2ZX2A 3HT2A 1UO9A 1E0EA 3VBRB 3HKZA 2CAUA 3K77A 3VHOA 3KP5A 1SFKA 1U2WA 2MEV3 3OGRA 4M3CA 1V6NA 2VT2A 1KITA 5JAXA 4K8RB 3O0VA 1IS3A 1R093 5DPNA 3VL9A 3POWA 5FMOL 1BYHA 2DFHA 1D4M3 2HDDA 1C5IA 4KBBA 2D5HA 1RHI3 1WA4A 2WV1A 1N1SA 2EIMH 1H1AA 2CYFA 3BG5A 2CW8A 3M3YJ 3ESWB 4MGRA 3MZHA 2WB1A 2WO7A 3T3YA 4EJVA 1RJ7A 1OKRA 3ABMH 2B45X 4PJYA 3LIHA 3CC7I 1DGWY 2QLZA 2A70A 3DPLC 4G8XA 2JA5J 1NE4A 1OT5A 3RWKX 5B4NA 3H92A 1V9U3 2XSDC 4Y4YA 3D8CA 4CXFA 2ADUA 2BGPA 2BHYA 5JSPA 2WN3A 1SCSA 2VVDA 3OMYA 1YEWA 3GFMA 3J7AO 2R30A 2DYSH 2GIVA 3UJOA 4RS5B 1L3LA 5A70A 5FY7A 3BOPA 3VBUA 4LMFA 3G6JB 4XZUG 3E1F1 1UY0A 4YW2A 3AM2A 3OD4A 2GXAA 1FMVA 1VRH1 3T08A 1ULGA 4UV8A 4MX3A 2VBPA 5A6XA 2WO1A 3QPLA 4A45A 5CIRA 3K69A 5FXZA 4XKWA 1SVMA 3TEZA 1RUH2 4HNUA 3KSCA 4BY1J 1YLLA 2OTJI 4D0PA 1AX0A 5BNPA 4O9EA 1S0CA 2Q30A 3SH5A 4DIQA 3E5UA 1JKOC 2QZ2A 4MH0E 5J3LA 1TLHB 1TWHJ 2GLOA 5FPVA 5BNNB 3R61A 1CAXA 2LKPA 1JUHA 3IUOA 3NRVA 4DRRA 4CU6A 3CCJI 4NWWA 2ELHA 1K83J 3WSOA 2QGUA 3J7AY 1A6CA 1T95A 3H50A 5KC6A 1MMGA 4LTAA 4P5HA 2ZKZA 5DDJ3 5IFPA 3RRDA 2FHRA 5CISA 4ORFA 5T52A 2Z42A 4YVWC 5ACA1 5BNQA 2C9AA 3PQKA 3BJOA 3W5NA 4G4FA 3GZAA 3J7NA 3J8F1 1TNFA 1LEBA 2V1DA 4KIFA 4MGYE 2HVRA 5JOYA 4JDOA 4R52A 1Z0XA 1GZCA 3VOEA 4PIXA 1BJAA 3USUA 1MDMA 4QWNA 1BI1A 2JE9A 3AC0A 3NV1A 1BBT1 3UR3C 2DVGA 4P14A 4GMP1 1A3KA 3LKJA 4YWAA 4Z82A 2EIJH 3AMMA 4XFCA 3BQZA 1APLC 2BWAA 1RVF3 4DS0A 2PHTA 5H9RA 4EJTA 1DBNA 1W04A 2HZTA 1ETVA 2VBWA 3MMYB 3SCFA 4OIPF 2Q5TA 3ACLA 1I5PA 3F22A 4X8PA 2RDSA 2A69F 1S7EA 4X8NA 2ZMEC 3FXUA 2ZS6B 1LFPA 4HA8A 1KA8A 3PFYA 4MV2A 1CAVA 1D0XA 1DU6A 4B1MA 2PMZA 3CHXA 2EXKA 5K7HA 2O0OA 4BMEA 5HNFA 4L0YB 3M1CA 1UPSA 5CAZA 4BK5A 3T2QA 1J1LA 1JU4A 2Q4SA 3D4KA 1UJ8A 1X9TA 1FYUA 1F5JA 3WP5A 2FA5A 2JG8C 2VQAA 3O1RA 2NS8A 4TXWA 1ULCA 3H0OA 