4LUKA

The crystal structure of the p132a, y133g mutant of pyrococcus furiosus phosphoglucose isomerase in complex with manganese and 5-phospho-d-arabinonate.
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
189
structure length
189
Chain Sequence
MYKEPFGVKVDFETGIIEGAKKSVRRLSDMEGYFVDERAWKELVEKEDPVVYEVYAVEQEEKEGDLNFATTVLYPGKVGKEFFFTKGHFHAKLDRAEVYVALKGKGGMLLQTPEGDAKWISMEPGTVVYVPAGWAHRTVNIGDEPFIFLAIYPADAGHDYGTIAEKGFSKIVIEENGEVKVVDNPRWKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Glucose-6-phosphate isomerase
publication title Correlated mutation analysis as a tool for smart library design to improve protein performance.
rcsb
source organism Pyrococcus furiosus
total genus 40
structure length 189
sequence length 189
ec nomenclature ec 5.3.1.9: Glucose-6-phosphate isomerase.
pdb deposition date 2013-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06560 GPI Glucose-6-phosphate isomerase (GPI)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4lukA00
2PAMA 4OLLA 2CAVA 2WC2A 4BH9A 5C8WA 1CAUA 4HZFA 1QWRA 1YFXA 1EY2A 4AQ6A 3NVCA 4Q0VA 4QM9A 2HJIA 3UKTA 3PNAA 3OTFA 2DCTA 5C6CA 1WGPA 3I54A 5F1RA 4ZU4A 4JTOA 4QX5A 5KHHA 4Z82A 2ATFA 3MZHA 4OFGA 2IXCA 4MZUA 1O5LA 5J3UA 2PYTA 2EVXA 4J1XA 2OPKA 3JZVA 4XF4A 5EFUA 3FHIB 1ZX5A 5EZWA 2UYAA 1CAWA 2UY8A 2XGXA 3EJKA 4BYYA 1I5ZA 4D7SA 4R52A 4XF3A 2D40A 4I0BA 4LTAA 4XFBA 3LOIA 4HLTA 5JSRA 2BNNA 2QNKA 3OF1A 1LR5A 1LKNA 4KWLA 2OZ6A 5I0RA 5FPXA 2GU9A 5KHIA 1XRUA 1O3TA 2GAUA 2Q4SA 5KHKA 4IERA 2IXKA 2OYZA 4I02A 1FXZA 4I01A 4YARA 4QGMA 3LA3A 1O3RA 5BV6A 2C0ZA 2XLAA 3EO6A 4IEPA 1SQ4A 3GYDA 2D93A 1WLTA 4ZU7A 1O4TA 3USSA 2IXIA 3M3IA 1EP0A 2PHDA 2B5HA 1DGRA 1O5UA 3EHKA 4L2NA 2IXJA 1YFUA 1ZZ6A 4TLFA 3ES1A 2VECA 1QXJA 3EQEA 4XFCA 3HIFA 4AXOA 4AVBA 4E2GA 5JAXA 4EWDA 1ZZBA 5I0SA 2Z69A 4IEXA 1CAUB 4KWKA 1Q3EA 4KWJA 3BCWA 3E5UA 4HMZA 2O8QA 4XETA 4QGLA 4EWEA 5JR7B 4IEOA 2H6CA 1UCXA 2XKOA 3LWCA 1YWKA 2N7GA 1SEFA 3N4MA 5FQ0A 4HVRA 1NE4A 4JV4A 5I91A 3FX3A 1O7FA 4KU7A 3I7DA 2WFPA 2IXLA 4LUMA 4LULA 1DZRA 4N9IA 3WW2A 4MUVA 5AVPA 4XFFA 1PM7A 1NXMA 1YLLA 2UY9A 3UKVA 4GULA 3RDIA 4LA3A 1EYBA 4HSLA 1FT9A 4O9EA 1RUOA 3QOPA 1RGSA 2FMYA 4Q0UA 5I8TA 4IEZA 1CGPA 1CAVA 4K8FA 4XF0A 4WZCA 2XLFA 4MGIE 5E16A 5FLJA 3D0SA 4A2UA 3CLPA 4AQ2A 2FQPA 4MX3A 2HKXA 2I45A 2Z2SB 3BALA 1O3QA 2OZJA 2XHKA 4AVAA 5FCCA 2Y0OA 4XFIA 4BIFA 2BNMA 3CO2A 1OI6A 3E6DA 2XLGA 4QXKA 1J58A 1UIKA 3SCFA 1IPKA 3SMHA 1L3JA 3H9AA 1ZRRA 1Q5OA 3ES4A 3TNQA 3O14A 2QDRA 3DL3A 1QY4A 3E6CC 2V09A 2BNOA 1J3QA 2GC2A 4PJYA 3ROUA 1YFYA 3ZDSA 5FDBA 3EBRA 1UW8A 3C3VA 1G6NA 3S0MA 5LEJA 3MYXA 3LZZA 3LAGA 3SXWA 4E2SA 4IESA 2K0GA 2EAAA 1GQHA 3IWZA 3MPBA 3MDPA 4HBNA 3IIAA 2P17A 5KHJA 4O9GA 4KU8A 2B8MA 1GQGA 3FZ3A 4CYDA 3H1WA 5FLHA 3FFQA 3SCHA 3IDBB 4FAGA 2VQAA 1O3SA 2QCSB 1X7NA 4EV0A 1VR3A 4YRDA 3VHRA 4KL1A 3ACLA 5I0UA 4H7LA 4I3PA 5T3NA 4HN1A 1X8MA 2IXHA 1ZREA 3OGJA 2EA7A 4QM8A 5JSPA 2E9QA 4R8HA 3I59A 4F7ZA 1H1IA 3NKTA 4Q0PA 2GZWA 5D1IA 1LRHA 2Q30A 5K8SA 3D82A 1ZRCA 4AVCA 4XEZA 3TNPB 1CAVB 1CAXA 2B9UA 2BYVE 2GC0A 4X6RB 3PVBB 4IEUA 3E5QA 5BPXA 1XE8A 4P9GA 3FWEA 4I09A 4I0AA 1Y9QA 4QGNA 2D5FA 5JSOA 5CADA 4Z07A 5JCTA 3G7DA 3KSCA 3KGZA 3DN7A 3KGLA 1ZZCA 3E5XA 5LEKA 1TQ5A 2O1QA 4UXAA 2BGCA 3SHRA 3WW1A 4UBGA 3NJZA 1CX4A 4BHPA 3FJSA 5I8YA 2QJVA 4XF9A 2D5HA 1ZRFA 3CEWA 1RC6A 1YHFA 1CAWB 5I8SA 1VJ2A 3S7EA 2PHLA 2VPVA 1OD5A 4Q0SA 2H6BA 4WVZA 4N9HA 3HT2A 4LEJA 4YYOA 1J3PA 2MPFA 1VP6A 1Y3TA 5J7MA 4DINB 3M70A 4FBFA 4ONUA 2IC1A 4FT8A 4X6QB 2PAEA 3WW3A 3RYKA 1J3RA 4IETA 3ST7A 4XFGA 1YFWA 1X82A 3KCCA 1PMIA 4PIZA 4YSFA 2XKPA 1QXRA 1UD1A 3I59B 3RZZA 3H8UA 3UKNA 3H3UA 4RD7A 1YUDA 1ZZ7A 3RYPA 4WBBA 1ZZ8A 3HT1A 4HVOA 1H1MA 2MNGA 1RTVA 1CAXB 3ETQA 4HN0A 2CGPA 3HQXA 2GC3A 1JUHA 4LLOA 3CJXA 4IEQA 1NYWA 3BU7A 1I6XA 1RUNA 2GH2A 5KHGA 1ZZ9A 3U11A 1OFNA 3GBFA 3PLQA 3ELNA 4MGKE 3IDCB 2MHFA 4MV2A 3RNSA 3LA7A 2ET1A 1OMIA 5I93A 2KXLA 5FQ0B 3R6SA 3NW4A 1UPIA 2GC1A 4JVAA 4PIYA 4FAHA 4L11A 5J48A 3H1YA 3H7JA 2Q0AA 4MGZE 1XE7A 1HW5A 4ZU5A 4QMAA 3KMHA 4HVQA 5BXXA 5BUVA 4IEYA 5E1RA 5CVRA 1IPJA 1FI2A 2CV6A 2XL9A 2ZKLA 3CL1A 1X8EA 2PQQA 3H50A 3DKWA 4JTNA 3E97A 5FPZA 3U0ZA 4XFHA 4I2OA 4YNIA 3DV8A 2PA7A 3H7YA 4IEWA 5LRRA 3L2HA 3FE5A 5FLIA 2BEOA 3SCGA 1NE6A 1WA4A 4IEVA 1ZNPA 1LB2A 1ZRDA 4D7TA 2PFWA 2PAKA 4B29A 4XF1A 4ORFA 3S7IA 1V70A 1DGWA 3BPZA 4Q29A 5LRSA 3U10A 5CU1A 1DZTA 1EPZA 2H0VA 3WW4A 2CAUA 3H1MA 1NZCA 4Q0QA 4META 2PTMA 4E2QA 2ETEA 2ET7A 3QACA 4MGYE 4XFAA 3CF6E 2OA2A 4LUKA 4LA2A 3H3ZA 2F4PA 4HSJA 1SFNA 2Q1ZB 2XL7A 4PIXA 3BB6A 3E6BA 3OD0A 3LA2A 3NSTA 3OCPA 3D0JA 4EROA 3IBMA 4F8AA 1RL3A 1UIJA 5I0TA 2QVSB 4UBHA 1ZVFA 3RYRA 5BY5A 1J1LA 4EWAA 4MH0E 1Q43A 5HI0A 1U12A 3NL1A 1J59A 2K9ZA 5KBFA 4NVPA 3RPQA 4J1WA 2UYBA 2ZCWA 3B02A
chains in the Genus database with same CATH superfamily
