4LUKA

The crystal structure of the p132a, y133g mutant of pyrococcus furiosus phosphoglucose isomerase in complex with manganese and 5-phospho-d-arabinonate.
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
189
structure length
189
Chain Sequence
MYKEPFGVKVDFETGIIEGAKKSVRRLSDMEGYFVDERAWKELVEKEDPVVYEVYAVEQEEKEGDLNFATTVLYPGKVGKEFFFTKGHFHAKLDRAEVYVALKGKGGMLLQTPEGDAKWISMEPGTVVYVPAGWAHRTVNIGDEPFIFLAIYPADAGHDYGTIAEKGFSKIVIEENGEVKVVDNPRWKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Correlated mutation analysis as a tool for smart library design to improve protein performance.
rcsb
source organism Pyrococcus furiosus
molecule tags Isomerase
molecule keywords Glucose-6-phosphate isomerase
total genus 40
structure length 189
sequence length 189
ec nomenclature ec 5.3.1.9: Glucose-6-phosphate isomerase.
pdb deposition date 2013-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06560 GPI Glucose-6-phosphate isomerase (GPI)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4lukA00
2EVXA 2XGXA 3NSTA 4N9HA 4Z07A 3DN7A 1DZRA 4HSLA 1J59A 3ACLA 1CAXA 3H1YA 3PNAA 3L2HA 4MGIE 4J1WA 2OZJA 2BEOA 5JSPA 4PIYA 5BY5A 1ZZBA 4KWJA 3HT1A 4D7TA 3RYKA 3ETQA 5FQ0A 4MV2A 4XFFA 4EWDA 4R8HA 3H7YA 2PAEA 5CU1A 2ZCWA 2ET1A 3FJSA 3KCCA 3UKTA 5I0SA 3I59B 4KU7A 2IXJA 1UIJA 4AXOA 5JSOA 3CL1A 1JUHA 2P17A 1ZVFA 5I93A 1EYBA 4WZCA 5KHKA 4EV0A 3KMHA 1L3JA 4META 5FPZA 3U11A 4XF4A 4QM8A 2H0VA 3I59A 4QGNA 4I01A 1RTVA 4JVAA 4EROA 1NE4A 3NVCA 3NW4A 4XF9A 2PHLA 1H1IA 3JZVA 1J3RA 4P9GA 1O5UA 3S7EA 3CEWA 1ZRCA 5FQ0B 1X8MA 2XKPA 4Q29A 3HT2A 3E5UA 4AQ6A 4QXKA 1G6NA 1CAUB 4JTOA 1GQHA 2GAUA 4MZUA 4DINB 3H1WA 4E2GA 2CAUA 3U10A 1YFYA 3U0ZA 3E5XA 2O8QA 5BV6A 1OMIA 2XKOA 4O9GA 5FLHA 4LA2A 1ZZ7A 3ST7A 1ZZ6A 3QACA 3O14A 1O3SA 1U12A 3QOPA 4YSFA 1SEFA 3WW4A 3MZHA 4HZFA 3NKTA 2ETEA 2D5HA 3E5QA 4AQ2A 4IEOA 3SXWA 3H50A 2XL9A 3MPBA 4QGLA 2WC2A 2BYVE 4ZU4A 4EWAA 5T3NA 3M70A 2GC3A 1O3QA 4AVBA 5C6CA 1LRHA 3TNPB 2QVSB 5BPXA 4YRDA 3IDBB 1O7FA 3H3ZA 2OZ6A 1Q3EA 3EO6A 1ZRRA 3LAGA 2IXIA 3H7JA 2Q30A 4XFCA 3SCFA 3FZ3A 1ZRDA 1RUOA 2GZWA 4Z82A 4J1XA 2B9UA 4JTNA 1J1LA 3TNQA 3LWCA 1TQ5A 2GC2A 5HI0A 1SQ4A 3ES4A 3CF6E 1FI2A 2UYBA 2C0ZA 3OCPA 2H6CA 4HVQA 2BNNA 5AVPA 3ES1A 1UW8A 1RUNA 3H8UA 2KXLA 4HVRA 3DL3A 4MGYE 4HN1A 2D40A 3VHRA 1EY2A 3ROUA 5I8TA 1ZZ8A 5BUVA 4MGZE 4LUKA 4KU8A 4LUMA 4Q0QA 1Y3TA 1Q43A 5J7MA 2N7GA 2XLFA 4PIXA 5E16A 3WW1A 1NE6A 3I7DA 3OGJA 4XF1A 3PVBB 1UCXA 1DGWA 1OFNA 1YFXA 2GH2A 1QWRA 2ZKLA 4E2QA 1OD5A 2EA7A 1J58A 3WW2A 4IEXA 5KHGA 3IWZA 1Y9QA 4F7ZA 4I09A 5I8SA 2XLGA 5CVRA 3UKNA 2B5HA 1UPIA 2QJVA 4IERA 1HW5A 1ZRFA 2CGPA 5I0TA 4HMZA 3E6BA 4KWLA 3SHRA 2I45A 4HN0A 4LTAA 4KL1A 3M3IA 1ZZCA 5LEJA 1LB2A 2Z69A 5I91A 3UKVA 3CO2A 5FCCA 4Q0UA 5JAXA 5JR7B 1NZCA 3KGLA 1YLLA 2ATFA 2OPKA 1RL3A 4OFGA 4XF3A 2MHFA 4RD7A 4HBNA 1CAWA 4XFAA 5EFUA 2HKXA 2IC1A 4MX3A 2PYTA 4XEZA 5LEKA 2PAMA 4I0BA 2QDRA 3BALA 3SMHA 4HVOA 4H7LA 1X82A 1O3TA 3HIFA 2HJIA 4IEQA 1ZNPA 3FX3A 1YUDA 1ZX5A 4BHPA 5FPXA 2Q1ZB 3SCGA 4CYDA 3NL1A 2GC0A 4AVCA 3FHIB 1WLTA 3LOIA 4QGMA 3D0JA 5I8YA 1CAUA 5EZWA 2BGCA 1DGRA 3FWEA 3KSCA 4FT8A 3RPQA 3BCWA 4HSJA 2EAAA 4FAGA 1J3QA 4F8AA 2UY8A 3LZZA 2IXKA 4MH0E 2F4PA 4Q0SA 5F1RA 4LA3A 2BNMA 4PJYA 1VP6A 1V70A 2PTMA 1RGSA 4ONUA 2Q4SA 4GULA 4E2SA 4D7SA 2K0GA 2DCTA 1CGPA 4YNIA 4XETA 4XFIA 5LRRA 1I5ZA 2PQQA 4PIZA 4MUVA 1X7NA 3RDIA 2VQAA 1IPKA 4AVAA 1VR3A 3RNSA 4ZU5A 4I02A 1PMIA 4JV4A 4R52A 3I54A 3IBMA 4L11A 3E6DA 3RYPA 2QCSB 1CX4A 4IETA 2E9QA 2QNKA 2GC1A 4IEUA 1IPJA 3LA7A 2V09A 5BXXA 2PA7A 3EQEA 1CAXB 4X6QB 3ZDSA 2Z2SB 1UIKA 2XL7A 5KBFA 4I0AA 2GU9A 3KGZA 1DZTA 1PM7A 2UY9A 4IEWA 1CAVA 2XHKA 4TLFA 3USSA 1FXZA 2CAVA 4IEZA 4QX5A 5E1RA 1OI6A 3S7IA 5KHJA 3E6CC 1WA4A 4IESA 5JCTA 5KHHA 1XRUA 4IEVA 2O1QA 3C3VA 1GQGA 5KHIA 1O4TA 1NXMA 1XE8A 4I2OA 1SFNA 3H1MA 4IEYA 2VPVA 4X6RB 1YHFA 4L2NA 4MGKE 1CAWB 4QMAA 1RC6A 1WGPA 3MDPA 5J3UA 2MNGA 2ET7A 4Q0VA 1QXRA 5K8SA 1O3RA 4N9IA 3G7DA 3IDCB 2IXCA 4LEJA 4K8FA 1NYWA 1YFWA 4LLOA 5FLJA 4ZU7A 4YARA 4WBBA 3CLPA 4UBGA 5D1IA 4FAHA 3E97A 3EJKA 5FDBA 2B8MA 3NJZA 2PAKA 3RYRA 2D5FA 2FQPA 2OA2A 1X8EA 4LULA 2XLAA 3RZZA 4UBHA 3DV8A 2BNOA 4QM9A 2WFPA 3BB6A 4XFBA 3H3UA 3GYDA 5FLIA 5LRSA 4A2UA 4Q0PA 2MPFA 1VJ2A 1Q5OA 2CV6A 1ZREA 3OD0A 5I0UA 1QXJA 4WVZA 3BU7A 1YFUA 2H6BA 1ZZ9A 3OTFA 2D93A 3FE5A 4I3PA 1H1MA 1QY4A 3DKWA 3ELNA 3GBFA 1XE7A 3MYXA 1EP0A 3PLQA 4XF0A 4KWKA 3EBRA 3HQXA 5C8WA 3B02A 3CJXA 2IXLA 4YYOA 1CAVB 3D82A 3LA2A 4UXAA 1UD1A 2VECA 5J48A 4BIFA 3H9AA 4NVPA 1LR5A 5CADA 4ORFA 1O5LA 2OYZA 4FBFA 3LA3A 5I0RA 1FT9A 4BYYA 3IIAA 5JSRA 1I6XA 2Q0AA 4XFGA 4O9EA 4B29A 4XFHA 3SCHA 2IXHA 3D0SA 4EWEA 3N4MA 1YWKA 3R6SA 3OF1A 2FMYA 2UYAA 1J3PA 2Y0OA 1EPZA 2K9ZA 4IEPA 3EHKA 1LKNA 2PHDA 4OLLA 4HLTA 3WW3A 2PFWA 3FFQA 3S0MA 3BPZA 4BH9A
chains in the Genus database with same CATH superfamily
