2Q8EA

Specificity and mechanism of jmjd2a, a trimethyllysine-specific histone demethylase
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
344
structure length
344
Chain Sequence
SESETLNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords JmjC domain-containing histone demethylation protein 3A
publication title Specificity and mechanism of JMJD2A, a trimethyllysine-specific histone demethylase.
pubmed doi rcsb
source organism Homo sapiens
total genus 105
structure length 344
sequence length 344
chains with identical sequence B
ec nomenclature ec 1.14.11.-:
pdb deposition date 2007-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 2q8eA01
4Y3OA 5FZCA 4EZHA 3U4SA 4QU1A 4DIQA 5FZ7A 2OX0A 3PTRB 5FZ9A 5FZAA 4CUGA 5FP3A 2Q8CA 5IVVA 3PURA 5FZKA 5IVJA 3KV4A 3U78A 5FP7A 5KR7A 5IW0A 2YU1A 5FXVA 4BXFA 5FXZA 2OQ6A 2PXJA 3AVRA 2WWJA 3UYJA 5A3PA 4HONA 5CEHA 4QXHA 5F32A 5FZ6A 5FZOB 5FXXA 2OQ7A 5FPLA 2YU2A 5FYIA 5A3NA 2OS2A 4V2WA 4ASKA 5FPVA 2Q8DA 5FXWA 2GP5A 5FUNA 4HOOA 5FY0A 5FZDA 4URAA 5FBJA 5FZIA 5A1FA 5LWBA 3KVAA 4AI9A 2OT7A 4QXCA 3DXUA 4XDOA 4QX8A 3PU8A 5K4LA 5FYUA 5FZEA 2YPDA 5A1LA 4C8DA 4Y4RA 5F3EA 5FP4A 5FYCA 4D6QA 5FYZA 4IGQA 5FJKA 3N9QA 5FZFA 5FZOA 5FZ1A 5FWJA 5IVCA 4GD4A 4Y33A 5FPAA 4EZ4A 5F2SA 3LDBA 3PUAA 4CCJA 5FUPA 2XDVA 4IGOA 5FZHA 5FJHA 4QXBA 5FV3A 4BISA 3OPTA 5F3GA 5A7WB 5FZ8A 5LW9A 4GAZA 4LXLA 4CCLA 4CCOA 5A7NA 3PU3A 5FZ0A 5FPUA 4NUBA 3K3OA 5F5AA 4CCMA 2VD7A 2YBKA 5F2WA 2W2IA 3DXTA 5FZMA 3AL6A 3PUQA 4GJYA 5F37A 3N9LA 5FPBA 5A3TA 5E6HA 5FYBA 5F3CA 5FYSA 5FZGA 5FZ3A 2XMLA 4CSWA 5LY1A 5FY9A 4CCNA 5A80A 5FY1A 5FZ4A 4D6RA 4EYUA 5F3IA 5F5IA 4D6SA 5IVEA 5IVBA 3N9OA 1VRBA 5FYVA 3PDQA 3RVHA 3K3NA 4GJZA 5A7OA 3OPWA 4CCKA 5FYMA 2YBPA 3KVBA 4LITA 4UF0B 3AVSA 3K2OA 3KV6A 5IVYA 3AL5A 2XXZA 2GP3A 2P5BA 5FYHA 3PUSA 3KV5A 4BU2A 5ISLA 4DO0A 4QWNA 3LD8A 5A7SA 3ZPOA 4TN7A 4LIUA 5FY7A 4AAPA 4IGPA 4E4HA 5FZBA 4XDPA 5FY5A 4LIVA 5A7PA 5LY2A 5FYYA 3NJYA 4QX7A 2XUEA 5F5CA 5FYTA 2Q8EA 3N9NA 5A7WA 4UF0A 5IVFA 4V2VA 5IWFA 5FWEA 5A7QA 5FZLA 2WWUA 5F39A 5FY8A 5FY4A 3KV9A 3ZLIA 3N9PA 2YBSA 5FP9A 3N9MA 5FP8A 5ANQA 5A3WA
chains in the Genus database with same CATH superfamily
2TBVA 4Q5OA 3N36A 1R083 3WW1A 5C3SA 3U4SA 3VBUC 4CDXC 1IKPA 2OIIA 2XONA 2FDHA 1RGSA 3A0KA 1WLTA 4EWAA 2BVVA 2D3SA 2ZJCA 4HVQA 5K0UB 1GOFA 2TUNA 5D1IA 5DZEA 1QH6A 3T3YA 5GZGA 3I8TA 4COZA 5IK4A 4M00A 5FBZA 4AVAA 3UYJA 2KA3A 1LR5A 3WQBA 5CEHA 5L19A 1N1SA 1VBE3 4UFJA 2P6HA 3ACLA 1R092 4RL7A 4GZ9A 3NNGA 5FXXA 2YU2A 1NA1C 2J1EA 1HB3A 2VCCA 4LORA 4ASKA 4K6BA 1UAIA 4GWMA 3D6EA 4FVVA 4AEDA 3ZXGA 5JPNB 4AI9A 4CA9A 4FBFA 4HLTA 5E16A 5BNNB 5L9BA 1DGRN 4CU7A 1ND3C 4QDSA 1JU3A 4TWTA 3WG3A 1E57A 1MACA 2ZGTA 2IZWA 3D3AA 5DG1A 4HK8A 1RHI1 5FZ1A 1O3QA 4EZ4A 3QACA 4YZ1A 2DUQA 2A3YA 4LK7A 1ULEA 1DLCA 4HVOA 2Y26A 3HN1A 4IGOA 3HOBA 1N47A 2JKXA 1BVP1 4Q4W3 2RM21 4N9HA 5BNOB 1J3PA 2XKPA 5L73A 5GLUA 1YRZA 3CZUA 1J58A 2CV6A 2GALA 2VE1A 3MGUA 1WW7A 3OOXA 1W8TA 3NJXA 3GHMA 4IDZA 2IXLA 2QUOA 1CGPA 4QT6A 4B4PA 5F37A 1DGWA 1IQDC 2HEYF 1TME3 2WO1A 5E6HA 3ST7A 4MXWA 1Q8SA 1XQNA 4FOWA 4OYUA 4CCNA 4IV1A 4AYUA 5C71A 5A80A 3M3OA 4FPKA 4RGAA 4RQPB 4CEYC 1T2XA 2Y64A 3WNKA 5JMOA 3P1IA 4JTNA 4X6RB 4X8PA 2VCBA 4OHWA 4AEKA 4N90A 3SH4A 5FMDA 3POSA 4BQ5A 2RJ2A 2FHRA 3NNMA 3MYXA 2XR4A 1QNWA 2Y8KA 5C8CB 2JX9A 3AL5A 3RZKA 2ADEA 2ZEXA 5FQ0B 2P3JA 3WP6A 4IEPA 1IS5A 5DAVA 2XOMA 5EP9A 1QJY3 1PNGA 1K5MC 3V0BA 3MIBA 1OD5A 1QJU3 4Q0QA 4XF0A 3NNLA 2AUYA 2FCVA 5EYXA 3L9JT 1MS9A 4NROA 4LKDA 5A6XA 3MIEA 4DFSA 4YW5A 4EWEA 3FN9A 3T4HB 1G7YA 2Q1FA 5DXDA 4FAHA 4LO6B 4RFRB 4DXSA 2OZJA 1OQ1A 3J9SA 2WT1A 4GA9A 3BGAA 4A3XA 1IGOA 1MEC3 1MS8A 1RVF2 4Q4V2 1KGYA 1AXKA 1Q8OA 4UT5A 1CAXB 3M3CA 4Q1PA 3VBFC 3VD4A 1EAH2 3NKTA 4YRDA 1UY4A 1QMJA 3M7AA 2FZ2A 2PYTA 1GANA 2B45X 1JU4A 3MLJA 1HLCA 3VLBB 5FZCA 5K0UC 3ZFGB 4QGNA 2DVDA 3T0DA 3BODA 5FZ7A 2QQLA 4META 1EV13 1SLLA 2XVKA 4B1MA 1HQNA 4QX2A 3PVNA 5B4NA 2HYKA 1O8PA 1XNBA 4CEWA 3O14A 4DZGA 2A73B 5F32A 3FC0A 1AL23 4IXLA 5FPLA 5A3NA 4YVSB 3U11A 2GMEA 2MEV1 3O1PA 4UFHA 4BYYA 4KBBA 5LA2A 5BNNC 1JYWA 2BYVE 2B5HA 3AMHA 3SMHA 4J25A 3WNNA 1H1AA 4LKEA 4H55A 1YFXA 4HZFA 4S2DA 1LGCA 4B4RA 1Y9MA 3O1VA 3QBQA 3DV8A 1HN0A 1ULPA 4TSVA 4B1LA 1PHMA 3CJIB 3ZKYA 1YYNA 4YM1A 4M4RA 4N53A 1LECA 5F3EA 1AR93 3UGGA 4WM8A 2CWMA 1WLWA 1RUE2 2DBIA 5CKMA 2WNUB 1SG3A 1TMF2 3TEWA 2V73A 1PMJX 2ZBJA 1UKRA 2P1BA 4HPKA 4DUVA 5BNOC 1IPKA 1W6NB 1WCQA 1ZRCA 1PIV2 5L7OA 3R6SA 4OZOA 4QXKA 2RV9A 3OBZA 5D21A 5LBFA 3VKOA 5A7WB 4YNIA 1UW8A 4AVBA 2R7EB 2BU9A 4O9EA 2GC1A 3R4UA 5C3RA 3Q8BA 3ZMOA 4MVTA 4E4ZA 2ARAA 2JB4A 2VMFA 4FAGA 3SNMA 4NIHA 4YGCA 5FZMA 1NLQA 1W2TA 3KCCA 3PUQA 1WW4A 3TN92 4AI2A 4RQPC 1JW6A 3VZNA 5JR2A 3JQXA 4IESA 3WG1A 1UZ0A 1NXD1 3RPQA 1QXRA 5D8AA 2ZKNA 1OH3A 3SLIA 1AUYA 1PO11 2UWCA 3VKLA 2JDZA 3ZDVA 1W0NA 4QPGB 1F15A 1VB4A 2ZABA 4YVWA 5C8CC 2QZ3A 3BIEA 1D4M3 1VRH3 2RS13 3KVBA 2JICA 3BTYA 3OUJA 3JQWA 2VQUA 4QB2A 4XOGA 5SV5A 4XFFA 5ERLA 4FTSA 1GP5A 2XB6C 3LDRA 1FPN3 5FTTC 1M06G 2JDMA 5A7SA 4NIAA 3WF4A 4AVTA 2ZHMA 4LIUA 5T52A 3K48A 3MICA 3VBSB 3IBMA 4FPEA 1JUIA 4MGYE 5CYYA 1ST8A 2GNMA 5CVRA 5ABJA 2DV9A 1OA4A 1Y9QA 1G9BA 1NQDA 2YZ4A 5EXOA 4JKMA 2JD4A 3N9NA 2Z4FA 3I2IA 3RGBA 3H8XA 3V56A 1H1MA 1UU6A 1US2A 1ZBA1 3VD5A 3MUY1 3W9AA 4JZRA 3ETQA 4QKBA 4QMAA 5JSOA 3ZFGC 4E9KA 3N9MA 3WCRA 2GH2A 2BNNA 2DTWA 3BOWA 2R1DA 4DIQA 4UI9L 1BK1A 3EB7A 4IEUA 3WQ0A 4AI1A 4Z2WA 1OLRA 3MI8A 2WFPA 4GB32 5CADA 2HWE2 1C57A 2OQ6A 3AVRA 4YVSC 4HONA 1W06A 2ZGMA 3KQRA 4QXHA 2VPVA 3NSTA 5IUQA 3AZWA 1W8ZA 2CTVA 4YYOA 1FXZA 4L11A 5KXCA 2NLRA 4DUWA 1NG0A 1LEMA 1QJEA 3VBRB 1DQ0A 1NY72 4XUPA 3JD73 3LA2A 5FZIA 3VL8A 3IM0A 1N1VA 3V64A 3CJIC 4EROA 1PVC1 1OHFA 2OUHA 2YC2A 1YFWA 2D5FA 3GCWA 2CAUA 3WNPA 4Z92B 5C3PA 4BQXA 3MIHA 3MIFA 1H1IA 4XF9A 2WNUC 5T5LA 2VQTA 4XUTA 3ILRA 4GWNA 3O0VA 2RMU1 1F5FA 3S7IA 4KBZA 3RZLA 3PVOA 3VV1A 5BYNA 1UOGA 3H8RA 3B7MA 5BNPC 2RS53 3CMGA 3CIHA 3WNXA 1PX4A 1UZZA 4GWIA 4Q0PA 1ZRFA 5FZHA 2HWC2 2VW1A 5FK8A 5C9AB 5LEKA 3CLPA 2NYYA 3ZYIB 3LSEA 3BKZA 4CP2A 3S57A 2NQYA 2HWB3 3WF0A 4YG0A 5H9RA 2W92A 1VBE1 5FZ0A 2EIEA 2JG8A 1G8WA 3AKSA 5A3MA 4NJ4A 2J1SA 1NCRB 2VD7A 3B02A 1J83A 2R0FA 1DHKB 1ZYBA 4IV3B 4Q0UA 4FP2A 1H8TB 4D0QA 2BRTA 4LBLA 3S7EA 4XAEA 2LM3A 2QJVA 5EV7A 1ACCA 1O59A 4HSJA 1DQ5A 4PI0A 4QPGC 5LA0A 2CL2A 1Y9GA 1VB2A 1LKNA 2PLV3 2ZGSA 3OBRA 3GJBA 4DMIA 1W8HA 4DB5A 4U2AA 1AZDA 5LASA 1LOGA 2EF6A 4YZ2A 3MIGA 2E51A 3THDA 2C5DA 3KV5A 1KFXL 1VBB3 3VBSC 3SEEA 2WN2A 3EQEA 4Y1XA 2OVUA 4Q4W1 1L7LA 1PO23 5CB7A 4TTGA 1MZ5A 5EHDA 3O1SA 2WZR3 1W2AX 2DVGA 1O3RA 4CVUA 2UY8A 4COUA 3E6CC 4MOAA 3RG0A 2BWAA 4WV8A 5CAZA 3KSCA 5LBBA 1GR3A 3K4ZA 5FO9B 2WUHA 1J84A 1C5IA 1GWMA 1WA6X 2JWPA 4QQHA 4YM0A 1ZRRA 5IVFA 1NYWA 2C24A 5JIAA 1UMHA 2YB7A 4JRAA 2PAEA 2ZTNA 1DP0A 5FY4A 2K0GA 1O5UA 2FMYA 1NXMA 3WF3A 2PTMA 4CUBA 1I6XA 3NJVA 4MSVA 1JZ8A 1J3QA 1PGSA 1HKDA 5AC93 1UCXA 2ZMLA 3WHTA 5JZGB 1VAMA 3HPNA 5IT6A 1GNYA 2OXBA 2CU5A 3KZ4C 1UPIA 1LODA 2ZX3A 1U5XA 2Y34A 4OHXA 2R072 1JHNA 1MVQA 3AFKA 3WLUA 2R043 4IEOA 1RUI2 2YU1A 4GH4B 3W58A 4EN7B 1QJY1 4FSJA 1CJDA 1DBNA 1H2KA 1QJU1 3DYPA 1RUD2 2EAAA 3N3HA 3Q8CA 2ATFA 4L8QA 4UBHA 5FZ6A 1FI2A 2WFF3 2IXIA 4WVMA 3VBRC 4CE8A 4OUSA 1Y3TA 4O61A 1O8SA 3FFQA 4JCKA 1MZEA 5IK8A 3H3ZA 3SEPA 3SCGA 4CU6A 5F1RA 2HYXA 3LA3A 2GAUA 2WLPA 2XVLA 2R063 1FMD3 1MEC1 3AK0A 3GM8A 1RUI1 4XILA 1VMJA 3RRDA 1NCQA 4NE9A 3SKJE 1SZBA 4E4DX 3SITA 4TLFA 5FLJA 1JYTA 1A3KA 1FT9A 2NP0A 2A6VA 1XNCA 5FYZA 3CL1A 4JVAA 5BXXA 3S5AA 3B01A 4I01A 1J3RA 5C9AC 2FDJA 1CIWA 1DZTA 3JCIA 3LDBA 4ORFA 3S5QA 4YW7A 4ZZ8A 3O1UA 3DL3A 5APAA 3MZHA 4LBNA 5FV3A 1RUC3 4N43C 2FDKA 1R093 4BA6A 1PGW2 3ZKUA 3VD9A 4HBNA 2XLFA 4YM3A 2DCJA 3FUOA 4GAZA 2D3RA 1NCRC 3GXUA 1V6NA 2JDUA 2GN3A 3PU3A 4IV3C 2D44A 4ZXEA 5CKNA 2BGOA 1H8TC 4P00B 2Y0OA 4OULA 4P9XA 4NHXA 4PHZA 4GJYA 2P3YA 3WUCA 1ZA4A 1YQ8A 2YGLA 5A3LA 4GKYA 2FZ1A 3CDZB 1C8M3 1DQ1A 2GH8A 3HR9A 2XWJB 5F3CA 3W59A 2XMLA 4ES8A 2BOIA 1PGW1 4NWWA 4D8MA 3IT8A 3ZN6B 2JDAA 4CPBD 4YFZA 2FDGA 4CDWB 2QBXA 2VBDA 1W8WA 2YXSA 1RXFA 3N9OA 4HN1A 5FYVA 4E8DA 1OPMA 1AR91 2CDOA 4OQ9A 4QQLA 2VQ0A 5A33B 2E9QA 1H9WA 5FRAA 2VZ1A 3LIGA 3MFAA 4M3CB 4O9GA 1AL0G 3AJYA 1L7RA 3UETA 4J6GA 5JI9A 4JGZB 4N8MA 1IPSA 4WVVA 4AQ6A 1U0AA 2VECA 4XUOA 2RS33 3I59A 2O8QA 1OOPB 1G9AA 5AVAA 3KGLA 3NMBA 3MO4A 4KU7A 1DQ2A 3BTXA 2PAMA 1DFQA 1GFF2 3X29B 4KH9A 4BZ4A 2WWSA 4FPLA 2D40A 3KCXA 3GALA 2MHFA 2X29A 4UFKA 1H9PA 2CSGA 4LA2A 4XF3A 3AP6A 2ZAAA 3P5BA 3JB4C 4YGBA 2VGDA 1DYOA 4GMP3 4O7XA 4QU1A 1VRH1 3PTRB 5HXVA 1ODNA 4GH4C 2Q8CA 3ZVXA 1NZCA 4RSUA 4YW6A 5IVVA 2GC2A 3JBG3 3IAPA 4NHMA 4B3NA 1NT0A 1YI7A 4QHZA 2JXAA 1EUUA 2G19A 3LB9A 1FPN1 3TWIA 2PXJA 1VBD2 2ZGNA 2VQAA 5DZGA 1YQ6A 3ZFFA 3A4UA 2EVXA 4ZS3A 4C0BA 1D4VB 1PZ9A 3TEYA 4XJZA 3FJSA 1LTEA 4XQWA 5JAXA 1JH5A 5FBJA 3I2FA 4LE3A 3P3NA 4QHBA 4XIKA 3QCWA 3J7HA 4AGVA 2P17A 3POWA 4YZ3A 3O12A 1XYOA 4CDQB 4ZKTB 2RDRA 1QH7A 2EAKA 1TNRA 4H14A 4Y4YA 2E7TA 1S55A 3VBUA 1CWPA 2B42B 2W95A 4I02A 1YLLA 3KGZA 2ORXA 3PLQA 1JZ5A 4AVCA 4C8DA 1C8NA 1O4TA 3UK9A 1RUF2 3IDCB 3WD5A 4GMP0 4IGQA 4XABA 1JYIA 4XE9A 3CHXA 2D6KA 3J8F2 2Z2SB 1H30A 4OZXA 4UFIA 4ATEA 3UL2A 3PUAA 1W8NA 3R05A 3AM2A 1UN1A 1NA1A 3MLKA 4TZDA 3GHNA 