3IB3A

Crystal structure of sacol2612 - coce/nond family hydrolase from staphylococcus aureus
Total Genus 192
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
192
sequence length
556
structure length
551
Chain Sequence
HLLGNPKLTVTHVNEVKAGINHIVVDSVQYGNQEMIMEKDGTVEMRDGEKLYINIFRPNKDGKFPVVMSADTYGKDNKMGALWPTLGTIPTSSFTPEESPDPGFWVPNDYVVVKVALRGSDKSKGVLSPWSKREAEDYYEVIEWAANQSWSNGNIGTNGVSYLAVTQWWVASLNPPHLKAMIPWEGLNDMYREVAFHGGIPDTGFYRFWTQGIFARWTDNPNIEDLIQAQQEHPLFDDFWKQRQVPLSQIKTPLLTCASWSTQGLHNRGSFEGFKQAASEEKWLYVHGRKEWESYYARENLERQKSFFDFYLKEENNDWKDTPHVIYEVRDQFYKGEFKSASAFPLPNAEYTPLYLNAENHTLNHAKISSAHVAQYDSEDKQQDVSFKYTFDKDTELVGNMNLKLWVSTKDSDDMDLFAGIKKLDRRGNEVNFPDFNHIENGQVATGWLRVSHRELDQEKSSIAQPWHKHETELKLSQDEIVPVEIELLPSGTLFKQGETLEVVVKGSEIVIGNSTPGMKTRYEHEETVNKGMHMIYTGGKYDSQLIIPIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of SACOL2612 - CocE/NonD family hydrolase from Staphylococcus aureus
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords CocE/NonD family hydrolase
total genus 192
structure length 551
sequence length 556
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02129 Peptidase_S15 X-Pro dipeptidyl-peptidase (S15 family)
A PF08530 PepX_C X-Pro dipeptidyl-peptidase C-terminal non-catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3020.20 Mainly Alpha Orthogonal Bundle alpha-amino acid ester hydrolase ( Helical cap domain) alpha-amino acid ester hydrolase ( Helical cap domain) 3ib3A02
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 3ib3A03
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ib3A01
1W1IA 1AGYA 2CEKA 1XZAA 4PNZA 2XI4A 3WYNA 3C43A 3S8YA 4CI9A 4W1PA 2BGPA 1K6EA 4PQQA 4ZZ8A 3KWJA 3JXSA 2Z3ZA 3ZM8A 1CFJA 2EDCA 4DTCA 4Y2XA 3A2NA 3NNGA 3IULA 1K12A 2CDOA 4BK4A 4DNFA 4IUGA 2J1EA 5CBKA 1MX1A 5LIPA 3GZJA 2CZQA 1RWQA 5AI4A 4W1RA 3DECA 4X3CA 4DXTA 3OG2A 2AJBA 1NU8A 2BGOA 5JZBA 3DKRA 4A16A 5FUIA 2QVBA 5AK6A 4MJ3A 1YASA 2XUJA 4OU4A 1ZIYA 3K9BA 3WK8A 1QIJA 1XQWA 4KWUA 4I3FA 2WHRA 1JZ5A 1JI3A 2G5TA 1X70A 1QJ4A 1XNAA 1K45A 2ZYHA 1DINA 4ET7A 3BF8A 2WBKA 4QPWA 2WDBA 2XUHA 4X95A 3STYA 2QQMA 2JEYA 4Q82A 5DYWA 1LPNA 1T2NA 5HCUA 4G8DA 4A23A 4KE9A 1W99A 4Y9SA 3DOHA 2VT6A 5HF9A 3QMVA 2X05A 2VCCA 1CUIA 1K63A 3WEZA 1YSCA 1CR6A 2E3JA 5K3FB 3DOIA 5D6OA 5EIEA 4ZV7A 4CU9A 2UZ0A 4N8DA 3KDAA 1CX1A 2JGFA 4UBNA 4C88A 2O2GA 1YS1X 2W47A 4XUPA 1JU4A 1ZIXA 4XUOA 5BWBA 4QLAA 4PSCA 3SC2A 4IO0A 5LCWL 2ZJFA 4MQLA 2R8BA 3WKEA 2VZPA 3U1TA 1K4YA 4OMCA 1CUGA 3WNOA 3CQOA 5EGNA 3T0AA 2RJ2A 2VTVA 4J0JA 5T4EA 3HABA 1UMIA 2WUGA 3N0TA 3NJVA 3R3UA 3STWA 2YFZA 3U37A 1TKRA 2XHNA 3D2CA 3WSOA 2DDUA 2W1UA 1ZJ5A 2JGJA 3FLAA 5AO9A 3W06A 1YCDA 4P92A 1GXSA 3G0IA 2VEOA 1WPXA 3FWHA 4J03A 1OILA 1MO2A 1E8MA 1A8UA 4NZZA 4E14A 3GFFA 3TRDA 5DMYA 5LZ7A 4DEQA 3UETA 2VQUA 4F0JA 3EB7A 4H7DA 2W1QA 2VTFA 4KE8A 4U2GA 2D5LA 1GQSA 1LBTA 1BEEA 3ZLTA 2GYUA 4QDSA 2VR4A 1FJ2A 4INZA 4OPMA 3FSGD 5JATA 4BZZA 3C7FA 5I7UA 3E1GA 4ZREA 5AP9A 2J1SA 2BZDA 1XLWA 1UK7A 1F0NA 1ZD2P 2OGTA 4UOJA 2VM9A 4J0KA 5AK3A 3GELA 2C7BA 3C6XA 2QJWA 5K3AA 2WSLA 5EJ1B 2VQTA 1W75A 4EB0A 4QDXA 3JWEA 4X90A 1WPRA 2JKXA 2WUHA 2CDPA 2OPHA 3WWCA 3QBJA 5C71A 2CJPA 2VZ3A 5JYCA 4EHBA 4AN0A 3VKFA 3VXKA 4H18A 4JKKA 2RONA 3OTQA 3K4DA 1KU0A 2V97A 4J3JA 4LYEA 4HAIA 5DPNA 4MXDA 4N8EA 3E4DA 3HI4A 4A6OA 1KEXA 3DJYA 1MNQA 1UXZA 2L9LA 4FWBA 2J1UA 4QX3A 4CUCA 4B7ZA 3OB8A 4HG6B 2HRRA 3ANTA 1UOPA 2WHQA 3GA7A 1WOMA 5HQ3B 4KE7A 4M0MA 4UUQA 4BVLA 4BTVA 3VVLA 5AM2A 5CH3A 2ID4A 2Y6JA 1QFMA 3F97A 5IVHA 5AIAA 1EB8A 1T4MA 2W22A 3WZMA 1UX7A 4QB2A 5IJRA 2AXEA 2OAEA 2XLBA 1XZJA 5LLSA 5HZGA 1LPBB 1YB7A 5C7YA 2WIKA 4L0CA 1S8OA 3AILA 2ZJ6A 1KGYA 4ZGBA 1GUIA 4KACA 5JD5A 4H7JA 4CUAA 1XRRA 1US2A 1XKTA 1OD3A 5ALZA 3U0VA 1XLUA 4RE6A 2C26A 1EA5A 4OD0A 1ZI8A 3QZUA 4UHEA 2OQIA 2CKMA 1EK2A 1DT5A 4UI9L 2J1RA 2H1IA 4FI9A 1JZ4A 1LLFA 4FFVA 4LHEA 5ALGA 4B82A 4QWMA 1TCAA 2VZUA 5BWCA 3F9CA 1SC9A 5C70A 1CUHA 2WG2A 3THCA 2DHDA 5AM5A 3DNMA 2K2QB 4ARYA 1F0PA 4U2BA 3WK6A 4RPCA 5AI0A 2HA0A 2PSEA 2HRQA 5JXHA 1O8SA 4ROTA 3WQBA 3PICA 3SEPA 2B4KA 1UKAA 3G02A 2HU7A 2QQOA 2W92A 2IITA 2LW8A 4FDMA 4IH9A 4AO7A 2VZVA 1JZ3A 1OXMA 3DS8A 1GQRA 3ED1A 1SCIA 3C7GA 1F4AA 