3OSDA

Crystal structure of a putative glycosyl hydrolase (bt2157) from bacteroides thetaiotaomicron vpi-5482 at 1.80 a resolution
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
264
structure length
264
Chain Sequence
GSAQEEQSANEVAVSYSKSLKAAEMDSLQLPVDADGYITIFDGKTFNGWRGYGKDRVPSKWTIEDGCIKFNGSGGGEAQDGDGGDLIFAHKFKNFELEMEWKVSKGGNSGIFYLAQEVTSKDKDGNDVLEPIYISAPEYQVLDNDNHPDAKLGKDNNRQSASLYDMIPAVPQNAKPFGEWNKAKIMVYKGTVVHGQNDENVLEYHLWTKQWTDLLQASKFSQDKWPLAFELLNNCGGENHEGFIGMQDHGDDVWFRNIRVKVLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords putative glycosyl hydrolase
publication title Crystal structure of a putative glycosyl hydrolase (BT2157) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution
rcsb
source organism Bacteroides thetaiotaomicron
total genus 73
structure length 264
sequence length 264
ec nomenclature
pdb deposition date 2010-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06439 DUF1080 Domain of Unknown Function (DUF1080)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.560 Mainly Beta Sandwich Jelly Rolls Exo-inulinase; domain 1 3osdA00
3IMMA 1UYPA 1Y9MA 3NMBA 4FFIA 3RWKX 5FKCA 1ST8A 3ZR6A 5FK8A 2ADDA 3OSDA 4HXCA 4CCCA 2QQUA 3SC7X 4UFJA 5FMBA 3LFIA 1Y9GA 4JQTA 4FFFA 2AC1A 2QQVA 3H3LA 3LDRA 3PIJA 4FFHA 5FMDA 3HBKA 2XQRA 4B1MA 4UFKA 4CCDA 1Y4WA 2AEYA 3LF7A 3KF3A 4QHZA 3U75A 3LDKA 3LEMA 3U1XA 4UFLA 2OXBA 3PIGA 5ANNA 3S5QA 4B1LA 5FK7A 3KF5A 4CCEA 2AEZA 3LIGA 5FKBA 3ZR5A 5FIXA 4UFMA 3UGFA 2ADEA 4UFHA 3LIHA 1W2TA 3UGHA 4AZZA 4UFIA 3UGGA 5FMCA 3U14A 4EQVA 2QQWA 4FFGA
chains in the Genus database with same CATH superfamily
4O61A 2Y34A 1UOGA 4JGZB 4MGIE 4XOGA 2FCVA 2XG3A 3T2QA 4RR3C 1H8VA 3O0XA 1BK1A 2BOIA 5JZGB 1W8ZA 1F9KA 2XMLA 3NJZA 4JDOA 3HAGA 3KB5A 3H1YA 3LFIA 1XQNA 2JJ6A 3KS7A 5JDBA 2JB4A 2QVSB 1JODA 2A71A 3NJVA 2W1SA 2X53S 4UW3A 3ZFEB 4JGYA 4FPEA 3D0SA 3BU0A 3MIBA 4K40A 3VHOA 5FY7A 4DY3A 1F4HA 2ZBJA 3M7AA 5FYZA 4J6GA 4CVUA 1UYYA 4X6RB 4Q8KA 1POV1 3IIIA 2WNEA 5D2AA 1FX5A 2R063 4XFAA 2A6WA 5FKBA 5K0UA 4AQ6A 3AJZA 1Z7S1 5FYSA 2W1WA 4LUMA 5A70A 2IUWA 4MYEA 1QEXA 2WS91 3IKWA 4PI2A 2W9XA 4HKLA 3M3OA 4Z92B 2VCMA 1F15A 3LPGA 1UMZA 3AVRA 1PHMA 1W6PA 2QZ2A 2HWE1 1H9WA 2YC4A 3PVBB 3A22A 4OZOA 1X82A 4H3WA 2PXJA 1LOCA 2JG9C 1NAEA 3U07A 2ZGUA 2QKDA 4D7SA 4E4SA 5L73A 2V4VA 1QXRA 2EF6A 5HCAA 2ZXQA 4DXSA 5GJ6A 2P3KA 4HG6B 1XOYA 2C26A 3SHRA 1PK6B 4AXOA 2DF7A 2Y6KA 5GLVA 4AE2A 3L2HA 5FQ0A 2J1AA 5J37A 2ZS6B 1UKGA 5F2WA 1NX9A 4E8DA 4K3UA 5FXVA 1VMHA 4W4ZA 2RS52 1RUJ1 4OUSA 3B00A 4LO4B 3NMBA 3O1OA 2BERA 2O0OA 4Q1RA 2OYZA 4EN9B 5A7OA 4QX7A 1BVVA 1CAWA 1VBD2 3MPPG 5ERLA 3HQXA 5CFDB 3DYOA 2WO2A 2R061 5I0UA 3VKLA 1MZFA 1VB4A 2P3YA 3PNAA 2JG8C 3O12A 4GWIA 2AR6A 4Y22A 2QQLA 1PM7A 2D44A 3LDBA 3K3NA 2XQXA 4AAXA 1HQNA 5GZEA 4QDQA 3LEKA 5FZLA 4ZZ5A 2DVAA 1MPXA 3GHMA 1Q56A 1ND3B 1JW6A 1DQ6A 5F37A 1Y7BA 2Y60A 2ZX3A 3WNLA 1NA1A 2W95A 2JDUA 5HV4A 1NE6A 2GAUA 3RGBA 2P34A 4OHWA 1QDCA 3KD4A 5FZ9A 5GLZA 4FAGA 3J7HA 1FYUA 3AL6A 3I2KA 2WC2A 3WF4A 1LHWA 2QBXA 5FMDA 2W3JA 3F2ZA 1JU4A 1BK0A 2X5IB 4IESA 1W0PA 3UL2A 3RPQA 1PZ7A 4AEJA 2OKXA 2O14A 1NLQA 4XMIA 3VBHC 1JYNA 4FTEA 5FP8A 3WF1A 3NJXA 5FZ8A 2K2SA 3OB8A 2YPDA 1ASJ2 5I91A 1TME2 3WHUA 1JYVA 2XR4A 1ND2B 2NMNA 4HPKB 4CDXA 5C33A 1LHOA 2E33A 4IW3A 2OA2A 1N1YA 1GZ9A 3WG2A 4QX1A 4RGGA 2RV9A 3GBGA 4AQSA 1KDKA 4AVAA 2BJSA 5DAQA 1NZIA 4HSLA 1YI7A 1QH6A 1WLDA 3GDBA 4EWAA 4L97A 1VALA 4NJ4A 5EXOA 1IHMA 1O8PA 3DF0A 1HIXA 2GN3A 3HT1A 2ZJCA 4KBZA 4PBOA 4XJ8A 5LBCA 5JXGA 3FLPA 1WLTA 1A3KA 5CFCB 4YYOA 5C8CB 1OA4A 5ANQA 1SLLA 1LOEA 1VBD3 3IAQA 1YJKA 2D40A 3ZXAC 4CCJA 1RMU3 2B9UA 4AZZA 4QAWA 3RVHA 4XTPA 2WNVB 1OA2A 2EALA 5FUIA 1N3PA 5LWBA 1CZSA 2PHUA 4NHXA 1W2UA 1VRBA 1DZTA 2VC9A 1RUI2 2VMCA 4FPJA 5CKNA 3VZOA 1HV0A 1PX3A 2GDFA 4MGZE 4JRLA 3PVNA 4IEQA 2ES3A 3NV3A 2JDAA 3MHZA 1PM4A 2VUJA 2VZQA 2VZTA 4ZONA 4JDMA 1JZ4A 1YIPA 1RHI2 1SFPA 4CU9A 4XZPA 2RHPA 2WLQA 3ACLA 4YGBA 4HVQA 3M1HA 4KGGA 4AWDA 1MVEA 2BQPA 3WDYA 5FPBA 3LIGA 1RUH2 2P3JA 3H3UA 5M0TA 5IVFA 5BNPA 2UY9A 2F6BA 4XDQA 1H8TB 4LR4A 4PDWA 4RS5A 3ZKUA 4BE3A 5EJZB 3U4XA 1I1EA 2A3XA 4NUBA 5IJRA 3U11A 2BGPA 2KM2A 5KR7A 4N43A 5EYXA 1ASJ3 3VBFB 3ZMNA 1G86A 1TME3 4L2NA 3C7GA 1DZQA 1VBD1 4LBOA 4AVVA 4IE6A 1A8MA 1OLQA 3MFAA 3AP5A 1X7NA 4ORFA 4FP3A 2V4AA 3UETA 4YVSB 2B8MA 5BNNB 1ZA4A 5I93A 1CR7A 5HPOA 1HJFA 1ZRIA 5IVJA 3FE5A 5F6KA 5J3UA 1AZDA 1RUE2 5FZ4A 3WV6A 1C8M2 4Q4V3 4EQVA 4URAA 1PMIA 1FAYA 2HEYF 2WN3A 2ZOEB 1PO22 1ALYA 2QDRA 5EJ1B 3WX5A 1RUG2 3IIAA 4HXCA 1RUC3 5EV7A 1PIV3 5F5AA 1M06G 1ZZ9A 4FQ4A 1XNCA 3VBRB 4CA9A 2RM23 4O7XA 5LY2A 2DYCA 2DVFA 2JDZA 1EPWA 4S2GA 4BISA 1UZYA 5FO9B 2ID4A 3USSA 4NPLA 4Z1VA 3LA3A 4COUA 4HZFA 2XONA 2JKBA 2MPFA 4NAMA 2QQPA 2JDNA 4QXBA 1D2SA 2CGPA 3GYDA 3AP7A 1OSGA 3H7JA 1VBE2 3MGUA 4GWJA 1UPSA 4B4RA 2D3RA 3UKVA 4CU7A 1ASJ1 3WP4A 4I09A 1TME1 1QJU2 2NMOA 1N3QA 4HN0A 3RSJA 1ULPA 1RHI3 3I59B 4QPWA 4NMIA 1CX4A 2DU1A 2DCZA 2VZOA 4GQ7A 4KL1A 3VZKA 2OQ6A 4EJRA 2WWSA 1ENXA 2YFZA 4HK9A 2QQVA 3CLPA 1ZBA2 4QMAA 1RC6A 2KR2A 3IWZA 1IS4A 4IGQA 1HN1A 3SH3A 4Q4V1 1W6QA 3A0NA 3NQHA 3JZVA 4FCAA 2XWJB 5C5UA 2D6NA 4A41A 1RUC1 5FJHA 5EQUA 2YBPA 2RM21 2HJIA 1UW8A 3N9PA 4P5YA 1H1IA 3FHAA 4AL9A 2W47A 4TZDA 3LEIA 4S2FA 4AGRA 1V0AA 4YZ1A 4Y5Z0 1WCDJ 2RJ2A 5K0UB 3CJIB 4CXWA 5KHGA 5FYBA 2V5YA 1LHNA 1KRIA 1V6OA 4A44A 1JH5A 2ZTNA 4M3CF 1NCQB 3VKFC 4AW7A 1FMD2 5CEHA 2WKKA 4PIZA 5HCFA 4OI1A 1VRH2 2P5BA 4P9YA 4RQPB 1RUE3 3VBRC 1JZ7A 3S0MA 3KHCA 2E51A 2VR4A 1PO12 5EPAA 1COV2 1PO23 4XF3A 1NXMA 1RUG3 1RHI1 1NQDA 1IPKA 4W50A 4QX5A 1Y43B 1OFNA 3M3QA 4DEQA 1CAUB 1W6NA 2G1MA 5HCHA 2UURA 3NL1A 5FQ0B 2Q5TA 1UY1A 1QMJA 5FZIA 2BV4A 4CP2A 2A6YA 4N53B 4J1WA 2ZEWA 5FK8A 3ALQA 4Y4RA 1GQGA 2VTFA 4BMEA 3UJOA 1VBE3 2RR12 2DCYA 2DTYA 3HMYA 3QCWA 1H0BA 2YROA 1MQTA 3OGJA 4IV1A 4QPIA 3WT3A 2B42B 2OZ6A 5F39A 4FBFA 2O8OA 3B3QE 3KQ4B 3T1MA 2WZ8A 4CDQC 5DUXA 1QJU3 5J36A 1XE7A 3I2IA 1CAWB 3T0BA 4OZXA 5KC6A 5JOXA 2VOWA 4RR3A 3SCFA 3IN9A 1LU1A 2VTXJ 3EXUA 3VDDB 4HSJA 4Y22B 2DUPA 2D6LX 1FV2A 1K45A 5F9TA 3WR0A 1W03A 1S0CA 3W59A 2NN8A 3O1MA 4LPLA 1ZBA3 4FVVA 2PHXA 4Y26A 3C2UA 1RUE1 2JEMA 4Z8BA 3J26N 3JD73 1C8M1 3LE0A 5A1FA 1WD4A 4X6QB 4KU7A 5EFUA 4OHYA 1PO21 2JDKA 2ZHKA 5DZFA 4YVWA 1RUG1 2UY8A 4AEDA 1D0HA 1CVNA 1NA1B 3KCYA 2WQZC 3CJIC 3ACGA 1SFNA 5T5OA 3VHNA 2BBVA 2G9ZA 5T50A 5IYYA 1DLLA 2E7QA 4GKXA 4AFCA 1WGPA 3GXUA 1ZRCA 1VBE1 4XW3A 1CX1A 3I3QA 1SCSA 4P9GA 1A34A 1FMD3 2NYYA 1NCRC 2Y0IA 5BNOB 3BTZA 1WCUA 2VOVA 1UYZA 1W9TA 1QJU1 5JSOA 1ZBE2 2RVAA 5C3QA 2PAKA 4EWDA 2GP5A 1PO13 1ULDA 2JIGA 1COV3 4YGCA 1ULFA 2EVXA 1NY72 2VNRA 2ILMA 2J1SA 3NNGA 1UOJA 3HPNA 5SV5A 3H3LA 4DS0A 3VD3A 2A70A 4I30A 1YNAA 3IZOA 3K51A 5FY9A 1ZBA1 3RMXA 2UU8A 4FPCA 4QHZA 1LR5A 5LW9A 3I3DA 2WUHA 3JD71 2ENRA 2E26A 2ZGQA 4JRAA 4K21A 4N9HA 1JZ6A 1XJAA 1VBB2 2Y6JA 4DUWA 1DZRA 1J83A 4JGZA 2SBAA 3E5XA 4LO6B 3A4UA 1VMFA 4XQ4A 3BTXA 1XRUA 2H6CA 1SLBA 2JG8A 3RJ2X 1WA6X 1UZ0A 4MO3M 5FPUA 4P02B 1W8NA 1UNBA 3PJYA 3AZYA 4CCCA 1OD5A 1YFYA 5IVCA 1SEFA 4EZHA 3AMMA 1BKZA 2EICA 2W0XA 3WDXA 4B8EA 1R093 3AJYA 4BZ4A 5LCWL 5K8SA 4YM2A 2YPJA 3IDEA 2IVJA 1FMD1 3TBDA 3POSA 5A7SA 1Q8OA 2OT7A 3VDAA 2N7GA 1UU5A 5L7OB 3NW4A 2A73B 2LM3A 1XXNA 3PMEA 3WNOA 4A3XA 5E8AA 1PO11 1E5IA 3I2JA 5LRSA 1COV1 2D7FA 4J1XA 4XUOA 2AACA 2ZGRA 1B35B 3OUJA 2Z2SB 5DMYA 1N3OA 3B9CA 4Y1UA 1YYNA 2AGSA 4AFDA 2EXIA 4ASMB 4GALA 2IXLA 4MOAA 4EN7B 3C3VA 1AR82 4LA2A 4YW4A 1UF2C 2NPIA 2Q1FA 3VBHA 1A8DA 3H9AA 5LZ6A 1WCKA 2XLAA 1UWWA 2WSVA 3VZJA 5BNPB 1AXKA 1XNDA 2BP6A 2LRPA 4LHNA 2VMEA 3N7KA 2BWCA 4QX8A 5BNOC 3RFRA 3ZYPA 3NNJA 2JDPA 4RS5B 5A7WB 1V6IA 2RR11 2VVDA 4IEVA 4QXCA 1W9FA 5D8AC 1GWKA 1PK6A 1L7LA 3E97A 2BBAA 2ATFA 5C9AB 3AFGA 4FOQA 4EV0A 3KMHA 4XCBA 5APAA 1X36A 1ZBE3 5FBJA 3C8XA 5AVPA 4IUGA 5JVVA 4UW4A 4BQ2A 2YBSA 3POWA 4CU6A 1CZTA 3KGLA 4K6BA 3LA7A 1CESA 3RZJA 1R091 3AMHA 4IL7A 2NQYA 2NZ9A 5BNQA 2IXHA 1ENSA 4YNIA 2SLIA 4JX0A 5CFDA 1AR72 3I2GA 2FQPA 4MXWA 2ZAHA 3UYJA 3OGRA 2GC3A 2D3SA 2OVUA 3C7EA 4XAAA 4XUNA 1JZ8A 3AK0A 4BQWA 1VBB3 1BHGA 1ZM1A 4DUXA 4JAAA 3THDA 3AYAA 3HWJA 2OZJA 3B94A 1MEC2 3TNPB 4YZ3A 4XFCA 2XJPA 3RZHA 5G04L 4Q5OA 2YXSA 1UXZA 4CCMA 3PIGA 1ND3A 1XE0A 4LMFA 2C4XA 5L7OC 3DYMA 1CQ9A 2NP0A 2Q8EA 4Q4W2 3ES1A 4MSVA 4ITCA 1O4TA 1IG0A 2VZUA 1B35C 2R30A 3NO8A 4XE9A 1JYXA 3V0BA 1ZBE1 1V9U2 4CP0A 1W05A 2XBO2 4IERA 4XFHA 4AEMA 3RWNA 1UPIA 2C9AA 3EO6A 1DQ4A 1YFUA 2V72A 3DL3A 1BBT2 1NY71 4GD4A 4MX3A 4IEZA 1ZZ6A 3I49A 1C28A 5DAXA 1SBDA 1F8VA 1AR83 3TNQA 4HL0A 4MVTA 4E8CA 2CNAA 4KH9A 3INAA 3POYA 4HPKA 3VBOB 4ES9A 3CNAA 1HRV3 2VPVA 4E4ZA 4OYUA 3ZKYA 3CL1A 1OVPA 1W6QB 2FCTA 1VBB1 3NV2A 3OOXA 3ZSLA 2PHFA 