2WC2A

Nmr structure of catabolite activator protein in the unliganded state
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
209
structure length
209
Chain Sequence
b'VLGKPQTDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYGTR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CATABOLITE GENE ACTIVATOR
publication title Structural Basis for Camp-Mediated Allosteric Control of the Catabolite Activator Protein.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription regulator
total genus 38
structure length 209
sequence length 209
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2wc2A02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2wc2A01
2W85A 3QACA 1V4RA 4XFIA 3GFIA 2HS5A 3SZPA 3KP4A 2LDUA 3DEUA 5J48A 4ENMA 4KUMA 1USTA 2P5LC 4YIFA 1B1BA 3SXWA 5J8CA 1X7NA 1IN8A 4UUVA 2G7UA 3KP3A 4I02A 3GZ5A 4CO8A 1AOYA 1QXRA 4QMAA 1ZLJA 1MD0A 3WU1B 3WTVC 4KYWA 3BB6A 1LB2A 4LK0F 3J7AO 1YW8A 4EVIA 3KP7A 2NNYA 1JE8A 1LDDA 2K9ZA 4KFCA 1SD6A 5H6RA 3ES4A 1BI3A 4Q0QA 4P9UA 2XAGA 1W4MA 1T6SA 5D1IA 3BPXA 2ESHA 1C0WA 3K2ZA 2ZJ2A 3GZ6A 3NSTA 5ICFA 2P5KA 3RI4A 4IEXA 2VC0A 3HRTA 3K9TA 4G6QA 3M8FA 3FMRA 1ZZ6A 2H94A 1IXRC 1PM7A 1HW2A 3DQVC 5LRSA 3FE5A 5EZWA 2VOOA 1SMTA 3V7CA 1WWXA 2PI0A 3WTYC 5CJ9A 3EJKA 3F8NA 5BMZA 1TQPA 4AQ2A 4ZZLA 2F5CA 5J7MA 2K27A 4DNCA 2JPCA 1CAXB 4IEVA 1J0RA 3QP6A 3Q5FA 4FX4A 4XLNF 3N97A 4HV6A 2B5HA 4MX3A 2L3DA 3KCCA 2YU3A 4GULA 5H20A 2FMYA 1ZRDA 1GVJA 2XLGA 2AXLA 4I0AA 4R79A 1WGPA 4HVQA 4HSLA 4YIIA 3PLQA 5L3EA 4MGRA 2V1UA 5A2QZ 3FZVA 3RKYA 3RTRA 2R3SA 2L4MA 2YX7A 2FF4A 4L0ZB 1J58A 3C3WA 1ZYRF 2PQQA 2V1XA 3RYRA 4A0YA 3ZQ7A 3WG9A 1RUOA 4FAGA 4LA2A 2VECA 4Q4ZF 3CO6C 4YSFA 3GF2A 2NAZA 2VODA 5CADA 5E16A 2VPVA 3TNQA 2GC3A 1L3JA 1RUNA 4OU0A 2E1CA 4L2NA 4G94A 1R23A 2DT5A 4HF2A 1ZGAA 2A5YB 3HHHA 2XLFA 3KGLA 3I4PA 4ZU4A 1UHWA 2EK5A 3TDUC 3QRFF 4P9GA 2BEOA 1LQ1A 1TTYA 3ELKA 1J3RA 1H1MA 3LWFA 2CQKA 4EWAA 2HEOA 4RD7A 1R5GA 3IWZA 4IVNA 1MKMA 1XD7A 4XLPF 4XSXF 2A3SA 1V70A 2EVXA 3NRVA 3J81K 1T98A 2QVOA 2ETEA 2H27A 1R58A 3E6CC 1I27A 3D0SA 1TW2A 1EH6A 3I71A 3KEQA 3MZHA 3VFZA 2DQLA 3RIRA 1NZCA 4U0YA 2HKOA 3H3UA 1OMIA 3JZVA 4YARA 2LNBA 5EEHA 2VT2A 2BV6A 3H1YA 4LG0A 2MLGA 3JTHA 1TLHB 4O6JA 1IF1A 3WTTC 4LGWA 3KEOA 2EV5A 1T0FA 3SCHA 3ZMUA 3IHUA 4UXNA 4IHSA 4LFUA 4X6QB 5D4RA 1SFXA 3PFIA 3NQOA 2NYXA 4ZU7A 4GCVA 3U11A 2BYVE 2DK8A 2XLAA 1BIBA 4YG2F 3T8TA 1J59A 1YS7A 1IRFA 4LLNA 4PIYA 3P9KA 1G3SA 5C8WA 1XN7A 5KK1A 2MLKA 2O8QA 2D40A 3NVCA 1GQHA 2F5FA 4DINB 3H1WA 2OZ6A 1IPKA 1OFNA 1TNTA 1D3YA 5DD4A 2UY9A 5D5UB 3NL1A 2QQ9A 4RB2C 1KQ8A 2QBYA 1GXPA 4UVBA 3WTXC 2Z2SB 5FB2A 4PGGA 3WU0A 5I0SA 4A0ZA 2Q4SA 5AIPA 4MHGA 2IC1A 4DQ2A 3GBFA 2P5VA 3I58A 3ISPA 3HSRA 1B9NA 3V7RA 5E8IA 1ZGJA 3KP2A 3EETA 2RC4A 4M74A 3OCPA 4L5JA 1YWKA 3IC7A 5FQ0B 3BCWA 3GYHX 3U10A 2O0YA 4XF9A 3OOPA 3U1DA 3ZMTA 2IXIA 2ZXJA 1WSUA 3NKTA 1S3JA 3KE2A 3VB2A 2XAFA 4ZZDA 3WW3A 5ICEA 2WC2A 1CAXA 3IDCB 4A0XA 1VP6A 3DFGA 3TGNA 2UYBA 3D82A 3L2CA 1R1TA 2OBPA 5LGUA 3JAMK 1ZG3A 4S05A 2GXGA 2PEXA 4LMYA 3EHKA 2VC1A 4IEOA 5DEQA 1O3RA 4IETA 2HTJA 2A61A 4J1WA 4JTOA 2IA1A 4QX5A 3DPTA 2FBHA 1NYWA 4MNUA 3HRMA 3NJZA 2E7XA 2RNJA 2HFHA 1Q43A 2PHDA 1SD5A 1XGNA 4CXFA 1KA8A 1R7JA 2B0LA 1IPJA 1XE8A 1EV7A 4I98B 5L3FA 4XRFA 4XFGA 4LTAA 1B9MA 3CUQC 3O3KA 2EV0A 5K5OA 4XF0A 3HRSA 4NHJA 1YW9A 1XE7A 1T39A 1R36A 3FF5A 2DQRA 1JUHA 2DBBA 3GUDA 2D45A 4HW0A 3WGIA 1F4KA 4E70A 3USSA 1Z1DA 3F8BA 1OD5A 4N9IA 2BE5F 2HWVA 2DCTA 2KKOA 4G7OF 5DCMB 3IWFA 4PJYA 2GC2A 1ZVFA 2L4AA 4LUMA 1ZLKA 3QP5A 4IRHA 4HAMA 2CSOA 3HIFA 4UXAA 3DPLC 5ILVA 1ZZ7A 5LEJA 3QAHA 1HSTA 2YSRA 5KBFA 2MNGA 2ISZA 3FJSA 1MJ9A 4KN7X 1TQ5A 2BBYA 2FU4A 4U7DA 5TJJA 2F5EA 4UNOA 4A6EA 1BI0A 2DFIA 4A5NA 2XL9A 4G6DA 3GVAA 2L54A 3BU7A 3ERED 2PLYA 3U2RA 3CLOA 3M9AA 4EM0B 2QDRA 4LD5A 2OQRA 3ETQA 3MFKA 4OFGA 2XRNA 4Y13A 2RKHA 4O9GA 2IRFG 5HLGA 3TDZC 5LRRA 4M9ZA 5DCFA 3OD0A 4UHTA 1J75A 1SD4A 4CGZA 2D5FA 4O9EA 3ELNA 3HUGA 3T1BA 5L3DA 3DP7A 1J3QA 3CDHA 1ZG1A 5JSPA 5CVUA 2M5WA 2K4JA 4A2UA 3P9CA 3HSFA 3KGZA 4HDUA 2HOEA 3CEWA 3K1MA 1U8RA 3C3VA 5BV6A 5BS6A 4Q0VA 2CGPA 1STZA 4KIFA 2Q8KA 1TQIA 1DZRA 5DDGA 1IZ1A 2QLZA 2KIUA 4BH9A 1ZX5A 4CDGA 4KN4X 2GWRA 4I2OA 5AVPA 1U5TC 4AVPA 1OPCA 4TV7A 2Y48A 4P5OA 1QBJA 4LJZF 2Z3YA 3ULQB 5FQ0A 2D1VA 4MTEA 4HMZA 3RKXA 3K0LA 2IXKA 5K1YA 2Z99A 3HTUA 2K7LA 2P17A 1W7PB 3P7NA 3E5UA 4R52A 3HOTA 4IHTA 2A68F 2MPFA 3IBMA 1G4DA 1E2XA 3ZN0A 5I0TA 2YX4A 3PQJA 3BP8A 4JK1X 5IT9K 1FBUA 5ICCA 2F2EA 3ZPLA 2QQAA 3FHIB 2QYOA 3HRUA 4IESA 5I93A 4EGZA 1YFHA 3BPZA 1IN5A 2MD5A 3BJ6A 4RB3C 5I91A 5K5RA 3WTSC 2PA7A 1J1LA 1X82A 2OQGA 4Q48A 2Q2EA 2EFWA 1GHCA 4IJAA 3PNAA 5BXXA 4Z82A 4ESFA 3L7WA 3F23A 3LFKA 4BIFA 4UV9A 2B9UA 4B8XA 4QWQA 1Y3TA 4HX8A 4CYDA 2GA2A 1T2KA 1F5TA 3ECHA 1FT9A 4KDPA 3GO5A 5LEKA 2IA0A 4EM1A 2HQRA 3SQNA 1TW3A 1FZPB 1UIKA 2MA3A 1ODDA 3EYIA 1DDNA 1KYZA 2HZTA 5DCMA 2PAMA 5KHKA 3LSTA 1UCXA 2FSWA 3CTAA 4ZH4F 1U3EM 4K8FA 5HDNA 5D6EA 1W7PD 1KU2A 2DW4A 1CAUB 5DUIA 3B73A 1IUYA 2QVSB 4P9FA 1P2FA 1W5SA 4MQ9F 4CICA 2DI3A 3F72A 4PDKA 2Y75A 4JBAA 1EPZA 1KQ9A 3ZMSA 4Q0SA 1YO5C 