3H19A 2O7RA 2VSQA 3H2IA 4BRSA 2XMSA 1Q83A 2WO3A 4ZWNA 4BYMA 3VDBA 2QTBA 3FYUC 3IA2A 5FPPA 2WUEA 1J1IA 1VOTA 4BP9A 2WN3A 3I3EA 5FRDA 2PQSA 3W2TA 3DQZA 4DUXA 1ZGBA 1J06A 1TRHA 2VJBA 3A2LA 3GUUA 3D3AA 4BAGA 2DCJA 3WL6A 4UAPA 1AC5A 2W6CX 3BXPA 5EIHA 4BCBA 2Y6UA 3KOOA 3T4UA 2WO2A 2C4XA 1XNTA 2H7CA 4ZXEA 5CXUA 1VA5A 5AM0A 3QMMA 2W5FA 4AZ0A 3WF2A 1QIGA 2WUDA 4WY5A 5FDFA 4DMHA 1ZI6A 2H7XA 4LHSA 4OZOA 3I28A 3I6ZA 1P0QA 3T2OA 5ALSA 2QM0A 3BE8A 5ALVA 3OEAA 2WN2A 2JGKA 3WWDA 1Q0RA 1R3DA 5K3FA 1LNSA 2CUTA 1EXWA 4A5SA 3PFCA 1YAJA 2VJAA 2QQJA 2QXUA 2QUAA 3CN7A 1XFDA 1JYXA 3CIHA 5JAPA 2I3DA 3GXUA 4GBGA 1WM1A 3WL8A 1TG7A 1ZD3A 5K3DA 4Q1VA 4KMQA 4B83A 1GQPA 4BBZA 1O59A 2ZYIA 5A1AA 1WCQA 2W95A 5SYNA 2AJ8A 3BDIA 4M4PA 3K4ZA 4GI1A 3VISA 4DMKA 2XMGA 3F67A 1QO9A 2WKWA 1HPLA 1EVQA 7YASA 2DSNA 4K6KA 5A6VA 1CUFA 2OQVA 2LS6A 2DHEA 2X76A 1ZJ4A 3DYIA 1VE7A 5AOCA 3O95A 2OCIA 2XB6A 5JALA 2BAGA 2QBXA 1G4HA 1A8SA 3C8HA 3EF3A 3LP5A 3ACFA 1UXOA 3STXA 1Y7HA 4AO6A 2BKLA 5CYYA 3DDUA 4WFKA 2J22A 2ZEYA 4BP8A 2HA6A 2BGRA 3PE6A 4ZZ5A 4DEVA 3HN3A 3OGVA 5E4JA 3H17A 3MO4A 5AKLA 4KYVA 5DNWA 3G8YA 5ISMA 4BJ0A 3RLIA 2R11A 4HZGA 3VD4A 1QIEA 1DLCA 1XZHA 3O9VA 4UHDA 1EI9A 4BK5A 4RNCA 5CXXA 4CU8A 3FYUB 5CT4A 1ACLA 5AKZA 2OKXA 4LPLA 2JBWA 3DKKA 2WG1A 3C45A 3A23A 1MN6A 4H0CA 5HQ3A 2WM2A 3C5VA 3R0VA 5C8XA 4BAZA 1UY1A 4OYUA 5LA1A 2GBGA 1ACJA 5K3EA 2VZRA 4AQDA 5DYYA 3D3NA 2PPLA 4E15A 2WHPB 3OURA 3B5EA 4D8MA 3BJMA 4UBLA 5JAHA 1LPSA 4FLEA 3WA7A 1USWA 2YC4A 1XLVA 4LKOA 2E31A 4GHWA 5I8PA 1MNAA 2XOMA 4G5XA 4G1FA 3I2JA 1WCYA 2C5FA 2EDAA 1LZLA 1GU3A 3ILSA 1CUSA 1P0MA 4KRXA 5T4HA 1FFDA 5D3KA 2WFLB 1XZCA 3NUZA 1XQXA 5JXGA 1DT3A 1ZD4A 1IVYA 1H2WA 3Q8WA 4MADA 2BERA 5K5EA 2W46A 5DNUA 1LPPA 1AKNA 1XRLA 2VZ1A 4WFJA 5LZ4A 1JYNA 2HFKA 2VL4A 3W5NA 1EUUA 3WWPA 5ALYA 3FLBA 3IURA 3HNMA 3PI6A 1YS2X 4X6UA 5DJ5A 3IB3A 1O6GA 3P2MA 2VZOA 4JEIA 1JFRA 2X5XA 2HA3A 1Z68A 5ALEA 1P0PA 3KSRA 5HXMA 3AJAA 5JZ9A 1QGED 1GPNA 1HQDA 1VE6A 1BROA 5LZ2A 4BDSA 3HLKA 4PF1A 4XWGA 5ALHA 1H6XA 3HEAA 2VAVA 4HVTA 1CUWA 3G9TA 2VOTA 2Y2UA 2G4LA 2WZEA 5CH8A 1US3A 3ACGA 4BVJA 3SX4A 4MWTA 3ICWA 4B6GA 5C8VA 1CUAA 2RAUA 2RV9A 4DMFA 2JEZA 4B81A 4W4ZA 3A6ZA 1OCEA 4P5YA 3R3XA 1L7RA 4BE9A 3EYPA 5G04L 4XUQA 5C81A 5F4ZA 3AIKA 3G9ZA 4E8DA 5CH5A 4BVKA 1W8OA 4A42A 1QO7A 3HACA 2XUAA 4TXWA 3WF4A 5JZSA 2ZYRA 2H9YA 4RYDA 3FCYA 2X8BA 3ACIA 1UZ0A 4AZ3A 2EEPA 3IAPA 4L3WA 1AMNA 3I6MA 3H2KA 1UYYA 5JIBA 5DLPA 1UK8A 3WF3A 3QPDA 3C5WP 2Z4FA 5CT6A 3I2HA 4J0IA 4JH0A 5K3CA 2NW6A 4DGQA 1LZKA 4CU7A 2VMCA 1CUVA 1B6GA 5FPQA 1FFBA 2OGZA 1CUXA 2WHPA 4W9RA 1AZWA 2AJDA 3WF0A 4D0QA 1ODCA 1UWWA 4I19A 3E1F1 1A7UA 1F6WA 5I9IA 1CZVA 1L7QA 1UT6A 2PM8A 1LPMA 4WDQA 4YPVA 4H7EA 4KR0A 3OBAA 1BCSA 3H1BA 4FFWA 5JUVA 3LLCA 4DUWA 1QLWA 1O8PA 4HRXA 5G05L 3O4IA 3JYHA 5LA2A 2R7EB 4C4ZA 1XZLA 1J07A 3MGAA 2YC2A 5A2GA 2VT7A 3SKVA 1UY0A 3AINA 1VZ3A 4RGYA 3GM8A 1ORWA 3IAQA 3LIPA 1JZ6A 3VJKA 4QDTA 2ROQA 3AZQA 3FHQA 4HTAA 1N8SA 3VDCA 1BS9A 2Q0XA 1ZOIA 1CUBA 4ZXFA 3W05A 5ALIA 3LS2A 1YR2A 2QQIA 2P8SA 5ALLA 5AM3A 3B12A 1GNYA 4GW3A 1GOHA 1SOMA 2JGMA 4EUSA 4H7HA 2C5GA 2OGSA 3TGLA 5B4XA 1N5MA 4JNCA 4CG1A 2VQ6A 5JAUA 1VA4A 4WFIA 3IUNA 4HS9A 4GXNA 4BRZA 3WNPA 4UPDA 1PFQA 2C0QA 5BOVA 5EHXA 2ZYSA 4DNPA 4GZ9A 1BEZA 2ZEZA 3RM3A 1CIJA 5A7HA 2VZTA 3WMRA 5AH0A 4O08A 4P93A 3THDA 3WL7A 5ALTA 4DXRA 2XT0A 3ZWQA 1CZSA 4QE3A 5LKRA 5LA0A 5IFTA 3B3QA 1W6RA 2JIDA 3D5EA 5ALRA 1O6FA 2VJCA 4JUIA 1JHJA 4A41A 1XZFA 1PMJX 2FUKA 1ZGCA 3OC0A 1UYXA 4H7IA 3D4LA 1QIIA 5LKAA 3ABZA 3PUHA 4G9GA 5DWDA 4M0FA 4TGLA 3DYVA 4N8SA 4GWIA 1TCCA 1MPXA 2HADA 4X97A 2OCLA 1I6WA 1WHSA 1XZEA 3HNYM 3NGMA 5ALDA 3WJ2A 2CMFA 3H2HA 4QNNA 3AZPA 3C8DA 2Y64A 1WHTA 2QQKA 2WIJA 4F21A 2B9VA 3T09A 5CT8A 2CBGA 2B20A 2VAXA 4BDTA 2QKYA 1PX3A 1ORVA 5D3ZA 5SYMA 2CB9A 4G8BA 3LIIA 2XQFA 4PSDA 1P8JA 2DHCA 1UMHA 2PUHA 1E3QA 2W9XA 3QYJA 5HK8A 3WIBA 4C4YA 1M33A 1VXRA 1W0NA 1XQYA 3WF1A 4DXSA 4EY5A 3HZOA 4UBMA 4M0EA 4GDMA 4BE4A 2QJRA 5B4NA 4EY8A 4QX2A 2XLCA 3BIWA 3GDBA 4OUKX 4KAFA 2XONA 5C8ZA 1NKGA 2GBCA 3FCXA 3QVMA 2I78A 2WILA 1W8NA 3M3DA 4OB8A 2XQJA 2W1WA 5CZKA 3K6KA 2ORZA 3X3HA 3H0CA 1GPKA 3LE0A 4UFNA 5JXIA 2BGNA 4MWSA 2O2IA 4DNQA 4J0CA 4TTGA 1KEZA 4KE6A 5FV4A 2OCGA 