4GMP3 2XVLA 4PLMA 2ORXA 3L2YA 5FLIA 3PUIA 3RDIA 3VV1A 3MO4A 1OPMA 4Q0SA 1UY3A 3OTFA 3MBWA 1G9FA 2RDRA 4ASKA 5IATA 4UOJA 2VUDA 3B01A 3MIDA 4LLFA 4Q4Y2 3S6PA 3VN4A 3MV11 4M01A 5FWEA 4CPBA 4GXLA 3HOBA 3CKHA 3Q8FA 4Q26A 1HN0A 2VMFA 1W9SA 4L92A 2OQ7A 1AVBA 3VBUC 4AVSA 2WYFA 3EMRA 4RN5A 1S4CA 2VW0A 2A6ZA 1DBNA 2R32A 5T54A 2J7MA 3PVEA 3I2DA 4PBPA 4PF1A 4DOUA 4XHXA 5FMOL 3TN92 4FT8A 1MEC3 1T2XA 2YGMA 3QLQA 1AR81 5E88A 4FPLA 3WF0A 5H9SA 1KGYA 3WQ1A 4LO5B 4CDWC 2Z69A 2DCTA 1ZX5A 3NNMA 3TEXA 1RTVA 1US2A 3ACFA 3K4ZA 4KWJA 4NIIA 3WF3A 3WQBA 3WEZA 4RL7A 3I2FA 2VXRA 1RYYA 4Q4W3 1JOJA 3SCGA 1WA4A 5T5PA 3NNFA 3AXEA 1LKNA 2WN2A 2D97A 4LNVA 3OUHA 1VAVA 4ONUA 5C3OA 5D1IA 3S57A 1H8TA 1V9U3 2WRAA 2XBO3 4JKLA 1RUD2 5E1RA 4RA0A 4YW6A 3ZYFA 3OYWB 1QWRA 4GWNA 1BBT3 4R9CA 4RR3B 1QNYA 3H3ZA 4EYUA 3VZMA 4NIAA 3HN1A 3VBFA 2P2KA 1GICA 1FNYA 1UYPA 4JHZA 1IZ3A 1W2AX 2ET7A 3GM8A 1W3VA 2XJVA 5ACA2 2DBNA 1XSQA 1UYXA 1W8UA 4PF5A 4GA9A 3ROUA 3UJQA 2E6VA 4BA6A 2YBKA 3LQCA 2VJXA 2Y6HA 4YVSA 2D5FA 2ZGKA 3ELNA 4LLOA 3P6BA 5BNNA 5KWRA 2XLFA 2QNKA 3LSEA 4QKFA 3KWVA 2VUAA 2JIJA 1MEC1 1PZ9A 2X05A 4A7ZA 2WQ8A 2ZCWA 5JI7A 4DQAA 5IT6A 2W39A 4RGKA 3TEZA 5A1AA 2JX9A 1HXS2 4UXAA 1YC61 4XFFA 1V6NA 1MS5A 4WBBA 1BCXA 3HQUA 1WZXA 3OBAA 5FY1A 4Q4Y3 3VBRA 4BQ1A 1KEXA 3WG1A 1R082 4Q4W1 3WW3A 1WUVA 2JG9B 3FUQA 3Q8AA 1POV0 2BOJA 2XJTA 1VAKA 4GAZA 5A33B 1SDWA 1V9U1 2XBO1 3ZXDA 4JTOA 4O65A 2GC1A 3LOIA 4A7KA 1BBT1 3D3AA 3D0JA 1F31A 3TN93 3X29B 4B7KA 2I2SA 1GZTA 4LHSA 5FY0A 4UBGA 4I02A 4UT5A 3J7LA 5IFPA 1BQPA 4AG4A 1MS1A 3IBMA 4C0BA 3I59A 4CDQA 5I8YA 3LAGA 5I0TA 4TLFA 3LZZA 1LEMA 2DBIA 2P4EA 4PJYA 3ZPOA 1RXFA 3RWKX 5FY5A 1MZEA 1H1AA 1DFQA 1TEIA 1H6YA 4IQPA 4I3PA 5JSRA 2R0FA 2JG8B 4NOTA 2D6OX 3IDAA 3IMNA 2I45A 1RUD3 2LTNA 3FLTA 3OUIA 4UAPA 3RQ0A 4FFFA 1LTEA 1AYM2 1RUNA 1V70A 2JXAA 4UW5A 1CPNA 3G6JB 3HD8B 3O1PA 5HV0A 3WZ1A 1DYKA 3LF7A 2E9QA 1OXCA 4AI8A 4Q4Y1 2DVGA 4I01A 5H9QA 2HBUA 2X10A 4LITA 5ACA3 4OLLA 4QPGB 3KGZA 1DGRA 1W28A 4FXGB 4F83A 3CJIA 2D43A 5FZDA 3K75B 1LHUA 1NOVA 1IS5A 1FI2A 3JQXA 1DQ2A 1KJLA 3GNEA 1BZWA 3HBZA 3I7DA 1NCQA 4LKDA 1VR3A 4LKFA 3TN91 5KXDA 4Y1VA 4Y24A 2YU2A 4RQPA 1IGOA 3H8XA 1DDLA 2JDHA 1HXS3 4OFGA 1BMV2 3VBHB 1REEA 1NCRA 2XGXA 2VOXA 1QQP2 3ETPA 4A4AA 4AHZA 2V09A 5JIAA 4EWEA 2VGDA 4YGDA 5FOBB 1R083 4ZY9A 1WW5A 2YZ4A 1YJLA 1CAUA 2ZX4A 1JU3A 5DG1A 5FXWA 4NIHA 1C1FA 2HEWF 4IEPA 4XZUG 4NO4A 1RUD1 4N53A 1JZ3A 3V0AB 3AMQA 4DY5A 4YARA 2AENA 1Q8SA 2GNBA 2F4LA 4IV3C 2FCUA 3BN6A 2RDNA 1LECA 3PVOA 4LXLA 3K48A 1OLRA 5EZWA 1ZZ8A 5ACA1 3ABZA 1CGPA 1RMU2 4Y1YA 3CEWA 4MXWB 2R7EB 3O1TA 2XQRA 3VDDA 3WNNA 3C7HA 3DPRB 2QDNA 2WZPP 3I3MA 2ZX2A 1VPHA 2GU9A 1SMVA 1XNAA 4QB1A 1W3XA 1AHSA 1CONA 2CGNA 2ZGSA 2QFEA 2VL4A 3SKVA 2E31A 3KM5A 3F95A 1AYM3 1HXS1 4QT6A 4XCAA 4XC9A 3POBA 5JPMB 2J1VA 4QPGC 5FPZA 4L9BA 2BNMA 3ILRA 2DCKA 5FZMA 5GLWA 3ZR6A 2Q0AA 2WJSA 4NHMA 1R081 4QB6A 2VU9A 1G9BA 1KFXL 1GNHA 2VECA 5F1RA 3R4DB 1CZVA 3ATGA 5T3NA 5A3OA 3U78A 3WDWA 1KD7A 2VVEA 4P08A 2YY1A 3V0BB 1LAJA 1HLCA 1GANA 3LB9A 3VBSC 4MGTA 3GZUC 3WP5A 5I0SA 5EWSA 1DGWA 2P37A 1V6LA 2PQQA 2GC0A 4Z2AA 5J7MA 3T0DA 4ASLA 1AYN2 5K9YA 4XAEA 1TQ5A 1S0FA 5BNOA 4FTBA 2CL2A 4YW3A 3D4KA 1GZWA 3UKNA 5J96B 4KWLA 5FP7A 1RL3A 3UGFA 1JOPA 2OS2A 4CTEA 4KGQA 2Q8OA 2PMWB 1H2NA 1QU0A 3THCA 1PNFA 1RUF2 4QKDA 5C4WB 1QQP3 3SXWA 3FHQA 5T5LA 3W21A 2O8QA 5FKCA 3WOGA 2WA3A 4YM3A 1W8WA 2VW1A 1UU6A 4NRPA 3BGAA 3ZO0B 2WNUB 3OG2A 4D7TA 1AF9A 2PELA 3VGIA 2PAMA 4JV4A 2J1RA 1YEWA 1OH3A 3WQ7A 1AYM1 3K4DA 4Q4V2 4D6SA 3ZSMA 4DMIA 3SCHA 4P9JA 3CDZB 2VUCA 5F3CA 1RUC2 3HN3A 1PIV2 4CXXA 5LY1A 1RJ8A 1JUIA 2RM22 2W1UA 3DPRC 5ABJB 3VHPA 2E7TA 4E2GA 1S0BA 2VO5A 4W6XA 3ZSEA 3KCCA 4Y33A 2VW2A 3D5OA 5FY4A 3ZN6B 4D8MA 2WAAA 4JCKA 2EA7A 1RUOA 1ZVFA 1HB3A 4BXSV 2WT1A 4IEUA 4CCOA 1AX1A 3ILFA 1U5ZA 1YQ6A 2WWJA 1TNFA 4I3GA 3NKTA 3VDCA 5L7OA 1PVC3 1SZBA 5DXDA 1BMV1 2QQKA 1X50A 3EYPA 1LOBA 2LROA 3IB3A 3MIEA 3OBZA 1B35A 1TMF3 1QQP1 4QM8A 5FRAA 2ZHNA 3E6BA 4XXAA 3BPZA 3VKMA 3LA2A 3KT4A 1S0GA 4F3JA 5EIYB 1ULOA 1E57A 2LS6A 4LORA 5FPXA 4NWVA 4WM8C 4O9EA 4META 3BYWA 1XC6A 2PHRA 2ZGMA 4L99A 2UWBA 1QJY2 1Y9MA 1VP6A 5A7WA 4FPFA 3AC0A 3AL5A 1X9TA 2RDQA 5I8SA 4XF1A 5C4WC 3Q8EA 1AYN3 3ZXFA 3MLLA 5C9AA 1GOHA 3POIA 2YHJA 4ZPIA 1I5ZA 1WMDA 2ARBA 2VZ1A 1EP0A 1OC1A 1LHVA 3CF6E 3SKJE 4AI9A 3M3CA 3TEYA 1RMU1 1RUF3 2WNUC 3S5AA 1G8WA 3M3EA 3NJYA 1WMXA 4ATEA 3WDTA 3AKRA 1WW6A 2QZ3A 1FOD3 5KXCA 3O1VA 3MPBA 2C0ZA 2VOKA 5FJKA 2XJQA 3THTA 5CG9A 1NXD1 3FWEA 3OBRA 4GH4C 1TG7A 1J3RA 3POFA 3RI8A 3WVJA 1OPOA 4ES8A 2WT0A 3HIFA 4XUQA 3B93A 1U0AA 1F4AA 5BXXA 2ZEXA 3VHRA 5ABJC 3DEMA 1XU1A 3S30A 1H4HA 5LA0A 1TMF1 4SBVA 1Z78A 5AVAA 4PQ9A 1JXNA 3SQOA 4BCUA 4ZZ8A 1ZRDA 4LBJA 1FPN3 2VQ0A 3N7MA 1DIWA 3AKQA 2Q1ZB 3VBUA 5IUQA 5FZ6A 4X8PA 1CAXA 4B1MA 3PHMA 1RB8G 2Y6GA 3RNSA 1XYNA 3LOBA 2FBEA 4KWKA 4X8NA 1K5JA 3AB0A 4P9WA 1SBEA 3BUCA 2WIIB 1CIWA 4CDWA 4QGLA 4RFRB 1QHDA 3WG3A 5A3MA 1AYN1 1JN2P 1YFWA 2VZVA 3B69A 3W5MA 2MEV2 4XUTA 5A7NA 1HJGA 5LRRA 5FO8B 1RUF1 2BW8A 1UIKA 1YQ5A 4TWTA 4FOWA 2IFWA 2Y8KA 5FY8A 5JPNB 1Q8QA 4CDQB 2W46A 1W04A 2GN7A 2DU0A 1VJ2A 2ZGLA 2TBVA 3H8RA 3AYCA 2IC1A 2VZRA 2ZABA 3WNPA 3GALA 3VBOA 5HCBA 2ARAA 2VBBA 3M3IA 1QJY3 4XQWA 4CCNA 3JD72 1DHKB 4M3CB 2ZMKA 4ZU4A 4KI5M 4H2AA 4DIQA 4BLJA 5A3LA 2YU1A 4Y1ZA 1PIV1 3KHBA 3OD4A 2VCAA 4UFMA 4LE3A 2L9LA 3AZVA 1QNWA 3QD6A 4ARYA 3AKSA 2DWRA 1DGLA 4MADA 5LB6A 4CE8A 3PJQA 3PU8A 1BXHA 2VBPA 3TEWA 2C24A 1AL0G 5B2GB 4MH0E 4AI2A 5C5TA 4AGVA 3GCWA 4UFJA 5FUNA 1AXYA 4OUMA 5JXIA 4D94A 3AP4A 3J8F2 1WMFA 5BY5A 2CU5A 1GMMA 4BXFA 1E5RA 3WW2A 5C3SA 4QQ2A 5JOYA 3POEA 2E53A 3NKGA 4A42A 1XNKA 2VTXA 4R8HA 4BU2A 2H6BA 4F8AA 3FX3A 4XTMA 2I74A 3BKZA 3RZKA 1NUKA 5A3WA 1NCRB 3URFA 5I0DA 3VKNA 1MS9A 2VNOA 2ZGNA 1KS4A 2P3IA 2VQUA 3WINE 1SPPB 4UF0B 3RS6A 4WV8A 2BDRA 5DZGA 4A2UA 4QB2A 1G9DA 1QJY1 1S55A 1X33A 2ZHLA 4HFSA 4EN8B 1AX2A 3N9NA 4ISQA 2OUJA 2C1FA 4GJZA 2BVBA 3KV5A 3O5SA 2MEV3 1GBGA 4YG3A 4V2WA 2WFF2 4R9DA 3CZJA 1SLTA 4UI9L 1PMHX 4Y5SA 5FZ1A 3OYWA 4P14A 4JKKA 4DNYA 1O6UA 5F5CA 1F5JA 1QJEA 1SG3A 3D6EA 1GKBA 3U37A 1R092 1QH7A 3O14A 3ZYRA 2ETEA 1TE1B 3AZWA 3O0VA 4OCTA 5FMCA 4DO0A 1IKPA 2QQWA 2FDHA 2DUQA 4AI3A 3RYKA 3AYDA 2CDPA 1UCXA 4K8FA 4C1WA 1LOAA 2VOTA 5FMOS 5E6HA 3I97A 4GB32 5FZBA 4TTGA 3U0ZA 2Z79A 2GMPA 3OY8B 2JECA 4JDNA 1MZ6A 1JHJA 3PIJA 5F7UA 5DN2A 4HT1T 3ZX7A 2RDSA 1UZWA 4OUEA 2VG9A 2A6XA 1WWYA 2BGOA 3CJXA 1E5SA 3R0RA 2AYHA 1JZ2A 4XBQA 4XBNA 1W8TA 2DURA 1EY2A 1NE4A 4HVOA 4JGYC 2BEOA 3J8F3 4YG0A 2JG9A 1BLZA 1MS3A 3J9SA 4GJYA 2V73A 4QPYA 5A33A 3NAPB 4FFGA 5C71A 2MEV1 2ARCA 3PUHA 1GZWB 1ST8A 4YM1A 5F6LB 5KXBA 1S0IA 5D8AB 1OHFA 4CP9B 4YSFA 1CJDA 3AMPA 1YCIA 3ENRA 2CDOA 2IXJA 3MW2A 4IGOA 4XILA 5A6ZA 1NKGA 2RMU2 4NHKA 3V65A 2Y26A 3M2MA 3I4IA 1EV12 1JZ5A 2AC1A 2MHFA 1WCQA 2BTVC 4AFAA 2LW8A 2YGLA 4XYXA 1SQ4A 2IXKA 2QJVA 4IV3A 4NIGA 2CSGA 3PUQA 1AXZA 3BPSA 3U75A 3ZM8A 2EAKA 4BK5A 2BNNA 2XOMA 5A3PA 2XH6A 3RZGA 2G19A 2Y33A 2GZWA 2JD4A 3FN9A 4BQ5A 4XABA 2A3WA 1GFF2 2BZDA 2K46A 3VL9A 4AF9A 4KU8A 3N3HA 2XB6C 4LK7A 2GNTA 1VLNA 1S2EA 1HW5A 1GR3A 2ZZJA 3IPVB 4BIOA 3BIEA 3RRDA 1MS0A 2R042 2WFF3 1OQDA 5CNAA 3IT8A 3RJRA 5GZGA 2NLRA 2HYXA 3MUY1 5FAXA 1GYKA 2C5DA 3IDCB 3UT0A 4EZ4A 4PLOA 1ZREA 1J59A 2YFUA 2AZ5A 2E63A 1QJX2 4QXKA 2X8KA 3J8F1 4UYBA 4QPGA 1X8EA 3RZZA 4HVRA 5F3IA 1L7QA 1PZ8A 4MZUA 2GNMA 4A6OA 3NVCA 4GB33 3BTYA 2Y0OA 3LFMA 4QQPA 3VD9A 4UFIA 1KDMA 1UX7A 1O3RA 2P1BA 3VBSA 3CMGA 2RS33 4AVCA 2XKOA 4EE2A 1WW7A 4PCRA 3C7FA 1BYHA 1GSLA 3AYEA 2EIEA 4Q2FA 5DPNA 1W90A 4YWAA 3VLBB 1RJ7A 3WQ0A 1HRV2 2VCCA 3NAPC 4B3NA 3H7YA 1D2QA 1EUUA 1GP6A 2QQOA 1YRZA 5JUVA 4UWDA 5IVVA 3W9AA 1REDA 4S2HA 5G05L 5DAWA 4BQ4A 4JC1A 3K46A 2P17A 4WVMB 4XEZA 1J84A 2WFF1 3T2TA 4E9KA 3V0AA 2PHTA 5BPXA 3AP9A 2RMU3 2A5ZA 4UFHA 1D4M2 2XXZA 4WVVA 3DV8A 1EV13 4H14A 3ACHA 1I6XA 3B02A 1D7PM 3BB6A 2OUHA 1FNZA 5FYMA 2XUMA 4FFIA 1EAH3 4FPOB 5KHIA 5CKMA 1AR93 3J4UH 4Z07A 5GKAC 1W2NA 4UW6A 4CP1A 3M70A 1HX6A 5FZ7A 3DPRA 3VD5A 4GB31 4B29A 1NLSA 4LOSA 4CDXC 5DDJ2 3JXSA 4BDVB 4LBNA 4QQOA 2R043 3VBUB 1S2KA 5TSWA 1CAXB 3N9LA 3R05A 4Q27A 2CAUA 3WG4A 1B09A 3KLSA 1FV3A 4IGPA 4N90A 2VD7A 1QJX3 5HI0A 4CDWB 1LOFC 2JWPA 3FFQA 4P00B 1PNGA 4XJUA 3RZLA 4PT6A 1JYWA 4MXVA 3PTRB 3GF6A 4XF9A 5KHKA 2VULA 4PIXA 4AI1A 1A78A 2EXJA 2RMU1 1AR62 3TYJA 1V6MA 4DB5A 1EV11 4WZCA 1KJRA 3KF3A 3TB0A 1IQDC 3LEMA 3OPZA 2GH2A 3O0WA 1LODA 1AR91 2V5DA 3MI8A 4A45A 2IZWA 5A7PA 4NPMA 5C4WA 4MG2A 2XDVA 3I3BA 4NHLA 1RXGA 1SLAA 3VL8A 5F32A 3EQEA 4YGEA 4RGAA 1SCRA 3T0AA 4KMQA 4R4XA 3E6CC 1MZ5A 2WNUA 4E2QA 5LEKA 1GLHA 1G7YA 1ODNA 4ZXKA 5LA2A 1XPWA 4MGYE 2UYBA 2ZX0A 2R041 3T4VA 4CDUB 1ACCA 3EBRA 