2LRPA 1FX5A 2EVXA 3H8OA 4IGQA 4N9HA 1NA1B 4LIVA 4DXTA 3HAGA 4ZZ8A 1DZRA 4HSLA 3WNOA 3BYWA 4XQ4A 3H1YA 3UJOA 4CDUC 4COYA 1R1A1 5EJ3A 5TSWA 1OURA 1M4WA 1PGSA 5FP7A 1KJLA 2AH2A 5JSPA 4CDQC 3ZSJA 2OT7A 4JHTA 1N3QA 2GNMA 1LU2A 1AX2A 5JVVA 3GCXA 3WX5A 2WZ8A 2W9XA 4DXZA 5FP3A 3AP7A 1PVC1 2BWCA 5FY5A 1KS4A 2VW0A 4OUSA 4N53C 4D7TA 4TTGA 1XYOA 3WXPA 2JKXA 3OGVA 4Q2FA 3VB9A 3SKJE 3ETQA 3NV2A 4M0NA 1GSLA 5FQ0A 4EWDA 4R8HA 2BGOA 3QCWA 1GQPA 3TEZA 5CU1A 4HG6B 2ZGLA 3LFMA 4YZ1A 2EXIA 4XAEA 1XPWA 2ZA9A 1S0EA 1HRI2 1SHWB 5JSOA 2WAAA 3CL1A 1ZRIA 3AVRA 5FPVA 2VL4A 2P17A 4XYXA 3T08A 2DUPA 2WN3A 5FZLA 4DUXA 1EV13 4YZ3A 4EV0A 5FOBB 4Q4V3 1CX1A 1LOFA 3PUIA 5FPZA 5FY1A 4NWWA 2H0VA 2VXJA 3NJYA 5T5PA 4AFMA 1JYIA 1B35A 1NE4A 3D6EA 4R9DA 3FLTA 4EROA 2NYYA 1QQP3 2PHLA 3AZZA 1K5JA 1RUJ2 3D3AA 4Y4YA 4YVWC 2SBAA 1NUKA 4FP3A 1K5MB 4CP2A 3KT4A 2AENA 1X8MA 1GR3A 1AYN3 2IFWA 2YBPA 1UZVA 4COVA 4RS5C 4ZXEA 1B35C 3C2UA 5DAQA 3ZYJB 4LBLA 5FZOA 5CISA 1COV3 2B7YA 4GH4B 5JLVA 2RDQA 4BQXA 4L8QA 3WP3A 2ARCA 1G9AA 2YG0A 4DINB 4E2GA 1VAMA 1VAVA 3V0AA 3R4UA 4LBKA 4NIAA 5BV6A 2B42B 3O1PA 3BU0A 1W39A 1VBE1 3KV9A 4TZDA 3QACA 4JGYB 3WQ7A 2ZGMA 1W6QB 1QJX2 2GNBA 1I9RA 2Q1MA 1CZTA 1KJRA 1LOCA 1Q8QA 3BVCA 4LHSA 5DUWA 4AL9A 5FREA 2R042 2R0HA 4KMQA 4AI0A 4I30A 4HZFA 3NKTA 1VIWB 2R062 1SG3A 3VD4A 3J8F2 3TN92 2VCAA 4FFHA 3ZXJA 3Q8AA 2XQRA 4GB32 5K0UB 1LOFC 4V1PA 2E53A 4LBQD 1VRH2 1S0DA 1ULEA 2PMWB 5BNPC 5JXIA 4CDQA 1QJY3 1AYN2 4XJ9A 1AJKA 4ZU4A 2YGMA 3J26N 3I3QA 4KNCA 2XMLA 4XILA 4YGDA 4M3CB 1ONAA 4FSJA 3RFRA 4HK9A 5DUXA 5IAVA 3TNPB 2IZWA 3IPVB 2KA3A 5DZFA 5EPAA 3WV6A 2ZTNA 2ORZA 4COUA 5A70A 4YRDA 3PTRB 2CGOA 1O7FA 2GN3A 5FZIA 4K1ZA 1UY4A 1IOAA 3EO6A 3OPWA 1POV3 1ZRRA 3LAGA 3SH5A 3UV9A 1XSRA 2IXIA 4WM7A 2DF7A 3INAA 3K51A 3J8F1 1FMD1 2R043 2R32A 1SBEA 4J1XA 3WQ1A 3CZUA 2VUAA 1SLBA 1MS1A 3MIGA 1PZ7A 1WW7A 3FFZA 2XJRA 3A0NA 1J1LA 1QJEA 1W0OA 5FZFA 3ZFFC 3JUUA 1LOBA 2WNVA 4BB3A 3ES4A 4ET7A 2VMCA 2BFUS 3N9OA 3IDEA 5A7WB 3AC0A 1WBLA 4C91A 2CL2A 4ZS2A 2FD8A 1SPPB 2ZMLA 2XPJA 2IVIB 2WQ4A 4AK3A 2BNNA 1RUI3 4AEJA 3ES1A 1RUNA 4FVVA 2NP0A 3DL3A 2J1SA 1AYM3 1SLIA 2BP6A 4MGYE 1WW4A 1JYVA 1TMF1 4AG4A 3B01A 1VRH3 1C8M3 2D40A 1W8HA 2YU1A 4LR4A 4RQPC 4RR3A 5FWJA 4Q1PA 1WZXA 1ZZ8A 1AZDA 1JN2P 1ZA7A 4CEWC 4LUKA 5FYTA 2R7EB 1RUC2 1YO8A 1O4ZA 5HCHA 2VMFA 4P5HA 1HN0A 3WW1A 1NE6A 1NXD1 3VD5A 5JMOA 1UU6A 1BQPA 4LBQA 2ZZQA 1C1LA 1STMA 2CSGA 2DBIA 5AVAA 1DGWA 1ND3B 2Y8KA 3W9AA 5C3QA 1OFNA 5D2AA 1YQ6A 2FDIA 3PUAA 4XJZA 1QWRA 2CHHA 4Q4W3 5DAWA 5LASA 3HD8B 2Z42A 1W8OA 1TNRA 2EA7A 2QQUA 5JXGA 5DXDA 1L7LA 5JZGB 2ZKNA 1QKQA 3CKHA 3PUSA 3WW2A 4WVVA 4HONA 5CKNA 3OY8A 4A7YA 4R9CA 4RGKA 2BOJA 4PDWC 3JD73 3UKNA 2JG9C 5FZ7A 5A32B 4JGZA 4RN5A 2Y6FA 1H4GA 2RR12 3I3EA 2QJVA 1SLCA 4IERA 1W9TA 1ZRFA 3O1TA 2ZHLA 1ZBA3 4IE0A 3SHRA 2JXAA 2ZX0A 5C4WC 3O1OA 2DURA 1T6GC 2WDBA 1REDA 2Y6HA 2Y60A 4XABA 5DPNA 2XOMA 1BEV3 2HBUA 3MLKA 2ES3A 1C5IA 3VBHA 5FCCA 2O14A 5JAXA 2VXRA 4FFFA 1VBB2 1W6QA 3NKGA 5FY8A 5BNPB 3IAQA 1NZCA 4OI4A 1DHKB 1AF9A 1W2NA 2H0BA 1PO11 2YHJA 5FBJA 1NZIA 5FBZA 3PJQA 4XFAA 5JIAA 2IC1A 5FAXA 1DLLA 3KV6A 3MICA 1NY71 5LEKA 1KDKA 3GJBA 3M7AA 1XNBA 3O0XA 4XJWA 4XW3A 4EQVA 2QDRA 4L9BA 3FBMA 3SMHA 3M1HA 2ZGOA 1O3TA 3VBSB 3LE0A 1FAYA 5D8AB 1AXZA 1ZNPA 4PBPA 4UF0A 3WUDA 5HCBA 3FX3A 2VW2A 5FPXA 2SLIA 4AFDA 4HKOA 5JOWA 2D6MA 4CYDA 3V64A 1TVGA 2GC0A 2JJ6A 3GZTB 1HIXA 3LOIA 5CZKA 5J1XA 3ZFGC 4HPKB 3WG3A 2HWB1 2XHNA 3D0JA 5FXWA 1MS9A 1W06A 2YDEA 2BGCA 4NAOA 5DDJ1 5EZWA 4A42A 3FWEA 1ND3C 4FT8A 2R49A 3I97A 3POIA 4F8AA 4GAZA 1B35B 4MH0E 3OYWB 4Q0SA 4RL7A 4W6XA 2BNMA 3O7OA 3VKLA 3S57A 1QJX3 1VP6A 4OULA 3QH6A 1AR82 2EIGA 4QXHA 5GZDA 4XUTA 4ONUA 5LBBA 4GWMA 1D4M3 2ID4A 2XDVA 2VBDA 3ZSEA 1D4VB 1VMFA 4GULA 4JGZC 4ZPIA 4E2SA 2W92A 1NOVA 3U07A 3N7KA 3R0RA 1H9WA 4YLZA 5LRRA 2PQQA 2FMDA 2F6BA 4ISRA 1UPSA 4XUNA 1OLME 4CXYA 4GJZA 1RUH2 1CPMA 1AR61 1H8TC 1EAH3 1GMMA 5FOJB 3BI3A 4PBOA 3VZLA 1XNDA 2PLV3 3WF0A 1WWYA 3GM8A 5FR3A 5FZ0A 2WZPP 3I54A 1H2MA 2QDNA 3A22A 4B4RA 5EIYB 1OUSA 1MS5A 4W6WA 1CX4A 3KCXA 4IETA 3WLUA 2E9QA 4CEYB 5L7OC 3O1VA 1XYPA 1IPJA 4A45A 3IM0A 3EQEA 1NCQA 4H14A 1C57A 3WDYA 4D7YA 1CAXB 1D2QA 3AXDA 3WHUA 3ZDSA 2Z2SB 1YXWA 2VMDA 1NA1A 3HR9A 4Y22A 1A78A 3ZSLA 5E8AA 3AMQA 4IV3B 1PIV1 3OUJA 2HH9A 1CAVA 2WNEA 4I0WB 5B2GB 1OF3A 2RDRA 4MVTA 4TLFA 4AHZA 1F8VA 2V5YA 5F3EA 3VDAA 1POQA 2XQXA 4JRLA 1WA4A 2BOIA 3SH3A 4WVMA 4CSWA 1D2SA 1ZBE2 4UF0B 3N7JA 5IFPA 4N43C 3MF6A 5EYYA 2JDHA 5L7OA 3HBKA 4I2OA 1FV3A 4MGSA 3VD3A 4X6RB 2HWF1 2V4AA 4L2NA 5LCWL 4LQRA 4CRQA 1PVC3 3WINE 4QMAA 4UFJA 5GLVA 4MLOA 3AX4A 1CJDA 2MNGA 1CZVA 2ET7A 1CQ9A 1PX3A 5SV5A 3ZYHA 2VOVA 4AHYA 2VCBA 4NUBA 2ZX3A 3WNPA 5K8SA 3M3QA 1QDOA 2V72A 4CDWB 3CHXA 1HRV1 2FDKA 1W90A 1EUTA 1H8TA 1TME2 1CN1A 4N9IA 3G7DA 1NAEA 1IQDC 3AZYA 2BBVA 3ZYGA 3DXUA 3GDBA 3VN4A 3ZXKA 4YVWB 1UU4A 4WM7C 3WF2A 3P1IA 4FPOB 5IK8A 4XTMA 3WD5A 3VZOA 4AEDA 1YFWA 2NN8A 1PO13 3I3DA 5FMBA 1A3KA 2P6HA 1KQRA 3USUA 2J1UA 4FAHA 4P08A 5T50A 3E97A 3Q8BA 2VR4A 4XDOA 5FDBA 2OQ6A 3ACFA 3NJZA 1AUYA 2K2SA 3AZXA 3IN9A 2WYFA 4WM7B 1YQCA 3PIJA 1CESA 1E5IA 2FQPA 2ZJCA 4XBNA 1X8EA 1BZWA 1PNGA 5HCAA 1OOPC 2XWBB 5CKMA 3RZZA 2VZSA 1KITA 1OT5A 5GZCA 1V0AA 4GIQA 5FUIA 1V9U1 5A80A 3DYPA 5IFTA 3BIEA 2R072 4LLFA 1YYNA 4UOJA 1G8WA 5F6LB 3GYDA 3ZO0B 2NPIA 2JEMA 1OOPB 3JBG1 1V6JA 2ZX2A 5GALA 1VJ2A 4B3NA 1J83A 2CDOA 2XVKA 5IVFA 3FUQA 2B9VA 1IQAA 4PHZA 5H9SA 4CDWA 2DWRA 4M4RA 2YPDA 