3H2GA 3GBSA 4NMWA 3STTA 4A3ZA 2QR5A 3CN9A 2QMQA 4FKBA 5FXMA 2BUAA 5DYTA 4A44A 4MEBA 5A62A 4CCWA 4X91A 4DNOA 3HNBM 3KXPA 2Z8ZA 1Y37A 1H2YA 3EQ7A 2DCKA 1E8NA 1JMYA 1HLGA 4Z49A 2XQXA 5EIYB 2X09A 1YA8A 3F2ZA 1TVGA 2WU3A 3C6ZA 5LZ5A 1WB6A 3NOXA 3WNKA 3G0CA 4FNGA 4FHZA 4J0DA 3I3BA 4MOAA 5JADA 1BE0A 2C58A 3AIOA 3C7HA 1BCRA 3SWWA 5A7GA 3PF9A 4QEKA 1XZKA 4FLFA 5IH7A 1CUEA 1EHYA 4DSZA 3TEJA 3R41A 5AKGA 2ES4A 1IQDC 4AXBA 2HHAA 1UY4A 2ZEWA 1ULOA 1CRLA 3IUQA 3R3YA 3BGAA 2OG1A 2J3QA 1MU0A 4UBKA 4IHAA 5ALUA 5EJZB 2AJCA 3DYOA 4ETWA 4Y2YA 3EQ9A 2XMDA 1XRPA 4PO3X 2PX6A 3DL7A 4Y2PA 1JT2A 2DR0A 2HA4A 3V1LA 2V72A 5LYYA 3MBWA 1E5TA 3FHAA 2QT9A 4OB6A 1RP1A 5HKAA 2XUFA 4CFSA 3D7RA 4B0PA 4B84A 2RGUA 3DEAA 2HFJA 1LGYA 4UBIA 4P9NA 4E46A 5AOAA 3WK9A 3V48A 3FYUA 3EBLA 4HRYA 1MAHA 4K2AA 5AI9A 1UOQA 4YX9A 4QZVA 4QX1A 2ACEA 2E26A 3QITA 1E8DA 5IVDA 4DMCA 2WQZA 4U2DA 4H7KA 3VJLA 5AI8A 5EI5A 2XUDA 1H23A 4U2CA 4XVHA 1QFSA 1LPOA 3LEKA 2XMZA 2XUIA 4ARXA 3WK7A 2VATA 4BATA 2WZ8A 4IH4A 1K3IA 1QIHA 4DLNA 5FP0A 4DSAA 3ZPXA 3H04A 5KWIA 4IQ4A 4WCVA 3W9UA 4A45A 2XUOA 5CT5A 2JE8A 3ZI7A 1N5RA 3C7OA 3A21A 3HYSA 4CG3A 4E11A 1J84A 3LEGA 2WAAA 1UK6A 2YH2A 1BN6A 1GOFA 2WABA 4XVCA 3C6YA 1FFCA 1UXXX 1ODSA 3P1IA 4GWLA 3EIOA 5ESRA 2JGIA 5HF6A 5JARA 5ALOA 4K5QA 1IMJA 5KWJA 5LP1A 3VD3A 3STVA 1NAEA 3N2ZB 2Y8KA 1JJBA 4J0GA 3FNBA 4Y2UA 5A7FA 2QQLA 1VKHA 5AKIA 1CVLA 1EVEA 4F60A 2PUJA 4QDZA 2Y6GA 3DD5A 5JD6A 1A88A 3HRHA 2RIPA 4BZWA 5DQ0A 3CZJA 2FX5A 3HC7A 4E8CA 5DTIA 2PSJA 4DUVA 3MV11 4N5IX 1W9TA 1H22A 3CCBA 2HDWA 1EINA 1QE3A 1MX9A 3UESA 3F8SA 3WK4A 1XC6A 3V1KA 2WFMA 1BN7A 4QB6A 1QIDA 1R9NA 5ALXA 4JYMA 1OH4A 5EFZA 1UY3A 1EUTA 3CZUA 1XPWA 3I6YA 3G0DA 4JYPA 4FBMA 2JDAA 4UHFA 4OSEA 4MGSA 5AIBA 1DX4A 1CUDA 3T2QA 4RE5A 2J1VA 3A70A 3R40A 3O4GA 3UMJA 4LIPD 3DLTA 4CIAA 4OCZA 4N5HX 4LXHA 4QB1A 1MJ5A 2FJPA 3I2GA 3ESDA 1GZ7A 1DP0A 5CTAA 4G4JA 5DNVA 4G4GA 5CRIA 1BRTA 1IZ7A 2WIGA 4H35A 2W87A 5IHRA 1IZ8A 1U2EA 2VCBA 4ZRDA 2OCKA 1OF4A 2WQ8A 3K4AA 1TCBA 2WFLA 3OGSA 1J83A 1UKCA 3CKHA 3KWFA 4W50A 4U2FA 5IKXA 3D59A 4FOLA 1THGA 1JU3A 1E66A 3QM1A 4BCDA 4Y2QA 3BJRA 3WNLA 1XKLA 5JASA 3FLEA 1P0IA 4P02B 4QDQA 2J4FA 3O0DA 2C0PA 4AN1A 1TQHA 2IIVA 3K75B 3MUY1 5AOBA 2HA5A 1GPLA 3QMWA 3A7QA 1QIMA 5KBYA 4ZV9A 1SG3A 3M83A 4OU5A 1DWOA 2XMQA 2V5DA 1OF3A 2VMEA 2I3ZA 4X7BA 4EY4A 4G4IA 3C70A 1LPAB 1ZICA 4Y2JA 4MQMA 1SHWB 4C4XA 1J2EA 3WK5A 2FJ0A 3L1JA 3WI7A 2HA2A 5LZ8A 1EB9A 3ZV7A 1ISPA 2XQIA 4OB7A 3AC0A 2WJ4A 2V9ZA 4KAJA 4KI5M 1MX5A 4BAUA 1UFOA 3EQ8A 2X10A 3HXKA 4UFOA 1C7JA 3MUOA 3C8XA 2OXEA 1AUOA 3O4JA 3WKBA 3E0XA 4HXGA 4QX0A 1A8QA 1AQLA 2HIHA 2PL5A 2XUPA 3FN9A 1XROA 3W04A 2LIPA 3C6BA 5LZ9A 1CPYA 4BTLA 3CXUA 1WKYA 5ALFA 5EHQA 3T0BA 4PQEA 4P08A 2HU8A 3T2PA 1DWQA 4BC0A 1IUOA 4UHBA 4Q3LA 4B0OA 4ARAA 4XUNA 4FNMA 3NWOA 4BB0A 4X71A 1YB6A 3SEEA 5AKHA 3T08A 2VA9A 3BF7A 3I1IA 2QS9A 2XQKA 4K6GA 3F98A 5CURA 2YB7A 3K46A 3YASA 5D7BA 4FMPA 4KRYA 3C7EA 1XZBA 4AMZA 4W1QA 4X94A 1H2ZA 3T52A 1R50A 4BC1A 3OG9A 2GYVA 3BIXA 4C89A 1QTRA 4EY6A 1W4LA 1ZD5A 2ACKA 3NRUA 4H77A 5EHNA 2WIFA 3G0GA 1UYZA 1VJ5A 5AI5A 5T4FA 4B9EA 4MYSA 2BUBA 5T4BA 4BCCA 5IVKA 2J4CA 3WWOA 5I0DA 1JI6A 2VMFA 4Y2RA 3BL8A 6YASA 2WG0A 4MYDA 4LXGA 4AX4A 1XZIA 1X2EA 5AICA 2Y6VA 1W9SA 1GT6A 3HOBA 1QTIA 3G9XA 3K77A 4UHCA 1XRNA 4V2IA 3VDXA 4IH1A 4S0XA 5AJHA 3NJXA 2ZSHA 1ULPA 4KJXA 1JJFA 3M82A 4LXIA 1CQWA 2J1TA 3I2FA 3IVMA 2QXTA 1HBJA 1FFEA 4QDOA 1DYOA 2OAGA 4GLBA 2W91A 5C7GA 1DQYA 2ECFA 5AKXA 3WL5A 5HKBA 3R3VA 1YQ2A 2VJXA 3G7NA 2W94A 1CUZA 3ANSA 3QH4A 2PBLA 2WJ3A 2WIDA 2XE4A 1EDEA 4YASA 3ECQA 1IUNA 1K8QA 2V98A 4DIUA 1F8UA 5E4YA 5AM1A 1YAHA 3T0DA 1MAAA 3RARA 1U4NA 4AMYA 3BN6A 1SCKA 3I2IA 2PU7A 4ARBA 4AB1A 3UNPA 3OPMA 5A71A 1WB4A 2XMBA 2O2HA 1THTA 1VXOA 3VD7A 5AK4A 4WJLA 3FL7A 1GOGA 2EIEA 1JYWA 3NQHA 3CMGA 1QOZA 3QPCA 4Q34A 1K42A 4GWJA 2YXPX 2RI6A 2WJ6A 4J7AA 4Q3KA 1T2XA 1KU6A 1WB5A 5IVIA 4G9EA 2WYSA 4ZY9A 4CU6A 2PU5A 3M81A 1HDEA 4QWWA 3C87A 3WIOA 1CUYA 2Z5GA 2JF0A 5JANA 1G66A 2WO1A 2OLEA 5FKJA 2HU5A 2WTMA 5AK5A 1H6YA 1UKBA 4HXFB 5ALNA 4BXSV 2JGEA 3O4HA 4MO3M 3F96A 1D07A 1ETHA 1R4ZA 3WNNA 3IUMA 2XMCA 3HJRA 3CCCA 5J1XA 2XUKA 2VMDA 3PF8A 4OYLA 2J1AA 1CIYA 3TJMA 1JZ8A 3WNMA 4Y2VA 1GKLA 1ZI9A 