1W6MB 2WO7A 5F3GA 4A3ZA 1BMV2 3O1MA 1QY4A 3LDKA 1LGBA 3W5MA 1OXCA 5DAWA 4ARXA 1RYYA 2RDQA 1UO9A 2A75A 4RFT0 3BPZA 4HL0A 3DXTA 3OD0A 1A78A 4CDUB 1ASJ3 3CZJA 1R1A2 2KD7A 1SDWA 3NL1A 1JTZX 1RUJ3 5EJ3A 1SPPA 2ENRA 3JD71 1OKQA 3ZXDA 4AFDA 4BH9A 4OI2A 1BMV1 5I91A 1RMU3 1DYKA 1S4CA 1FOD3 2EXKA 1ULFA 3CF6E 1HB2A 1YO8A 4O65A 5HI0A 1EYBA 1OUSA 1XSQA 3V0AB 5GZCA 3VN4A 2GZWA 1WGPA 1XU1A 1H6YA 3WV6A 2ARBA 3N4MA 2A7AA 2YROA 1NKGA 4X6QB 4LO7A 1NLRA 1OVPA 2WAAA 1A8MA 4AE2A 1UPSA 4HMZA 1AF9A 5DG2A 3ZN4A 2BWCA 5CKQA 4CP1A 4XFCA 3OPZA 4D7TA 2F4PA 4JGZC 2GP3A 3OGVA 4P9YA 3UESA 1OKOA 3ZFEB 2E33A 3N7KA 5HCAA 3TNQA 1UKGA 4NVPA 4ZS2A 4A2UA 3AB0A 2DURA 4RA0A 4BK4A 3WW3A 4I2OA 4NR1A 5IHRA 2HWB1 1HV1A 1OOPC 2WO2A 3M8LA 4UW6A 5DZFA 3VHOA 1PVXA 1RINA 1G9DA 3NRUA 4AFMA 4L9BA 1SLTA 3K46A 1CD3G 2GC0A 2V4VA 1CAWB 5GLTA 3UKNA 4UFLA 5IK5A 1VBC2 1MR5A 1GZWB 5GM0A 5IWFA 2PHTA 2R30A 1BXHA 3K75B 4MGIE 2WWUA 4Q26A 5A6ZA 2ZMKA 5LK5A 2VUAA 1W3VA 3ZLIA 2WSUA 1CAVA 1PGL2 3DKWA 3RMXA 4PQ9A 3VZMA 5FLHA 3I2DA 5ANQA 1RUG3 1W6PA 1BBT2 1NAEA 4QX0A 4XUQA 1W8FA 3OGSA 2PLV1 3LEKA 4RHV3 3SQOA 4AF9A 1H8VA 2OA2A 3DKQA 4AGGA 4BE3A 2AGSA 2WRAA 2JENA 3NW4A 1W9YA 4Q8LA 1JUHA 3B5LB 3T0AA 2UYAA 3NWKA 4JKKA 1VBB1 1PGL1 4FPYA 1MQTB 2WIIB 2F17A 1GKBA 4KI5M 2O0OA 1DG6A 2WWJA 2ZHNA 3EHKA 3GZAA 3NQHA 3LFMA 4Y20A 5FZOB 4CTEA 3H8UA 2WZR1 1W9TA 1QJX2 3LEIA 5FK7A 1UY0A 1VMFA 1B35B 2ARXA 3GZTB 3DEMA 1CVNA 1V6LA 2E53A 1WD4A 2WR9A 5B2GB 2OKXA 3VBFB 2VUCA 2ZGKA 3Q8AA 5IAVA 1S0CA 1P8JA 4AAXA 2VC9A 3GBFA 4F7ZA 1QJX1 4BWOA 1F9KA 5FOBB 1Q8VA 4NIDA 1HXS3 4YG6A 4AOCA 5C4WB 4RS5A 4IERA 5AC91 4ZPIA 3VZOA 1QQP3 1X50A 3HQUA 2VOXA 4DEQA 4XQ4A 5FO8B 1AYN3 1G9FA 3QH6A 3OY8B 2WNVB 2ZX1A 4AFCA 5JWPA 3PTYA 1Q56A 1LCLA 4BLJA 4DOUA 1KRIA 2X5IC 3DF0A 2R041 1RHI2 3BN6A 4BB3A 1KS4A 4AGRA 4XFHA 2PHDA 4IEZA 4CCLA 1LENA 2DBNA 4E4SA 3HD8B 1W8OA 3M70A 4CDUC 2DTYA 3WCSA 2HWD3 3NAPB 3K3OA 1UU4A 4Y1UA 1Z0HA 2WFF1 4MHRA 2ADDA 1V6OA 2VY0A 5T3NA 4CUCA 5CFDB 4AVSA 3AXEA 4YW2A 2VOKA 1V6KA 1GP6A 1LOFA 2RM22 3SHRA 4QQOA 5FCCA 5J48A 4I0AA 3V65A 2R061 1FMD1 3JU9A 5SV8A 2VU9A 3C7FA 4MXVA 1AR63 5T5OA 4XXPA 5F6KA 3JZVA 2NMOA 4LBQB 3PIGA 3T1MA 5EPAA 4NHYA 3ILNA 3K3NA 3O0XA 2BDRA 1AYM3 3APBA 4CCKA 3AXDA 1G6NA 3MW3A 2PHWA 4HFSA 3DPRA 3ZFEC 1JMUB 3M3IA 4Q4Y2 4HETA 4JRLA 1RXGA 3AVSA 4LO4B 4EQVA 2CNAA 3VZKA 2XXZA 2NM1A 4KGGA 4CXYA 2ETEA 1RUC1 3TEZA 4I30A 4PLOA 1OVSA 4Q27A 1AVBA 4UW3A 4LNVA 2P3IA 2XHNA 3M2MA 1ZBE3 2V09A 3U07A 3IKWA 3RYRA 4MX3A 4PDWA 4LTAA 2X09A 4Q4Y1 5LY2A 2UWBA 1YHFA 4LK6A 3UKTA 4V2VA 1C8M1 1HX6A 5CFCA 1CAUA 2UWAA 3CBNA 4XJ8A 5C8CA 4Y24A 4PIYA 4K7JA 4KWKA 3INAA 3KT7A 4YLZA 5FQ0A 3ZR5A 3E6BA 1ZZCA 1GOHA 4XJWA 4AK3A 3IIAA 3MV11 1Z7S3 2VNRA 5J3UA 3BIWE 1FATA 1X9PA 1H2LA 2RDSA 4RR3C 4Y3OA 4FFHA 3E5XA 3VDBA 2VTXA 3MLLA 1W99A 3IPVB 4QM8A 5J96B 2CDPA 2WC2A 4ZZ5A 2W68A 3NV4A 1HRI2 1MQTC 5FP3A 1W0PA 3SCFA 2B9VA 3UV9A 3LZZA 2WL1A 5FR3A 4BXFA 3KWVA 5FXVA 5IK7A 1R64A 1ND2B 4XJ9A 2A5ZA 3HJRA 2HEWF 1B35C 1N3OA 4TYSA 2RS31 5FPZA 5ACA3 2Q5TA 3FX3A 4IE6A 1IS3A 4CUAA 1OSGA 1ENXA 1OUXA 2B39A 4GKXA 2Q8DA 4EN0A 5FMOL 4ZXKA 4ATFA 5FY0A 3LKJA 4OMDA 1HRI1 4DINB 4XUNA 4IW3A 3URFA 1ZA7A 2OT7A 2XBO3 1GWLA 4QXCA 3HBKA 2W91A 2J1VA 3VKFC 3FE5A 5CZKA 3E5UA 2BUKA 3OBAA 5C4WC 1AR83 2MEV2 3NNJA 3I2GA 5FP4A 4BDVB 4F3JA 4Q4X3 2RE9A 1OI6A 2VVDA 3MBWA 1UX7A 4AW7A 3ZXEA 2WNVC 4GMP1 5F2SA 5BY5A 1KDMA 3NV2A 1J59A 4XETA 4DRVA 3ZOIA 5DAPA 4AQSA 1YUDA 1VJ2A 1COV2 1JYXA 1POV3 1VMHA 3NAPC 1TEIA 5A32A 1VAKA 4PCRA 4P9IA 3MDPA 1RTVA 2OYZA 3NV3A 3RJRA 5CFDC 3CJIA 5A70A 3VDDA 1YC61 3AYAA 1HQLA 3S30A 5JOWA 3EJKA 4LEJA 2FDFA 5C70A 4QX1A 1COV1 3WHUA 2HWF3 5FZGA 3OG2A 3KS7A 4HANA 4NO4A 2JEMA 5EJ1B 3RSJA 1F4AA 1V6MA 1WLCA 2J7MA 1QOOA 2LW8A 2UU8A 3OEAA 4UOJA 3THTA 5JSPA 5FY1A 2BV4A 1S0FA 5E1RA 2A3WA 4D6RA 2QQUA 1OF3A 1NOVA 5IVBA 1JS9A 3BU0A 3PDQA 2J1TA 1BEV3 2VVEA 3LQCA 2GDFA 3M3QA 5BNPB 3MPPG 2XJPA 2AENA 1XBFA 4AEDC 3RI8A 5A3OA 4BIOA 1OBNA 3H50A 1L3JA 4HSLA 3LE0A 4A6OA 4W6WA 1PO12 2ZGLA 3PUSA 1OQDA 1GNHA 3RDIA 2AH2A 1TQ5A 4XW3A 4XAAA 5I93A 1W6OA 3AZYA 1WBFA 3ZIWA 2EIBA 4BQYA 4COVA 2OPKA 4UW5A 4QPGA 1ZZ7A 4WM8B 2J42A 4LKFA 4UWDA 3ZXKA 1RUJ1 4ZU5A 1QWRA 3POEA 3BB6A 3ZO0B 1RMU1 1UMZA 4QDRA 4HXCA 4CCEA 2ZGOA 3WQ7A 3B9IA 3VZLA 2JE9A 1GZTA 3LEMA 3ZXAC 1V9U3 4LO5B 4XFIA 1XNDA 3H3LA 2D7FA 5HCBA 2Y60A 2P4EA 1DGLA 2WQ8A 1UF2C 3OF1A 4HKWA 5IFTA 2AR6A 4LKSA 5FZ9A 3VDCA 1ZBA2 4YM2A 3UNPA 5JXIA 1AR73 3SXWA 4OI0A 1ND2C 1C1LA 1C1FA 1OMIA 3A7QA 5DDJ2 2W87A 2Y6HA 4K9SA 3MW2A 4OFGA 4WZCA 4NN0A 2XJUA 5FXZA 3U37A 2P6CA 3A0NA 2UURA 5D8AB 3WDYA 4CU9A 2QNKA 4V2WA 4MGQA 2GP5A 3H1MA 1S2KA 3T2PA 4CP9B 4IEVA 4YVWB 2AREA 4LBQD 2RR13 2C1FA 3OCPA 5EQUA 4CPBA 1V0AA 4P9GA 5LWBA 5DDJ1 4XDOA 2XVGA 2ET1A 5K4LA 1V70A 1Q43A 1ZRDA 4NRPA 2MNGA 1XE8A 2VCAA 1QNYA 1VAVA 3AP7A 4MUVA 3MEPA 1YJLA 4GD4A 3Q9OA 4XFGA 2W1QA 1CJPA 2D6OX 1PVC2 3PUHA 2B9UA 2BNOA 2Y38A 2QQNA 4H7MA 3LOBA 4QKDA 2Y6GA 1JYVA 2YC0A 3VBRA 5ABJB 2X8KA 3KF3A 1OC1A 1HJGA 2RMU2 4I3PA 1LRHA 4K1ZA 1PZ7A 1S0GA 2A6WA 2WQ4A 1SLIA 3C7OA 3DGTA 4NHLA 1R082 4IUGA 3RS6A 1IZ3A 2ZGRA 3MW4A 5FAXA 3O1OA 5JXJA 4FP3A 2A3XA 1NLSA 2YPJA 4Z82A 2UY9A 2W47A 5CBLA 1E5SA 1RJ7A 4FPGA 3C2UA 3FLTA 1SLCA 5FZ3A 4Z1VA 3MIDA 3O5SA 1VBE2 3D0SA 1JYNA 1WKYA 2ZGUA 1GNZA 4CEWC 5FZ4A 1R081 1VBA3 4D6SA 4WBBA 2WS93 5HV4A 4LBOA 5G05L 4N7UA 4XMAA 5A7OA 2PA7A 1YI9A 1W6QB 5JLVA 3KT4A 2YBPA 5KHGA 1QQP1 1UZWA 4NWVA 5CG8A 1XNKA 1OA2A 4AI3A 1OFNA 1AYN1 4AWDA 4N43B 5FYHA 1XC6A 2J22A 4BU2A 1EP0A 3MFCA 1IKQA 1XSRA 1Y43B 1D0HA 5FFOC 1F4HA 4KWLA 4E2QA 5JPMB 5E88A 4IGPA 5HCFA 3I54A 4BMEA 4WM8C 5A7PA 2HWD1 4LIVA 3WDXA 1C3HA 3FHIB 5HBAA 3VBOB 4COWA 3GBGA 5FYTA 4CXWA 4Q4W2 2ZZQA 4H2AA 3HVDA 3ON7A 2VXJA 1LULA 2LTNA 4PLMA 1YQ2A 4Y1YA 4DQAA 1QJFA 2B4KA 3POIA 1Q8PA 4FXKB 1EPWA 1K3IA 4JKLA 2ZS6B 4JC1A 1AR61 1YQ5A 3ZYHA 1UOFA 4KQ7A 1GSLA 3T2OA 1TME2 5H9QA 1AYM1 3OUIA 2D98A 3H7YA 1QU0A 1QDCA 1Z78A 3ZDSA 3KHCA 2OX0A 2BEOA 3KMHA 4QDQA 4C90A 1C4RA 5FDBA 1W28A 1ULGA 2LRPA 5LRSA 3O1TA 2IXKA 2WJSA 3ZSKA 1XYNA 1J1LA 3N35A 1UOBA 2WZ8A 2J1UA 5D8AC 2DDUA 3ME2A 3PHMA 2JB8A 1U5IA 5JVVA 2BJSA 1TME1 1F35A 4YVWC 2WBKA 4OUMA 1HJFA 2QQIA 2HBTA 1OQEA 3F95A 3MUZ1 4Y5SA 4QX3A 4YWAA 5JZGA 2XUMA 3B9CA 1QJY2 3H3UA 2CGNA 3VD7A 5I0SA 4EE2A 1RUH3 1QJU2 3VBHB 3I97A 1BK0A 1JHJA 1UIKA 4OCTA 2QE3A 2WA4A 2EICA 2Z42A 3OYWA 3D8CA 2VBPA 2DVAA 2EIDA 4ZU7A 1KDKA 1DQ4A 1Z7S1 2JDYA 3N9QA 5IVCA 1HRV3 4Y33A 1MZFA 1X9TA 2W3JA 3OEBA 5CNAA 5ABJC 1MEC2 1UYZA 3WDTA 4KG8A 5FPXA 2BOJA 1ZZ6A 3WT3A 5FUPA 3RI9A 3PVEA 2JECA 4SLIA 4U36A 1QHDA 1UZYA 2Q1MA 1CIYA 2ZHLA 3DYMA 4MG2A 3DCQA 2WINB 2Y0IA 3OJBA 1F5JA 1QIQA 2AYHA 3WDVA 1M4WA 1YWKA 3UJOA 1SMVA 4NUBA 1J1TA 3JUUA 4QU2A 2EIGA 1EV12 2G4IA 4JHTA 4Y22A 4D7YA 5ACA1 2DCYA 2VNGA 3ACHA 4QB6A 4DXRA 3N9LA 1OLQA 1SBFA 2JDKA 4XPVA 2ZA9A 4AHWA 1MS3A 1B09A 1S0IA 5KC6A 2JKBA 2RVAA 4PLNA 1HW5A 3VD3A 4EN6B 1EUTA 1AJKA 1CPMA 4QPIA 1CESA 3E1F1 3OSDA 1AL22 3BTAA 1S1AA 5F3IA 3Q8EA 4OI1A 3VGIA 4BCUA 5IVEA 4UW4A 1AR81 3AJZA 1K5JA 4ITCA 2DWRA 4MH0E 5DAXA 1EV11 1QXPA 1S0BA 3MPBA 4Q2FA 4FXGB 5FYMA 2XL7A 3A23A 4WVMB 3USUB 1SQ4A 2A71A 3K2OA 4LLFA 5FREA 2ILMA 5C8WA 3FFZA 2PMWB 3LGRA 1D0GA 1POV1 1AL21 4IE5A 5GZEA 1LJ7A 1AR92 3H1WA 3EBRA 3J7NA 3OGJA 1UMIA 5LRRA 1JOPA 2P3KA 4JDNA 3ZN6A 1V6JA 3ZPOA 5KHIA 3VBOC 4AHYA 2D3PA 3AP4A 3LF7A 4A41A 4CDWA 1X82A 5CG9A 3ZR6A 3VL9A 4P5HA 3SCHA 1U5ZA 2R0HA 3NJYA 3MF6A 2YC4A 3E5QA 1UXZA 3T2TA 2Q8OA 1WMDA 4N9IA 4D7SA 2EXIA 2HWF1 1QGLA 4M3CA 5GLVA 3JXSA 5F39A 3WSOA 2K46A 4P9WA 2DYCA 5LBCA 3N9PA 1SEFA 5LATA 1BJQA 5JCTA 1XB9A 3LEGA 1CQ9A 2CHHA 2VZQA 3DUIA 4JGZA 3WDWA 5A3WA 1PM4A 1UYPA 3WG4A 3T4VA 2IFWA 2DCTA 1BEV1 4I3GA 4ASMB 2A6XA 2D6PA 2D93A 2ZACA 1IS6A 1AXZA 4JQRA 1FNYA 1S2BA 1YFYA 2WNEA 5FZKA 5GLZA 3PJYA 4IE0A 2HEVF 3WINE 1PX3A 3HT1A 5DUVA 1QOSA 3CQOA 3WNOA 5A3PA 2WA3A 1IOAA 2VNOA 1D4M2 1W39A 1VRH2 2RS12 4JV4A 1BLZA 2VW2A 4NAMA 4G3YC 5FPVA 4Y5TA 5FXWA 3HT2A 2XQXA 1WBLA 3VBHC 2VMHA 4I0BA 3T0BA 4EJRA 1KJLA 3FBMA 4HKOA 1FPN2 4FQZA 4AL9A 4OLLA 1SDDB 2BZDA 1KS5A 2ID4A 3RWKX 4BQWA 2QCSB 5CA6A 1AXYA 4OMCA 2WABA 3G6JB 3SH3A 1D4M1 1SBDA 2RS11 5FYCA 2ZOEB 2WSVA 1V9U1 3IB3A 3ACIA 2Q1ZB 3RZZA 4R8HA 3LFIA 3SKVA 3U14A 3ES1A 4XHBA 4DS0A 3LA7A 3GBWA 4XEZA 1AX0A 5FKBA 2YG0A 3VHNA 4CDQA 1XNAA 3AX4A 3I2OA 1RVF3 1SLBA 2PAKA 4Q4V3 3ILFA 3QD6A 3OGRA 1VE0A 4ISQA 5ANNA 5CISA 1EAH3 5EFUA 3N7LA 2YBKA 2I07B 2EALA 4M3CF 2IFRA 3OGGA 4CDXA 2WT0A 3H9AA 4BLIA 4AI8A 5KXBA 2UYBA 5FYBA 1MS5A 2RR11 5FYSA 3OBTA 5A3UA 3IZOA 5F5IA 4OHZA 4YSFA 2PHFA 5LK7B 3IDBB 5GZFA 5C7GA 2FD8A 1GU3A 1N1TA 3U75A 1K45A 3I3DA 2ARCA 1GBGA 3A21A 3JD72 5AFBA 5C3OA 3BUCA 4IQPA 2GNBA 4UFMA 3DN7A 3ZFFB 4AZZA 1NE4A 4XCBA 4PF1A 2XGXA 3FZ3A 2DU0A 4CDUA 3WXPA 1GMMA 2X5IB 5JSRA 4YFWA 1H4GA 1NCQC 1W8UA 3B3QE 4R9CA 1ND3A 4XXAA 5I8TA 5GZDA 3ZYPA 4KWUA 1YEWA 4TN7A 1I3HA 3GDBA 3LPGA 3T1LA 4R52A 3V0AA 2ZHKA 2JE8A 4M0NA 3T08A 1HIXA 2RS52 4GULA 5A6YA 2WNOA 4LULA 3IN9A 5F5CA 1RUE3 2ZEWA 3PL0A 3PIJA 5T5JA 1TMF3 2HWB2 3LIHA 4HT1T 5KBFA 4GXLA 3KV9A 1D7PM 4PQQA 1PIV3 1U12A 2YBSA 5FP9A 3K4AA 4XTMA 3USSA 2WS91 2YGMA 2RS51 2O1QA 1IG0A 5LA9A 2DCZA 3E6DA 4FO9A 4L0PA 3GJAA 1MS4A 3E97A 1W05A 3HNYM 4QM9A 4W65A 3ZXFA 5LEJA 5AFEA 2FMDA 3M3EA 1CAWA 2XH6A 