5E88A 2F17A 2VZ1A 2Y38A 4YWAA 1QXJA 2C9KA 4KH9A 1VBA2 4WVZA 5F3CA 3ZSKA 3I2OA 5DG2A 4GMP1 4KGGA 4D6RA 1ZZ9A 3O1MA 1TEIA 4CA9A 1FATA 3EXUA 2WNUB 2D93A 5FFOC 3T4HB 1GOHA 4R4XA 3RWKX 3DXTA 1BJQA 3U4XA 4D6SA 2A73B 1PGW1 2W91A 4XJAA 1HDKA 5IVCA 1SMVA 4H7MA 1MPXA 4N53B 4NN0A 2VOWA 3MYXA 5FYMA 5FYCA 2DVGA 2ORXA 2E63A 4Q4X3 1W8ZA 2JG9A 1QNYA 3B5LB 1AR62 3ZN5A 2A75A 2MEV2 2BWAA 4S2FA 2WS91 2XJTA 4CDUB 4JGYC 4YPJA 1CAVB 1G9DA 2WSUA 4YW2A 3LA2A 4ASKA 3S6PA 1FPN1 1B09A 2ZBJA 1ULGA 2YXSA 3K4DA 4K7JA 5A6YA 1DG6A 2BJSA 2HWC2 2RM22 4RQPB 5IVJA 2BBAA 3IMNA 1ENQA 4BIFA 1AR73 3N9PA 4XOGA 1UOBA 1LR5A 5LBCA 5DAPA 2IWGB 2OYZA 1O5LA 3R4DB 1F31A 1NCRC 3DEMA 3ZX7A 1W9YA 3M3CA 2RS33 2WKKA 1DGLA 4QPGB 1WCSA 2W1WA 4DIQA 4G9SB 3T0BA 3ZFEB 1I6XA 4QKDA 2B46X 2Q8EA 1X9TA 4O9EA 1QJZA 2YY1A 3HWJA 3MIBA 5KXDA 1A8DA 2HWE3 5A3UA 2XONA 3ZOIA 2FDGA 1K12A 1XNKA 5ANNA 2X5IB 2I07B 1AR83 1ASJ2 4BPZA 2NM1A 4W6YA 4XUOA 4PLNA 1MVQA 4INDA 3POSA 5IVYA 2P1BA 3LEMA 4DXRA 1R082 2DTYA 1DF0A 3MUZ1 4HOOA 1K3IA 1EPZA 1LHWA 3UETA 4ZXKA 2TBVA 4Q4W2 3EHKA 5EXOA 3ZXGA 3VD7A 5CA6A 1REEA 5FZGA 4B1MA 4QDQA 1LECA 1VBC3 4QQ2A 3NSTA 1H4HA 2P3JA 2WQZC 3RWNA 5CB7A 4FFIA 3DN7A 4P9JA 1RJ7A 1FV2A 4AGRA 5KXEA 2WZR2 3ZXEA 1SACA 5IK4A 4W50A 1H2LA 1WMEA 3KS7A 4D94A 1GU3A 1OA2A 2ZACA 3T0AA 2XJVA 2BEOA 4M0HA 1A8MA 4LO6B 2YC4A 2WLPA 3LB9A 5F3IA 4CE8A 1RUG2 4FOYA 1ZBE3 3QBQA 4CP9A 1JYXA 4PF1A 2QFEA 1R092 1QJU2 4YW7A 2DUOA 3JB4C 3T2OA 4AI8A 1NQJA 4LJHA 4M01A 2W0XA 1ODNA 1NLRA 4IV3C 2R063 4CCEA 3ZSMA 2PAEA 4BCUA 3N3HA 2ZCWA 2ET1A 4DMIA 2VZRA 2BGPA 4GZ9A 3KT7A 5I0SA 2Y33A 2VMHA 2HWB2 4GA9A 2YZ4A 4HK8A 2OS2A 1UIJA 3CZJA 4AXOA 4EN0A 1JUHA 3AZVA 2P3YA 1ZVFA 4FO9A 5I93A 2C26A 3W20A 1DGRN 5F2WA 1L3JA 2R1BA 4FPGA 3U11A 5LBEA 4Z92B 2ZGPA 3I59A 2WWSA 1LENA 2VE1A 3NVCA 3NW4A 1C28A 1AL22 4XF9A 4XUQA 2B39A 4F3JA 4LOTA 2D6OX 1RUD3 3S7EA 4L97A 5B4XA 3M3EA 1YC61 1QJU1 2NMOA 2NZ9A 3NV1A 2XKPA 4QKNA 4XHXA 4LBOA 3PVEA 3PURA 4Q29A 2Q8OA 3OY8B 1NCQB 3WDXA 1Z0HA 1GP5A 1NCRB 3POFA 2OPWA 2XUMA 1PO23 1G6NA 4J25A 2BW8A 3AFGA 3GJAA 2ZGKA 5FWEA 1WMFA 1CAUB 5BNOA 2GAUA 1FOD2 2Z4FA 4KQ7A 3LEGA 1YFYA 4EN6B 4CDXA 2ZXQA 1W9SA 5FLHA 3RZKA 2LALA 5LA2A 3ST7A 2E33A 2ERFA 1ZZ6A 5ACA3 1RHI3 1O3SA 3KQ4B 1DFQA 3VGIA 4YSFA 1SEFA 5FZBA 3QLQA 3MHZA 1TG7A 2ADDA 3VDCA 5HPOA 4QXCA 4F83A 4FPYA 2HWD3 2BERA 3E5QA 1S1AA 4RR3B 4MGQA 3N9LA 3H50A 1DYKA 2VVEA 1W6OB 2GNTA 2W46A 1L7QA 3VKFC 1OVPA 3LPGA 4AI1A 4BQYA 2UWAA 4DB5A 3NAPB 2HEWF 3NV3A 4LO8A 4NAMA 2WIIB 3MV01 1JODA 2R073 5LATA 5JXHA 1AR91 3OBRA 4EWAA 3ZFFB 3MF9A 2CY6A 2R1DA 3UESA 5C7GA 2WFF3 3HMYA 1COV2 5APAA 4FTEA 1F9KA 1OA3A 4TLGA 4AVBA 3I2IA 1LRHA 5FUNA 3DPRC 1AR63 5BPXA 4O61A 1AHSA 1AYM2 3GZUC 4CUGA 1RUG1 1PK6C 2J1EA 3IDBB 4Y5SA 5GZFA 1GV9A 1GOFA 2RM21 2LW8A 3OGRA 2R16A 1OC1A 2RDNA 3DYMA 3H7JA 4QKFA 3HVDA 1MEC3 2W5FA 3AL5A 1UOFA 1SCRA 1GNZA 2VQTA 4UFHA 4Z82A 4AAXA 5A33B 1XXNA 4JTNA 4LKDA 1YJLA 4GB33 2A1XA 5BNQA 2UWCA 2Y6KA 5LZ6A 1HXS3 2X5IC 2GC2A 5CFDC 3THTA 1SLAA 1R1A3 5HI0A 2ADEA 1Q56A 1CD3G 1Z78A 1W8NA 1VBA1 2UYBA 4NPMA 3GNEA 1R081 2C0ZA 2VUJA 3OCPA 4ES9A 2WO3A 5L9BA 2NLRA 1ASJ3 4BZ4A 4CUCA 1GNHA 1NQDA 3WG1A 3TB0A 4HVQA 2JDPA 1UF2C 1Y9MA 2YFZA 4X8NA 5DAVA 1V6OA 1VB2A 3A4UA 4NRPA 5AVPA 1W6PA 3H8UA 4BQ3A 4RA0A 5LA1A 1URXA 4OI1A 1S2KA 3K75B 2VH9A 2R061 2W08A 4PI2A 4Q8LA 3HEIA 3DKQA 1UL9A 5FYZA 2DCYA 5A3OA 1LHUA 2GMPA 2WINB 3GBGA 1RITA 4K3UA 4KU8A 4LUMA 1RUJ1 1Q43A 1Y3TA 2N7GA 4Q0QA 4YM1A 4AEKA 4DUWA 5LA0A 1UNBA 4XE9A 2O8OA 5HCFA 3UL2A 3PVBB 3IDAA 2G9FA 5KC5A 3CJIB 1UCXA 1W28A 1BHGA 4LK7A 4ASMB 3B93A 5IAXA 1AVBA 3J4UH 4RS5B 2RMU1 5A33A 2ZKLA 5FV3A 4R4ZA 3NNLA 3T0DA 5FYVA 4BOWA 4C8DA 5JI9A 3K3OA 4R9BA 4BE3A 2I74A 2D6NA 2WT1A 4IEXA 1WW6A 2PN5A 5ABJB 4NIHA 3PTYA 2AYHA 2WNUA 5I8SA 5FP4A 2XLGA 5CVRA 4F7ZA 1X9PA 4JQTA 3SEEA 1AJOA 1ULFA 3DPRB 3ZR5A 3PUQA 2TUNA 4GWNA 5GZGA 4FOWA 1HW5A 2I2SA 1W6OA 1IS4A 1HRI3 3RGBA 2J1VA 2VNGA 4HN0A 3BUCA 1DCSA 3BTZA 3ZN6A 5FKBA 4KL1A 5ABJC 1GZ9A 4OYUA 5LEJA 1LB2A 4YGCA 1HLCA 4A4AA 2VTXA 5I91A 4QHZA 4R9AA 5LK7B 3CO2A 3WDTA 4D6QA 1QDCA 4CPBD 2VVFA 2JE7A 4HT1T 4QKBA 5AC92 4N7IA 2ZGTA 4OCTA 4Y20A 3KGLA 5FZHA 2OPKA 1AXKA 3IT8A 3L2YA 4XF3A 4RD7A 5CYYA 1IG3A 1DYOA 4YW5A 2HKXA 5D21A 5C9AA 4IV1B 1GZCA 1EPWA 1V9U2 2J22A 2XR4A 2PAMA 4QPGC 4CP1A 2DVFA 5C8CA 1CZSA 4HVOA 3VUOA 3AZWA 3WNMA 3ZMOA 3ZXLA 3J7HA 4IV3A 2Y26A 1CIYA 1ENRA 5F5IA 4Z2WA 4YW1A 2DU1A 4CDWC 2A3YA 2VVDA 2JE8A 2C1FA 4P02B 5J98B 1ULCA 3SCGA 1RVF2 1VBD2 2JIJA 1PO22 2LM3A 3FHIB 3IKWA 4URTA 4EE2A 5FZKA 1C8NA 4RHV1 1BMV2 4CEYA 1CAUA 2JICA 1UU5A 1DGRA 3AJZA 3B9IA 5FYUA 3P3PA 1UX6A 2ZGUA 3RPQA 4HSJA 4HANA 3UGGA 4SLIA 4CVUA 5C3SA 1RUF1 5FYIA 5T55A 4GMP0 4M3CA 4WV8A 1WA6X 2XBO3 2ARXA 3KLSA 1OQ1A 4CUAA 4QQOA 2Q4SA 3WDWA 3IB3A 4IQPA 5FY0A 3J8F3 3BGAA 2A6ZA 1WCDJ 1XOYA 2QZ2A 4OUMA 4D7SA 2K0GA 2RS51 4IV1A 2DCTA 3MIEA 4NPRA 1O59A 1U5IA 4YNIA 4YGBA 2LUWA 4B4PA 4PIZA 1LHOA 2BQPA 3HN3A 5JUVA 5FXZA 1N1SA 3KF5A 3K46A 1IPKA 4AI9A 2VTXJ 1RUE1 5B4NA 4YZ2A 1OLRA 5AC93 2YGLA 2YC2A 1OPMA 5A3TA 2YV8A 3KT1A 3MIDA 1Y9GA 1UXZA 3POEA 3E6DA 3QD6A 4Y1YA 3RYPA 4LIUA 4OUEA 4AVVA 5L19A 1KDMA 1PO12 2QCSB 1QNWA 1LOGA 3I3BA 