2Q8EA

Specificity and mechanism of jmjd2a, a trimethyllysine-specific histone demethylase
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
344
structure length
344
Chain Sequence
b'SESETLNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords JmjC domain-containing histone demethylation protein 3A
molecule tags Oxidoreductase
source organism Homo sapiens
publication title Specificity and mechanism of JMJD2A, a trimethyllysine-specific histone demethylase.
pubmed doi rcsb
total genus 105
structure length 344
sequence length 344
chains with identical sequence B
ec nomenclature ec 1.14.11.-:
pdb deposition date 2007-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 2q8eA01
2VD7A 5FZ3A 4DIQA 4LXLA 4HONA 5FZBA 4LIUA 4CCKA 5FY4A 5FPVA 4V2VA 3PUSA 5FY1A 4XDPA 5FZDA 4CCNA 5IVBA 3N9NA 5FY9A 3PU8A 2XUEA 5FYTA 4AAPA 5FYUA 4C8DA 5FYSA 5FXWA 2XDVA 5F3EA 5FJHA 4EZ4A 4Y33A 4Y4RA 4CUGA 5A3NA 5FP4A 4DO0A 5A7SA 4XDOA 5FZMA 5ISLA 5F32A 3AL5A 5FYVA 4TN7A 5FZIA 4BISA 4LITA 5ANQA 5FY8A 1VRBA 5FZHA 4BXFA 5F37A 5FZKA 3U4SA 4EYUA 5FWEA 2OQ7A 2YU2A 2YPDA 3LDBA 5F3CA 4GJZA 5A7WA 5F5CA 5FP8A 5F3GA 4IGPA 5LW9A 4AI9A 2GP5A 4EZHA 5F2SA 4ASKA 3UYJA 5FZ7A 3N9PA 5FPLA 4D6QA 5FZGA 5IVVA 5FYCA 5FYYA 5FYBA 5FYZA 2W2IA 2XMLA 3N9MA 5F2WA 5FBJA 5FZ1A 5A7NA 3KV5A 5A3TA 3NJYA 4CCLA 5FZFA 2Q8CA 2GP3A 5FP3A 5FPBA 2Q8EA 4QXHA 2OT7A 5A3WA 3AVRA 5A7PA 4LIVA 5A7WB 5A7QA 3N9LA 3K3NA 3PDQA 2OQ6A 2YBPA 5FZEA 5E6HA 5LY2A 4HOOA 2Q8DA 4CSWA 4IGQA 4QU1A 3N9QA 5F3IA 5FZ9A 5IVYA 5FPAA 4GAZA 4UF0B 2WWJA 3DXUA 5IWFA 2YBKA 2YBSA 3KV6A 4CCMA 5FYIA 5LY1A 5IW0A 3KV4A 5KR7A 5FXXA 4NUBA 5FZ4A 5FY5A 3PTRB 3PUAA 3KV9A 5F5AA 5F5IA 4D6RA 5FP7A 5FZOA 5FXZA 3KVAA 4GD4A 2YU1A 5F39A 3K3OA 4CCOA 5A1FA 3U78A 3K2OA 3OPTA 3PUQA 3N9OA 5FV3A 5IVEA 5IVJA 3PU3A 4V2WA 3AL6A 5IVCA 2PXJA 4QX7A 5A7OA 5FUNA 4QXCA 3PURA 4GJYA 5FYMA 5FZ8A 2WWUA 4URAA 4D6SA 5FP9A 5LWBA 4CCJA 5FY0A 3AVSA 5FZOB 5FJKA 3RVHA 3LD8A 5FZ0A 5CEHA 4QX8A 4E4HA 5FYHA 5A3PA 5A80A 5FZLA 4QWNA 5FZ6A 4UF0A 3ZPOA 5IVFA 5FZCA 5K4LA 3ZLIA 4QXBA 3DXTA 5FWJA 5FZAA 5FUPA 4Y3OA 5FY7A 2P5BA 5FXVA 4IGOA 2OX0A 5A1LA 5FPUA 3KVBA 3OPWA 2OS2A 2XXZA 4BU2A
chains in the Genus database with same CATH superfamily
3MGUA 2J7MA 1V6OA 5LRRA 3CHXA 3O12A 3Q8AA 2J22A 5FPVA 1F2NA 4Z82A 1WW6A 5DAQA 1JZ4A 3NQHA 5DUUA 2ZGLA 4XEZA 5FPZA 2QQMA 3EJKA 4QQLA 4BOWA 2UWCA 1PVC2 3GM8A 4GB33 4MGQA 5JMCA 1H1MA 4S2HA 3B5LB 3SXWA 2D40A 1O4YA 5DG1A 5JOXA 1DQ5A 2B45X 3B01A 1GP5A 3DCQA 3DUIA 1VRH1 4E4SA 5A3LA 1JYIA 2R043 3ECQA 4FQ4A 3ZYFA 1PIV2 4OHZA 4Q1RA 2JKBA 4COWA 2EALA 3FWEA 4P9YA 2D6OX 4OHYA 1ND3B 1WZXA 1W2OA 1PZ8A 2LW8A 4HVRA 5I0TA 2CHHA 4BQ3A 1JZ2A 5A32A 3A7QA 1W2NA 1H30A 3LEKA 2EVXA 3NNMA 3P3PA 4RN5A 5IK8A 4P14A 4RGAA 5HCHA 1FX5A 5LBFA 2WNVC 1PGL2 4XJWA 3POGA 1UOFA 4I09A 4OFGA 4PI0A 3VZOA 5EHDA 4RYDA 5FYZA 4DS0A 4DUXA 1US3A 1OPOA 2W2IA 3ZXKA 2Z42A 4DY3A 5C7GA 3WINE 3I7DA 1JI6A 1TE1B 5LB6A 2AH2A 5FBZA 4ZZ5A 2DF7A 4YZ4A 2VUDA 1GZ9A 1UKGA 5L36A 1OXCA 2IXJA 1UY2A 2WJSA 3LSDA 4EWEA 1CIWA 1JMUB 1QU0A 5AVAA 3WF1A 4ITCA 5KR7A 1LGCA 5EWSA 3C7OA 5CADA 3RZGA 2A71A 4FCAA 3ME2A 4AAXA 4UAPA 2UURA 5C5UA 1XOYA 5IHRA 3H1WA 4NUBA 3NWKA 5F5IA 1YNAA 1RUD3 3KVAA 4ONUA 2XJVA 4IETA 1W0NA 4I0AA 2P1BA 3KQRA 4LBMA 4KG8A 1GWKA 2I07B 3LFIA 3HR9A 1RUOA 4Y1XA 4HVQA 2JDNA 2UY8A 4FAGA 4UFHA 4XACA 5IVJA 4DXTA 4RFRB 2JE7A 1RHI1 3HMYA 1S2KA 1ZBE2 3MI8A 2VVFA 4KMQA 1TG7A 4N53C 4FO9A 3MIFA 5ACA1 3OGSA 1JXNA 4DINB 4QKBA 1BLZA 4E2SA 1IQDC 3PUIA 1CESA 3LD8A 3OY8A 1SQ4A 2ETEA 1H6YA 2XJTA 3UV9A 1FV2A 5CKQA 4QWNA 2DTWA 2ARAA 2IXKA 3J4UH 3GHMA 5D8AA 4EQVA 4D3WA 2O1QA 1QY4A 1U12A 2QQLA 3CF6E 4XTPA 4XURA 5FZCA 4CDXB 1OMIA 1V0AA 1WW5A 5A33A 4N90A 1RUG1 2DUQA 1W6QB 1X7NA 3L9JT 3N7JA 3Q8BA 4KNCA 3TYJA 1U5ZA 5DXDA 5A1LA 2RDNA 1FMD3 4YRDA 1XNCA 5A7QA 2GNDA 4D0QA 2RDRA 3WF4A 4DIQA 1DQ0A 1ZRCA 1AYM3 3A4UA 4PDWC 3ROUA 1CAVA 3ILNA 5A70A 1CZVA 1PK6C 2VCCA 2WO1A 3JZVA 5J1XA 1K42A 1V9U1 3NNJA 2ATFA 4IEXA 2QZ3A 4QPIC 1YRZA 4BLJA 4W50A 1XQNA 3BGAA 3FUQA 4DO0A 1Y9QA 4QAWA 1OF4A 4O9GA 4Q4V2 4A41A 1W6MA 4JHTA 1OI6A 3T0AA 1HRV2 2H0VA 4R52A 1YWKA 3S30A 2GZWA 4BQYA 1PVC1 1YQ8A 3IDAA 3N7LA 5LASA 3ZFFA 1AR82 1UWWA 4OHXA 5A3OA 4LBQA 5F5CA 4IGPA 4AI9A 3M3IA 2O8OA 2VPVA 4HXCA 1L3JA 4BCUA 3AZXA 3DGTA 2RS13 4YW3A 1COV3 3NJXA 2XJQA 2QQJA 3B00A 4Y26A 1QXJA 2JDYA 5FPLA 2VQAA 4HSLA 2PA7A 4XJZA 3NJVA 2ES3A 2EXKA 1O4TA 5FYYA 1QJX3 3MF9A 1ENSA 4AVTA 2VJXA 2JENA 3OCPA 1NUKA 2ZX0A 3OD0A 4LPLA 4E2GA 2B8MA 4N8MA 3SEEA 2E7QA 3WSOA 1YEWA 5FZFA 2BWCA 1Z7S2 1Y9MA 1R091 2YPJA 4JKMA 5DG2A 1B35A 3OG2A 2PHUA 4H3WA 3MIBA 5FCCA 2ZZJA 1NX9A 4QKDA 4Q0SA 3V65A 5LEJA 4WVVA 2YDEA 2WWJA 4N43C 3U07A 4LUMA 4B1LA 1DZQA 1MS4A 2R061 1SMVA 2D98A 4LORA 4ZKTB 1IS6A 5JPMB 2WZPP 4JHZA 2VMFA 4IERA 4IL7A 1STMA 1WBFA 1PM7A 3MIGA 4AE2A 1ND2B 4WM8A 2VMGA 4XVHA 3WW1A 1LOGA 2UYAA 2R071 2YU1A 2NLRA 3K75B 4CDQC 5F39A 1FPN2 4ISRA 4Q1PA 4B7EA 3LEIA 4K21A 4YYOA 1AR92 2C9AA 3AYDA 4LBLA 4B3NA 1JYTA 3JCIA 1W0OA 5CB7A 1X9TA 4Q4X2 4NVPA 1UY0A 3GJBA 3J26N 1PNFA 1LENA 1ZZ7A 4NR1A 4PBOA 1BMV2 4NAMA 2XQXA 2KM2A 2ZEWA 4PIXA 4URAA 2ZBJA 3SQOA 3USSA 1XE7A 1MVEA 1O7FA 2DV9A 5BV6A 4YZ2A 3RZJA 3DN7A 4ISQA 2RDQA 2YHJA 3D6EA 3OYWA 3HVDA 3GXUA 3Q9OA 4FAHA 3GZEA 5A3PA 2VZTA 3VKOA 4R8HA 1BK1A 2CY6A 1MZEA 2D43A 5E88A 3HPNA 1DCSA 4NWVA 2FDKA 4A7ZA 1VJ2A 3RJ2X 5JZGA 1L7LA 1VBD1 4WVZA 5C3QA 1CX1A 1PZ9A 4ZU7A 2ORZA 1W2AX 2RDSA 1JHNA 3LZZA 2O14A 3ZFFB 5CAZA 1TMF3 1AL0G 2FDHA 4YG3A 2OS2A 5FMCA 1ACCA 3HN1A 4V1PA 2ADEA 2XPJA 4IV1B 2B4KA 4CCDA 5HV4A 4LLFA 4GH4B 3SMHA 3AMNA 4OMDA 5FQ0B 2Q4SA 4ZS3A 4XDPA 5IVBA 5FY9A 3T2OA 2A7AA 1UNBA 4M3CA 2ZMLA 1LULA 4XQ4A 1WCSA 1DYKA 5GLTA 5ABJB 5DAWA 3VBSC 5CISA 2CDPA 4X8NA 4ZU4A 3A23A 2FDJA 1UYXA 3VD4A 2ZMNA 4BISA 4HSJA 2K2SA 3FMGA 4CXWA 2VZVA 2VVDA 4QGNA 2QBXA 2W46A 3DF0A 3VDAA 4YW7A 1XYOA 1REEA 3IM0A 4A42A 1S1AA 5ACA3 3I4IA 2IVIB 2BVVA 2G9ZA 1A8DA 2Y6KA 1KJRA 1RJ7A 2Y64A 3C3VA 3ES1A 4MH0E 4UT5A 4FQZA 5GJ6A 1V6MA 5IVVA 2BNOA 1UY1A 3D0JA 5C4WB 4D7SA 2XBO3 4N7IA 2FZ2A 4P00B 1WCUA 4PLNA 3HT2A 1DP0A 4AHXA 3PJQA 1EUUA 4HKLA 3KV5A 5B4XA 1AR91 1W39A 3BIEA 1RUE2 2EF6A 5SV5A 5D21A 4IE4A 4LBQB 4Y22B 3U75A 4LIVA 2C24A 4HVOA 2C0ZA 1S0GA 1PO13 3KCCA 3M4FA 4OZOA 1I9RA 1PK6B 3ENRA 2ZOEB 3AMHA 2R062 3ZIXA 2BZDA 3KV6A 2MEV3 4MXVA 3D0SA 2W3JA 4N53B 4AK3A 3V0AA 4U36A 5CFCA 1GP4A 3PTRB 4D7TA 2ZHMA 1HKDA 1X82A 5FKBA 3WF2A 4XQWA 2LRPA 2ZMKA 4BE3A 4AEDA 4DMIA 1W99A 3VKNA 4DPNA 1W2TA 3H3ZA 3PU3A 5JI7A 3MW4A 1D0HA 3AL6A 3QD6A 2W0XA 1MVQA 4UFLA 5JLVA 2AYHA 2R49A 5FUNA 3PURA 2OIIA 1EAH2 1S2EA 1XYPA 3F95A 3VBHC 2VUAA 4D6SA 5AFBA 2NQYA 1K5MA 4Q0UA 3M3QA 3AKRA 1NXD1 5EP9A 1JH5A 2FCUA 1DQ2A 3POSA 1UZZA 1B35B 1CR7A 2GH8A 1AXKA 4NIGA 5LA0A 4PJYA 5C8CA 3G7DA 4PQ9A 3O1MA 1MZFA 4I01A 4D69A 3D5OA 2G4IA 2QNKA 3ILFA 4Q4W3 4Q4V1 4Y4YA 4BK4A 5IVFA 3G6JB 4QXBA 2VBBA 2A6VA 3POIA 4M4PA 4F7ZA 2P5BA 1YFUA 1Q43A 2E31A 1FNYA 3N7KA 2BW8A 5GKAC 1AXZA 2EXJA 3VHPA 2VOVA 1V9U2 4EROA 4FPHA 2Y6LA 3B9IA 3SEPA 2MEV1 4LXLA 3RYRA 4QXKA 4DY5A 2GAUA 3PUSA 3VB9A 1POV0 2WZ8A 2XONA 1LESA 4CCNA 4JDOA 4CPBA 5LCWL 3SH4A 5KHJA 5I8SA 4FBFA 1WLTA 3CDZB 3T1LA 2DCKA 1OUSA 4Y4RA 1ZA4A 3ZMOA 2CV6A 3M2MA 5FZMA 3RFRA 5F32A 2PHRA 5FYVA 3WG4A 2DVFA 1ZNPA 5C8WA 1IPKA 5JXHA 5FZIA 2JJ6A 3LGRA 5KHIA 1SLTA 1LR5A 1QJU3 1NLSA 3QH7A 2XJUA 5DPNA 2IXLA 3LDBA 2PHLA 2P6HA 1OA4A 2D6LX 2GN3A 3IDBB 4UBHA 4UW6A 4YFWA 5F3GA 3I3EA 1EP0A 3MIDA 2RR13 4ASMB 3J7LA 3FE5A 2LS6A 4I3PA 1FT9A 3JBG3 5GLZA 3WDYA 4AEDC 1RHI2 1OKQA 3ZN6A 1H2MA 4GXLA 3S5AA 3VDDA 2J1VA 3SNMA 1SLIA 3TBDA 1U0AA 1HX6A 3THDA 4BIOA 2QKDA 1TNFA 1QMJA 4F83A 1GZWB 1PX3A 4IV1A 4KBBA 3P6BA 4BWOA 1OF3A 2VZUA 3RYPA 3RZHA 2BWAA 4QXHA 4XUOA 3AVRA 1YI7A 1UU4A 2PLV2 4LNVA 2VMCA 5A7PA 3NV4A 4NE9A 4IQPA 4C91A 1LODA 4YVSB 2HEVF 1NCQB 3I3QA 4NWWA 1MQTC 2GNTA 3W5NA 4XETA 4ES8A 4NRQA 2KR2A 1D4M3 1FAYA 1W05A 2W94A 4FOWA 3VZMA 3GCWA 2IZWA 3ZXGA 4ATFA 5LY1A 1YIPA 1VLNA 4E27A 1VAMA 4XILA 1ND3C 3O0XA 5FY5A 1G86A 1UOJA 1LOCA 3PUAA 3KV9A 4M0HA 2XBO2 2AEYA 1BYHA 4EJRA 1J58A 1PMHX 1UL9A 3FBMA 4RHV3 3VBOA 2HLEA 3ZSKA 4P5YA 4Q26A 4HLTA 4Q4Y2 1VBB1 2R6QA 2XVLA 4ZU5A 2A3YA 2NN8A 5DAPA 1VBA2 1DG6A 4V2WA 2JDKA 5DDJ2 4LHLA 2EIDA 1UZ0A 2ZKNA 3NAPA 4EN6B 3FLRA 2W39A 3V0AB 1YFXA 3LFMA 1NCQC 4Y5TA 2B5HA 4QD2A 2OPKA 1C57A 4DUVA 4YSFA 2PAMA 1XNBA 2C1FA 2DDUA 4M4RA 3WOGA 1CQ9A 4AQ6A 4LK7A 1ULCA 1F4AA 1JUHA 3DV8A 4IEOA 3ZYRA 3WR0A 1NAEA 1PIV1 1C8NA 4AGGA 4CU7A 4YGBA 2ADDA 3J8F2 4KI5M 1VRH2 1YC61 3FHIB 5FMOL 3AJZA 3AMMA 2SLIA 5K4LA 3A22A 1YFYA 3MPPG 1GOHA 1YJLA 2B42B 2WT2A 5I8TA 4QB1A 1AYM1 3W59A 4QGMA 1ZZ9A 3POEA 4HK9A 4CP2A 2SBAA 2VZRA 1F31A 3OPWA 4NIHA 3RMXA 2DCTA 4Q27A 1R1A2 2BGPA 3NW4A 3ZFEC 2VTXJ 4X6RB 2DURA 4BPZA 4AI8A 2J42A 1NKGA 4OCTA 2R30A 2WWSA 3MW3A 2QQUA 3ZXDA 4MV2A 2WR9A 5FUIA 5JPNB 2EAAA 2DFBA 2FBEA 2EIBA 3AP6A 3MYXA 4K1ZA 4L9BA 3KSCA 4XF9A 5FYSA 1AX0A 2A75A 3B7MA 3I2DA 4JTOA 5FIXA 3MLKA 3T2PA 2ZGRA 4KWUA 1T6GC 2G9FA 1S0IA 3PIGA 4QDSA 5FLIA 4LE3A 2WFF3 1C8M3 4QGLA 4IV3C 1ULEA 2ID4A 1C4RA 2HEWF 3MICA 4ZS2A 3MW2A 3SLIA 1QH6A 4QX3A 4Y1UA 4CUBA 3LEMA 5A7WA 1PMJX 4XUNA 2RR11 5JSRA 3VGIA 1DZRA 1MS8A 5C33A 3VD9A 4CP9B 3VDBA 1QH7A 4E9KA 4MUVA 5FZ7A 3ZFEB 2VCBA 3H1YA 3LIGA 3AX4A 5CFDC 5IT6A 