4ES9A 5I8YA 1UYXA 1REDA 3TN93 3IWZA 2WYFA 2WT2A 2JG9B 1GZCA 1REEA 4CEYA 2PLV2 1XPWA 1NQJA 2A6ZA 4CYDA 2VOTA 4JGYB 3UJQA 3TB0A 5FYIA 2B46X 3J26N 3ZXLA 3AP9A 5I8SA 1DZRA 3FWEA 4MGTA 3BPSA 5FUNA 1KD7A 2QQWA 4FFGA 2IC1A 1W9FA 1VBB2 4YW4A 2Y6FA 1LESA 1WMFA 4AQ2A 1LHNA 4A7ZA 1PO22 3ATGA 2WZR2 4TLGA 5FYUA 1K5MA 4BM8A 2R16A 1JBCA 1MQTA 4KNCA 4RR3B 2D43A 3WOGA 3ZYGA 2HKXA 1FYUA 3CKHA 5HPOA 5FZOA 3KM5A 2F6BA 5FPAA 1RIRA 4CP0A 3FLPA 4MGSA 4KG0A 4B7KA 5JMCA 1N3PA 3FMGA 3ORJA 4NOTA 1BHGA 4FPJA 1PO21 4JHZA 4XF4A 3WX5A 4XMIA 3RYPA 5FZ8A 4WVWA 1SFYA 3VBFA 3I2JA 1OFSA 4XBNA 5AC92 2BVBA 2ET7A 1WCKA 3OUHA 4CCOA 4CZSA 1GWKA 2BP6A 4D3WA 4AHZA 2YV8A 4LUMA 5FUIA 1UX6A 4LUKA 5K0UA 3ZPYA 2VAUA 2ZZJA 4MADA 1BQPA 4IEWA 2ZGQA 2C26A 4RD7A 1QKQA 1RITA 2R042 4GWJA 4KMQA 4S2GA 1RUH1 3OY8A 1V00A 5FO7B 2Q0AA 2VM9A 1O7FA 3ASIA 4LHSA 2WFF2 4EYUA 4PI2A 5DABA 1WCDJ 4OHVA 2IVJA 4GB33 5GALA 5J98B 1YQCA 3ZFFC 3GZEA 2HWE3 4WM7B 4DNYA 3FHQA 1TZOA 1WCUA 1HRV1 4EWDA 2YFUA 2MPFA 2Y6LA 5EIYB 5BNNA 4UF0B 2R062 1FMD2 2CYFA 5DUUA 1AHSA 4FOVA 3KV6A 5IVYA 3H1YA 3ZX7A 5JXHA 1PK6B 3ZXJA 4YW3A 1PNFA 2WKKA 1K42A 2OW4A 3FHAA 5LCWL 1XU2A 4CRQA 3PNAA 1CZVA 1QDOA 2C0ZA 4LBQA 4ZY9A 3GCXA 4K20A 4LQRA 2JJ6A 3MV01 1VIWB 3VKMA 4YGDA 1RUC2 4RS5B 1YFUA 5EWSA 2FDIA 2DVBA 2VZTA 3ACFA 4IE7A 5EYYA 2Q8EA 4HKLA 5BNOA 1W0OA 3L2YA 2W1SA 5A7QA 5FY8A 1HDKA 2HWC3 5IAXA 2PELA 3R4SA 3RWNA 4AI0A 1BZWA 2R1BA 4BQ4A 1LOCA 2VZ3A 4H3WA 4BMBA 1C8M2 4MO3M 2W0XA 4AEDB 1R091 5C33A 3UGHA 1R1ZA 4YG3A 2JG9C 4CUGA 4RQPA 3THCA 5L9RA 1O6UA 1F2NA 1KFUL 1UL9A 3AYDA 4JGYC 5IW0A 1PZ8A 1CX4A 3AMQA 5IYYA 1XE7A 1X36A 3ACGA 4L99A 1ULDA 3NVCA 1HN1A 2HH9A 1H2NA 3OTFA 2OS2A 2WYSA 4F83A 3WP3A 4HOOA 3IPVA 5A1FA 1S0JA 3ABZA 3VKNA 3WUDA 4XZPA 3DPRB 4MZUA 1K12A 5AVPA 2AEYA 2BW8A 1YJKA 2RS32 3ELNA 4M01A 1LOEA 2YPDA 2IXJA 3ZN5A 3F2ZA 1KEXA 3AZZA 4A44A 4B8EA 3G7DA 1ND2A 3POGA 4KWJA 5FJKA 2XJRA 1LNSA 2FQPA 5FMCA 2W39A 2W5FA 2XG3A 1VR3A 1KQRA 3B69A 4MXWB 4IEQA 1WMEA 4PF5A 1CAXA 2XDVA 1Q3EA 4IV1B 4PDWB 4B7EA 2QQKA 5DAQA 4FOQA 3OPTA 4C91A 4J1XA 4JDOA 3T2QA 5CFCB 4YZ5A 1CAUB 3ZM8A 5LW9A 4LXLA 3ZFGA 2D6NA 1OH4A 1ULOA 1ZNPA 4S2FA 2B7YA 3L2HA 5E89A 4A7YA 3RZHA 1C28A 3I3EA 1CZTA 4FCAA 5C6CA 3AL6A 5J37A 3AMNA 3JBG2 4R9DA 3FLRA 5FMBA 1JZ4A 3VUOA 4DEVA 3PJQA 4SBVA 5BUVA 3V0BB 5FY9A 2W46A 4Q1RA 3K51A 4Q29A 3WNLA 4WM7C 5F8PA 3KQ4B 4XCAA 4YVSA 2W94A 1RJ8A 2R073 5LA1A 4JX0A 3RVHA 1RUI3 2YHJA 3THPA 3S0MA 5JR7B 2F4LA 1RUD3 1SHWB 3JBG1 1PK6C 3PMSA 4NPMA 2QDRA 1W3XA 2E31A 1O4YA 1SBEA 2I74A 4E8CA 5IFPA 5FKCA 4LBMA 3C7HA 4XBLA 1LB2A 1OLMA 2KM2A 2VR4A 3LSDA 2GN7A 1AJOA 4W6XA 4XDQA 1RVF1 2P37A 2WNUA 1AX2A 2XKOA 2CAVA 4K3UA 4Q4V1 4HN0A 4BXSV 4E4HA 5FIXA 1BKZA 2AZ5A 4RS5C 2ZAHA 1UY1A 1JZ6A 1DDLA 1EAH1 4K40A 4PJYA 5A6QA 1W6NA 4Y26A 2GMMA 1NE6A 2VZSA 5J7MA 4QX7A 2K9ZA 1QXJA 5BNPA 4MYEA 1LHVA 1I9RA 5A7WA 5T55A 4M3CE 2YFZA 4CEWB 5DPNA 3TOJA 2X05A 1RL3A 1W9SA 3POBA 4ASLA 2BGCA 1YIPA 2C9AA 4BHPA 2KR2A 3PMEA 4NRMA 4YZ4A 2X53S 4FPFA 4XQDA 4EN8B 1ASJ2 5A32B 1LHWA 1POV0 1XXNA 2OUJA 2R6QA 1RUJ2 4MGKE 4EZHA 3GYDA 3NJZA 4RGGA 2E7AA 5BNQA 3B93A 1LOFC 1RMU2 2N7GA 4QQ2A 1O5LA 2VMDA 2IXHA 5FZAA 3VDDB 1ULCA 1FOD2 2VZPA 3T30A 4D94A 3PURA 2VZUA 5T5PA 3J4UH 2E63A 2ZXQA 3RNSA 2W52A 3POJA 4LBJA 4N53B 1I1EA 1ASJ1 1LU1A 3AKQA 3U0ZA 3DECA 5C5UA 3CU7A 2OQ7A 3H7JA 5KWRA 2H0BA 2VH9A 3LAGA 2BNMA 4XF1A 3DPRC 4HPKB 3WG2A 2D6MA 5FZDA 5L36A 1FOD1 4LHKA 5L7OB 5TSWA 1RUE1 4A6SA 3HBZA 1TMF1 2RJKA 4BQ1A 3BVCA 2Y6KA 4R9AA 3PU8A 2FCUA 3VBSA 5JUVA 2AEZA 1DYPA 1MPXA 1PIV1 4K21A 4BK5A 1D2QA 2H6CA 3KCYA 5LZ6A 2ZKLA 4AG4A 4FPCA 1GUIA 1UY2A 1W6OB 3M1HA 4ONUA 4PDWC 4IV1C 4KGQA 2IWGB 3AKTA 3D82A 3MHZA 4PIXA 4XFAA 4CCJA 4PT6A 1H6XA 3U1XA 5CFCC 4MV2A 5FJHA 4CP9A 4QXBA 4PBPA 2G9ZA 3TN91 2ZX2A 1ALYA 1W9WA 1GV9A 2V4AA 5F7UA 1RUG2 3MF9A 1URXA 4P02B 1OD3A 5FLIA 5A7NA 2QFEA 4I09A 4RHV2 2VJXA 3VHRA 2RDNA 1UZVA 5FPUA 1GYKA 4NIGA 4DXZA 3IIIA 3AKPA 3I3QA 4FTBA 3NO8A 1TNFA 1CONA 2VZRA 3AFGA 4LLOA 2VOWA 1GOGA 2C6SA 3WW2A 3KF5A 3HQXA 4LA3A 3ENRA 4MHUA 3RFRA 1G9CA 2ORZA 1HB1A 2XHKA 3I2KA 2VCMA 1SCSA 4FOYA 1IHMA 4G4FA 1RUG1 3AP5A 5T54A 1XOYA 2ZCWA 4RHV1 5JOXA 5I0DA 3EXUA 4S2HA 5EJZB 1APNA 4JQTA 1VRBA 4Q8KA 1DIWA 4K8FA 2RJLA 1VBD3 2W1UA 3OPWA 3CEWA 3VDAA 5FOJB 1NUKA 1JZ7A 4UYBA 1WLDA 1REFA 2Y33A 4K8RB 2NZ9A 3BOPA 3D4KA 1QEXA 4P9JA 4CCCA 4XTPA 4L2NA 5ISLA 1NZIA 2QKDA 2R49A 3SC7X 1ONAA 2WDBA 1WMXA 3KD4A 3VHPA 1HXS2 3I3BA 1O3TA 2Z69A 5F5QA 4FPOB 1MS1A 2X10A 1QQP2 2VL4A 4XACA 3ZIXA 1WD3A 4COYA 3WQ1A 4XHXA 4XDPA 1X33A 5DQ0A 1AYN2 4FI9A 1SFPA 3EO6A 1WA4A 3KHBA 1S2EA 3TNPB 3A22A 4FQ4A 1RUF3 1O91A 5FYYA 2KXLA 1W6QA 2VTXJ 2DCKA 4CU8A 5C9AA 2XUEA 4XVHA 3I3MA 3I49A 3J8F3 3H0OA 5DMYA 5JXGA 2LS6A 5JI7A 4A7KA 1O4ZA 1KXGA 2BGPA 4N43A 3SH5A 1HXS1 2QQJA 2HWD2 2QQMA 2EXJA 3ZYBA 2AACA 2HJIA 1NCRA 1VP6A 5KHHA 4IV3A 4GB31 4NRQA 2RG4A 3VDDC 1WW5A 3D5OA 2HWE1 1RUOA 1H8TA 1JXNA 4URTA 1MS0A 1TE1B 3VZJA 4NMIA 2BFUL 5H9PA 1A8DA 4LE4A 1F31A 2HBUA 3VBOA 1Q8QA 1ZZ8A 4EN9B 3WP4A 2PQQA 4N53C 5IVJA 1AR62 1R1A3 1ZREA 1CR7A 4Z07A 4QPYA 1WUVA 1NY71 5FP7A 4FFIA 4BJ0A 5K9YA 2FCTA 4RGKA 1AYM2 1C5HA 1DU3D 3TYJA 2JIGA 2SLIA 3QH7A 4HK9A 5L7OC 3P6BA 4GALA 4E2SA 2QZ2A 3O7OA 4URAA 3LWCA 1ZVFA 2PHXA 4LR4A 1JOJA 1AX1A 2SBAA 5JIUA 4W4ZA 3SISA 1ZBE2 3ECQA 2G9GA 3QLQA 2HWC1 2JG8B 4JAAA 1OURA 1X7NA 1SCRA 4INDA 3UKVA 4D6QA 3H8OA 5FZFA 1ZM1A 1WWYA 2QTWB 3EYPA 2FBEA 5F9TA 5M0TA 4L97A 5IATA 2CGOA 3ES4A 5H9SA 4DXTA 5BPXA 4F8AA 1XRUA 3W21A 3WP5A 1MZ6A 3POFA 1UQXA 2DVFA 3HAGA 4NHKA 1YXWA 1ZBE1 1VBC3 1Z7S2 4R4XA 2XL9A 3VBHA 2R32A 3WVJA 1E5IA 3PVBB 4QX5A 2GNTA 2K2SA 3GF6A 2W1WA 2C9KA 1LOBA 2VXRA 3HIFA 4LPLA 2E7QA 3N7JA 4Y1VA 2W2IA 1DGRA 3BTZA 1SLAA 1A34A 4V1PA 5JDBA 3UT0A 4A42A 3ITQA 1BBT3 2D97A 1W2NA 1UWWA 4XURA 3T09A 4GH4A 1HB4A 1CZSA 1VPHA 4P9LA 4XJUA 2VBBA 4B29A 1SACA 2BBAA 2YYOA 1IPJA 1FX5A 3I7DA 2C4XA 2YUEA 1OT5A 5I0RA 1JOBA 3K4DA 3NKGA 4BQ2A 5ACA2 2CGPA 1W90A 4EV0A 4AFBA 4HVRA 2P2KA 3IDEA 5KC5A 5HCHA 4YPJA 4GJZA 2JIJA 1MVEA 4LO8A 4QHOA 4WZFA 3WZ1A 5KXDA 3AYEA 4XZUG 3C7EA 5CIRA 1JZ3A 2XBO2 5FMOS 4AFAA 1GZ9A 2DF7A 4A4AA 1N3QA 1QJX3 2OPWA 1ENRA 2VOVA 2VULA 4Y5Z0 1GQPA 1AR82 4CCDA 2XLAA 4OVEA 4ZHNA 4XBQA 4E27A 3KB5A 4Q4X2 1OA3A 4ET7A 1LHUA 4JDMA 2HLEA 4XYXA 2YMZA 2VUDA 4AAPA 4NAOA 3TEXA 3OYWB 5FZBA 4QD2A 3ZYJB 1DF0A 2GSYA 2XBO1 2BPA2 2O14A 4DY5A 2PHUA 2VMGA 2DFBA 2I45A 5K7PA 2BTVC 1UIJA 2BQPA 2QQOA 1ZRIA 2WN3A 3TRSB 3USUA 1WW6A 5KHKA 3WF1A 2TNFA 4QB1A 1I5ZA 3ZYRA 4LOTA 1X8EA 2PFWA 4Q4X1 4ZU4A 3WF2A 4Z2AA 1T6GC 2XJTA 1UY3A 1WCSA 2DU1A 1VALA 3CNAA 3H42B 5FP8A 3Q8FA 2R071 5DUWA 2Q30A 1RHI3 2QQVA 3IMNA 1RB8G 4G9SB 4KU8A 4BQ3A 3P3PA 3CJXA 2HWF2 1BVVA 1RUD1 1YNAA 3BCWA 2BERA 1LGNA 3QOPA 1VLNA 4MLOA 3VB9A 3B94A 4Y22B 1LAJA 2L9LA 5J1XA 2J1RA 1UNBA 1NCQB 4I0WB 1LOAA 5BV6A 3KV4A 4QAWA 3R4DB 2RM23 1DLLA 2ZEYA 3U78A 2VUJA 4ISRA 5KR7A 4MGZE 3AMPA 3FUQA 5K8SA 5LB6A 1BEV2 1EPZA 5CU1A 1E5HA 4OQ8A 1QOTA 3TAYA 2IUWA 1LEDA 4QPIB 1CPNA 4XFBA 5A33A 2BBVA 3WR0A 2W08A 2V5YA 1LU2A 2GC3A 4BIFA 4DY3A 3HEIA 4QQPA 2VVFA 2NN8A 2CWSA 3ZSMA 2GNDA 3O0WA 3HMYA 4FFFA 3ZSJA 2PQSA 2WZEA 2Y6JA 2JG8C 3BU7A 4Q4Y3 1ENQA 2E6VA 4QX8A 3WY6A 4RYDA 3ZYFA 4X8NA 4AEMA 3AKRA 2D6LX 2B8MA 1T6BX 1HQWA 1OOPA 2ERFA 4P14A 5FZEA 2DFCA 1H0BA 1PMHX 3HNBM 4LHNA 4Y4RA 1QJZA 5JOYA 2XWBB 1FV3A 3WNMA 4IE4A 5FWJA 4BPZA 3AZXA 3BALA 5B4XA 2WLQA 4LJHA 4NPRA 1GQHA 2ZGPA 5KHJA 4DRRA 3I4IA 1IS4A 1XYPA 4Z8BA 2ES3A 2RHPA 3LPFA 2J1AA 4M4PA 3LOIA 4AHXA 2VTFA 5I0TA 1GQGA 2XJVA 4P5YA 1KITA 2GMPA 1Q5OA 1V9U2 2VMEA 3O1RA 5DN2A 4LT5A 1H4HA 4YW1A 1JZ2A 4B4QA 1O3SA 1JN2P 5F2WA 1AR72 4OUEA 2H6BA 3B00A 5F6LB 1STMA 2AC1A 1PM7A 5FPBA 5A3TA 2E32A 2GU9A 1H2MA 2ZMNA 3S6PA 4W6YA 5GJ6A 2A1XA 2XLGA 1HRI3 3J7LA 3WEZA 3I59B 4CXXA 1UYYA 4ZONA 1AR71 4FPHA 2RR12 5GLWA 1XJAA 4RN5A 3IDAA 4LITA 3N7MA 5JZGC 5HXMA 3AC0A 1OLME 2P5BA 3GNEA 3WDUA 1OF4A 2ZPXA 1N1YA 1DCSA 1L7QA 4QGLA 1BCXA 1GICA 3J7MA 4D69A 2OZ6A 2WZPP 1ZZ9A 1DGWX 4FT8A 2VG9A 4YGEA 2VNVA 1SFNA 2MEV3 4LMFA 1W2OA 4XIOA 4BOWA 1W6MA 1E5RA 2VMIA 4LHLA 4QKNA 1ODMA 4M0HA 4DPNA 5KXEA 1YIFA 5FWEA 5D2AA 2JDHA 5FZLA 1D2SA 3BI3A 4JTOA 2X5IA 4FTEA 5EZWA 1COV3 4HG6B 1PMIA 2NPIA 4N7IA 2JE7A 4XC9A 5L9VA 4ARYA 3HQRA 1Y4WA 2PN5A 2EA7A 2A70A 5E8AA 1RUNA 4W50A 2XJQA 3JB8A 1VBD1 3K77A 4IL7A 1YCIA 1XNTA 1JI6A 1XE0A 2Q4SA 4LOSA 4GIQA 4K1YA 4QGMA 4OHYA 1GP4A 2JDPA 4UAPA 2JDNA 3C3VA 1TG7A 3VBUB 4CDXB 4DUXA 1VBA2 3IAQA 2Z5WA 2VMCA 2WS92 1IG3A 2CY6A 1UD1A 4QPIC 2E26A 4WVZA 1WZXA 2I2SA 4L92A 1ZZBA 1FV2A 3AYCA 3RYKA 4IEXA 1US3A 5I0UA 1S0DA 1ENSA 3ZSLA 2XJSA 2WQZC 4J1WA 3GZUC 2TEPA 2VZOA 3BYWA 1RUF1 4PBOA 2XQRA 2LUWA 3ZFEA 1NA1B 1CN1A 3HN3A 1VBA1 1S0EA 3D0JA 3J8F1 3KVAA 4NIIA 4C0HA 3DXUA 3ZMNA 2DUPA 2ZEZA 1HV0A 2G1MA 2LALA 2BFUS 3M4FA 3PUIA 2IXCA 3WW4A 5GKAC 1PO13 2EXHA 3NNFA 2JG9A 4IEYA 1F8VA 4OI4A 2VO5A 2QVSB 3ZSEA 1QF3A 5A1LA 1ND3B 1I5PA 4CDWC 1A6CA 1JODA 1GLHA 2WAOA 4JGYA 1FAYA 1GZWA 2WO3A 1SPPB 2G9FA 4PIZA 4AQTA 4TXWA 1FNZA 1IQAA 3RZMA 3POYA 3NV1A 1G86A 4BISA 1R1A1 3IMMA 1Y7BA 4R4ZA 5J09A 3ALQA 3HWJA 1EY2A 4Q0SA 3ROUA 5T50A 2PHLA 1POQA 5G04L 5LBEA 4AEJA 5F5AA 4RR3A 3C7GA 4CCMA 2O8OA 2LROA 2ZX4A 2W9XA 1W03A 2QDNA 3OD4A 3RZGA 5J36A 2VW0A 4AVVA 4R9BA 4C1XA 3KLSA 1UOJA 4H7LA 5JOZA 2IVIB 4XJAA 5LY1A 1BYHA 4CSWA 4KL1A 1ZBA3 3HNMA 3U10A 3C8XA 2D5HA 1W04A 3EMRA 4E2GA 2P34A 4P08A 5DDJ3 4AR2A 4QPWA 1B35A 1OPOA 1V6IA 3AZVA 5DUXA 4CEYB 1LHOA 3DYOA 2ZX0A 3AMMA 1U5YA 2YDEA 4C1WA 1RUH2 3OB8A 1DQ6A 3CO2A 1W2UA 1UXXX 4Q0VA 3KT1A 5C3QA 5C5TA 3U4XA 4Y1ZA 1UU5A 1ZX5A 3RMYA 5A1AA 4IETA 3W20A 4DO0A 1CAVB 2YY1A 4QWNA 4UXAA 3FBYA 1VBC1 2DUOA 3LD8A 3ETPA 5C4WA 2A6YA 1HRV2 1JYCA 2H0VA 3RZJA 5FY7A 1W6PB 3RQ0A 4AXOA 1CX1A 1K5MB 5FY5A 3RJ2X 2PHRA 3GGLA 2Z79A 4QKFA 5IJRA 4NPLA 2WNVA 4WM7A 1RC6A 2V72A 4W8JA 3TBDA 4YARA 4GQ7A 1X8MA 1KJRA 4A45A 4UBGA 1BBT1 2XPJA 4UF0A 1TVGA 2JD9A 2V5DA 3I2HA 1PVC3 3R0RA 4LBKA 2QQPA 4CDQC 1PK6A 3NAPA 4Y20B 3FL7A 3W5NA 2NMNA 1NX9A 2VZVA 1DZQA 2RMU3 5CFDA 3UGFA 5HV0A 3LCPA
