4LUKA

The crystal structure of the p132a, y133g mutant of pyrococcus furiosus phosphoglucose isomerase in complex with manganese and 5-phospho-d-arabinonate.
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
189
structure length
189
Chain Sequence
MYKEPFGVKVDFETGIIEGAKKSVRRLSDMEGYFVDERAWKELVEKEDPVVYEVYAVEQEEKEGDLNFATTVLYPGKVGKEFFFTKGHFHAKLDRAEVYVALKGKGGMLLQTPEGDAKWISMEPGTVVYVPAGWAHRTVNIGDEPFIFLAIYPADAGHDYGTIAEKGFSKIVIEENGEVKVVDNPRWKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Correlated mutation analysis as a tool for smart library design to improve protein performance.
rcsb
source organism Pyrococcus furiosus
molecule tags Isomerase
molecule keywords Glucose-6-phosphate isomerase
total genus 40
structure length 189
sequence length 189
ec nomenclature ec 5.3.1.9: Glucose-6-phosphate isomerase.
pdb deposition date 2013-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06560 GPI Glucose-6-phosphate isomerase (GPI)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4lukA00
4EWDA 4AQ2A 3EJKA 1IPJA 2D40A 3NKTA 2IXHA 1VJ2A 1WLTA 5T3NA 4AXOA 1X8MA 2K9ZA 2PAEA 5JSOA 4BH9A 1NXMA 3BCWA 5I0TA 2Q30A 3KGLA 4O9EA 3USSA 3VHRA 1DGWA 4YARA 2CV6A 4XFHA 2H6BA 3D0JA 4IERA 4KL1A 5C8WA 1OMIA 2XL7A 2C0ZA 3LA7A 2Z69A 1PMIA 4HZFA 3TNQA 4BYYA 1ZZ7A 1L3JA 4YRDA 1CAXA 1UCXA 5LRRA 3NW4A 2K0GA 4META 3ES4A 2IC1A 5I93A 4QM9A 1CAVB 1ZX5A 3ETQA 4HN0A 1RC6A 2PFWA 3EHKA 1X8EA 2GH2A 2O8QA 2IXKA 3SCHA 4PIZA 4IEYA 3KGZA 4MUVA 5JSPA 1ZRDA 4Q0QA 4YNIA 1OI6A 3ZDSA 3E5XA 4JV4A 1OD5A 4QGMA 3QOPA 1I5ZA 3H3ZA 3I59A 1QWRA 4XEZA 1ZRFA 3EO6A 4LEJA 4B29A 3SCGA 3S0MA 3LWCA 4IEUA 4UXAA 4TLFA 2Z2SB 4IETA 4YYOA 5I0RA 1CGPA 3CJXA 2CAVA 3FX3A 3KMHA 1CX4A 4IEVA 2UYBA 4HVQA 4QX5A 2PAKA 3LA3A 5BY5A 1YFWA 4XFBA 5C6CA 4IEZA 5FLJA 1ZZ6A 4BHPA 3BPZA 3G7DA 4HVRA 3S7IA 4YSFA 4KWJA 4R8HA 1EP0A 5I8TA 3PLQA 1U12A 1ZRCA 5CVRA 3JZVA 3E6BA 4X6RB 2F4PA 2ZKLA 4XFCA 5E16A 5BUVA 3RYPA 1J58A 3LAGA 4QGNA 2XHKA 3D82A 2PTMA 5FQ0A 1VR3A 2OZ6A 4Q0UA 4MH0E 2OPKA 4LTAA 2GC1A 2MHFA 3H7YA 3KSCA 3B02A 1Y9QA 1CAWA 2BNMA 3ROUA 3H8UA 4QM8A 1GQGA 3BU7A 2XKOA 2QVSB 2D5HA 2EAAA 5I0SA 3SMHA 1ZZCA 5CU1A 1CAUB 3H1MA 4P9GA 2XGXA 5KHIA 1NYWA 4MGZE 2H6CA 3HIFA 2IXIA 5FLIA 4J1XA 4EV0A 2Q0AA 2QJVA 1CAWB 5BPXA 1O7FA 1QXJA 3IDBB 5I8YA 4Q0PA 2WC2A 3RNSA 1Q3EA 3NVCA 3U0ZA 3H1YA 3HT2A 4EWEA 3E97A 5FCCA 4LUKA 4Q0SA 3CLPA 2GC0A 4E2GA 3KCCA 3HQXA 3WW1A 1ZREA 1ZZ8A 5LEKA 1Y3TA 1DZRA 2O1QA 1XE8A 4XFIA 4X6QB 3WW3A 4XFFA 1ZZBA 3L2HA 3FZ3A 4IEOA 1G6NA 1VP6A 4ZU5A 3EBRA 4FAHA 4Q29A 3GBFA 3H50A 2MNGA 1O3QA 3ACLA 5BV6A 4MGYE 3WW4A 4BIFA 3S7EA 4ORFA 2QDRA 4HLTA 5KHJA 1TQ5A 2OYZA 1YFXA 2FQPA 3M70A 4E2SA 2XLFA 4E2QA 2IXCA 1WA4A 4QMAA 3U11A 5HI0A 2Y0OA 3ST7A 1O3RA 2BNNA 2B8MA 1Q5OA 1X7NA 3DL3A 5LRSA 4D7TA 4FBFA 1EYBA 4XF0A 5FQ0B 5I91A 5I8SA 4N9IA 1ZNPA 1CAVA 2HKXA 4WVZA 3M3IA 5KHKA 2D93A 4N9HA 2FMYA 4XFGA 2VQAA 4ZU7A 2Q1ZB 3LOIA 3SXWA 4JTNA 3FWEA 1UW8A 3EQEA 3E5QA 2GU9A 1RGSA 4ONUA 4LA3A 1EY2A 5J3UA 2EVXA 2XL9A 4MV2A 2ETEA 4UBHA 2V09A 2E9QA 4AVAA 3H3UA 4HN1A 2UY8A 2OA2A 3H1WA 5FPZA 3NL1A 4KU8A 4WZCA 3MDPA 5J48A 4IEXA 1FXZA 5CADA 1RUNA 2WFPA 2BGCA 4Z07A 1H1IA 1XRUA 5D1IA 4CYDA 3OTFA 1J3PA 2PAMA 4KWLA 4J1WA 4JVAA 1YUDA 4RD7A 1CAUA 4O9GA 2PA7A 2PQQA 3DV8A 4L2NA 2QCSB 2B9UA 1UD1A 5BXXA 3NJZA 4XETA 2DCTA 3FE5A 2XLAA 1SFNA 2H0VA 4MX3A 1RTVA 5FPXA 2GAUA 2CAUA 1EPZA 3U10A 4I0AA 4DINB 1RUOA 3GYDA 3MPBA 1I6XA 2VECA 4HSJA 1J59A 2OZJA 2Q4SA 4R52A 3LA2A 3UKNA 2KXLA 2ET7A 4K8FA 3BALA 1UIJA 2CGPA 4F7ZA 3SCFA 3MZHA 3OD0A 5EFUA 2D5FA 1O5UA 2XLGA 3FJSA 5KHHA 1LKNA 5JSRA 1ZZ9A 2QNKA 3CEWA 3I7DA 2IXLA 3C3VA 3R6SA 2UYAA 4UBGA 4GULA 4MGIE 3N4MA 1JUHA 5K8SA 4EWAA 3NSTA 2BYVE 1O3SA 3HT1A 3UKTA 4EROA 3RDIA 1LRHA 4NVPA 2HJIA 1ZRRA 3SHRA 4L11A 4LUMA 3I54A 3H7JA 4PJYA 4A2UA 4QGLA 1QY4A 5AVPA 1YHFA 2PHDA 5JR7B 2BEOA 2BNOA 4IEPA 2GZWA 4XF1A 2MPFA 5E1RA 4XF9A 2PHLA 1DZTA 3I59B 3DKWA 4PIYA 5J7MA 3UKVA 3E6CC 4H7LA 4LULA 4HSLA 1YLLA 3FFQA 2ZCWA 1UIKA 4I09A 2B5HA 5F1RA 2EA7A 2VPVA 2ET1A 4KU7A 5JAXA 1HW5A 3D0SA 1QXRA 3OCPA 2I45A 3MYXA 4Q0VA 1FI2A 4Z82A 3RYRA 4IEQA 4JTOA 1OFNA 4I02A 4KWKA 3ELNA 1SEFA 4HBNA 4ZU4A 4AQ6A 4HMZA 5FLHA 3QACA 1LR5A 3OGJA 4HVOA 4IESA 4XF3A 4OLLA 4FAGA 3OF1A 1V70A 4I2OA 4IEWA 3O14A 4AVCA 1GQHA 3LZZA 3E5UA 2PYTA 4XF4A 1Q43A 4F8AA 2ATFA 3CF6E 3PNAA 1J1LA 1YFUA 2GC3A 4OFGA 4D7SA 5FDBA 5EZWA 1IPKA 1CAXB 1LB2A 3IIAA 1WGPA 4MGKE 3RPQA 1FT9A 4PIXA 1X82A 4I0BA 4I3PA 2N7GA 4QXKA 3ES1A 5JCTA 3TNPB 1RL3A 2IXJA 5KBFA 4FT8A 3IBMA 1YFYA 1J3QA 1UPIA 1ZVFA 3CO2A 3H9AA 3DN7A 1NZCA 3E6DA 5KHGA 1PM7A 3IWZA 1O5LA 1NE4A 4MZUA 4I01A 1YWKA 3RYKA 4AVBA 2P17A 3RZZA 1DGRA 4LLOA 1J3RA 3PVBB 1SQ4A 5I0UA 4WBBA 1O3TA 3FHIB 3BB6A 4LA2A 2XKPA 1XE7A 3WW2A 2UY9A 2GC2A 1O4TA 1H1MA 1NE6A 5LEJA 3IDCB 3CL1A 4XFAA
chains in the Genus database with same CATH superfamily
