2WC2A

Nmr structure of catabolite activator protein in the unliganded state
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
209
structure length
209
Chain Sequence
VLGKPQTDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYGTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Camp-Mediated Allosteric Control of the Catabolite Activator Protein.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription regulator
molecule keywords CATABOLITE GENE ACTIVATOR
total genus 38
structure length 209
sequence length 209
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2wc2A02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2wc2A01
2P7CB 2O1QA 1IAWA 5D6FA 1Z05A 3L09A 4KYWA 2IXHA 1FY7A 3F72A 3ZMTA 2VODA 1ZZ8A 3LWFA 1KYWA 2D2WA 4AWXB 3M8FA 2M30A 3WTTC 5I8SA 4U0YA 2GZWA 3CJXA 5DD4A 1EPZA 4Y17A 3T1BA 5CADA 1RI7A 4ESJA 3CLPA 2EFPA 3FZ3A 2PHLA 1UD1A 1XB4A 2EFNA 3I0TA 4BAYA 2RN7A 4Y15A 4KN7X 3NKTA 2G9WA 1NZCA 5D5VB 3E97A 1OPCA 2VPVA 4U0WA 1BBYA 2QCSB 1WGPA 3KEOA 3GFJA 1CAUA 5JR7B 4JBAA 2D45A 2UY8A 3KP7A 4M9XA 4WXDA 4EMSA 1W7PA 2PQQA 4EQQA 1J7KA 1GXPA 4ZYEA 3IDCB 2FQPA 1ZRCA 1GQGA 1SMYF 1IN8A 3LFKA 2A68F 1AOYA 1KU3A 2IXKA 2XV4S 2CGPA 3BY6A 2ELHA 5KBFA 4Q48A 2FEZA 4L9JA 1PUEE 1XD7A 1TTYA 2FBHA 1FYKA 3MQ0A 4HAMA 4I98B 4I0BA 4PGHA 3ZMSA 4R79A 2YSRA 1MDMA 2HR3A 5ERIA 4BH9A 4A0ZA 3TDUC 5L3EA 5J8FA 4G8XA 1JUHA 2Q8KA 5D4RA 1B9NA 3CEWA 1UIJA 3FJSA 4CYDA 3FMSA 3ACLA 4HN0A 2BV6A 4N9HA 3J80Z 4ZU7A 2FRHA 4PZJA 2BYVE 4FX4A 4HDVA 4LLOA 2O3FA 2A69F 3JSOA 2QJVA 5K8SA 2PJPA 3LQRA 2C0ZA 2HKOA 4CGZA 5L3FA 4MTDA 3TO6A 4XBFA 1HW2A 2CAUA 4PIYA 4OLLA 3ZPLA 2VQAA 3E5XA 2XLAA 1YG2A 3F21A 2JZYA 3HTSB 4L5JA 2L54A 2O8XA 3IKTA 4QMAA 5A2QZ 1WI9A 4F7ZA 4Q29A 3FXUA 1MGTA 2PAMA 4ORFA 1TW2A 3N97A 2ET1A 4I3PA 1FYMA 2GXBA 3S2WA 3FM5A 1SAXA 1ZG1A 1R00A 1SD7A 3ES1A 3UKVA 3GX4X 2ESHA 2MHFA 3CL1A 3SMHA 2CV6A 1T38A 1I1SA 4Z82A 2W24A 1MJAA 1P2FA 4YG2F 2R3SA 2Q0OA 1NE4A 3ISPA 5TRDA 4X6RB 4YNIA 5DCMA 4P9UA 3DN7A 1EYBA 1BI0A 2VBZA 4WXCA 3HIFA 3RNSA 5ICCA 4LA2A 1PM7A 4UBGA 3IRRA 1XSXA 1DZRA 2FA5A 1XDUA 4EWAA 4ENMA 1I5ZA 1J59A 1RZ4A 4QGLA 2NRAC 5AIPA 1YW8A 3GW2A 3BJOA 1LQ1A 4HVRA 2OPKA 4P9GA 2OYZA 5D5WB 1J3RA 2VBYA 4WCGA 5HI0A 2Q30A 5HDNA 3QRFF 4HQEA 3LAPA 3BPVA 1F4KA 2VOPA 1FBQA 2TDXA 3C3VA 2DCTA 5E8IA 2IJLA 3NEUA 2MA3A 4LB6B 2QENA 4MQVA 5BXXA 2IVMA 3HOTA 4Q0VA 1RC6A 4WX9A 2GC1A 4KWKA 3GZ6A 1B1BA 3M9AA 5KHHA 5LHHA 2Y0MA 1B9MA 4U7DA 4JTOA 1RUNA 2XROA 4IHTA 3BJ6A 3KZYA 4UV8A 1XMKA 4FBFA 2KXLA 2B5HA 1W7PB 4KN4X 1W4MA 3ZN1A 4WVZA 3ZMZA 1UW8A 2V1XA 1SFUA 3V8KA 1YFYA 2HGCA 2D40A 4BIFA 5IT3A 1ZAOA 1LRHA 3FM3A 4NQWA 3MPBA 1QXRA 3Q9SA 1TQPA 3KP2A 2ZXJA 1FNNA 4OOIA 3IWFA 1IZ1A 4B09A 2PHDA 2FF4A 1JE8A 1OYWA 4K2EA 1YW9A 2I45A 5K1YA 5A2QK 1T39A 4XSZF 3WG9A 1O3SA 3ERED 4IEWA 3HYIA 3QP6A 2OQRA 3TDZC 3H1MA 1FPQA 2PYTA 5EEHA 3P9IA 1LB2A 5CVRA 3COAC 3H92A 1CAVB 5IT9K 2VXZA 4GO1A 3J7AO 1Y3TA 4GXOA 1D3YA 2QBYB 4OIPF 4X6QB 4HDUA 4IETA 4EWEA 4KMFA 5FD5A 2F4PA 3SCFA 2QUFA 3GF2A 3DP7A 3KZZA 3W6KB 3TNPB 2GU9A 4M72A 3WTZA 4HLYA 4HF1A 2L3DA 4J1XA 2RV8A 3EQEA 4IRGA 1DP7P 5I0SA 2IW5A 4LLLA 5ILVA 4LB5A 2P8TA 4KNYA 4KIBA 2WTEA 1UPIA 3OOPA 1K79A 2Z69A 3MYXA 5I91A 4HV6A 3TGNA 3MEXA 1EP0A 2D5HA 2YPRA 3E5QA 3NQOA 2EAAA 4BHCA 1UB9A 4XRFA 4RB0A 3F22A 1BI1A 4WZCA 2BNNA 2LDUA 2L4AA 2E7WA 4KIFA 3FWEA 4LGWA 4RGXA 1H1MA 4M6XA 1FP1D 3FFQA 2GXGA 4A6DA 3VODA 4KIGA 4QM8A 4TLFA 4XFBA 4L9NA 3WE3A 1ON1A 1HQCA 4G6QA 2JRTA 5LHGA 3K69A 2QBYA 1IN6A 3HRUA 2D5FA 4Q5SF 1LEBA 3S7EA 4RAZA 1FBUA 4HBLA 1F9NA 3M7GA 1ZVFA 4YFXF 3QOPA 3ZMDA 1XE8A 2M45A 2QQ9A 1NYWA 3Q5FA 4UV9A 2RGVA 3K9TA 2Q0AA 5CJ9A 4O5VA 4N9IA 5HOOA 1OKRA 1UHMA 4EGYA 3IBMA 4I0AA 2HTSA 3O2PE 3BCWA 2PN6A 1XDSA 4QLCU 3K1NA 4YIFA 4ZYGA 2BNMA 4EJUA 4P55A 3H9AA 2DLLA 2DFIA 3T5XA 3H1YA 3HUGA 4HA8A 3DKWA 3GEZA 4IVNA 3TKYA 3K1PA 1OFNA 2O8QA 1Z7UA 3WTSC 3FF5A 4MGIE 1LDDA 4CHUA 3DXJF 3C7JA 2QWWA 4M6YA 3L7WA 1FWZA 2P6TA 1QBJA 5KVRA 3GO5A 1ZGAA 5E1WA 2NNYA 4ZU5A 1T98A 4KDPA 1O3TA 1YLLA 1O5LA 1ZH5A 1J58A 3CUOA 2XL9A 3I58A 1RNLA 2K7LA 2ZNYA 1Q1HA 3C18A 1ZZ9A 3H7JA 1ZGJA 2CYYA 3S7IA 1IXCA 2D1VA 2MLGA 1HW5A 1O3QA 4IF4A 3OGJA 5J7MA 2ISZA 3G73A 3J80K 1XMAA 4RGUA 5I93A 1XCVA 3RTRA 2EFWA 3O3KA 3WU1B 3LA2A 3ZQ7A 4OIQF 2RC4A 3G3ZA 2H6BA 3T8RA 2QVOA 1PP8F 3V8LA 1U5TA 4PIXA 1CAVA 1K78A 1QNTA 2E1NA 5HDGA 3DL3A 2BGCA 2RKHA 1ONVA 4IEZA 4BXUA 4PCQA 2PMHA 1XSVA 3RYPA 3PLQA 2DU9A 5L3CA 3JTHA 3O14A 2KIMA 4M9SA 3NW4A 2UY9A 4O9EA 4MGRA 4A6EA 2KJCA 2XLFA 4Z07A 1RIOH 2ADUA 1YTYA 2GAUA 2GA2A 2DQLA 3HRTA 2OAZA 3ABTA 1JGSA 2Z5UA 2OD5A 4D7SA 4A5NA 3UKTA 4BYYA 5JI6A 4CO8A 4H7LA 2VN2A 3I7DA 4EM0B 1S29A 3WW2A 4O6JA 5FQ0A 3TOAA 1BIBA 2EK5A 1Q5OA 3M3IA 3QACA 1NHAA 4EV0A 2XLGA 2FU4A 1QQIA 2BE5F 4XSXF 5JCTA 4LLNA 1SD6A 5DYMA 2F5CA 4KU7A 5D1IA 1XE7A 2IPQX 2R7DA 3LAJA 4QGNA 4IERA 3BU7A 2FMYA 4LUKA 3ML6A 2NAZA 3J81Z 1FOKA 1ZRDA 4RB2C 4KA4A 3G7DA 3ETQA 2P5VA 1R22A 2AS5F 4HVOA 1KU9A 2NNNA 5CYVA 1WQ2A 3DPTA 1Q43A 4U0VA 3IC7A 5E1RA 1KA8A 1K7AA 3H3ZA 4XLPF 4EM2A 4GCVA 3N4MA 2PTMA 1WLTA 3V7SA 1TW3A 2Y75A 1WRJA 2UYBA 4QM9A 2RVCA 