3OSDA

Crystal structure of a putative glycosyl hydrolase (bt2157) from bacteroides thetaiotaomicron vpi-5482 at 1.80 a resolution
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
264
structure length
264
Chain Sequence
GSAQEEQSANEVAVSYSKSLKAAEMDSLQLPVDADGYITIFDGKTFNGWRGYGKDRVPSKWTIEDGCIKFNGSGGGEAQDGDGGDLIFAHKFKNFELEMEWKVSKGGNSGIFYLAQEVTSKDKDGNDVLEPIYISAPEYQVLDNDNHPDAKLGKDNNRQSASLYDMIPAVPQNAKPFGEWNKAKIMVYKGTVVHGQNDENVLEYHLWTKQWTDLLQASKFSQDKWPLAFELLNNCGGENHEGFIGMQDHGDDVWFRNIRVKVLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative glycosyl hydrolase
publication title Crystal structure of a putative glycosyl hydrolase (BT2157) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
total genus 73
structure length 264
sequence length 264
ec nomenclature
pdb deposition date 2010-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06439 DUF1080 Domain of Unknown Function (DUF1080)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.560 Mainly Beta Sandwich Jelly Rolls Exo-inulinase; domain 1 3osdA00
2OXBA 3LIHA 5ANNA 1Y4WA 3ZR5A 4FFHA 1UYPA 3HBKA 5FMCA 3H3LA 3LDRA 2QQVA 2AEZA 1Y9MA 3SC7X 3LFIA 4JQTA 4UFIA 3S5QA 5FMDA 4FFFA 3PIJA 3PIGA 4UFKA 3UGFA 5FK7A 3U14A 3UGGA 2ADDA 4CCDA 5FKCA 4QHZA 2QQUA 3KF3A 5FMBA 1Y9GA 3LF7A 3U75A 4B1MA 4CCCA 3LEMA 3NMBA 5FK8A 2AEYA 3OSDA 5FKBA 2QQWA 3UGHA 4HXCA 2AC1A 4UFMA 4UFLA 3IMMA 3ZR6A 4FFIA 1W2TA 4FFGA 4CCEA 3KF5A 4EQVA 3LDKA 5FIXA 4UFHA 4B1LA 1ST8A 2XQRA 2ADEA 3LIGA 3RWKX 4AZZA 3U1XA 4UFJA
chains in the Genus database with same CATH superfamily
1BBT1 2IVJA 1CZSA 1VBA1 3AZXA 4JDNA 4D6SA 2EAAA 4RN5A 4QPGB 2RS13 4IE5A 1VALA 3JZVA 5CEHA 1Y9MA 1C1FA 4I0BA 4WVMA 4UWDA 3RJ2X 5A1FA 3VBHA 4KBBA 3N9PA 4K20A 1AR83 5E89A 1AXKA 1YO8A 5FP9A 3NMBA 4JX0A 1RUD3 4BPZA 2QQWA 4NRPA 1O7FA 1OI6A 3BTAA 4BQYA 2JX9A 5FRAA 4Y33A 1W9TA 4N8MA 4HMZA 3AC0A 3GBGA 2C9KA 4JKLA 3AK0A 2NN8A 1QNYA 1A3KA 2XKOA 3J7HA 3AJYA 2LRPA 3CJIA 4FFHA 4EWEA 3WOGA 4AEDC 1NLRA 2E33A 1XYOA 5CFCB 3CNAA 1RJ7A 1JZ8A 2JXAA 1XXNA 2FCVA 2K46A 1VLNA 4FOQA 4XDOA 5EYYA 5DXDA 1GNYA 4LUMA 5FYBA 1HV0A 3BCWA 3RGBA 2VY0A 5FOJB 5ACA1 5FK7A 1MEC3 5C33A 4X6QB 1BKZA 2ZMLA 4Q2FA 5FZ1A 1G86A 4P9JA 1GWKA 4RR3B 1JUIA 2W91A 5FY7A 5GLVA 1AYM1 4AHWA 1CAUB 4K8FA 3T1LA 1QHDA 1I5ZA 2WT0A 5F3EA 2B9VA 2HWF1 2JDNA 3CJIC 4IEZA 1GU3A 1K12A 2YC4A 3ELNA 3GZTB 4XC9A 5A70A 2B5HA 2JIGA 4QPIB 3DECA 4IV3B 4LKEA 2XJSA 1WBFA 2QQLA 2ATFA 4JAAA 5F5IA 4AZZA 1ND2B 1PIV3 4AQ2A 3WR0A 1HRI2 2IXIA 4OZXA 1YFYA 2TNFA 2RR13 5T54A 1WCSA 1UO9A 1NCRB 4PDWA 1FPN3 3SC7X 2WWUA 3FUQA 5FXXA 2XLAA 3AL5A 3SISA 3SCGA 1WMXA 3AP4A 3Q8EA 4YRDA 3WDTA 2DURA 4UYBA 1W3VA 4MZUA 1GZWA 4OHWA 4R9DA 3U10A 5LA9A 2Y38A 2RDQA 2FDGA 3LE0A 2GH2A 3RG0A 4PF5A 2CGPA 3IAPA 1TE1B 5J7MA 2WZ8A 4IE0A 3V0BA 3MBWA 2EXHA 4XURA 2C24A 3POYA 5IVJA 5KXBA 2W87A 4QDRA 5A33A 5JXJA 4L2NA 2D6NA 1TNRA 1NCQB 5CISA 2HLEA 2ZBJA 3ZYRA 2BWCA 3HBZA 4J1XA 3WG3A 3WW4A 2JICA 1WLWA 3RZJA 1AR61 1G9AA 4CVUA 4FAHA 3ZR6A 1BXHA 4XBQA 3B02A 1H9PA 1OFNA 3X29B 4BH9A 5AC93 2Y6LA 5L19A 2J22A 5FZLA 2KD7A 3VBRA 4FXKB 2VMIA 4EQVA 1RL3A 3T09A 3RZMA 3FE5A 1S0DA 2V72A 3W9AA 2IXCA 4CCKA 4XHXA 1EV12 2R32A 3T0BA 5JSOA 1SMVA 4DXRA 4YM3A 3K2OA 5H9SA 3O1MA 5FP8A 2P4EA 3WG4A 2JG9B 2UWCA 3FMGA 4GB32 5FZ4A 2ZGTA 3BI3A 3MIEA 3O12A 1WW7A 4BYYA 3VHRA 4JHTA 1W0PA 4JKKA 1W8TA 2RS31 3H1YA 4IEWA 1MS9A 1JHNA 3CJXA 4HXCA 1H2KA 2YU2A 3CBNA 4XJ9A 2MPFA 2OKXA 3G7DA 3FX3A 4E8CA 5K8SA 2BBVA 1EYBA 1MZEA 2FDFA 4L0PA 1DFQA 2DDUA 2AR6A 3IT8A 1ZRFA 2JDUA 2Y6GA 3VGIA 2FDJA 1VBB1 2JE9A 4LORA 4MGSA 4Y26A 3WNKA 2VZ1A 4D7YA 3H3LA 4DQAA 1SLAA 2N7GA 5FZFA 2P3KA 1W6MB 4DUWA 1W6QB 1HB3A 4I0WB 5FZ3A 5L9BA 4Q4Y3 2FDHA 2EIBA 3FHAA 3OD4A 4WVWA 2GMMA 2Z79A 3ZN6A 3WQ0A 2WQ4A 4F3JA 1POV1 2Z4FA 2A7AA 3S5AA 4Q1PA 2EALA 5DDJ1 1JYVA 2OQ6A 3J7LA 5JDBA 1V9U2 1WD4A 3OJBA 4GH4A 3ABZA 1WCDJ 1J1TA 3IDAA 4NR1A 4QHBA 2WA3A 2FDIA 1JHJA 3ZMNA 2X5IC 1PVC1 3RMYA 1WA6X 2WFF3 5J36A 3JBG3 1CX1A 2RS53 3WUCA 5LZ6A 2HWE1 3O1PA 2E6VA 3CJIB 2R061 3PU8A 3ZFEA 1OA4A 2WUHA 5FYTA 4P5YA 2YBKA 1F15A 2QQVA 3DKQA 1AR92 1AJOA 4Y5Z0 5F5QA 2XBO3 2CNAA 1XB9A 4LKFA 1UWWA 1APNA 4GH4C 1J3RA 2WLPA 3PVEA 5LA1A 1R1A1 1Q5OA 2A3WA 3QBQA 1EAH1 2ARCA 1YEWA 3KQRA 3ZDVA 3JU9A 5A7SA 4BA6A 1HXS2 2RM21 2XVLA 2ZA9A 5FAXA 3J7NA 4IV1A 2VBBA 2W95A 3QOPA 2ZGKA 5F5CA 1VBE3 4ZU4A 5L7OA 4S2HA 1W8ZA 5JWPA 2G4IA 5T3NA 4AG4A 1VIWB 1VMHA 1NQDA 1QJX2 4WM8C 5HV4A 1D2SA 4CU7A 2J1AA 4A7ZA 2YHJA 4NWVA 2VPVA 4AQSA 3FLRA 3NJVA 3MW3A 2BOJA 1ODMA 1X82A 4QQ2A 5M0TA 1UZWA 2ZGPA 4JGZC 4UFKA 5A6XA 2Y0OA 1Q8OA 3R0RA 3KQ4B 2DV9A 1W90A 2TUNA 4NROA 5K7PA 3MI8A 1LHWA 2GMPA 3UGHA 3WF0A 1BYHA 1QIQA 4GKYA 4KU7A 2VAUA 3RZZA 3KVAA 5DUUA 2Z5WA 4ZKTB 2F4PA 1FOD3 3ZFGA 3HNMA 2H6BA 5IVEA 3W21A 1RHI3 3WDYA 4XJWA 1OQEA 3HWJA 3IDBB 2VOWA 4FPYA 1OOPC 1RUG3 2WO2A 3POEA 4LHNA 3WY6A 4MO3M 1MZ6A 4MHRA 5JCTA 5EP9A 1BBT3 1LOAA 2XH6A 1VBA3 3C2UA 4KQ7A 4K1YA 4FTEA 3FBYA 1GWLA 1TMF3 3CIHA 4Q1RA 2J1EA 3HQRA 3AM2A 2VC9A 1LGNA 1XPWA 3LQCA 2P2KA 3H3UA 3EJKA 3TNQA 2DFCA 5FJHA 4ORFA 4MGYE 4K3UA 2I07B 1UCXA 4FFGA 5B4NA 5KC6A 2DBNA 1QJU3 1ASJ2 2OIIA 5FUNA 3B5LB 3MLJA 1H6XA 2WZPP 1US3A 5EXOA 3U1XA 2AACA 2OX0A 1IGOA 3VDDA 2WZR1 1OT5A 3FL7A 4FPFA 2BEOA 2FMYA 4P08A 5C3QA 5ERLA 3THCA 4E4ZA 2Q1FA 2G19A 1DCSA 2VVFA 3N3HA 3BTZA 4YGBA 1OMIA 4QKBA 3IDCB 4UFIA 4DO0A 4HSLA 1DGWA 1RUE2 1LOFC 2D93A 1N3QA 4P9XA 4GZ9A 3OGVA 4FP3A 3LA3A 2VNVA 3D82A 4LBJA 2WZEA 4MHUA 1PGW2 1XNKA 4XCBA 5FWEA 3U37A 1JI6A 3D5OA 2CL2A 2RJLA 4E2SA 3VN4A 2DWRA 1UMIA 4ZU5A 3GYDA 2MNGA 5IUQA 3AJZA 1AYM3 3K4DA 1NYWA 1R093 3AMMA 1IOAA 1W05A 4Y24A 1QXJA 4GMP1 3W59A 4AGRA 5F9TA 4GWMA 4YM1A 1LU1A 1PX4A 4XF4A 4DNYA 4Z2AA 4KWKA 2X5IB 5H9QA 5CFDA 1VBC3 1VRH1 1J58A 1X9PA 1ZA4A 1FMD1 2WNVA 2YBSA 2UYAA 1WW4A 1US2A 4P9LA 4YG6A 5C5TA 3SHRA 4LE3A 4CUBA 1JXNA 3VBSC 3ZN6B 4M3CE 5JI7A 3ZYJB 2VMFA 3CZUA 3WVJA 1H2NA 2Y8KA 5JPMB 1DZQA 4LK7A 1U5YA 1G9FA 2IFRA 4Y22A 1CD3G 4GH4B 1DGRA 1OF3A 1RUJ1 4XFBA 4YM2A 4OI0A 3C3VA 3HAGA 4FQZA 1COV3 4KWJA 4B4PA 1LKNA 4CDXC 2R49A 1BHGA 4YG3A 4LLOA 4EYUA 4M00A 1ZZBA 4NMIA 2MEV1 5K9YA 3KLSA 4Q0UA 5DG2A 5LY2A 4QKFA 2BERA 3LDRA 3I3BA 4FT8A 4ITCA 3NV2A 4XJZA 1AL21 2C1FA 3MLKA 2P3YA 3DUIA 4PJYA 4ATFA 4BQ1A 4DUVA 4YVWA 4FOYA 3PIGA 1Y9QA 2BTVC 4WM8B 4WBBA 2W5FA 1HX6A 2EVXA 1NE6A 2TEPA 3T30A 2A6ZA 3NRUA 4M4PA 2C4XA 1ZBE2 1WCQA 1D4M3 2JG8A 3OGSA 4JGZB 1OA3A 2P34A 3LSDA 1O6UA 4CDQC 1LNSA 1RUH1 1YQ6A 2A3XA 3I3QA 4XYXA 2R071 3DYPA 1YNAA 2VUJA 4LBQA 4NAOA 2NQYA 5JIAA 1X9TA 2QQNA 3N7KA 1GQHA 1LRHA 2FCTA 5HPOA 3E5UA 1O5UA 2ES3A 1YQ8A 3FC0A 4NHXA 5A1LA 1YQ2A 2IXJA 1V70A 4QQOA 1MS5A 3VL9A 4WVVA 4LO7A 5AVAA 3I4IA 3PUIA 4XF9A 2D3RA 1ZZ7A 2Y26A 1M06G 4IETA 4XJ8A 5DAXA 3WNMA 1HIXA 1UD1A 3NJZA 2RS33 2ZEYA 4LBOA 4YGDA 1YRZA 3VB9A 4Q4V2 3HIFA 5GJ6A 4KWLA 4BU2A 4BMEA 5A3PA 4QX5A 1H6YA 3VZLA 2QUOA 2V4AA 4FPGA 3BKZA 3M7AA 4W6WA 2W1WA 4K1ZA 2Q8EA 1QDOA 3TN91 2P37A 1QU0A 2R6QA 1GKBA 2OUJA 2VJXA 3LB9A 1VE0A 4HG6B 2YBPA 5FZMA 1S0JA 4CEYC 5JZGA 4FOVA 3LFMA 4BM8A 1O4ZA 4Q4W1 5DQ0A 4M3CB 3WQ7A 4Z8BA 1XNTA 3H7JA 4E4SA 1OXCA 1JZ4A 1O3SA 3C7OA 4XTMA 4OUEA 4CTEA 5A3UA 2QDNA 1DQ5A 4QX7A 2R1BA 4HL0A 3PUQA 4TLFA 1POV3 2EA7A 5H9RA 1LECA 1JUHA 4Q0VA 4NIDA 3N7MA 4XBLA 2XOMA 3MZHA 1MVQA 4PQ9A 2D43A 3S7IA 3INAA 4YYOA 2W39A 2VOXA 3R4UA 5DN2A 3WW2A 3MPBA 1WLTA 1YIFA 3GHNA 3S0MA 1JOPA 1R64A 3KHCA 2ENRA 3NNLA 4LLFA 3E5QA 5KC5A 2W46A 2DUPA 2WR9A 2VZTA 2AH2A 3JQWA 1R1ZA 2CTVA 2YY1A 2ARBA 3A7QA 4I30A 3WF4A 4CCEA 1C5HA 2RMU3 5FP7A 2JJ6A 3OGJA 5C9AC 2A75A 2PQQA 3VBSB 1BZWA 3FHQA 5FYHA 4WV8A 5FP4A 2NYYA 5J1XA 4XQ4A 4LIVA 1KS5A 3SNMA 4GWJA 3P3NA 4CU6A 1W6OB 4NN0A 1TEIA 4NIGA 2AEZA 4CDXB 2H6CA 4QXKA 1Y7BA 1QDCA 4XXAA 1EY2A 1MQTA 3EO6A 4JDOA 4CP9A 2IWGB 3KD4A 2XPJA 2ARAA 5FZOA 2B39A 3T2OA 1RIRA 2JENA 3GGLA 3MGUA 4Y4RA 5JSPA 1OD3A 1ZX5A 4A45A 1HRI1 2GNMA 4P00B 4DY5A 1H30A 1K5MA 2XQRA 1T2XA 2R043 2UY8A 2HWC3 1CAVA 4W8JA 2PMWB 3GF6A 2VG9A 3ZVXA 4DXZA 1YFWA 1AYN3 2WN2A 2FQPA 3IM0A 4NHKA 4X8NA 5LBEA 3VD5A 3AKQA 1K5JA 1MS8A 4XFHA 1PO22 3VBUC 1A6CA 4ONUA 3E1F1 2E7QA 3OBZA 3ZKUA 4YVWB 2FZ1A 3FN9A 4OYUA 5KR7A 3T3YA 4BCUA 4CCDA 1L7RA 2NM1A 1HB2A 5C3SA 1Y43B 4YZ4A 4B1MA 1N1SA 4YW1A 4CP1A 4U36A 4R9BA 3KS7A 1WCUA 4ARXA 5IVFA 4IE7A 2DUOA 1QJY2 4YSFA 2R1DA 2XVKA 1IKQA 2BVVA 3I2KA 2ET1A 4GWNA 1S1AA 4Q5OA 4ES9A 2VZVA 4UFHA 2VOKA 4RHV2 1HW5A 1RINA 2PAMA 2XKPA 3AYCA 4EZ4A 2GU9A 1RGSA 4F7ZA 4MOAA 1OH3A 1W9WA 3ORJA 4Q4X3 5A7WB 3KWVA 1W8WA 1H4GA 2IUWA 4META 3WNNA 1HQNA 1PK6C 2JDPA 4BQ4A 4IQPA 4HPKA 1UY2A 2WZR3 2FHRA 2HKXA 2I74A 4XIKA 1D0GA 2ZGNA 3BIWE 3D0JA 4L9BA 3EYPA 3TB0A 1MVEA 1XU2A 4CEYB 2B7YA 4NOTA 4JCKA 5HV0A 2E51A 3MLLA 1CZTA 