5BNOC 1SFPA 3VBOB 1JZ7A 4IEUA 1W2AX 5GKAC 3O12A 4HPKA 4AHXA 4OMDA 1SFYA 1C8M1 4YG6A 5DUVA 3BIWE 1MEC2 1BKZA 1LODA 2XL7A 3H42B 1QOOA 4I0AA 1RVF3 1VBD3 5EHDA 4ATFA 4BMBA 4XQWA 5DQ0A 3RZLA 1DZTA 3MIHA 1PM7A 2DVBA 2QE3A 3M8LA 3N9QA 3WNLA 3O0VA 1IKQA 2UY9A 1PK6B 3VHNA 1H30A 5JZGC 5FZ4A 1HQWA 3ENRA 3VHPA 2XHKA 1OQDA 3B7MA 3USSA 2CAVA 4IEZA 4QD2A 5E1RA 5EV7A 3I2JA 4D0QA 1UZYA 5HV0A 1L7RA 1G86A 3KHCA 4UWDA 1R1ZA 1NY72 3ZYFA 4W65A 4DFSA 3KM5A 2B4KA 5KHHA 1XRUA 4DS0A 4IEVA 1GQGA 1DQ2A 4YM3A 3DGTA 1O4TA 3MIFA 1S4CA 1O8SA 2LS6A 1POV0 1SFNA 2Y6GA 5F8PA 3SNMA 1A34A 5A1AA 2ZS6B 3ZYBA 2P6CA 4OHXA 5IK7A 2JD9A 4A6SA 2VTFA 3JQWA 1PMJX 5HXVA 5LY1A 4K20A 4ZONA 1D7PM 3I8TA 1YIPA 4Q5OA 4CEWB 2HWB3 3CNAA 1JOJA 2P2KA 3WY6A 1QXRA 3DYOA 5FZAA 3WF3A 1W04A 2QQJA 2X5IA 1IPSA 3THPA 4UAPA 3VBFA 5A6ZA 4CU7A 3ZMNA 4NIDA 2VOTA 2ZOEB 1JOPA 1W9FA 5A3WA 4N43B 3SEPA 2G1MA 2EAKA 4OMCA 4OQ8A 1S0JA 4QX1A 5K7PA 3DPRA 4LEJA 3LPFA 4K8FA 1U5XA 4XAAA 2VCCA 1GLHA 4I3GA 3TOJA 4CDUA 5J96B 5H9PA 4ZU7A 5C3PA 5FZDA 4YARA 1ACCA 3ZXFA 5D1IA 4BDVB 2AZ5A 4Q1RA 2GH8A 4XVHA 4K9SA 2TNFA 5FXVA 5K4LA 2A3WA 2CWMA 4IW3A 3ZIXA 1TMF3 3THCA 4Q4X2 4YM2A 2JDAA 2OA2A 3GGLA 5C4WB 4O7XA 2VC9A 4LO4B 1H6XA 5C33A 2VZPA 5JOXA 3NNMA 3PIGA 2XLAA 1QH7A 4UFIA 4AQSA 1TZOA 1DQ6A 4MYEA 1BBT1 1HJGA 3DV8A 3VBRC 5F9TA 5T54A 2JG8A 1W8FA 4XFBA 5G05L 2VMEA 3LDKA 2MPFA 3B94A 1DQ0A 5HV4A 2WT2A 3FHQA 2ZGRA 1Z7S2 4A3XA 5HBAA 2WNUC 1SBFA 3GZEA 4Z8BA 4LT5A 4PDWB 5A7NA 2WAOA 2DFBA 2ZGSA 3EB7A 4XDPA 5H9RA 3PVNA 3OOXA 2Y64A 3WP4A 3RMYA 2C4XA 1W6PB 2VZUA 3ZXAC 1FMD3 2R041 3F2ZA 5GLUA 4P9WA 4DEVA 1ZBA2 1OUXA 3NV4A 1FNZA 1GANA 1W2OA 4EZHA 1H1MA 2E31A 4K1YA 4B7EA 1G7YA 3PJYA 3JD71 3GBFA 5DUUA 5IK5A 3P6BA 1MS4A 1XE7A 3MW4A 3AP6A 3UNPA 5ISLA 4FOQA 5EQUA 1XJAA 3PLQA 5HXMA 1ZBA1 1LTEA 3U4SA 1UYXA 3VZJA 1WLWA 1RUE3 3EBRA 3B02A 1HN1A 3HQXA 5C8WA 1OKQA 1T6BX 3CJXA 4CDXB 1F4HA 2AR6A 2IXLA 4DNYA 1HB2A 3ZFGB 4QQPA 1N3OA 3WCSA 1F5JA 1PGL1 4YVWA 2VECA 1MACA 2YBSA 1O4YA 3JXSA 4P9YA 4QPIA 3I2GA 1JS9A 2DFCA 2HLEA 3MO4A 4NVPA 2GDFA 2QUOA 4ARXA 4CDXC 5CIRA 5CADA 1IS6A 3O1SA 5I0RA 1RUI2 1LOEA 1W03A 3I2HA 3OUIA 1PGW2 4U2AA 3P5BA 4MSVA 4Q4Y3 5EP9A 4OHZA 5JSRA 1MVEA 1H9PA 3H0OA 4NOTA 4XCAA 4W8JA 4OHYA 1XNAA 2Q0AA 3VKOA 4EN8B 1OF4A 5IATA 1JTZX 4XFHA 5K0UA 2DVDA 2AGSA 2IXHA 3I2KA 4MADA 5FP8A 5FZ9A 3ZFFA 1RUH3 1HKDA 1PM4A 2JECA 5FK8A 4DOUA 2EXJA 3D0SA 1IZ3A 2JG8B 1W8WA 1H0BA 4Q26A 1OH4A 3VBSC 2HEYF 1S2EA 3VBRA 3R6SA 4MXWA 3BTYA 5CAZA 2J42A 5JPNB 4UI9L 5A3PA 4YG0A 3OEAA 4C90A 4WVMB 1VBE3 4CCJA 4IEPA 2KR2A 3APBA 4HLTA 4OLLA 3WW3A 4E4SA 2PFWA 5FRAA 3NJXA 4JC1A 3ZKUA 4BK4A 5A6XA 2WJSA 2OX0A 4HFSA 4IDZA 5T5LA 4BH9A 3V0BB 4J6GA 1H2NA 2XGXA 1AR72 3UGHA 2RG4A 1T2XA 1QHDA 2QQWA 4Z07A 1J59A 1GUIA 2FZ1A 3LGRA 1CAXA 4W4ZA 4C0BA 3PNAA 4C0HA 1MQTB 2EXKA 1UO9A 1W99A 2OZJA 1QQP2 5KXCA 1QU0A 4QU2A 5DAXA 2ZPXA 5C3OA 2VOKA 3ACGA 1C4RA 1LESA 1AL21 2HWC3 3HT1A 3E1F1 4FP2A 2RVAA 1NT0A 5CKQA 3VBFB 5LW9A 1QOSA 4Q4W1 1MZ6A 1KFXL 1K45A 3RYKA 4MV2A 4XFFA 3LKJA 1KFUL 5FMOS 3H7YA 5F2SA 1OLQA 1N1VA 1W05A 5FJKA 4Y3OA 5GM0A 4JRAA 5A1LA 2P3KA 4QHOA 1KD7A 2VNRA 1W6MB 3I59B 1EUUA 3LEIA 2IXJA 4KU7A 1UWWA 2RJ2A 3C8XA 3I2DA 1XB9A 3L9JT 5EYXA 5CFCA 5FZCA 2HWE2 2VW1A 4WZCA 4P9LA 4KI5M 4LK6A 2JDNA 1FPN3 3VHOA 5FO7B 1SLLA 2D7FA 2D3RA 1HRI1 4FPLA 4META 4D69A 2EIDA 4QM8A 4QGNA 1LGNA 4OHWA 4I01A 2JD4A 3ZN6B 2WWUA 3ILFA 3AKPA 1MZEA 3HQRA 4EYUA 1BEV1 2XJSA 2AEZA 1W2TA 4P9GA 3WNXA 1GKBA 2VNVA 1O5UA 3CEWA 4H55A 3SLIA 3MPPG 3B9CA 5FZOB 3WNNA 4LHNA 2QQMA 3SISA 4YZ4A 2VJXA 1MZFA 2WT0A 4QB1A 4UW3A 5DN2A 1GP6A 1IHMA 1YJKA 1ZA4A 3WP6A 3OPZA 1DIWA 4ISQA 3NWKA 3R4SA 3WNKA 1GP4A 2P5BA 5F32A 4LHKA 3V0BA 1DQ1A 4JTOA 2JIGA 3K4AA 1GQHA 4CCLA 4CU9A 5FYBA 3H1WA 1G9FA 4QHBA 1LGCA 2CAUA 4WM8C 4YFWA 3RVHA 3WVJA 4A7ZA 2O8QA 2XKOA 1H1AA 5FY4A 5J09A 4TN7A 4RS5A 1AX0A 3TEYA 3RZHA 4LA2A 1R64A 2XJPA 3AP9A 2WS93 4IE4A 3O14A 4MXWB 3A0KA 3AYAA 4XMAA 4GJYA 1S2BA 3WQBA 1PVXA 1Y7BA 4Q4V2 1XC6A 1QF3A 3A21A 5CFCB 3WW4A 3MZHA 1D4M2 1TMF2 1RXFA 5BNNA 2XUEA 3VBUC 1JYCA 2JENA 2VZQA 2D5HA 2RV9A 2YBKA 3Q9OA 1JUIA 3NO8A 4MXVA 2D6KA 1RMU1 1DGWX 3VD9A 2XJQA 4CPBA 3MPBA 3POBA 4QGLA 1PIV3 2RS12 5FJHA 1YQ8A 2WZR1 3C7GA 3WT3A 5CFCC 5A3MA 2VBBA 1BVVA 4V2WA 3HJRA 2BFUL 3M70A 3S5QA 2UU8A 1Z7S3 3LFIA 5KR7A 1O3QA 3ZKYA 4QPYA 2YROA 1DQ5A 2ZEWA 3ETPA 1R091 2JKBA 5A7SA 4CEYC 3T3YA 5C6CA 4AGGA 3TEWA 1EAH1 3ZFGA 5C5TA 4FTSA 2FCUA 2EICA 2OUJA 1HV1A 5AC91 2VZOA 3AMMA 4UFLA 2JG8C 4LKEA 5LWBA 1OA4A 1UYYA 1QMJA 4SBVA 5FMCA 4YVSA 4LNVA 4FPKA 2Q30A 2Y6JA 3VV1A 2QQNA 4RSUA 1KRIA 4JDMA 3WDUA 2B45X 2JB4A 1OPOA 4AQ6A 3U78A 4AWDA 2GZWA 1P8JA 2RJLA 1UN1A 2K46A 4BJ0A 1FOD3 3HNMA 3LOBA 2VAUA 3VZNA 1F4AA 1TQ5A 2MEV3 5F37A 4Y20B 1SQ4A 4CU6A 4RFT0 4OI2A 1W0PA 1HRV2 3CF6E 3AMNA 1O8PA 4BXSV 3VL8A 1LCLA 2XWJB 5FY9A 2QQKA 1UZ0A 4JZRA 2V73A 5LK5A 4WVWA 1H8TB 3K2OA 1AYN1 4E8DA 4RHV2 1H8VA 1UQXA 2W95A 2H6CA 3RMXA 3ZYPA 4AR2A 5A7QA 5M0TA 3WR0A 1WD3A 1M06G 3J7LA 5IW0A 1UW8A 1PO21 2X10A 1BCXA 4AF9A 4Q8KA 3LD8A 4HVRA 4QPIC 1S0FA 1DLCA 2VMIA 3KQRA 4HN1A 1W0NA 3OUHA 1HB4A 3VHRA 3N7LA 4RGAA 2PXJA 3NRUA 3VDDC 3R05A 5BUVA 1MS3A 3M4FA 5ERLA 3ITQA 1W2UA 