4HOBA 3HOSA 1UCRA 1IRGA 4L9VA 2HZTA 2ZO4A 2KIFA 1S7AA 4IPAA 2GC2A 1KQ8A 1IN7A 2ETEA 1QPMA 4MX3A 5E18F 1J3PA 1CF7B 1ZZCA 4G94A 3FHIB 4LMYA 4PIZA 2H6CA 3WTUC 1BI2A 3KP5A 5E8GA 4EROA 2P6SA 1O5UA 3EDPA 3KFWX 1EH6A 3IWZA 3ZMVA 4MQ9F 1KGSA 1J5YA 1CAUB 4LG0A 1WWXA 1RL3A 2HFHA 2PQ8A 3ZMUA 3GWZA 4PDKA 2EV0A 2D1HA 3TOBA 5F64A 3H50A 3MZYA 4E2GA 4M74A 4EVIA 2O61A 1FSEA 2G7HA 2H09A 3K0LA 4IEPA 1EH7A 3I64A 2LF8A 4XFHA 1WKMA 1HKQA 2KIUA 5DDGA 5JHUA 3GFMA 3RYKA 4DQ2A 3WE2A 4O9GA 2KJBA 3T0YA 3ST7A 1E17A 3FXQA 1EY2A 2HTJA 5FO5A 3OV8A 1USTA 4KMUX 4MH0E 1E2XA 2KKOA 4L0ZB 1G4DA 3WTWC 4IEOA 3E6DA 5D6EA 1MJBA 3DFGA 2EJRA 4MNUA 1FP2A 2YX7A 5FLXK 3HSFA 2M8EA 2CO5A 3TQNA 5HS8A 1CX4A 1KQ0A 5FLHA 3RKYA 5LGTA 1S8NA 3OD0A 4JVAA 1FI2A 1LDJA 4IEYA 2ZNZA 3KP3A 1F5TA 3D0SA 2JPBA 1X8MA 4UXAA 1HSJA 1KU2A 2ZMEA 3GUDA 5F1RA 4XFGA 2WWYA 4L0YB 2FQ3A 3SZPA 4YIIA 1K78B 2L4MA 2VBWA 3BJAA 3JAMK 4IRIA 2VE9A 1WA4A 5D8LB 1UCXA 1JHHA 1XGSA 1FSHA 5LBQA 3E3VA 3QU3A 5J3UA 4AQ6A 1SEFA 2GH2A 3CO6C 2K02A 1WSUA 1CF7A 4IHSA 1T0FA 3WGGA 1XGOA 3QPTA 4YFNF 4RB3C 1T2KA 4KU8A 3HRMA 1CAXA 3ZN0A 3EQLF 3OCPA 2RQPA 2XGXA 1ZZ6A 3EETA 1SFNA 5FPXA 3LQQA 2K86A 4IEUA 1U12A 4M9ZA 3HHGA 1TLHB 1U3EM 4N0BA 4YFKF 1ZLJA 2ETHA 2VC0A 4HX7A 5LRRA 1O3RA 4AVAA 4PGGA 3JZVA 2VT3A 1MZBA 1G6NA 1HW1A 1SQ4A 2O6GE 2G7UA 2PFBA 1SFXA 3KGLA 3RDIA 4L2NA 3V8JA 5LEKA 1W5SA 4Z2YA 5J6XA 2ATFA 2UXXA 4AD9A 5D8KB 1TQ5A 1U78A 3BALA 3C3WA 1PMIA 3CUQC 5IT9Z 4RGRA 2OZJA 1IXSB 4Q0PA 2OBPA 2PMUA 4S04A 1HKTA 2F5DA 3BDDA 1TNTA 2XAJA 4HVQA 2ZMEB 4Q0UA 1QO0D 1BC7C 3QP5A 2XAFA 2Z2SB 3ULQB 3FMQA 5BS6A 1NXMA 1CGPA 2EFOA 1VTNC 4HLTA 1YFXA 4FT8A 1XCBA 1R5GA 3V4GA 2CWEA 5HLIA 4A0YA 3GVAA 2J5OA 2X4HA 1OYYA 1D8KA 4BQAA 3R0AA 4WXHA 5BUVA 2ESNA 1LDKB 5C8WA 4I09A 3I59A 5JR3A 5FLJA 2A6HF 2DAOA 1I1GA 1LJ9A 2H94A 1IRFA 4IEXA 1QZYA 2EWNA 1O7LA 2QQBA 3R61A 1LVAA 4P9FA 1ZHFA 3F8CA 4J1WA 2EV6A 3IIAA 1L3LA 3BZ6A 3FX3A 2ZJ2A 2A3SA 1ZZBA 3CUQB 4IEVA 4PJYA 3RIRA 2STTA 2COMA 3I4PA 5LEJA 2QDRA 4LK0F 1B6AA 1QZZA 1U2WA 3GBFA 4MHGA 4LG0B 4Q0SA 2L01A 1BJAA 1LEAA 4AVCA 1YLFA 4UUVA 1RGSA 2ISYA 4ZU4A 1UFMA 2XAGA 3WGHA 4OMYA 4M73A 1J0RA 4LULA 5J48A 5F6FA 3E6CC 4A2UA 5HLGA 3D5LA 3EBRA 2VE8A 3VHRA 5DEQA 3WTXC 2YU3A 3VEPA 2IXIA 3R0JA 4HYEA 5LGUA 2EA2A 4M71A 3QPHA 2CFXA 4XF0A 3ELKA 5KHKA 1X7NA 2E9QA 1QWRA 5FPZA 4Q0QA 1I6XA 2FNPA 4KWLA 2XKOA 3L9FA 3OTFA 5BMZA 5BQTA 1B4AA 5K5OA 4FAHA 4S05A 1YFWA 4OU0A 5D4SA 5DUIA 1J9IA 4RAYA 1H0MA 2V6CA 1U5TB 2IRFG 4XF1A 1KQ9A 1ZARA 2IP2A 3SXYA 3BPXA 2V1DA 2VT2A 3HRSA 1BIAA 2K4BA 1K6OA 1J3QA 3L2HA 3KLOA 3LSTA 1MKMA 3GFLA 3KETA 1R7JA 2XVCA 4FX0A 4TV7A 1YHFA 1PP7U 3EO6A 3CUQA 1DUXC 4E70A 2HJIA 1FT9A 3LOIA 1FLIA 2DW4A 4ZYDA 2NYXA 1KU7A 2CW0F 3R6SA 5JAXA 1YIOA 1ZZ7A 4EJTA 5BPXA 4ONUA 4MGYE 5BY5A 4UXNA 2KRFA 4G7HF 1OMIA 2XASA 4RD7A 5HS7A 2K4JA 2VECA 3RPUA 5JVTA 2M87A 2Y48A 4NVPA 5AONA 3EUHA 4ENNA 5I0UA 2PBIA 5HDKA 1STZA 4ZYHA 2DBBA 4HN1A 1BOAA 3HSRA 2QNKA 2R7FA 2B0LA 4LK1F 1W7PD 1DGRA 3ZDSA 3D82A 5HVQC 2F2EA 3DEUA 3IHUA 1XGMA 3I71A 4G6DA 2MNGA 3U1DA 2X0LA 1YS6A 1MDMB 3IDBB 1IN4A 1GVJA 3ECOA 5FD6A 3J81K 2A07F 1Z91A 2FE3A 3REOA 2FBIA 5KHIA 1ZLKA 4XF4A 5BV6A 2HYGD 4META 4HX4A 3PFIA 1W5TA 2PAEA 1REPC 4XF9A 3B02A 3NSTA 2CAVA 3ZP5A 4B8XA 1I27A 2EA4A 2NS0A 4UHTA 3CF6E 2Z99A 1DDNA 4CZZA 2JSCA 2MD5A 3GYHX 1ON2A 4IESA 4GGGA 2HDCA 3Q9VA 1GHCA 2FOKA 5AVPA 5K5QA 3F8BA 4EWDA 3SHFA 1OD5A 5E1XA 4KFCA 1KYZA 1IUYA 2STWA 3HT2A 3WW3A 3HHHA 4G7ZF 2EV5A 1YUDA 5FLIA 1GXQA 1C0WA 2MBFA 2W57A 5ICGA 4E2QA 2MLKA 4O3MA 4HV5A 4EJVA 2P5KA 3IL2A 3NVCA 1X3UA 1B59A 1SD4A 4IJAA 1SD5A 4LEJA 4HX8A 3S0MA 4B29A 4I02A 1S6LA 2YX4A 1IW7F 2GA1A 3WTYC 3T8TA 3U11A 1HXDA 2FNAA 1J75A 3JW4A 2K27A 3MFKA 3LA3A 3FE5A 3EYYA 2HEOA 3F6OA 5EZWA 2Y0OA 3ELNA 1U6GA 1L0OC 3VB2A 4ENKA 2V09A 3M70A 1P4WA 3MCZA 4JK1X 4WBBA 3P9CA 4KL1A 2A5YB 5L3DA 5I0RA 1XGNA 4XFIA 5H6RA 4MZUA 1QXJA 1YFHA 2OZUA 4UVBA 2CSOA 2Q1ZB 2Q4SA 3NRVA 1O7FA 4AVPA 5HLHA 1H9TA 4HF2A 3KEQA 2QVSB 1VR3A 3H3UA 2IXLA 2K9ZA 5CVUA 2BEOA 6PAXA 4XFAA 1BN5A 4QWQA 1XSDA 3MZHA 2FMLA 1H9GA 2ZKZA 3V7RA 3OF1A 3U10A 2PFWA 3USSA 3GZ5A 1YYVA 5CU1A 5DCMB 2Z33A 1R1TA 1TQMA 2M5WA 5KK1A 1IPJA 2RDPA 2IA0A 3L00A 1IXRC 2VOOA 3GYDA 1FC3A 3B73A 2DO7A 4MGKE 1CAXB 2UYAA 2IXJA 4KICA 2IT0A 4OFGA 5T3NA 2M1BA 5CLSA 2JPCA 3ROUA 4DNCA 4D0PA 2MH9A 2O0YA 3WTVC 3O6BB 5ILUA 1QGPA 3SCHA 2ACJA 3RZZA 3KE2A 3UKNA 4LTAA 4I01A 2E1CA 3TO9A 4ZH4F 2N7GA 2HOEA 3VFZA 3ES4A 1YW7A 3WGIA 2PLYA 5CVVA 4BHPA 1D8JA 4IRHA 4RS8A 5LHIA 1DZTA 1R1UA 1Y9QA 1ZRRA 1V70A 1IN5A 3JSPA 2OZ6A 4HLXA 5E17F 5CVIA 3GXOA 4ZZDA 3BOQA 3F3XA 1SMTA 4RB1A 3E6BA 2F5EA 1LR5A 3KLNA 4L9TA 2DPUA 2XAHA 2A61A 3R60A 4AIHA 2XHKA 4XLNF 1HKSA 2ET7A 4FAGA 2PA7A 1Z9CA 1OR7A 3GLXA 4H0EA 5FDBA 3BP8A 5JFRA 2B8MA 4MEYF 3FZVA 2V79A 1J2XA 4F8AA 5ED4A 3CO7C 4CDGA 2V1UA 3RYRA 1AWCA 3K1MA 4ESFA 1UHWA 3FMRA 5LLQA 3MDPA 3M8EA 4AVBA 5KHGA 2IA2A 1EV7A 4HW0A 3I53A 1TBXA 1JXSA 5BOXA 1P6RA 4MV2A 3AAFA 4K8FA 3PQJA 2V9VA 4E2SA 1X82A 4CICA 4LA3A 2XRNA 2B9UA 3TNQA 4P96A 4QXKA 2FSWA 4FHTA 4LD5A 4KT5C 1VP6A 5D5UB 2XUBA 3H8UA 1YQAA 3R4KA 2CG4A 2WFPA 1PDNC 4YYOA 