1IXSB 2C0ZA 3V8LA 3COAC 3VEPA 4AIJA 2IW5A 4UV8A 5FO5A 4PZJA 2IVMA 1RI7A 3F22A 3I53A 1GXQA 5DD8A 4JQFA 5BOXA 1O5UA 1WI9A 1IRGA 1LKNA 5FLHA 3ACLA 3OTFA 4WCGA 5BPDA 1ZH5A 2QJVA 3LA2A 1P4XA 4WZCA 1FOKA 5DUKA 4E2GA 5HS8A 3ZP5A 2EAAA 3ABUA 2MC3A 3OF1A 2FA5A 5ILUA 2GC0A 3E5XA 3HT2A 2IA2A 2P8TA 4MGYE 1XDSA 4O3MA 1Z9CA 1LR5A 2KRFA 4EGYA 1YUDA 3JSOA 3O14A 1QZZA 3H92A 2P7CB 3TQNA 4YYOA 4WK8F 2IXCA 3EQLF 3JTGA 5E8GA 4R8HA 4BYYA 1Y0UA 2COMA 3GFLA 1ZNPA 1ZZBA 3R60A 2PAKA 3IDBB 1FC3A 1L3LA 2GU9A 1ZARA 2JZYA 3WTZA 3DN7A 5F1RA 2H6BA 3TOBA 2M45A 3JSPA 1OYIA 5D8KB 1UD1A 1Y9QA 2GZWA 2ESNA 2PMUA 4YFNF 5LLQA 1HKSA 1LEAA 2OAZA 4Q0PA 1UB9A 4HA8A 4KMUX 4P96A 1MGTA 4OINF 4L9JA 3TKYA 5FPXA 1HBXG 3R6SA 4ZYDA 1BC7C 4KMFA 3D5LA 2CAVA 4U88A 1B6AA 5E20A 1H0MA 2UZKA 1VTNC 2GC1A 1S7OA 2JRTA 3K69A 3OGJA 3M7GA 1WRJA 2HR3A 2IPQX 1FNNA 1LVAA 4M6YA 4KL1A 1O57A 1YS6A 2LSOA 1ZG5A 4YFXF 4U7BA 5FLIA 1F1ZA 1SFNA 5D4SA 4NB5A 1NXMA 4EWEA 4ZYEA 1RC6A 2BNOA 1GQGA 3PVBB 1FSEA 1XSXA 1HXDA 3FMSA 4UBHA 4D7TA 2XKPA 3FXRA 1MDMA 4RS8A 3CJXA 4I01A 3REOA 3T8RA 2OYZA 4A5MA 5JCTA 3WW2A 4XF4A 2VONA 4BHBA 1KU3A 3L9FA 4WVZA 3EO6A 5BY5A 3NEUA 5I8SA 3M3IA 2FE3A 3J80K 2QWWA 2Y0MA 1X8MA 1HQCA 3PQKA 4KIBA 4RGSA 5FLXK 5AONA 4N0BA 4HYEA 2RV8A 3SCGA 3FM5A 4EV0A 5HLHA 3GYDA 5LGTA 1TQMA 1MJBA 5LGNA 5FD5A 1IW7F 1OYYA 1WA4A 4JV4A 4XFFA 4PIZA 1J3PA 1ZRFA 3GW2A 4WWCA 5JFRA 1BJAA 3MYXA 2W24A 2DAOA 1HW1A 2FRHA 2OU2A 2EFPA 1FYMA 1CAUA 1FP1D 1I5ZA 4RAZA 3GWZA 4IPAA 2DPDA 2E1NA 2PYTA 4IEUA 5CVRA 5CVJA 2ZFWA 5L3BA 3WGHA 1H1IA 1KQ0A 3R4KA 4M71A 2P7VB 3MDPA 1U78A 1OI6A 4IEZA 5FD6A 5ICGA 1O5LA 2KJCA 3S2WA 1ZZ8A 1QNTA 3HT1A 1U12A 4F7ZA 2EA2A 4OIOF 4U0VA 1VJ2A 4KWLA 2O6GE 1LNWA 4H7LA 2V09A 3HTSB 5D5VB 3CO2A 3GFMA 5E1XA 5FCCA 4AVAA 5LBQA 2P4WA 2OD5A 2M87A 1NE6A 4ESBA 3J81Z 3H50A 3O2PE 1XSDA 2D1HA 4HF1A 4QM8A 2FBKA 2NRAC 3EQEA 5TRDA 1YG2A 3BROA 3QPHA 4MGIE 1XCBA 2K0GA 1P4AA 2HGCA 4L5IA 4I3PA 1ZAOA 5JR3A 1LDJA 1HSJA 4Z07A 2ZNYA 4LULA 1UPIA 3LQRA 4EJTA 2R7DA 4GYIA 4MQVA 3HQXA 3SHRA 4OMYA 2CO5A 3T0YA 4YFKF 1CGPA 4FBFA 4R1HA 2EFNA 4IRIA 5HVQC 1QPMA 2MH9A 5FDBA 3E5QA 3UKTA 3CJNA 2GAUA 2PN6A 3J80Z 2N7GA 3E6BA 1XMKA 4HZFA 2AS5F 4WF2A 3ROUA 4D0PA 1ON2A 1F9NA 3LOIA 4L9VA 2Z69A 1B4AA 4HF0A 3FFQA 3RPUA 3H1MA 3U9GA 3BDDA 3R0AA 4EWDA 2O1QA 2PFBA 1XCVA 1FBSA 5LHGA 1IAWA 3T5XA 2K86A 1O7FA 2H0VA 1QY4A 3I0TA 1ZZCA 3QOPA 4RB1A 3ECOA 3KLNA 2M1BA 2EFQA 6PAXA 2XASA 4L9NA 4BAYA 3BY6A 4HX7A 4CHUA 4KIGA 3V8JA 1CAVB 5D8LB 4AVCA 1IN4A 3G73A 4HLTA 2LKPA 4KNYA 3WE3A 4HQEA 3LAJA 1UFMA 4AIHA 3DL3A 3LA7A 2XAQA 2XGXA 5IT3A 1HKQA 2STWA 5FPZA 2DK5A 3L2HA 3SHFA 1CF7B 1REPC 3P9IA 3C18A 3BJAA 4UVCA 4OOIA 4PCQA 3JAMZ 2D5HA 2L01A 1KU9A 2D93A 5KHIA 2FQ3A 2A69F 2BNMA 1PMIA 2VQAA 3I7DA 3VODA 1SD7A 5BPIA 5F6FA 5D5XB 2DTRA 2Q0AA 1FBQA 1YYVA 3KMHA 2G9WA 5HI0A 4X6RB 5JSOA 1TNSA 4HQMA 2L02A 4G7HF 2G7HA 3D0JA 2ELHA 5DV5A 1Q5OA 4M9XA 1RIOH 3M70A 3KSCA 4EJOA 2LF8A 3VOEA 2VBYA 1BOAA 2FQPA 3GFJA 1FXZA 1ZZ9A 1USSA 4KU8A 1LJ9A 4ENNA 3V7SA 3LAPA 2V6CA 2O8XA 3RYKA 4GGGA 5FFXA 4KT5C 3KP6A 5CVVA 3EYYA 2OZUA 4A6DA 1PP8F 2HJIA 3GEZA 1J7KA 4KWJA 5JSRA 4MGZE 4B29A 1D8JA 1B59A 3G7DA 5KHGA 2D2WA 5EFUA 3SCFA 4IEYA 5A2QK 1PP7U 1FYKA 4AIKA 2DO7A 3FZ3A 1SAXA 1BI1A 3I54A 4IF4A 2PBIA 4UBGA 4YRDA 4CZZA 3H7YA 1O7LA 3F21A 5BPXA 1Z6TA 2ISYA 2WTEA 2V9VA 4LLLA 1KGSA 2FOKA 3CUOA 1ZHFA 2DPUA 3MEXA 3F3XA 1S7AA 4L18B 1H9TA 4HVOA 3CUQB 1G3WA 1IN6A 3W6KB 2FMLA 3HSEA 2OPKA 5HDGA 2HQNA 4IERA 4UVAA 4NQWA 4HDVA 5JHUA 4BHCA 1FPQA 1XGOA 1BI2A 3BJOA 1XGSA 3WODF 1L0OC 3LWCA 3BWGA 2STTA 4EROA 2ZNZA 2HKXA 5J6XA 4PIXA 1WKMA 1I1GA 5I0RA 1XB4A 1NHAA 1EH8A 2WWYA 5LHHA 3M8EA 4BXUA 2XL7A 2GA1A 1EY2A 1S8NA 3IRQA 2YR2A 5F64A 1I1SA 4FHTA 3CF6E 3KLOA 2ZBKA 1YFUA 3ZMVA 1R1VA 3R61A 2IP2A 2QBYB 4XSZF 4LEJA 5H6QA 4MH0E 2GXBA 2O61A 2E9QA 1PUEE 1Z91A 3TOAA 4YNIA 5T3NA 2CAUA 2ZMEB 3K1PA 4EM2A 3TNPB 3HHGA 4M9SA 2VT3A 3DV8A 2CG4A 3F8FA 1XDUA 5JR7B 2VBZA 1XSVA 3W6JB 1DUXC 3H7JA 3WTWC 5AIQA 3S7IA 5E18F 4MEXF 1QXJA 3RZZA 3DKWA 1OKRA 3QU6A 1BN5A 3FM3A 3N4MA 5J8FA 3IRRA 2JPBA 1RZ4A 1UCRA 3LA3A 2P6TA 1CAVA 1K79A 2HYFA 4RGUA 3BZ6A 2IXLA 1IXCA 4K2EA 4RB0A 4XBFA 1YHFA 5D5WB 4G9YA 5JVTA 4N9HA 1CF7A 3RYPA 1SEFA 3OV8A 3GX4X 2WV0A 1K6OA 5L3CA 1OYWA 1FWZA 5IT9Z 1CAWB 2QQBA 2R7FA 1FYLA 3CO7C 1P92A 4AD9A 4JTNA 1LDKB 3HOSA 4LLOA 3CL1A 1SMYF 4FT8A 4XF1A 4QGMA 3KZZA 1LRHA 4ZYGA 2O3FA 4OIPF 4MV2A 1U5TB 1S29A 2PMHA 4XFBA 3F6VA 2EB7A 2KIMA 1J2XA 4AXOA 2OA4A 2KJBA 5C6CA 4HX4A 2VXZA 5BUVA 4H0EA 4RGXA 1YFXA 2VBXA 5ERIA 3E97A 4JVAA 4QGNA 3ZMDA 4ZU5A 1ZRRA 4AVBA 1W7PA 4PGHA 1DZTA 1ZRCA 1WLTA 2P6SA 3ES1A 1O3QA 4Q5SF 1D8KA 4G7ZF 4F8AA 2HTSA 1G3YA 5ED4A 2FNAA 1XMAA 4FX0A 2PJPA 2NS0A 2K02A 2CWEA 4Q47A 5J3UA 4HOBA 3QU3A 4XFCA 1MJAA 4META 2VE9A 4M72A 4HSJA 1YTYA 3SMHA 3I64A 2CV6A 2VN2A 3H9AA 1I6XA 2FXAA 1Z05A 2QZ8A 5JAXA 4G8XA 2A6EF 2W84A 4IXAA 3GXOA 2PAEA 2RGVA 1ONVA 2GQQA 3CUQA 4OIRF 1CX4A 2UXXA 4WXHA 1SFUA 4HVRA 1DGRA 2JSCA 3WW4A 4B09A 2M30A 3RNSA 2PHLA 4GXOA 3K1NA 4OLLA 4KICA 5D6FA 2OA2A 5I0UA 2W25A 2J5PA 3BPVA 3LZZA 3RKWA 4BNCA 5CLSA 4LUKA 1BBYA 2BGCA 3Q9VA 4GYGA 