3ACFA 3MZHA 3LKJA 5T5PA 2ET1A 1OKOA 1PVC3 4XFBA 5HXMA 1D2QA 4LJHA 4W6YA 4LR4A 1U5YA 4IXLA 5A3TA 1LHUA 2CYFA 2HYKA 2QQVA 4UW3A 2VQTA 3BYWA 3BTXA 5HI0A 3FLTA 1UPIA 1E5HA 3CMGA 2X5IA 2XGXA 3GDBA 3VZLA 3WW3A 4A6SA 1UAIA 2A1XA 3ZYIB 3A0KA 1KQRA 1QJU2 4LEJA 2OXBA 3U37A 2E9QA 2ZGMA 4CZSA 2DYCA 1BBT2 3AYEA 1W04A 3ZN6B 2AUYA 3BU7A 1DU3D 2Z69A 3UGHA 5CFCB 3ZM8A 2A6XA 1XU1A 1K45A 1NLQA 3JBG2 2OZJA 4MSVA 3I8TA 2RHPA 1I5ZA 1LCLA 1IS5A 1FOD1 1FMD1 4NMIA 2B9UA 3IWZA 4RSUA 3BKZA 1VMJA 1APNA 4D6RA 2A73B 1TMF1 2WA3A 4GD4A 1LOAA 4TLFA 4OUEA 1VBE1 2JIGA 5IAXA 2VG9A 2DFCA 2BOIA 2Q1ZB 1UY3A 3HAGA 3N9OA 5T3NA 2NPIA 4QPGC 3BODA 1JHJA 4QX2A 3GF6A 3U4XA 2AREA 1VR3A 2EA7A 1GWLA 4JDNA 3E5UA 3FX3A 4LA3A 2JXAA 2ET7A 4P9IA 5KHKA 4BB3A 5LWBA 2RS53 5JR2A 2YG0A 4E4DX 4FFIA 3DL3A 1BVP1 1NE4A 4DRRA 3VZNA 3JD71 1AR62 1PMIA 1IKQA 2VW0A 2XWBB 4NHXA 4CEWB 1LOBA 3P5BA 4MGZE 4W4ZA 5GZGA 2CGPA 1VMHA 4XXPA 3QLQA 1OA3A 3GNEA 1G9BA 5FZ6A 3Q8EA 5SV8A 4DNYA 3CO2A 4OULA 3THCA 1HV1A 1QQP2 1NY71 1A3KA 1UYZA 4LHNA 4D94A 1ND2C 2GMPA 5FZAA 5FUPA 4A7YA 2JX9A 1MQTB 1V6JA 2D3RA 3OGVA 1C1FA 4I0WB 5BNNC 1LEDA 2VAUA 1MACA 4JGYB 3ACIA 3OBTA 4R9AA 1YYNA 4DZGA 2DTYA 4J6GA 4LO5B 3TOJA 1ZZ6A 5BY5A 4NRPA 1KITA 5AC91 1GLHA 3KD4A 1SDWA 1VALA 2PELA 4D8MA 1GOFA 3ITQA 1SCSA 2XDVA 3M7AA 4O9EA 1YHFA 2D6KA 5DDJ3 2CGOA 2C5DA 2VMIA 3AKQA 3QBQA 4YFZA 1LHWA 1VE0A 5CYYA 5LRSA 2HYXA 1GV9A 4H14A 2HBTA 3KCXA 2VOXA 2ZX3A 3HJRA 1AR61 1NZIA 1S0BA 1RMU3 3AXEA 5D8AC 2R7EB 1EUTA 2W5FA 2O0OA 1S0FA 4I0BA 4LBJA 3GZUC 4EZHA 5JZGC 1LJ7A 1I3HA 4MO3M 2X09A 2VECA 3TEZA 3AZWA 1RUI3 3GBWA 1E5IA 3RJRA 5BNNA 5CZKA 2HWF2 2WQ4A 1KJLA 1MS3A 4PLMA 1W8ZA 4GKYA 5FYBA 4L92A 3JXSA 3F2ZA 4HN0A 4MHRA 4TWTA 4PDWA 4ZXEA 3SCFA 2CWSA 1PGSA 3TRSB 1Y3TA 4NJ4A 4NHMA 4CCLA 4QDRA 1UX6A 4KWLA 4AG4A 3PUHA 5BNPA 1SEFA 1BEV1 2WNUC 5CIRA 1FXZA 5CBLA 5DMYA 1HV0A 1TMF2 4G9SB 4BK5A 3BTZA 2HEYF 5FDBA 4GIQA 4XF4A 1POQA 1H1AA 3WEZA 1CX4A 1WW4A 1L7QA 2CNAA 3KT7A 1XNAA 4QX0A 1LECA 3E1F1 2QQIA 3BPZA 3DEMA 1RUJ1 1AYN1 3NV1A 3ZX7A 1W8HA 5B2GB 4UW4A 1IPSA 1GU3A 3RZZA 3NJZA 1BJQA 2JDMA 4YARA 3B02A 4NROA 1AJOA 1QJU1 2YYOA 5J3UA 2OA2A 1RUF1 3VHOA 5EFUA 1AR83 2P34A 3MHZA 5BPXA 3VN4A 2EICA 2WSUA 4CP9A 3HWJA 3IPVA 1TZOA 4WM7A 3IPVB 3WG3A 5A6XA 1QXPA 2C26A 3T08A 4CE8A 4BYYA 2E26A 4O7XA 4FXGB 3S7IA 3VKMA 1WCQA 2WWUA 4LKFA 3VD7A 5JAXA 1F5FA 1E5SA 2DU1A 2R042 5KXBA 1OD3A 1AYN2 3CZJA 4XFGA 1CJDA 1GQGA 2VOWA 2E32A 4XDQA 3UGGA 3VBUC 2RM23 3OGGA 5DABA 5BNOA 4JKKA 4HPKB 1CD3G 5F7UA 1XPWA 5FYHA 3LCPA 4B29A 3H8RA 3QACA 5HBAA 1BK0A 1BEV2 1PVXA 4LQRA 3T0DA 2CTVA 4KG0A 5D8AB 4RL7A 2WNOA 1GZCA 1S2BA 3AYCA 2Y8KA 2WQ8A 4Y3OA 2LROA 1IQAA 2Q5TA 3TB0A 2Q8OA 4QB6A 2V09A 3U14A 1JZ3A 2VUCA 1JYNA 4HKOA 5E8AA 5CKNA 4INDA 3WW4A 1P8JA 1BXHA 3DKQA 2BFUL 3C7GA 4P5HA 3AZYA 3IT8A 4OQ9A 3OBAA 2J1EA 1LAJA 2W1SA 2JWPA 1PO11 2XJRA 1ZBA2 3I54A 3VBUB 3MUZ1 3U11A 1HRI2 4K9SA 5F3EA 4XJ8A 2ZGQA 3GYDA 3OBZA 4XIKA 2B9VA 3JB8A 4HANA 1UZVA 1NA1B 2WNVA 3AL5A 1XRUA 2JE8A 1W2UA 1UIKA 4PCRA 5FY8A 5T5OA 3T4HB 2VXJA 5EJ3A 5F5QA 1ZZBA 3WT3A 1QEXA 1SHWB 4LBNA 4B7KA 2YFUA 4Q4W2 3URFA 5J09A 1JOJA 1AR63 4IEYA 4LKDA 4AEDB 2EIEA 4DRVA 4JQRA 5LW9A 2GP5A 3I49A 3RWNA 4ASKA 2HKXA 4XFAA 3T1MA 1BQPA 1BHGA 1MS5A 3CIHA 2XJSA 2P17A 3MIHA 3ABZA 3EO6A 4OI1A 5FYCA 3KCYA 2W9XA 5FPXA 4CU8A 2WS93 4IV3A 4WVMA 5FBJA 3ACGA 3LEGA 3W9AA 2PHTA 1W8FA 2IXCA 4AVSA 1M06G 1JYWA 3POYA 1WWYA 1OURA 2WL1A 3J8F3 2ZX1A 3LDKA 5FR3A 2GNBA 2QFEA 4QPGB 2V4VA 3LB9A 3PNAA 3W20A 3JD72 4Q4V3 2CAUA 1OA2A 4J1XA 3ZO0B 5K0UA 2TEPA 4JRAA 3VHRA 4BA6A 1ULDA 1UMIA 2Q1FA 1SACA 2Z4FA 4MLOA 3KV4A 2F6BA 1OC1A 1VBD3 2HWE1 2HWC2 1VAVA 4X8PA 2VW2A 1GZWA 3TAYA 1KRIA 4AI2A 3AP5A 3H50A 2D5HA 1ZRDA 2WO2A 3K48A 4NPRA 2FMDA 3LPFA 1CZSA 2IVJA 3CZUA 2ERFA 5E1RA 2VQUA 5KHHA 1E5RA 2F17A 1WW7A 3K2OA 2LALA 4Y20A 2FHRA 4H2AA 1ENQA 2JDUA 3M8LA 3PHMA 5KXDA 3BI3A 4BXSV 3B9CA 1DLCA 2FMYA 3DYMA 3WNNA 1IPJA 4OI4A 5C4WA 1H4GA 1H4HA 1XYNA 3H8UA 4LO6B 4XYXA 3WNKA 1AZDA 1RUI2 1JW6A 1GOGA 1OUXA 2WLQA 3AKTA 3FFZA 3ORJA 4RA0A 5HXVA 4HMZA 5T55A 3ZYGA 1F35A 1ASJ1 3ZPYA 3HQUA 2P3JA 4AEKA 2JE9A 3AVSA 2YC2A 2WNEA 2OUJA 1XSRA 4XCBA 2RG4A 1ODNA 4Z92B 2HJIA 1BBT1 1X36A 4MGSA 1SFNA 4META 2WIIB 4ZHNA 1VBC2 5FQ0A 5J7MA 1SBEA 3BPSA 4OVEA 2QDRA 1UN1A 1POV1 4MGYE 4NPMA 2OUHA 4P9WA 4OI0A 3ZPOA 1AF9A 5IUQA 2WNVB 4UWDA 3AFKA 3R6SA 1WD3A 1HJGA 1FI2A 1NG0A 2YMZA 1KEXA 3UNPA 4YM1A 5T50A 2HWB1 5C9AA 1XNTA 4BU2A 4FPCA 2DBNA 4CEWC 1AYN3 5FAXA 1CAXA 2GC3A 2VOKA 3CEWA 4IEWA 1GICA 1VAKA 2LUWA 2MHFA 3POBA 1RXGA 3BN6A 1TME2 4NRMA 3ZKYA 4CTEA 1YJKA 4P9LA 3D82A 4WM7B 2RMU2 1N3OA 1QNYA 1OD5A 1VBE3 5C8CB 5FREA 1MZ5A 1DQ1A 4A45A 3RYKA 2JG8C 4QMAA 5HPOA 3H7YA 2VTFA 1D2SA 1PGW1 3NNGA 2RS51 4AQSA 1ZX5A 4LITA 2Y26A 4UYBA 2VCMA 5FZKA 5FWEA 4KGGA 1ZRIA 2BJSA 2FDIA 2BVBA 2BUKA 5IAVA 2P37A 3ZXFA 3PVNA 4FFFA 1A34A 1QF3A 4UFJA 2I2SA 2CGNA 4XFFA 3UYJA 2VBPA 1XXNA 3TN91 3O1OA 4JZRA 1DQ4A 1AVBA 2Y6FA 4XAEA 4LO8A 2NYYA 1C8M1 1LGNA 4KU8A 4YW4A 1CPMA 3BB6A 4B4RA 5JSOA 3GZAA 4N43A 3WLUA 4CDUC 1H1IA 2WS91 1AYM2 4JTNA 1JOPA 1C5HA 4JGZC 3O5SA 4XHXA 4UI9L 4L2NA 2Q8EA 1NZCA 3QOPA 3J8F1 4NPLA 3U1XA 1SBFA 1Y4WA 5FMBA 5A7WB 3E5QA 2PHWA 1QOSA 2VW1A 4R4XA 4MZUA 1NQDA 4R9BA 3I97A 5H9RA 4JC1A 3ASIA 5F6KA 2D44A 2F4PA 2VTXA 1EV12 1Z0HA 5C3PA 1JYXA 2PYTA 3AKSA 1RJ8A 2Y0OA 1CAUB 1WCKA 1ZA7A 4Y1YA 1N1SA 3N36A 5A32B 4CEYA 5ABJC 1GFF2 2HBUA 4GWNA 1S0DA 2WFF1 4IE6A 2YC4A 1W9WA 4Q0QA 3VHNA 4AW7A 5J48A 4MXWB 2JB8A 2RMU3 3VUOA 2WNUA 2QQWA 2EXHA 2RVAA 5ANNA 4AVVA 5FZOA 3WNXA 1X9PA 2J1AA 3AFGA 3KLSA 2RS12 1N3PA 3VBFA 2W87A 2VCAA 1Q5OA 2XKOA 1IG3A 3DKWA 1HRV3 1S4CA 1QKQA 2VH9A 3FJSA 3U78A 3R4DB 2GC1A 1RINA 2D3SA 2W1UA 1EPZA 3VL8A 2XLGA 1N1YA 1GYKA 2VVEA 5DZGA 1ODMA 4MVTA 3TEYA 3NNLA 1RHI3 3AP9A 5D2AA 3UJOA 5CA6A 2VZPA 1U5IA 1JU3A 5DAVA 5CG9A 1RVF3 5FP9A 4PHZA 4FPKA 4HFSA 3ZXJA 1NCRC 1HXS3 3O1SA 3FN9A 5HCFA 4QX8A 1I1EA 5IK7A 1NYWA 2XL7A 3ZMNA 5KHGA 5A80A 2DVAA 4A3ZA 2PLV1 2KA3A 4Y22A 5C71A 3PLQA 2ARBA 2AACA 4XIOA 3RG0A 4IEZA 2AGSA 1SPPB 2B39A 1GNYA 3H0OA 5JWPA 4XW3A 5T5JA 5F1RA 1R093 1DLLA 4HBNA 4E4ZA 4NIAA 2XR4A 3VBOC 3KHCA 2QCSB 4XF1A 1EY2A 3C2UA 4J25A 4AHZA 3DECA 3S5QA 2VD7A 5EXOA 5FZBA 1VPHA 3RWKX 4Q0VA 4ARXA 4NAOA 1QJZA 4Q8LA 1RIRA 2BPA2 1OQDA 1WA6X 2X5IC 2Y33A 3OY8B 3WP4A 2XHNA 1Q8SA 1WLDA 3IIIA 2BEOA 3NAPB 4JCKA 5L73A 1CPNA 1LEMA 5JOZA 4XZUG 2BOJA 1VBD2 3E6DA 1MQTA 3HEIA 4R4ZA 5FOBB 2VMDA 1OBNA 1EYBA 1KS4A 3ACHA 1VP6A 5E16A 4CCEA 5ABJA 4JGYA 3PIJA 4XUTA 3EQEA 2QE3A 3VL9A 4BXFA 5F37A 1J3RA 2AEZA 4CDQB 2ILMA 1MS9A 2WA4A 4N9IA 1N3QA 1ND3A 3ZN4A 5CFDB 1HQWA 4E8DA 3EBRA 2XLAA 4RR3A 1D4M2 1DHKB 1AJKA 4CDXA 5IK5A 2TUNA 4XZPA 1B35C 3K77A 5JIUA 1VBB3 4IE0A 4W8JA 5BYNA 1NLRA 1HB3A 3BOPA 4D6QA 4YWAA 1BMV1 5DZFA 5K9YA 5C3OA 1G9FA 5BNOB 3NAPC 3N9MA 5FZ1A 4F8AA 3WCRA 1YI9A 3POJA 4FT8A 3GGLA 5BNPB 2WT1A 2VULA 3PMSA 1QJY3 1I6XA 1GMMA 3N9LA 1MEC1 4QHOA 1UYPA 3J7HA 1MS1A 3VZJA 2JDPA 1QIQA 4TXWA 4COVA 2PMWB 2JECA 5C6CA 5FPAA 3NKGA 4UF0B 2ZCWA 1S0JA 2YBKA 1DGRN 2ZGOA 4UFMA 2MPFA 1YXWA 5FYIA 3WQ7A 3WQBA 2ZX2A 3O1PA 4A3XA 1AX2A 4FP3A 2BYVE 4NN0A 3WF3A 1RUH1 1R64A 5BNQA 2W52A 4BQ2A 2JG8B 2N7GA 5GZCA 4PIYA 4YVWB 4PF1A 3X29B 1R092 3MO4A 1V00A 1DYPA 1Z7S1 4YG6A 1W6NA 2GN7A 1GWMA 1VRH3 4JAAA 2D6NA 2Y38A 1BKZA 3OPTA 2H6CA 3PUQA 4GMP0 1Z7S3 3S6PA 2TBVA 2YUEA 4Y1VA 3OTFA 4O61A 2AC1A 1KD7A 1CZTA 4YLZA 3ACLA 4EN7B 2WBKA 1RUH2 4JV4A 5FYMA 2UYBA 4C0HA 4WVWA 1PNGA 4GWJA 3AP4A 1W03A 5LBEA 1R083 1JODA 2ZGUA 4YW5A 1DGRA 2G19A 4Y1ZA 5FLHA 3VKLA 1LU1A 1UKRA 1OPMA 2VE1A 4E4HA 4OUSA 1MEC2 4AFAA 4GMP1 3ELNA 1GNHA 3OEBA 3UKNA 2XG3A 4FPGA 2VOTA 3FBYA 2R16A 3GBGA 3RMYA 2A6YA 4COYA 4XJUA 1HQLA 1YQ5A 3C7EA 4FOQA 1JYCA 5FY7A 3I2GA 1H6XA 1PIV3 3LE0A 5FXVA 1Y7BA 2XB6C 1QWRA 4OLLA 4YPJA 4FTBA 3VBSA 3SKJE 3B3QE 1R1ZA 1UY4A 2ZEYA 1AX1A 3OOXA 2PFWA 1D4M1 3UJQA 4AVBA 5FY4A 2RS33 1OQ1A 1H2LA 3B69A 4XE9A 1UX7A 5BNPC 1VMFA 1OLRA 3UKVA 5FFOC 5EQUA 1CVNA 3AP7A 3V64A 1K12A 4PT6A 1X8EA 2JDAA 4COUA 2VGDA 3JQWA 1OT5A 2DU0A 5FO7B 4Z07A 3H42B 3FC0A 1TNRA 4FTSA 3VDDC 2W68A 3I2HA 4TN7A 1QHDA 2K46A 3PJYA 1FNZA 3RS6A 1GZTA 4CA9A 2A6WA 5KWRA 4JVAA 3LA2A 3AJYA 2Y34A 1DYOA 2Z5WA 4XHBA 2J1SA 4AHYA 5AFEA 2YPDA 2FDGA 3WV6A 4G4FA 1NXMA 5IATA 2OYZA 3E6CC 5B4NA 2V73A 3ATGA 1ZBE1 2QDNA 4LHKA 4ARYA 1SLAA 4L11A 4FTEA 1W90A 1URXA 1ZBE3 2P3KA 3B94A 1OQEA 5FZGA 3HQRA 3OD4A 3WCSA 5IJRA 5HCAA 3EB7A 1LOFC 4K6BA 2D97A 2JB4A 1UCXA 2ZKLA 2DVBA 2VL4A 2YV8A 4PF5A 2Q8CA 2GP3A 4YW1A 1AR93 5L9BA 4FXKB 5I0UA 4QPIA 3OGRA 4I3GA 4P9XA 1V6NA 3Q8FA 4GWMA 4HOOA 4X6QB 3O1TA 2BNNA 1UMHA 4Z2WA 1ENRA 2ZA9A 4P9GA 1DBNA 2DWRA 2XQRA 1UW8A 2WO7A 1POV3 2BDRA 3KHBA 3ES4A 4FPOB 4H7MA 3OEAA 4EN8B 1M4WA 1REDA 4GKXA 5K7PA 5GZEA 3T2QA 4Q29A 2QUOA 1CN1A 2CDOA 2FCTA 3UKTA 4K7JA 3ZIWA 4GULA 2VMEA 4QM8A 5FP7A 1H9PA 1ZVFA 3Q8CA 2ZHKA 4ORFA 3CNAA 3IAPA 3ZYJB 3WP5A 2GU9A 1W8OA 1RUC3 3KMHA 4JRLA 2XLFA 3N3HA 1KS5A 1NT0A 2R072 4BQWA 4AWDA 3AXDA 1PGL1 1H0BA 5FZ8A 2E33A 1SZBA 3PTYA 1ZBA3 1D7PM 1UZWA 5A6YA 2WFF2 3WNOA 4FFGA 1W9YA 3AMPA 4IEQA 1XNDA 2ARCA 2IFWA 2JDHA 3WP3A 4CXXA 5A6QA 2WINB 3CU7A 1GQHA 1W6NB 4OQ8A 1WBLA 4DOUA 1GSLA 3VKFC 4L0PA 4W6WA 5G05L 5EYXA 2X5IB 3ZFEA 4COZA 3AM2A 4XXAA 3ZFFC 3THTA 1W0PA 2X8KA 4DQAA 4XBQA 3UETA 3ZLIA 1CIYA 1ONAA 