2WC2A

Nmr structure of catabolite activator protein in the unliganded state
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
209
structure length
209
Chain Sequence
VLGKPQTDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYGTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Camp-Mediated Allosteric Control of the Catabolite Activator Protein.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription regulator
molecule keywords CATABOLITE GENE ACTIVATOR
total genus 38
structure length 209
sequence length 209
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2wc2A02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2wc2A01
4MGKE 5FDBA 3KLNA 2C0ZA 5A2QK 1H1IA 1R22A 1LDKB 2UXNA 2QUFA 4EQQA 2VC0A 4U0WA 3HYIA 1GXQA 1O3SA 4UXAA 2CWEA 2FMYA 4Q47A 1U78A 1VR3A 5KHHA 4EJOA 4EJUA 5CYVA 2FNPA 1P6RA 1KU2A 1TQ5A 1XE8A 1XN7A 1FNNA 4I3PA 2VT2A 2IP2A 3K9TA 4MQ9F 2D5HA 5L3EA 2PYTA 4RAZA 4LFUA 4WWCA 1CAVB 1XSXA 2X0LA 5CJ9A 1Q43A 1S29A 1XCVA 4GYGA 1XSDA 3SXYA 3LWFA 1P2FA 4M9ZA 1XRUA 3FWEA 5FGMA 5BV6A 4IEXA 2OA4A 3C18A 3BJ6A 4H7LA 3OOPA 5K8SA 3WW4A 3K0LA 3JAMK 4PGHA 2XGXA 3F6OA 3AAFA 1XMKA 1CAWA 2W84A 4MEXF 4IHSA 5JVTA 3R0AA 3V7CA 5C6CA 2OPKA 4AXOA 4R1HA 1H9GA 2IXJA 5KHIA 1R23A 2WFPA 1O7FA 2JSCA 3EYYA 5LRRA 2VOOA 4A6DA 4OIQF 1SD7A 4OOIA 1P92A 4EV0A 1KU3A 4LB5A 3HRSA 3E5QA 3WW3A 2CYYA 2IPQX 2IA0A 4Q48A 5HLHA 3QP5A 1ODDA 4KWLA 1DGRA 2ZBKA 3E3VA 3KP3A 4LGWA 1SAXA 5EZWA 4S05A 2O3FA 3DN7A 3LQQA 5E1WA 2O6GE 3R4KA 1J0RA 5ICGA 2H6BA 3WGGA 3HTUA 2BNMA 3IWFA 1O3QA 3DV8A 2OZ6A 4OMYA 5A2QZ 1CF7B 3LAGA 2ELHA 2LF7A 1DZTA 2PHLA 2RQPA 4UVBA 1MKMA 1E17A 2AS5F 2EAAA 2V6CA 3QU3A 1Z9CA 3T8TA 1DP7P 2XKPA 3SCFA 2WTEA 5BUVA 2GC2A 3H3ZA 4EGZA 2PN6A 4LEJA 5HI0A 2XROA 2DAOA 2HZTA 1HW2A 1HBXG 3FX3A 1YYVA 1FP1D 2ET7A 1ZYRF 2PMUA 4ENNA 1HSJA 2EA2A 1AWCA 2V9VA 2NAZA 4HDVA 1HXDA 3F8BA 1BN5A 1TTYA 4BAYA 5L3CA 1QNTA 1B9MA 1V70A 4O9GA 3KEQA 4IXAA 1BIBA 3RIRA 1QPMA 2MHFA 3V8LA 2VONA 4Q29A 1BOAA 2RNJA 1FBQA 5E8GA 2QWWA 1VP6A 1YLLA 1IRFA 3ZPLA 5KHKA 4XFBA 5DV5A 3CO2A 4ZU5A 5FPZA 2DK5A 2PBIA 3TGNA 5F6FA 2M5WA 3KP7A 4KU8A 3TDUC 4PDKA 3GUDA 1R00A 3ZMTA 4OLLA 3C3WA 4LK1F 2FNAA 1ZRCA 4JK1X 2UWMA 1X3UA 1STZA 3FMSA 5I8TA 5I0UA 5FD5A 3BALA 4EJTA 2QVOA 2Z69A 2XAQA 1IXCA 4I98B 2DO7A 1MJBA 3TO7A 2DCTA 4HDUA 1OPCA 3KGZA 1FBSA 4L5IA 4IRGA 4KNYA 3H9AA 4KN7X 3OTFA 4K2EA 2EK5A 4UUVA 2O61A 4GYIA 2R7DA 2XAJA 2QDRA 3WTZA 2K4BA 2M45A 1LRHA 5DD8A 5D4RA 3V8KA 4A6EA 2D45A 2PTMA 5I0SA 4P9GA 5BMZA 4IESA 4QXKA 3G7DA 3BDDA 1QXRA 3IRRA 1RUOA 5EEGA 1S7AA 1J5YA 3I59A 2HOEA 2X4HA 1CAUB 3OV8A 2PMHA 1YO5C 2B9UA 3CUQA 4L0ZB 1LEBA 3GFMA 3ECHA 3RKWA 3TNPB 4Q4ZF 2I45A 2PQQA 3O6BB 2D2WA 3Q5FA 2AXLA 1DGWA 4ENJA 1BI1A 4D0PA 2HR3A 2OBPA 1S8NA 3I59B 4LLNA 4FBFA 2A5YB 5FLIA 1XDSA 4MGIE 1I6XA 2KJBA 4J1XA 4RB1A 1FZPB 1W7PD 1R1VA 2FMLA 2KJCA 3I71A 3IDCB 1NYWA 1YS7A 1LDDA 4LG0B 2IXHA 3NJZA 3GLXA 2ISZA 3VHRA 1BI0A 3F23A 3DEUA 3RI4A 2PAEA 4HYEA 2GC0A 5BPDA 1G6NA 4Z82A 4KIBA 3CUQC 4MUVA 4AVAA 5E8IA 4GCVA 1YW8A 5K5QA 2YU3A 3VB2A 4K8FA 4IERA 5BPXA 2WWYA 4FX4A 4LLGF 3EDPA 2P6SA 3ZMDA 1T39A 4AD9A 4G6DA 1GHCA 2OD5A 3G3ZA 3C3VA 2GAUA 4ESJA 3H7YA 1TNSA 5E20A 4KFCA 1FSEA 1PUEE 2CG4A 2PEXA 4HF0A 2QCSB 1T38A 1BC7C 3O2PE 3SFZA 3WW2A 2R3SA 2ZCWA 3F21A 2O8QA 1LEAA 4M71A 3MYXA 1Z7UA 3NW4A 1UW8A 4AVCA 2XL9A 5CVVA 3IKTA 2MD5A 3FMQA 2D93A 5I0RA 4OFGA 4G6QA 4XFHA 2E9QA 4FHTA 2QQBA 2KXLA 1OR7A 2O1QA 4F8AA 4H0EA 1CX4A 3HSEA 2COMA 2ATFA 1FOKA 4AWXB 2Y0MA 2CAUA 3IL2A 3E6BA 1XCBA 2FOKA 2IT0A 1TQIA 1QQIA 1MDMA 1K78B 5I8SA 1KU7A 5LGUA 2DT5A 1BC8C 3CO6C 2EV0A 1X8EA 1EP0A 3BOQA 1W7PA 1O5LA 1VJ2A 1HSTA 1B6AA 2K9ZA 4HV6A 5BOXA 1RUNA 3JSPA 5CADA 2FRHA 2K7LA 3DKWA 1WGPA 4O5VA 3BU7A 2HKOA 3KZYA 1FI2A 4HLXA 1U5TA 3VOEA 5JCTA 4E2SA 2GA2A 2NS0A 3R61A 4RD7A 5J7MA 3V7SA 2FEZA 4META 3V7RA 1I1GA 3SCGA 4HF2A 1KA8A 3BZ6A 1B59A 3ISPA 1R7JA 4N9IA 4ESBA 5LLQA 4HA8A 2XLGA 4HX7A 3F8MA 3WW1A 3S7IA 5H6RA 1EH8A 3PQKA 4P9FA 4QGNA 3MZYA 2EJRA 1E2XA 4HSLA 1YW7A 4A0YA 3ZMZA 4QWQA 4EWDA 4EM1A 1XD7A 2GXBA 5BXXA 4FAHA 2IRFG 1UIKA 1RC6A 2V09A 3ZDSA 2UY9A 3I0TA 3QOPA 4I0BA 2QQ9A 2RDPA 4ON0A 1ZX5A 4AIKA 1C0WA 3KP2A 1Z6TA 1ZH5A 1TNTA 5F64A 2M1BA 1RNLA 4M9SA 1KQ0A 5BY5A 3MFKA 4EJVA 4EM0B 1J59A 4BNCA 4LJZF 1ZZ9A 1FYMA 2STTA 1ZZ8A 5E1XA 2WV0A 4Z07A 2GU9A 2GA1A 4JTOA 2XLFA 2VE8A 3Q9VA 2OQGA 3CL1A 2K27A 3GW2A 1SD6A 2IA1A 1CAXB 3NSTA 2DU9A 1J58A 2RV8A 4L9TA 2H27A 5DD4A 4PGGA 3KE2A 1R5GA 4NB5A 2ISYA 1ZHFA 3DL3A 2QENA 2KRFA 1CF7A 2EFWA 4WXCA 3DP7A 4XLNF 4YFNF 2HGCA 1LJ9A 2F4PA 5J8CA 3V8JA 3M7GA 5CVJA 1ZLKA 3HRMA 3BPXA 2ZXJA 3GEZA 4ORFA 4Q0VA 3LAJA 3U0ZA 5D5XB 2XLAA 5LRSA 2D1VA 1HW1A 4G9YA 3FM5A 4MGYE 4L2NA 3FE5A 2QLZA 3ULQB 3ZP5A 2DW4A 5CU1A 3SHFA 1OI6A 2L4MA 4BQAA 2VPVA 1UHMA 1LB2A 1ZREA 2VBXA 5JFRA 1TBXA 3E6CC 1FYLA 1EPZA 2Z2SB 3I53A 3REOA 2E1CA 1V4RA 2HWVA 4OIOF 2GC3A 1REPC 1R36A 5D5WB 4ENKA 1G3YA 4E2QA 4KIFA 4ESFA 3SMHA 3BCWA 3HOTA 2RC4A 4G7HF 4WXHA 1S7OA 3ELKA 4FX0A 3HT1A 2VN2A 3KP6A 1IN8A 3K1MA 4M6YA 1XGSA 3DQVC 2UXXA 3ZMUA 3I58A 4PJYA 1UPIA 4I02A 3USSA 2L4AA 1YS6A 2LKPA 4ZU4A 1QBJA 