1R1ZA 3QH6A 4XUPA 1TNRA 2RS13 1CAVA 1ZZBA 1N1VA 3N9MA 4QGMA 4C1XA 2FZ1A 1D4M3 1MACA 2H0VA 1GWMA 3T09A 3U10A 3QBQA 1QJX1 4K8RB 2XUEA 3OCPA 4M3CE 4N9IA 2WNOA 5ABJA 1I9RA 4SLIA 4N43C 2XHKA 1J3QA 1IKQA 1LGNA 1MR5A 1O7FA 1UL9A 4OI2A 4AEKA 5IHRA 3T1LA 3AZXA 3ZN6A 2J22A 1GQPA 2CGOA 2F17A 2BPA2 2KA3A 4HLTA 5DDJ3 3POJA 1JUHA 3ST7A 2DCJA 1TVGA 1R1A3 5JLVA 2EXKA 5E89A 1IG3A 4FI9A 2DV9A 1M4WA 5BUVA 5JAXA 3ZFGC 4TLGA 4BH9A 4QHBA 1QY4A 3OGSA 1D0GA 1L3JA 3ZYBA 4FPKA 3FJSA 2YMZA 3R4UA 4KG0A 3RZMA 5J09A 3WDUA 4HONA 4DRVA 1HRV1 1XNTA 4BJ0A 2GNDA 4IEYA 5A32A 3VZLA 4DXRA 1GU3A 4HBNA 4K7JA 4LTAA 1H2MA 1U12A 2WSUA 4GMP1 4XFGA 4NHYA 2IXIA 1IS6A 1JOBA 5FK7A 2A6VA 3FL7A 3PTYA 1YO8A 2XJSA 5LEJA 4MHRA 4E27A 5LK7B 1AR63 1R64A 1D4M1 4FXKB 2BRTA 3EB7A 4LBKA 4LK6A 1XE8A 1S0JA 3OJBA 1QF3A 1G6NA 2JKXA 2ZEZA 4RHV3 4Q8LA 2HYKA 1C5HA 3IAPA 1VE0A 3T08A 3MV01 4C8DA 2E7AA 3BCWA 4YZ4A 2NM1A 1OQ1A 2WABA 1CD3G 5GZFA 2J1TA 1WKYA 4AQ2A 3MIGA 3NNLA 5FYIA 3PUAA 4CDUC 5DDJ1 3KZ4C 4CCDA 5CG8A 2FMYA 5FV3A 1XNBA 2I07B 5EYYA 2XHNA 1DGWX 3LDKA 1LOGA 4O9GA 1R1A1 5GLUA 4COVA 4F7ZA 5CADA 4E4DX 3OBTA 1OI6A 4TXWA 3ZYGA 4CUBA 3M8LA 2WO7A 4IXLA 4IETA 4ET7A 4KQ7A 3THPA 2PFWA 5CISA 1OURA 4AVTA 1JI6A 1O4ZA 2EIDA 2R49A 2PQSA 1OMIA 1YHFA 3EHKA 3T3YA 2XVGA 4P5HA 1OFSA 1Q3EA 1PGSA 5F5QA 2FDFA 4R52A 1QKQA 3UV9A 5C8WA 4DEVA 1UXXX 2Y6FA 1NG0A 2WZR2 3FMGA 2J1EA 2Q8DA 2WLPA 4IEOA 2C9KA 2ZAAA 4FP2A 2IWGB 5FYCA 3HQRA 5CZKA 4ZXEA 5FP3A 1AR61 2YV8A 3MDPA 5F2SA 4ZS3A 3WUCA 1HV1A 2JDMA 3WNXA 1J1TA 2Q1MA 3D8CA 3GBFA 4RHV1 2HWC2 4WVZA 2AEZA 5FP4A 5FZKA 4IV3B 2D98A 3WCSA 2ORZA 4ZS2A 4DZGA 5DUVA 3ZN4A 3WNKA 3ZFFC 1D4VB 2DVDA 3ON7A 3HJRA 5FLHA 5FLJA 4OVEA 1DQ1A 1FT9A 3N4MA 4ATFA 4LULA 2DVBA 4S2DA 1UU4A 3FZ3A 2VQTA 5A80A 3ZDSA 1UD1A 4XURA 4KWUA 2QQIA 3JBG2 2CY6A 1W8FA 4M3CA 3LCPA 3ETQA 4Q0PA 2VZPA 3JB8A 4QXHA 4G9SB 4XXPA 4Y1XA 1C1LA 3AM2A 2QQJA 3FLRA 3D82A 4Q4X2 2HWE3 4YW7A 5HXVA 4QPIC 2VNGA 4IV1C 5SV8A 4ZU5A 3ZLIA 1MQTC 3ITQA 2ZMNA 3KF5A 5T55A 1C8NA 1BEV2 4BMBA 3N7LA 2GP3A 5IW0A 1W6OB 3K3OA 3ZYJB 5JMCA 3UGGA 5A6XA 2TNFA 2WINB 4D7YA 1G9CA 1SDDB 3W5NA 1VIWB 1NQJA 2OIIA 2WZEA 1OKOA 1MS8A 2R6QA 3OEAA 4YLZA 1EPZA 4KG8A 3TAYA 5I8TA 2JE9A 3VBSB 5JMOA 2HKXA 2O1QA 1RUJ3 1ZA7A 1RIRA 4A3ZA 4AFBA 2EIBA 1LCLA 1VMJA 4RFT0 4CEYC 5FZCA 1JYIA 1YQCA 3PLQA 4TYSA 1YI9A 1QGLA 5CIRA 5KXEA 3APBA 4IE5A 1SPPA 2PHDA 3G7DA 3I54A 4LBMA 4YVWC 4CRQA 3KCXA 4IE0A 4AEDC 4ZU7A 4UF0A 5LBFA 5GM0A 2AUYA 5EHDA 1YUDA 3C7OA 1UO9A 2WZR3 3N7JA 1W2TA 2LUWA 4QU2A 1REFA 3WXPA 4AHXA 4BQ3A 4DXTA 4DUVA 4LBLA 4U2AA 2D93A 5GALA 5IAVA 5FTTC 1Q5OA 4CSWA 4HKOA 5FZGA 2W52A 1WLWA 1HRI2 2A75A 2VBDA 4CEWC 3FFZA 2QTWB 1W06A 4Y20A 4CUAA 1OOPC 2HWC3 2BNOA 3GZTB 4Z2WA 3GZAA 5FDBA 5IAXA 1GP5A 3A21A 5KHHA 2VAUA 3T2PA 5J1XA 4W8JA 1UAIA 1OBNA 1DCSA 4YW5A 4V2VA 3B5LB 1K5MB 5J48A 3V64A 5HXMA 2WR9A 2XKPA 4XFBA 4COYA 5GZCA 3AP6A 4MGSA 3JBG3 3RI9A 3ZIXA 1K12A 3JCIA 3UGHA 3NSTA 2OPKA 3QH7A 1PVC2 1CIYA 5IK7A 4HN1A 1J58A 1GWLA 2EXHA 4CYDA 5A3TA 3O1SA 2DUOA 1UY4A 3DYPA 1TMF2 3OY8A 4LHKA 1EUTA 5L19A 1OKQA 2VZ3A 4Q4X3 4NR1A 2VXJA 4LKEA 4H7MA 4JGZC 4W65A 4ISRA 1CN1A 2GMEA 1BEV3 1Q8PA 5JZGC 4QU1A 1J3PA 2G4IA 2B45X 2WZR1 1QDOA 2B39A 4QD2A 2QE3A 3AKTA 3RG0A 3CQOA 5JCTA 1YLLA 3LD8A 3OEBA 3ZFEC 2EAAA 1UY0A 3BIWE 3DUIA 4WM8B 5FYHA 2D6KA 2FHRA 5JOWA 3NAPA 4FOYA 2PHLA 3A7QA 3K4AA 3ZXEA 2ADEA 2HWC1 5D8AA 4CP9A 3U14A 1UY2A 4FO9A 4AAPA 5A6YA 2R0HA 4NVPA 4XIKA 2WDBA 2KD7A 1V00A 2WBKA 1LENA 3OF1A 1FOD2 5IK5A 1AJKA 4NE9A 2W08A 1LGCA 2XJUA 4UBHA 4Q0VA 4Y5TA 3DXUA 3H1MA 1ZRFA 1AL22 1SACA 3JBG1 1O91A 1YXWA 5E16A 3WW1A 1ZNPA 4CUGA 4XJAA 1OLME 1CAVB 1GOGA 4GH4B 1HRI3 2WL1A 1PVXA 2QCSB 3IPVA 4OULA 4Q4X1 3ZMOA 3CU7A 1FPN2 2XPJA 1PK6C 3B7MA 3HEIA 2ZEYA 4LJHA 5FBZA 1BEV1 3PL0A 3QACA 1K5MC 1WW4A 4L11A 3SISA 1RGSA 3ZN5A 1H1MA 3I2HA 4W6WA 3RMYA 3T30A 2PYTA 2R1DA 3WY6A 3H42B 5FZFA 4AHYA 3ME2A 2D6MA 4NN0A 5D21A 1W9WA 1QXJA 1WCSA 5LATA 2HWD2 2RS53 5CFDC 4LBQA 1YWKA 4AYUA 1LOFA 2TUNA 3FUOA 3U4SA 1AJOA 1DP0A 1GNZA 2PA7A 3BVCA 3UESA 3P1IA 3KV9A 2FDIA 3GZEA 4GZ9A 4QKBA 4CCEA 4CXYA 5A32B 1NLRA 1W0OA 5C3RA 1UKRA 1OT5A 1IPJA 3HNMA 2GC2A 3W58A 1LU2A 3DKWA 3OGGA 2YYOA 5T5JA 1OD3A 2W1QA 3IMMA 3W20A 1ND3C 1UZVA 2ZX1A 4QX0A 2QQUA 5FUPA 1HQLA 4QX2A 1CWPA 1HRI1 3H0OA 4AGGA 4DFSA 2AH2A 3IDBB 2BU9A 4WM7B 2CYFA 2MNGA 4WVMA 2HWF2 1XB9A 1Q8VA 4M4RA 4UFKA 1Y4WA 1QIQA 2W92A 2W87A 2DDUA 3BU7A 3E6DA 3U1XA 4K20A 2X5IC 4EROA 3ZOIA 2HLEA 1S1AA 4QDSA 1KQRA 5IVYA 4YPJA 4A6SA 1DYPA 2DFCA 1DU3D 3CZUA 2XJRA 4PLNA 4XF4A 1AL23 2YG0A 4JQRA 2B46X 2RS51 3MW4A 1PVC1 3PURA 1ND2C 1QOOA 4YZ2A 5IFTA 4AK3A 5IVEA 5CBLA 1HDKA 2VY0A 4LKSA 4DRRA 3USUA 4CCLA 2BFUS 5FO7B 3EJKA 1IS3A 2ZGTA 3LDRA 4LUKA 3B9IA 1W8HA 1QOSA 5FWJA 4A7YA 5H9RA 2VZSA 1OUSA 5FZAA 4UFLA 3ZFGA 5ANNA 4AR2A 4OMCA 2WT2A 2ET1A 3ZXGA 4ZHNA 5CFCC 5JWPA 2R072 4P9IA 3WCRA 1YFXA 4QM9A 3VB9A 5C8CC 3VDBA 2OW4A 3MICA 5GLTA 3WNMA 3MLJA 2CV6A 2HWD3 4RYDA 2XLGA 4BQXA 2Y38A 1KFUL 5FZ3A 2WNVC 2W5FA 3KT7A 4PHZA 1SFYA 3KSCA 1UOBA 2BYVE 3SMHA 1I5PA 1FOD1 2JENA 4D0QA 1OVSA 2YC2A 1US3A 1S0DA 5DQ0A 5K4LA 4YW1A 1OLMA 1P8JA 3PMSA 4XMAA 4TN7A 1AL21 3K2OA 1JTZX 4WM7C 3VD4A 1H6XA 1JYTA 1RUI3 3GHNA 3LSDA 1C57A 1RINA 4PI0A 3MW3A 4CCKA 1T6BX 3GJAA 5K7PA 1G9AA 4C0HA 3OGVA 1N1TA 2FMDA 2A3YA 3JU9A 5DAPA 1FPN1 3I2OA 5ISLA 2HWF3 1KITA 3O7OA 4LA3A 4CDUA 4D6QA 3BOWA 1EYBA 1LGBA 3BALA 3OPTA 4XFIA 1F5FA 1H8TC 3POGA 4QDRA 3LPFA 2BWAA 2VVFA 4XETA 4MGQA 5IVBA 4ARXA 1WBLA 1RUH3 1H9PA 2ZACA 1UX6A 4XJ9A 2FDGA 1ULEA 3QOPA 2VQAA 3MLKA 2HWB2 4JZRA 5CVRA 3VBFC 2D3PA 2HWD1 4KBBA 2BVVA 5FZHA 1W9YA 3WHTA 4JGYB 2CHHA 4FPYA 1DF0A 1J1LA 2VMHA 3H8UA 4TSVA 4Y3OA 4IDZA 4YVSC 5FIXA 3M4FA 4NRQA 2WYSA 2DFBA 2ARXA 4R4ZA 2ZKLA 4CUCA 2ZGOA 4XBLA 5BNNC 4H55A 3VUOA 3CBNA 3O1UA 5H9PA 3WD5A 4DXZA 4HOOA 2YUEA 4XF0A 5LK5A 3TRSB 3VKOA 2JDYA 4R9AA 3MEPA 4GIQA 3CIHA 4LIUA 2UWCA 1GQHA 1RUI1 3A0KA 1ZRRA 3A23A 4B4PA 2R073 1LJ7A 2PAEA 3JUUA 3WDVA 1C3HA 3GCXA 5LBEA 3HBKA 1C8M3 1W6PB 4FQZA 3ZFFA 3HVDA 2HWF1 1K3IA 4Y20B 5LA1A 3KV4A 1F2NA 2IFRA 5FZEA 1UIJA 5C6CA 5AC92 4P9XA 3AFKA 3ZSKA 4XJWA 5FOJB 1AUYA 4B4QA 2RG4A 5FZOA 5CAZA 4LEJA 3ZR5A 5BV6A 2K0GA 3AXDA 1RUH1 3LKJA 4YW2A 1GV9A 4XQDA 1UOFA 3ZYHA 1KXGA 3WUDA 4QWNA 1F35A 4FPHA 5L9BA 3NV4A 1LEDA 2E32A 4W6YA 4BK4A 1JBCA 2GMMA 3HNBM 3MF6A 3ZVXA 3AKPA 5FZ0A 3NV1A 5JXHA 1HKDA 4JVAA 2RS32 4P9LA 4XDOA 3MFCA 2Q8CA 4U36A 4B1LA 4N8MA 2XVKA 3I3EA 3ILNA 3MF9A 3UKTA 1N47A 4D6RA 2R071 1W2OA 1Y3TA 4CPBD 4CEYA 2HWB3 1NT0A 3HT2A 5C70A 1IPSA 5JSPA 1UMIA 4YFZA 1QXPA 2DTWA 5C7GA 2XL9A 1YIFA 3J7MA 5K0UC 1W0NA 4LO7A 3Q8BA 5F5IA 2YDEA 4COZA 4R9BA 3R6SA 3BI3A 1NCQC 1X8MA 2AEYA 4HANA 1KS5A 1EAH2 2H0BA 4CU8A 2WO3A 2JICA 1AR92 2JE7A 2OXBA 2WWUA 3J7NA 3PDQA 4RQPC 3UNPA 2CTVA 4CEWA 1OOPA 4L0PA 4BQYA 5B4NA 4BIFA 5KC5A 1VRH3 3LWCA 3BOPA 4I0BA 1VBC2 5JR7B 1W6MA 1FATA 1WD3A 2Z42A 4M4PA 1XYOA 1ZZCA 3TWIA 2ADDA 4CDXB 5AC93 5FR3A 1BJQA 1VBA2 4ZKTB 5L36A 3T2OA 3O1RA 1S0EA 3SH5A 4EN6B 2FD8A 4N53C 5FPLA 1UQXA 3UK9A 3VD7A 3TOJA 4D69A 1X9PA 5FYUA 5IWFA 5AFBA 1OQEA 4N7IA 3VZNA 2HWB1 2Q4SA 1XYPA 1UMHA 4XDPA 1W6OA 2RR13 5F3EA 4QQHA 2X09A 4LBQB 4FAHA 1ZYBA 5DUUA 5JZGA 5FREA 3VDDC 3ZDVA 4PQQA 2OX0A 4Q0UA 5A6QA 2W91A 3MIFA 1DQ0A 2R16A 3T4HB 1S2BA 3ZFEA 1FXZA 4J25A 2CAVA 4I2OA 4WVWA 1W99A 2BFUL 1RITA 3Q9OA 4YG6A 1DLCA 1WBFA 4LE4A 1ULCA 3CO2A 3H50A 4OHVA 1O59A 5A7QA 1JS9A 1U5XA 1VRH1 2WFPA 1IOAA 4QHOA 1DQ5A 1NA1C 1GNYA 3KT1A 4GKYA 4Q1PA 2Q30A 4G3YC 4HKWA 5GZDA 4BOWA 4AHWA 5AC91 2PLV2 2KXLA 4INDA 2W2IA 4H7LA 2RS12 3KVBA 3SEPA 3PUSA 1OF4A 1XU2A 4OHXA 4OQ9A 2VMDA 3DKQA 3E5QA 4V1PA 4FOVA 1ZZ7A 5CKQA 2UWAA 2VM9A 3SNMA 1O5UA 4AVBA 4PDWB 2RE9A 2QQMA 1PGW2 3AVSA 4IE7A 2X29A 4QX3A 3ZSJA 3SH4A 3ZXJA 4M00A 4N43B 3DXTA 1K5MA 1RVF2 1VBC3 1Z0HA 2B9VA 2IVIB 1R1A2 1SLCA 1T6GC 1Y9QA 3USUB 1PGL2 4HETA 4FSJA 1ODMA 2RS31 5FPVA 1WMEA 4LQRA 1VBA3 2CWMA 2WA4A 5FYYA 3N9QA 4HK8A 5AFEA 4Z82A 2J42A 3WLUA 2ZHMA 3ZFGB 5KHJA 1JMUB 2G9GA 1DG6A 1JYCA 4DPNA 4C90A 3DECA 2HBTA 2JD9A 4I0WB 4JTNA 5DZEA 1HB2A 4K9SA 5LA9A 2A1XA 3MIHA 5FCCA 3WP3A 1A6CA 5JI9A 2K9ZA 1YQ8A 1Y9GA 1W8OA 1XSRA 2C6SA 3AX4A 4BLIA 4B7EA 4YZ5A 1SBFA 3E5UA 4WM8A 4XACA 3S7IA 2HEVF 5JXJA 1O3TA 3JB4C 5DABA 5C3PA 1APNA 1XBFA 5B4XA 5LBBA 4M0HA 4RHV2 1EAH1 2GALA 3S7EA 2GH8A 4AQTA 2LALA 2FDJA 4M0NA 4CZSA 2FZ2A 4C91A 2B5HA 5JR2A 5KBFA 4Q0QA 2D5HA 3GGLA 5LASA 2Y6LA 1O4YA 3BTAA 2VMGA 1LULA 4XVHA 4YM0A 4MHUA 1H2LA 5BYNA 3OD0A 1VBC1 4YFWA 4GMP0 2X5IA 1ENQA 3LGRA 4K1ZA 3H8OA 3MUZ1 2PLV3 1HQWA 1VBA1 5T52A 4D3WA 2TEPA 5A3UA 4EN0A 4FPGA 5BNPC 4FFHA 3MZHA 4GH4A 1C5IA 1V6JA 4PDWC 4RS5C 4LOTA 3P3NA 4MGKE 1L7RA 1H30A 1ND2A 2GSYA 3PU3A 4XPVA 4OI4A 3HNYM 4LT5A 1H2KA 