4LUKA

The crystal structure of the p132a, y133g mutant of pyrococcus furiosus phosphoglucose isomerase in complex with manganese and 5-phospho-d-arabinonate.
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
189
structure length
189
Chain Sequence
MYKEPFGVKVDFETGIIEGAKKSVRRLSDMEGYFVDERAWKELVEKEDPVVYEVYAVEQEEKEGDLNFATTVLYPGKVGKEFFFTKGHFHAKLDRAEVYVALKGKGGMLLQTPEGDAKWISMEPGTVVYVPAGWAHRTVNIGDEPFIFLAIYPADAGHDYGTIAEKGFSKIVIEENGEVKVVDNPRWKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glucose-6-phosphate isomerase
publication title Correlated mutation analysis as a tool for smart library design to improve protein performance.
rcsb
source organism Pyrococcus furiosus
molecule tags Isomerase
total genus 40
structure length 189
sequence length 189
ec nomenclature ec 5.3.1.9: Glucose-6-phosphate isomerase.
pdb deposition date 2013-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06560 GPI Glucose-6-phosphate isomerase (GPI)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4lukA00
4J1XA 2D5FA 3H9AA 5F1RA 1Y9QA 3KCCA 1CAUB 5K8SA 4KWLA 5KHJA 3ES1A 4I02A 2OPKA 1ZRCA 4K8FA 3BB6A 4F8AA 3NL1A 1NXMA 5FCCA 5FLIA 2BNOA 4WVZA 2QDRA 5JSRA 3SCHA 2CAVA 1ZRRA 3H7JA 3QOPA 4XFIA 5FQ0A 3QACA 4I09A 3CLPA 1DGWA 1O3SA 4QGLA 2XGXA 4P9GA 3OCPA 2ETEA 3IDCB 4Q29A 5FDBA 2FMYA 2DCTA 3SCGA 2PFWA 2Z69A 3E6BA 2XL7A 1O3TA 4Q0UA 4QGMA 4R52A 3B02A 3HT2A 2PHDA 5JSPA 4IETA 5J3UA 3FJSA 4HSLA 1I6XA 3UKNA 1ZNPA 1U12A 4L2NA 4META 5AVPA 4IEVA 2D40A 2XKPA 2PHLA 4J1WA 3NW4A 4FAHA 3TNQA 1DZTA 3WW1A 2XLGA 4HVQA 4I0AA 3E5UA 3O14A 1RUNA 1ZZ7A 4JTOA 4AVBA 1Y3TA 5FPZA 4BH9A 1L3JA 5EZWA 4MH0E 3MDPA 2PAEA 3FX3A 4WZCA 2B8MA 4EV0A 4E2QA 3WW3A 5I0UA 4HBNA 3IIAA 3N4MA 3LA3A 2PA7A 3OGJA 1LRHA 1YFWA 3U10A 2CGPA 3MPBA 5FQ0B 1J59A 4JVAA 4Z07A 5KHIA 1ZZ9A 2GH2A 3C3VA 1Q5OA 1PM7A 2IXIA 3H3UA 1GQGA 3WW2A 1XRUA 2OYZA 5LEJA 3CF6E 4MGZE 3RNSA 5E16A 2WFPA 1CAVA 5JR7B 1CAXB 3OTFA 3LA7A 4E2GA 4D7SA 1O5LA 4IEQA 3GBFA 3PLQA 2IXHA 3U0ZA 1RL3A 3M3IA 1DZRA 3EQEA 2VECA 4I01A 2UYBA 1WLTA 1UPIA 4R8HA 4UBHA 4JV4A 4LA3A 1VJ2A 2EVXA 1UW8A 4E2SA 3H7YA 4D7TA 4AVAA 2Y0OA 4IEPA 4LUMA 4KU8A 2H6CA 3E6DA 1ZX5A 4XF3A 5CVRA 4PIZA 4F7ZA 2XHKA 3DKWA 3CJXA 5LEKA 4IEUA 3I59A 2HKXA 4XF4A 1ZZ8A 3E6CC 2ATFA 4Z82A 3KSCA 4LUKA 4YSFA 4PIXA 4RD7A 4O9GA 3GYDA 3M70A 3DL3A 2PTMA 3D82A 4IESA 1OMIA 1YWKA 3UKTA 5HI0A 2PQQA 3ACLA 4IEXA 4AVCA 4MGYE 4OLLA 4AXOA 3MYXA 3U11A 4EWEA 1O3RA 5I91A 2XLFA 1QY4A 1QWRA 2MHFA 5EFUA 2BYVE 4ONUA 4XF0A 4I2OA 2QJVA 1PMIA 2PYTA 2Q4SA 1UIJA 1ZZ6A 3I7DA 5BUVA 2MNGA 1O4TA 2WC2A 1ZVFA 5FPXA 1CAVB 1LB2A 3NJZA 4ZU4A 1YFXA 5BY5A 3KGZA 4QM8A 1X8EA 4QX5A 5BV6A 2FQPA 3TNPB 3FE5A 2D93A 3BU7A 4KWKA 4XFBA 2H6BA 5CU1A 4CYDA 3H50A 2Q30A 3HQXA 1YFUA 2GC0A 1O3QA 3LZZA 1Q43A 4HMZA 2VQAA 3FFQA 1H1IA 4Q0VA 1CAWA 3WW4A 5I0RA 3PNAA 1IPJA 1J3RA 4KU7A 4XF1A 5C6CA 2H0VA 1FT9A 4LULA 3IBMA 2EAAA 1XE7A 3R6SA 3NKTA 5BPXA 2XKOA 3IWZA 2ET7A 4O9EA 3ST7A 3UKVA 3H1YA 4BIFA 4HZFA 2PAKA 4AQ2A 2K9ZA 3S7EA 2GC2A 1RTVA 3D0SA 1OD5A 3CL1A 4ZU5A 4LTAA 1ZRFA 1CAUA 1IPKA 3G7DA 4MGIE 1NYWA 3L2HA 3ZDSA 3LA2A 3HT1A 4EWDA 1XE8A 4XFAA 2QCSB 2UYAA 5JAXA 3H3ZA 4FT8A 3DV8A 3IDBB 3RPQA 1CGPA 5JSOA 4X6RB 4EROA 2VPVA 4MUVA 1VP6A 4TLFA 3KMHA 3FHIB 2PAMA 3EHKA 1J58A 4YNIA 3H8UA 3NVCA 4XFHA 4QXKA 3LOIA 2KXLA 4HN1A 1O5UA 1X82A 3DN7A 5D1IA 2BGCA 2IXCA 2C0ZA 3HIFA 5LRSA 1DGRA 4XFCA 4DINB 1FI2A 3ETQA 4HVOA 5CADA 4XFFA 4BYYA 2XLAA 4ZU7A 2CV6A 5I8TA 3E5QA 4NVPA 1YFYA 2O1QA 5FLHA 4HSJA 5FLJA 1NE6A 1HW5A 3USSA 3EO6A 3E5XA 4L11A 1ZZBA 4OFGA 1G6NA 3CO2A 1YUDA 1J3PA 2K0GA 4Q0QA 4IEWA 5KHHA 2QVSB 4KWJA 4MX3A 3S0MA 3SXWA 1OI6A 4BHPA 5I0SA 2ZKLA 2ZCWA 3S7IA 1RC6A 3SCFA 5I93A 1LKNA 1H1MA 1UD1A 2MPFA 4UBGA 3MZHA 2OZJA 2GC1A 4LLOA 3E97A 4QMAA 4MGKE 1NZCA 2F4PA 4IERA 3CEWA 2GZWA 1YHFA 3ES4A 3FZ3A 1CX4A 4HN0A 2O8QA 3RDIA 1YLLA 4QM9A 2QNKA 1J3QA 1OFNA 3RYKA 1JUHA 1VR3A 4IEOA 1O7FA 1UIKA 1SFNA 1RGSA 4N9HA 2BEOA 4B29A 1ZZCA 1CAXA 1WA4A 2IXJA 3PVBB 1SEFA 2CAUA 4WBBA 4PJYA 2EA7A 1NE4A 1I5ZA 1V70A 2OA2A 5I8YA 4N9IA 4KL1A 4PIYA 3FWEA 5I8SA 5KBFA 1ZREA 3I59B 4MV2A 2V09A 3LAGA 3OF1A 4MZUA 5E1RA 2XL9A 1J1LA 3H1MA 3NSTA 4QGNA 1GQHA 1TQ5A 1X8MA 3D0JA 4I0BA 3BALA 4ORFA 4A2UA 1FXZA 4HLTA 5KHKA 2GAUA 2BNMA 2IC1A 2P17A 4UXAA 5J7MA 4LEJA 3SMHA 4HVRA 4YRDA 4Q0PA 3RZZA 5I0TA 4IEZA 5LRRA 1X7NA 4XETA 4X6QB 2D5HA 3RYPA 1EP0A 1EPZA 2N7GA 2I45A 4I3PA 3ELNA 3RYRA 1SQ4A 2UY9A 2IXKA 3H1WA 5BXXA 1WGPA 2OZ6A 1RUOA 2UY8A 2ET1A 2GU9A 3EJKA 3JZVA 4JTNA 4XFGA 5KHGA 4H7LA 1UCXA 3ROUA 4EWAA 1Q3EA 1QXJA 1CAWB 2Q0AA 2IXLA 3LWCA 4YYOA 2B5HA 4FAGA 3SHRA 5T3NA 2BNNA 1EYBA 4XF9A 4XEZA 4YARA 4FBFA 3VHRA 3EBRA 1EY2A 5JCTA 2GC3A 3BCWA 3I54A 3BPZA 4GULA 4IEYA 2Z2SB 1QXRA 2Q1ZB 3OD0A 2HJIA 4Q0SA 3KGLA 5J48A 5C8WA 2E9QA 4AQ6A 1LR5A 4LA2A 2B9UA 1ZRDA
chains in the Genus database with same CATH superfamily