4EN9B 4AQ2A 1IPJA 1C8M2 2J7MA 4XQ4A 1QOSA 3ZXGA 2A3WA 3GZTB 4ZZ5A 4N7UA 5ABJC 5C8CA 1VJ2A 1PO11 2NQYA 2VM9A 4GIQA 1G9DA 3BCWA 2WUHA 1LTEA 3S30A 3WDTA 1W6MB 2R0FA 3MIEA 4N43B 5DG2A 5IJRA 4AEJA 1F2NA 4COZA 4FPYA 4CEWB 1N3PA 1VAKA 2DDUA 2HBUA 4AI2A 2DV9A 5FXXA 4KL1A 5LB6A 4C0BA 3S57A 3ATGA 2RMU1 3I8TA 2VNOA 2EIEA 3I3BA 1PGSA 2Z79A 4SBVA 4YVWC 3TNQA 1NCQA 3APBA 1LOAA 3WNNA 1LHOA 1ZZ7A 1OC1A 2BW8A 2FCVA 5EP9A 1POQA 4SLIA 1EV13 4Y1ZA 4BQ4A 5FZDA 1UCXA 5LRRA 3PJYA 3ES4A 2IC1A 3AYAA 2IUWA 2W87A 5T5OA 2UURA 4QM9A 4C0HA 1CAVB 2AH2A 2CWSA 2K46A 1RC6A 2VTFA 2D6PA 1IGOA 2PFWA 3WW3A 3WP3A 4CDQA 1PIV2 3FLTA 1AYN3 4AVVA 3ZO0B 1IKQA 2BERA 4AI9A 1BYHA 5FP7A 4C8DA 1OKQA 5FY9A 1XNTA 4RN5A 1KJLA 1AJOA 3VBSC 2QQIA 3E5XA 5DG1A 5A3MA 4JV4A 4QPGB 1SPPA 4GMP3 4QGMA 1BBT1 4FSJA 4MXWB 3I59A 3ZR6A 3B9IA 1QWRA 3GBGA 1QJU3 4CEYB 2ZEYA 4XEZA 5IVVA 3VBHC 4LEJA 2WZEA 3RI9A 2ZGLA 3SCGA 3WQBA 4B29A 5A1LA 3O1RA 1NLQA 3WNMA 2D6NA 2ZACA 3THDA 5FYTA 5FYCA 2ES3A 3IM0A 4QKDA 5FMBA 2QFEA 4S2FA 1W8WA 3FX3A 4OHWA 3GZUC 3FHAA 1HIXA 2WJSA 4P00B 2YYOA 4N8MA 5FYUA 3BKZA 2MEV2 1FMD2 1W99A 2PAKA 3LA3A 3N9QA 1GWLA 1DG6A 4IEZA 4XFBA 5FTTC 5C6CA 2VUCA 1ZZ6A 2AZ5A 2A6WA 2ZKNA 5FZ0A 2JICA 4HVRA 2DFCA 1YQ8A 4NRQA 1HX6A 3MIDA 1RVF2 1S0GA 4R8HA 5CB7A 3MLLA 4XJZA 4Z8BA 2W68A 3B01A 4DUWA 4UW3A 1U12A 4FFGA 2WS92 3JQXA 5EJZB 1YRZA 2ORXA 1NG0A 4XVHA 4XZUG 1ZA4A 3E6BA 4DY3A 2OUJA 3N9PA 3OUHA 3UYJA 4DXRA 5HV4A 2JEMA 5E16A 1SG3A 1CZSA 4I0WB 4AVTA 5BUVA 3R0RA 4Q4X3 5FBJA 5LK7B 5I0DA 5K7PA 2CTVA 1KS4A 4KQ7A 1VR3A 2WNUA 3POJA 3WLUA 1QQP3 1VRBA 4QHOA 1NCRA 3URFA 5KXEA 4LTAA 2GMPA 2MHFA 3D5OA 4CXXA 2VY0A 1Z0HA 1Y9GA 3B5LB 5JDBA 3MBWA 4BLJA 1JYIA 3V0BA 2BNMA 2XWJB 4QXBA 5FZ6A 4YG3A 3VBRA 4XOGA 2PHUA 3BU7A 2VMHA 4Z2WA 3VHPA 4QB2A 3T2OA 4KBZA 5I0SA 4LPLA 1D0HA 5DAVA 3T2PA 3NNLA 2BTVC 1E57A 1GFF2 4P9GA 2UWBA 1NYWA 2QQOA 4E27A 4BZ4A 2WFF3 2VZOA 5FBZA 1O6UA 4JQRA 5FLIA 2ZPXA 3ZR5A 2FDJA 5A32A 4YW3A 1AHSA 2OT7A 1LHWA 2QJVA 1CAWB 3ECQA 4DZGA 1O8PA 1QH7A 3O5SA 3FN9A 4M01A 1QXJA 4XCAA 2A3XA 1ZM1A 4RFT0 4XABA 1ODNA 1MS3A 5BNOC 4GJZA 3NVCA 4MG2A 1BVP1 1JS9A 1R091 2XJPA 3GCXA 1UU4A 4FPLA 5D21A 5DAWA 5DUVA 1BZWA 1R082 3TEYA 1YNAA 5A6XA 1A6CA 1BKZA 1CN1A 2HEVF 2PXJA 2EIBA 1ASJ3 4V2VA 2GN3A 1XE8A 2W2IA 2ZZQA 3CBNA 2HWE3 3CJIA 3QBQA 1AF9A 1PO22 2J1SA 2VE1A 1HB2A 2VZTA 1GQPA 1VLNA 1ZZBA 3DXUA 1AX1A 2Z5WA 4D94A 1OA3A 4ZU5A 1N3QA 2VMDA 1RUI1 4Q29A 3FHQA 2XPJA 2DUQA 2YGMA 2WFF2 1H2NA 1JZ7A 4W4ZA 4AGRA 1DQ4A 1WZXA 1QXPA 1BXHA 2K2SA 3R05A 1DU3D 4U2AA 5JZGB 2QQVA 3ZPOA 1MZEA 4BMBA 5JVVA 5A6ZA 4UF0A 2ZGKA 3KV4A 5FWJA 4BIFA 2A70A 3V65A 1QJY3 4PLOA 1N1VA 1POV1 1UMHA 2QDRA 4UI9L 4DRVA 1OBNA 5KHJA 2OYZA 2LM3A 1FX5A 1FYUA 4RGAA 1MACA 4B7EA 1POV3 3WDXA 1QJY1 5CIRA 2A5ZA 1YCIA 2IFRA 2XLFA 3DGTA 4E2QA 1OOPA 2IXCA 4R4ZA 4NWWA 3ZYRA 1K5MA 1W8HA 3U11A 4UFLA 4H14A 4NPLA 5IAXA 2Y0OA 4A6OA 4LE3A 2WNVA 1KJRA 1JHJA 2ZGMA 2B8MA 1JUIA 1OA2A 1C4RA 1X7NA 3U14A 1ND2A 1EYBA 4QQ2A 5I91A 5I8SA 1CIWA 3AK0A 5DXDA 1PO12 1VIWB 5T5LA 3ACFA 1UOBA 5HV0A 5C5UA 3I2FA 3WNOA 1AR92 3MUY1 1AUYA 3HNBM 4Q4V3 3B00A 3KT1A 4LHLA 4QPIA 4UW4A 2VTXJ 3DYMA 1H9PA 2RS11 1OH4A 2JDNA 4GKXA 4XFGA 4QQPA 1L7LA 4NIAA 1UU5A 1SLBA 3LFMA 2G1MA 5JI7A 4JGZA 4PDWA 3GNEA 4FI9A 2D3RA 1CZVA 2FHRA 2VQTA 3KV5A 2VZ1A 1ULCA 3PVOA 3E5QA 1YQCA 3THCA 1XU2A 4IE4A 5D8AB 1EY2A 4JDMA 4Q1RA 4MV2A 1CPMA 2ETEA 1G86A 2V09A 4XBNA 2P3YA 4BLIA 3ZXDA 1WMDA 1AR63 3RZGA 4FTBA 4HN1A 1VBC2 2UY8A 2OA2A 2WRAA 3H1WA 3KHCA 1V6IA 2ZEZA 5KC6A 1ALYA 1S0IA 1TMF2 1H2KA 1UX6A 4IEXA 2WFF1 5CADA 2DUOA 1RUNA 5FZ8A 1HKDA 3AMMA 3BVCA 3RGBA 4KMQA 2WFPA 3HBKA 4HETA 1VBC1 2BGCA 4C90A 3QH7A 5KC5A 4NHYA 2DURA 4FFHA 1XRUA 1LODA 5EHDA 4HANA 4CYDA 2GNBA 1J3PA 3ACHA 1ZBA1 3T0BA 4XMIA 4J1WA 1XNKA 1O59A 4M3CA 4RD7A 1CONA 2FDHA 1JZ5A 5FRAA 4HFSA 4XXAA 2Z4FA 3N3HA 2QQWA 1VMFA 4FFFA 3VKOA 2JKBA 2PA7A 3WX5A 2QCSB 1NLSA 3N7MA 2B9UA 3AL6A 2HWD3 3C8XA 2AR6A 2ZS6B 5BXXA 5A6QA 1AYM2 4DO0A 2GALA 4ZS3A 2IVJA 1RIRA 1VRH3 3CZUA 1SFNA 3LE0A 2HWB2 1RTVA 4CDXC 1G8WA 4GH4B 2ADDA 3U10A 1EPZA 2AACA 2LS6A 1GWKA 1VAMA 4Z92B 5C70A 3ZYJB 3RWKX 4YW4A 1I6XA 1F35A 3N7LA 4CDUA 2AEZA 1YI7A 3MFCA 1W2TA 2VECA 2RS53 3T1MA 5GM0A 4FFIA 3C7OA 5IATA 3IKWA 2W39A 4A3ZA 2YUEA 3ETPA 3ILFA 4LKEA 4ES8A 3LA2A 4RS5A 3UJQA 1COV1 2ET7A 4ARYA 2O0OA 3NJVA 4NIGA 4BQ3A 1JYVA 3HN1A 4FCAA 4EN7B 2RG4A 2VCMA 5A7WB 2WNEA 3ZYGA 5JUVA 2NN8A 4V1PA 3MF9A 1RVF1 1W8UA 1JZ8A 3BIEA 2ZAAA 5JSRA 2HBTA 2QNKA 3BUCA 3CU7A 3I7DA 1H0BA 4QX7A 2IXLA 2D3SA 2YROA 4XW3A 2PELA 2W1UA 4CU7A 4Q5OA 1O3SA 1JU3A 4EWAA 3BOPA 2YBKA 1BMV1 4NVPA 5L9VA 2E33A 2HH9A 4R4XA 4AQSA 2RR13 5A1FA 4XUQA 5F9TA 3I54A 2E53A 1LEMA 2TNFA 2C1FA 1H2LA 3WXPA 2VNRA 4AFDA 3AJZA 1C5IA 1RUH1 3E1F1 1CR7A 4M0HA 4B1MA 1NY72 4XF1A 2MPFA 4DQAA 4HL0A 5E1RA 4HT1T 5GJ6A 4E4SA 1DZQA 2HWD1 4LKSA 3DKWA 4RGGA 3Q8BA 3KCYA 2WZR3 1B35A 4DIQA 5JOZA 3INAA 1LCLA 3I49A 1W8NA 4LKDA 2O14A 3SKJE 4D6RA 2B4KA 3ZOIA 4CVUA 2GP5A 5C3QA 5L36A 1JZ2A 2ZGRA 3WG2A 1DF0A 1MEC1 1XPWA 4H55A 1EUUA 2HWB3 1FPN1 1REFA 1WW5A 4N53A 1WD3A 4B8EA 5JAXA 1RITA 3D0SA 2PHWA 1LECA 2WKKA 3OCPA 1DQ2A 3VUOA 3JQWA 2R7EB 4WM8B 3RYRA 1REEA 2V5YA 2YZ4A 3TAYA 3H42B 4TXWA 4CTEA 5F3CA 4CDUC 3N9MA 1KDKA 1H30A 1LHNA 1SEFA 4IDZA 4HMZA 5EV7A 4NR1A 5CG8A 2R0HA 4QKNA 3W5MA 3PVEA 4HVOA 5DUWA 2NP0A 4LO4B 3AB0A 1REDA 4OLLA 5FPVA 4QU1A 2X10A 1LU1A 5CAZA 1FMD3 1MS8A 3VKLA 5FR3A 1YIFA 4XQWA 3RVHA 5IK7A 1H4GA 4IW3A 4L92A 2VOVA 3AJYA 3KV6A 3O14A 