4XSZF 2DQRA 5KK1A 2PHDA 3TOAA 5J8FA 1O4TA 1OMIA 5HS9A 1TW2A 3BWGA 1MZBA 1PDNC 4O9EA 1USSA 1YFYA 4XFCA 3K2ZA 3KMHA 4AQ2A 5BPIA 3GYHX 2IXIA 3GF2A 1O5UA 4LB6B 4M73A 2BE5F 1RGSA 3LFKA 5J6XA 5ICCA 2GIVA 5JHUA 4M9XA 5KBFA 1T98A 1UFMA 4MV2A 1YWKA 1FP2A 2DTRA 2PI0A 5C8WA 1O57A 1G3TA 1LNWA 2HQRA 3OF1A 3JW4A 4QLCU 1J9IA 4GO1A 4R52A 5LEKA 1ONVA 1YFHA 5CVRA 2VE9A 1WRJA 4EWAA 2DFIA 1OYIA 3M70A 3K1NA 3KETA 1F9NA 1SMTA 3HIFA 5FLXZ 2CW0F 5I0TA 4HN0A 4Q0PA 4CICA 2KKOA 1J3PA 1JGSA 2FU4A 3FXUA 2L02A 2P7VB 1QXJA 4BHCA 3H50A 4UBGA 4JVAA 1FY7A 4CYDA 2MLGA 3MQ0A 5KHJA 3M8FA 1SMYF 1J7KA 3M1EA 1WSUA 2HJIA 2PG4A 3N97A 2FF4A 3GWZA 2EA7A 3O14A 3I7DA 2PLYA 3DXJF 3WU1B 1TW3A 4RS8A 5DCFA 4HX8A 5LBQA 3RZZA 4LUMA 1Z91A 1YUDA 4YRDA 4KWJA 2L01A 1U2WA 4IHTA 3I64A 3KP5A 4LD5A 2QBYB 4XFIA 3FZ3A 1OD5A 3CLOA 5LHGA 4LTAA 1X8MA 1MJAA 3QPHA 4PZJA 4MTDA 3IRQA 2J5PA 1YFUA 1HQCA 2A3SA 4M74A 2A07F 3SXWA 2CGPA 4OIRF 3BB6A 1L3LA 1KGSA 4IEZA 3RKYA 2MLKA 4ASNA 1NE6A 1GVJA 3B02A 3D0JA 1J3RA 1RTVA 2NYXA 2PJPA 3IDBB 3H1WA 1NZCA 4JTNA 2HQNA 4S04A 4UXNA 2V1DA 4L9VA 2E1NA 3KGLA 1K6OA 1BI2A 1K79A 4HVOA 2BNOA 1XDUA 3IBMA 3RYKA 1EH6A 2RVCA 5HDKA 1D8JA 1RZ4A 4HV5A 2BGCA 4IVNA 5HVQC 4MTEA 3RTRA 3COAC 3C7JA 3CLPA 2W57A 3ETQA 1I5ZA 5ICFA 5DCMB 4IEUA 1R1TA 4LK0F 2EFOA 2P6TA 3H1MA 4ZZLA 5E1ZB 3E5UA 1Y0UA 2XHKA 3RKXA 2JT1A 5BS6A 1K7AA 3ZQ7A 2Y0OA 2K02A 1IF1A 4UV8A 2ZFWA 4WX9A 3K69A 2VBWA 2M8EA 3JSOA 2HYFA 5AVPA 2M30A 3NQOA 1ZNPA 2FQPA 5K5OA 1ZVFA 4G94A 1Q1HA 3U11A 2A6EF 4M72A 3LWCA 3U1DA 2E7WA 5ERIA 1J3QA 1Z05A 2Q1ZB 3OD0A 3J80Z 2ZMEB 2EFPA 2ESNA 1AOYA 1J2XA 3H92A 4XBFA 1D5VA 4LA2A 5HOOA 3O3KA 1FLIA 3PFIA 1UB9A 1HKTA 2P5KA 4MZUA 1YLFA 3J7AO 3WU0A 2Z3YA 2HDCA 4HOBA 3WGHA 4GXOA 1G3SA 4P96A 5DCMA 4ZH4F 3OGJA 4MX3A 4BXUA 1XB4A 2LSOA 2VOPA 3GVAA 3WE3A 3NL1A 5JR3A 5HDNA 4Z2YA 5DYMA 1OYYA 4P9UA 1QWRA 5CVIA 4LLLA 4PIYA 1KYZA 4KUMA 1FX7A 2WC2A 4XEZA 2A6HF 2A69F 1MDMB 4HZFA 5HDGA 3E5XA 3SCHA 3MZHA 5E16A 2ETHA 5DEQA 2E7XA 2W24A 1OFNA 1JHHA 4IRHA 3F8NA 2HKXA 1PP8F 3P9CA 1KYWA 1ZZ7A 3UKNA 2JPBA 4OMZA 5D8LB 4R8HA 2L54A 4Y13A 5EEHA 4Q5SF 2UY8A 2J5OA 5FCCA 5H6QA 1ZRDA 5ICEA 2CAVA 3M8EA 4A12A 1XMAA 1PM7A 5E18F 4IJAA 3Q9SA 1CAWB 2IC1A 2LF8A 2ZKZA 2OYZA 4ZYGA 2FSWA 3T5XA 4B09A 2XV4S 4OIPF 2IXLA 3F22A 3PNAA 4FAGA 2EWNA 4R79A 2UYBA 4IEOA 4HVRA 4HVQA 2OZJA 4U7DA 4KYWA 1YQAA 2NRAC 3DPLC 3EUHA 4UBHA 3ERED 4XFFA 1IN5A 5L3GA 2P17A 1TQMA 5HLGA 4EWEA 3ELNA 5L3FA 1IW7F 3WTVC 4QM8A 4KN4X 1Q5OA 2XIGA 1KQ9A 1GXPA 4U0YA 1SQ4A 5ILSA 2O03A 1BBYA 1SD4A 2GXGA 5FPXA 1CGPA 4GGGA 2XAHA 1IXRC 3FXRA 1SEFA 3FJSA 3IKVA 3E97A 3F8FA 3KLOA 2O0YA 2DI3A 4LUKA 3MPBA 3T8RA 5F1RA 2FBIA 4PCQA 4AIJA 1U5TC 2XL7A 1XGNA 3BPZA 4E2GA 4TLFA 4ZZDA 5FLJA 5AIPA 3KZZA 3V4GA 1PP7U 1B9NA 2RN7A 3U10A 3L00A 2HTJA 4QMAA 2EFQA 3TOBA 5J3UA 2QM3A 5FLHA 1O7LA 2BBYA 3LOIA 4QM9A 1W5SA 2OZUA 1ZN2A 5JSPA 1EH7A 1DUXC 1JE8A 4U7BA 4KDPA 2XVCA 2D1HA 1MJ9A 4KU7A 5JSOA 3FFQA 3I54A 1ZRRA 2IVMA 3ZMSA 3MEXA 1J1LA 4Q0QA 4NQWA 1F4KA 5E17F 3TO9A 4WBBA 1O3TA 4I01A 5HS7A 2JRTA 2Q2EA 2Q4SA 1WQ2A 3B73A 4MGZE 2MPFA 3VEPA 2A68F 3KFWX 3M9AA 3KSCA 2F5DA 2GZWA 4IF4A 4D7TA 1PMIA 2R7FA 4ZYDA 3H7JA 4QGMA 2UZKA 1EV7A 2IW5A 2V1XA 3D5LA 4DQ2A 3TO6A 2P7CB 3P9IA 3HHGA 4UVAA 4O3MA 3LAPA 2K0GA 2DQLA 5DUIA 2C6YA 1KQ8A 4A2UA 4BYYA 1S6LA 2XKOA 5H20A 3L2HA 1R5HA 4E70A 4B8XA 1RL3A 4XF0A 3SQNA 3CEWA 1VTNC 4BHBA 5FD6A 4MH0E 2VT3A 5K1YA 3RPQA 3EETA 2MC3A 5DUKA 3EO6A 3FHIB 5HS8A 1IRGA 3EQEA 1IXSB 4JBAA 4WCGA 1LQ1A 4IEQA 4YARA 1FPQA 1FT9A 1XGOA 3ST7A 4Q0UA 4YFKF 2LDUA 1EY2A 1FBUA 1T0FA 3PVBB 3GXOA 3U9GA 4AVBA 2IJLA 3IWZA 2QNKA 1ON1A 2VBZA 5ILVA 3TQNA 1CAXA 1B1BA 3I5UA 4HN1A 5CLSA 1L0OC 3U2RA 1YIOA 4L5JA 1GQHA 1V3FA 2F5EA 2P5LC 1ZAOA 1ZZ6A 5JAXA 2DLLA 3GFLA 5FFZA 1NE4A 5CVUA 4U0VA 3RPUA 3HSRA 1G4DA 1WA4A 3GYDA 2H09A 4HQEA 2EVXA 5D5UB 2QZ8A 3H1YA 4FT8A 3GZ5A 4HBLA 4MHGA 4A0ZA 4WK8F 4X6RB 3S0MA 3S2WA 3EHKA 3QAHA 3RDIA 3RNSA 1UHWA 4KWKA 2F5FA 3FZVA 3DFGA 3WTTC 3QP6A 4RGRA 3UKTA 4U88A 4ENMA 1SFEA 4NHJA 4XF4A 4L11A 1ZG1A 1U5TB 1W7PB 2FE3A 1QZZA 1ON2A 4OINF 3HHHA 2VODA 4HX4A 1J75A 5J48A 1HW5A 1K78A 2STWA 4GULA 3KEOA 2IXCA 3HT2A 5LHIA 5FFXA 1Q3EA 2LNBA 5I91A 2CSOA 4WXDA 3EYIA 4I7HA 5JSRA 4EROA 2FXAA 2YR2A 3JAMZ 4XLPF 3H8UA 2IXKA 5IT3A 5D1IA 2CQKA 2QVSB 4ONUA 4AIHA 4O6JA 2H6CA 2N7GA 1P4XA 1IN6A 4L9NA 2K86A 4L0YB 1SFNA 4RGSA 1WLTA 3BROA 1U12A 3P7NA 3ROUA 1A04A 2IA2A 2V1UA 4DNCA 3GBFA 1JUHA 2ETEA 1FWZA 1TQPA 1YHFA 1Z1DA 2VXZA 4YNIA 4MQVA 4P5OA 3LSTA 4L18B 2XAFA 2DPDA 2V79A 4IEVA 4KL1A 6PAXA 2Z5UA 1KU9A 4HW0A 3EJKA 2EFNA 4XFAA 2DPUA 2YPRA 1W4MA 2GC1A 2F5CA 2BNNA 1G3WA 5HLIA 3WE2A 2MNGA 1HKSA 1ZGJA 2EV5A 1QY4A 3VFZA 2EB7A 3MWMA 1R58A 4KT5C 2M87A 1EYBA 4G7OF 1ZGAA 1UIJA 2YX7A 4EM2A 2W85A 1XE7A 3F6VA 5DDGA 3R0JA 3G73A 2Y48A 2JZYA 2ZNZA 2HYGD 3HRUA 4YG2F 2L3DA 3LA3A 4HLYA 3D0SA 4XSXF 1RIOH 1T6SA 1U8RA 3ZN1A 3NKTA 3F8CA 4UNOA 4YIFA 4EMSA 3TNQA 4IEPA 2VC1A 1X82A 3IIAA 1IPJA 3QACA 2PAMA 3NRVA 2KIMA 5IT9Z 1UD1A 2TDXA 4JQFA 2QYOA 4HBNA 4CO8A 2BV6A 3L2CA 3ECOA 4XETA 2MH9A 1Y3TA 3E6MA 1LR5A 3RJPA 4UHTA 4I0AA 2HEOA 4RB0A 3WODF 4HAMA 1ZARA 4L9JA 