2GNDA 1W8UA 4OVEA 1MS1A 1Y9QA 3KCCA 2VXRA 4D7YA 4AAPA 5A32A 4KWLA 1NCRB 5K4LA 1FOD3 4GWMA 1VB4A 5FYUA 4I02A 5C5TA 1JYXA 4U36A 4LIVA 3WNOA 4OHWA 5FZBA 2EIDA 1A8DA 4DPNA 1FPN1 2KR2A 3RI8A 5FCCA 1H0BA 4XJWA 4DUVA 3DPRA 1PVC1 2DFBA 5JSRA 3E1F1 2OUJA 1G9AA 5LBBA 3H7JA 1D2SA 4B7EA 1TZOA 1OPOA 1APNA 1W8ZA 2C26A 4WZFA 1FMD2 5FQ0A 2D97A 3CLPA 1C5IA 3ZLIA 2SBAA 1DGWA 2P6CA 3PMEA 1JMUB 4XXAA 1PGW2 4QGLA 4JDMA 3AYCA 4NHKA 1OD3A 3R0RA 1WD4A 1XXNA 4COYA 1OA3A 2XJQA 1YIFA 3IDCB 4PCRA 4QX1A 2JDAA 3V0BB 1L7LA 4L92A 3UETA 4YGCA 3OBZA 1W6MA 2R072 1AXKA 1BBT1 2HYKA 3E6BA 3HMYA 4OMDA 2XL7A 1WCKA 1RUG3 3NNJA 4QGMA 5C33A 2DUOA 3I2GA 1UX7A 3B02A 3RWKX 5FZHA 4IETA 3W58A 2YBPA 2ORZA 4Y33A 2OVUA 2WZR3 1ZNPA 1U12A 4L2NA 3LDBA 4META 2A70A 4RQPB 4A4AA 1LOFA 3KS7A 2NP0A 4PDWA 1GZCA 3JCIA 2D44A 2RR12 4FPYA 5EIYB 1CIWA 3UV9A 3AXEA 1UYPA 3HWJA 4YVWB 4J1WA 1V9U3 3NW4A 4CCEA 1ASJ1 4FXGB 2ZMNA 2DVFA 1CESA 5IATA 5K0UC 4CCOA 1K45A 4A3XA 4Y5Z0 2V73A 4I0AA 2TNFA 3ENRA 3O14A 1E5SA 4GWJA 1YEWA 5FZ0A 4QAWA 3SQOA 1Y3TA 4XURA 5FPZA 4JGYA 4XW3A 3SLIA 3WQ1A 3ZKYA 1TNRA 4BH9A 2ZPXA 5EZWA 3MDPA 4OHXA 1AR71 3FX3A 1RHI3 3V56A 4S2FA 1UN1A 1W28A 1RUJ3 2B8MA 4XDPA 4KWUA 1QJU2 1E5IA 3C8XA 1HQLA 1GFF2 4LBJA 4EV0A 4Y1YA 4FOQA 4C0HA 3MGUA 4AQTA 1YCIA 1W8WA 4AHYA 4LE4A 4P14A 3ZR5A 2QQJA 3OGJA 3T0DA 1LRHA 3P3NA 1YFWA 1H2KA 4YVSB 5F9TA 5IAXA 2ZEWA 1FPN3 5FOJB 2W87A 1J59A 1HRI1 3U4SA 4XUQA 1MACA 1PVC3 5F5IA 1N3PA 3C3VA 1OLQA 5FPBA 1ONAA 3KQRA 4BM8A 4HL0A 4EN8B 1W3VA 4CCMA 1J83A 1GQGA 1GWMA 3WD5A 1NY72 1XRUA 2OYZA 1ENQA 2DVDA 1QKQA 2RDRA 1GKBA 1PMJX 2YGMA 1CAVA 2GDFA 4WM7C 1ULEA 3HEIA 1CAXB 1W0PA 3OOXA 3LA7A 5FY8A 3WF4A 4KGGA 5F2WA 1UYZA 5IVYA 1LGCA 3I2FA 3GBFA 3PLQA 3ZDVA 4QPIB 4B8EA 4KGQA 2VULA 5GZEA 2JDYA 2VECA 1WZXA 2A71A 4KG8A 4NMIA 1UPIA 4OULA 2C5DA 3LSEA 5A1FA 2R16A 1BBT3 1BK1A 1U0AA 4UBHA 3VUOA 4AFBA 2VZPA 4UYBA 1K42A 4K1YA 2ORXA 2Z5WA 2ZOEB 4BXSV 4ASLA 4D7TA 1WMFA 2X10A 4CU7A 2R1BA 2Y60A 4ARYA 1LU1A 3O1OA 1W2AX 3JB4C 3VBSC 4YPJA 5AVAA 5CB7A 4F7ZA 4XF3A 5GM0A 4PIZA 2A73B 3MUY1 2PHUA 1XQNA 4PLOA 1ASJ3 1ENRA 1PGW1 3I59A 4FPGA 4LBNA 4P9JA 5F8PA 4AL9A 5FY9A 1UZVA 2XUEA 2XWBB 4HFSA 3KSCA 4LUKA 4P9IA 2BU9A 3IMMA 4Y1VA 4NIDA 3M70A 2P3IA 3DL3A 2YY1A 4JHTA 4PDWC 2R071 1AR73 1MQTB 5ERLA 4RGKA 1GP5A 4BQYA 3ASIA 3AX4A 2DWRA 2Y33A 4QPYA 5A3TA 4NOTA 2ZJCA 1H8TA 3DUIA 4IEXA 5A7OA 3ZPOA 2D98A 2P1BA 3U11A 4AXOA 4EWEA 3KVBA 5DAQA 4DY5A 1HN0A 5GZFA 3W21A 1H8VA 2BYVE 1N47A 1NT0A 1H2NA 3GBWA 1QJEA 3WP4A 1W9TA 1UIJA 4LORA 2RR11 2WNVC 4MGQA 1YI9A 3OJBA 4Q4W2 2EAKA 3WNPA 2WNOA 5BUVA 1A78A 1FV2A 5FK7A 3FHQA 2WC2A 2FDIA 1HRI3 1ZVFA 5FZ4A 4CEWC 3AYDA 1GU3A 3HQUA 1RMU2 3LKJA 4QX5A 4OYUA 5FYIA 1K5MB 5FWJA 1OKQA 1ULGA 4XFBA 1BKZA 1UOFA 4CYDA 3TEYA 4GQ7A 4D8MA 4COVA 2R32A 3HQXA 4O7XA 2ZX0A 4CDXA 4DXSA 3KT4A 4JCKA 1QJU1 2GC0A 4UF0B 1H1IA 3H3LA 2BJSA 4JKLA 5HV4A 3FBYA 2WN3A 3USUB 5FWEA 1B35A 2EXIA 2G9ZA 1ND3B 2QUOA 4XDQA 4UT5A 5HXMA 3CZUA 3NNFA 3KQ4B 3VDDC 5A32B 4KH9A 5FMCA 5AFBA 2PHRA 1KFUL 3ABZA 5DPNA 2WYFA 1VBE2 3T4HB 5CFDB 3ST7A 3BODA 1NY71 2OQ6A 1S2BA 2PAKA 3POYA 2BVVA 3AKSA 1SLIA 5ANNA 3MIHA 3RFRA 3S7EA 1RTVA 1C4RA 3CIHA 4L99A 1IZ3A 3MF6A 4ZU5A 5B2GB 3DPRB 4AI0A 1CAUA 1IPKA 2VZVA 2X5IA 1VALA 2EICA 3LA2A 1ODMA 4RR3B 2E26A 5LY2A 4X8PA 3GGLA 1VRH2 2UYAA 5A7WA 5FXWA 2R073 3PUQA 3Q9OA 4NE9A 4PQ9A 1CX1A 2VNOA 1WWYA 5FO7B 2OXBA 5JSOA 1JH5A 3AB0A 4CCLA 1ULCA 5FZGA 4EROA 2PN5A 2W47A 2VPVA 5DUVA 5F39A 2W92A 2VW1A 1ZA4A 4NN0A 2NQYA 4FPFA 1V6NA 2J1SA 4E4SA 3ZO0B 2NMNA 1W6MB 1SPPA 3TB0A 4A6SA 4XHXA 1JUIA 1V6LA 1YRZA 1UKGA 2RR13 4OI0A 2UURA 2WNUC 5JZGB 2A3YA 1UAIA 4QXKA 2KXLA 1O5UA 3AK0A 4FOYA 1DYPA 3WDWA 1X36A 1WCSA 1V6OA 5LK7B 2F4LA 4W4ZA 5T5PA 1BZWA 4HVOA 3PVOA 1W2UA 1BMV2 4ZZ8A 1H6XA 3HBKA 4NHMA 2BQPA 2C1FA 2DYCA 4BYYA 5CADA 3H8RA 4ZU7A 2CV6A 3AC0A 3VZOA 4B4QA 1UYYA 2GP3A 4NVPA 1Q8QA 4ARXA 2PHTA 5FLHA 2WFF2 1QJU3 2A6YA 3KF5A 4R9AA 2VG9A 5FLJA 2WL1A 4IUGA 3M7AA 4NJ4A 4LJHA 4JGYB 1AF9A 1MZ5A 4XBLA 4YZ2A 5A6ZA 3VL9A 2VMFA 3W20A 1W2NA 1D0GA 2V5DA 1TEIA 1S0CA 1NOVA 1YUDA 4Q4W1 4XAAA 1J3PA 4LBQA 4Q0QA 2YPDA 2ZGOA 5FZAA 2BPA2 3MIGA 5KHHA 4EN9B 2RS12 1S4CA 1WLDA 4GKXA 3AYAA 3MO4A 5GALA 2DDUA 5F3EA 4Q4X2 4Y4RA 3WQ0A 4BHPA 4N53A 1RMU1 1LECA 1YQ2A 2ARBA 1A8MA 2ZKLA 3GALA 1AL22 3L2YA 3S7IA 5KXCA 4WVVA 1SBDA 1H1MA 1H1AA 3C7EA 1ODNA 1RB8G 3NNLA 2VVDA 2WT0A 2XJTA 3WHUA 3WV6A 3JUUA 4FFIA 4LLOA 4U2AA 5BNQA 2GH8A 3LSDA 4XXPA 1JI6A 3VBUC 1UU6A 4D6QA 3BIEA 3DXTA 4YWAA 4L8QA 3ZYJB 1NZCA 3KCXA 4IERA 5A3PA 2ZGTA 1YHFA 1QQP1 5BNPC 3WG3A 5BNOB 1NLQA 4HN0A 2J1AA 3QH7A 1WW4A 1OOPC 1Q8SA 1BJQA 4W6YA 2XBO2 3U07A 3G6JB 3ZSEA 5AC92 5HCHA 1J3QA 4BWOA 5LA1A 1JU3A 3RYKA 4ZHNA 2VOTA 1JZ3A 4IEOA 1RIRA 4E4DX 1RGSA 1VBE1 3K75B 2BEOA 2A75A 4UFIA 3VHNA 5HCAA 2Y6KA 3KV5A 1XE0A 5FXVA 1I1EA 2MEV1 4G9SB 4Q4Y1 1R082 1W6PA 1PK6A 3VBRA 4WBBA 3T2OA 4H3WA 4QHOA 1ZM1A 1NA1C 2EA7A 1SLBA 3AZWA 1NE4A 5A6XA 3OPWA 2GSYA 1V70A 2OA2A 2QTWB 5A7NA 1VRH1 4NRQA 4XMAA 2BOIA 3I59B 3BUCA 5FK8A 1GBGA 2ZMKA 3AMNA 2TEPA 3TN91 4MVTA 3KHCA 1FATA 4L97A 1UY2A 2VQ0A 4CE8A 2X09A 1GQHA 5H9QA 3RZGA 2Y0IA 4ORFA 3U4XA 3BALA 4A2UA 1OVPA 4MXWB 2YG0A 1F4AA 2BWAA 4ZZ5A 5J96B 2JKXA 4MYEA 4Q4W3 4CDQA 4CUBA 3WQ7A 1W9WA 1XB9A 4A45A 2UWAA 1AX1A 2IC1A 1H8TB 5EYYA 4WM8C 1OLME 3T30A 5L73A 4AGGA 4UXAA 3AKPA 2VNGA 4QPGB 4TXWA 4YRDA 1G9DA 4A7ZA 1DGRN 1XC6A 1SCRA 1W8TA 1OF4A 1RMU3 2RHPA 2ZEYA 3NV3A 1X7NA 2ZGUA 5I0TA 1A34A 4CCCA 5JIUA 3AVSA 4RFRB 