4DEQA 4C90A 3ZXAC 5CFCC 3MDPA 3H1MA 3WDXA 5FTTC 2VNOA 4OZXA 1CAWB 3ZFGC 1O59A 1CAWA 3OUJA 5D1IA 1UXXX 3WVJA 1VBA3 3UL2A 2YFZA 4MGIE 1O5LA 2GMEA 2PHFA 1W28A 1EV13 1AR81 3RRDA 2XUEA 3ZDVA 1QJEA 2BTVC 3R4SA 2BV4A 2E7TA 2UWAA 3LF7A 3I2IA 5EPAA 1V6KA 5FJHA 4R9CA 2BNMA 2RS52 1JZ6A 5A3NA 1PGW2 1JOBA 1HRV1 1RTVA 2WUHA 2V5YA 5FP4A 2RJ2A 3WDWA 3E97A 2IC1A 4XDOA 5I91A 3LSEA 1FOD3 1KDKA 3RI8A 1HB2A 1X33A 3VBFB 5EYYA 3T30A 1COV1 1VRBA 4RR3B 4XABA 2GSYA 2RMU1 3CLPA 3RSJA 4AXOA 3EMRA 2DUPA 3WDTA 1LNSA 2BERA 4XJ9A 4XMIA 4GJZA 4ZPIA 5F8PA 1TME1 1XC6A 3EXUA 4XCAA 5K0UB 3BOWA 4BQXA 5F2SA 4RQPB 1KDMA 5CU1A 3HNYM 4YZ1A 5JR7B 1PHMA 4L97A 1WMDA 1IHMA 2JD4A 2P2KA 1B09A 3N9PA 5JOYA 4IEPA 1RVF2 2HWB3 1D0GA 2ZXQA 3BIWE 2YROA 3LIHA 1Q8QA 5KBFA 1RUG2 3DYPA 1SPPA 5DQ0A 2CU5A 2XMLA 1RL3A 5LBBA 2LTNA 4FPEA 3IKWA 4KWKA 4W65A 1H2KA 3IN9A 1TQ5A 1GR3A 2OT7A 1W6PB 4LBKA 5JIAA 3OUIA 5A3WA 3KQ4B 3RI9A 4A7KA 4KL1A 4IEVA 3T0BA 4EE2A 3H8XA 5IVCA 5AVPA 1HLCA 3VBFC 4IGQA 3SH5A 3K4ZA 1ULPA 1LOFA 4ES9A 5ACA2 4QPIB 3WDVA 1ASJ2 2YBSA 4CCMA 1HW5A 1RUNA 4LLOA 4AQ2A 4XBNA 4JDMA 5FXXA 5GALA 1SDDB 4AI0A 2UWBA 3T4VA 3INAA 2WKKA 4AFCA 2DCJA 2RV9A 4LBQD 2VXRA 3ALQA 1JZ5A 5C9AC 5T52A 1QDOA 2WLPA 4RS5A 2IWGB 1O8PA 4JX0A 2JKXA 5FV3A 4KU7A 4B4PA 2VC9A 1OH4A 3T3YA 3O0VA 5HCBA 4CDWA 1HQNA 3MEPA 4MYEA 3ZKUA 4QQPA 5JXIA 4LHSA 5J96B 1N47A 3RGBA 5L9RA 1OLQA 2HWE2 5A33B 4CRQA 4EWAA 2JG9C 1W8TA 4QKFA 4W6XA 5CG8A 4FOVA 4QU2A 1HJFA 2F4LA 2IFRA 4A4AA 1O91A 3FUOA 4WZCA 3RVHA 5CEHA 3O7OA 3AYAA 3WG2A 5FZLA 4PBPA 4GWIA 1LTEA 3AK0A 2A5ZA 2Q1MA 4B1MA 2QQPA 4XUPA 3JU9A 4E8CA 4XAAA 3UGFA 5JDBA 1AR72 5FWJA 3VV1A 3MPBA 2ZHLA 5C5TA 4D7YA 3HOBA 5F6LB 2FD8A 2Y6HA 1KFXL 2J1TA 3S7EA 4NIDA 3I3BA 1EAH3 1OSGA 2ARXA 2XXZA 4RS5C 4WV8A 5FY0A 2HWC3 1VIWB 1JU4A 3OSDA 1DFQA 5H9SA 3V0BB 4YM0A 4FPYA 1AUYA 1US2A 3KZ4C 2Z2SB 1OHFA 1RUH3 2BBAA 4RHV2 5FZDA 3SISA 1XBFA 3JQXA 3IB3A 2BU9A 5FYUA 3FHAA 4EZ4A 2WDBA 3MUY1 4L99A 4Y33A 2FQPA 1A78A 4P08A 4UXAA 1HDKA 4ZZ8A 1BVVA 4CDUB 1WGPA 2W47A 5J36A 3NO8A 5JXGA 5A3MA 4KH9A 2J1RA 1PO22 1W8UA 2L9LA 2WZR3 1O3SA 4EYUA 1AL23 4A6OA 1ZBA1 5L7OC 2YU2A 1JS9A 2EIGA 1PO12 1RUF3 3IMNA 4FSJA 1GNZA 1OH3A 1FYUA 3IMMA 1QQP3 5F9TA 4CXYA 1CAUA 3WNLA 1QJFA 2V72A 4OHVA 2VUJA 2ZACA 2W08A 3J9SA 5LA9A 2BGOA 2OZ6A 3IDCB 3SHRA 2WT0A 2A70A 4XF0A 1ST8A 2BGCA 4FVVA 2OKXA 3WG1A 4I30A 1DGWX 4S2DA 4A44A 5JCTA 2ENRA 2PQQA 1RXFA 4GQ7A 1YUDA 1JYVA 4TLGA 4ET7A 5H9PA 5EIYB 4DUWA 3KT4A 3APBA 2VZSA 3KS7A 4NHLA 3WHUA 3D8CA 4XQDA 1Q3EA 4LT5A 1WCDJ 1UXZA 1BEV3 1G7YA 4Z8BA 2NZ9A 5I93A 1NCRA 4OHWA 2YBPA 1ZM1A 4M3CB 5FZEA 1DGLA 5M0TA 4PIZA 1J3PA 2IXHA 1LHVA 5F3IA 2W92A 3LAGA 5JSPA 4I2OA 1YQCA 4AYUA 5L7OB 3AMQA 3K46A 5DUVA 2OVUA 4QX1A 2QZ2A 2IXIA 2R041 2ZGPA 3WUCA 3PMEA 1H8VA 3POFA 5GLVA 1NA1C 2PHDA 1RMU2 1WMXA 1MEC3 1V70A 1H8TB 3O14A 3OBRA 2W1WA 5LEKA 1SLCA 3WX5A 1XB9A 3K3OA 3QCWA 3AC0A 1H2NA 3GJAA 3H9AA 4BDVB 1RUF2 3IAQA 1WA4A 3H3UA 1AL22 3SH3A 3RZMA 3LA3A 5EV7A 4M01A 4GB31 1C1LA 2VO5A 4N43B 4GJYA 1ZZCA 2ZAHA 4LTAA 4QQ2A 2VZOA 3HBZA 3M1HA 4XBLA 4HN1A 4ZXKA 3ZDSA 1RUJ2 1DF0A 1OOPA 1QJY2 4CCJA 5IFPA 1BZWA 4QT6A 3S57A 5JMOA 4DXSA 2AENA 1DIWA 3KWVA 5FJKA 1TEIA 1Q8VA 3R0RA 2H6BA 1UIJA 5LZ6A 3ZYBA 2R0HA 2TNFA 1O3QA 4NO4A 3N4MA 3SKVA 1UU5A 2EAKA 2KXLA 1LKNA 4CDUA 1BBT3 4QB2A 4WVMB 4OI2A 2D6PA 3NKTA 4QHBA 1LHNA 4YVWC 5LK5A 3ZSJA 3TEXA 1QOOA 4QM9A 3KT1A 1EPWA 2VZ1A 3A0NA 3MBWA 3FFQA 4IGOA 4AI1A 4CU6A 3KVBA 5C3SA 2HWF1 3USUA 3K4AA 1LOEA 2MNGA 1Q8PA 1C5IA 1QGLA 4YM3A 2RJLA 2QQOA 5H9QA 4MG2A 5C8CC 2DCYA 5I0SA 4LOTA 1W3VA 3R05A 3I2FA 3N9NA 1HN0A 1X8MA 3BTYA 3CJIA 4CDWB 3CJIB 3HBKA 1NCRB 4IDZA 4AOCA 1DGWA 2BP6A 1OOPC 4Y20B 5E89A 4CUGA 4IUGA 4AL9A 1YFWA 1UU6A 3E6BA 3LA7A 3ZFGA 5LATA 3ZFGB 3EHKA 5A7SA 2DVGA 2ORXA 5FK7A 1GQPA 3O1UA 2R063 4Q4Y3 2ZGTA 1VBC3 1F9KA 1R082 3BALA 1VB4A 4QHZA 4YVSA 4M3CE 2Y60A 2OQ7A 1UPSA 2O8QA 1Y43B 4AHWA 2NMNA 1C28A 4AEJA 5FP8A 5IYYA 2R073 5LBCA 4IEUA 4XMAA 2W1QA 3AZVA 3NSTA 1UQXA 2XKPA 1G9CA 1T2XA 2HWD2 3MF6A 1J3QA 2UY9A 2WSVA 2WFPA 1UOBA 3HNMA 5J37A 1YCIA 4DXZA 4MX3A 2WNUB 2X53S 1UO9A 1QQP1 3ST7A 1KFUL 1OOPB 3JUUA 3LQCA 5FP3A 4AFBA 4AVAA 1KGYA 5BXXA 2RS11 2ZS6B 3FL7A 3QH6A 4RQPC 3IDEA 5LA1A 2WZR2 4HPKA 5GLUA 3WQ1A 1O3RA 2GH2A 4BQ1A 1W3XA 2RM22 4HK8A 5CVRA 2RS32 3CJXA 3ZSEA 4XOGA 1F8VA 2X05A 1DQ6A 5FOJB 2W95A 3L2HA 4GAZA 4BQ4A 1VB2A 3DXUA 4LOSA 2LM3A 3SCHA 1C3HA 3P1IA 4Z1VA 1G6NA 2NM1A 4IV1C 4CP0A 1EV11 5C4WC 4SLIA 4M00A 4LMFA 4Y24A 1G9DA 1ND2A 4WM8B 3TWIA 2WN2A 1ZRRA 2VMHA 5FXZA 1AXYA 3DPRB 4EV0A 3LPGA 1N1TA 3USUB 1W06A 4AI3A 3C7HA 3IIAA 4R9DA 1V9U3 3UESA 5C3RA 2WO3A 1VBE2 3BTAA 5T54A 2CL2A 2WS92 4AEMA 1W8WA 2PXJA 4CYDA 5I8YA 4GZ9A 4XUQA 2K9ZA 3VBSB 4RFT0 1C8M2 3NRUA 4QXCA 3WF0A 5HV0A 1FMD2 1FOD2 5KC5A 2E51A 2QQNA 3WNMA 4IW3A 1LU2A 1TVGA 1YO8A 4UW5A 1CONA 3J7MA 3TN92 3JBG1 4K8RB 4PQQA 3RNSA 4YW6A 3NL1A 4K8FA 2V5DA 1MPXA 2K0GA 2C4XA 2HWD3 2OPWA 4UFKA 1W9FA 3VBRC 2E7AA 3TEWA 3ZYHA 2XL9A 3ZXLA 1SLLA 4LUKA 4NIIA 4CEWA 5BUVA 4HG6B 3BU0A 1O4ZA 1W6OA 5DZEA 4KWJA 2GMMA 4UF0A 1FV3A 1ULFA 4HL0A 1HXS1 2VNVA 1J1LA 1J83A 2YB7A 4YGCA 5DAXA 5FMDA 2X29A 4ATEA 4WBBA 1QJX1 4QKNA 2OX0A 3UT0A 2HWF3 1W6PA 4NHYA 5FPUA 4RGKA 3NMBA 1SLBA 1RUC2 4ZY9A 5FZ3A 4MXWA 3N35A 4UOJA 4GH4A 1NQJA 3ZN5A 4CCKA 4NHKA 2XOMA 2YXSA 1GBGA 3MIEA 3U10A 3ZOIA 3I3MA 4V2VA 5A6ZA 2VY0A 1L7RA 2FCVA 2Q30A 3KM5A 2HWB2 4LULA 1UMZA 2PHXA 4N7UA 4XPVA 1Q56A 1QJX2 4CVUA 4N53A 2B46X 4UFIA 3KF3A 4QDQA 1K5JA 1NE6A 2C9KA 2D5FA 2I74A 1HXS2 1WLCA 3GBFA 4G3YC 2G9GA 3WXPA 4JGZB 3O1VA 5DUXA 5G04L 1N1VA 4HT1T 3M3OA 4PI2A 4MGKE 5C70A 4OUMA 5FZHA 1HIXA 3SITA 1VBC1 4EWDA 3U4SA 1F5JA 1RUD1 3IBMA 4YZ3A 3RQ0A 2DCZA 1MS0A 4N9HA 1OLMA 4YNIA 3DPRC 4FP2A 1R1A1 2R32A 3KF5A 1JUIA 1LHOA 2ZEZA 1RUI1 2R1BA 1W6QA 2QQKA 5L9VA 1OFSA 5JI9A 1LB2A 3T09A 5L19A 4J1WA 3OGJA 3HT1A 5DUWA 5A7NA 4IE5A 1WUVA 3B93A 1OLME 1TME3 3LOIA 2Y0IA 3NJYA 2WYSA 3OF1A 1MR5A 1RC6A 2YY1A 5I0DA 3H8OA 1W6MB 3I3DA 1CAVB 2IUWA 2WYFA 3VBOB 1YQ6A 1JN2P 3K3NA 1I5PA 1G9AA 3VBUA 2A6ZA 5E6HA 4FFHA 4U2AA 2HWC1 3LDRA 3H3LA 3VD5A 1GP6A 3AZZA 3OUHA 5FRAA 3HNBM 2E63A 2Z79A 2Q0AA 4Q2FA 3I2OA 2JIJA 3BCWA 2XUMA 3MLLA 5IW0A 1ULGA 4H7LA 1IKPA 2RS31 2J1UA 2ZEXA 5F5AA 5JVVA 3ZSMA 1KXGA 4B4QA 5C9AB 2WZR1 2D3PA 4IV3B 5DDJ1 2E53A 2JG9A 1VBA1 4K40A 1K5MC 1WMEA 2ZTNA 4Q0PA 4Z2AA 1J84A 1VBB2 4EN0A 2ZGSA 2ZPXA 4NOTA 4Q4Y1 2PAKA 1GKBA 4ZONA 1IS4A 4K20A 4MOAA 2VBDA 1OVPA 2WABA 3WP6A 2Y6GA 4JKLA 5IVEA 3ZR6A 1GUIA 3M3EA 2P6CA 1SBDA 2XBO1 4QX7A 3WD5A 2HWD1 1Y9GA 2WQZC 2DUOA 4CUCA 2QTWB 3NVCA 1SG3A 4M3CF 4QQOA 1IG0A 2XVKA 4QPYA 4DB5A 4M0NA 2RE9A 4XTMA 5FZOB 1S0EA 4A2UA 4BH9A 4GA9A 3RZKA 5GM0A 4Q4W1 4QPGA 2VM9A 3SCGA 2D7FA 1V6IA 1R081 4L8QA 1ASJ3 4K3UA 3TNPB 1IOAA 4BLIA 4C1XA 5FKCA 1E57A 2PLV3 3DXTA 3PL0A 1QDCA 4AFDA 4LO7A 3P3NA 3RPQA 3WW2A 4OYUA 2WRAA 1HRI1 1PO23 3JD73 5JUVA 3H7JA 4TTGA 1XU2A 3WDUA 2AR6A 4Q5OA 1ALYA 1SCRA 4DEVA 2XHKA 4JGYC 3FHQA 4Y5SA 4WM7C 2JEMA 5FO8B 4YVSC 3I2JA 4FPJA 5J98B 1H8TA 2FZ1A 5L7OA 1RUD2 1ZYBA 1QOTA 3PU8A 3VBHA 2HWE3 4AAPA 3W58A 3WNPA 3HQXA 3ILRA 1X50A 5ERLA 5KC6A 2VQ0A 3VDCA 2RJKA 1NOVA 1ZZ8A 4RGGA 4SBVA 3MV01 1HB1A 3FLPA 4LE4A 5BNOC 1J59A 5EJZB 5ISLA 4H55A 4Y5Z0 5APAA 3ETQA 2JDZA 3WY6A 3VD3A 1FPN3 2I45A 4GMP3 3ETPA 3GZTB 2A3XA 4BJ0A 5F3CA 4BHPA 1HB4A 3ZYPA 4K1YA 4B8EA 5FO9B 2B7YA 1S55A 3CKHA 2ZABA 2MEV2 4YGEA 4EN9B 1XE0A 2D93A 1RUC1 3KGLA 4LO4B 4FI9A 4XF3A 3TN93 2ZX4A 2P3IA 5FMOS 4HZFA 4YGDA 1PZ7A 3OPZA 3POWA 4LK6A 5JOWA 1WMFA 4GB32 3WHTA 1GANA 5BNNB 5F2WA 2H0BA 2BRTA 2P4EA 1MZ6A 2ZJCA 5FPBA 4UBGA 4BQ5A 2PTMA 1UOGA 2VZQA 3KB5A 4F3JA 1O3TA 1JTZX 3DPRA 5JXJA 4BMEA 4AGRA 2OQ6A 4KBZA 5LY2A 2Q8DA 4AZZA 3JB4C 5GLWA 1JBCA 1V6LA 3GHNA 3N9QA 1FATA 4QU1A 4XC9A 1AHSA 5DN2A 4I02A 1RUJ3 1RGSA 2GC0A 2A3WA 3V56A 3K4DA 4CU9A 1JZ7A 3RDIA 2Y6JA 5FZ4A 1EAH1 3DYOA 5IK4A 3BUCA 2GC2A 3RZLA 1ULOA 2DVDA 2G1MA 1LGBA 1RYYA 2GALA 4WZFA 4TZDA 5IFTA 3I2KA 4CCOA 1A8MA 2XJPA 5A3UA 3V0BA 1UF2C 2QVSB 3W5MA 4YG0A 2WZEA 1WD4A 1LRHA 4C0BA 3EYPA 2JG9B 4P9JA 3LWCA 1WKYA 4IE7A 3K51A 4TYSA 1PX4A 5A7OA 4O65A 4WM8C 5CKMA 3D4KA 4HETA 4MADA 4YVWA 1UYYA 2GDFA 2DBIA 2JG8A 5GZDA 4C1WA 2CSGA 3MV11 3GCXA 1Z78A 5FZ0A 2CAVA 3VBHB 2UU8A 2RM21 2VZ3A 4YZ5A 4LBOA 1CJPA 4LA2A 2ZGKA 2AZ5A 1HRI3 1PO21 5LK7B 2XH6A 1T6BX 4CEYC 2HH9A 3ZR5A 1PK6A 4Q8KA 1RUE1 3CL1A 4RS5B 1OVSA 2PN5A 3ZXEA 3VDDB 4IESA 3VBRA 4CPBD 5I0RA 2WN3A 3VBRB 4RHV1 3M3CA 1HN1A 5AC92 4HONA 4LIUA 3O1RA 3NV2A 3C8XA 1Q8OA 3WZ1A 2JICA 4CDWC 5FY1A 1W9SA 3VZKA 5FYTA 3T2TA 5T5LA 3KGZA 3UK9A 3U0ZA 4C8DA 5FXWA 1NCQA 1QNWA 4QX5A 4CDXC 4Q4X3 3BVCA 1AR71 4YM2A 1NY72 2KD7A 3MFAA 5LA2A 1J1TA 1RB8G 5CFDA 1AR73 5FK8A 3SC7X 4RD7A 4BMBA 1G8WA 4ASLA 3ZVXA 5CNAA 5ANQA 4P02B 4PDWB 5A1AA 2YGMA 2NP0A 2BFUS 3LOBA 3ZSLA 1YIFA 1NA1A 4E2QA 3E5XA 1H9WA 1R1A3 2XVGA 3MFCA 2NMOA 3OYWB 4RQPA 1S0CA 2BQPA 4QQHA 3AB0A 4HKWA 1IGOA 1DDLA 1A6CA 3PVBB 1XNKA 2C6SA 5TSWA 4AFMA 3VLBB 4DXRA 3FZ3A 3S0MA 2WAAA 1YQ2A 4FPLA 3TNQA 4AF9A 2QJVA 2ZAAA 3CJIC 4QPWA 1W6OB 1CWPA 1RITA 4URTA 1UD1A 3PDQA 1REFA 1ENXA 2BBVA 3C7FA 4CSWA 4S2FA 2WAOA 4CDQA 3CQOA 5JZGB 4KGQA 3HN3A 5FZ9A 2D6MA 5IVYA 4MGTA 2OW4A 3HD8B 1F15A 3OB8A 4BIFA 5IWFA 1QJY1 1BCXA 2P3YA 3NNFA 4DFSA 5KXCA 4CEYB 2EXIA 2R0FA 2ZZQA 4AGVA 5K8SA 4AQTA 3R4UA 4FPFA 2ZHNA 1O8SA 4BZ4A 3O0WA 4PLOA 3J7NA 4LKEA 4Q4X1 2YZ4A 4RR3C 4CCCA 1AL21 3NV3A 4CUAA 2VNGA 2PQSA 1UZYA 3PVEA 3WUDA 5A1FA 1JZ8A 4FOYA 1SFPA 2X10A 3CBNA 3PVOA 4XFHA 1O6UA 4S2GA 1FPN1 4XJAA 5AC93 5K0UC 1IS3A 2CWMA 3GALA 3N7MA 3ON7A 5FLJA 2VR4A 2JD9A 4XFCA 4YW2A 1PM4A 4AR2A 1K3IA 2ZGNA 1W9TA 3WQ0A 2PAEA 1RMU1 4JGZA 1IZ3A 1RVF1 1XE8A 4LKSA 3HIFA 1D4VB 3L2YA 1CAXB 4MHUA 3M70A 2W91A 1F4HA 5EJ1B 5GZFA 4OMCA 1K5MB 2XWJB 2RR12 3MLJA 2YGLA 1OFNA 2VNRA 3THPA 4TSVA 4KQ7A 1U5XA 3A21A 1W8NA 3AKPA 5EZWA 3IZOA 1COV2 3W21A 4GH4C 1O5UA 5KXEA 1RUE3 4GALA 2WC2A 1XSQA 1CGPA 1H8TC 2V4AA 2VU9A 1DZTA 1ZRFA 3OJBA 1QXRA 2R1DA 1RUG3 1SFYA 2YC0A 4CP1A 1XJAA 1WLWA 3D3AA 4BM8A 2GNMA 4XFIA 4JQTA 1ZREA 2FDFA 3I59A 2E6VA 3I59B 1YLLA 4AVCA