4BM8A 5C9AC 1U5YA 5L9RA 4G4FA 1AX0A 4PIYA 2VNVA 1PX4A 2XL7A 3FBMA 4AFMA 4E2SA 3SITA 1ONAA 2FDKA 2BGCA 3LIHA 4K1YA 3FHIB 1N1SA 1HB4A 1LESA 1RVF3 5FPAA 1C4RA 3HR9A 5DUWA 5EP9A 3V56A 1HB1A 2YC0A 1I3HA 2JB8A 2B7YA 5FXXA 3ORJA 4JHTA 5CFCA 4QQLA 1OF3A 5FMBA 5FFOC 4OHZA 2W68A 5C8CA 1TZOA 5IK4A 1URXA 2J1UA 3BODA 3CHXA 3KQRA 4RD7A 1LRHA 1QOTA 2P6CA 2PN5A 4LIVA 1AR73 2VE1A 4AI0A 1NYWA 2R1BA 2WNVA 1K42A 3IM0A 1QJZA 2Y64A 2ZPXA 3ZYIB 4MV2A 3ZFFB 1Z7S2 1ULGA 3Q8CA 4Y4YA 4L8QA 2PLV1 2HH9A 2UYAA 3AZZA 3ECQA 2D6PA 2WS92 2RS11 4GWMA 1H4GA 3KV6A 2A7AA 2G9FA 3P5BA 5FP9A 4E4HA 5FZOB 4FTSA 1O8SA 5CB7A 5HBAA 4WM7A 1W6NB 3N9OA 4Q29A 2HWE2 4NWWA 2CWSA 1O3QA 3DN7A 4QGNA 2F4PA 4HMZA 4JQTA 4LO8A 3N35A 3FBYA 1PGW1 3SEEA 4QPIB 4IV1B 4KNCA 4URTA 1MQTB 3SLIA 4GULA 2OPWA 4DINB 3MYXA 1RVF1 1OH4A 5I0RA 3S5QA 1PGL1 1MS4A 1NZCA 1V6KA 1VAMA 3FC0A 4NIDA 1STMA 4BWOA 3RYRA 4BPZA 2Z5WA 2VCBA 3ACIA 3GJBA 3P3PA 1RUJ2 4XIOA 5EJ3A 3ASIA 1Q43A 3VBOC 4XHBA 3WP6A 1OUXA 2ZKNA 4NROA 2QUOA 2PHWA 1CJPA 3OSDA 1AR71 1BVP1 1GP4A 2B4KA 5CA6A 5IK8A 4OQ8A 2R062 4IEXA 3SC7X 4CEYB 1U5IA 1DGRN 2ZMLA 1OA3A 3WSOA 2WO1A 1POQA 4XJZA 1O5LA 2VH9A 3DGTA 5A3NA 4NPRA 4MUVA 4YVWB 1UN1A 1LB2A 4QKNA 4AEDB 1DYOA 1W39A 1SHWB 4IE4A 3R4SA 4MLOA 1O3SA 2WAOA 3E1F1 3WF2A 3ZXKA 1JHNA 4NRMA 5DG2A 5DAVA 4LBQD 1GZCA 5CYYA 5JIUA 5FXZA 2BUKA 3ZIWA 3L9JT 3JQWA 3DCQA 3K77A 2IXCA 3N36A 4BHPA 4CEWB 1WLCA 1OOPB 1E5HA 2Z4FA 2YB7A 5F8PA 5F3GA 1POV3 4IEWA 4RSUA 3LEGA 1GUIA 3GBWA 5J98B 1PMJX 3WW4A 2P6HA 3OPWA 1GOFA 3ZXLA 1W6MB 4AOCA 3H1WA 2ERFA 4BYYA 1Z7S3 1QJFA 1SLIA 3ES4A 3I8TA 1UZZA 5FYVA 5A1LA 2RJKA 4YRDA 2WS93 2XWBB 4NAOA 1MVQA 2W94A 3NRUA 4LHLA 5CU1A 3NWKA 1IQAA 3KVAA 5FYTA 1LNSA 3ZPYA 2ZZQA 4JKMA 2ZA9A 2QQNA 4WZFA 4COWA 5L9VA 2VMIA 2AREA 1YQ2A 3RYPA 2ZGPA 4OMDA 1CPMA 2JE8A 4OI0A 2EIGA 5JOZA 1VB2A 4N7UA 2PTMA 3AMNA 1ENRA 2RJLA 4BB3A 4I0AA 2WQ4A
chains in the Genus database with same CATH topology
3IMMA 1UYPA 1Y9MA 3NMBA 4FFIA 3RWKX 5FKCA 1ST8A 3ZR6A 5FK8A 2ADDA 3OSDA 4HXCA 4CCCA 2QQUA 3SC7X 4UFJA 5FMBA 3LFIA 1Y9GA 4JQTA 4FFFA 2AC1A 2QQVA 3H3LA 3LDRA 3PIJA 4FFHA 5FMDA 3HBKA 2XQRA 4B1MA 4UFKA 4CCDA 1Y4WA 2AEYA 3LF7A 3KF3A 4QHZA 3U75A 3LDKA 3LEMA 3U1XA 4UFLA 2OXBA 3PIGA 5ANNA 3S5QA 4B1LA 5FK7A 3KF5A 4CCEA 2AEZA 3LIGA 5FKBA 3ZR5A 5FIXA 4UFMA 3UGFA 2ADEA 4UFHA 3LIHA 1W2TA 3UGHA 4AZZA 4UFIA 3UGGA 5FMCA 3U14A 4EQVA 2QQWA 4FFGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IMM A;  1UYP A;  1Y9M A;  3NMB A;  4FFI A;  3RWK X;  5FKC A;  1ST8 A;  3ZR6 A;  5FK8 A;  2ADD A;  3OSD A;  4HXC A;  4CCC A;  2QQU A;  3SC7 X;  4UFJ A;  5FMB A;  3LFI A;  1Y9G A;  4JQT A;  4FFF A;  2AC1 A;  2QQV A;  3H3L A;  3LDR A;  3PIJ A;  4FFH A;  5FMD A;  3HBK A;  2XQR A;  4B1M A;  4UFK A;  4CCD A;  1Y4W A;  2AEY A;  3LF7 A;  3KF3 A;  4QHZ A;  3U75 A;  3LDK A;  3LEM A;  3U1X A;  4UFL A;  2OXB A;  3PIG A;  5ANN A;  3S5Q A;  4B1L A;  5FK7 A;  3KF5 A;  4CCE A;  2AEZ A;  3LIG A;  5FKB A;  3ZR5 A;  5FIX A;  4UFM A;  3UGF A;  2ADE A;  4UFH A;  3LIH A;  1W2T A;  3UGH A;  4AZZ A;  4UFI A;  3UGG A;  5FMC A;  3U14 A;  4EQV A;  2QQW A;  4FFG A; 
#chains in the Genus database with same CATH topology
 4O61 A;  2Y34 A;  1UOG A;  4JGZ B;  4MGI E;  4XOG A;  2FCV A;  2XG3 A;  3T2Q A;  4RR3 C;  1H8V A;  3O0X A;  1BK1 A;  2BOI A;  5JZG B;  1W8Z A;  1F9K A;  2XML A;  3NJZ A;  4JDO A;  3HAG A;  3KB5 A;  3H1Y A;  3LFI A;  1XQN A;  2JJ6 A;  3KS7 A;  5JDB A;  2JB4 A;  2QVS B;  1JOD A;  2A71 A;  3NJV A;  2W1S A;  2X53 S;  4UW3 A;  3ZFE B;  4JGY A;  4FPE A;  3D0S A;  3BU0 A;  3MIB A;  4K40 A;  3VHO A;  5FY7 A;  4DY3 A;  1F4H A;  2ZBJ A;  3M7A A;  5FYZ A;  4J6G A;  4CVU A;  1UYY A;  4X6R B;  4Q8K A;  1POV 1;  3III A;  2WNE A;  5D2A A;  1FX5 A;  2R06 3;  4XFA A;  2A6W A;  5FKB A;  5K0U A;  4AQ6 A;  3AJZ A;  1Z7S 1;  5FYS A;  2W1W A;  4LUM A;  5A70 A;  2IUW A;  4MYE A;  1QEX A;  2WS9 1;  3IKW A;  4PI2 A;  2W9X A;  4HKL A;  3M3O A;  4Z92 B;  2VCM A;  1F15 A;  3LPG A;  1UMZ A;  3AVR A;  1PHM A;  1W6P A;  2QZ2 A;  2HWE 1;  1H9W A;  2YC4 A;  3PVB B;  3A22 A;  4OZO A;  1X82 A;  4H3W A;  2PXJ A;  1LOC A;  2JG9 C;  1NAE A;  3U07 A;  2ZGU A;  2QKD A;  4D7S A;  4E4S A;  5L73 A;  2V4V A;  1QXR A;  2EF6 A;  5HCA A;  2ZXQ A;  4DXS A;  5GJ6 A;  2P3K A;  4HG6 B;  1XOY A;  2C26 A;  3SHR A;  1PK6 B;  4AXO A;  2DF7 A;  2Y6K A;  5GLV A;  4AE2 A;  3L2H A;  5FQ0 A;  2J1A A;  5J37 A;  2ZS6 B;  1UKG A;  5F2W A;  1NX9 A;  4E8D A;  4K3U A;  5FXV A;  1VMH A;  4W4Z A;  2RS5 2;  1RUJ 1;  4OUS A;  3B00 A;  4LO4 B;  3NMB A;  3O1O A;  2BER A;  2O0O A;  4Q1R A;  2OYZ A;  4EN9 B;  5A7O A;  4QX7 A;  1BVV A;  1CAW A;  1VBD 2;  3MPP G;  5ERL A;  3HQX A;  5CFD B;  3DYO A;  2WO2 A;  2R06 1;  5I0U A;  3VKL A;  1MZF A;  1VB4 A;  2P3Y A;  3PNA A;  2JG8 C;  3O12 A;  4GWI A;  2AR6 A;  4Y22 A;  2QQL A;  1PM7 A;  2D44 A;  3LDB A;  3K3N A;  2XQX A;  4AAX A;  1HQN A;  5GZE A;  4QDQ A;  3LEK A;  5FZL A;  4ZZ5 A;  2DVA A;  1MPX A;  3GHM A;  1Q56 A;  1ND3 B;  1JW6 A;  1DQ6 A;  5F37 A;  1Y7B A;  2Y60 A;  2ZX3 A;  3WNL A;  1NA1 A;  2W95 A;  2JDU A;  5HV4 A;  1NE6 A;  2GAU A;  3RGB A;  2P34 A;  4OHW A;  1QDC A;  3KD4 A;  5FZ9 A;  5GLZ A;  4FAG A;  3J7H A;  1FYU A;  3AL6 A;  3I2K A;  2WC2 A;  3WF4 A;  1LHW A;  2QBX A;  5FMD A;  2W3J A;  3F2Z A;  1JU4 A;  1BK0 A;  2X5I B;  4IES A;  1W0P A;  3UL2 A;  3RPQ A;  1PZ7 A;  4AEJ A;  2OKX A;  2O14 A;  1NLQ A;  4XMI A;  3VBH C;  1JYN A;  4FTE A;  5FP8 A;  3WF1 A;  3NJX A;  5FZ8 A;  2K2S A;  3OB8 A;  2YPD A;  1ASJ 2;  5I91 A;  1TME 2;  3WHU A;  1JYV A;  2XR4 A;  1ND2 B;  2NMN A;  4HPK B;  4CDX A;  5C33 A;  1LHO A;  2E33 A;  4IW3 A;  2OA2 A;  1N1Y A;  1GZ9 A;  3WG2 A;  4QX1 A;  4RGG A;  2RV9 A;  3GBG A;  4AQS A;  1KDK A;  4AVA A;  2BJS A;  5DAQ A;  1NZI A;  4HSL A;  1YI7 A;  1QH6 A;  1WLD A;  3GDB A;  4EWA A;  4L97 A;  1VAL A;  4NJ4 A;  5EXO A;  1IHM A;  1O8P A;  3DF0 A;  1HIX A;  2GN3 A;  3HT1 A;  2ZJC A;  4KBZ A;  4PBO A;  4XJ8 A;  5LBC A;  5JXG A;  3FLP A;  1WLT A;  1A3K A;  5CFC B;  4YYO A;  5C8C B;  1OA4 A;  5ANQ A;  1SLL A;  1LOE A;  1VBD 3;  3IAQ A;  1YJK A;  2D40 A;  3ZXA C;  4CCJ A;  1RMU 3;  2B9U A;  4AZZ A;  4QAW A;  3RVH A;  4XTP A;  2WNV B;  1OA2 A;  2EAL A;  5FUI A;  1N3P A;  5LWB A;  1CZS A;  2PHU A;  4NHX A;  1W2U A;  1VRB A;  1DZT A;  2VC9 A;  1RUI 2;  2VMC A;  4FPJ A;  5CKN A;  3VZO A;  1HV0 A;  1PX3 A;  2GDF A;  4MGZ E;  4JRL A;  3PVN A;  4IEQ A;  2ES3 A;  3NV3 A;  2JDA A;  3MHZ A;  1PM4 A;  2VUJ A;  2VZQ A;  2VZT A;  4ZON A;  4JDM A;  1JZ4 A;  1YIP A;  1RHI 2;  1SFP A;  4CU9 A;  4XZP A;  2RHP A;  2WLQ A;  3ACL A;  4YGB A;  4HVQ A;  3M1H A;  4KGG A;  4AWD A;  1MVE A;  2BQP A;  3WDY A;  5FPB A;  3LIG A;  1RUH 2;  2P3J A;  3H3U A;  5M0T A;  5IVF A;  5BNP A;  2UY9 A;  2F6B A;  4XDQ A;  1H8T B;  4LR4 A;  4PDW A;  4RS5 A;  3ZKU A;  4BE3 A;  5EJZ B;  3U4X A;  1I1E A;  2A3X A;  4NUB A;  5IJR A;  3U11 A;  2BGP A;  2KM2 A;  5KR7 A;  4N43 A;  5EYX A;  1ASJ 3;  3VBF B;  3ZMN A;  1G86 A;  1TME 3;  4L2N A;  3C7G A;  1DZQ A;  1VBD 1;  4LBO A;  4AVV A;  4IE6 A;  1A8M A;  1OLQ A;  3MFA A;  3AP5 A;  1X7N A;  4ORF A;  4FP3 A;  2V4A A;  3UET A;  4YVS B;  2B8M A;  5BNN B;  1ZA4 A;  5I93 A;  1CR7 A;  5HPO A;  1HJF A;  1ZRI A;  5IVJ A;  3FE5 A;  5F6K A;  5J3U A;  1AZD A;  1RUE 2;  5FZ4 A;  3WV6 A;  1C8M 2;  4Q4V 3;  4EQV A;  4URA A;  1PMI A;  1FAY A;  2HEY F;  2WN3 A;  2ZOE B;  1PO2 2;  1ALY A;  2QDR A;  5EJ1 B;  3WX5 A;  1RUG 2;  3IIA A;  4HXC A;  1RUC 3;  5EV7 A;  1PIV 3;  5F5A A;  1M06 G;  1ZZ9 A;  4FQ4 A;  1XNC A;  3VBR B;  4CA9 A;  2RM2 3;  4O7X A;  5LY2 A;  2DYC A;  2DVF A;  2JDZ A;  1EPW A;  4S2G A;  4BIS A;  1UZY A;  5FO9 B;  2ID4 A;  3USS A;  4NPL A;  4Z1V A;  3LA3 A;  4COU A;  4HZF A;  2XON A;  2JKB A;  2MPF A;  4NAM A;  2QQP A;  2JDN A;  4QXB A;  1D2S A;  2CGP A;  3GYD A;  3AP7 A;  1OSG A;  3H7J A;  1VBE 2;  3MGU A;  4GWJ A;  1UPS A;  4B4R A;  2D3R A;  3UKV A;  4CU7 A;  1ASJ 1;  3WP4 A;  4I09 A;  1TME 1;  1QJU 2;  2NMO A;  1N3Q A;  4HN0 A;  3RSJ A;  1ULP A;  1RHI 3;  3I59 B;  4QPW A;  4NMI A;  1CX4 A;  2DU1 A;  2DCZ A;  2VZO A;  4GQ7 A;  4KL1 A;  3VZK A;  2OQ6 A;  4EJR A;  2WWS A;  1ENX A;  2YFZ A;  4HK9 A;  2QQV A;  3CLP A;  1ZBA 2;  4QMA A;  1RC6 A;  2KR2 A;  3IWZ A;  1IS4 A;  4IGQ A;  1HN1 A;  3SH3 A;  4Q4V 1;  1W6Q A;  3A0N A;  3NQH A;  3JZV A;  4FCA A;  2XWJ B;  5C5U A;  2D6N A;  4A41 A;  1RUC 1;  5FJH A;  5EQU A;  2YBP A;  2RM2 1;  2HJI A;  1UW8 A;  3N9P A;  4P5Y A;  1H1I A;  3FHA A;  4AL9 A;  2W47 A;  4TZD A;  3LEI A;  4S2F A;  4AGR A;  1V0A A;  4YZ1 A;  4Y5Z 0;  1WCD J;  2RJ2 A;  5K0U B;  