5E1WA 3GLXA 1KU7A 1QGPA 1JHFA 4LLGF 4LB5A 2UXNA 3I59B 2MHFA 1R5HA 4KA4A 2VE8A 5KHJA 3C1DA 1G6NA 3ABTA 2PTMA 1QWRA 2F5DA 2GH2A 1J5YA 2ZKZA 1AWCA 1FY7A 4J1XA 4U0WA 4RGRA 2B8MA 4ORFA 2ZMEA 2FEZA 1SFEA 1ULYA 3BOQA 1W5TA 2Z5UA 3R0JA 3SFZA 2ZCWA 4FAHA 1ON1A 4HV5A 2KXLA 3G3ZA 1K78B 2ADUA 2V79A 1U6GA 4L11A 2UWMA 1D5VA 1J9IA 2W57A 4ENJA 4MUVA 2K4BA 2QCSB 2OZJA 3ML6A 1G3TA 3MAJA 3MQ0A 5EEGA 1YFWA 4QGLA 3HYIA 5HDKA 1YLLA 4QXKA 4HBNA 4MTDA 4WXCA 2C6YA 3MWMA 1RNLA 2WFPA 4Q0UA 3KZYA 2M8EA 2ETHA 1FSHA 4I0BA 2IXJA 3MCZA 2A6HF 2XKOA 4WXDA 1O3TA 1EP0A 1XRUA 2CFXA 2ACJA 4ETSA 2YPRA 4LB6B 4LK1F 4P55A 5CU1A 3IIAA 2Q1ZB 3M1EA 1FP2A 3MPBA 3CLPA 1CAWA 3ST7A 3S0MA 2PQ8A 3UKVA 3DXJF 1O3SA 3ZMZA 1NE4A 1VR3A 4EQQA 2ET1A 3C7JA 4KWKA 3E6DA 4D7SA 3E6MA 2A07F 2HDCA 1YFYA 1JHHA 3KFWX 1X8EA 2HYGD 4WX9A 3F6OA 4XFAA 1U5TA 3KP5A 4L9TA 4HN1A 1YIOA 4HN0A 4KU7A 4Z2YA 1FX7A 2QM3A 2MBFA 4ZYHA 5E17F 3WTUC 3O6BB 5FLXZ 2RQPA 4EMSA 2LF7A 4ESJA 2XIGA 3WE2A 4O5VA 4ASNA 2UYAA 1T38A 3WGGA 2Z9OA 4HBLA 5E1RA 1QQIA 2DLLA 3NW4A 2ET7A 1H9GA 5HS7A 1WQ2A 2TDXA 1S6LA 3B02A 1UIJA 2Q30A 2H09A 2X4HA 2RVCA 4MGKE 4NVPA 2RDPA 1JGSA 4XETA 3EUHA 2EFOA 1DPRA 1R22A 5KHHA 3F8CA 3RDIA 2CYYA 3V8KA 2IT0A 3FWEA 4S04A 3VHRA 1R1UA 5CVIA 2XUBA 2X0LA 5LHIA 3JW4A 2FBIA 4Y17A 3IKVA 2EA7A 2EA4A 2XHKA 2RN7A 3U0ZA 2Y0OA 1ZREA 3H8UA 2Q0OA 2XROA 2BNNA 1TBXA 4A12A 2Z33A 4XFHA 1RL3A 1SQ4A 3L00A 1YQAA 2ZKLA 5BQTA 4OIQF 4ON0A 2EJRA 1KYWA 1QZYA 5JI6A 4GO1A 3EBRA 1R00A 3ZN1A 4XEZA 2H6CA 2XAHA 1ZN2A 3FHZA 2PFWA 3UKNA 5K8SA 2QENA 1U2WA 3DF8A 3MZYA 4EJUA 3AAFA 5I8TA 1BC8C 2FNPA 2IXHA 2EV6A 1DP7P 1FLIA 2I45A 2IJLA 3S7EA 5FFZA 2XAJA 4WBBA 1Q1HA 2MH2A 1DPUA 5K5QA 4MEYF 3I59A 4HLXA 4I7HA 4HLYA 4AWXB 4I09A 1IN7A 1BIAA 1HKTA 4M73A 4L0YB 4TLFA 1RGSA 5FGMA 3FX3A 2XVCA 4EJVA 5FLJA 4MZUA 1UW8A 3WW1A 1LEBA 2VBWA 2ATFA 2CW0F 5E1ZB 3IL2A 1Z7UA 2VOPA 1UHMA 2EWNA 3E3VA 1PDNC 5I8YA 4E2QA 5ILSA 1BM9A 3ZDSA 3LQQA 2JTVA 4IEPA 3FXQA 4ONUA 1YLFA 1P6RA 3IKTA 3RPQA 2E7WA 4M6XA 3SXYA 2J5OA 3TO7A 3Q9SA 1A04A 1V3FA 1EYBA 1FI2A 1K78A 2QUFA 5DYMA 4Y15A 1YW7A 3BALA 1XGMA 2JT1A 4XF3A 4AQ6A 5HS9A 4Q29A 2QNKA 2O03A 2DU9A 1P4WA 4RAYA 3L09A 3RJPA 3FXUA 5HOOA 4BQAA 5KVRA 2UY8A 4IEWA 1RTVA 4EJWA 3H3ZA 5L3GA 1EH7A 1JXSA 1DGWA 2KIFA 3V4GA 3KETA 4BHPA 3F8MA 1O4TA 4ENKA 1QO0D 2F4PA 4LA3A 2PG4A 1HW5A 3QPTA 1OR7A 3EDPA 4IRGA 4QLCU 1K7AA 2NNNA 4LG0B 3LAGA 3SZTA 5HLIA 2V1DA 3I5UA 4OMZA 4E2SA 3TO9A 2GIVA 4IEQA 1Q3EA 2ZO4A 1MDMB 1E17A 4QM9A 1X3UA 1Z6RA 3FMQA 1MZBA 2XV4S 3TO6A 5CYVA
chains in the Genus database with same CATH superfamily
2QBXA 3GNEA 4XFIA 5DQ0A 2HNHA 4FPJA 4GB32 4AVTA 3DU5A 1EV13 5AC91 2EPFA 3Q0UA 4RR3B 2WS93 3SXWA 2X1DA 3ZLIA 2CU5A 2G7UA 1S2BA 3GZ5A 2YBKA 1QXRA 4QMAA 3NJVA 4AHYA 1MD0A 3WU1B 1ULFA 4KYWA 4YG6A 4W8JA 3ZXEA 4EVIA 5DDJ2 3KP7A 2L7ZA 1MBFA 2TNFA 1OFSA 3MICA 4CP2A 2VI6A 4KFCA 5H6RA 5FYCA 3ES4A 4PFOA 2XAGA 1RUG2 1RUJ2 4EZ4A 4Y33A 1T6SA 5D1IA 4BIOA 4NNJA 5FRMA 3MIBA 4L9BA 1PIV2 5B2GB 3RI4A 4P9JA 2BXYA 3ABLH 3K9TA 1JHNA 2DMQA 2VXJA 2WAEA 1FOD1 1VMHA 3NO8A 1JUIA 5GZCA 2XPJA 3DQVC 4HXCA 1WZ2A 4H3WA 5EZWA 4GKXA 4NHLA 5CJ9A 3J7MA 3EJKA 3F8NA 5BMZA 4AQ2A 2RS12 1W8ZA 1QJEA 1NX9A 4A3IJ 5J7MA 2JPCA 4Q4W3 4NDLA 4FX4A 4PJNA 1GKBA 1UKRA 3H5NA 5FUIA 1FPN2 1FTTA 4Z92B 2UWAA 4IV3B 2YU3A 5F5AA 2TBVA 4JX4A 3KQ4B 4CSWA 3G2BA 5FY9A 2VKDA 4NPLA 4AGGA 1KFXL 1LOGA 2V1UA 4LIVA 1NQDA 1LGBA 4XDOA 1H4HA 3I2IA 2R3SA 2L4MA 2YX7A 2FF4A 3RS6A 2WBKA 1ND3B 2PQQA 3RYRA 4L97A 2R0FA 3WG9A 3N9NA 3ZFFA 4XHBA 4D6SA 3MW3A 2LW8A 4Q4ZF 5M5WJ 2VODA 1WUVA 5E16A 4EATA 3R4SA 1PGSA 1UYPA 4Q4Y2 1O8SA 2MEV3 3ZFGA 2FX0A 4OI2A 5DZFA 1UAAA 2A5YB 3HHHA 4IHWA 3TDUC 3QRFF 2Y9ZA 1TTYA 1HQLA 1MS5A 1MS3A 1GQPA 3FL7A 5EGOA 3LWFA 2HYXA 2O9LA 2W94A 2DDUA 4IVNA 3HBZA 1MKMA 4XLPF 4DS0A 3VL9A 2XR4A 2H27A 4UF0B 1JTXA 2HWC3 1TW2A 4AM3A 2JD9A 1QVTA 1TNRA 4HFSA 1AHDP 1VALA 5FP3A 3VFZA 4XJ9A 1OCTC 3GTLJ 2MC4A 3VUOA 3OY8A 3ZFEB 2MYSA 2VULA 2ZC2A 1KFUL 4LKSA 3H1YA 3VKLA 4XUOA 3R4UA 4LGWA 3KEOA 2EV5A 3ZMUA 4E7ZA 2RMU2 1C8M2 4LFUA 4CZSA 5D4RA 1H2NA 3ZYGA 4UUSB 1XX5A 4GCVA 2BYVE 1D1CA 2VVFA 3T8TA 3BR0A 1WCMJ 4R9BA 1LGNA 1W2TA 2R7VA 1STMA 2R5YB 4DY5A 3HUGB 5KK1A 2MLKA 3ZQGA 2JX9A 3H1WA 4ZZ5A 3NV4A 3QLQA 5D5UB 3NL1A 3SLIA 4LKDA 5DAWA 5J4YA 1UZ0A 4IQ4A 3RZLA 1GXPA 3S1MJ 4BBSJ 5FB2A 3PMEA 1N75A 4OCTA 5DS9A 2ZEZA 4MHGA 2IC1A 2WBMA 2GMMA 2CUZA 3RPUD 3HSRA 1B9NA 2J1SA 1ZGJA 1E3HA 3M4FA 2LVSA 1APLC 3I2OA 3TN92 4M74A 1PZ9A 4L5JA 3IC7A 2HYKA 3VBUA 3HNMA 3OOXA 1S3JA 4JQTA 3KE2A 2V4AA 4PLNA 5F2SA 2WC2A 1HRV2 1PO22 2ZEYA 4Q8LA 1SBFA 1MVQA 4XMIA 2XBO1 1SLCA 3WCSA 3LDKA 2G1MA 3WDXA 2A61A 4AOCA 1UPSA 5ISLA 3DPTA 2H8RA 3NJZA 4CDQC 4EN0A 1SD5A 4QU2A 3CCMI 1VAKA 3R4DB 2ZTNA 3QYFA 1KA8A 1ULEA 1R7JA 1AR82 3J8F3 4XFGA 2ZPXA 2YGMA 5F8PA 1EF4A 1HCRA 1VBD2 3CUQC 2E53A 3AP4A 3OBZA 1L7QA 2UU8A 5K5OA 4I99C 1YQ5A 3SC7X 1T39A 1R36A 1C4RA 1CVNA 1PNGA 1JUHA 4HW0A 1QJX3 2W87A 1VE0A 4O7XA 2HWE3 2K5CA 1F4KA 4PI0A 3NJXA 3KD4A 4B44A 2BE5F 2DCTA 4B47A 3MKLA 1QJFA 2DUPA 1LGCA 1RUD1 4PJYA 5EZGA 3POGA 4XZUG 1N3OA 5T52A 3WDYA 2BBVA 3OYJA 2CSOA 4XUTA 3ASNH 5ILVA 