3BDVA 1XZDA 4NVRA 2I03A 2D0DA 2DCMA 4UBJA 4G8CA 4B80A 2HA7A 4GECA 4I4CA 3WQHA 4X6YA 5FLKA 1SDDB 2PKYX 1Q0ZA 2VZQA 3WJ1A 2Y6LA 2PSHA 3PDCA 2XDWA 4QDUA 2EICA 4Y2SA 3G9UA 4FBLA 1UOOA 4LYDA 4L0PA 4AO8A 4W1SA 3LQCA 2Z3WA 2Z8XA 5AI6A 4ZI5A 4CIBA 5EHZA 4F5ZA 3PUIA 4KAAA 3FAKA 1G42A 3PFBA 4YK7A 4Q05A 3DL4A 4OYYA 2AJLI 1XQVA 4MGQA 4C87A 2Y6HA 3RKSA 3OGRA 3UUEA 3WKDA 2RHWA 1TIBA 4UHHA 3WZLA 4Y2TA 3MVEA 1K5PA 4BDVB 1R1DA 3FYTA 2WTNA 1PMHX 5ALPA 1DTEA 1VZ2A 3Q0TA 2VZSA 3LPGA 2JD9A 5F7UA 2QQNA 3BWXA 4XZUG 4Z2AA 4X00A 3K2IA 1CUCA 3LCRA 1XRMA 2WLSA 3WKAA 5HK9A 1U65A 2EIBA 3H2JA 4FTWA 2BFNA 1Q84A 5AHXA 5IYYA 4JKMA 1BU8A 3D2BA 2GZRA 5ALMA 3SKJE 5DTJA 4CG2A 2GYWA 2HL6A 3W9BA 4Q3OA 1I5PA 3V1MA 4YPJA 1E89A 4OUEA 2B61A 5K3BA 3VJMA 1EX9A 4XX1A 1AURA 1W9WA 2G63A 1DWPA 2DQZA 4OMDA 1EDDA 2XMRA 3P6BA 2ZVDA 1JJIA 3J7HA 1PJAA 1LBSA 3H1AA 3IBTA 2DFPA 2PVSA 3RK4A 4XJVA 3MV01 5JAOA 4PV7A 4TVKA 5ALJA 4UBOA 5ALWA 3DYMA 4GEGA 3WA6A 4XIIA 1SCQA 2VO5A 3IUJA 2YFUA 2BBAA 1UZAA 2JGLA 2O7VA 4XURA 1PX4A 1CUJA 3OOSA 2W1SA 5AKYA 5E2IA 3D0KA 5CMLA 4HXEB 3ZLVA 1F4HA 2YG0A 3HJUA 3ETPA 4A4AA 2ZSIA 1Y7IA 4WDRA 3WWEA 3DCNA 3HPNA 4K6HA 4AG4A 4EA6A 3IIIA 5AKJA 4TPKA 4JHZA 1XZGA 4L72A 4UFPA 1SFRA 4B85A 2ZXQA 2DQYA 1U8EA 4D9JA 2HLEA 3FBWA 2Y1KA 1BHGA 2KD7A 4MEAA 2ORXA 3R3WA 5AM4A 1H2XA 3MUZ1 3VD9A 4PT6A 3FVRA 2E33A 5YASA 2HYXA 4X85A 1QONA 4WY8A 2VC9A 2VCAA 5EIAA 3E3AA 1AX9A 2ORYA 3STUA 3LEIA 1HKHA 2WFZA 2PSFA 2WAOA 1X2BA 3AFIA 4M4RA 2H7YA 2E32A 1JKMA 1CZTA 4DYHA 2YASA 2G5PA 4B9AA 1VLQA 3FVTA 5JXJA 3ESBA 3A2MA 4PSUA 5FOQA 4QLOA 4L9AA 5HFAA 2XQGA 2WU4A 1EK1A 2J3DA 4DM7A 2GZSA 3QPAA 3SK0A 3GGLA 3WLAA 3AUKA 3D2AA 4CUBA 4Y7DA 5KREA 5HFNA 2RVAA 2BJHA 4EY7A 1UK9A 1MTZA 2QOEA 1PV1A 1JZ2A 2HM7A 2W3JA 3I2KA 3JW8A 3UUFA 1CQZA 3ESAA 5HF5A 1W76A 4X93A 1R64A 1OT5A 2EIDA 4CVUA 1JZ7A 2RHTA 2QRUA 2YYSA 3I3DA 1QIFA 2V96A 4LQRA 3ACHA 4KEAA 1HL7A 4H7FA 3VD5A 5IFPA 4JX0A 2J7MA 5HPOA 3GROA 5CW2A 1FFAA 5AKEA 1N1MA 4C6HA 4CCYB 1C7IA 4QA9A 1CLEA 3V9AA 2GBFA 4X6XA 1RYYA 1UWCA 1L7AA 3LPFA 1TAHA 5ALQA 1CEXA 3AIMA 3MUNA 4W8JA 1R88A 1UY2A 4AAXA 5BV7A 1IUPA 4FLMA 5JR2A 4LKSA 3ESCA 1NU6A 4U2EA 4RN5A 3W5MA 1DU4A 2VF2A 4QAWA 1EDBA 1MT3A 2V4VA 3VVMA 1XZMA 3FOBA 3O9MA 1G5FA 2VJDA 5FUMA 5CT9A 2WUFA 4NS4A 1ODTC 1XRQA 2ZEXA 4QDRA 2BUCA 2ZJ7A 3WKCA 1HN1A 1QZ3A 5JMOA 5ALKA 5E4TA 1CV2A 3HSSA 3OM8A 1W52X 3H18A 3R3ZA 4X92A 3L1HA 4C01A 3FSGA 3L1IA 1EH5A 1YA4A 5J3JA 3OEBA 2XUQA 1D7PM 3ICVA 1GKKA 1R9MA 2C9KA 3CDZB 1GMMA 1B41A 1JMKC 1DQZA 4P00B 5JD4A 3WYDA 2IX9A 3G0BA 1FSSA 2Y6KA 2QZPA 2PSDA 1DX6A 3IDAA 1CUUA 3DYPA 5HF8A 1NUKA 3V1NA 2Y2VA 4W63A 4J0HA 1C4XA 3ZLUA 2C4HA 4JKLA 3I97A 1QIKA 2ONCA 5DN2A 1GGVA 3A22A 4EZIA 2BCEA 5H3HA 4PW0A 4XUTA 3KD2A 5AKKA 4CCYA 1JYVA 3AZOA 2QUBA 4ITVA 3I1YA 3S2ZA 1TK3A 4EBBA 3HEIA 3VDAA 2GBIA 1NX9A 2XUGA
chains in the Genus database with same CATH superfamily
1L8AA 2RKBA 4KSBA 1Z74A 1EXMA 4DR6B 4RZ2A 3J7MA 1PJSA 4X8MA 1NXVA 3NM6B 4DBVO 3LWNA 1WZCA 1HJFA 1JXAA 4FFIA 3ZQ6A 3VSEA 3KVOA 1LU9A 4CKWA 3RYIB 1QHSA 5FR2A 4Z86A 5FO1A 4ZZ2A 3T1YB 3GUYA 1BW9B 5TVGA 4QREA 3O31A 3H5TA 5AK6A 4TSVA 1YASA 4JEHA 4BB5A 4CNBA 3TQIA 1KOJA 1JDBC 4ET7A 5M3BA 3TN92 2VP2A 3VNVA 1A9YA 4DHEA 1Z3IX 2JEYA 3S55A 2UY9A 5DYWA 5HCUA 5G02A 2EQBA 2YQZA 4Q3NA 4KE9A 2CNKA 4I1SA 1ODNA 4BO0A 5BYJA 3U4AA 4ARSA 4IV3A 1EEXB 5DRYA 4MR7B 3FBMA 2OXCA 3IMFA 2OZ6A 3VU1A 2XH8A 3M5WA 3A10A 4U6NA 4C7OB 1H3FA 3TW8A 2HU2A 2R1TB 2ZJFA 3HWSA 1MIOB 1TQ4A 1WSDA 3M1AA 4GYYA 2FZ1A 2Y0OA 3CU7A 4AP5A 1MRZA 3DMRA 1NYLA 4Y6OA 3M4ZA 1Z2EA 4LRTB 1FFSA 5JT1A 3MYYA 2VDKB 1G5RA 2H6BA 4ZQCB 2PFWA 2BCJQ 5ADWA 1YCDA 2WNSA 2GPAA 1F35A 2VEOA 3R5JA 4PG8A 2CLLB 5JOQA 4YR9A 1A8UA 3X2SA 1GL3A 2ADEA 2QRZA 4NZ9A 3RRMA 5CFRA 1GWMA 3KXDA 5IC6A 4H7DA 4BQRA 1GQSA 2RGNA 4OA5A 5FLYA 2VQDA 3GMSA 2JH9A 4XPIB 4OYHA 4MQ5A 1RPTA 5IKMA 3AYEA 2DM6A 2J1SA 1UP4A 1Z75A 1RZVA 4Q39A 5ACA1 3FNEA 1CY6A 4UM9D 1AR82 4DR4B 1I7SB 1XP8A 1W75A 5LQCA 3U1VA 1E4EB 2ZREA 2NO9A 2HWF3 1J4AA 2CK3D 3ONVA 3PMEA 5IUQA 3VZQA 4QUDA 1NVGA 2WTAA 2RDMA 3CZAA 3T7AA 1OBHA 2ZSDA 4FCTA 1E2UA 4EKIA 1O3RA 2OUIA 1OKKA 2KBEA 1NMQA 1NUHA 4LDJA 1X0XA 5HUHA 1KHTA 4Z99A 1Z2NX 1L5WA 4E12A 3ZHQA 5GZGA 3BCUA 4ZT6A 2EXJA 2OFOA 4PBOA 