1I9RA 4JGYA 3S7EA 3ZYHA 3M3OA 3AKTA 2PHWA 4M0NA 1W6NA 1AF9A 5FMOS 1IQAA 1EV11 1MZ5A 2ZGMA 5EJ3A 5LRSA 4GB31 3PUHA 3ENRA 4HK9A 3ES4A 4A41A 4RQPA 1KJLA 2Y34A 2QCSB 2SLIA 5FO7B 1RITA 2DTYA 2WINB 4FFFA 4XHBA 3ZPYA 5CG9A 1AUYA 2WRAA 5BXXA 3VBOC 1GFF2 1WMEA 1VPHA 5F6LB 4CDUC 2ILMA 4ZXKA 5DG1A 1FXZA 3ECQA 5K0UA 2O14A 3LEKA 5HI0A 1CJPA 3KGLA 1V6NA 4CDWA 1DZTA 4EROA 2JIJA 2LROA 1X50A 4KG8A 1DG6A 5C9AB 3K77A 5JOYA 1D2QA 5JSRA 1JZ6A 3RYPA 5EFUA 4QXHA 4ZS3A 1PGSA 2Q1ZB 4NAMA 5EZWA 3V56A 4B8EA 3WT3A 5K0UC 2RDNA 3FWEA 4YVSC 4ET7A 5CADA 5J96B 1QJFA 1AL23 2QNKA 1V9U1 5FPXA 4CCCA 1IZ3A 1B35A 3AP5A 5FKBA 5KXDA 2F17A 3NV4A 1HKDA 4JVAA 2VZRA 1BEV3 1GNHA 1NLQA 2C0ZA 5FCCA 2D6LX 2HWD2 5IWFA 4HBNA 4IEOA 2QQMA 3Q8AA 4XMAA 3AKSA 4HT1T 4KG0A 1AR91 2GNBA 4QQHA 3O7OA 1RUH3 4TXWA 5I0TA 2Q8OA 4M4RA 3CKHA 5GKAC 1B35C 1VBD2 3H50A 2B45X 2B46X 3K4ZA 4DS0A 5FO9B 3P5BA 1HQWA 2P3JA 5EWSA 3BN6A 1IHMA 2PLV2 3B3QE 4R4XA 4CP9B 5IYYA 2ADDA 4JV4A 1SFNA 1HXS1 1Z0HA 3VBUB 1RB8G 4Y1ZA 1E5HA 2DVFA 3ZN5A 4CUCA 2XHKA 2PAEA 1V6JA 1IPKA 5B4XA 2PFWA 3MF6A 3H0OA 1URXA 3A4UA 1QKQA 4RFT0 3WNPA 4DZGA 1F4HA 1SDWA 2CWSA 1VR3A 3AYDA 1QJX1 3DYMA 1CAVB 5SV8A 1OKOA 2JDYA 4BE3A 4UF0A 4PHZA 1VB2A 4DPNA 3UL2A 3WCSA 2C6SA 5BUVA 1W9SA 2BFUL 5FZEA 2ZGOA 4KMQA 2EXKA 1V00A 1NKGA 5A6YA 5ABJC 2DU1A 1W8OA 3POFA 3UESA 1FT9A 1AR82 2VZUA 1GQGA 3PIJA 4E8DA 5A3LA 1ENSA 3UGFA 4N53C 4R8HA 3M3EA 5CKMA 5E6HA 4IGPA 1W8HA 3NAPA 4LULA 3ZIWA 1PK6B 5FMBA 4CU8A 1LR5A 2ZHKA 3KCXA 5DUXA 5HCFA 1LGCA 3GALA 5GZEA 4AI9A 1TNFA 3KT4A 3KGZA 4JTOA 1ULDA 2KM2A 3FLPA 4LBKA 4AFCA 4AQTA 3IPVA 4D7SA 2WS93 1VRBA 4XJAA 3ZXEA 4YW5A 3VKFC 3HQUA 4UAPA 4AI0A 3VBHC 2OXBA 2RDSA 5JLVA 1PGL2 3NAPC 1R082 4QWNA 3AKRA 3EB7A 4B3NA 1S0FA 3T4HB 3ON7A 1DF0A 1W0OA 2WFPA 4F8AA 4TWTA 3MIGA 3NKTA 2R7EB 4BQXA 4YZ1A 4Z07A 1MEC2 2OVUA 2J1UA 5A3OA 4CYDA 3RWNA 3UGGA 5DZEA 4XVHA 3V65A 3ZXJA 2NLRA 1ND3A 4CUAA 1H1IA 4H2AA 1UKRA 1ASJ1 4XAEA 4CEWA 3ME2A 4RFRB 2VVDA 4I2OA 1HV1A 3OF1A 2C5DA 4AF9A 3IZOA 3VBOB 2W68A 1QQP3 3BGAA 4FTSA 3HQXA 2QQIA 5FPLA 2PA7A 1ZBA3 2W08A 2EIDA 1PIV2 2ERFA 3OBTA 4H14A 4CDUB 2YYOA 3DGTA 3BB6A 2OYZA 5FDBA 5KHIA 4YGEA 1CJDA 2RR12 4ZPIA 1ZREA 4LHKA 4P9GA 2RE9A 2VW2A 4K8RB 2BYVE 5FYUA 1FPN2 3RZKA 1LTEA 3TAYA 1BCXA 1RUE1 2ZXQA 4ZZ8A 2VU9A 3WDVA 1HQLA 5T5PA 4CEWC 3VUOA 4L11A 1PO13 4K7JA 4EV0A 1A78A 1PGW1 1BK0A 1VB4A 3D8CA 5LATA 4AAXA 3I2FA 2W94A 1W6PA 2BGOA 1QOSA 3M8LA 4CXYA 1ZVFA 2WNUA 3SEEA 3J8F3 3ZXLA 4D3WA 5K0UB 3B93A 3I7DA 2DFBA 4YVSB 3VZJA 2CHHA 1SLCA 3HN1A 1SBFA 2FBEA 3HMYA 4XOGA 5LBFA 1SHWB 2QTWB 4I3PA 2WYFA 4PDWC 5TSWA 1CAWB 1OC1A 5I8TA 2IC1A 5CU1A 1GOFA 3OY8A 1NX9A 1OPMA 2ZGSA 4UOJA 1HLCA 1OFSA 1QJZA 2NMNA 4RD7A 5DUWA 1UPIA 3J26N 1CWPA 1SLTA 1YYNA 4K6BA 1NXMA 1BVVA 1G9CA 1UMHA 3L2YA 2WA4A 1LB2A 1SACA 3FLTA 3WD5A 3KF3A 4LJHA 4Y1UA 1B35B 4QPWA 3MFAA 1C8M3 2D7FA 3LGRA 1MR5A 4PT6A 5FP3A 1LENA 1RC6A 5FZDA 2H0VA 3JXSA 5AC92 3ATGA 2OS2A 3MIBA 3RSJA 4DB5A 4QX0A 1ZRIA 1GBGA 1V6LA 5FXWA 1WMDA 5T5JA 4D69A 4YZ2A 4PLMA 2VCCA 3WP6A 3THTA 2V5DA 4R52A 3ZFFA 3V0AB 1UY0A 5I0UA 1SCSA 4UXAA 3O14A 2BGCA 2CDPA 2GMEA 3P6BA 3UYJA 5FY8A 5LB6A 4KL1A 4PLOA 4B7KA 3WSOA 3ZKYA 3UJQA 2GN7A 4CCMA 1XU1A 5F3GA 5LA2A 3UT0A 5ABJB 2ETEA 1YWKA 1ZBE1 5FZBA 1YLLA 1NOVA 5FK8A 3VBRC 3WHTA 2VNGA 4NO4A 4C0HA 5GZCA 1UIKA 1J3QA 4NPMA 2LALA 3TNPB 1U12A 4N53B 2BV4A 5FY1A 3E97A 2ZJCA 2ZGQA 2YDEA 2D3PA 4UF0B 1BLZA 3CLPA 2JG9C 3CQOA 2DVAA 2B9UA 2ZHNA 2ZACA 3T0AA 1I3HA 1YHFA 3TWIA 3PUSA 1WWYA 1NG0A 2R30A 3HNBM 1AR73 2UY9A 4WVMB 2I45A 2EIGA 4EN9B 5A3NA 1F8VA 2PQSA 5GM0A 3VBHB 4S2GA 3NAPB 3RYKA 2ZEZA 3UKTA 1CR7A 2BNMA 2QQOA 1UU4A 4J1WA 4P9IA 4QDQA 4OMDA 5CB7A 3U75A 1OLMA 1KDKA 3ILNA 2XR4A 3MYXA 5LASA 4Q4V1 1UPSA 3QH7A 4B4QA 1QH7A 5FY5A 4QB2A 4AGVA 5GZDA 2ZEWA 4BQ5A 2CAVA 2IXKA 2WFF2 3E6BA 1JU3A 1PNFA 2PHXA 3LZZA 5T52A 2WO1A 1ZYBA 2DU0A 1DYKA 2Q4SA 2HEYF 4XPVA 5I8YA 4ZS2A 4AVSA 1ULEA 1JZ7A 3JUUA 4AVCA 1RMU2 1W99A 1C1LA 1NAEA 4EN7B 4I3GA 2XBO2 1YCIA 1GZCA 2VZPA 3PVOA 3R6SA 2AUYA 2OA2A 3ZPOA 1IG0A 4DIQA 4QQPA 1QOOA 2YGLA 3MV01 3BIEA 4AVTA 1SFYA 2BP6A 2J1VA 1UL9A 3GZEA 5FREA 1OF4A 4BQ3A 4CEWB 3NV3A 3VHPA 3DPRA 3BOPA 3IMMA 3D0SA 4JTNA 1V9U3 1VBE2 4E27A 2GAUA 3ST7A 3ZFEC 2XXZA 3TEWA 5FIXA 1S0IA 1QF3A 3CZJA 4XEZA 4N9HA 1XSQA 3VD4A 2CY6A 1TME3 2X53S 4NIAA 3RNSA 1QWRA 1RUC2 3GJAA 3JB4C 3WV6A 4FO9A 1UZVA 4FPJA 1HDKA 1RJ8A 4PDWB 5SV5A 4AI1A 1OSGA 4KBZA 1Q8QA 5H9PA 1FATA 5FY9A 1WD3A 1SDDB 3AP9A 4IV1C 1NE4A 2G9GA 4XABA 1W03A 5L7OC 4S2FA 1H0BA 1KD7A 5KWRA 1H2LA 1GZWB 5C5UA 3PJYA 2E31A 4AI3A 1FOD2 4BLJA 4NUBA 4MADA 5C8WA 5C6CA 1QY4A 1RHI2 3CEWA 3TEZA 5JIUA 3SKJE 3V0BB 1RXFA 3C7EA 5F1RA 1RUG2 1QEXA 2AENA 5A32A 1QJX3 4LBNA 3RJRA 1DYOA 4NIHA 1RUF3 5A33B 1E57A 2QQJA 3WNLA 3LFIA 3N36A 5IT6A 3Q8CA 5GLUA 1TMF2 3G6JB 2VNRA 4UW4A 4NPLA 4YLZA 3THPA 3H1MA 3SITA 4KU8A 3ZFGC 5FYCA 1CONA 5DAVA 5FUPA 1ZNPA 5IK5A 3WF3A 3AZZA 4AVAA 3KT1A 1WMFA 4N90A 5T50A 1C5IA 4N43A 1T6GC 1QJU2 4CXWA 3AXEA 3PVNA 1A8DA 2XMLA 2E7AA 2YV8A 3OGRA 2BZDA 3IBMA 3R4SA 4WM7A 1CQ9A 5C7GA 4W50A 2DUQA 3VBRB 1PO21 2D6KA 4XILA 2ARXA 1XNDA 4Z2WA 2EF6A 1F5FA 1JODA 4G3YC 4ARYA 3DF0A 1AXYA 1DGLA 4Y20A 2VM9A 1VMFA 1PHMA 3PDQA 4BK5A 4N9IA 4XMIA 4OHZA 3K3NA 3MW4A 2CSGA 2VH9A 3N9NA 1XBFA 4FSJA 1B09A 1QXPA 4QB1A 1ZRDA 1OH4A 4QHOA 2VMDA 1QJY1 4DEQA 3OUJA 3POBA 1QNWA 5FZ6A 1TVGA 2YFUA 1Q56A 4RHV1 5D2AA 3VDDC 5ACA3 2D97A 4L97A 1ZM1A 2CYFA 2HJIA 4FFIA 4Y5TA 4GALA 2VQAA 3R05A 4Q29A 4BLIA 4I0AA 1V6KA 5FBJA 1WBLA 3AP6A 3OBRA 4J25A 4LHLA 1R092 4D7TA 4XAAA 5EQUA 4YW4A 1HB4A 1JU4A 2WDBA 1H1AA 5T55A 2HWF3 2XVGA 3AZVA 4K21A 1CX4A 2YC2A 1XRUA 1Z78A 5C70A 4FPKA 2HBUA 3WCRA 3B69A 2KXLA 1PX3A 1VBC2 3WG2A 4DY3A 5C8CA 5GLZA 2CGOA 4LMFA 5FMDA 1X8MA 3OPTA 2V4VA 5FYIA 1OUXA 3RZGA 5GLTA 3DV8A 3PUAA 4C91A 3T2PA 2QZ3A 4XJUA 4YZ5A 1CVNA 2C26A 2GN3A 4AAPA 2YROA 3P3PA 5L9VA 1COV2 2D6MA 1OUSA 2XUEA 3FFQA 4A3ZA 1JYXA 3SQOA 1ST8A 3M4FA 4JDMA 5FZCA 3VV1A 3SKVA 4EN0A 5KHJA 1LOGA 5CFDC 1HJGA 2WQZC 2WNVC 1PVXA 3BYWA 3O5SA 4HK8A 5IAVA 4COZA 1XNBA 3ZFEB 1UYPA 3JQXA 5F2WA 5LA0A 3PVBB 4O65A 1Q8SA 2W1QA 4NHMA 1K42A 3CMGA 3S5QA 1N1TA 5BNNA 1W2UA 2BOIA 2QQKA 3LPFA 3VBFA 4CCLA 1S0CA 1NXD1 2IXHA 4XDQA 1LHOA 3LPGA 2J1TA 5I91A 3LEMA 3KB5A 3VD3A 1ACCA 1D4M2 1NQJA 2WAOA 3AMQA 2JB8A 4JRAA 4QGMA 4RGKA 2K9ZA 5J09A 2JEMA 3MUY1 4IV1B 5FPAA 5L7OB 2XUMA 4M3CF 5B2GB 1AR63 2DTWA 3ZSLA 4RS5A 3C8XA 4YVWC 3VLBB 1OPOA 2AYHA 4MXWA 1MS3A 2GP3A 3N35A 5LRRA 5CBLA 3I8TA 5FYZA 5BNOC 1NA1A 2B42B 3MUZ1 3POIA 4XDPA 5A7OA 4A3XA 1DLCA 4DRRA 2ZEXA 4C0BA 2JG8C 1C57A 3KVBA 3CF6E 4BWOA 3IIIA 4XACA 4A6OA 2OQ7A 5DZFA 5AVPA 4AVVA 5EJ1B 1RUI2 2PTMA 3GCWA 4FPLA 1W8NA 2HWD1 4QX2A 4FBFA 3TYJA 1W9FA 3K48A 2E26A 5KHHA 3WDUA 3ZFGB 3FUOA 3LWCA 1E5IA 2Y0IA 1UXXX 3Q8BA 3MFCA 4W6YA 2RJKA 1VBD1 1JBCA 4BXFA 3M70A 4IW3A 1W39A 1I6XA 1UYXA 3MIHA 3H8OA 3AMPA 2PLV1 4AQ6A 4HVQA 3HJRA 3V64A 1ZRCA 5FYYA 2W52A 4ASKA 3QACA 3BVCA 3ZIXA 1VBB3 4AXOA 4HKLA 5FXVA 4URTA 3M3CA 3MEPA 2QQUA 3SCHA 1WZXA 5BNPA 5IHRA 1P8JA 2JB4A 5JMOA 3CU7A 2D3SA 1UNBA 1H8TA 3CDZB 1UMZA 4YW2A 2Q8DA 2HWB2 3HEIA 3ITQA 4AI8A 4BK4A 1EUUA 1RVF2 2YXSA 1G9DA 3VZOA 3ZXFA 4Q4V3 1DIWA 2P5BA 1CAXA 5DDJ3 3KV9A 3VDDB 1UZYA 1NY72 5DABA 1NUKA 1ZRRA 5JZGC 3BALA 1AR81 2DF7A 4QGNA 4LNVA 5FZHA 3UNPA 2H0BA 1TQ5A 1PVC3 2QZ2A 4TLGA 5FZGA 4AEJA 3UK9A 2B8MA 2PHFA 2NP0A 3OBAA 1LOCA 2HWE3 3ZO0B 2R063 1X8EA 3OPZA 4P9WA 5FZ9A 4EWAA 4XFAA 4UT5A 2XL7A 5JPNB 4FPCA 1IS4A 4MGZE 1F4AA 1IG3A 3ASIA 4W65A 2XG3A 3C7FA 5JR7B 3MICA 4XXPA 5BYNA 2RMU2 4B29A 1LHNA 3O1TA 4JKMA 1OURA 1R1A3 5L36A 4HLTA 1TZOA 4LO5B 2A3YA 1UX7A 2D5HA 1EAH3 4XZUG 1PGL1 1R081 4FPEA 1RXGA 2RM23 3H8UA 3RI9A 2BGPA 4LO8A 5L9RA 4QD2A 3MPPG 5GZFA 4CPBA 4AHXA 4LT5A 1HRV2 1MEC1 2D6PA 1H9WA 1UYYA 2VZOA 4LTAA 4XF3A 1BQPA 3H9AA 2Y6HA 4IGOA 3IMNA 5CFDB 3B9IA 2WNVB 3QCWA 3HVDA 3S30A 3M2MA 1ONAA 1WUVA 3PL0A 3RPQA 2MHFA 3H3ZA 2CU5A 3I59A 4PBPA 3ACGA 1NZIA 1V0AA 2X29A 3LCPA 5CKQA 1PIV1 1GYKA 4Y22B 1O4TA 4PIZA 1LJ7A 5I0SA 2R042 2HWC2 2RR11 3D3AA 3MV11 1N47A 4AFMA 1AYN2 3POJA 1FPN1 4CCNA 2ZS6B 2Z42A 2Y6FA 4Q0SA 5JMCA 1MQTC 1Y4WA 4XW3A 1OA2A 3ACLA 3OEAA 3WP4A 3ZSKA 2SBAA 3OGGA 1UOBA 2OW4A 3IN9A 2D6OX 3RS6A 3T1MA 4ZHNA 3AXDA 5ANQA 1XQNA 2KA3A 2GSYA 1WGPA 2V5YA 3ACHA 1ZA7A 1JYNA 1AVBA 1SPPA 3J9SA 1DU3D 1K5MC 3PTRB 1DQ2A 5CZKA 1KGYA 3OSDA 2VBPA 4AHZA 5BNQA 5D21A 2JG8B 1Q8VA 4QQLA 5EIYB 4BDVB 2BU9A 4JC1A 4AR2A 2ZMKA 5C3PA 2JKBA 4AEKA 3OUIA 4B7EA 2DBIA 1XYNA 4XUPA 3RI8A 4F83A 4Q4X2 4C1WA 3AVSA 2JKXA 4NWWA 3ZYGA 5LY1A 3VKMA 2A6WA 2P17A 1XOYA 4LBQB 2R0HA 2WSUA 2ZZJA 4LE4A 4BOWA 4QPGA 3O1SA 1E5SA 1CIYA 2PYTA 2VOVA 4V2WA 3T4VA 4SLIA 3DEMA 4EN6B 5GZGA 2DVGA 3R4DB 4G4FA 4MG2A 5FYVA 