3CJI B;  4CXW A;  5KHG A;  5FYB A;  2V5Y A;  1LHN A;  1KRI A;  1V6O A;  4A44 A;  1JH5 A;  2ZTN A;  4M3C F;  1NCQ B;  3VKF C;  4AW7 A;  1FMD 2;  5CEH A;  2WKK A;  4PIZ A;  5HCF A;  4OI1 A;  1VRH 2;  2P5B A;  4P9Y A;  4RQP B;  1RUE 3;  3VBR C;  1JZ7 A;  3S0M A;  3KHC A;  2E51 A;  2VR4 A;  1PO1 2;  5EPA A;  1COV 2;  1PO2 3;  4XF3 A;  1NXM A;  1RUG 3;  1RHI 1;  1NQD A;  1IPK A;  4W50 A;  4QX5 A;  1Y43 B;  1OFN A;  3M3Q A;  4DEQ A;  1CAU B;  1W6N A;  2G1M A;  5HCH A;  2UUR A;  3NL1 A;  5FQ0 B;  2Q5T A;  1UY1 A;  1QMJ A;  5FZI A;  2BV4 A;  4CP2 A;  2A6Y A;  4N53 B;  4J1W A;  2ZEW A;  5FK8 A;  3ALQ A;  4Y4R A;  1GQG A;  2VTF A;  4BME A;  3UJO A;  1VBE 3;  2RR1 2;  2DCY A;  2DTY A;  3HMY A;  3QCW A;  1H0B A;  2YRO A;  1MQT A;  3OGJ A;  4IV1 A;  4QPI A;  3WT3 A;  2B42 B;  2OZ6 A;  5F39 A;  4FBF A;  2O8O A;  3B3Q E;  3KQ4 B;  3T1M A;  2WZ8 A;  4CDQ C;  5DUX A;  1QJU 3;  5J36 A;  1XE7 A;  3I2I A;  1CAW B;  3T0B A;  4OZX A;  5KC6 A;  5JOX A;  2VOW A;  4RR3 A;  3SCF A;  3IN9 A;  1LU1 A;  2VTX J;  3EXU A;  3VDD B;  4HSJ A;  4Y22 B;  2DUP A;  2D6L X;  1FV2 A;  1K45 A;  5F9T A;  3WR0 A;  1W03 A;  1S0C A;  3W59 A;  2NN8 A;  3O1M A;  4LPL A;  1ZBA 3;  4FVV A;  2PHX A;  4Y26 A;  3C2U A;  1RUE 1;  2JEM A;  4Z8B A;  3J26 N;  3JD7 3;  1C8M 1;  3LE0 A;  5A1F A;  1WD4 A;  4X6Q B;  4KU7 A;  5EFU A;  4OHY A;  1PO2 1;  2JDK A;  2ZHK A;  5DZF A;  4YVW A;  1RUG 1;  2UY8 A;  4AED A;  1D0H A;  1CVN A;  1NA1 B;  3KCY A;  2WQZ C;  3CJI C;  3ACG A;  1SFN A;  5T5O A;  3VHN A;  2BBV A;  2G9Z A;  5T50 A;  5IYY A;  1DLL A;  2E7Q A;  4GKX A;  4AFC A;  1WGP A;  3GXU A;  1ZRC A;  1VBE 1;  4XW3 A;  1CX1 A;  3I3Q A;  1SCS A;  4P9G A;  1A34 A;  1FMD 3;  2NYY A;  1NCR C;  2Y0I A;  5BNO B;  3BTZ A;  1WCU A;  2VOV A;  1UYZ A;  1W9T A;  1QJU 1;  5JSO A;  1ZBE 2;  2RVA A;  5C3Q A;  2PAK A;  4EWD A;  2GP5 A;  1PO1 3;  1ULD A;  2JIG A;  1COV 3;  4YGC A;  1ULF A;  2EVX A;  1NY7 2;  2VNR A;  2ILM A;  2J1S A;  3NNG A;  1UOJ A;  3HPN A;  5SV5 A;  3H3L A;  4DS0 A;  3VD3 A;  2A70 A;  4I30 A;  1YNA A;  3IZO A;  3K51 A;  5FY9 A;  1ZBA 1;  3RMX A;  2UU8 A;  4FPC A;  4QHZ A;  1LR5 A;  5LW9 A;  3I3D A;  2WUH A;  3JD7 1;  2ENR A;  2E26 A;  2ZGQ A;  4JRA A;  4K21 A;  4N9H A;  1JZ6 A;  1XJA A;  1VBB 2;  2Y6J A;  4DUW A;  1DZR A;  1J83 A;  4JGZ A;  2SBA A;  3E5X A;  4LO6 B;  3A4U A;  1VMF A;  4XQ4 A;  3BTX A;  1XRU A;  2H6C A;  1SLB A;  2JG8 A;  3RJ2 X;  1WA6 X;  1UZ0 A;  4MO3 M;  5FPU A;  4P02 B;  1W8N A;  1UNB A;  3PJY A;  3AZY A;  4CCC A;  1OD5 A;  1YFY A;  5IVC A;  1SEF A;  4EZH A;  3AMM A;  1BKZ A;  2EIC A;  2W0X A;  3WDX A;  4B8E A;  1R09 3;  3AJY A;  4BZ4 A;  5LCW L;  5K8S A;  4YM2 A;  2YPJ A;  3IDE A;  2IVJ A;  1FMD 1;  3TBD A;  3POS A;  5A7S A;  1Q8O A;  2OT7 A;  3VDA A;  2N7G A;  1UU5 A;  5L7O B;  3NW4 A;  2A73 B;  2LM3 A;  1XXN A;  3PME A;  3WNO A;  4A3X A;  5E8A A;  1PO1 1;  1E5I A;  3I2J A;  5LRS A;  1COV 1;  2D7F A;  4J1X A;  4XUO A;  2AAC A;  2ZGR A;  1B35 B;  3OUJ A;  2Z2S B;  5DMY A;  1N3O A;  3B9C A;  4Y1U A;  1YYN A;  2AGS A;  4AFD A;  2EXI A;  4ASM B;  4GAL A;  2IXL A;  4MOA A;  4EN7 B;  3C3V A;  1AR8 2;  4LA2 A;  4YW4 A;  1UF2 C;  2NPI A;  2Q1F A;  3VBH A;  1A8D A;  3H9A A;  5LZ6 A;  1WCK A;  2XLA A;  1UWW A;  2WSV A;  3VZJ A;  5BNP B;  1AXK A;  1XND A;  2BP6 A;  2LRP A;  4LHN A;  2VME A;  3N7K A;  2BWC A;  4QX8 A;  5BNO C;  3RFR A;  3ZYP A;  3NNJ A;  2JDP A;  4RS5 B;  5A7W B;  1V6I A;  2RR1 1;  2VVD A;  4IEV A;  4QXC A;  1W9F A;  5D8A C;  1GWK A;  1PK6 A;  1L7L A;  3E97 A;  2BBA A;  2ATF A;  5C9A B;  3AFG A;  4FOQ A;  4EV0 A;  3KMH A;  4XCB A;  5APA A;  1X36 A;  1ZBE 3;  5FBJ A;  3C8X A;  5AVP A;  4IUG A;  5JVV A;  4UW4 A;  4BQ2 A;  2YBS A;  3POW A;  4CU6 A;  1CZT A;  3KGL A;  4K6B A;  3LA7 A;  1CES A;  3RZJ A;  1R09 1;  3AMH A;  4IL7 A;  2NQY A;  2NZ9 A;  5BNQ A;  2IXH A;  1ENS A;  4YNI A;  2SLI A;  4JX0 A;  5CFD A;  1AR7 2;  3I2G A;  2FQP A;  4MXW A;  2ZAH A;  3UYJ A;  3OGR A;  2GC3 A;  2D3S A;  2OVU A;  3C7E A;  4XAA A;  4XUN A;  1JZ8 A;  3AK0 A;  4BQW A;  1VBB 3;  1BHG A;  1ZM1 A;  4DUX A;  4JAA A;  3THD A;  3AYA A;  3HWJ A;  2OZJ A;  3B94 A;  1MEC 2;  3TNP B;  4YZ3 A;  4XFC A;  2XJP A;  3RZH A;  5G04 L;  4Q5O A;  2YXS A;  1UXZ A;  4CCM A;  3PIG A;  1ND3 A;  1XE0 A;  4LMF A;  2C4X A;  5L7O C;  3DYM A;  1CQ9 A;  2NP0 A;  2Q8E A;  4Q4W 2;  3ES1 A;  4MSV A;  4ITC A;  1O4T A;  1IG0 A;  2VZU A;  1B35 C;  2R30 A;  3NO8 A;  4XE9 A;  1JYX A;  3V0B A;  1ZBE 1;  1V9U 2;  4CP0 A;  1W05 A;  2XBO 2;  4IER A;  4XFH A;  4AEM A;  3RWN A;  1UPI A;  2C9A A;  3EO6 A;  1DQ4 A;  1YFU A;  2V72 A;  3DL3 A;  1BBT 2;  1NY7 1;  4GD4 A;  4MX3 A;  4IEZ A;  1ZZ6 A;  3I49 A;  1C28 A;  5DAX A;  1SBD A;  1F8V A;  1AR8 3;  3TNQ A;  4HL0 A;  4MVT A;  4E8C A;  2CNA A;  4KH9 A;  3INA A;  3POY A;  4HPK A;  3VBO B;  4ES9 A;  3CNA A;  1HRV 3;  2VPV A;  4E4Z A;  4OYU A;  3ZKY A;  3CL1 A;  1OVP A;  1W6Q B;  2FCT A;  1VBB 1;  3NV2 A;  3OOX A;  3ZSL A;  2PHF A;  4GMP 3;  2XVL A;  4PLM A;  2ORX A;  3L2Y A;  5FLI A;  3PUI A;  3RDI A;  3VV1 A;  3MO4 A;  1OPM A;  4Q0S A;  1UY3 A;  3OTF A;  3MBW A;  1G9F A;  2RDR A;  4ASK A;  5IAT A;  4UOJ A;  2VUD A;  3B01 A;  3MID A;  4LLF A;  4Q4Y 2;  3S6P A;  3VN4 A;  3MV1 1;  4M01 A;  5FWE A;  4CPB A;  4GXL A;  3HOB A;  3CKH A;  3Q8F A;  4Q26 A;  1HN0 A;  2VMF A;  1W9S A;  4L92 A;  2OQ7 A;  1AVB A;  3VBU C;  4AVS A;  2WYF A;  3EMR A;  4RN5 A;  1S4C A;  2VW0 A;  2A6Z A;  1DBN A;  2R32 A;  5T54 A;  2J7M A;  3PVE A;  3I2D A;  4PBP A;  4PF1 A;  4DOU A;  4XHX A;  5FMO L;  3TN9 2;  4FT8 A;  1MEC 3;  1T2X A;  2YGM A;  3QLQ A;  1AR8 1;  5E88 A;  4FPL A;  3WF0 A;  5H9S A;  1KGY A;  3WQ1 A;  4LO5 B;  4CDW C;  2Z69 A;  2DCT A;  1ZX5 A;  3NNM A;  3TEX A;  1RTV A;  1US2 A;  3ACF A;  3K4Z A;  4KWJ A;  4NII A;  3WF3 A;  3WQB A;  3WEZ A;  4RL7 A;  3I2F A;  2VXR A;  1RYY A;  4Q4W 3;  1JOJ A;  3SCG A;  1WA4 A;  5T5P A;  3NNF A;  3AXE A;  1LKN A;  2WN2 A;  2D97 A;  4LNV A;  3OUH A;  1VAV A;  4ONU A;  5C3O A;  5D1I A;  3S57 A;  1H8T A;  1V9U 3;  2WRA A;  2XBO 3;  4JKL A;  1RUD 2;  5E1R A;  4RA0 A;  4YW6 A;  3ZYF A;  3OYW B;  1QWR A;  4GWN A;  1BBT 3;  4R9C A;  4RR3 B;  1QNY A;  3H3Z A;  4EYU A;  3VZM A;  4NIA A;  3HN1 A;  3VBF A;  2P2K A;  1GIC A;  1FNY A;  1UYP A;  4JHZ A;  1IZ3 A;  1W2A X;  2ET7 A;  3GM8 A;  1W3V A;  2XJV A;  5ACA 2;  2DBN A;  1XSQ A;  1UYX A;  1W8U A;  4PF5 A;  4GA9 A;  3ROU A;  3UJQ A;  2E6V A;  4BA6 A;  2YBK A;  3LQC A;  2VJX A;  2Y6H A;  4YVS A;  2D5F A;  2ZGK A;  3ELN A;  4LLO A;  3P6B A;  5BNN A;  5KWR A;  2XLF A;  2QNK A;  3LSE A;  4QKF A;  3KWV A;  2VUA A;  2JIJ A;  1MEC 1;  1PZ9 A;  2X05 A;  4A7Z A;  2WQ8 A;  2ZCW A;  5JI7 A;  4DQA A;  5IT6 A;  2W39 A;  4RGK A;  3TEZ A;  5A1A A;  2JX9 A;  1HXS 2;  4UXA A;  1YC6 1;  4XFF A;  1V6N A;  1MS5 A;  4WBB A;  1BCX A;  3HQU A;  1WZX A;  3OBA A;  5FY1 A;  4Q4Y 3;  3VBR A;  4BQ1 A;  1KEX A;  3WG1 A;  1R08 2;  4Q4W 1;  3WW3 A;  1WUV A;  2JG9 B;  3FUQ A;  3Q8A A;  1POV 0;  2BOJ A;  2XJT A;  1VAK A;  4GAZ A;  5A33 B;  1SDW A;  1V9U 1;  2XBO 1;  3ZXD A;  4JTO A;  4O65 A;  2GC1 A;  3LOI A;  4A7K A;  1BBT 1;  3D3A A;  3D0J A;  1F31 A;  3TN9 3;  3X29 B;  4B7K A;  2I2S A;  1GZT A;  4LHS A;  5FY0 A;  4UBG A;  4I02 A;  4UT5 A;  3J7L A;  5IFP A;  1BQP A;  4AG4 A;  1MS1 A;  3IBM A;  4C0B A;  3I59 A;  4CDQ A;  5I8Y A;  3LAG A;  5I0T A;  4TLF A;  3LZZ A;  1LEM A;  2DBI A;  2P4E A;  4PJY A;  3ZPO A;  1RXF A;  3RWK X;  5FY5 A;  1MZE A;  1H1A A;  1DFQ A;  1TEI A;  1H6Y A;  4IQP A;  4I3P A;  5JSR A;  2R0F A;  2JG8 B;  4NOT A;  2D6O X;  3IDA A;  3IMN A;  2I45 A;  1RUD 3;  2LTN A;  3FLT A;  3OUI A;  4UAP A;  3RQ0 A;  4FFF A;  1LTE A;  1AYM 2;  1RUN A;  1V70 A;  2JXA A;  4UW5 A;  1CPN A;  3G6J B;  3HD8 B;  3O1P A;  5HV0 A;  3WZ1 A;  1DYK A;  3LF7 A;  2E9Q A;  1OXC A;  4AI8 A;  4Q4Y 1;  2DVG A;  4I01 A;  5H9Q A;  2HBU A;  2X10 A;  4LIT A;  5ACA 3;  4OLL A;  4QPG B;  3KGZ A;  1DGR A;  1W28 A;  4FXG B;  4F83 A;  3CJI A;  2D43 A;  5FZD A;  3K75 B;  1LHU A;  1NOV A;  1IS5 A;  1FI2 A;  3JQX A;  1DQ2 A;  1KJL A;  3GNE A;  1BZW A;  3HBZ A;  3I7D A;  1NCQ A;  4LKD A;  1VR3 A;  4LKF A;  3TN9 1;  5KXD A;  4Y1V A;  4Y24 A;  2YU2 A;  4RQP A;  1IGO A;  3H8X A;  1DDL A;  2JDH A;  1HXS 3;  4OFG A;  1BMV 2;  3VBH B;  1REE A;  1NCR A;  2XGX A;  2VOX A;  1QQP 2;  3ETP A;  4A4A A;  4AHZ A;  2V09 A;  5JIA A;  4EWE A;  2VGD A;  4YGD A;  5FOB B;  1R08 3;  4ZY9 A;  1WW5 A;  2YZ4 A;  1YJL A;  1CAU A;  2ZX4 A;  1JU3 A;  5DG1 A;  5FXW A;  4NIH A;  1C1F A;  2HEW F;  4IEP A;  4XZU G;  4NO4 A;  