4CYDA 1FNYA 3GAMA 3EXG2 3ZIUA 1VE9A 1LPBB 5KC8A 1YB7A 4B31A 3B02A 4XJ8A 3TTVA 2CK3A 3VV1A 1KGYA 1GUIA 3LP8A 1W87A 3SICE 1NUAA 1XKTA 1OD3A 1QGLA 5ALZA 1DO0A 1ABBA 2DBIA 4YCAA 1QDUA 4A8TA 1AJKA 3LT4A 1VYTA 3PVCA 4PCLA 1SBTA 4UI9L 3TIVA 2IUYA 4MW1A 3EXHC 3VYSB 3HM2A 2QPTA 1G2IA 1A76A 3DNMA 4ARYA 1TEHA 4XYMA 2ZRKA 1AXKA 2QPAA 4C78A 3HVDA 2X1VA 1C0PA 4UOZA 4PFSA 3IIEA 2B45X 3ZWKA 4NPLA 5JD3A 2ZI7A 3FHIB 5JSPA 1R2QA 2JLAA 4A15A 1O94D 5FNVA 1AKYA 4FWTA 4BRSA 2PGNA 3KT1A 4NPCA 4PLYA 5JROA 4BS9A 1AYN1 2J3HA 2O05A 4V0MA 4QAJA 1FCJA 3G7SA 3K8QA 4FCWA 3TG2A 3H9JA 1E7QA 3HFSA 3FGOA 3KVBA 1EG7A 2WLPA 1J5EB 1NA1B 4XAAA 2FMTA 2YV5A 4PXYA 4WH0A 3HBLA 3UOGA 5IDQA 1KAHA 2JANA 4PRZA 1JEOA 5FP3A 1VE0A 1IDN1 3T1NA 3KALA 1LX7A 4EG3A 2WNUB 3DEHA 3GF6A 2VUTA 4C22A 5HEKA 5FDFA 1JSLA 4WWHA 4LHXA 2VHEA 3BPZA 1M5RA 4QFDA 4DJDC 1E9SA 3FPHA 3WWDA 1RAGA 3E61A 1BXHA 1JH5A 4MVJG 4WQMA 1B6TA 5HP4A 2QQJA 4NX2A 2RBGA 3KOMA 1IN1A 1Y3FE 3NGLA 2E4VA 4EMUA 2GK3A 5DM4A 4X61A 1KJYA 3WIEA 3HCEA 1LBQA 1FZQA 4OLAA 4E3WA 3GBWA 3MM4A 3NHWA 2A9QA 4WUTA 3LC2O 4ILEA 3QU9A 4QT4A 5JALA 1QJX2 3PIRA 3ZBQA 4HUJA 1G4HA 2EAUA 1KI1A 4FR2A 4XJWA 3FZGA 3F73A 1DXYA 3BGWA 4CMIB 1HWYA 1K5JA 1AR73 2IZOA 3JQAD 3BWBA 3H17A 3V33A 1P8AA 4HV4A 5H4HA 4IS3A 3AVQA 4OUDA 1SFYA 3KLSA 3AXDA 2JFXA 4ZDWA 3X2FA 2DUUA 1C7RA 3PXUA 2A2ZA 3QLUC 4Y1UA 1LDNA 3W2EA 4BNFA 5EWJA 4LBQD 3HYNA 4LE0A 4I9GA 1KAGA 1P6XA 4P7KA 2PQ6A 3MWDA 1FU4A 1Y6ZA 2WF5A 4URVR 3OURA 3B5EA 3UAWA 5FMCA 3MZHA 3WS7A 1JMVA 1KI4A 5EUCA 5A3QA 3H0OA 1AHPA 4QM6A 5HOQA 3AB0A 1W44A 1ILWA 4UPEA 1G64A 4DZZA 3QVOA 1GANA 4AJIA 3K0FB 3V65A 5BRJA 2JFGA 1JYNA 3T34A 3W5NA 1A9XA 3MLLA 4L0MA 4AUKA 2CW5A 3GJ7A 1UBSB 4CP2A 3QVKA 2PT9A 3HNMA 2HB6A 3MICA 4B7KA 4FS3A 1Z47A 3U62A 1RZ3A 2GERA 1Z68A 4TZ0A 2HJSA 4PLWA 4KUGA 1E99A 4QXBA 4M9CA 1QYIA 2ZACA 1JQ5A 1YFKA 4XFHA 5A7NA 1H6XA 1KOGA 3JZFA 4J6FA 3UV9A 4MUVA 3NOOA 2ONJA 3HE3A 4B44A 2R1UA 3I6BA 1IJFA 3ICWA 3CMCO 4K9NA 3DFUA 2JEZA 1DEHA 4MI6A 3U4SA 1FU7A 3DBRB 1E5HA 2XCIA 3POYA 3BA1A 4QXCA 1N6IA 4Q1DA 3RFFA 1EFCA 4QT0A 3GEDA 2I8AA 4U0JA 3SHVA 1DP4A 4BIFA 2DG2A 4OKNA 4ZVVA 1ZJJA 3N3BC 4B8WA 2VCEA 1C1XA 2YMMA 3U7QB 2XT6A 3IAPA 1NVVQ 3WW1A 1P75A 1RMTA 1Z0KA 5L7OB 2VRNA 1TU3A 2OXBA 2DV9A 4B7UA 4UW3A 2C2KA 3M4YA 4OQFA 8AT1A 2H2AA 5D3QA 2ZROA 3FFZA 3TTTA 4EG4A 5JR7B 1FFBA 4K6BA 3E03A 3V56A 1T5HX 3WF0A 1OFGA 3SVZA 5FUXA 3O47A 3NV9A 5F35A 2PLFA 5HIAA 1VDMA 4TMXA 4B09A 3VR1A 1QWSA 2AYYA 3BMCB 3H2BA 3A6GA 1NBMD 2IBTA 4LYGA 4B3NA 2I6QA 3K35A 5BN3B 1WLTA 5LQRA 3VPBA 2G9ZA 5FBHA 4EO7A 2WT8A 2O0OA 3AINA 4AI1A 4NCXA 3AHIA 3OTHA 2QAIA 2AL7A 2ROQA 3N9LA 4ZXFA 4F06A 5KJ6A 2QMOA 3DWEX 2VS1A 3H9GA 3I64A 1JR3D 1FS6A 3B3JA 2OGSA 3AETB 2J0EA 2VQ6A 4NCBA 4HS9A 3DUFA 2NP7A 2HZ7A 5LIRA 1Z0UA 3VDQA 1QH0A 1T9GR 1SIWA 1GCAA 1CE8B 1SHKA 1VLJA 2XT0A 3WXPA 4G3YC 2XCLA 1NVVR 4YP5A 2Q9CA 2Q6VA 3D5EA 2J30A 1OAAA 1BKYA 5I7SA 3OPQA 4XWKA 1JHJA 4ZOEA 4HQ6A 2FUKA 3OLQA 3I9LA 3VU0A 2P7HA 2AKEA 2PLNA 3ZW7A 4DRXA 3P45A 1B0AA 5CDYA 2LP4Y 1FAYA 1ESCA 2FCUA 3IEPA 2VUSA 4B6EA 2Y64A 2PWZA 4OQZA 3HR9A 4OGKA 4FP2A 1W9HA 3GBVA 2KMLA 4UQPA 4BDTA 1ZKMA 4NFYA 5AUOB 5SYMA 4FIDA 2JB4A 3CEHA 1UMHA 5LCXA 1E3QA 2W9XA 1XQYA 1PCXA 4EG8A 1NQAO 3BEOA 2DLNA 2QJRA 1RXWA 3ZV4A 4IEYA 3ORRA 4F8YA 1YFUA 1UMZA 4YN3A 4URAA 3SBXA 2QTHA 3NVMB 2OQ7A 2BGNA 4J1WA 2EKZA 4M60A 5DOVA 4LYYA 1YKGA 2B1RA 1MKYA 1GQYA 2G07A 1EXNA 4TXMA 4XIGS 5FXMA 3OQHA 1GKYA 4QGLA 3GUVA 2Y0BA 2IP2A 2P9CA 1LX6A 3O0WA 2BYTA 4JFAA 4TWBA 1O96B 1J70A 3H11B 4P0QB 3S3TA 3TQTA 3JVIA 3NOXA 1SCAA 2PHZA 1Q6ZA 3C8ZA 2IGBA 1R4MB 3N28A 1C9YA 3P7MA 2JFQA 2MJLA 4L97A 3SFTA 4DSZA 3TEJA 1XJCA 1O91A 2JIGA 1RLOA 5DBGA 3GGJA 3GOQA 3KKEA 2FUNB 1IAQA 5KS2A 4K88A 2G1KA 3OZBA 1K3FA 4RJIA 4JGIA 3AFMA 4XQCA 2GTIA 1HT0A 2XKAA 2RHGB 2IYUA 1CLUA 1HFWA 1NNLA 2XCUA 4XBLA 4TTIA 3CEMA 4HQRA 4IXTA 4JP2A 3CURA 4OB6A 5BN5B 5L3VA 5BSEA 4IOKA 4P7GA 3DTVA 3B9CA 2HFJA 2ERCA 1UAAA 1AL23 3OJXA 5H80A 2ZYWX 3AXTA 4FZVA 3ENWA 2O9JA 5JVDA 4E2QA 1ORHA 5CDHA 1PK8A 3EEIA 4H7KA 1TYCA 4JGYA 1HRKA 1ZHHA 1JILA 1L7OA 4IDEA 2HQBA 1M1YB 4A82A 5EA2A 2VOKA 3JYQA 4Y26A 1CSEE 4U7DA 2J0VA 1DKLA 3ZPXA 3MWEB 3G79A 5EJ9A 1N5RA 2FEAA 1FFXB 3A05A 3NYWA 1NLMA 2DUJA 3U44B 2RG1A 