1BIAA 4CHUA 2ZNYA 5L3BA 2ET1A 1LKNA 2B5HA 4HMZA 1USTA 3I4PA 3FF5A 2P5VA 3JZVA 1R1UA 2HTSA 3TDZC 1O3RA 2HFHA 3CUQB 5FQ0B 3CDHA 1Z6RA 2MH2A 3F3XA 2PAKA 3WG9A 1CAUA 2OA2A 1FSHA 2H0VA 3ZN0A 3WTXC 2VBYA 5D5VB 1BJAA 4YYOA 2D40A 2UYAA 3J81Z 4LMYA 3SZTA 4M6XA 4IEYA 1IUYA 4LG0A 4KA4A 2OAZA 3W6JB 4QGLA 1OYWA 2G9WA 2DK8A 1YTYA 1UCXA 3HSFA 2PFWA 4AVPA 3VODA 3FMRA 1B4AA 5JR7B 5D4SA 3CF6E 3LQRA 2FA5A 4WZCA 1ZG5A 4P55A 3WTSC 5LEJA 2F2EA 4CDGA 4RB3C 3DF8A 4XRFA 1ZZBA 3WGIA 3ABUA 2HS5A 3QU6A 3JTGA 2Z99A 5JI6A 2VECA 1QO0D 1H9TA 4F7ZA 2P4WA 3BPVA 1OKRA 4MGRA 3ES4A 4UVCA 3GO5A 4QX5A 4RAYA 3J80K 3KCCA 1L3JA 3M3IA 1YG2A 3JTHA 4G7ZF 2GH2A 5FO5A 1SFXA 2FBHA 1WI9A 3FHZA 4A0XA 2NNNA 3H3UA 3WTYC 3T1BA 3P9KA 5T3NA 1XSVA 1ZZCA 3NVCA 5AIQA 3GFIA 3ABTA 4JV4A 4XF1A 4XF3A 2YX4A 1X7NA 5ILUA 4IRIA 3MDPA 4NVPA 4X6QB 3MCZA 4EVIA 1FYKA 1W5TA 1IPKA 2Z33A 4N9HA 1NXMA 2BEOA 2JTVA 3C1DA 4A5MA 3CO7C 2H94A 1ZG3A 2B0LA 4HQMA 2EV6A 3CJNA 4HSJA 3LZZA 3LA2A 1FXZA 4HLTA 1U6GA 3BJAA 3J81K 1DDNA 2ZKLA 2PA7A 4YFXF 1MD0A 4KMFA 4I2OA 4I09A 4RGXA 3R60A 2D5FA 3S7EA 1DPRA 3F72A 4HF1A 2ACJA 3BP8A 1TLHB 5K5RA 1ZRFA 4YIIA 3QPTA 4CZZA 1GQGA 2RKHA 2XAGA 3BY6A 1H1MA 2ZJ2A 3IHUA 4Y17A 4XFGA 1JHFA 5TJJA 1DZRA 4KMUX 3SZPA 1UCRA 4A5NA 4WVZA 1WKMA 4EJWA 2JPCA 5FB2A 4AQ6A 4XF9A 1LVAA 3MAJA 1P4AA 4ETSA 3DPTA 1YFXA 4CGZA 3HTSB 2ZMEA 2XRNA 2ZO4A 3TKYA 1D8KA 1Y9QA 5FLXK 3R6SA 3L7WA 2P8TA 1MGTA 4BHPA 5D6EA 2MA3A 2Z9OA 4ZU7A 4MEYF 3FM3A 1IN7A 2ADUA 4CXFA 3UKVA 3WTWC 4TV7A 2EA4A 2W25A 4B29A 3L9FA 4IEWA 2XUBA 4IPAA 4DINB 4UV9A 5I8YA 3BJOA 4Y15A 2O8XA 2FQ3A 1I1SA 3K1PA 2XASA 1IAWA 1HKQA 2Y75A 5L3DA 1ULYA 4OU0A 2GWRA 4KIGA 1SFUA 4LLOA 3KP4A 2CV6A 2ESHA 3HOSA 2OU2A 3HQXA 2FBKA 4LULA 3WTUC 4EGYA 1WWXA 5EFUA 4BIFA 4ZYHA 3PQJA 3CTAA 5LGTA 4Q0SA 3RYPA 4RGUA 1QZYA 3SHRA 1JXSA 1IZ1A 4MNUA 1ZLJA 2Q30A 4D7SA 2PQ8A 2K4JA 3RYRA 4YSFA 2YSRA 2G7HA 3CUOA 1RI7A 4ZYEA 3EQLF 1BI3A 3LA7A 1IN4A 1F5TA 3E6DA 5AONA 2PFBA 4J1WA 1S3JA 4WF2A 2BYVE 3FXQA 2MBFA 1P4WA 2QQAA 1XGMA 3HUGA 2OQRA 2Q8KA 5E1RA 4RB2C 3ML6A 4KICA 2QBYA 1F1ZA 5FQ0A 4G8XA 3N4MA 1FC3A 3NEUA 3L09A 2A61A 3IC7A 1YW9A 1NHAA 1LDJA 1D3YA 5I93A 2KIFA 5IT9K 1T2KA 3W6KB 1QGPA 3EBRA 1U3EM 5LHHA 3PLQA 1DPUA 3CJXA 5KHGA 2DBBA 1CAVA 5BQTA 3HRTA 1SD5A 2KIUA 2RGVA 3OCPA 4PIXA 2B8MA 5LGNA 2Q0OA 5KVRA 3ES1A 3ACLA 4BH9A 1I27A 2G7UA 4LA3A 2CO5A 5D6FA 2NNYA 2VQAA 5ED4A 1YFWA 4N0BA 2QJVA 1BM9A 3GFJA 3T0YA 3GX4X 3ZMVA 5TRDA 4PIZA 2GQQA 4IETA 3GZ6A 5D8KB 2Q0AA 1H0MA 2CFXA 3D82A 3QRFF
chains in the Genus database with same CATH superfamily
1DCSA 4MGKE 4PQ9A 3ON7A 1I3QJ 3GALA 4N43B 2UXNA 2VQGA 2ZXQA 1O3SA 3MKLA 2VJ4A 2CWEA 4UXAA 1VR3A 4EJOA 3NAUA 2L2OA 4XIDA 5FY4A 1CD3G 1KU2A 5M5WJ 1RUH3 3K4AA 1PIV1 3K9TA 1UZWA 2D5HA 4SLIA 2WS93 1XSXA 1AXKA 2LRPA 2OUJA 1XCVA 2OXBA 4GYGA 5D21A 2M8GX 3HWJA 3SXYA 1U5XA 1P2FA 1AYN2 3T3YA 3W59A 1OVSA 2OA4A 1RINA 2WZPP 4H7LA 5K8SA 1EUUA 4AOCA 1XU1A 4PGHA 1XMKA 3JRDA 4D6QA 3CLQA 3LF7A 5JVTA 3WNNA 5C6CA 2VZOA 3Q8AA 4JC1A 4R1HA 1H9GA 2IXJA 5KHIA 1R23A 2WFPA 3EYYA 5LRRA 3CDIA 4A6DA 4OIQF 1SD7A 3ERMA 4LB5A 4EV0A 1G59A 1QJX2 1HIXA 3N9QA 5D8AB 1SDWA 4QHZA 4MFDA 2PX9A 3K4JA 2CYYA 1ACCA 2Y2ZA 2YPDA 3DEWA 3MV11 3LSMA 4KWLA 2DT7B 3I4MJ 3KP3A 1IDZA 1QXPA 5EZWA 3JD73 2HOTA 3LQQA 3DN7A 3R4KA 3WGGA 1AJKA 4LPLA 1O3QA 4TN7A 1FOWA 3CCEI 2OZ6A 3W9AA 2VH9A 1CF7B 1P8JA 2ELHA 4MXWB 2LF7A 2C6SA 1DZTA 2W4SA 2DA3A 5IFTA 2XBO3 1G9FA 1MKMA 1E17A 1UY0A 1TMF2 1Z9CA 2VCBA 3VHNA 4AW7A 3RI9A 1YXWA 5BUVA 1OT5A 5HXMA 3C2UA 4FQZA 2GC2A 3H3ZA 3SEZA 4E8DA 5FP3A 2R7ZJ 4AL9A 2F17A 2EIKH 1ND2A 2KMUA 2EA2A 1FV2A 2NAZA 3TP0A 4HDVA 2DOAA 1UOGA 2VGDA 2DN0A 2DV9A 1RUI3 4BAYA 5L3CA 4P1WA 2RNGA 3HGYA 4DEVA 1BEV3 4RFT0 3ZXKA 3BG3A 3RIRA 2MHFA 4XDPA 1N1YA 4TWTA 1E5IA 1HRV1 1VBB3 2RDRA 2XJTA 1R081 2H1LA 4KG8A 1OSGA 2FCUA 5KHKA 4D9JA 4XFBA 3IP4B 2W46A 1FX5A 4WVMB 3TGNA 3QH6A 3U07A 2WAOA 3GUDA 4XUNA 2AR6A 2BU9A 4B7EA 5FR3A 3C3WA 4LK1F 5GZFA 4DY3A 5H9SA 1X3UA 4WM7A 2CSGA 2RDQA 4LQRA 2F4OB 4FQ4A 4EJTA 3NJXA 1JU4A 3KWVA 3HZJA 2Z69A 3JRGA 4JYKA 3CDZB 3OJBA 1MBKA 1Y8QB 2DO7A 4Y5TA 1MBHA 1OPCA 1XYPA 5ISLA 1VQ8I 3OTFA 4K2EA 2O61A 1CZTA 4GYIA 2JEMA 2ZA9A 2MC4A 4DEQA 3EYPA 5JVVA 4CDUA 4B7KA 2AH2A 4A6EA 3ZFGB 2PTMA 5LASA 2RS33 3PVNA 4GA9A 1W99A 4NRQA 2CUJA 1S0IA 4BEHA 1RUOA 2XQXA 3MIBA 5EEGA 3FXJA 3IM0A 4GB31 1NT0A 4XJZA 1J5YA 4Q5OA 4HNTA 3I59A 2HOEA 3ZLIA 2Y9YA 2PMHA 1YO5C 1ENSA 2WO2A 1WW6A 3ECHA 3AP9A 1RUF3 5BNOC 2DFBA 1X58A 2D44A 3Q5FA 1TWHJ 1WBFA 3GF6A 4BQ3A 4ENJA 2WT2A 3ZFGC 2GN3A 4D0PA 4P5YA 3ZR6A 1S8NA 2FJ1A 3I59B 2A5YB 3JUUA 4J1XA 4RB1A 1W7PD 2VBDA 4D1QA 3I71A 1S7EA 3IDCB 4Y1YA 3H5RA 2WYFA 3ZPOA 2IXHA 4LG0B 2QQMA 3ZFGA 4AGVA 1R4MB 2XONA 4Z82A 3RI8A 1YIPA 4BKXA 1K45A 2E5NA 2OPTA 5FZMA 4AEDA 4BE3A 4XDOA 4K8FA 5EWSA 5BNNA 2WR9A 3G3ZA 3KYCB 4LIUA 4KFCA 4Y5Z0 2LMDA 2VUDA 2QCSB 4D69A 3SFZA 5JUVA 5B1BH 1JMUB 1OKOA 4EN7B 4M71A 3VZMA 4AVCA 2L5QA 2XL9A 2D93A 2JSPA 4M01A 4OFGA 4YW3A 3TEXA 4Y5SA 2E9QA 2KXLA 1OR7A 4F8AA 3ABKH 3WHCA 1CX4A 2ATFA 1FOKA 2TUNA 2Y0MA 3IL2A 2O8OA 3E6BA 1GV9A 1S0CA 2LTNA 5BNPA 2TEPA 1KITA 1KU7A 3K51A 5A3LA 