1RUD 1;  4N53 A;  1JZ3 A;  3V0A B;  3AMQ A;  4DY5 A;  4YAR A;  2AEN A;  1Q8S A;  2GNB A;  2F4L A;  4IV3 C;  2FCU A;  3BN6 A;  2RDN A;  1LEC A;  3PVO A;  4LXL A;  3K48 A;  1OLR A;  5EZW A;  1ZZ8 A;  5ACA 1;  3ABZ A;  1CGP A;  1RMU 2;  4Y1Y A;  3CEW A;  4MXW B;  2R7E B;  3O1T A;  2XQR A;  3VDD A;  3WNN A;  3C7H A;  3DPR B;  2QDN A;  2WZP P;  3I3M A;  2ZX2 A;  1VPH A;  2GU9 A;  1SMV A;  1XNA A;  4QB1 A;  1W3X A;  1AHS A;  1CON A;  2CGN A;  2ZGS A;  2QFE A;  2VL4 A;  3SKV A;  2E31 A;  3KM5 A;  3F95 A;  1AYM 3;  1HXS 1;  4QT6 A;  4XCA A;  4XC9 A;  3POB A;  5JPM B;  2J1V A;  4QPG C;  5FPZ A;  4L9B A;  2BNM A;  3ILR A;  2DCK A;  5FZM A;  5GLW A;  3ZR6 A;  2Q0A A;  2WJS A;  4NHM A;  1R08 1;  4QB6 A;  2VU9 A;  1G9B A;  1KFX L;  1GNH A;  2VEC A;  5F1R A;  3R4D B;  1CZV A;  3ATG A;  5T3N A;  5A3O A;  3U78 A;  3WDW A;  1KD7 A;  2VVE A;  4P08 A;  2YY1 A;  3V0B B;  1LAJ A;  1HLC A;  1GAN A;  3LB9 A;  3VBS C;  4MGT A;  3GZU C;  3WP5 A;  5I0S A;  5EWS A;  1DGW A;  2P37 A;  1V6L A;  2PQQ A;  2GC0 A;  4Z2A A;  5J7M A;  3T0D A;  4ASL A;  1AYN 2;  5K9Y A;  4XAE A;  1TQ5 A;  1S0F A;  5BNO A;  4FTB A;  2CL2 A;  4YW3 A;  3D4K A;  1GZW A;  3UKN A;  5J96 B;  4KWL A;  5FP7 A;  1RL3 A;  3UGF A;  1JOP A;  2OS2 A;  4CTE A;  4KGQ A;  2Q8O A;  2PMW B;  1H2N A;  1QU0 A;  3THC A;  1PNF A;  1RUF 2;  4QKD A;  5C4W B;  1QQP 3;  3SXW A;  3FHQ A;  5T5L A;  3W21 A;  2O8Q A;  5FKC A;  3WOG A;  2WA3 A;  4YM3 A;  1W8W A;  2VW1 A;  1UU6 A;  4NRP A;  3BGA A;  3ZO0 B;  2WNU B;  3OG2 A;  4D7T A;  1AF9 A;  2PEL A;  3VGI A;  2PAM A;  4JV4 A;  2J1R A;  1YEW A;  1OH3 A;  3WQ7 A;  1AYM 1;  3K4D A;  4Q4V 2;  4D6S A;  3ZSM A;  4DMI A;  3SCH A;  4P9J A;  3CDZ B;  2VUC A;  5F3C A;  1RUC 2;  3HN3 A;  1PIV 2;  4CXX A;  5LY1 A;  1RJ8 A;  1JUI A;  2RM2 2;  2W1U A;  3DPR C;  5ABJ B;  3VHP A;  2E7T A;  4E2G A;  1S0B A;  2VO5 A;  4W6X A;  3ZSE A;  3KCC A;  4Y33 A;  2VW2 A;  3D5O A;  5FY4 A;  3ZN6 B;  4D8M A;  2WAA A;  4JCK A;  2EA7 A;  1RUO A;  1ZVF A;  1HB3 A;  4BXS V;  2WT1 A;  4IEU A;  4CCO A;  1AX1 A;  3ILF A;  1U5Z A;  1YQ6 A;  2WWJ A;  1TNF A;  4I3G A;  3NKT A;  3VDC A;  5L7O A;  1PVC 3;  1SZB A;  5DXD A;  1BMV 1;  2QQK A;  1X50 A;  3EYP A;  1LOB A;  2LRO A;  3IB3 A;  3MIE A;  3OBZ A;  1B35 A;  1TMF 3;  1QQP 1;  4QM8 A;  5FRA A;  2ZHN A;  3E6B A;  4XXA A;  3BPZ A;  3VKM A;  3LA2 A;  3KT4 A;  1S0G A;  4F3J A;  5EIY B;  1ULO A;  1E57 A;  2LS6 A;  4LOR A;  5FPX A;  4NWV A;  4WM8 C;  4O9E A;  4MET A;  3BYW A;  1XC6 A;  2PHR A;  2ZGM A;  4L99 A;  2UWB A;  1QJY 2;  1Y9M A;  1VP6 A;  5A7W A;  4FPF A;  3AC0 A;  3AL5 A;  1X9T A;  2RDQ A;  5I8S A;  4XF1 A;  5C4W C;  3Q8E A;  1AYN 3;  3ZXF A;  3MLL A;  5C9A A;  1GOH A;  3POI A;  2YHJ A;  4ZPI A;  1I5Z A;  1WMD A;  2ARB A;  2VZ1 A;  1EP0 A;  1OC1 A;  1LHV A;  3CF6 E;  3SKJ E;  4AI9 A;  3M3C A;  3TEY A;  1RMU 1;  1RUF 3;  2WNU C;  3S5A A;  1G8W A;  3M3E A;  3NJY A;  1WMX A;  4ATE A;  3WDT A;  3AKR A;  1WW6 A;  2QZ3 A;  1FOD 3;  5KXC A;  3O1V A;  3MPB A;  2C0Z A;  2VOK A;  5FJK A;  2XJQ A;  3THT A;  5CG9 A;  1NXD 1;  3FWE A;  3OBR A;  4GH4 C;  1TG7 A;  1J3R A;  3POF A;  3RI8 A;  3WVJ A;  1OPO A;  4ES8 A;  2WT0 A;  3HIF A;  4XUQ A;  3B93 A;  1U0A A;  1F4A A;  5BXX A;  2ZEX A;  3VHR A;  5ABJ C;  3DEM A;  1XU1 A;  3S30 A;  1H4H A;  5LA0 A;  1TMF 1;  4SBV A;  1Z78 A;  5AVA A;  4PQ9 A;  1JXN A;  3SQO A;  4BCU A;  4ZZ8 A;  1ZRD A;  4LBJ A;  1FPN 3;  2VQ0 A;  3N7M A;  1DIW A;  3AKQ A;  2Q1Z B;  3VBU A;  5IUQ A;  5FZ6 A;  4X8P A;  1CAX A;  4B1M A;  3PHM A;  1RB8 G;  2Y6G A;  3RNS A;  1XYN A;  3LOB A;  2FBE A;  4KWK A;  4X8N A;  1K5J A;  3AB0 A;  4P9W A;  1SBE A;  3BUC A;  2WII B;  1CIW A;  4CDW A;  4QGL A;  4RFR B;  1QHD A;  3WG3 A;  5A3M A;  1AYN 1;  1JN2 P;  1YFW A;  2VZV A;  3B69 A;  3W5M A;  2MEV 2;  4XUT A;  5A7N A;  1HJG A;  5LRR A;  5FO8 B;  1RUF 1;  2BW8 A;  1UIK A;  1YQ5 A;  4TWT A;  4FOW A;  2IFW A;  2Y8K A;  5FY8 A;  5JPN B;  1Q8Q A;  4CDQ B;  2W46 A;  1W04 A;  2GN7 A;  2DU0 A;  1VJ2 A;  2ZGL A;  2TBV A;  3H8R A;  3AYC A;  2IC1 A;  2VZR A;  2ZAB A;  3WNP A;  3GAL A;  3VBO A;  5HCB A;  2ARA A;  2VBB A;  3M3I A;  1QJY 3;  4XQW A;  4CCN A;  3JD7 2;  1DHK B;  4M3C B;  2ZMK A;  4ZU4 A;  4KI5 M;  4H2A A;  4DIQ A;  4BLJ A;  5A3L A;  2YU1 A;  4Y1Z A;  1PIV 1;  3KHB A;  3OD4 A;  2VCA A;  4UFM A;  4LE3 A;  2L9L A;  3AZV A;  1QNW A;  3QD6 A;  4ARY A;  3AKS A;  2DWR A;  1DGL A;  4MAD A;  5LB6 A;  4CE8 A;  3PJQ A;  3PU8 A;  1BXH A;  2VBP A;  3TEW A;  2C24 A;  1AL0 G;  5B2G B;  4MH0 E;  4AI2 A;  5C5T A;  4AGV A;  3GCW A;  4UFJ A;  5FUN A;  1AXY A;  4OUM A;  5JXI A;  4D94 A;  3AP4 A;  3J8F 2;  1WMF A;  5BY5 A;  2CU5 A;  1GMM A;  4BXF A;  1E5R A;  3WW2 A;  5C3S A;  4QQ2 A;  5JOY A;  3POE A;  2E53 A;  3NKG A;  4A42 A;  1XNK A;  2VTX A;  4R8H A;  4BU2 A;  2H6B A;  4F8A A;  3FX3 A;  4XTM A;  2I74 A;  3BKZ A;  3RZK A;  1NUK A;  5A3W A;  1NCR B;  3URF A;  5I0D A;  3VKN A;  1MS9 A;  2VNO A;  2ZGN A;  1KS4 A;  2P3I A;  2VQU A;  3WIN E;  1SPP B;  4UF0 B;  3RS6 A;  4WV8 A;  2BDR A;  5DZG A;  4A2U A;  4QB2 A;  1G9D A;  1QJY 1;  1S55 A;  1X33 A;  2ZHL A;  4HFS A;  4EN8 B;  1AX2 A;  3N9N A;  4ISQ A;  2OUJ A;  2C1F A;  4GJZ A;  2BVB A;  3KV5 A;  3O5S A;  2MEV 3;  1GBG A;  4YG3 A;  4V2W A;  2WFF 2;  4R9D A;  3CZJ A;  1SLT A;  4UI9 L;  1PMH X;  4Y5S A;  5FZ1 A;  3OYW A;  4P14 A;  4JKK A;  4DNY A;  1O6U A;  5F5C A;  1F5J A;  1QJE A;  1SG3 A;  3D6E A;  1GKB A;  3U37 A;  1R09 2;  1QH7 A;  3O14 A;  3ZYR A;  2ETE A;  1TE1 B;  3AZW A;  3O0V A;  4OCT A;  5FMC A;  4DO0 A;  1IKP A;  2QQW A;  2FDH A;  2DUQ A;  4AI3 A;  3RYK A;  3AYD A;  2CDP A;  1UCX A;  4K8F A;  4C1W A;  1LOA A;  2VOT A;  5FMO S;  5E6H A;  3I97 A;  4GB3 2;  5FZB A;  4TTG A;  3U0Z A;  2Z79 A;  2GMP A;  3OY8 B;  2JEC A;  4JDN A;  1MZ6 A;  1JHJ A;  3PIJ A;  5F7U A;  5DN2 A;  4HT1 T;  3ZX7 A;  2RDS A;  1UZW A;  4OUE A;  2VG9 A;  2A6X A;  1WWY A;  2BGO A;  3CJX A;  1E5S A;  3R0R A;  2AYH A;  1JZ2 A;  4XBQ A;  4XBN A;  1W8T A;  2DUR A;  1EY2 A;  1NE4 A;  4HVO A;  4JGY C;  2BEO A;  3J8F 3;  4YG0 A;  2JG9 A;  1BLZ A;  1MS3 A;  3J9S A;  4GJY A;  2V73 A;  4QPY A;  5A33 A;  3NAP B;  4FFG A;  5C71 A;  2MEV 1;  2ARC A;  3PUH A;  1GZW B;  1ST8 A;  4YM1 A;  5F6L B;  5KXB A;  1S0I A;  5D8A B;  1OHF A;  4CP9 B;  4YSF A;  1CJD A;  3AMP A;  1YCI A;  3ENR A;  2CDO A;  2IXJ A;  3MW2 A;  4IGO A;  4XIL A;  5A6Z A;  1NKG A;  2RMU 2;  4NHK A;  3V65 A;  2Y26 A;  3M2M A;  3I4I A;  1EV1 2;  1JZ5 A;  2AC1 A;  2MHF A;  1WCQ A;  2BTV C;  4AFA A;  2LW8 A;  2YGL A;  4XYX A;  1SQ4 A;  2IXK A;  2QJV A;  4IV3 A;  4NIG A;  2CSG A;  3PUQ A;  1AXZ A;  3BPS A;  3U75 A;  3ZM8 A;  2EAK A;  4BK5 A;  2BNN A;  2XOM A;  5A3P A;  2XH6 A;  3RZG A;  2G19 A;  2Y33 A;  2GZW A;  2JD4 A;  3FN9 A;  4BQ5 A;  4XAB A;  2A3W A;  1GFF 2;  2BZD A;  2K46 A;  3VL9 A;  4AF9 A;  4KU8 A;  3N3H A;  2XB6 C;  4LK7 A;  2GNT A;  1VLN A;  1S2E A;  1HW5 A;  1GR3 A;  2ZZJ A;  3IPV B;  4BIO A;  3BIE A;  3RRD A;  1MS0 A;  2R04 2;  2WFF 3;  1OQD A;  5CNA A;  3IT8 A;  3RJR A;  5GZG A;  2NLR A;  2HYX A;  3MUY 1;  5FAX A;  1GYK A;  2C5D A;  3IDC B;  3UT0 A;  4EZ4 A;  4PLO A;  1ZRE A;  1J59 A;  2YFU A;  2AZ5 A;  2E63 A;  1QJX 2;  4QXK A;  2X8K A;  3J8F 1;  4UYB A;  4QPG A;  1X8E A;  3RZZ A;  4HVR A;  5F3I A;  1L7Q A;  1PZ8 A;  4MZU A;  2GNM A;  4A6O A;  3NVC A;  4GB3 3;  3BTY A;  2Y0O A;  3LFM A;  4QQP A;  3VD9 A;  4UFI A;  1KDM A;  1UX7 A;  1O3R A;  2P1B A;  3VBS A;  3CMG A;  2RS3 3;  4AVC A;  2XKO A;  4EE2 A;  1WW7 A;  4PCR A;  3C7F A;  1BYH A;  1GSL A;  3AYE A;  2EIE A;  4Q2F A;  5DPN A;  1W90 A;  4YWA A;  3VLB B;  1RJ7 A;  3WQ0 A;  1HRV 2;  2VCC A;  3NAP C;  4B3N A;  3H7Y A;  1D2Q A;  1EUU A;  1GP6 A;  2QQO A;  1YRZ A;  5JUV A;  4UWD A;  5IVV A;  3W9A A;  1RED A;  4S2H A;  5G05 L;  5DAW A;  4BQ4 A;  4JC1 A;  3K46 A;  2P17 A;  4WVM B;  4XEZ A;  1J84 A;  2WFF 1;  3T2T A;  4E9K A;  3V0A A;  2PHT A;  5BPX A;  3AP9 A;  2RMU 3;  2A5Z A;  4UFH A;  1D4M 2;  2XXZ A;  4WVV A;  3DV8 A;  1EV1 3;  4H14 A;  3ACH A;  1I6X A;  3B02 A;  1D7P M;  3BB6 A;  2OUH A;  1FNZ A;  5FYM A;  2XUM A;  4FFI A;  1EAH 3;  4FPO B;  5KHI A;  5CKM A;  1AR9 3;  3J4U H;  4Z07 A;  5GKA C;  1W2N A;  4UW6 A;  4CP1 A;  3M70 A;  1HX6 A;  5FZ7 A;  3DPR A;  3VD5 A;  4GB3 1;  4B29 A;  1NLS A;  4LOS A;  4CDX C;  5DDJ 2;  3JXS A;  4BDV B;  4LBN A;  4QQO A;  2R04 3;  3VBU B;  1S2K A;  5TSW A;  1CAX B;  3N9L A;  3R05 A;  4Q27 A;  2CAU A;  3WG4 A;  1B09 A;  3KLS A;  1FV3 A;  4IGP A;  4N90 A;  2VD7 A;  1QJX 3;  5HI0 A;  4CDW B;  1LOF C;  2JWP A;  3FFQ A;  