chains in the Genus database with same CATH topology
2VD7A 5FZ3A 4DIQA 4LXLA 4HONA 5FZBA 4LIUA 4CCKA 5FY4A 5FPVA 4V2VA 3PUSA 5FY1A 4XDPA 5FZDA 4CCNA 5IVBA 3N9NA 5FY9A 3PU8A 2XUEA 5FYTA 4AAPA 5FYUA 4C8DA 5FYSA 5FXWA 2XDVA 5F3EA 5FJHA 4EZ4A 4Y33A 4Y4RA 4CUGA 5A3NA 5FP4A 4DO0A 5A7SA 4XDOA 5FZMA 5ISLA 5F32A 3AL5A 5FYVA 4TN7A 5FZIA 4BISA 4LITA 5ANQA 5FY8A 1VRBA 5FZHA 4BXFA 5F37A 5FZKA 3U4SA 4EYUA 5FWEA 2OQ7A 2YU2A 2YPDA 3LDBA 5F3CA 4GJZA 5A7WA 5F5CA 5FP8A 5F3GA 4IGPA 5LW9A 4AI9A 2GP5A 4EZHA 5F2SA 4ASKA 3UYJA 5FZ7A 3N9PA 5FPLA 4D6QA 5FZGA 5IVVA 5FYCA 5FYYA 5FYBA 5FYZA 2W2IA 2XMLA 3N9MA 5F2WA 5FBJA 5FZ1A 5A7NA 3KV5A 5A3TA 3NJYA 4CCLA 5FZFA 2Q8CA 2GP3A 5FP3A 5FPBA 2Q8EA 4QXHA 2OT7A 5A3WA 3AVRA 5A7PA 4LIVA 5A7WB 5A7QA 3N9LA 3K3NA 3PDQA 2OQ6A 2YBPA 5FZEA 5E6HA 5LY2A 4HOOA 2Q8DA 4CSWA 4IGQA 4QU1A 3N9QA 5F3IA 5FZ9A 5IVYA 5FPAA 4GAZA 4UF0B 2WWJA 3DXUA 5IWFA 2YBKA 2YBSA 3KV6A 4CCMA 5FYIA 5LY1A 5IW0A 3KV4A 5KR7A 5FXXA 4NUBA 5FZ4A 5FY5A 3PTRB 3PUAA 3KV9A 5F5AA 5F5IA 4D6RA 5FP7A 5FZOA 5FXZA 3KVAA 4GD4A 2YU1A 5F39A 3K3OA 4CCOA 5A1FA 3U78A 3K2OA 3OPTA 3PUQA 3N9OA 5FV3A 5IVEA 5IVJA 3PU3A 4V2WA 3AL6A 5IVCA 2PXJA 4QX7A 5A7OA 5FUNA 4QXCA 3PURA 4GJYA 5FYMA 5FZ8A 2WWUA 4URAA 4D6SA 5FP9A 5LWBA 4CCJA 5FY0A 3AVSA 5FZOB 5FJKA 3RVHA 3LD8A 5FZ0A 5CEHA 4QX8A 4E4HA 5FYHA 5A3PA 5A80A 5FZLA 4QWNA 5FZ6A 4UF0A 3ZPOA 5IVFA 5FZCA 5K4LA 3ZLIA 4QXBA 3DXTA 5FWJA 5FZAA 5FUPA 4Y3OA 5FY7A 2P5BA 5FXVA 4IGOA 2OX0A 5A1LA 5FPUA 3KVBA 3OPWA 2OS2A 2XXZA 4BU2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VD7 A;  5FZ3 A;  4DIQ A;  4LXL A;  4HON A;  5FZB A;  4LIU A;  4CCK A;  5FY4 A;  5FPV A;  4V2V A;  3PUS A;  5FY1 A;  4XDP A;  5FZD A;  4CCN A;  5IVB A;  3N9N A;  5FY9 A;  3PU8 A;  2XUE A;  5FYT A;  4AAP A;  5FYU A;  4C8D A;  5FYS A;  5FXW A;  2XDV A;  5F3E A;  5FJH A;  4EZ4 A;  4Y33 A;  4Y4R A;  4CUG A;  5A3N A;  5FP4 A;  4DO0 A;  5A7S A;  4XDO A;  5FZM A;  5ISL A;  5F32 A;  3AL5 A;  5FYV A;  4TN7 A;  5FZI A;  4BIS A;  4LIT A;  5ANQ A;  5FY8 A;  1VRB A;  5FZH A;  4BXF A;  5F37 A;  5FZK A;  3U4S A;  4EYU A;  5FWE A;  2OQ7 A;  2YU2 A;  2YPD A;  3LDB A;  5F3C A;  4GJZ A;  5A7W A;  5F5C A;  5FP8 A;  5F3G A;  4IGP A;  5LW9 A;  4AI9 A;  2GP5 A;  4EZH A;  5F2S A;  4ASK A;  3UYJ A;  5FZ7 A;  3N9P A;  5FPL A;  4D6Q A;  5FZG A;  5IVV A;  5FYC A;  5FYY A;  5FYB A;  5FYZ A;  2W2I A;  2XML A;  3N9M A;  5F2W A;  5FBJ A;  5FZ1 A;  5A7N A;  3KV5 A;  5A3T A;  3NJY A;  4CCL A;  5FZF A;  2Q8C A;  2GP3 A;  5FP3 A;  5FPB A;  2Q8E A;  4QXH A;  2OT7 A;  5A3W A;  3AVR A;  5A7P A;  4LIV A;  5A7W B;  5A7Q A;  3N9L A;  3K3N A;  3PDQ A;  2OQ6 A;  2YBP A;  5FZE A;  5E6H A;  5LY2 A;  4HOO A;  2Q8D A;  4CSW A;  4IGQ A;  4QU1 A;  3N9Q A;  5F3I A;  5FZ9 A;  5IVY A;  5FPA A;  4GAZ A;  4UF0 B;  2WWJ A;  3DXU A;  5IWF A;  2YBK A;  2YBS A;  3KV6 A;  4CCM A;  5FYI A;  5LY1 A;  5IW0 A;  3KV4 A;  5KR7 A;  5FXX A;  4NUB A;  5FZ4 A;  5FY5 A;  3PTR B;  3PUA A;  3KV9 A;  5F5A A;  5F5I A;  4D6R A;  5FP7 A;  5FZO A;  5FXZ A;  3KVA A;  4GD4 A;  2YU1 A;  5F39 A;  3K3O A;  4CCO A;  5A1F A;  3U78 A;  3K2O A;  3OPT A;  3PUQ A;  3N9O A;  5FV3 A;  5IVE A;  5IVJ A;  3PU3 A;  4V2W A;  3AL6 A;  5IVC A;  2PXJ A;  4QX7 A;  5A7O A;  5FUN A;  4QXC A;  3PUR A;  4GJY A;  5FYM A;  5FZ8 A;  2WWU A;  4URA A;  4D6S A;  5FP9 A;  5LWB A;  4CCJ A;  5FY0 A;  3AVS A;  5FZO B;  5FJK A;  3RVH A;  3LD8 A;  5FZ0 A;  5CEH A;  4QX8 A;  4E4H A;  5FYH A;  5A3P A;  5A80 A;  5FZL A;  4QWN A;  5FZ6 A;  4UF0 A;  3ZPO A;  5IVF A;  5FZC A;  5K4L A;  3ZLI A;  4QXB A;  3DXT A;  5FWJ A;  5FZA A;  5FUP A;  4Y3O A;  5FY7 A;  2P5B A;  5FXV A;  4IGO A;  2OX0 A;  5A1L A;  5FPU A;  3KVB A;  3OPW A;  2OS2 A;  2XXZ A;  4BU2 A; 
#chains in the Genus database with same CATH topology
 3MGU A;  2J7M A;  1V6O A;  5LRR A;  3CHX A;  3O12 A;  3Q8A A;  2J22 A;  5FPV A;  1F2N A;  4Z82 A;  1WW6 A;  5DAQ A;  1JZ4 A;  3NQH A;  5DUU A;  2ZGL A;  4XEZ A;  5FPZ A;  2QQM A;  3EJK A;  4QQL A;  4BOW A;  2UWC A;  1PVC 2;  3GM8 A;  4GB3 3;  4MGQ A;  5JMC A;  1H1M A;  4S2H A;  3B5L B;  3SXW A;  2D40 A;  1O4Y A;  5DG1 A;  5JOX A;  1DQ5 A;  2B45 X;  3B01 A;  1GP5 A;  3DCQ A;  3DUI A;  1VRH 1;  4E4S A;  5A3L A;  1JYI A;  2R04 3;  3ECQ A;  4FQ4 A;  3ZYF A;  1PIV 2;  4OHZ A;  4Q1R A;  2JKB A;  4COW A;  2EAL A;  3FWE A;  4P9Y A;  2D6O X;  4OHY A;  1ND3 B;  1WZX A;  1W2O A;  1PZ8 A;  2LW8 A;  4HVR A;  5I0T A;  2CHH A;  4BQ3 A;  1JZ2 A;  5A32 A;  3A7Q A;  1W2N A;  1H30 A;  3LEK A;  2EVX A;  3NNM A;  3P3P A;  4RN5 A;  5IK8 A;  4P14 A;  4RGA A;  5HCH A;  1FX5 A;  5LBF A;  2WNV C;  1PGL 2;  4XJW A;  3POG A;  1UOF A;  4I09 A;  4OFG A;  4PI0 A;  3VZO A;  5EHD A;  4RYD A;  5FYZ A;  4DS0 A;  4DUX A;  1US3 A;  1OPO A;  2W2I A;  3ZXK A;  2Z42 A;  4DY3 A;  5C7G A;  3WIN E;  3I7D A;  1JI6 A;  1TE1 B;  5LB6 A;  2AH2 A;  5FBZ A;  4ZZ5 A;  2DF7 A;  4YZ4 A;  2VUD A;  1GZ9 A;  1UKG A;  5L36 A;  1OXC A;  2IXJ A;  1UY2 A;  2WJS A;  3LSD A;  4EWE A;  1CIW A;  1JMU B;  1QU0 A;  5AVA A;  3WF1 A;  4ITC A;  5KR7 A;  1LGC A;  5EWS A;  3C7O A;  5CAD A;  3RZG A;  2A71 A;  4FCA A;  3ME2 A;  4AAX A;  4UAP A;  2UUR A;  5C5U A;  1XOY A;  5IHR A;  3H1W A;  4NUB A;  3NWK A;  5F5I A;  1YNA A;  1RUD 3;  3KVA A;  4ONU A;  2XJV A;  4IET A;  1W0N A;  4I0A A;  2P1B A;  3KQR A;  4LBM A;  4KG8 A;  1GWK A;  2I07 B;  3LFI A;  3HR9 A;  1RUO A;  4Y1X A;  4HVQ A;  2JDN A;  2UY8 A;  4FAG A;  4UFH A;  4XAC A;  5IVJ A;  4DXT A;  4RFR B;  2JE7 A;  1RHI 1;  3HMY A;  1S2K A;  1ZBE 2;  3MI8 A;  2VVF A;  4KMQ A;  1TG7 A;  4N53 C;  4FO9 A;  3MIF A;  5ACA 1;  3OGS A;  1JXN A;  4DIN B;  4QKB A;  1BLZ A;  4E2S A;  1IQD C;  3PUI A;  1CES A;  3LD8 A;  3OY8 A;  1SQ4 A;  2ETE A;  1H6Y A;  2XJT A;  3UV9 A;  1FV2 A;  5CKQ A;  4QWN A;  2DTW A;  2ARA A;  2IXK A;  3J4U H;  3GHM A;  5D8A A;  4EQV A;  4D3W A;  2O1Q A;  1QY4 A;  1U12 A;  2QQL A;  3CF6 E;  4XTP A;  4XUR A;  5FZC A;  4CDX B;  1OMI A;  1V0A A;  1WW5 A;  5A33 A;  4N90 A;  1RUG 1;  2DUQ A;  1W6Q B;  1X7N A;  3L9J T;  3N7J A;  3Q8B A;  4KNC A;  3TYJ A;  1U5Z A;  5DXD A;  5A1L A;  2RDN A;  1FMD 3;  4YRD A;  1XNC A;  5A7Q A;  2GND A;  4D0Q A;  2RDR A;  3WF4 A;  4DIQ A;  1DQ0 A;  1ZRC A;  1AYM 3;  3A4U A;  4PDW C;  3ROU A;  1CAV A;  3ILN A;  5A70 A;  1CZV A;  1PK6 C;  2VCC A;  2WO1 A;  3JZV A;  5J1X A;  1K42 A;  1V9U 1;  3NNJ A;  2ATF A;  4IEX A;  2QZ3 A;  4QPI C;  1YRZ A;  4BLJ A;  4W50 A;  1XQN A;  3BGA A;  3FUQ A;  4DO0 A;  1Y9Q A;  4QAW A;  1OF4 A;  4O9G A;  4Q4V 2;  4A41 A;  1W6M A;  4JHT A;  1OI6 A;  3T0A A;  1HRV 2;  2H0V A;  4R52 A;  1YWK A;  3S30 A;  2GZW A;  4BQY A;  1PVC 1;  1YQ8 A;  3IDA A;  3N7L A;  5LAS A;  3ZFF A;  1AR8 2;  1UWW A;  4OHX A;  5A3O A;  4LBQ A;  5F5C A;  4IGP A;  4AI9 A;  3M3I A;  2O8O A;  2VPV A;  4HXC A;  1L3J A;  4BCU A;  3AZX A;  3DGT A;  2RS1 3;  4YW3 A;  1COV 3;  3NJX A;  2XJQ A;  2QQJ A;  3B00 A;  4Y26 A;  1QXJ A;  2JDY A;  5FPL A;  2VQA A;  4HSL A;  2PA7 A;  4XJZ A;  3NJV A;  2ES3 A;  2EXK A;  1O4T A;  5FYY A;  1QJX 3;  3MF9 A;  1ENS A;  4AVT A;  2VJX A;  2JEN A;  3OCP A;  1NUK A;  2ZX0 A;  3OD0 A;  4LPL A;  4E2G A;  2B8M A;  4N8M A;  3SEE A;  2E7Q A;  3WSO A;  1YEW A;  5FZF A;  2BWC A;  1Z7S 2;  1Y9M A;  1R09 1;  2YPJ A;  4JKM A;  5DG2 A;  1B35 A;  3OG2 A;  2PHU A;  4H3W A;  3MIB A;  5FCC A;  2ZZJ A;  1NX9 A;  4QKD A;  4Q0S A;  3V65 A;  5LEJ A;  4WVV A;  2YDE A;  2WWJ A;  4N43 C;  3U07 A;  4LUM A;  4B1L A;  1DZQ A;  1MS4 A;  2R06 1;  1SMV A;  2D98 A;  4LOR A;  4ZKT B;  1IS6 A;  5JPM B;  2WZP P;  4JHZ A;  2VMF A;  4IER A;  4IL7 A;  1STM A;  1WBF A;  1PM7 A;  3MIG A;  4AE2 A;  1ND2 B;  4WM8 A;  2VMG A;  4XVH A;  3WW1 A;  1LOG A;  2UYA A;  2R07 1;  2YU1 A;  2NLR A;  3K75 B;  4CDQ C;  5F39 A;  1FPN 2;  4ISR A;  4Q1P A;  4B7E A;  3LEI A;  4K21 A;  4YYO A;  1AR9 2;  2C9A A;  3AYD A;  4LBL A;  4B3N A;  1JYT A;  3JCI A;  1W0O A;  5CB7 A;  1X9T A;  4Q4X 2;  4NVP A;  1UY0 A;  3GJB A;  3J26 N;  1PNF A;  1LEN A;  1ZZ7 A;  4NR1 A;  4PBO A;  1BMV 2;  4NAM A;  2XQX A;  2KM2 A;  2ZEW A;  4PIX A;  4URA A;  2ZBJ A;  3SQO A;  3USS A;  1XE7 A;  1MVE A;  1O7F A;  2DV9 A;  5BV6 A;  4YZ2 A;  3RZJ A;  3DN7 A;  4ISQ A;  2RDQ A;  2YHJ A;  3D6E A;  3OYW A;  3HVD A;  3GXU A;  3Q9O A;  4FAH A;  3GZE A;  5A3P A;  2VZT A;  3VKO A;  4R8H A;  1BK1 A;  2CY6 A;  1MZE A;  2D43 A;  5E88 A;  3HPN A;  1DCS A;  4NWV A;  2FDK A;  4A7Z A;  1VJ2 A;  3RJ2 X;  5JZG