4Q4V3 3VPRA 1AUYA 5H9QA 3OY8A 2JB8A 1O4ZA 3QODA 3WF4A 2K40A 3BG3A 3KT4A 3HWJA 3ZMNA 3MYXA 2MA3A 2P6HA 1NK2P 1J58A 1UIJA 1R1A2 1J1TA 1RUE2 3ZFFA 3VBSA 3WQ0A 3PO2J 4PHZA 1RUD1 3LCPA 4F83A 3W58A 3BTZA 3ITQA 3KETA 3RWNA 4KN4X 5J8CA 5J48A 2EFQA 3GTQJ 4O65A 2ID3A 5BXXA 2CW0F 2QSFX 4GWMA 1DP7P 4QKFA 2BHZA 2AXTC 4CTEA 2C6YA 4BQNA 4XF4A 1UFMA 4FXKB 1LGCA 4UNOA 5CQGA 5JCTA 4WVWA 4QPYA 1RUF3 4NROA 4CH7A 1SFOJ 1SQ4A 1U5XA 4ZJZA 3FL7A 1DQ2A 2VNGA 4Q0VA 1VQ5I 5FZ1A 1RUF2 4XYXA 4JC1A 3V7CA 2G1MA 2XF6A 2WYFA 2Y30A 2VBYA 2BOJA 3ERED 4FOWA 2QBYB 1VMHA 1BMV2 1QGLA 1JXSA 1X50A 4CYCA 1XPWA 1OD3A 3GBGA 1W6PA 2WAOA 1NXD1 1TP4A 3H0GJ 5CKQA 3HEIA 2HXIA 4MIMA 3OYDA 5CYVA 1QXRA 2E31A 4ZU5A 1LRHA 1B35B 1AF9A 1K3IA 4YW6A 1TVGA 1MNDA 2OIIA 1UU6A 3KVAA 2IA0A 3H0DA 2E26A 4RL7A 5KHDA 2VMHA 4I02A 1XOYA 2J1VA 2VQCA 3HN3A 4IV1A 3KHCA 5FLJA 2KRCA 3LDKA 2MH2A 4AFDA 2A75A 4HFSA 2XGDA 1NOVA 5DUKA 2VOTA 4HAMA 4YW7A 1XSQA 4FTSA 4OI1A 2WS93 5GZDA 3G2BA 2CH0A 3ZXLA 3O1TA 3GVAA 1IS5A 4XFAA 4AVTA 4NDLA 1AWCA 1MH4A 1BA5A 5A7PA 3EYPA 1TME1 2KJCA 5FYUA 2F5FA 2IXKA 3LSTA 5ACA2 4IXLA 2R073 4ASLA 2LP0A 3NEUA 3T0BA 3MD2A 3DPRA 4BQXA 2EIGA 3SJMA 2WA4A 5K0UA 4YIRX 3ABKH 1ULFA 1Z91A 1FYLA 1H1MA 1PIV2 4FFHA 1S0IA 1P2FA 2ZZJA 2ZX3A 2J5PA 1IN5A 1OH4A 4HPKA 4BQYA 1D7PM 4GRIA 1GSLA 2ECCA 5C4JJ 1LDJA 4XMYA 5FRAA 3RZZA 4ZZ8A 4FTHA 1F35A 1DUXC 3HPNA 1LNWA 2QKDA 5FZAA 2DBNA 1JTXA 4CU9A 3AG2H 4HV5A 3D5OA 1WW5A 5D5XB 4EV0A 2HWF2 3K4NA 3N3HA 2JDUA 3ZQHA 3C7GA 5K9YA 1S0DA 4A3XA 3EO6A 2CUZA 3D0SA 2OD5A 4U87A 4RGRA 1OQEA 3DKYA 3L2VA 4GYIA 2K85A 2EXJA 2LVSA 2HOAA 1W9TA 1FMD1 5E3LA 2OXBA 4BBRJ 3NW4A 3OL4A 2V6CA 5L3BA 2VMDA 1QU3A 1J9IA 5JFRA 3LOCA 4GGGA 1JUMA 5E88A 3JRCA 1A8DA 3BT9A 2YHJA 3QLQA 4XQ4A 2E51A 4XRFA 1X1CA 1CQ9A 2VQGA 2MG4A 2RV8A 3G4SI 4Y3OA 2NN8A 