4RQPB 2CAVA 4FPHA 3FN9A 4BH9A 1KS5A 1JU3A 1C8M3 3I8TA 5C8WA 5DAXA 1CAUA 3TAYA 3KT7A 2W46A 1QGLA 1EY2A 4ES9A 3NVCA 4Q0VA 1ODMA 4D6QA 1RJ7A 3K51A 4CSWA 1JZ2A 4WM7C 1BBT1 1NKGA 4PDWB 1W3XA 4Q4Y3 4YM2A 3I2FA 4CXYA 1PVC2 4JTOA 4ZU4A 4QX5A 5A7WB 2PHTA 1H4HA 3J9SA 1W9FA 2DURA 4YFWA 2HLEA 1UNBA 4DZGA 2Y0IA 1XU1A 3PUQA 5A6ZA 2VBBA 1O5LA 3DKQA 4HK9A 4M0HA 4OHXA 1OF3A 1C8M1 2OPKA 4Q4X2 1S2KA 2Q1MA 3WF0A 4YZ2A 1RUF2 5BNQA 1DIWA 2R042 3HNYM 4V1PA 4XTMA 3ZDVA 2PLV3 4EN7B 2UY8A 3PU8A 1C8NA 3NNJA 4Q4Y1 3PJQA 1PNFA 3T2TA 1BVP1 5JMOA 2VVFA 2CU5A 2WINB 4XF3A 3RZJA 5DABA 1H2KA 1WUVA 1HXS3 3BIEA 3GDBA 2YBSA 5L36A 1XYOA 3I2KA 3VKFC 4BWOA 3SH3A 4LBJA 1LR5A 4AF9A 3JD73 4N90A 3ZX7A 1NUKA 1XRUA 2AYHA 2VZPA 5J98B 2D97A 5FYUA 4AFMA 4AFBA 3VDBA 4QXBA 2IXKA 2SBAA 2OYZA 1H8TC 5JPMB 4C1WA 3D8CA 4I02A 4UW4A 2PLV1 1UN1A 5FY9A 3W9AA 2EXKA 4I01A 3ZFEB 1P8JA 5BNPB 5FYYA 2W0XA 3LA3A 4IGOA 5F3CA 4JKMA 5BV6A 2ZEXA 4BQ3A 1O3RA 2XBO2 4H7MA 2E33A 4K7JA 1G9FA 1SLTA 2ZX2A 3ZSEA 1HXS1 1S1AA 4D6RA 5LASA 4QKFA 1W6MB 3NV4A 5DUXA 1D4VB 1WMXA 1RVF2 3B00A 4XBNA 4ZU7A 4F83A 3ZSKA 1OURA 4XJWA 1PK6A 1XYPA 1F4HA 2BOJA 4QPGC 3JD71 1LHOA 2B4KA 2FCTA 5LA0A 2B5HA 1DGRA 4XHXA 1UY2A 4AG4A 3HBKA 1N1SA 3EHKA 4L2NA 4QPIB 4AI8A 1DQ1A 3TWIA 4TLFA 5IJRA 4PI2A 3UGHA 3SISA 3ZSJA 4AAXA 4JDMA 2A1XA 5C7GA 1QXJA 4XFCA 2QQPA 2XJQA 4Y22B 1S55A 3WG2A 4JGZC 4AVBA 1H4GA 1JH5A 1XOYA 5LZ6A 1W2TA 1FMD2 2B46X 3AFKA 4IEXA 2WSVA 3N9OA 5FYHA 1B35C 1CAUB 5GM0A 2VVDA 1Q3EA 5A33B 2P5BA 4ITCA 4TXWA 1KITA 4HMZA 1AYM2 1XSRA 2Q5TA 3ILNA 3MV01 3HPNA 1XNTA 3OD4A 2R0HA 5LBBA 1UCXA 4HK8A 3DYOA 2YZ4A 5AC92 1JBCA 1SEFA 2N7GA 1WMFA 2VZQA 2XXZA 4H2AA 3N35A 3VBFC 3ZKYA 2Y6GA 3GNEA 3K3OA 4L0PA 4W6XA 5DUUA 2WZEA 1EUUA 1KEXA 4Q2FA 3FX3A 1W6OA 5C3OA 3O1TA 4ZHNA 3I7DA 1CZTA 4S2FA 3OOXA 4QKDA 4OI4A 5FZIA 2JG8A 3WW2A 1AXKA 5L73A 2PHFA 2OQ6A 2AEZA 1W0OA 4NOTA 2UY9A 5D8AC 2C5DA 2VL4A 3UKVA 5FO8B 4B4QA 2VMGA 2WQ8A 3DCQA 4GULA 5HCBA 2VW0A 1S4CA 3CJIA 2ZMLA 1QIQA 4C0HA 3RZKA 2G1MA 5IUQA 2QQVA 1A78A 3MIHA 4KG8A 1PGSA 4UFLA 4BQ4A 2RDNA 2VU9A 5C8CC 4D8MA 2ZGNA 1LOFC 5T5LA 2FQPA 2IVIB 2VNGA 3ZIWA 1S0EA 1DCSA 1ZA4A 2P3KA 5G04L 3WEZA 2ADEA 2HWD3 3LDKA 4FP3A 3BALA 2W91A 1AL23 1UZYA 4LBKA 5JVVA 1O3QA 1BYHA 1WCSA 1B35B 2Y0OA 1XBFA 3HOBA 2EAKA 3OEBA 1JZ3A 3VB9A 4UW5A 4YVWB 1PO23 2BW8A 3E6DA 2YBPA 5FJKA 2ZGKA 3WNNA 5IK8A 2Y6FA 1WW7A 1J58A 1UIKA 1IPSA 3ACFA 1WD3A 2FDJA 2WNUA 3NJYA 3OYWA 2ZGRA 4N53A 2VOVA 5IVEA 2AR6A 5F8PA 3O14A 5LK7B 2QDRA 1OPOA 5FZCA 3QBQA 3E6CC 2HWD1 1TMF3 1Z0HA 5HBAA 3MO4A 4QHBA 1CIYA 1AL21 2DVBA 2ID4A 5F32A 3LDBA 3C3VA 1G6NA 4X8PA 3GHMA 4F3JA 1CQ9A 2HWE3 5A3WA 1PO21 1QOTA 4E2SA 4LORA 2V4VA 2ZBJA 2JB8A 4PF1A 2GN3A 2BVVA 2B42B 4FPEA 4ES8A 1OLQA 2EAAA 4BXSV 3UJQA 1GQHA 1UXXX 1W0PA 3MPBA 4XIOA 3GZAA 2B45X 3F2ZA 4QB6A 4XIKA 4QX8A 4GWMA 3WDUA 3VBRC 2P17A 1TMF1 5HCFA 1UWWA 3ORJA 1ZBA2 4LLFA 2AH2A 2NN8A 4IW3A 1DU3D 1OC1A 1PX4A 2AC1A 4P9YA 2YG0A 2HWE1 3B9CA 3H0OA 2WO3A 4FAGA 2WN2A 5A3UA 5JZGB 4LITA 4BQYA 3VZLA 1W6OB 2JIJA 2RS13 3OPWA 4FOQA 1YQ6A 4AVTA 4HONA 5JI9A 3J8F3 2JG8B 1NCRA 1AX2A 3JQWA 1X8MA 3OGSA 1F9KA 2IXHA 2Y6LA 3POYA 4XURA 4AEKA 1W8TA 2ZS6B 4QM8A 2JECA 1OLRA 2ZX4A 3MLLA 3RG0A 1POV3 3WDTA 4F7ZA 5GLUA 2D3RA 1G86A 1TEIA 1DLCA 2DYCA 2WFF3 1EV13 1LRHA 2ZPXA 1OLMA 1LODA 3CJIB 2WKKA 3DPRA 3MW2A 2WA3A 3WG1A 2WZ8A 5JPNB 5L7OC 4N43A 1GP6A 1UZZA 2JDNA 4LKEA 4BB3A 4E8DA 5FYTA 1BEV2 2BP6A 2OXBA 4LIVA 1RUC2 1IQDC 2RS11 3N7MA 1BQPA 3ZKUA 3TNPB 2JDAA 2B9UA 2P2KA 2RM23 3J8F1 1GQPA 1GSLA 4XUQA 1WBFA 4IEUA 4PBOA 5KR7A 5KXCA 5BPXA 4YM3A 3VUOA 5CYYA 2GP3A 4LMFA 4NPLA 4XBQA 1POV1 1WWYA 3F95A 4NO4A 4OULA 4NWWA 1CR7A 2L9LA 2NQYA 2WFF1 1BZWA 1EV11 1LHWA 1FPN3 3MIDA 5JCTA 4NE9A 1GLHA 4DIQA 5C3SA 5AFEA 1PGL1 2J1UA 3KGZA 1J83A 2XOMA 2ZACA 1ULDA 3DN7A 4L92A 5LEKA 5FTTC 4P08A 1XNCA 3IMNA 2D6PA 2WNUB 4B4PA 3OYWB 4N53B 3VBRB 2RM21 4ZKTB 3SHRA 1W2UA 4JAAA 1L7RA 1SFPA 4KGQA 1N1VA 1OQDA 3I49A 3NJXA 1MQTC 2A6VA 4XF9A 2D5HA 1QQP3 2A3XA 2FCUA 2Q8EA 1JXNA 4G4FA 3RWNA 3ZFGA 4OHVA 1LHNA 4GZ9A 3ETPA 2VNRA 1FPN1 1OVPA 3S7EA 4Q0SA 3SEPA 3AL6A 2GNMA 3Q8EA 4N9HA 3HT2A 5E89A 5FZMA 4XYXA 3ACGA 4GWNA 3ZPOA 5CBLA 1D0GA 5FPBA 4FBFA 4Y5TA 4E4HA 3LEGA 4L9BA 2J1RA 4ONUA 1DBNA 1W99A 2IC1A 2YV8A 3LPGA 2JE9A 3WT3A 1W05A 2XHNA 4AK3A 3RSJA 1UMHA 3I3MA 1S0IA 5A80A 1QQP1 1YC61 4UFKA 3SLIA 3GZUC 3VDCA 3UGGA 5CB7A 4EE2A 2C9KA 1RUG2 2KD7A 2LRPA 4CP2A 3H42B 5C5TA 5HCHA 4FOWA 1MS4A 3ST7A 5JXGA 4QHOA 2D6NA 5FYCA 3W59A 4QPYA 2WO1A 3GZEA 2WNVA 4NROA 3IDAA 1F4AA 3WQBA 4LKDA 3CMGA 4PIZA 2ZEWA 4QU2A 4Y20A 4UOJA 3LGRA 1UD1A 1Q8PA 5LW9A 1BMV2 2JICA 4AI9A 4MXVA 1NCQA 4AWDA 3N9PA 2B39A 4DO0A 1XPWA 1U5YA 5FY4A 3OUHA 1XNAA 2JE8A 1XE0A 1VAKA 4CU6A 1ZZ8A 4XILA 3VKNA 3NMBA 4N43B 5GZDA 5IAVA 5ABJA 4CCMA 1D4M3 1RTVA 5CISA 3DUIA 4EN9B 1MQTB 2CGPA 1WMDA 1JUHA 1MVQA 1NYWA 1F2NA 2O8OA 1E57A 1I6XA 3ZYGA 4Z92B 3AKTA 2VOTA 1ZZ9A 3AL5A 2VM9A 2IVJA 5C4WC 3J7HA 3CQOA 2Q8CA 3OPTA 1SPPA 4A7YA 2J1SA 1EUTA 4IE7A 4A6OA 3IDCB 4CCOA 2MHFA 1RHI2 3LA7A 2PXJA 3AB0A 1D4M1 5GZEA 5C33A 1S0JA 5I93A 3T2OA 1LU1A 2FCVA 3DYMA 3MBWA 2CSGA 5T54A 3R6SA 3VD5A 2CL2A 3NW4A 2DFBA 2WZR3 4QWNA 1HB4A 4S2HA 5ACA2 1XNDA 2ZGUA 4XUTA 2GC1A 3Q8BA 4PQQA 5DG1A 2AUYA 2BQPA 3WDVA 4YGBA 1HKDA 1IOAA 1LNSA 5JMCA 1HQWA 4IV1A 5J48A 1MACA 2EIDA 4PT6A 2I07B 3UV9A 3H7JA 4YZ3A 2Q0AA 5FP4A 1IS6A 1VIWB 2LUWA 5JWPA 4M3CF 4ZU5A 4D94A 5BUVA 2EXHA 3LCPA 5BXXA 1ENRA 1HIXA 2YPDA 4LO4B 4Y4YA 5BNNC 5IYYA 2QQWA 2CTVA 1IPJA 4UT5A 