chains in the Genus database with same CATH topology
4Y3OA 5FZCA 4EZHA 3U4SA 4QU1A 4DIQA 5FZ7A 2OX0A 3PTRB 5FZ9A 5FZAA 4CUGA 5FP3A 2Q8CA 5IVVA 3PURA 5FZKA 5IVJA 3KV4A 3U78A 5FP7A 5KR7A 5IW0A 2YU1A 5FXVA 4BXFA 5FXZA 2OQ6A 2PXJA 3AVRA 2WWJA 3UYJA 5A3PA 4HONA 5CEHA 4QXHA 5F32A 5FZ6A 5FZOB 5FXXA 2OQ7A 5FPLA 2YU2A 5FYIA 5A3NA 2OS2A 4V2WA 4ASKA 5FPVA 2Q8DA 5FXWA 2GP5A 5FUNA 4HOOA 5FY0A 5FZDA 4URAA 5FBJA 5FZIA 5A1FA 5LWBA 3KVAA 4AI9A 2OT7A 4QXCA 3DXUA 4XDOA 4QX8A 3PU8A 5K4LA 5FYUA 5FZEA 2YPDA 5A1LA 4C8DA 4Y4RA 5F3EA 5FP4A 5FYCA 4D6QA 5FYZA 4IGQA 5FJKA 3N9QA 5FZFA 5FZOA 5FZ1A 5FWJA 5IVCA 4GD4A 4Y33A 5FPAA 4EZ4A 5F2SA 3LDBA 3PUAA 4CCJA 5FUPA 2XDVA 4IGOA 5FZHA 5FJHA 4QXBA 5FV3A 4BISA 3OPTA 5F3GA 5A7WB 5FZ8A 5LW9A 4GAZA 4LXLA 4CCLA 4CCOA 5A7NA 3PU3A 5FZ0A 5FPUA 4NUBA 3K3OA 5F5AA 4CCMA 2VD7A 2YBKA 5F2WA 2W2IA 3DXTA 5FZMA 3AL6A 3PUQA 4GJYA 5F37A 3N9LA 5FPBA 5A3TA 5E6HA 5FYBA 5F3CA 5FYSA 5FZGA 5FZ3A 2XMLA 4CSWA 5LY1A 5FY9A 4CCNA 5A80A 5FY1A 5FZ4A 4D6RA 4EYUA 5F3IA 5F5IA 4D6SA 5IVEA 5IVBA 3N9OA 1VRBA 5FYVA 3PDQA 3RVHA 3K3NA 4GJZA 5A7OA 3OPWA 4CCKA 5FYMA 2YBPA 3KVBA 4LITA 4UF0B 3AVSA 3K2OA 3KV6A 5IVYA 3AL5A 2XXZA 2GP3A 2P5BA 5FYHA 3PUSA 3KV5A 4BU2A 5ISLA 4DO0A 4QWNA 3LD8A 5A7SA 3ZPOA 4TN7A 4LIUA 5FY7A 4AAPA 4IGPA 4E4HA 5FZBA 4XDPA 5FY5A 4LIVA 5A7PA 5LY2A 5FYYA 3NJYA 4QX7A 2XUEA 5F5CA 5FYTA 2Q8EA 3N9NA 5A7WA 4UF0A 5IVFA 4V2VA 5IWFA 5FWEA 5A7QA 5FZLA 2WWUA 5F39A 5FY8A 5FY4A 3KV9A 3ZLIA 3N9PA 2YBSA 5FP9A 3N9MA 5FP8A 5ANQA 5A3WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Y3O A;  5FZC A;  4EZH A;  3U4S A;  4QU1 A;  4DIQ A;  5FZ7 A;  2OX0 A;  3PTR B;  5FZ9 A;  5FZA A;  4CUG A;  5FP3 A;  2Q8C A;  5IVV A;  3PUR A;  5FZK A;  5IVJ A;  3KV4 A;  3U78 A;  5FP7 A;  5KR7 A;  5IW0 A;  2YU1 A;  5FXV A;  4BXF A;  5FXZ A;  2OQ6 A;  2PXJ A;  3AVR A;  2WWJ A;  3UYJ A;  5A3P A;  4HON A;  5CEH A;  4QXH A;  5F32 A;  5FZ6 A;  5FZO B;  5FXX A;  2OQ7 A;  5FPL A;  2YU2 A;  5FYI A;  5A3N A;  2OS2 A;  4V2W A;  4ASK A;  5FPV A;  2Q8D A;  5FXW A;  2GP5 A;  5FUN A;  4HOO A;  5FY0 A;  5FZD A;  4URA A;  5FBJ A;  5FZI A;  5A1F A;  5LWB A;  3KVA A;  4AI9 A;  2OT7 A;  4QXC A;  3DXU A;  4XDO A;  4QX8 A;  3PU8 A;  5K4L A;  5FYU A;  5FZE A;  2YPD A;  5A1L A;  4C8D A;  4Y4R A;  5F3E A;  5FP4 A;  5FYC A;  4D6Q A;  5FYZ A;  4IGQ A;  5FJK A;  3N9Q A;  5FZF A;  5FZO A;  5FZ1 A;  5FWJ A;  5IVC A;  4GD4 A;  4Y33 A;  5FPA A;  4EZ4 A;  5F2S A;  3LDB A;  3PUA A;  4CCJ A;  5FUP A;  2XDV A;  4IGO A;  5FZH A;  5FJH A;  4QXB A;  5FV3 A;  4BIS A;  3OPT A;  5F3G A;  5A7W B;  5FZ8 A;  5LW9 A;  4GAZ A;  4LXL A;  4CCL A;  4CCO A;  5A7N A;  3PU3 A;  5FZ0 A;  5FPU A;  4NUB A;  3K3O A;  5F5A A;  4CCM A;  2VD7 A;  2YBK A;  5F2W A;  2W2I A;  3DXT A;  5FZM A;  3AL6 A;  3PUQ A;  4GJY A;  5F37 A;  3N9L A;  5FPB A;  5A3T A;  5E6H A;  5FYB A;  5F3C A;  5FYS A;  5FZG A;  5FZ3 A;  2XML A;  4CSW A;  5LY1 A;  5FY9 A;  4CCN A;  5A80 A;  5FY1 A;  5FZ4 A;  4D6R A;  4EYU A;  5F3I A;  5F5I A;  4D6S A;  5IVE A;  5IVB A;  3N9O A;  1VRB A;  5FYV A;  3PDQ A;  3RVH A;  3K3N A;  4GJZ A;  5A7O A;  3OPW A;  4CCK A;  5FYM A;  2YBP A;  3KVB A;  4LIT A;  4UF0 B;  3AVS A;  3K2O A;  3KV6 A;  5IVY A;  3AL5 A;  2XXZ A;  2GP3 A;  2P5B A;  5FYH A;  3PUS A;  3KV5 A;  4BU2 A;  5ISL A;  4DO0 A;  4QWN A;  3LD8 A;  5A7S A;  3ZPO A;  4TN7 A;  4LIU A;  5FY7 A;  4AAP A;  4IGP A;  4E4H A;  5FZB A;  4XDP A;  5FY5 A;  4LIV A;  5A7P A;  5LY2 A;  5FYY A;  3NJY A;  4QX7 A;  2XUE A;  5F5C A;  5FYT A;  2Q8E A;  3N9N A;  5A7W A;  4UF0 A;  5IVF A;  4V2V A;  5IWF A;  5FWE A;  5A7Q A;  5FZL A;  2WWU A;  5F39 A;  5FY8 A;  5FY4 A;  3KV9 A;  3ZLI A;  3N9P A;  2YBS A;  5FP9 A;  3N9M A;  5FP8 A;  5ANQ A;  5A3W A; 
#chains in the Genus database with same CATH topology
 2TBV A;  4Q5O A;  3N36 A;  1R08 3;  3WW1 A;  5C3S A;  3U4S A;  3VBU C;  4CDX C;  1IKP A;  2OII A;  2XON A;  2FDH A;  1RGS A;  3A0K A;  1WLT A;  4EWA A;  2BVV A;  2D3S A;  2ZJC A;  4HVQ A;  5K0U B;  1GOF A;  2TUN A;  5D1I A;  5DZE A;  1QH6 A;  3T3Y A;  5GZG A;  3I8T A;  4COZ A;  5IK4 A;  4M00 A;  5FBZ A;  4AVA A;  3UYJ A;  2KA3 A;  1LR5 A;  3WQB A;  5CEH A;  5L19 A;  1N1S A;  1VBE 3;  4UFJ A;  2P6H A;  3ACL A;  1R09 2;  4RL7 A;  4GZ9 A;  3NNG A;  5FXX A;  2YU2 A;  1NA1 C;  2J1E A;  1HB3 A;  2VCC A;  4LOR A;  4ASK A;  4K6B A;  1UAI A;  4GWM A;  3D6E A;  4FVV A;  4AED A;  3ZXG A;  5JPN B;  4AI9 A;  4CA9 A;  4FBF A;  4HLT A;  5E16 A;  5BNN B;  5L9B A;  1DGR N;  4CU7 A;  1ND3 C;  4QDS A;  1JU3 A;  4TWT A;  3WG3 A;  1E57 A;  1MAC A;  2ZGT A;  2IZW A;  3D3A A;  5DG1 A;  4HK8 A;  1RHI 1;  5FZ1 A;  1O3Q A;  4EZ4 A;  3QAC A;  4YZ1 A;  2DUQ A;  2A3Y A;  4LK7 A;  1ULE A;  1DLC A;  4HVO A;  2Y26 A;  3HN1 A;  4IGO A;  3HOB A;  1N47 A;  2JKX A;  1BVP 1;  4Q4W 3;  2RM2 1;  4N9H A;  5BNO B;  1J3P A;  2XKP A;  5L73 A;  5GLU A;  1YRZ A;  3CZU A;  1J58 A;  2CV6 A;  2GAL A;  2VE1 A;  3MGU A;  1WW7 A;  3OOX A;  1W8T A;  3NJX A;  3GHM A;  4IDZ A;  2IXL A;  2QUO A;  1CGP A;  4QT6 A;  4B4P A;  5F37 A;  1DGW A;  1IQD C;  2HEY F;  1TME 3;  2WO1 A;  5E6H A;  3ST7 A;  4MXW A;  1Q8S A;  1XQN A;  4FOW A;  4OYU A;  4CCN A;  4IV1 A;  4AYU A;  5C71 A;  5A80 A;  3M3O A;  4FPK A;  4RGA A;  4RQP B;  4CEY C;  1T2X A;  2Y64 A;  3WNK A;  5JMO A;  3P1I A;  4JTN A;  4X6R B;  4X8P A;  2VCB A;  4OHW A;  4AEK A;  4N90 A;  3SH4 A;  5FMD A;  3POS A;  4BQ5 A;  2RJ2 A;  2FHR A;  3NNM A;  3MYX A;  2XR4 A;  1QNW A;  2Y8K A;  5C8C B;  2JX9 A;  3AL5 A;  3RZK A;  2ADE A;  2ZEX A;  5FQ0 B;  2P3J A;  3WP6 A;  4IEP A;  1IS5 A;  5DAV A;  2XOM A;  5EP9 A;  1QJY 3;  1PNG A;  1K5M C;  3V0B A;  3MIB A;  1OD5 A;  1QJU 3;  4Q0Q A;  4XF0 A;  3NNL A;  2AUY A;  2FCV A;  5EYX A;  3L9J T;  1MS9 A;  4NRO A;  4LKD A;  5A6X A;  3MIE A;  4DFS A;  4YW5 A;  4EWE A;  3FN9 A;  3T4H B;  1G7Y A;  2Q1F A;  5DXD A;  4FAH A;  4LO6 B;  4RFR B;  4DXS A;  2OZJ A;  1OQ1 A;  3J9S A;  2WT1 A;  4GA9 A;  3BGA A;  4A3X A;  1IGO A;  1MEC 3;  1MS8 A;  1RVF 2;  4Q4V 2;  1KGY A;  1AXK A;  1Q8O A;  4UT5 A;  1CAX B;  3M3C A;  4Q1P A;  3VBF C;  3VD4 A;  1EAH 2;  3NKT A;  4YRD A;  1UY4 A;  1QMJ A;  3M7A A;  2FZ2 A;  2PYT A;  1GAN A;  2B45 X;  1JU4 A;  3MLJ A;  1HLC A;  3VLB B;  5FZC A;  5K0U C;  3ZFG B;  4QGN A;  2DVD A;  3T0D A;  3BOD A;  5FZ7 A;  2QQL A;  4MET A;  1EV1 3;  1SLL A;  2XVK A;  4B1M A;  1HQN A;  4QX2 A;  3PVN A;  5B4N A;  2HYK A;  1O8P A;  1XNB A;  4CEW A;  3O14 A;  4DZG A;  2A73 B;  5F32 A;  3FC0 A;  1AL2 3;  4IXL A;  5FPL A;  5A3N A;  4YVS B;  3U11 A;  2GME A;  2MEV 1;  3O1P A;  4UFH A;  4BYY A;  4KBB A;  5LA2 A;  5BNN C;  1JYW A;  2BYV E;  2B5H A;  3AMH A;  3SMH A;  4J25 A;  3WNN A;  1H1A A;  4LKE A;  4H55 A;  1YFX A;  4HZF A;  4S2D A;  1LGC A;  4B4R A;  1Y9M A;  3O1V A;  3QBQ A;  3DV8 A;  1HN0 A;  1ULP A;  4TSV A;  4B1L A;  1PHM A;  3CJI B;  3ZKY A;  1YYN A;  4YM1 A;  4M4R A;  4N53 A;  1LEC A;  5F3E A;  1AR9 3;  3UGG A;  4WM8 A;  2CWM A;  1WLW A;  1RUE 2;  2DBI A;  5CKM A;  2WNU B;  1SG3 A;  1TMF 2;  3TEW A;  2V73 A;  1PMJ X;  2ZBJ A;  1UKR A;  2P1B A;  4HPK A;  4DUV A;  5BNO C;  1IPK A;  1W6N B;  1WCQ A;  1ZRC A;  1PIV 2;  5L7O A;  3R6S A;  4OZO A;  4QXK A;  2RV9 A;  3OBZ A;  5D21 A;  5LBF A;  3VKO A;  5A7W B;  4YNI A;  1UW8 A;  4AVB A;  2R7E B;  2BU9 A;  4O9E A;  2GC1 A;  3R4U A;  5C3R A;  3Q8B A;  3ZMO A;  4MVT A;  4E4Z A;  2ARA A;  2JB4 A;  2VMF A;  4FAG A;  3SNM A;  4NIH A;  4YGC A;  5FZM A;  1NLQ A;  1W2T A;  3KCC A;  3PUQ A;  1WW4 A;  3TN9 2;  4AI2 A;  4RQP C;  1JW6 A;  3VZN A;  5JR2 A;  3JQX A;  4IES A;  3WG1 A;  1UZ0 A;  1NXD 1;  3RPQ A;  1QXR A;  5D8A A;  2ZKN A;  1OH3 A;  3SLI A;  1AUY A;  1PO1 1;  2UWC A;  3VKL A;  2JDZ A;  3ZDV A;  1W0N A;  4QPG B;  1F15 A;  1VB4 A;  2ZAB A;  4YVW A;  5C8C C;  2QZ3 A;  3BIE A;  1D4M 3;  1VRH 3;  2RS1 3;  3KVB A;  2JIC A;  3BTY A;  3OUJ A;  3JQW A;  2VQU A;  4QB2 A;  4XOG A;  5SV5 A;  4XFF A;  5ERL A;  4FTS A;  1GP5 A;  2XB6 C;  3LDR A;  1FPN 3;  5FTT C;  1M06 G;  2JDM A;  5A7S A;  4NIA A;  3WF4 A;  4AVT A;  2ZHM A;  4LIU A;  5T52 A;  3K48 A;  3MIC A;  3VBS B;  3IBM A;  4FPE A;  1JUI A;  4MGY E;  5CYY A;  1ST8 A;  2GNM A;  5CVR A;  5ABJ A;  2DV9 A;  1OA4 A;  1Y9Q A;  1G9B A;  1NQD A;  2YZ4 A;  5EXO A;  4JKM A;  2JD4 A;  3N9N A;  2Z4F A;  3I2I A;  3RGB A;  3H8X A;  3V56 A;  1H1M A;  1UU6 A;  1US2 A;  1ZBA 1;  3VD5 A;  3MUY 1;  3W9A A;  4JZR A;  3ETQ A;  4QKB A;  4QMA A;  5JSO A;  3ZFG C;  