2JE9A 5LEJA 4D7NA 2L9LA 1HSTA 3MPPG 1QJU3 1LCLA 2ISZA 3S1NJ 1HJGA 2FU4A 2JWPA 1D1AA 1LPQA 3OL4A 4XIDA 1BI0A 1ZGWA 3IDEA 4HKOA 5C70A 1ODNA 1HDKA 3GVAA 2L54A 3OIPA 3U2RA 1MEC2 3M9AA 3PU8A 2VUAA 3ERMA 3AP5A 4OMCA 4AE2A 1VRBA 3MFKA 4OFGA 4BS9A 3QPSA 4AF9A 5GAGJ 1O8PA 4BE0A 5HLGA 1V0AA 3M8JA 5DCFA 1T2XA 4R9AA 1CZTA 3BTXA 3T1BA 1LU2A 3QQAA 3CDHA 1ZG1A 5JSPA 2K4JA 4A2UA 3P9CA 4PI2A 4E8CA 1VQ6I 1AHSA 2HOEA 3CEWA 1U8RA 3C3VA 2DVDA 4KIFA 2KIUA 3JRBA 4LO4B 4CDGA 4KN4X 3VDDB 1V6KA 1MQTB 1VBB3 1IHMA 1JYVA 1E5SA 1S0GA 4ASLA 1RUC1 5FPUA 1S5LC 1HC8A 5K7PA 4LJZF 2GP3A 5FQ0A 3Q9OA 3RKXA 4EN9B 3K0LA 2W3JA 5K1YA 5A70A 1CONA 4Q1PA 4XM3A 1W7PB 4PHZA 1AXYA 3LSEA 1W36D 4IHTA 2DU0A 4AI0A 5B1AH 1DYOA 4JRLA 2RM23 3IBMA 1UU5A 1G4DA 4E4SA 5HBAA 4UUTA 3ZN0A 2VAUA 5I0TA 2YX4A 3PQJA 1ULPA 3Q3SA 3ORJA 3UK9A 5ICCA 1R083 3GCMA 5A1LA 3HKZA 3HRUA 5LASA 4IESA 2P37A 4ISRA 1AXKA 5CFCC 2MD5A 2X1EA 4RB3C 2YYOA 1X33A 2PA7A 1J1LA 1U5IA 1X82A 4LQRA 4SBVA 1AL0G 5BXXA 2A6WA 3F23A 2ADEA 3LFKA 2B9UA 4B8XA 4JGYA 1Y3TA 1ZBA1 1YRNA 3U14A 1OJLA 5FWEA 1HB4A 3WUDA 1RJ8A 1FT9A 2C5DA 1IZ3A 4Y1XA 2WRAA 3I55I 1VRH3 2FD8A 2MA3A 5F2WA 5DZGA 1UN1A 1SCSA 3LDBA 5FUNA 2P1BA 3MFCA 3LSTA 1POV1 2HVSA 4QPGA 1UCXA 2FSWA 4A3KJ 2BU9A 4QHBA 2MG4A 1HXS2 3ONQA 3P3NA 1W7PD 3LB9A 3O1MA 5DUIA 1VQNI 2FQ4A 3PNYA 2GNBA 2ZMNA 1P2FA 5J1UA 4PDKA 3E7LA 1K12A 4JBAA 1GMMA 4Q0SA 5LY2A 1A8MA 1WJ5A 3COAC 4YVWC 2O5RA 3ZXKA 3T0AA 3FHNA 1OOPB 2MGQA 2MFZA 2IW5A 4G3YC 3RZGA 4CXYA 3I53A 4JQFA 2LTNA 1O5UA 1WI9A 1IRGA 4D94A 5FLHA 3ACLA 5C71A 1F5FA 1XYNA 3OTFA 2NVQJ 4WCGA 5BPDA 1A8DA 2DT7B 2M4KA 1D4M3 2QJVA 2D7FA 2TCTA 1LOFC 4NJ4A 4HKWA 5HS8A 2XWBB 3L2WA 3ABUA 3OF1A 4I30A 1CR7A 2QQNA 4LO7A 4PBPA 1XDSA 2KRFA 4EGYA 3JSOA 2VBPA 1BEV3 2W82A 1G9FA 3TQNA 3GHMA 2JDNA 2VE1A 4WK8F 4FCAA 4L8QA 1N77A 5DDJ1 3JTGA 5FYMA 4P02B 4R8HA 3ZN6B 4BYYA 2LK2A 2IGOA 1DCSA 1VQ9I 3MLJA 2COMA 1O6UA 2FOWA 3GFLA 1ZNPA 1RUG1 3R60A 1RUJ1 1VBE2 4GMP0 4HOOA 2WNUB 5KXBA 1PIV1 3JUUA 1QHDA 2A6ZA 3C7OA 1L3LA 3H9QA 3VZMA 4IV1B 1W0NA 1ZARA 3ALQA 5JMOA 1OYIA 5D8KB 3PJYA 2F4IA 1JS9A 3B9IA 2DOFA 3QYEA 3LEMA 3O8HA 2KZVA 4II2A 2GZWA 4TXWA 3K4DA 5LLQA 4LBKA 4Q0PA 2RS11 5A6QA 4B1MA 1UB9A 2DVFA 3CZUA 4P96A 4C2UA 4OINF 1IKPA 4PJ0C 4K20A 5FPXA 4ZYDA 3JD73 4U88A 1FPN1 1VTNC 1OD3A 1W6PB 3C7EA 3KB5A 5FRAA 4IDZA 4K7JA 2VZTA 5F7UA 1FNNA 1LVAA 1R5ID 1ZG5A 4YFXF 5A7QA 4F52A 1F1ZA 4NB5A 5FYZA 5T55A 4XOTA 4CDWA 1FSEA 4LHSA 2RAEA 3K6GA 1K5JA 3FMSA 2E5ZA 2HVQA 1RUH2 2OTLI 4Y5Z0 3F95A 2VZUA 4I01A 1XG1A 2VU9A 2VQTA 3WUCA 3L9FA 1Y39A 2E63A 5JLVA 3WHCA 4RDUA 4E7KA 1WJBA 1X8MA 3M4OJ 3O0VA 1YRZA 1FV3A 2HEYF 1FX5A 4Q8KA 4Q4Y1 4FQZA 2P0WA 2B39A 1TQMA 1QJY2 1OPMA 1AYM2 5CQGA 1TWGJ 1OBNA 1PMHX 1K42A 1OYYA 1WJDA 5DM7F 1WA4A 4RHV3 2PX9A 1IUFA 5JUVA 3HM5A 1I6HJ 2OF7A 5JFRA 2GNMA 1A5JA 1UZWA 2FRHA 4Q5OA 2EFPA 1H9PA 1CAUA 4LO8A 1I5ZA 2JIJA 4RL7A 3NARA 4LPLA 3SDGA 3I2GA 1DZQA 2A6TA 1X19A 3ZFGC 2ZZJA 2JE8A 4LKEA 1WCSA 3ZSJA 4IXLA 4KMQA 5KC6A 4A3DJ 1U78A 5CAZA 2P6HA 5FD6A 4FPFA 3QBQA 3NWSA 4AYBA 1W8NA 1X50A 3EPZA 1U12A 2YGLA 1OCPA 2H1KA 2ID3A 3S32A 2RMU1 1C8M1 1QU3A 3DXTA 5FZ7A 5L19A 4OIOF 2RS32 4KWLA 5J3LA 4H7LA 4A93J 3CO2A 2W39A 5E1XA 4HK9A 3L2QA 4AC0A 3J81Z 3ITQA 3IB3A 3H50A 1XSDA 3OEBA 3AP9A 4IGPA 2ZGNA 1YOVB 3EQEA 4CYCB 1XCBA 1RXFA 4JHZA 2YPDA 4H2AA 3CNAA 4I3PA 1IG3A 3AZVA 1A35A 4P08A 2Q8EA 4HNTA 2KP6A 4D8MA 4EJTA 5HNHA 3JRIA 3HQXA 3BG3A 3CCYA 1W03A 3T0YA 4YFKF 1UU4A 1GLNA 4NHYA 4IRIA 4AFMA 1S0JA 2MH9A 5FDBA 5H9RA 1JBCA 3E5QA 3AG1H 3UKTA 3CJNA 2CFOA 4XUNA 2GAUA 3CJQB 5HXMA 3OYEA 3S3MA 1D0ZA 4XKVA 3LOIA 1UKGA 2DCEA 4C9YA 4HF0A 1PO21 3OUJA 4N8MA 1DU0A 2CGOA 2WB1A 4AEDA 2K86A 3FXLA 1JU4A 4ANJA 1BBT3 1ZZCA 1QMJA 3QOPA 3BCBA 4CPBA 3BR2A 3AYCA 3F0CA 4XACA 5CEHA 3BODA 2ME6A 3ZN5A 3LOCA 6PAXA 3J7HA 3VBUC 2JDHA 3VL8A 3T4VA 2WAAA 3PJRA 1CAVB 5D8LB 2D97A 4A7ZA 5BNQA 1AR81 1POQA 2FDIA 4IE5A 2VJXA 5A3MA 4HQEA 3AYAA 4M0NA 1VBD1 4MO3M 2XAQA 1IS5A 1L7RA 1HKQA 5FPZA 1MMDA 5T5JA 3SHFA 1REPC 4KBBA 2I8DA 2A5WA 1W04A 3BJAA 4WVMA 3FHQA 2V1NA 5EJCA 4RBOA 3ZSKA 5KHIA 1RETA 3HOUJ 1JH5A 2FQ3A 2VQAA 3VODA 3WT3A 1CD3G 3GDBA 1RHI3 2XF7A 4HSTA 5A3PA 4UI9L 2X85A 2VNOA 4HQMA 2L02A 4G7HF 2G7HA 3PUBA 5FROA 2BZTA 2ELHA 4XLEA 2XMLA 4M9XA 4WM7A 3CCVI 3TEDA 5IVBA 3KSCA 1ETXA 3D5OA 1TWFJ 1AR73 5IY5H 5JLXA 1V5EA 5A6YA 3CF5F 3V7SA 1TVGA 2BOJA 2R063 2ZX0A 2PLV2 3ZSEA 1RVF2 1GP4A 2OZUA 3KV6A 1PK6A 1UMIA 5BNOA 1IV8A 1MEC1 5H9PA 5KHGA 2R4GA 1FAYA 2R7ZJ 4DFSA 1PP7U 1FYKA 5GLVA 1GWMA 3FZ3A 1SAXA 1H9WA 4HG6B 3I54A 4IF4A 4YRDA 5HODA 4JYKA 5FZIA 4CDQB 2CUFA 5GZDA 2WTEA 2V9VA 2VMIA 1ACIA 1KGSA 1OLTA 2FOKA 2JDKA 1ZHFA 1JGGA 1UY3A 1S7AA 4J01A 3CUQB 1G3WA 3OPZA 2JIGA 3W6KB 5BNNA 3HSEA 3GTMJ 5HDGA 2C24A 5JHUA 4BHCA 2B7YA 3ZQLA 1IG7A 3DCFA 2JMWA 3BJOA 3OYIA 3D5RC 3WODF 1TMF3 5CBLA 1L0OC 3LWCA 1C5HA 3BWGA 3CCRI 2HKXA 4TSVA 2YHJA 2HLEA 1PGL2 3FISA 4XIKA 5IK5A 2J1UA 2QQVA 2WWYA 1MMSA 3OGVA 3M8EA 3OBTA 3ZXLA 1MS0A 3VZLA 5IWFA 4QKFA 2ZHMA 1AYN2 4AHZA 4Y22A 5F64A 3LKJA 2ID6A 2ZBKA 3QPLA 3ZMVA 1R1VA 2KIQA 3OSDA 3HL2A 3AFGA 5L9BA 5GZEA 2J7MA 1Z91A 5GPAA 3TOAA 4KG8A 4XW3A 