2DVFA 3DCFA 1VBC2 5HXVA 1FPN1 4A5MA 4DQ2A 1BI0A 2ARCA 4Y13A 4ISQA 4PF1A 1XSDA 1W9FA 1W2UA 4J00A 3I71A 3CCSI 2RNGA 4JCKA 3QPTA 3BUCA 5JVTA 2PJPA 3ZXAC 3VDBA 1DPUA 4LNVA 5KXDA 2DO7A 4H55A 3OWTA 2V4VA 4NRPA 1RJ8A 2FD5A 1VALA 3AFKA 1J59A 3LGRA 3ZMUA 3LL7A 3LQQA 2WINB 4GB31 3K3OA 5GLVA 3A4CA 4OYUA 1T6GC 2E19A 2YZ4A 2R5ZB 5CNAA 4XZPA 3J4UH 3IRRA 3MKYB 3HL2A 4AHXA 1Z05A 3HNYM 3NWKA 2COBA 1JYWA 4MQ9F 1GWMA 3LQCA 1JJ6C 2GMEA 4QPIB 3PIPF 1W6OB 1WLTA 4HKWA 2DLLA 3IZOA 5EYXA 1Z6RA 3LWCA 2AREA 3Q8BA 2MABA 4DUWA 5KK1A 1MPXA 3KQRA 4PI0A 4ASNA 4KNCA 1OLQA 4OWRB 4RMNA 5GJ6A 4JX5A 1GXQA 5JLXA 3S1RJ 4BY7J 3LNQA 4XJ9A 1KYZA 1LHUA 4E7LA 2MSYA 2X5IA 2OQ6A 4XLCA 3S17J 4ZYEA 3S2HJ 1SCRA 4RQPC 4AEDB 3WY6A 2K2SA 1OSGA 1REEA 5DZGA 2ZNZA 1DQ5A 5FYMA 2YC2A 3IPVA 1S55A 3U11A 4RGXA 2P5VA 4K20A 3ZXJA 4RR3C 3H1WA 3FFQA 4PDWB 5C3PA 2MGQA 2VJXA 4IUGA 3K75B 3KV6A 1A35A 4H0EA 4JDNA 1IUFA 1Y8RB 4LLNA 1C8M2 2MPFA 3KP2A 3ZXFA 5KC5A 3CDHA 3CUQB 5KHGA 4UVAA 3DYPA 4R8HA 5CVUA 1PMHX 4OZOA 4RHV1 3P9IA 1XG1A 3D1NI 1STMA 2D6LX 3R0JA 3W2WA 2YMZA 4HSTA 2R32A 1Y1WJ 3VZLA 2IA1A 3G3ZA 2XR4A 1ASJ2 3C7EA 4CUGA 2OQGA 2VZPA 5K7FA 2IS4A 5FZ3A 1OFCX 2KZVA 3FHQA 3OYHA 2VQ0A 4W8JA 3CTAA 5ABJC 2WLPA 2PFWA 5CFDA 1HDDC 1WMDA 3MIHA 3Q8EA 2XB5A 4I3PA 3GBWA 3KD4A 3EUHA 1C0WA 4FOVA 5F0FA 4COVA 1WJEA 1MMAA 4X6AJ 3FXJA 4DEVA 5C8CA 4OUMA 3U9GA 2I5UA 2VBDA 5FY4A 3RFRA 2WZR3 4NN0A 2E6VA 1F5FA 4LULA 1DYOA 5M3FJ 2VJ5A 5IHRA 2E1OA 1UY2A 4Q26A 3ZVXA 3M4FA 1JTZX 2BGOA 2YROA 2HS5A 1KFXL 1NXMA 1YRZA 4RN5A 5AFEA 2MFZA 2X8KA 3KEOA 2R0FA 3ZXDA 2VW1A 2F48A 3HOBA 4LGWA 3WTTC 1C8M1 3B9IA 3WEZA 1NYWA 3WQ7A 2GH8A 3AVRA 4BS9A 1LENA 1WKYA 1AL21 4ATFA 3ZR6A 4E8DA 3ZMOA 4KJZA 1ZNPA 1MS1A 1W1WE 1KU2A 4IO9F 1UX7A 1R092 2WC2A 2OVUA 4KISA 3KM5A 4D5CA 1T8IA 4AFMA 3K70C 4IE5A 2CGNA 5K0UB 