3C6YA 1PLJA 4XRRA 1UXXX 4HN9A 4DCTA 3EIOA 1ENOA 5B1EA 3CLSC 1FUIA 3KGZA 2IXIA 4MLZA 3CF0A 3VD3A 3WMFA 4J0GA 4KHPB 4KX5A 1SLIA 4YW5A 2RM21 4DCNA 5CKMA 2FOLA 4INDA 1YMQA 1Q0UA 3CSDA 2XKKA 4DZTA 3I9V1 3DPSA 1AQUA 1BN7A 2ZVPX 4AI3A 3PHIA 3ZSMA 1NN5A 3N9OA 3IESA 1X38A 1M2GA 3EVDA 3G0DA 3RFVA 1JLRA 2UWAA 2DU1A 3WGYA 4LIPD 1UFKA 1PR2A 3I5AA 3PG5A 2NXJA 1MJ5A 3BULA 4HS4A 5A3SA 4RHV1 3RI9A 2WIGA 1VRH3 4AHWA 4K87A 5BSKA 4E2XA 3K31A 3ZQKA 1YGPA 5U4QA 4E13A 4CLXA 1QYXA 1O57A 2XLGA 2FGJA 4G5HA 1JFFB 4XIJA 4U2FA 5J1TB 1GPJA 4PZZA 1ISJA 3RT1A 2WOOA 3WNLA 1DEOA 2DQSA 3ZGOA 2VUCA 5H3CA 4BFCA 2IIVA 1ZEJA 1CY2A 1GGNA 1G3RA 4YNIA 2HJRA 1NPYA 3A3KA 4OU5A 3WLNA 1PJ8A 3RTAA 4M1KA 5J63A 1RBQA 4PBSA 4Y2JA 1VALA 1J2EA 2FJ0A 4Q0PA 2XDQA 3L1JA 1RQ2A 2FEXA 1NVEA 3ZWNA 1OU0A 4TSFD 3S8MA 1PK6A 1VPWA 1Z6YA 4Q8KA 4Q1RA 2X4LA 4URWR 3D81A 1AQLA 5LVAA 1D7AA 1MH9A 3GRRA 1KMMA 3D54D 5IWAB 1QY4A 5A32A 3C6BA 2XEXA 3S2EA 3ZW9A 2FFHA 3DEZA 4II2A 4DV3B 3JRNA 2FR0A 3RU9A 4FUQA 3QXCA 2PMBA 4RX1A 4DUGD 5LD2C 1IUOA 4M8KA 3TUJC 1JZQA 2G67A 5H82A 4KQCA 3SHTA 2PX8A 3FFBA 3K8OE 4MUGA 2WJSA 3NDJA 3AR3A 3KB5A 2ZAHA 2Q2VA 4PX3A 5DM1A 1S7GA 1K7FB 5K0ZA 2JVKA 2GPYA 5AVOA 4OL9A 5IDXA 2QMUA 5LRSA 2K7FA 1ESZA 3WWOA 4GOLD 4OGLA 4M21A 2OZJA 4CDWB 1SXJB 2YHIB 3Q2IA 4R1OA 4J90A 3T0IA 2B34A 2LALA 5IAOA 3NJXA 3BMNB 4D6YA 5AUPB 3R4VA 3UB3A 2JICA 3EC2A 1RI2A 4DLAA 3AZVA 1TO6A 3TRFA 5D8AA 3O82A 4P0PB 2EJVA 3PQFA 5DHQA 4U7FA 1BLZA 1KITA 5DZFA 5C7GA 3R3VA 2IYZA 3AVOA 3GFBA 4P2BA 2ZE5A 2FF5A 3LPAA 4PLPA 2PBLA 2X7HA 2VK2A 1RAEA 1XDBA 4YASA 3AMPA 3WLJA 4IIGA 1MZFA 5E4YA 3S30A 2GVDC 4WVVA 1KDZA 4BFVA 2PU7A 4WOBA 4BFSA 5A71A 4QQ8A 3W5IA 2UY8A 1TW2A 4ZIRB 4DCUA 1YGYA 3CWZA 2EXXA 3O1OA 2OP1A 3BL5A 1F48A 3CRQA 1E2BA 3BL6A 1SWVA 1DL5A 3DPIA 1I3MA 2RS33 3ZY2A 3OLXA 4BXSV 3PQCA 5H83A 1N5JA 4PWZA 2R6ZA 2XMCA 3CCCA 1F4LA 1CIPA 4IEIA 2ZXFA 5CIYA 5G4KB 1JR6A 4K0RA 2OBFA 2J1AA 2C83A 2P37A 3GPDG 1HQCA 1ZI9A 3JQ8A 1RM0A 3E5QA 1YCFA 2PKYX 2F4VB 3ROFA 2EICA 4JN6B 3LFMA 1JFLA 2JAXA 1JZTA 3OHSX 2ECOA 1C5HA 5FOBB 2ZRMA 1V5GA 4BNLA 1CQ9A 5BNZA 2VQ0A 1GU7A 4I6JA 1NCRC 2Y6HA 1EVKA 2IPXA 5H9PA 1TIBA 2O8VA 1OV4A 5B3KA 3WZLA 4Y2TA 3NKLA 2VMIA 1R1DA 2NYUA 3HI6A 2P9FA 2WB2A 5ALPA 1MT0A 1ECPA 1UMBA 1IHXA 3R9IA 2BR5A 3AL6A 4YXWA 4HNQA 3ES9A 2R4UA 4US2R 2ASVA 1IKQA 3B60A 3IKJA 3RSGA 3HN2A 3B3GA 3NC4A 4CCNA 3V64A 5AHXA 3P32A 2JJ6A 3SOZA 5CFQA 2YCBA 1VCNA 3DKPA 1OTHA 5EE0A 3KVRA 3RD5A 1EX9A 4I4IA 5BUZA 4BHPA 1VBE1 1XB2A 3MJCA 1EDDA 4JTOA 2CXPA 3KPWA 4I5FA 3CKYA 4F71A 1EFPA 4YI3A 1CT9A 5IAAA 2JJ1A 3DTVD 4GEGA 3D4NA 4BLWA 2VKQA 4NPHA 3RIXA 3FKSD 1GAQA 3VBFC 2R1TA 5E2IA 1GAWA 2FK8A 4ID9A 4DQKA 2ADMA 3SBDA 5F6LB 3HPNA 5KJFA 1RUF3 4AMGA 2XVLA 3V00A 4KXNA 4B85A 4ZHNA 3UMBA 2AGSA 3T99A 2I1VB 4N49A 3R3WA 4WKOA 3FMOB 3FRIA 1X3SA 4RVSA 1V6JA 2P9QA 3CKMA 3AK0A 2RS32 4ZEXA 3V42A 1FPN3 1PDWA 4YJHA 1U8XX 2H7YA 1CYEA 3KQKA 4V0KA 4ESHA 2WE8A 3BG5A 5HV0A 3CVWA 2G5PA 1GV9A 1UDXA 4R8RA 4M46A 2V1XA 2GWRA 4F1JA 4ZYXA 5DIFA 2DYCA 2DUPA 3T5PA 2WP8J 2QJOA 3GJAA 1LDGA 1UK9A 4CF5A 4N5MA 4P2GA 1TC1A 3FPLA 4MR8A 3AK4A 2V5YA 2EIDA 2XRMA 2FCAA 1EGHA 1ISMA 2HY7A 2V3VA 3UKNA 3S8EA 5LYJA 2H08A 5FI5A 4H7FA 1RYFA 4PC1A 5EYPB 5EIOA 4BOWA 1J8VA 1B0ZA 1L8LA 3LI2A 1DC8A 4NEHB 4A0SA 1AKVA 3AV0B 1A04A 2C7GA 5C32A 5JR2A 3LPDA 4RETA 1XELA 5L7OC 4OJNA 3HKEB 4Q18A 4B6RA 3FMVA 3VVMA 4XEHA 5FBZA 2HYDA 3I9JA 4PHZA 3VKNA 4KO2S 3F3KA 2Y1CA 2FWNA 1N75A 1H6BA 4KWKA 3OBRA 1MENA 3A06A 3ZFEC 1QZ3A 5JMOA 2AF3C 4EPRA 2VUAA 5GALA 3H8RA 3MGKA 2YC4C 2OO5A 1X8LA 3VH3A 4C01A 3K72B 4ZGWA 3FI9A 2CHQA 1SCRA 2ZGUA 3D1VA 1S0CA 3K48A 2PS1A 3ANXA 5KAPA 3THXB 4RH3A 2JATA 2PSDA 3HG7A 1GA1A 4W63A 2D1RA 2BISA 2GNAA 4J0HA 2IYYA 4GUAA 1UKEA 1UU6A 1V1MB 4HEJA 1R9JA 3DT8A 1KMCA 2WAXA 4MW5A 3AF3A 5FUPA 2CL0X 5HM8A 3PLAE 4EBBA 4JENA 4UE3S 5IT6A 1QX3A 1B3RA 1NR7A 4RJTA 4XOUA 2NUAA 3HCRA 3ZU2A 2DU8A 1RWKA 5CLFA 5FUNA 1DTWA 3BMQA 1RPZA 2EDCA 1T4GA 2OFWA 2VDVE 1DS6A 3NV2A 4MS1A 2WSUA 5CBKA 3GZJA 1RWQA 4FFSA 1D1QA 4MQ4A 3NIBA 4DXTA 2OO7A 1ASJ3 1YI1A 3DPRA 2V4AA 1X7HA 3CLSD 1QIJA 3MB5A 4ZV4A 4RKYA 2YHAA 1X70A 1GKIA 4GEKA 4WKBA 3DHNA 4CQJA 4ESEA 3AX6A 1DAMA 1UZYA 2BHRA 2CJYA 3VR3D 4FFLA 2B5HA 1LB2A 4J94A 3VDDB 2VCCA 