4QX8A 1GQHA 4QB6A 3OBTA 4F8AA 1Q43A 4K21A 3LOBA 1K42A 3ZX7A 1WMXA 5FWEA 1XSRA 1IPKA 1XXNA 5FKBA 2GNMA 1SDWA 2DF7A 1WGPA 4MGKE 3I3QA 4WV8A 5BNOB 1OHFA 1LULA 1W6NB 2JD9A 1EAH2 1H8TC 1X82A 2ZMLA 4I3PA 2XDVA 1RUH3 4NHMA 3OPTA 2Y33A 2BQPA 5IVCA 5JCTA 1RL3A 4TWTA 2IXJA 3VZLA 2VQUA 5FZHA 1W6OA 1QH6A 2PMWB 2W5FA 2VBPA 1R092 2FDIA 4FQZA 4NIHA 2EF6A 3CO2A 3ZYPA 3H9AA 4NRPA 3VBFA 4AFCA 2VXJA 3DN7A 5EIYB 2JKXA 1X9TA 1RUG3 3FLRA 4QWNA 2ARBA 2BBVA 1W6PB 2XJTA 4N53B 3NO8A 4MOAA 1AYN2 5C9AC 3WQ7A 1O5LA 3ZM8A 4MZUA 3OYWB 4XAAA 4P14A 5JZGA 2W0XA 5G04L 2E31A 2B42B 3HQRA 3MIBA 5A3WA 5GZGA 4OUMA 2BU9A 1URXA 2P37A 3IMMA 1Y43B 4NIIA 4ATEA 2XVKA 2ZX4A 5C71A 4L99A 3PVBB 3O1UA 4WBBA 4P08A 4YW5A 2ILMA 2VBBA 3BN6A 4LOSA 1HXS3 5CKQA 2XKPA 3NV1A 1LOFA 2RS51 4BM8A 1XE7A 4UFKA 1ODMA 3WT3A 4GWNA 4KG0A 5JXGA 1VBB3 5A33A 1OFSA 2VW0A 1O4TA 3ZFGA 2ZBJA 4UFJA 4WVVA 2D97A 4GWMA 4LHNA 1A3KA 1LOBA 4XFAA 4BK5A 1NCRB 5FK7A 4EWDA 3OG2A 3ZIXA 3S5AA 1VMJA 3B7MA 2D40A 4YGEA 5KR7A 1LGCA 1MQTC 2IXHA 3M3OA 1WLTA 5EQUA 5T3NA 3VBHB 3WF0A 3WR0A 1X8MA 3ZXJA 2R041 4DEVA 1N1YA 1W03A 1NXMA 1JXNA 4WM7A 4D8MA 4X8NA 3WG1A 4A45A 3RZHA 5I0TA 2EIGA 2Q30A 4O9EA 1DGWX 1JOPA 1Q8QA 4LIVA 3USSA 1DQ1A 1UY2A 1XNDA 2HEWF 1DGWA 4YARA 2CV6A 1EPWA 3IPVB 3O1MA 3NKGA 1WUVA 2YMZA 3ME2A 3OSDA 1OQDA 2JDYA 3K2OA 2XL7A 2Y6GA 2C0ZA 1HRI3 3LA7A 4MGTA 2JE7A 2J1VA 2X5IC 1XYOA 4HZFA 1GKBA 2RR12 5FP8A 2A7AA 1H4HA 3RZKA 1MPXA 4OYUA 4W65A 1L3JA 5SV5A 4WM7C 3ZSEA 5BNNB 4YG6A 3C7FA 3IT8A 3WSOA 2CGOA 3NW4A 4OMDA 1MR5A 3LDKA 4XILA 4CDUB 2W91A 1NA1B 3PU8A 4X6QB 1UF2C 4AEDB 2BV4A 3O0WA 4UFIA 4BQWA 1DQ0A 2O8QA 4WM8C 3A7QA 4PF5A 3SCHA 4PIZA 1J84A 4EZ4A 5JSPA 5ACA3 1MS9A 1ZRDA 2JE9A 1SBDA 4Q0QA 4HKLA 2ENRA 1W6NA 3AZWA 4PI2A 3EB7A 1S0DA 3LIHA 1OD5A 2RS13 4N43C 3WP4A 1PHMA 3ZYHA 3NNMA 4H2AA 4I3GA 1PGL2 3ZVXA 1Z7S1 3ZN5A 1AR93 1IG3A 1YI9A 2MEV1 1JZ4A 1UPSA 3ZLIA 1TZOA 4D0QA 3RRDA 2XR4A 4AEMA 2PHFA 4FOQA 5FK8A 5C9AA 1DGRN 1QDOA 3T09A 4TLFA 4YYOA 2OPWA 2P3KA 2Y34A 4W6XA 3CJXA 1V00A 1YEWA 3BTAA 4XHXA 4YW7A 2DU0A 5LY2A 2CY6A 2OS2A 4JDOA 5L9RA 4DEQA 5FMOS 4MGQA 1IS3A 2R072 4OCTA 4OQ8A 4A4AA 2R49A 3HNMA 3MUZ1 4YGDA 5BY5A 2DTYA 2O8OA 1WBFA 5FLJA 4OUSA 4CP9B 1W6OB 4BHPA 1OPOA 3UT0A 3G7DA 2UWAA 1WCUA 3S7IA 4EQVA 4Z2AA 4NN0A 4M4RA 2CWMA 2HLEA 1K5MB 2WYSA 5HCFA 1H8TB 5L9BA 5F37A 2R30A 2YBSA 4AE2A 5JMOA 3JZVA 3ENRA 4LBOA 3G6JB 3ZXKA 5F7UA 4Q8KA 5FZ9A 4F3JA 1ND2B 4PQQA 1RUF2 4XFCA 1GLHA 1PVC2 1F31A 3U37A 3AFKA 1NOVA 5FZOB 4Q4V1 4AW7A 3GZAA 4XTMA 1F15A 2XHKA 3OD4A 1PZ7A 2PTMA 2RDRA 4YW6A 4E9KA 4OULA 4PBPA 1B35B 4Q0UA 4KWUA 3KSCA 4YFWA 2G19A 3MHZA 5A70A 3AMPA 1SLTA 1SACA 3ZSJA 4XURA 1GWMA 3VZNA 4ZXKA 5C4WB 3CMGA 2QVSB 2RDSA 2E51A 2EAAA 4OI2A 1NCQC 4Y4RA 4OMCA 1ZZCA 2BOJA 2WR9A 3T3YA 1CAUB 4QKBA 3H1MA 2GSYA 3VDDB 1UY0A 2XGXA 5KHIA 1OLQA 1S4CA 2XWBB 4G4FA 4YVSB 3VHOA 3HIFA 3J7MA 4INDA 2V73A 1VALA 2EXJA 3OBZA 5A1AA 4OZOA 5DDJ2 5FPUA 2VQ0A 5FPLA 2WIIB 2Y26A 4K40A 1O7FA 2GNTA 2RJLA 1VE0A 2OIIA 1UY1A 4MSVA 1RYYA 3KCXA 4AHYA 3OY8A 1SFPA 5I8YA 5C3PA 1UMIA 5JOWA 2R32A 3A21A 2ZGSA 3ZN6A 2VVDA 3KB5A 4ASLA 3HQUA 3E97A 5ABJA 5C8CC 3NWKA 5F3GA 1GMMA 5FZGA 3WNLA 5KXDA 3RFRA 4LUKA 4Q0SA 5LATA 2VNGA 1QIQA 3CLPA 3VD3A 4C1WA 2YXSA 5LA0A 3BI3A 1RUE3 3AKTA 1VBE3 3EYPA 3HQXA 1VBE2 3TBDA 5GKAC 4P02B 1Y3TA 1MEC3 1JYWA 1W9SA 4QQHA 2ZHNA 3AKPA 2VCCA 1H8TA 1LHVA 4RHV1 1SLAA 3LCPA 1E5SA 2WLQA 1NT0A 3NNJA 1HB1A 3L2HA 5GALA 3SH3A 3VD7A 1YJLA 5LBBA 2RS32 2CDOA 3B69A 5F39A 4FAHA 5ACA1 2XJUA 5JXJA 1JZ3A 3WUDA 4Q4V2 1AR83 1C8M1 1XC6A 3ACLA 3M7AA 2FZ1A 4IV3A 1VAVA 2DVAA 4MGYE 2VG9A 1PO21 1TG7A 1TME1 1A8DA 5T50A 5H9SA 3JD71 1VBA2 2QQKA 5A32B 2YPDA 4GMP0 4HLTA 1F4HA 1TQ5A 2J1RA 2XBO1 2X09A 1UXZA 4P5HA 2YFZA 3PMSA 3KF3A 5JOXA 4CDWA 3PUAA 5DAQA 2BOIA 4L9BA 5FZKA 4E2SA 4K7JA 3WDUA 1ENQA 5FY4A 2JG8C 3KHBA 2C9KA 3BOWA 4CCCA 1WA4A 1MS0A 4QMAA 1W3VA 2JDZA 1RVF3 1W05A 3K4AA 2EAKA 4LNVA 3ST7A 1W39A 3AXEA 2WT1A 1TMF1 4Y24A 5IVYA 3VDCA 5F6LB 1RJ7A 5JI9A 3ZKUA 5IT6A 5CA6A 4ITCA 4JGYA 3D4KA 4P9IA 5LRSA 2BJSA 1PVC3 2CU5A 1QQP1 3DPRA 4AEDA 2EXIA 1ZNPA 2NYYA 4DUXA 3ITQA 2JDKA 3WOGA 4XAEA 5KHKA 4GKYA 1OF3A 3N36A 1Q8PA 4QXCA 2RDNA 1IOAA 4ZU7A 2VQAA 4EN6B 3FUQA 4Q26A 1W8OA 1R1A1 1XNAA 3LOIA 4K6BA 1U0AA 3OUJA 3M2MA 2XUMA 1HQWA 5FJKA 5D2AA 3DCQA 2GU9A 5DAXA 2RHPA 3WHUA 1I1EA 1XNBA 1KFUL 1SPPB 2D6OX 2XL9A 2LUWA 4LO6B 5IW0A 4FPFA 2VD7A 4QX2A 4AHXA 4AGGA 1SZBA 4AVAA 5H9RA 5JMCA 4LJHA 2EICA 4NIDA 3UV9A 2ZXQA 4R9CA 1H1AA 4KU8A 4RS5C 4QQLA 4CCDA 4AGVA 3RZLA 4WZCA 3MDPA 4OHXA 4JHTA 1GNYA 5JXIA 1D2QA 1WBLA 4ZHNA 4QX0A 4OQ9A 2YG0A 2WO1A 4FXGB 5APAA 4MXWA 4N53C 3D6EA 3PUSA 4OVEA 5FIXA 2RV9A 2BWCA 2NPIA 2SBAA 4BJ0A 4Y22A 5D1IA 1HJGA 1EV12 5FREA 2PAMA 1LESA 1X36A 3HJRA 4KWLA 5ANNA 2JG9C 4NHXA 1YUDA 2X5IB 3AX4A 2DBIA 3GJBA 3J8F1 3MF6A 3UGHA 1PNFA 2V5DA 3KLSA 3KT4A 3SEEA 1OD3A 3QLQA 5C3RA 3W21A 3NJZA 4XETA 2BGOA 5FUPA 3VZMA 4E8CA 3SEPA 1RUI2 4M4PA 2XLAA 5FYBA 1UY3A 1RHI3 4MX3A 5FPXA 3QCWA 1M06G 1ND2C 2ORZA 2GAUA 1AR72 4DINB 2ZHKA 4I0AA 4Y1VA 3GYDA 1RUOA 3MPBA 1YO8A 5HCHA 1WCSA 4Q4Y3 5BNNC 4A7ZA 3CJIB 2WNVC 5SV8A 1KD7A 1US3A 4W50A 1QJFA 1ULEA 2Q4SA 3QD6A 1GP4A 4XDQA 1X50A 3VBFB 