4JDNA 2XLFA 3IIIA 4KG0A 4YM0A 1NG0A 3NNJA 4XQDA 3V56A 3I7DA 1W6NA 2E32A 3OGJA 4YVSB 2ENRA 1G9CA 3OBTA 3RI9A 1BMV1 5A1FA 5F6KA 2VNOA 2D43A 1YFXA 1NCQC 4A7KA 3RJ2X 2W1QA 4DQAA 2QKDA 1OD5A 3MI8A 1I5PA 3W5MA 2ARBA 1LEMA 2W68A 1F5FA 1NCRA 1UKRA 1QJU3 4BQ5A 3SH4A 2PLV1 3ZPOA 3IWZA 4Z1VA 1Y9QA 2BTVC 2C24A 2A71A 3HBZA 5CNAA 1ULPA 1N47A 3LSDA 4AFAA 2PELA 4YG3A 2B5HA 2YC0A 1CONA 4DY5A 1TME1 2CGPA 4KWLA 3E6BA 5J37A 1JU3A 2BDRA 2I45A 2JX9A 4M3CE 3VBOC 4K40A 4N90A 2QZ3A 2Y0IA 2DCJA 1Y43B 1HV0A 4KG8A 4NHKA 3H8RA 1CR7A 2Z69A 3MW2A 1QQP1 2AREA 4P9IA 2BVVA 5F5AA 3UKVA 4E4DX 2L9LA 2CYFA 4XXPA 3BODA 3KD4A 5JR7B 2YFUA 1UY3A 3U1XA 5JOYA 1U5YA 1ALYA 2VO5A 3AMHA 4GD4A 2ATFA 1VB4A 2W39A 2MHFA 4HBNA 1CVNA 1AR71 2X53S 4MX3A 2PYTA 1JZ8A 1IGOA 4XDQA 2OIIA 3J7NA 1LOAA 4K21A 5FYHA 1COV1 1NLQA 1X82A 3HIFA 3T2PA 5L9RA 1HQLA 3ME2A 2HWF3 4BHPA 2Q1ZB 5I0DA 4FPCA 1GICA 2HWE1 1QH6A 3LDRA 2FDHA 1WLTA 1Z7S1 5GJ6A 5FYYA 2VQUA 2RR13 4UW5A 1JYWA 1K5MA 4QGMA 1EV11 1JH5A 3K48A 3ZLIA 4GH4A 3KSCA 1XSQA 4LO7A 1AYM1 2GMEA 3BCWA 1V6LA 5A7OA 4BIOA 5IHRA 2EAAA 1W8TA 4QXBA 4DEQA 1J3QA 2UY8A 2W2IA 2IXKA 5F1RA 5EJZB 4LA3A 4Q27A 5C9AC 5FPAA 1H6YA 3ZIWA 2RM23 1Q8OA 5JIUA 1RGSA 4QPWA 3TEXA 3UJQA 3I4IA 3NAPA 1BYHA 1K5MC 3THDA 5AFBA 4NE9A 2P37A 2CU5A 1HJFA 3MW3A 3GHMA 5FO9B 4U36A 1JW6A 1XQNA 5FZMA 5JDBA 4XETA 4XFIA 3PL0A 5DG1A 1I5ZA 1U0AA 4CCOA 4L99A 4UYBA 4MUVA 2XH6A 1X7NA 3NNGA 5C70A 1LHNA 3AKTA 3ZVXA 3HNBM 3RG0A 2FDFA 4AVAA 3VDBA 2HWF2 4C1WA 3FLRA 2ZABA 5D8AC 3VBFC 4PCRA 1PMIA 5LB6A 4AFCA 4UW6A 1MS8A 5AFEA 4L11A 5L36A 4UW4A 3MLLA 2V5DA 4BWOA 2XB6C 2QNKA 2GC1A 1JZ6A 5A32A 1S0GA 3LA7A 2RS13 4JX0A 1MQTA 5BXXA 2QQOA 4IGOA 2HWD1 4NO4A 3GCWA 3N35A 1JHNA 4BK5A 4WZFA 2BUKA 4LKSA 4RQPA 2GU9A 3MFCA 3KGZA 1QEXA 1IG0A 4BQ4A 3GHNA 4IEWA 1GFF2 2E7QA 2QQVA 2R6QA 3CDZB 1XU2A 4Q4V1 1HB3A 1FXZA 4QX5A 2Q1FA 3WP5A 4Y26A 4FCAA 3MEPA 4BA6A 4IESA 1VLNA 1RUI1 1BBT2 4A41A 3PU8A 3ZDVA 4LBQB 3C3VA 4JHZA 1BXHA 2ZHNA 1NXMA 1XE0A 5IJRA 1V00A 3H1MA 1VRH1 3I3MA 4XBQA 4K6BA 1YHFA 1ODMA 4QX3A 1PGL2 4MGKE 1AL23 2E7AA 1BK1A 5A7PA 1W9WA 3VKMA 3N9NA 1ULDA 1WGPA 2E7TA 3MDPA 4GXLA 5J3UA 1BVP1 4CTEA 4GH4C 3OGSA 2WO7A 3KV5A 3RZGA 2IVJA 1DP0A 3BOWA 3LDBA 2WN2A 3P3NA 4YVSC 5FZ8A 5H9QA 3N7MA 1EAH2 4Y5TA 4XPVA 4NRQA 3ZN4A 3JU9A 4AZZA 4CCMA 4Z2AA 3IDCB 3OB8A 2IXCA 1J1TA 3T2TA 4QX2A 4CZSA 4XZUG 1V6IA 3KVAA 3HNYM 1FMD2 1NKGA 1GNYA 2Q8CA 4QWNA 4IL7A 5FLJA 4XACA 4WBBA 1O6UA 2R30A 1MZ5A 2OKXA 1JHJA 1REFA 1S0IA 1ULOA 1WBFA 3CJIA 3DECA 4XMIA 1PNFA 1VMHA 1UKGA 3EJKA 5A6QA 3LCPA 5IVVA 3RYRA 4NRMA 3WZ1A 3TYJA 2FZ2A 5FUPA 1US3A 4YW4A 1V6NA 3ILNA 1OQEA 1X50A 2WLQA 4LHLA 3U14A 2HWD2 4H2AA 3TAYA 4NIGA 2E51A 4YFZA 1RUC1 4G3YC 3LF7A 2BU9A 1ND3A 4UBHA 5IWFA 3VZKA 4OHVA 3ASIA 2RR11 1W6NB 1HX6A 2BNOA 4QM9A 4V2VA 2A6YA 1VBC1 3EMRA 4HKLA 3O1UA 3BB6A 1KGYA 4AHWA 4A2UA 4Q0PA 5IUQA 4XTPA 2WA4A 3UYJA 4YZ5A 5FZ6A 5J48A 2KD7A 1NX9A 3O5SA 3WOGA 2CV6A 1ZREA 3OD0A 3MFAA 1RVF1 1VBD1 4CDQB 3ZFEA 1MEC1 1O91A 1YFUA 2ARAA 1QOTA 1Q8SA 4QPGA 1MR5A 1C5HA 4D3WA 4ZKTB 3ILRA 3Q8CA 1UXXX 3FE5A 1YNAA 4AW7A 5ABJA 1QY4A 1GWMA 3V65A 2PHRA 1IKPA 3DKWA 5E89A 1RMU3 5C4WA 3MLJA 1E57A 1VPHA 2D3PA 1KS5A 2G9GA 3CMGA 4JGYA 1VALA 2WUHA 2GSYA 3OG2A 3AXEA 2VQ0A 5F7UA 3C7EA 2V4VA 1UAIA 2OVUA 2WFF1 3V0AB 1KEXA 2JDYA 4TSVA 2BZDA 2Y6LA 4UXAA 1UD1A 2YB7A 5FPUA 2WR9A 1SDWA 4M4PA 5A3LA 5C3RA 1NA1C 4LMFA 3H9AA 2ZAAA 4XIOA 2VZVA 1CWPA 3B00A 4D8MA 4JDOA 4FBFA 1UYZA 5C71A 4XCBA 3WHTA 5CFDB 2DV9A 2FCVA 3K3NA 2RJKA 1WMXA 3Q8EA 3A7QA 1HXS2 1GYKA 1QJY1 2JDMA 4XFGA 5FY7A 2OW4A 2PHXA 4B29A 4Y1XA 3SCHA 2AEYA 2WNVC 3OJBA 1BLZA 2WA3A 4GB31 3ATGA 1DQ4A 1EV12 1MS0A 2ZGQA 5FMDA 3TN91 2A7AA 1UY0A 5FPLA 4LBMA 4EWEA 3ZXDA 4LE3A 4PT6A 5JMCA 2YU2A 4CEWA 3GBWA 4Y4RA 2UYAA 5E6HA 2WSVA 1VBA3 3JQXA 3KZ4C 3S5AA 4CCKA 1J3PA 2Y0OA 3FHAA 3OPTA 1W6MA 2GP5A 3POGA 4PLOA 2K9ZA 2VD7A 5BNNB 4LKFA 4QT6A 2PHDA 3K4ZA 1SDDB 1YRZA 1PK6A 1RHI1 3FFQA 4QAWA 1JYNA 2ZAHA 3BPZA 3S0MA 2PHFA 4OQ9A 2BV4A 3WF4A 1FPN2 2QBXA 3JB8A 1K42A 4MHUA 5DABA 3T30A 3WG4A 3ACLA 1RB8G 5FO8B 3H3LA 3L2HA 2J1TA 5CG8A 1CIWA 3CIHA 4J1WA 4MGIE 2Q8DA 3WSOA 4AEDC 5FZEA 1PHMA 4ZZ5A 2D3SA 2FCTA 4LO5B 4QDRA 3RQ0A 1YI7A 2R0FA 1JZ3A 4PIYA 2R071 2G4IA 5DMYA 3AMPA 3POJA 5FIXA 1ZZBA 4KWJA 4Y33A 5BY5A 1RHI2 3PMSA 4GWIA 3PDQA 4JQRA 2WYSA 3ZPYA 1SZBA 3WG2A 5K0UC 5C5UA 2EALA 3N36A 2CWSA 3VBSA 4DRVA 2RS32 1WD4A 4QU1A 3FLPA 4Q4X1 3FJSA 2NMNA 2P3IA 3DF0A 1S0BA 3KCCA 3UKTA 2BPA2 3W58A 3AFKA 4FI9A 4FXGB 4HETA 2HBTA 5LBFA 4CP0A 2P4EA 2RE9A 3J9SA 1POV1 2OXBA 2A6VA 3I49A 3AB0A 4QX8A 5KXBA 1BBT3 2JDKA 4MO3M 4DPNA 1EYBA 5KHKA 4FQ4A 1J84A 1ENXA 2RMU2 5L7OB 1GZWA 3KMHA 4XIKA 4XXAA 4MG2A 3VBHC 1VAKA 3WEZA 2DTWA 4XF4A 3AKRA 4AEDB 3AKSA 1RTVA 3GF6A 3UT0A 4JVAA 4CP9B 5DZEA 1QJX1 4AGVA 1PVC2 1UYPA 2YMZA 1H1IA 3JZVA 1J3RA 2C5DA 4IE5A 5L73A 4IGPA 4Y22B 4FQZA 5FQ0B 4DXSA 4FPFA 4XBLA 1ZRCA 3WDVA 5GLZA 1LU1A 2ZGNA 5GLTA 2C9AA 1OXCA 3OGGA 4XJ8A 4PQQA 2RS53 1HB1A 1RUH1 3HT2A 4OVEA 4FPEA 3E5UA 1JMUB 1GWKA 1RJ8A 4XC9A 5IT6A 2D6PA 5FKCA 4QXKA 2XVLA 4MZUA 3MUY1 5GLWA 5KC6A 3U10A 2DUQA 2ZMKA 3U0ZA 3E5XA 2Z79A 1OMIA 1NLSA 3JBG2 2LTNA 4O9GA 2WO1A 2WNOA 5C9AB 1ZZ7A 3KF3A 