A;  1L7L A;  1VBD 1;  4WVZ A;  5C3Q A;  1CX1 A;  1PZ9 A;  4ZU7 A;  2ORZ A;  1W2A X;  2RDS A;  1JHN A;  3LZZ A;  2O14 A;  3ZFF B;  5CAZ A;  1TMF 3;  1AL0 G;  2FDH A;  4YG3 A;  2OS2 A;  5FMC A;  1ACC A;  3HN1 A;  4V1P A;  2ADE A;  2XPJ A;  4IV1 B;  2B4K A;  4CCD A;  5HV4 A;  4LLF A;  4GH4 B;  3SMH A;  3AMN A;  4OMD A;  5FQ0 B;  2Q4S A;  4ZS3 A;  4XDP A;  5IVB A;  5FY9 A;  3T2O A;  2A7A A;  1UNB A;  4M3C A;  2ZML A;  1LUL A;  4XQ4 A;  1WCS A;  1DYK A;  5GLT A;  5ABJ B;  5DAW A;  3VBS C;  5CIS A;  2CDP A;  4X8N A;  4ZU4 A;  3A23 A;  2FDJ A;  1UYX A;  3VD4 A;  2ZMN A;  4BIS A;  4HSJ A;  2K2S A;  3FMG A;  4CXW A;  2VZV A;  2VVD A;  4QGN A;  2QBX A;  2W46 A;  3DF0 A;  3VDA A;  4YW7 A;  1XYO A;  1REE A;  3IM0 A;  4A42 A;  1S1A A;  5ACA 3;  3I4I A;  2IVI B;  2BVV A;  2G9Z A;  1A8D A;  2Y6K A;  1KJR A;  1RJ7 A;  2Y64 A;  3C3V A;  3ES1 A;  4MH0 E;  4UT5 A;  4FQZ A;  5GJ6 A;  1V6M A;  5IVV A;  2BNO A;  1UY1 A;  3D0J A;  5C4W B;  4D7S A;  2XBO 3;  4N7I A;  2FZ2 A;  4P00 B;  1WCU A;  4PLN A;  3HT2 A;  1DP0 A;  4AHX A;  3PJQ A;  1EUU A;  4HKL A;  3KV5 A;  5B4X A;  1AR9 1;  1W39 A;  3BIE A;  1RUE 2;  2EF6 A;  5SV5 A;  5D21 A;  4IE4 A;  4LBQ B;  4Y22 B;  3U75 A;  4LIV A;  2C24 A;  4HVO A;  2C0Z A;  1S0G A;  1PO1 3;  3KCC A;  3M4F A;  4OZO A;  1I9R A;  1PK6 B;  3ENR A;  2ZOE B;  3AMH A;  2R06 2;  3ZIX A;  2BZD A;  3KV6 A;  2MEV 3;  4MXV A;  3D0S A;  2W3J A;  4N53 B;  4AK3 A;  3V0A A;  4U36 A;  5CFC A;  1GP4 A;  3PTR B;  4D7T A;  2ZHM A;  1HKD A;  1X82 A;  5FKB A;  3WF2 A;  4XQW A;  2LRP A;  2ZMK A;  4BE3 A;  4AED A;  4DMI A;  1W99 A;  3VKN A;  4DPN A;  1W2T A;  3H3Z A;  3PU3 A;  5JI7 A;  3MW4 A;  1D0H A;  3AL6 A;  3QD6 A;  2W0X A;  1MVQ A;  4UFL A;  5JLV A;  2AYH A;  2R49 A;  5FUN A;  3PUR A;  2OII A;  1EAH 2;  1S2E A;  1XYP A;  3F95 A;  3VBH C;  2VUA A;  4D6S A;  5AFB A;  2NQY A;  1K5M A;  4Q0U A;  3M3Q A;  3AKR A;  1NXD 1;  5EP9 A;  1JH5 A;  2FCU A;  1DQ2 A;  3POS A;  1UZZ A;  1B35 B;  1CR7 A;  2GH8 A;  1AXK A;  4NIG A;  5LA0 A;  4PJY A;  5C8C A;  3G7D A;  4PQ9 A;  3O1M A;  1MZF A;  4I01 A;  4D69 A;  3D5O A;  2G4I A;  2QNK A;  3ILF A;  4Q4W 3;  4Q4V 1;  4Y4Y A;  4BK4 A;  5IVF A;  3G6J B;  4QXB A;  2VBB A;  2A6V A;  3POI A;  4M4P A;  4F7Z A;  2P5B A;  1YFU A;  1Q43 A;  2E31 A;  1FNY A;  3N7K A;  2BW8 A;  5GKA C;  1AXZ A;  2EXJ A;  3VHP A;  2VOV A;  1V9U 2;  4ERO A;  4FPH A;  2Y6L A;  3B9I A;  3SEP A;  2MEV 1;  4LXL A;  3RYR A;  4QXK A;  4DY5 A;  2GAU A;  3PUS A;  3VB9 A;  1POV 0;  2WZ8 A;  2XON A;  1LES A;  4CCN A;  4JDO A;  4CPB A;  5LCW L;  3SH4 A;  5KHJ A;  5I8S A;  4FBF A;  1WLT A;  3CDZ B;  3T1L A;  2DCK A;  1OUS A;  4Y4R A;  1ZA4 A;  3ZMO A;  2CV6 A;  3M2M A;  5FZM A;  3RFR A;  5F32 A;  2PHR A;  5FYV A;  3WG4 A;  2DVF A;  1ZNP A;  5C8W A;  1IPK A;  5JXH A;  5FZI A;  2JJ6 A;  3LGR A;  5KHI A;  1SLT A;  1LR5 A;  1QJU 3;  1NLS A;  3QH7 A;  2XJU A;  5DPN A;  2IXL A;  3LDB A;  2PHL A;  2P6H A;  1OA4 A;  2D6L X;  2GN3 A;  3IDB B;  4UBH A;  4UW6 A;  4YFW A;  5F3G A;  3I3E A;  1EP0 A;  3MID A;  2RR1 3;  4ASM B;  3J7L A;  3FE5 A;  2LS6 A;  4I3P A;  1FT9 A;  3JBG 3;  5GLZ A;  3WDY A;  4AED C;  1RHI 2;  1OKQ A;  3ZN6 A;  1H2M A;  4GXL A;  3S5A A;  3VDD A;  2J1V A;  3SNM A;  1SLI A;  3TBD A;  1U0A A;  1HX6 A;  3THD A;  4BIO A;  2QKD A;  1TNF A;  1QMJ A;  4F83 A;  1GZW B;  1PX3 A;  4IV1 A;  4KBB A;  3P6B A;  4BWO A;  1OF3 A;  2VZU A;  3RYP A;  3RZH A;  2BWA A;  4QXH A;  4XUO A;  3AVR A;  1YI7 A;  1UU4 A;  2PLV 2;  4LNV A;  2VMC A;  5A7P A;  3NV4 A;  4NE9 A;  4IQP A;  4C91 A;  1LOD A;  4YVS B;  2HEV F;  1NCQ B;  3I3Q A;  4NWW A;  1MQT C;  2GNT A;  3W5N A;  4XET A;  4ES8 A;  4NRQ A;  2KR2 A;  1D4M 3;  1FAY A;  1W05 A;  2W94 A;  4FOW A;  3VZM A;  3GCW A;  2IZW A;  3ZXG A;  4ATF A;  5LY1 A;  1YIP A;  1VLN A;  4E27 A;  1VAM A;  4XIL A;  1ND3 C;  3O0X A;  5FY5 A;  1G86 A;  1UOJ A;  1LOC A;  3PUA A;  3KV9 A;  4M0H A;  2XBO 2;  2AEY A;  1BYH A;  4EJR A;  1J58 A;  1PMH X;  1UL9 A;  3FBM A;  4RHV 3;  3VBO A;  2HLE A;  3ZSK A;  4P5Y A;  4Q26 A;  4HLT A;  4Q4Y 2;  1VBB 1;  2R6Q A;  2XVL A;  4ZU5 A;  2A3Y A;  2NN8 A;  5DAP A;  1VBA 2;  1DG6 A;  4V2W A;  2JDK A;  5DDJ 2;  4LHL A;  2EID A;  1UZ0 A;  2ZKN A;  3NAP A;  4EN6 B;  3FLR A;  2W39 A;  3V0A B;  1YFX A;  3LFM A;  1NCQ C;  4Y5T A;  2B5H A;  4QD2 A;  2OPK A;  1C57 A;  4DUV A;  4YSF A;  2PAM A;  1XNB A;  2C1F A;  2DDU A;  4M4R A;  3WOG A;  1CQ9 A;  4AQ6 A;  4LK7 A;  1ULC A;  1F4A A;  1JUH A;  3DV8 A;  4IEO A;  3ZYR A;  3WR0 A;  1NAE A;  1PIV 1;  1C8N A;  4AGG A;  4CU7 A;  4YGB A;  2ADD A;  3J8F 2;  4KI5 M;  1VRH 2;  1YC6 1;  3FHI B;  5FMO L;  3AJZ A;  3AMM A;  2SLI A;  5K4L A;  3A22 A;  1YFY A;  3MPP G;  1GOH A;  1YJL A;  2B42 B;  2WT2 A;  5I8T A;  4QB1 A;  1AYM 1;  3W59 A;  4QGM A;  1ZZ9 A;  3POE A;  4HK9 A;  4CP2 A;  2SBA A;  2VZR A;  1F31 A;  3OPW A;  4NIH A;  3RMX A;  2DCT A;  4Q27 A;  1R1A 2;  2BGP A;  3NW4 A;  3ZFE C;  2VTX J;  4X6R B;  2DUR A;  4BPZ A;  4AI8 A;  2J42 A;  1NKG A;  4OCT A;  2R30 A;  2WWS A;  3MW3 A;  2QQU A;  3ZXD A;  4MV2 A;  2WR9 A;  5FUI A;  5JPN B;  2EAA A;  2DFB A;  2FBE A;  2EIB A;  3AP6 A;  3MYX A;  4K1Z A;  4L9B A;  3KSC A;  4XF9 A;  5FYS A;  1AX0 A;  2A75 A;  3B7M A;  3I2D A;  4JTO A;  5FIX A;  3MLK A;  3T2P A;  2ZGR A;  4KWU A;  1T6G C;  2G9F A;  1S0I A;  3PIG A;  4QDS A;  5FLI A;  4LE3 A;  2WFF 3;  1C8M 3;  4QGL A;  4IV3 C;  1ULE A;  2ID4 A;  1C4R A;  2HEW F;  3MIC A;  4ZS2 A;  3MW2 A;  3SLI A;  1QH6 A;  4QX3 A;  4Y1U A;  4CUB A;  3LEM A;  5A7W A;  1PMJ X;  4XUN A;  2RR1 1;  5JSR A;  3VGI A;  1DZR A;  1MS8 A;  5C33 A;  3VD9 A;  4CP9 B;  3VDB A;  1QH7 A;  4E9K A;  4MUV A;  5FZ7 A;  3ZFE B;  2VCB A;  3H1Y A;  3LIG A;  3AX4 A;  5CFD C;  5IT6 A;  3ACF A;  3MZH A;  3LKJ A;  5T5P A;  2ET1 A;  1OKO A;  1PVC 3;  4XFB A;  5HXM A;  1D2Q A;  4LJH A;  4W6Y A;  4LR4 A;  1U5Y A;  4IXL A;  5A3T A;  1LHU A;  2CYF A;  2HYK A;  2QQV A;  4UW3 A;  2VQT A;  3BYW A;  3BTX A;  5HI0 A;  3FLT A;  1UPI A;  1E5H A;  3CMG A;  2X5I A;  2XGX A;  3GDB A;  3VZL A;  3WW3 A;  4A6S A;  1UAI A;  2A1X A;  3ZYI B;  3A0K A;  1KQR A;  1QJU 2;  4LEJ A;  2OXB A;  3U37 A;  2E9Q A;  2ZGM A;  4CZS A;  2DYC A;  1BBT 2;  3AYE A;  1W04 A;  3ZN6 B;  2AUY A;  3BU7 A;  1DU3 D;  2Z69 A;  3UGH A;  5CFC B;  3ZM8 A;  2A6X A;  1XU1 A;  1K45 A;  1NLQ A;  3JBG 2;  2OZJ A;  4MSV A;  3I8T A;  2RHP A;  1I5Z A;  1LCL A;  1IS5 A;  1FOD 1;  1FMD 1;  4NMI A;  2B9U A;  3IWZ A;  4RSU A;  3BKZ A;  1VMJ A;  1APN A;  4D6R A;  2A73 B;  1TMF 1;  2WA3 A;  4GD4 A;  1LOA A;  4TLF A;  4OUE A;  1VBE 1;  2JIG A;  5IAX A;  2VG9 A;  2DFC A;  2BOI A;  2Q1Z B;  1UY3 A;  3HAG A;  3N9O A;  5T3N A;  2NPI A;  4QPG C;  3BOD A;  1JHJ A;  4QX2 A;  3GF6 A;  3U4X A;  2ARE A;  1VR3 A;  2EA7 A;  1GWL A;  4JDN A;  3E5U A;  3FX3 A;  4LA3 A;  2JXA A;  2ET7 A;  4P9I A;  5KHK A;  4BB3 A;  5LWB A;  2RS5 3;  5JR2 A;  2YG0 A;  4E4D X;  4FFI A;  3DL3 A;  1BVP 1;  1NE4 A;  4DRR A;  3VZN A;  3JD7 1;  1AR6 2;  1PMI A;  1IKQ A;  2VW0 A;  2XWB B;  4NHX A;  4CEW B;  1LOB A;  3P5B A;  4MGZ E;  4W4Z A;  5GZG A;  2CGP A;  1VMH A;  4XXP A;  3QLQ A;  1OA3 A;  3GNE A;  1G9B A;  5FZ6 A;  3Q8E A;  5SV8 A;  4DNY A;  3CO2 A;  4OUL A;  3THC A;  1HV1 A;  1QQP 2;  1NY7 1;  1A3K A;  1UYZ A;  4LHN A;  4D94 A;  1ND2 C;  2GMP A;  5FZA A;  5FUP A;  4A7Y A;  2JX9 A;  1MQT B;  1V6J A;  2D3R A;  3OGV A;  1C1F A;  4I0W B;  5BNN C;  1LED A;  2VAU A;  1MAC A;  4JGY B;  3ACI A;  3OBT A;  4R9A A;  1YYN A;  4DZG A;  2DTY A;  4J6G A;  4LO5 B;  3TOJ A;  1ZZ6 A;  5BY5 A;  4NRP A;  1KIT A;  5AC9 1;  1GLH A;  3KD4 A;  1SDW A;  1VAL A;  2PEL A;  4D8M A;  1GOF A;  3ITQ A;  1SCS A;  2XDV A;  3M7A A;  4O9E A;  1YHF A;  2D6K A;  5DDJ 3;  2CGO A;  2C5D A;  2VMI A;  3AKQ A;  3QBQ A;  4YFZ A;  1LHW A;  1VE0 A;  5CYY A;  5LRS A;  2HYX A;  1GV9 A;  4H14 A;  2HBT A;  3KCX A;  2VOX A;  2ZX3 A;  3HJR A;  1AR6 1;  1NZI A;  1S0B A;  1RMU 3;  3AXE A;  5D8A C;  2R7E B;  1EUT A;  2W5F A;  2O0O A;  1S0F A;  4I0B A;  4LBJ A;  3GZU C;  4EZH A;  5JZG C;  1LJ7 A;  1I3H A;  4MO3 M;  2X09 A;  2VEC A;  3TEZ A;  3AZW A;  1RUI 3;  3GBW A;  1E5I A;  3RJR A;  5BNN A;  5CZK A;  2HWF 2;  2WQ4 A;  1KJL A;  1MS3 A;  4PLM A;  1W8Z A;  4GKY A;  5FYB A;  4L92 A;  3JXS A;  3F2Z A;  4HN0 A;  4MHR A;  4TWT A;  4PDW A;  4ZXE A;  3SCF A;  2CWS A;  1PGS A;  3TRS B;  1Y3T A;  4NJ4 A;  4NHM A;  4CCL A;  4QDR A;  1UX6 A;  4KWL A;  4AG4 A;  3PUH A;  5BNP A;  1SEF A;  1BEV 1;  2WNU C;  5CIR A;  1FXZ A;  5CBL A;  5DMY A;  1HV0 A;  1TMF 2;  4G9S B;  4BK5 A;  3BTZ A;  2HEY F;  5FDB A;  4GIQ A;  4XF4 A;  1POQ A;  1H1A A;  3WEZ A;  1CX4 A;  1WW4 A;  1L7Q A;  2CNA A;  3KT7 A;  1XNA A;  4QX0 A;  1LEC A;  3E1F 1;  2QQI A;  3BPZ A;  3DEM A;  1RUJ 1;  1AYN 1;  3NV1 A;  3ZX7 A;  1W8H A;  5B2G B;  4UW4 A;  1IPS A;  1GU3 A;  3RZZ A;  3NJZ A;  1BJQ A;  2JDM A;  4YAR A;  3B02 A;  4NRO A;  1AJO A;  1QJU 1;  2YYO A;  5J3U A;  2OA2 A;  1RUF 1;  3VHO A;  5EFU A;  1AR8 3;  2P34 A;  3MHZ A;  5BPX A;  3VN4 A;  2EIC A;  2WSU A;  4CP9 A;  3HWJ A;  3IPV A;  1TZO A;  4WM7 A;  3IPV B;  3WG3 A;  5A6X A;  1QXP A;  2C26 A;  3T08 A;  4CE8 