2Q8CA 3UKNA 1RUF1 1S0BA 2JG8A 4LBJA 3AKRA 1UIJA 5DPNA 1VBD3 2PLV2 2ZEXA 3OGRA 3PVNA 1WA6X 4R9DA 3KVAA 1GOGA 3OD0A 5JIUA 4M0NA 2DBNA 1O5UA 2XLGA 5FZLA 3CKHA 1LKNA 4ZXEA 5A3OA 5GLWA 1NUKA 3CEWA 3JCIA 3NJYA 2VMIA 4XIKA 3PTRB 5AFEA 4JGYC 3C3VA 2ZEWA 5JOYA 3R6SA 1DYOA 1GNZA 1W6MA 2UYAA 4LITA 4GULA 3F2ZA 5FOBB 2Y6LA 4BCUA 1WW4A 3V56A 4Y4YA 3UKTA 3RDIA 2G4IA 2HJIA 5C8CB 1ZRRA 3N7KA 5JWPA 3V0AA 1E5IA 3RZJA 1LAJA 2R063 4PJYA 3H7JA 4Y20A 4J6GA 3WINE 1KS5A 2RM21 1TEIA 2HWB1 1HXS2 3POIA 5BNPA 2BEOA 2BNOA 4IEPA 4B3NA 4CCKA 1RHI1 3O1TA 2GMMA 4XQDA 3MLKA 3H8XA 3UESA 2DUPA 4NPRA 2CHHA 4WZFA 4XF9A 1DZTA 1ACCA 4ARXA 3I2IA 2WN3A 1S2KA 5F2SA 3AP9A 3J8F3 2VZQA 3HEIA 1MZ5A 3O1PA 4OI0A 3HN3A 1JYXA 2E26A 2GN7A 4Q4X1 1UU6A 1DBNA 4Q8LA 5C4WC 3VL8A 1VB2A 3HOBA 3NAPB 3P3NA 1IPSA 2EIDA 3PURA 5JIAA 1W9TA 1XSQA 1U5YA 4QU2A 4AI3A 2B46X 4NAOA 3J9SA 3RG0A 4FTEA 1IHMA 1UNBA 1TNFA 2VULA 1GOFA 3MYXA 1PK6C 3FBYA 1FI2A 1O4YA 4O61A 4Q0VA 3TN91 4Z82A 3I3MA 3EXUA 1KFXL 1OFNA 4I02A 3R4UA 4UW6A 1HRI2 5BNQA 4LORA 1Y7BA 4XUPA 4KWKA 2QQMA 5HCAA 3TYJA 3ELNA 2DVBA 4HBNA 4ZU4A 1SCRA 4AQ6A 2DYCA 5FXVA 2DCJA 2JDUA 2XONA 5H9PA 4NMIA 3CJIC 4IESA 1QJY2 4P9XA 4QHBA 3PUIA 3A4UA 4AR2A 4E4ZA 3GALA 3HR9A 4RHV2 2QUOA 3FL7A 2Y6FA 3RI8A 4YVWB 1S1AA 5G05L 4M3CE 1QJX2 1VMHA 5AVAA 4O65A 2B45X 1X33A 1NZIA 3ZSMA 1R1A3 2HYKA 2W1WA 1RUE2 1UX7A 2XXZA 5LA2A 3ZYIB 1DQ6A 2PYTA 3E5UA 4Q4W3 2ATFA 1UN1A 3PNAA 1FPN2 4QAWA 1ULPA 1VBB1 1AYM3 1W8TA 1YFUA 2WT0A 5LY1A 3ILNA 3WDWA 1V6JA 3I2HA 3GGLA 2VVEA 5LK5A 2HWE2 5DUXA 4S2DA 2VMFA 1ZYBA 1Q8OA 1R081 2VUAA 1VRH1 4PIXA 1IZ3A 3ES1A 1JU4A 4JGZB 4PDWB 2W47A 1IQDC 3VDBA 4IL7A 5IK5A 4P9JA 2VC9A 4PBOA 3TNPB 1QQP2 1WW7A 5FY1A 3VBUC 4IUGA 4FT8A 4LBKA 3U1XA 3NNFA 5FXWA 2JJ6A 1YYNA 1UPIA 1RINA 1RUG1 3VBRC 2PQSA 3OBAA 4PT6A 1ZVFA 3NAPA 2DCKA 5FZ4A 5L19A 1BMV2 1V9U1 2BRTA 4CUBA 2ZHMA 1SLIA 2VGDA 2VO5A 3R4SA 4AZZA 4E8DA 1TME3 2VOWA 3JBG1 3IWZA 2YGLA 1V6KA 3OGVA 3DKQA 4I01A 4V2WA 1YWKA 2W52A 5B4XA 2W94A 4IV1C 3LD8A 3AYDA 3Q8CA 5FP4A 2A75A 4AVBA 1NA1C 4B4QA 4FPJA 2VH9A 3PJQA 3POBA 5A7QA 3GM8A 1H8VA 4URTA 2E6VA 4Y1XA 3VB9A 5A3NA 3VDAA 3I3EA 4DNYA 1RUF3 1O3TA 4LHKA 3FHIB 5CISA 2QQJA 1QGLA 1YXWA 4PQ9A 4RHV3 3FLPA 5FO9B 3WW2A 3OB8A 2Y6KA 3AFGA 2YBPA 4BQYA 4LO7A 3MIHA 5LEJA 1RUC1 2J22A 1QU0A 4XBLA 4Y20B 1ENSA 3U4SA 4GAZA 4R9AA 4CDQC 3T4VA 4AFAA 2SLIA 5FPAA 1J1TA 3WNXA 4YW1A 4AXOA 2DVDA 1PZ9A 3GJAA 3OY8B 2VJXA 2RJKA 1AYN1 1MZ6A 2G9FA 1W9WA 2JDHA 5DDJ1 2JB8A 4RGKA 2H6BA 3D0JA 2X5IA 3LSDA 3PUQA 3SQOA 3H8RA 4YM3A 2BVVA 4LK7A 1EV11 2ZA9A 4FOVA 3LB9A 1C28A 4YVSA 5ERLA 3BYWA 2GMEA 4CSWA 2Z69A 2FDGA 5J36A 3AZZA 2WS93 1PMIA 3H3LA 3ZYFA 4B7KA 1Z7S2 1PMHX 2TBVA 5DMYA 3HAGA 2A6YA 3AMQA 4YM0A 2R1DA 3ZFFC 4BYYA 1Q56A 2I74A 3V64A 1MS5A 1V9U3 4YRDA 4JQTA 2BFUS 2QDNA 2RMU3 1LJ7A 4QX3A 3NJXA 2NMNA 1ST8A 5GZFA 3NNGA 1E5HA 1QDCA 1ZX5A 2OXBA 3ZFFA 1ND3B 1X8EA 2BUKA 1UZYA 1Y4WA 2DVGA 4KG8A 1CIYA 3KS7A 3ZFGC 3MFAA 2AUYA 2W46A 1S0CA 4HK9A 4LBQD 1OUSA 5KXCA 3LPGA 3KGZA 3OBRA 1MEC2 1JYCA 3PU3A 4LO8A 4PHZA 3TEXA 1UOGA 3K4DA 1SLCA 2JDAA 4CA9A 2Q8OA 3AMHA 1IKPA 1OI6A 1PK6A 2TEPA 3GZEA 4W6YA 4YNIA 1US2A 3VD5A 3WCRA 5B2GB 2WWUA 1RUC3 1UZVA 3IIIA 1W2UA 4FOWA 3H8OA 5IWFA 2ZTNA 3QOPA 1HB4A 2VAUA 2P6CA 1ASJ1 2XJRA 2RR11 1QF3A 1NX9A 3Q8AA 3MO4A 4QHZA 5GLZA 1JW6A 1ZRFA 1MQTA 2EXKA 3M3CA 5A3TA 2RM22 3S0MA 4WM8A 3CDZB 4CUGA 3WF1A 5I0RA 4IETA 5FMCA 1CGPA 4UF0B 3AZYA 4QD2A 2CAVA 4OI1A 3BU0A 1R093 3T2QA 1HN1A 3LGRA 4HKOA 3WNKA 2R073 2BDRA 2UYBA 5IVJA 4HVQA 4EJRA 4QX5A 3WDVA 4BMEA 5LCWL 1VPHA 2C4XA 2IVIB 3BPZA 4NRMA 4HKWA 4YVWA 1FAYA 5AC93 1XE0A 4RQPA 4DFSA 5CFDA 5EXOA 3VBOA 3KD4A 1IS6A 4JKMA 5J09A 4EN0A 3TN93 3PLQA 2JD4A 5C7GA 2C5DA 5CVRA 3ON7A 5DZEA 4GA9A 3IDAA 3ZPYA 3WG3A 5FO8B 2R062 1PO23 2ZMKA 4CDWB 1AR73 2PHRA 1JN2P 1ZBE1 2RS12 2F4PA 2VZRA 4GWIA 3ZXEA 3M3EA 3B9CA 3C2UA 5DZFA 2JXAA 3RYPA 4Q4X2 1C57A 3P5BA 3RJRA 3LAGA 3S5QA 3UNPA 4IGQA 1W3XA 1AX2A 3A0KA 1LENA 5CFCB 2HWC2 1JOBA 2OZ6A 2Y64A 5D8AA 4QKFA 1T6GC 1CAWA 4HXCA 4XUNA 2FBEA 5E89A 1CX1A 2OQ6A 1ZBA3 3NV3A 3H8UA 3POYA 1VBE1 4HONA 2BPA2 1RUE1 1GQGA 1RMU2 4QB1A 4MGSA 1UOJA 1E5RA 2VOTA 3ZYBA 2D5HA 4AOCA 2WWSA 3C7HA 1RUD1 3SMHA 1N1SA 1ZRIA 4PLNA 1AL22 1GYKA 3U4XA 1DP0A 5JPMB 1FOD1 2Y38A 4RSUA 5IUQA 2J42A 5H9QA 3ZSLA 4EV0A 3IPVA 3OYWA 5JZGC 1GZWB 1ULDA 2FCTA 1GZCA 4CCMA 1WCQA 1GU3A 2VUJA 4S2GA 2WC2A 4FP2A 4XACA 4GH4A 2QZ2A 3H1YA 1OKOA 3HT2A 2TUNA 2R043 3PTYA 4YFZA 4UFHA 1CPNA 3OOXA 5FCCA 3ZMOA 1HQLA 2P2KA 4RFRB 3VKMA 5A6YA 5CFCC 2LRPA 2ZHLA 5A3UA 2GC0A 4COUA 4W6WA 1D2SA 1W6QB 2JG8B 1PK6B 3KCCA 3WW1A 3ZKYA 4E2GA 4XYXA 2FCUA 5A33B 2OQ7A 1ZZ8A 5T5JA 3SH5A 5LEKA 2YV8A 1DZRA 2KA3A 2QKDA 2NLRA 1RXGA 3RWNA 4FVVA 5FO7B 1YIPA 3BIWE 4JX0A 4UAPA 4XFFA 2QQLA 3AZXA 1DQ5A 1XYNA 4IEOA 4XJWA 2VW1A 4AFMA 1BJQA 1VP6A 5F5QA 5CZKA 2WO2A 4YPJA 4A7KA 4Y3OA 3EBRA 1F8VA 1ULFA 2VL4A 3J7LA 1UYYA 1CJDA 2ZGUA 3H50A 3HPNA 5A7NA 1JMUB 1RUJ1 4NWVA 5FZOA 5J96B 1O3QA 2B39A 1NLRA 2RM23 3USUA 3ZFEB 3ZFEC 2QQPA 3VZJA 4GXLA 3TRSB 3SLIA 4WVMB 3WW4A 3WUCA 4N7IA 1OF4A 3S7EA 5JPNB 4YZ2A 4ORFA 5IK4A 3O1SA 3A0NA 4A42A 1OLRA 1ZBA2 4YZ5A 1MQTB 2GDFA 1NQJA 4AHZA 4FPHA 5FZMA 5J37A 