4FOVA 2CV6A 1SZBA 1WD4A 2ZKLA 4W65A 1QNWA 3UNPA 2WZR1 2PQQA 1AZDA 3LFIA 4HPKA 1URXA 2WN3A 1N1TA 1VLNA 2YC2A 2HWB3 3JBG3 3MUY1 5GLWA 4AVVA 3M7AA 3U0ZA 3AMNA 2VTXJ 3VBSC 4V2WA 1HRI2 4FFHA 1KDMA 5LWBA 2IFRA 3AKSA 2GMMA 1RUH3 2A75A 3FLTA 1HRV2 3OY8A 5F2WA 5LBEA 2VE1A 1JS9A 2ORXA 2WNVB 4XDPA 3UT0A 4Y1YA 3AMQA 1DQ0A 1GYKA 2BERA 5FLIA 2BEOA 1QJY2 1YJLA 1NE6A 3CZJA 4LHLA 4LK6A 4W6YA 2XR4A 3IAPA 1CJPA 4Y20B 2KM2A 4IEVA 4YW6A 2E26A 1ZRDA 2AACA 1NXD1 1SHWB 3ZXJA 5LA1A 1NCQB 2BV4A 3VBHA 2PAKA 3GJAA 3LFMA 1W8HA 2HWB1 3BVCA 2P6CA 1C5IA 3DXUA 1PVC3 1QDCA 3JBG1 1V70A 4XF1A 5A1LA 1DGWA 3MI8A 3WP4A 2VC9A 1O59A 5FY8A 5ABJB 3B93A 1RUH1 3U10A 4CCNA 1NA1C 2JB4A 1N3QA 1W8NA 3POWA 5JR2A 1NZCA 5ANNA 4CEYC 5K0UB 3O1PA 1MS5A 4Q4X3 5BNOA 1ONAA 2BFUL 1TE1B 2OIIA 2R043 2FMDA 1GZWB 3FC0A 2CWSA 1H2MA 2JIGA 2JWPA 4CPBA 5FPAA 3VBUA 4DXRA 1HB1A 2ET7A 1SPPB 3QACA 1OH4A 2UWBA 3T1MA 2J42A 1PVC1 3BTZA 5A32A 2DVDA 3MPPG 4HSJA 4XBLA 2OS2A 5FZ9A 4PIXA 2W47A 2ZZQA 1COV2 1AL0G 3LA2A 3OCPA 3D0JA 4EROA 4F8AA 1W8FA 2RJ2A 1LOAA 1RL3A 2CHHA 3NKGA 4XPVA 4Q4X1 2R49A 5LA2A 1JUIA 1MR5A 2R041 4K21A 5A7NA 1DGLA 3MV11 1ND3C 3O0VA 3RYRA 5BY5A 3R4SA 1C3HA 4CP9A 4NPMA 1RUD2 5FY7A 5SV8A 5KBFA 2ARBA 2LS6A 3BTXA 4NVPA 2Q1FA 5FZLA 4MOAA 4LIUA 5A3OA 4CDWC 4CTEA 2XBO3 5JOYA 3O5SA 2WDBA 3AXDA 1CN1A 3B02A 3C7EA 4XHBA 5FOBB 2PAMA 3O1VA 4G3YC 1Y7BA 3MW3A 4OUEA 3I2OA 1RVF3 3GBGA 4HZFA 4YW3A 2OUHA 1QWRA 4JDNA 4BIOA 4AQ6A 1M06G 5CFDA 4HPKB 1QEXA 4QM9A 2DUPA 3I3DA 3TOJA 3UKTA 1PO12 3OTFA 2RJLA 3I54A 1US2A 3KQRA 4DEQA 1KFUL 2VBDA 3O1SA 2X09A 2IXCA 2XBO1 3NAPA 4FPGA 2XH6A 1UKGA 1YJKA 4OCTA 3ZFFA 4YW5A 3RS6A 5J3UA 2PYTA 2ZHLA 3OY8B 1FMD3 5JOWA 3LSEA 3JZVA 3R4DB 4J1XA 1RVF1 1OOPA 2C4XA 3MICA 1MPXA 1GP4A 3FHIB 3NJVA 1LENA 2EIBA 5GZCA 5FKBA 3R4UA 4K40A 1OUXA 4YVSC 1CWPA 1CAWA 1AYM3 2XGXA 3KF5A 3EJKA 3AYCA 3A4UA 4BYYA 5FIXA 4R52A 1SDWA 2D40A 4PCRA 2IWGB 3WNPA 1AR92 4PF5A 5JOXA 4MHRA 2A5ZA 3RRDA 2E32A 3I2HA 3EMRA 4MYEA 5JSRA 5AC93 2AZ5A 3PMSA 1FNYA 2WNOA 2QNKA 3JQXA 4XABA 3OF1A 1FMD1 1LKNA 1ZRIA 5FPXA 1CJDA 5BNOB 5FMOS 2GAUA 1K5MC 2Q4SA 3J7MA 1Z7S2 2Y6KA 4CDUC 1W03A 4JRAA 1F31A 2B9VA 1ZBE3 4COUA 4AI0A 3TYJA 3VDAA 1VMHA 1AYM1 2FHRA 2YU2A 2XVLA 4FFFA 4P14A 4RR3C 4ZZ8A 2JEMA 3LIHA 1GV9A 1O4YA 3H8OA 1FYUA 4LO7A 3ZN5A 1LHVA 4EN0A 1OUSA 3BUCA 4XTPA 4JQTA 3KF3A 2HEVF 1VBD3 1UYZA 5AC91 3USSA 1NY72 4XJ8A 4QPWA 5JIAA 3M3IA 2VUDA 2RJKA 5EP9A 4SBVA 1CX1A 2WBKA 5GZGA 4XJZA 5FZ8A 1ZZ6A 1ZBE1 3WCRA 3USUB 2VR4A 4IUGA 4RQPC 4CP9B 4EQVA 4LO8A 2W2IA 3HIFA 1WW4A 1J1TA 2W87A 1R1A2 2OW4A 2VQUA 4EWDA 4CEWA 1X9PA 4QKBA 1ZZBA 4P9WA 5IT6A 1LAJA 2Z69A 1VBD1 3J7LA 4NHKA 2OKXA 4YVSB 3AFGA 4PDWC 4AFDA 4MGSA 5EYYA 5CFDB 3APBA 4KWJA 1CZSA 3C7HA 3E5UA 4M3CE 1UOFA 4P9XA 3T0AA 2UWCA 5FPLA 3FL7A 4BZ4A 4EWEA 1RB8G 1VB4A 5FZOB 3VZJA 5JR7B 2H6CA 2C9AA 1WKYA 2XKOA 4AEDA 4HANA 3NAPB 3ZFFB 1YWKA 4M4RA 4N8MA 1GNYA 2QUOA 1NE4A 1VB2A 4B3NA 2VVEA 1MZ6A 3PTYA 3WF4A 4K20A 1UKRA 4GB32 4FSJA 3ALQA 2VZVA 2PHRA 2WFPA 2XWBB 4LUMA 1CESA 2OUJA 3BI3A 2XJRA 1DZRA 4N9IA 3G6JB 3PUHA 2OQ7A 2YU1A 4MGQA 4MGTA 5HXVA 1PM7A 3ZYJB 4HKOA 5H9QA 3ZYFA 5F5QA 4EN6B 1JZ6A 3MLJA 2RS52 1VPHA 3WF1A 1ZBA3 1EYBA 2VZTA 1YQ2A 5C3PA 3HN1A 3OBAA 1CIWA 4W50A 2BBAA 4QXCA 3KWVA 4TWTA 4Q0UA 3ZFEC 4UW3A 1WA6X 3OB8A 3LEIA 5I8TA 5BNPC 1GICA 1CAVA 1WLWA 4DMIA 4K8FA 5A3TA 4LBNA 1REDA 1CGPA 4MGIE 3WP6A 3PUIA 3D0SA 3CLPA 4LKFA 4MX3A 4AI1A 4NHYA 5HCAA 2I45A 4YZ4A 1O3SA 4LPLA 3OEAA 4WM7A 2ZGMA 4AVAA 2HWF2 4IV3A 5FCCA 2YHJA 3W58A 4A41A 2WUHA 2AREA 3VZKA 1D2SA 1ZBA1 3ILFA 4BIFA 2BNMA 5EQUA 4QPIC 2XLGA 2XUMA 4QXKA 5C6CA 5FMOL 3NO8A 3VL8A 1LEMA 3PJYA 2R32A 5JI7A 5FR3A 3ZXKA 1RUC3 1UX6A 3SCFA 3SH5A 3SMHA 4DQAA 4FTBA 4Q5OA 3WVJA 1OA4A 1ZRRA 2WT1A 3BOWA 3LF7A 4AQTA 1VBC2 3QCWA 3GHNA 3ES4A 4MXWA 4Q4W2 3DL3A 1QY4A 2V09A 2DVAA 5T5OA 4Q1PA 1U5ZA 5FDBA 4QX0A 4CEWB 2RR12 2KA3A 1QMJA 3A0KA 1KXGA 1HB2A 3S0MA 1GZTA 3MYXA 4JKKA 3LZZA 2VOWA 3VKLA 1V9U2 3ITQA 5E8AA 1BKZA 4IESA 3I2IA 1X50A 3KVBA 1RUC1 2VXRA 1XJAA 4NMIA 3IWZA 2D6LX 4D3WA 1GBGA 4HL0A 3D6EA 3IN9A 4UYBA 2VMDA 5L9RA 1OKOA 4XCBA 3LEKA 1H8TA 2YBKA 4WM8A 2CGOA 3AYEA 3W5NA 1AYN3 4KU8A 4AEDB 5LBCA 5KWRA 2J1VA 5L9BA 2GALA 3ZLIA 3AMHA 5DAWA 1OKQA 4AW7A 2YDEA 2VQAA 5FZ1A 2QCSB 1RMU2 2E53A 1IHMA 3OBZA 1YO8A 2Y60A 4RSUA 3WUCA 4EV0A 1IS3A 3Q9OA 4YRDA 1ALYA 4QPGA 4I3PA 3S5AA 1MS0A 1ZREA 3OGJA 2EA7A 4KH9A 3AP7A 4AEJA 3V65A 5JSPA 4XZUG 4Z2WA 5IVCA 3GF6A 4XXAA 1IG0A 5GLZA 1AYN1 5IVFA 3OPZA 2GZWA 2Q30A 4WV8A 1JI6A 3D82A 4PHZA 2D44A 4XZPA 2ZX3A 3PIGA 3MFAA 4V2VA 2VCAA 3VKMA 1WCUA 2F6BA 1YIFA 5LB6A 3DEMA 1IKQA 4NAMA 1CAVB 5CAZA 1UQXA 3OBRA 4X6RB 4IXLA 1XXNA 3PUSA 3E5QA 4YVWC 4JC1A 4MLOA 5APAA 4JQRA 4BQ5A 1XE8A 4P9GA 1JYIA 1PNGA 2P4EA 4I0AA 4IV3B 1Y9QA 5CEHA 1ULEA 5FZ4A 2D5FA 3WNMA 5IAXA 1JYTA 1V6IA 2V5DA 1TG7A 2GH8A 4GH4A 1S2EA 3G7DA 3KSCA 2EIEA 3T0BA 3LB9A 1W90A 3KGLA 1ZZCA 3PU3A 4H3WA 3SITA 5IFTA 3O1OA 5AVAA 1UZ0A 1TQ5A 1U5IA 3GBWA 4UXAA 4JX0A 4HT1T 2BRTA 4B1MA 4JGYA 4MXWB 4UBGA 2WWJA 5FUIA 3RWKX 3I4IA 1UOGA 2QJVA 3RFRA 4CDXA 1GKBA 2WT0A 4GJZA 3GCXA 1BMV1 2R1DA 1HQNA 1W2OA 2VQ0A 4TSVA 4HFSA 2R16A 2FDKA 4YLZA 1VJ2A 1S0CA 2R062 3T2PA 1R64A 