A;  4BYY A;  2E26 A;  4O7X A;  4FXG B;  3S7I A;  3VKM A;  1WCQ A;  2WWU A;  4LKF A;  3VD7 A;  5JAX A;  1F5F A;  1E5S A;  2DU1 A;  2R04 2;  5KXB A;  1OD3 A;  1AYN 2;  3CZJ A;  4XFG A;  1CJD A;  1GQG A;  2VOW A;  2E32 A;  4XDQ A;  3UGG A;  3VBU C;  2RM2 3;  3OGG A;  5DAB A;  5BNO A;  4JKK A;  4HPK B;  1CD3 G;  5F7U A;  1XPW A;  5FYH A;  3LCP A;  4B29 A;  3H8R A;  3QAC A;  5HBA A;  1BK0 A;  1BEV 2;  1PVX A;  4LQR A;  3T0D A;  2CTV A;  4KG0 A;  5D8A B;  4RL7 A;  2WNO A;  1GZC A;  1S2B A;  3AYC A;  2Y8K A;  2WQ8 A;  4Y3O A;  2LRO A;  1IQA A;  2Q5T A;  3TB0 A;  2Q8O A;  4QB6 A;  2V09 A;  3U14 A;  1JZ3 A;  2VUC A;  1JYN A;  4HKO A;  5E8A A;  5CKN A;  4IND A;  3WW4 A;  1P8J A;  1BXH A;  3DKQ A;  2BFU L;  3C7G A;  4P5H A;  3AZY A;  3IT8 A;  4OQ9 A;  3OBA A;  2J1E A;  1LAJ A;  2W1S A;  2JWP A;  1PO1 1;  2XJR A;  1ZBA 2;  3I54 A;  3VBU B;  3MUZ 1;  3U11 A;  1HRI 2;  4K9S A;  5F3E A;  4XJ8 A;  2ZGQ A;  3GYD A;  3OBZ A;  4XIK A;  2B9V A;  3JB8 A;  4HAN A;  1UZV A;  1NA1 B;  2WNV A;  3AL5 A;  1XRU A;  2JE8 A;  1W2U A;  1UIK A;  4PCR A;  5FY8 A;  5T5O A;  3T4H B;  2VXJ A;  5EJ3 A;  5F5Q A;  1ZZB A;  3WT3 A;  1QEX A;  1SHW B;  4LBN A;  4B7K A;  2YFU A;  4Q4W 2;  3URF A;  5J09 A;  1JOJ A;  1AR6 3;  4IEY A;  4LKD A;  4AED B;  2EIE A;  4DRV A;  4JQR A;  5LW9 A;  2GP5 A;  3I49 A;  3RWN A;  4ASK A;  2HKX A;  4XFA A;  3T1M A;  1BQP A;  1BHG A;  1MS5 A;  3CIH A;  2XJS A;  2P17 A;  3MIH A;  3ABZ A;  3EO6 A;  4OI1 A;  5FYC A;  3KCY A;  2W9X A;  5FPX A;  4CU8 A;  2WS9 3;  4IV3 A;  4WVM A;  5FBJ A;  3ACG A;  3LEG A;  3W9A A;  2PHT A;  1W8F A;  2IXC A;  4AVS A;  1M06 G;  1JYW A;  3POY A;  1WWY A;  1OUR A;  2WL1 A;  3J8F 3;  2ZX1 A;  3LDK A;  5FR3 A;  2GNB A;  2QFE A;  4QPG B;  2V4V A;  3LB9 A;  3PNA A;  3W20 A;  3JD7 2;  4Q4V 3;  2CAU A;  1OA2 A;  4J1X A;  3ZO0 B;  5K0U A;  2TEP A;  4JRA A;  3VHR A;  4BA6 A;  1ULD A;  1UMI A;  2Q1F A;  1SAC A;  2Z4F A;  4MLO A;  3KV4 A;  2F6B A;  1OC1 A;  1VBD 3;  2HWE 1;  2HWC 2;  1VAV A;  4X8P A;  2VW2 A;  1GZW A;  3TAY A;  1KRI A;  4AI2 A;  3AP5 A;  3H50 A;  2D5H A;  1ZRD A;  2WO2 A;  3K48 A;  4NPR A;  2FMD A;  3LPF A;  1CZS A;  2IVJ A;  3CZU A;  2ERF A;  5E1R A;  2VQU A;  5KHH A;  1E5R A;  2F17 A;  1WW7 A;  3K2O A;  2LAL A;  4Y20 A;  2FHR A;  4H2A A;  1ENQ A;  2JDU A;  3M8L A;  3PHM A;  5KXD A;  3BI3 A;  4BXS V;  3B9C A;  1DLC A;  2FMY A;  3DYM A;  3WNN A;  1IPJ A;  4OI4 A;  5C4W A;  1H4G A;  1H4H A;  1XYN A;  3H8U A;  4LO6 B;  4XYX A;  3WNK A;  1AZD A;  1RUI 2;  1JW6 A;  1GOG A;  1OUX A;  2WLQ A;  3AKT A;  3FFZ A;  3ORJ A;  4RA0 A;  5HXV A;  4HMZ A;  5T55 A;  3ZYG A;  1F35 A;  1ASJ 1;  3ZPY A;  3HQU A;  2P3J A;  4AEK A;  2JE9 A;  3AVS A;  2YC2 A;  2WNE A;  2OUJ A;  1XSR A;  4XCB A;  2RG4 A;  1ODN A;  4Z92 B;  2HJI A;  1BBT 1;  1X36 A;  4MGS A;  1SFN A;  4MET A;  2WII B;  4ZHN A;  1VBC 2;  5FQ0 A;  5J7M A;  1SBE A;  3BPS A;  4OVE A;  2QDR A;  1UN1 A;  1POV 1;  4MGY E;  4NPM A;  2OUH A;  4P9W A;  4OI0 A;  3ZPO A;  1AF9 A;  5IUQ A;  2WNV B;  4UWD A;  3AFK A;  3R6S A;  1WD3 A;  1HJG A;  1FI2 A;  1NG0 A;  2YMZ A;  1KEX A;  3UNP A;  4YM1 A;  5T50 A;  2HWB 1;  5C9A A;  1XNT A;  4BU2 A;  4FPC A;  2DBN A;  4CEW C;  1AYN 3;  5FAX A;  1CAX A;  2GC3 A;  2VOK A;  3CEW A;  4IEW A;  1GIC A;  1VAK A;  2LUW A;  2MHF A;  3POB A;  1RXG A;  3BN6 A;  1TME 2;  4NRM A;  3ZKY A;  4CTE A;  1YJK A;  4P9L A;  3D82 A;  4WM7 B;  2RMU 2;  1N3O A;  1QNY A;  1OD5 A;  1VBE 3;  5C8C B;  5FRE A;  1MZ5 A;  1DQ1 A;  4A45 A;  3RYK A;  2JG8 C;  4QMA A;  5HPO A;  3H7Y A;  2VTF A;  1D2S A;  1PGW 1;  3NNG A;  2RS5 1;  4AQS A;  1ZX5 A;  4LIT A;  2Y26 A;  4UYB A;  2VCM A;  5FZK A;  5FWE A;  4KGG A;  1ZRI A;  2BJS A;  2FDI A;  2BVB A;  2BUK A;  5IAV A;  2P37 A;  3ZXF A;  3PVN A;  4FFF A;  1A34 A;  1QF3 A;  4UFJ A;  2I2S A;  2CGN A;  4XFF A;  3UYJ A;  2VBP A;  1XXN A;  3TN9 1;  3O1O A;  4JZR A;  1DQ4 A;  1AVB A;  2Y6F A;  4XAE A;  4LO8 A;  2NYY A;  1C8M 1;  1LGN A;  4KU8 A;  4YW4 A;  1CPM A;  3BB6 A;  4B4R A;  5JSO A;  3GZA A;  4N43 A;  3WLU A;  4CDU C;  1H1I A;  2WS9 1;  1AYM 2;  4JTN A;  1JOP A;  1C5H A;  4JGZ C;  3O5S A;  4XHX A;  4UI9 L;  4L2N A;  2Q8E A;  1NZC A;  3QOP A;  3J8F 1;  4NPL A;  3U1X A;  1SBF A;  1Y4W A;  5FMB A;  5A7W B;  3E5Q A;  2PHW A;  1QOS A;  2VW1 A;  4R4X A;  4MZU A;  1NQD A;  4R9B A;  3I97 A;  5H9R A;  4JC1 A;  3ASI A;  5F6K A;  2D44 A;  2F4P A;  2VTX A;  1EV1 2;  1Z0H A;  5C3P A;  1JYX A;  2PYT A;  3AKS A;  1RJ8 A;  2Y0O A;  1CAU B;  1WCK A;  1ZA7 A;  4Y1Y A;  1N1S A;  3N36 A;  5A32 B;  4CEY A;  5ABJ C;  1GFF 2;  2HBU A;  4GWN A;  1S0D A;  2WFF 1;  4IE6 A;  2YC4 A;  1W9W A;  4Q0Q A;  3VHN A;  4AW7 A;  5J48 A;  4MXW B;  2JB8 A;  2RMU 3;  3VUO A;  2WNU A;  2QQW A;  2EXH A;  2RVA A;  5ANN A;  4AVV A;  5FZO A;  3WNX A;  1X9P A;  2J1A A;  3AFG A;  3KLS A;  2RS1 2;  1N3P A;  3VBF A;  2W87 A;  2VCA A;  1Q5O A;  2XKO A;  1IG3 A;  3DKW A;  1HRV 3;  1S4C A;  1QKQ A;  2VH9 A;  3FJS A;  3U78 A;  3R4D B;  2GC1 A;  1RIN A;  2D3S A;  2W1U A;  1EPZ A;  3VL8 A;  2XLG A;  1N1Y A;  1GYK A;  2VVE A;  5DZG A;  1ODM A;  4MVT A;  3TEY A;  3NNL A;  1RHI 3;  3AP9 A;  5D2A A;  3UJO A;  5CA6 A;  2VZP A;  1U5I A;  1JU3 A;  5DAV A;  5CG9 A;  1RVF 3;  5FP9 A;  4PHZ A;  4FPK A;  4HFS A;  3ZXJ A;  1NCR C;  1HXS 3;  3O1S A;  3FN9 A;  5HCF A;  4QX8 A;  1I1E A;  5IK7 A;  1NYW A;  2XL7 A;  3ZMN A;  5KHG A;  5A80 A;  2DVA A;  4A3Z A;  2PLV 1;  2KA3 A;  4Y22 A;  5C71 A;  3PLQ A;  2ARB A;  2AAC A;  4XIO A;  3RG0 A;  4IEZ A;  2AGS A;  1SPP B;  2B39 A;  1GNY A;  3H0O A;  5JWP A;  4XW3 A;  5T5J A;  5F1R A;  1R09 3;  1DLL A;  4HBN A;  4E4Z A;  4NIA A;  2XR4 A;  3VBO C;  3KHC A;  2QCS B;  4XF1 A;  1EY2 A;  3C2U A;  4J25 A;  4AHZ A;  3DEC A;  3S5Q A;  2VD7 A;  5EXO A;  5FZB A;  1VPH A;  3RWK X;  4Q0V A;  4ARX A;  4NAO A;  1QJZ A;  4Q8L A;  1RIR A;  2BPA 2;  1OQD A;  1WA6 X;  2X5I C;  2Y33 A;  3OY8 B;  3WP4 A;  2XHN A;  1Q8S A;  1WLD A;  3III A;  2BEO A;  3NAP B;  4JCK A;  5L73 A;  1CPN A;  1LEM A;  5JOZ A;  4XZU G;  2BOJ A;  1VBD 2;  3E6D A;  1MQT A;  3HEI A;  4R4Z A;  5FOB B;  2VMD A;  1OBN A;  1EYB A;  1KS4 A;  3ACH A;  1VP6 A;  5E16 A;  4CCE A;  5ABJ A;  4JGY A;  3PIJ A;  4XUT A;  3EQE A;  2QE3 A;  3VL9 A;  4BXF A;  5F37 A;  1J3R A;  2AEZ A;  4CDQ B;  2ILM A;  1MS9 A;  2WA4 A;  4N9I A;  1N3Q A;  1ND3 A;  3ZN4 A;  5CFD B;  1HQW A;  4E8D A;  3EBR A;  2XLA A;  4RR3 A;  1D4M 2;  1DHK B;  1AJK A;  4CDX A;  5IK5 A;  2TUN A;  4XZP A;  1B35 C;  3K77 A;  5JIU A;  1VBB 3;  4IE0 A;  4W8J A;  5BYN A;  1NLR A;  1HB3 A;  3BOP A;  4D6Q A;  4YWA A;  1BMV 1;  5DZF A;  5K9Y A;  5C3O A;  1G9F A;  5BNO B;  3NAP C;  3N9M A;  5FZ1 A;  4F8A A;  3WCR A;  1YI9 A;  3POJ A;  4FT8 A;  3GGL A;  5BNP B;  2WT1 A;  2VUL A;  3PMS A;  1QJY 3;  1I6X A;  1GMM A;  3N9L A;  1MEC 1;  4QHO A;  1UYP A;  3J7H A;  1MS1 A;  3VZJ A;  2JDP A;  1QIQ A;  4TXW A;  4COV A;  2PMW B;  2JEC A;  5C6C A;  5FPA A;  3NKG A;  4UF0 B;  2ZCW A;  1S0J A;  2YBK A;  1DGR N;  2ZGO A;  4UFM A;  2MPF A;  1YXW A;  5FYI A;  3WQ7 A;  3WQB A;  2ZX2 A;  3O1P A;  4A3X A;  1AX2 A;  4FP3 A;  2BYV E;  4NN0 A;  3WF3 A;  1RUH 1;  1R64 A;  5BNQ A;  2W52 A;  4BQ2 A;  2JG8 B;  2N7G A;  5GZC A;  4PIY A;  4YVW B;  4PF1 A;  3X29 B;  1R09 2;  3MO4 A;  1V00 A;  1DYP A;  1Z7S 1;  4YG6 A;  1W6N A;  2GN7 A;  1GWM A;  1VRH 3;  4JAA A;  2D6N A;  2Y38 A;  1BKZ A;  3OPT A;  2H6C A;  3PUQ A;  4GMP 0;  1Z7S 3;  3S6P A;  2TBV A;  2YUE A;  4Y1V A;  3OTF A;  4O61 A;  2AC1 A;  1KD7 A;  1CZT A;  4YLZ A;  3ACL A;  4EN7 B;  2WBK A;  1RUH 2;  4JV4 A;  5FYM A;  2UYB A;  4C0H A;  4WVW A;  1PNG A;  4GWJ A;  3AP4 A;  1W03 A;  5LBE A;  1R08 3;  1JOD A;  2ZGU A;  4YW5 A;  1DGR A;  2G19 A;  4Y1Z A;  5FLH A;  3VKL A;  1LU1 A;  1UKR A;  1OPM A;  2VE1 A;  4E4H A;  4OUS A;  1MEC 2;  4AFA A;  4GMP 1;  3ELN A;  1GNH A;  3OEB A;  3UKN A;  2XG3 A;  4FPG A;  2VOT A;  3FBY A;  2R16 A;  3GBG A;  3RMY A;  2A6Y A;  4COY A;  4XJU A;  1HQL A;  1YQ5 A;  3C7E A;  4FOQ A;  1JYC A;  5FY7 A;  3I2G A;  1H6X A;  1PIV 3;  3LE0 A;  5FXV A;  1Y7B A;  2XB6 C;  1QWR A;  4OLL A;  4YPJ A;  4FTB A;  3VBS A;  3SKJ E;  3B3Q E;  1R1Z A;  1UY4 A;  2ZEY A;  1AX1 A;  3OOX A;  2PFW A;  1D4M 1;  3UJQ A;  4AVB A;  5FY4 A;  2RS3 3;  1OQ1 A;  1H2L A;  3B69 A;  4XE9 A;  1UX7 A;  5BNP C;  1VMF A;  1OLR A;  3UKV A;  5FFO C;  5EQU A;  1CVN A;  3AP7 A;  3V64 A;  1K12 A;  4PT6 A;  1X8E A;  2JDA A;  4COU A;  2VGD A;  3JQW A;  1OT5 A;  2DU0 A;  5FO7 B;  4Z07 A;  3H42 B;  3FC0 A;  1TNR A;  4FTS A;  3VDD C;  2W68 A;  3I2H A;  4TN7 A;  1QHD A;  2K46 A;  3PJY A;  1FNZ A;  3RS6 A;  1GZT A;  4CA9 A;  2A6W A;  5KWR A;  4JVA A;  3LA2 A;  3AJY A;  2Y34 A;  1DYO A;  2Z5W A;  4XHB A;  2J1S A;  4AHY A;  5AFE A;  2YPD A;  2FDG A;  3WV6 A;  4G4F A;  1NXM A;  5IAT A;  2OYZ A;  3E6C C;  5B4N A;  2V73 A;  3ATG A;  1ZBE 1;  2QDN A;  4LHK A;  4ARY A;  1SLA A;  4L11 A;  4FTE A;  1W90 A;  1URX A;  1ZBE 3;  2P3K A;  3B94 A;  1OQE A;  5FZG A;  3HQR A;  3OD4 A;  3WCS A;  5IJR A;  5HCA A;  3EB7 A;  1LOF C;  4K6B A;  2D97 A;  2JB4 A;  1UCX A;  2ZKL A;  2DVB A;  2VL4 A;  2YV8 A;  4PF5 A;  2Q8C A;  2GP3 A;  