5C33A 3VZOA 3ORJA 2FQPA 3M70A 1C3HA 4K9SA 4QT6A 1D0GA 4ISQA 4XUTA 4FPEA 1U5IA 4I30A 4JHZA 5K0UA 4RA0A 2Q8DA 1FPN3 2WWJA 3OUIA 1BQPA 1LOCA 5HI0A 4IV1B 1O3RA 1NY71 2BNNA 1RHI2 1PGW1 3OJBA 3WNPA 1Q5OA 1VBD1 1BEV2 3DL3A 3KWVA 3T1LA 1GNHA 4AK3A 1LOEA 4JKKA 5FY5A 2J1UA 4S2HA 4XF0A 5FQ0B 4CUAA 3MPPG 4D6QA 4ZPIA 3ZFFB 4N9IA 4GB31 1PO13 1CAVA 4H7MA 4WVZA 3M3IA 4XTPA 3K48A 2RS31 4Y5Z0 3GDBA 4N9HA 2FMYA 2ZX1A 1W2NA 3I4IA 4LO5B 4RR3B 5EJ1B 5LA1A 2Z42A 1I3HA 3SXWA 4NPMA 2BWAA 2VOKA 4DRRA 2JX9A 1W0PA 1X9PA 3EQEA 4AI0A 3N9OA 2OX0A 4ONUA 1LNSA 2E32A 2XOMA 5J3UA 2EVXA 2WL1A 2YC0A 4UW5A 3BTZA 3DPRB 5M0TA 2E9QA 1FATA 1PNGA 2J1AA 3H3UA 3AVRA 1WD4A 2P3IA 3HBZA 4WVWA 1OH3A 3THTA 1MVEA 4YZ3A 4EYUA 4ES9A 2GNDA 3DYPA 2IFWA 4XE9A 1RUJ2 4UWDA 4EZHA 1FXZA 4TLGA 4BOWA 2J1EA 1QHDA 5HXMA 3PL0A 1ULGA 3EMRA 3AXDA 5FZ3A 4AHWA 3I2KA 1QJX1 3LDRA 2P3JA 4ZY9A 5EPAA 4OUEA 5LA9A 5EWSA 4L0PA 4LXLA 3VKNA 4C1XA 2BBAA 3IAPA 2BVBA 1GUIA 2I2SA 4K3UA 1AJKA 2WSUA 3P1IA 2MEV3 3JD73 4NO4A 4BXFA 1KRIA 3TWIA 1GP5A 3VBSB 4CP0A 5L7OA 2XB6C 4LBQB 3WF4A 5FYHA 2ZGPA 3ILRA 1H2MA 2WZR2 3AP5A 1UYPA 3AYCA 3DV8A 4L2NA 2A3YA 4IV3C 4Q4W2 5F5CA 1AX0A 1EAH1 5K4LA 5ACA2 1VRH2 1BHGA 3FE5A 2H0VA 3IAQA 3LDBA 4OHVA 1RMU3 4UOJA 5FZAA 5FZEA 2QQNA 2QBXA 1RJ8A 2CAUA 4R9BA 3WEZA 1RB8G 4NJ4A 3VD9A 3UL2A 1ZBE3 5IFPA 1XYPA 4B4RA 3O1VA 1AL23 4NUBA 2VXRA 1XBFA 3WG4A 2BFUL 5GLTA 1TNRA 1AYM1 1S55A 2VCBA 3GHMA 1PVC1 4R52A 2LROA 5LASA 4K8FA 3FUOA 1ENXA 2WAOA 4XJAA 1JHNA 1WMEA 3BALA 3FC0A 3KM5A 3SCFA 4DXZA 1K5JA 2CGPA 4TSVA 1GSLA 1P8JA 1SBEA 4BWOA 3MZHA 3S6PA 3IZOA 1VBA3 4CEWC 3AM2A 5EFUA 3IB3A 2AYHA 2D5FA 1MVQA 4NOTA 1HV0A 3WP5A 2OKXA 5KHHA 3ABZA 1KGYA 1ZZ9A 2IZWA 2W1SA 3MICA 5FZBA 3RS6A 3SITA 3W20A 5FZCA 1VBA1 4AEKA 2YU1A 3N9LA 4MO3M 4UBGA 5ABJB 4IV3B 1MZFA 3MLJA 2KR2A 1A8MA 3ZFGB 4CEYC 2NMOA 1HRV2 3HT1A 4NAMA 4OHZA 1QJEA 4EROA 1DDLA 4FTSA 3O12A 1K45A 3HWJA 4CUCA 5BNPC 4XCBA 1UO9A 5A7OA 2VZ3A 2VMEA 4LUMA 4G3YC 4IE6A 1QY4A 4ASMB 4CDWC 1PZ8A 1GICA 5JR7B 4A6SA 2PHDA 4BIOA 5IFTA 4LLFA 4LBQA 4DB5A 2GZWA 5FXZA 2X05A 1DHKB 4RYDA 3OEAA 1U5ZA 2A1XA 3I59B 1GOHA 1RUD2 4BDVB 3TB0A 4LQRA 4PIYA 1B09A 4O7XA 1LOGA 2F17A 5J7MA 4RR3A 1QOTA 4OZXA 4A41A 1W8ZA 5A3LA 3UKVA 3I2GA 2D6KA 4PI0A 4KI5M 3VDDC 3V0AB 3FMGA 4LULA 4AQTA 4CPBD 4LBMA 2ARXA 3FFQA 2ZCWA 3C7EA 1UIKA 4I09A 2JE8A 1PVXA 2VPVA 3K51A 4HK8A 4KU7A 4MXVA 1HW5A 5KWRA 1QXRA 1VBC3 4JCKA 5F5IA 3ZIWA 4LBLA 2I45A 4ATFA 1DCSA 2ZX3A 1FMD1 5IK8A 1OQEA 2AGSA 2WS91 1PX3A 3J26N 4IEQA 2E7QA 1OVSA 1K5MC 2Q1MA 3O7OA 3PIGA 1PMJX 2VOXA 1YJKA 3WDYA 1OOPC 4NROA 3K3OA 2X53S 5FLHA 1XU1A 1AR61 1SFYA 1S2BA 4KBBA 3TEZA 3NRUA 1AXZA 1SMVA 3BODA 3J7NA 4FAGA 1ONAA 3OF1A 1V70A 1JZ6A 1Q8VA 2H0BA 2QZ3A 3JD72 3VKFC 2FD8A 5BNOA 2YC4A 3AMNA 4I2OA 4CP9A 1IG0A 5FUIA 1Q8SA 5BNPB 2WO3A 1R1A2 2YC2A 4XDOA 1GV9A 1DFQA 1KQRA 2WNUC 2YDEA 3P3PA 3AP6A 4XF4A 2E7TA 4JZRA 1W06A 4BB3A 1JODA 1J1LA 1O4ZA 3B93A 4XUOA 4OFGA 3AYEA 2ERFA 1NQDA 1OXCA 1ASJ2 1W2OA 4Q4Y1 5EZWA 4D7SA 1UYXA 1SBFA 2CYFA 4GB33 2WABA 2W92A 3SISA 1PIV1 3ZXFA 4PCRA 4D6SA 2AENA 5FMDA 1ZBE2 4L8QA 3ZDVA 3M8LA 2YHJA 1H6YA 4FPOB 1UQXA 2QTWB 3WZ1A 2JECA 2VCAA 1HQNA 4AAXA 5K0UB 5E88A 3WVJA 3VZKA 3X29B 3LSEA 3W58A 5KBFA 1YQ6A 3IBMA 1S0EA 5EYYA 4WVMA 5ISLA 4HPKB 2HYXA 4LMFA 1J3QA 1JYTA 5FV3A 5GZCA 1BLZA 4XHBA 5FY7A 1UWWA 2Q1FA 4LIUA 5GLUA 3LF7A 4QPWA 1LEDA 1NZCA 2YU2A 3AC0A 5D8AC 1BEV1 1CZTA 3CIHA 2VZSA 1XOYA 2ADEA 4XJ9A 2XMLA 1IS4A 2G9GA 4RL7A 5F3IA 2DWRA 4XDPA 1DLCA 4BISA 4FP3A 3C7GA 3RYKA 4BA6A 1G9FA 3O1OA 5A7PA 2WN2A 1RUJ3 3RZZA 2VZUA 3Q8FA 1DGRA 1RUI3 2GP3A 4AEDC 2X8KA 2JDPA 5JR2A 5F32A 1SQ4A 5I0UA 1PGL1 1C8NA 4ZKTB 3BTXA 2ZGQA 3BB6A 3SH4A 1W9FA 2HWE1 3JB8A 1FV3A 2B7YA 3NAPC 1F5FA 1T2XA 2D3PA 2WO7A 1UL9A 2Y6HA 5A80A 2UY9A 4JRLA 1BCXA 2GC2A 4A44A 5K0UC 1FV2A 1POV0 3FBMA 1NE6A 2W1QA 1HV1A 2ARCA 2DFBA 3IDCB 2C24A 1UYZA 3CL1A 1NCRC 3ASIA 1CD3G 4JDNA 1C5HA 1ENRA 3EJKA 4YGBA 1K12A 3NKTA 2EXHA 2J1TA 4YWAA 2Y8KA 1WKYA 5FYSA 3VBHA 1I5PA 2YB7A 2K9ZA 2PAEA 3U78A 5B4NA 5JSOA 4BH9A 2VZVA 4GD4A 4TYSA 1SLLA 3TOJA 1RUG2 1OLMA 3KGLA 3VHRA 2WQ8A 3VBUB 1HB3A 4XFHA 4IERA 5L7OB 3MGUA 1JOJA 3SKVA 5C8WA 3DXTA 3RSJA 1OMIA 3D3AA 3PHMA 1STMA 4KH9A 5E6HA 4BXSV 4CU6A 4DMIA 2NM1A 4NHKA 5A7WA 5LBEA 1OPMA 2Y6JA 3K3NA 1GR3A 2WYFA 3WHTA 4WM7B 1HRI1 4JC1A 2VW2A 5FUNA 1CAXA 3UK9A 3MW3A 3LKJA 3VD4A 3DYOA 3AL5A 1UZ0A 1BVVA 3P6BA 2K0GA 4META 2XUEA 4UT5A 2X29A 3V0BB 5I93A 2F4LA 1VBB2 2XQRA 3OGGA 3ETQA 4HN0A 3AKSA 3EHKA 1WMFA 2ZAHA 4AG4A 5CFCA 2GH2A 2WINB 2C6SA 1D4M2 1GP6A 2LTNA 5FP9A 2IXKA 4E4DX 1AR81 1C8M3 2L9LA 2ARAA 4IEYA 4Y26A 4MUVA 4LK6A 1Z78A 1U5XA 2UU8A 1XQNA 4M00A 1V0AA 4AWDA 3ZDSA 5FYVA 3QH6A 2W9XA 3WQ1A 4QPGC 2PHXA 1I5ZA 3H3ZA 2R061 3VBSA 4M3CB 4QPIB 3VLBB 5CNAA 4E4HA 2ZX2A 4YGCA 2QQUA 5L73A 1HXS1 3RMXA 4DXSA 3EO6A 4Y5TA 4ISRA 3LWCA 4IEUA 3CQOA 4IE0A 4UXAA 1B35C 1R64A 1G9BA 2Z2SB 5GZDA 1OURA 5CG9A 3IMNA 4D3WA 2Q8EA 2XJVA 3SC7X 2WNVB 3KMHA 3POFA 2JG9B 1CX4A 3GXUA 4IEVA 4QDRA 3VGIA 2OVUA 2R042 3F95A 1QNYA 1YFWA 4MLOA 1F9KA 3NMBA 5T55A 5HBAA 3HNYM 2WA3A 1WWYA 2ZMNA 1HJFA 1S2EA 1A34A 5HXVA 3J7HA 4YSFA 1CVNA 5LW9A 4KGQA 5DN2A 4KWJA 1EP0A 4YW2A 4NHLA 4M3CF 