4IL7A 1RHI3 2ZKNA 1W04A 3EB7A 4WVZA 3S6PA 5K7PA 2QQUA 2Y38A 3IZOA 4YYOA 1Y3TA 4ASMB 4R9DA 4DINB 2I74A 4XACA 3M70A 3ZOIA 3S57A 4Z8BA 3B94A 1APNA 4WM8B 5DZFA 2P1BA 3KV6A 1LOFA 4DS0A 4YGCA 5GKAC 1UYYA 2ZOEB 4DXSA 5A70A 1GFF2 1VAVA 3WW3A 5FP3A 2PN5A 4L99A 1UPSA 5FMDA 5FYIA 1CVNA 4ZS3A 3X29B 1Y4WA 4TN7A 1IZ3A 5J37A 1BHGA 2JG8C 1GOGA 1RHI1 2O14A 1OA3A 4DRVA 1WW6A 3TEYA 2VG9A 1OFSA 1PGW2 1X82A 5T55A 2FDFA 2DUOA 3MFCA 5FP9A 3KCCA 5GZFA 1GWLA 2EXIA 1PK6B 5DZEA 4YSFA 5JUVA 2XG3A 3CJIC 3KV4A 4IE0A 2H0BA 2WRAA 2XKPA 3BGAA 3H8UA 3QD6A 4R9AA 3UKNA 4U2AA 4RD7A 2RVAA 3IMMA 5F2SA 1QXPA 1MEC3 4WBBA 5FZKA 5LY1A 3UGFA 1HRI3 1S0BA 3FLPA 2W08A 3U1XA 1R093 1HRV3 3VD9A 1YEWA 2JKXA 3ETQA 1AX1A 3HR9A 3UK9A 5D21A 4TZDA 1X9TA 3HQXA 1SBEA 1HJGA 2JDUA 2WS92 4XUPA 4ZXEA 3CJXA 4IEQA 1PZ8A 5A7SA 5A1FA 2RMU2 2GH2A 3C7GA 4EJRA 4M00A 5DAQA 4YM0A 4KI5M 4HETA 1J84A 1DP0A 2IFWA 2WYFA 1MEC1 4MGKE 4GH4B 5F5AA 1US3A 4MV2A 1OD3A 1H0BA 2WNUC 3LEMA 5F6KA 1VAMA 4N53C 3RNSA 1HRI1 3ZXFA 3O12A 1R091 4ET7A 2VW2A 4LKSA 1HRV1 1AVBA 2KXLA 4OZXA 4AHYA 4BMEA 4OI2A 2X29A 4JGYB 5FY5A 3MUZ1 3K46A 3NV1A 4Q4V2 4JVAA 4JCKA 4FAHA 4LXLA 1V6MA 2X53S 5FFOC 5H9PA 3KHCA 3H1YA 1ULOA 4TLGA 3AJZA 2X5IA 4AGVA 2E63A 2ORZA 4XJAA 4XUNA 4QMAA 1U0AA 2W68A 5CVRA 5KC5A 2VBPA 4BDVB 4RS5A 2WYSA 3I2GA 1W3VA 1E5SA 2OX0A 2XVKA 3PIJA 3S5QA 4Z1VA 2DDUA 3GALA 3H50A 3DKWA 4UF0A 4UWDA 4ATFA 3IAQA 4LJHA 2R0FA 1RUD3 2P3IA 2DCKA 4R4XA 4IDZA 1XNKA 1NCRC 1R1ZA 4KMQA 4I2OA 3Q8FA 3WNLA 3B9IA 2BJSA 5EJZB 2PA7A 2JENA 3O0WA 5LATA 3H7YA 1W6QA 4R9BA 3R05A 5LRRA 2QZ2A 4NRMA 4BJ0A 3KS7A 4O65A 5LCWL 5LK5A 1EAH3 1L7QA 1WA4A 2VY0A 3EYPA 3JUUA 3POIA 1OQEA 4N43C 5FV3A 3U78A 4BLIA 4AHWA 1K42A 3M2MA 2J22A 2QQJA 2Y26A 1FNZA 1A8MA 4JHZA 1RUD1 1H9PA 2VUAA 4Q29A 4AFCA 5IHRA 2MEV2 3GGLA 1SACA 4CUAA 4FXKB 5FYSA 5CU1A 1DZTA 2H0VA 2BOIA 1UOJA 1VRH2 3H1MA 3K2OA 2YFUA 3UL2A 4AHXA 3CHXA 3WG4A 4XMAA 3ZMOA 4XQ4A 4Y3OA 1D0HA 1DG6A 5IVYA 1W9WA 1EAH1 3BODA 1DYOA 1KD7A 1O8SA 3AZZA 3NNFA 4NIGA 1V6KA 2LM3A 5F7UA 1W6PA 3OGRA 4MGYE 2G9GA 4U36A 2XJTA 5FXVA 4NIAA 3SNMA 4BMBA 4Y33A 3ZXGA 1I3HA 3H3ZA 1UOBA 4CCKA 3TBDA 4AHZA 4LQRA 1AR93 1F35A 1HV1A 4OHZA 3OD0A 2A73B 2DV9A 3IBMA 3K4AA 4WVVA 2NPIA 5T50A 1IQAA 5B2GB 2VAUA 1PMJX 1JYWA 1UIJA 2QVSB 4LE4A 4CCDA 1Z7S3 5J1XA 3WX5A 3ATGA 3AC0A 4KG0A 5B4NA 1AXYA 1NCRB 4MH0E 1HX6A 5A3MA 5K9YA 5FO9B 2X5IB 3RPQA 4J1WA 2ZCWA 2G4IA 1KJRA 4OLLA 1AR91 3VD7A 4JZRA 3DPRB 3P3NA 5GALA 1GMMA 1C57A 2G19A 4RS5B 4D0QA 1YFXA 4LR4A 2OT7A 3MIBA 1W8OA 2Z4FA 1JYCA 2D3PA 3U4XA 2HJIA 4HG6B 4UF0B 5T52A 1Z7S1 1ULPA 4NJ4A 3WNXA 3B7MA 2YFZA 3I97A 1AR72 2WNEA 4YPJA 4DPNA 5C5UA 3MZHA 1CPNA 1I5PA 1HJFA 2WNVC 4RHV2 5K4LA 4MZUA 1R1A3 1OXCA 1E5HA 4P02B 1W6QB 2RDRA 5FZEA 2W92A 4LBQA 1OA2A 1NCQC 1NY71 1YYNA 3HN3A 3NNMA 1ZX5A 4P5YA 2WQ4A 4XUOA 1QJX3 2YB7A 4W6WA 4Q26A 5EZWA 1WCDJ 1QU0A 2ARAA 2WO2A 5ABJC 4K8RB 3NWKA 5EHDA 1I5ZA 2KR2A 4D7SA 1PM4A 2ZHMA 3QLQA 3AZYA 1W9YA 3KT4A 2DTWA 4LTAA 2YC4A 1IS5A 3PVNA 3U37A 5FXWA 1C1FA 5K0UC 1R1A1 1VMJA 2X10A 2BNNA 3ZFGB 2GMPA 2VMCA 3HBZA 3IDEA 3PL0A 3WY6A 3WP5A 4N7IA 3PVEA 4KWLA 4RFT0 4A3XA 2GU9A 3THDA 1DQ6A 5ANQA 1O3TA 4RL7A 3U4SA 1SBFA 4GB33 4IERA 2C6SA 4NHLA 1QJEA 1QJX1 4MSVA 1XC6A 4A44A 5JIUA 2P3JA 3AVRA 3VDDA 4NR1A 1W6PB 1OF4A 1TNFA 2DCZA 2VZRA 5FY1A 2VMFA 4M0NA 4B4RA 4AYUA 4B8EA 2R6QA 5CZKA 5JZGC 4AEMA 5IWFA 4FPCA 2RS53 1VALA 3EO6A 4QDRA 3GYDA 4KGGA 5FZGA 1SLCA 3WF3A 5F37A 1O4TA 5LA9A 1PHMA 2YYOA 4CP0A 1EP0A 3AXEA 2FBEA 3WHTA 4BISA 4OQ9A 5FWJA 2YY1A 3KHBA 4GB31 1WMEA 3KD4A 4NRPA 5DG2A 3ZO0B 3LD8A 2A3WA 3ES1A 3OUIA 4BQ2A 2CYFA 5DN2A 3EQEA 2AEYA 4FFGA 5C8CA 4N7UA 4E2GA 5HV4A 5CG8A 3LOBA 3WINE 2HWF3 2RS51 3RVHA 1H9WA 2ARXA 1G8WA 4KWKA 4DNYA 1CZVA 1C5HA 1XSQA 3SQOA 2R072 3K75B 1LHUA 3ILRA 3UJOA 4LHSA 1QHDA 1VBE2 1X36A 2O8QA 2EICA 4CEYA 3N7KA 4Y26A 2HWE2 1UU6A 2GP5A 1VBC3 3I2DA 3VHOA 2W3JA 4QXHA 4Q4W3 3KV5A 2VCMA 1RUF3 1VBA2 1CD3G 3IM0A 2FZ1A 2FZ2A 1YQCA 3LWCA 2QFEA 2ZX0A 1W9SA 4FTSA 2HWF1 2RR13 5FYZA 5FQ0A 2GSYA 4HXCA 2HEWF 4FVVA 3ZN6A 4QQLA 2LTNA 5I91A 4LHKA 4LBQB 4BQWA 2AGSA 1ZM1A 1O7FA 1V9U3 4KU7A 2J1TA 3HNBM 2ZXQA 4LULA 4RGAA 3JB8A 1FV3A 1UY1A 2YC0A 1DDLA 3WNKA 4MUVA 5AVPA 1VBC1 1HB3A 1RJ8A 1NXMA 4Q4W1 1RUF1 3L2YA 4RYDA 4YW4A 1UL9A 4YZ1A 4B7KA 2O0OA 2VH9A 2NYYA 4LA3A 3RDIA 5BNOC 2RR11 5FZ0A 4IV1B 2BGOA 4O9EA 4QT6A 1FX5A 3QOPA 3AX4A 2BZDA 4OMDA 1V9U1 3H8RA 1RMU3 1VMFA 5FK8A 1YXWA 2A71A 5E16A 4A2UA 2IUWA 4AQ2A 1JHJA 4Q8LA 4GALA 4BU2A 2HKXA 4JKLA 4AFAA 2A6WA 1Q8OA 3JCIA 2Z2SB 1WCQA 2DVFA 3ZR6A 4D69A 4P9LA 1W9TA 4QX3A 2OZJA 2VXJA 2XHKA 3LIGA 3NV2A 4XDQA 5ISLA 2ZTNA 5CKMA 2XWJB 5FXXA 4GMP0 4WVWA 3VZMA 4CCLA 4A42A 5JDBA 5JXHA 2JG9A 5FKCA 5FRAA 1GOHA 3VGIA 1YI7A 4YW2A 1LECA 4CDQA 4HKWA 1ZA7A 2QDNA 4YG0A 5T5PA 1RMU1 1RUE2 3H9AA 3ZN4A 3KZ4C 4GQ7A 3TNQA 1WBLA 3SKJE 2VZSA 1VBB2 1DYPA 3HAGA 1YFYA 3ZDSA 1POQA 5DQ0A 3T3YA 1UW8A 4ATEA 2WWUA 3CZUA 5IATA 1FOD2 1GU3A 1RUJ2 5LEJA 3VBHB 1TME2 3WDXA 5CFDC 1DQ2A 2E51A 1W6NA 2EALA 3RMYA 1WZXA 3LAGA 3SXWA 4R4ZA 4BLJA 2DWRA 1K5JA 2K0GA 2RHPA 1UY3A 1SLAA 1LTEA 4M3CA 3HD8B 2DU0A 3NAPC 3ZFFC 4CDUA 1AJKA 1W0NA 3ZYHA 3BKZA 5KHJA 3VBOA 1Y9GA 1NQJA 1QJU2 