5LGUA 2JE7A 3WP6A 3FIWA 1WI3A 2VNRA 1HSTA 2VTXA 5FYVA 2RV9A 2EZIA 2D6LX 4YVSA 3O0VA 1VZ0A 1RUNA 1RUE3 5C8CA 2FDJA 1BOBA 2WS92 3QODA 1G8XA 1WGPA 4O5VA 1FI2A 1APLC 1U5TA 5CFDB 3T2TA 5J7MA 1DQ1A 1LULA 1GLHA 3CCQI 4HF2A 4PJNA 4KT6A 5LLQA 3NWTA 1GKBA 2R1DA 3UNPA 1YITI 5FTTC 5H6RA 3PQKA 2DCKA 2R6QA 1HF0A 4PJ0C 2AGSA 1N1SA 4A0YA 1K3IA 1XD7A 4RM3A 1OA3A 4A3GJ 1UIKA 3QOPA 4DXTA 2HZDA 4LIVA 3ALQA 2RDPA 1FATA 1UYXA 3KP2A 1ZH5A 1KJLA 2HWE3 2Y6JA 1OVPA 3I2DA 1RHI2 2YFUA 1GR3A 4AHXA 1HLVA 1R6RA 1ZZ8A 2K85A 1D2QA 3MEPA 4Z07A 4K1ZA 3ZQLA 5B1AH 1RUD1 3I2IA 3CL1A 1QJEA 4M3CB 1RVF2 2ZGTA 3GW2A 1DGRM 4LHSA 2DU9A 3A02A 1J58A 1JXNA 2AYHA 4MG2A 3CKHA 3GZUC 1X33A 4AI8A 4PGGA 4AK3A 4W65A 3VL9A 4NC7A 5E3MA 1JZ7A 3DL3A 4C30A 3S2HJ 2JE9A 3S8PA 2NQYA 4CP2A 5GZCA 5DS9A 5J8CA 3V8JA 1LENA 2WLQA 3HRMA 1OPOA 1OJLA 3OR1C 4Q4X1 4OI0A 2VMIA 2JG9B 3Q0UA 5D5XB 5L36A 5DZGA 3VBFA 2VPRA 4B3AA 1GZTA 3FHQA 2CNAA 3FE5A 5CKQA 1WH5A 3ZP5A 5LK7B 2VPVA 1FMWA 2CDPA 1ZREA 2HPMA 3HKZN 4C2MJ 1RUC3 5BNPB 5FP9A 3WDVA 1EPZA 1I39A 3AMQA 3I53A 2IGMA 3UKGA 2EIDA 4OIOF 4M3BA 1REPC 1R36A 2E2HJ 5D5WB 2E34A 2Y8KA 4KIFA 4ESFA 4M00A 3CMAI 4G7HF 3AKRA 1TNFA 4FX0A 3WY6A 4CU8A 4F52A 3MICA 2E63A 2VN2A 3R05A 3K1MA 2KDOA 4NDLA 2ARCA 2Y0SA 2UXXA 3ZMUA 3O7OA 1ULPA 3USSA 3VDDB 4UFHA 5ABJA 3AP4A 2RR13 3IIIA 1QBJA 2NVUB 3PL8A 2CWMA 5HS9A 4YIRX 1TW2A 2KLOA 1MZBA 5BNNC 4J01A 1YI2I 5F3GA 4AQ2A 1VLNA 3D6EA 4DY5A 5K0UB 1W8NA 1O5UA 4C3IJ 2E1MB 1IKQA 2BE5F 1PHMA 1PO13 3MW2A 5EYYA 3BPSA 5J6XA 2VMFA 4ZXKA 5JHUA 4M9XA 3WF2A 5KBFA 1T98A 1X3WB 4LBKA 5C8WA 1G3TA 1LNWA 4RL7A 1J9IA 3TW7A 5LEKA 4Y1VA 1UF2C 5FK7A 1YFHA 4NE9A 2E35A 4NROA 4EWAA 5L7OB 3K70D 2DFIA 1W2NA 2VM9A 4XABA 2QQKA 1TEIA 3HIFA 2YUEA 3VYUB 5FREA 2OC6A 4Q0PA 4QQOA 4LORA 1ZR4A 5A33B 1QXJA 4BHCA 4CYDA 4FPKA 1UMQA 1SMYF 2GLOA 1J7KA 4IGQA 3TEYA 1QHGA 1TWAJ 3OIOA 2X1CA 3N97A 3ZFFB 1JN2P 4GAZA 3GWZA 1NUKA 4RS8A 5T50A 1QDOA 2YUSA 1EAH2 1U2WA 2WY8Q 1QDCA 1YC61 3PUAA 2XPUA 2WZR1 3FZ3A 4Z2WA 5FP8A 4NAMA 4ZDLA 3CLOA 4CTEA 4FPGA 3QPHA 4FP2A 3ZXDA 2D5VA 1HB1A 5ACA3 2J5PA 4M74A 5A7NA 2CGPA 3OPTA 5HCBA 3M8JA 3I49A 1K6YA 4IEZA 3RKYA 1GVJA 1J3RA 3IN9A 1NZCA 1H2KA 2XQRA 2HQNA 1MH4A 4IGOA 5IK5A 1X4OA 3KGLA 3AYCA 1VBB2 5C44J 2XUMA 4AQSA 1RYYA 4AYBA 2M4KA 1SMVA 1ETXA 4X0GA 3KHCA 3OL3A 4MTEA 2MW8A 3ZYGA 4E7HA 2W57A 3TWIA 3ETQA 4BUPA 1I5ZA 5DCMB 3PUQA 4IEUA 4LK0F 4BMBA 5GPCA 1URXA 1GLNA 5E1ZB 1Y0UA 1RUC1 3BG5A 4XQWA 3G6EI 2JT1A 5JOWA 2DCZA 1K7AA 2FZ2A 3ZYPA 2EIGA 4UV8A 1NCRB 3K69A 3CHXA 4LOTA 1S0FA 3H9GA 1Q8VA 3WD5A 1ETVA 1W0OA 3QYFA 4Q4Y2 5FXZA 5K5OA 1R71A 1ZVFA 2J1RA 4E6KG 4G94A 4N7UA 4A3FJ 1Q1HA 1JUPA 1Z05A 4GQ7A 3BKZA 2DMTA 2ESNA 4XKVA 2OTLI 1U5ZA 4GMP1 3C7GA 1QJY3 3H92A 3O3KA 3BR3A 1HKTA 3ZRGA 3J7AO 3WU0A 2RS32 2VW0A 2ENRA 2IZWA 1V6LA 3OGJA 2E7TA 4ZH4F 1GP6A 1D1CA 4BXUA 1X50A 2X48A 5JR3A 5HDNA 4DXZA 2DCJA 2RJKA 1QJU3 4IE7A 3BVCA 1VRH3 4LLLA 4KUMA 1FX7A 2Y6HA 1D4M1 2P3KA 2WC2A 5FROA 2DYCA 3KZIC 2EZKA 4B44A 4A3CJ 4H2AA 1MMSA 3MZHA 5E16A 2QA4I 2W24A 2ARBA 3NKGA 2D6OX 4IRHA 2HWC1 5EQUA 3BTIA 3F8NA 4QX8A 1PP8F 4MYEA 3UKNA 4OMZA 1SANA 3ZCOA 2F4MB 4Y13A 4Q5SF 5FCCA 2XG3A 3W21A 3M8EA 4A12A 1TG7A 1EV13 1XMAA 3Q9SA 1CAWB 1Y43B 2LF8A 4O7XA 3BR1A 1O4YA 2ZKZA 2OQ7A 5FPUA 1C8M2 2QSHX 4FOVA 4COZA 2JB4A 3PNAA 2DMUA 4CCLA 2XB0X 2UYBA 4HVQA 4U7DA 2WAFA 4AGGA 2MEV1 4UBHA 1Y1VJ 4JX6A 1IN5A 4QDRA 2JDKA 1TQMA 5HPOA 3ELNA 4CDQA 1IW7F 5L7OA 2QQOA 3CCRI 2VNVA 4LLFA 3K4DA 2Y30A 4OWRB 1GXPA 3NWKA 1FEXA 5ILSA 1BBYA 3GLLA 4LNVA 3N9LA 4B47A 2FMDA 4MGQA 4N43A 4GGGA 4LHLA 4CCDA 3FXRA 1SEFA 2YZ4A 2B7EA 5EGOB 1HRI2 3P6BA 2MYSA 1PVC3 1JKQC 1IRZA 2W5FA 3GTOJ 4XQDA 3BPZA 4E2GA 3IUOA 1PK6B 1W03A 3V4GA 2J1TA 1PP7U 5C3SA 4BLIA 5T5JA 2IUWA 3TW6A 3U10A 5AFBA 3L00A 3TOBA 4OQ9A 1FOD2 2P3JA 4PLMA 2CMPA 3WOGA 1ZN2A 1RUH2 2D98A 2EINH 3BIEA 3FLRA 3BLYA 3K4LA 1QOTA 2WSVA 1R9TJ 2HBTA 3ZR8X 4KU7A 3H5AA 2G9FA 5JSOA 2BP6A 3C7EA 1JYWA 1BKZA 3I54A 1ZRRA 2IVMA 4I3GA 3LSRA 3MEXA 1J1LA 1PGSA 4XRMA 4Q0QA 1R49A 5E17F 4I01A 2W00A 3FDYA 2EIBA 5C4JJ 2MPFA 3VEPA 2E5ZA 1HN0A 4ZDPA 3KSCA 3KM5A 2GZWA 2R7FA 4ZYDA 1YE9A 3BQYA 4QGMA 4DQ2A 1GOGA 3O1VA 1W8TA 4O3MA 4XURA 3LAPA 4B4QA 3VSLA 1G9CA 2K0GA 2JDNA 2QQLA 4I6ZA 4UB8C 1DQ6A 1D7PM 1BMV2 2VTXJ 4H14A 1NCQA 4PLNA 1S6LA 2PHWA 3B3QE 3ZM8A 4BQ2A 2ME6A 4E70A 3JD72 5GP9A 3OY9A 3HG9A 1DF0A 2AXTC 1VTNC 3U4SA 3H8XA 4UW5A 4NWWA 3KPHA 3RPQA 3L2UA 2MC3A 3HNMA 5DUKA 3EO6A 3MFAA 3W2VA 1YRNA 1X9TA 3EQEA 1IXSB 4JBAA 4WCGA 4IEQA 3U78A 2XUEA 3RWNA 3WNXA 4Q27A 1VBC2 1WUVA 2OCCH 4OHYA 1XGOA 4Q0UA 3WDXA 2LDUA 1EY2A 3VBRC 3GXOA 2RS51 4AVBA 1SBEA 1CPMA 5C33A 1MEC1 2WNEA 3WX5A 1OXCA 1ODMA 1CAXA 2LVSA 3K4KA 1B1BA 1VBD3 2DU0A 5CLSA 1SFYA 5DAWA 4XJWA 1JZ6A 1L0OC 1GQHA 1GOFA 1BR2A 1AL22 3J7LA 1W2UA 3A0KA 4P9WA 5FYUA 4XLEA 2HYKA 4J25A 3SNMA 3IAM2 2XSDC 4URTA 1AR92 3M2MA 3RS6A 1QHHD 3WNKA 4A4AA 3HOBA 4BY1J 2E71A 3AKTA 2WNUA 5KR7A 2DMQA 1RUG1 2YXSA 2H09A 3LPGA 2CDOA 4OHXA 1HKDA 1XBFA 5IHRA 3GZ5A 1GP5A 3LSJA 4MHGA 3NV3A 2GBYA 4WK8F 3T0AA 3CMYA 3S5AA 3PM1A 3R4UA 5CFCB 4QPIA 1E57A 3QAHA 4KWKA 3IKWA 5CEHA 3BTAA 2Q1MA 3UKTA 1TL8A 