5I8TA 3Q8EA 1QMJA 2VTXA 5CKMA 3TN92 1W9YA 1LHUA 1QJU1 4FXKB 3POWA 5IAVA 1ZRCA 1BBT2 3W9AA 1KXGA 4GALA 2D43A 2OW4A 1TVGA 4X6RB 4G9SB 2ZKLA 5F8PA 1QEXA 1IQAA 2XHNA 4DXTA 4P9YA 5LZ6A 2VUDA 4JKLA 1J58A 3POSA 4QGNA 4IV1A 1G9CA 1W0OA 4Y1UA 3D82A 5F6KA 3AP7A 5AFBA 3MW4A 5FQ0A 2LALA 2XJSA 5J98B 3HMYA 3T08A 5C9AB 3HD8B 1WLWA 1PIV3 2JDMA 1ND3A 4MH0E 3CNAA 2OPKA 2GC1A 3H7YA 3B02A 1Y9QA 2P5BA 3GCWA 4D7YA 5EYXA 4TTGA 3ROUA 1GZTA 1MS1A 4QM8A 3T0DA 4J25A 2XKOA 2JWPA 1G9AA 2VR4A 3OPWA 5F2WA 1OOPB 1AR62 3B94A 2P4EA 3JB4C 5DAPA 4AI8A 4EN8B 4Q4Y2 5CU1A 3VL9A 3RZMA 2Y60A 4H3WA 4ET7A 1AVBA 1O91A 3K75B 3MI8A 4MGZE 2KD7A 4YVSC 1HRV3 2H6CA 4YM1A 4YM2A 2IXIA 4P9WA 4J1XA 2HWF3 2Q0AA 3PUHA 3WCSA 2XQXA 2D98A 3J4UH 4N43A 5BPXA 2VMCA 3K46A 4FPCA 4COYA 4ZZ8A 3OEBA 1V9U2 4CRQA 2P1BA 3IDBB 2FDKA 4Q0PA 3RNSA 1Q3EA 3U0ZA 4IQPA 3O0XA 2LW8A 1BK1A 3MIGA 3WP6A 3WF2A 1FOD2 1NKGA 1SHWB 2ZOEB 4EWEA 2VBDA 2JIGA 2WNOA 1H9WA 1OUXA 4XIOA 3ZSKA 4Q27A 1W0NA 3WQ0A 4QQOA 4P5YA 3PMEA 4TZDA 1OQ1A 3L9JT 3POEA 2UWCA 3U75A 2BZDA 4CXWA 2HWD2 5K9YA 2IWGB 2WA4A 3PDQA 3AVSA 2O1QA 4FOYA 4QDSA 5FZ7A 4XFIA 4GB32 2WZR1 4Y22B 4LHSA 1J83A 3FZ3A 3MEPA 1EUTA 3NV4A 4YLZA 1COV2 1G6NA 2AREA 1YC61 4IGOA 5C3OA 1C1FA 1TMF3 1RUH2 2JENA 1WLCA 3GBFA 3T4HB 4CPBA 5BYNA 2MNGA 3MW2A 5FJHA 2WZPP 2C26A 5A3PA 1DYKA 5CEHA 2XJQA 4JGZC 2W08A 4PDWC 5BV6A 4AFBA 2PLV3 3JBG3 4B4PA 4K8RB 4UFMA 4AAPA 3BGAA 2FDFA 3I2OA 2I07B 2HEYF 3Q9OA 4Y5SA 2RVAA 5FYIA 3RMYA 3BPSA 1ULOA 1YFXA 5LBCA 1FOD3 3VBRB 5AC91 5CBLA 1UOFA 3DPRC 1QJX3 4XPVA 3VHNA 4CDXB 1N1TA 1TE1B 2G9ZA 4MHRA 1JTZX 2XG3A 2ID4A 5A7SA 4LT5A 1QKQA 4X8PA 5F5AA 1ZREA 1R1ZA 2R071 2WNUB 4EE2A 2PHTA 4URAA 4QX1A 1LOFC 1ZA7A 2HWF2 1PX4A 1SCSA 4DY5A 2CGNA 3LQCA 2A71A 3THPA 3T0AA 1W04A 2R1BA 2ZGOA 3IDEA 3O0VA 2W95A 3A22A 1Y9MA 2HWC1 1COV3 4JGYB 2ZGNA 4D7TA 1HDKA 4FBFA 3UGFA 1N47A 4A7YA 1NA1A 1W28A 2HKXA 2BGPA 4CEYA 4CZSA 4D69A 1S0FA 3GHNA 5FY0A 2D93A 4BQ1A 2AC1A 5FZ1A 1V6MA 3LEGA 3JU9A 1DIWA 2Q1ZB 1VBD2 2CL2A 2WBKA 1RMU1 2NZ9A 3VV1A 2A6XA 3GF6A 4JTNA 4QPIC 5IVEA 3FWEA 2FZ2A 4Q2FA 4LKFA 1UW8A 2BP6A 3VBFC 4QXHA 1CQ9A 1RGSA 1MS4A 4LA3A 5GLVA 3OPZA 2Q5TA 4UBHA 4XXPA 1YQ5A 4Y1YA 2Y0IA 1D4VB 1PM4A 3VBUA 4AL9A 4AVSA 4IE5A 3DEMA 3NL1A 5FMOL 5FPZA 3W59A 4MYEA 5J48A 4BK4A 3LEKA 4TN7A 3WV6A 1DLLA 3CZJA 3M1HA 4U36A 4CU9A 4N90A 3H0OA 4K1YA 5FP3A 3AZVA 1BEV3 3ZN4A 1DGLA 1UKRA 4Z07A 4GZ9A 1H1IA 3POGA 4AYUA 4YG0A 3LEMA 2A6ZA 1F4AA 1HN0A 2RMU2 3DF0A 3OTFA 2CNAA 3B3QE 4L97A 2CSGA 5F3EA 2R16A 3VDDA 2R6QA 4JVAA 3AP4A 2ZX0A 1CAUA 1M4WA 2WZ8A 3RQ0A 4O9GA 4RR3C 5CYYA 3W5NA 2C9AA 3N35A 4CU8A 2PQQA 5HCBA 1XNCA 4P9LA 5L7OC 1UD1A 1YQ2A 2JG9A 1GBGA 4A3XA 1KDMA 4GWJA 1APNA 4BPZA 2DCTA 4Y33A 4Q1PA 4DPNA 4B1LA 3UJOA 2V4AA 3WD5A 2FMDA 5DQ0A 2VVFA 2AEYA 4CCJA 2D6LX 2ZZJA 3MIFA 3U07A 2PN5A 4COVA 1W2AX 2RS33 3TEWA 3AKQA 3ZXLA 2VNVA 4HSJA 2RS52 5JXHA 1AXYA 2OZJA 1AL0G 4HOOA 4OI4A 3OGSA 1K3IA 1I9RA 4ZONA 4IXLA 5FZFA 2QE3A 4BQ2A 1KITA 5ANQA 2KXLA 3KT7A 4GQ7A 3DECA 3LEIA 4XMAA 1NCQB 4F7ZA 2WLPA 1UMZA 4HPKA 4JRAA 4NE9A 2OUHA 3I3DA 3JUUA 2ZABA 3KZ4C 4HG6B 3A23A 4W8JA 1FNZA 2VMGA 3GBWA 1NAEA 5C4WA 4CCOA 3KQRA 2B9VA 3FJSA 4BU2A 2EALA 4IE7A 4CEWA 1CESA 1WCKA 4MHUA 1W8FA 3HVDA 3N9NA 1TME2 5C3SA 3KQ4B 3N7JA 2XH6A 5AC92 3ZMNA 4UYBA 1V6NA 4LR4A 2F6BA 4MGIE 3USUB 2P6HA 3ZFEA 1JH5A 1W90A 3N4MA 1JUHA 1L7QA 3NQHA 3NSTA 2BYVE 5K8SA 3VN4A 1LGBA 1LRHA 3DUIA 1AR91 1S0JA 4GJYA 1Z7S3 5FZIA 5IHRA 3SHRA 2VZPA 1GZWA 4L11A 5FAXA 5T54A 2GH8A 4QGLA 4ZS2A 4A2UA 4XJ8A 2XVLA 2DCZA 3WY6A 4DUVA 5AVPA 1YHFA 2YY1A 4K1ZA 4XZPA 5CKNA 1CWPA 2A6VA 2D44A 4JAAA 4CCEA 2WQZC 1UKGA 4AF9A 4C91A 4CXYA 2P34A 1QJZA 2PHLA 3CHXA 1W6QA 2KM2A 4FO9A 4CP1A 3KVBA 5T5PA 2HWC3 3J8F2 1D4M3 4RS5B 5FOJB 4XBQA 5IVBA 1HLCA 5JLVA 1JYNA 1H6XA 3LIGA 3E6CC 2W3JA 1UZWA 4Z1VA 4H7LA 3FFZA 2YPJA 1VB4A 4FQ4A 1YLLA 4HSLA 4LE4A 4COWA 4BE3A 2B5HA 1OSGA 5FFOC 5F1RA 2EA7A 1OLME 2ET1A 1AR71 2ZGTA 3M4FA 1KEXA 3I2DA 2DTWA 2ZJCA 1V6LA 1NXD1 1QJU2 1OA4A 2DVFA 4JTOA 2V72A 3I2JA 2XVGA 4K20A 2XBO3 2DCYA 4OHYA 1FNYA 2RDQA 1F5JA 4DOUA 5FYYA 3VBOB 5CFDB 5BNNA 5IYYA 1WW6A 3R4DB 5FY8A 4CCLA 2WSVA 1GANA 1JBCA 2PLV1 3QACA 4CP2A 1LR5A 4CDXA 5HPOA 4BQ5A 1IS5A 1L7RA 3OGJA 4XF3A 3SNMA 5IVFA 2YFUA 2D6MA 1D7PM 2V4VA 4XC9A 4F83A 1V6OA 2RE9A 1XB9A 4CCNA 3K77A 2WT2A 4IEWA 4KNCA 4PF1A 1RUD3 1JI6A 1R083 2JIJA 3JXSA 3PIJA 4MVTA 3D8CA 3KF5A 1AZDA 1DYPA 4AVCA 3MV11 3LZZA 3UETA 5FKCA 3CF6E 1UAIA 2E63A 1GZ9A 5FYZA 4AI1A 2GC3A 1OVPA 3LFIA 5FDBA 1AL21 2DU1A 1BBT3 3KV9A 1D4M1 2WAAA 4Q4W1 1CAXB 4FPKA 1N3OA 3LPFA 5E8AA 1LB2A 2WQ4A 3IIAA 1O8SA 1PGW2 1WLDA 3ACGA 3ZXAC 3RPQA 1FT9A 1EAH3 4ASKA 4I0BA 3UGGA 4CE8A 2N7GA 4QXKA 5GZEA 2XBO2 1CJPA 4RQPB 4RQPC 1AXKA 1T6BX 3M3QA 2WDBA 5DABA 3WF3A 3T30A 1QOOA 4CDQB 5EJ3A 3JBG2 3MV01 1YFYA 5LBFA 1OT5A 2RJ2A 2VU9A 3ACIA 3ALQA 4PLMA 2D7FA 5FYMA 4YZ4A 3L2YA 2HWF1 1RXFA 4GH4C 1HRV1 4QDQA 3E6DA 1WCDJ 1W6PA 5KHGA 1PM7A 2A73B 4YZ1A 1UY4A 4QPYA 3NV2A 3T2TA 1NE4A 1QNWA 2JB4A 1C1LA 3K4ZA 5T52A 2CDPA 5TSWA 5C5TA 5DZGA 4DS0A 1J59A 2P17A 5KXBA 4KGGA 4LLOA 5DDJ3 4FPGA 4XJUA 1G7YA 1J3RA 4QPGA 2E7AA 4MADA 1RUC2 1SDDB 1LU2A 1UZZA 1LGNA 5FPBA 4LA2A 3I97A 4LOTA 1XJAA 3IN9A 5LWBA 4LBNA 5DUUA 3ZN6B 3VBOC 1AR82 5CFDC 1A78A 1BK0A 5J1XA 4GMP1 1H1MA 4IGPA 1UXXX 3RJ2X 4BQXA 1ND3C 3BTYA