2FUG2 1I1EA 3LA3A 3OTFA 2J1SA 2V6EA 3I3BA 1RKTA 2JUCA 2WZPP 2E1MB 5FJ8J 1ZG1A 4DQAA 1ULPA 2HBTA 1W0OA 4YZ4A 5SV5A 3GZEA 2KT0A 3DF8A 1UL9A 2ME0A 1Q8PA 3LEMA 3I2GA 2ET7A 2A68F 2JB4A 2JRMA 4HLTA 3DXUA 4QPWA 1ND3A 3ZR8X 1C8M3 4D7MA 3ZMSA 3F72A 3O1MA 1MZFA 3T0AA 4D1QA 1OPOA 4AIKA 2GWRA 4WCGA 4HOBA 2VUAA 2G19A 3C2BA 2WNUA 1XD7A 3DBHB 4IW3A 1TWFJ 4AR2A 1R7JA 1AYM3 5LHGA 2ZO4A 3B00A 2PTMA 1B6AA 4BPZA 2LALA 2HI3A 3F23A 3LA7A 2EV6A 4Q4X2 2X5IC 3H3VK 1N3PA 3F2ZA 3DTKA 3S7EA 1VQOI 4U7DA 2ZAAA 1PO21 2EICA 2G9FA 1FI2A 1PIV3 4UAPA 2ZZQA 3VBFB 3DGTA 2RKHA 5LY1A 1UU4A 2PAMA 3GTLJ 1N3OA 2K27A 3CKHA 2PELA 2AH2A 5DZFA 4UYBA 3CZ6A 1GOGA 1H9GA 1WBFA 3H7JA 5CLSA 5E3OA 1CGPA 3VBHA 4AQ6A 2VTXJ 2DVDA 5TGTA 1LOBA 4K9SA 1A78A 4Y1VA 2ZGRA 4L9JA 2RR12 4QXCA 1LOGA 3OSFA 2NM1A 2A6EF 3ST7A 4JRLA 5FMBA 2BZTA 4C8DA 2Y31A 4QPOA 5JSOA 2JECA 2LUWA 4HOOA 2WLQA 2MD0A 4L5JA 1LKXA 3OUHA 1K6OA 3S15J 4DGWB 1GNHA 2ZGQA 5C70A 5KHHA 4MGSA 1W8UA 4ZYAA 1G4DA 3VBSC 2HQ5A 4U0YA 2JA7J 1BEV1 4KWUA 3DEWA 5L3FA 2EIBA 2IAIA 4JGYC 2VECA 4XF0A 5J3UA 1KONA 3VGIA 2UZKA 3WTWC 1BBT2 1FJLA 3WG1A 1C3HA 5LEKA 3CCEI 1UOJA 3PVBB 3DWLE 3KF5A 3DFGA 3CCRI 3RJRA 4RA2A 4XBNA 3E1SA 5FYCA 2IJLA 3RPUD 1W0NA 2YY1A 3PURA 2ENRA 1QXJA 4A6EA 2XBO3 3VDAA 3B9CA 2EJRA 2HNHA 5FYYA 4UFHA 2G7HA 5HLHA 3HOTA 1HCRA 5JUVA 1QJU3 2HPMA 1ZM1A 4QDQA 3RG0A 1DU0A 1IV6A 3EMRA 1IOAA 1VBE3 3ACFA 2X1DA 3KYLA 1E3PA 3CZUA 4HVQA 3ABTA 4AGGA 3H9GA 3JRIA 4L5EA 4XBQA 1OQ1A 1UY1A 1UY3A 3K48A 2P2KA 4AEKA 1VR3A 3TW6A 1JYVA 3E0JB 4UW6A 4J19A 3U2RA 1YW8A 3ZYGA 2YU1A 4Q48A 1QJX1 4ZZ5A 4KU8A 1S1AA 2GC1A 2QFEA 4WXCA 2E53A 3ZKUA 5DUXA 2VG9A 4XHXA 4KWJA 1FBUA 5IJRA 3WG9A 4AVCA 2WT2A 3FFZA 1LQ1A 2DXIA 2OQ7A 3TDZC 1YFUA 1G9BA 3KZIC 2EA4A 1KZHA 1AZDA 1YCIA 3M7AA 2P7VB 3OOXA 3HBZA 2JDMA 4XLPF 1NY72 2BBYA 4NVPA 