3DQVC 1IPKA 2HS5A 3E6MA 3ECHA 3EYIA 3SQNA 5JSRA 2D93A 1R5HA 3HT1A 3I54A 2HKXA 3BROA 4QGMA 3DPLC 4Q47A 4EJOA 2VC1A 3DV8A 5DCFA 3BPZA 5J8CA 3RKXA 3BWGA 5FFXA 2LNBA 4IXAA 5L3BA 2LSOA 1SFEA 3SXWA 1Z6TA 4CXFA 2HQNA 3WW4A 3CJNA 2QZ8A 4A12A 1FZPB 2OQGA 1FXZA 1L3JA 4XF3A 3PVBB 2OA4A 4HBNA 4BNCA 2VONA 3IKVA 2FXAA 2YR2A 4UNOA 4NHJA 2F5FA 2BNOA 3QU6A 2GC0A 4UVAA 1U5TC 1ZYRF 2BBYA 1P4AA 1LNWA 4ENJA 2DT5A 2C6YA 4Y13A 1BI3A 5JSOA 4U88A 2K0GA 4L5IA 4ON0A 1VJ2A 4LJZF 2MPFA 4HMZA 3KSCA 3KCCA 4AIKA 1EH8A 1DPRA 4I7HA 3E5UA 1G3TA 1ULYA 3HSEA 4LUMA 5DV5A 2XKPA 1R36A 1BM9A 4HZFA 3NL1A 4JTNA 2OU2A 4ESBA 1JHFA 4EJWA 4AQ2A 1O57A 2QLZA 3U2RA 2P5LC 2L02A 4L11A 4R8HA 5FCCA 1ZX5A 2RNJA 1V3FA 2WC2A 5FLXZ 1HBXG 1Y0UA 4ETSA 3CDHA 1FBSA 2DK5A 4UBHA 4HSJA 2GIVA 2EA7A 3MWMA 1HSTA 5KHJA 3HTUA 4HSLA 1S7OA 1XN7A 3TO7A 5K5RA 2W85A 2AXLA 4U7BA 4BHBA 5LRSA 2HYFA 1YO5C 4I2OA 4KUMA 5E20A 2H27A 3F6VA 1IF1A 4KWJA 4G7OF 4YARA 2PG4A 5FQ0B 5CVJA 4P5OA 2PEXA 5FB2A 1UIKA 3I5UA 2FBKA 4A0XA 4EGZA 4LFUA 2P17A 2O03A 2GWRA 2XAQA 3EJKA 4R52A 4L18B 1OYIA 1F1ZA 2HQRA 2XIGA 2IA1A 5EFUA 2P4WA 3V7CA 4OINF 1ZRFA 5BPDA 1H1IA 3K2ZA 1ZG3A 2W25A 2GC3A 4DINB 2JT1A 3WW1A 4OIOF 1Z1DA 3PNAA 1TQIA 4G9YA 4GULA 2QM3A 3ABUA 1J1LA 1Z6RA 3W6JB 2W84A 1ZREA 2Z9OA 1ZNPA 5ILSA 4MEXF 4GYIA 1QY4A 1YWKA 4QX5A 5FGMA 1P92A 2DI3A 3C1DA 2OA2A 2J5PA 3M1EA 4D7TA 1ODDA 2EFQA 3LZZA 3RKWA 4XFCA 4HF0A 3JTGA 4WWCA 2GQQA 4WK8F 1T6SA 1ZN2A 3DF8A 2CQKA 3SFZA 5ICEA 3D0JA 1R23A 1V4RA 3FXRA 1MD0A 1DPUA 5E16A 3RPQA 4R1HA 5DUKA 3NJZA 2DTRA 5C6CA 4MTEA 4WF2A 5BPIA 5E1ZB 3IRQA 3GFIA 5EEGA 3F23A 2DPDA 3SHRA 3JAMZ 3FHZA 1CAWB 4ZZLA 1YS7A 2E7XA 4RGSA 2QYOA 3WODF 4MUVA 5AIQA 2JTVA 4OMZA 1YFUA 3P9KA 4YRDA 5JSPA 2EVXA 4XFFA 5HS9A 1G3SA 1G3YA 2HWVA 3CO2A 3LAGA 3CLOA 1BC8C 2LF7A 2XL7A 2VBXA 3F8NA 3P7NA 4MGZE 2DK8A 3U9GA 3KMHA 3KP4A 1ZG5A 2Z3YA 5H6QA 3QAHA 2IC1A 3SCGA 3LA7A 4XETA 2MH2A 4Q4ZF 1RUOA 1R58A 1FX7A 2PI0A 1LKNA 5I8TA 2ZFWA 1X8EA 3KGZA 2ZCWA 4GYGA 4ASNA 1GQHA 2UWMA 1XRUA 4JV4A 2A6EF 3WU0A 3U0ZA 3RJPA 3EHKA 3H7YA 2ZBKA 3KP6A 3L2CA 4JQFA 5TJJA 3MAJA 4AXOA 3CTAA 3HQXA 2H0VA 2IXCA 5ICFA 3PQKA 4XEZA 2UZKA 1MJ9A 5H20A 4NB5A 1U8RA 2EB7A 3I59B 1A04A 3F8MA 4OIRF 4EM1A 2ZKLA 1DGWA 5I0TA 3F8FA 3VOEA 1D5VA 1OI6A 3RI4A 1CAWA 4A5MA 1USSA 4AIJA 2WV0A 1NE6A 1Q3EA 3H1WA 3SZTA 4IEQA 2DQRA 2P7VB 4LLGF 1O4TA 2QQAA 2MC3A 5DD8A 1S3JA 2LKPA 4UVCA 5L3GA 4HQMA 1FYLA 1RTVA 5D5XB 3BB6A 5LGNA 2Q2EA 2UXNA 2PAKA 3LWCA 1TNSA 1G3WA 1R1VA 1P4XA 4YSFA 5FFZA 5I8YA
chains in the Genus database with same CATH superfamily
1YRNA 2O1QA 4Q4V1 1IAWA 3J8F3 1R4MB 2PJRA 4IW3A 2BQPA 3B69A 2VODA 5E79C 5CKMA 4ET7A 4YELA 3M8FA 4MGTA 1VFCA 1Y9MA 2WYSA 1KJLA 5DD4A 3T1BA 4ZC3A 2M7AA 5E88A 3S1RJ 5CZKA 1XB4A 3I0TA 4Y15A 1L7QA 3I3LA 1F15A 3E97A 3IM0A 1H88C 3ZXSA 3KS7A 4ZDLA 5JR7B 2WB1A 1B8IA 4XN3A 2UY8A 3BR0A 4Q4V2 1HC8A 1IRZA 4PJMA 2CHHA 2PQQA 3ZXAC 3SJMA 2YDEA 3AM2A 1J7KA 3VYTB 2BJSA 2VZ3A 1RUE2 5DG1A 4JQTA 1WMXA 4Q48A 2YG0A 2VASA 1PUEE 2VBBA 2DVAA 2WLQA 1HIXA 2FBHA 1FYKA 3DEWA 2C6SA 3ZMSA 1IS4A 4R79A 2VW2A 5IYYA 2DUPA 1MSEC 2JB4A 3OPZA 4BH9A 1BYHA 3E1F1 5J1YA 4FE7A 4XZPA 5BYNA 5D4RA 1WMEA 1VQKI 4J19A 4AVTA 1B9NA 3ZYBA 4HL0A 3GTMJ 4JGZB 4ZU7A 1N1SA 1RUH2 3E7LA 5KR7A 2BYVE 2DA7A 2DDBA 2A69F 3JSOA 1WCUA 4JAAA 2Y26A 3TO6A 3MF6A 2CAUA 2WNUC 2EIJH 3GMEA 3V0BA 2JG9A 4XMIA 2XLAA 1YG2A 3F21A 4J6GA 2FDKA 3HTSB 1SFOJ 2Z4FA 4FFGA 3OUIA 4Q1PA 1JI6A 3R4DB 4UUSA 2PAMA 1AL0G 3PIPF 3SYTA 1NLSA 2I07B 2JA8J 2HOSA 2QQMA 2YFUA 4Y7NJ 1F9KA 4JX4A 1ULDA 1WCSA 3IN9A 3CCLI 1MJAA 1LVKA 4LITA 3OY8B 3MKZA 2Q0OA 5TRDA 3DPUA 4X6RB 1OPOA 2WAOA 2ZXHA 2VNOA 4PQQA 4JGZA 2QSHX 4LA2A 1X2NA 4UBGA 1MSFC 4XZUG 2DT6A 1CPMA 2PMZA 3GTJJ 1YW8A 3IMNA 4GFBA 3ZYRA 1RUC3 4HVRA 2Y34A 5IP6A 4P9GA 3IH3A 5D5WB 1J3RA 1SPPA 5HI0A 2D98A 4HQEA 3BPVA 3CMEI 3DXTA 2TBVA 2J7MA 2DN0A 3GALA 4M4RA 2CDOA 2KQRA 2WL1A 5E8IA 4FVVA 1O91A 2IJLA 1FPN3 2E36A 4MQVA 1ITYA 3HOTA 4B43A 2YC0A 4UUTA 2M0CA 2NS7A 3GZ6A 1RUJ2 2ZGOA 2R041 1FX5A 5A32B 1B9MA 5C3EJ 1K6YA 3DYPA 1MACA 3N7LA 4IHTA 4P02B 3MGUA 1ZELA 3KZYA 4UV8A 3PJYA 4QPIA 2KXLA 2B5HA 2ZKNA 3OWTA 2JKXA 3I2KA 1UW8A 3WCSA 1GOGA 3HOWJ 1J1TA 5LZ6A 3O7OA 5L7OB 1LRHA 3FM3A 3Q9SA 2ZXJA 1FNNA 1UXZA 2JUCA 1S0IA 4I99C 4B09A 4KBZA 1RR7A 1RUI1 3BVCA 1LUJB 1CQTA 1T95A 1RVF2 4DXSA 4GA9A 5A2QK 2E71A 2UU8A 2J1RA 4IEWA 3HYIA 3QP6A 2AACA 1W0PA 3JD73 3TDZC 1V6MA 2GSYA 5CBLA 3MV11 4YGBA 5FBJA 1JZ8A 5CVRA 1Z77A 3OYCA 4CDWC 5L19A 4GO1A 3G1OA 1QJY2 4OIPF 2VUCA 2XBO1 1RUD1 5J09A 5FD5A 2F4PA 3SCFA 2J1TA 2WSUA 2AC1A 3KZZA 4XRSA 3WVJA 2GU9A 4M72A 5J4VA 3PVNA 1ZM1A 3VUOA 3PO2J 2J1UA 3KQ4B 4GJYA 2QFEA 5LK7B 4J1XA 3WDUA 5IJRA 2RV8A 2C1FA 2K9SA 4CU8A 1KS5A 5I0SA 2IW5A 4LLLA 5FPAA 2WQ8A 4OHYA 2ZZJA 3Q0UA 2RVAA 4HV6A 1RUI3 2ZBJA 3WF3A 2EAAA 4CDXA 4Z92B 5FWJA 3HUGB 4AI2A 1BI1A 4FPEA 3GHNA 1W8ZA 3C2UA 2L4AA 5FZIA 4FPKA 4NAOA 1COV2 4M6XA 4XJAA 1H2NA 3A0NA 5A3UA 5DQ0A 2NVQJ 3FFQA 3PUAA 2VM9A 4RR3C 3D6EA 4OUEA 4QM8A 1NA1C 2W5FA 1GWKA 1ON1A 2HEVF 2DODA 4CDQA 1Z67A 3K69A 3BG3A 2YGLA 2QBYA 4INDA 2WQZC 2XF6A 1DYOA 3CJRB 3BTCA 1RESA 3TBDA 1JN2P 1F9NA 