4U88A 1SFEA 4NHJA 2XHNA 3LQCA 2EF6A 1UG0A 3JR9A 2W47A 5FKOA 2HXIA 3H8RA 1ON2A 4X6AJ 3W6VA 4JX4A 1HW5A 1K78A 2STWA 2ZOEB 2ZGLA 2OTJI 2LLKA 5FFXA 1XYOA 2AEZA 2UURA 3O1MA 2QZ2A 2VUJA 2CSOA 2XBO2 2IS1A 1OQEA 2KR2A 2YR2A 3JAMZ 4HG2A 2R071 2CQKA 4CEYA 5F32A 2QVSB 2Q2EB 1OFCX 1UWWA 4O6JA 2DJIA 3GCWA 1A8MA 5LY1A 3O1SA 2K86A 1SFNA 2PHTA 1U5YA 1REDA 5C4XJ 1PO11 1TWCJ 1WGXA 3ZQCA 2IS2A 3LNQA 1WCMJ 4L8QA 3KV5A 4DNCA 2ZHLA 2SBAA 1FWZA 3BCAA 3HJRA 1Z1DA 4NUBA 1EKEA 1W6QB 4L18B 2DPDA 1O4ZA 4RLQA 2YU1A 4D6SA 4IEVA 2BVVA 6PAXA 2Z5UA 1XPXA 4HW0A 2EFNA 3L2RA 3MMYB 3PMEA 1OOPA 1F5FA 2WT1A 4N53A 3DKXA 1HKSA 4PJMA 1NH3A 1VE0A 3VFZA 3DCFA 2BFUL 4XBLA 2EB7A 1B72A 1JBCA 1R58A 4KT5C 4G7OF 5H2FC 2UWAA 1GBGA 2W85A 2VJXA 3F6VA 5A6YA 1WW7A 2IBDA 1XSRA 2Y6FA 2L3DA 2JG8A 4NC8A 2R92J 4XSXF 3MLKA 3N9PA 5C4WB 2RREA 1U8RA 4LXLA 1VRBA 1E5HA 4UNOA 1X3ZB 1X1CA 4Q1RA 2ZX4A 4A44A 3TNQA 3ACGA 1TME3 3Q9OA 2X1EA 4DFSA 1OCRH 1BW5A 4FETA 3QACA 2HWC3 3NRVA 2W2IA 2TDXA 2QYOA 4FOYA 3L2CA 4QPYA 4FCYA 3S6PA 1Y3TA 3E6MA 3VBFC 1AX1A 3LEIA 3WODF 3NAPA 2ZNYA 4QPGA 4YVWC 3WXPA 1JHNA 3I4PA 1JGGA 3JZVA 2DYRH 2Z1DA 2HTSA 1CQ9A 5TSWA 1O3RA 3NV4A 5FQ0B 3CDHA 3J4UH 3WG9A 3HOYJ 4AEKA 1CAUA 5F08A 2AQFA 2JDPA 3ZN0A 2CWSA 4PT6A 5HXVA 1ULCA 4B1LA 4L97A 4YYOA 2UYAA 1HRI3 4M6XA 4IEYA 5JZGA 3QYBA 3M1HA 5B4NA 4KA4A 4AI3A 1UCXA 2R7EB 1W8UA 3V0BA 4IE5A 2PFWA 1GANA 4CDWA 1A36A 3AP5A 3CF6E 3DXTA 4WZCA 2NM1A 1KRIA 1S72I 2JWTA 1OISA 4CA9A 1JYVA 5EJCA 2LD5A 1NKGA 1I5PA 3OUJA 4AZZA 3JTGA 1XX5A 4M3FA 1H9TA 2M9HA 1UY2A 3QWLA 4YW4A 4B4CA 3BPVA 1CZSA 1OKRA 2R0FA 3DBHB 1DG6A 2WO1A 4AHZA 4FFGA 4QX5A 4Y1ZA 4RAYA 3KCCA 4CP9A 2GH2A 5FO5A 1VMFA 1WI9A 4RA2A 1Q8OA 1DBNA 4BQXA 5DUXA 3ZQIA 1RUG3 1A35A 2O8KA 3T1BA 3K4NA 3P9KA 3NVCA 5AIQA 2R7RA 3H3VK 1QJU2 3ABTA 3OPZA 1PGW2 2YBSA 4II2A 2WB1N 2YX4A 4F3JA 1X7NA 5ILUA 4IL7A 1OLRA 1S0DA 1ETYA 3MKZA 4EVIA 4FFFA 1FYKA 1W5TA 1APNA 4QSHA 4HKLA 2BOIA 4AU7A 4G9SB 5FMCA 4CXWA 2JUGA 5FYBA 4HQMA 3BZCA 3KHBA 3NRUA 3LZZA 5KC6A 3POSA 3O8GA 3J81K 5F5CA 2BBAA 1WPKA 5APAA 2ZKLA 2AC1A 1HQWA 3I4IA 4I99C 1KDMA 3S7EA 2W87A 3TN91 1TLHB 1ZRFA 4CZZA 5LZ6A 1XS9A 2A70A 3BY6A 1JZ5A 1OR7C 4JQRA 5FZ9A 4AYBN 1KD7A 4KMUX 3SZPA 4A5NA 1MIJA 1UYPA 4WVZA 1YQCA 2NVQJ 2JPCA 2K9LA 1X1PA 2ZEWA 3H0GJ 4A93J 4E7LA 5FRNA 2ZMEA 3A0HC 3TKYA 1Y9QA 5FLXK 1VAMA 3R6SA 1MGTA 4BHPA 2MA3A 4MEYF 3KYLA 3UKVA 4N4NB 3V0AB 1AR93 3VBSC 4IV3C 4B29A 3VBHB 4GH4C 4HPKB 4IEWA 2IFRA 4QB2A 3VZJA 2A5ZA 4UV9A 5I8YA 4GRIA 1X1DA 3SH3A 4Y15A 2LUWA 4P14A 3ZOBA 1ULYA 4XLAA 2W95A 3SEQA 2YROA 3KEYA 1VQKI 1SFUA 2W7NA 3B94A 5M5XJ 1SG3A 1VBC1 4A3BJ 2JDYA 4NRPA 4LKEA 2OU2A 3GJAA 3I3EA 4P9XA 1UOBA 5LGTA 4RGGA 4ANJA 5GTIC 2DFEA 1QZYA 4JDNA 4GH4B 2ZABA 2XGDA 4NR1A 1GICA 2VASA 4JDMA 4YSFA 4XKCA 3T0BA 4YFWA 1Y0NA 1H8AC 3S30A 2V4AA 3DF0A 1K5JA 1HB3A 2VQHA 1K61A 3WUCA 5JXIA 5FOJB 1HDDC 4ATFA 1XGMA 3HUGA 3S3MA 2ARXA 2ZXIA 3WG2A 4UOJA 1RVF1 3NEUA 1QJFA 5K7PA 3L09A 2FD5A 2Y38A 1NHAA 1D0ZA 1T2KA 4TYSA 3UGFA 2HEYF 3EBRA 4FPYA 4EYUA 2QTWB 3PLQA 5DG2A 1LUJB 3THTA 3CJXA 2DBBA 3CF2A 5LA1A 2CYFA 5J4VA 4ZJZA 5BQTA 3HRTA 1SPPB 3OOXA 4YZ2A 1GU3A 2RGVA 1W2TA 2Q0OA 1TC3C 3BOWA 4A45A 5KVRA 2XR4A 2K5CA 3VLBB 1WW5A 5CB7A 2GNTA 1EA3A 4ARXA 4BB3A 4XW3A 4BDVB 1HJFA 5D6FA 1EV11 1BM9A 3GFJA 4B48A 5FO8B 3HAGA 1DLCA 3WZ1A 5D8KB 2BGOA 2VJIA 4OULA 1UKGA 2CFXA 3D82A 4AVTA 2BVMA 4P9LA 3KLNA 3SISA 3VSKA 3TN93 3LSIA 2BOJA 1OLMA 1R22A 3JBG2 1Q56A 9ANTA 3O1RA 3QD6A 1VQLI 2ZGMA 2VC0A 3DPRA 2M2EA 2E36A 2KISA 3OYWA 2LR8A 4C0BA 2DFFA 5CYVA 2W68A 1P6RA 2R062 4E7ZA 2V5YA 5L3EA 4JGYB 4RGAA 4PFPA 3BGAA 2YU9J 2RR12 1CAVB 1V00A 2X0LA 4G6TB 2CQ7A 3D5SC 3M07A 3OD4A 3FWEA 5FGMA 2L9RA 1N78A 4IEXA 2QE3A 3C18A 2O5RA 3CQZJ 3BJ6A 1NK2P 1S2BA 4KH9A 3AAFA 3CJIB 4AEMA 4MEXF 1VBE3 4Y20A 2X10A 2VQCA 3EUHC 4BY7J 1RPWA 2XVGA 3RZMA 2VOOA 2KD7A 3GXUA 4M3CF 4OOIA 1P92A 5L9VA 2YY1A 1B35B 4NRMA 3RZJA 5FUIA 2QQNA 1MMGA 5HLHA 3QP5A 4R9AA 1ODDA 1YRZA 2HYJA 1YJKA 3LSDA 2ZBKA 4F92B 3PJRA 1SAXA 3B6AA 4XCAA 2B45X 4S05A 3BR0A 3CJIC 2BWCA 2BNMA 2ZX0A 3HTUA 2EXKA 3UV9A 3DV8A 3POGA 4S2DA 1JZ3A 3LAGA 2W1UA 4CDXC 2IWGB 2B42B 2BXZA 2AS5F 2JUCA 1NK3P 3QU3A 1LHOA 1JZ4A 2BY0A 3ECQA 2WTEA 2Y34A 1XYNA 2DA4A 1X4PA 3VBOC 1EJ9A 1HW2A 4ABZA 1MS9A 2FDHA 2ET7A 3S16J 2V9VA 2JA8J 1AX2A 5F7UA 3GTGJ 1QNTA 4CDXB 3KEQA 1BIBA 2VVDA 1T0FC 2QFEA 3V8LA 1N3PA 3J8F2 4A6SA 1BOAA 1FBQA 2LBFA 5E8GA 1REEA 1VP6A 1YLLA 4QHOA 1IRFA 2HDWA 3ZPLA 1IKPA 3U1XA 1JYTA 3H9QA 1LHUA 3RCOA 4X8PA 1WD4A 1LECA 5FPZA 4E7IA 2PBIA 2VL4A 3A4UA 1AR63 3T2QA 3LSPA 1GVDA 3OGSA 4KU8A 1SLAA 4RQPB 4OLLA 5TGTA 1UNBA 3W5MA 2I2SA 3DEEA 3FKIJ 3ZO0B 2KM2A 4JK1X 3M4OJ 1Z67A 1RKTA 3ZMNA 2J1UA 2OIIA 1PMJX 1ND3A 5I0UA 4A42A 3AVRA 5FD5A 5IK8A 2QVOA 2V4JC 2XAQA 1MJBA 3TO7A 2DCTA 4HDUA 3H9AA 4IRGA 2LOOA 3VDDC 3S32A 4F3QA 2WWSA 2J1VA 2EK5A 4OZOA 2I5UA 2OCEA 2PJRA 4PDWB 2XVLA 1PO12 2QDRA 1VFCA 4UW6A 4A41A 2K4BA 2M45A 4BXXJ 1QRYA 2TNFA 3R4SA 3AXDA 5D4RA 2QQWA 5J1YA 3HBKA 3NJVA 3V8KA 4XKWA 5FIXA 4QX0A 5DUUA 5BMZA 4QXKA 3G7DA 3ZSKA 3OYBA 3GCMA 3I3DA 3IRRA 4CEWA 1S7AA 2EIJH 2XDVA 3J7MA 4JKLA 3OV8A 2AZ5A 3GFMA 4Q2FA 