4E9K A;  3N9M A;  3WCR A;  2GH2 A;  2BNN A;  2DTW A;  3BOW A;  2R1D A;  4DIQ A;  4UI9 L;  1BK1 A;  3EB7 A;  4IEU A;  3WQ0 A;  4AI1 A;  4Z2W A;  1OLR A;  3MI8 A;  2WFP A;  4GB3 2;  5CAD A;  2HWE 2;  1C57 A;  2OQ6 A;  3AVR A;  4YVS C;  4HON A;  1W06 A;  2ZGM A;  3KQR A;  4QXH A;  2VPV A;  3NST A;  5IUQ A;  3AZW A;  1W8Z A;  2CTV A;  4YYO A;  1FXZ A;  4L11 A;  5KXC A;  2NLR A;  4DUW A;  1NG0 A;  1LEM A;  1QJE A;  3VBR B;  1DQ0 A;  1NY7 2;  4XUP A;  3JD7 3;  3LA2 A;  5FZI A;  3VL8 A;  3IM0 A;  1N1V A;  3V64 A;  3CJI C;  4ERO A;  1PVC 1;  1OHF A;  2OUH A;  2YC2 A;  1YFW A;  2D5F A;  3GCW A;  2CAU A;  3WNP A;  4Z92 B;  5C3P A;  4BQX A;  3MIH A;  3MIF A;  1H1I A;  4XF9 A;  2WNU C;  5T5L A;  2VQT A;  4XUT A;  3ILR A;  4GWN A;  3O0V A;  2RMU 1;  1F5F A;  3S7I A;  4KBZ A;  3RZL A;  3PVO A;  3VV1 A;  5BYN A;  1UOG A;  3H8R A;  3B7M A;  5BNP C;  2RS5 3;  3CMG A;  3CIH A;  3WNX A;  1PX4 A;  1UZZ A;  4GWI A;  4Q0P A;  1ZRF A;  5FZH A;  2HWC 2;  2VW1 A;  5FK8 A;  5C9A B;  5LEK A;  3CLP A;  2NYY A;  3ZYI B;  3LSE A;  3BKZ A;  4CP2 A;  3S57 A;  2NQY A;  2HWB 3;  3WF0 A;  4YG0 A;  5H9R A;  2W92 A;  1VBE 1;  5FZ0 A;  2EIE A;  2JG8 A;  1G8W A;  3AKS A;  5A3M A;  4NJ4 A;  2J1S A;  1NCR B;  2VD7 A;  3B02 A;  1J83 A;  2R0F A;  1DHK B;  1ZYB A;  4IV3 B;  4Q0U A;  4FP2 A;  1H8T B;  4D0Q A;  2BRT A;  4LBL A;  3S7E A;  4XAE A;  2LM3 A;  2QJV A;  5EV7 A;  1ACC A;  1O59 A;  4HSJ A;  1DQ5 A;  4PI0 A;  4QPG C;  5LA0 A;  2CL2 A;  1Y9G A;  1VB2 A;  1LKN A;  2PLV 3;  2ZGS A;  3OBR A;  3GJB A;  4DMI A;  1W8H A;  4DB5 A;  4U2A A;  1AZD A;  5LAS A;  1LOG A;  2EF6 A;  4YZ2 A;  3MIG A;  2E51 A;  3THD A;  2C5D A;  3KV5 A;  1KFX L;  1VBB 3;  3VBS C;  3SEE A;  2WN2 A;  3EQE A;  4Y1X A;  2OVU A;  4Q4W 1;  1L7L A;  1PO2 3;  5CB7 A;  4TTG A;  1MZ5 A;  5EHD A;  3O1S A;  2WZR 3;  1W2A X;  2DVG A;  1O3R A;  4CVU A;  2UY8 A;  4COU A;  3E6C C;  4MOA A;  3RG0 A;  2BWA A;  4WV8 A;  5CAZ A;  3KSC A;  5LBB A;  1GR3 A;  3K4Z A;  5FO9 B;  2WUH A;  1J84 A;  1C5I A;  1GWM A;  1WA6 X;  2JWP A;  4QQH A;  4YM0 A;  1ZRR A;  5IVF A;  1NYW A;  2C24 A;  5JIA A;  1UMH A;  2YB7 A;  4JRA A;  2PAE A;  2ZTN A;  1DP0 A;  5FY4 A;  2K0G A;  1O5U A;  2FMY A;  1NXM A;  3WF3 A;  2PTM A;  4CUB A;  1I6X A;  3NJV A;  4MSV A;  1JZ8 A;  1J3Q A;  1PGS A;  1HKD A;  5AC9 3;  1UCX A;  2ZML A;  3WHT A;  5JZG B;  1VAM A;  3HPN A;  5IT6 A;  1GNY A;  2OXB A;  2CU5 A;  3KZ4 C;  1UPI A;  1LOD A;  2ZX3 A;  1U5X A;  2Y34 A;  4OHX A;  2R07 2;  1JHN A;  1MVQ A;  3AFK A;  3WLU A;  2R04 3;  4IEO A;  1RUI 2;  2YU1 A;  4GH4 B;  3W58 A;  4EN7 B;  1QJY 1;  4FSJ A;  1CJD A;  1DBN A;  1H2K A;  1QJU 1;  3DYP A;  1RUD 2;  2EAA A;  3N3H A;  3Q8C A;  2ATF A;  4L8Q A;  4UBH A;  5FZ6 A;  1FI2 A;  2WFF 3;  2IXI A;  4WVM A;  3VBR C;  4CE8 A;  4OUS A;  1Y3T A;  4O61 A;  1O8S A;  3FFQ A;  4JCK A;  1MZE A;  5IK8 A;  3H3Z A;  3SEP A;  3SCG A;  4CU6 A;  5F1R A;  2HYX A;  3LA3 A;  2GAU A;  2WLP A;  2XVL A;  2R06 3;  1FMD 3;  1MEC 1;  3AK0 A;  3GM8 A;  1RUI 1;  4XIL A;  1VMJ A;  3RRD A;  1NCQ A;  4NE9 A;  3SKJ E;  1SZB A;  4E4D X;  3SIT A;  4TLF A;  5FLJ A;  1JYT A;  1A3K A;  1FT9 A;  2NP0 A;  2A6V A;  1XNC A;  5FYZ A;  3CL1 A;  4JVA A;  5BXX A;  3S5A A;  3B01 A;  4I01 A;  1J3R A;  5C9A C;  2FDJ A;  1CIW A;  1DZT A;  3JCI A;  3LDB A;  4ORF A;  3S5Q A;  4YW7 A;  4ZZ8 A;  3O1U A;  3DL3 A;  5APA A;  3MZH A;  4LBN A;  5FV3 A;  1RUC 3;  4N43 C;  2FDK A;  1R09 3;  4BA6 A;  1PGW 2;  3ZKU A;  3VD9 A;  4HBN A;  2XLF A;  4YM3 A;  2DCJ A;  3FUO A;  4GAZ A;  2D3R A;  1NCR C;  3GXU A;  1V6N A;  2JDU A;  2GN3 A;  3PU3 A;  4IV3 C;  2D44 A;  4ZXE A;  5CKN A;  2BGO A;  1H8T C;  4P00 B;  2Y0O A;  4OUL A;  4P9X A;  4NHX A;  4PHZ A;  4GJY A;  2P3Y A;  3WUC A;  1ZA4 A;  1YQ8 A;  2YGL A;  5A3L A;  4GKY A;  2FZ1 A;  3CDZ B;  1C8M 3;  1DQ1 A;  2GH8 A;  3HR9 A;  2XWJ B;  5F3C A;  3W59 A;  2XML A;  4ES8 A;  2BOI A;  1PGW 1;  4NWW A;  4D8M A;  3IT8 A;  3ZN6 B;  2JDA A;  4CPB D;  4YFZ A;  2FDG A;  4CDW B;  2QBX A;  2VBD A;  1W8W A;  2YXS A;  1RXF A;  3N9O A;  4HN1 A;  5FYV A;  4E8D A;  1OPM A;  1AR9 1;  2CDO A;  4OQ9 A;  4QQL A;  2VQ0 A;  5A33 B;  2E9Q A;  1H9W A;  5FRA A;  2VZ1 A;  3LIG A;  3MFA A;  4M3C B;  4O9G A;  1AL0 G;  3AJY A;  1L7R A;  3UET A;  4J6G A;  5JI9 A;  4JGZ B;  4N8M A;  1IPS A;  4WVV A;  4AQ6 A;  1U0A A;  2VEC A;  4XUO A;  2RS3 3;  3I59 A;  2O8Q A;  1OOP B;  1G9A A;  5AVA A;  3KGL A;  3NMB A;  3MO4 A;  4KU7 A;  1DQ2 A;  3BTX A;  2PAM A;  1DFQ A;  1GFF 2;  3X29 B;  4KH9 A;  4BZ4 A;  2WWS A;  4FPL A;  2D40 A;  3KCX A;  3GAL A;  2MHF A;  2X29 A;  4UFK A;  1H9P A;  2CSG A;  4LA2 A;  4XF3 A;  3AP6 A;  2ZAA A;  3P5B A;  3JB4 C;  4YGB A;  2VGD A;  1DYO A;  4GMP 3;  4O7X A;  4QU1 A;  1VRH 1;  3PTR B;  5HXV A;  1ODN A;  4GH4 C;  2Q8C A;  3ZVX A;  1NZC A;  4RSU A;  4YW6 A;  5IVV A;  2GC2 A;  3JBG 3;  3IAP A;  4NHM A;  4B3N A;  1NT0 A;  1YI7 A;  4QHZ A;  2JXA A;  1EUU A;  2G19 A;  3LB9 A;  1FPN 1;  3TWI A;  2PXJ A;  1VBD 2;  2ZGN A;  2VQA A;  5DZG A;  1YQ6 A;  3ZFF A;  3A4U A;  2EVX A;  4ZS3 A;  4C0B A;  1D4V B;  1PZ9 A;  3TEY A;  4XJZ A;  3FJS A;  1LTE A;  4XQW A;  5JAX A;  1JH5 A;  5FBJ A;  3I2F A;  4LE3 A;  3P3N A;  4QHB A;  4XIK A;  3QCW A;  3J7H A;  4AGV A;  2P17 A;  3POW A;  4YZ3 A;  3O12 A;  1XYO A;  4CDQ B;  4ZKT B;  2RDR A;  1QH7 A;  2EAK A;  1TNR A;  4H14 A;  4Y4Y A;  2E7T A;  1S55 A;  3VBU A;  1CWP A;  2B42 B;  2W95 A;  4I02 A;  1YLL A;  3KGZ A;  2ORX A;  3PLQ A;  1JZ5 A;  4AVC A;  4C8D A;  1C8N A;  1O4T A;  3UK9 A;  1RUF 2;  3IDC B;  3WD5 A;  4GMP 0;  4IGQ A;  4XAB A;  1JYI A;  4XE9 A;  3CHX A;  2D6K A;  3J8F 2;  2Z2S B;  1H30 A;  4OZX A;  4UFI A;  4ATE A;  3UL2 A;  3PUA A;  1W8N A;  3R05 A;  3AM2 A;  1UN1 A;  1NA1 A;  3MLK A;  4TZD A;  3GHN A;  1W6M B;  2WO7 A;  5F3G A;  4A3Z A;  1BMV 2;  3O1M A;  1QY4 A;  3LDK A;  1LGB A;  3W5M A;  1OXC A;  5DAW A;  4ARX A;  1RYY A;  2RDQ A;  1UO9 A;  2A75 A;  4RFT 0;  3BPZ A;  4HL0 A;  3DXT A;  3OD0 A;  1A78 A;  4CDU B;  1ASJ 3;  3CZJ A;  1R1A 2;  2KD7 A;  1SDW A;  3NL1 A;  1JTZ X;  1RUJ 3;  5EJ3 A;  1SPP A;  2ENR A;  3JD7 1;  1OKQ A;  3ZXD A;  4AFD A;  4BH9 A;  4OI2 A;  1BMV 1;  5I91 A;  1RMU 3;  1DYK A;  1S4C A;  1FOD 3;  2EXK A;  1ULF A;  3CF6 E;  1HB2 A;  1YO8 A;  4O65 A;  5HI0 A;  1EYB A;  1OUS A;  1XSQ A;  3V0A B;  5GZC A;  3VN4 A;  2GZW A;  1WGP A;  1XU1 A;  1H6Y A;  3WV6 A;  2ARB A;  3N4M A;  2A7A A;  2YRO A;  1NKG A;  4X6Q B;  4LO7 A;  1NLR A;  1OVP A;  2WAA A;  1A8M A;  4AE2 A;  1UPS A;  4HMZ A;  1AF9 A;  5DG2 A;  3ZN4 A;  2BWC A;  5CKQ A;  4CP1 A;  4XFC A;  3OPZ A;  4D7T A;  2F4P A;  4JGZ C;  2GP3 A;  3OGV A;  4P9Y A;  3UES A;  1OKO A;  3ZFE B;  2E33 A;  3N7K A;  5HCA A;  3TNQ A;  1UKG A;  4NVP A;  4ZS2 A;  4A2U A;  3AB0 A;  2DUR A;  4RA0 A;  4BK4 A;  3WW3 A;  4I2O A;  4NR1 A;  5IHR A;  2HWB 1;  1HV1 A;  1OOP C;  2WO2 A;  3M8L A;  4UW6 A;  5DZF A;  3VHO A;  1PVX A;  1RIN A;  1G9D A;  3NRU A;  4AFM A;  4L9B A;  1SLT A;  3K46 A;  1CD3 G;  2GC0 A;  2V4V A;  1CAW B;  5GLT A;  3UKN A;  4UFL A;  5IK5 A;  1VBC 2;  1MR5 A;  1GZW B;  5GM0 A;  5IWF A;  2PHT A;  2R30 A;  1BXH A;  3K75 B;  4MGI E;  2WWU A;  4Q26 A;  5A6Z A;  2ZMK A;  5LK5 A;  2VUA A;  1W3V A;  3ZLI A;  2WSU A;  1CAV A;  1PGL 2;  3DKW A;  3RMX A;  4PQ9 A;  3VZM A;  5FLH A;  3I2D A;  5ANQ A;  1RUG 3;  1W6P A;  1BBT 2;  1NAE A;  4QX0 A;  4XUQ A;  1W8F A;  3OGS A;  2PLV 1;  3LEK A;  4RHV 3;  3SQO A;  4AF9 A;  1H8V A;  2OA2 A;  3DKQ A;  4AGG A;  4BE3 A;  2AGS A;  2WRA A;  2JEN A;  3NW4 A;  1W9Y A;  4Q8L A;  1JUH A;  3B5L B;  3T0A A;  2UYA A;  3NWK A;  4JKK A;  1VBB 1;  1PGL 1;  4FPY A;  1MQT B;  2WII B;  2F17 A;  1GKB A;  4KI5 M;  2O0O A;  1DG6 A;  2WWJ A;  2ZHN A;  3EHK A;  3GZA A;  3NQH A;  3LFM A;  4Y20 A;  5FZO B;  4CTE A;  3H8U A;  2WZR 1;  1W9T A;  1QJX 2;  3LEI A;  5FK7 A;  1UY0 A;  1VMF A;  1B35 B;  2ARX A;  3GZT B;  3DEM A;  1CVN A;  1V6L A;  2E53 A;  1WD4 A;  2WR9 A;  5B2G B;  2OKX A;  3VBF B;  2VUC A;  2ZGK A;  3Q8A A;  5IAV A;  1S0C A;  1P8J A;  4AAX A;  2VC9 A;  3GBF A;  4F7Z A;  1QJX 1;  4BWO A;  1F9K A;  5FOB B;  1Q8V A;  4NID A;  1HXS 3;  4YG6 A;  4AOC A;  5C4W B;  4RS5 A;  4IER A;  5AC9 1;  4ZPI A;  3VZO A;  1QQP 3;  1X50 A;  3HQU A;  2VOX A;  4DEQ A;  4XQ4 A;  5FO8 B;  1AYN 3;  1G9F A;  3QH6 A;  3OY8 B;  2WNV B;  2ZX1 A;  4AFC A;  5JWP A;  3PTY A;  1Q56 A;  1LCL A;  4BLJ A;  4DOU A;  1KRI A;  2X5I C;  3DF0 A;  2R04 1;  1RHI 2;  3BN6 A;  4BB3 A;  1KS4 A;  4AGR A;  4XFH A;  2PHD A;  4IEZ A;  4CCL A;  1LEN A;  2DBN A;  4E4S A;  3HD8 B;  1W8O A;  3M70 A;  4CDU C;  2DTY A;  3WCS A;  2HWD 3;  3NAP B;  3K3O A;  1UU4 A;  4Y1U A;  1Z0H A;  2WFF 1;  4MHR A;  2ADD A;  1V6O A;  2VY0 A;  5T3N A;  4CUC A;  5CFD B;  4AVS A;  3AXE A;  4YW2 A;  2VOK A;  1V6K A;  1GP6 A;  1LOF A;  2RM2 2;  3SHR A;  4QQO A;  5FCC A;  5J48 A;  4I0A A;  3V65 A;  2R06 1;  1FMD 1;  3JU9 A;  5SV8 A;  2VU9 A;  3C7F A;  4MXV A;  1AR6 3;  5T5O A;  4XXP A;  5F6K A;  3JZV A;  2NMO A;  4LBQ B;  3PIG A;  3T1M A;  5EPA A;  4NHY A;  3ILN A;  3K3N A;  3O0X A;  2BDR A;  1AYM 3;  3APB A;  4CCK A;  3AXD A;  1G6N A;  3MW3 A;  2PHW A;  