5BNPB 3T8TA 2RVAA 4CCMA 1P7IA 3BR3A 2L01A 4QQOA 3VZOA 5JI9A 5KXBA 4NC7A 2HWC3 5L7OB 3A23A 5FY5A 1S7OA 4QM9A 2YUEA 5EJ1B 3IC7A 4RHV3 1V00A 3RQIA 5A3TA 3WODF 2LSOA 4OUEA 2FEZA 3HKZN 1LFUP 5ILVA 1J0RA 1TZOA 1TTYA 1H8TB 1UYXA 3N9QA 4FXGB 3L9FA 2GC2A 4HG6B 1S2BA 5DCMA 1QZEA 1QHHD 4GO1A 2O5RA 4J1XA 3ZP5A 1I50J 3ULQB 3GXOA 4WX9A 1RESA 4JHZA 3PUSA 4UOJA 4EE2A 3NV4A 3T4HB 5IFTA 5TRDA 2HU9A 1W90A 3ABZA 1VQPI 1OOPC 3HOSA 4OI4A 5FLMJ 3GZTB 4A12A 2HWD2 3OG2A 3OSDA 1AHDP 2LBFA 4GZ9A 5EP9A 1PNGA 2OU2A 3HUGB 2W46A 4HV6A 3ZQCA 3IWFA 1OR7C 4ZHNA 2XROA 1PO22 2DTZA 5HODA 2RVCA 1V0AA 3DEMA 3T0DA 1HBXG 4Q4Y3 2EB7A 1BW6A 1OF3A 1HXS2 3CJIA 4YG3A 4EM1A 4BE0A 4AYBA 5FZCA 4BXUA 1YYVA 1O3TA 2BYVE 1M1EB 1ZKGA 4CPBA 2XONA 1UZ0A 3RI8A 4CP1A 1USSA 4XORA 3EYYA 1R71A 4Y5Z0 3G71I 3Q8CA 1UG0A 2CHHA 1XNKA 5D4RA 4V2FA 2PLV2 4HQEA 5A1FA 4N7IA 4I0AA 2LOOA 4ZYGA 4AFCA 1MD0A 2KIFA 5JR3A 3T8RA 2OQRA 2B9VA 1TME2 2A71A 4DW6A 3ON7A 4ISRA 1UZWA 3TP0A 2FDKA 5FZBA 1A6IA 4DPNA 3S3OA 2PAEA 5KBFA 1HF0A 1Y43B 2RS53 1OLRA 5KAIC 1ONVA 2WAFA 2K9QA 1W0TA 1OBNA 4COUA 2YUSA 3BB6A 1MS8A 4L9TA 4QX0A 3K1NA 3ZFFC 3W59A 3ZQLA 2JWPA 1HN1A 4B3AA 5C4WB 4YLZA 5A33A 2IZWA 5TJJA 1G3TA 4XXAA 2HTSA 2XASA 4P5YA 4COZA 3IB3A 2YBSA 4EJUA 1P8JA 5FYIA 1IXRC 2AHQA 3T1BA 2D5VA 1R23A 4CYDA 3O8HA 4I0WB 3ZXSA 2H0VA 2B9UA 4ONUA 3LD8A 2Y2ZA 1DGRM 4TZDA 1VB4A 1UY4A 1T08B 4H3WA 1W36D 2FRHA 4ON0A 5FZKA 2VXDA 1K4SA 5C3OA 1AJOA 2JG8A 3ZYJB 1SDWA 2P5BA 4YPJA 2DMUA 1R4NB 3NJXA 4PCQA 1HB3A 3OPWA 3DECA 1IKQA 4SLIA 5A3LA 1FATA 2EALA 5FXVA 4UXNA 1R22A 4BQOA 1B35A 2BP6A 3ZMDA 5LA0A 2XXZA 4HF2A 4QKBA 3A01B 2UY9A 1R49A 1LR5A 1RZ4A 4Y52J 2QVSB 3GTOJ 5E1XA 1IF1A 1UMQA 1B4AA 2EZLA 4XKVA 3M1EA 5IYBJ 4UFMA 2VMIA 5FOJB 4AWXB 1FP2A 1V5FA 2VJJA 5FRMA 2FJ1A 4PSWA 5DEQA 5C3QA 2D5FA 3P7NA 1ZLKA 