1K63A 3DOUA 1MB9A 2JNWA 3EA0A 2E3JA 1NONA 4NBWA 5IJXA 3PGXA 3AVWA 5EY5B 5K8CA 4QXKA 1DU3D 3SC2A 1VKOA 4MWEA 1E5RA 1AR92 1E77A 4BMDA 3I4IA 1YJ8A 3C48A 3MIBA 5FOWA 3VHRA 5BYAA 1XSQA 2H2IA 3R3UA 2PR2A 3R6DA 4Z0PA 1I0IA 1S4MA 1CVRA 1ZJ5A 1JKJB 4E27A 4P92A 4FN5A 3L7YA 2ZB4A 2CHGA 2P2LA 1QTQA 2GP5A 3B01A 3KYDB 3B9IA 1IZZA 4WINA 3T7SA 2XB8A 4DQLA 5LZ7A 3Q12A 1DKUA 5IK4A 2R071 2HTFA 4EGCB 1M3SA 3I72A 4OLJA 3AUJB 4IXNA 1AK9A 1I0LA 4KNCA 3PENA 1CS4C 2Z1DA 2B4AA 5AP9A 4OOEA 1KFJB 3A7EA 4LC9A 4ECAA 1IZ3A 3CGWA 4J0KA 2C7BA 5DAPA 4GOOD 3WFIA 3MJTA 5KYGA 1X80B 2JI7A 2FPLA 3CBNA 5K2OA 4JVAA 2I9PA 1QPGA 4KZKA 4BY9E 3NHZA 3SG0A 2PUAA 3RZHA 1EK6A 4KGVA 1JYCA 5HJEA 1EKXA 4JUCA 3A4NA 3F2IA 3H7JA 3F5FA 4RTOA 3DJYA 4X45A 3E35A 1JP7A 1CBUA 3NBQA 2VJOA 5IULC 1X82A 4B7ZA 2Y33A 1QVVA 5ERLA 3AYDA 2HAEA 3EXEB 4R16A 4CPDA 1BOFA 2QE7A 2ZJBA 2R1ZA 3UGFA 5EUBA 1FXZA 3LDFA 3UY4A 2QU7A 4XAQA 5IJRA 5FBWB 1F4VA 4DUYB 4FYXA 4AR2A 1XZPA 3OH8A 3SLKA 4RF2A 4A8JA 5BRNA 1W0PA 2FPXA 3SF0A 2NWQA 2IUEA 1UZNA 1XDSA 3REQB 3UC9A 5J3UA 1O5LA 4MYTA 1GPYA 4PIMA 2J1RA 1E4EA 2COKA 1N2CA 5I51A 2VTDA 4W99A 4O9EA 1TCAA 2VZUA 4LDPA 4GPBA 4MTLA 4F6RB 4DRZA 2C2YA 3IPRA 2AWNA 3VZRA 2P5YA 3O3OB 2SBTA 4Q7EA 4ZO4A 3TOJA 3IDEA 1T2FA 4IV0A 3K0AB 1YOVA 4W5OA 3DWFA 3NH6A 2Y9PB 1M76A 4HWOA 1UMCA 3DS8A 4AKTA 1PVVA 2VQFB 3FUQA 3C7GA 1NF9A 4BH9A 2GEDA 1BGWA 5HWSA 2A30A 4HD8A 1Z36A 3ZHCA 3BHMA 4QRIA 3IAEA 1W85A 4L5BA 2C1EA 4Z1VA 2P34A 3ZX4A 3AEUB 2ZK7A 3D6AA 1JB9A 1I3NA 4LZLA 1ZK3A 1A8MA 5JOYA 2IF2A 2V3CC 1OXSC 1RI5A 4EJ0A 1ND6A 3GUUA 3COVA 1GL9B 2DCJA 4KLCA 3M0EA 1X39A 1YVDA 3MGGA 3DV9A 4LJRA 3VAYA 2PANA 5ULLA 2GSWA 1VB3A 1U12A 2EJUA 4OEHA 5BN3A 2HGSA 2JCXA 1N5IA 1C1YA 4QM9A 5KJ1A 3T2OA 2GMWA 4BNMA 2ZGTA 1GZVA 1GP4A 5TQJA 3DZGA 1KI6A 3PFCA 3R7SA 3FN4A 4QX6A 3S7IA 4M0DA 1JEYB 2BWCA 4GBGA 1FP1D 2FMIA 4ALIA 4R1QA 4TS9A 4OM8A 2IXCA 1LCIA 3HQ4O 4IOLA 2E37A 4HB2A 2ZIUB 5I8YA 2XJQA 2IHKA 3EWIA 5BO5A 2KX7A 4JJIA 3FSRA 5K8IA 3NJ8A 4DA7A 1MRNA 3O95A 2LUWA 5B7GA 4YXWD 1CZHA 1K88A 1EFUA 3LP5A 1TZBA 4URXR 3CPJB 3O1VA 1DC5A 1G8WA 1MOSA 4M8SA 4BP8A 3HYLA 2RI1A 4IWYA 2HUPA 1X92A 4OG2A 3BCSA 2DERA 5F5QA 4UM7A 2ZAMA 4RHYA 5ENZA 2JAWA 1U99A 2PHWA 1Q14A 4G0WA 3TN93 2ETEA 3DGFC 4HADA 4R8HA 1SLAA 4RSMA 1WEKA 4WOKA 3T5TA 4HNAB 4WM8B 3FVQA 3R0VA 4MGHA 4IIJF 4JOQA 4PTZA 3RUAA 2WINI 4NIAA 4MLCA 3CISA 3R8CA 5LA1A 2GBGA 3AP5A 5K3EA 1FK8A 2ZRCA 4AQDA 5BMVA 1LV7A 3OQ1A 4JP8A 1XA0A 1O95A 3D8CA 4HYTA 3WLIA 3QYPA 2C5FA 1HNNA 1WUVA 1U8CB 1ULSA 1TQ6A 5EKTA 4KRXA 1ZCAA 4GMGA 3OY8B 2QSZA 2AJTA 3JB8A 3OZUA 3BERA 3GP8A 2A8YA 6REQB 4WFJA 2FWIA 3VAAA 1WIWA 3DMNA 4K9PA 3OBTA 4NJEB 3VBUC 2AR6A 3IB3A 2AMLA 1NHWA 3K0BA 4AP6A 1RM3A 2X7XA 1P0PA 3TECE 3OZDA 2JIQA 1OH6A 3AMNA 3DZCA 2AYZA 1EK5A 3WQ7A 2IYSA 2GEBA 4B4UA 4DRVA 4JP5A 3C6KA 3PTLA 2PGXA 3KJNA 1NOJA 5CH8A 2COUA 3CA8A 3O93A 5BN4B 1ZY2A 4CDNA 1BD3A 1T8RA 3Q9OA 1TA9A 1VPLA 4YLYA 5F4BA 4P4LA 3O92A 3A6ZA 4C03A 1MTOA 3OVMA 3ER9A 2GLUA 3HNRA 2WNEA 3RB8A 3K0EA 4EW3A 3WF4A 3H05A 2TMGA 4MVJA 3N9QA 4RYDA 3WVJA 1CEEA 1KWGA 5T41A 3NMUF 2CVHA 4FYHA 1XL1A 3H2KA 5LW9A 1USGA 4Y1XA 4DV0B 4BP3A 5DLPA 3OE5A 4E2YA 3L3BA 4S12A 3FWNA 4DG9A 4KPGA 5GKAC 1ENPA 5FOSA 1P1RA 1YDWA 4RIEA 1RYMA 3QWIA 1L4HA 4EK9A 1ZD1A 3SVTA 4IV3B 4JOSA 1PR6A 3COJA 2AD1A 1LB1B 3DSRA 3LF2A 5D87A 4I14A 2IS4A 4OHMA 1DIRA 1JG2A 2VHTA 5AJXA 1E2FA 1APNA 3O4IA 5J4HA 3HKDB 3Q8MA 1SUDA 5CYFA 2GZMA 1MBZA 1RMQA 1CDDA 3ITDA 3EEOA 3SC6A 4YVSA 2ZX0A 1IS3A 2PS3A 3WGVA 4RS4A 1XYNA 3ZCPA 4YQYA 3E9YA 4ZYTA 4H3WA 2AZDA 1U7OA 2C5GA 4CR8A 1JQDA 4UATA 2AN9A 4MS3A 3RC1A 1DF0A 2LCQA 2NT3A 4WJKB 4DANA 2A5JA 3W0LB 5JVDF 4O08A 1J0DA 3U2QA 3FDZA 1TGVA 1EP3B 3PHGA 3GLGE 2EFGA 3SF8A 3ENKA 2GPNA 5IN5A 1DJOA 1DPGA 3DAHA 5L9VA 1NT4A 5TNXA 1IJBA 2ES3A 1JQJC 1E3WA 3CZRA 4N8SA 1XF9A 3SNKA 1Q7BA 2RHPA 1EAH3 4JIGA 1AY0A 1RAAA 4CLHA 4A8JC 3ABOB 2HQOA 5AVAA 1KI6B 4YP1A 1L4KA 1VLMA 3GNEA 2WIJA 5ABJC 4WA8A 1Y42X 2C1ZA 5DASA 2I3BA 1Z39A 1BXGB 2IOHA 3C3XA 2HX1A 4NCIA 4CP9B 4MQBA 3RG2A 5CJ2A 2QKYA 4RGAA 3TINA 2RGNC 3TRJA 1TLFA 1ZLXA 4OJTA 2REQB 3BCWA 3B1KA 3VH1A 3N8DA 1ADJA 4EY5A 1FVHA 5A04A 2RS11 4G5SA 3ZS9A 5KWEA 4JUAA 1ZRFA 3SDZA 2I78A 1CN1A 4AHZA 5T5LA 4H60A 3WDKA 5CJPA 4A7PA 