4HFS A;  3DPR A;  3ZFE C;  1JMU B;  3M3I A;  4Q4Y 2;  4HET A;  4JRL A;  1RXG A;  3AVS A;  4LO4 B;  4EQV A;  2CNA A;  3VZK A;  2XXZ A;  2NM1 A;  4KGG A;  4CXY A;  2ETE A;  1RUC 1;  3TEZ A;  4I30 A;  4PLO A;  1OVS A;  4Q27 A;  1AVB A;  4UW3 A;  4LNV A;  2P3I A;  2XHN A;  3M2M A;  1ZBE 3;  2V09 A;  3U07 A;  3IKW A;  3RYR A;  4MX3 A;  4PDW A;  4LTA A;  2X09 A;  4Q4Y 1;  5LY2 A;  2UWB A;  1YHF A;  4LK6 A;  3UKT A;  4V2V A;  1C8M 1;  1HX6 A;  5CFC A;  1CAU A;  2UWA A;  3CBN A;  4XJ8 A;  5C8C A;  4Y24 A;  4PIY A;  4K7J A;  4KWK A;  3INA A;  3KT7 A;  4YLZ A;  5FQ0 A;  3ZR5 A;  3E6B A;  1ZZC A;  1GOH A;  4XJW A;  4AK3 A;  3IIA A;  3MV1 1;  1Z7S 3;  2VNR A;  5J3U A;  3BIW E;  1FAT A;  1X9P A;  1H2L A;  2RDS A;  4RR3 C;  4Y3O A;  4FFH A;  3E5X A;  3VDB A;  2VTX A;  3MLL A;  1W99 A;  3IPV B;  4QM8 A;  5J96 B;  2CDP A;  2WC2 A;  4ZZ5 A;  2W68 A;  3NV4 A;  1HRI 2;  1MQT C;  5FP3 A;  1W0P A;  3SCF A;  2B9V A;  3UV9 A;  3LZZ A;  2WL1 A;  5FR3 A;  4BXF A;  3KWV A;  5FXV A;  5IK7 A;  1R64 A;  1ND2 B;  4XJ9 A;  2A5Z A;  3HJR A;  2HEW F;  1B35 C;  1N3O A;  4TYS A;  2RS3 1;  5FPZ A;  5ACA 3;  2Q5T A;  3FX3 A;  4IE6 A;  1IS3 A;  4CUA A;  1OSG A;  1ENX A;  1OUX A;  2B39 A;  4GKX A;  2Q8D A;  4EN0 A;  5FMO L;  4ZXK A;  4ATF A;  5FY0 A;  3LKJ A;  4OMD A;  1HRI 1;  4DIN B;  4XUN A;  4IW3 A;  3URF A;  1ZA7 A;  2OT7 A;  2XBO 3;  1GWL A;  4QXC A;  3HBK A;  2W91 A;  2J1V A;  3VKF C;  3FE5 A;  5CZK A;  3E5U A;  2BUK A;  3OBA A;  5C4W C;  1AR8 3;  2MEV 2;  3NNJ A;  3I2G A;  5FP4 A;  4BDV B;  4F3J A;  4Q4X 3;  2RE9 A;  1OI6 A;  2VVD A;  3MBW A;  1UX7 A;  4AW7 A;  3ZXE A;  2WNV C;  4GMP 1;  5F2S A;  5BY5 A;  1KDM A;  3NV2 A;  1J59 A;  4XET A;  4DRV A;  3ZOI A;  5DAP A;  4AQS A;  1YUD A;  1VJ2 A;  1COV 2;  1JYX A;  1POV 3;  1VMH A;  3NAP C;  1TEI A;  5A32 A;  1VAK A;  4PCR A;  4P9I A;  3MDP A;  1RTV A;  2OYZ A;  3NV3 A;  3RJR A;  5CFD C;  3CJI A;  5A70 A;  3VDD A;  1YC6 1;  3AYA A;  1HQL A;  3S30 A;  5JOW A;  3EJK A;  4LEJ A;  2FDF A;  5C70 A;  4QX1 A;  1COV 1;  3WHU A;  2HWF 3;  5FZG A;  3OG2 A;  3KS7 A;  4HAN A;  4NO4 A;  2JEM A;  5EJ1 B;  3RSJ A;  1F4A A;  1V6M A;  1WLC A;  2J7M A;  1QOO A;  2LW8 A;  2UU8 A;  3OEA A;  4UOJ A;  3THT A;  5JSP A;  5FY1 A;  2BV4 A;  1S0F A;  5E1R A;  2A3W A;  4D6R A;  2QQU A;  1OF3 A;  1NOV A;  5IVB A;  1JS9 A;  3BU0 A;  3PDQ A;  2J1T A;  1BEV 3;  2VVE A;  3LQC A;  2GDF A;  3M3Q A;  5BNP B;  3MPP G;  2XJP A;  2AEN A;  1XBF A;  4AED C;  3RI8 A;  5A3O A;  4BIO A;  1OBN A;  3H50 A;  1L3J A;  4HSL A;  3LE0 A;  4A6O A;  4W6W A;  1PO1 2;  2ZGL A;  3PUS A;  1OQD A;  1GNH A;  3RDI A;  2AH2 A;  1TQ5 A;  4XW3 A;  4XAA A;  5I93 A;  1W6O A;  3AZY A;  1WBF A;  3ZIW A;  2EIB A;  4BQY A;  4COV A;  2OPK A;  4UW5 A;  4QPG A;  1ZZ7 A;  4WM8 B;  2J42 A;  4LKF A;  4UWD A;  3ZXK A;  1RUJ 1;  4ZU5 A;  1QWR A;  3POE A;  3BB6 A;  3ZO0 B;  1RMU 1;  1UMZ A;  4QDR A;  4HXC A;  4CCE A;  2ZGO A;  3WQ7 A;  3B9I A;  3VZL A;  2JE9 A;  1GZT A;  3LEM A;  3ZXA C;  1V9U 3;  4LO5 B;  4XFI A;  1XND A;  3H3L A;  2D7F A;  5HCB A;  2Y60 A;  2P4E A;  1DGL A;  2WQ8 A;  1UF2 C;  3OF1 A;  4HKW A;  5IFT A;  2AR6 A;  4LKS A;  5FZ9 A;  3VDC A;  1ZBA 2;  4YM2 A;  3UNP A;  5JXI A;  1AR7 3;  3SXW A;  4OI0 A;  1ND2 C;  1C1L A;  1C1F A;  1OMI A;  3A7Q A;  5DDJ 2;  2W87 A;  2Y6H A;  4K9S A;  3MW2 A;  4OFG A;  4WZC A;  4NN0 A;  2XJU A;  5FXZ A;  3U37 A;  2P6C A;  3A0N A;  2UUR A;  5D8A B;  3WDY A;  4CU9 A;  2QNK A;  4V2W A;  4MGQ A;  2GP5 A;  3H1M A;  1S2K A;  3T2P A;  4CP9 B;  4IEV A;  4YVW B;  2ARE A;  4LBQ D;  2RR1 3;  2C1F A;  3OCP A;  5EQU A;  4CPB A;  1V0A A;  4P9G A;  5LWB A;  5DDJ 1;  4XDO A;  2XVG A;  2ET1 A;  5K4L A;  1V70 A;  1Q43 A;  1ZRD A;  4NRP A;  2MNG A;  1XE8 A;  2VCA A;  1QNY A;  1VAV A;  3AP7 A;  4MUV A;  3MEP A;  1YJL A;  4GD4 A;  3Q9O A;  4XFG A;  2W1Q A;  1CJP A;  2D6O X;  1PVC 2;  3PUH A;  2B9U A;  2BNO A;  2Y38 A;  2QQN A;  4H7M A;  3LOB A;  4QKD A;  2Y6G A;  1JYV A;  2YC0 A;  3VBR A;  5ABJ B;  2X8K A;  3KF3 A;  1OC1 A;  1HJG A;  2RMU 2;  4I3P A;  1LRH A;  4K1Z A;  1PZ7 A;  1S0G A;  2A6W A;  2WQ4 A;  1SLI A;  3C7O A;  3DGT A;  4NHL A;  1R08 2;  4IUG A;  3RS6 A;  1IZ3 A;  2ZGR A;  3MW4 A;  5FAX A;  3O1O A;  5JXJ A;  4FP3 A;  2A3X A;  1NLS A;  2YPJ A;  4Z82 A;  2UY9 A;  2W47 A;  5CBL A;  1E5S A;  1RJ7 A;  4FPG A;  3C2U A;  3FLT A;  1SLC A;  5FZ3 A;  4Z1V A;  3MID A;  3O5S A;  1VBE 2;  3D0S A;  1JYN A;  1WKY A;  2ZGU A;  1GNZ A;  4CEW C;  5FZ4 A;  1R08 1;  1VBA 3;  4D6S A;  4WBB A;  2WS9 3;  5HV4 A;  4LBO A;  5G05 L;  4N7U A;  4XMA A;  5A7O A;  2PA7 A;  1YI9 A;  1W6Q B;  5JLV A;  3KT4 A;  2YBP A;  5KHG A;  1QQP 1;  1UZW A;  4NWV A;  5CG8 A;  1XNK A;  1OA2 A;  4AI3 A;  1OFN A;  1AYN 1;  4AWD A;  4N43 B;  5FYH A;  1XC6 A;  2J22 A;  4BU2 A;  1EP0 A;  3MFC A;  1IKQ A;  1XSR A;  1Y43 B;  1D0H A;  5FFO C;  1F4H A;  4KWL A;  4E2Q A;  5JPM B;  5E88 A;  4IGP A;  5HCF A;  3I54 A;  4BME A;  4WM8 C;  5A7P A;  2HWD 1;  4LIV A;  3WDX A;  1C3H A;  3FHI B;  5HBA A;  3VBO B;  4COW A;  3GBG A;  5FYT A;  4CXW A;  4Q4W 2;  2ZZQ A;  4H2A A;  3HVD A;  3ON7 A;  2VXJ A;  1LUL A;  2LTN A;  4PLM A;  1YQ2 A;  4Y1Y A;  4DQA A;  1QJF A;  2B4K A;  3POI A;  1Q8P A;  4FXK B;  1EPW A;  1K3I A;  4JKL A;  2ZS6 B;  4JC1 A;  1AR6 1;  1YQ5 A;  3ZYH A;  1UOF A;  4KQ7 A;  1GSL A;  3T2O A;  1TME 2;  5H9Q A;  1AYM 1;  3OUI A;  2D98 A;  3H7Y A;  1QU0 A;  1QDC A;  1Z78 A;  3ZDS A;  3KHC A;  2OX0 A;  2BEO A;  3KMH A;  4QDQ A;  4C90 A;  1C4R A;  5FDB A;  1W28 A;  1ULG A;  2LRP A;  5LRS A;  3O1T A;  2IXK A;  2WJS A;  3ZSK A;  1XYN A;  1J1L A;  3N35 A;  1UOB A;  2WZ8 A;  2J1U A;  5D8A C;  2DDU A;  3ME2 A;  3PHM A;  2JB8 A;  1U5I A;  5JVV A;  2BJS A;  1TME 1;  1F35 A;  4YVW C;  2WBK A;  4OUM A;  1HJF A;  2QQI A;  2HBT A;  1OQE A;  3F95 A;  3MUZ 1;  4Y5S A;  4QX3 A;  4YWA A;  5JZG A;  2XUM A;  3B9C A;  1QJY 2;  3H3U A;  2CGN A;  3VD7 A;  5I0S A;  4EE2 A;  1RUH 3;  1QJU 2;  3VBH B;  3I97 A;  1BK0 A;  1JHJ A;  1UIK A;  4OCT A;  2QE3 A;  2WA4 A;  2EIC A;  2Z42 A;  3OYW A;  3D8C A;  2VBP A;  2DVA A;  2EID A;  4ZU7 A;  1KDK A;  1DQ4 A;  1Z7S 1;  2JDY A;  3N9Q A;  5IVC A;  1HRV 3;  4Y33 A;  1MZF A;  1X9T A;  2W3J A;  3OEB A;  5CNA A;  5ABJ C;  1MEC 2;  1UYZ A;  3WDT A;  4KG8 A;  5FPX A;  2BOJ A;  1ZZ6 A;  3WT3 A;  5FUP A;  3RI9 A;  3PVE A;  2JEC A;  4SLI A;  4U36 A;  1QHD A;  1UZY A;  2Q1M A;  1CIY A;  2ZHL A;  3DYM A;  4MG2 A;  3DCQ A;  2WIN B;  2Y0I A;  3OJB A;  1F5J A;  1QIQ A;  2AYH A;  3WDV A;  1M4W A;  1YWK A;  3UJO A;  1SMV A;  4NUB A;  1J1T A;  3JUU A;  4QU2 A;  2EIG A;  1EV1 2;  2G4I A;  4JHT A;  4Y22 A;  4D7Y A;  5ACA 1;  2DCY A;  2VNG A;  3ACH A;  4QB6 A;  4DXR A;  3N9L A;  1OLQ A;  1SBF A;  2JDK A;  4XPV A;  2ZA9 A;  4AHW A;  1MS3 A;  1B09 A;  1S0I A;  5KC6 A;  2JKB A;  2RVA A;  4PLN A;  1HW5 A;  3VD3 A;  4EN6 B;  1EUT A;  1AJK A;  1CPM A;  4QPI A;  1CES A;  3E1F 1;  3OSD A;  1AL2 2;  3BTA A;  1S1A A;  5F3I A;  3Q8E A;  4OI1 A;  3VGI A;  4BCU A;  5IVE A;  4UW4 A;  1AR8 1;  3AJZ A;  1K5J A;  4ITC A;  2DWR A;  4MH0 E;  5DAX A;  1EV1 1;  1QXP A;  1S0B A;  3MPB A;  4Q2F A;  4FXG B;  5FYM A;  2XL7 A;  3A23 A;  4WVM B;  3USU B;  1SQ4 A;  2A71 A;  3K2O A;  4LLF A;  5FRE A;  2ILM A;  5C8W A;  3FFZ A;  2PMW B;  3LGR A;  1D0G A;  1POV 1;  1AL2 1;  4IE5 A;  5GZE A;  1LJ7 A;  1AR9 2;  3H1W A;  3EBR A;  3J7N A;  3OGJ A;  1UMI A;  5LRR A;  1JOP A;  2P3K A;  4JDN A;  3ZN6 A;  1V6J A;  3ZPO A;  5KHI A;  3VBO C;  4AHY A;  2D3P A;  3AP4 A;  3LF7 A;  4A41 A;  4CDW A;  1X82 A;  5CG9 A;  3ZR6 A;  3VL9 A;  4P5H A;  3SCH A;  1U5Z A;  2R0H A;  3NJY A;  3MF6 A;  2YC4 A;  3E5Q A;  1UXZ A;  3T2T A;  2Q8O A;  1WMD A;  4N9I A;  4D7S A;  2EXI A;  2HWF 1;  1QGL A;  4M3C A;  5GLV A;  3JXS A;  5F39 A;  3WSO A;  2K46 A;  4P9W A;  2DYC A;  5LBC A;  3N9P A;  1SEF A;  5LAT A;  1BJQ A;  5JCT A;  1XB9 A;  3LEG A;  1CQ9 A;  2CHH A;  2VZQ A;  3DUI A;  4JGZ A;  3WDW A;  5A3W A;  1PM4 A;  1UYP A;  3WG4 A;  3T4V A;  2IFW A;  2DCT A;  1BEV 1;  4I3G A;  4ASM B;  2A6X A;  2D6P A;  2D93 A;  2ZAC A;  1IS6 A;  1AXZ A;  4JQR A;  1FNY A;  1S2B A;  1YFY A;  2WNE A;  5FZK A;  5GLZ A;  3PJY A;  4IE0 A;  2HEV F;  3WIN E;  1PX3 A;  3HT1 A;  5DUV A;  1QOS A;  3CQO A;  3WNO A;  5A3P A;  2WA3 A;  1IOA A;  2VNO A;  1D4M 2;  1W39 A;  1VRH 2;  2RS1 2;  4JV4 A;  1BLZ A;  2VW2 A;  4NAM A;  4G3Y C;  5FPV A;  4Y5T A;  5FXW A;  3HT2 A;  2XQX A;  1WBL A;  3VBH C;  2VMH A;  4I0B A;  3T0B A;  4EJR A;  1KJL A;  3FBM A;  4HKO A;  1FPN 2;  4FQZ A;  4AL9 A;  4OLL A;  1SDD B;  2BZD A;  1KS5 A;  2ID4 A;  3RWK X;  4BQW A;  2QCS B;  5CA6 A;  1AXY A;  4OMC A;  2WAB A;  3G6J B;  3SH3 A;  1D4M 1;  1SBD A;  2RS1 1;  5FYC A;  2ZOE B;  2WSV A;  1V9U 1;  3IB3 A;  3ACI A;  2Q1Z B;  3RZZ A;  4R8H A;  3LFI A;  3SKV A;  3U14 A;  3ES1 A;  4XHB A;  4DS0 A;  3LA7 A;  3GBW A;  4XEZ A;  1AX0 A;  5FKB A;  2YG0 A;  3VHN A;  4CDQ A;  1XNA A;  3AX4 A;  3I2O A;  1RVF 3;  1SLB A;  2PAK A;  4Q4V 3;  3ILF A;  3QD6 A;  3OGR A;  1VE0 A;  4ISQ A;  5ANN A;  5CIS A;  1EAH 3;  5EFU A;  3N7L A;  2YBK A;  2I07 B;  2EAL A;  4M3C F;  2IFR A;  3OGG A;  4CDX A;  