4XUNA 4CE8A 2WKKA 4B7EA 4N43B 3RVHA 4IQPA 4CRQA 1H4GA 4M4PA 1IKPA 2Y0MA 3VFZA 2P17A 1Y4WA 2LFBA 5FKNA 1RVF2 2JT1A 1F1ZA 5DAWA 4C3JJ 1CZSA 4C2TA 1ETQA 3OSGA 1OA3A 4QQLA 1ULEA 1PGL1 3VBOC 2VO5A 1AXKA 1XTAA 5A3WA 4JAAA 2XF5A 2A73B 4P9XA 5J37A 1KU9A 4RGAA 4YYOA 5I0RA 2PG4A 1ETXA 1HLVA 2ET1A 4ZPIA 4XBLA 3FBIB 5H2FC 2VQHA 4M01A 3CQOA 4HX7A 3WW1A 4XBFA 1V54H 3K6GA 2LG4A 5D6EA 3KYCB 3I9V2 2QQMA 4D7SA 4XTPA 4OQ9A 5FUNA 1U9NA 4MTDA 5BNNA 4TLFA 4UVBA 1R64A 1OLME 1V5GA 3LSRA 4BXXJ 3J7LA 2W92A 5FOBB 2ZJPF 1DLLA 3IMNA 1TG7A 1RL3A 2L4MA 1PK6A 3WTXC 2WQZC 3V0AB 3AG1H 1GZTA 4XJZA 4MHUA 3LOIA 2DFFA 4NIGA 1NZIA 4CDQC 4GQ7A 1QHGA 5B3SH 3UL2A 1YI2I 4IEOA 3WF1A 3WD5A 2E63A 2RDRA 2QQIA 2WNVA 1R5ID 1UHMA 2JJ7A 5HDGA 4RB3C 2H8WA 4YZ2A 4BQAA 2QQVA 3NMBA 1VAMA 1AR72 2V1XA 4IOCF 3QACA 2OX0A 5D5UB 5JZGA 4WM8A 1XCBA 3MKZA 3KQ4B 2IA2A 4CCNA 2ZBKA 4LD5A 3M3EA 4FCAA 4Z92B 4YM2A 2JIJA 4IE6A 2DT6A 3VBUC 5HV4A 4KT5C 3HUGA 2XSJC 2LY2A 1CJDA 2A6YA 3ZYPA 1DIWA 3NVCA 2UWBA 4ZC3A 4QLCU 4AAPA 1NLQA 1ZBE3 2W0XA 1R00A 1ZBA3 3BTLA 2EF6A 4Y15A 3UNPA 1C1FA 4IRGA 2X6YA 5HLIA 4A3DJ 2JICA 1RMU3 4M0HA 2V9VA 3LSDA 4PT6A 3DN7A 4P1WA 4NBQA 4PGHA 4J1WA 1DU3D 3M3IA 1QIQA 3SHRA 3OCPA 3TO9A 1OA4A 1BM9A 2LRDA 3HOUJ 3M70A 4HQMA 4KWKA 2A6ZA 2KIUA 2GNTA 4R9CA 3D82A 2P6SA 3SNMA 2K9NA 2HEVF 4XICA 4DXSA 1X3ZB 4U36A 3GTMJ 5HI0A 2L7FP 1LJ7A 1MZEA 2R6QA 2I74A 3AKRA 3GM8A 1MBGA 1SFPA 3OPZA 1PDNC 3MVPA 3WP6A 5C7GA 1D2SA 3SEQA 3BLYA 2JPBA 2PMWB 5FKCA 1LKNA 1RUI3 1W5SA 4HKLA 4YFWA 4BBSJ 2DPDA 1T38A 4CHUA 2KXLA 5FUIA 1POQA 3N9NA 4HRIA 2K3FA 1FX5A 1LNSA 4JZRA 5F7UA 1H2NA 1H6YA 4Z2YA 5JHUA 1OD5A 5CVRA 5FLVA 2DODA 3VWBA 2SBAA 1RYYA 2MW8A 2DCZA 4AVBA 1B9MA 1IV8A 2HWVA 1HXS3 2XVLA 3BIWE 3IWZA 3ZQIA 2QSHX 4CEWA 2L54A 5BV6A 3MV01 3KV5A 4AHWA 2OTLI 5F5QA 2P0WA 4B7KA 3WGGA 