4P00 B;  1PNG A;  4XJU A;  3RZL A;  4PT6 A;  1JYW A;  4MXV A;  3PTR B;  3GF6 A;  4XF9 A;  5KHK A;  2VUL A;  4PIX A;  4AI1 A;  1A78 A;  2EXJ A;  2RMU 1;  1AR6 2;  3TYJ A;  1V6M A;  4DB5 A;  1EV1 1;  4WZC A;  1KJR A;  3KF3 A;  3TB0 A;  1IQD C;  3LEM A;  3OPZ A;  2GH2 A;  3O0W A;  1LOD A;  1AR9 1;  2V5D A;  3MI8 A;  4A45 A;  2IZW A;  5A7P A;  4NPM A;  5C4W A;  4MG2 A;  2XDV A;  3I3B A;  4NHL A;  1RXG A;  1SLA A;  3VL8 A;  5F32 A;  3EQE A;  4YGE A;  4RGA A;  1SCR A;  3T0A A;  4KMQ A;  4R4X A;  3E6C C;  1MZ5 A;  2WNU A;  4E2Q A;  5LEK A;  1GLH A;  1G7Y A;  1ODN A;  4ZXK A;  5LA2 A;  1XPW A;  4MGY E;  2UYB A;  2ZX0 A;  2R04 1;  3T4V A;  4CDU B;  1ACC A;  3EBR A;  1R1Z A;  3QH6 A;  4XUP A;  1TNR A;  2RS1 3;  1CAV A;  1ZZB A;  1N1V A;  3N9M A;  4QGM A;  4C1X A;  2FZ1 A;  1D4M 3;  1MAC A;  2H0V A;  1GWM A;  3T09 A;  3U10 A;  3QBQ A;  1QJX 1;  4K8R B;  2XUE A;  3OCP A;  4M3C E;  4N9I A;  2WNO A;  5ABJ A;  1I9R A;  4SLI A;  4N43 C;  2XHK A;  1J3Q A;  1IKQ A;  1LGN A;  1MR5 A;  1O7F A;  1UL9 A;  4OI2 A;  4AEK A;  5IHR A;  3T1L A;  3AZX A;  3ZN6 A;  2J22 A;  1GQP A;  2CGO A;  2F17 A;  2BPA 2;  2KA3 A;  4HLT A;  5DDJ 3;  3POJ A;  1JUH A;  3ST7 A;  2DCJ A;  1TVG A;  1R1A 3;  5JLV A;  2EXK A;  5E89 A;  1IG3 A;  4FI9 A;  2DV9 A;  1M4W A;  5BUV A;  5JAX A;  3ZFG C;  4TLG A;  4BH9 A;  4QHB A;  1QY4 A;  3OGS A;  1D0G A;  1L3J A;  3ZYB A;  4FPK A;  3FJS A;  2YMZ A;  3R4U A;  4KG0 A;  3RZM A;  5J09 A;  3WDU A;  4HON A;  4DRV A;  1HRV 1;  1XNT A;  4BJ0 A;  2GND A;  4IEY A;  5A32 A;  3VZL A;  4DXR A;  1GU3 A;  4HBN A;  4K7J A;  4LTA A;  1H2M A;  1U12 A;  2WSU A;  4GMP 1;  4XFG A;  4NHY A;  2IXI A;  1IS6 A;  1JOB A;  5FK7 A;  2A6V A;  3FL7 A;  3PTY A;  1YO8 A;  2XJS A;  5LEJ A;  4MHR A;  4E27 A;  5LK7 B;  1AR6 3;  1R64 A;  1D4M 1;  4FXK B;  2BRT A;  3EB7 A;  4LBK A;  4LK6 A;  1XE8 A;  1S0J A;  3OJB A;  1QF3 A;  1G6N A;  2JKX A;  2ZEZ A;  4RHV 3;  4Q8L A;  2HYK A;  1C5H A;  3IAP A;  1VE0 A;  3T08 A;  3MV0 1;  4C8D A;  2E7A A;  3BCW A;  4YZ4 A;  2NM1 A;  1OQ1 A;  2WAB A;  1CD3 G;  5GZF A;  2J1T A;  1WKY A;  4AQ2 A;  3MIG A;  3NNL A;  5FYI A;  3PUA A;  4CDU C;  5DDJ 1;  3KZ4 C;  4CCD A;  5CG8 A;  2FMY A;  5FV3 A;  1XNB A;  2I07 B;  5EYY A;  2XHN A;  1DGW X;  3LDK A;  1LOG A;  4O9G A;  1R1A 1;  5GLU A;  4COV A;  4F7Z A;  5CAD A;  4E4D X;  3OBT A;  1OI6 A;  4TXW A;  3ZYG A;  4CUB A;  3M8L A;  2WO7 A;  4IXL A;  4IET A;  4ET7 A;  4KQ7 A;  3THP A;  2PFW A;  5CIS A;  1OUR A;  4AVT A;  1JI6 A;  1O4Z A;  2EID A;  2R49 A;  2PQS A;  1OMI A;  1YHF A;  3EHK A;  3T3Y A;  2XVG A;  4P5H A;  1OFS A;  1Q3E A;  1PGS A;  5F5Q A;  2FDF A;  4R52 A;  1QKQ A;  3UV9 A;  5C8W A;  4DEV A;  1UXX X;  2Y6F A;  1NG0 A;  2WZR 2;  3FMG A;  2J1E A;  2Q8D A;  2WLP A;  4IEO A;  2C9K A;  2ZAA A;  4FP2 A;  2IWG B;  5FYC A;  3HQR A;  5CZK A;  4ZXE A;  5FP3 A;  1AR6 1;  2YV8 A;  3MDP A;  5F2S A;  4ZS3 A;  3WUC A;  1HV1 A;  2JDM A;  3WNX A;  1J1T A;  2Q1M A;  3D8C A;  3GBF A;  4RHV 1;  2HWC 2;  4WVZ A;  2AEZ A;  5FP4 A;  5FZK A;  4IV3 B;  2D98 A;  3WCS A;  2ORZ A;  4ZS2 A;  4DZG A;  5DUV A;  3ZN4 A;  3WNK A;  3ZFF C;  1D4V B;  2DVD A;  3ON7 A;  3HJR A;  5FLH A;  5FLJ A;  4OVE A;  1DQ1 A;  1FT9 A;  3N4M A;  4ATF A;  4LUL A;  2DVB A;  4S2D A;  1UU4 A;  3FZ3 A;  2VQT A;  5A80 A;  3ZDS A;  1UD1 A;  4XUR A;  4KWU A;  2QQI A;  3JBG 2;  2CY6 A;  1W8F A;  4M3C A;  3LCP A;  3ETQ A;  4Q0P A;  2VZP A;  3JB8 A;  4QXH A;  4G9S B;  4XXP A;  4Y1X A;  1C1L A;  3AM2 A;  2QQJ A;  3FLR A;  3D82 A;  4Q4X 2;  2HWE 3;  4YW7 A;  5HXV A;  4QPI C;  2VNG A;  4IV1 C;  5SV8 A;  4ZU5 A;  3ZLI A;  1MQT C;  3ITQ A;  2ZMN A;  3KF5 A;  5T55 A;  1C8N A;  1BEV 2;  4BMB A;  3N7L A;  2GP3 A;  5IW0 A;  1W6O B;  3K3O A;  3ZYJ B;  5JMC A;  3UGG A;  5A6X A;  2TNF A;  2WIN B;  4D7Y A;  1G9C A;  1SDD B;  3W5N A;  1VIW B;  1NQJ A;  2OII A;  2WZE A;  1OKO A;  1MS8 A;  2R6Q A;  3OEA A;  4YLZ A;  1EPZ A;  4KG8 A;  3TAY A;  5I8T A;  2JE9 A;  3VBS B;  5JMO A;  2HKX A;  2O1Q A;  1RUJ 3;  1ZA7 A;  1RIR A;  4A3Z A;  4AFB A;  2EIB A;  1LCL A;  1VMJ A;  4RFT 0;  4CEY C;  5FZC A;  1JYI A;  1YQC A;  3PLQ A;  4TYS A;  1YI9 A;  1QGL A;  5CIR A;  5KXE A;  3APB A;  4IE5 A;  1SPP A;  2PHD A;  3G7D A;  3I54 A;  4LBM A;  4YVW C;  4CRQ A;  3KCX A;  4IE0 A;  4AED C;  4ZU7 A;  4UF0 A;  5LBF A;  5GM0 A;  2AUY A;  5EHD A;  1YUD A;  3C7O A;  1UO9 A;  2WZR 3;  3N7J A;  1W2T A;  2LUW A;  4QU2 A;  1REF A;  3WXP A;  4AHX A;  4BQ3 A;  4DXT A;  4DUV A;  4LBL A;  4U2A A;  2D93 A;  5GAL A;  5IAV A;  5FTT C;  1Q5O A;  4CSW A;  4HKO A;  5FZG A;  2W52 A;  1WLW A;  1HRI 2;  2A75 A;  2VBD A;  4CEW C;  3FFZ A;  2QTW B;  1W06 A;  4Y20 A;  4CUA A;  1OOP C;  2HWC 3;  2BNO A;  3GZT B;  4Z2W A;  3GZA A;  5FDB A;  5IAX A;  1GP5 A;  3A21 A;  5KHH A;  2VAU A;  3T2P A;  5J1X A;  4W8J A;  1UAI A;  1OBN A;  1DCS A;  4YW5 A;  4V2V A;  3B5L B;  1K5M B;  5J48 A;  3V64 A;  5HXM A;  2WR9 A;  2XKP A;  4XFB A;  4COY A;  5GZC A;  3AP6 A;  4MGS A;  3JBG 3;  3RI9 A;  3ZIX A;  1K12 A;  3JCI A;  3UGH A;  3NST A;  2OPK A;  3QH7 A;  1PVC 2;  1CIY A;  5IK7 A;  4HN1 A;  1J58 A;  1GWL A;  2EXH A;  4CYD A;  5A3T A;  3O1S A;  2DUO A;  1UY4 A;  3DYP A;  1TMF 2;  3OY8 A;  4LHK A;  1EUT A;  5L19 A;  1OKQ A;  2VZ3 A;  4Q4X 3;  4NR1 A;  2VXJ A;  4LKE A;  4H7M A;  4JGZ C;  4W65 A;  4ISR A;  1CN1 A;  2GME A;  1BEV 3;  1Q8P A;  5JZG C;  4QU1 A;  1J3P A;  2G4I A;  2B45 X;  2WZR 1;  1QDO A;  2B39 A;  4QD2 A;  2QE3 A;  3AKT A;  3RG0 A;  3CQO A;  5JCT A;  1YLL A;  3LD8 A;  3OEB A;  3ZFE C;  2EAA A;  1UY0 A;  3BIW E;  3DUI A;  4WM8 B;  5FYH A;  2D6K A;  2FHR A;  5JOW A;  3NAP A;  4FOY A;  2PHL A;  3A7Q A;  3K4A A;  3ZXE A;  2ADE A;  2HWC 1;  5D8A A;  4CP9 A;  3U14 A;  1UY2 A;  4FO9 A;  4AAP A;  5A6Y A;  2R0H A;  4NVP A;  4XIK A;  2WDB A;  2KD7 A;  1V00 A;  2WBK A;  1LEN A;  3OF1 A;  1FOD 2;  5IK5 A;  1AJK A;  4NE9 A;  2W08 A;  1LGC A;  2XJU A;  4UBH A;  4Q0V A;  4Y5T A;  3DXU A;  3H1M A;  1ZRF A;  1AL2 2;  1SAC A;  3JBG 1;  1O91 A;  1YXW A;  5E16 A;  3WW1 A;  1ZNP A;  4CUG A;  4XJA A;  1OLM E;  1CAV B;  1GOG A;  4GH4 B;  1HRI 3;  2WL1 A;  1PVX A;  2QCS B;  3IPV A;  4OUL A;  4Q4X 1;  3ZMO A;  3CU7 A;  1FPN 2;  2XPJ A;  1PK6 C;  3B7M A;  3HEI A;  2ZEY A;  4LJH A;  5FBZ A;  1BEV 1;  3PL0 A;  3QAC A;  1K5M C;  1WW4 A;  4L11 A;  3SIS A;  1RGS A;  3ZN5 A;  1H1M A;  3I2H A;  4W6W A;  3RMY A;  3T30 A;  2PYT A;  2R1D A;  3WY6 A;  3H42 B;  5FZF A;  4AHY A;  3ME2 A;  2D6M A;  4NN0 A;  5D21 A;  1W9W A;  1QXJ A;  1WCS A;  5LAT A;  2HWD 2;  2RS5 3;  5CFD C;  4LBQ A;  1YWK A;  4AYU A;  1LOF A;  2TUN A;  3FUO A;  3U4S A;  1AJO A;  1DP0 A;  1GNZ A;  2PA7 A;  3BVC A;  3UES A;  3P1I A;  3KV9 A;  2FDI A;  3GZE A;  4GZ9 A;  4QKB A;  4CCE A;  4CXY A;  5A32 B;  1NLR A;  1W0O A;  5C3R A;  1UKR A;  1OT5 A;  1IPJ A;  3HNM A;  2GC2 A;  3W58 A;  1LU2 A;  3DKW A;  3OGG A;  2YYO A;  5T5J A;  1OD3 A;  2W1Q A;  3IMM A;  3W20 A;  1ND3 C;  1UZV A;  2ZX1 A;  4QX0 A;  2QQU A;  5FUP A;  1HQL A;  4QX2 A;  1CWP A;  1HRI 1;  3H0O A;  4AGG A;  4DFS A;  2AH2 A;  3IDB B;  2BU9 A;  4WM7 B;  2CYF A;  2MNG A;  4WVM A;  2HWF 2;  1XB9 A;  1Q8V A;  4M4R A;  4UFK A;  1Y4W A;  1QIQ A;  2W92 A;  2W87 A;  2DDU A;  3BU7 A;  3E6D A;  3U1X A;  4K20 A;  2X5I C;  4ERO A;  3ZOI A;  2HLE A;  1S1A A;  4QDS A;  1KQR A;  5IVY A;  4YPJ A;  4A6S A;  1DYP A;  2DFC A;  1DU3 D;  3CZU A;  2XJR A;  4PLN A;  4XF4 A;  1AL2 3;  2YG0 A;  4JQR A;  2B46 X;  2RS5 1;  3MW4 A;  1PVC 1;  3PUR A;  1ND2 C;  1QOO A;  4YZ2 A;  5IFT A;  4AK3 A;  5IVE A;  5CBL A;  1HDK A;  2VY0 A;  4LKS A;  4DRR A;  3USU A;  4CCL A;  2BFU S;  5FO7 B;  3EJK A;  1IS3 A;  2ZGT A;  3LDR A;  4LUK A;  3B9I A;  1W8H A;  1QOS A;  5FWJ A;  4A7Y A;  5H9R A;  2VZS A;  1OUS A;  5FZA A;  4UFL A;  3ZFG A;  5ANN A;  4AR2 A;  4OMC A;  2WT2 A;  2ET1 A;  3ZXG A;  4ZHN A;  5CFC C;  5JWP A;  2R07 2;  4P9I A;  3WCR A;  1YFX A;  4QM9 A;  3VB9 A;  5C8C C;  3VDB A;  2OW4 A;  3MIC A;  5GLT A;  3WNM A;  3MLJ A;  2CV6 A;  2HWD 3;  4RYD A;  2XLG A;  4BQX A;  2Y38 A;  1KFU L;  5FZ3 A;  2WNV C;  2W5F A;  3KT7 A;  4PHZ A;  1SFY A;  3KSC A;  1UOB A;  2BYV E;  3SMH A;  1I5P A;  1FOD 1;  2JEN A;  4D0Q A;  1OVS A;  2YC2 A;  1US3 A;  1S0D A;  5DQ0 A;  5K4L A;  4YW1 A;  1OLM A;  1P8J A;  3PMS A;  4XMA A;  4TN7 A;  1AL2 1;  3K2O A;  1JTZ X;  4WM7 C;  3VD4 A;  1H6X A;  1JYT A;  1RUI 3;  3GHN A;  3LSD A;  1C57 A;  1RIN A;  4PI0 A;  3MW3 A;  4CCK A;  1T6B X;  3GJA A;  5K7P A;  1G9A A;  4C0H A;  3OGV A;  1N1T A;  2FMD A;  2A3Y A;  3JU9 A;  5DAP A;  1FPN 1;  3I2O A;  5ISL A;  