4ZU7A 2JE8A 1E5RA 3JCIA 4AGGA 4XUQA 1POV0 2ZGUA 3B7MA 4LIUA 3U78A 4A44A 4PBOA 3ZYFA 5AC91 2W1UA 3WP3A 1XE0A 1UXZA 1W8UA 4LHSA 4O7XA 4QAWA 1CN1A 5A7PA 1QH6A 3RVHA 3SH4A 1AX0A 4FPHA 1LEMA 1VMJA 4RHV3 1QOTA 4UFJA 1H2MA 5A3MA 2VECA 3B9CA 3UETA 3NKGA 5CFCA 4GJZA 4BJ0A 1GZTA 2VXRA 2X05A 1PM7A 3ACFA 3U4XA 2HH9A 4C90A 3LEGA 4YARA 2ZAHA 5F3IA 3VD9A 4MV2A 2V09A 4Y5SA 1H1MA 4GMP3 3SCFA 2UWAA 5JZGB 1HJFA 2JDMA 4JGYC 2XHNA 4RR3A 2QBXA 5JVVA 2BW8A 1VRH3 3I54A 2YGMA 3JD72 1FMD3 1YQCA 4AEMA 2ORXA 4IE6A 3M3IA 4LBQD 4SBVA 5CNAA 5E16A 1KQRA 4QPIA 3LOIA 4IV3A 2RG4A 4RQPC 5HXVA 1RUJ3 4RA0A 2VOTA 2YU1A 4NE9A 1OQDA 1SEFA 2E63A 4WZFA 5A80A 3SH5A 3TEXA 1ULOA 2E53A 4CCJA 1NCRA 2RV9A 1JOBA 1I1EA 2J42A 2O8OA 2VCMA 2MEV3 4BB3A 2UWBA 3PHMA 3EMRA 3N7LA 4OULA 2CAUA 1O4YA 5L73A 5IFTA 3KMHA 4KH9A 4ISRA 2XL9A 1L3JA 2RVAA 1OVPA 3KV5A 3LD8A 1ULPA 5FPVA 2WFF1 4CDWC 2Q5TA 2OZJA 4DEVA 1VAMA 1BEV2 5JUVA 3BODA 4GJYA 3K3OA 3B01A 2HYKA 3FZ3A 2XJVA 4H7MA 5AFEA 2F4LA 1RMU1 3NJXA 1YFUA 1CPMA 1FNZA 2JWPA 2AZ5A 2XBO1 2ZPXA 3A0NA 3NO8A 1ULGA 4L92A 5IVBA 1Z7S2 1I5PA 2JDHA 2CGNA 1NCQA 2ZCWA 2O0OA 4I02A 2R073 4MGKE 2VTFA 3BTYA 2OZ6A 4JHZA 1MQTB 5J48A 3BTXA 3O1VA 5JXIA 3ZM8A 5IJRA 5FZOB 2P6CA 3LSEA 3OTFA 1T6BX 5HCAA 5JAXA 3FFZA 3I2HA 2GDFA 4I01A 2GH8A 2EAKA 3GBWA 3AKPA 1L7LA 3MW2A 4AOCA 3WX5A 3LKJA 3QH6A 2ZGRA 2WYSA 1D0HA 1K5MB 3HR9A 4AI2A 2UURA 1RUC1 4JRLA 1UZ0A 3KCYA 5I0RA 1DHKB 2PHTA 5ANNA 1SCRA 5LK5A 4AFBA 2QKDA 2RS12 4FPOB 3MO4A 1PMIA 3DYOA 1W2NA 5F2SA 2BDRA 2JG9A 2P3IA 3UV9A 2PLV3 1BMV2 1Y9GA 1FOD1 1AXZA 1HB1A 1W0NA 2A6YA 3ILFA 1RUD2 4L99A 4U2AA 3TN93 2YUEA 1RHI1 5FV3A 4DXSA 4ZONA 2ET7A 1DBNA 2BWAA 3N9QA 3PMSA 2WS92 4UFMA 2XWBB 1WW5A 2OPWA 3NNGA 4O61A 1RUG1 4Q4W3 2YFZA 4YNIA 2XJRA 3WZ1A 2BQPA 4B1LA 3LIGA 2NMOA 4FAGA 4HKWA 1PNGA 3O1OA 1QMJA 1UY4A 2ZABA 5FOBB 2GZWA 1FI2A 1DQ4A 1HN0A 2JD4A 4TYSA 4LO4B 5E1RA 5E8AA 5HBAA 1TMF1 4NHLA 5IW0A 1X7NA 1XYPA 2XJQA 4HPKB 5FWJA 3B00A 2VD7A 4Q26A 4XUTA 1W6MA 1W6QA 2W3JA 3WNOA 1EUTA 1ALYA 3WHUA 4AEDA 1AHSA 5KXCA 1QJU1 4QU2A 2VNOA 1UU5A 1J1LA 4UBHA 4ASLA 4BQWA 2VR4A 3IKWA 2YB7A 1CZVA 1QQP2 1ZZ9A 2XQXA 4FI9A 4PLNA 5BNOA 1ZBA2 1U5XA 2Z2SB 4MGIE 5LEKA 2GC1A 1WA4A 4JGYB 3TRSB 2GC2A 1H4HA 4AVBA 1JYWA 1W6NB 2QFEA 2VL4A 4AWDA 2VUCA 1R083 2BFUS 3I3DA 2A5ZA 2Y6JA 2F6BA 1LEDA 1J84A 1ND3C 3F95A 1PO12 1ULCA 4RQPB 3WDWA 3ZSJA 4HANA 1VAVA 4CP2A 2DCZA 4KGGA 1F5JA 3CHXA 4Y1YA 4YG0A 3O0VA 4PIXA 3RQ0A 4BQ2A 5FPBA 4DFSA 2Y33A 5JXHA 2FMDA 2LM3A 2O8QA 1YJKA 4QU1A 4QX1A 4XFCA 4DRVA 1DQ0A 1SBEA 3J8F2 5I8SA 4AK3A 1C28A 1ODNA 1EPZA 4UBGA 4E4HA 1R091 3ILRA 3RYRA 3VKLA 3VKNA 2ZX1A 3DXUA 2WO3A 4GWIA 2ZOEB 1ZZ6A 1PZ7A 2IFWA 2WC2A 3T2QA 1W8FA 4LUKA 1UOFA 1FYUA 4AE2A 4OUSA 5A6QA 1JS9A 5F3CA 4CDWB 1VBC1 3LIHA 1J3PA 5FR3A 1HRI3 4XUNA 1WW6A 3ETQA 1SBDA 4XQWA 5FTTC 4OI1A 3WXPA 5CKNA 4UW6A 2DYCA 5KBFA 1N1YA 1GP6A 5LK7B 5LCWL 3IDEA 4JQTA 2WNUC 5FYSA 1S0BA 4NJ4A 3WNXA 4LKSA 3OYWA 4Z1VA 2J1SA 1C8M2 5F8PA 2AREA 4Q0QA 3O0WA 4IE4A 1COV1 2FD8A 1DDLA 3UKNA 1WCKA 4MVTA 2CDOA 1W2TA 4D94A 5F37A 4ATEA 3OOXA 3AL6A 4BMBA 3PTYA 5K4LA 4HVOA 5CIRA 1G8WA 2ID4A 2ORZA 1J59A 1SLLA 1POQA 4MYEA 4N7UA 2GC0A 5FLIA 3ZXAC 4N7IA 4GKXA 1GANA 5A7NA 1S4CA 3I2IA 4Q8KA 2J7MA 4A6SA 5FXZA 2ZAAA 4HFSA 2A1XA 1D4M1 1LOEA 3AP7A 1ULFA 4LOSA 1Q43A 3QD6A 2WL1A 1W3XA 2A70A 2P6HA 3SLIA 2VMHA 1G7YA 3EXUA 5IK8A 3ZFFC 2JDAA 4NRQA 4RSUA 4CUGA 2GALA 4QM8A 4KGQA 1GNZA 4RGGA 1RUNA 1O5LA 2VXJA 1G9BA 3POGA 2NPIA 3OPWA 2HEVF 4XE9A 4NRMA 2HBTA 2QJVA 2YPDA 3U0ZA 4HKOA 2ZX0A 1O3TA 1AR72 3L9JT 1EV13 1X33A 1DQ6A 3JB8A 2OT7A 3USSA 4COWA 4XUOA 3KSCA 1RUI1 2WIIB 4GB33 3HOBA 3BPZA 2RJ2A 1VP6A 4Q4Y2 4RYDA 5I93A 2D44A 4KNCA 5I0DA 5F7UA 2LUWA 2AC1A 1JYTA 1GSLA 1N3OA 1PZ9A 3RMXA 3IPVB 2WT2A 1LHUA 1A34A 5F6KA 2WT1A 5DMYA 3JBG2 1XE8A 1MZFA 2RS52 2XLGA 1QGLA 2Y60A 4L8QA 2B4KA 4AW7A 1XNAA 3KZ4C 4R9AA 5EHDA 3D4KA 2JECA 2ZHMA 2IZWA 2X5IA 4URAA 1W28A 1YI7A 4PF1A 3ZSEA 3DCQA 5EJZB 3VZMA 1FV3A 3H7YA 1MACA 3U14A 4AEDB 2DVDA 3IB3A 5FY4A 4EE2A 3N7JA 4CZSA 3AMNA 3H8XA 4XCAA 2HWB1 4XBNA 1ND3B 3SXWA 3S57A 1LODA 1RVF1 4D8MA 5BNOB 5IVVA 4FXGB 1XSRA 4PCRA 1W04A 1NY71 1W9YA 4HN0A 4NHYA 2VE1A 3A22A 3NV1A 2D98A 2ZTNA 4MXVA 2G9ZA 2W47A 2ZHLA 3BOWA 1TME2 1YQ5A 2K2SA 2LW8A 2ZMNA 4FP2A 5FPUA 2QDRA 1GP4A 1SFPA 2R0FA 4RGAA 1O3RA 1RMU3 2BUKA 4KI5M 5JOXA 2YZ4A 3O1RA 1AR93 2HEWF 4S2DA 3DPRC 5CVRA 3ZDSA 3ZMOA 2PHUA 4WM8A 2WO7A 3IIAA 1SLIA 4O9EA 1KXGA 2RMU1 1W6PB 3GBFA 3CL1A 1OLME 2WNUB 2FDKA 2NZ9A 2CV6A 4JGZA 4IUGA 4OHVA 3WQBA 1HXS3 1D4VB 1NLSA 3RZHA 2WWJA 1O3QA 1A8MA 1REDA 4YFWA 1IS3A 3N4MA 1ENRA 4OZOA 1HRV1 4LO6B 1ENQA 3MF9A 4Z92B 4CRQA 1M4WA 1J83A 1RUF2 4QB6A 3AZWA 4YW3A 3OY8B 4TSVA 3GZUC 1NT0A 1RUC3 2VMCA 4IEQA 1H8VA 1REEA 1BBT2 2RHPA 1VBA2 4LEJA 4DMIA 2W1SA 3OYWB 1JOJA 1OOPA 3OG2A 4IEYA 5J3UA 4YFZA 2IVIB 3NL1A 3GDBA 4E2GA 3AFGA 4QKNA 2DCYA 3NVCA 4INDA 4KWUA 2BJSA 2R041 2Z69A 1AZDA 2HWC1 4BXSV 5JOWA 2WLQA 3ALQA 1AYN1 5JXGA 5GLWA 5C4WA 4PIYA 2PN5A 3NW4A 3POSA 3D6EA 4Y3OA 3WF2A 4GIQA 1SZBA 1BK1A 2VTXA 1OVSA 4OI2A 3N9OA 5EYXA 5FLHA 3PLQA 3ZFFB 1IPSA 2QQPA 1RUOA 4TN7A 3DN7A 3IWZA 4IEPA 5FMCA 4BISA 3UKVA 1CGPA 1UW8A 3PU3A 5APAA 4AFDA 1FX5A 3NJYA 2VCBA 3LAGA 4N43C 1UQXA 1O8PA 4Y1VA 5C4WC 4WM7C 4M3CA 1UZZA 2D5FA 2WJSA 3K75B 5FYMA 3DXTA 1AL0G 2ZGLA 2VCAA 5FBZA 2EXIA 3WDXA 5ACA2 5BY5A 3TEYA 3I49A 3ZXGA 5F39A 1KFUL 4D6RA 1K45A 1FNYA 4Q4X1 3HD8B 1LOFA 4A7YA 5BV6A 3SH3A 3L2HA 1AYM2 3LDKA 2VQ0A 4QXBA 1SQ4A 1ASJ3 2HWF2 4OFGA 4XF0A 4BZ4A 5DUVA 3VHOA 4OQ9A 1YC61 1JZ2A 2VW1A 1LOBA 2PHLA 5KHGA 2G9FA 2QVSB 3N9LA 3OEBA 4E4DX 1V6MA 3Q9OA 4QGLA 2BNNA 1SG3A 2KR2A 3EHKA 4JZRA 4B4RA 4P02B 1UAIA 4BIOA 4P5HA 3ZN4A 4XZPA 4MGTA 1STMA 2JD9A 3GHMA 2WWSA 4H7LA 4YW6A 3RFRA 4QT6A 1RUE3 3GNEA 4YZ3A 1S2KA 2YG0A 3NQHA 1S55A 3THDA 1VAKA 1LESA 4CCOA 3F2ZA 4XFGA 1UOGA 1C3HA 5G05L 4UI9L 4QM9A 3VBSA 2BVBA 2VQUA 4PI2A 2XLFA 1OBNA 5LW9A 5C8CC 3U4SA 5IATA 4BHPA 3ZXKA 2VZSA 3I97A 2A6XA 2XONA 3LA7A 2O1QA 5J98B 3BU0A 1L7QA 4IEUA 1W6OA 1C8NA 3ETPA 2DCKA 4OUMA 1UYZA 3WG1A 3ZSMA 5C3RA 4CDXA 1UIJA 5A7QA 4V2VA 3WLUA 3LA2A 1PMHX 3JD71 1JTZX 5DAPA 5IFPA 1O8SA 4YPJA 1IQDC 3DKWA 5EV7A 3I2DA 3ZOIA 1UOJA 2EICA 3AYAA 3W5MA 5BPXA 2J1RA 2K0GA 3DPRB 5E88A 3DL3A 2VQTA 3OD0A 1Q3EA 1AR62 3I2OA 1O59A 2VZ3A 4ES8A 2RDRA 1JN2P 2XDVA 2FCUA 1LULA 4NVPA 5FKCA 5CYYA 5A6ZA 3ZLIA 4PQQA 3KHBA 4J6GA 2X8KA 2I2SA 4A2UA 5BNNC 3VBFC 4OHXA 4CDQA 5IVCA 4MSVA 5FZ8A 3QLQA 1JZ3A 2E7TA 2Y6KA 3Q8FA 2VO5A 3S6PA 1Y3TA 2IXLA 3VDBA 4OHYA 4QPYA 5C71A 2VMEA 2XGXA 1BEV1 1KS4A 3HN3A 3A0KA 1UN1A 4P14A 1CIWA 3O1UA 4CU9A 2BNOA 4RS5C 2RS32 1KJRA 1KDMA 4Q27A 3AZYA 2A6VA 1ZBE3 3RDIA 4DINB 1YJLA 1YI9A 4ZZ5A 3GCXA 4IL7A 4G9SB 1Z7S1 1NA1C 2OPKA 2WABA 4A4AA 5HCBA 1V6IA 5A7WA 5D1IA 5A32B 4E9KA 1UX6A 4IGQA 3P1IA 3C7HA 5DPNA 5LWBA 1GLHA 1VBB2 4GAZA 4LPLA 3VKOA 1OOPB 1F2NA 3APBA 3N9MA 3AMHA 2BRTA 1GR3A 3C7GA 2R16A 3POWA 5IK7A 1CESA 1BJQA 4I09A 3MIDA 2XJTA 2X09A 1RUI3 4HONA 3E5XA 4CEYA 2A71A 1OHFA 5FFOC 5GALA 3E6CC 4HETA 4N43B 4LOTA 4DXTA 2GNDA 2JE7A 4WM7B 5C4WB 1MPXA 3AYEA 3SEPA 3ACIA 5DDJ2 4UW5A 1S2EA 1LCLA 1ZZ8A 2RS11 1XE7A 4JQRA 4XF1A 1W2AX 3PNAA 3WUDA 1DYPA 2CWMA 3ZYIB 1JZ5A 2ZKLA 3CO2A 3KCCA 4HSJA 3ZR5A 3WQ1A 1PVC2 4Y20B 1HN1A 3I3EA 5BNPC 1GOGA 2XJPA 5DAWA 3FBMA 2HWE2 5CA6A 1G6NA 1BMV1 2R062 2G1MA 4LQRA 4CA9A 2WKKA 3VZKA 5JR2A 1H8TC 2LS6A 1RUD1 1YUDA 1K3IA 1W2OA 2VMGA 3AFKA 4QHZA 1UU6A 4C8DA 2WS91 4IERA 3W58A 4GD4A 1S2BA 3ROUA 5FY0A 3E6DA 1S0GA 4WZCA 3ZXDA 3UJOA 1JMUB 1GICA 4AL9A 2UU8A 1R1A2 2OUHA 3HPNA 4OMCA 5FZKA 4FQ4A 4DUXA 1EAH2 2HWB3 3T0DA 2GNTA 3OUHA 2W92A 1RVF3 3H42B 2RM22 4RL7A 2PELA 2ADEA 3FJSA 3NNFA 4COYA 4TTGA 2PAKA 5G04L 1KFXL 1VJ2A 1YFXA 1ENXA 4LBMA 2Q1MA 5C9AA 4OQ8A 2P1BA 4K9SA 3WEZA 1WKYA 1UKGA 5C8CB 4H3WA 2VGDA 1LU2A 4CXXA 4LR4A 1OKQA 1ZZCA 4OCTA 1GUIA 2VVEA 1YXWA 2EIEA 2ZKNA 3B94A 3H1WA 4ISQA 1QQP1 2XB6C 4O9GA 5A1AA 1ZBA1 3M1HA 1RYYA 4QX8A 4COVA 5C3OA 1KITA 1UY1A 2LTNA 3K46A 4HVRA 4IEVA 1KRIA 2Q30A 2C9AA 3T2TA 5KHKA 3T08A 3VHNA 1QJEA 3K51A 1DGRN 4MGQA 2ZZQA 5IAXA 1GOHA 3USUA 4HN1A 1MS1A 4GXLA 4QKDA 5FLJA 2TBVA 5A3WA 4IESA 1V6OA 1PO11 2V73A 3U07A 1IPJA 4YGCA 1HRV3 2DCTA 3MHZA 5F5AA 1JYCA 2Q0AA 2PXJA 4YWAA 4YW7A 3AB0A 1DQ1A 2BPA2 3WINE 3J8F1 2PHDA 5BNNB 3NWKA 1MS4A 3VBFB 1LHVA 3VBUA 4R4ZA 1FAYA 4XFIA 4EZHA 4XIOA 3NSTA 3HT2A 4IEXA 4NIIA 2WQ8A 2EXJA 5D8AA 1GQPA 4QDSA 5DZGA 4R9CA 5FO8B 5FMOL 3AVRA 2DCJA 1U5IA 3PURA 1W06A 5F32A 4D0QA 5FQ0A 5A3TA 3SMHA 4RS5B 1AX1A 1QXRA 1F31A 4MXWB 4FOWA 1U5ZA 4CDQB 3BUCA 5HXMA 4UW3A 3VL8A 4LA2A 1PO23 2WZR2 5AFBA 4GQ7A 1IKPA 1NA1B 1C8M1 2WSVA 2XWJB 2A73B 4Q8LA 4QXCA 1UF2C 3J7MA 1OLRA 5JOZA 2ZX3A 4GA9A 3VDCA 2WNOA 3BU7A 5D8AC 4MUVA 5CAZA 