4P5YA 4IE7A 5GLTA 4MOAA 2X05A 3RYRA 3NAPA 4E9KA 3B5LB 4IE0A 1F9KA 3WW3A 2FBEA 4LKEA 4LO6B 4LO4B 1IPSA 1SQ4A 3HNMA 2VUAA 4QQHA 4BA6A 5C3PA 3FLRA 3PVNA 2OZ6A 3MICA 2Y6FA 3BGAA 3N9MA 1IQDC 2UY8A 3PU8A 5FUIA 2ET1A 4M4PA 1QQP3 4OHYA 3EJKA 1WKYA 2X53S 3VD5A 3WNMA 4CDXB 1BCXA 3GZUC 4CDUA 1QJZA 1JZ8A 3UJQA 2WO2A 3FBMA 4Q4V2 3MPPG 3GCXA 2RS11 4HOOA 4EWAA 4IGPA 2J1UA 5JIAA 2Q0AA 1VBE3 4CUCA 2IFRA 2VOXA 4PF1A 1LESA 1LHUA 3LWCA 4YYOA 3ZXEA 4FAGA 5KXBA 1B35B 1EYBA 4XF9A 1AL21 5CKMA 2MEV3 4FBFA 3RZHA 1US3A 3EBRA 1GOFA 4WVWA 1SCSA 4GJZA 3AKTA 2GC3A 1H2LA 3W59A 3BCWA 3I54A 5EP9A 1JZ6A 1XSRA 3C7OA 3O1MA 1NZIA 1O8SA 1QXRA 2HWE2 2J1VA 5GZGA 5KC5A 1RINA 1S2KA 3J8F1 3NJVA 2BP6A 3LDKA 3D6EA 5JI9A 2DF7A 3ZXKA 4HETA 4CP2A 4FFHA 1VRH3 1UNBA 3HBZA 3PTRB 2HWB2 3AL6A 3ACFA 2B9UA 3LEGA 4DXZA 3TN93 3H9AA 3CJIB 4XJ8A 3ZPYA 1CAUB 2X5IB 3ZFGB 2XHNA 3VBRC 4F83A 2BTVC 4MXVA 2XBO1 5KHJA 5AC91 2ZX4A 3AJZA 3ES1A 2CWMA 2PHWA 2WWJA 1WMXA 1ULPA 2OPKA 5A7WB 1XU1A 3BB6A 2BRTA 2XWJB 2OS2A 2VBPA 3VBOC 1G9BA 3IN9A 3WNNA 2VAUA 3WDXA 2WZPP 1X9TA 3VDAA 1JOJA 1R081 2ZX2A 3H42B 3SCHA 4TZDA 4JRAA 4YVSA 2BFUL 3SEPA 1TMF2 2QQWA 1JYIA 3MW4A 1H9WA 4OI2A 4YG3A 3V65A 3FC0A 2FDHA 4E4HA 1VBB2 3MV11 1TVGA 3POIA 5FREA 4P9GA 4XIKA 2D3SA 2VZOA 1NCRC 4AI9A 1NCQC 3GBGA 1UYXA 1T6GC 2ETEA 2VZTA 3OCPA 4ITCA 4DUWA 2WFF3 4OHVA 4Q29A 4OQ8A 2FMYA 3ZFFA 1UL9A 1VAKA 2QBXA 2AGSA 2OKXA 5I0DA 2Z69A 3ZN4A 3RSJA 4AFCA 2JXAA 5E88A 3ILFA 3UJOA 3URFA 3OUIA 3HT2A 1QDOA 4W50A 3UKNA 2OX0A 4QXBA 4K8RB 4XDOA 2XB6C 1B09A 2WQ8A 2RS13 5CG8A 3POFA 3ZFEA 5AVPA 3ETPA 4L9BA 1PGSA 2D40A 1PX3A 3MFAA 1VMHA 2VOVA 4Q4X3 2AACA 1UOGA 4CUAA 5KR7A 1SLTA 2B7YA 2ERFA 1AR62 3POEA 4CDWA 1GZTA 2DTWA 4N7IA 1AL23 4JQTA 5C8CA 1Y4WA 4LBQB 1W99A 3TNQA 1IGOA 2JG9A 1QJY1 2ZGNA 3AP5A 4Y5TA 2W1WA 3WW1A 3E5UA 3LEIA 1VIWB 2V5YA 3AKQA 1DF0A 1PO12 3I2OA 4JTOA 4AVBA 3F2ZA 4YZ5A 2JIGA 2OIIA 1L3JA 3JBG2 4Z2WA 3Q8BA 2Y6LA 1UZZA 3O0WA 4N53B 4GAZA 3J26N 2P3KA 4QX3A 3THPA 1LULA 1RUH2 3QCWA 5F5AA 2JWPA 4RQPC 1DLLA 1REEA 1Z78A 4IGQA 4AQSA 4E27A 4FTBA 1QXPA 4GZ9A 2R0FA 1E5RA 2RJKA 2XBO3 4YVWC 5I0UA 3FMGA 4HBNA 4Q4V1 4HKWA 3T4VA 3APBA 3P6BA 5AC93 5C3SA 3BOWA 1N1VA 3LA3A 3RZKA 2ZGRA 4K6BA 1JTZX 5A7QA 3ZIXA 3U10A 4ES8A 1G7YA 1S0JA 4JHZA 1R083 4N43A 2GH2A 4TYSA 5IVCA 3TEWA 2IXIA 3GJBA 1RUG1 2ZX3A 3D5OA 2HWE1 3HVDA 1JYNA 2YV8A 5GLUA 4K7JA 4MGZE 3P3PA 3RNSA 3M3EA 2A6ZA 4Y4YA 1RUC2 1W04A 3ZOIA 2HWB1 1W6PB 1O5LA 2WLQA 4KI5M 1PK6B 4EQVA 5FR3A 5IT6A 1NQDA 1CZSA 2VNRA 5DUXA 3FHAA 5C4WA 1U5IA 5C5UA 2F6BA 4I01A 4OUSA 2UYBA 1FX5A 2CNAA 4R8HA 4MHRA 3CKHA 2DVBA 1R64A 3O0XA 3MLLA 4UF0A 4Z8BA 5B4NA 4MLOA 4AFAA 5CYYA 1GMMA 1WW7A 2E31A 2ZGPA 4R4XA 3NV1A 2A1XA 1PNFA 4LXLA 2HYXA 3H7YA 3MI8A 4M3CF 2VOWA 2YMZA 4AVAA 1QHDA 1SFYA 1MZFA 1UZ0A 4JAAA 1ND2B 1YQ5A 4IEPA 4LUMA 5F7UA 5DG1A 1TMF1 4QB6A 4NHXA 2H6CA 2NN8A 1PIV1 2RE9A 5CZKA 1SBEA 4ET7A 1Q8OA 1ZX5A 5CVRA 3AP6A 2XHKA 4AI1A 1HN1A 3CJXA 1VBB1 4XZPA 4CDQB 1YJLA 4XF4A 1C5HA 5CFDA 4HANA 1QJY3 4QPIC 1DYOA 1SLLA 1ZZ8A 1PO21 3NKGA 3E6CC 4Z82A 4PIXA 4RD7A 5FV3A 4XJAA 5DUUA 3CHXA 3AMMA 4Y3OA 1JYVA 1MVQA 3BTAA 3VBFA 3FLPA 3A0NA 3K77A 1ZBE2 4YLZA 4UW4A 4QB2A 4MGTA 3DYPA 4CP1A 4RR3A 3KF3A 2PQQA 3RVHA 5HI0A 3ZM8A 4LOSA 1W6QA 4AVCA 1RUE2 4MGYE 2DURA 4MHUA 4OLLA 3GZAA 3NAPB 1HIXA 1QJFA 1XJAA 1AJKA 4XCAA 5GLWA 1QWRA 4Q4V3 3WF3A 3T1LA 3WLUA 2QJVA 1Q56A 4PLNA 4NHLA 5GZDA 5FXXA 1ZZ6A 3TBDA 1L7QA 3PIJA 2MNGA 2CDOA 1FNYA 1AR61 3MFCA 4X8NA 2YZ4A 3RJRA 1LOGA 1W06A 1YI7A 3LFMA 2OPWA 5FY0A 2VUCA 4CDUB 5FPXA 1LB2A 2XONA 3NJZA 5IW0A 4HPKB 2WZ8A 4ZU4A 1MQTC 1GUIA 4AHXA 5JZGA 1PO11 4PT6A 5JVVA 2HWE3 1X8EA 2LM3A 3JBG1 3TNPB 5J1XA 3VBHC 3BOPA 3OUJA 3VDDA 1XBFA 4YM1A 3BTZA 3H50A 2DCKA 4LKFA 3W9AA 4NHYA 1WW6A 2HWB3 4FPOB 1OFSA 5C70A 1IKPA 3LZZA 1UMHA 4P5HA 5A6QA 3VB9A 4XE9A 4Q0VA 3RMXA 1OUXA 4YG6A 2QQMA 4AI2A 2WWSA 2JE8A 3WNXA 4AW7A 3PNAA 1S1AA 3M4FA 1HJFA 2DFCA 5JMOA 3TWIA 1NQJA 3ZYPA 2YGLA 2JE9A 1LOCA 1HX6A 1FT9A 3IBMA 1K5MC 1Y43B 2VCBA 5A33B 4S2DA 5FO9B 3NKTA 5JOWA 2ET7A 3GF6A 1TMF3 1D4VB 4NRMA 1PIV3 4WV8A 3H1YA 3POBA 4BIFA 3LPFA 2G9FA 2JG8B 5FKCA 4XTPA 2BUKA 3VKNA 5TSWA 2K9ZA 1VBB3 3ZSLA 2GC2A 4DS0A 3GCWA 5FZLA 2VL4A 1PO23 1ZRFA 3G7DA 1NYWA 3L2HA 1OXCA 4A7YA 3ZDSA 3B69A 1JZ7A 1SDWA 3HOBA 5T55A 3ZYHA 4P9LA 1ND3C 1IS6A 2WN2A 4N90A 3VGIA 2ID4A 3U14A 3H3ZA 4FT8A 2JEMA 3B94A 5APAA 4MADA 5EXOA 3ACGA 3POWA 4MG2A 5GKAC 1CGPA 4DFSA 2VCMA 2W94A 4V2WA 5CFDC 3P5BA 4CU9A 4BLJA 1VAVA 4Q27A 1VP6A 2R1DA 5FZFA 2RJ2A 3KMHA 1AUYA 4HK9A 4CVUA 5BNOA 2ARXA 4XJUA 3ZFFB 1MS8A 1ULOA 3RG0A 2CTVA 2W95A 5IHRA 2RDNA 4LKSA 2I2SA 4P02B 1QU0A 4LHLA 4UFKA 4YNIA 3DPRC 1ULDA 2W1QA 3NVCA 2XMLA 4M00A 1AR63 4KNCA 3KV4A 3DN7A 2AR6A 4RR3C 4AEDA 2RS32 3HIFA 4XFCA 3NO8A 4QT6A 5FRAA 2IVIB 1PO13 5JXIA 5ISLA 3ZFEB 1ZYBA 1RUI2 3V0AA 4XFFA 3JBG3 2XLAA 2Q8CA 4IL7A 4ZS2A 3E5QA 4CDWB 4COWA 1ZBE1 1IOAA 3PUIA 4LK7A 5C8CB 1IG0A 2JG9B 3B7MA 1YFYA 4QX8A 1FMD1 4HSJA 5KWRA 3D8CA 1RUE1 2X29A 3I2HA 3VN4A 5F6KA 5DDJ2 3H8OA 1BEV2 2NYYA 4L11A 3DECA 5SV8A 2JE7A 1ZZBA 4XJZA 2A6XA 3T1MA 1G6NA 4R9CA 2LRPA 2RM22 5F3GA 2E7AA 4QXCA 2YFZA 2F17A 1GSLA 3OYWA 1LOFC 1WLWA 4QDRA 4PI2A 4D69A 2ZAHA 