4YW1 A;  1AR9 3;  5L9B A;  4FXK B;  5I0U A;  4QPI A;  3OGR A;  4I3G A;  4P9X A;  1V6N A;  3Q8F A;  4GWM A;  4HOO A;  4X6Q B;  3O1T A;  2BNN A;  1UMH A;  4Z2W A;  1ENR A;  2ZA9 A;  4P9G A;  1DBN A;  2DWR A;  2XQR A;  1UW8 A;  2WO7 A;  1POV 3;  2BDR A;  3KHB A;  3ES4 A;  4FPO B;  4H7M A;  3OEA A;  4EN8 B;  1M4W A;  1RED A;  4GKX A;  5K7P A;  5GZE A;  3T2Q A;  4Q29 A;  2QUO A;  1CN1 A;  2CDO A;  2FCT A;  3UKT A;  4K7J A;  3ZIW A;  4GUL A;  2VME A;  4QM8 A;  5FP7 A;  1H9P A;  1ZVF A;  3Q8C A;  2ZHK A;  4ORF A;  3CNA A;  3IAP A;  3ZYJ B;  3WP5 A;  2GU9 A;  1W8O A;  1RUC 3;  3KMH A;  4JRL A;  2XLF A;  3N3H A;  1KS5 A;  1NT0 A;  2R07 2;  4BQW A;  4AWD A;  3AXD A;  1PGL 1;  1H0B A;  5FZ8 A;  2E33 A;  1SZB A;  3PTY A;  1ZBA 3;  1D7P M;  1UZW A;  5A6Y A;  2WFF 2;  3WNO A;  4FFG A;  1W9Y A;  3AMP A;  4IEQ A;  1XND A;  2ARC A;  2IFW A;  2JDH A;  3WP3 A;  4CXX A;  5A6Q A;  2WIN B;  3CU7 A;  1GQH A;  1W6N B;  4OQ8 A;  1WBL A;  4DOU A;  1GSL A;  3VKF C;  4L0P A;  4W6W A;  5G05 L;  5EYX A;  2X5I B;  3ZFE A;  4COZ A;  3AM2 A;  4XXA A;  3ZFF C;  3THT A;  1W0P A;  2X8K A;  4DQA A;  4XBQ A;  3UET A;  3ZLI A;  1CIY A;  1ONA A;  4DEQ A;  4C90 A;  3ZXA C;  5CFC C;  3MDP A;  3H1M A;  3WDX A;  5FTT C;  2VNO A;  4OZX A;  1CAW B;  3ZFG C;  1O59 A;  1CAW A;  3OUJ A;  5D1I A;  1UXX X;  3WVJ A;  1VBA 3;  3UL2 A;  2YFZ A;  4MGI E;  1O5L A;  2GME A;  2PHF A;  1W28 A;  1EV1 3;  1AR8 1;  3RRD A;  2XUE A;  3ZDV A;  1QJE A;  2BTV C;  3R4S A;  2BV4 A;  2E7T A;  2UWA A;  3LF7 A;  3I2I A;  5EPA A;  1V6K A;  5FJH A;  4R9C A;  2BNM A;  2RS5 2;  1JZ6 A;  5A3N A;  1PGW 2;  1JOB A;  1HRV 1;  1RTV A;  2WUH A;  2V5Y A;  5FP4 A;  2RJ2 A;  3WDW A;  3E97 A;  2IC1 A;  4XDO A;  5I91 A;  3LSE A;  1FOD 3;  1KDK A;  3RI8 A;  1HB2 A;  1X33 A;  3VBF B;  5EYY A;  3T30 A;  1COV 1;  1VRB A;  4RR3 B;  4XAB A;  2GSY A;  2RMU 1;  3CLP A;  3RSJ A;  4AXO A;  3EMR A;  2DUP A;  3WDT A;  1LNS A;  2BER A;  4XJ9 A;  4XMI A;  4GJZ A;  4ZPI A;  5F8P A;  1TME 1;  1XC6 A;  3EXU A;  4XCA A;  5K0U B;  3BOW A;  4BQX A;  5F2S A;  4RQP B;  1KDM A;  5CU1 A;  3HNY M;  4YZ1 A;  5JR7 B;  1PHM A;  4L97 A;  1WMD A;  1IHM A;  2JD4 A;  2P2K A;  1B09 A;  3N9P A;  5JOY A;  4IEP A;  1RVF 2;  2HWB 3;  1D0G A;  2ZXQ A;  3BIW E;  2YRO A;  3LIH A;  1Q8Q A;  5KBF A;  1RUG 2;  3DYP A;  1SPP A;  5DQ0 A;  2CU5 A;  2XML A;  1RL3 A;  5LBB A;  2LTN A;  4FPE A;  3IKW A;  4KWK A;  4W65 A;  1H2K A;  3IN9 A;  1TQ5 A;  1GR3 A;  2OT7 A;  1W6P B;  4LBK A;  5JIA A;  3OUI A;  5A3W A;  3KQ4 B;  3RI9 A;  4A7K A;  4KL1 A;  4IEV A;  3T0B A;  4EE2 A;  3H8X A;  5IVC A;  5AVP A;  1HLC A;  3VBF C;  4IGQ A;  3SH5 A;  3K4Z A;  1ULP A;  1LOF A;  4ES9 A;  5ACA 2;  4QPI B;  3WDV A;  1ASJ 2;  2YBS A;  4CCM A;  1HW5 A;  1RUN A;  4LLO A;  4AQ2 A;  4XBN A;  4JDM A;  5FXX A;  5GAL A;  1SDD B;  4AI0 A;  2UWB A;  3T4V A;  3INA A;  2WKK A;  4AFC A;  2DCJ A;  2RV9 A;  4LBQ D;  2VXR A;  3ALQ A;  1JZ5 A;  5C9A C;  5T52 A;  1QDO A;  2WLP A;  4RS5 A;  2IWG B;  1O8P A;  4JX0 A;  2JKX A;  5FV3 A;  4KU7 A;  4B4P A;  2VC9 A;  1OH4 A;  3T3Y A;  3O0V A;  5HCB A;  4CDW A;  1HQN A;  3MEP A;  4MYE A;  3ZKU A;  4QQP A;  5JXI A;  4LHS A;  5J96 B;  1N47 A;  3RGB A;  5L9R A;  1OLQ A;  2HWE 2;  5A33 B;  4CRQ A;  4EWA A;  2JG9 C;  1W8T A;  4QKF A;  4W6X A;  5CG8 A;  4FOV A;  4QU2 A;  1HJF A;  2F4L A;  2IFR A;  4A4A A;  1O91 A;  3FUO A;  4WZC A;  3RVH A;  5CEH A;  3O7O A;  3AYA A;  3WG2 A;  5FZL A;  4PBP A;  4GWI A;  1LTE A;  3AK0 A;  2A5Z A;  2Q1M A;  4B1M A;  2QQP A;  4XUP A;  3JU9 A;  4E8C A;  4XAA A;  3UGF A;  5JDB A;  1AR7 2;  5FWJ A;  3VV1 A;  3MPB A;  2ZHL A;  5C5T A;  4D7Y A;  3HOB A;  5F6L B;  2FD8 A;  2Y6H A;  1KFX L;  2J1T A;  3S7E A;  4NID A;  3I3B A;  1EAH 3;  1OSG A;  2ARX A;  2XXZ A;  4RS5 C;  4WV8 A;  5FY0 A;  2HWC 3;  1VIW B;  1JU4 A;  3OSD A;  1DFQ A;  5H9S A;  3V0B B;  4YM0 A;  4FPY A;  1AUY A;  1US2 A;  3KZ4 C;  2Z2S B;  1OHF A;  1RUH 3;  2BBA A;  4RHV 2;  5FZD A;  3SIS A;  1XBF A;  3JQX A;  3IB3 A;  2BU9 A;  5FYU A;  3FHA A;  4EZ4 A;  2WDB A;  3MUY 1;  4L99 A;  4Y33 A;  2FQP A;  1A78 A;  4P08 A;  4UXA A;  1HDK A;  4ZZ8 A;  1BVV A;  4CDU B;  1WGP A;  2W47 A;  5J36 A;  3NO8 A;  5JXG A;  5A3M A;  4KH9 A;  2J1R A;  1PO2 2;  1W8U A;  2L9L A;  2WZR 3;  1O3S A;  4EYU A;  1AL2 3;  4A6O A;  1ZBA 1;  5L7O C;  2YU2 A;  1JS9 A;  2EIG A;  1PO1 2;  1RUF 3;  3IMN A;  4FSJ A;  1GNZ A;  1OH3 A;  1FYU A;  3IMM A;  1QQP 3;  5F9T A;  4CXY A;  1CAU A;  3WNL A;  1QJF A;  2V72 A;  4OHV A;  2VUJ A;  2ZAC A;  2W08 A;  3J9S A;  5LA9 A;  2BGO A;  2OZ6 A;  3IDC B;  3SHR A;  2WT0 A;  2A70 A;  4XF0 A;  1ST8 A;  2BGC A;  4FVV A;  2OKX A;  3WG1 A;  4I30 A;  1DGW X;  4S2D A;  4A44 A;  5JCT A;  2ENR A;  2PQQ A;  1RXF A;  4GQ7 A;  1YUD A;  1JYV A;  4TLG A;  4ET7 A;  5H9P A;  5EIY B;  4DUW A;  3KT4 A;  3APB A;  2VZS A;  3KS7 A;  4NHL A;  3WHU A;  3D8C A;  4XQD A;  1Q3E A;  4LT5 A;  1WCD J;  1UXZ A;  1BEV 3;  1G7Y A;  4Z8B A;  2NZ9 A;  5I93 A;  1NCR A;  4OHW A;  2YBP A;  1ZM1 A;  4M3C B;  5FZE A;  1DGL A;  5M0T A;  4PIZ A;  1J3P A;  2IXH A;  1LHV A;  5F3I A;  2W92 A;  3LAG A;  5JSP A;  4I2O A;  1YQC A;  4AYU A;  5L7O B;  3AMQ A;  3K46 A;  5DUV A;  2OVU A;  4QX1 A;  2QZ2 A;  2IXI A;  2R04 1;  2ZGP A;  3WUC A;  3PME A;  1H8V A;  3POF A;  5GLV A;  1NA1 C;  2PHD A;  1RMU 2;  1WMX A;  1MEC 3;  1V70 A;  1H8T B;  3O14 A;  3OBR A;  2W1W A;  5LEK A;  1SLC A;  3WX5 A;  1XB9 A;  3K3O A;  3QCW A;  3AC0 A;  1H2N A;  3GJA A;  3H9A A;  4BDV B;  1RUF 2;  3IAQ A;  1WA4 A;  3H3U A;  1AL2 2;  3SH3 A;  3RZM A;  3LA3 A;  5EV7 A;  4M01 A;  4GB3 1;  1C1L A;  2VO5 A;  4N43 B;  4GJY A;  1ZZC A;  2ZAH A;  4LTA A;  4QQ2 A;  2VZO A;  3HBZ A;  3M1H A;  4XBL A;  4HN1 A;  4ZXK A;  3ZDS A;  1RUJ 2;  1DF0 A;  1OOP A;  1QJY 2;  4CCJ A;  5IFP A;  1BZW A;  4QT6 A;  3S57 A;  5JMO A;  4DXS A;  2AEN A;  1DIW A;  3KWV A;  5FJK A;  1TEI A;  1Q8V A;  3R0R A;  2H6B A;  1UIJ A;  5LZ6 A;  3ZYB A;  2R0H A;  2TNF A;  1O3Q A;  4NO4 A;  3N4M A;  3SKV A;  1UU5 A;  2EAK A;  2KXL A;  1LKN A;  4CDU A;  1BBT 3;  4QB2 A;  4WVM B;  4OI2 A;  2D6P A;  3NKT A;  4QHB A;  1LHN A;  4YVW C;  5LK5 A;  3ZSJ A;  3TEX A;  1QOO A;  4QM9 A;  3KT1 A;  1EPW A;  2VZ1 A;  3A0N A;  3MBW A;  3FFQ A;  4IGO A;  4AI1 A;  4CU6 A;  3KVB A;  5C3S A;  2HWF 1;  3USU A;  3K4A A;  1LOE A;  2MNG A;  1Q8P A;  1C5I A;  1QGL A;  4YM3 A;  2RJL A;  2QQO A;  5H9Q A;  4MG2 A;  5C8C C;  2DCY A;  5I0S A;  4LOT A;  1W3V A;  3R05 A;  3I2F A;  3N9N A;  1HN0 A;  1X8M A;  3BTY A;  3CJI A;  4CDW B;  3CJI B;  3HBK A;  1NCR B;  4IDZ A;  4AOC A;  1DGW A;  2BP6 A;  1OOP C;  4Y20 B;  5E89 A;  4CUG A;  4IUG A;  4AL9 A;  1YFW A;  1UU6 A;  3E6B A;  3LA7 A;  3ZFG A;  5LAT A;  3ZFG B;  3EHK A;  5A7S A;  2DVG A;  2ORX A;  5FK7 A;  1GQP A;  3O1U A;  2R06 3;  4Q4Y 3;  2ZGT A;  1VBC 3;  1F9K A;  1R08 2;  3BAL A;  1VB4 A;  4QHZ A;  4YVS A;  4M3C E;  2Y60 A;  2OQ7 A;  1UPS A;  2O8Q A;  1Y43 B;  4AHW A;  2NMN A;  1C28 A;  4AEJ A;  5FP8 A;  5IYY A;  2R07 3;  5LBC A;  4IEU A;  4XMA A;  2W1Q A;  3AZV A;  3NST A;  1UQX A;  2XKP A;  1G9C A;  1T2X A;  2HWD 2;  3MF6 A;  1J3Q A;  2UY9 A;  2WSV A;  2WFP A;  1UOB A;  3HNM A;  5J37 A;  1YCI A;  4DXZ A;  4MX3 A;  2WNU B;  2X53 S;  1UO9 A;  1QQP 1;  3ST7 A;  1KFU L;  1OOP B;  3JUU A;  3LQC A;  5FP3 A;  4AFB A;  4AVA A;  1KGY A;  5BXX A;  2RS1 1;  2ZS6 B;  3FL7 A;  3QH6 A;  4RQP C;  3IDE A;  5LA1 A;  2WZR 2;  4HPK A;  5GLU A;  3WQ1 A;  1O3R A;  2GH2 A;  4BQ1 A;  1W3X A;  2RM2 2;  4HK8 A;  5CVR A;  2RS3 2;  3CJX A;  3ZSE A;  4XOG A;  1F8V A;  2X05 A;  1DQ6 A;  5FOJ B;  2W95 A;  3L2H A;  4GAZ A;  4BQ4 A;  1VB2 A;  3DXU A;  4LOS A;  2LM3 A;  3SCH A;  1C3H A;  3P1I A;  4Z1V A;  1G6N A;  2NM1 A;  4IV1 C;  4CP0 A;  1EV1 1;  5C4W C;  4SLI A;  4M00 A;  4LMF A;  4Y24 A;  1G9D A;  1ND2 A;  4WM8 B;  3TWI A;  2WN2 A;  1ZRR A;  2VMH A;  5FXZ A;  1AXY A;  3DPR B;  4EV0 A;  3LPG A;  1N1T A;  3USU B;  1W06 A;  4AI3 A;  3C7H A;  3IIA A;  4R9D A;  1V9U 3;  3UES A;  5C3R A;  2WO3 A;  1VBE 2;  3BTA A;  5T54 A;  2CL2 A;  2WS9 2;  4AEM A;  1W8W A;  2PXJ A;  4CYD A;  5I8Y A;  4GZ9 A;  4XUQ A;  2K9Z A;  3VBS B;  4RFT 0;  1C8M 2;  3NRU A;  4QXC A;  3WF0 A;  5HV0 A;  1FMD 2;  1FOD 2;  5KC5 A;  2E51 A;  2QQN A;  3WNM A;  4IW3 A;  1LU2 A;  1TVG A;  1YO8 A;  4UW5 A;  1CON A;  3J7M A;  3TN9 2;  3JBG 1;  4K8R B;  4PQQ A;  3RNS A;  4YW6 A;  3NL1 A;  4K8F A;  2V5D A;  1MPX A;  2K0G A;  2C4X A;  2HWD 3;  2OPW A;  4UFK A;  1W9F A;  3VBR C;  2E7A A;  3TEW A;  3ZYH A;  2XL9 A;  3ZXL A;  1SLL A;  4LUK A;  4NII A;  4CEW A;  5BUV A;  4HG6 B;  3BU0 A;  1O4Z A;  1W6O A;  5DZE A;  4KWJ A;  2GMM A;  4UF0 A;  1FV3 A;  1ULF A;  4HL0 A;  1HXS 1;  2VNV A;  1J1L A;  1J83 A;  2YB7 A;  4YGC A;  5DAX A;  5FMD A;  2X29 A;  4ATE A;  4WBB A;  1QJX 1;  4QKN A;  2OX0 A;  3UT0 A;  2HWF 3;  1W6P A;  4NHY A;  5FPU A;  4RGK A;  3NMB A;  1SLB A;  1RUC 2;  4ZY9 A;  5FZ3 A;  4MXW A;  3N35 A;  4UOJ A;  4GH4 A;  1NQJ A;  3ZN5 A;  4CCK A;  4NHK A;  2XOM A;  2YXS A;  1GBG A;  3MIE A;  3U10 A;  3ZOI A;  3I3M A;  4V2V A;  5A6Z A;  2VY0 A;  1L7R A;  2FCV A;  2Q30 A;  3KM5 A;  2HWB 2;  4LUL