2CS3A 2VJ4A 1W0UA 2FOWA 4ATEA 4N9HA 2PQQA 3OY9A 4YZ1A 1W6OA 4O7XA 4I3GA 2HDCA 5IT9Z 1W8TA 1DCSA 1Z1DA 4KUMA 2HVQA 4QX8A 1BKZA 4INDA 5I91A 3UKTA 2FMDA 3H8XA 5FAXA 1FY7A 2ID4A 1EUUA 4A42A 2ISZA 2BXZA 1APNA 4AI8A 3J7HA 1IPKA 5FKLA 4ENMA 1MBFA 1RXGA 1RRJA 3C8XA 3AZXA 4AVSA 4L9VA 1WH7A 2R062 1QJEA 3KLSA 4K8FA 4AF9A 5HDNA 1AKHA 2DMPA 3T30A 2GOMA 2PHFA 2O0YA 3WTZA 2VAUA 1UW8A 3RKWA 4G7ZF 2ZA9A 4KFCA 2GC3A 1ERDA 1D5VA 1CAUB 1W28A 3ZN0A 1NZCA 3K4KA 4E2QA 5ACA3 2KIQA 3BP8A 1E17A 1QKQA 1AYN1 4E27A 3CIHA 2GNBA 3HOWJ 3OBRA 1LFBA 1Z7S1 5LY2A 1DP3A 2VC0A 3FE5A 2VZ3A 3M4OJ 3DYMA 4M6YA 2I10A 3SEPA 4IESA 4M3FA 1ZVFA 2XH6A 3ZXEA 2QM3A 1DQUA 3QYFA 2IWGB 1K79A 2J5OA 1UYPA 5E8GA 4PDKA 2K9MA 2BVVA 2P8TA 2M7AA 2NXNB 3MIGA 2KP6A 3NJYA 1GNYA 1JKRC 1GV5A 2BNMA 5LFAA 2E1NA 3BR2A 1ZZ6A 2DK5A 3WX5A 2RM21 4B09A 4DB5A 3DKWA 1MS0A 1WMXA 3Q0VA 2MYSA 4U88A 2DA7A 5A2QK 3SEZA 2BW3A 4BE3A 2YBKA 3L2WA 2P3KA 3ZN6B 4LHKA 4BEHB 4QX7A 5BMZA 5JXJA 2DMQA 1BZWA 1G9FA 2XRLA 3AJZA 3HTUA 3QP6A 4BM8A 2WRAA 1HB2A 1Q8OA 4LO4B 4PGGA 2WQ4A 2Z5UA 2XB0X 2NVTJ 1WJFA 4IL6C 3GYHX 5D8LB 4XUOA 3FBYA 3WCSA 1RKWA 3EB7A 1QH7A 3MKWB 2F5VA 3HOVJ 3GF2A 3BG7A 4E7IA 2F4LA 1GQPA 5L3DA 3LSKA 2IGKA 1VBD2 5F5IA 1PO11 3M07A 1QVUA 4B43A 1BK0A 9ANTA 2QQAA 1V6IA 2RM23 3KV9A 4BK4A 4YRVA 3K4CA 1YFXA 4XHBA 4N90A 4YIIA 3ONQA 2YYOA 1MQTB 3VKLA 2IGMA 3BWGA 4HX4A 2PHRA 1OCPA 2VOXA 3WG2A 5CEHA 3DLLF 4D0QA 2MEV1 3AZZA 4Q4X1 5FQ0A 3HC7A 2PXJA 4QPGA 2JE7A 3X2QH 2CQNA 2BFUL 2JWTA 2XJUA 3FZVA 1O6UA 5FFOC 2XUMA 3PLQA 4JDMA 1O4TA 2Q2EA 4CDWB 4R4ZA 4UFJA 3J7YJ 4CDXC 1C28A 2Y6JA 4MGIE 2VC9A 1ZK8A 1X19A 2BJSA 3C2GA 1M06G 3JRHA 1LGNA 2PEXA 4YIFA 4P00B 4NB5A 4PDWC 1SD4A 2R061 5CA6A 4TLGA 3RZHA 2WZR2 1HKDA 3TAYA 2O8QA 2AZ5A 5FZEA 4NIAA 4S05A 1XNDA 2XQXA 2SLIA 1W5TA 3HBKA 4HZFA 3WGIA 4A3LJ 