1VQOI 2RJKA 3POSA 2CNAA 2CDOA 3RMYA 3UL2A 2DFFA 1Y8RB 4CE8A 4EM2A 5JPMB 3TNPB 3HHGA 3ZR6A 4XMAA 4E7LA 2WSVA 1XDUA 3RSNA 3H7JA 4HONA 3DU6A 2ELJA 4RGGA 2VY0A 4CUAA 3QU6A 2JPBA 3N4MA 2WJSA 3LA3A 4L5EA 3JRCA 4ZZ8A 4B4QA 3GTPJ 2WZR2 1ZBE3 4CU8A 3I3LA 1I9RA 2E6VA 1NLSA 1SLAA 4RB0A 3A0HC 4R4ZA 1GOGA 1I39A 3B3QE 2KHMA 3H5RA 1SEFA 1QHGA 1B8IB 3O12A 4R9DA 3WQ0A 5GKAC 2J22A 1NH3A 2VR4A 5CNAA 2O7OA 2WV0A 5E6HA 1CAWB 4COWA 1RUE3 1P8JA 2QQBA 3Q0VA 2ZGMA 3TW7A 2VZVA 1IC8A 1P92A 4YZ4A 4JTNA 1LDKB 4CCKA 3P5BA 3CL1A 4FT8A 1SCRA 4XF1A 1H0BA 3KZZA 2XOMA 1IDYA 5FZFA 3LMMA 1R1A3 1S29A 2ME0A 1RMU2 2PMHA 3VLBB 4XFBA 4JGYC 2X9DA 2OA4A 5A33B 2OX0A 4IGOA 1YFXA 2VBXA 5ERIA 2G0EA 2ZGUA 1GU3A 4JVAA 2F17A 3SKVA 1ST8A 4ZU5A 5IK4A 1DZTA 4LHKA 4YG0A 3ES1A 3LPGA 1WH7A 1D8KA 3W2VA 4G7ZF 4QPGC 5FZBA 1G3YA 1XMAA 3VD5A 1ZR4A 1OQYA 4EN8B 3CCQI 2LS6A 2R042 1WWYA 3OUIA 4PJLA 4RAFA 4ATFA 4HL0A 4I3GA 5CFCB 4AVZA 4II3A 3OGGA 3I64A 2IBDA 3JR9A 4TLGA 3H9AA 3G71I 2JVHA 3DPRC 3VSLA 5BNPA 5JAXA 1WZXA 2A6EF 1TWAJ 2D6LX 2W84A 2IWGB 1XU1A 2O14A 4E7SA 2RE9A 4YEJA 3BIWE 2ID4A 3KF5A 4TN7A 4LBOA 3VKOA 5AC93 2OW4A 2UXXA 1O59A 1F35A 1RESA 1VBE1 3MUZ1 3WW4A 5A7SA 2AQEA 2E19A 3PVOA 3RNSA 3LSDA 2PHLA 4GXOA 4URTA 5D6FA 1OF4A 1XS9A 1HJFA 2W25A 4X8NA 5JXGA 1H6YA 2J5PA 2K2SA 4LO6B 4BNCA 2HH9A 5LA2A 3V0AA 2BGCA 1NCRA 1KU7A 2QKMB 1JHFA 5C9AA 4AI9A 4LLGF 4LB5A 2UXNA 3I59B 1R5HA 3C2BA 1OVPA 4KA4A 1UO9A 1S0CA 2PJRA 4K1YA 1FOD3 2JB8A 2VZOA 2PTMA 3BN6A 1QWRA 5CFDA 1XOYA 2F5DA 2GH2A 1J5YA 2Q8OA 1XTAA 1AWCA 1XXNA 3HNBM 1FY7A 3POIA 5C3PA 1ETKA 1SFEA 4BJTA 1AKHB 1K3IA 2RJLA 3K75B 4YVWB 1K78B 4XHXA 4EZHA 1DU6A 4L11A 5CIRA 1YQ8A 3A4UA 2L5QA 1RUH1 1S55A 2ZXHA 5KAIC 2WZPP 3RFRA 3GTJJ 2XJTA 3NV3A 4QGLA 5FP9A 4GQ7A 4WXCA 4IE7A 3KT7A 4O61A 1DP3A 1PUFB 2ETHA 3OYGA 1FSHA 4I0BA 3AMPA 4DEQA 3FKJA 1YI7A 3AJZA 1Z3XA 2XKOA 4B7KA 4UB8C 4KISA 2YPRA 1QJY1 1AYM1 3OGSA 5LK7B 5IT6A 4CRQA 2JG8A 1WKYA 1O3SA 3ZMZA 4WVWA 4Y4YA 4NBQA 3AMHA 3EUKL 1DQ6A 3CJRB 4EQQA 3KLSA 4D7SA 3E6MA 2HDCA 3KFWX 2DCJA 1IS3A 2EZKA 3F6OA 4XFAA 2Y30A 1SDWA 3I49A 4L9TA 5F6KA 1YIOA 3EUAA 1BK0A 2CV0A 5IVVA 5DTDA 4CEWA 3WTUC 1CX1A 1UZCA 3CMMA 3WE2A 3CCSI 5FYTA 3M1CA 2Z9OA 3TAYA 4ET7A 2EZHA 3ACHA 1Q8OA 3NW4A 5HS7A 3OYHA 1WQ2A 2PMZA 3I97A 2X4HA 4MGKE 5C3QA 5CKMA 2RDPA 4E7IA 4JX5A 5FO9B 2EFOA 4IOCF 3F8CA 3PSIA 5ANQA 3V8KA 4S04A 3L2VA 2RS31 3TBDA 2XUBA 2X0LA 3MZ8A 3OR2C 1HV0A 2XHKA 4DBQA 2XB5A 3GM8A 1JZ3A 2CW7A 2LALA 3S1RJ 2Y0OA 3H8UA 3DPUA 2XROA 2ZSHB 4A12A 4QDRA 4UFKA 2COBA 5FY0A 3SEEA 3L00A 5A6ZA 1LHWA 4DO0A 2ZKLA 3H8XA 3J4UH 2VM9A 1QPIA 2YROA 4M3CE 2EJRA 1KYWA 2W91A 2WN2A 4GO1A 1R00A 3ZN1A 3IPVA 1VMFA 4OHYA 2NVXJ 3FHZA 2PFWA 1L7LA 4DOZA 1WMFA 1U2WA 4X0GA 1ETOA 3CDLA 4EJUA 3RKQA 2QFEA 2FNPA 2IXHA 4MOAA 3M1HA 1FLIA 5FFZA 4JGZC 3S15J 2B9SA 2NOJB 4MIMA 2K9NA 1UYZA 4JKKA 4MEYF 2ZX2A 3CC2I 4AWXB 3RJ2X 5EJ1B 2EIBA 1VBC2 2DVAA 5IAXA 4EJVA 2XVCA 5FZOA 4A41A 4XZPA 1W6QA 4ZTFA 3BC8A 2VOPA 3ZFGB 2YB7A 3ECQA 3LQQA 3FXQA 1MS4A 3IKTA 1LOAA 2J5OA 1V3FA 5JVVA 5DYMA 4Y4RA 5L9RA 3BALA 2XBO3 1C1FA 5EGOB 1X1AA 3CCJI 1SG3A 4W4ZA 2WO1A 4OZXA 3H35A 2CGNA 4N4OB 1NK3P 3L09A 2AYHA 3I8TA 4Y7NJ 4F3JA 2Y60A 4BQAA 5HOOA 1RTVA 4EJWA 5LY1A 5L3GA 2DMNA 1ETVA 4XXPA 1G9DA 2VNVA 2KPMA 3V4GA 3KETA 1WW6A 3WDWA 4A7KA 1O4TA 4AEDC 3OY8B 2E33A 1I5PA 2JRMA 1HX6A 3POFA 1K7AA 3HVDA 3MHZA 2DYRH 5FMCA 5IPAA 3TO9A 2GIVA 2JEMA 4IEQA 1MDMB 2TUNA 2WFF3 1SACA 2L0KA 1X3UA 1GUUA 1MZBA 4HSRA 4S0HB 1DU3D 3DBRB 4KH9A 3TO6A 2W85A 2EZIA 4BXFA 1RKTA 3KP4A 1OCZH 4MADA 4MHUA 4IE6A 3S93A 4ENMA 4KUMA 2P5LC 4CA9A 3ZPOA 1B1BA 2A70A 1RUD3 1XNKA 3O1VA 2A75A 4I02A 5DN2A 4CO8A 1JZ5A 4D1QA 1AOYA 1QKQA 3BZKA 1ZLJA 2DCKA 1NG6A 1QQP2 3BB6A 4BE1A 4LK0F 2PHRA 2PLV1 4K6BA 1RVF1 4KNCA 2NNYA 2CW8A 3AKTA 1SBEA 4Q0QA 2AC1A 4P9UA 2VBBA 2Y69H 4FI9A 4N7IA 1CJPA 4IL7A 3KZIC 3DKXA 2JDUA 5F3EA 5FXXA 1C0WA 1TME1 3VBRA 3AZXA 3WNKA 2D98A 3IH3A 2FCTA 1Q8QA 3HRTA 1KONA 4WM7C 1WLCA 1ZZ6A 3P6BA 2HPIA 5FY7A 5LRSA 4NHMA 1YEWA 3OYLA 3VBUB 3T2TA 2ZJCA 1OA3A 1GP5A 2RDSA 3WINE 2DA7A 4DNCA 3CMEI 4XLNF 1HLCA 4RGAA 2L3DA 1PK6C 5BNOC 3KCCA 2LLKA 4BKXA 4GULA 4QB1A 1LE8A 2JJ7A 1V9U2 2FMYA 1ZRDA 5A3UA 1GVJA 2XLGA 4ZTJA 4BQ1A 1WGPA 1NG0A 2A6XA 4YIIA 1AL23 5L3EA 4MGRA 4AEJA 5A2QZ 1MIJA 4YW3A 3FZVA 1PGL1 3DECA 5L7OA 4S2HA 3CD6I 4PT6A 3D6EA 1J58A 5EYYA 3MF9A 1ZYRF 2V1XA 1AYN1 1OR7C 1LJ7A 1XB9A 3ZQ7A 2R5ZA 5GJ6A 1RUOA 4Q4V3 2GOXB 4LA2A 4MXWA 4LXLA 4YSFA 2NAZA 5CADA 1VB2A 3S1QJ 1E5IA 1W9FA 3TNQA 2GC3A 3AFKA 4OU0A 4L2NA 4G94A 3LFIA 1R23A 2DT5A 1YX3A 3ZYIB 2R7RA 4JDNA 3U07A 3I4PA 4P9GA 5FOBB 2W5FA 3ELKA 4QKNA 2JA6J 2CQKA 5KXCA 2HEOA 3WHUA 4RD7A 5C4WA 1V70A 5E3MA 2EVXA 2JDZA 2WZR1 3J81K 5EV7A 2ETEA 3QH6A 2TRTA 1R58A 2QA4I 4Z2WA 1EH6A 4QQ2A 3I71A 3MF6A 1W8FA 2M9HA 5IHRA 2J1TA 4AEKA 2V5YA 3RIRA 1PHMA 2DUOA 3HR9A 1MBGA 1DP0A 2HKOA 3H3UA 4YARA 4V19K 2WA4A 5H2FC 5EEHA 5FZEA 3Q0WA 3WG7H 4XAEA 2O0OA 3ABZA 3DGTA 5LCWL 1TLHB 3WTTC 5FKLA 4N90A 4FTBA 1T0FA 3SCHA 5H9SA 5GM0A 1ZBA3 3BTAA 1NQJA 1QNWA 4YM1A 1SFXA 2ZOEB 2NYXA 4ZU7A 1LFBA 1BIBA 2NM1A 1VBA2 3OUHA 2OQ6A 2VKEA 5C8WA 4L99A 2O8QA 2LKSA 