4MXWA 2J1TA 3TRSB 1UX6A 2QVSB 5FYTA 2EIEA 2VW2A 1OI6A 3GXUA 5A7PA 4OI4A 1REDA 3B9CA 4K1ZA 4G3YC 1LKNA 4QPGA 5LWBA 4UI9L 1UD1A 2MPFA 1MS4A 3AYEA 1GLHA 4JGYC 3H0OA 4DB5A 5FZ9A 4Q1RA 2PELA 3B01A 4N43B 3MZHA 1YQ6A 2GC1A 2QQKA 3MLJA 2ZZJA 3O1RA 1XU2A 5FJHA 4P9XA 1H30A 5IYYA 3K51A 1CN1A 1XNCA 3CMGA 4C90A 3GZTB 1F8VA 4YFZA 1KGYA 3ES4A 1RITA 5CFCA 1H4HA 4GALA 1YLLA 4WVMA 4R9DA 1CQ9A 3WG2A 3N9OA 2LW8A 3O12A 2WO7A 1OFNA 5C4WB 4FTEA 1JUHA 1UXXX 1VR3A 2BZDA 4G4FA 1BYHA 1DLCA 1HQWA 5JOZA 2UWBA 4QKFA 2ZEXA 1S2EA 1IS3A 4N9HA 2ZACA 5D8AA 4DMIA 4EN6B 5T54A 2DU1A 5F3IA 4AF9A 5K0UB 1ENXA 2HWD2 3PVBB 1AZDA 4FI9A 4FXKB 3VZNA 1KDMA 5AFEA 1SEFA 4BPZA 4NR1A 5BNNA 4PJYA 2VUJA 5A3MA 2UWCA 1MS0A 1OQEA 1AXYA 2W0XA 5JI7A 1GOHA 5E89A 3BKZA 2IVJA 5FIXA 1XNBA 4N9IA 2FZ2A 5I8SA 3NNMA 1PHMA 1ZBE3 4CPBA 1ZREA 2VE1A 2C6SA 2AH2A 3HNYM 1W6NB 3DYOA 2D3PA 3OF1A 4H55A 4H7MA 1FMD3 5FZ8A 3WP5A 1QDCA 4C91A 3VD9A 1RUE3 3NSTA 2R49A 3MIBA 1KDKA 2QQIA 3FL7A 2XDVA 2C9AA 3N9LA 4IE6A 3RGBA 3D0JA 4PBPA 2HWC2 5IK5A 3QD6A 3VBFB 1QOTA 1QOOA 2VM9A 3CJIA 4CUGA 2XOMA 4LE3A 4NO4A 3ZFGA 1S0BA 3CU7A 5LA9A 4AEJA 2Y8KA 5KHKA 3LEKA 3TEZA 1D7PM 3T3YA 1W9SA 2BNMA 4AGRA 1W6QB 4EZHA 2P17A 2Z4FA 2RS31 5EJ1B 3FFZA 1XSQA 5FYYA 3SMHA 5FPUA 5IK7A 1MEC2 4Q0PA 5DG2A 5SV5A 1RUI1 1WLCA 3R4SA 1JODA 4XETA 1FAYA 2FDJA 3RYPA 1F15A 3KLSA 1OA4A 1W6OB 4IE5A 1CPMA 2OT7A 3ALQA 3OPTA 4CP0A 3OPZA 4YW1A 2R042 5FJKA 4I3GA 4XBQA 4QX2A 4OUEA 2JJ6A 3H1WA 2UY9A 4DRRA 1VBD2 1VAMA 5DDJ1 1WGPA 1QMJA 1BEV1 1KXGA 2WSUA 4XMIA 1RUOA 5IK4A 1PVXA 2O8OA 1H8TC 1EUTA 4C0BA 2P34A 3LD8A 3SITA 2RM21 3JZVA 1LENA 2R7EB 4QPGC 4XCBA 4JTNA 4XFGA 5LBEA 5KHGA 4BQ5A 2RVAA 3MW2A 3HJRA 4QDSA 2VCAA 4INDA 1OQ1A 4UFHA 5EPAA 3IMNA 4BCUA 3HAGA 2ZGMA 5DZEA 2JX9A 4CSWA 2IXLA 2G1MA 1EV12 3OD4A 5D21A 5FPLA 3UK9A 3WY6A 2AREA 3C7HA 1JU4A 5A70A 1QGLA 2AUYA 2BNNA 3MUZ1 3J4UH 3RMYA 4UW3A 2HEVF 4DRVA 3PTYA 5JCTA 2LALA 3J7HA 2OQ7A 1GWKA 2WA3A 5FO8B 1D4M2 4YM3A 4GULA 1DQ2A 4IEYA 4LMFA 4XQDA 1NAEA 3OD0A 2PLV2 3WEZA 1O6UA 2HJIA 1OLMA 2DTYA 4FP3A 4NIIA 4AG4A 3QLQA 4CDXC 1DGWX 3NMBA 4LBOA 3BTXA 1CWPA 1Z0HA 5FZ3A 1K5JA 3I3BA 4IGOA 4ZONA 1LGBA 3I3QA 1ZRDA 3HD8B 3J7MA 3X29B 3I2JA 1AX0A 4NPRA 4EN0A 5F1RA 5K8SA 1DCSA 2JD4A 2ADEA 3I2DA 4LO5B 2FHRA 3POGA 1B35C 1JS9A 4QU2A 1H4GA 1NLSA 5JXGA 1ZRCA 4F8AA 3AFGA 2VBDA 2CSGA 5J37A 2HWD1 5FLIA 2BNOA 2EALA 2VZ3A 2XJRA 2SLIA 4D0QA 2QDRA 2YFUA 1AR92 2CAVA 1DDLA 3WNKA 1U5ZA 2RS33 2Z79A 3QOPA 5FP7A 3NV4A 4URAA 5C3OA 4Y26A 4S2GA 1F31A 3VKFC 4A42A 3M3QA 2W39A 1RUI3 1EPWA 2ZS6B 1GP6A 5T50A 4YW3A 3VDCA 1XNAA 3OB8A 2X5IC 1HKDA 1YC61 3K4AA 3PJYA 5IFPA 2G4IA 1QEXA 1Z7S2 2K2SA 1KJLA 4AEDB 2B45X 5FKBA 5C9AA 4YG0A 1LHVA 3B3QE 2FDKA 3WX5A 1WW5A 3IAQA 1AX2A 3SCGA 1ACCA 5DDJ3 4PQQA 3V0AB 4GB32 4GWIA 1BEV3 1HRV2 2HWC1 4PHZA 2PXJA 5F2SA 4BJ0A 3OG2A 4LBLA 5KXDA 4W6XA 4Q0UA 4R52A 2RM23 4AHZA 1CJDA 1DIWA 2JIJA 4LR4A 3M1HA 1QJX2 5LATA 3A21A 1PNGA 2WA4A 4IV3B 5FP8A 5JSPA 2Y26A 5CISA 5J3UA 2QZ3A 4HSLA 5LW9A 4UAPA 3ME2A 5L9VA 1E5HA 4JKMA 1S0GA 2C9KA 4IEVA 2VMIA 2XKPA 2PHLA 2WRAA 2ZBJA 3S5AA 1S0IA 1X9PA 1MEC1 2P4EA 1HLCA 3C2UA 4AFMA 1ND2A 4FPLA 3IDEA 2R062 2JD9A 2XLGA 2WZEA 3OYWB 4NUBA 4HVQA 4JGZA 1OSGA 1RUNA 2R041 4YGBA 3LFIA 3ZKUA 4RS5A 1LU2A 4PI0A 4GMP1 4NAOA 3OGVA 1Q8VA 4MH0E 2W3JA 4Z1VA 1VBD1 2A6WA 3MIEA 2YBKA 2PAEA 3IT8A 4E8DA 1MZ6A 1RXFA 4I0WB 4WZCA 2A6VA 1C28A 3WCRA 1IS5A 5LY1A 4RFT0 1KITA 1L7RA 4PF5A 1BMV1 3MW3A 2ZZQA 4E2QA 4H2AA 4N7UA 4W65A 5CBLA 3IIAA 1MS3A 3N7KA 3NRUA 5FZIA 2VQTA 5F5QA 2PA7A 5FYCA 1EV11 3VHPA 2WFF1 3BIWE 2VOKA 3I2KA 3SC7X 4XVHA 5LCWL 1GV9A 5CFCB 2HWD3 4JVAA 5DAXA 4NIGA 3O1VA 1R092 3HN1A 4WVMB 3OY8A 3BI3A 1ZZ9A 4AVVA 2W46A 5JDBA 4FQ4A 2Q1MA 1S55A 4N53C 3WOGA 1PM7A 4GH4A 1D4M1 4Y1ZA 3H3UA 4XHBA 3WCSA 3WW2A 4IE4A 3CF6E 1YO8A 5D8AB 4P08A 2CL2A 2WFPA 1FOD2 4HPKA 4I30A 3OTFA 5FZ6A 1DHKB 4E2GA 4RGGA 5F37A 4ZXKA 1DQ1A 5FYVA 1O59A 4EZ4A 4IEQA 4Q4X1 5BNNB 4DOUA 1UO9A 1LTEA 2IXHA 1OURA 1WA6X 3N7LA 5A3NA 3M3IA 4Z92B 3EQEA 3POSA 4Q1PA 3MV01 2QDNA 5FFOC 1Y9MA 1DZQA 2HWC3 3AMHA 2ZGLA 4ZXEA 1W9YA 3JQXA 3NJYA 1JHNA 3WXPA 2EVXA 5FMDA 5BYNA 1W0NA 2B9VA 2XJSA 1GQPA 3WDTA 4IV1B 4Y20A 3RI9A 2J1RA 2YXSA 2DU0A 4LIUA 4E2SA 5L7OA 4ASKA 2EF6A 3EMRA 3ECQA 1AR91 1G86A 2Y0OA 2E53A 4KU8A 1H2MA 1EUUA 4FSJA 2DBNA 2VO5A 1TG7A 2DVGA 1KQRA 1MEC3 2D7FA 3E6DA 1PK6C 4XILA 4AYUA 4BK4A 3NNGA 4KBBA 2NM1A 2L9LA 1HJGA 4P9WA 4XYXA 5FY5A 2QE3A 3W5MA 2ES3A 2W68A 1GOGA 3RWNA 5IK8A 4YGDA 1NXD1 5IAVA 1TME2 2KA3A 1Z7S1 2WO1A 3WP6A 2YUEA 2JG8A 2R043 2YPJA 3VBUB 3WF0A 2AC1A 1KS4A 4GMP3 1PMHX 3GYDA 4DO0A 1DU3D 1RXGA 1VBD3 2BGOA 5ABJA 5A3OA 5FZDA 5A3UA 1OMIA 1LJ7A 3WP3A 2ARCA 4N8MA 1GICA 1V0AA 2YC4A 1ND2C 3PVEA 4AGVA 2BBAA 2EIGA 2W1UA 3ACLA 4M3CA 4GXLA 3MYXA 1FNZA 1O3RA 4A41A 1TNFA 2XLFA 4IXLA 1QY4A 2VTXA 3H8XA 5LB6A 5IJRA 4C8DA 4IDZA 3VHOA 4CDQC 3SNMA 2Q4SA 1EV13 2QFEA 3DGTA 3KT1A 2I74A 5D2AA 1OBNA 4FTSA 5IVJA 3AKRA 4HK8A 3LIHA 5HPOA 1POQA 2GNTA 1GNHA 1CR7A 1D4M3 1HB4A 1YFXA 2ZHNA 1RUD2 4YW7A 2YBSA 1VE0A 3KGZA 4JDOA 2KD7A 4QM8A 4FPCA 2XUMA 3N9NA 1US2A 2PLV3 4M4RA 3FE5A 2D93A 3CQOA 3BU7A 4KWKA 3WG1A 1N1YA 2EIBA 4V2VA 5CU1A 1AJOA 3NAPC 1JZ5A 5FUNA 