1PK6A 3HNYM 3BPSA 3LF7A 2FZ2A 3GJBA 2X10A 3GXUA 4XQDA 5IK4A 1LGBA 4GULA 4QX3A 1DP0A 5LEJA 4NPRA 3M3QA 1GWMA 3KV6A 1GV9A 1QJY3 2VZQA 3VZNA 2BBAA 2YMZA 4QPGC 2VTXJ 1S0EA 3KM5A 4CE8A 4MH0E 2WN3A 1WLDA 2VW0A 3ES1A 4YM0A 3K4AA 5FPZA 5CG8A 1REFA 4Z82A 4HOOA 1X36A 1C4RA 4XFFA 4LBLA 4ZY9A 5ISLA 4X6RB 4LKDA 4PI0A 3HBKA 2JDZA 5FUIA 5EPAA 1XC6A 3LDBA 4HZFA 5T5LA 1AJKA 5KXEA 3LOBA 3IAQA 3TOJA 3WW1A 3KV4A 3URFA 1JW6A 1VRH2 4ZXEA 4CSWA 3FHIB 1FMD2 1XNCA 1IS5A 3ZYBA 5BNPB 4A42A 1CAUA 4W4ZA 1H8TB 3VDAA 3O0XA 3I2JA 3PJQA 1PZ8A 5T5OA 3VBOA 5CFCC 3KF5A 1UY3A 4FCAA 4AHYA 1YIPA 5FZIA 4CDUA 3GZAA 1RUJ2 4FVVA 2HYXA 1OQ1A 1AR71 1CAXB 1RTVA 1ND2A 4H55A 4MX3A 3ZYPA 1LAJA 3I2GA 1NZCA 1GZ9A 2YPJA 1BVP1 3PMEA 4RR3C 5DAQA 4XETA 2MEV2 1SLBA 3A21A 4Q4Y1 5LBCA 1D7PM 5FZ7A 3HT1A 1N3PA 3U11A 3W5NA 3LEIA 4IDZA 4EWDA 3NNMA 2XJUA 1AL22 4W6XA 3OB8A 2Q8CA 4K40A 4QPIC 4LITA 4IV3C 4X8PA 2VUDA 2AEYA 3JD73 1ND2C 3H8RA 3W20A 2GP5A 1PMJX 5JI9A 3JBG1 1MS0A 4YVSA 1OD5A 2RS51 5FZ0A 4AYUA 1CPNA 3EQEA 1NCRC 2QE3A 3MIFA 1XJAA 2UYBA 4IXLA 4AFAA 4A7KA 4CP0A 1O91A 1CAWA 4LK6A 4OLLA 4EJRA 1TG7A 2PHRA 1RUH2 2E9QA 4COUA 1JYIA 1PM4A 5IVYA 2JDKA 4LA3A 2D40A 2WBKA 2Y64A 2R072 1GMMA 3RZLA 3AX4A 5FZAA 3WP5A 2GC3A 4Q0PA 3WF1A 2WNEA 3TBDA 2DVBA 1VBE1 3I59B 3MDPA 1OLQA 5HCHA 4Y1XA 2W2IA 4M0HA 1F9KA 4EN8B 1TME1 2E32A 3I3MA 3J4UH 3USUB 1N1VA 1NCQC 4WVZA 3EBRA 2HWD3 4ASMB 4BIFA 2W0XA 3V0AA 1DGWX 2ZX4A 2W9XA 4OI4A 3OCPA 1Z7S3 4XTPA 2L9LA 3GM8A 1FV2A 3WW3A 1VBD3 1IS6A 3A23A 1Q8PA 1KEXA 3RWKX 3ZX7A 1F35A 1DZRA 2ZX2A 2VBDA 4QMAA 4OVEA 5J37A 4LXLA 3NNJA 3TN92 4D6QA 5ABJA 4TZDA 2VULA 1SPPB 4C1XA 4MLOA 4M01A 4Y4YA 5LBBA 4FTBA 2AGSA 1JH5A 2YC0A 3KT7A 1EP0A 5FJKA 4Q4W2 3VD7A 4UFLA 3RRDA 4CPBD 4N53A 4P9YA 1AX2A 2WAAA 5D8AB 4V1PA 1EPWA 1GP5A 1RUF1 1DLLA 4DOUA 4E2QA 5FQ0B 2VUAA 4GMP0 1U0AA 1WLCA
chains in the Genus database with same CATH topology
2OXBA 3LIHA 5ANNA 1Y4WA 3ZR5A 4FFHA 1UYPA 3HBKA 5FMCA 3H3LA 3LDRA 2QQVA 2AEZA 1Y9MA 3SC7X 3LFIA 4JQTA 4UFIA 3S5QA 5FMDA 4FFFA 3PIJA 3PIGA 4UFKA 3UGFA 5FK7A 3U14A 3UGGA 2ADDA 4CCDA 5FKCA 4QHZA 2QQUA 3KF3A 5FMBA 1Y9GA 3LF7A 3U75A 4B1MA 4CCCA 3LEMA 3NMBA 5FK8A 2AEYA 3OSDA 5FKBA 2QQWA 3UGHA 4HXCA 2AC1A 4UFMA 4UFLA 3IMMA 3ZR6A 4FFIA 1W2TA 4FFGA 4CCEA 3KF5A 4EQVA 3LDKA 5FIXA 4UFHA 4B1LA 1ST8A 2XQRA 2ADEA 3LIGA 3RWKX 4AZZA 3U1XA 4UFJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OXB A;  3LIH A;  5ANN A;  1Y4W A;  3ZR5 A;  4FFH A;  1UYP A;  3HBK A;  5FMC A;  3H3L A;  3LDR A;  2QQV A;  2AEZ A;  1Y9M A;  3SC7 X;  3LFI A;  4JQT A;  4UFI A;  3S5Q A;  5FMD A;  4FFF A;  3PIJ A;  3PIG A;  4UFK A;  3UGF A;  5FK7 A;  3U14 A;  3UGG A;  2ADD A;  4CCD A;  5FKC A;  4QHZ A;  2QQU A;  3KF3 A;  5FMB A;  1Y9G A;  3LF7 A;  3U75 A;  4B1M A;  4CCC A;  3LEM A;  3NMB A;  5FK8 A;  2AEY A;  3OSD A;  5FKB A;  2QQW A;  3UGH A;  4HXC A;  2AC1 A;  4UFM A;  4UFL A;  3IMM A;  3ZR6 A;  4FFI A;  1W2T A;  4FFG A;  4CCE A;  3KF5 A;  4EQV A;  3LDK A;  5FIX A;  4UFH A;  4B1L A;  1ST8 A;  2XQR A;  2ADE A;  3LIG A;  3RWK X;  4AZZ A;  3U1X A;  4UFJ A; 
#chains in the Genus database with same CATH topology
 1BBT 1;  2IVJ A;  1CZS A;  1VBA 1;  3AZX A;  4JDN A;  4D6S A;  2EAA A;  4RN5 A;  4QPG B;  2RS1 3;  4IE5 A;  1VAL A;  3JZV A;  5CEH A;  1Y9M A;  1C1F A;  4I0B A;  4WVM A;  4UWD A;  3RJ2 X;  5A1F A;  3VBH A;  4KBB A;  3N9P A;  4K20 A;  1AR8 3;  5E89 A;  1AXK A;  1YO8 A;  5FP9 A;  3NMB A;  4JX0 A;  1RUD 3;  4BPZ A;  2QQW A;  4NRP A;  1O7F A;  1OI6 A;  3BTA A;  4BQY A;  2JX9 A;  5FRA A;  4Y33 A;  1W9T A;  4N8M A;  4HMZ A;  3AC0 A;  3GBG A;  2C9K A;  4JKL A;  3AK0 A;  2NN8 A;  1QNY A;  1A3K A;  2XKO A;  3J7H A;  3AJY A;  2LRP A;  3CJI A;  4FFH A;  4EWE A;  3WOG A;  4AED C;  1NLR A;  2E33 A;  1XYO A;  5CFC B;  3CNA A;  1RJ7 A;  1JZ8 A;  2JXA A;  1XXN A;  2FCV A;  2K46 A;  1VLN A;  4FOQ A;  4XDO A;  5EYY A;  5DXD A;  1GNY A;  4LUM A;  5FYB A;  1HV0 A;  3BCW A;  3RGB A;  2VY0 A;  5FOJ B;  5ACA 1;  5FK7 A;  1MEC 3;  5C33 A;  4X6Q B;  1BKZ A;  2ZML A;  4Q2F A;  5FZ1 A;  1G86 A;  4P9J A;  1GWK A;  4RR3 B;  1JUI A;  2W91 A;  5FY7 A;  5GLV A;  1AYM 1;  4AHW A;  1CAU B;  4K8F A;  3T1L A;  1QHD A;  1I5Z A;  2WT0 A;  5F3E A;  2B9V A;  2HWF 1;  2JDN A;  3CJI C;  4IEZ A;  1GU3 A;  1K12 A;  2YC4 A;  3ELN A;  3GZT B;  4XC9 A;  5A70 A;  2B5H A;  2JIG A;  4QPI B;  3DEC A;  4IV3 B;  4LKE A;  2XJS A;  1WBF A;  2QQL A;  2ATF A;  4JAA A;  5F5I A;  4AZZ A;  1ND2 B;  1PIV 3;  4AQ2 A;  3WR0 A;  1HRI 2;  2IXI A;  4OZX A;  1YFY A;  2TNF A;  2RR1 3;  5T54 A;  1WCS A;  1UO9 A;  1NCR B;  4PDW A;  1FPN 3;  3SC7 X;  2WWU A;  3FUQ A;  5FXX A;  2XLA A;  3AL5 A;  3SIS A;  3SCG A;  1WMX A;  3AP4 A;  3Q8E A;  4YRD A;  3WDT A;  2DUR A;  4UYB A;  1W3V A;  4MZU A;  1GZW A;  4OHW A;  4R9D A;  3U10 A;  5LA9 A;  2Y38 A;  2RDQ A;  2FDG A;  3LE0 A;  2GH2 A;  3RG0 A;  4PF5 A;  2CGP A;  3IAP A;  1TE1 B;  5J7M A;  2WZ8 A;  4IE0 A;  3V0B A;  3MBW A;  2EXH A;  4XUR A;  2C24 A;  3POY A;  5IVJ A;  5KXB A;  2W87 A;  4QDR A;  5A33 A;  5JXJ A;  4L2N A;  2D6N A;  1TNR A;  1NCQ B;  5CIS A;  2HLE A;  2ZBJ A;  3ZYR A;  2BWC A;  3HBZ A;  4J1X A;  3WG3 A;  3WW4 A;  2JIC A;  1WLW A;  3RZJ A;  1AR6 1;  1G9A A;  4CVU A;  4FAH A;  3ZR6 A;  1BXH A;  4XBQ A;  3B02 A;  1H9P A;  1OFN A;  3X29 B;  4BH9 A;  5AC9 3;  2Y6L A;  5L19 A;  2J22 A;  5FZL A;  2KD7 A;  3VBR A;  4FXK B;  2VMI A;  4EQV A;  1RL3 A;  3T09 A;  3RZM A;  3FE5 A;  1S0D A;  2V72 A;  3W9A A;  2IXC A;  4CCK A;  4XHX A;  1EV1 2;  2R32 A;  3T0B A;  5JSO A;  1SMV A;  4DXR A;  4YM3 A;  3K2O A;  5H9S A;  3O1M A;  5FP8 A;  2P4E A;  3WG4 A;  2JG9 B;  2UWC A;  3FMG A;  4GB3 2;  5FZ4 A;  2ZGT A;  3BI3 A;  3MIE A;  3O12 A;  1WW7 A;  4BYY A;  3VHR A;  4JHT A;  1W0P A;  4JKK A;  1W8T A;  2RS3 1;  3H1Y A;  4IEW A;  1MS9 A;  1JHN A;  3CJX A;  4HXC A;  1H2K A;  2YU2 A;  3CBN A;  4XJ9 A;  2MPF A;  2OKX A;  3G7D A;  3FX3 A;  4E8C A;  5K8S A;  2BBV A;  1EYB A;  1MZE A;  2FDF A;  4L0P A;  1DFQ A;  2DDU A;  2AR6 A;  3IT8 A;  1ZRF A;  2JDU A;  2Y6G A;  3VGI A;  2FDJ A;  1VBB 1;  2JE9 A;  4LOR A;  4MGS A;  4Y26 A;  3WNK A;  2VZ1 A;  4D7Y A;  3H3L A;  4DQA A;  1SLA A;  2N7G A;  5FZF A;  2P3K A;  1W6M B;  4DUW A;  1W6Q B;  1HB3 A;  4I0W B;  5FZ3 A;  5L9B A;  4Q4Y 3;  2FDH A;  2EIB A;  3FHA A;  3OD4 A;  4WVW A;  2GMM A;  2Z79 A;  3ZN6 A;  3WQ0 A;  2WQ4 A;  4F3J A;  1POV 1;  2Z4F A;  2A7A A;  3S5A A;  4Q1P A;  2EAL A;  5DDJ 1;  1JYV A;  2OQ6 A;  3J7L A;  5JDB A;  1V9U 2;  1WD4 A;  3OJB A;  4GH4 A;  3ABZ A;  1WCD J;  1J1T A;  3IDA A;  4NR1 A;  4QHB A;  2WA3 A;  2FDI A;  1JHJ A;  3ZMN A;  2X5I C;  1PVC 1;  3RMY A;  1WA6 X;  2WFF 3;  5J36 A;  3JBG 3;  1CX1 A;  2RS5 3;  3WUC A;  5LZ6 A;  2HWE 1;  3O1P A;  2E6V A;  3CJI B;  2R06 1;  3PU8 A;  3ZFE A;  1OA4 A;  2WUH A;  5FYT A;  4P5Y A;  2YBK A;  1F15 A;  2QQV A;  3DKQ A;  1AR9 2;  1AJO A;  4Y5Z 0;  5F5Q A;  2XBO 3;  2CNA A;  1XB9 A;  4LKF A;  1UWW A;  1APN A;  4GH4 C;  1J3R A;  2WLP A;  3PVE A;  5LA1 A;  1R1A 1;  1Q5O A;  2A3W A;  3QBQ A;  1EAH 1;  2ARC A;  1YEW A;  3KQR A;  3ZDV A;  3JU9 A;  5A7S A;  4BA6 A;  1HXS 2;  2RM2 1;  2XVL A;  2ZA9 A;  5FAX A;  3J7N A;  4IV1 A;  2VBB A;  2W95 A;  3QOP A;  2ZGK A;  5F5C A;  1VBE 3;  4ZU4 A;  5L7O A;  4S2H A;  1W8Z A;  5JWP A;  2G4I A;  5T3N A;  4AG4 A;  1VIW B;  1VMH A;  1NQD A;  1QJX 2;  4WM8 C;  5HV4 A;  1D2S A;  4CU7 A;  2J1A A;  4A7Z A;  2YHJ A;  4NWV A;  2VPV A;  4AQS A;  3FLR A;  3NJV A;  3MW3 A;  2BOJ A;  1ODM A;  1X82 A;  4QQ2 A;  5M0T A;  1UZW A;  2ZGP A;  4JGZ C;  4UFK A;  5A6X A;  2Y0O A;  1Q8O A;  3R0R A;  3KQ4 B;  2DV9 A;  1W90 A;  2TUN A;  4NRO A;  5K7P A;  3MI8 A;  1LHW A;  2GMP A;  3UGH A;  3WF0 A;  1BYH A;  1QIQ A;  4GKY A;  4KU7 A;  2VAU A;  3RZZ A;  3KVA A;  5DUU A;  2Z5W A;  4ZKT B;  2F4P A;  1FOD 3;  3ZFG A;  3HNM A;  2H6B A;  5IVE A;  3W21 A;  1RHI 3;  3WDY A;  4XJW A;  1OQE A;  3HWJ A;  3IDB B;  2VOW A;  4FPY A;  1OOP C;  1RUG 3;  2WO2 A;  3POE A;  4LHN A;  3WY6 A;  4MO3 M;  1MZ6 A;  4MHR A;  5JCT A;  5EP9 A;  1BBT 3;  1LOA A;  2XH6 A;  1VBA 3;  3C2U A;  4KQ7 A;  4K1Y A;  4FTE A;  3FBY A;  1GWL A;  1TMF 3;  3CIH A;  4Q1R A;  2J1E A;  3HQR A;  3AM2 A;  2VC9 A;  1LGN A;  1XPW A;  3LQC A;  2P2K A;  3H3U A;  3EJK A;  3TNQ A;  2DFC A;  5FJH A;  4ORF A;  4MGY E;  4K3U A;  2I07 B;  1UCX A;  4FFG A;  5B4N A;  5KC6 A;  2DBN A;  1QJU 3;  1ASJ 2;  2OII A;  5FUN A;  3B5L B;  3MLJ A;  1H6X A;  2WZP P;  1US3 A;  5EXO A;  3U1X A;  2AAC A;  2OX0 A;  1IGO A;  3VDD A;  2WZR 1;  1OT5 A;  3FL7 A;  4FPF A;  2BEO A;  2FMY A;  4P08 A;  5C3Q A;  5ERL A;  3THC