4BY1J 3NVCA 4CCMA 2F5FA 2XGCA 2OZ6A 1IPKA 4XL9A 2Y2ZA 1OC1A 3NQHA 1D3YA 2ARAA 5A7NA 3PTRB 4UVBA 2WNVA 2Z2SB 2BOLA 1FYUA 3GZEA 2JXAA 5I0SA 4A0ZA 4FP2A 1AR62 2DJIA 3GBFA 3AB0A 3K51A 1JKRC 3V7RA 5E8IA 3VBOA 3KP2A 2R041 4QX1A 4BQNA 5FY4A 1R9TJ 3VD4A 3N9MA 4NOTA 4XABA 3B93A 5FQ0B 4ZDPA 2O0YA 4XF9A 3ZMTA 2IXIA 3VB2A 2XAFA 3TWIA 1CAXA 4A42A 3IDCB 3DFGA 4GB33 3TGNA 2QQMA 2BY1A 1Y9GA 1R1TA 5A7OA 2OBPA 5LGUA 4S05A 2GXGA 2PEXA 4FXGB 2VC1A 4IEOA 2IXSA 5C3EJ 3RQ0A 4IETA 2C6SA 4QX5A 5DDJ3 2W2IA 3NNLA 3R0RA 3HRMA 1MVEA 4DEVA 1X1CA 1Q43A 1RUJ3 1MBKA 1XGNA 4CXFA 4PSWA 1W6OA 4OAZA 5BNPC 4Q4W2 1EV7A 5L3FA 1B9MA 3IT8A 2XWJB 2J42A 2P2KA 3BUCA 2O8KA 2LFBA 1K5MA 1UX7A 4O65A 4JGYB 4XF0A 1YRNB 2DBBA 3GUDA 1W6MB 5TGTA 4FPLA 4DIQA 1X9PA 2DWRA 4OUMA 3OYDA 3USSA 4XRSG 2M7AA 3F8BA 4CTEA 4G9SB 4LBQD 1FPN3 1NCRC 4W65A 2E2HJ 4QPGB 3IWFA 5C9AC 2L4AA 4B3XA 3QP5A 5HXVA 1VIWB 5CFDC 1PJRA 1AU7A 3HIFA 1ZZ7A 2SBAA 5AFBA 2V4JC 3Q8EA 3SISA 5KBFA 1HF0A 5E89A 3FJSA 4FTEA 3HBKA 1QH7A 3DPRB 2HZDA 1BR2A 5APAA 2XL9A 4G6DA 1LECA 5FY5A 3BU7A 4YM0A 2K40A 2PLYA 1Y1WJ 2NZ9A 4YW4A 1ULCA 5B4NA 4OUEA 2DUQA 2XRNA 1JUSA 1LESA 2HDWA 4FTSA 1LOBA 5LRRA 4UOJA 5JXJA 3OD0A 3P1IA 3VHOA 4O9EA 4RYDA 3ELNA 3DP7A 1OA2A 1J3QA 3CCLI 2M5WA 2AUYA 5FYIA 2JG8C 5FMOL 2LYCA 4RQPC 3KGZA 3CU7A 2X8KA 5JIUA 3K1MA 2DA6A 3MEPA 4Q0VA 5DDGA 4LOSA 1IZ1A 2QLZA 4BH9A 3W20A 2YC2A 2GWRA 1OPCA 4TV7A 3OMYA 2Y48A 1MZFA 2EXKA 1T6GC 1QBJA 5J98B 1ZA7A 4CEWC 3CC7I 3POEA 2RMU3 4MTEA 5JOYA 1C8M3 4HMZA 1RUF3 1COV3 1X2MA 2Z99A 2HQ5A 1XSRA 2DTYA 4NHKA 4XCAA 2K7LA 2P17A 4MYEA 3HG9A 3E5UA 3RZOJ 1V6IA 2JA5J 5EZHA 4M6VA 2CUEA 3S3NA 4LK6A 5GZGA 1E2XA 4WVVA 1ODMA 4JK1X 2W52A 1V6JA 2CUJA 2JD4A 4XLHA 2DURA 1AX0A 1XPXA 3N9LA 2F2EA 4E4HA 4W6WA 3ZPLA 3KYDB 1GFF2 2VOVA 3T08A 4G4FA 4EGZA 5KNLA 1IN5A 1V5FA 2IS1A 3ZQHA 4JKMA 4FPOB 5I91A 3KYCB 4GKYA 3ASIA 3L2UA 4K21A 3GBWA 2XB6C 5FMBA 4Q48A 2ZBJA 2EFWA 1GHCA 4K1ZA 1VBC1 1OA4A 3SNMA 3TN93 4BIFA 1HRI2 2ZGRA 1DFQA 1UZYA 1N1YA 2A3XA 2VOWA 1QXPA 2BP6A 3ECHA 4QPYA 4XJAA 1U0AA 1HRV3 2E7AA 5LEKA 4QB6A 2QSFX 1E0EA 3SQNA 4Y1VA 1UIKA 2XJUA 1DDNA 2K9SA 3K4JA 2OPTA 2HZTA 5DCMA 5FJHA 1CJDA 3K48A 5CPRB 2Y38A 4LBJA 3ZYRA 3CTAA 4ZH4F 5HDNA 2UV1A 3U1KA 2EILH 2LREA 3J8F2 3ZOIA 2DW4A 1CAUB 2ES3A 5M0TA 3OD4A 2DOAA 2QVSB 2Q1FA 1M1EB 4P9FA 4RAGA 1W5SA 2XVKA 2DI3A 2NXNB 1AX1A 2Y75A 4PDWB 1YO5C 4ASKA 3WF1A 4FPYA 1FIPA 2C0ZA 1NLQA 2VQLA 1TT0A 1AR83 2HWE2 1WJAA 4PLOA 2G9FA 1VBD3 5FO5A 2CV2A 2IVMA 1YC61 1RI7A 3F22A 4KITB 1GXQA 5DD8A 3RZHA 1FNZA 4DUWA 2XSDC 1LULA 5FK7A 1WPKA 1ZH5A 3HQUA 2VVEA 4OHXA 1R1ZA 1P4XA 4WZCA 4A69C 3WDVA 2FA5A 1ZM1A 3HT2A 1JODA 1T33A 4LK7A 4DRRA 1LR5A 3WSOA 1YUDA 4JGZB 1OLME 2E1MC 3LSGA 2P7CB 4BJ5C 1QQP1 3VHNA 4ZHNA 3EQLF 5EYXA 1B72A 3CESA 2JG9A 3TP3A 1Y0UA 5F04A 4FQGA 1GOHA 4BQ3A 1SVMA 4QXCA 3FK6A 1REEA 3WVJA 1C8NA 1O4YA 3IDBB 4IE4A 5JXHA 2H6BA 3TOBA 2JUGA 2M45A 2HWF1 1MZ6A 2JQ7A 1N1SA 1UD1A 3FN9A 3AKZA 2ESNA 4IEJA 1MEC3 4AI1A 5IK7A 4ZPIA 1XMXA 5K7FA 2E7QA 4RS5A 4L9JA 3BQZA 3TKYA 1OQEA 1DQ1A 4AHWA 4ARYA 1BC7C 4ZS2A 1QHHD 3PUQA 1Z0XA 1H0MA 2GC1A 2JRTA 2W1OA 4I76A 2JB4A 1WRJA 2HR3A 1V9U1 3VBRC 4PQQA 4AEDB 5CKQA 2LROA 5AVAA 4IL6C 1YS6A 4IZZA 2K85A 3IM0A 5FLIA 2L7MP 5D4SA 4DZPA 5GAEJ 2NMOA 4GXLA 4A3MJ 1VBB2 1RC6A 2BNOA 1SPPA 3PVBB 4LBLA 1DBNA 1XSXA 3K4CA 1HXDA 2VZRA 3FXRA 4M3FA 4RS8A 3CJXA 1GSLA 2OYZA 3JRAA 3LIHA 4UFHA 2NVYJ 2VASA 3PSFA 5KWRA 4WVZA 1ZK8A 1NXD1 1PM4A 1POV0 4IW3A 5HV4A 3J80K 1U5XA 2QWWA 1H8TA 3VYRB 3PQKA 5AONA 2RM22 5KR7A 3Q8CA 4N0BA 4WVMB 3AG2H 2XUMA 3FM5A 4E27A 4E8DA 2BDRA 4IHVA 3VZKA 5LGTA 5FD5A 3I4NJ 3PURA 5L7OC 3AMQA 5CKNA 3UJOA 1ACCA 2DVBA 3ZDVA 2UURA 4JV4A 1ENXA 5C33A 4QU1A 4M3BA 4JDMA 1QGLA 3GW2A 4WWCA 1BJAA 4WM7B 2XRLA 2DAOA 2WR9A 1BCXA 4BUPA 1HW1A 2OU2A 1YJWI 3RZKA 1FP1D 1CIYA 1WCDJ 2OC6A 3GWZA 5GPCA 2DPDA 2CS3A 4NIHA 2PYTA 5K9YA 4IEUA 4A44A 3T30A 2R7QA 2ZFWA 3WGHA 1H1IA 1KQ0A 1H89C 4RFRB 5F6LB 4M71A 2Y6JA 1OI6A 4IEZA 3QCWA 1PK6B 5BNOB 1POGA 2BV4A 1ZZ8A 1X2NA 4N53A 5BYNA 4AWDA 5EYRA 2V5DA 5C4WC 2CU7A 4F7ZA 3IV5A 2FZ2A 1BA5A 3OYMA 1YJNI 2HEVF 1LNWA 1Y4WA 3L2YA 3HTSB 5LBQA 2P4WA 3FMGA 2OD5A 3PJQA 1RC9A 1VBA1 4HF1A 1WLDA 2M4GA 1US3A 1W3VA 1HXS3 4I0WB 3AL6A 3V64A 4L5IA 2HWB2 3KHBA 4NIIA 2ZNYA 3CMYA 2HDDA 2W0XA 1UPIA 1J09A 1T56A 1US2A 2C26A 1Y1VJ 2R7DA 3S16J 4GYIA 1D4M2 3SHRA 4OMYA 1WHUA 2CO5A 4MG2A 2R7SA 2Z5WA 5A32A 2ORXA 2FDKA 5HVQC 1W99A 2VXRA 1MACA 1T08B 5DUXA 3GF6A 1BVP1 1BEV2 2KMUA 3OSFA 2AS5F 4U2AA 3B6AA 3BTCA 4WF2A 2Z69A 2WINB 5CB7A 4PJMA 3RPUA 3H1MA 3U9GA 3KX2A 4CH7A 2WNVC 1UAIA 3MO4A 4QDSA 3ILFA 3GBGA 1XCVA 4AIDA 1ALYA 5GLWA 1D7PM 1FBSA 2R7XA 1IAWA 1LENA 3NRUA 4QPWA 1IGOA 3I0TA 3VBOC 4UYBA 3WP5A 4RLFA 2PQSA 3G6EI 2DV9A 4XUPA 2VZSA 3HGGA 1VBE3 4BAYA 2ZX4A 4CHUA 3V8JA 4AVCA 3K4BA 1RITA 3OIQA 2WLPA 4HLTA 4Q4W1 2VCMA 5JXIA 3WE3A 1CQTA 3K2OA 1PO12 4HG2A 3LAJA 3BG7A 3DL3A 2BPA2 1MSFC 2XGXA 2E2IJ 5IT3A 3VWBA 1JYTA 3B69A 3RSJA 2CQNA 3S57A 2PELA 2JECA 2D5HA 1QZEA 2D93A 3ON7A 2BNMA 3I7DA 2BUKA 4A4AA 5BPIA 5F39A 2DTRA 3LSIA 2Q0AA 4P00B 2XVGA 3BYWA 1Q8PA 2LP0A 3KMHA 4V2WA 3BG6A 5JSOA 2JA8J 3ZKYA 