2VTXA 3VBUB 4CYDA 5A6YA 5EYXA 5FLHA 3SCHA 3V0AA 3AYAA 1DQ4A 1GR3A 1V0AA 2JDPA 2XJSA 4Y5SA 3ZN6B 4DY5A 1SLBA 3FUQA 1BXHA 3U75A 3ACIA 4DFSA 5A32B 3J7NA 5FUPA 4QB1A 4FQ4A 1X7NA 1VR3A 3VHRA 4KL1A 3V64A 1JYXA 3ACLA 4H7LA 3ZXDA 2A6XA 3GM8A 5T3NA 4HN1A 5DAPA 1YIPA 4X8NA 5IW0A 4LOTA 2E7TA 2J7MA 4ZS2A 2E9QA 4R8HA 4YWAA 4E9KA 3I59A 4Q0PA 5D1IA 4P00B 3THPA 4XAEA 5DPNA 3WXPA 4AE2A 4LT5A 5DUVA 2JDKA 3FFZA 3O1UA 4XEZA 1MZFA 3TN92 1SCSA 1ULCA 1JOPA 2E7AA 4YW7A 1F8VA 2VJXA 5DUWA 5F3GA 1A34A 2BYVE 2GC0A 4GAZA 2V73A 2RS32 3PVBB 3RZLA 5DDJ2 5CKQA 4FFIA 3AKQA 2DU1A 3VN4A 4COWA 1B09A 2DUQA 2PMWB 2DBIA 2VO5A 2ZHKA 4K3UA 4ZONA 4B1LA 5JLVA 3TRSB 3PMEA 1W8ZA 2RDQA 3OUJA 4QGNA 3W20A 2BGPA 5JSOA 1G9DA 2EF6A 3L9JT 4TYSA 2DF7A 1ND2A 1C4RA 4MVTA 2DFCA 4ZPIA 2WZPP 2JG9B 3EXUA 3RJ2X 4A4AA 4AI3A 1NX9A 2C1FA 3WQ7A 3WQ0A 2ZA9A 1S0GA 2QQIA 1AUYA 1MS9A 4NAOA 4CCEA 1N47A 5SV5A 3T08A 5CKNA 4CEWC 4YG6A 1OOPB 1UU4A 3LQCA 4LNVA 2YXSA 2VMEA 1CX4A 4BHPA 1UXZA 1CPMA 2W95A 5I8YA 1JN2P 4FP2A 4JRLA 5CFCA 2R30A 2RMU3 1RC6A 1YHFA 4OI0A 1KRIA 1CAWB 4Y1XA 5I8SA 5KXDA 5LBFA 1IG3A 4GKYA 4HKLA 1W6NB 1E5IA 1JYNA 1LOEA 2JDHA 2RDSA 2PHLA 2VPVA 1OD5A 4OHWA 2BBVA 2H6BA 2TNFA 2TEPA 2RG4A 4YW1A 3AM2A 3I3EA 3V56A 5C71A 4LEJA 1J3PA 4IE4A 1ODNA 4BXFA 4M3CB 5C9AA 3GZTB 4AEDC 4WVMA 4FT8A 1WW5A 2Z42A 4G9SB 3INAA 3TB0A 2PAEA 1NT0A 3KCYA 4Q8KA 4FO9A 4Q4V3 2YROA 5F3IA 1QH7A 2RMU1 4A7KA 4QX7A 1PMHX 3U14A 5C3RA 2J1EA 1JYVA 4FPJA 3V0AB 2Z79A 1G7YA 1BK1A 1GZCA 3WG3A 1J3RA 4GD4A 4IETA 3DF0A 3KM5A 2UU8A 1NLSA 5F39A 4ASKA 1YFWA 2GNTA 4W4ZA 4XMIA 2QZ3A 1PMIA 4EYUA 2ILMA 4H55A 3ZIXA 2ZGQA 1BEV3 1RUH2 3QH7A 3JU9A 2SLIA 1QXRA 3I59B 1JOBA 1SDDB 1Y9MA 4Q4V1 1REEA 5DXDA 3VD4A 1S2BA 1YUDA 1BVVA 1ZZ7A 3OGVA 3HNMA 4NHXA 4OQ8A 2XJPA 5FZAA 4W8JA 5A33A 4AGRA 5A7OA 2VCBA 3HEIA 2VNVA 1ULFA 4IE6A 4AR2A 1ST8A 5EV7A 5DAVA 5H9SA 4IV3C 4NPRA 3A23A 4S2GA 4MG2A 4LLOA 4GKXA 4QB2A 3BU7A 2OPWA 4OZOA 1BEV1 1RUNA 1G9AA 4FPOB 5KHGA 2ZZJA 3GBFA 1JODA 3KB5A 2XB6C 3FHAA 2VUJA 3C7OA 1LOBA 1ND2B 1UO9A 1V6LA 2ENRA 1LCLA 2D7FA 3ZR5A 4ISQA 2MEV3 2P34A 3FHQA 3C8XA 2BPA2 3N7LA 1U5XA 2CNAA 3AP4A 3N9QA 1VRH3 2DBNA 1ASJ2 2HBTA 2JDYA 2LALA 3AP5A 4Q1RA 4QQPA 3THCA 3NNLA 1GP5A 2ZABA 2VNOA 3VZNA 2WIIB 3T4VA 1SLLA 5CFCB 3WUDA 3ASIA 4QX2A 4PIYA 3RZMA 2A6ZA 3ZYPA 1ENSA 4L11A 2CWMA 4URAA 3PURA 3ACHA 1H6XA 2VQTA 4J6GA 4CA9A 3AKRA 4MO3M 2JKBA 1AX0A 2MEV1 2HWC2 3SC7X 1N3PA 3KMHA 4BK5A 4WM8C 4IEYA 2J1AA 4JGZA 2WQZC 4Y5Z0 5E1RA 5C9AB 5IVVA 1A6CA 4XOGA 2VOXA 4WVMB 2VZ3A 2XL9A 1VRH1 1RUG3 4OYUA 4CPBD 1JU4A 2F17A 2Y6HA 4I30A 3W5MA 4XJUA 3P3PA 1B35A 1F15A 4XJ9A 3AKPA 3A7QA 4XVHA 4DY3A 3RZHA 3BU0A 1LGBA 4YVWA 5FJHA 3HJRA 1GWMA 3E97A 2W5FA 3K48A 3ZSMA 3H8XA 2PHXA 1KJLA 3M4FA 4COYA 4WM7B 2WR9A 4YNIA 4MHUA 3RZGA 1PK6C 2ADDA 4C91A 3POSA 1S0DA 2X05A 3HWJA 4DUVA 3L2HA 4CUGA 1OT5A 3O0XA 3VBFA 1WCKA 1RUG1 4E4DX 3T1LA 2VTFA 1LGNA 1A3KA 1ZNPA 1LB2A 3WDYA 4DRRA 4YZ5A 2PFWA 4B29A 3BOPA 2P6HA 5F9TA 1AR73 1V00A 3WSOA 1SLIA 1AXZA 3BPZA 1PZ9A 3HQRA 4RHV3 4TTGA 4NN0A 2YGLA 5FAXA 1EPZA 5D8AA 4OUMA 2CAUA 3VZOA 2QBXA 1BK0A 1RUI2 1JW6A 1NLRA 3WHUA 1DF0A 1PIV2 2BWAA 2NLRA 1R082 1NAEA 3CKHA 4META 4GH4C 4CXWA 5M0TA 4FQZA 2ETEA 1W8UA 4BCUA 4CE8A 3CIHA 4D6SA 4XFAA 4GXLA 1H8TB 2QQLA 4URTA 2ES3A 1AR71 4L97A 4LUKA 2BVBA 3MGUA 4PI0A 1XYNA 2E7QA 4LA2A 2WLPA 2PELA 5ACA3 4RHV1 4JGYC 1SBDA 2XL7A 1ZBE2 1W06A 3BB6A 3OJBA 3MEPA 4OMCA 1Y43B 4OUSA 1UZVA 2P37A 1XB9A 4FI9A 4CDXC 1V6OA 2V72A 2XUEA 1ZYBA 2QTWB 3T2QA 4UBHA 2ZMKA 5JXIA 4QPGB 1VBD2 1POV0 4L8QA 4DUWA 4EWAA 4NIDA 2WO7A 3I3BA 2FD8A 1NG0A 1U12A 3MIEA 3FUOA 3NL1A 1J59A 2K9ZA 2GMEA 2Z5WA 1ENXA 2QQKA 3MIGA 5IVBA 1D2QA 5ACA1 5DZGA 3CBNA 4AOCA 3U07A 2WC2A 1RXGA 2A6YA 2VZUA 4JGZB 4B7EA 4OVEA 1MZEA 2Y64A 3S30A 5EJ3A 5FWEA 3PUAA 5FOJB 5L9VA 1MS8A 2ZHNA 3PNAA 2DCTA 5FZ6A 1WGPA 3PVOA 5FYBA 3URFA 5C3QA 5F1RA 5GLTA 1AR82 4Z82A 5KHHA 1GANA 2ATFA 1UX7A 4M4PA 4WZFA 1F5FA 4OFGA 5GJ6A 3WCSA 3N3HA 1QJY3 1JZ4A 2A7AA 2FDGA 1DHKB 5EIYB 2VGDA 3C7FA 2GDFA 3VBRA 2EVXA 1QKQA 2WL1A 4NRQA 4XF4A 4NIIA 3WLUA 4AI2A 4QKNA 5EFUA 1QH6A 1V6JA 2ZAHA 3FMGA 3VBFB 3FBYA 2R073 3NQHA 3C2UA 2VCCA 1AR62 2NP0A 2UYAA 3CU7A 1VBE3 4DUXA 5F3EA 1O6UA 1EPWA 4JDOA 2PHUA 3D5OA 4I0BA 4LE3A 1UYXA 1VBA3 4D7YA 1W28A 1QJY1 4XFBA 3B69A 3LOIA 1YNAA 2W1WA 3OG2A 4PLOA 4HLTA 4CDXB 3GJBA 1UMZA 2QQOA 5D8AB 3M3CA 1H1AA 1HV0A 1OVSA 3BN6A 5L19A 2FDIA 1FV2A 5I0RA 2OZ6A 2JX9A 3PHMA 1YQ5A 5KHIA 2XQXA 5KHKA 1FAYA 2CDOA 2R071 5L7OA 1BBT2 2CGNA 1T2XA 3POGA 4INDA 1FXZA 5FK7A 1UYPA 1KDKA 1VBE1 1COV3 3KLSA 4YARA 5IK4A 1UY4A 3M3OA 5HXMA 4QGMA 2ZX1A 3AZWA 4UFMA 4UAPA 4Y1VA 5C8CB 2C0ZA 2XLAA 3I2JA 1VBA1 2C26A 2ZAAA 4IEPA 2BWCA 1SQ4A 2WJSA 3RMXA 4C0BA 4EN8B 1LOCA 1C8M2 2D93A 4OHYA 2D6MA 1WLTA 3ZXAC 1IGOA 2ZGPA 5FZHA 2G9FA 2IXIA 1OQ1A 5CG9A 5C70A 2VMHA 3KVAA 2PHDA 5GLVA 3M8LA 1O5UA 2X5IC 5HPOA 1ULGA 2OVUA 2YMZA 2K46A 3B01A 2IXJA 1DFQA 4Q4Y2 5KC6A 1MZ5A 1YFUA 1LJ7A 1COV1 1GNHA 1OPMA 2VECA 2ZGTA 4QQOA 3N36A 3MF9A 1UY0A 3SEEA 3DPRC 2B7YA 4AGGA 4AXOA 3K77A 5JAXA 4RS5C 1STMA 1OSGA 1PO13 3T09A 4DOUA 5I0SA 1MQTA 3VV1A 4YM1A 3ENRA 3K4DA 1OBNA 4CXXA 4LBOA 2Q8DA 3BCWA 1JHNA 2PLV2 1SFYA 3MF6A 4XETA 