4UFKA 2XG3A 5FXXA 1AX1A 4ATEA 4BQWA 1XU1A 4LOSA 3DCQA 1U12A 2Y34A 2A6WA 3QOPA 2XBO2 4YW3A 1XNTA 1JZ5A 3ZYIB 2DCZA 4URAA 5FTTC 1D0HA 2ETEA 1E5RA 4YGEA 1CPNA 2W87A 2WZEA 4IV1C 3VDDA 5DDJ2 3AKQA 4AQ2A 4IEOA 4CCNA 2WQ8A 2VULA 2ZZJA 3SXWA 1ST8A 2XL9A 2JE9A 1S0CA 2AUYA 1R1A2 1C8M2 3OBZA 2WC2A 4PQ9A 2BYVE 2OUHA 4NHLA 1ZBE1 5T3NA 3FBYA 2JDZA 3OYWA 2RDSA 2GC3A 4P5YA 1DDLA 2JWPA 2ZMNA 2UWBA 5L9VA 1IS3A 2E6VA 1RUE2 2QVSB 4FPJA 3RSJA 1UMZA 1ZM1A 4M3CF 1AR92 4NR1A 3JBG3 1YEWA 4QQLA 1W3XA 1UMIA 2IUWA 4XZPA 1WLDA 3H3ZA 4E27A 3UGFA 4DO0A 2XJUA 3TRSB 3AM2A 1ND2B 2OZ6A 4OZXA 4BLIA 1Q3EA 5G04L 4QPIB 2JB8A 1RMU2 2RS52 2W1SA 3QH7A 4NHXA 4XFCA 3SCFA 4OI0A 1G9BA 3FZ3A 1LEDA 2KM2A 4GMP3 1ZRDA 1N1YA 4N53A 4EN9B 1RUOA 3PU3A 2B9UA 1GWLA 3U37A 2W52A 4XUPA 4AQTA 3BTAA 4S2GA 3TNQA 2GALA 3LWCA 1AR81 1FYUA 2HYXA 4QX0A 2ZEZA 1RUD1 1FI2A 2A70A 3C7OA 3HOBA 4BMEA 4DRRA 4AOCA 5IYYA 2EF6A 5FZ1A 4N43A 1VBB1 4NIIA 2HWC1 4M00A 3KHBA 1V6MA 3T2QA 4IE6A 1VRBA 5DDJ3 3ACIA 2KXLA 4K8RB 3RZMA 3S30A 5SV8A 3AP5A 2WABA 4PDWA 4LE4A 1E5HA 3ALQA 1EY2A 1RUF3 3ROUA 1QJY2 5I8TA 4B4QA 3NJVA 4MGZE 1SLTA 1YIFA 1W8UA 1VBC2 1D0GA 2RS31 3ON7A 5J7MA 3FMGA 4PIXA 1BEV2 5E16A 3AJYA 3W21A 4FXKB 5JZGA 1JYTA 1WCUA 3O0WA 4CCDA 4A44A 4BLJA 3ORJA 3FL7A 4XF1A 1UOGA 5FZ3A 1APNA 3HQUA 4L0PA 5CEHA 4FOVA 4TYSA 2HEVF 2GH2A 1WW5A 4E9KA 2FHRA 2NQYA 1XBFA 1JBCA 1Q8VA 2PHTA 4Y1UA 4NHYA 4E2QA 1N3PA 4JKLA 4QQHA 1WKYA 3M2MA 2W3JA 2DU0A 1UZZA 4IXLA 4GQ7A 1J58A 3IMMA 3MV11 5KHGA 1ND2C 2BVBA 4KGQA 2W94A 4I09A 5JI7A 2D98A 2J7MA 3C7FA 3IAPA 1UY1A 1UPIA 3SITA 1OH3A 2DVAA 3VL9A 4DUVA 3PHMA 4HMZA 2GMMA 5I0TA 3G6JB 1JOBA 1RUF2 5ACA2 1HRV3 1RUG3 4XHBA 4LTAA 3VDDB 3VLBB 3BKZA 3LQCA 3M3IA 2DYCA 1RUC3 2ZEXA 1ZZCA 1LAJA 1OOPA 4E4ZA 3KWVA 1VMJA 1DBNA 4DZGA 3OSDA 5CBLA 3RJRA 4Q0UA 1F15A 3ABZA 3EYPA 4COZA 2QQPA 2X05A 3LIGA 2WNVB 3DUIA 4PF5A 1YLLA 4OFGA 1RL3A 3GZAA 5EFUA 3D4KA 1CAWA 3PVOA 4XJUA 2C6SA 3AP4A 4RGGA 4XEZA 3RRDA 2FBEA 5J36A 2VG9A 3SKVA 3H8XA 4I0BA 1HXS1 3BALA 2YUEA 5IVEA 4RFRB 4NJ4A 3OBAA 2Z5WA 4H7LA 4ARYA 1F2NA 2VBPA 3BN6A 3Q8FA 4P14A 1VE0A 1WCQA 2Q5TA 3SC7X 2ZEYA 4FFGA 2HJIA 4IEQA 3VKNA 4LBJA 4CXXA 1YUDA 1ZX5A 1GZTA 2E26A 3GXUA 2EIEA 3NL1A 4G4FA 1HQNA 5EWSA 4AVCA 2VZTA 3POYA 3AK0A 3KVBA 3NQHA 1N1TA 2VOXA 4Y1VA 4ES8A 3I2FA 5ACA1 5I8YA 1US2A 3IPVA 4AE2A 3N9MA 5GZEA 1V6KA 2VUDA 2WRAA 1DU3D 2WWJA 3WUCA 5C8CC 3CJIC 2D44A 4IE7A 4FAGA 2P34A 3LZZA 2PHWA 2O0OA 1KXGA 2F4PA 2WO2A 3BOPA 4PJYA 1V70A 2PTMA 4E8CA 5JPMB 4B8EA 3VBOA 1GZWB 4CCCA 1PZ8A 4BQ2A 4IUGA 3JD72 4DY3A 1I1EA 2HYKA 2X8KA 3MBWA 5JOZA 5C8CB 4Q4Y2 4NMIA 4GKYA 2W1UA 2PQSA 3F95A 1LGBA 1FOD1 1WCKA 2ZX4A 3AVSA 3FUOA 4NWVA 5F5QA 3VBUA 4COWA 1CGPA 1PIV2 2OQ7A 1FNYA 5T5JA 1ENSA 1OSGA 1YI9A 2WS92 1XYNA 4LITA 4Q4Y1 3RDIA 4A6OA 2VQAA 4BM8A 1PMHX 5T52A 1UZWA 2UURA 1XNCA 1BK0A 1VR3A 5FMOL 3RNSA 3NMBA 3HN1A 4ZU5A 1VBB3 4I02A 5F39A 4JV4A 4ZY9A 3VBUB 4BXFA 5BYNA 4R52A 3TN93 3D5OA 3IBMA 2DDUA 1VBE2 3KB5A 3D8CA 1V9U3 4AVSA 4AFBA 1UOJA 1LHVA 1W3VA 1ZYBA 2V09A 3ZM8A 2FDJA 3M3OA 4BU2A 4CXWA 2PA7A 4AEMA 1OD3A 2A6XA 2VZ3A 3A23A 4X6QB 1Q8PA 1UIKA 4CUBA 4EJRA 5KBFA 5ANQA 3WQ0A 3OD4A 3MGUA 2WFF2 5D8AA 2ILMA 3T4VA 2GN7A 1OKOA 2EXHA 1QJFA 2GNDA 5F5CA 3U75A 1AR93 3E6CC 1UY2A 4NROA 4O65A 1OI6A 3S7IA 5KHJA 4N8MA 1X33A 4JKMA 4QB2A 1UX7A 1YCIA 2VUCA 2YYOA 4NPLA 5JCTA 4QX7A 1LULA 3VZMA 2CGNA 2G9ZA 2O1QA 1R093 3WF1A 4RYDA 2G19A 1JXNA 5KHIA 1TNFA 1XE8A 1S55A 4KBBA 4NHMA 1OLMA 1OFSA 4IEYA 1WLCA 2VPVA 1QIQA 4OZOA 1PX4A 3NAPC 5FPBA 1MQTC 3BTXA 1GBGA 4CU8A 5FYSA 2X29A 1C1FA 4S2HA 4S2DA 1CAWB 4JAAA 4UFMA 1RUJ3 1C3HA 1RC6A 1Y4WA 5JR2A 3PUHA 4ZHNA 1SCSA 4Q0VA 3RZJA 2A5ZA 4X8PA 3URFA 5CFDA 1O3RA 1AL0G 2VCMA 2ZHKA 5EJ1B 2D6LX 5LY2A 3O1RA 4Y24A 4AYUA 2AC1A 1TE1B 2PLV2 3W59A 5K9YA 4LPLA 2YPJA 1JZ4A 5JWPA 1DZQA 1JI6A 3OEBA 1NYWA 2AACA 4QB6A 4KWUA 2ZHMA 3WCRA 3CU7A 4LLOA 4H3WA 3AL6A 3LIHA 2VMGA 3CLPA 2D97A 2A3XA 2LROA 2QQLA 4L92A 4UBGA 5CG9A 2CNAA 4FTBA 2EIBA 2XVGA 5FK7A 4E4HA 2B8MA 2PAKA 1F35A 2XXZA 1CJPA 4ITCA 2D5FA 4GWJA 3IZOA 4LORA 2BRTA 4MGTA 3KCYA 1WUVA 2J1AA 4AAPA 1E5SA 2VU9A 3B3QE 3PMEA 3POWA 4LULA 4P9XA 4A3ZA 2JG9B 1PZ9A 4B1LA 3VBRB 5BNPA 2WFPA 3ECQA 2J1RA 4MOAA 5IVBA 1X36A 3GALA 3H3UA 3VBHB 3LEKA 5FLIA 2RS11 5LRSA 1YQ2A 1SBDA 4PI0A 1SPPA 2CDPA 1QGLA 4EZ4A 1Q5OA 3AYDA 4YW6A 4ASLA 2JDUA 2IFRA 5FP9A 5I0UA 4AI2A 4HXCA 3BU7A 4JKKA 3BPSA 3X29B 2H6BA 4JGZB 1H2KA 2VY0A 2TEPA 3OTFA 1RXGA 4I3PA 3T09A 3JCIA 4XURA 2QTWB 3LSEA 3ELNA 4WM8A 3HPNA 1JZ2A 2RHPA 1EP0A 1TME3 5F3GA 4B7KA 4XF0A 3UK9A 4PLMA 2WZR3 3FC0A 4GKXA 1LNSA 3AYCA 2VM9A 4KWKA 1R083 4N7UA 5BNNC 1OHFA 2GP3A 1ASJ1 1IS5A 4Y1ZA 3RS6A 4YYOA 3TWIA 1JU4A 4P00B 3K77A 4MHRA 4Y5Z0 3D82A 3CBNA 4RR3C 3SQOA 1D4M1 3ZYRA 3NNFA 3ZR6A 4AI3A 5T5OA 4EN7B 2DCKA 2WL1A 2WBKA 2ZX1A 4TXWA 4UT5A 3C7HA 5BNOB 4GALA 1RIRA 1WMDA 4WM8B 3USUB 2QQIA 1UMHA 1ND2A 2X09A 3J7MA 1AXYA 4BISA 5JXJA 4ORFA 1GOGA 3LA3A 2DBNA 2CTVA 1FT9A 4BYYA 1I3HA 2W47A 3IIAA 1OVSA 3ZFEC 1A6CA 4FPHA 4QDSA 1YQ5A 4HL0A 3AYEA 4TWTA 5DZGA 5A3NA 4KBZA 4ZS3A 1RINA 2VGDA 3FN9A 4LBNA 4HKWA 1U5ZA 2RMU3 4BQ1A 4JCKA 5A7WA 4AVTA 4C1XA 3W5NA 2MEV1 4RHV3 4LXLA 5LA9A 3T1MA 3RI8A 3N4MA 1YWKA 3TBDA 3OF1A 2FMYA 3KV4A 1OBNA 3ACHA 3CQOA 5KWRA 1LJ7A 1RUD2 1LKNA 2XBO1 3T1LA 1DYPA 1QXPA 3B69A 2PHUA 2F4LA 1RYYA