4M0HA 1R4MB 3HXLA 1S0DA 1Q5OA 1X4PA 3I4IA 5J09A 1K5MC 5F5IA 2QGUA 2Z1DA 2L7FP 1RIOH 2WNEA 5F08A 1RUH3 3ZIXA 3VOEA 4A3FJ 2FQPA 3OEAA 3GFJA 2HBUA 1FXZA 5EQUA 1USSA 4KU8A 1LJ9A 5C8CA 3LAPA 2A73B 3VD7A 2O8XA 2DF7A 1VI0A 2K9QA 4GGGA 1ULOA 3KP6A 4ASMB 1J7KA 5HPOA 4M4PA 3O1OA 4MGZE 4B29A 1D8JA 1YJLA 4IHYA 4Y5SA 3SCFA 3H36A 1D2QA 5A2QK 5FYVA 3BTIA 1G59A 3D1NI 2Z4FA 2VMHA 4B1LA 1YNAA 1FNYA 2X6WA 3BG5A 1AYM3 4UBGA 4CCNA 4CZZA 3H7YA 5JZGC 5C44J 3F21A 4C1WA 2ISYA 5T54A 5D2AA 2OV7A 3PO3J 3CP2A 3MMYB 2J1EA 5FP8A 5BNPB 1WMDA 3CUOA 4GFBA 1IO2A 3ZMNA 2Y0SA 1X9TA 2NN8A 3LD8A 5C3SA 4CU7A 1H2KA 4YFWA 4EJRA 1YITI 1IN6A 3ILNA 1XNAA 1WW4A 3FHAA 4CDUC 4NIGA 1XNBA 1FPQA 1APNA 3DCQA 2A3YA 3H0DA 4OVEA 2D43A 2STTA 2HOAA 1EUTA 5DAXA 1NCRB 2DOEA 4CCOA 5LHHA 5C9AB 2XL7A 3PNTA 2GA1A 4HNVA 1EY2A 4K9SA 1WMEA 5F3IA 2YR2A 2F48A 1I1SA 3CF6E 2PJRB 5DUWA 4EYUA 3NV2A 1LNSA 5CFDB 3ETPA 2QBYB 4LNVA 4YZ5A 2ELKA 2VMFA 2NS7A 2NVUB 3VBFC 5GLTA 1OQDA 2M3AA 1OUXA 2QZ3A 1CIWA 1F4AA 3N36A 4HRIA 4EN7B 5FZ9A 3UJQA 1X58A 3WP3A 5JR7B 3W6JB 1DUXC 5AIQA 3S7IA 5E18F 1ERDA 1IPSA 5C5TA 2P3JA 4AEMA 4M4RA 4XKCA 1LAJA 1JW6A 3IRRA 1RZ4A 2YU2A 4E4DX 1JXNA 1W6NA 5ANNA 1H8AC 1PMJX 3E1F1 2DBNA 3MKZA 3HB9A 4RGUA 5F0CA 1FOYA 5ACA3 1HRI1 4G9YA 4BQYA 5JVTA 4N9HA 4NROA 1CF7A 2X5IA 3OV8A 3N9QA 1W2AX 5L3CA 1SFKA 3MN2A 1VQMI 4P14A 2VW0A 5IT9Z 2JG8B 3A2KA 4RQPB 4X6AJ 1FYLA 4FFHA 3NNGA 1ETWA 3HOSA 5B1BH 2DA5A 4QGMA 4CXXA 3J8F1 1LRHA 3PUHA 2FZ1A 4ZY9A 1W05A 1B09A 2FDGA 3X2QH 5JVGF 4AK3A 4CEWB 1QRYA 3AKQA 1VF9A 3WF0A 2VXZA 4RGXA 1JZ8A 2DTZA 1VQ8I 2HWE1 4GMP3 3OS1A 2DDAA 1ZRRA 1NY72 1SANA 1W7PA 1SFOJ 2R0QC 1ZRCA 2P6SA 2Y8KA 3H8RA 1RHI2 1O3QA 4MSVA 4QPIA 1SBDA 4FX0A 2NS0A 3QU3A 4XFCA 4META 1NZIA 2WT1A 4HSJA 3SMHA 1DYPA 1DGLA 4HANA 2X48A 5LA1A 2FXAA 1G9AA 2F4LA 4JX0A 4NC6A 4OUSA 3HOXJ 2EICA 4IXAA 3JBG2 4LG3A 3SH4A 3IPVB 1DGRA 1SVOA 5A1AA 1PVC2 4NIDA 3K1NA 1XNTA 4KICA 2OA2A 3OBAA 3WNOA 1MNMC 3LZZA 2FD5A 1Q8VA 3WP4A 2YG0A 2LC2A 3B7MA 1HOMA 5CLSA 4LUKA 4A7YA 1BBYA 3Q9VA 4GYGA 5E1WA 1Z0HA 4YW1A 1QGPA 1BJZA 2D6MA 3GXUA 3KV5A 1RINA 5KHJA 1SLLA 4D7MA 5FZOB 2JG9C 1G6NA 3ABTA 1NOVA 5IOZA 3WOGA 1MBJA 2A1XA 1W6QB 3K4NA 1CZVA 1UOBA 4CU6A 1TZOA 1D0YA 1A6QA 2ZSIB 3OG2A 2ZMEA 2GMPA 3WZ1A 2Z5UA 3R0JA 2CQXA 2ZCWA 1TWHJ 1OQ1A 3VHPA 5JDBA 4XRSA 4HV5A 2UWMA 1VBB1 3AL5A 2GN3A 1D5VA 1NA1C 2JN6A 2VC9A 2W57A 3WG1A 2VJ4A 4G6TB 2PHFA 1YFWA 2IS4A 1VPHA 3HYIA 1YLLA 4RS5C 4HBNA 3HN3A 1MS1A 2KR2A 3DWLE 4Z8BA 3C2UA 2J1AA 3PL0A 3KZYA 4RFT0 3CF2A 2ZEXA 2RM21 2XF5A 3RZMA 1JJ8C 3MCZA 2E1MB 4GWIA 4WXDA 1BZWA 1Q1VA 1AYN3 1O3TA 2ACJA 2GP5A 4ISQA 2E1OA 3K46A 3C7GA 3NJYA 3IAS2 2RDNA 5DAPA 3M1EA 3S8PA 3RQ4A 2F4OB 3ST7A 3BZCA 3VBSA 5A6XA 1NE4A 1BHGA 3LDRA 4FPGA 2WNUA 3FXJA 2ET1A 2SLIA 1P7IA 4IV1A 4BJ0A 1OLMA 1K45A 1JHHA 2CQ7A 1H8TC 1U5TA 3KP5A 2R7UA 2QM3A 2MBFA 2WAFA 5E17F 3O6BB 2RQPA 2UYAA 1T38A 3WGGA 3J7AY 2VOXA 4YW6A 2E26A 2ZABA 2DLLA 1WCKA 2MABA 2WNOA 1O4XA 1UIJA 2H09A 3N9PA 3EUHA 4XAAA 3VBRB 1W6PA 3CDIA 4GAZA 2CYYA 3JU9A 4QB2A 1XE0A 1JZ4A 2CY6A 4A3EJ 4F91B 2FBIA 2EA7A 1R1A2 5HNFA 1ZREA 3WXPA 2Q0OA 3D8CA 5IVCA 2QSGX 2QE3A 4P1WA 4UFLA 5LZ6A 1RL3A 3ZYFA 2GM4A 2CSGA 1YQAA 1LHVA 4OIQF 4JRAA 1SDDB 3MIEA 5F5CA 3AXEA 4BQWA 1AVBA 1RMU3 2HWB1 4BQOA 4N53C 3A03A 1LE8B 4OHVA 2XVLA 1OH3A 4Z6YA 5DZEA 4PFPA 2XAHA 3WNPA 2QQWA 3ZIWA 1D4M1 3UKNA 2M0CA 2IVJA 5K8SA 2QENA 5J37A 1KJRA 5L7OB 3DF8A 3DLLF 3MZYA 4HPKA 3AAFA 3HEIA 5I8TA 4RA0A 4KG0A 2W00A 3S7EA 4XLCA 1UOGA 1Q1HA 2R5ZB 1BEV1 2MH2A 4QPQA 1DPUA 3WU2C 4JC1A 1IN7A 4XNFA 4MXWB 3TEWA 4M73A 3NNFA 2R043 5M5YJ 1FIAA 4MZUA 3WW1A 4B4PA 1JKPC 2VBWA 1Z7UA 1UHMA 5FV3A 3C2HA 3E3VA 1PDNC 4A3LJ 5CA6A 5I8YA 4XXAA 5ILSA 2JTVA 4Z2AA 1U5YA 3AMMA 4IEPA 3QODA 3RPQA 2E7WA 3Q9SA 2FDFA 1EYBA 1I50J 2QUFA 4CCLA 2ZHKA 1YW7A 4GH4A 4AZZA 1F2NA 2QDNA 3WF2A 4XF3A 1BW6A 4AQ6A 3HJEA 3PUIA 5IYBJ 3JB4C 5C4WB 2QNKA 2JSPA 5FZAA 3J7ZI 2R92J 4IEWA 5KVRA 4HPQA 1PO11 1JZ2A 3MKWB 3UNGC 1XC5A 4FFFA 4YW7A 4FO9A 4OQ9A 4ZJZA 3Q8BA 5DXDA 2F4PA 3OIOA 1W0OA 4GWJA 5FMOS 3QPTA 3AYEA 3VGIA 2WO2A 2DBIA 4Y26A 4CYCA 3LAGA 5D8AA 2RR13 4E2SA 2WO3A 3VZNA 4QQPA 2P34A 2XPWA 3AJYA 2C1FA 2OPWA 2WKKA 1TNFA 4BDYA 2A05A 2XV4S 3KV9A 5K0UA 3QACA 1I3AA 3SZPA 2KQRA 3PUAA 3DEUA 3NMBA 2LD5A 2M34A 2ZAAA 1USTA 1HB1A 1X7NA 1W06A 4UUVA 3KP3A 3PL8A 3VDBA 3LSPA 3WTVC 3FIWA 2WAQA 1LB2A 2A3WA 1YW8A 1YQCA 3POJA 1JE8A 1LDDA 2WNVB 2K9ZA 2BW8A 1BI3A 4OZOA 4BB3A 2ESHA 1AZDA 3LEGA 3K2ZA 2W9XA 1EUUA 2JJ6A 2YBSA 1REFA 4RHV1 3GZ6A 5ICFA 2X1CA 3ZMOA 4IEXA 2VC0A 3VBOB 4YZ1A 2ZGKA 5GLUA 4G6QA 2K9LA 2JKBA 3KT1A 3ABKH 1UY1A 3M8FA 3FMRA 2WUHA 3HMYA 3K77A 1W9WA 1Y6IA 5GAHJ 2EXJA 3FE5A 4QQOA 2VOOA 1SMTA 2Y0IA 3WTYC 2BHYA 2ZGPA 5C8CC 4AU7A 1TQPA 4ZZLA 4IEVA 1CAXB 1J0RA 3SH3A 1OISA 4D6RA 3T2OA 4HV6A 3IAM2 2UUZA 3HKZN 4XICA 3G1OA 4QHOA 2LY2A 1JI8A 5H20A 1AX2A 4CUBA 4JDOA 1AF9A 2W95A 4WM8C 2AXLA 4BY7J 4R79A 4HSLA 4XQ4A 4IGQA 3PIGA 1GR3A 5LWBA 3UGHA 4QKDA 2BY2A 2CH0A 3RKYA 2DU1A 3RTRA 3UT0A 4L0ZB 5FZKA 3C3WA 4BLIA 1W6OB 5LBCA 4A0YA 2XH6A 4AI3A 2WADA 3A7QA 2WAQN 3SEPA 4NAMA 1K5MB 4C0HA 2Y33A 4BQXA 5HCAA 4R9CA 4D5FA 4NHXA 