1ERDA 4FXGB 3M7GA 1LOAA 2WS92 1XE8A 2QQ9A 1NYWA 5A6YA 2RGVA 3K9TA 1R083 5T5PA 4WM8C 4Y5Z0 4RLQA 4O5VA 3LEIA 3M3YJ 3FLRA 2OUHA 2FHRA 5LFAA 1JZ4A 2PN6A 2EXHA 4ZYGA 1APNA 2BVVA 2BNMA 2AEZA 1TWFJ 3H9AA 3UETA 1TT5B 4NIIA 2O7OA 4PFOA 1Y43B 3H1YA 3HUGA 5F3CA 2AQEA 4MO3M 3KT7A 5DS9A 5CFDB 2WA3A 3MHZA 4MGIE 3O1UA 1OISA 3HKZA 4M6YA 1R6RA 3LSRA 1FV3A 1FWZA 2P6TA 4HANA 2EILH 1QBJA 3RQ4A 2W39A 5KVRA 1LULA 3GO5A 5FR3A 1MS1A 1UY4A 4XACA 1T6GC 5HLTA 1HLVA 1O5LA 1J58A 2XL9A 4XHBA 4W50A 1ZBA3 3PIJA 2CYYA 3ZCOA 1GKBA 3S7IA 5FY9A 2XWJB 1W9TA 3K7AJ 1QNWA 2ISZA 2CUEA 5LK5A 3CQZJ 3CCVI 2DTYA 3LA2A 1CR7A 4HKOA 3RZKA 3WP6A 4R9DA 3V8LA 2HU9A 1EPWA 4COVA 2V72A 1Z21A 3JCIA 1OVPA 1QNTA 4DBQA 1MS9A 4IEZA 4PCQA 2L9LA 4J00A 2Y38A 3KV4A 5JLVA 2E31A 3JTHA 2ZJCA 4M9SA 4RR3A 1HRI1 1ODMA 2K5CA 4XJUA 4BQ1A 1RIOH 4IV3C 2ADUA 5C44J 5FXZA 2GAUA 3I3DA 3HRTA 2QZ3A 3NMBA 2MSYA 3HGYA 1H89C 2RMU2 3I7DA 4EM0B 3WW2A 4O6JA 5FQ0A 5FO9B 4AQSA 1RUG2 3T4HB 3W21A 4M3CF 1X50A 4CCDA 4NOTA 3TN93 3WNKA 5FXWA 2BE5F 4E7IA 2CQNA 3OGRA 4RBOA 1VMHA 5JCTA 1MMSA 3WDYA 1P9QC 1YHQI 4BXSV 3WNOA 3IH2A 3HJRA 4FPFA 4IV1B 5IK5A 2WWUA 3LDBA 3E0JB 3DTIA 3RZLA 4XDOA 3BU7A 2VKEA 4LUKA 3KYDB 3AL0B 1FOKA 3ZXDA 4RB2C 3LSIA 1BR2A 2RJ2A 2AS5F 5FYCA 5LY1A 5E3LA 5T5LA 3DPTA 1IDZA 2TCTA 5DPNA 1Q43A 2B9SA 4RR3B 2EALA 2P1BA 3IC7A 1HRI3 1CWPA 4YG0A 4QPIC 1RXGA 4EM2A 4GCVA 1HXS1 3RI9A 2PTMA 3V7SA 1FYUA 1TW3A 1HRV3 1O59A 2E5NA 1OQDA 4IE0A 3FHNA 3ZO0B 1PX4A 4RAFA 5T50A 5FRNA 3BR1A 4R4XA 1ZZCA 3NARA 2UWAA 5F2WA 4YEJA 3LSKA 2WA4A 1MEC3 1V0AA 2RE9A 1RHI1 2YU1A 1QVUA 5E8GA 1R64A 3FHQA 3EDPA 4QAWA 4YGEA 5CPRB 1VRH2 5FP8A 2LMDA 2KFDA 3ZMVA 1YQ8A 1C1LA 2ORXA 2HFHA 4PDKA 2BFUL 3TOBA 5JHFA 2VBDA 1G8XA 1S2BA 2I2SA 3MZYA 1AYN3 3IIIA 3WQ7A 4M74A 2O61A 1JYTA 2Y6JA 4ZZ8A 1JT6A 2WO3A 2HWD2 3ILRA 3AVSA 2RR13 4M3GA 2R061 1YJNI 2KIUA 1H4HA 1VBA2 5GZDA 1PGL1 4HKLA 4DQ2A 3AFKA 3NNLA 4QPQA 2VCMA 2Z42A 3ST7A 2QQVA 1K3IA 1NAEA 1E2XA 1SBDA 2KKOA 1PK6C 1VI0A 1G4DA 3DEEA 4Z2WA 1MJBA 3DFGA 2C9KA 2V4VA 4D94A 3WDWA 5BNPB 5FLXK 3AFGA 3A02A 1QNYA 2CO5A 2AREA 2NMNA 3A0HC 3ZSLA 3M8LA 3CMGA 2LY9A 3RKYA 4FPLA 5LGTA 4ISQA 1YJLA 5JZGC 2TRTA 3NV2A 1JXNA 1LDJA 1MZ5A 2MABA 2ZNZA 3M2MA 2I74A 3D0SA 1X8MA 3DPRC 2ZABA 1YQCA 4XFGA 4YIIA 1K5MB 1QJY1 3IPVA 1Z78A 1YIFA 3MFAA 3JAMK 1QJU3 2VE9A 2XOMA 5D8LB 1XC6A 1UCXA 4J25A 1XGSA 4AHXA 2OKXA 3ITQA 1SEFA 1POV3 2ZXIA 1CF7A 3CP2A 2EBIA 3WGGA 1XGOA 4YFNF 4RB3C 1MEC1 3EQLF 3IAQA 4CUBA 1ZZ6A 1IRXA 3CDIA 4QB1A 3WHTA 4CPBA 3WNXA 3LSDA 2K86A 3N7JA 4M9ZA 4LBNA 3O12A 2E34A 1JUIA 3QQAA 4UW6A 2L7FP 4JKKA 2YHJA 1C4RA 4Q8KA 2E33A 1AYN1 2WR9A 2VT3A 4XLEA 3RZDJ 1G6NA 1A6QA 1HW1A 3S16J 1NG6A 2VNRA 1N77A 5GM0A 3ZYPA 1W5SA 4AD9A 4JQRA 5IYDJ 1JHNA 1U78A 1GNZA 3HWJA 5FYMA 3ZFFA 3WT3A 4YRVA 1IXSB 4Q0PA 1HKTA 4NJ4A 4HG2A 1TNTA 4HG6B 1O8SA 3EMRA 2OPWA 2WNVC 1ETQA 3KHBA 1QO0D 4F93B 1WJBA 3IPVB 3HMYA 1VTNC 1PK6A 3N35A 2FCVA 3LSEA 3U1KA 4QX2A 1YFXA 3V4GA 2CWEA 2X09A 3VZNA 4M3BA 1D8KA 5BUVA 2ESNA 3SZGA 5C8WA 5IVEA 5FLJA 3VL9A 4RMNA 3LGRA 2H94A 3PTYA 3CCEI 1QZYA 5CFDC 2XXZA 1O7LA 3TMOA 3V0AA 3LKJA 3JRBA 4P9FA 1N1VA 1ZHFA 1UZZA 3RVHA 1X19A 3VBSB 2EV6A 3CBNA 1ODNA 1YOVB 1PUFA 4XURA 4EZ4A 1Y6IA 4TZDA 3RIRA 5EG0A 4E9KA 3J4UH 4F3QA 1AYN2 4JC1A 4GRIA 2COMA 1B6AA 3GBFA 4LG0B 4CXYA 4JHZA 2V6EA 1LEAA 2JDUA 1JZ6A 2YYOA 4OMYA 3JREA 3HOUJ 5F6FA 5K4LA 4A2UA 3D5LA 2VE8A 3MIEA 3WTXC 4YW2A 3BCAA 3THTA 2EXKA 4Q4Y1 3ELKA 1EJ9A 2K3FA 1DQ5A 2E9QA 5FPZA 1AL21 2YC4A 2VUMJ 3L9FA 4L0PA 4FAHA 1I3AA 1ZBA1 4S05A 1V6OA 2V6CA 1KRIA 3SXYA 2WZR2 5IYBJ 1UJ8A 2K4BA 3L2HA 4PSXA 1VRH3 3N7MA 1WBFA 2E7AA 1YHFA 1WW7A 3POSA 3IKWA 3LOIA 4KQ7A 2JENA 2NYXA 1GP4A 1XNTA 3R6SA 3TEZA 1YIOA 1ZZ7A 2GP3A 3CZUA 4E7ZA 3WG4A 3FXMA 4UXNA 2KRFA 1VQNI 2VECA 1QMJA 3RPUA 1PJRA 4V2FA 5JVTA 1HJGA 2G19A 1E3PA 1W6NA 2RJKA 1OA3A 2Y48A 4BQOA 3ZR8X 3U37A 4PQ9A 1BMV2 1TT0A 4YZ1A 4WVMA 1W8UA 4QPGB 2GM4A 1HXS3 3B9CA 5I0UA 1AVBA 5FOBB 3SFIA 5CFDA 1YQ5A 1R5ID 4HN1A 3HSRA 1VQMI 1W7PD 2CUJA 4Y5SA 3U14A 1X1CA 2CV2A 5EPAA 2F2EA 4V2GA 2J1AA 3DEUA 1TEIA 3QOEA 2YS9A 3NAPB 5FKOA 4LKSA 1GZ9A 4L92A 4NC8A 3MKLA 3IDBB 5L9VA 1O8PA 4HKWA 4L5EA 2A07F 1Z91A 5CFCC 4HNTA 3TYJA 4AF9A 2FBIA 1U5IA 1M4WA 1ZLKA 2ORZA 4BQNA 1WZXA 4YGDA 5BV6A 2HYGD 4META 1YEWA 4JDOA 4E4HA 3PFIA 1W5TA 2LALA 2BRTA 4BA6A 1QF3A 4ASKA 3NSTA 3B94A 4CDXC 1SACA 4B8XA 1Y0NA 4RS5A 4UHTA 2H0BA 3CF6E 4DIQA 4Y1VA 4A3DJ 2QQLA 2Z99A 3SH4A 4RLFA 3NQHA 2MD5A 3CJIB 4IESA 3Q9VA 2A1XA 2C24A 2EIGA 5E1XA 2LM3A 4Y5TA 4KFCA 1KYZA 2QCOA 4NWVA 3BZKA 2STWA 1JKRC 4Q4X3 3HHHA 2XBO3 2ZAAA 2EV5A 1SLCA 1LGCA 1YUDA 2DCKA 4DGWB 1GXQA 2W57A 1UY2A 4FPOB 1OFCX 4O3MA 5M5XJ 5DUXA 3OYGA 4Y1YA 5K7FA 5C5TA 3IUOA 2JDKA 3K4NA 5L73A 2LC2A 4I02A 1S6LA 4QX7A 3ZIXA 2MW8A 2BWAA 3H5NA 1R71A 2X53S 1TC3C 2C26A 1NKGA 1HXDA 4KWUA 2FNAA 2K27A 3MFKA 4XJWA 2F17A 3I8TA 2HEOA 5F3GA 5GTHC 3IV5A 3PNVA 5FZDA 5BNPC 1U6GA 2DV9A 3VB2A 1RUG1 2VXRA 3MCZA 4JK1X 4WBBA 3P9CA 5A7QA 2A5YB 5A33B 1W2OA 1SHWB 1XGNA 1N75A 5IVCA 2X1DA 3FLPA 2BU9A 4UFLA 5C3RA 2ZGKA 3JRIA 4AVPA 1H9TA 4D9JA 1JUMA 4QHOA 1MIJA 4SLIA 2KT0A 3H3UA 3WY6A 2BEOA 