5DMYA 1RUE3 4CU9A 2K2SA 4QGLA 2CY6A 2TUNA 5FZ3A 5FO7B 1DLLA 4E27A 3DXTA 3CNAA 2D6OX 1QOSA 1DQ5A 4IEOA 4IQPA 3ZMNA 1F5JA 1VBB3 1S0FA 3ZYRA 1HXS2 4O61A 3MHZA 3VKOA 2PQSA 4PQ9A 5FBZA 2ERFA 5FYVA 1FOD3 1AF9A 3N4MA 1RUJ3 1PO11 4HVRA 3WOGA 1TME3 3JD72 4JV4A 4LO5B 5ERLA 5J09A 2DCJA 1BJQA 4XQDA 1BCXA 4RN5A 2JDZA 4QQ2A 4AAPA 4OI1A 1AYN2 4UFHA 2NMOA 3IPVA 3ZSLA 1AJOA 1IKPA 3ME2A 4ARYA 4E4SA 4E4ZA 1PX3A 2IXLA 4GA9A 4UFJA 1RUE1 1W2AX 5J36A 3MLKA 2XDVA 2Q8OA 4DEVA 4XFFA 5EWSA 5A3PA 3ZFGC 1KFXL 3N9MA 1YLLA 5EJ1B 4NHMA 2VD7A 1VBB1 4Y4RA 4K1ZA 1HN0A 1OLME 1G9BA 2WAOA 4HSLA 1QJU3 1TVGA 1FT9A 1FOD1 3J4UH 3WV6A 1RUJ1 2JJ6A 1RGSA 1RUOA 1TME1 1REFA 5AFBA 4P9IA 2ZGLA 2FMYA 4ZY9A 2EXJA 5IK7A 4IEZA 1L7LA 3RQ0A 5L7OB 4FXGB 4XF0A 2HYXA 3AJYA 4BE3A 4WZCA 2XLFA 3K3NA 5FLJA 4NUBA 4S2DA 1NZIA 1QJZA 2A70A 3AMMA 1VE0A 1MS3A 3KV9A 3GCWA 2XMLA 4P5HA 3WP3A 1O91A 1C28A 1UU5A 2V5YA 1HN1A 4QQHA 5TSWA 4RA0A 4SLIA 1GWKA 1GUIA 4XFIA 4C1XA 1W2NA 3WF2A 1SCRA 1QJU1 1OI6A 2W1SA 1CONA 3CO2A 3UETA 3WDWA 5B4XA 5C4WA 1DGWX 4ZXKA 3T30A 3ZPYA 2BFUS 1UMIA 3TN93 3RGBA 4FPFA 1IPKA 2W1QA 1L3JA 3N9NA 1Q5OA 2ZEZA 4XCAA 3K4ZA 3WNOA 2YGMA 5IVJA 1PZ7A 2RS33 2NZ9A 2BNOA 1J3QA 1OH3A 2GC2A 2JD4A 5DDJ3 4PJYA 4KWUA 4KQ7A 3CDZB 3ROUA 3DECA 3NV3A 3EBRA 4I0WB 4RGGA 4RGKA 5IK5A 2FDHA 5I0DA 3AK0A 2W39A 3KT1A 5FZ7A 5K0UA 2W1UA 1GZWA 3IB3A 3B5LB 3TN91 4CCJA 1DZQA 5KXEA 3AP6A 5FREA 2LW8A 4CUBA 3MDPA 2BUKA 4HBNA 5F5IA 4M01A 3M1HA 2RS31 5FUNA 3IIAA 5FZDA 1V6NA 1QDOA 3HMYA 4FPYA 5DDJ1 4EZ4A 5D2AA 5BNNA 3Q8AA 4O9GA 2BTVC 2B8MA 4AZZA 2ZGOA 1GQGA 1LU2A 2LROA 1RIRA 2ZJCA 2C24A 3FZ3A 3H1WA 3M3EA 3FFQA 2VMIA 5JZGA 5F5CA 1T6BX 2CDPA 3IDBB 4A3ZA 2DVGA 2HEYF 2R7EB 1QOOA 1JOJA 4ARXA 2DTYA 3PDQA 1H30A 1RXFA 3IPVB 4UFIA 4K9SA 3VBSA 1SG3A 3D3AA 1C1LA 5I0UA 2HYKA 2HH9A 4IGPA 3O1RA 3P5BA 4BOWA 2HWD2 3VL9A 2W94A 4H14A 4XQWA 1AL22 3N7JA 4IV1C 5FZFA 1JZ8A 1AHSA 2ARCA 1H8VA 1H1IA 3NKTA 4Y24A 1LOGA 1Q8VA 1PO22 4ISRA 4BQXA 5A6XA 3BTAA 2EIGA 2DCYA 2ZGSA 1LEDA 5K8SA 4AL9A 1ZRCA 1HLCA 2XPJA 3VDDC 1G9CA 3RI9A 4AVCA 1BLZA 2X8KA 3LSDA 3ZXLA 4XDOA 1YQ8A 1CAXA 3VHPA 3ON7A 4XC9A 1MEC2 1M4WA 4FPKA 5H9RA 4PBPA 1TMF2 4JHTA 2UURA 1NA1A 5A3NA 1R092 1ENQA 3FWEA 4I09A 1YRZA 4COZA 3ZVXA 4NWVA 5CADA 4Z07A 2D6KA 1JMUB 3LDRA 4YFZA 4FCAA 1A8DA 2AENA 5C4WB 1H6YA 5F6LB 3E5XA 2IZWA 4QDQA 4C8DA 3HVDA 4IGQA 5G05L 2O1QA 3BTYA 4A45A 2BGCA 1OHFA 3WW1A 3GXUA 3VBHC 3W21A 3IT8A 3NJZA 3P6BA 3FJSA 3PTRB 4LBLA 4DXTA 2XQRA 1ZRFA 4DXZA 2W52A 3CEWA 3A21A 3SH4A 1KQRA 1QNYA 1Q8SA 3A22A 3WQ1A 1ND3A 2RS12 2GN7A 3AP9A 5E6HA 1K45A 4NIHA 1H2LA 4FTEA 2D43A 1KGYA 3IKWA 3J8F2 1O4ZA 3NNGA 2MPFA 1VP6A 2BDRA 4QD2A 4CDWA 5J7MA 3VLBB 3KCXA 4LO6B 4BK4A 4LK7A 4K1YA 4X6QB 3VBUC 3I3QA 4GIQA 1ASJ3 1N1YA 2P3YA 4C90A 4CVUA 1YI9A 1RYYA 2XJVA 2GNDA 2VZOA 5BNNB 1T6GC 2WFF2 1PVXA 1QF3A 3M3QA 3V0BA 1EV12 3VDDB 4J25A 3JB4C 3MIFA 3RYKA 2VUCA 1PGL2 3FLRA 5IFPA 2WT2A 4XFGA 3VBSB 3AZXA 2RM22 2XJUA 2HWC3 1UZWA 3USUA 1DGRN 1UF2C 1ASJ1 3RJRA 3Q8CA 3DYPA 1Q8QA 1Q56A 4DB5A 3RZZA 5J96B 1WLDA 2YUEA 4XE9A 1HQLA 2QQNA 3H3UA 3IIIA 2WAAA 1FPN2 3LE0A 4AQSA 3RYPA 4YVSA 3OBTA 3HT1A 1VRBA 1UAIA 1GOFA 1EAH2 4HVOA 3O1MA 2RE9A 3ABZA 1H1MA 1X33A 2MNGA 3B3QE 2Y33A 1CAXB 4HN0A 2HWC1 3OSDA 1W39A 1MVEA 4UW6A 2GC3A 3R0RA 5FPUA 3T0DA 1GZ9A 5FZOA 1JTZX 1NA1B 1QQP2 5FYMA 3D4KA 1I9RA 3U11A 4CEYB 1OFNA 1K12A 2JG9C 2E31A 5FBJA 3H3LA 4CDQC 5A7PA 4PLMA 1K5MA 3PLQA 3POJA 4ASLA 3ELNA 4CU8A 4BPZA 4LOSA 3P1IA 2ET1A 4R9CA 4RR3A 4CP1A 4XXPA 1OOPC 1OMIA 2V4AA 2VOKA 2VULA 2ZMNA 4I3GA 1RITA 3T4HB 2BU9A 3ECQA 4A7ZA 4KBBA 5FQ0B 1WLCA 4XW3A 4CRQA 2F4LA 1NLQA 1HDKA 1RUI3 2R063 2YPJA 3BPSA 3ZM8A 1LGCA 4BQ1A 1UPIA 3DGTA 5LY2A 4Z2AA 2A3YA 3A0NA 2WABA 3POBA 4P9JA 4YG3A 4Y1ZA 1PIV3 1R083 4YGEA 2G9ZA 4BM8A 4CZSA 4O7XA 2R1BA 1TZOA 4HOOA 4GWJA 2QQMA 1XNBA 3ZYBA 1O8PA 2QKDA 1ND3B 5T5JA 2NM1A 4QAWA 1YCIA 3LKJA 4MGZE 4RQPA 5CNAA 2JDMA 2Y34A 3VD3A 1XE7A 1HW5A 3KQ4B 4HVQA 1XQNA 4CDWB 5E88A 3WR0A 2NMNA 2D98A 4E8CA 5A6QA 1ACCA 3VBOC 1FI2A 3CL1A 5A7QA 1RUI1 2R061 1X8EA 5A1AA 4YGDA 2WWSA 2D3SA 2JXAA 3V0BB 1PIV1 1R081 4PDWA 5FY0A 2VW1A 2HBUA 3POEA 5FMBA 1MS1A 4JTNA 1D7PM 3BYWA 5FPZA 5A7WA 1I1EA 4LBMA 3WD5A 1IS4A 4AVSA 4XFHA 1D4M2 4QDSA 4MADA 3ZXEA 4COVA 4K6BA 5A3LA 2JD9A 4GMP3 5FZBA 3ZYIB 3DV8A 2W9XA 3UESA 3AVSA 4IEWA 1LESA 4KNCA 2VZ1A 3VHNA 3FE5A 1H2NA 1QJFA 2Y6JA 3POFA 1JZ7A 4RFRB 4KBZA 2ZEYA 3QH6A 3SCGA 2XVGA 5EPAA 2GNBA 4CDQB 3LPFA 4EZHA 2RV9A 2E6VA 3HQUA 2QE3A 4FOYA 5FXZA 4FPLA 5FMCA 4D7TA 1XU2A 3TEXA 1PGW1 5HV0A 5JXJA 1JZ5A 4ORFA 3S7IA 1LULA 2XONA 3UYJA 1AR83 1GNZA 2WS93 5FPVA 3AZVA 3TEWA 1QJX2 2WLQA 4LHNA 5LRSA 4QHZA 4GMP1 3J26N 3AYDA 5FP8A 1K3IA 1RINA 3TEZA 3WW4A 1Z78A 2I2SA 2WZR2 1DYKA 1KS4A 4Q0QA 3O7OA 5EXOA 1ND2C 3NRUA 2PHWA 4GWIA 1AR63 2PTMA 4UI9L 5CIRA 4E2QA 3ZFEA 2WSUA 1K5MB 5BNPA 1W8WA 3CF6E 2OA2A 4CDUB 1AR81 2WS91 2UWAA 5BYNA 3OGGA 2F4PA 3BIWE 4RR3B 1SFNA 2Q1ZB 3VBOB 1NOVA 1FATA 1W6MA 4LBQD 1N3OA 4QX1A 3AMPA 3E6BA 4BA6A 1SMVA 4Q27A 3NSTA 4XAAA 3WZ1A 5CFCC 3JXSA 4A6SA 5KXBA 4Y1UA 2Y8KA 4GJYA 3E1F1 5FP7A 3THTA 4IE5A 5I0TA 3RI8A 5JOZA 4QPIA 3N9LA 1TNRA 1BBT3 2JE7A 2HWB2 1ZVFA 1E5RA 1AR61 2WA4A 3JBG2 3FBMA 3MW4A 1J1LA 3SKVA 4CUCA 1Q43A 4PLNA 1NQDA 4CU7A 4ZZ5A 5CA6A 5HI0A 2TBVA 4QU1A 4Y22A 5C9AC 2UYBA 4CCCA