2K3FA 4KGQA 1RUNA 5T5OA 3HGYA 3JRGA 2QEXI 2E1CA 4YPJA 1DGWY 3LPFA 4GWNA 1YX5A 3UESA 5A1FA 5FRNA 1UHWA 2EK5A 1LQ1A 1FATA 2G4IA 2ZFUA 4YW5A 2Y6GA 1W8WA 1RJ7A 3RVHA 3DEEA 1R5GA 5EDNA 4XSXF 2KRHA 3DEMA 3AX4A 1T98A 2QVOA 1SLTA 1O91A 2VCBA 3E6CC 4PUSA 4DUXA 1I27A 5JZGB 3D0SA 4B48A 5IW0A 3DTKA 1OVSA 2ZJPF 4HEA2 2KD7A 2DQLA 4HNUA 1LUJB 1OMIA 1HV1A 3KQRA 3JZVA 1VBC3 2VT2A 2BV6A 4DXSA 3LOBA 4GWMA 4LG0A 1S72I 4JAAA 1D0GA 5J1YA 1EAH2 2EIJH 1IDZA 3V0BA 3U4SA 4AI2A 4CDUB 5FR3A 1BR1A 1BYHA 4UXNA 4AL9A 4IHSA 3AP6A 4P9YA 4C0BA 5JLWA 3OYKA 3NQOA 4AHXA 4SLIA 2RDQA 3U11A 1E3PA 2DK8A 2XLAA 4YG2F 1J59A 1YS7A 5LBEA 4YW2A 1IRFA 4LLNA 5I0DA 1Q56A 4XC9A 4PIYA 4NWVA 3BR5A 3P9KA 5FZCA 2X5IC 3O1PA 2FDHA 1G3SA 1GV9A 4CDXA 1H8VA 3AC0A 1W9YA 2D40A 4Y5TA 4EEFG 2HPMA 3THTA 2QKDA 3RWKX 2MD0A 1FTZA 5DD4A 5FFOC 1UF2C 3MIGA 2DTWA 1IJWC 1NY71 2QQ9A 2LMDA 4FOWA 3BIEA 4PGGA 1RHI1 2K9MA 3VBFB 2QQJA 1RPWA 5AIPA 3TYJA 3ZFFC 3OYNA 3I58A 2R7OA 3ISPA 2B42B 3EETA 1VLNA 2RC4A 3DTEA 3H8OA 1ULGA 1TWCJ 3VYTB 1JYIA 1WJFA 1YWKA 2WWUA 2LG4A 5DPNA 2OKXA 3FBMA 2VOTA 5FJKA 3BCWA 4EE2A 3U10A 3OOPA 1JYXA 3PIOF 1WSUA 3NKTA 2HI3A 3FBYA 1I3HA 2AEYA 2X6YA 3WW3A 1AJOA 5J36A 5ICEA 4A0XA 1VP6A 3JBG1 4QX3A 2UYBA 3SJMA 2E71A 2D3RA 1KJLA 3SZGA 1WMXA 4LMYA 2ECCA 4QPIC 3EHKA 1ZA4A 4CP9A 1PVC1 5FYYA 2PHUA 4RLQA 4BEHB 4J1WA 4JTOA 2IA1A 3TEXA 1SEUA 2EIMH 2Y6HA 4KQ7A 4LT5A 2FBHA 1PZ8A 1YO8A 1TG7A 4Q4X2 2R1DA 3L9JT 1D0HA 5G05L 2VTXA 4BXXJ 1UU6A 4UAPA 2B0LA 1XE8A 2WYFA 4W6XA 4XRFA 4LTAA 3AFHA 1QNYA 3KCYA 2QKLB 1F8VA 3TOJA 3AKRA 3O3KA 2WY7Q 2VMGA 3ZXGA 3D5SC 4A3CJ 1XE7A 4NHJA 1WBLA 2DA1A 3BR6A 4YM2A 2D45A 3WGIA 1AL22 1OD5A 3ZXDA 4OHZA 4OULA 4AFCA 3ZRGA 1H1AA 2KKOA 4XTMA 2GLOA 5DCMB 4G7OF 3RG0A 5IYCJ 4A6SA 1V9U3 4CEYA 2TEPA 4CCDA 2GC2A 2CWSA 4DQAA 2BVVA 5BNGA 1ZVFA 4AVVA 3PFYA 1ZLKA 2EIGA 4YGDA 1FOWA 3B5LB 3LEIA 4UXAA 1AR92 3DPLC 2ZJQF 1LHOA 1OCRH 2YV8A 3QAHA 4LITA 5CFCA 1FOXA 4B3AA 1IOAA 1MJ9A 4AYBN 2ZMEC 4KN7X 2A5ZA 1UY4A 4TTGA 3ZR5A 4CVUA 4U7DA 3W59A 5TJJA 2F5EA 4LBNA 4A6EA 3BGAA 4URAA 2BERA 5JWPA 1HKDA 3MVPA 4DZJA 4IHXA 3CZJA 5L9VA 5GADJ 2XPUA 2QQOA 3WHTA 1K6YA 1VAVA 3RRDA 4Y1YA 3KF3A 4LD5A 2OQRA 1XJAA 4PJJA 1XSQA 4O9GA 4BISA 2IRFG 3TEYA 1GV2A 3TDZC 2OIIA 3DYPA 1K4SA 1ND2A 1RR7A 4UHTA 4NRPA 2RVAA 2ZXWH 4CXWA 5L3DA 1B72B 2JG9B 1OCOH 5CVUA 3KZ4C 3HSFA 2ZGSA 3BOWA 3VBSC 5BV6A 5BS6A 1FMD2 2RHPA 4HK8A 5KXDA 2ZHNA 1XYOA 1TQIA 2BY3A 1DZRA 2EQRA 2M0MA 1H2LA 2W4SA 4I2OA 1R1A1 5AVPA 1U5TC 1NA1B 1A31A 4UW6A 5FIXA 2Q1MA 2H8WA 4NAOA 3VD9A 4L92A 2WN3A 1PGW2 2BGOA 3T4HB 3VSKA 1K83J 3HOZJ 4RS5B 2MSYA 3INAA 4F83A 2WB1N 3HTUA 1Z7S3 4B4CA 2CWMA 3P7NA 4FFIA 5CG8A 2HWD2 4R52A 3KVAA 1GZWB 3HOTA 2WDBA 2MPFA 2A71A 2KA3A 1VBA3 2GH8A 4XQDA 1TME2 1CZSA 3OPWA 2R073 5IT9K 1FBUA 5FPBA 1H2MA 1SPPB 3FHIB 3H9GA 4DUVA 2QYOA 5F5QA 1E5RA 1LU1A 5I93A 1YFHA 5K4LA 1JOJA 2OJED 1R64A 4XDQA 3BJ6A 4FETA 5T5PA 4IKFA 1AR63 4XLFA 3WTSC 3WQ7A 4JHTA 2OQGA 2Q2EA 2Z42A 4BACA 1H8TB 4XILA 2R7TA 2FJ1A 4Z82A 3L7WA 4YZ2A 4UV9A 3GGLA 2ORZA 5IUQA 1YXWA 4HX8A 4M3DA 4CYDA 1VFCA 2RS53 2FUG2 1T2KA 3FK7A 2VCCA 2WABA 3VDAA 3PMSA 4EM1A 2GDFA 1TW3A 1FZPB 3AP7A 2E34A 3EYIA 4PF5A 4S2FA 4AI8A 1KYZA 1BR4A 1NK2P 5KHKA 4CUCA 4YM3A 1H30A 1Y7BA 5FY8A 4FE7A 2G19A 1U3EM 4K8FA 4MLOA 1F31A 3O1SA 2XPVA 5D6EA 5F3GA 4BE2A 1KU2A 3ZSLA 3B73A 3K4KA 3T2PA 3OYWA 3NAPA 1YI2I 4CICA 1EPZA 3ZMSA 4XIOA 3N7JA 1IXSB 5FXVA 3M7AA 3HN1A 1IS6A 2EF6A 1HDPA 2VJ5A 2DT6A 3W58A 5FKNA 2Y6LA 2EIDA 2W08A 4GH4C 4K8RB 4N53B 5BOXA 3PO2J 1WVRA 5IP7J 4YVSA 4DB5A 1XYPA 3LA2A 1G9BA 2F4MB 4BU2A 1FOKA 5DUKA 1CPMA 5J4VA 3ZP5A 3ZSMA 2MC3A 2GC0A 4QKBA 5A7WB 3HBLA 2E7TA 4P9XA 1HQNA 2P8TA 4MGYE 2RDRA 1QZZA 2E5NA 3H92A 3OL3A 3K4MA 4JQRA 4YYOA 3I2KA 2IXCA 1H6XA 5D8AC 1OT5A 3CJIA 4IE0A 1OHFA 1YJ9I 2LH9A 1PNFA 3CQZJ 4XKBA 3TW6A 1R6RA 2CYFA 2DFCA 1FEXA 5K0UC 3WV6A 2GU9A 2JA7J 3WTZA 3VPRA 2YFZA 3DN7A 5F1RA 5A32B 4NN0A 5FZ0A 5FPLA 3OYCA 1HN0A 1NUKA 4K40A 2XJVA 3HZJA 2Y31A 5EIYB 3O1RA 4YFNF 3L2RA 5K7ZA 2OAZA 4HA8A 4KMUX 4D9JA 1GNHA 4W97A 3K4LA 3R6SA 1YHQI 4KMFA 3D5LA 2WWSA 2CAVA 2BWCA 3T3YA 1S7OA 2E2JJ 1LOEA 3M7GA 3R05A 1JZ7A 1O57A 4C30A 2VZ1A 1U5ZA 4U7BA 1S4CA 3JCIA 1SFNA 3GMEA 1YIFA 2MW8A 4YELA 4EWEA 1UELB 1GQGA 1IQDC 4D7TA 4UBHA 3V65A 1MMGA 2XKPA 4IX7A 1MDMA 1VQPI 4A5MA 1RUF2 2JE7A 1COV2 2X10A 3WW2A 5JCTA 5B5EC 4BHBA 2JVGA 1JU3A 3T2QA 2WQZC 1EPWA 2R16A 5I8SA 3M3IA 4Y1UA 2X05A 2Y0MA 3VBHA 5JI7A 1HQCA 4KIBA 1Z78A 2HEWF 2JKXA 4BQ2A 1MSEC 4C90A 4HYEA 4FQ4A 2ZXIA 1KEXA 3SCGA 4EV0A 4NR1A 2VGDA 2VZ3A 5HLHA 5LW9A 3GYDA 3USUB 2D3PA 2Y64A 1MJBA 5LGNA 1N3QA 2NS8A 1QEXA 5A3NA 3IKWA 1WW7A 2ZMLA 1TL8A 2VQHA 2ZZQA 4XFFA 5F0FA 4PIZA 1J3PA 4ITCA 1S0EA 1RIRA 4OMDA 3MYXA 2BW3A 4P5YA 4MXVA 4IPAA 2VB6A 4OI1A 1UG2A 5C8CB 5L3BA 2BGPA 3C2GA 2GALA 4JP0A 4AQSA 1JKQC 2P7VB 3MDPA 1TT5B 2E32A 4E6KG 2YDEA 4ZXKA 3LFUA 4NMIA 5JOZA 1UZVA 1O5LA 4LMFA 3H0GJ 1EAH1 4DOUA 3S2WA 2QQLA 1QNTA 1HRI3 5GP9A 3HT1A 3D4KA 1NT0A 1URXA 4U87A 4WM8B 2JENA 1HDDC 3FFZA 3M07A 4XN0A 4ZXEA 3ZKUA 4NC8A 4U0VA 1HQWA 4YRVA 2O6GE 2BHZA 2V09A 5D5VB 3GFMA 5FCCA 4AVAA 3PNVA 2DFBA 2M87A 1DGRM 2XUEA