A;  4E4Z A;  2Q1F A;  2G19 A;  1DCS A;  2VVF A;  3N3H A;  3BTZ A;  4YGB A;  1OMI A;  4QKB A;  3IDC B;  4UFI A;  4DO0 A;  4HSL A;  1DGW A;  1RUE 2;  1LOF C;  2D93 A;  1N3Q A;  4P9X A;  4GZ9 A;  3OGV A;  4FP3 A;  3LA3 A;  2VNV A;  3D82 A;  4LBJ A;  2WZE A;  4MHU A;  1PGW 2;  1XNK A;  4XCB A;  5FWE A;  3U37 A;  1JI6 A;  3D5O A;  2CL2 A;  2RJL A;  4E2S A;  3VN4 A;  2DWR A;  1UMI A;  4ZU5 A;  3GYD A;  2MNG A;  5IUQ A;  3AJZ A;  1AYM 3;  3K4D A;  1NYW A;  1R09 3;  3AMM A;  1IOA A;  1W05 A;  4Y24 A;  1QXJ A;  4GMP 1;  3W59 A;  4AGR A;  5F9T A;  4GWM A;  4YM1 A;  1LU1 A;  1PX4 A;  4XF4 A;  4DNY A;  4Z2A A;  4KWK A;  2X5I B;  5H9Q A;  5CFD A;  1VBC 3;  1VRH 1;  1J58 A;  1X9P A;  1ZA4 A;  1FMD 1;  2WNV A;  2YBS A;  2UYA A;  1WW4 A;  1US2 A;  4P9L A;  4YG6 A;  5C5T A;  3SHR A;  4LE3 A;  4CUB A;  1JXN A;  3VBS C;  3ZN6 B;  4M3C E;  5JI7 A;  3ZYJ B;  2VMF A;  3CZU A;  3WVJ A;  1H2N A;  2Y8K A;  5JPM B;  1DZQ A;  4LK7 A;  1U5Y A;  1G9F A;  2IFR A;  4Y22 A;  1CD3 G;  4GH4 B;  1DGR A;  1OF3 A;  1RUJ 1;  4XFB A;  4YM2 A;  4OI0 A;  3C3V A;  3HAG A;  4FQZ A;  1COV 3;  4KWJ A;  4B4P A;  1LKN A;  4CDX C;  2R49 A;  1BHG A;  4YG3 A;  4LLO A;  4EYU A;  4M00 A;  1ZZB A;  4NMI A;  2MEV 1;  5K9Y A;  3KLS A;  4Q0U A;  5DG2 A;  5LY2 A;  4QKF A;  2BER A;  3LDR A;  3I3B A;  4FT8 A;  4ITC A;  3NV2 A;  4XJZ A;  1AL2 1;  2C1F A;  3MLK A;  2P3Y A;  3DUI A;  4PJY A;  4ATF A;  4BQ1 A;  4DUV A;  4YVW A;  4FOY A;  3PIG A;  1Y9Q A;  2BTV C;  4WM8 B;  4WBB A;  2W5F A;  1HX6 A;  2EVX A;  1NE6 A;  2TEP A;  3T30 A;  2A6Z A;  3NRU A;  4M4P A;  2C4X A;  1ZBE 2;  1WCQ A;  1D4M 3;  2JG8 A;  3OGS A;  4JGZ B;  1OA3 A;  2P34 A;  3LSD A;  1O6U A;  4CDQ C;  1LNS A;  1RUH 1;  1YQ6 A;  2A3X A;  3I3Q A;  4XYX A;  2R07 1;  3DYP A;  1YNA A;  2VUJ A;  4LBQ A;  4NAO A;  2NQY A;  5JIA A;  1X9T A;  2QQN A;  3N7K A;  1GQH A;  1LRH A;  2FCT A;  5HPO A;  3E5U A;  1O5U A;  2ES3 A;  1YQ8 A;  3FC0 A;  4NHX A;  5A1L A;  1YQ2 A;  2IXJ A;  1V70 A;  4QQO A;  1MS5 A;  3VL9 A;  4WVV A;  4LO7 A;  5AVA A;  3I4I A;  3PUI A;  4XF9 A;  2D3R A;  1ZZ7 A;  2Y26 A;  1M06 G;  4IET A;  4XJ8 A;  5DAX A;  3WNM A;  1HIX A;  1UD1 A;  3NJZ A;  2RS3 3;  2ZEY A;  4LBO A;  4YGD A;  1YRZ A;  3VB9 A;  4Q4V 2;  3HIF A;  5GJ6 A;  4KWL A;  4BU2 A;  4BME A;  5A3P A;  4QX5 A;  1H6Y A;  3VZL A;  2QUO A;  2V4A A;  4FPG A;  3BKZ A;  3M7A A;  4W6W A;  2W1W A;  4K1Z A;  2Q8E A;  1QDO A;  3TN9 1;  2P37 A;  1QU0 A;  2R6Q A;  1GKB A;  2OUJ A;  2VJX A;  3LB9 A;  1VE0 A;  4HG6 B;  2YBP A;  5FZM A;  1S0J A;  4CEY C;  5JZG A;  4FOV A;  3LFM A;  4BM8 A;  1O4Z A;  4Q4W 1;  5DQ0 A;  4M3C B;  3WQ7 A;  4Z8B A;  1XNT A;  3H7J A;  4E4S A;  1OXC A;  1JZ4 A;  1O3S A;  3C7O A;  4XTM A;  4OUE A;  4CTE A;  5A3U A;  2QDN A;  1DQ5 A;  4QX7 A;  2R1B A;  4HL0 A;  3PUQ A;  4TLF A;  1POV 3;  2EA7 A;  5H9R A;  1LEC A;  1JUH A;  4Q0V A;  4NID A;  3N7M A;  4XBL A;  2XOM A;  3MZH A;  1MVQ A;  4PQ9 A;  2D43 A;  3S7I A;  3INA A;  4YYO A;  2W39 A;  2VOX A;  3R4U A;  5DN2 A;  3WW2 A;  3MPB A;  1WLT A;  1YIF A;  3GHN A;  3S0M A;  1JOP A;  1R64 A;  3KHC A;  2ENR A;  3NNL A;  4LLF A;  3E5Q A;  5KC5 A;  2W46 A;  2DUP A;  2WR9 A;  2VZT A;  2AH2 A;  3JQW A;  1R1Z A;  2CTV A;  2YY1 A;  2ARB A;  3A7Q A;  4I30 A;  3WF4 A;  4CCE A;  1C5H A;  2RMU 3;  5FP7 A;  2JJ6 A;  3OGJ A;  5C9A C;  2A75 A;  2PQQ A;  3VBS B;  1BZW A;  3FHQ A;  5FYH A;  4WV8 A;  5FP4 A;  2NYY A;  5J1X A;  4XQ4 A;  4LIV A;  1KS5 A;  3SNM A;  4GWJ A;  3P3N A;  4CU6 A;  1W6O B;  4NN0 A;  1TEI A;  4NIG A;  2AEZ A;  4CDX B;  2H6C A;  4QXK A;  1Y7B A;  1QDC A;  4XXA A;  1EY2 A;  1MQT A;  3EO6 A;  4JDO A;  4CP9 A;  2IWG B;  3KD4 A;  2XPJ A;  2ARA A;  5FZO A;  2B39 A;  3T2O A;  1RIR A;  2JEN A;  3GGL A;  3MGU A;  4Y4R A;  5JSP A;  1OD3 A;  1ZX5 A;  4A45 A;  1HRI 1;  2GNM A;  4P00 B;  4DY5 A;  1H30 A;  1K5M A;  2XQR A;  1T2X A;  2R04 3;  2UY8 A;  2HWC 3;  1CAV A;  4W8J A;  2PMW B;  3GF6 A;  2VG9 A;  3ZVX A;  4DXZ A;  1YFW A;  1AYN 3;  2WN2 A;  2FQP A;  3IM0 A;  4NHK A;  4X8N A;  5LBE A;  3VD5 A;  3AKQ A;  1K5J A;  1MS8 A;  4XFH A;  1PO2 2;  3VBU C;  1A6C A;  4ONU A;  3E1F 1;  2E7Q A;  3OBZ A;  3ZKU A;  4YVW B;  2FZ1 A;  3FN9 A;  4OYU A;  5KR7 A;  3T3Y A;  4BCU A;  4CCD A;  1L7R A;  2NM1 A;  1HB2 A;  5C3S A;  1Y43 B;  4YZ4 A;  4B1M A;  1N1S A;  4YW1 A;  4CP1 A;  4U36 A;  4R9B A;  3KS7 A;  1WCU A;  4ARX A;  5IVF A;  4IE7 A;  2DUO A;  1QJY 2;  4YSF A;  2R1D A;  2XVK A;  1IKQ A;  2BVV A;  3I2K A;  2ET1 A;  4GWN A;  1S1A A;  4Q5O A;  4ES9 A;  2VZV A;  4UFH A;  2VOK A;  4RHV 2;  1HW5 A;  1RIN A;  2PAM A;  2XKP A;  3AYC A;  4EZ4 A;  2GU9 A;  1RGS A;  4F7Z A;  4MOA A;  1OH3 A;  1W9W A;  3ORJ A;  4Q4X 3;  5A7W B;  3KWV A;  1W8W A;  1H4G A;  2IUW A;  4MET A;  3WNN A;  1HQN A;  1PK6 C;  2JDP A;  4BQ4 A;  4IQP A;  4HPK A;  1UY2 A;  2WZR 3;  2FHR A;  2HKX A;  2I74 A;  4XIK A;  1D0G A;  2ZGN A;  3BIW E;  3D0J A;  4L9B A;  3EYP A;  3TB0 A;  1MVE A;  1XU2 A;  4CEY B;  2B7Y A;  4NOT A;  4JCK A;  5HV0 A;  2E51 A;  3MLL A;  1CZT A;  1I9R A;  4JGY A;  3S7E A;  3ZYH A;  3M3O A;  3AKT A;  2PHW A;  4M0N A;  1W6N A;  1AF9 A;  5FMO S;  1IQA A;  1EV1 1;  1MZ5 A;  2ZGM A;  5EJ3 A;  5LRS A;  4GB3 1;  3PUH A;  3ENR A;  4HK9 A;  3ES4 A;  4A41 A;  4RQP A;  1KJL A;  2Y34 A;  2QCS B;  2SLI A;  5FO7 B;  1RIT A;  2DTY A;  2WIN B;  4FFF A;  4XHB A;  3ZPY A;  5CG9 A;  1AUY A;  2WRA A;  5BXX A;  3VBO C;  1GFF 2;  1WME A;  1VPH A;  5F6L B;  4CDU C;  2ILM A;  4ZXK A;  5DG1 A;  1FXZ A;  3ECQ A;  5K0U A;  2O14 A;  3LEK A;  5HI0 A;  1CJP A;  3KGL A;  1V6N A;  4CDW A;  1DZT A;  4ERO A;  2JIJ A;  2LRO A;  1X50 A;  4KG8 A;  1DG6 A;  5C9A B;  3K77 A;  5JOY A;  1D2Q A;  5JSR A;  1JZ6 A;  3RYP A;  5EFU A;  4QXH A;  4ZS3 A;  1PGS A;  2Q1Z B;  4NAM A;  5EZW A;  3V56 A;  4B8E A;  3WT3 A;  5K0U C;  2RDN A;  3FWE A;  4YVS C;  4ET7 A;  5CAD A;  5J96 B;  1QJF A;  1AL2 3;  2QNK A;  1V9U 1;  5FPX A;  4CCC A;  1IZ3 A;  1B35 A;  3AP5 A;  5FKB A;  5KXD A;  2F17 A;  3NV4 A;  1HKD A;  4JVA A;  2VZR A;  1BEV 3;  1GNH A;  1NLQ A;  2C0Z A;  5FCC A;  2D6L X;  2HWD 2;  5IWF A;  4HBN A;  4IEO A;  2QQM A;  3Q8A A;  4XMA A;  3AKS A;  4HT1 T;  4KG0 A;  1AR9 1;  2GNB A;  4QQH A;  3O7O A;  1RUH 3;  4TXW A;  5I0T A;  2Q8O A;  4M4R A;  3CKH A;  5GKA C;  1B35 C;  1VBD 2;  3H50 A;  2B45 X;  2B46 X;  3K4Z A;  4DS0 A;  5FO9 B;  3P5B A;  1HQW A;  2P3J A;  5EWS A;  3BN6 A;  1IHM A;  2PLV 2;  3B3Q E;  4R4X A;  4CP9 B;  5IYY A;  2ADD A;  4JV4 A;  1SFN A;  1HXS 1;  1Z0H A;  3VBU B;  1RB8 G;  4Y1Z A;  1E5H A;  2DVF A;  3ZN5 A;  4CUC A;  2XHK A;  2PAE A;  1V6J A;  1IPK A;  5B4X A;  2PFW A;  3MF6 A;  3H0O A;  1URX A;  3A4U A;  1QKQ A;  4RFT 0;  3WNP A;  4DZG A;  1F4H A;  1SDW A;  2CWS A;  1VR3 A;  3AYD A;  1QJX 1;  3DYM A;  1CAV B;  5SV8 A;  1OKO A;  2JDY A;  4BE3 A;  4UF0 A;  4PHZ A;  1VB2 A;  4DPN A;  3UL2 A;  3WCS A;  2C6S A;  5BUV A;  1W9S A;  2BFU L;  5FZE A;  2ZGO A;  4KMQ A;  2EXK A;  1V00 A;  1NKG A;  5A6Y A;  5ABJ C;  2DU1 A;  1W8O A;  3POF A;  3UES A;  1FT9 A;  1AR8 2;  2VZU A;  1GQG A;  3PIJ A;  4E8D A;  5A3L A;  1ENS A;  3UGF A;  4N53 C;  4R8H A;  3M3E A;  5CKM A;  5E6H A;  4IGP A;  1W8H A;  3NAP A;  4LUL A;  3ZIW A;  1PK6 B;  5FMB A;  4CU8 A;  1LR5 A;  2ZHK A;  3KCX A;  5DUX A;  5HCF A;  1LGC A;  3GAL A;  5GZE A;  4AI9 A;  1TNF A;  3KT4 A;  3KGZ A;  4JTO A;  1ULD A;  2KM2 A;  3FLP A;  4LBK A;  4AFC A;  4AQT A;  3IPV A;  4D7S A;  2WS9 3;  1VRB A;  4XJA A;  3ZXE A;  4YW5 A;  3VKF C;  3HQU A;  4UAP A;  4AI0 A;  3VBH C;  2OXB A;  2RDS A;  5JLV A;  1PGL 2;  3NAP C;  1R08 2;  4QWN A;  3AKR A;  3EB7 A;  4B3N A;  1S0F A;  3T4H B;  3ON7 A;  1DF0 A;  1W0O A;  2WFP A;  4F8A A;  4TWT A;  3MIG A;  3NKT A;  2R7E B;  4BQX A;  4YZ1 A;  4Z07 A;  1MEC 2;  2OVU A;  2J1U A;  5A3O A;  4CYD A;  3RWN A;  3UGG A;  5DZE A;  4XVH A;  3V65 A;  3ZXJ A;  2NLR A;  1ND3 A;  4CUA A;  1H1I A;  4H2A A;  1UKR A;  1ASJ 1;  4XAE A;  4CEW A;  3ME2 A;  4RFR B;  2VVD A;  4I2O A;  1HV1 A;  3OF1 A;  2C5D A;  4AF9 A;  3IZO A;  3VBO B;  2W68 A;  1QQP 3;  3BGA A;  4FTS A;  3HQX A;  2QQI A;  5FPL A;  2PA7 A;  1ZBA 3;  2W08 A;  2EID A;  1PIV 2;  2ERF A;  3OBT A;  4H14 A;  4CDU B;  2YYO A;  3DGT A;  3BB6 A;  2OYZ A;  5FDB A;  5KHI A;  4YGE A;  1CJD A;  2RR1 2;  4ZPI A;  1ZRE A;  4LHK A;  4P9G A;  2RE9 A;  2VW2 A;  4K8R B;  2BYV E;  5FYU A;  1FPN 2;  3RZK A;  1LTE A;  3TAY A;  1BCX A;  1RUE 1;  2ZXQ A;  4ZZ8 A;  2VU9 A;  3WDV A;  1HQL A;  5T5P A;  4CEW C;  3VUO A;  4L11 A;  1PO1 3;  4K7J A;  4EV0 A;  1A78 A;  1PGW 1;  1BK0 A;  1VB4 A;  3D8C