2WT1A 3Q8EA 2WQZC 2FDGA 5DMYA 2JB8A 1YFUA 1O3QA 2JENA 3MEPA 2E51A 4HMZA 1ALYA 1JOPA 3M2MA 2VQAA 2WT2A 2VZUA 3FFQA 3IM0A 5GLZA 4D3WA 2A5ZA 1CAWA 3WW4A 4YW2A 1DQ5A 4B1LA 2LROA 5I0RA 1DFQA 1IPJA 4CDUC 4KU7A 4GD4A 3AZYA 5HXVA 1UZWA 1F5FA 4XF1A 5C6CA 4LULA 1R091 4EJRA 2EAAA 4KQ7A 3LQCA 1XE7A 1AR93 5L9RA 5BPXA 2XR4A 2XKOA 1W0OA 3AL5A 3HPNA 4J25A 4O9EA 4CZSA 3PJQA 2Y38A 3DEMA 1AYM2 5D8AC 2P37A 1IQAA 3U1XA 4HZFA 1LOEA 4XBNA 4AEKA 4AQ2A 4AVSA 1V6IA 4CCNA 1LOBA 1OD5A 3CL1A 3OBTA 1UF2C 3OGSA 2OW4A 1Z7S3 5H9PA 1EAH2 4MGIE 4AE2A 1XNKA 1U5YA 3D4KA 4AI8A 4EWDA 5FP4A 1XE8A 3NJXA 4FPJA 1CVNA 1SBFA 3LCPA 5JAXA 3JU9A 4GB33 3WNLA 1YYNA 3MIDA 3GDBA 3DV8A 4BE3A 3RPQA 4QX7A 2XXZA 4LHNA 4X6RB 3WG4A 3ZYGA 1O91A 4HXCA 4MUVA 2ZMLA 4D6RA 5C9AB 2BOJA 1UKRA 2QQNA 2JG8C 2PAMA 3EHKA 5LA0A 4C1XA 2QKDA 4TN7A 5LZ6A 2P3YA 4BQXA 1POV1 2FD8A 4ZY9A 2EXHA 3H8UA 3ZN5A 3J7LA 4XFHA 4YVSC 3LOIA 4HN1A 5FZKA 1X82A 2YYOA 4XQWA 2R063 2C0ZA 3V64A 2D6NA 1DGRA 4CCDA 1TME1 3N36A 5K0UA 4AFDA 2VD7A 1FI2A 4DINB 3ETQA 2ZABA 4FPEA 5J98B 3JXSA 4GMP0 4QXHA 1LEMA 4RA0A 2Q8EA 4QQOA 3T2TA 2B46X 5FOBB 3UL2A 3TYJA 5T52A 3SH5A 1WMDA 2O1QA 3ZFFC 2P3JA 1YQ8A 4JGZB 4YFWA 3IDAA 1CZVA 1G9FA 1NE6A 2FCVA 3GHNA 4RS5B 5DAPA 3USSA 3WINE 3ZXJA 3EO6A 1HRI2 2QQLA 3E5XA 5CIRA 1Y7BA 1NLRA 1W6NA 2RV9A 1CPNA 3MBWA 5DZGA 2J42A 1WCUA 4OFGA 1HB3A 4AI3A 4YZ3A 1VLNA 3AZVA 3K48A 2K0GA 5A1LA 4L0PA 5FYHA 3ZFEC 2WQ4A 5K9YA 3PUAA 2RDSA 3VL8A 1JYTA 1S0EA 5FZOA 1R093 2WUHA 4RN5A 1HB2A 4LBMA 4MX3A 3UGGA 4B4PA 4CDWC 3ZXLA 3LDRA 1W8NA 4CXYA 1DQ0A 1RUD1 1UU5A 2VMEA 5C8CC 5I0SA 3O1TA 1YQCA 1NKGA 1VMFA 2JG9C 3AZXA 1RC6A 1DYKA 1NCQB 4W8JA 5I93A 2EXKA 4R9BA 1REFA 1NG0A 3OY8B 3MLKA 4WM7A 3K3NA 4QKBA 1IG3A 4RHV2 4Y22A 3O7OA 2XVGA 1LHOA 2P6HA 3KM5A 2ZEZA 1W6OA 4GH4B 2WNEA 4CP9A 2GN7A 1RVF2 2ZTNA 1V00A 2JDHA 2A7AA 1OH3A 2GZWA 1LODA 2DV9A 2J7MA 1CX4A 2O8QA 1LHWA 1E57A 3RDIA 3PHMA 1UOBA 1UU4A 2QNKA 2BDRA 2W08A 4MSVA 4OZXA 5JPNB 5GZCA 2PQSA 5IVBA 2WABA 3THTA 4DQAA 4JZRA 1O7FA 1UIKA 1VB2A 1RUH1 5FMOS 1WCQA 4ZS3A 3LIGA 1CZTA 1POV3 3LE0A 3A23A 4B29A 1OF3A 1AYM1 1ZZCA 3M8LA 1UY4A 4CEYB 4N43C 2D6KA 3VBSA 3BTYA 2DUQA 3MHZA 3IIIA 5IFTA 3THDA 2WS92 1VPHA 3I8TA 4Y20B 3EYPA 2CAUA 4BQ2A 5IUQA 5L7OB 2J22A 1ENSA 4XQ4A 1HB1A 1TME3 1EAH1 1FV3A 2VZSA 4LITA 1SLCA 1VRBA 2CGNA 2Q1FA 4QQPA 5ACA2 2ZGQA 4NPMA 1LAJA 4A7KA 4UWDA 5I8YA 3ZXAC 2VNVA 5T5JA 4PIYA 4Y1XA 3ZXGA 2P2KA 5KBFA 3R05A 2BVBA 3SKJE 4MV2A 3U37A 2RG4A 3CBNA 5C4WC 2GMPA 1DBNA 3CZJA 3KD4A 5E1RA 3WT3A 2XL9A 1J1LA 4HKLA 3KVAA 4IW3A 3H1MA 1AXZA 1X8MA 4ISRA 1CIYA 2RJLA 1COV2 4C1WA 1RUC1 1UY0A 2JECA 3N7MA 2WAOA 3ON7A 4DXTA 3UESA 5ABJB 2W2IA 1JOBA 3BVCA 4LBKA 5CG9A 4HLTA 3B9IA 1PM4A 3ZMOA 2GAUA 5J09A 1C8M2 2I07B 1OKOA 2WNVA 2VTXJ 3RZMA 5L9BA 1LCLA 2WAAA 1PZ8A 4LEJA 1RUD3 2XJPA 1ST8A 4P00B 3RZZA 4M3CE 4AR2A 5HBAA 4ISQA 5LK5A 4IEZA 1J1TA 4UFLA 4YZ4A 4AZZA 1W90A 4X6QB 4CEWA 3FUQA 1DQ4A 3WDVA 1EP0A 1NX9A 1OC1A 4QB1A 1KEXA 2DUPA 5FYMA 1JYWA 2N7GA 2I45A 1CD3G 1IHMA 3ELNA 4I3PA 3WSOA 3VBFC 1OPMA 1VBC2 2E63A 2WR9A 4Q26A 5JWPA 3A22A 1VBA2 3WVJA 3VD7A 2TUNA 5E8AA 4CRQA 2HWF2 4A6OA 4LO7A 1UY1A 2V4VA 3ILRA 1UCXA 3PURA 3W5NA 3CDZB 4AWDA 5M0TA 2XH6A 2W91A 1QIQA 5K7PA 2VGDA 1QXJA 1CAWB 1RUH3 1W05A 2B42B 2VMDA 2WIIB 2Y6HA 2Y6JA 2ZAAA 3KT7A 4IV3A 4ATFA 5IVFA 2Q5TA 1M06G 1AYM3 1MS5A 4M0HA 2CWSA 5CKQA 4YW4A 3ILNA 3VHRA 3K46A 5JZGC 2VW0A 3INAA 3O5SA 1JXNA 4GJYA 1HQNA 5FZ7A 4UW6A 3BPZA 4B7KA 2Z2SB 3UGFA 1EAH3 3ACHA 3WDYA 3NV2A 4RHV1 4K20A 1AHSA 5CEHA 4XPVA 5J48A 1A3KA 1RVF1 1C8NA 3KZ4C 2CYFA 2E9QA 4QKDA 1WMEA 3U78A 5A80A 2IZWA 4XC9A 1QF3A 1LR5A 1OLRA 4LA2A 4FO9A 4W6WA 5F32A 1YNAA 1W39A 2RDQA 1GYKA 5FY4A 4J1XA 4ATEA 2D5FA 1KS5A 3SISA 1JW6A 3A0KA 3NQHA 3R4UA 4FPKA 4COZA 1XPWA 2IFWA 4COUA 3AM2A 1QH7A 4HKOA 1RUC3 4BDVB 3ORJA 2VZRA 2W5FA 4K8FA 5HCBA 1PGL2 1IKQA 2YDEA 1D2QA 3NL1A 2WKKA 1NXMA 1POV0 2GALA 4TSVA 5FYSA 2VJXA 5T5OA 2QQPA 4WVZA 2WNUA 2WS91 1ZRRA 1C3HA 3WUCA 5B4XA 4XFIA 2JKBA 3UGHA 4B4RA 3SKVA 3QACA 3VBHB 4I09A 4K3UA 1Q8PA 4AVTA 5ACA1 4BQWA 3THCA 1AYN2 1BK0A 1CJPA 1O3SA 2XGXA 3OEAA 4DY3A 1BXHA 2Y64A 2IUWA 5JXHA 2E33A 1MS9A 1YJKA 3VKMA 3ZR6A 4E8CA 5FDBA 3BU0A 2DCTA 2ZX1A 1W8OA 4EYUA 4LPLA 1COV1 2QQVA 2PFWA 4M01A 5CNAA 5G05L 3WR0A 4BB3A 1O3TA 2RS52 1KFXL 1BVVA 2YB7A 3ATGA 3IAPA 3WF2A 3ZYFA 2PHDA 1ZA7A 5BNOC 3HNBM 1C8M1 3QH6A 3FJSA 4RYDA 1I6XA 4S2HA 2ZA9A 5JPMB 4QDQA 3TEXA 4GA9A 1UXZA 3KB5A 4HG6B 1F5JA 3EB7A 1W03A 3RS6A 5DAWA 4XAEA 3RQ0A 4IV1A 1AL0G 4P9YA 4AEDC 5C3RA 1UPSA 1GANA 3MF9A 1XNTA 2P5BA 3RZJA 1TE1B 4FAHA 5G04L 1DZTA 4BQ4A 4OMCA 2GNBA 3LPGA 1YXWA 4NIAA 1QQP2 4DEVA 1UZYA 1ZZ7A 2VH9A 2WYSA 5FZOB 4O61A 4XTMA 2ZHKA 5KXEA 3I3MA 5FZCA 4LHSA 4RHV3 4CTEA 3LB9A 4M3CB 3KWVA 1D0HA 1RUF2 1VBC1 1S0DA 4PBOA 1OUSA 1RVF3 1VBA1 2W1SA 3ZSKA 2LUWA 4IV3C 5LA2A 3IPVA 2Q8OA 3VBUA 5JLVA 3N9QA 1S0FA 4FOVA 4YZ1A 5KC6A 3RZLA 2HWF1 1KD7A 2WBKA 3N9PA 4RL7A 3AFKA 5FMBA 4WM7B 5BNPA 2Y34A 2XVKA 2MEV2 4LO8A 4Q4Y2 2GN3A 4Y22B 2JICA 4DNYA 2FDFA 2WLPA 3FUOA 2VU9A 4CP9B 3N4MA 1OOPA 2VR4A 1BQPA 4FFGA 4UW5A 1VMJA 1MR5A 2NPIA 1RJ8A 3WDUA 4OHZA 4LQRA 2CGPA 2CY6A 2GNMA 3MPBA 5FQ0B 4A44A 4Z07A 5KHIA 3IB3A 4CU6A 1JHJA 