2WT0 A;  3H9A A;  4BLI A;  4AI8 A;  5KXB A;  2UYB A;  5FYB A;  1MS5 A;  2RR1 1;  5FYS A;  3OBT A;  5A3U A;  3IZO A;  5F5I A;  4OHZ A;  4YSF A;  2PHF A;  5LK7 B;  3IDB B;  5GZF A;  5C7G A;  2FD8 A;  1GU3 A;  1N1T A;  3U75 A;  1K45 A;  3I3D A;  2ARC A;  1GBG A;  3A21 A;  3JD7 2;  5AFB A;  5C3O A;  3BUC A;  4IQP A;  2GNB A;  4UFM A;  3DN7 A;  3ZFF B;  4AZZ A;  1NE4 A;  4XCB A;  4PF1 A;  2XGX A;  3FZ3 A;  2DU0 A;  4CDU A;  3WXP A;  1GMM A;  2X5I B;  5JSR A;  4YFW A;  1H4G A;  1NCQ C;  1W8U A;  3B3Q E;  4R9C A;  1ND3 A;  4XXA A;  5I8T A;  5GZD A;  3ZYP A;  4KWU A;  1YEW A;  4TN7 A;  1I3H A;  3GDB A;  3LPG A;  3T1L A;  4R52 A;  3V0A A;  2ZHK A;  2JE8 A;  4M0N A;  3T08 A;  1HIX A;  2RS5 2;  4GUL A;  5A6Y A;  2WNO A;  4LUL A;  3IN9 A;  5F5C A;  1RUE 3;  2ZEW A;  3PL0 A;  3PIJ A;  5T5J A;  1TMF 3;  2HWB 2;  3LIH A;  4HT1 T;  5KBF A;  4GXL A;  3KV9 A;  1D7P M;  4PQQ A;  1PIV 3;  1U12 A;  2YBS A;  5FP9 A;  3K4A A;  4XTM A;  3USS A;  2WS9 1;  2YGM A;  2RS5 1;  2O1Q A;  1IG0 A;  5LA9 A;  2DCZ A;  3E6D A;  4FO9 A;  4L0P A;  3GJA A;  1MS4 A;  3E97 A;  1W05 A;  3HNY M;  4QM9 A;  4W65 A;  3ZXF A;  5LEJ A;  5AFE A;  2FMD A;  3M3E A;  1CAW A;  2XH6 A;  4ES9 A;  5I8Y A;  1UYX A;  1RED A;  3TN9 3;  3IWZ A;  2WYF A;  2WT2 A;  2JG9 B;  1GZC A;  1REE A;  4CEY A;  2PLV 2;  1XPW A;  1NQJ A;  2A6Z A;  4CYD A;  2VOT A;  4JGY B;  3UJQ A;  3TB0 A;  5FYI A;  2B46 X;  3J26 N;  3ZXL A;  3AP9 A;  5I8S A;  1DZR A;  3FWE A;  4MGT A;  3BPS A;  5FUN A;  1KD7 A;  2QQW A;  4FFG A;  2IC1 A;  1W9F A;  1VBB 2;  4YW4 A;  2Y6F A;  1LES A;  1WMF A;  4AQ2 A;  1LHN A;  4A7Z A;  1PO2 2;  3ATG A;  2WZR 2;  4TLG A;  5FYU A;  1K5M A;  4BM8 A;  2R16 A;  1JBC A;  1MQT A;  4KNC A;  4RR3 B;  2D43 A;  3WOG A;  3ZYG A;  2HKX A;  1FYU A;  3CKH A;  5HPO A;  5FZO A;  3KM5 A;  2F6B A;  5FPA A;  1RIR A;  4CP0 A;  3FLP A;  4MGS A;  4KG0 A;  4B7K A;  5JMC A;  1N3P A;  3FMG A;  3ORJ A;  4NOT A;  1BHG A;  4FPJ A;  1PO2 1;  4JHZ A;  4XF4 A;  3WX5 A;  4XMI A;  3RYP A;  5FZ8 A;  4WVW A;  1SFY A;  3VBF A;  3I2J A;  1OFS A;  4XBN A;  5AC9 2;  2BVB A;  2ET7 A;  1WCK A;  3OUH A;  4CCO A;  4CZS A;  1GWK A;  2BP6 A;  4D3W A;  4AHZ A;  2YV8 A;  4LUM A;  5FUI A;  1UX6 A;  4LUK A;  5K0U A;  3ZPY A;  2VAU A;  2ZZJ A;  4MAD A;  1BQP A;  4IEW A;  2ZGQ A;  2C26 A;  4RD7 A;  1QKQ A;  1RIT A;  2R04 2;  4GWJ A;  4KMQ A;  4S2G A;  1RUH 1;  3OY8 A;  1V00 A;  5FO7 B;  2Q0A A;  2VM9 A;  1O7F A;  3ASI A;  4LHS A;  2WFF 2;  4EYU A;  4PI2 A;  5DAB A;  1WCD J;  4OHV A;  2IVJ A;  4GB3 3;  5GAL A;  5J98 B;  1YQC A;  3ZFF C;  3GZE A;  2HWE 3;  4WM7 B;  4DNY A;  3FHQ A;  1TZO A;  1WCU A;  1HRV 1;  4EWD A;  2YFU A;  2MPF A;  2Y6L A;  5EIY B;  5BNN A;  4UF0 B;  2R06 2;  1FMD 2;  2CYF A;  5DUU A;  1AHS A;  4FOV A;  3KV6 A;  5IVY A;  3H1Y A;  3ZX7 A;  5JXH A;  1PK6 B;  3ZXJ A;  4YW3 A;  1PNF A;  2WKK A;  1K42 A;  2OW4 A;  3FHA A;  5LCW L;  1XU2 A;  4CRQ A;  3PNA A;  1CZV A;  1QDO A;  2C0Z A;  4LBQ A;  4ZY9 A;  3GCX A;  4K20 A;  4LQR A;  2JJ6 A;  3MV0 1;  1VIW B;  3VKM A;  4YGD A;  1RUC 2;  4RS5 B;  1YFU A;  5EWS A;  2FDI A;  2DVB A;  2VZT A;  3ACF A;  4IE7 A;  5EYY A;  2Q8E A;  4HKL A;  5BNO A;  1W0O A;  3L2Y A;  2W1S A;  5A7Q A;  5FY8 A;  1HDK A;  2HWC 3;  5IAX A;  2PEL A;  3R4S A;  3RWN A;  4AI0 A;  1BZW A;  2R1B A;  4BQ4 A;  1LOC A;  2VZ3 A;  4H3W A;  4BMB A;  1C8M 2;  4MO3 M;  2W0X A;  4AED B;  1R09 1;  5C33 A;  3UGH A;  1R1Z A;  4YG3 A;  2JG9 C;  4CUG A;  4RQP A;  3THC A;  5L9R A;  1O6U A;  1F2N A;  1KFU L;  1UL9 A;  3AYD A;  4JGY C;  5IW0 A;  1PZ8 A;  1CX4 A;  3AMQ A;  5IYY A;  1XE7 A;  1X36 A;  3ACG A;  4L99 A;  1ULD A;  3NVC A;  1HN1 A;  2HH9 A;  1H2N A;  3OTF A;  2OS2 A;  2WYS A;  4F83 A;  3WP3 A;  4HOO A;  3IPV A;  5A1F A;  1S0J A;  3ABZ A;  3VKN A;  3WUD A;  4XZP A;  3DPR B;  4MZU A;  1K12 A;  5AVP A;  2AEY A;  2BW8 A;  1YJK A;  2RS3 2;  3ELN A;  4M01 A;  1LOE A;  2YPD A;  2IXJ A;  3ZN5 A;  3F2Z A;  1KEX A;  3AZZ A;  4A44 A;  4B8E A;  3G7D A;  1ND2 A;  3POG A;  4KWJ A;  5FJK A;  2XJR A;  1LNS A;  2FQP A;  5FMC A;  2W39 A;  2W5F A;  2XG3 A;  1VR3 A;  1KQR A;  3B69 A;  4MXW B;  4IEQ A;  1WME A;  4PF5 A;  1CAX A;  2XDV A;  1Q3E A;  4IV1 B;  4PDW B;  4B7E A;  2QQK A;  5DAQ A;  4FOQ A;  3OPT A;  4C91 A;  4J1X A;  4JDO A;  3T2Q A;  5CFC B;  4YZ5 A;  1CAU B;  3ZM8 A;  5LW9 A;  4LXL A;  3ZFG A;  2D6N A;  1OH4 A;  1ULO A;  1ZNP A;  4S2F A;  2B7Y A;  3L2H A;  5E89 A;  4A7Y A;  3RZH A;  1C28 A;  3I3E A;  1CZT A;  4FCA A;  5C6C A;  3AL6 A;  5J37 A;  3AMN A;  3JBG 2;  4R9D A;  3FLR A;  5FMB A;  1JZ4 A;  3VUO A;  4DEV A;  3PJQ A;  4SBV A;  5BUV A;  3V0B B;  5FY9 A;  2W46 A;  4Q1R A;  3K51 A;  4Q29 A;  3WNL A;  4WM7 C;  5F8P A;  3KQ4 B;  4XCA A;  4YVS A;  2W94 A;  1RJ8 A;  2R07 3;  5LA1 A;  4JX0 A;  3RVH A;  1RUI 3;  2YHJ A;  3THP A;  3S0M A;  5JR7 B;  2F4L A;  1RUD 3;  1SHW B;  3JBG 1;  1PK6 C;  3PMS A;  4NPM A;  2QDR A;  1W3X A;  2E31 A;  1O4Y A;  1SBE A;  2I74 A;  4E8C A;  5IFP A;  5FKC A;  4LBM A;  3C7H A;  4XBL A;  1LB2 A;  1OLM A;  2KM2 A;  2VR4 A;  3LSD A;  2GN7 A;  1AJO A;  4W6X A;  4XDQ A;  1RVF 1;  2P37 A;  2WNU A;  1AX2 A;  2XKO A;  2CAV A;  4K3U A;  4Q4V 1;  4HN0 A;  4BXS V;  4E4H A;  5FIX A;  1BKZ A;  2AZ5 A;  4RS5 C;  2ZAH A;  1UY1 A;  1JZ6 A;  1DDL A;  1EAH 1;  4K40 A;  4PJY A;  5A6Q A;  1W6N A;  4Y26 A;  2GMM A;  1NE6 A;  2VZS A;  5J7M A;  4QX7 A;  2K9Z A;  1QXJ A;  5BNP A;  4MYE A;  1LHV A;  1I9R A;  5A7W A;  5T55 A;  4M3C E;  2YFZ A;  4CEW B;  5DPN A;  3TOJ A;  2X05 A;  1RL3 A;  1W9S A;  3POB A;  4ASL A;  2BGC A;  1YIP A;  2C9A A;  4BHP A;  2KR2 A;  3PME A;  4NRM A;  4YZ4 A;  2X53 S;  4FPF A;  4XQD A;  4EN8 B;  1ASJ 2;  5A32 B;  1LHW A;  1POV 0;  1XXN A;  2OUJ A;  2R6Q A;  1RUJ 2;  4MGK E;  4EZH A;  3GYD A;  3NJZ A;  4RGG A;  2E7A A;  5BNQ A;  3B93 A;  1LOF C;  1RMU 2;  2N7G A;  4QQ2 A;  1O5L A;  2VMD A;  2IXH A;  5FZA A;  3VDD B;  1ULC A;  1FOD 2;  2VZP A;  3T30 A;  4D94 A;  3PUR A;  2VZU A;  5T5P A;  3J4U H;  2E63 A;  2ZXQ A;  3RNS A;  2W52 A;  3POJ A;  4LBJ A;  4N53 B;  1I1E A;  1ASJ 1;  1LU1 A;  3AKQ A;  3U0Z A;  3DEC A;  5C5U A;  3CU7 A;  2OQ7 A;  3H7J A;  5KWR A;  2H0B A;  2VH9 A;  3LAG A;  2BNM A;  4XF1 A;  3DPR C;  4HPK B;  3WG2 A;  2D6M A;  5FZD A;  5L36 A;  1FOD 1;  4LHK A;  5L7O B;  5TSW A;  1RUE 1;  4A6S A;  3HBZ A;  1TMF 1;  2RJK A;  4BQ1 A;  3BVC A;  2Y6K A;  4R9A A;  3PU8 A;  2FCU A;  3VBS A;  5JUV A;  2AEZ A;  1DYP A;  1MPX A;  1PIV 1;  4K21 A;  4BK5 A;  1D2Q A;  2H6C A;  3KCY A;  5LZ6 A;  2ZKL A;  4AG4 A;  4FPC A;  1GUI A;  1UY2 A;  1W6O B;  3M1H A;  4ONU A;  4PDW C;  4IV1 C;  4KGQ A;  2IWG B;  3AKT A;  3D82 A;  3MHZ A;  4PIX A;  4XFA A;  4CCJ A;  4PT6 A;  1H6X A;  3U1X A;  5CFC C;  4MV2 A;  5FJH A;  4CP9 A;  4QXB A;  4PBP A;  2G9Z A;  3TN9 1;  2ZX2 A;  1ALY A;  1W9W A;  1GV9 A;  2V4A A;  5F7U A;  1RUG 2;  3MF9 A;  1URX A;  4P02 B;  1OD3 A;  5FLI A;  5A7N A;  2QFE A;  4I09 A;  4RHV 2;  2VJX A;  3VHR A;  2RDN A;  1UZV A;  5FPU A;  1GYK A;  4NIG A;  4DXZ A;  3III A;  3AKP A;  3I3Q A;  4FTB A;  3NO8 A;  1TNF A;  1CON A;  2VZR A;  3AFG A;  4LLO A;  2VOW A;  1GOG A;  2C6S A;  3WW2 A;  3KF5 A;  3HQX A;  4LA3 A;  3ENR A;  4MHU A;  3RFR A;  1G9C A;  2ORZ A;  1HB1 A;  2XHK A;  3I2K A;  2VCM A;  1SCS A;  4FOY A;  1IHM A;  4G4F A;  1RUG 1;  3AP5 A;  5T54 A;  1XOY A;  2ZCW A;  4RHV 1;  5JOX A;  5I0D A;  3EXU A;  4S2H A;  5EJZ B;  1APN A;  4JQT A;  1VRB A;  4Q8K A;  1DIW A;  4K8F A;  2RJL A;  1VBD 3;  2W1U A;  3OPW A;  3CEW A;  3VDA A;  5FOJ B;  1NUK A;  1JZ7 A;  4UYB A;  1WLD A;  1REF A;  2Y33 A;  4K8R B;  2NZ9 A;  3BOP A;  3D4K A;  1QEX A;  4P9J A;  4CCC A;  4XTP A;  4L2N A;  5ISL A;  1NZI A;  2QKD A;  2R49 A;  3SC7 X;  1ONA A;  2WDB A;  1WMX A;  3KD4 A;  3VHP A;  1HXS 2;  3I3B A;  1O3T A;  2Z69 A;  5F5Q A;  4FPO B;  1MS1 A;  2X10 A;  1QQP 2;  2VL4 A;  4XAC A;  3ZIX A;  1WD3 A;  4COY A;  3WQ1 A;  4XHX A;  4XDP A;  1X33 A;  5DQ0 A;  1AYN 2;  4FI9 A;  1SFP A;  3EO6 A;  1WA4 A;  3KHB A;  1S2E A;  3TNP B;  3A22 A;  4FQ4 A;  1RUF 3;  1O91 A;  5FYY A;  2KXL A;  1W6Q A;  2VTX J;  2DCK A;  4CU8 A;  5C9A A;  2XUE A;  4XVH A;  3I3M A;  3I49 A;  3J8F 3;  3H0O A;  5DMY A;  5JXG A;  2LS6 A;  5JI7 A;  4A7K A;  1O4Z A;  1KXG A;  2BGP A;  4N43 A;  3SH5 A;  1HXS 1;  2QQJ A;  2HWD 2;  2QQM A;  2EXJ A;  3ZYB A;  2AAC A;  2HJI A;  1NCR A;  1VP6 A;  5KHH A;  4IV3 A;  4GB3 1;  4NRQ A;  2RG4 A;  3VDD C;  1WW5 A;  3D5O A;  2HWE 1;  1RUO A;  1H8T A;  1JXN A;  4URT A;  1MS0 A;  1TE1 B;  3VZJ A;  4NMI A;  2BFU L;  5H9P A;  1A8D A;  4LE4 A;  1F31 A;  2HBU A;  3VBO A;  1Q8Q A;  1ZZ8 A;  4EN9 B;  3WP4 A;  2PQQ A;  4N53 C;  5IVJ A;  1AR6 2;  1R1A 3;  1ZRE A;  1CR7 A;  4Z07 A;  4QPY A;  1WUV A;  1NY7 1;  5FP7 A;  4FFI A;  4BJ0 A;  5K9Y A;  2FCT A;  4RGK A;  1AYM 2;  1C5H A;  1DU3 D;  3TYJ A;  2JIG A;  2SLI A;  3QH7 A;  4HK9 A;  5L7O C;  3P6B A;  4GAL A;  4E2S A;  2QZ2 A;  3O7O A;  4URA A;  3LWC A;  1ZVF A;  2PHX A;  4LR4 A;  1JOJ A;  1AX1 A;  2SBA A;  5JIU A;  4W4Z A;  3SIS A;  1ZBE 2;  3ECQ A;  2G9G A;  3QLQ A;  2HWC 1;  2JG8 B;  4JAA A;  1OUR A;  1X7N A;  1SCR A;  4IND A;  3UKV A;  