A;  5LAT A;  4AAX A;  3I2F A;  2W94 A;  1W6P A;  2BGO A;  1QOS A;  3M8L A;  4CXY A;  1ZVF A;  2WNU A;  3SEE A;  3J8F 3;  3ZXL A;  4D3W A;  5K0U B;  3B93 A;  3I7D A;  2DFB A;  4YVS B;  3VZJ A;  2CHH A;  1SLC A;  3HN1 A;  1SBF A;  2FBE A;  3HMY A;  4XOG A;  5LBF A;  1SHW B;  2QTW B;  4I3P A;  2WYF A;  4PDW C;  5TSW A;  1CAW B;  1OC1 A;  5I8T A;  2IC1 A;  5CU1 A;  1GOF A;  3OY8 A;  1NX9 A;  1OPM A;  2ZGS A;  4UOJ A;  1HLC A;  1OFS A;  1QJZ A;  2NMN A;  4RD7 A;  5DUW A;  1UPI A;  3J26 N;  1CWP A;  1SLT A;  1YYN A;  4K6B A;  1NXM A;  1BVV A;  1G9C A;  1UMH A;  3L2Y A;  2WA4 A;  1LB2 A;  1SAC A;  3FLT A;  3WD5 A;  3KF3 A;  4LJH A;  4Y1U A;  1B35 B;  4QPW A;  3MFA A;  1C8M 3;  2D7F A;  3LGR A;  1MR5 A;  4PT6 A;  5FP3 A;  1LEN A;  1RC6 A;  5FZD A;  2H0V A;  3JXS A;  5AC9 2;  3ATG A;  2OS2 A;  3MIB A;  3RSJ A;  4DB5 A;  4QX0 A;  1ZRI A;  1GBG A;  1V6L A;  5FXW A;  1WMD A;  5T5J A;  4D69 A;  4YZ2 A;  4PLM A;  2VCC A;  3WP6 A;  3THT A;  2V5D A;  4R52 A;  3ZFF A;  3V0A B;  1UY0 A;  5I0U A;  1SCS A;  4UXA A;  3O14 A;  2BGC A;  2CDP A;  2GME A;  3P6B A;  3UYJ A;  5FY8 A;  5LB6 A;  4KL1 A;  4PLO A;  4B7K A;  3WSO A;  3ZKY A;  3UJQ A;  2GN7 A;  4CCM A;  1XU1 A;  5F3G A;  5LA2 A;  3UT0 A;  5ABJ B;  2ETE A;  1YWK A;  1ZBE 1;  5FZB A;  1YLL A;  1NOV A;  5FK8 A;  3VBR C;  3WHT A;  2VNG A;  4NO4 A;  4C0H A;  5GZC A;  1UIK A;  1J3Q A;  4NPM A;  2LAL A;  3TNP B;  1U12 A;  4N53 B;  2BV4 A;  5FY1 A;  3E97 A;  2ZJC A;  2ZGQ A;  2YDE A;  2D3P A;  4UF0 B;  1BLZ A;  3CLP A;  2JG9 C;  3CQO A;  2DVA A;  2B9U A;  2ZHN A;  2ZAC A;  3T0A A;  1I3H A;  1YHF A;  3TWI A;  3PUS A;  1WWY A;  1NG0 A;  2R30 A;  3HNB M;  1AR7 3;  2UY9 A;  4WVM B;  2I45 A;  2EIG A;  4EN9 B;  5A3N A;  1F8V A;  2PQS A;  5GM0 A;  3VBH B;  4S2G A;  3NAP B;  3RYK A;  2ZEZ A;  3UKT A;  1CR7 A;  2BNM A;  2QQO A;  1UU4 A;  4J1W A;  4P9I A;  4QDQ A;  4OMD A;  5CB7 A;  3U75 A;  1OLM A;  1KDK A;  3ILN A;  2XR4 A;  3MYX A;  5LAS A;  4Q4V 1;  1UPS A;  3QH7 A;  4B4Q A;  1QH7 A;  5FY5 A;  4QB2 A;  4AGV A;  5GZD A;  2ZEW A;  4BQ5 A;  2CAV A;  2IXK A;  2WFF 2;  3E6B A;  1JU3 A;  1PNF A;  2PHX A;  3LZZ A;  5T52 A;  2WO1 A;  1ZYB A;  2DU0 A;  1DYK A;  2Q4S A;  2HEY F;  4XPV A;  5I8Y A;  4ZS2 A;  4AVS A;  1ULE A;  1JZ7 A;  3JUU A;  4AVC A;  1RMU 2;  1W99 A;  1C1L A;  1NAE A;  4EN7 B;  4I3G A;  2XBO 2;  1YCI A;  1GZC A;  2VZP A;  3PVO A;  3R6S A;  2AUY A;  2OA2 A;  3ZPO A;  1IG0 A;  4DIQ A;  4QQP A;  1QOO A;  2YGL A;  3MV0 1;  3BIE A;  4AVT A;  1SFY A;  2BP6 A;  2J1V A;  1UL9 A;  3GZE A;  5FRE A;  1OF4 A;  4BQ3 A;  4CEW B;  3NV3 A;  3VHP A;  3DPR A;  3BOP A;  3IMM A;  3D0S A;  4JTN A;  1V9U 3;  1VBE 2;  4E27 A;  2GAU A;  3ST7 A;  3ZFE C;  2XXZ A;  3TEW A;  5FIX A;  1S0I A;  1QF3 A;  3CZJ A;  4XEZ A;  4N9H A;  1XSQ A;  3VD4 A;  2CY6 A;  1TME 3;  2X53 S;  4NIA A;  3RNS A;  1QWR A;  1RUC 2;  3GJA A;  3JB4 C;  3WV6 A;  4FO9 A;  1UZV A;  4FPJ A;  1HDK A;  1RJ8 A;  4PDW B;  5SV5 A;  4AI1 A;  1OSG A;  4KBZ A;  1Q8Q A;  5H9P A;  1FAT A;  5FY9 A;  1WD3 A;  1SDD B;  3AP9 A;  4IV1 C;  1NE4 A;  2G9G A;  4XAB A;  1W03 A;  5L7O C;  4S2F A;  1H0B A;  1KD7 A;  5KWR A;  1H2L A;  1GZW B;  5C5U A;  3PJY A;  2E31 A;  4AI3 A;  1FOD 2;  4BLJ A;  4NUB A;  4MAD A;  5C8W A;  5C6C A;  1QY4 A;  1RHI 2;  3CEW A;  3TEZ A;  5JIU A;  3SKJ E;  3V0B B;  1RXF A;  3C7E A;  5F1R A;  1RUG 2;  1QEX A;  2AEN A;  5A32 A;  1QJX 3;  4LBN A;  3RJR A;  1DYO A;  4NIH A;  1RUF 3;  5A33 B;  1E57 A;  2QQJ A;  3WNL A;  3LFI A;  3N36 A;  5IT6 A;  3Q8C A;  5GLU A;  1TMF 2;  3G6J B;  2VNR A;  4UW4 A;  4NPL A;  4YLZ A;  3THP A;  3H1M A;  3SIT A;  4KU8 A;  3ZFG C;  5FYC A;  1CON A;  5DAV A;  5FUP A;  1ZNP A;  5IK5 A;  3WF3 A;  3AZZ A;  4AVA A;  3KT1 A;  1WMF A;  4N90 A;  5T50 A;  1C5I A;  4N43 A;  1T6G C;  1QJU 2;  4CXW A;  3AXE A;  3PVN A;  1A8D A;  2XML A;  2E7A A;  2YV8 A;  3OGR A;  2BZD A;  3IBM A;  3R4S A;  4WM7 A;  1CQ9 A;  5C7G A;  4W50 A;  2DUQ A;  3VBR B;  1PO2 1;  2D6K A;  4XIL A;  2ARX A;  1XND A;  4Z2W A;  2EF6 A;  1F5F A;  1JOD A;  4G3Y C;  4ARY A;  3DF0 A;  1AXY A;  1DGL A;  4Y20 A;  2VM9 A;  1VMF A;  1PHM A;  3PDQ A;  4BK5 A;  4N9I A;  4XMI A;  4OHZ A;  3K3N A;  3MW4 A;  2CSG A;  2VH9 A;  3N9N A;  1XBF A;  4FSJ A;  1B09 A;  1QXP A;  4QB1 A;  1ZRD A;  1OH4 A;  4QHO A;  2VMD A;  1QJY 1;  4DEQ A;  3OUJ A;  3POB A;  1QNW A;  5FZ6 A;  1TVG A;  2YFU A;  1Q56 A;  4RHV 1;  5D2A A;  3VDD C;  5ACA 3;  2D97 A;  4L97 A;  1ZM1 A;  2CYF A;  2HJI A;  4FFI A;  4Y5T A;  4GAL A;  2VQA A;  3R05 A;  4Q29 A;  4BLI A;  4I0A A;  1V6K A;  5FBJ A;  1WBL A;  3AP6 A;  3OBR A;  4J25 A;  4LHL A;  1R09 2;  4D7T A;  4XAA A;  5EQU A;  4YW4 A;  1HB4 A;  1JU4 A;  2WDB A;  1H1A A;  5T55 A;  2HWF 3;  2XVG A;  3AZV A;  4K21 A;  1CX4 A;  2YC2 A;  1XRU A;  1Z78 A;  5C70 A;  4FPK A;  2HBU A;  3WCR A;  3B69 A;  2KXL A;  1PX3 A;  1VBC 2;  3WG2 A;  4DY3 A;  5C8C A;  5GLZ A;  2CGO A;  4LMF A;  5FMD A;  1X8M A;  3OPT A;  2V4V A;  5FYI A;  1OUX A;  3RZG A;  5GLT A;  3DV8 A;  3PUA A;  4C91 A;  3T2P A;  2QZ3 A;  4XJU A;  4YZ5 A;  1CVN A;  2C26 A;  2GN3 A;  4AAP A;  2YRO A;  3P3P A;  5L9V A;  1COV 2;  2D6M A;  1OUS A;  2XUE A;  3FFQ A;  4A3Z A;  1JYX A;  3SQO A;  1ST8 A;  3M4F A;  4JDM A;  5FZC A;  3VV1 A;  3SKV A;  4EN0 A;  5KHJ A;  1LOG A;  5CFD C;  1HJG A;  2WQZ C;  2WNV C;  1PVX A;  3BYW A;  3O5S A;  4HK8 A;  5IAV A;  4COZ A;  1XNB A;  3ZFE B;  1UYP A;  3JQX A;  5F2W A;  5LA0 A;  3PVB B;  4O65 A;  1Q8S A;  2W1Q A;  4NHM A;  1K42 A;  3CMG A;  3S5Q A;  1N1T A;  5BNN A;  1W2U A;  2BOI A;  2QQK A;  3LPF A;  3VBF A;  4CCL A;  1S0C A;  1NXD 1;  2IXH A;  4XDQ A;  1LHO A;  3LPG A;  2J1T A;  5I91 A;  3LEM A;  3KB5 A;  3VD3 A;  1ACC A;  1D4M 2;  1NQJ A;  2WAO A;  3AMQ A;  2JB8 A;  4JRA A;  4QGM A;  4RGK A;  2K9Z A;  5J09 A;  2JEM A;  3MUY 1;  4IV1 B;  5FPA A;  5L7O B;  2XUM A;  4M3C F;  5B2G B;  1AR6 3;  2DTW A;  3ZSL A;  4RS5 A;  3C8X A;  4YVW C;  3VLB B;  1OPO A;  2AYH A;  4MXW A;  1MS3 A;  2GP3 A;  3N35 A;  5LRR A;  5CBL A;  3I8T A;  5FYZ A;  5BNO C;  1NA1 A;  2B42 B;  3MUZ 1;  3POI A;  4XDP A;  5A7O A;  4A3X A;  1DLC A;  4DRR A;  2ZEX A;  4C0B A;  2JG8 C;  1C57 A;  3KVB A;  3CF6 E;  4BWO A;  3III A;  4XAC A;  4A6O A;  2OQ7 A;  5DZF A;  5AVP A;  4AVV A;  5EJ1 B;  1RUI 2;  2PTM A;  3GCW A;  4FPL A;  1W8N A;  2HWD 1;  4QX2 A;  4FBF A;  3TYJ A;  1W9F A;  3K48 A;  2E26 A;  5KHH A;  3WDU A;  3ZFG B;  3FUO A;  3LWC A;  1E5I A;  2Y0I A;  1UXX X;  3Q8B A;  3MFC A;  4W6Y A;  2RJK A;  1VBD 1;  1JBC A;  4BXF A;  3M70 A;  4IW3 A;  1W39 A;  1I6X A;  1UYX A;  3MIH A;  3H8O A;  3AMP A;  2PLV 1;  4AQ6 A;  4HVQ A;  3HJR A;  3V64 A;  1ZRC A;  5FYY A;  2W52 A;  4ASK A;  3QAC A;  3BVC A;  3ZIX A;  1VBB 3;  4AXO A;  4HKL A;  5FXV A;  4URT A;  3M3C A;  3MEP A;  2QQU A;  3SCH A;  1WZX A;  5BNP A;  5IHR A;  1P8J A;  2JB4 A;  5JMO A;  3CU7 A;  2D3S A;  1UNB A;  1H8T A;  3CDZ B;  1UMZ A;  4YW2 A;  2Q8D A;  2HWB 2;  3HEI A;  3ITQ A;  4AI8 A;  4BK4 A;  1EUU A;  1RVF 2;  2YXS A;  1G9D A;  3VZO A;  3ZXF A;  4Q4V 3;  1DIW A;  2P5B A;  1CAX A;  5DDJ 3;  3KV9 A;  3VDD B;  1UZY A;  1NY7 2;  5DAB A;  1NUK A;  1ZRR A;  5JZG C;  3BAL A;  1AR8 1;  2DF7 A;  4QGN A;  4LNV A;  5FZH A;  3UNP A;  2H0B A;  1TQ5 A;  1PVC 3;  2QZ2 A;  4TLG A;  5FZG A;  4AEJ A;  3UK9 A;  2B8M A;  2PHF A;  2NP0 A;  3OBA A;  1LOC A;  2HWE 3;  3ZO0 B;  2R06 3;  1X8E A;  3OPZ A;  4P9W A;  5FZ9 A;  4EWA A;  4XFA A;  4UT5 A;  2XL7 A;  5JPN B;  4FPC A;  1IS4 A;  4MGZ E;  1F4A A;  1IG3 A;  3ASI A;  4W65 A;  2XG3 A;  3C7F A;  5JR7 B;  3MIC A;  4XXP A;  5BYN A;  2RMU 2;  4B29 A;  1LHN A;  3O1T A;  4JKM A;  1OUR A;  1R1A 3;  5L36 A;  4HLT A;  1TZO A;  4LO5 B;  2A3Y A;  1UX7 A;  2D5H A;  1EAH 3;  4XZU G;  1PGL 1;  1R08 1;  4FPE A;  1RXG A;  2RM2 3;  3H8U A;  3RI9 A;  2BGP A;  4LO8 A;  5L9R A;  4QD2 A;  3MPP G;  5GZF A;  4CPB A;  4AHX A;  4LT5 A;  1HRV 2;  1MEC 1;  2D6P A;  1H9W A;  1UYY A;  2VZO A;  4LTA A;  4XF3 A;  1BQP A;  3H9A A;  2Y6H A;  4IGO A;  3IMN A;  5CFD B;  3B9I A;  2WNV B;  3QCW A;  3HVD A;  3S30 A;  3M2M A;  1ONA A;  1WUV A;  3PL0 A;  3RPQ A;  2MHF A;  3H3Z A;  2CU5 A;  3I59 A;  4PBP A;  3ACG A;  1NZI A;  1V0A A;  2X29 A;  3LCP A;  5CKQ A;  1PIV 1;  1GYK A;  4Y22 B;  1O4T A;  4PIZ A;  1LJ7 A;  5I0S A;  2R04 2;  2HWC 2;  2RR1 1;  3D3A A;  3MV1 1;  1N47 A;  4AFM A;  1AYN 2;  3POJ A;  1FPN 1;  4CCN A;  2ZS6 B;  2Z42 A;  2Y6F A;  4Q0S A;  5JMC A;  1MQT C;  1Y4W A;  4XW3 A;  1OA2 A;  3ACL A;  3OEA A;  3WP4 A;  3ZSK A;  2SBA A;  3OGG A;  1UOB A;  2OW4 A;  3IN9 A;  2D6O