6PAXA 5IFPA 3LFMA 4QQOA 1XSDA 3U10A 3W6VA 1RUJ1 3SH3A 5CU1A 3OIOA 1YITI 3F9KA 4E8DA 1GUUA 4D7YA 2IA0A 3NNJA 3F95A 3CMAI 2WNVA 2R073 2R1DA 2R0QC 4R4ZA 2HI3A 5KXEA 4DYQA 1F5FA 4I3GA 2UYAA 2AXTC 3I2OA 1JODA 3URFA 3FKJA 1LNSA 2M1BA 1VB4A 3ROUA 2V73A 4XPVA 4D0PA 1OUSA 2YPJA 2GP5A 3PIGA 3QCWA 2IZWA 2O0YA 3PSFA 4XJ8A 2X05A 2BPA2 3RZZA 1RUC2 4HK9A 3VZKA 4I01A 2VMFA 2L2OA 4ZH4F 2RM23 2BZTA 4XDPA 3A1YA 2M9HA 2WIIB 1YW7A 5KWRA 4BHPA 4RS8A 1HA8A 2P5BA 1MMGA 1GZWB 1FMVA 5HODA 1C57A 2YFZA 1IN5A 3JSPA 3WHUA 2X5IB 4HLXA 3TBIA 5FMOS 2CFOA 2CJJA 1PO12 3K4KA 4ZZDA 3BOQA 1WZ2A 5H9PA 4XIDA 3KLNA 2DPUA 4BMBA 2XAHA 2A61A 4ITVA 2XHKA 3O1OA 3NJXA 4XLNF 2ET7A 1OURA 4RGAA 2WA0A 4LXLA 2ICWG 4LOCA 2CMPA 5FDBA 3BP8A 1TMF3 2XAUA 3W20A 4MEYF 3UNGC 3OUJA 3FZVA 3POJA 3RCOA 5FBZA 3KD4A 4F8AA 5BNGA 1AA7A 4WVMB 2V1UA 3RYRA 4OI1A 3GJBA 3GCMA 1UHWA 2NYYA 3MDPA 1UMZA 3KB5A 1WMDA 3ZFEA 1TBXA 2PHRA 1SVLA 1BXHA 5FZCA 3THCA 2W87A 1QJY3 4MV2A 1PGW2 1VQPI 3PQJA 3L2WA 4BXFA 2W0XA 1PZ7A 4LA3A 2LP0A 5GLZA 1ZQ3P 4GD4A 4B7EA 2W1OA 3G1LA 1LOBA 2FBEA 4FHTA 3OEBA 4QT6A 2WNUA 5D5UB 2XUBA 3AYAA 3H8UA 3AKPA 3R4KA 3KEYA 3VKMA 2WFPA 5HXMA 1S72I 1PDNC 2RS12 4NC7A 3E6MA 1QH7A 2LK2A 2D93A 2WFF3 2GOMA 2PLV2 4QGMA 5FKBA 1W0TA 1QIQA 3ILNA 1QJX3 2BWCA 5FFXA 2LNBA 4IXAA 2LSOA 3HPNA 4CA0A 3N9PA 3LOBA 3WW4A 2RJLA 1FZPB 2XGCA 1UU6A 1WH5A 2VONA 3IKVA 2FXAA 2AZ5A 4QQHA 1U5TC 5J4YA 1R1A3 2IUWA 1P4AA 3VBUC 3AL0C 1BI3A 2WJSA 4E4SA 1VJ2A 2MPFA 2F5VA 3KV6A 4XQDA 3PUIA 4I7HA 3PURA 5BNNA 1G3TA 1IDYA 1QPIA 2DVBA 1ZR4A 1WW5A 2OUMA 1D4M1 1BOBA 1WJEA 5DV5A 3KF5A 5KXBA 2XKPA 4CU9A 1R082 2KD7A 3BPSA 3NL1A 2R7SA 1AXYA 3B7MA 4EJWA 3PNTA 4ZS2A 3M3EA 2ZEXA 4Q27A 4QPGC 3LIGA 3OYLA 4R8HA 3CJQB 2WC2A 5B4XA 1HBXG 3SEQA 3WQ0A 3ZR5A 1FBSA 3LSPA 4L9BA 3ZGKA 1FMD1 3MWMA 4IV3B 1AR83 5K5RA 3H1CA 3KV5A 1MBHA 3JRHA 1WWYA 4BHBA 3V65A 2WWSA 5A3TA 2XVLA 1PVEA 5KXCA 4JP0A 1YO5C 1X1PA 4KUMA 5E20A 2CQXA 2Z5WA 1L7LA 3CQOA 4DO0A 1LOEA 4XABA 2PG4A 2OX0A 4BLIA 2DDAA 4P5OA 2PEXA 2B45X 2XGEA 1X9TA 3I5UA 2DYRH 3J8F1 2X85A 2Z16A 2OIIA 2XB6C 4LFUA 2P17A 3VKFC 2XAQA 4AWDA 2XIGA 3VV1A 5EFUA 5T55A 2CNAA 3K4CA 3VKNA 1FTZA 5SV5A 4FFIA 1ZRFA 5BPDA 2A6ZA 1LHOA 2ECCA 3K2ZA 1ZG3A 3RZJA 3T4VA 4OIOF 2XG3A 1V6NA 4G9YA 4GULA 1ETOA 4E7HA 2QM3A 1W6OA 3ABUA 4RM3A 3IH4A 1D0XA 2X5IC 4M01A 2RS32 2VZRA 3EUKL 2BY2A 3TOJA 4MEXF 1YWKA 5FY1A 4QX5A 5F39A 1NCRB 2J5PA 2XJSA 3IDAA 2W92A 4TYSA 4D7TA 4N53B 3RZHA 4QXBA 4NO4A 1LU2A 4XFCA 1QJX2 2VIXA 1UG0A 5A3LA 5FP7A 2JQ7A 2PN5A 2PHWA 3WR0A 5ICEA 3D0JA 2E7QA 1V4RA 5FKNA 5GALA 1S0CA 4M3CA 1LGNA 3S30A 4R1HA 2GMPA 2WN2A 2CW8A 3LQCA 3NJZA 2DTRA 3OR2C 3IRQA 4XAAA 4TLGA 2DPDA 3SHRA 3FHZA 1CAWB 4ZZLA 2WZ8A 1AR71 2JTVA 3CCYA 4OMZA 1D1CA 1JYCA 4YRDA 3U4XA 5HS9A 4EN6B 3CCQI 3PHMA 1NXD1 3PM1A 1Y1WJ 4A6OA 4JDMA 4YW3A 2VBXA 3F8NA 3P7NA 4H55A 3BN6A 1QJX1 1J09A 1HQNA 2VCCA 5T54A 2GOXB 1WCKA 5AC92 4H14A 2I8DA 4NRPA 1LEMA 2L7KA 1RINA 2IC1A 3SCGA 2ZA9A 1JZ5A 2ZHKA 3QYFA 2MH2A 2FD5A 5H9RA 4YVWB 3SEEA 4CH7A 2R7ZJ 1RUOA 1VE0A 3W58A 1V9U3 1LKNA 3GZTB 1SLIA 5IOZA 2PMZN 3RZGA 2VQUA 1RMU3 3C8XA 4JV4A 3WU0A 1HX6A 4HONA 1V9U2 2JEMA 3EHKA 3KP6A 2NVUB 4JQFA 3AMPA 5IVYA 3MAJA 4GAZA 2VUAA 4AXOA 1WJDA 3CTAA 4UFJA 4QDQA 3PFYA 4C9YA 2QTWB 3PQKA 4OHWA 3CJTB 1MJ9A 4LK6A 3GTLJ 5H20A 4NB5A 1VQ7I 3I59B 1G9AA 1A04A 2DUQA 3QYBA 4BE1A 1Y39A 2K40A 1OI6A 1CAWA 1IOAA 1IJWC 2RV9A 4AEDB 4AIJA 2WV0A 1FV2A 2HVQA 1JZ7A 3QLQA 4E7JA 2HYJA 2DQRA 1W3VA 1FOD2 1A6CA 1MQTB 2A6WA 1QHGA 2DA4A 5DD8A 5EZHA 4LBQA 4H4KC 1TNRA 4M0NA 4HQMA 4XORA 3BTXA 3BB6A 3PUFA 2BP6A 2UXNA 4HPKB 3UYJA 1BBT2 4YSFA 4WM8B 5FZ7A 2P7CB 4DZGA 3T0AA 3L09A 5F08A 3N05A 3BR5A 2L9VA 2R043 4IV1A 4Y1UA 4QD2A 4AW7A 2A3WA 1QHHD 1UQXA 2ZJPF 2Q5TA 3B9IA 2M30A 3WTTC 5I8SA 4U0YA 5K0UA 2X6WA 3CJXA 3VDXA 4Y17A 5CADA 1RUJ3 3LOCA 4BQ5A 5FZGA 5C8CA 3WNNA 4BGDA 1UOJA 2VH9A 1LHVA 1KXGA 4BAYA 2RN7A 4PJNA 1H1AA 4LO4B 3KLSA 2G9WA 4A3EJ 1OLME 5J98B 5J96B 2NN8A 4GQ7A 1OPCA 2VPVA 3AZWA 4U0WA 2QCSB 1WGPA 5F5AA 2L9RA 1WH7A 4DZJA 2DFFA 1CAUA 1PZ8A 4M6VA 4S2DA 1QXPA 4JKMA 3GCWA 4AFMA 5HCAA 1BL0A 3KP7A 1V6LA 1W7PA 5DM7F 4C8DA 4BISA 4ZYEA 3IDCB 3OGVA 4QPGA 4C3IJ 3VZOA 1LJ7A 2XV4S 3BG5A 3DEMA 2PJRB 3BY6A 4DXRA 2ELHA 2W08A 3OPTA 2FEZA 1UKGA 4L9JA 3U78A 1QDOA 3VBFC 4HAMA 4AG4A 5L9RA 4WM7B 3VBUB 1X1AA 4WZFA 2K9QA 2HR3A 5IHRA 3LB9A 1JUHA 2WAEA 3ZPYA 4CCNA 5JUVA 4QPWA 4AE2A 2JVHA 1NA1B 1AR73 4CYDA 1X9PA 4Q8LA 4GXLA 1BA5A 2BV6A 4N9HA 1XX5A 2D6KA 3HZJA 4ZPIA 3ERMA 1HDKA 5LY2A 5DZGA 4CEWA 4HDVA 1H6YA 2R5YA 1OLTA 2O3FA 5DAPA 2VUDA 2AO9A 1SLBA 4CGZA 1VALA 5L3FA 2DMTA 3B6AA 5EJZB 1NY72 4PIYA 1MEC2 3MEPA 3KCYA 4M3CE 5DAVA 3OMYA 3ZPLA 4YW7A 3K4JA 2W9XA 2JZYA 4L5JA 2L54A 5JZGB 1QQP3 3IKTA 5M5WJ 1S55A 2CV1A 1FPN1 1A35A 2DFCA 1WI9A 4LG3A 4IV1C 3FXUA 1XNAA 4QHZA 1MGTA 4BUPA 3DU6A 1OQYA 1UMHA 4ORFA 1MZEA 3ACFA 2XH6A 1FYMA 4P9WA 3FM5A 2KDZA 2ESHA 2MHFA 1O4YA 2HWD3 2K9LA 3CL1A 3MIDA 1T38A 1P2FA 3P5JA 4YG2F 2RDSA 4AYUA 3H0OA 2RS53 2Y8KA 2WADA 3CF5F 1ACIA 4PJLA 1OH3A 5DCMA 1EYBA 1BI0A 2VBZA 4WXCA 3HIFA 1VLNA 4XJZA 1ASJ2 3RNSA 5GJ6A 4NROA 1DZRA 1W2AX 4EWAA 2G1MA 1J59A 1RZ4A 