5L7OC 1DYPA 2PQQA 2VBBA 4AEJA 2BGPA 4CP1A 2HU9A 2D2WA 1POGA 2AXLA 1DGWA 5B2GB 2TCTA 3K77A 1CR7A 1UU5A 2HVSA 1UN1A 3RRDA 4NJ4A 3DTKA 1BI1A 1AF9A 1Q8PA 1YJWI 2HOSA 4JAAA 4CCOA 4LLNA 1ZR2A 4FBFA 3TOJA 1XDSA 1FZPB 1IOAA 1H9WA 1OA2A 4OHVA 1R1VA 2FMLA 2ARAA 1PVXA 1E3OC 2GNBA 3N3HA 4BXFA 3NJZA 3VHRA 1BI0A 2R5ZB 5F9TA 5DTDA 1G6NA 1JJ8C 1S55A 4KIBA 2BW8A 4MUVA 4AVAA 3VDBA 4GCVA 4JOMA 5K5QA 3ZQFA 1HB4A 3VB2A 3AKSA 1TME2 3A22A 3CZUA 1QIQA 4HL0A 3HMYA 5C3RA 4IERA 2HWF3 3AFGA 3J7NA 1UY1A 3EDPA 2XGCA 1T39A 2K2SA 2RS11 4G6DA 1GHCA 2OD5A 1TZLA 4E7KA 4C1XA 2OS2A 5E20A 1FTZA 3VZKA 4XUTA 4ZY9A 1W2AX 2VD7A 4P02B 1BC7C 1IS5A 1GUIA 3WW2A 1YQ2A 1GWLA 3GGLA 3F21A 2LY1A 4ZHNA 1LEAA 3NW4A 5CVVA 3IKTA 2MD5A 2BJSA 5I0RA 4RYDA 3SEPA 4XVHA 5A1FA 3ABMH 4ATEA 4G6QA 2QQBA 4HNVA 4H0EA 4A3IJ 2VL8A 3HSEA 4HANA 3WG7H 4AWXB 3A1YA 1AR61 1SBDA 2CAUA 2V9PA 4Q4V3 3POBA 2K40A 1XCBA 4LBQD 1W04A 2FOKA 3WLUA 1SVMA 3UGGA 3KT7A 4UT5A 1IC8A 4XCBA 5CISA 2DT5A 1JTYA 4KNCA 3CCMI 2EV0A 1VJ2A 2Y6KA 2VXDA 4CUAA 2K9ZA 1FOD3 3HXLA 1QNWA 4AFCA 5CADA 5DDJ2 2FRHA 3DKWA 2DDUA 1QZEA 4LITA 2JWPA 1V6KA 3KZYA 3V65A 3VOEA 3OYNA 4BE0A 1CJDA 4E2SA 2MSYA 4AHYA 3V7SA 4META 2VUCA 4LKFA 1WJAA 1KA8A 3PSIA 1Y9MA 3B9CA 3BZ6A 1R7JA 4N9IA 2W9XA 3DU6A 3MVPA 1UHSA 1ENQA 4QXCA 1PGL1 3WW1A 1M1EB 1W05A 4QGNA 4YM2A 1UOFA 3LIGA 1OCOH 4YGEA 4HOOA 5BXXA 2V09A 2UY9A 3AVSA 1DU6A 5HV4A 3WEZA 1N3OA 4Q4Y1 3VBUB 1ZX5A 3HD8B 2W92A 1C0WA 3VBSB 1ETKA 3MFKA 1W0NA 2YBPA 5EYRA 4EM0B 1FJLA 1J59A 1MZEA 2PHFA 1MNMC 3QBQA 3ABZA 5E1XA 3DYPA 3UK9A 3QPSA 2DVBA 2GU9A 3WNPA 3J9SA 2EQRA 2ZS6B 4BJ6C 1FMVA 1UMZA 1Y7BA 3SLIA 5GJ6A 2OQGA 3A23A 3OS0A 1QJU1 3CDLA 3Q8CA 1WWYA 5J47A 2RV8A 2YDEA 2JIGA 3OUHA 1POV0 2QSFX 2N8GA 1VMJA 4RGKA 2R073 4NB5A 3RSNA 2ISYA 3OEBA 2QGUA 2QENA 4XMIA 2BRTA 3RZDJ 3HL2A 2EFWA 2D6MA 5GZEA 1EUTA 4XNFA 5FXWA 1NAEA 2F4PA 5EV7A 1F43A 4UB6C 5CVJA 1PZ8A 5EEAA 2VQUA 4I76A 4RQPC 4YM0A 3BPXA 2ZXJA 3LAJA 4NMIA 3U0ZA 1LJ7A 3ILNA 2XLAA 5LRSA 1DQUA 4MGYE 2HXOA 2V72A 1LU2A 1B09A 2DW4A 5CU1A 5FZKA 1OI6A 1GFF2 2L4MA 3ZOIA 4MIMA 2HBUA 5JFRA 5DAXA 2O0OA 3PO2J 3D4KA 1A8DA 2L7MP 3REOA 1M4WA 1GV5A 1STMA 3KCXA 2E1CA 2GC3A 2HWVA 3ZN6B 4RR3C 2ZPXA 4DW6A 4BLJA 1GP4A 4E2QA 4BIOA 1JZ2A 4UF0B 3BCWA 2WAQN 1DGWX 1TNRA 2FX0A 2PMZN 3DWLE 3BODA 1AR71 1LEDA 1IN8A 2QQPA 4M6YA 3DQVC 1UPIA 2FBEA 2VIXA 1SFKA 1MBFA 2Y69H 3OL4A 1JKPC 2JJ7A 3V42A 4C0HA 4BPZA 1TP4A 2ZTNA 3VPRA 1O4TA 4OI1A 1PDNC 5IVFA 1USSA 2WAQA 3K2ZA 3KMHA 1RVF3 5BPIA 2ORXA 3GYHX 2IXIA 4PBOA 2ZC2A 1IV8A 5DZEA 3TMOA 3BCBA 2RAEA 5J40A 5ICCA 5FZAA 2VG9A 5FYZA 4AC0A 3HOXJ 1YWKA 2JVGA 3OF1A 4NIGA 4QLCU 5FUNA 4GO1A 1LKXA 1MBGA 2XBO1 4BE2A 1ONVA 5CVRA 2BW3B 1OYIA 4FOQA 3U1KA 1W6MB 5DN2A 4YGCA 1F9NA 1SMTA 2HLEA 1V9U2 5FK8A 1Z0XA 1RMU3 4HN0A 2KKOA 5B66C 4OI2A 1VRH2 3FXUA 2IXSA 1KS5A 1FY7A 1ENXA 4AFBA 2IVIB 2MLGA 2GMPA 1MBJA 2ZGRA 3QQAA 2CFOA 3M1EA 4YZ3A 2HJIA 1SAUA 1QQP3 2YHJA 2PG4A 3N9MA 1BYHA 1UZZA 3O14A 5C5TA 3I7DA 1C5IA 3CP8A 1G86A 5LBQA 3RZZA 5ANNA 3PU3A 1H2LA 3CQOA 3QOEA 4IV1C 2L01A 2VOXA 3KP5A 2QBYB 4K7JA 1REFA 4HT1T 2VY0A 3K3NA 1F35A 1MJAA 2AACA 1D0HA 5IATA 1K83J 4PZJA 5FYMA 3MHZA 2HH9A 2IAIA 1LHWA 1HQCA 2A3SA 1JYXA 4CVUA 4DNYA 2RJLA 1RTVA 2PJPA 3H1WA 4UXNA 3POJA 1JODA 5E3NA 4L9VA 3AZVA 5C9AB 5DPNA 5FV3A 1Q8QA 2BHYA 2A6ZA 1K79A 4GWIA 1VALA 3QCWA 4HVOA 2BNOA 1XDUA 4IE6A 1WCQA 4GH4A 4LHKA 2RVCA 2VU9A 3CMMA 1D8JA 3I2OA 1HDPA 4IVNA 5HVQC 1YYNA 3CLPA 4CYCA 4K9SA 4IV3B 2JD9A 4ZZLA 2XF5A 3RKXA 5FKCA 2QEXI 3JREA 5FP7A 1XU2A 3AG1H 4UFMA 4D8MA 4WX9A 2ZFWA 3T2OA 4AHWA 1XG1A 2KL4A 3PNYA 2M8EA 4W4ZA 2JA7J 3P3PA 3FMGA 3VBUA 2HYFA 1K12A 5AVPA 5F1JA 5A1LA 2WNVA 3S3OA 4IHWA 4V2FA 2LRDA 2NP0A 3U11A 2Z79A 3LWCA 5ERIA 5HCAA 5IAVA 5IAXA 3BC8A 1H4GA 1WZ2A 3I2FA 2EFPA 2NS7A 2EIMH 4XBFA 3GTKJ 3FBNB 1PMHX 2VQLA 4KI5M 4FPJA 2O7OA 1ZKGA 2HDCA 4HOBA 4CP0A 2VMGA 4XMYA 3WGHA 4GXOA 4MX3A 1PVC2 1RUG2 2VB6A 3BTLA 2LSOA 2VOPA 4QHBA 3FN9A 3LFMA 4GDFA 3MW4A 4P9UA 4IZZA 3AJYA 1S0JA 1C5HA 1G2HA 1K4SA 5DUVA 3VBOA 1J83A 5GLUA 3LIHA 4H3WA 3POWA 2A69F 3E5XA 3SCHA 5F8PA 3OBTA 2ETHA 1BBT3 2CS3A 3S2DJ 3WV6A 5C9AA 2VW1A 1JHHA 4QAWA 5IVBA 1POV1 3DKQA 1ZZ7A 3N05A 2JPBA 5FY0A 3DGTA 1LTEA 4YW1A 5FZEA 2BV4A 5EEHA 2UY8A 5H6QA 1UOJA 1ZRDA 2AO9A 1NA1A 4WM8B 3A01A 2WAAA 4XMAA 2B46X 3VUOA 3L2VA 4IJAA 2DFCA 1VBA1 4SBVA 2GM4A 3E1SA 2HWC2 4XRSA 4OIPF 3LOCA 1RITA 2FHRA 3PNTA 2EWNA 1DYKA 2E31A 2HWF2 5F3CA 5FZ3A 2R063 1YQAA 2HWB1 2XPVA 3DPLC 3EUHA 3PIOF 3OG2A 1ULDA 2Y31A 3WDUA 3PUFA 4BISA 2VUAA 5L3FA 4X1EA 1H8TA 1AL21 2GIZA 1FPN2 4QM8A 4KN4X 1Q5OA 2PLV2 4U0YA 1GNYA 4YG3A 3VN4A 4KISA 4QX2A 3NARA 1PX3A 4JGYC 1CGPA 4RA0A 5FPXA 4BJTA 3ZFEC 3RQIA 4NPMA 3FJSA 2E1MC 2X6YA 3IKVA 3E97A 3F8FA 2O0YA 5F0HA 2JK3A 1HDKA 4PCQA 4AIJA 3WDWA 1XGNA 2DOFA 1HX6A 2CV1A 4A6OA 5FLJA 1ETOA 5C3PA 1ZBA1 4C8DA 3JRFA 1RUF2 4Z92B 4QMAA 2RM21 3L2YA 3SKVA 2CW8A 1F9KA 3LFIA 5FLHA 2BBYA 1LOAA 3LOIA 1GDTA 2D97A 1W5SA 5DM6F 1O59A 5FO7B 2XF6A 3WQ7A 3Q8BA 3C2GA 5LFAA 1IGOA 1JE8A 5J98B 3MUZ1 2JQ7A 1WHUA 2XVCA 5M3FJ 3ZMSA 4HRIA 4QU1A 4YW2A 3J7AY 3CF5F 3INAA 3TO9A 4AWDA 3ZVXA 3WNLA 4UF0A 2JRTA 