chains in the Genus database with same CATH topology
1FX5A 2EVXA 4N9HA 1NA1B 3HAGA 1DZRA 4HSLA 4XQ4A 3H1YA 3UJOA 4CDUC 4COYA 1R1A1 5EJ3A 5TSWA 1M4WA 1PGSA 1KJLA 2AH2A 5JSPA 4CDQC 3ZSJA 1N3QA 2GNMA 1LU2A 1AX2A 5JVVA 3WX5A 4DXZA 3AP7A 1PVC1 2BWCA 1KS4A 2VW0A 4OUSA 4N53C 4D7TA 1XYOA 3WXPA 4Q2FA 3ETQA 3NV2A 4M0NA 1GSLA 5FQ0A 4EWDA 4R8HA 3QCWA 5CU1A 2ZGLA 4YZ1A 2EXIA 2ZA9A 1S0EA 1HRI2 5JSOA 3CL1A 2P17A 4XYXA 2DUPA 1EV13 4YZ3A 4EV0A 5FOBB 4Q4V3 1LOFA 5FPZA 4NWWA 2H0VA 5T5PA 4AFMA 1JYIA 1B35A 1NE4A 3D6EA 4R9DA 3FLTA 4EROA 2NYYA 1QQP3 2PHLA 3AZZA 1RUJ2 4Y4YA 4YVWC 2SBAA 4FP3A 1K5MB 4CP2A 3KT4A 2AENA 1X8MA 1GR3A 1AYN3 2IFWA 4COVA 4RS5C 1B35C 3C2UA 3ZYJB 4LBLA 1COV3 2B7YA 4GH4B 5JLVA 4L8QA 3WP3A 1G9AA 4DINB 4E2GA 1VAMA 1VAVA 3V0AA 3R4UA 4LBKA 5BV6A 2B42B 1W39A 1VBE1 4TZDA 3QACA 4JGYB 3WQ7A 2ZGMA 2Q1MA 1W6QB 1QJX2 2GNBA 1I9RA 1LOCA 1KJRA 5DUWA 1Q8QA 5FREA 2R042 2R0HA 4AI0A 4I30A 4HZFA 3NKTA 1VIWB 2R062 3J8F2 3TN92 3ZXJA 4GB32 5K0UB 1LOFC 4V1PA 2E53A 4LBQD 1VRH2 1S0DA 1ULEA 5BNPC 4CDQA 1QJY3 1AYN2 4XJ9A 1AJKA 4ZU4A 2YGMA 3J26N 4KNCA 4XILA 4YGDA 4M3CB 1ONAA 4FSJA 4HK9A 5DUXA 3TNPB 2IZWA 3IPVB 2KA3A 5DZFA 4COUA 3WV6A 2ZTNA 4YRDA 2CGOA 1O7FA 2GN3A 4K1ZA 1IOAA 3EO6A 1POV3 1ZRRA 3LAGA 3SH5A 3UV9A 2IXIA 4WM7A 2DF7A 3INAA 3K51A 3J8F1 1FMD1 2R043 2R32A 1SBEA 4J1XA 3WQ1A 2VUAA 1SLBA 1MS1A 3MIGA 1PZ7A 1WW7A 3FFZA 2XJRA 3A0NA 1J1LA 3ZFFC 1W0OA 3JUUA 1LOBA 2WNVA 3ES4A 2BFUS 3IDEA 4C91A 1WBLA 2CL2A 2ZMLA 2XPJA 2WQ4A 4AK3A 2BNNA 1RUI3 4AEJA 3ES1A 1RUNA 4FVVA 2NP0A 3DL3A 4MGYE 1AYM3 1SLIA 1WW4A 1TMF1 4AG4A 3B01A 1VRH3 1C8M3 2D40A 4LR4A 4RQPC 4RR3A 4Q1PA 1ZZ8A 1AZDA 1JN2P 4CEWC 4LUKA 1RUC2 1O4ZA 1YO8A 4P5HA 3WW1A 1NE6A 1NXD1 1UU6A 1BQPA 4LBQA 2ZZQA 1C1LA 5AVAA 1DGWA 1ND3B 3W9AA 1OFNA 4XJZA 1QWRA 4Q4W3 3HD8B 2Z42A 1TNRA 2EA7A 5DXDA 5JZGB 2ZKNA 1QKQA 3WW2A 4WVVA 3OY8A 4A7YA 4R9CA 4PDWC 3JD73 3UKNA 2JG9C 5A32B 4JGZA 1H4GA 2RR12 2QJVA 1SLCA 4IERA 1ZRFA 2ZHLA 1ZBA3 3SHRA 5C4WC 2JXAA 2ZX0A 2DURA 1T6GC 1REDA 1BEV3 3MLKA 2ES3A 1C5IA 3VBHA 5FCCA 5JAXA 2VXRA 5BNPB 1VBB2 1W6QA 3NKGA 1NZCA 4OI4A 1DHKB 1AF9A 2YHJA 2H0BA 1PO11 5FBZA 5JIAA 3PJQA 4XFAA 2IC1A 5FAXA 1DLLA 5LEKA 3MICA 1NY71 1KDKA 3M7AA 3O0XA 1XNBA 4XJWA 4XW3A 2QDRA 4L9BA 3FBMA 3SMHA 3M1HA 2ZGOA 1O3TA 3VBSB 1FAYA 5D8AB 1AXZA 1ZNPA 4PBPA 3WUDA 5HCBA 3FX3A 2VW2A 5FPXA 2SLIA 4AFDA 4HKOA 5JOWA 2D6MA 4CYDA 3V64A 2GC0A 2JJ6A 3GZTB 1HIXA 3LOIA 3ZFGC 4HPKB 3WG3A 2HWB1 3D0JA 1MS9A 2YDEA 5DDJ1 2BGCA 5EZWA 3FWEA 1ND3C 4FT8A 2R49A 4F8AA 1B35B 4MH0E 3OYWB 4Q0SA 4RL7A 4W6XA 2BNMA 3O7OA 3VKLA 1QJX3 1VP6A 4OULA 3QH6A 1AR82 2EIGA 5GZDA 4ONUA 4GWMA 1D4M3 3ZSEA 1D4VB 4GULA 4JGZC 4E2SA 1NOVA 3U07A 3N7KA 3R0RA 1H9WA 4YLZA 5LRRA 2PQQA 2FMDA 2F6BA 4ISRA 1UPSA 1RUH2 1CPMA 1AR61 1H8TC 1EAH3 5FOJB 4PBOA 3VZLA 1XNDA 2PLV3 2WZPP 3I54A 1H2MA 2QDNA 4B4RA 1MS5A 4W6WA 1CX4A 3KCXA 4IETA 3WLUA 2E9QA 4CEYB 5L7OC 1XYPA 1IPJA 3IM0A 3EQEA 1NCQA 4H14A 1C57A 3WDYA 4D7YA 1CAXB 1D2QA 3AXDA 3WHUA 3ZDSA 2Z2SB 1YXWA 1NA1A 3HR9A 4Y22A 1A78A 3ZSLA 5E8AA 3AMQA 4IV3B 1PIV1 2WNEA 1CAVA 4I0WB 5B2GB 4TLFA 4MVTA 4AHZA 1F8VA 2V5YA 4JRLA 1WA4A 3SH3A 4WVMA 1D2SA 1ZBE2 3N7JA 4N43C 3MF6A 5EYYA 5L7OA 4I2OA 1FV3A 4X6RB 2HWF1 4L2NA 4CRQA 1PVC3 3WINE 4QMAA 5GLVA 4MLOA 3AX4A 1CJDA 2MNGA 2ET7A 1CQ9A 5SV5A 2VOVA 4AHYA 2ZX3A 5K8SA 3M3QA 1QDOA 4CDWB 1HRV1 1H8TA 1TME2 1CN1A 4N9IA 3G7DA 2BBVA 3AZYA 3ZYGA 3VN4A 3ZXKA 4YVWB 1UU4A 4WM7C 4FPOB 5IK8A 4XTMA 3WD5A 3VZOA 4AEDA 1YFWA 2NN8A 1PO13 1A3KA 1KQRA 3USUA 4FAHA 5T50A 3E97A 5FDBA 3NJZA 1AUYA 2K2SA 3AZXA 3IN9A 4WM7B 1CESA 2FQPA 2ZJCA 4XBNA 1X8EA 1BZWA 1PNGA 5HCAA 1OOPC 2XWBB 3RZZA 1KITA 5GZCA 4GIQA 1V9U1 2R072 4LLFA 1YYNA 5F6LB 1G8WA 3ZO0B 3GYDA 2NPIA 2JEMA 1OOPB 3JBG1 2ZX2A 1V6JA 5GALA 1VJ2A 4B3NA 2XVKA 3FUQA 5H9SA 1IQAA 4CDWA 2DWRA 5E88A 2Y38A 1QXJA 4KH9A 4WVZA 1VBA2 3ZSKA 5DG2A 4GMP1 4KGGA 1ZZ9A 1TEIA 1FATA 3EXUA 2WNUB 2D93A 5FFOC 4R4XA 1BJQA 3U4XA 2A73B 1PGW1 4XJAA 1HDKA 1SMVA 4H7MA 4NN0A 4N53B 2VOWA 3MYXA 2DVGA 2E63A 4Q4X3 2JG9A 1QNYA 3B5LB 1AR62 3ZN5A 2A75A 2MEV2 2BWAA 4S2FA 2WS91 2XJTA 4CDUB 4JGYC 1CAVB 1G9DA 2WSUA 4YW2A 3LA2A 3S6PA 1FPN1 1B09A 2ZBJA 1ULGA 2YXSA 4K7JA 1DG6A 2HWC2 4RQPB 2RM22 5J48A 4BIFA 3IMNA 1ENQA 1AR73 4XOGA 1LR5A 2IWGB 2OYZA 1O5LA 3R4DB 1F31A 1NCRC 3ZX7A 3M3CA 2RS33 2WKKA 1DGLA 4QPGB 1WCSA 4G9SB 3ZFEB 1I6XA 2B46X 4O9EA 1QJZA 2YY1A 3HWJA 3MIBA 5KXDA 1A8DA 2HWE3 1XNKA 2X5IB 2I07B 1AR83 1ASJ2 4BPZA 2NM1A 4W6YA 4PLNA 1MVQA 4INDA 3POSA 1R082 2DTYA 1DF0A 1EPZA 1LHWA 4ZXKA 2TBVA 4Q4W2 3EHKA 5EXOA 3ZXGA 5CA6A 1REEA 1LECA 1VBC3 4QQ2A 3NSTA 1H4HA 2P3JA 2WQZC 3RWNA 5CB7A 3DN7A 4P9JA 1RJ7A 1FV2A 4AGRA 5KXEA 2WZR2 3ZXEA 1SACA 5IK4A 1H2LA 1WMEA 3KS7A 4D94A 1OA2A 2ZACA 2XJVA 2BEOA 4M0HA 1A8MA 4LO6B 2WLPA 3LB9A 1RUG2 4FOYA 1ZBE3 3QBQA 2QFEA 1R092 1QJU2 2DUOA 3JB4C 4AI8A 1NQJA 4M01A 2W0XA 1NLRA 4IV3C 2R063 3ZSMA 2PAEA 4BCUA 3N3HA 2ZCWA 2ET1A 4DMIA 3KT7A 5I0SA 2VMHA 2HWB2 4GA9A 2YZ4A 4HK8A 1UIJA 4AXOA 4EN0A 1JUHA 3AZVA 1ZVFA 4FO9A 5I93A 1DGRN 1L3JA 2R1BA 4FPGA 3U11A 4Z92B 