chains in the Genus database with same CATH topology
4EN9B 4AQ2A 1IPJA 1C8M2 4XQ4A 1QOSA 3ZXGA 2A3WA 3GZTB 5C8CA 4N7UA 5ABJC 1VJ2A 1PO11 2NQYA 4GIQA 1G9DA 3BCWA 1LTEA 3S30A 3WDTA 1W6MB 2R0FA 3MIEA 4N43B 5DG2A 4AEJA 1F2NA 4COZA 4FPYA 4CEWB 1N3PA 1VAKA 4AI2A 2DV9A 4KL1A 4C0BA 3ATGA 2RMU1 3I8TA 2VNOA 1PGSA 2Z79A 4SBVA 4YVWC 3TNQA 1NCQA 3APBA 1LOAA 1LHOA 1ZZ7A 2BW8A 4SLIA 1EV13 4Y1ZA 1UCXA 5LRRA 3PJYA 3ES4A 2IC1A 3AYAA 5T5OA 2UURA 4QM9A 4C0HA 1CAVB 2AH2A 2CWSA 1RC6A 2D6PA 1IGOA 2PFWA 3WP3A 4CDQA 1PIV2 3FLTA 1AYN3 4AVVA 3ZO0B 1IKQA 1BYHA 1OKQA 1KJLA 1AJOA 3VBSC 3E5XA 5DG1A 5A3MA 4JV4A 4QPGB 4GMP3 4QGMA 4FSJA 1BBT1 4MXWB 3I59A 3B9IA 1QWRA 3GBGA 1QJU3 4CEYB 4XEZA 3VBHC 4LEJA 3RI9A 2ZGLA 3SCGA 4B29A 2D6NA 2ZACA 2ES3A 3IM0A 2QFEA 4S2FA 4OHWA 3FX3A 3GZUC 1HIXA 2WJSA 2YYOA 2MEV2 1FMD2 2PAKA 3LA3A 4XFBA 1DG6A 4IEZA 5FTTC 5C6CA 1ZZ6A 2AZ5A 2A6WA 2ZKNA 2JICA 4HVRA 2DFCA 1HX6A 3MIDA 1RVF2 1S0GA 4R8HA 5CB7A 3MLLA 4XJZA 4Z8BA 2W68A 3B01A 4UW3A 1U12A 2WS92 3JQXA 1YRZA 1NG0A 1ZA4A 3E6BA 4DY3A 2OUJA 2JEMA 5E16A 4AVTA 4I0WB 5BUVA 3R0RA 4Q4X3 5LK7B 5K7PA 2CTVA 1KS4A 4KQ7A 1VR3A 2WNUA 3WLUA 1QQP3 1NCRA 3URFA 5KXEA 4LTAA 2GMPA 2MHFA 3D5OA 2VY0A 1Z0HA 3B5LB 5JDBA 4BLJA 1JYIA 3V0BA 2BNMA 2XWJB 4YG3A 3VBRA 4XOGA 2PHUA 3BU7A 2VMHA 4Z2WA 3VHPA 5I0SA 1D0HA 2BTVC 1E57A 1GFF2 4P9GA 2UWBA 1NYWA 4E27A 4BZ4A 2WFF3 5FBZA 4JQRA 5FLIA 2ZPXA 5A32A 4YW3A 1AHSA 1LHWA 2QJVA 1CAWB 3ECQA 4DZGA 1QH7A 3O5SA 4M01A 1QXJA 2A3XA 1ZM1A 4RFT0 5BNOC 1MS3A 3NVCA 1BVP1 1R091 2XJPA 1UU4A 4FPLA 5DUVA 1BZWA 1R082 1YNAA 1A6CA 1BKZA 1CN1A 2HEVF 1ASJ3 2GN3A 1XE8A 3W9AA 2ZZQA 3CJIA 2HWE3 3QBQA 4X6QB 1AF9A 1PO22 3WW3A 1VLNA 1ZZBA 1AX1A 2Z5WA 4D94A 1OA3A 4ZU5A 1N3QA 1RUI1 4Q29A 2XPJA 2DUQA 2YGMA 2WFF2 1H2NA 4AGRA 1DQ4A 3R05A 1QXPA 1BXHA 2K2SA 4U2AA 1DU3D 5JZGB 1MZEA 4BMBA 5JVVA 2ZGKA 4BIFA 2A70A 3V65A 1QJY3 4PLOA 1N1VA 1POV1 2QDRA 4DRVA 5KHJA 2OYZA 2LM3A 1FX5A 1FYUA 4RGAA 1MACA 4B7EA 1POV3 3WDXA 1QJY1 5CIRA 2A5ZA 1YCIA 2IFRA 2XLFA 3DGTA 4E2QA 1OOPA 2IXCA 4R4ZA 4NWWA 3ZYRA 1K5MA 3U11A 4H14A 2Y0OA 4LE3A 2WNVA 2ZGMA 1KJRA 2B8MA 1JUIA 1OA2A 1C4RA 1X7NA 1ND2A 1EYBA 4QQ2A 5I91A 5I8SA 1CIWA 3AK0A 5DXDA 1PO12 1VIWB 5T5LA 1AR92 1AUYA 4Q4V3 3B00A 3KT1A 4LHLA 4QPIA 4UW4A 4GKXA 1H9PA 2RS11 4XFGA 4QQPA 1UU5A 1SLBA 5JI7A 4JGZA 4PDWA 3GNEA 2D3RA 2FHRA 1ULCA 3PVOA 3E5QA 1XU2A 5D8AB 1EY2A 4JDMA 4Q1RA 4MV2A 1CPMA 2ETEA 1G86A 2V09A 4XBNA 4BLIA 3ZXDA 1WMDA 1AR63 4FTBA 4HN1A 1VBC2 2UY8A 2OA2A 3H1WA 1V6IA 5KC6A 1ALYA 1S0IA 1TMF2 1H2KA 1UX6A 4IEXA 2WFF1 5CADA 2DUOA 1RUNA 1HKDA 3AMMA 2WFPA 4HETA 1VBC1 2BGCA 4C90A 3QH7A 5KC5A 2DURA 1XRUA 1LODA 4CYDA 4HANA 2GNBA 1J3PA 1ZBA1 4XMIA 4J1WA 1XNKA 4M3CA 4RD7A 1CONA 5FRAA 4HFSA 4XXAA 3N3HA 3VKOA 2JKBA 2PA7A 3WX5A 2QCSB 1NLSA 3N7MA 2B9UA 2HWD3 2AR6A 2ZS6B 5BXXA 1AYM2 2GALA 1RIRA 1VRH3 1SFNA 2HWB2 1RTVA 4CDXC 1G8WA 4GH4B 3U10A 1EPZA 1VAMA 4Z92B 3ZYJB 4YW4A 1I6XA 3N7LA 4CDUA 1YI7A 3MFCA 2VECA 3T1MA 2RS53 1J59A 5GM0A 3IKWA 2W39A 2YUEA 3ILFA 4ES8A 3LA2A 4RS5A 3UJQA 1COV1 2ET7A 2O0OA 3HN1A 4FCAA 4EN7B 2WNEA 3ZYGA 2NN8A 4V1PA 3MF9A 1RVF1 2ZAAA 5JSRA 2QNKA 3CU7A 3I7DA 1H0BA 2IXLA 2D3SA 2YROA 4XW3A 2PELA 1O3SA 4EWAA 3BOPA 1BMV1 4NVPA 4R4XA 4AQSA 2RR13 5F9TA 3I54A 2E53A 1LEMA 2TNFA 2C1FA 1H2LA 3WXPA 2VNRA 4AFDA 3AJZA 1C5IA 1RUH1 1CR7A 4M0HA 1NY72 4XF1A 2MPFA 4DQAA 4HL0A 5E1RA 4HT1T 5GJ6A 4E4SA 1DZQA 2HWD1 4RGGA 3DKWA 3KCYA 2WZR3 1B35A 5JOZA 3INAA 1LCLA 5L36A 2ZGRA 3WG2A 1DF0A 1MEC1 4H55A 2HWB3 1FPN1 1REFA 1WW5A 4N53A 1WD3A 4B8EA 5JAXA 1RITA 3D0SA 2PHWA 1LECA 2WKKA 3OCPA 1DQ2A 3VUOA 3JQWA 4WM8B 3RYRA 1REEA 2V5YA 2YZ4A 3TAYA 4CTEA 4CDUC 1KDKA 1H30A 1LHNA 1SEFA 4HMZA 5EV7A 4NR1A 5CG8A 2R0HA 3PVEA 4HVOA 5DUWA 4LO4B 3AB0A 1REDA 4OLLA 1LU1A 5CAZA 1FMD3 1MS8A 3VKLA 1YIFA 4XQWA 5IK7A 1H4GA 4L92A 2VOVA 3AJYA 3O14A 1GQHA 3OBTA 4F8AA 1Q43A 4K21A 3LOBA 3ZX7A 1IPKA 1XXNA 2GNMA 1SDWA 2DF7A 1WGPA 4MGKE 4WV8A 5BNOB 1OHFA 1LULA 1W6NB 1EAH2 1H8TC 1X82A 2ZMLA 4I3PA 1RUH3 4NHMA 2BQPA 5JCTA 1RL3A 4TWTA 2IXJA 3VZLA 1W6OA 1QH6A 1R092 4FQZA 2EF6A 3CO2A 3ZYPA 3H9AA 3VBFA 4AFCA 3DN7A 1RUG3 3FLRA 2ARBA 2BBVA 1W6PB 2XJTA 4N53B 3NO8A 5C9AC 1AYN2 3WQ7A 1O5LA 5JZGA 4MZUA 3OYWB 4P14A 2W0XA 2B42B 3MIBA 5GZGA 4OUMA 1URXA 2P37A 1Y43B 4ATEA 2XVKA 2ZX4A 4L99A 3PVBB 4WBBA 4YW5A 2ILMA 1HXS3 2XKPA 3NV1A 1LOFA 2RS51 4BM8A 1XE7A 3WT3A 4GWNA 4KG0A 1VBB3 5A33A 1OFSA 2VW0A 1O4TA 3ZFGA 2ZBJA 4WVVA 2D97A 4GWMA 4LHNA 1A3KA 1LOBA 4XFAA 1NCRB 4EWDA 3ZIXA 3B7MA 2D40A 4YGEA 1LGCA 1MQTC 2IXHA 3M3OA 1WLTA 5T3NA 3VBHB 3WR0A 3ZXJA 1X8MA 2R041 1N1YA 1NXMA 1JXNA 4WM7A 4X8NA 3WG1A 5I0TA 2EIGA 2Q30A 4O9EA 1DGWX 1Q8QA 3USSA 1DQ1A 1XNDA 2HEWF 1DGWA 4YARA 2CV6A 1EPWA 3IPVB 3NKGA 1WUVA 2YMZA 3ME2A 1OQDA 2XL7A 2C0ZA 1HRI3 3LA7A 2JE7A 2X5IC 1XYOA 4HZFA 1GKBA 2RR12 2A7AA 1H4HA 4W65A 1L3JA 5SV5A 4WM7C 3ZSEA 5BNNB 4YG6A 3IT8A 2CGOA 3NW4A 1MR5A 4XILA 4CDUB 1NA1B 1UF2C 4AEDB 3O0WA 1DQ0A 2O8QA 4WM8C 4PF5A 3SCHA 4PIZA 5JSPA 5ACA3 1MS9A 1ZRDA 2JE9A 1SBDA 4Q0QA 4HKLA 2ENRA 1W6NA 3AZWA 1S0DA 1OD5A 2RS13 4N43C 