3GZAA 5F3IA 3MUY1 4XUPA 4MGZE 3DBRB 3EB7A 3M9AA 2F5DA 1PMIA 2L7ZA 3VYSB 3QH7A 2OVUA 5FZHA 5IP7J 2NS8A 4XM3A 2WL1A 5CQEA 2V26A 2HEWF 5FUPA 1DDLA 4BBRJ 3IV5A 1MW7A 2F4LA 3DLAA 2WQ8A 3RGBA 3L2HA 5H20A 1R5HA 4B8XA 1CZVA 3CEWA 2ECBA 4BHBA 5FD6A 3PTYA 2VT3A 1HXS2 4RN5A 1S0BA 5IOZA 3FHIB 4LHNA 2FD8A 1PO21 2L9VA 5A6QA 3G1MA 4IQJA 3FUOA 4E9KA 4YARA 1AR82 1FPQA 2NN8A 1FT9A 3ST7A 2RDSA 2P0WA 3LSGA 2VKVA 3U9GA 3PURA 2KFDA 1QPIA 3VBUC 2QNKA 2VBZA 1W39A 2D3SA 3PIJA 4EN9B 3I5UA 1WLWA 4WM8C 4DB5A 3MKWB 4LJHA 3HPHA 4CDXA 2Q5TA 2JDMA 1ACIA 2F5EA 2DVDA 2Y9ZA 3FXOA 4JDOA 3BZKA 2WV1A 5LY2A 2W82A 1UL9A 5J1RA 1NE4A 5DAQA 3RPUA 4DRVA 5FLVA 1G4DA 5F27A 5D5UB 1Z7S3 3OY8B 2QZ8A 1KZHA 2ID6A 1R091 1KXGA 4X6RB 4IEJA 3RVHA 4MVTA 3S0MA 3JRHA 2CU5A 3FUQA 2QF7A 2EAKA 3CBNA 3VHOA 5HNFA 1WVRA 1BZWA 2ZB9A 3AFHA 4N90A 4NO4A 5HCFA 3AP6A 5HV0A 1ZG1A 4KMQA 1W7PB 1SLTA 3SYTA 2OUMA 1XOYA 1J75A 1VBB1 2Y0IA 4GULA 1CVNA 2VZQA 4D5FA 1OFSA 5I91A 5JMCA 2XPJA 2J7MA 5FZ8A 2CHHA 1NQDA 5JSRA 1ORKA 1KJRA 3MO4A 2FXAA 1W6NA 3JRBA 3H8UA 4IOCF 5A70A 3FBYA 5EIYB 3U75A 1ZGWA 4ONUA 1AX0A 2H6CA 1Z7LA 2R072 3GJBA 3PL0A 4L9NA 4L0YB 1VQOI 2WFF1 2XJQA 1WLTA 3KV6A 3BROA 1S9HA 1U12A 4XICA 2W1SA 3P7NA 5LA0A 4M4PA 3OOUA 4M3GA 2V1UA 4URAA 1JUHA 2ETEA 1WJ5A 2CTVA 5FY1A 2KQRA 2DMNA 2VXZA 1LFUP 5DAPA 3CZJA 4NWVA 2JRMA 3RZKA 4Q8KA 2QKDA 3JD71 4FSJA 4LBQA 3EJKA 5EG0B 1W6PB 4BZ4A 1MH3A 2A71A 2GC1A 2BNNA 5HLIA 2MNGA 5FPVA 3GZNB 1QY4A 3TB0A 3MGUA 1IG7A 4ZPIA 1EYBA 2M87A 1ZGAA 1UIJA 1BK1A 2W1OA 2R0HA 4CRQA 5DDGA 4Y22B 5JIAA 3HRUA 4ASKA 4YG2F 3GTQJ 3BT9A 5FY5A 4AAXA 1T6SA 1H6XA 5LA2A 1RR8C 2KRCA 3F8CA 4Q4V2 2VMEA 2A6YA 4Y1UA 3K4BA 1UQXA 2VC1A 1X82A 4DZJA 1SPPA 2DA5A 4UI9L 4GKXA 3GMEA 1GNHA 3O12A 5JXGA 2HWF1 1W36C 2PMWB 4D3WA 1LR5A 1KEXA 2HEOA 4RB0A 1AJOA 3T2PA 4PI0A 1OCPA 4L9JA 2XGEA 2EIEA 1RUH1 1F36A 5GALA 4HMZA 4Y4RA 4UW3A 3ZXGA 3B01A 1A5JA 5TISC 2RM22 3U37A 2HFHA 4OQ8A 4D94A 1JYCA 4ZKTB 1E3HA 3F3XA 1XNTA 1D1AA 2NVTJ 2PAKA 1TWGJ 2Q1FA 5KNLA 5A32A 2VBYA 1ENHA 3HUGB 1BJAA 1I6HJ 1RXFA 1AZDA 2D40A 3J81Z 1QJY1 4Y22A 1C8NA 1IUYA 2VNGA 2H8WA 3POIA 1OYWA 2G9WA 2DK8A 1YTYA 3OYEA 4OUSA 3J8F1 2NYYA 3PJQA 5CFCC 1WMXA 5JIUA 1W3VA 2Z5WA 4QKBA 1H8TB 2JDAA 1ZG5A 4FI9A 1W6PA 3ZQHA 2D6KA 3WGIA 3K46A 3ABUA 2Z99A 4E4HA 1YHQI 4GFBA 5JLXA 3WNMA 2P4WA 1BCXA 1U5IA 2UU8A 3BR5A 5ERLA 4GZ9A 1MEC2 4OVEA 4UVCA 4IW3A 4QPQA 2L7FP 1L3JA 3M3IA 3JTHA 4NPLA 1FOYA 4WVWA 2XH6A 2NNNA 2PHXA 3FBIB 1NLQA 2TRTA 5T3NA 4QKFA 1XSVA 2VKHA 2ZSIB 3BUCA 5L9BA 4IRIA 5JDBA 3VBOB 1W6OB 4CA0A 2R16A 4CCMA 3OGRA 1FOD1 2PXJA 4AVZA 1IPKA 2GP3A 2Z33A 2P5BA 2BEOA 2JTVA 3C1DA 3MIDA 5IPAA 1RUF1 1RHI1 2ME0A 4A3ZA 3LOBA 2ZMEC 1RUI1 3CJNA 1D5YA 4HSJA 3LA2A 3HNBM 1FXZA 4HLTA 4BS9A 3ACIA 1Y39A 1A34A 1D4M2 4P08A 1IQDC 4DZPA 2PA7A 4PF1A 5DMYA 1MD0A 5E6HA 1NLRA 4B4PA 2D5FA 3A0BC 4D6RA 4M4RA 4IKFA 3FK6A 3DCQA 2VZPA 4HF1A 3QPTA 2RKHA 2XAGA 5FYIA 1QKQA 5C71A 1H1MA 4FPCA 1COV2 4UW4A 4R9DA 3W2WA 5LK5A 1JHFA 1ITYA 3SDBA 5A1AA 1GZWB 3OY8A 3NV2A 4EJWA 1K5MB 5FB2A 3T4VA 2XF7A 1LVAA 4Y33A 5HCHA 4ETSA 1MR5A 2X05A 2YMZA 2FDIA 4XJAA 1MSEC 3HTSB 1OQ1A 2BQPA 4QX1A 2RMU1 3L7WA 2P8TA 5EYXA 1LOGA 4QPIC 5BYNA 5KXDA 3H0DA 2XUBA 1NQJA 2RM23 2VCAA 2O8XA 4TLGA 1JI8A 2ELJA 3K1PA 3LB9A 1HKQA 4BK5A 5L3DA 2WFF2 1Q8SA 4OU0A 1O8PA 2GWRA 3DXUA 4KIGA 2P34A 1XNBA 4OHWA 4FE4A 4N8MA 5AC91 3BR2A 2CV6A 2K9NA 2Y33A 1ASJ2 3R0RA 3WTUC 1WWXA 1HV0A 2NOGA 3HOVJ 4BIFA 2VOKA 3CTAA 4Q0SA 5FZOA 1DQ4A 1OLQA 4RGUA 1BEV1 1C1LA 1RUD2 3UL2A 4K40A 2W91A 1UKRA 1IZ1A 4AM3A 4XJUA 2Q30A 4D7SA 4PCRA 3KYDB 1OKQA 5BNOB 2YSRA 4JGYA 2OQ6A 3J8F3 1NZIA 3PHMA 3EQLF 1W6MA 3PIPF 4K6BA 1DIWA 2D7FA 3MLLA 2MBFA 2BZTA 1P4WA 1N1VA 3AG3H 2Q8KA 5E1RA 4RB2C 1BQPA 3OYFA 2QBYA 5C7GA 1F1ZA 3KCYA 3WSOA 1Y4WA 1A31A 2HEVF 4G8XA 1R092 4ES8A 1WH7A 2W48A 4NQWB 3THDA 3RJRA 4MADA 3ABLH 2ZJCA 1LDJA 3P5JA 2JDZA 1D3YA 4IGPA 2WA3A 3THCA 3W6KB 1QGPA 1U3EM 3RSJA 2X6OA 2ZXWH 1JU3A 4L99A 1BBT1 3ZXAC 2GOMA 3DECA 2ZHKA 3A4CA 4QT6A 3ZYFA 5A33A 3ASNH 1QHDA 2CO5A 1NX9A 2NNYA 2ZGSA 3IAPA 4EN6B 1T33A 1YFWA 3T0YA 4BOWA 3ZMVA 3S1QJ 4NN0A 4PIZA 1OURA 4IETA 1H0MA 3H9JA 4BGDA 3QRFF 5FYYA 5FDBA 3OYJA 4XBQA 1GQPA 3BOPA 3ZN4A 1LDKB 2P4EA 3D3AA 2QUFA 4EQQA 1EF4A 4U0WA 3HYIA 1GXQA 3I2GA 3BIWE 2E2IJ 3LPFA 1UMHA 4NPRA 4EJUA 2XVKA 1FOXA 2FNPA 1I9RA 1YQ5A 1XE8A 1RETA 5KWRA 3CMEI 3MIHA 1FNNA 1N75A 3VWBA 2WINB 4I3PA 4OHZA 3ZKYA 4RAZA 2WKKA 4LFUA 4YW6A 4QQ2A 2ADEA 1S29A 1S0EA 3O1OA 3TYJA 1XSDA 1JS9A 4P9YA 1IRXA 3VKOA 1H2MA 3LWFA 4M9ZA 4HPQA 2E32A 2ERFA 3ZN6A 2Z4FA 5FBJA 1RC9A 3OOPA 3WW4A 3ZYIB 5T54A 3JAMK 5FKMA 2G9ZA 3DYMA 2W84A 1Z0HA 5CFDC 2ZJRF 3V7CA 5KAIC 2OPKA 2CW7A 4AXOA 3B9IA 4UFIA 1G9BA 3IB3A 5F04A 3B00A 4ZYAA 2DXIA 4HEA2 1KU3A 1GSLA 1QVTA 4LE4A 3SFIA 2LH9A 3HRSA 3VDAA 4N7IA 3E5QA 3ZPYA 4YG0A 2WNUC 4ISRA 5FPBA 4TZDA 1DGRA 5CNAA 1TT0A 5BNOA 4F91B 3BR6A 5B5EC 4U36A 3S15J 1TE1B 1RUJ1 5E1WA 3WQ1A 5E89A 2A73B 2H6BA 3VV1A 3IWFA 2NMNA 1F4HA 3IAS2 3TL4X 1FMD2 2WNOA 5M0TA 2PHLA 4PQQA 4COUA 5FZIA 2BY3A 5FMOS 1PGL2 1YOVB 2EAAA 2V6CA 5LD2C 1GZWA 5G05L 1JYNA 1QOSA 4YG6A 3NWSA 2XKPA 1DP7P 3HQRA 2V9KA 4MOAA 