2LUWA 2HQAA 2NRAC 5AIPA 2YV8A 5FJHA 3NWKA 1JOBA 1W2NA 1MQTA 4UAPA 1BHGA 1RXFA 2BW8A 5F0HA 5A80A 3M8JA 2HNHA 4WCGA 2Q30A 3QRFF 3LAPA 3O0WA 1FBQA 4GMP0 3BOPA 3W2VA 3E1SA 2DU1A 3BYWA 5EYXA 3NEUA 1IS6A 2QENA 1RC6A 3VBOB 1ND3A 2ID4A 1B1BA 2DCEA 5LHHA 3GBGA 2XB5A 3NNFA 5EJCA 5IP7J 2R7WA 4EYUA 1XMKA 5EF6A 1AX1A 1W7PB 1W4MA 4CYCA 3O0VA 5LASA 1UZVA 4CEWC 1SFUA 1YFYA 3M7AA 1LENA 5IT3A 3BIEA 3MPBA 1QXRA 2WZR3 3KP2A 3OSFA 1JYWA 3GDBA 3IWFA 2JUGA 1ENHA 2VB6A 3FBMA 4PJJA 4NIAA 1JE8A 3RFRA 3HJEA 3ZQHA 3IZOA 5FYUA 3JD72 2K3PA 1GZWA 1BEV2 3PSIA 2BW3A 4YG6A 3DBRB 5K1YA 3FBYA 1W8OA 2JDMA 3ERED 3DYOA 3UT0A 5FZ4A 1VMJA 3T2PA 3H1MA 1FPQA 2PYTA 4K21A 5IYCJ 1GR3A 1GZCA 2VXZA 1Y3TA 4GXOA 5ERLA 5K7ZA 1K42A 4V2WA 1D3YA 2D5VA 2QUFA 4DJAA 4DYRA 3NO8A 5FROA 4HLYA 4L99A 1BVP1 1Q1VA 5ANNA 1H30A 4HOOA 3A0BC 4Q1RA 5FZ1A 2VOTA 2HWB2 4HFSA 2OV7A 4KGGA 3PU3A 5ILVA 2V7FA 4LB5A 5JOXA 2P8TA 4KIBA 2WTEA 1UPIA 3OOPA 1PVC1 2JKBA 5IVJA 5IFTA 1UY1A 3Q8AA 3MEXA 1XJAA 4NPLA 4LHNA 3ABMH 1UB9A 1OKOA 1OCZH 5HV4A 4RB0A 3GTQJ 3MF9A 5C9AC 4H2AA 4PJ0C 4OUMA 3FHAA 4K40A 3BODA 2LDUA 4AR2A 3VBUA 2UURA 2E7WA 3KWVA 4DUWA 4BK4A 3PJQA 2GXGA 3I3BA 3SLIA 3VODA 1NLQA 2ZMNA 1KEXA 4XFBA 4LOSA 2JECA 4LIUA 2EIEA 3L2QA 3ZN6B 1RETA 4G6QA 2JRTA 5LHGA 5FPBA 1QQP1 1QGLA 5A7SA 1DGRM 2BXZA 1IN6A 4B4RA 4D7MA 1LEBA 3I2IA 4MHRA 4HPQA 1GP6A 1W6NB 4HBLA 2F6BA 2WUHA 3KHCA 1GICA 2GN7A 2M45A 2IFRA 2XSDC 1AX0A 5FUNA 1LTEA 4FFHA 2Q0AA 5A33A 3VHPA 3MI8A 5KXDA 2ARCA 1VNDA 1VBD2 3WD5A 1XDSA 3K1NA 1QU0A 4EJRA 2E2HJ 3VBFA 3WXPA 2DFIA 4HA8A 2NMOA 2A7AA 5A7OA 1UY3A 1RIRA 2DA6A 1DF0A 2KL4A 5F3IA 4PK4A 1ZK8A 1YX5A 2BHZA 5M0TA 3IAPA 3WTSC 4XICA 4FPCA 2ERFA 1DU0A 3DXJF 4F55A 1TME3 2QWWA 3K10A 3A21A 4CA9A 5E1WA 2NNYA 1MH4A 3ASNH 3QPSA 1YLLA 5L7OA 3KV9A 4R9CA 1UZ0A 3I58A 1RNLA 2K7LA 1Q1HA 3C18A 3VBSA 3EB7A 4OQ9A 2E63A 3RI8A 5JXGA 3OGJA 4ANJA 5H2FC 4RGUA 5EQUA 4YM0A 1PIV3 3MW2A 3O3KA 5C70A 1VBA3 3JCUC 2X5IA 3MLKA 3G3ZA 2H6BA 1W0NA 1TE1B 1PP8F 4PT6A 1Z7S3 2SBAA 1K78A 2E1NA 5HDGA 1SDWA 2C5DA 1WHUA 4B3AA 1ST8A 2PMHA 1XSVA 3PO3J 2QUOA 2Y6HA 3RYPA 5FJKA 3HD8B 3NW4A 2BW3B 4MGRA 2KJCA 1RJ7A 4Z07A 1PVXA 1YTYA 2R7RA 4YVWC 2OAZA 4A5NA 3UKTA 3HOBA 4H7LA 5HCHA 4FCYA 2B7EA 1S29A 2ECBA 2RDRA 2HOAA 5EGOA 1BIBA 5EWSA 5JOWA 1YQ6A 1S9HA 3HNYM 2E53A 2BFUS 3QH6A 4JYKA 3UK9A 5L9BA 5LA0A 2FU4A 3S14J 4BACA 3LEGA 4K1ZA 5F9TA 4A7YA 3AG2H 5IUQA 2DTZA 5DAWA 3HEFA 2FMYA 4BEHB 5EV7A 1TG7A 3WUCA 4AVVA 3BR2A 2X10A 5C4WC 1UNBA 1S7EA 2W1UA 4Y22A 4D7NA 1KA8A 1K7AA 2QQJA 4XLPF 1RPWA 4A3BJ 5DDJ3 5C3QA 2PMWB 3PVEA 1NTCA 2IGMA 4N53C 3WNPA 3CF2A 3CP8A 4L9VA 3L2RA 5CQGA 2GC2A 1KQ8A 2VW1A 5JI9A 2DDUA 1QPMA 1J3PA 4CDQB 2OCEA 1CF7B 3KPHA 3K2AA 1O4ZA 4G94A 4E27A 2VD7A 3FHIB 1W6PA 4LKEA 3N36A 1KS4A 2EXJA 1BI2A 3KP5A 4EROA 3OBAA 2AYHA 2EH3A 1CVNA 2P3YA 4MQ9F 1ULGA 1TWHJ 4LG0A 3RRDA 2W91A 3ZMUA 3VBOC 2WFF2 2D1HA 2F4OB 5B66C 3Q0WA 4E2GA 4EVIA 1JS9A 4IEPA 1WKMA 4H7MA 3TW7A 5C5UA 1HKQA 3S15J 2W1WA 3VSKA 5JHUA 1HB4A 4LOTA 3WE2A 1UX6A 4O9GA 2KJBA 4WVWA 3T0YA 2WZPP 1P7JA 4BPZA 1E17A 2HTJA 4MH0E 4L0ZB 5A3PA 1HXS2 4IEOA 2HXOA 3AZXA 3I97A 3CCUI 2EJRA 2ME0A 4MNUA 1FP2A 5HV0A 5GADJ 2YX7A 5J47A 3HSFA 2M8EA 4CCKA 1O6UA 3LPGA 5F7UA 2GLOA 1CX4A 1KQ0A 1AKHA 1W1WE 5FLHA 1S8NA 4JVAA 1POV0 4WM7C 1FI2A 4IEYA 1X3WB 4NIDA 1WA6X 4UXAA 1BW5A 1KU2A 1LU1A 2VU9A 4L0YB 2FQ3A 3LSJA 3SZPA 5C7GA 1K78B 5E3MA 3PUBA 3FFZA 4ITCA 1OA4A 2VBWA 2V4JC 2R92J 4C2MJ 3U1XA 1FSHA 5LBFA 2F6CA 3E3VA 5J3UA 3CO6C 1ETYA 2X48A 5FZKA 2ID3A 4JX0A 4IHSA 2JB8A 5FUIA 3L2YA 4KU8A 5T5JA 3HRMA 1CAXA 2VPRA 3AB0A 1Z3XA 2JE7A 1HV0A 4CEYC 3WLUA 5JMOA 1UHSA 4D1QA 5FPXA 1SVMA 1UZWA 3ZN4A 1U12A 3HHGA 4N0BA 3JRDA 4QB6A 2ETHA 4AI9A 5LRRA 3SEPA 1MMAA 1AXKA 3CJIC 2L9NA 5CYYA 5IK7A 1MZBA 4NWWA 3LCPA 4PBOA 4DXZA 5IAXA 2O6GE 2PFBA 2WBKA 3ZYFA 4M4PA 2IXSA 3KGLA 2R4GA 2X9DA 1H8TC 1KD7A 5FY7A 4L2NA 5LEKA 2IGNA 4Z2YA 5J6XA 1HDPA 2VJ4A 1Q8OA 4A7ZA 1W28A 5IT9Z 1W8WA 4RGRA 3ZYHA 2PMUA 1KZHA 2P4EA 1JKQC 1F2NA 3LMMA 1SLTA 4ZS3A 4MIMA 5DAQA 2P2KA 2XAFA 2Z2SB 3ULQB 1NXMA 3O8GA 1CGPA 4HLTA 3RG0A 5K9YA 2VO5A 4FT8A 4ZKTB 2ZGNA 5C4JJ 4A0YA 1O4XA 1GBGA 1D0HA 5FZ9A 4C3JJ 3R0AA 3N9NA 5DDJ1 1QJZA 1POQA 4I09A 3I59A 4AUXA 4IKFA 3OYMA 1OPMA 2ZGSA 3FBIB 4C30A 2DAOA 1YXWA 1BMV1 1I1GA 1YX3A 1IRFA 1XNKA 4LO7A 2EWNA 1K45A 2QQBA 1IPSA 4XJ9A 3WF1A 3F8CA 4J1WA 1L3LA 2ZJ2A 3MIHA 2A3SA 1JOPA 3WV6A 1GFF2 5LEJA 1UU4A 2QDRA 4LK0F 1QZZA 1U2WA 5FP3A 2ZX4A 2L01A 3A4CA 2ELKA 2B9VA 2XUMA 1YLFA 3ZXLA 1UFMA 3WGHA 1WFXA 5J48A 1T56A 3BIWE 3WG1A 2VCBA 1REFA 3EBRA 4DNYA 1DIWA 4LPLA 4P5YA 3I2JA 5DEQA 2FX0A 4R9BA 2YU3A 4AEJA 3VEPA 2A6VA 5DUWA 4LBMA 5LGUA 3QPHA 3PU8A 2CFXA 3P3PA 1HRV2 1S4CA 1QWRA 1MBFA 2P3JA 4FOQA 1DQ6A 5BMZA 3AXEA 1GU3A 1B4AA 4YM1A 1WCQA 5D4SA 1J9IA 1H0MA 3BU0A 1UKRA 3CJIA 4C90A 4XF1A 1GOHA 1US3A 1ZARA 4RQPB 2ZEYA 1OF4A 4YW5A 3BPXA 2ZGLA 2V1DA 2X6OA 3GZEA 2C9AA 3DPRB 2CU5A 4BU2A 3OYWB 2DCYA 5LCWL 1GYKA 1HJFA 3GFLA 2R072 3KETA 4TV7A 1PP7U 2XJUA 2O14A 1N1TA 3Q8EA 4ASLA 4E70A 2HJIA 1FT9A 3JBG1 4Z2AA 1XNDA 2JG9C 1QA6A 2RDNA 5A1FA 1OUXA 5JAXA 4EJTA 4LO8A 2QKMB 4N43C 2XASA 2GNTA 3VBRA 