X;  3RS6 A;  3T1M A;  4ZHN A;  3AXD A;  5ANQ A;  1XQN A;  2KA3 A;  2GSY A;  1WGP A;  2V5Y A;  3ACH A;  1ZA7 A;  1JYN A;  1AVB A;  1SPP A;  3J9S A;  1DU3 D;  1K5M C;  3PTR B;  1DQ2 A;  5CZK A;  1KGY A;  3OSD A;  2VBP A;  4AHZ A;  5BNQ A;  5D21 A;  2JG8 B;  1Q8V A;  4QQL A;  5EIY B;  4BDV B;  2BU9 A;  4JC1 A;  4AR2 A;  2ZMK A;  5C3P A;  2JKB A;  4AEK A;  3OUI A;  4B7E A;  2DBI A;  1XYN A;  4XUP A;  3RI8 A;  4F83 A;  4Q4X 2;  4C1W A;  3AVS A;  2JKX A;  4NWW A;  3ZYG A;  5LY1 A;  3VKM A;  2A6W A;  2P17 A;  1XOY A;  4LBQ B;  2R0H A;  2WSU A;  2ZZJ A;  4LE4 A;  4BOW A;  4QPG A;  3O1S A;  1E5S A;  1CIY A;  2PYT A;  2VOV A;  4V2W A;  3T4V A;  4SLI A;  3DEM A;  4EN6 B;  5GZG A;  2DVG A;  3R4D B;  4G4F A;  4MG2 A;  5FYV A;  4ZU7 A;  2JE8 A;  1E5R A;  3JCI A;  4AGG A;  4XUQ A;  1POV 0;  2ZGU A;  3B7M A;  4LIU A;  3U78 A;  4A44 A;  4PBO A;  3ZYF A;  5AC9 1;  2W1U A;  3WP3 A;  1XE0 A;  1UXZ A;  1W8U A;  4LHS A;  4O7X A;  4QAW A;  1CN1 A;  5A7P A;  1QH6 A;  3RVH A;  3SH4 A;  1AX0 A;  4FPH A;  1LEM A;  1VMJ A;  4RHV 3;  1QOT A;  4UFJ A;  1H2M A;  5A3M A;  2VEC A;  3B9C A;  3UET A;  3NKG A;  5CFC A;  4GJZ A;  4BJ0 A;  1GZT A;  2VXR A;  2X05 A;  1PM7 A;  3ACF A;  3U4X A;  2HH9 A;  4C90 A;  3LEG A;  4YAR A;  2ZAH A;  5F3I A;  3VD9 A;  4MV2 A;  2V09 A;  4Y5S A;  1H1M A;  4GMP 3;  3SCF A;  2UWA A;  5JZG B;  1HJF A;  2JDM A;  4JGY C;  2XHN A;  4RR3 A;  2QBX A;  5JVV A;  2BW8 A;  1VRH 3;  3I54 A;  2YGM A;  3JD7 2;  1FMD 3;  1YQC A;  4AEM A;  2ORX A;  4IE6 A;  3M3I A;  4LBQ D;  4SBV A;  5CNA A;  5E16 A;  1KQR A;  4QPI A;  3LOI A;  4IV3 A;  2RG4 A;  4RQP C;  5HXV A;  1RUJ 3;  4RA0 A;  2VOT A;  2YU1 A;  4NE9 A;  1OQD A;  1SEF A;  2E63 A;  4WZF A;  5A80 A;  3SH5 A;  3TEX A;  1ULO A;  2E53 A;  4CCJ A;  1NCR A;  2RV9 A;  1JOB A;  1I1E A;  2J42 A;  2O8O A;  2VCM A;  2MEV 3;  4BB3 A;  2UWB A;  3PHM A;  3EMR A;  3N7L A;  4OUL A;  2CAU A;  1O4Y A;  5L73 A;  5IFT A;  3KMH A;  4KH9 A;  4ISR A;  2XL9 A;  1L3J A;  2RVA A;  1OVP A;  3KV5 A;  3LD8 A;  1ULP A;  5FPV A;  2WFF 1;  4CDW C;  2Q5T A;  2OZJ A;  4DEV A;  1VAM A;  1BEV 2;  5JUV A;  3BOD A;  4GJY A;  3K3O A;  3B01 A;  2HYK A;  3FZ3 A;  2XJV A;  4H7M A;  5AFE A;  2F4L A;  1RMU 1;  3NJX A;  1YFU A;  1CPM A;  1FNZ A;  2JWP A;  2AZ5 A;  2XBO 1;  2ZPX A;  3A0N A;  3NO8 A;  1ULG A;  4L92 A;  5IVB A;  1Z7S 2;  1I5P A;  2JDH A;  2CGN A;  1NCQ A;  2ZCW A;  2O0O A;  4I02 A;  2R07 3;  4MGK E;  2VTF A;  3BTY A;  2OZ6 A;  4JHZ A;  1MQT B;  5J48 A;  3BTX A;  3O1V A;  5JXI A;  3ZM8 A;  5IJR A;  5FZO B;  2P6C A;  3LSE A;  3OTF A;  1T6B X;  5HCA A;  5JAX A;  3FFZ A;  3I2H A;  2GDF A;  4I01 A;  2GH8 A;  2EAK A;  3GBW A;  3AKP A;  1L7L A;  3MW2 A;  4AOC A;  3WX5 A;  3LKJ A;  3QH6 A;  2ZGR A;  2WYS A;  1D0H A;  1K5M B;  3HR9 A;  4AI2 A;  2UUR A;  1RUC 1;  4JRL A;  1UZ0 A;  3KCY A;  5I0R A;  1DHK B;  2PHT A;  5ANN A;  1SCR A;  5LK5 A;  4AFB A;  2QKD A;  2RS1 2;  4FPO B;  3MO4 A;  1PMI A;  3DYO A;  1W2N A;  5F2S A;  2BDR A;  2JG9 A;  2P3I A;  3UV9 A;  2PLV 3;  1BMV 2;  1Y9G A;  1FOD 1;  1AXZ A;  1HB1 A;  1W0N A;  2A6Y A;  3ILF A;  1RUD 2;  4L99 A;  4U2A A;  3TN9 3;  2YUE A;  1RHI 1;  5FV3 A;  4DXS A;  4ZON A;  2ET7 A;  1DBN A;  2BWA A;  3N9Q A;  3PMS A;  2WS9 2;  4UFM A;  2XWB B;  1WW5 A;  2OPW A;  3NNG A;  4O61 A;  1RUG 1;  4Q4W 3;  2YFZ A;  4YNI A;  2XJR A;  3WZ1 A;  2BQP A;  4B1L A;  3LIG A;  2NMO A;  4FAG A;  4HKW A;  1PNG A;  3O1O A;  1QMJ A;  1UY4 A;  2ZAB A;  5FOB B;  2GZW A;  1FI2 A;  1DQ4 A;  1HN0 A;  2JD4 A;  4TYS A;  4LO4 B;  5E1R A;  5E8A A;  5HBA A;  1TMF 1;  4NHL A;  5IW0 A;  1X7N A;  1XYP A;  2XJQ A;  4HPK B;  5FWJ A;  3B00 A;  2VD7 A;  4Q26 A;  4XUT A;  1W6M A;  1W6Q A;  2W3J A;  3WNO A;  1EUT A;  1ALY A;  3WHU A;  4AED A;  1AHS A;  5KXC A;  1QJU 1;  4QU2 A;  2VNO A;  1UU5 A;  1J1L A;  4UBH A;  4ASL A;  4BQW A;  2VR4 A;  3IKW A;  2YB7 A;  1CZV A;  1QQP 2;  1ZZ9 A;  2XQX A;  4FI9 A;  4PLN A;  5BNO A;  1ZBA 2;  1U5X A;  2Z2S B;  4MGI E;  5LEK A;  2GC1 A;  1WA4 A;  4JGY B;  3TRS B;  2GC2 A;  1H4H A;  4AVB A;  1JYW A;  1W6N B;  2QFE A;  2VL4 A;  4AWD A;  2VUC A;  1R08 3;  2BFU S;  3I3D A;  2A5Z A;  2Y6J A;  2F6B A;  1LED A;  1J84 A;  1ND3 C;  3F95 A;  1PO1 2;  1ULC A;  4RQP B;  3WDW A;  3ZSJ A;  4HAN A;  1VAV A;  4CP2 A;  2DCZ A;  4KGG A;  1F5J A;  3CHX A;  4Y1Y A;  4YG0 A;  3O0V A;  4PIX A;  3RQ0 A;  4BQ2 A;  5FPB A;  4DFS A;  2Y33 A;  5JXH A;  2FMD A;  2LM3 A;  2O8Q A;  1YJK A;  4QU1 A;  4QX1 A;  4XFC A;  4DRV A;  1DQ0 A;  1SBE A;  3J8F 2;  5I8S A;  4AK3 A;  1C28 A;  1ODN A;  1EPZ A;  4UBG A;  4E4H A;  1R09 1;  3ILR A;  3RYR A;  3VKL A;  3VKN A;  2ZX1 A;  3DXU A;  2WO3 A;  4GWI A;  2ZOE B;  1ZZ6 A;  1PZ7 A;  2IFW A;  2WC2 A;  3T2Q A;  1W8F A;  4LUK A;  1UOF A;  1FYU A;  4AE2 A;  4OUS A;  5A6Q A;  1JS9 A;  5F3C A;  4CDW B;  1VBC 1;  3LIH A;  1J3P A;  5FR3 A;  1HRI 3;  4XUN A;  1WW6 A;  3ETQ A;  1SBD A;  4XQW A;  5FTT C;  4OI1 A;  3WXP A;  5CKN A;  4UW6 A;  2DYC A;  5KBF A;  1N1Y A;  1GP6 A;  5LK7 B;  5LCW L;  3IDE A;  4JQT A;  2WNU C;  5FYS A;  1S0B A;  4NJ4 A;  3WNX A;  4LKS A;  3OYW A;  4Z1V A;  2J1S A;  1C8M 2;  5F8P A;  2ARE A;  4Q0Q A;  3O0W A;  4IE4 A;  1COV 1;  2FD8 A;  1DDL A;  3UKN A;  1WCK A;  4MVT A;  2CDO A;  1W2T A;  4D94 A;  5F37 A;  4ATE A;  3OOX A;  3AL6 A;  4BMB A;  3PTY A;  5K4L A;  4HVO A;  5CIR A;  1G8W A;  2ID4 A;  2ORZ A;  1J59 A;  1SLL A;  1POQ A;  4MYE A;  4N7U A;  2GC0 A;  5FLI A;  3ZXA C;  4N7I A;  4GKX A;  1GAN A;  5A7N A;  1S4C A;  3I2I A;  4Q8K A;  2J7M A;  4A6S A;  5FXZ A;  2ZAA A;  4HFS A;  2A1X A;  1D4M 1;  1LOE A;  3AP7 A;  1ULF A;  4LOS A;  1Q43 A;  3QD6 A;  2WL1 A;  1W3X A;  2A70 A;  2P6H A;  3SLI A;  2VMH A;  1G7Y A;  3EXU A;  5IK8 A;  3ZFF C;  2JDA A;  4NRQ A;  4RSU A;  4CUG A;  2GAL A;  4QM8 A;  4KGQ A;  1GNZ A;  4RGG A;  1RUN A;  1O5L A;  2VXJ A;  1G9B A;  3POG A;  2NPI A;  3OPW A;  2HEV F;  4XE9 A;  4NRM A;  2HBT A;  2QJV A;  2YPD A;  3U0Z A;  4HKO A;  2ZX0 A;  1O3T A;  1AR7 2;  3L9J T;  1EV1 3;  1X33 A;  1DQ6 A;  3JB8 A;  2OT7 A;  3USS A;  4COW A;  4XUO A;  3KSC A;  1RUI 1;  2WII B;  4GB3 3;  3HOB A;  3BPZ A;  2RJ2 A;  1VP6 A;  4Q4Y 2;  4RYD A;  5I93 A;  2D44 A;  4KNC A;  5I0D A;  5F7U A;  2LUW A;  2AC1 A;  1JYT A;  1GSL A;  1N3O A;  1PZ9 A;  3RMX A;  3IPV B;  2WT2 A;  1LHU A;  1A34 A;  5F6K A;  2WT1 A;  5DMY A;  3JBG 2;  1XE8 A;  1MZF A;  2RS5 2;  2XLG A;  1QGL A;  2Y60 A;  4L8Q A;  2B4K A;  4AW7 A;  1XNA A;  3KZ4 C;  4R9A A;  5EHD A;  3D4K A;  2JEC A;  2ZHM A;  2IZW A;  2X5I A;  4URA A;  1W28 A;  1YI7 A;  4PF1 A;  3ZSE A;  3DCQ A;  5EJZ B;  3VZM A;  1FV3 A;  3H7Y A;  1MAC A;  3U14 A;  4AED B;  2DVD A;  3IB3 A;  5FY4 A;  4EE2 A;  3N7J A;  4CZS A;  3AMN A;  3H8X A;  4XCA A;  2HWB 1;  4XBN A;  1ND3 B;  3SXW A;  3S57 A;  1LOD A;  1RVF 1;  4D8M A;  5BNO B;  5IVV A;  4FXG B;  1XSR A;  4PCR A;  1W04 A;  1NY7 1;  1W9Y A;  4HN0 A;  4NHY A;  2VE1 A;  3A22 A;  3NV1 A;  2D98 A;  2ZTN A;  4MXV A;  2G9Z A;  2W47 A;  2ZHL A;  3BOW A;  1TME 2;  1YQ5 A;  2K2S A;  2LW8 A;  2ZMN A;  4FP2 A;  5FPU A;  2QDR A;  1GP4 A;  1SFP A;  2R0F A;  4RGA A;  1O3R A;  1RMU 3;  2BUK A;  4KI5 M;  5JOX A;  2YZ4 A;  3O1R A;  1AR9 3;  2HEW F;  4S2D A;  3DPR C;  5CVR A;  3ZDS A;  3ZMO A;  2PHU A;  4WM8 A;  2WO7 A;  3IIA A;  1SLI A;  4O9E A;  1KXG A;  2RMU 1;  1W6P B;  3GBF A;  3CL1 A;  1OLM E;  2WNU B;  2FDK A;  2NZ9 A;  2CV6 A;  4JGZ A;  4IUG A;  4OHV A;  3WQB A;  1HXS 3;  1D4V B;  1NLS A;  3RZH A;  2WWJ A;  1O3Q A;  1A8M A;  1RED A;  4YFW A;  1IS3 A;  3N4M A;  1ENR A;  4OZO A;  1HRV 1;  4LO6 B;  1ENQ A;  3MF9 A;  4Z92 B;  4CRQ A;  1M4W A;  1J83 A;  1RUF 2;  4QB6 A;  3AZW A;  4YW3 A;  3OY8 B;  4TSV A;  3GZU C;  1NT0 A;  1RUC 3;  2VMC A;  4IEQ A;  1H8V A;  1REE A;  1BBT 2;  2RHP A;  1VBA 2;  4LEJ A;  4DMI A;  2W1S A;  3OYW B;  1JOJ A;  1OOP A;  3OG2 A;  4IEY A;  5J3U A;  4YFZ A;  2IVI B;  3NL1 A;  3GDB A;  4E2G A;  3AFG A;  4QKN A;  2DCY A;  3NVC A;  4IND A;  4KWU A;  2BJS A;  2R04 1;  2Z69 A;  1AZD A;  2HWC 1;  4BXS V;  5JOW A;  2WLQ A;  3ALQ A;  1AYN 1;  5JXG A;  5GLW A;  5C4W A;  4PIY A;  2PN5 A;  3NW4 A;  3POS A;  3D6E A;  4Y3O A;  3WF2 A;  4GIQ A;  1SZB A;  1BK1 A;  2VTX A;  1OVS A;  4OI2 A;  3N9O A;  5EYX A;  5FLH A;  3PLQ A;  3ZFF B;  1IPS A;  2QQP A;  1RUO A;  4TN7 A;  3DN7 A;  3IWZ A;  4IEP A;  5FMC A;  4BIS A;  3UKV A;  1CGP A;  1UW8 A;  3PU3 A;  5APA A;  4AFD A;  1FX5 A;  3NJY A;  2VCB A;  3LAG A;  4N43 C;  1UQX A;  1O8P A;  4Y1V A;  5C4W C;  4WM7 C;  4M3C A;  1UZZ A;  2D5F A;  2WJS A;  3K75 B;  5FYM A;  3DXT