2WZR2 4EGZA 1LVKA 4LEJA 1N25A 5HI0A 2WNUB 1DLLA 2XROA 2HZTA 1GWKA 2XWBB 5ACA2 1HBXG 3FX3A 1RKWA 3JB4C 1HXDA 3F8BA 3N7MA 1BN5A 1TTYA 4V19K 3DUIA 2Q8EA 1K5MC 2A7AA 2DBIA 1K42A 2EXJA 2VKDA 1O91A 1LFPA 4CSWA 1ZBE2 1VB4A 4Q29A 4W6WA 3K6GA 3U21A 2QWWA 2WYSA 3T0DA 2P6CA 4XQ4A 1UAIA 2QQJA 5DV5A 2X51A 1TWFJ 3ZSJA 3CO2A 4ZU5A 4LO6B 2VLAA 1YO8A 5CKTA 4C90A 1OUXA 2KRHA 5F6FA 2HI3A 2MG4A 4M3DA 5FKBA 3KP7A 5FFOC 3WQ0A 3TDUC 4CU6A 1A6CA 3ZMTA 4IXLA 4K3UA 5A3OA 1CQTA 2DT6A 2FNAA 3SH4A 5C4WC 3FMSA 3OYKA 5I8TA 1R083 3LEMA 1QJZA 1IXCA 5IVYA 1XE0A 4L5IA 4FFIA 4KN7X 3GTMJ 4FQGA 2R7DA 5FJHA 2R1BA 3G2BA 2XJVA 3WTZA 1BR1A 3I56I 1LRHA 5DD8A 5BNQA 5F5AA 2EICA 1ZBA2 5FP4A 4CCKA 5I0SA 4XXAA 1UYYA 4IESA 4Z6YA 3I97A 3BDDA 4QQLA 5JZGB 2X5IC 3T1LA 3POEA 3M7AA 2DUOA 2C9AA 1YNAA 2BVBA 1QA6A 2X4HA 1SLIA 1CAUB 3OYGA 2L0KA 5K4LA 2B9UA 2MD0A 4L0ZB 4GXLA 1LEBA 4S2FA 3MKYB 2I45A 1JHJA 1ETWA 3ESWB 2VPLA 2MEV2 3SH5A 4QKDA 4BWOA 5FLIA 1PK6A 2E60A 1I6XA 4MGIE 2KJBA 2KJCA 1NYWA 5DG1A 1AR62 1JKOC 1LDDA 1VBA2 4XZPA 2ISZA 3DEUA 2ID3A 5CQGA 2GC0A 2HDDA 3JQWA 5BPDA 1MSFC 1AYM2 2R5ZA 5JPMB 5E8IA 2VOTA 1YW8A 2IGNA 4RLFA 2W94A 3N7LA 3AC0A 5EG0A 4L0PA 1Z3XA 3K3OA 4LLGF 4Z8BA 2P6SA 3ZMDA 1B72B 4RS5B 4RHV1 2B39A 2G9GA 2R7SA 2GAUA 1WFXA 3H7YA 4BA6A 1UZCA 1FSEA 1PUEE 1HJGA 1D4M3 2CG4A 4HF0A 1WJCA 4D0QA 4RBOA 4BK4A 4OMDA 2ZCWA 1A78A 1WW4A 3DKYA 2WZEA 1UW8A 4N53C 1FPN3 2Y0SN 5LW9A 2E6VA 5GZGA 1ZELA 3SEEA 4FHTA 2O1QA 4JGZA 5KAFC 4RS5C 2COMA 3ETPA 1POV3 4V2GA 1X2MA 1LOEA 2EZHA 5B4XA 2X9DA 5IYBJ 3VYRB 2IT0A 1TQIA 5F2SA 1VBD2 1BC8C 2ZAHA 1GZCA 4IHYA 4G12A 4D7MA 3I2HA 1EP0A 3PUIA 1IZ3A 1W7PA 4Q4Y3 2PJRB 4PDWA 5FZ4A 1ND3B 5A80A 1UU6A 1OOPB 1B6AA 2R30A 4HV6A 4JZRA 1QQP2 1OQYA 2VZ3A 2K7LA 1XNKA 1I3AA 4FXGB 5JXHA 1RR7A 4XN3A 5JCTA 2BZDA 2GA2A 2NS0A 1DYOA 2HQAA 3R61A 1SFOJ 2FEZA 1GT0C 3ZYBA 3ISPA 2L9NA 4ESBA 5M3MJ 4HKWA 3LD8A 1PM4A 5FY9A 4HX7A 3F8MA 1Z7S1 4UFKA 2DTYA 4HSLA 2EJRA 1E2XA 3I4NJ 4ZZ5A 2I8DA 4YZ1A 4ZS2A 5A7OA 3ZMZA 2ZGKA 4QWQA 4EWDA 4EM1A 4FAHA 4FFHA 2IRFG 1RC6A 4KBBA 3ZDSA 3I0TA 3RQ4A 4I0BA 1HCRA 4LBLA 4AIKA 1XB9A 5A3MA 1Z6TA 1TNTA 4XHBA 4M9SA 1KQ0A 3GTLJ 1SLCA 5BY5A 1NA1C 4EJVA 2RHPA 1VRH1 2CGNA 4BNCA 4LJZF 1ZZ9A 1B35A 2ZMLA 4NIHA 2WV0A 3JB8A 5A3WA 3X2QH 1W0UA 5GADJ 4DOUA 3Q9VA 3IZOA 3GHNA 3K70C 1HRI1 3N36A 1CAXB 4IV3A 3WUDA 4L9TA 3BN6A 5CFCA 3KE2A 4FXKB 1R5GA 4L92A 5C70A 4DQAA 5FOBB 3OGGA 4WXCA 4AVVA 1S2KA 4XLNF 4YFNF 2HGCA 1AR81 1LJ9A 4G3YC 2QUOA 2XXZA 1DP0A 1YRNB 3M7GA 3OWTA 1NXD1 3OEAA 2KA3A 1W28A 3UESA 2VZUA 4Q0VA 1VQ7I 2WN3A 2CY6A 3ZN5A 1TT5B 4XC9A 4N4OB 3W58A 4CH7A 2D1VA 1SFPA 2NPIA 3GHMA 3N7JA 4LMFA 1BEV2 3DPRB 4L2NA 4P9JA 4RHV3 3ULQB 1AR72 1HV1A 1OA4A 1SEUA 1UHMA 2KHMA 2QKLB 5A3UA 3JBG1 3H35A 1ASJ1 3MF6A 3O1PA 3Q8FA 1HB2A 3E6CC 3AXEA 1SDDB 1FYLA 3PNVA 1SVOA 4UFJA 5JI9A 4ZTJA 1V4RA 1LGCA 4JGZB 1MS3A 4B43A 2MABA 2COBA 4ENKA 4DYRA 3SMHA 4GIQA 2RC4A 3BG7A 2YS9A 3MIFA 4WXHA 1S7OA 3WF0A 3KP6A 1XGSA 3HM5A 2EXIA 4YGBA 2NMOA 1RUD3 4I02A 4V2VA 2L4AA 1VMHA 3ZSEA 2UWCA 1MACA 4UAPA 1MZ6A 1ZA4A 4XSZF 3ASOH 2PHDA 3TOAA 4NIAA 3BWGA 2FDGA 1YFYA 3T08A 1IO2A 1SVLA 5A7QA 2BXYA 5JOXA 3GF2A 4XDQA 3NO8A 2D6PA 2WA4A 2W1WA 1UFMA 5DABA 3JXSA 1FP2A 2DTRA 3H0OA 2DA6A 4INDA 4R52A 4LE3A 4YZ5A 1FPN1 1V6MA 3ZXFA 2OPWA 5CG9A 5FWJA 3GTJJ 3K1NA 4COYA 3KETA 3MBWA 2C26A 4MFEA 5FLXZ 2QSGX 2YFZA 5A3PA 2CW0F 1IG3A 3ZIWA 2MFZA 1JI6A 2HWE1 2XJPA 5I0TA 1EAH1 1J3PA 2FU4A 2FZ1A 5KXBA 2P7VB 1AR91 3G6JB 3H50A 4UBGA 2NVYJ 1UY4A 1CPNA 5KHJA 3M8FA 2ZGOA 4U2AA 4CXXA 1SACA 2FF4A 3V56A 1HXS3 2EA7A 3T1MA 2D6NA 3QLQA 2ZHMA 1RUC2 3LSEA 2PLYA 1TW3A 5DCFA 4MGTA 3A01B 4GKYA 3VDXA 3T30A 4IHTA 2IVJA 3I64A 2GSYA 3ZFEA 1MBEA 4XFIA 5IVEA 1H30A 2X6WA 3HPNA 1AUYA 2DVFA 5LHGA 4LTAA 1X8MA 1US2A 4MTDA 3IRQA 1OF3A 4COWA 2BY2A 2CRGA 4OIRF 1Z3YA 5KC5A 1L3LA 4E4DX 1KGSA 4ASNA 2MLKA 1NE6A 3D0JA 3IPVB 2JMWA 2NYXA 1XPWA 4JTNA 4XQFA 4BQYA 4QD2A 4QXHA 4S04A 5GKAC 1CWPA 4FASD 2M0CA 5CBLA 2ZACA 2V1DA 3IMMA 4UUSA 2VMDA 2JG9A 2A3YA 1ZBE3 3F0CA 1K6OA 4LKSA 2G4IA 2FOWA 4COVA 5K7HA 1VQNI 3IBMA 3S1MJ 4Z1VA 1XNAA 4AI2A 3RYKA 3VHPA 1J84A 1EH6A 3OBZA 1ZA7A 5HDKA 3KB5A 1D2SA 1RZ4A 4HV5A 1V55H 3UR3C 3RTRA 3CJTB 4IHXA 3C7JA 1V5GA 1VNDA 3IT8A 3OYCA 2A6VA 3J7HA 3ZXLA 4WM8A 2EFOA 1GOHA 2P6TA 3H1MA 4C2UA 5FZFA 5C9AC 1V5FA 1ASJ3 4CUCA 4ASMB 3NMBA 1VQ5I 1YCIA 3FKJA 4NHLA 3ZQ7A 4E7JA 4PSWA 1IF1A 2VBWA 4LKDA 2CQXA 3MLJA 2LBFB 3JSOA 3F95A 1RUE1 2WSUA 5IVVA 5FMOL 3WDYA 1HQNA 4Q4X3 2M30A 1ZNPA 2FQPA 3RKQA 2VMCA 3FK7A 1K5MA 4XONA 2A6EF 2AUYA 2VXJA 2E7WA 3J26N 2LKXA 1J3QA 1JOPA 2Q1ZB 5JHFA 2LY2A 2ZMEB 3LFUA 4PLOA 1LAJA 3HBZA 3VD9A 2WQZC 1FLIA 3PFIA 1UB9A 3AKPA 1YEWA 1VIWB 2P5KA 5F37A 1ZK8A 1YLFA 5J4YA 2Z3YA 3HGGA 4DUVA 1R1A1 4AYUA 4P96A 1G3SA 4KG0A 5DCMA 4F83A 5CKNA 3GVAA 3WE3A 2HPIA 2YB7A 1QWRA 4UUSB 4PIYA 1KYZA 2YU2A 3IDEA 5A6ZA 3OBAA 5FMBA 1W6OA 2WNVB 1OUSA 1DZQA 3IPVA 2A75A 1S5LC 5FKLA 5HDGA 3D1NI 4PBPA 4KGQA 5DEQA 2LP0A 2YGMA 4IL6C 1OFNA 3WQBA 2RJ2A 2HKXA 3VKFC 3P9CA 1KYWA 2W52A 2WBKA 2XPWA 1US3A 2L54A 2J5OA 2XJSA 5E88A 5ICEA 2CAVA 1OHFA 2DURA 1D0YA 1F8VA 3ZIXA 1XNDA 2IC1A 1VQ6I <