4UI9L 2IC1A 1F4KA 2VCCA 2XAHA 4GD4A 1NY71 3FHZA 5FPBA 4I98B 5F1RA 1ZG5A 1ULOA 3FBNB 2O8KA 3WNNA 2VKDA 4B4PA 4I09A 4MG2A 1Z7S2 3WTYC 4EYUA 4YGBA 1SFUA 4AK3A 1KRIA 2LTPA 5FBJA 5FMCA 1SBEA 4GIQA 1XMAA 1EH6A 4BIFA 2R7WA 3MIBA 4FP2A 3INAA 4XSZF 1AVBA 2V1UA 4IHVA 1N47A 5ILSA 5FD6A 1YO5C 3UKNA 2R93J 3J81K 2WJSA 3FUOA 2DFEA 1IPJA 3PHMA 3GFJA 1POV3 5FGMA 2IXJA 5FPZA 4LEJA 3TGNA 5B5EC 4KI5M 3C18A 4B4QA 5LBEA 1XYNA 2DYCA 2XJPA 2E2IJ 5FBZA 5GALA 1FPN3 1MJBA 5L3CA 1IZ3A 4YG6A 3HJEA 5BUVA 1VQ7I 3FXKA 3A0KA 1WWXA 2VVEA 5E8AA 4EM2A 5IVCA 3PNYA 2AGSA 2F6CA 4L8QA 3W20A 1TE1B 2BV6A 4XOTA 1A5JA 1FEXA 4Q4V2 1WMFA 4GWIA 2EZKA 2ZSHB 3AL0B 3VDCA 2H1KA 4OLLA 2UWCA 5JLVA 2K9SA 1XYPA 2AYHA 2GXGA 1TEIA 1H8TA 2TBVA 4Y1UA 3KE2A 5LA1A 5DD8A 1FYMA 1ZZ9A 3TN93 1S6LA 4QGMA 3MPPG 2XHNA 3BTXA 1H4HA 3ZMTA 5FYVA 4ENKA 3FZ3A 1UKRA 3FX3A 4N53C 1R5HA 4XJUA 3R4SA 1V6JA 2NQYA 4DZGA 2CGOA 4A3BJ 2HTJA 2FNAA 2GM4A 1J5YA 2K4BA 2WSVA 1HRV3 2XJRA 1GBGA 5E20A 3S7IA 1ZGJA 3KP3A 1XB9A 3R4DB 1QDCA 5ICFA 2VMCA 3K3NA 2D3SA 4X0GA 5SV8A 1VRBA 1YNAA 2QSGX 3RIRA 1H89C 3IHUA 3GTPJ 4XMAA 3ORJA 3T2PA 1V9U2 5FZFA 3ZYRA 2R5ZA 3LIGA 3H8OA 2L9SA 2DYRH 1LHWA 4E70A 1FXZA 3VV1A 5GLWA 3HOYJ 1Q1VA 3POYA 2XIGA 1VFCA 3WF3A 3ZSMA 3OIQA 2DT5A 3L1PA 4BQ5A 5LHHA 4LA2A 1VNDA 4X1EA 4TN7A 4CXXA 1GWLA 1EY2A 5CFDC 3M7GA 5A7OA 1YFWA 4IEWA 3BCBA 4D9JA 2ID6A 1JYNA 1NG0A 3BKZA 4HN0A 3LSJA 3TRSB 2R3SA 4MHGA 5DAVA 1NH3A 3BPZA 2WZR1 1TL8A 3HSRA 1VBC3 2GDFA 1RGSA 1WW4A 5T55A 1NKGA 4HMZA 1WD4A 5LGUA 2WWSA 4FPEA 2RE9A 4FHTA 3VBFC 5FD5A 2CO5A 1MSFC 2M0MA 5EPAA 2E2HJ 3MGUA 1X2NA 2L4AA 3HEFA 1UF2C 2XQRA 4WK8F 1GV2A 2R071 4IZZA 3AMHA 3K0LA 1V70A 4AM3A 1RUJ3 3RJ2X 2VQLA 1KQ8A 3EUAA 4RDUA 3AMQA 2ZNYA 1E3OC 2P7CB 1TWGJ 4LB5A 3I2JA 1SFXA 3TOJA 3ASNH 3KLNA 1OOPB 4XIDA 2CQ7A 5E8IA 4BYYA <