2Y0IA 1DGRN 5CKTA 1IHMA 5FXXA 4K3UA 2M87A 4DY3A 2KR2A 4NVPA 3EUHA 3J7AY 4K1YA 4ENNA 3ZYGA 5A3WA 2PBIA 5HDKA 3VBOA 1KDMA 4ZYHA 2VMHA 4UT5A 4B7KA 3T2TA 5C4WB 3OYJA 2M34A 2B0LA 3ACIA 1I39A 4AEKA 1PO11 2OS2A 3O1SA 3ZFFB 1OOPA 4QU2A 2JDPA 1NOVA 3HN3A 2X0LA 1GVJA 5FD6A 3J81K 4QSHA 3DLLF 4AVSA 3FMGA 1RUD3 2BDRA 4XF4A 5C3OA 2JE9A 5JWPA 3GTOJ 1LOGA 2PAEA 3OS1A 2K9NA 1REPC 5CIRA 1VF9A 4XF9A 1AJOA 1C8M2 2TNFA 1NK3P 2GH8A 4CZSA 4CZZA 2VMEA 3J26N 1Z7S1 5FO8B 1ON2A 4GGGA 4MVTA 4WM7A 2GDFA 1YI7A 3GF6A 2BVMA 1W6QA 5KCMA 3WW3A 4G7ZF 1W8FA 3M3QA 2L5QA 1C0WA 4BJ5C 2YU9J 4UYBA 2MBFA 4E2QA 3QH7A 3SDGA 2CUZA 2Y0SA 4EJVA 4LT5A 2P5KA 1ORKA 5FJ8J 3CDZB 2HWC2 4LEJA 1HRI2 5FYBA 4NAMA 2YX4A 1A36A 2LY2A 3WTYC 3T8TA 2DMUA 4YLZA 3WHBA 4LBQB 1J75A 4Y4RA 1SFYA 1OR7C 2W4SA 2HBUA 2FDGA 1Y8QB 3ZYIB 2VQLA 2Y0OA 3ELNA 1L0OC 4ENKA 5F6KA 4OCTA 1L7RA 5JLWA 2V26A 5H6RA 4XBQA 1Z0XA 1UOFA 1K5MA 4LO6B 4MZUA 2B4KA 2P34A 2Q4SA 3TP3A 4V19K 4HF2A 3M1HA 3KEQA 2QVSB 1WCDJ 4YM3A 5F3EA 3O5SA 1X2MA 5J3LA 3OYWA 1BN5A 4RHV2 4NRQA 1B72B 2ZKZA 3V7RA 3K46A 3VWBA 4Y1XA 4RQPC 2PFWA 5F5QA 3OS0A 2BOJA 3TN91 4XTPA 3OB8A 4DFSA 3JUUA 2E35A 1TQMA 2M5WA 1WCMJ 1AHDP 5CAZA 3D5SC 1IXRC 1GQPA 2PHUA 4MGKE 2RR12 2J1VA 2IXJA 4KICA 4XOPA 2ZZQA 3WQ1A 5CLSA 2JPCA 5ACA2 1G9FA 1UMQA 1IG7A 4CEYB 1UYZA 2WNEA 1QGPA 3UKGA 3N9QA 1GP5A 3BUCA 1XPXA 1F8VA 1S0GA 3KE2A 1MS5A 4LTAA 4NPMA 3DCQA 3PVOA 2E1CA 3ZQCA 4CDUB 2DF7A 1MNMC 1OSGA 1BW6A 1YE9A 2PLYA 3W59A 3AMMA 4OWRB 4IRHA 1DZTA 4CE8A 4UI9L 2LFBA 1ZRRA 3K70C 1V70A 5FRMA 1B72A 4ZZ5A 1IG0A 4ATFA 3GXOA 3FK7A 3M4FA 1C8M3 4NQWB 4MSVA 2V9KA 1YRNB 1BLZA 3UV9A 1W8HA 2LTNA 4ZHNA 4YW4A 1LR5A 2VQ0A 3JR9A 3R60A 4GH4C 2XJPA 2LROA 4IXLA 2X6YA 4CVUA 2D3SA 1OR7A 4M3FA 2XJVA 2QDNA 5GKAC 4COWA 5JFRA 2B8MA 1SCRA 4D8MA 1U0AA 3WINE 1WJ5A 4DZPA 4N7UA 2KM2A 2WO7A 5FREA 5FZEA 3CO7C 4CDGA 1W8NA 3SITA 1XMXA 3BTJA 1OQEA 2VJXA 5LLQA 4QDSA 1X3ZB 1LFUP 2IA2A 2A3YA 5EIYB 4K20A 1JXSA 4XNFA 1JH5A 2GXAA 1SPPB 5BOXA 2OXBA 3ZPOA 1M1EB 1GMMA 1H9WA 3KVAA 1SVOA 1OCPA 3TNQA 3ZFGA 4A3GJ 5FPVA 3WP3A 1VP6A 1BK0A 1YQAA 2CG4A 5JIUA 1ETXA 4N90A 3H8RA 4XUPA 4GWIA 3NNGA 5B1AH 5JSRA 3HT1A 4LBQD 2HKXA 4CP1A 3DPLC 4Q47A 4FTHA 3OSDA 2ZFUA 1MBEA 3RKXA 3L2UA 1WJFA 1RUI2 1Z6TA 3I3QA 1F36A 4CXFA 3ZN5A 1QJU1 1W0OA 2OQ7A 2OQGA 2BVLA 4BNCA 3GM8A 4A6SA 4UNOA 1BR1A 2WZR1 2F5FA 5FO7B 2CDPA 4UFHA 1JKPC 4U88A 2K0GA 4L5IA 1IKPA 2WB1N 4JKLA 4LJZF 1GSLA 3AYEA 2WN3A 1OT5A 3ZM8A 3KSCA 2VKHA 1N25A 4HSTA 2D6PA 3GXUA 4QXCA 5B4NA 3V56A 1LE8A 3BGAA 2OC6A 3J8F2 4KITB 1WBLA 3KQRA 4UUSB 1OF3A 3JBG2 3ASOH 4RFRB 1K83J 3MBWA 4LUMA 4XC9A 1R36A 1BM9A 1X4OA 1D4VB 4A42A 5FZHA 2D44A 1ZBE1 3RS6A 2YZ4A 4ESBA 4GWMA 1WLCA 4OZOA 3AKTA 3VGIA 2L02A 5HBAA 4L11A 4Q4W2 5FCCA 2RNJA 2KRCA 5FLXZ 1WUVA 4GKYA 4ETSA 3CDHA 2DK5A 4UBHA 3DXUA 1UOGA 1IGNA 4HSJA 5KC5A 4YZ3A 2EA7A 5IK4A 1HSTA 1C3HA 3HTUA 1S7OA 2X6XA 4D6QA 1UU5A 2IFWA 4U7BA 3AYDA 2DFBA 1UZYA 3BLYA 2H27A 4HPKA 3F6VA 1W05A 1IF1A 1TL8A 3GTPJ 4KWJA 4XR6A 4BB3A 1R1A1 1UN1A 1D2QA 3J7LA 2ADEA 2KP6A 2VTFA 5FQ0B 1U8BA 1PYVA 1UIKA 1UYXA 3THDA 3K51A 2FBKA 2DVDA 4A0XA 4D5CA 1S0EA 4ARYA 5FK7A 1MH3A 1U9OA 2XQRA 1P7IA 1MMDA 4RGKA 2OUJA 1AYM3 2W48A 1LOCA 4CDUC 2P4WA 3U4SA 2RMU1 1C5IA 2E2JJ 1HB3A 4OINF 2WV1A 2GC3A 3MUZ1 5FY5A 4D0QA 1MZFA 3WW1A 2BZDA 5DTDA 1TQIA 2O9LA 1RUF3 1TMF1 4YFZA 2XVGA 1Z6RA 4Y20B 4BY1J 4JX5A 5DZEA 1V6JA 3ZXEA 2BOLA 5A7WB 2Z79A 1S0JA 1QY4A 3MV01 1Y7BA 1OQ1A 5B5EC 1PO23 5FTTC 1B09A 1ODDA 3LZZA 4HF0A 3JTGA 1T33A 1W06A 4CRQA 1GZTA 1X4PA 2OT7A 1ZN2A 3JXSA 4GZ9A 3ZFEB 1DPUA 1QQP2 4CUCA 3S3OA 3RPQA 2ZEZA 3RSJA 5C6CA 2K9MA 4WF2A 2BTVC 3GFIA 5JI7A 1FATA 2BVBA 5EEGA 3F23A 4CP9A 4YPJA 4A45A 2ARAA 2E7XA 4QQPA 4MUVA 5LA9A 4OMCA 3PUQA 1GANA 1GNYA 3VZLA 2WAQA 5A70A 3KZIC 5JSPA 5ABJB 3W3CA 2N8GA 4RAGA 1UL9A 1VBC1 1VRH1 1G3SA 4XVHA 3JRGA 4NMIA 1YIPA 1N47A 1CESA 4QXHA 2LF7A 2XL7A 3EPZA 3U9GA 3KMHA 3V0BB 4E6KG 1MW7A 3KIOA 4BBRJ 5BNNB 1W6MA 3KP4A 3MUY1 2L7ZA 1ZG5A 1H8TB 5H6QA 2A70A 3OOUA 2ZSHB 5FZFA 3BQYA 1GV9A 3QYEA 2XC7A 1QEXA 5I8TA 1X8EA 3OBRA 2CQ7A 2ZCWA 2Y2ZA 2KIQA 2COBA 1K61A 2A6EF 5ACA1 4ES9A 3U0ZA 1LEDA 3H7YA 1QH6A 2VZTA 3CU7A 4QB2A 1Y9GA 3S5AA 3HQXA 4OQ8A 1C8M1 1RHI2 3GJAA 1B8IB 4NDLA 3VYUB 3ZDVA 3T0BA 2EB7A 2QKDA 3MD2A 4XLFA 4Z6YA 4EM1A 2ZKLA 2DMQA 3H3VK 5I0TA 1VBC3 5FLMJ 1YC61 2M2EA 3ZFFC 3ECQA 1D5VA 3WG3A 4A5MA 2MD0A 4KG8A 3VD9A 1Q3EA 3J7YJ 2P7VB 4LLGF 4MYEA 4AK3A 3PJRA 1O4TA 4ISRA 2R32A 4K9SA 5JXHA 3QPLA 1W36C 4QX3A 4V1PA 5D5XB 1BVVA 1DU3D 1G3WA 1R1VA 1W90A 1POGA 2XVKA 1MS0A 2VOKA 5D6FA 1W6OB 4M0HA 1Z05A 4KYWA 1FNYA 2HWF2 2Y64A 2JXAA 1DCSA 3RQ0A 1URXA 1ND2C 2XDVA 3ZR6A 1FY7A 1ZZ8A 3NV3A 5FMBA 2XJQA 3R4UA 3H0GJ 3OYHA 2ZX1A 4ZJZA 2QZ2A 2VXDA 4XXAA 1FOWA 3GBWA 4LKFA 3CLPA 3VHOA 2EFPA 1GV2A 3CLQA 5EYYA 2JA5J 3POBA 2EFNA 5E6HA 4KN7X 1VBB2 1VZ0A 1NZCA 5D5VB 2E6VA 1RUD2 2YUEA 3UNPA 1VQ4I 1HQLA 3GFJA 2JIJA 4YG3A 2JICA 4JBAA 2DA3A 2WO2A 1LODA 4WXDA 4M9XA 4EMSA 4OI4A 1N3QA 4EQQA 3OS2A 1HB2A 5H9QA 1GQGA 1P8JA 1BEV3 3WSOA 2GMMA 3LFKA 2JWTA 1KU3A 2IXKA 4AAPA 3HVDA 2IS6A 3HN1A 3V64A 5KBFA 3H36A 1XB9A 1LAJA 3MQ0A 4BZ4A 4I98B 3UGGA 