chains in the Genus database with same CATH topology
4RQPB 2CAVA 4FPHA 4BH9A 1KS5A 3I8TA 1C8M3 5C8WA 1CAUA 3TAYA 3KT7A 4ES9A 1QGLA 1EY2A 3NVCA 4Q0VA 1RJ7A 3K51A 4WM7C 1BBT1 4PDWB 4Q4Y3 4YM2A 1PVC2 4JTOA 4ZU4A 4QX5A 2PHTA 1H4HA 3J9SA 2DURA 4YFWA 4DZGA 2Y0IA 1XU1A 1O5LA 4HK9A 4M0HA 4OHXA 1C8M1 2OPKA 4Q4X2 1S2KA 2Q1MA 4YZ2A 5BNQA 1RUF2 1DIWA 2R042 4V1PA 4XTMA 2PLV3 4EN7B 2UY8A 1C8NA 4Q4Y1 3PJQA 1PNFA 3T2TA 1BVP1 2VVFA 2WINB 4XF3A 1H2KA 1WUVA 1HXS3 5L36A 1XYOA 3VKFC 4BWOA 4LBJA 1LR5A 4AF9A 3JD73 4N90A 3ZX7A 1XRUA 4AFBA 2AYHA 5J98B 4AFMA 2D97A 2IXKA 2SBAA 2OYZA 1H8TC 5JPMB 4C1WA 3D8CA 4I02A 4UW4A 2PLV1 1UN1A 3W9AA 2EXKA 4I01A 3ZFEB 5BNPB 2W0XA 3LA3A 1O3RA 5BV6A 2XBO2 4H7MA 4K7JA 1G9FA 1SLTA 2ZX2A 3ZSEA 1HXS1 1S1AA 1W6MB 3NV4A 5DUXA 1D4VB 1RVF2 3B00A 4XBNA 4ZU7A 4F83A 3ZSKA 4XJWA 1PK6A 1XYPA 4QPGC 3JD71 1LHOA 2B5HA 1DGRA 4XHXA 4AG4A 1N1SA 3EHKA 4L2NA 4QPIB 4AI8A 1DQ1A 3TWIA 4TLFA 3ZSJA 3SISA 4JDMA 1QXJA 4XFCA 2QQPA 2XJQA 4Y22B 1S55A 3WG2A 4JGZC 4AVBA 1H4GA 1JH5A 1FMD2 2B46X 3AFKA 4IEXA 2WSVA 1B35C 1CAUB 5GM0A 2VVDA 1Q3EA 5A33B 4ITCA 1KITA 4HMZA 1AYM2 2Q5TA 3ILNA 3OD4A 2R0HA 1UCXA 4HK8A 2YZ4A 5AC92 1JBCA 1SEFA 2N7GA 1WMFA 3VBFC 4FTSA 3N35A 3GNEA 4W6XA 5DUUA 4Q2FA 3FX3A 1W6OA 3I7DA 4S2FA 4OI4A 2JG8A 3WW2A 1AXKA 5L73A 2PHFA 1W0OA 4NOTA 2UY9A 5D8AC 2C5DA 3UKVA 5FO8B 4B4QA 2VMGA 4GULA 5HCBA 2VW0A 3CJIA 2ZMLA 4C0HA 5IUQA 1A78A 3MIHA 4KG8A 1PGSA 2VU9A 5C8CC 2ZGNA 1LOFC 5T5LA 2FQPA 2VNGA 3ZIWA 1S0EA 1ZA4A 2P3KA 2HWD3 4FP3A 3BALA 4LBKA 1AL23 1UZYA 5JVVA 1O3QA 1BYHA 1WCSA 1B35B 2Y0OA 2EAKA 4UW5A 4YVWB 1PO23 2BW8A 3E6DA 2ZGKA 5IK8A 1WW7A 1J58A 1UIKA 1WD3A 2WNUA 3OYWA 2ZGRA 4N53A 2VOVA 2AR6A 3O14A 5LK7B 2QDRA 1OPOA 3E6CC 3QBQA 1TMF3 2HWD1 1Z0HA 5HBAA 4QHBA 1AL21 2DVBA 3C3VA 1G6NA 4X8PA 3GHMA 4F3JA 1CQ9A 2HWE3 1PO21 1QOTA 4E2SA 2ZBJA 2GN3A 2BVVA 2B42B 4FPEA 4ES8A 1OLQA 2EAAA 3UJQA 1GQHA 1W0PA 3MPBA 4XIOA 3GZAA 2B45X 4XIKA 4GWMA 3WDUA 3VBRC 2P17A 1TMF1 5HCFA 1ZBA2 4LLFA 2AH2A 2NN8A 1DU3D 4P9YA 2HWE1 3B9CA 3H0OA 4FAGA 3VZLA 1W6OB 2RS13 4FOQA 4AVTA 5JI9A 3J8F3 2JG8B 1NCRA 1AX2A 3JQWA 1X8MA 3POYA 1F9KA 2IXHA 5F6KA 4AEKA 2ZS6B 4QM8A 2JECA 1OLRA 2ZX4A 3MLLA 3RG0A 1POV3 3WDTA 4F7ZA 5GLUA 2D3RA 1G86A 1TEIA 2DYCA 2WFF3 1EV13 1LRHA 2ZPXA 5JPNB 1LODA 3CJIB 2WKKA 3DPRA 3MW2A 2WA3A 3WG1A 5L7OC 4N43A 1UZZA 1BEV2 1RUC2 2RS11 3N7MA 1BQPA 3TNPB 2B9UA 2P2KA 2RM23 3J8F1 1GSLA 1WBFA 4IEUA 4PBOA 5KXCA 5BPXA 4YM3A 3VUOA 4XBQA 1POV1 4NO4A 4OULA 4NWWA 1CR7A 2NQYA 2WFF1 1BZWA 1EV11 1LHWA 1FPN3 3MIDA 5JCTA 1GLHA 5AFEA 1PGL1 3KGZA 2ZACA 1ULDA 3DN7A 4L92A 5LEKA 5FTTC 1XNCA 3IMNA 2D6PA 2WNUB 4B4PA 3OYWB 4N53B 3VBRB 2RM21 4ZKTB 3SHRA 1W2UA 4JAAA 4KGQA 1N1VA 1OQDA 1MQTC 2A6VA 4XF9A 2D5HA 1QQP3 2A3XA 1JXNA 4G4FA 3RWNA 3ZFGA 4OHVA 1LHNA 2VNRA 1FPN1 3S7EA 4Q0SA 2GNMA 4N9HA 3HT2A 5E89A 4XYXA 4GWNA 1D0GA 4FBFA 4L9BA 5IK4A 4ONUA 1DBNA 2IC1A 3WT3A 2YV8A 2JE9A 4AK3A 3RSJA 1S0IA 1QQP1 3SLIA 3GZUC 5CB7A 1RUG2 4CP2A 4FOWA 1MS4A 3ST7A 2D6NA 3W59A 4QPYA 2WNVA 4PIZA 4QU2A 4Y20A 3LGRA 1UD1A 1Q8PA 1BMV2 2JICA 4MXVA 1NCQA 4AWDA 2B39A 1U5YA 1VAKA 1ZZ8A 4XILA 3VKNA 4N43B 5GZDA 5ABJA 1D4M3 1RTVA 3DUIA 4EN9B 1MQTB 2CGPA 1WMDA 1JUHA 1MVQA 1NYWA 1F2NA 2O8OA 1E57A 1I6XA 3ZYGA 4Z92B 3AKTA 1ZZ9A 5C4WC 4A7YA 3IDCB 2MHFA 1RHI2 3LA7A 3AB0A 1D4M1 5GZEA 5C33A 1S0JA 5I93A 1LU1A 5T54A 3R6SA 2CL2A 3NW4A 2DFBA 2WZR3 4S2HA 5ACA2 1XNDA 2ZGUA 2GC1A 5DG1A 2AUYA 2BQPA 3WDVA 4YGBA 1HKDA 1IOAA 5JMCA 1HQWA 4IV1A 5J48A 1MACA 3UV9A 2I07B 3H7JA 4YZ3A 2Q0AA 1IS6A 1VIWB 2LUWA 5JWPA 4M3CF 4ZU5A 4D94A 5BUVA 2EXHA 3LCPA 5BXXA 1ENRA 1HIXA 4LO4B 4Y4YA 5BNNC 3SH3A 2CTVA 1IPJA 4W65A 4FOVA 2CV6A 1WD4A 2ZKLA 2FZ2A 1QNWA 2WZR1 2PQQA 1AZDA 4HPKA 1URXA 1N1TA 1VLNA 5GLWA 2HWB3 3JBG3 4AVVA 3M7AA 3U0ZA 3AMNA 3VBSC 1HRI2 1KDMA 2IFRA 3AKSA 2GMMA 1RUH3 2A75A 3FLTA 1HRV2 3OY8A 2WNVB 4Y1YA 3AMQA 1DQ0A 1GYKA 5FLIA 2BEOA 1QJY2 1YJLA 1NE6A 4LHLA 4W6YA 4Y20B 1CJPA 2KM2A 4IEVA 1ZRDA 3ZXJA 1NXD1 1NCQB 3VBHA 2PAKA 4XJ9A 2HWB1 3JBG1 4XF1A 1C5IA 1PVC3 1QDCA 1V70A 1DGWA 3MI8A 3WP4A 5ABJB 3B93A 1RUH1 3U10A 1NA1C 1N3QA 3POWA 1NZCA 4CEYC 5K0UB 1MS5A 4Q4X3 5BNOA 1ONAA 1TE1B 2OIIA 2BFUL 2R043 2FMDA 1GZWB 3FC0A 2CWSA 1H2MA 3VBUA 2ET7A 3QACA 2UWBA 3T1MA 1PVC1 5A32A 2DVDA 3MPPG 4HSJA 4XBLA 4PIXA 2ZZQA 1COV2 1AL0G 3LA2A 3OCPA 3D0JA 4EROA 4F8AA 5JZGB 1LOAA 1RL3A 3NKGA 4XPVA 4Q4X1 2R49A 1JUIA 1MR5A 2R041 4K21A 1DGLA 1ND3C 3O0VA 3RYRA 5BY5A 3R4SA 1C3HA 1RUD2 5SV8A 5KBFA 2ARBA 4NVPA 4CDWC 4CTEA 2XBO3 5JOYA 3O5SA 3B02A 3AXDA 1CN1A 4XHBA 5FOBB 2PAMA 4G3YC 1Y7BA 3MW3A 1RVF3 3GBGA 4HZFA 4YW3A 2OUHA 1QWRA 4JDNA 4BIOA 4AQ6A 1M06G 5CFDA 4HPKB 4QM9A 2DUPA 3TOJA 3UKTA 1PO12 3OTFA 2RJLA 3I54A 3KQRA 1KFUL 2IXCA 2XBO1 3NAPA 4FPGA 2XH6A 1UKGA 1YJKA 3ZFFA 4YW5A 3RS6A 5J3UA 2PYTA 2ZHLA 3OY8B 1FMD3 5JOWA 3LSEA 3JZVA 3R4DB 4J1XA 1RVF1 1OOPA 3MICA 3FHIB 1LENA 5GZCA 3R4UA 4K40A 4YVSC 1CAWA 1AYM3 2XGXA 3EJKA 3AYCA 3A4UA 4BYYA 4R52A 1SDWA 2D40A 4PCRA 2IWGB 5JOXA 1AR92 4PF5A 2A5ZA 3RRDA 5JSRA 4MYEA 5AC93 2AZ5A 3PMSA 1FNYA 3JQXA 2QNKA 3OF1A 