2WS93 1T2XA 5EV7A 1Q5OA 1WBFA 3KV6A 1N1SA 3DCQA 3QBQA 4Q8LA 3TN92 3KCYA 5LEJA 5ACA3 3ZXFA 1NA1A 5E16A 3I4IA 3WUDA 3K2OA 5FPAA 4JC1A 5FXZA 1C1FA 2XJUA 4YW5A 5JR7B 3VBSB 1R1A2 3PIGA 1C1LA 4D7SA 1W2TA 5DQ0A 5EJZB 3OSDA 2FCUA 2HBTA 2IWGB 2CDPA 2Z42A 1Y9GA 4Y5SA 1ZBA2 1YIPA 1RYYA 3U0ZA 1RL3A 2YC0A 2B39A 2JDKA 4J6GA 1DZRA 1GR3A 5FBJA 2XPJA 1DG6A 1WLTA 1COV3 5CFCC 3J7NA 1GZWA 4JV4A 4DIQA 1PGL1 2TBVA 2VUDA 4LA3A 1VJ2A 5A33A 3BPSA 5CKNA 2BGPA 1H9PA 2HH9A 4LK6A 1MPXA 4PDWB 5F3CA 1UW8A 3D3AA 2E7TA 1C8M3 4FVVA 1SHWB 1JN2P 3AP7A 1UQXA 3N35A 1U5XA 2JDUA 4QX0A 1T6BX 2GP5A 4XJ9A 4Y1UA 5F5CA 3T2PA 3F95A 2Y6GA 4URTA 4WM8A 5A3LA 1OT5A 1OHFA 1SDDB 2A3WA 3VD4A 3O1PA 1I3HA 2HLEA 3K4DA 5BNNC 5LEKA 1AYN1 1W8FA 3DKWA 4IEUA 2VC9A 4GWNA 2HKXA 5C7GA 5CA6A 2QQUA 2JDMA 2H0BA 2WNVB 2X8KA 2D6PA 4OUMA 2ATFA 2BWCA 2WDBA 4YSFA 4O9GA 1LGNA 2EXJA 5A6YA 2RMU2 4BXFA 2ZHLA 1VBC3 2W52A 4GIQA 3AVRA 2PTMA 4LT5A 1OVSA 1VBA3 3D82A 4IESA 4IV1C 4CEWB 3ZN6A 1YWKA 4QWNA 4QKNA 5F6LB 3UKTA 1ZRIA 1JBCA 3C7FA 5FAXA 1SACA 2HWF3 2RS51 4MO3M 5E6HA 1KRIA 3ZYRA 3M3OA 5I91A 2DCZA 1UMZA 3CJIC 2J1EA 2JB4A 2MHFA 3I97A 4XUPA 5EFUA 4YGEA 3OUHA 3ZFGC 4NRPA 4CCJA 4ONUA 4XF0A 4I2OA 1M4WA 1PMIA 2PYTA 2NZ9A 5FPVA 3ZMNA 4Q5OA 3I7DA 2ZGKA 3J8F2 3JQWA 4TWTA 4ZPIA 3S5QA 4DXRA 2E32A 1O4TA 5GJ6A 2LS6A 2VXJA 4A3ZA 4RSUA 2DBIA 1W8HA 1CAVB 1F2NA 2NLRA 5BY5A 2E7QA 3AXDA 4F3JA 2W9XA 3VDDB 5JOYA 5BV6A 4QQ2A 3PDQA 3BN6A 2FQPA 1RUF1 3JB8A 4QPWA 1HV1A 4FPHA 5ANQA 4SBVA 3ZX7A 2H6BA 1JZ4A 4BLIA 2Q30A 1QNYA 4OCTA 3U75A 4XUOA 3SH4A 1MZEA 4SLIA 1V6MA 1R1ZA 3OGGA 1AR82 2YU1A 3AP4A 4UFMA 4UOJA 4NWWA 1Q43A 5EWSA 1N3QA 3Q8CA 3ZYIB 3AMQA 1V6JA 5LBCA 2HBUA 3N7JA 4Y24A 1J3RA 1K12A 2DCJA 3CNAA 3GZEA 4FQZA 5JMCA 3Q8FA 2D6LX 3DKQA 3MIFA 4HT1T 4NWVA 4O65A 3T0AA 2YROA 2H0VA 5A7SA 3VBOA 4M0NA 1J84A 1O8PA 3PU3A 1XYOA 3R6SA 1HXS2 2AYHA 1SLAA 3IWZA 2XG3A 4CXWA 4IQPA 3OBRA 4K40A 3UKVA 4XACA 4BK5A 4XIOA 4OZOA 2O14A 3VZLA 3A4UA 3VZMA 2VBBA 1N3OA 1AYN3 2Q8DA 2JDNA 3S6PA 2AZ5A 1WBLA 2K46A 1H6YA 3D0SA 4FP2A 1R1A1 4XOGA 3N3HA 3VDBA 2NMOA 4CPBD 2WNUB 4LTAA 3PUHA 4RGAA 5L36A 3SEEA 4KBZA 5JXJA 1NCRA 1NCQA 1ZBA1 1QNWA 3AMPA 3HT1A 4Q2FA 5DABA 3GNEA 3ITQA 4B3NA 2VVEA 3HQRA 4XFAA 2QCSB 1V6KA 1GWLA 3OEBA 3WQBA 2D3RA 2GMEA 4LLFA 3SH3A 2R6QA 3JD72 3I2IA 3IDBB 1IS4A 4QU1A 2V72A 1HDKA 2RS53 3ZVXA 1W2OA 2GMMA 2PLV1 5JUVA 4TLFA 3FHIB 1QJY2 4UFJA 1F35A 4OQ9A 1O4YA 1J58A 2BW8A 3VV1A 2VMCA 4KMQA 2PHXA 2WINB 2CU5A 4DEQA 4AOCA 5HV0A 5L19A 4DUXA 1UOJA 3ACIA 3TAYA 2KM2A 3BYWA 1JYCA 3WZ1A 1PZ7A 1CONA 4Q8KA 3J9SA 1DP0A 5IVVA 5D1IA 3VKLA 2BGCA 2IXCA 4CEYA 4MGSA 5LRSA 2ZHMA 2DCYA 3V0BA 4AK3A 2HEWF 2ZGSA 4YM2A 2FCTA 5DUWA 4BZ4A 4HONA 2RMU1 3T2QA 1RUF3 5DAVA 3AP9A 1QOSA 2XVLA 4AHWA 5I8TA 5C9AC 1QH6A 4LKDA 5FY1A 2DVAA 4ASMB 2AENA 4AEMA 5HCFA 3VZJA 3LF7A 1MVEA 4PLMA 4RQPA 3T08A 3LOBA 1HW5A 5FY7A 4Q4Y3 4BU2A 4Z2AA 1OA2A 2AEZA 2D6MA 2VY0A 1XYPA 3AJYA 1GNYA 4YVWA 1RUG2 4CCKA 3CO2A 3IPVB 3P1IA 1BLZA 3ZSMA 3DXUA 2XQXA 1I9RA 3B00A 2JDZA 2VCCA 3L9JT 2JDPA 2WZR2 4IEWA 4K9SA 5H9RA 5BNPB 3T0BA 3DYMA 4GB31 4LOTA 3ZYBA 1HRV1 4KWJA 1ULFA 2ENRA 5FP3A 3S0MA 4NAMA 1LHNA 1OOPB 4NROA 3SXWA 2BERA 3VD3A 1V9U2 1QJX1 1STMA 1A6CA 2AEYA 2ZCWA 5C71A 4LBQD 4FCAA 2VMHA 5LBFA 4JGZC 1JZ2A 3SCFA 3TOJA 4RS5C 2ILMA 5A3WA 2BV4A 4XUNA 3GJAA 4UBGA 1R1A3 4JQRA 1WD3A 5DN2A 4EN7B 2XQRA 1XOYA 1LNSA 1SZBA 2OZJA 1AR81 1WUVA 2WO3A 4BOWA 1ZBA3 2QQOA 3E97A 1SFPA 4QMAA 1GNZA 4MGKE 2LTNA 2WJSA 4H14A 1UY3A 5FYZA 1RHI2 2FZ1A 2F4PA 1NA1B 2ADDA 2R061 4YM0A 3CEWA 5DXDA 1RUJ2 4R4ZA 5IWFA 4NPLA 1PIV2 2VZ1A 3FZ3A 2PHFA 4D94A 2O0OA 3S30A 1FYUA 1C57A 1SPPB 2BBVA 4QM9A 4AAXA 4LNVA 2YU2A 4TLGA 3VZKA 4JKKA 5FBZA 4BQ3A 4NIHA 3WF1A 5EJ3A 3HR9A 1BVP1 1PO22 1HXS1 1SFNA 1GZ9A 4GKYA 3PMSA 2XJVA 1SMVA 1FPN2 4BMBA 1GZWB 3OBAA 1CAXA 1WA4A 2IXJA 5FUPA 5J36A 1BHGA 1OQDA 5FTTC 3M3CA 3GHMA 4GH4C 3OGRA 1PVC2 2UU8A 1XNDA 5LASA 4ES9A 3KHBA 4KG0A 1LEDA 5C3QA 2B4KA 2E6VA 4QHZA 2YC2A 3FN9A 3IKWA 2OUHA 4QPIA 1DGLA 1I5ZA 4WM8B 3UYJA 5EHDA 2RMU3 2ZXQA 4JDNA 3S57A 4D6SA 4KL1A 3FWEA 4LHKA 5T5LA 5DZFA 2V09A 3JD71 1W9FA 3LAGA 2YHJA 4OI1A 2C4XA 3POJA 4MZUA 4YW6A 3FLTA 3DF0A 4QGNA 1TQ5A 4CEYC 2G19A 1FOD1 4XUTA 5FZEA 3O1SA 2QZ2A 3Q8AA 4I0BA 1BBT2 3VKOA 4CA9A 2R30A 1X33A 3GM8A 5JOXA 1UMIA 2G9GA 2VMGA 2A3XA 2HEYF 4K21A 3ZN6B 3ZXDA 5L7OC 3RRDA 1FXZA 4ZKTB 3J8F3 4E4ZA 1LOAA 4B1MA 2WWUA 4BISA 3UNPA 1OH4A 5EQUA 4JRLA 3R4DB 1HRV3 4V1PA 5IVEA 5J7MA 1G9CA 4BQ1A 4CU8A 2PMWB 4HVRA 3O1UA 2C24A 3ZSJA 1F4HA 2ZKNA 4XZUG 1QJX3 1MQTA 5LRRA 3VLBB 1ASJ2 1SG3A 1HV0A 2D5HA 3NWKA 4XABA 5FMOL 1DQ6A 2VTFA 1N1TA 4QD2A 3VBHA 4EE2A 1EPZA 1PX4A 2D6OX 3O0VA 2D43A 1AR83 5JR2A 5ABJC 1GP4A 3T09A 2IXKA 5BXXA 3LGRA 5FZ1A 1AR72 5GLVA 3EXUA 3LEMA 5H9SA 3K4ZA 1RJ7A 1URXA 1P8JA 3C7GA 1O4ZA 5CAZA 1PZ9A 2FMDA 2GU9A 3PUSA 2VQUA 2BFUS 1X50A 3I3EA 2V4AA 4H7LA 2CGOA 4FOWA 3RJ2X 3KV9A 3ROUA 2WZR1 3K3OA 1WCDJ 1Q3EA 2R0HA 1AVBA 1XYNA 1HXS3 1K5MA 1UWWA 1I5PA 2VVFA 2WSVA 3VBRB 2B5HA 4DZGA 3I49A 3SHRA 5T3NA 4JX0A 1KJRA 1V9U1 3A7QA 3HN3A 3I3DA 1NUKA 5FZMA 4XEZA 3UT0A 3ZIWA 4YARA 1K3IA 5EYXA 4TTGA 1EY2A 1W3XA 2CHHA 2VZQA 5A1AA 4CXXA 3VBOB 3B93A 4QQLA 1G8WA 4QHBA 2Q1ZB 3WHTA 4Q0SA 3KGLA 3PL0A 5C8WA 3USUA 4FFFA 1RHI1 3IZOA 5FYBA 4AQ6A 5FP9A 4BMEA 4BIOA 1ND3A 1RUJ1 3AZZA 3JD73 2ARAA