A;  1UMZ A;  2PHX A;  4N7U A;  4XPV A;  1Q56 A;  1QJX 2;  4CVU A;  4N53 A;  2B46 X;  4UFI A;  3KF3 A;  4QDQ A;  1K5J A;  1NE6 A;  2C9K A;  2D5F A;  2I74 A;  1HXS 2;  1WLC A;  3GBF A;  4G3Y C;  2G9G A;  3WXP A;  4JGZ B;  3O1V A;  5DUX A;  5G04 L;  1N1V A;  4HT1 T;  3M3O A;  4PI2 A;  4MGK E;  5C70 A;  4OUM A;  5FZH A;  1HIX A;  3SIT A;  1VBC 1;  4EWD A;  3U4S A;  1F5J A;  1RUD 1;  3IBM A;  4YZ3 A;  3RQ0 A;  2DCZ A;  1MS0 A;  4N9H A;  1OLM A;  4YNI A;  3DPR C;  4FP2 A;  1R1A 1;  2R32 A;  3KF5 A;  1JUI A;  1LHO A;  2ZEZ A;  1RUI 1;  2R1B A;  1W6Q A;  2QQK A;  5L9V A;  1OFS A;  5JI9 A;  1LB2 A;  3T09 A;  5L19 A;  4J1W A;  3OGJ A;  3HT1 A;  5DUW A;  5A7N A;  4IE5 A;  1WUV A;  3B93 A;  1OLM E;  1TME 3;  3LOI A;  2Y0I A;  3NJY A;  2WYS A;  3OF1 A;  1MR5 A;  1RC6 A;  2YY1 A;  5I0D A;  3H8O A;  1W6M B;  3I3D A;  1CAV B;  2IUW A;  2WYF A;  3VBO B;  1YQ6 A;  1JN2 P;  3K3N A;  1I5P A;  1G9A A;  3VBU A;  2A6Z A;  5E6H A;  4FFH A;  4U2A A;  2HWC 1;  3LDR A;  3H3L A;  3VD5 A;  1GP6 A;  3AZZ A;  3OUH A;  5FRA A;  3HNB M;  2E63 A;  2Z79 A;  2Q0A A;  4Q2F A;  3I2O A;  2JIJ A;  3BCW A;  2XUM A;  3MLL A;  5IW0 A;  1ULG A;  4H7L A;  1IKP A;  2RS3 1;  2J1U A;  2ZEX A;  5F5A A;  5JVV A;  3ZSM A;  1KXG A;  4B4Q A;  5C9A B;  2WZR 1;  2D3P A;  4IV3 B;  5DDJ 1;  2E53 A;  2JG9 A;  1VBA 1;  4K40 A;  1K5M C;  1WME A;  2ZTN A;  4Q0P A;  4Z2A A;  1J84 A;  1VBB 2;  4EN0 A;  2ZGS A;  2ZPX A;  4NOT A;  4Q4Y 1;  2PAK A;  1GKB A;  4ZON A;  1IS4 A;  4K20 A;  4MOA A;  2VBD A;  1OVP A;  2WAB A;  3WP6 A;  2Y6G A;  4JKL A;  5IVE A;  3ZR6 A;  1GUI A;  3M3E A;  2P6C A;  1SBD A;  2XBO 1;  4QX7 A;  3WD5 A;  2HWD 1;  1Y9G A;  2WQZ C;  2DUO A;  4CUC A;  2QTW B;  3NVC A;  1SG3 A;  4M3C F;  4QQO A;  1IG0 A;  2XVK A;  4QPY A;  4DB5 A;  4M0N A;  2RE9 A;  4XTM A;  5FZO B;  1S0E A;  4A2U A;  4BH9 A;  4GA9 A;  3RZK A;  5GM0 A;  4Q4W 1;  4QPG A;  2VM9 A;  3SCG A;  2D7F A;  1V6I A;  1R08 1;  4L8Q A;  1ASJ 3;  4K3U A;  3TNP B;  1IOA A;  4BLI A;  4C1X A;  5FKC A;  1E57 A;  2PLV 3;  3DXT A;  3PL0 A;  1QDC A;  4AFD A;  4LO7 A;  3P3N A;  3RPQ A;  3WW2 A;  4OYU A;  2WRA A;  1HRI 1;  1PO2 3;  3JD7 3;  5JUV A;  3H7J A;  4TTG A;  1XU2 A;  3WDU A;  2AR6 A;  4Q5O A;  1ALY A;  1SCR A;  4DEV A;  2XHK A;  4JGY C;  3FHQ A;  4Y5S A;  4WM7 C;  2JEM A;  5FO8 B;  4YVS C;  3I2J A;  4FPJ A;  5J98 B;  1H8T A;  2FZ1 A;  5L7O A;  1RUD 2;  1ZYB A;  1QOT A;  3PU8 A;  3VBH A;  2HWE 3;  4AAP A;  3W58 A;  3WNP A;  3HQX A;  3ILR A;  1X50 A;  5ERL A;  5KC6 A;  2VQ0 A;  3VDC A;  2RJK A;  1NOV A;  1ZZ8 A;  4RGG A;  4SBV A;  3MV0 1;  1HB1 A;  3FLP A;  4LE4 A;  5BNO C;  1J59 A;  5EJZ B;  5ISL A;  4H55 A;  4Y5Z 0;  5APA A;  3ETQ A;  2JDZ A;  3WY6 A;  3VD3 A;  1FPN 3;  2I45 A;  4GMP 3;  3ETP A;  3GZT B;  2A3X A;  4BJ0 A;  5F3C A;  4BHP A;  1HB4 A;  3ZYP A;  4K1Y A;  4B8E A;  5FO9 B;  2B7Y A;  1S55 A;  3CKH A;  2ZAB A;  2MEV 2;  4YGE A;  4EN9 B;  1XE0 A;  2D93 A;  1RUC 1;  3KGL A;  4LO4 B;  4FI9 A;  4XF3 A;  3TN9 3;  2ZX4 A;  2P3I A;  5FMO S;  4HZF A;  4YGD A;  1PZ7 A;  3OPZ A;  3POW A;  4LK6 A;  5JOW A;  1WMF A;  4GB3 2;  3WHT A;  1GAN A;  5BNN B;  5F2W A;  2H0B A;  2BRT A;  2P4E A;  1MZ6 A;  2ZJC A;  5FPB A;  4UBG A;  4BQ5 A;  2PTM A;  1UOG A;  2VZQ A;  3KB5 A;  4F3J A;  1O3T A;  1JTZ X;  3DPR A;  5JXJ A;  4BME A;  4AGR A;  2OQ6 A;  4KBZ A;  5LY2 A;  2Q8D A;  4AZZ A;  3JB4 C;  5GLW A;  1JBC A;  1V6L A;  3GHN A;  3N9Q A;  1FAT A;  4QU1 A;  4XC9 A;  1AHS A;  5DN2 A;  4I02 A;  1RUJ 3;  1RGS A;  2GC0 A;  2A3W A;  3V56 A;  3K4D A;  4CU9 A;  1JZ7 A;  3RDI A;  2Y6J A;  5FZ4 A;  1EAH 1;  3DYO A;  5IK4 A;  3BUC A;  2GC2 A;  3RZL A;  1ULO A;  2DVD A;  2G1M A;  1LGB A;  1RYY A;  2GAL A;  4WZF A;  4TZD A;  5IFT A;  3I2K A;  4CCO A;  1A8M A;  2XJP A;  5A3U A;  3V0B A;  1UF2 C;  2QVS B;  3W5M A;  4YG0 A;  2WZE A;  1WD4 A;  1LRH A;  4C0B A;  3EYP A;  2JG9 B;  4P9J A;  3LWC A;  1WKY A;  4IE7 A;  3K51 A;  4TYS A;  1PX4 A;  5A7O A;  4O65 A;  4WM8 C;  5CKM A;  3D4K A;  4HET A;  4MAD A;  4YVW A;  1UYY A;  2GDF A;  2DBI A;  2JG8 A;  5GZD A;  4C1W A;  2CSG A;  3MV1 1;  3GCX A;  1Z78 A;  5FZ0 A;  2CAV A;  3VBH B;  2UU8 A;  2RM2 1;  2VZ3 A;  4YZ5 A;  4LBO A;  1CJP A;  4LA2 A;  2ZGK A;  2AZ5 A;  1HRI 3;  1PO2 1;  5LK7 B;  2XH6 A;  1T6B X;  4CEY C;  2HH9 A;  3ZR5 A;  1PK6 A;  4Q8K A;  1RUE 1;  3CL1 A;  4RS5 B;  1OVS A;  2PN5 A;  3ZXE A;  3VDD B;  4IES A;  3VBR A;  4CPB D;  5I0R A;  2WN3 A;  3VBR B;  4RHV 1;  3M3C A;  1HN1 A;  5AC9 2;  4HON A;  4LIU A;  3O1R A;  3NV2 A;  3C8X A;  1Q8O A;  3WZ1 A;  2JIC A;  4CDW C;  5FY1 A;  1W9S A;  3VZK A;  5FYT A;  3T2T A;  5T5L A;  3KGZ A;  3UK9 A;  3U0Z A;  4C8D A;  5FXW A;  1NCQ A;  1QNW A;  4QX5 A;  4CDX C;  4Q4X 3;  3BVC A;  1AR7 1;  4YM2 A;  1NY7 2;  2KD7 A;  3MFA A;  5LA2 A;  1J1T A;  1RB8 G;  5CFD A;  1AR7 3;  5FK8 A;  3SC7 X;  4RD7 A;  4BMB A;  1G8W A;  4ASL A;  3ZVX A;  5CNA A;  5ANQ A;  4P02 B;  4PDW B;  5A1A A;  2YGM A;  2NP0 A;  2BFU S;  3LOB A;  3ZSL A;  1YIF A;  1NA1 A;  4E2Q A;  3E5X A;  1H9W A;  1R1A 3;  2XVG A;  3MFC A;  2NMO A;  3OYW B;  4RQP A;  1S0C A;  2BQP A;  4QQH A;  3AB0 A;  4HKW A;  1IGO A;  1DDL A;  1A6C A;  3PVB B;  1XNK A;  2C6S A;  5TSW A;  4AFM A;  3VLB B;  4DXR A;  3FZ3 A;  3S0M A;  2WAA A;  1YQ2 A;  4FPL A;  3TNQ A;  4AF9 A;  2QJV A;  2ZAA A;  3CJI C;  4QPW A;  1W6O B;  1CWP A;  1RIT A;  4URT A;  1UD1 A;  3PDQ A;  1REF A;  1ENX A;  2BBV A;  3C7F A;  4CSW A;  4S2F A;  2WAO A;  4CDQ A;  3CQO A;  5JZG B;  4KGQ A;  3HN3 A;  5FZ9 A;  2D6M A;  5IVY A;  4MGT A;  2OW4 A;  3HD8 B;  1F15 A;  3OB8 A;  4BIF A;  5IWF A;  1QJY 1;  1BCX A;  2P3Y A;  3NNF A;  4DFS A;  5KXC A;  4CEY B;  2EXI A;  2R0F A;  2ZZQ A;  4AGV A;  5K8S A;  4AQT A;  3R4U A;  4FPF A;  2ZHN A;  1O8S A;  4BZ4 A;  3O0W A;  4PLO A;  3J7N A;  4LKE A;  4Q4X 1;  2YZ4 A;  4RR3 C;  4CCC A;  1AL2 1;  3NV3 A;  4CUA A;  2VNG A;  2PQS A;  1UZY A;  3PVE A;  3WUD A;  5A1F A;  1JZ8 A;  4FOY A;  1SFP A;  2X10 A;  3CBN A;  3PVO A;  4XFH A;  1O6U A;  4S2G A;  1FPN 1;  4XJA A;  5AC9 3;  5K0U C;  1IS3 A;  2CWM A;  3GAL A;  3N7M A;  3ON7 A;  5FLJ A;  2VR4 A;  2JD9 A;  4XFC A;  4YW2 A;  1PM4 A;  4AR2 A;  1K3I A;  2ZGN A;  1W9T A;  3WQ0 A;  2PAE A;  1RMU 1;  4JGZ A;  1IZ3 A;  1RVF 1;  1XE8 A;  4LKS A;  3HIF A;  1D4V B;  3L2Y A;  1CAX B;  4MHU A;  3M70 A;  2W91 A;  1F4H A;  5EJ1 B;  5GZF A;  4OMC A;  1K5M B;  2XWJ B;  2RR1 2;  3MLJ A;  2YGL A;  1OFN A;  2VNR A;  3THP A;  4TSV A;  4KQ7 A;  1U5X A;  3A21 A;  1W8N A;  3AKP A;  5EZW A;  3IZO A;  1COV 2;  3W21 A;  4GH4 C;  1O5U A;  5KXE A;  1RUE 3;  4GAL A;  2WC2 A;  1XSQ A;  1CGP A;  1H8T C;  2V4A A;  2VU9 A;  1DZT A;  1ZRF A;  3OJB A;  1QXR A;  2R1D A;  1RUG 3;  1SFY A;  2YC0 A;  4CP1 A;  1XJA A;  1WLW A;  3D3A A;  4BM8 A;  2GNM A;  4XFI A;  4JQT A;  1ZRE A;  2FDF A;  3I59 A;  2E6V A;  3I59 B;  1YLL A;  4AVC A; 
#chains in the Genus database with same CATH homology
 2VD7 A;  5FZ3 A;  4DIQ A;  4LXL A;  4HON A;  5FZB A;  4LIU A;  4CCK A;  5FY4 A;  5FPV A;  4V2V A;  3PUS A;  5FY1 A;  4XDP A;  5FZD A;  4CCN A;  5IVB A;  3N9N A;  5FY9 A;  3PU8 A;  2XUE A;  5FYT A;  4AAP A;  5FYU A;  4C8D A;  5FYS A;  5FXW A;  2XDV A;  5F3E A;  5FJH A;  4EZ4 A;  4Y33 A;  4Y4R A;  4CUG A;  5A3N A;  5FP4 A;  4DO0 A;  5A7S A;  4XDO A;  5FZM A;  5ISL A;  5F32 A;  3AL5 A;  5FYV A;  4TN7 A;  5FZI A;  4BIS A;  4LIT A;  5ANQ A;  5FY8 A;  1VRB A;  5FZH A;  4BXF A;  5F37 A;  5FZK A;  3U4S A;  4EYU A;  5FWE A;  2OQ7 A;  2YU2 A;  2YPD A;  3LDB A;  5F3C A;  4GJZ A;  5A7W A;  5F5C A;  5FP8 A;  5F3G A;  4IGP A;  5LW9 A;  4AI9 A;  2GP5 A;  4EZH A;  5F2S A;  4ASK A;  3UYJ A;  5FZ7 A;  3N9P A;  5FPL A;  4D6Q A;  5FZG A;  5IVV A;  5FYC A;  5FYY A;  5FYB A;  5FYZ A;  2W2I A;  2XML A;  3N9M A;  5F2W A;  5FBJ A;  5FZ1 A;  5A7N A;  3KV5 A;  5A3T A;  3NJY A;  4CCL A;  5FZF A;  2Q8C A;  2GP3 A;  5FP3 A;  5FPB A;  2Q8E A;  4QXH A;  2OT7 A;  5A3W A;  3AVR A;  5A7P A;  4LIV A;  5A7W B;  5A7Q A;  3N9L A;  3K3N A;  3PDQ A;  2OQ6 A;  2YBP A;  5FZE A;  5E6H A;  5LY2 A;  4HOO A;  2Q8D A;  4CSW A;  4IGQ A;  4QU1 A;  3N9Q A;  5F3I A;  5FZ9 A;  5IVY A;  5FPA A;  4GAZ A;  4UF0 B;  2WWJ A;  3DXU A;  5IWF A;  2YBK A;  2YBS A;  3KV6 A;  4CCM A;  5FYI A;  5LY1 A;  5IW0 A;  3KV4 A;  5KR7 A;  5FXX A;  4NUB A;  5FZ4 A;  5FY5 A;  3PTR B;  3PUA A;  3KV9 A;  5F5A A;  5F5I A;  4D6R A;  5FP7 A;  5FZO A;  5FXZ A;  3KVA A;  4GD4 A;  2YU1 A;  5F39 A;  3K3O A;  4CCO A;  5A1F A;  3U78 A;  3K2O A;  3OPT A;  3PUQ A;  3N9O A;  5FV3 A;  5IVE A;  5IVJ A;  3PU3 A;  4V2W A;  3AL6 A;  5IVC A;  2PXJ A;  4QX7 A;  5A7O A;  5FUN A;  4QXC A;  3PUR A;  4GJY A;  5FYM A;  5FZ8 A;  2WWU A;  4URA A;  4D6S A;  5FP9 A;  5LWB A;  4CCJ A;  5FY0 A;  3AVS A;  5FZO B;  5FJK A;  3RVH A;  3LD8 A;  5FZ0 A;  5CEH A;  4QX8 A;  4E4H A;  5FYH A;  5A3P A;  5A80 A;  5FZL A;  4QWN A;  5FZ6 A;  4UF0 A;  3ZPO A;  5IVF A;  5FZC A;  5K4L A;  3ZLI A;  4QXB A;  3DXT A;  5FWJ A;  5FZA A;  5FUP A;  4Y3O A;  5FY7 A;  2P5B A;  5FXV A;  4IGO A;  2OX0 A;  5A1L A;  5FPU A;  3KVB A;  3OPW A;  2OS2 A;  2XXZ A;  4BU2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...