1FMD1 1LKNA 5FPXA 1CJDA 5BNOB 5FMOS 2GAUA 1K5MC 2Q4SA 1Z7S2 4CDUC 4JRAA 1F31A 1ZBE3 4COUA 4AI0A 3TYJA 2FHRA 1AYM1 2XVLA 4RR3C 4P14A 2JEMA 1GV9A 1O4YA 1FYUA 4LO7A 3ZN5A 1LHVA 4EN0A 4XTPA 2HEVF 1VBD3 5AC91 3USSA 1NY72 4XJ8A 5JIAA 3M3IA 2RJKA 4SBVA 5GZGA 4XJZA 1ZZ6A 1ZBE1 3WCRA 3USUB 4RQPC 4LO8A 3HIFA 1WW4A 1J1TA 1R1A2 2OW4A 4EWDA 4CEWA 1ZZBA 4P9WA 5IT6A 2Z69A 1VBD1 4NHKA 4YVSB 3AFGA 4PDWC 4AFDA 5EYYA 5CFDB 3APBA 4KWJA 3E5UA 4M3CE 4P9XA 2UWCA 4BZ4A 2UYBA 4EWEA 1RB8G 1VB4A 3VZJA 5JR7B 2H6CA 2C9AA 2XKOA 4AEDA 4HANA 3NAPB 3ZFFB 1YWKA 2QUOA 1NE4A 1VB2A 4B3NA 2VVEA 1MZ6A 3PTYA 4K20A 1UKRA 4GB32 4FSJA 3ALQA 2PHRA 2WFPA 2XWBB 4LUMA 1CESA 2OUJA 2XJRA 1DZRA 4N9IA 3G6JB 5HXVA 1PM7A 3ZYJB 4HKOA 5H9QA 4EN6B 5F5QA 3MLJA 2RS52 1ZBA3 1EYBA 3HN1A 1CIWA 4TWTA 4Q0UA 3ZFEC 4UW3A 5I8TA 5BNPC 1GICA 1CAVA 1WLWA 4DMIA 4K8FA 1CGPA 4LBNA 1REDA 4MGIE 3WP6A 3D0SA 3CLPA 4MX3A 4AI1A 5HCAA 2I45A 4YZ4A 4WM7A 2ZGMA 4AVAA 2HWF2 4IV3A 5FCCA 2YHJA 3W58A 2AREA 3VZKA 1D2SA 1ZBA1 3ILFA 4BIFA 2BNMA 4QPIC 2XLGA 2XUMA 4QXKA 5FMOL 3NO8A 3VL8A 1LEMA 3PJYA 2R32A 5JI7A 3ZXKA 1RUC3 1UX6A 3SCFA 3SH5A 3SMHA 4DQAA 4FTBA 3WVJA 1OA4A 1ZRRA 2WT1A 3BOWA 4AQTA 1VBC2 3QCWA 3GHNA 3ES4A 4MXWA 4Q4W2 3DL3A 1QY4A 2V09A 2DVAA 5T5OA 4Q1PA 1U5ZA 5FDBA 4CEWB 2RR12 2KA3A 1QMJA 3A0KA 1KXGA 3S0MA 3MYXA 3LZZA 2VOWA 3VKLA 1V9U2 5E8AA 1BKZA 4IESA 1X50A 1RUC1 2VXRA 4D3WA 3IWZA 2D6LX 1GBGA 4HL0A 3D6EA 3IN9A 1H8TA 4WM8A 2CGOA 3AYEA 1AYN3 4KU8A 4AEDB 5KWRA 2GALA 3AMHA 4AW7A 1OKQA 2YDEA 2VQAA 1O3SA 2QCSB 1RMU2 2E53A 1IHMA 1YO8A 4RSUA 3WUCA 4EV0A 1IS3A 3Q9OA 4YRDA 1ALYA 4QPGA 4I3PA 1MS0A 1ZREA 3OGJA 2EA7A 4KH9A 3AP7A 4AEJA 3V65A 5JSPA 4Z2WA 3GF6A 4XXAA 5GLZA 1AYN1 3OPZA 2GZWA 2Q30A 4WV8A 3D82A 2D44A 4XZPA 2ZX3A 3MFAA 3VKMA 2F6BA 1YIFA 1IKQA 1CAVB 5CAZA 3OBRA 4X6RB 4IXLA 1XXNA 3E5QA 4YVWC 4JC1A 4MLOA 4JQRA 1JYIA 1XE8A 4P9GA 1PNGA 4I0AA 4IV3B 1Y9QA 1ULEA 2D5FA 1V6IA 2GH8A 4GH4A 3G7DA 3KSCA 3LB9A 3KGLA 3SITA 1ZZCA 4H3WA 5AVAA 1TQ5A 1U5IA 3GBWA 4UXAA 4HT1T 4JGYA 4MXWB 4UBGA 3I4IA 2QJVA 4CDXA 1GKBA 2WT0A 1BMV1 2R1DA 1HQNA 4TSVA 2VQ0A 4HFSA 2R16A 4YLZA 1VJ2A 1S0CA 2R062 4IL7A 1RHI3 2ZKNA 4WVZA 3S6PA 5K7PA 2Y38A 4YYOA 1Y3TA 4ASMB 4R9DA 4DINB 2I74A 3M70A 4Z8BA 3B94A 1APNA 4WM8B 5DZFA 4DS0A 1LOFA 4YGCA 5GKAC 2ZOEB 5K9YA 1GFF2 1VAVA 3WW3A 2PN5A 4L99A 1UPSA 1CVNA 3X29B 1IZ3A 5J37A 2JG8C 1RHI1 1OA3A 4DRVA 1WW6A 2VG9A 1OFSA 1PGW2 1X82A 5T55A 2DUOA 3MFCA 3KCCA 5GZFA 2EXIA 1PK6B 5DZEA 4YSFA 2XG3A 3CJIC 2H0BA 2XKPA 3H8UA 3QD6A 4R9AA 3UKNA 4U2AA 4RD7A 1QXPA 1MEC3 4WBBA 1HRI3 1S0BA 3FLPA 2W08A 1R093 1HRV3 3ETQA 3HR9A 1AX1A 3UK9A 4TZDA 3HQXA 1SBEA 2WS92 3CJXA 4IEQA 1PZ8A 2RMU2 2GH2A 4EJRA 4M00A 4YM0A 4HETA 2IFWA 1MEC1 4MGKE 4GH4B 4MV2A 2WNUC 1H0BA 3RNSA 1VAMA 4N53C 1HRI1 3ZXFA 3O12A 1R091 2VW2A 1HRV1 1AVBA 2KXLA 4OZXA 4AHYA 4BMEA 4OI2A 2X29A 4JGYB 3NV1A 4Q4V2 4JVAA 4JCKA 4FAHA 1V6MA 2X53S 5FFOC 5H9PA 3H1YA 3AJZA 2X5IA 4AGVA 2E63A 4XJAA 4QMAA 1U0AA 2W68A 5CVRA 5KC5A 4RS5A 4Z1VA 2XVKA 3GALA 3H50A 3DKWA 4ATFA 2R0FA 1RUD3 2P3IA 2DCKA 4R4XA 4I2OA 1XNKA 1NCRC 1R1ZA 3B9IA 2PA7A 2JENA 3O0WA 3H7YA 1W6QA 4R9BA 3R05A 5LRRA 2QZ2A 3KS7A 5LK5A 1EAH3 1WA4A 2VY0A 3JUUA 1OQEA 4N43C 4BLIA 4AHWA 3M2MA 2Y26A 1FNZA 1A8MA 1RUD1 1H9PA 2VUAA 4Q29A 4AFCA 2MEV2 1SACA 4FXKB 5CU1A 1DZTA 2H0VA 3H1MA 1VRH2 3UL2A 4AHXA 3WG4A 4XMAA 3ZMOA 4XQ4A 1D0HA 1DG6A 1EAH1 3BODA 1KD7A 3AZZA 1V6KA 2LM3A 1W6PA 4MGYE 2G9GA 4U36A 2XJTA 3SNMA 4BMBA 3ZXGA 1I3HA 3H3ZA 3TBDA 4AHZA 1AR93 1HV1A 4OHZA 3OD0A 2A73B 2DV9A 3IBMA 4WVVA 2NPIA 5T50A 1IQAA 5B2GB 1UIJA 2QVSB 4LE4A 1Z7S3 3WX5A 3ATGA 4KG0A 1AXYA 1NCRB 4MH0E 1HX6A 5A3MA 5FO9B 2X5IB 3RPQA 4J1WA 2ZCWA 2G4IA 1KJRA 4OLLA 1AR91 3DPRB 3P3NA 5GALA 1C57A 4RS5B 1YFXA 4LR4A 3MIBA 1JYCA 2D3PA 3U4XA 2HJIA 5T52A 1Z7S1 3WNXA 3B7MA 1AR72 2WNEA 4DPNA 3MZHA 1CPNA 2WNVC 4RHV2 4MZUA 1R1A3 1W6QB 4LBQA 1OA2A 1NCQC 1NY71 1YYNA 1ZX5A 2WQ4A 1QJX3 4W6WA 4Q26A 5EZWA 1WCDJ 1QU0A 5ABJC 3NWKA 1I5ZA 4D7SA 2ZHMA 3QLQA 3AZYA 3KT4A 2DTWA 4LTAA 1IS5A 3PVNA 5K0UC 1C1FA 1R1A1 2BNNA 3ZFGB 2GMPA 3HBZA 3IDEA 3WY6A 3WP5A 4N7IA 3PVEA 4KWLA 4RFT0 4A3XA 2GU9A 1DQ6A 1O3TA 4RL7A 1SBFA 4GB33 4IERA 4NHLA 1QJX1 4MSVA 5JIUA 2P3JA 3VDDA 4NR1A 1W6PB 2DCZA 1TNFA 4M0NA 4B4RA 4AYUA 4B8EA 2R6QA 5JZGC 4AEMA 4FPCA 2RS53 1VALA 3EO6A 3GYDA 4KGGA 1SLCA 1O4TA 1PHMA 2YYOA 4CP0A 1EP0A 3AXEA 2FBEA 3WHTA 2YY1A 4GB31 1WMEA 3KD4A 5DG2A 3ZO0B 2A3WA 3ES1A 2CYFA 3EQEA 4N7UA 4E2GA 3LOBA 5CG8A 3WINE 2HWF3 2RS51 1H9WA 2ARXA 1G8WA 4KWKA 4DNYA 1C5HA 2R072 3UJOA 1LHUA 3ILRA 1QHDA 1VBE2 1X36A 2O8QA 4CEYA 3N7KA 4Y26A 2HWE2 1UU6A 1VBC3 3I2DA 3VHOA 4Q4W3 1RUF3 1VBA2 1CD3G 3IM0A 2FZ1A 3LWCA 2QFEA 2ZX0A 2HWF1 2RR13 5FQ0A 2GSYA 2HEWF 4FVVA 3ZN6A 4QQLA 2LTNA 5I91A 4LHKA 4LBQB 2AGSA 1ZM1A 1O7FA 1V9U3 4KU7A 4LULA 4RGAA 3JB8A 1FV3A 2YC0A 1DDLA 4MUVA 5AVPA 1VBC1 1RJ8A 1NXMA 4Q4W1 1RUF1 3L2YA 4YW4A 1UL9A 4YZ1A 4B7KA 2O0OA 2VH9A 2NYYA 4LA3A 3RDIA 5BNOC 2RR11 4IV1B 4O9EA 4QT6A 1FX5A 3QOPA 3AX4A 1V9U1 1RMU3 1YXWA 2A71A 5E16A 4A2UA 4AQ2A 4Q8LA 4GALA 2HKXA 4AFAA 2A6WA 1Q8OA 3JCIA 2Z2SB 2DVFA 4D69A 4P9LA 2OZJA 2XHKA 3NV2A 4XDQA 2ZTNA 2XWJB 4GMP0 4WVWA 3VZMA 5JDBA 2JG9A 5FRAA 3VGIA