2HWF 3;  1KIT A;  3O7O A;  4LA3 A;  4CDU A;  4D6Q A;  3BOW A;  1EYB A;  1LGB A;  3BAL A;  3OPT A;  4XFI A;  1F5F A;  1H8T C;  3POG A;  4QDR A;  3LPF A;  2BWA A;  2VVF A;  4XET A;  4MGQ A;  5IVB A;  4ARX A;  1WBL A;  1RUH 3;  1H9P A;  2ZAC A;  1UX6 A;  4XJ9 A;  2FDG A;  1ULE A;  3QOP A;  2VQA A;  3MLK A;  2HWB 2;  4JZR A;  5CVR A;  3VBF C;  2D3P A;  2HWD 1;  4KBB A;  2BVV A;  5FZH A;  1W9Y A;  3WHT A;  4JGY B;  2CHH A;  4FPY A;  1DF0 A;  1J1L A;  2VMH A;  3H8U A;  4TSV A;  4Y3O A;  4IDZ A;  4YVS C;  5FIX A;  3M4F A;  4NRQ A;  2WYS A;  2DFB A;  2ARX A;  4R4Z A;  2ZKL A;  4CUC A;  2ZGO A;  4XBL A;  5BNN C;  4H55 A;  3VUO A;  3CBN A;  3O1U A;  5H9P A;  3WD5 A;  4DXZ A;  4HOO A;  2YUE A;  4XF0 A;  5LK5 A;  3TRS B;  3VKO A;  2JDY A;  4R9A A;  3MEP A;  4GIQ A;  3CIH A;  4LIU A;  2UWC A;  1GQH A;  1RUI 1;  3A0K A;  1ZRR A;  3A23 A;  4B4P A;  2R07 3;  1LJ7 A;  2PAE A;  3JUU A;  3WDV A;  1C3H A;  3GCX A;  5LBE A;  3HBK A;  1C8M 3;  1W6P B;  4FQZ A;  3ZFF A;  3HVD A;  2HWF 1;  1K3I A;  4Y20 B;  5LA1 A;  3KV4 A;  1F2N A;  2IFR A;  5FZE A;  1UIJ A;  5C6C A;  5AC9 2;  4P9X A;  3AFK A;  3ZSK A;  4XJW A;  5FOJ B;  1AUY A;  4B4Q A;  2RG4 A;  5FZO A;  5CAZ A;  4LEJ A;  3ZR5 A;  5BV6 A;  2K0G A;  3AXD A;  1RUH 1;  3LKJ A;  4YW2 A;  1GV9 A;  4XQD A;  1UOF A;  3ZYH A;  1KXG A;  3WUD A;  4QWN A;  1F35 A;  4FPH A;  5L9B A;  3NV4 A;  1LED A;  2E32 A;  4W6Y A;  4BK4 A;  1JBC A;  2GMM A;  3HNB M;  3MF6 A;  3ZVX A;  3AKP A;  5FZ0 A;  3NV1 A;  5JXH A;  1HKD A;  4JVA A;  2RS3 2;  4P9L A;  4XDO A;  3MFC A;  2Q8C A;  4U36 A;  4B1L A;  4N8M A;  2XVK A;  3I3E A;  3ILN A;  3MF9 A;  3UKT A;  1N47 A;  4D6R A;  2R07 1;  1W2O A;  1Y3T A;  4CPB D;  4CEY A;  2HWB 3;  1NT0 A;  3HT2 A;  5C70 A;  1IPS A;  5JSP A;  1UMI A;  4YFZ A;  1QXP A;  2DTW A;  5C7G A;  2XL9 A;  1YIF A;  3J7M A;  5K0U C;  1W0N A;  4LO7 A;  3Q8B A;  5F5I A;  2YDE A;  4COZ A;  4R9B A;  3R6S A;  3BI3 A;  1NCQ C;  1X8M A;  2AEY A;  4HAN A;  1KS5 A;  1EAH 2;  2H0B A;  4CU8 A;  2WO3 A;  2JIC A;  1AR9 2;  2JE7 A;  2OXB A;  2WWU A;  3J7N A;  3PDQ A;  4RQP C;  3UNP A;  2CTV A;  4CEW A;  1OOP A;  4L0P A;  4BQY A;  5B4N A;  4BIF A;  5KC5 A;  1VRH 3;  3LWC A;  3BOP A;  4I0B A;  1VBC 2;  5JR7 B;  1W6M A;  1FAT A;  1WD3 A;  2Z42 A;  4M4P A;  1XYO A;  1ZZC A;  3TWI A;  2ADD A;  4CDX B;  5AC9 3;  5FR3 A;  1BJQ A;  1VBA 2;  4ZKT B;  5L36 A;  3T2O A;  3O1R A;  1S0E A;  3SH5 A;  4EN6 B;  2FD8 A;  4N53 C;  5FPL A;  1UQX A;  3UK9 A;  3VD7 A;  3TOJ A;  4D69 A;  1X9P A;  5FYU A;  5IWF A;  5AFB A;  1OQE A;  4N7I A;  3VZN A;  2HWB 1;  2Q4S A;  1XYP A;  1UMH A;  4XDP A;  1W6O A;  2RR1 3;  5F3E A;  4QQH A;  2X09 A;  4LBQ B;  4FAH A;  1ZYB A;  5DUU A;  5JZG A;  5FRE A;  3VDD C;  3ZDV A;  4PQQ A;  2OX0 A;  4Q0U A;  5A6Q A;  2W91 A;  3MIF A;  1DQ0 A;  2R16 A;  3T4H B;  1S2B A;  3ZFE A;  1FXZ A;  4J25 A;  2CAV A;  4I2O A;  4WVW A;  1W99 A;  2BFU L;  1RIT A;  3Q9O A;  4YG6 A;  1DLC A;  1WBF A;  4LE4 A;  1ULC A;  3CO2 A;  3H50 A;  4OHV A;  1O59 A;  5A7Q A;  1JS9 A;  1U5X A;  1VRH 1;  2WFP A;  1IOA A;  4QHO A;  1DQ5 A;  1NA1 C;  1GNY A;  3KT1 A;  4GKY A;  4Q1P A;  2Q30 A;  4G3Y C;  4HKW A;  5GZD A;  4BOW A;  4AHW A;  5AC9 1;  2PLV 2;  2KXL A;  4IND A;  2W2I A;  4H7L A;  2RS1 2;  3KVB A;  3SEP A;  3PUS A;  1OF4 A;  1XU2 A;  4OHX A;  4OQ9 A;  2VMD A;  3DKQ A;  3E5Q A;  4V1P A;  4FOV A;  1ZZ7 A;  5CKQ A;  2UWA A;  2VM9 A;  3SNM A;  1O5U A;  4AVB A;  4PDW B;  2RE9 A;  2QQM A;  1PGW 2;  3AVS A;  4IE7 A;  2X29 A;  4QX3 A;  3ZSJ A;  3SH4 A;  3ZXJ A;  4M00 A;  4N43 B;  3DXT A;  1K5M A;  1RVF 2;  1VBC 3;  1Z0H A;  2B9V A;  2IVI B;  1R1A 2;  1SLC A;  1T6G C;  1Y9Q A;  3USU B;  1PGL 2;  4HET A;  4FSJ A;  1ODM A;  2RS3 1;  5FPV A;  1WME A;  4LQR A;  1VBA 3;  2CWM A;  2WA4 A;  5FYY A;  3N9Q A;  4HK8 A;  5AFE A;  4Z82 A;  2J42 A;  3WLU A;  2ZHM A;  3ZFG B;  5KHJ A;  1JMU B;  2G9G A;  1DG6 A;  1JYC A;  4DPN A;  4C90 A;  3DEC A;  2HBT A;  2JD9 A;  4I0W B;  4JTN A;  5DZE A;  1HB2 A;  4K9S A;  5LA9 A;  2A1X A;  3MIH A;  5FCC A;  3WP3 A;  1A6C A;  5JI9 A;  2K9Z A;  1YQ8 A;  1Y9G A;  1W8O A;  1XSR A;  2C6S A;  3AX4 A;  4BLI A;  4B7E A;  4YZ5 A;  1SBF A;  3E5U A;  4WM8 A;  4XAC A;  3S7I A;  2HEV F;  5JXJ A;  1O3T A;  3JB4 C;  5DAB A;  5C3P A;  1APN A;  1XBF A;  5B4X A;  5LBB A;  4M0H A;  4RHV 2;  1EAH 1;  2GAL A;  3S7E A;  2GH8 A;  4AQT A;  2LAL A;  2FDJ A;  4M0N A;  4CZS A;  2FZ2 A;  4C91 A;  2B5H A;  5JR2 A;  5KBF A;  4Q0Q A;  2D5H A;  3GGL A;  5LAS A;  2Y6L A;  1O4Y A;  3BTA A;  2VMG A;  1LUL A;  4XVH A;  4YM0 A;  4MHU A;  1H2L A;  5BYN A;  3OD0 A;  1VBC 1;  4YFW A;  4GMP 0;  2X5I A;  1ENQ A;  3LGR A;  4K1Z A;  3H8O A;  3MUZ 1;  2PLV 3;  1HQW A;  1VBA 1;  5T52 A;  4D3W A;  2TEP A;  5A3U A;  4EN0 A;  4FPG A;  5BNP C;  4FFH A;  3MZH A;  4GH4 A;  1C5I A;  1V6J A;  4PDW C;  4RS5 C;  4LOT A;  3P3N A;  4MGK E;  1L7R A;  1H30 A;  1ND2 A;  2GSY A;  3PU3 A;  4XPV A;  4OI4 A;  3HNY M;  4LT5 A;  1H2K A;  4BM8 A;  5C9A C;  1U5Y A;  5L9R A;  4G4F A;  1AX0 A;  4PIY A;  2VNV A;  1PX4 A;  2XL7 A;  3FBM A;  4AFM A;  4E2S A;  3SIT A;  1ONA A;  2FDK A;  2BGC A;  3LIH A;  4K1Y A;  3FHI B;  1N1S A;  1HB4 A;  1LES A;  1RVF 3;  5FPA A;  1C4R A;  3HR9 A;  5DUW A;  5EP9 A;  3V56 A;  1HB1 A;  2YC0 A;  1I3H A;  2JB8 A;  2B7Y A;  5FXX A;  3ORJ A;  4JHT A;  5CFC A;  4QQL A;  1OF3 A;  5FMB A;  5FFO C;  4OHZ A;  2W68 A;  5C8C A;  1TZO A;  5IK4 A;  1URX A;  2J1U A;  3BOD A;  3CHX A;  3KQR A;  4RD7 A;  1LRH A;  1QOT A;  2P6C A;  2PN5 A;  4LIV A;  1AR7 3;  2VE1 A;  4AI0 A;  1NYW A;  2R1B A;  2WNV A;  1K42 A;  3IM0 A;  1QJZ A;  2Y64 A;  2ZPX A;  3ZYI B;  4MV2 A;  3ZFF B;  1Z7S 2;  1ULG A;  3Q8C A;  4Y4Y A;  4L8Q A;  2PLV 1;  2HH9 A;  2UYA A;  3AZZ A;  3ECQ A;  2D6P A;  2WS9 2;  2RS1 1;  4GWM A;  1H4G A;  3KV6 A;  2A7A A;  2G9F A;  3P5B A;  5FP9 A;  4E4H A;  5FZO B;  4FTS A;  1O8S A;  5CB7 A;  5HBA A;  4WM7 A;  1W6N B;  3N9O A;  4Q29 A;  2HWE 2;  4NWW A;  2CWS A;  1O3Q A;  3DN7 A;  4QGN A;  2F4P A;  4HMZ A;  4JQT A;  4LO8 A;  3N35 A;  3FBY A;  1PGW 1;  3SEE A;  4QPI B;  4IV1 B;  4KNC A;  4URT A;  1MQT B;  3SLI A;  4GUL A;  2OPW A;  4DIN B;  3MYX A;  1RVF 1;  1OH4 A;  5I0R A;  3S5Q A;  1PGL 1;  1MS4 A;  1NZC A;  1V6K A;  1VAM A;  3FC0 A;  4NID A;  1STM A;  4BWO A;  3RYR A;  4BPZ A;  2Z5W A;  2VCB A;  3ACI A;  3GJB A;  3P3P A;  1RUJ 2;  4XIO A;  5EJ3 A;  3ASI A;  1Q43 A;  3VBO C;  4XHB A;  3WP6 A;  1OUX A;  2ZKN A;  4NRO A;  2QUO A;  2PHW A;  1CJP A;  3OSD A;  1AR7 1;  1BVP 1;  1GP4 A;  2B4K A;  5CA6 A;  5IK8 A;  4OQ8 A;  2R06 2;  4IEX A;  3SC7 X;  4CEY B;  1U5I A;  1DGR N;  2ZML A;  1OA3 A;  3WSO A;  2WO1 A;  1POQ A;  4XJZ A;  1O5L A;  2VH9 A;  3DGT A;  5A3N A;  4NPR A;  4MUV A;  4YVW B;  1UN1 A;  1LB2 A;  4QKN A;  4AED B;  1DYO A;  1W39 A;  1SHW B;  4IE4 A;  3R4S A;  4MLO A;  1O3S A;  2WAO A;  3E1F 1;  3WF2 A;  3ZXK A;  1JHN A;  4NRM A;  5DG2 A;  5DAV A;  4LBQ D;  1GZC A;  5CYY A;  5JIU A;  5FXZ A;  2BUK A;  3ZIW A;  3L9J T;  3JQW A;  3DCQ A;  3K77 A;  2IXC A;  3N36 A;  4BHP A;  4CEW B;  1WLC A;  1OOP B;  1E5H A;  2Z4F A;  2YB7 A;  5F8P A;  5F3G A;  1POV 3;  4IEW A;  4RSU A;  3LEG A;  1GUI A;  3GBW A;  5J98 B;  1PMJ X;  3WW4 A;  2P6H A;  3OPW A;  1GOF A;  3ZXL A;  1W6M B;  4AOC A;  3H1W A;  2ERF A;  4BYY A;  1Z7S 3;  1QJF A;  1SLI A;  3ES4 A;  3I8T A;  1UZZ A;  5FYV A;  5A1L A;  2RJK A;  4YRD A;  2WS9 3;  2XWB B;  4NAO A;  1MVQ A;  2W94 A;  3NRU A;  4LHL A;  5CU1 A;  3NWK A;  1IQA A;  3KVA A;  5FYT A;  1LNS A;  3ZPY A;  2ZZQ A;  4JKM A;  2ZA9 A;  2QQN A;  4WZF A;  4COW A;  5L9V A;  2VMI A;  2ARE A;  1YQ2 A;  3RYP A;  2ZGP A;  4OMD A;  1CPM A;  2JE8 A;  4OI0 A;  2EIG A;  5JOZ A;  1VB2 A;  4N7U A;  2PTM A;  3AMN A;  1ENR A;  2RJL A;  4BB3 A;  4I0A A;  2WQ4 A; 
#chains in the Genus database with same CATH homology
 3IMM A;  1UYP A;  1Y9M A;  3NMB A;  4FFI A;  3RWK X;  5FKC A;  1ST8 A;  3ZR6 A;  5FK8 A;  2ADD A;  3OSD A;  4HXC A;  4CCC A;  2QQU A;  3SC7 X;  4UFJ A;  5FMB A;  3LFI A;  1Y9G A;  4JQT A;  4FFF A;  2AC1 A;  2QQV A;  3H3L A;  3LDR A;  3PIJ A;  4FFH A;  5FMD A;  3HBK A;  2XQR A;  4B1M A;  4UFK A;  4CCD A;  1Y4W A;  2AEY A;  3LF7 A;  3KF3 A;  4QHZ A;  3U75 A;  3LDK A;  3LEM A;  3U1X A;  4UFL A;  2OXB A;  3PIG A;  5ANN A;  3S5Q A;  4B1L A;  5FK7 A;  3KF5 A;  4CCE A;  2AEZ A;  3LIG A;  5FKB A;  3ZR5 A;  5FIX A;  4UFM A;  3UGF A;  2ADE A;  4UFH A;  3LIH A;  1W2T A;  3UGH A;  4AZZ A;  4UFI A;  3UGG A;  5FMC A;  3U14 A;  4EQV A;  2QQW A;  4FFG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...