4I0BA 4PGHA 3GHMA 2YSRA 5FZ3A 5FYZA 1X33A 4N53A 3TDUC 4G8XA 1ENRA 2Q8KA 4OAYA 1F5JA 1W6QB 3CEWA 2ZMKA 3TAYA 3N3HA 1NG0A 3ACLA 4LQRA 3J80Z 4X0GA 3EUAA 3USUA 4EN9B 4DRVA 1JUSA 4LLOA 2UV1A 4A41A 1IO2A 5K8SA 2PJPA 3LQRA 2HKOA 3T08A 3HOVJ 4I6ZA 3MZ8A 4XBFA 1HW2A 4ABZA 4B4CA 4LBOA 1XNCA 4OLLA 2VQAA 3E5XA 1E3OC 1GLNA 3K4AA 2P6HA 4Y22B 3N9OA 4DS0A 2O8XA 4QMAA 4E7SA 1KFUL 4OHZA 1YIJI 4BBSJ 2ZGUA 4Q29A 2HWB3 5EGOB 1OCOH 4RN5A 1YJ9I 1TW2A 1OLRA 3N97A 5F04A 2FDIA 5ACA3 5FYSA 2GXBA 2A73B 5CFCA 2Y30A 4QIWN 5F6LB 1ZG1A 1R00A 1SD7A 3UKVA 1G8WA 2R5ZA 3TWIA 3SMHA 2CV6A 5C3PA 4ZTJA 4TWTA 1FJLA 1D0YA 4URAA 1RKWA 5GP9A 2R3SA 1CJPA 1V5FA 4HSRA 3POEA 3ISPA 3T1MA 4AEMA 4YNIA 4P9UA 3DN7A 5KC6A 5EEAA 4R9AA 4C1XA 4CP0A 1CN1A 1FAYA 4KJZA 5ICCA 5CG9A 1W5CC 1AJKA 1QJEA 3HPGA 3IRRA 4EE2A 4Q2FA 4ENMA 3N9LA 2JD9A 4QGLA 2FZ2A 1IC8A 3H9QA 3GW2A 3NKGA 4CP2A 1LQ1A 5HCFA 2Y6FA 4CDQC 1QZEA 1SLLA 1JUPA 5HDNA 2YXSA 1NY71 2HOTA 1F4KA 2VOPA 4DPNA 2TDXA 2PXJA 4PHZA 2DCTA 3D1NI 1VBE2 2MA3A 3MN2A 4GALA 5BXXA 3M3OA 3WUDA 1DBNA 2RMU3 4WM8A 4Q0VA 2O8KA 4Q4V3 4KWKA 3M9AA 2Y60A 3DTKA 4JTOA 2XROA 3BJ6A 4XONA 2JG8C 3WDTA 2HWD1 2B63J 1NZIA 4OI2A 4KN4X 3ZN1A 4WVZA 1RC9A 2XGDA 1AX2A 2D40A 3OOXA 4NQWA 4WVVA 2E32A 1TQPA 5EP9A 4OOIA 1IZ1A 4BK5A 1LOFC 2PHDA 1W04A 2XMLA 2VNVA 4AU7A 4K2EA 3LSMA 2R063 4BQ4A 3X29B 1Z7S2 1AR92 2H8WA 4XSZF 3WG9A 1O3SA 2F4LA 4PLMA 2E1MB 2W94A 3P9IA 1LB2A 3VBFB 3H92A 3AP4A 3MIBA 1Y1VJ 4UOJA 2WINB 2DT7B 3ZQIA 2R042 3WG7H 2W3JA 4X6QB 4HDUA 4AZZA 1MMNA 4EWEA 4KMFA 1V55H 3GF2A 3DP7A 3W6KB 2GIZA 3ZQGA 4BDVB 1VQ9I 3WTZA 4GB31 4Z8BA 4HF1A 3M1CA 3C2BA 1PMJX 3WDVA 4IRGA 1F4HA 1DP7P 1CZVA 1Q8QA 1LESA 4FO9A 3JU9A 1DLLA 4KNYA 4IGOA 1K79A 4IV3A 2ZXQA 2BHYA 3TGNA 4AOCA 4NHMA 4COYA 2D5HA 1EP0A 2YPRA 3E5QA 3NQOA 2A5ZA 4BHCA 4XRFA 4A3JJ 5FFOC 4QKBA 3DGTA 2BNNA 1R4NB 4F52A 3ABKH 3FWEA 4LGWA 4RGXA 3FC0A 1H1MA 1H8AC 1FP1D 4A6DA 1EAH2 2HWE2 4KIGA 2ZACA 4XE9A 4L9NA 1A8DA 3WE3A 2XR4A 1SZBA 1HQCA 3ZXGA 4IE5A 4RS5C 3HRUA 2ZJQF 3Q9OA 1XOYA 4LK7A 5DXDA 5LA1A 2P6CA 1FBUA 2MGQA 3I4NJ 4JCKA 2VXJA 2DCZA 1ZVFA 4Y26A 1JYXA 2YPDA 2DA1A 4LBJA 1GNHA 4XK4A 2FCUA 3BC8A 4LHLA 4OAZA 5CJ9A 1KITA 1GDTA 2E1OA 2VULA 4CUAA 5HOOA 1OKRA 4M00A 5FZMA 4RDUA 3IBMA 4I0AA 2HTSA 3O2PE 1WI3A 3S17J 1KDKA 3BCWA 3VDDC 3I4MJ 2Q2EB 3DBHB 2IWGB 2D6MA 4QLCU 4YIFA 5FLVA 4COUA 2XWBB 3HM5A 4EZHA 4P55A 5LWBA 2WO1A 5FZAA 2DLLA 4P9XA 4QDRA 3GEZA 4IVNA 3TKYA 4KGQA 5A6QA 5JR2A 1AR82 2O8QA 2FDFA 5A7NA 4II2A 2ZSIB 2LRDA 3FF5A 3CC4I 1LDDA 3K4MA 4CHUA 5GPAA 3C7JA 2D3RA 4PBPA 1D2SA 1JJ8C 1DFQA 4GIQA 3K4DA 2M4GA 5F2SA 5T5OA 1ZGAA 4ZU5A 4IE7A 1T98A 1ULOA 4N43A 2ZGRA 4QQLA 1ZH5A 5F32A 5CISA 3CUOA 2IGOA 3HAGA 2JG8B 4CDUA 1XYOA 4FCAA 3H7JA 1ZGJA 3AX4A 1ZBE3 2CY6A 1IXCA 2D1VA 2I10A 2KHMA 3IMMA 1HW5A 1EV12 4IF4A 5J7MA 3G73A 2CGOA 5I93A 1XCVA 3RTRA 2EFWA 3WU1B 3VL8A 4OIQF 2QVOA 3S2HJ 3U21A 5D8AB 1U5TA 3BOWA 5M5YJ 1JU3A 3AP7A 3MIGA 1REEA 2BGCA 1NLRA 1ULEA 3CZJA 2UWBA 4BM8A 3PLQA 1VPHA 5L3CA 3O14A 4NHYA 2KIMA 4O9EA 1LHUA 3LSGA 5BNNC 2XLFA 4K6BA 1AL23 2ZX2A 2VL4A 2RM22 5M3FJ 2LH9A 3ABTA 2Z5UA 4D7SA 3AP6A 3WEZA 2VOVA 5JI6A 4CO8A 5LATA 2VN2A 4UFMA 5JZGA 5FMDA 3P5BA 4FOWA 2CW7A 3FK6A 1W9SA 1Q5OA 3M3IA 2CS3A 1NHAA 1VAKA 2XLGA 3ON7A 3DPRA 3GNEA 1QQIA 3LSHA 3K75B 5F5CA 5HNHA 2D97A 3VDDA 4LLNA 1SD6A 2BERA 5DYMA 1CD3G 1MR5A 4KU7A 1XE7A 2IPQX 2R7DA 4X8PA 3LAJA 4QGNA 4C3HJ 3U75A 4ZTFA 2IS1A 1AF9A 3ML6A 4A3LJ 3J81Z 2IS2A 4MXWA 2NS8A 5A1AA 5JPNB 4KA4A 2DOFA 3G7DA 1Y56A 2ES3A 2P5VA 3ETQA 1R22A 4BKXA 4A3IJ 4BLJA 2NNNA 5CYVA 1WQ2A 3CIHA 4CSWA 1VMFA 1F35A 2KZVA 4QTRA 1JBCA 1G59A 3ZQQA 5IY5H 3N4MA 4BL0B 2Y75A 1WRJA 2G0EA 1QOSA 2UYBA 2GBYA 4BDYA 2WZEA 4QM9A 2RVCA 5A6XA 1UCRA 2HZTA 2RS13 2ZO4A 2KIFA 1S7AA 1IN7A 2ETEA 1QKQA 3AMQA 5E18F 2WRAA 4RL7A 2HYKA 2XJRA 5DN2A 2HZDA 1ND2B 5DMYA 5F8PA 3A01A 4LMYA 2H6CA 2VNGA 2E5ZA 2Q8OA 4FTBA 2YC2A 3IWZA 1KGSA 1J5YA 1CAUB 1LFPA 1WWXA 1RL3A 3PTRB 5J1UA 3RWKX 4IHVA 2EV0A 5IPAA 5F64A 4RGGA 5KNLA 1OHFA 1W36D 1FSEA 2H09A 3K0LA 1KQRA 3WOGA 4P14A 3I64A 1COV1 2LF8A 3HG9A 4XFHA 2NVXJ 5C8CB 1AHSA 2QSGX 5DDGA 3ZX7A 4Q26A 1AZDA 4FP2A 4CTEA 3RYKA 2BY1A 3RJRA 1K5JA 3FXQA 2CWMA 5FO5A 4KMUX 2CH0A 2WKKA 2DU0A 2YMZA 5FP4A 5G04L 1T08B 4B3XA 4EQVA 1WD3A 3AK0A 5A3NA 1DGLA 4B3NA 4AM3A 5GPCA 1D1BA 2RS31 1WD4A 1FMWA 3MKYB 3TQNA 5HS8A 2FD8A 3OD0A 3C7GA 4CPBD 3WHCA 1R1ZA 1AR63 2EICA 1SDDB 2JPBA 5F1RA 3CC2I 2WWYA 4NC6A 4BQXA 2OVUA 1GLHA 2L4MA 1R091 3AKSA 3C7EA 3BJAA 2RNGA 3F0CA 5BNPA 1MNDA 1WA4A 1JHHA 5LBQA 3QU3A 2MYSA 4AQ6A 2VOWA 1LHNA 5JPMB 2GH2A 2OCCH 1WSUA 1T0FA 1YQ2A 1T2KA 4JX6A 1V6IA 3ZN0A 5GZGA 5IP9J 2RQPA 3OCPA 3MICA 3C2GA 3WP5A 4HXCA 1N1YA 1VIWB 3EETA 2R7TA 1UYYA 1RUE1 4IEUA 5FKCA 1REDA 5FMCA 3S1MJ 1TLHB 4YFKF 3R4SA 2H1KA 3OYNA 4GWJA 4N8MA 5FYVA 4A7KA 3HDDA 3JQXA 4PGGA 2P0WA 2A5WA 3O1VA 4YVSB 1V5GA 3ME2A 5C4XJ 2G7UA 5E3OA 1SFXA 3ABLH 2TUNA 3ATGA 2XSJC 4A3FJ 3VDCA 2ATFA 2DOAA 2UXXA 4A3CJ 5D8KB 1TQ5A 3CUQC 5SV8A 3VKOA 4BE2A 4S04A 4GH4B 1AR93 4XLHA 2DJIA 4HVQA 3OY8A 2ZMEB 4QQ2A 2VQCA 2M3AA 1WJAA 2DBIA 1XU1A 3QP5A 1U0JA 4UB8C 4NHLA 3CZ6A 3FMQA 1OXCA 1U5XA <