A;  1AL0 G;  2ZGL A;  2VCA A;  5FBZ A;  2EXI A;  3WDX A;  5ACA 2;  5BY5 A;  3TEY A;  3I49 A;  3ZXG A;  5F39 A;  1KFU L;  4D6R A;  1K45 A;  1FNY A;  4Q4X 1;  3HD8 B;  1LOF A;  4A7Y A;  5BV6 A;  3SH3 A;  3L2H A;  1AYM 2;  3LDK A;  2VQ0 A;  4QXB A;  1SQ4 A;  1ASJ 3;  2HWF 2;  4OFG A;  4XF0 A;  4BZ4 A;  5DUV A;  3VHO A;  4OQ9 A;  1YC6 1;  1JZ2 A;  2VW1 A;  1LOB A;  2PHL A;  5KHG A;  2G9F A;  2QVS B;  3N9L A;  3OEB A;  4E4D X;  1V6M A;  3Q9O A;  4QGL A;  2BNN A;  1SG3 A;  2KR2 A;  3EHK A;  4JZR A;  4B4R A;  4P02 B;  1UAI A;  4BIO A;  4P5H A;  3ZN4 A;  4XZP A;  4MGT A;  1STM A;  2JD9 A;  3GHM A;  2WWS A;  4H7L A;  4YW6 A;  3RFR A;  4QT6 A;  1RUE 3;  3GNE A;  4YZ3 A;  1S2K A;  2YG0 A;  3NQH A;  1S55 A;  3THD A;  1VAK A;  1LES A;  4CCO A;  3F2Z A;  4XFG A;  1UOG A;  1C3H A;  5G05 L;  4UI9 L;  4QM9 A;  3VBS A;  2BVB A;  2VQU A;  4PI2 A;  2XLF A;  1OBN A;  5LW9 A;  5C8C C;  3U4S A;  5IAT A;  4BHP A;  3ZXK A;  2VZS A;  3I97 A;  2A6X A;  2XON A;  3LA7 A;  2O1Q A;  5J98 B;  3BU0 A;  1L7Q A;  4IEU A;  1W6O A;  1C8N A;  3ETP A;  2DCK A;  4OUM A;  1UYZ A;  3WG1 A;  3ZSM A;  5C3R A;  4CDX A;  1UIJ A;  5A7Q A;  4V2V A;  3WLU A;  3LA2 A;  1PMH X;  3JD7 1;  1JTZ X;  5DAP A;  5IFP A;  1O8S A;  4YPJ A;  1IQD C;  3DKW A;  5EV7 A;  3I2D A;  3ZOI A;  1UOJ A;  2EIC A;  3AYA A;  3W5M A;  5BPX A;  2J1R A;  2K0G A;  3DPR B;  5E88 A;  3DL3 A;  2VQT A;  3OD0 A;  1Q3E A;  1AR6 2;  3I2O A;  1O59 A;  2VZ3 A;  4ES8 A;  2RDR A;  1JN2 P;  2XDV A;  2FCU A;  1LUL A;  4NVP A;  5FKC A;  5CYY A;  5A6Z A;  3ZLI A;  4PQQ A;  3KHB A;  4J6G A;  2X8K A;  2I2S A;  4A2U A;  5BNN C;  3VBF C;  4OHX A;  4CDQ A;  5IVC A;  4MSV A;  5FZ8 A;  3QLQ A;  1JZ3 A;  2E7T A;  2Y6K A;  3Q8F A;  2VO5 A;  3S6P A;  1Y3T A;  2IXL A;  3VDB A;  4OHY A;  4QPY A;  5C71 A;  2VME A;  2XGX A;  1BEV 1;  1KS4 A;  3HN3 A;  3A0K A;  1UN1 A;  4P14 A;  1CIW A;  3O1U A;  4CU9 A;  2BNO A;  4RS5 C;  2RS3 2;  1KJR A;  1KDM A;  4Q27 A;  3AZY A;  2A6V A;  1ZBE 3;  3RDI A;  4DIN B;  1YJL A;  1YI9 A;  4ZZ5 A;  3GCX A;  4IL7 A;  4G9S B;  1Z7S 1;  1NA1 C;  2OPK A;  2WAB A;  4A4A A;  5HCB A;  1V6I A;  5A7W A;  5D1I A;  5A32 B;  4E9K A;  1UX6 A;  4IGQ A;  3P1I A;  3C7H A;  5DPN A;  5LWB A;  1GLH A;  1VBB 2;  4GAZ A;  4LPL A;  3VKO A;  1OOP B;  1F2N A;  3APB A;  3N9M A;  3AMH A;  2BRT A;  1GR3 A;  3C7G A;  2R16 A;  3POW A;  5IK7 A;  1CES A;  1BJQ A;  4I09 A;  3MID A;  2XJT A;  2X09 A;  1RUI 3;  4HON A;  3E5X A;  4CEY A;  2A71 A;  1OHF A;  5FFO C;  5GAL A;  3E6C C;  4HET A;  4N43 B;  4LOT A;  4DXT A;  2GND A;  2JE7 A;  4WM7 B;  5C4W B;  1MPX A;  3AYE A;  3SEP A;  3ACI A;  5DDJ 2;  4UW5 A;  1S2E A;  1LCL A;  1ZZ8 A;  2RS1 1;  1XE7 A;  4JQR A;  4XF1 A;  1W2A X;  3PNA A;  3WUD A;  1DYP A;  2CWM A;  3ZYI B;  1JZ5 A;  2ZKL A;  3CO2 A;  3KCC A;  4HSJ A;  3ZR5 A;  3WQ1 A;  1PVC 2;  4Y20 B;  1HN1 A;  3I3E A;  5BNP C;  1GOG A;  2XJP A;  5DAW A;  3FBM A;  2HWE 2;  5CA6 A;  1G6N A;  1BMV 1;  2R06 2;  2G1M A;  4LQR A;  4CA9 A;  2WKK A;  3VZK A;  5JR2 A;  1H8T C;  2LS6 A;  1RUD 1;  1YUD A;  1K3I A;  1W2O A;  2VMG A;  3AFK A;  4QHZ A;  1UU6 A;  4C8D A;  2WS9 1;  4IER A;  3W58 A;  4GD4 A;  1S2B A;  3ROU A;  5FY0 A;  3E6D A;  1S0G A;  4WZC A;  3ZXD A;  3UJO A;  1JMU B;  1GIC A;  4AL9 A;  2UU8 A;  1R1A 2;  2OUH A;  3HPN A;  4OMC A;  5FZK A;  4FQ4 A;  4DUX A;  1EAH 2;  2HWB 3;  3T0D A;  2GNT A;  3OUH A;  2W92 A;  1RVF 3;  3H42 B;  2RM2 2;  4RL7 A;  2PEL A;  2ADE A;  3FJS A;  3NNF A;  4COY A;  4TTG A;  2PAK A;  5G04 L;  1KFX L;  1VJ2 A;  1YFX A;  1ENX A;  4LBM A;  2Q1M A;  5C9A A;  4OQ8 A;  2P1B A;  4K9S A;  3WEZ A;  1WKY A;  1UKG A;  5C8C B;  4H3W A;  2VGD A;  1LU2 A;  4CXX A;  4LR4 A;  1OKQ A;  1ZZC A;  4OCT A;  1GUI A;  2VVE A;  1YXW A;  2EIE A;  2ZKN A;  3B94 A;  3H1W A;  4ISQ A;  1QQP 1;  2XB6 C;  4O9G A;  5A1A A;  1ZBA 1;  3M1H A;  1RYY A;  4QX8 A;  4COV A;  5C3O A;  1KIT A;  1UY1 A;  2LTN A;  3K46 A;  4HVR A;  4IEV A;  1KRI A;  2Q30 A;  2C9A A;  3T2T A;  5KHK A;  3T08 A;  3VHN A;  1QJE A;  3K51 A;  1DGR N;  4MGQ A;  2ZZQ A;  5IAX A;  1GOH A;  3USU A;  4HN1 A;  1MS1 A;  4GXL A;  4QKD A;  5FLJ A;  2TBV A;  5A3W A;  4IES A;  1V6O A;  1PO1 1;  2V73 A;  3U07 A;  1IPJ A;  4YGC A;  1HRV 3;  2DCT A;  3MHZ A;  5F5A A;  1JYC A;  2Q0A A;  2PXJ A;  4YWA A;  4YW7 A;  3AB0 A;  1DQ1 A;  2BPA 2;  3WIN E;  3J8F 1;  2PHD A;  5BNN B;  3NWK A;  1MS4 A;  3VBF B;  1LHV A;  3VBU A;  4R4Z A;  1FAY A;  4XFI A;  4EZH A;  4XIO A;  3NST A;  3HT2 A;  4IEX A;  4NII A;  2WQ8 A;  2EXJ A;  5D8A A;  1GQP A;  4QDS A;  5DZG A;  4R9C A;  5FO8 B;  5FMO L;  3AVR A;  2DCJ A;  1U5I A;  3PUR A;  1W06 A;  5F32 A;  4D0Q A;  5FQ0 A;  5A3T A;  3SMH A;  4RS5 B;  1AX1 A;  1QXR A;  1F31 A;  4MXW B;  4FOW A;  1U5Z A;  4CDQ B;  3BUC A;  5HXM A;  4UW3 A;  3VL8 A;  4LA2 A;  1PO2 3;  2WZR 2;  5AFB A;  4GQ7 A;  1IKP A;  1NA1 B;  1C8M 1;  2WSV A;  2XWJ B;  2A73 B;  4Q8L A;  4QXC A;  1UF2 C;  3J7M A;  1OLR A;  5JOZ A;  2ZX3 A;  4GA9 A;  3VDC A;  2WNO A;  3BU7 A;  5D8A C;  4MUV A;  5CAZ A;  1PK6 A;  3HNY M;  3BPS A;  3LF7 A;  2FZ2 A;  3GJB A;  2X10 A;  3GXU A;  4XQD A;  5IK4 A;  1LGB A;  4GUL A;  4QX3 A;  1DP0 A;  5LEJ A;  4NPR A;  3M3Q A;  1GWM A;  3KV6 A;  1GV9 A;  1QJY 3;  2VZQ A;  3VZN A;  2BBA A;  2YMZ A;  4QPG C;  2VTX J;  1S0E A;  3KM5 A;  4CE8 A;  4MH0 E;  2WN3 A;  1WLD A;  2VW0 A;  3ES1 A;  4YM0 A;  3K4A A;  5FPZ A;  5CG8 A;  1REF A;  4Z82 A;  4HOO A;  1X36 A;  1C4R A;  4XFF A;  4LBL A;  4ZY9 A;  5ISL A;  4X6R B;  4LKD A;  4PI0 A;  3HBK A;  2JDZ A;  5FUI A;  5EPA A;  1XC6 A;  3LDB A;  4HZF A;  5T5L A;  1AJK A;  5KXE A;  3LOB A;  3IAQ A;  3TOJ A;  3WW1 A;  3KV4 A;  3URF A;  1JW6 A;  1VRH 2;  4ZXE A;  4CSW A;  3FHI B;  1FMD 2;  1XNC A;  1IS5 A;  3ZYB A;  5BNP B;  4A42 A;  1CAU A;  4W4Z A;  1H8T B;  3VDA A;  3O0X A;  3I2J A;  3PJQ A;  1PZ8 A;  5T5O A;  3VBO A;  5CFC C;  3KF5 A;  1UY3 A;  4FCA A;  4AHY A;  1YIP A;  5FZI A;  4CDU A;  3GZA A;  1RUJ 2;  4FVV A;  2HYX A;  1OQ1 A;  1AR7 1;  1CAX B;  1RTV A;  1ND2 A;  4H55 A;  4MX3 A;  3ZYP A;  1LAJ A;  3I2G A;  1NZC A;  1GZ9 A;  2YPJ A;  1BVP 1;  3PME A;  4RR3 C;  5DAQ A;  4XET A;  2MEV 2;  1SLB A;  3A21 A;  4Q4Y 1;  5LBC A;  1D7P M;  5FZ7 A;  3HT1 A;  1N3P A;  3U11 A;  3W5N A;  3LEI A;  4IDZ A;  4EWD A;  3NNM A;  2XJU A;  1AL2 2;  4W6X A;  3OB8 A;  2Q8C A;  4K40 A;  4QPI C;  4LIT A;  4IV3 C;  4X8P A;  2VUD A;  2AEY A;  3JD7 3;  1ND2 C;  3H8R A;  3W20 A;  2GP5 A;  1PMJ X;  5JI9 A;  3JBG 1;  1MS0 A;  4YVS A;  1OD5 A;  2RS5 1;  5FZ0 A;  4AYU A;  1CPN A;  3EQE A;  1NCR C;  2QE3 A;  3MIF A;  1XJA A;  2UYB A;  4IXL A;  4AFA A;  4A7K A;  4CP0 A;  1O91 A;  1CAW A;  4LK6 A;  4OLL A;  4EJR A;  1TG7 A;  2PHR A;  1RUH 2;  2E9Q A;  4COU A;  1JYI A;  1PM4 A;  5IVY A;  2JDK A;  4LA3 A;  2D40 A;  2WBK A;  2Y64 A;  2R07 2;  1GMM A;  3RZL A;  3AX4 A;  5FZA A;  3WP5 A;  2GC3 A;  4Q0P A;  3WF1 A;  2WNE A;  3TBD A;  2DVB A;  1VBE 1;  3I59 B;  3MDP A;  1OLQ A;  5HCH A;  4Y1X A;  2W2I A;  4M0H A;  1F9K A;  4EN8 B;  1TME 1;  2E32 A;  3I3M A;  3J4U H;  3USU B;  1N1V A;  1NCQ C;  4WVZ A;  3EBR A;  2HWD 3;  4ASM B;  4BIF A;  2W0X A;  3V0A A;  1DGW X;  2ZX4 A;  2W9X A;  4OI4 A;  3OCP A;  1Z7S 3;  4XTP A;  2L9L A;  3GM8 A;  1FV2 A;  3WW3 A;  1VBD 3;  1IS6 A;  3A23 A;  1Q8P A;  1KEX A;  3RWK X;  3ZX7 A;  1F35 A;  1DZR A;  2ZX2 A;  2VBD A;  4QMA A;  4OVE A;  5J37 A;  4LXL A;  3NNJ A;  3TN9 2;  4D6Q A;  5ABJ A;  4TZD A;  2VUL A;  1SPP B;  4C1X A;  4MLO A;  4M01 A;  4Y4Y A;  5LBB A;  4FTB A;  2AGS A;  1JH5 A;  2YC0 A;  3KT7 A;  1EP0 A;  5FJK A;  4Q4W 2;  3VD7 A;  4UFL A;  3RRD A;  4CPB D;  4N53 A;  4P9Y A;  1AX2 A;  2WAA A;  5D8A B;  4V1P A;  1EPW A;  1GP5 A;  1RUF 1;  1DLL A;  4DOU A;  4E2Q A;  5FQ0 B;  2VUA A;  4GMP 0;  1U0A A;  1WLC A; 
#chains in the Genus database with same CATH homology
 2OXB A;  3LIH A;  5ANN A;  1Y4W A;  3ZR5 A;  4FFH A;  1UYP A;  3HBK A;  5FMC A;  3H3L A;  3LDR A;  2QQV A;  2AEZ A;  1Y9M A;  3SC7 X;  3LFI A;  4JQT A;  4UFI A;  3S5Q A;  5FMD A;  4FFF A;  3PIJ A;  3PIG A;  4UFK A;  3UGF A;  5FK7 A;  3U14 A;  3UGG A;  2ADD A;  4CCD A;  5FKC A;  4QHZ A;  2QQU A;  3KF3 A;  5FMB A;  1Y9G A;  3LF7 A;  3U75 A;  4B1M A;  4CCC A;  3LEM A;  3NMB A;  5FK8 A;  2AEY A;  3OSD A;  5FKB A;  2QQW A;  3UGH A;  4HXC A;  2AC1 A;  4UFM A;  4UFL A;  3IMM A;  3ZR6 A;  4FFI A;  1W2T A;  4FFG A;  4CCE A;  3KF5 A;  4EQV A;  3LDK A;  5FIX A;  4UFH A;  4B1L A;  1ST8 A;  2XQR A;  2ADE A;  3LIG A;  3RWK X;  4AZZ A;  3U1X A;  4UFJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...