2ZGPA 3I59A 2WWSA 1LENA 3NVCA 3NW4A 1C28A 1AL22 4XF9A 2B39A 4F3JA 2D6OX 1RUD3 3S7EA 4L97A 3M3EA 1QJU1 2NMOA 2NZ9A 3NV1A 2XKPA 4XHXA 4LBOA 3PVEA 4Q29A 2Q8OA 3OY8B 1NCQB 3WDXA 1Z0HA 1NCRB 2XUMA 4AQ6A 1PO23 1G6NA 2BW8A 3AFGA 5BNOA 2ZGKA 1WMFA 1CAUB 2GAUA 1FOD2 4KQ7A 1YFYA 4EN6B 4CDXA 5FLHA 2LALA 3ST7A 2ERFA 1ZZ6A 5ACA3 1RHI3 1O3SA 1DFQA 3VGIA 4YSFA 1SEFA 3QLQA 4F83A 4FPYA 2HWD3 3E5QA 1S1AA 4RR3B 3H50A 1DYKA 2VVEA 1W6OB 2GNTA 3VKFC 4AI1A 2UWAA 4DB5A 3NAPB 2HEWF 3NV3A 4LO8A 2WIIB 2R073 1AR91 3OBRA 4EWAA 3ZFFB 3MF9A 2CY6A 2R1DA 2WFF3 3HMYA 1COV2 4FTEA 1F9KA 1OA3A 4AVBA 1LRHA 3DPRC 1AR63 5BPXA 1AHSA 1AYM2 3GZUC 1RUG1 1PK6C 3IDBB 5GZFA 1GV9A 2RM21 2R16A 3H7JA 1MEC3 1SCRA 1GNZA 4Z82A 5A33B 1XXNA 4JTNA 1YJLA 4GB33 5BNQA 2UWCA 1HXS3 2X5IC 2GC2A 5CFDC 3THTA 1SLAA 1R1A3 5HI0A 1Q56A 1CD3G 1Z78A 1VBA1 2UYBA 3GNEA 1R081 2C0ZA 2VUJA 3OCPA 4ES9A 2NLRA 1ASJ3 4BZ4A 1GNHA 1NQDA 3WG1A 3TB0A 4HVQA 1UF2C 4X8NA 1V6OA 1VB2A 3A4UA 5AVPA 1W6PA 3H8UA 4RA0A 1URXA 4OI1A 1S2KA 2VH9A 2R061 2W08A 4Q8LA 1UL9A 2DCYA 1LHUA 2GMPA 2WINB 3GBGA 1RITA 4K3UA 4KU8A 4LUMA 1RUJ1 1Q43A 1Y3TA 2N7GA 4Q0QA 4YM1A 4AEKA 4XE9A 2O8OA 5HCFA 3UL2A 3PVBB 2G9FA 5KC5A 3CJIB 1UCXA 4ASMB 3B93A 1AVBA 3J4UH 4RS5B 2RMU1 5A33A 2ZKLA 4R4ZA 4BOWA 5JI9A 4R9BA 4BE3A 2I74A 2D6NA 2WT1A 4IEXA 1WW6A 2PN5A 5ABJB 3PTYA 2AYHA 2WNUA 5I8SA 4F7ZA 2XLGA 5CVRA 1AJOA 1ULFA 3DPRB 2TUNA 4GWNA 5GZGA 4FOWA 1HW5A 2I2SA 1W6OA 1IS4A 1HRI3 2VNGA 4HN0A 3ZN6A 4KL1A 5ABJC 1GZ9A 5LEJA 1LB2A 4YGCA 1HLCA 5I91A 4R9AA 5LK7B 3CO2A 3WDTA 1QDCA 2VVFA 2JE7A 4HT1T 5AC92 4N7IA 2ZGTA 4Y20A 3KGLA 2OPKA 1AXKA 3IT8A 3L2YA 4XF3A 4RD7A 4YW5A 2HKXA 5C9AA 4IV1B 1GZCA 1EPWA 1V9U2 2PAMA 4QPGC 4CP1A 2DVFA 5C8CA 3VUOA 4HVOA 3AZWA 3ZMOA 3ZXLA 4IV3A 2Y26A 1ENRA 4Z2WA 4YW1A 2DU1A 4CDWC 2A3YA 2VVDA 2C1FA 5J98B 1ULCA 3SCGA 1RVF2 1VBD2 1PO22 2LM3A 3FHIB 3IKWA 4URTA 1C8NA 4RHV1 1BMV2 4CEYA 1CAUA 2JICA 3B9IA 1UU5A 1DGRA 3AJZA 3P3PA 1UX6A 2ZGUA 3RPQA 4HSJA 4HANA 4SLIA 1RUF1 5T55A 4GMP0 4M3CA 4WV8A 2XBO3 2ARXA 3KLSA 1OQ1A 4QQOA 2Q4SA 3WDWA 4IQPA 3J8F3 2A6ZA 1WCDJ 2QZ2A 4OUMA 4D7SA 2K0GA 2RS51 4IV1A 2DCTA 3MIEA 4NPRA 4YNIA 1U5IA 4YGBA 2LUWA 4B4PA 4PIZA 1LHOA 2BQPA 1N1SA 1IPKA 1RUE1 4YZ2A 1OLRA 5AC93 2YGLA 1OPMA 2YV8A 3KT1A 3MIDA 4Y1YA 3QD6A 3E6DA 3RYPA 4AVVA 5L19A 1KDMA 1PO12 2QCSB 1QNWA 1LOGA 5BNOC 3VBOB 4IEUA 5GKAC 3O12A 4HPKA 4AHXA 1SFYA 1C8M1 4YG6A 5DUVA 3BIWE 1MEC2 1BKZA 1LODA 2XL7A 1QOOA 4I0AA 1RVF3 1VBD3 4ATFA 4BMBA 4XQWA 1DZTA 3MIHA 1PM7A 2DVBA 2QE3A 3M8LA 3O0VA 1IKQA 2UY9A 1PK6B 3VHNA 1H30A 5JZGC 1HQWA 3ENRA 3VHPA 2XHKA 1OQDA 3B7MA 3USSA 2CAVA 4IEZA 4QD2A 5E1RA 5EV7A 1UZYA 1G86A 1R1ZA 1NY72 4W65A 4DFSA 3KM5A 5KHHA 1XRUA 4DS0A 4IEVA 1GQGA 1DQ2A 4YM3A 3DGTA 1O4TA 3MIFA 1POV0 1SFNA 3SNMA 2ZS6B 4OHXA 5IK7A 3JQWA 5HXVA 4K20A 3I8TA 4CEWB 1YIPA 2HWB3 3CNAA 1JOJA 2P2KA 3WY6A 1QXRA 2X5IA 3THPA 3VBFA 3ZMNA 2ZOEB 4N43B 2EAKA 1S0JA 5K7PA 3DPRA 4LEJA 4K8FA 1U5XA 4CDUA 1GLHA 4I3GA 3TOJA 5J96B 5H9PA 4ZU7A 4YARA 3ZXFA 5D1IA 2AZ5A 4Q1RA 2GH8A 4K9SA 2TNFA 2A3WA 2CWMA 3ZIXA 1TMF3 4Q4X2 4YM2A 2OA2A 5C4WB 4LO4B 5C33A 5JOXA 2XLAA 1QH7A 4AQSA 1DQ6A 4MYEA 1BBT1 3DV8A 3VBRC 5F9TA 5T54A 2JG8A 4XFBA 3B94A 2MPFA 1DQ0A 2WT2A 2ZGRA 1Z7S2 4A3XA 5HBAA 2WNUC 1SBFA 4Z8BA 4LT5A 4PDWB 2DFBA 2ZGSA 5H9RA 3PVNA 3WP4A 3RMYA 1W6PB 3ZXAC 1FMD3 2R041 5GLUA 4P9WA 1ZBA2 3NV4A 1FNZA 1GANA 1H1MA 4K1YA 4B7EA 1G7YA 3PJYA 3JD71 3GBFA 5DUUA 5IK5A 1MS4A 1XE7A 3MW4A 3AP6A 4FOQA 3PLQA 1ZBA1 1LTEA 3VZJA 1WLWA 1RUE3 3EBRA 3B02A 3HQXA 5C8WA 1OKQA 3CJXA 4CDXB 2AR6A 2IXLA 4DNYA 3ZFGB 4QQPA 1N3OA 3WCSA 1F5JA 1PGL1 4YVWA 2VECA 1MACA 1O4YA 4P9YA 4QPIA 2DFCA 4NVPA 2GDFA 2QUOA 4CDXC 5CIRA 5CADA 1IS6A 5I0RA 1RUI2 1LOEA 1PGW2 4U2AA 4MSVA 4Q4Y3 4OHZA 5JSRA 1MVEA 1H9PA 3H0OA 4NOTA 4OHYA 2Q0AA 3VKOA 4EN8B 1JTZX 4XFHA 5K0UA 2DVDA 2AGSA 2IXHA 3ZFFA 1RUH3 1HKDA 2JECA 4DOUA 2EXJA 3D0SA 1IZ3A 2JG8B 1H0BA 4Q26A 3VBSC 2HEYF 3VBRA 3R6SA 4MXWA 5CAZA 5JPNB 4YG0A 4C90A 4WVMB 1VBE3 4IEPA 4OLLA 3APBA 4HLTA 3WW3A 4E4SA 2PFWA 5FRAA 4JC1A 2WJSA 4HFSA 5T5LA 4BH9A 3V0BB 4J6GA 1H2NA 2XGXA 1AR72 1QHDA 4Z07A 1J59A 2FZ1A 3LGRA 1CAXA 4C0BA 3PNAA 4C0HA 1MQTB 2EXKA 2OZJA 1QQP2 5KXCA 1QU0A 4QU2A 2ZPXA 2VOKA 1C4RA 1LESA 1AL21 2HWC3 3HT1A 3VBFB 4FP2A 1QOSA 4Q4W1 1MZ6A 1KFXL 3RYKA 4MV2A 4XFFA 3LKJA 1KFUL 5FMOS 3H7YA 1OLQA 1N1VA 5GM0A 4JRAA 2P3KA 1KD7A 2VNRA 1W6MB 3I59B 4KU7A 2IXJA 3L9JT 3I2DA 5EYXA 5CFCA 2HWE2 2VW1A 4WZCA 4P9LA 3VHOA 1FPN3 5FO7B 1SLLA 2D7FA 2D3RA 1HRI1 4FPLA 4META 4D69A 4QM8A 4QGNA 1LGNA 4OHWA 4I01A 2JD4A 3ZN6B 3ILFA 3AKPA 1MZEA 1BEV1 2XJSA 4P9GA 3WNXA 1GKBA 1O5UA 3CEWA 4H55A 3SLIA 3MPPG 3B9CA 4LHNA 3SISA 4YZ4A 1MZFA 2WT0A 4UW3A 1YJKA 1IHMA 1ZA4A 3WP6A 3OPZA 1DIWA 4ISQA 3NWKA 3R4SA 4LHKA 3V0BA 1DQ1A 4JTOA 1GQHA 3H1WA 1G9FA 4QHBA 1LGCA 2CAUA 4WM8C 4YFWA 3WVJA 4A7ZA 2O8QA 2XKOA 1H1AA 5J09A 4RS5A 1AX0A 4LA2A 2XJPA 3AP9A 2WS93 3O14A 4MXWB 3A0KA 3AYAA 4XMAA 1S2BA 1PVXA 1Y7BA 4Q4V2 1QF3A 5CFCB 3WW4A 3MZHA 1D4M2 1TMF2 5BNNA 3VBUC 1JYCA 2JENA 2D5HA 3Q9OA 1JUIA 3NO8A 4MXVA 2D6KA 1RMU1 1DGWX 2XJQA 3MPBA 4QGLA 1PIV3 2RS12 2WZR1 3WT3A 5CFCC 5A3MA 1BVVA 2BFUL 3M70A 2UU8A 1Z7S3 1O3QA 4QPYA 2YROA 1DQ5A