chains in the Genus database with same CATH topology
2GNDA 4OVEA 1MS1A 1Y9QA 3KCCA 2VXRA 4D7YA 5A32A 4KWLA 1NCRB 1FOD3 4GWMA 1VB4A 4I02A 4U36A 4OHWA 1A8DA 4DPNA 1FPN1 3RI8A 5FCCA 1H0BA 4XJWA 3DPRA 1PVC1 2DFBA 5JSRA 2OUJA 1G9AA 3H7JA 1D2SA 4B7EA 1OPOA 1APNA 4WZFA 1FMD2 5FQ0A 2D97A 3CLPA 1C5IA 2SBAA 1DGWA 3PMEA 4XXAA 1PGW2 4QGLA 4JDMA 3AYCA 4NHKA 3R0RA 1WD4A 1XXNA 4COYA 1OA3A 2XJQA 1YIFA 3IDCB 4PCRA 3V0BB 4L92A 4YGCA 1W6MA 2R072 1AXKA 1BBT1 2HYKA 3E6BA 3HMYA 2XL7A 1WCKA 1RUG3 4QGMA 5C33A 2DUOA 3B02A 4IETA 3W58A 2OVUA 2WZR3 1ZNPA 1U12A 4L2NA 4META 4RQPB 2A70A 1LOFA 3KS7A 2NP0A 4PDWA 1GZCA 3JCIA 2D44A 2RR12 4FPYA 1CIWA 3UV9A 3AXEA 4YVWB 3HWJA 4J1WA 1V9U3 3NW4A 1ASJ1 4FXGB 2ZMNA 2DVFA 1CESA 5K0UC 4A3XA 4Y5Z0 2V73A 4I0AA 2TNFA 3ENRA 3O14A 1Y3TA 5FPZA 4BH9A 4JGYA 4XW3A 3SLIA 3WQ1A 1TNRA 2ZPXA 5EZWA 3MDPA 4OHXA 1AR71 3FX3A 1RHI3 3V56A 4S2FA 1UN1A 1RUJ3 2B8MA 1QJU2 1HQLA 1GFF2 4LBJA 4EV0A 4Y1YA 4FOQA 4C0HA 3MGUA 4AQTA 1YCIA 4AHYA 4LE4A 4P14A 3OGJA 1LRHA 3P3NA 1YFWA 1H2KA 4YVSB 5F9TA 1FPN3 5FOJB 1J59A 1HRI1 1MACA 1PVC3 1N3PA 3C3VA 1OLQA 1ONAA 3KQRA 4BM8A 4HL0A 4EN8B 1GQGA 3WD5A 1NY72 1XRUA 2OYZA 1ENQA 2DVDA 1QKQA 1GKBA 2YGMA 1CAVA 2GDFA 4WM7C 1ULEA 1CAXB 1W0PA 3LA7A 4KGGA 1LGCA 3GBFA 3PLQA 4QPIB 4B8EA 4KGQA 2VULA 5GZEA 2VECA 4OULA 2A71A 4KG8A 1UPIA 2C5DA 3LSEA 2R16A 1BBT3 1BK1A 1U0AA 4UBHA 3VUOA 4AFBA 4K1YA 2Z5WA 2ZOEB 4ASLA 4D7TA 1WMFA 2R1BA 1LU1A 3JB4C 3VBSC 5AVAA 5CB7A 4F7ZA 4XF3A 5GM0A 4PIZA 2A73B 2PHUA 1XQNA 4PLOA 1ASJ3 1ENRA 1PGW1 3I59A 4FPGA 4LBNA 4P9JA 2XWBB 4HFSA 3KSCA 4LUKA 4P9IA 4Y1VA 3M70A 2P3IA 3DL3A 2YY1A 4PDWC 2R071 1AR73 1MQTB 3ASIA 3AX4A 2DWRA 4QPYA 4NOTA 2ZJCA 1H8TA 3DUIA 4IEXA 4AXOA 2D98A 3U11A 4EWEA 4DY5A 5GZFA 1H8VA 2BYVE 1N47A 1H2NA 3GBWA 3WP4A 1UIJA 2RR11 2WNVC 4Q4W2 1YI9A 3OJBA 5BUVA 2EAKA 1A78A 1FV2A 2WC2A 1HRI3 1ZVFA 4CEWC 3AYDA 1RMU2 3LKJA 4QX5A 1K5MB 1OKQA 1ULGA 4XFBA 1BKZA 4CYDA 4GQ7A 2R32A 3HQXA 4CDXA 2ZX0A 3KT4A 4JCKA 1QJU1 2GC0A 1H1IA 3FBYA 3USUB 1B35A 2EXIA 1ND3B 2QUOA 4XDQA 3VDDC 5A32B 4KH9A 5AFBA 2PHRA 1KFUL 1VBE2 5CFDB 3ST7A 3BODA 1NY71 1S2BA 2PAKA 3POYA 2BVVA 3AKSA 1SLIA 3MIHA 3S7EA 1RTVA 1C4RA 4ZU5A 4L99A 1IZ3A 3MF6A 5B2GB 3DPRB 4AI0A 1CAUA 1IPKA 2X5IA 1VALA 3LA2A 4RR3B 4X8PA 1VRH2 2UYAA 2R073 3Q9OA 4PQ9A 2VNOA 5FO7B 5JSOA 1JH5A 3AB0A 1ULCA 4EROA 2PN5A 2VPVA 5DUVA 2VW1A 1ZA4A 4NN0A 2NQYA 4FPFA 1V6NA 4E4SA 3ZO0B 2NMNA 1W6MB 3TB0A 4XHXA 1JUIA 1V6LA 1YRZA 1UKGA 2RR13 4OI0A 2UURA 2WNUC 5JZGB 2A3YA 1UAIA 4QXKA 2KXLA 1O5UA 3AK0A 4FOYA 1DYPA 3WDWA 1X36A 1WCSA 1V6OA 5LK7B 5T5PA 1BZWA 4HVOA 3PVOA 1W2UA 1BMV2 5CADA 4NHMA 4BYYA 2BQPA 2C1FA 2DYCA 4ZU7A 2CV6A 3VZOA 4B4QA 4NVPA 1Q8QA 2PHTA 5FLHA 2WFF2 1QJU3 2A6YA 4R9AA 5FLJA 2VG9A 2WL1A 3M7AA 4JGYB 1AF9A 1MZ5A 4XBLA 4YZ2A 3VL9A 1D0GA 1TEIA 1S0CA 1NOVA 1YUDA 4Q4W1 1J3PA 4LBQA 4Q0QA 2ZGOA 2BPA2 3MIGA 5KHHA 4EN9B 2RS12 1WLDA 4GKXA 3AYAA 5GALA 4Q4X2 3WQ0A 4BHPA 4N53A 1RMU1 1LECA 2ZKLA 2ARBA 1A8MA 3L2YA 3GALA 1AL22 3S7IA 5KXCA 4WVVA 1SBDA 1H1MA 1H1AA 1RB8G 2VVDA 2WT0A 2XJTA 3WHUA 3WV6A 3JUUA 4LLOA 4U2AA 5BNQA 2GH8A 3LSDA 4XXPA 3VBUC 1UU6A 4L8QA 3ZYJB 1NZCA 3KCXA 4IERA 2ZGTA 1YHFA 1QQP1 5BNPC 3WG3A 5BNOB 4HN0A 3QH7A 1WW4A 1OOPC 1Q8SA 1BJQA 4W6YA 2XBO2 3U07A 3G6JB 3ZSEA 5AC92 1J3QA 4BWOA 3RYKA 4IEOA 1RIRA 4E4DX 1RGSA 1VBE1 2BEOA 2A75A 3VHNA 5HCAA 1I1EA 2MEV1 4G9SB 4Q4Y1 1R082 1W6PA 1PK6A 3VBRA 4WBBA 4H3WA 1ZM1A 1NA1C 1SLBA 2EA7A 3AZWA 1NE4A 2GSYA 1V70A 2OA2A 1VRH1 4XMAA 3I59B 1GBGA 2ZMKA 3AMNA 2TEPA 3TN91 4MVTA 1FATA 4L97A 2VQ0A 1GQHA 5H9QA 2Y0IA 4ORFA 3U4XA 3BALA 4A2UA 4MXWB 2BWAA 5J96B 4MYEA 4Q4W3 4CDQA 3WQ7A 2UWAA 1AX1A 2IC1A 1H8TB 5EYYA 4WM8C 5L73A 4AGGA 4UXAA 3AKPA 2VNGA 4QPGB 4YRDA 1G9DA 4A7ZA 1DGRN 1SCRA 5I0TA 1RMU3 2RHPA 3NV3A 1X7NA 2ZGUA 5JIUA 5GLTA 3RYRA 3NAPA 4E9KA 3B5LB 1F9KA 2FBEA 4LO4B 4LO6B 1SQ4A 2VUAA 4QQHA 4BA6A 3FLRA 3PVNA 2OZ6A 3MICA 2UY8A 2ET1A 1QQP3 4OHYA 3EJKA 2X53S 4CDXB 1BCXA 3GZUC 4CDUA 1QJZA 3UJQA 3FBMA 4Q4V2 3MPPG 2RS11 4EWAA 5JIAA 2Q0AA 1VBE3 2IFRA 2VOXA 1LESA 1LHUA 3LWCA 4YYOA 3ZXEA 4FAGA 5KXBA 1B35B 1EYBA 4XF9A 1AL21 2MEV3 4FBFA 3EBRA 4WVWA 1SCSA 3AKTA 2GC3A 1H2LA 3W59A 3BCWA 3I54A 1QXRA 2HWE2 5GZGA 5KC5A 1RINA 1S2KA 3J8F1 3D6EA 5JI9A 2DF7A 3ZXKA 4HETA 4CP2A 1VRH3 3HBZA 2HWB2 2B9UA 4DXZA 3TN93 3H9AA 3CJIB 4XJ8A 3ZPYA 1CAUB 2X5IB 3ZFGB 3VBRC 4F83A 2BTVC 4MXVA 2XBO1 5KHJA 5AC91 2ZX4A 3AJZA 3ES1A 2CWMA 2PHWA 2OPKA 1XU1A 3BB6A 2XWJB 3VBOC 1G9BA 3IN9A 3WDXA 2WZPP 1JOJA 1R081 2ZX2A 3SCHA 4TZDA 4JRAA 4YVSA 2BFUL 1TMF2 1JYIA 3MW4A 1H9WA 4OI2A 4YG3A 3V65A 3FC0A 1VBB2 5FREA 4P9GA 4XIKA 2D3SA 1NCRC 1NCQC 3GBGA 1T6GC 2ETEA 3OCPA 4ITCA 2WFF3 4OHVA 4Q29A 2FMYA 3ZFFA 1UL9A 1VAKA 2AGSA 2Z69A 3ZN4A 3RSJA 4AFCA 2JXAA 5E88A 3ILFA 3UJOA 3URFA 3HT2A 1QDOA 3UKNA 2XB6C 1B09A 2RS13 5CG8A 3ZFEA 5AVPA 4L9BA 1PGSA 2D40A 3MFAA 2VOVA 4Q4X3 1SLTA 2B7YA 2ERFA 1AR62 4CDWA 2DTWA 4N7IA 1AL23 5C8CA 4LBQB 3TNQA 1IGOA 2JG9A 1QJY1 2ZGNA 3AP5A 3WW1A 3E5UA 1VIWB 2V5YA 3AKQA 1DF0A 1PO12 4JTOA 4AVBA 4YZ5A 2OIIA 1L3JA 3JBG2 4Z2WA 1UZZA 