4D6Q A;  3H8O A;  5FZF A;  1ZM1 A;  1WWY A;  2QTW B;  3EYP A;  2FBE A;  5F9T A;  5M0T A;  4L97 A;  5IAT A;  2CGO A;  3ES4 A;  5H9S A;  4DXT A;  5BPX A;  4F8A A;  1XRU A;  3W21 A;  3WP5 A;  1MZ6 A;  3POF A;  1UQX A;  2DVF A;  3HAG A;  4NHK A;  1YXW A;  1ZBE 1;  1VBC 3;  1Z7S 2;  4R4X A;  2XL9 A;  3VBH A;  2R32 A;  3WVJ A;  1E5I A;  3PVB B;  4QX5 A;  2GNT A;  2K2S A;  3GF6 A;  2W1W A;  2C9K A;  1LOB A;  2VXR A;  3HIF A;  4LPL A;  2E7Q A;  3N7J A;  4Y1V A;  2W2I A;  1DGR A;  3BTZ A;  1SLA A;  1A34 A;  4V1P A;  5JDB A;  3UT0 A;  4A42 A;  3ITQ A;  1BBT 3;  2D97 A;  1W2N A;  1UWW A;  4XUR A;  3T09 A;  4GH4 A;  1HB4 A;  1CZS A;  1VPH A;  4P9L A;  4XJU A;  2VBB A;  4B29 A;  1SAC A;  2BBA A;  2YYO A;  1IPJ A;  1FX5 A;  3I7D A;  2C4X A;  2YUE A;  1OT5 A;  5I0R A;  1JOB A;  3K4D A;  3NKG A;  4BQ2 A;  5ACA 2;  2CGP A;  1W90 A;  4EV0 A;  4AFB A;  4HVR A;  2P2K A;  3IDE A;  5KC5 A;  5HCH A;  4YPJ A;  4GJZ A;  2JIJ A;  1MVE A;  4LO8 A;  4QHO A;  4WZF A;  3WZ1 A;  5KXD A;  3AYE A;  4XZU G;  3C7E A;  5CIR A;  1JZ3 A;  2XBO 2;  5FMO S;  4AFA A;  1GZ9 A;  2DF7 A;  4A4A A;  1N3Q A;  1QJX 3;  2OPW A;  1ENR A;  2VOV A;  2VUL A;  4Y5Z 0;  1GQP A;  1AR8 2;  4CCD A;  2XLA A;  4OVE A;  4ZHN A;  4XBQ A;  4E27 A;  3KB5 A;  4Q4X 2;  1OA3 A;  4ET7 A;  1LHU A;  4JDM A;  2HLE A;  4XYX A;  2YMZ A;  2VUD A;  4AAP A;  4NAO A;  3TEX A;  3OYW B;  5FZB A;  4QD2 A;  3ZYJ B;  1DF0 A;  2GSY A;  2XBO 1;  2BPA 2;  2O14 A;  4DY5 A;  2PHU A;  2VMG A;  2DFB A;  2I45 A;  5K7P A;  2BTV C;  1UIJ A;  2BQP A;  2QQO A;  1ZRI A;  2WN3 A;  3TRS B;  3USU A;  1WW6 A;  5KHK A;  3WF1 A;  2TNF A;  4QB1 A;  1I5Z A;  3ZYR A;  4LOT A;  1X8E A;  2PFW A;  4Q4X 1;  4ZU4 A;  3WF2 A;  4Z2A A;  1T6G C;  2XJT A;  1UY3 A;  1WCS A;  2DU1 A;  1VAL A;  3CNA A;  3H42 B;  5FP8 A;  3Q8F A;  2R07 1;  5DUW A;  2Q30 A;  1RHI 3;  2QQV A;  3IMN A;  1RB8 G;  4G9S B;  4KU8 A;  4BQ3 A;  3P3P A;  3CJX A;  2HWF 2;  1BVV A;  1RUD 1;  1YNA A;  3BCW A;  2BER A;  1LGN A;  3QOP A;  1VLN A;  4MLO A;  3VB9 A;  3B94 A;  4Y22 B;  1LAJ A;  2L9L A;  5J1X A;  2J1R A;  1UNB A;  1NCQ B;  4I0W B;  1LOA A;  5BV6 A;  3KV4 A;  4QAW A;  3R4D B;  2RM2 3;  1DLL A;  2ZEY A;  3U78 A;  2VUJ A;  4ISR A;  5KR7 A;  4MGZ E;  3AMP A;  3FUQ A;  5K8S A;  5LB6 A;  1BEV 2;  1EPZ A;  5CU1 A;  1E5H A;  4OQ8 A;  1QOT A;  3TAY A;  2IUW A;  1LED A;  4QPI B;  1CPN A;  4XFB A;  5A33 A;  2BBV A;  3WR0 A;  2W08 A;  2V5Y A;  1LU2 A;  2GC3 A;  4BIF A;  4DY3 A;  3HEI A;  4QQP A;  2VVF A;  2NN8 A;  2CWS A;  3ZSM A;  2GND A;  3O0W A;  3HMY A;  4FFF A;  3ZSJ A;  2PQS A;  2WZE A;  2Y6J A;  2JG8 C;  3BU7 A;  4Q4Y 3;  1ENQ A;  2E6V A;  4QX8 A;  3WY6 A;  4RYD A;  3ZYF A;  4X8N A;  4AEM A;  3AKR A;  2D6L X;  2B8M A;  1T6B X;  1HQW A;  1OOP A;  2ERF A;  4P14 A;  5FZE A;  2DFC A;  1H0B A;  1PMH X;  3HNB M;  4LHN A;  4Y4R A;  1QJZ A;  5JOY A;  2XWB B;  1FV3 A;  3WNM A;  4IE4 A;  5FWJ A;  4BPZ A;  3AZX A;  3BAL A;  5B4X A;  2WLQ A;  4LJH A;  4NPR A;  1GQH A;  2ZGP A;  5KHJ A;  4DRR A;  3I4I A;  1IS4 A;  1XYP A;  4Z8B A;  2ES3 A;  2RHP A;  3LPF A;  2J1A A;  4M4P A;  3LOI A;  4AHX A;  2VTF A;  5I0T A;  1GQG A;  2XJV A;  4P5Y A;  1KIT A;  2GMP A;  1Q5O A;  1V9U 2;  2VME A;  3O1R A;  5DN2 A;  4LT5 A;  1H4H A;  4YW1 A;  1JZ2 A;  4B4Q A;  1O3S A;  1JN2 P;  5F2W A;  1AR7 2;  4OUE A;  2H6B A;  3B00 A;  5F6L B;  1STM A;  2AC1 A;  1PM7 A;  5FPB A;  5A3T A;  2E32 A;  2GU9 A;  1H2M A;  2ZMN A;  3S6P A;  4W6Y A;  5GJ6 A;  2A1X A;  2XLG A;  1HRI 3;  3J7L A;  3WEZ A;  3I59 B;  4CXX A;  1UYY A;  4ZON A;  1AR7 1;  4FPH A;  2RR1 2;  5GLW A;  1XJA A;  4RN5 A;  3IDA A;  4LIT A;  3N7M A;  5JZG C;  5HXM A;  3AC0 A;  1OLM E;  2P5B A;  3GNE A;  3WDU A;  1OF4 A;  2ZPX A;  1N1Y A;  1DCS A;  1L7Q A;  4QGL A;  1BCX A;  1GIC A;  3J7M A;  4D69 A;  2OZ6 A;  2WZP P;  1ZZ9 A;  1DGW X;  4FT8 A;  2VG9 A;  4YGE A;  2VNV A;  1SFN A;  2MEV 3;  4LMF A;  1W2O A;  4XIO A;  4BOW A;  1W6M A;  1E5R A;  2VMI A;  4LHL A;  4QKN A;  1ODM A;  4M0H A;  4DPN A;  5KXE A;  1YIF A;  5FWE A;  5D2A A;  2JDH A;  5FZL A;  1D2S A;  3BI3 A;  4JTO A;  2X5I A;  4FTE A;  5EZW A;  1COV 3;  4HG6 B;  1PMI A;  2NPI A;  4N7I A;  2JE7 A;  4XC9 A;  5L9V A;  4ARY A;  3HQR A;  1Y4W A;  2PN5 A;  2EA7 A;  2A70 A;  5E8A A;  1RUN A;  4W50 A;  2XJQ A;  3JB8 A;  1VBD 1;  3K77 A;  4IL7 A;  1YCI A;  1XNT A;  1JI6 A;  1XE0 A;  2Q4S A;  4LOS A;  4GIQ A;  4K1Y A;  4QGM A;  4OHY A;  1GP4 A;  2JDP A;  4UAP A;  2JDN A;  3C3V A;  1TG7 A;  3VBU B;  4CDX B;  4DUX A;  1VBA 2;  3IAQ A;  2Z5W A;  2VMC A;  2WS9 2;  1IG3 A;  2CY6 A;  1UD1 A;  4QPI C;  2E26 A;  4WVZ A;  1WZX A;  2I2S A;  4L92 A;  1ZZB A;  1FV2 A;  3AYC A;  3RYK A;  4IEX A;  1US3 A;  5I0U A;  1S0D A;  1ENS A;  3ZSL A;  2XJS A;  2WQZ C;  4J1W A;  3GZU C;  2TEP A;  2VZO A;  3BYW A;  1RUF 1;  4PBO A;  2XQR A;  2LUW A;  3ZFE A;  1NA1 B;  1CN1 A;  3HN3 A;  1VBA 1;  1S0E A;  3D0J A;  3J8F 1;  3KVA A;  4NII A;  4C0H A;  3DXU A;  3ZMN A;  2DUP A;  2ZEZ A;  1HV0 A;  2G1M A;  2LAL A;  2BFU S;  3M4F A;  3PUI A;  2IXC A;  3WW4 A;  5GKA C;  1PO1 3;  2EXH A;  3NNF A;  2JG9 A;  4IEY A;  1F8V A;  4OI4 A;  2VO5 A;  2QVS B;  3ZSE A;  1QF3 A;  5A1L A;  1ND3 B;  1I5P A;  4CDW C;  1A6C A;  1JOD A;  1GLH A;  2WAO A;  4JGY A;  1FAY A;  1GZW A;  2WO3 A;  1SPP B;  2G9F A;  4PIZ A;  4AQT A;  4TXW A;  1FNZ A;  1IQA A;  3RZM A;  3POY A;  3NV1 A;  1G86 A;  4BIS A;  1R1A 1;  3IMM A;  1Y7B A;  4R4Z A;  5J09 A;  3ALQ A;  3HWJ A;  1EY2 A;  4Q0S A;  3ROU A;  5T50 A;  2PHL A;  1POQ A;  5G04 L;  5LBE A;  4AEJ A;  5F5A A;  4RR3 A;  3C7G A;  4CCM A;  2O8O A;  2LRO A;  2ZX4 A;  2W9X A;  1W03 A;  2QDN A;  3OD4 A;  3RZG A;  5J36 A;  2VW0 A;  4AVV A;  4R9B A;  4C1X A;  3KLS A;  1UOJ A;  4H7L A;  5JOZ A;  2IVI B;  4XJA A;  5LY1 A;  1BYH A;  4CSW A;  4KL1 A;  1ZBA 3;  3HNM A;  3U10 A;  3C8X A;  2D5H A;  1W04 A;  3EMR A;  4E2G A;  2P34 A;  4P08 A;  5DDJ 3;  4AR2 A;  4QPW A;  1B35 A;  1OPO A;  1V6I A;  3AZV A;  5DUX A;  4CEY B;  1LHO A;  3DYO A;  2ZX0 A;  3AMM A;  1U5Y A;  2YDE A;  4C1W A;  1RUH 2;  3OB8 A;  1DQ6 A;  3CO2 A;  1W2U A;  1UXX X;  4Q0V A;  3KT1 A;  5C3Q A;  5C5T A;  3U4X A;  4Y1Z A;  1UU5 A;  1ZX5 A;  3RMY A;  5A1A A;  4IET A;  3W20 A;  4DO0 A;  1CAV B;  2YY1 A;  4QWN A;  4UXA A;  3FBY A;  1VBC 1;  2DUO A;  3LD8 A;  3ETP A;  5C4W A;  2A6Y A;  1HRV 2;  1JYC A;  2H0V A;  3RZJ A;  5FY7 A;  1W6P B;  3RQ0 A;  4AXO A;  1CX1 A;  1K5M B;  5FY5 A;  3RJ2 X;  2PHR A;  3GGL A;  2Z79 A;  4QKF A;  5IJR A;  4NPL A;  2WNV A;  4WM7 A;  1RC6 A;  2V72 A;  4W8J A;  3TBD A;  4YAR A;  4GQ7 A;  1X8M A;  1KJR A;  4A45 A;  4UBG A;  1BBT 1;  2XPJ A;  4UF0 A;  1TVG A;  2JD9 A;  2V5D A;  3I2H A;  1PVC 3;  3R0R A;  4LBK A;  2QQP A;  4CDQ C;  1PK6 A;  3NAP A;  4Y20 B;  3FL7 A;  3W5N A;  2NMN A;  1NX9 A;  2VZV A;  1DZQ A;  2RMU 3;  5CFD A;  3UGF A;  5HV0 A;  3LCP A; 
#chains in the Genus database with same CATH homology
 4Y3O A;  5FZC A;  4EZH A;  3U4S A;  4QU1 A;  4DIQ A;  5FZ7 A;  2OX0 A;  3PTR B;  5FZ9 A;  5FZA A;  4CUG A;  5FP3 A;  2Q8C A;  5IVV A;  3PUR A;  5FZK A;  5IVJ A;  3KV4 A;  3U78 A;  5FP7 A;  5KR7 A;  5IW0 A;  2YU1 A;  5FXV A;  4BXF A;  5FXZ A;  2OQ6 A;  2PXJ A;  3AVR A;  2WWJ A;  3UYJ A;  5A3P A;  4HON A;  5CEH A;  4QXH A;  5F32 A;  5FZ6 A;  5FZO B;  5FXX A;  2OQ7 A;  5FPL A;  2YU2 A;  5FYI A;  5A3N A;  2OS2 A;  4V2W A;  4ASK A;  5FPV A;  2Q8D A;  5FXW A;  2GP5 A;  5FUN A;  4HOO A;  5FY0 A;  5FZD A;  4URA A;  5FBJ A;  5FZI A;  5A1F A;  5LWB A;  3KVA A;  4AI9 A;  2OT7 A;  4QXC A;  3DXU A;  4XDO A;  4QX8 A;  3PU8 A;  5K4L A;  5FYU A;  5FZE A;  2YPD A;  5A1L A;  4C8D A;  4Y4R A;  5F3E A;  5FP4 A;  5FYC A;  4D6Q A;  5FYZ A;  4IGQ A;  5FJK A;  3N9Q A;  5FZF A;  5FZO A;  5FZ1 A;  5FWJ A;  5IVC A;  4GD4 A;  4Y33 A;  5FPA A;  4EZ4 A;  5F2S A;  3LDB A;  3PUA A;  4CCJ A;  5FUP A;  2XDV A;  4IGO A;  5FZH A;  5FJH A;  4QXB A;  5FV3 A;  4BIS A;  3OPT A;  5F3G A;  5A7W B;  5FZ8 A;  5LW9 A;  4GAZ A;  4LXL A;  4CCL A;  4CCO A;  5A7N A;  3PU3 A;  5FZ0 A;  5FPU A;  4NUB A;  3K3O A;  5F5A A;  4CCM A;  2VD7 A;  2YBK A;  5F2W A;  2W2I A;  3DXT A;  5FZM A;  3AL6 A;  3PUQ A;  4GJY A;  5F37 A;  3N9L A;  5FPB A;  5A3T A;  5E6H A;  5FYB A;  5F3C A;  5FYS A;  5FZG A;  5FZ3 A;  2XML A;  4CSW A;  5LY1 A;  5FY9 A;  4CCN A;  5A80 A;  5FY1 A;  5FZ4 A;  4D6R A;  4EYU A;  5F3I A;  5F5I A;  4D6S A;  5IVE A;  5IVB A;  3N9O A;  1VRB A;  5FYV A;  3PDQ A;  3RVH A;  3K3N A;  4GJZ A;  5A7O A;  3OPW A;  4CCK A;  5FYM A;  2YBP A;  3KVB A;  4LIT A;  4UF0 B;  3AVS A;  3K2O A;  3KV6 A;  5IVY A;  3AL5 A;  2XXZ A;  2GP3 A;  2P5B A;  5FYH A;  3PUS A;  3KV5 A;  4BU2 A;  5ISL A;  4DO0 A;  4QWN A;  3LD8 A;  5A7S A;  3ZPO A;  4TN7 A;  4LIU A;  5FY7 A;  4AAP A;  4IGP A;  4E4H A;  5FZB A;  4XDP A;  5FY5 A;  4LIV A;  5A7P A;  5LY2 A;  5FYY A;  3NJY A;  4QX7 A;  2XUE A;  5F5C A;  5FYT A;  2Q8E A;  3N9N A;  5A7W A;  4UF0 A;  5IVF A;  4V2V A;  5IWF A;  5FWE A;  5A7Q A;  5FZL A;  2WWU A;  5F39 A;  5FY8 A;  5FY4 A;  3KV9 A;  3ZLI A;  3N9P A;  2YBS A;  5FP9 A;  3N9M A;  5FP8 A;  5ANQ A;  5A3W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...