3WP4A 1PHMA 1PGL2 4I3GA 3ZVXA 1Z7S1 3ZN5A 1AR93 1YI9A 2MEV1 1UPSA 3RRDA 4AEMA 2PHFA 4FOQA 5C9AA 1DGRN 1QDOA 4TLFA 4YYOA 2P3KA 4W6XA 3CJXA 1V00A 3BTAA 4XHXA 2DU0A 2CY6A 4JDOA 5FMOS 1IS3A 2R072 2R49A 4YGDA 5BY5A 2DTYA 2O8OA 1WBFA 5FLJA 4OUSA 1W6OB 4BHPA 1OPOA 3G7DA 2UWAA 3S7IA 4NN0A 2CWMA 1K5MB 1H8TB 2R30A 4AE2A 3JZVA 3ENRA 4LBOA 3G6JB 3ZXKA 4Q8KA 4F3JA 1ND2B 1RUF2 4XFCA 1GLHA 1PVC2 1F31A 3AFKA 1NOVA 4Q4V1 4AW7A 3GZAA 4XTMA 2XHKA 3OD4A 1PZ7A 2PTMA 4E9KA 4OULA 4PBPA 1B35B 4Q0UA 3KSCA 4YFWA 3AMPA 1SLTA 1SACA 3ZSJA 3VZNA 4ZXKA 5C4WB 2QVSB 2E51A 2EAAA 4OI2A 1NCQC 1ZZCA 1CAUB 3H1MA 2GSYA 3VDDB 2XGXA 5KHIA 1OLQA 4YVSB 2XWBB 4G4FA 3VHOA 3HIFA 4INDA 2V73A 1VALA 2EXJA 5DDJ2 2VQ0A 2WIIB 2Y26A 4K40A 1O7FA 2GNTA 2RJLA 4MSVA 2OIIA 4AHYA 3KCXA 5JOWA 5I8YA 3OY8A 2R32A 2ZGSA 3ZN6A 2VVDA 3KB5A 4ASLA 5ABJA 3E97A 5C8CC 3NWKA 5KXDA 4LUKA 4Q0SA 2VNGA 3CLPA 4C1WA 2YXSA 1RUE3 3AKTA 1VBE3 3HQXA 3TBDA 1VBE2 5GKAC 1Y3TA 1MEC3 4QQHA 2ZHNA 3AKPA 1H8TA 1LHVA 4RHV1 1SLAA 3LCPA 2WLQA 3L2HA 5GALA 3SH3A 1YJLA 2RS32 3B69A 4FAHA 5ACA1 2XJUA 3WUDA 4Q4V2 1AR83 1C8M1 3ACLA 3M7AA 2FZ1A 4IV3A 1VAVA 2DVAA 4MGYE 2VG9A 1PO21 1TME1 1A8DA 5T50A 5H9SA 3JD71 1VBA2 5A32B 4GMP0 4HLTA 1TQ5A 2XBO1 4P5HA 3PMSA 5JOXA 4CDWA 4E2SA 4L9BA 4K7JA 3WDUA 1ENQA 2JG8C 3BOWA 1WA4A 1MS0A 4QMAA 2JDZA 1RVF3 2EAKA 4LNVA 3ST7A 1W39A 3AXEA 2WT1A 1TMF1 4Y24A 5F6LB 1RJ7A 5JI9A 5IT6A 5CA6A 4ITCA 4JGYA 3D4KA 4P9IA 5LRSA 1PVC3 3DPRA 1QQP1 4AEDA 2EXIA 1ZNPA 2NYYA 3WOGA 5KHKA 4GKYA 3N36A 1Q8PA 1IOAA 4ZU7A 2VQAA 4EN6B 3FUQA 4Q26A 1R1A1 3LOIA 4K6BA 1U0AA 3M2MA 2XUMA 1HQWA 2GU9A 2RHPA 3WHUA 1I1EA 1XNBA 1KFUL 4LO6B 2D6OX 2XL9A 2LUWA 4FPFA 4AHXA 4AGGA 4AVAA 5H9RA 5JMCA 3UV9A 4R9CA 1H1AA 4KU8A 4RS5C 4QQLA 4AGVA 4WZCA 3MDPA 4OHXA 1D2QA 1WBLA 4FXGB 4MXWA 4N53C 3D6EA 4OVEA 2BWCA 2NPIA 2SBAA 4Y22A 5D1IA 1EV12 5FREA 2PAMA 1LESA 1X36A 4KWLA 2JG9C 1YUDA 2X5IB 3AX4A 3J8F1 3MF6A 1PNFA 3KLSA 3KT4A 3QLQA 3NJZA 4XETA 3VZMA 1RUI2 2XLAA 1RHI3 4MX3A 5FPXA 3QCWA 1M06G 1ND2C 2GAUA 1AR72 4DINB 2ZHKA 4I0AA 4Y1VA 3GYDA 1RUOA 3MPBA 1YO8A 1WCSA 4Q4Y3 5BNNC 4A7ZA 3CJIB 2WNVC 5SV8A 1KD7A 1ULEA 2Q4SA 3QD6A 4XDQA 1X50A 3VBFB 3UKNA 1RUF1 1S0BA 2JG8A 4LBJA 3AKRA 1UIJA 1VBD3 2PLV2 3PVNA 4R9DA 3OD0A 5JIUA 4M0NA 1O5UA 2XLGA 1LKNA 5GLWA 3JCIA 3CEWA 4XIKA 2VMIA 5AFEA 4JGYC 3C3VA 5JOYA 3R6SA 1GNZA 1W6MA 2UYAA 4GULA 4BCUA 1WW4A 3V56A 4Y4YA 3UKTA 3RDIA 2G4IA 2HJIA 5C8CB 1ZRRA 3N7KA 5JWPA 3V0AA 2R063 4PJYA 3H7JA 4Y20A 4J6GA 3WINE 1KS5A 2RM21 1TEIA 2HWB1 1HXS2 5BNPA 2BEOA 2BNOA 4IEPA 4B3NA 1RHI1 2GMMA 4XQDA 3MLKA 2DUPA 4NPRA 4WZFA 4XF9A 1DZTA 1S2KA 3AP9A 3J8F3 1MZ5A 4OI0A 2GN7A 4Q4X1 1UU6A 1DBNA 4Q8LA 5C4WC 3VL8A 1VB2A 3NAPB 3P3NA 5JIAA 4QU2A 4AI3A 1U5YA 2B46X 4FTEA 3J9SA 3RG0A 1IHMA 1TNFA 2VULA 3MYXA 1PK6C 3FBYA 1FI2A 1O4YA 4Q0VA 3TN91 4Z82A 3EXUA 1KFXL 1OFNA 4I02A 3R4UA 4UW6A 1HRI2 5BNQA 1Y7BA 4KWKA 5HCAA 3TYJA 3ELNA 2DVBA 4HBNA 4ZU4A 1SCRA 4AQ6A 2DYCA 2DCJA 5H9PA 3CJIC 4IESA 1QJY2 4P9XA 4QHBA 3A4UA 4E4ZA 3GALA 3HR9A 4RHV2 2QUOA 3RI8A 4YVWB 1S1AA 4M3CE 1QJX2 5AVAA 2B45X 1X33A 3ZSMA 1R1A3 2HYKA 3ZYIB 1RUE2 1DQ6A 2PYTA 3E5UA 4Q4W3 2ATFA 1UN1A 3PNAA 1FPN2 2NP0A 1VBB1 1AYM3 1YFUA 2WT0A 3ILNA 3WDWA 1V6JA 2VVEA 5LK5A 2HWE2 5DUXA 4S2DA 1ZYBA 1Q8OA 1R081 2VUAA 1VRH1 4PIXA 1IZ3A 3ES1A 4JGZB 4PDWB 5IK5A 4IL7A 4P9JA 4PBOA 3TNPB 1QQP2 1WW7A 3VBUC 4FT8A 4LBKA 2JJ6A 1YYNA 1UPIA 1RINA 1RUG1 3VBRC 1ZVFA 3NAPA 2DCKA 5L19A 1BMV2 1V9U1 2ZHMA 1SLIA 2VGDA 3R4SA 1TME3 2VOWA 3JBG1 3IWZA 2YGLA 1V6KA 4I01A 1YWKA 2W52A 4IV1C 3AYDA 4AVBA 2A75A 1NA1C 4B4QA 4FPJA 2VH9A 3PJQA 1H8VA 4URTA 2E6VA 4Y1XA 4DNYA 1RUF3 1O3TA 4LHKA 3FHIB 1QGLA 1YXWA 4PQ9A 4RHV3 3FLPA 5FO9B 3WW2A 3AFGA 4LO7A 3MIHA 5LEJA 1RUC1 1QU0A 4XBLA 4Y20B 4CDQC 1ENSA 4R9AA 4AFAA 2SLIA 1J1TA 3WNXA 4YW1A 4AXOA 2DVDA 1PZ9A 3OY8B 2RJKA 1AYN1 1MZ6A 2G9FA 5DDJ1 2H6BA 3D0JA 2X5IA 3LSDA 4YM3A 2BVVA 1EV11 2ZA9A 4FOVA 3LB9A 1C28A 4YVSA 2GMEA 2Z69A 5J36A 3AZZA 2WS93 1PMIA 4B7KA 1Z7S2 2TBVA 3HAGA 2A6YA 3AMQA 4YM0A 2R1DA 3ZFFC 4BYYA 1Q56A 2I74A 3V64A 1MS5A 1V9U3 4YRDA 2BFUS 2QDNA 2RMU3 1LJ7A 2NMNA 5GZFA 1QDCA 1ZX5A 3ZFFA 1ND3B 1X8EA 2BUKA 1UZYA 2DVGA 4KG8A 3KS7A 3ZFGC 3MFAA 2AUYA 4HK9A 1S0CA 4LBQD 5KXCA 3KGZA 3OBRA 1MEC2 1JYCA 4LO8A 1SLCA 2Q8OA 3AMHA 1IKPA 1OI6A 1PK6A 2TEPA 4W6YA 4YNIA 3WCRA 5B2GB 1RUC3 4FOWA 1W2UA 2ZTNA 3QOPA 1ASJ1 2XJRA 2RR11 1QF3A 5GLZA 1JW6A 1ZRFA 1MQTA 2EXKA 3M3CA 2RM22 3S0MA 4WM8A 5I0RA 4IETA 1CGPA 3AZYA 4QD2A 2CAVA 4OI1A 1R093 3LGRA 4HKOA 2R073 2UYBA 4HVQA 4EJRA 4QX5A 3WDVA 4BMEA 3BPZA 4HKWA 4YVWA 1FAYA 5AC93 4RQPA 4DFSA 5CFDA 5EXOA 3VBOA 3KD4A 1IS6A 5J09A 4EN0A 3TN93 3PLQA 2JD4A 2C5DA 5CVRA 5DZEA 4GA9A 3ZPYA 3WG3A 5FO8B 2R062 1PO23 2ZMKA 4CDWB 1AR73 2PHRA 1JN2P 1ZBE1 2RS12 2F4PA 3ZXEA 3M3EA 3B9CA 3C2UA 5DZFA 2JXAA 3RYPA 4Q4X2 1C57A 3RJRA 3LAGA 1AX2A 3A0KA 1LENA 5CFCB 2HWC2 2OZ6A 5D8AA 1T6GC 1CAWA 5E89A 2FBEA 1ZBA3 3NV3A 3H8UA 3POYA 1VBE1 2BPA2 1RUE1 1GQGA 1RMU2 2D5HA 2WWSA 1RUD1 3SMHA 1N1SA 4PLNA 1AL22 1GYKA 3U4XA 5JPMB 1FOD1 2Y38A 4RSUA 5IUQA 5H9QA 3ZSLA 4EV0A 3IPVA 3OYWA 5JZGC 1GZWB 1ULDA 1GZCA 2VUJA 4S2GA 2WC2A 4FP2A 4GH4A 2QZ2A 3H1YA 3HT2A 2TUNA 2R043 3PTYA 4YFZA