3O0WA 4N53B 3J26N 2P3KA 3THPA 1LULA 1RUH2 3QCWA 4RQPC 1DLLA 1REEA 1Z78A 4AQSA 4FTBA 4E27A 1QXPA 2R0FA 2RJKA 2XBO3 4YVWC 5I0UA 3FMGA 4HBNA 4Q4V1 4HKWA 3WW3A 3APBA 5AC93 3BOWA 1N1VA 3LA3A 2ZGRA 4K6BA 1JTZX 3ZIXA 3U10A 4ES8A 1G7YA 1S0JA 1R083 4N43A 2GH2A 4TYSA 2IXIA 1RUG1 2ZX3A 3D5OA 2HWE1 2YV8A 5GLUA 4K7JA 4MGZE 3P3PA 3RNSA 3M3EA 2A6ZA 4Y4YA 1RUC2 2HWB1 1W6PB 1O5LA 2WLQA 5IT6A 1PK6B 1NQDA 2VNRA 5DUXA 5C4WA 1U5IA 2F6BA 4I01A 4OUSA 2UYBA 1FX5A 2CNAA 4R8HA 2DVBA 3O0XA 3MLLA 4Z8BA 4MLOA 4AFAA 1WW7A 2ZGPA 4R4XA 3NV1A 1PNFA 3H7YA 3MI8A 4M3CF 2VOWA 2YMZA 4AVAA 1QHDA 1SFYA 1MZFA 4JAAA 1ND2B 4IEPA 4LUMA 5DG1A 1TMF1 2H6CA 2NN8A 1PIV1 2RE9A 1SBEA 1Q8OA 1ZX5A 5CVRA 3AP6A 2XHKA 4AI1A 3CJXA 1VBB1 4XZPA 4CDQB 1YJLA 4XF4A 1C5HA 5CFDA 4HANA 1QJY3 4QPIC 1SLLA 1ZZ8A 1PO21 3NKGA 3E6CC 4Z82A 4PIXA 4RD7A 4XJAA 5DUUA 3AMMA 1MVQA 3BTAA 3VBFA 3FLPA 3A0NA 1ZBE2 4YLZA 4UW4A 4CP1A 4RR3A 5HI0A 2PQQA 1W6QA 4AVCA 1RUE2 4MGYE 2DURA 4OLLA 3GZAA 3NAPB 1HIXA 1AJKA 5GLWA 1QWRA 4Q4V3 3T1LA 3WLUA 2QJVA 1Q56A 4PLNA 4NHLA 5GZDA 1ZZ6A 3TBDA 2MNGA 1FNYA 1AR61 3MFCA 4X8NA 2YZ4A 3RJRA 1LOGA 1YI7A 4CDUB 5FPXA 1LB2A 3NJZA 4HPKB 4ZU4A 1MQTC 5JZGA 4AHXA 1PO11 5JVVA 2HWE3 1X8EA 2LM3A 3JBG1 3TNPB 3VBHC 3BOPA 4YM1A 3H50A 2DCKA 1WW6A 2HWB3 4FPOB 1OFSA 1IKPA 3LZZA 4P5HA 4XE9A 4Q0VA 3RMXA 4YG6A 4AI2A 2WWSA 3WNXA 4AW7A 3PNAA 1S1AA 3M4FA 2DFCA 3TWIA 1NQJA 3ZYPA 2YGLA 2JE9A 1LOCA 1HX6A 1FT9A 3IBMA 1K5MC 1Y43B 4S2DA 5FO9B 3NKTA 5JOWA 2ET7A 3GF6A 1TMF3 1D4VB 1PIV3 4WV8A 3H1YA 4BIFA 2G9FA 2JG8B 4XTPA 2BUKA 3VKNA 5TSWA 2K9ZA 1VBB3 3ZSLA 2GC2A 4DS0A 1PO23 1ZRFA 3G7DA 1NYWA 3L2HA 4A7YA 3ZDSA 3B69A 1SDWA 5T55A 4P9LA 1ND3C 1IS6A 4N90A 3VGIA 3H3ZA 4FT8A 2JEMA 3B94A 5EXOA 3POWA 5GKAC 1CGPA 4DFSA 5CFDC 4BLJA 1VAVA 4Q27A 1VP6A 2R1DA 3KMHA 1AUYA 4HK9A 5BNOA 2ARXA 4XJUA 3ZFFB 1MS8A 3RG0A 2CTVA 2I2SA 1QU0A 4LHLA 4YNIA 3DPRC 1ULDA 3NVCA 4M00A 1AR63 4KNCA 3DN7A 2AR6A 4RR3C 4AEDA 2RS32 3HIFA 4XFCA 3NO8A 4QT6A 5FRAA 1PO13 3ZFEB 1ZYBA 1RUI2 3V0AA 4XFFA 3JBG3 2XLAA 4IL7A 3E5QA 4CDWB 4COWA 1ZBE1 1IOAA 5C8CB 2JG9B 3B7MA 1YFYA 1FMD1 4HSJA 5KWRA 3D8CA 1RUE1 2X29A 3VN4A 5F6KA 5DDJ2 1BEV2 2NYYA 4L11A 5SV8A 2JE7A 1ZZBA 4XJZA 2A6XA 3T1MA 1G6NA 4R9CA 2RM22 2E7AA 1GSLA 3OYWA 1LOFC 1WLWA 4D69A 2ZAHA 4MXWA 3TRSB 1UX6A 2QVSB 2VW2A 1OI6A 4OI4A 1REDA 3B9CA 4K1ZA 4G3YC 1LKNA 4QPGA 1UD1A 2MPFA 1MS4A 3AYEA 1GLHA 4JGYC 3H0OA 4DB5A 4Q1RA 2PELA 3B01A 4N43B 3MZHA 2GC1A 3MLJA 2ZZJA 1XU2A 4P9XA 1H30A 3K51A 1CN1A 1XNCA 4C90A 3GZTB 1F8VA 4YFZA 3ES4A 1RITA 5CFCA 1H4HA 4GALA 1YLLA 4WVMA 4R9DA 1CQ9A 3WG2A 4FTEA 3O12A 1OFNA 5C4WB 1JUHA 1VR3A 4G4FA 5JOZA 1BYHA 1HQWA 2UWBA 5D8AA 1IS3A 4N9HA 2ZACA 4DMIA 4EN6B 5T54A 2DU1A 4AF9A 5K0UB 1ENXA 2HWD2 3PVBB 1AZDA 3VZNA 4FXKB 1KDMA 5AFEA 1SEFA 4BPZA 4NR1A 5BNNA 4PJYA 2VUJA 5A3MA 2UWCA 1MS0A 1OQEA 1AXYA 2W0XA 5JI7A 5E89A 1XNBA 4N9IA 2FZ2A 5I8SA 1PHMA 1ZBE3 1ZREA 2AH2A 4H55A 1W6NB 3OF1A 2D3PA 3WP5A 4H7MA 4COZA 1FMD3 4C91A 1QDCA 1RUE3 3NSTA 2R49A 3MIBA 1KDKA 2C9AA 3D0JA 4PBPA 2HWC2 5IK5A 3QD6A 3VBFB 1QOTA 1QOOA 3CJIA 4LE3A 4NO4A 3ZFGA 1S0BA 3CU7A 4AEJA 5KHKA 4AGRA 2BNMA 1W6QB 2P17A 2RS31 3FFZA 3SMHA 5IK7A 1MEC2 4Q0PA 5DG2A 5SV5A 1RUI1 1WLCA 3R4SA 4XETA 1FAYA 3RYPA 3KLSA 1OA4A 1W6OB 1CPMA 3ALQA 4CP0A 3OPZA 4YW1A 2R042 4I3GA 4XBQA 2JJ6A 3H1WA 2UY9A 4DRRA 1VBD2 1VAMA 5DDJ1 1WGPA 1QMJA 1BEV1 1KXGA 2WSUA 4XMIA 1RUOA 5IK4A 1PVXA 2O8OA 1H8TC 4C0BA 2P34A 3SITA 2RM21 3JZVA 1LENA 4QPGC 4JTNA 4XFGA 5KHGA 3MW2A 4INDA 1OQ1A 3IMNA 4BCUA 3HAGA 2ZGMA 5DZEA 2JX9A 2IXLA 1EV12 3OD4A 3UK9A 3WY6A 2AREA 1QGLA 2AUYA 2BNNA 3J4UH 3RMYA 4UW3A 2HEVF 4DRVA 3PTYA 5JCTA 2LALA 2WA3A 5FO8B 1D4M2 4YM3A 4GULA 1DQ2A 4IEYA 4XQDA 3OD0A 2PLV2 2HJIA 2DTYA 4FP3A 4AG4A 3QLQA 4CDXC 1DGWX 4LBOA 1Z0HA 1ZRDA 1LGBA 3HD8B 3X29B 1AX0A 4NPRA 4EN0A 5F1RA 5K8SA 2JD4A 3I2DA 4LO5B 2FHRA 1B35C 4QU2A 1H4GA 1NLSA 1ZRCA 4F8AA 3AFGA 5J37A 2HWD1 5FLIA 2BNOA 2EALA 2XJRA 2SLIA 2QDRA 1AR92 2CAVA 1DDLA 1U5ZA 2RS33 2Z79A 3QOPA 3NV4A 4Y26A 4S2GA 1F31A 3VKFC 3M3QA 2W39A 1RUI3 1EPWA 2ZS6B 5T50A 4YW3A 2X5IC 1HKDA 3PJYA 2G4IA 1Z7S2 2K2SA 1KJLA 4AEDB 2B45X 5C9AA 4YG0A 1LHVA 3B3QE 3WX5A 1WW5A 1AX2A 3SCGA 5DDJ3 3V0AB 4GB32 1BEV3 1HRV2 2HWC1 4LBLA 5KXDA 4W6XA 4Q0UA 4R52A 2RM23 4AHZA 1CJDA 1DIWA 4LR4A 3M1HA 1QJX2 1PNGA 2WA4A 4IV3B 5JSPA 2Y26A 5J3UA 2QZ3A 4HSLA 3ME2A 1S0GA 4IEVA 2VMIA 2XKPA 2PHLA 2ZBJA 1S0IA 1MEC1 1HLCA 3C2UA 4AFMA 1ND2A 4FPLA 3IDEA 2R062 2XLGA 3OYWB 4HVQA 4JGZA 1OSGA 1RUNA 2R041 4YGBA 4RS5A 1LU2A 4GMP1 1Q8VA 4MH0E 4Z1VA 1VBD1 2A6WA 3MIEA 2PAEA 3IT8A 1MZ6A 4I0WB 4WZCA 2A6VA 1C28A 3WCRA 1IS5A 4RFT0 1KITA 4PF5A 1BMV1 3MW3A 2ZZQA 4E2QA 4N7UA 4W65A 5CBLA 3IIAA 1MS3A 3N7KA 5F5QA 2PA7A 1EV11 3VHPA 2WFF1 3BIWE 2VOKA 1GV9A 5CFCB 2HWD3 4JVAA 1R092 3HN1A 4WVMB 3OY8A 1ZZ9A 4AVVA 5JDBA 4FQ4A 2Q1MA 1S55A 4N53C 3WOGA 1PM7A 4GH4A 1D4M1 4Y1ZA 3H3UA 4XHBA 3WCSA 3WW2A 3CF6E 1YO8A 5D8AB 2CL2A 2WFPA 1FOD2 4HPKA 4I30A 3OTFA 1DHKB 4E2GA 4RGGA 4ZXKA 1DQ1A 5BNNB 4IEQA 4Q4X1 4DOUA 1LTEA 2IXHA 3N7LA 3M3IA 4Z92B 3EQEA 3POSA 4Q1PA 2QDNA 5FFOC 1DZQA 2HWC3 3AMHA 2ZGLA 3JQXA 5BYNA 1JHNA 3WXPA 2EVXA 2XJSA 3WDTA 4IV1B 4Y20A 3RI9A 2YXSA 4E2SA 2DU0A 5L7OA