1BJKA 2B2CA 3BJZA 1FSZA 2CZGA 2UYYA 1KZ4A 3FH0A 4N39A 5KQGA 1P6QA 2H4ZA 4E30A 4NMWA 1UZUA 1RVF3 3AVVA 4KSCA 2RKWA 1NN0A 1WUJS 3TE7A 2VMHA 3ZWMA 2IYXA 3A3OA 4Z8XA 4TMVA 4NOKA 4YAWA 1BE1A 4A3SA 1QDCA 2A71A 1G7RA 5A6SA 1SXGA 4BLTA 4GYWA 1RUD3 5AXBA 3CPSA 2Y92A 1JKJA 1DCKA 2BHTA 3LPLA 4F1KA 1HURA 4TSKA 3UW1A 1RMU2 3SHRA 2C58A 3VFDA 1UOEA 3HXLA 1TIPA 3F90A 2HWUA 2WV9A 5FHQA 2X15A 1REEA 4JV4A 1SPPA 1EHYA 4M86A 4JUBA 3QE3A 3R41A 5T8KC 5TQ0B 1UBOS 3S29A 1SUEA 3EG9A 1KJQA 1IM2A 2J87A 3WQQA 3RV4A 2DCYA 3HLTA 3ZFFC 4EGFA 2VZ0A 2C4NA 2HA4A 3PDIB 2V72A 1C0LA 3STHA 3FHAA 2VU9A 4AECA 4YZ2A 1PQYA 1X1BA 2LR0A 4B84A 5FNVF 1ISSA 4UC0A 4QUHA 1PTJC 2SCUB 1X1TA 1YQEA 1W04A 4G0ZA 4ZVUA 5KNBA 2D5CA 2ZSBA 3ADKA 4YX9A 3KEFA 3EGWA 2JIRA 4U2DA 3VJLA 5AI8A 1QE0A 5DP2A 3PXBA 4KP7A 3DBLA 4L2NA 4U2CA 2E9SA 1P1FA 4ER0A 2VATA 3ICPA 3I0MA 3KBBA 4D56A 3H13A 3P9IA 3GJSA 1T9DA 2BNMA 2HWKA 3ZEIA 4BLRA 5A1LA 1SXJD 1WUKS 3A21A 3HYSA 4LVUA 4NABA 1ZRDA 1OI4A 4EN7B 3CEJA 1HMYA 2CVQA 1FFCA 3NHUA 4XX0B 3NBAA 5I7FA 4LGVA 4C5BA 4HGZA 1C9JA 1ORRA 3CSUA 2Q2WA 5I7HA 4HMZA 4MGEA 1RIIA 1ORTA 4NEGA 3KOUA 3NBMA 2QQLA 3OAAD 2H59A 1YVUA 3GEEA 1SMKA 5AD1A 4WXRA 3BTOA 2J85A 3LW7A 3EIUA 4QB6A 1R9NA 4HX5A 3CU5A 3LKZA 3BHIA 2ZDHA 3RJ9A 3WINE 1PL7A 1UQUA 1KGDA 1CC1S 2QVCA 3SYKA 2J1VA 3O4GA 4CUGA 2C5LA 4ADSG 2XPCA 4U7GA 4QB1A 4GM1A 1WMSA 4JLDA 2GC0A 2OCXA 2WJZB 3BIEA 4G4GA 4L50A 4Q4CA 1LHUA 1BRTA 3RASA 2R8RA 4JLKA 3HKBB 1XXHE 2B3DA 1E9AA 1WKCA 4NRDA 1ND3B 3IOBA 1WCUA 1NASA 1A98A 4ESOA 2C4MA 5FH9A 1NLRA 1JG4A 3QM1A 3P2IA 4AZ0B 5AVJA 4A7YA 1G98A 4MI9A 3UK7A 3Q9LA 1EUCA 2VJKA 5AOBA 3H3ZA 4NMLA 1Z0DA 2YICA 4GM0A 4QJIA 1DO2A 3IH5A 3FLMA 1SWWA 2ZB3A 1QZZA 3ZX5A 1UPFA 4C4XA 3IN9A 1ZGAA 4G5QA 1DZTA 3TG8A 4D3FA 1G20B 2A1TR 2OM6A 3SZ3A 4F5DA 4OB7A 1W28A 3DLIA 1JSRA 2R16A 1UFOA 2X10A 3NT4A 2JWPA 4OFZA 2ESRA 3C8XA 2EJCA 4QPGB 4Q19A 2SICE 4PCUA 5EYXA 4D79A 1DZIA 4IDNA 4K1YA 2XTJA 1VMJA 1WKYA 3IIKA 1L5LA 1AE1A 4XBNA 1W8WA 4PQEA 3QX8A 4CLEA 4WTOA 5J37A 3T2PA 3U7FB 2I2DA 1EUYA 5BMOA 2ZI3A 4H4EA 1B7GO 2P6UA 4FNMA 4BL5A 3SNMA 2HPHA 4LV5B 1W3VA 4FXKB 4KXVA 3QXHA 4MRAA 2WD7B 1WZIA 2YNMD 1FEZA 1WCXA 3KTAB 4DA9A 2BGMA 3WGMA 2K2WA 1PJRA 5EHNA 2BCGY 5T4BA 2YXBA 2ID8A 5IVKA 3T3PB 5BR8B 3G2KA 3GFRA 4QXPA 3ADBA 1QFJA 1LTKA 3WNDA 1NCRB 4UF0A 1BU5A 1FP4B 3C3EA 4MMZB 2JDNA 1EYBA 2V6FA 1YS6A 3Q3CA 4LO4B 4V2IA 3VTKA 4BXOA 1Z16A 2Y0CA 3FFQA 4YGBA 4FMBB 2Z43A 2L69A 2ZU6A 1H9AA 5FZ7A 2E4AA 3EXUA 1PSZA 1ZAYA 3HYTA 3A37A 4PIPA 3W8EA 4HFMA 3DCJA 1EDEA 4LRWA 3T30A 3WVNA 1XIVA 3IZOA 3PEVA 3DP7A 1Y98A 2PKCA 4QPDA 1YHFA 3R9KA 2JAQA 1X15A 4TLFA 2YZ2A 4PLVA 5BUSA 3PVBB 1WB4A 2KR2A 2XMBA 2O2HA 4FMCF 1Q77A 2GRJA 2B82A 1NE4A 1SN7A 4CUKA 2WICA 4PQYA 3DEMA 2H11A 1RM4A 3QPCA 4I4TF 2J7PA 4MXWB 1GKBA 1S3GA 3CKKA 2GPBA 3ZFFB 1ZK1A 3RW9A 2FHPA 2Q28A 3CH4B 3EVZA 2QQVA 2PU5A 2ARXA 2ZI9A 3COWA 4WEOA 2ABWA 1U6IA 2HU5A 3KB6A 3FPCA 4LK2A 5L3SA 4QD2A 1CQJB 3QLVA 2AGVA 2Q1XA 4UOEA 5BV0A 3S0JA 1SBQA 2XUKA 2WUWE 1QOOA 1D6SA 3L40A 5ETJA 1NN1A 2OHJA 3ICCA 4BQ3A 4D3SA 4TT3A 4KRGA 5AUNB 4KFCA 3HDJA 4Q03A 5IAKA 3Q7PA 4FBLA 3V1UA 4AEDC 5CB0A 4CXXA 3SC2B 1JECA 2RAVA 2E82A 5A3VA 4UE2A 2IDMA 3RBAA 4F93B 3FDJA 4HN0A 5EG5A 4YAUA 1GU1A 3LDBA 3DZHA 4RV9A 2NOAA 4Q1FA 2X0FA 4Z54A 3QY0A 4B7EA 3PT9A 4L74A 1PZ9A 1V25A 2NU8B 2CMDA 5LASA 5FZGA 1MQAA 1PLKA 1U3CA 1BZWA 4Z2AA 3BWXA 2GUWA 1UADA 1XRMA 3H2JA 4GNKA 4LBMA 4GQAA 2VDRB 4XYEA 5KNCA 3NTLA 4TZDA 5GJWC 1V8DA 4IFBA 4NARA 1W9WA 5DNAA 4OMDA 3ZG6A 1Z08A 1H0SA 1FP4A 1YBVA 1JRLA 4DIDA 2D2XA 3DH0A 4N9WA 3FJ1A 5GZEA 2A7AA 4KCGA 1GFSA 3I34X 4WDRA 2IPMA 3LJKA 2Y0EA 4ZT5A 4HLQB 1U8EA 3ZFEA 3TD9A 1B8VA 3RYRA 1CXZA 1VMEA 2YVAA 5LB2A 3RTDA 2R043 3CF4A 4H55A 3QOPA 3HIFA 3QUSA 4TVOA 3HBNA 4RGVA 3KL2A 1E57A 1PJLA 1CZTA 3ESBA 4LE1A 3TLAA 1EK1A 1KEUA 3SK0A 4IDOA 3R7LA 3K4PA 3V6LA 1XTKA 3CVYA 3MJ4A 3U81A 1EVJA 3CL1A 5MF6A 5LMUB 3LYAA 1QIFA 1U1FA 4IEFB 1E20A 4AP9A 2APJA 3GROA 3W90A 5L3SB 5A0FA 1X7XB 2I4MA 3GP3A 3Q1LA 1AR83 4BUJA 1RYYA 5I6DA 1XCGB 1N57A 4NZPA 4YQZA 4IF4A 5GZFA 3NU1A 4LDNA 2PXXA 4AZWA 5B36A 5KVQA 1UM9B 5CJJA 5FQ0A 4IL7A 4GX2A 1ODTC 4MAFA 4ZQHA 2BMDA 3C0KA 2RJNA 3Q8CA 4D5EA 2ZYDA 4HMPA 5E4TA 1WGPA 3PUKA 1FTSA 1YWKA 4YLEA 1JEQA 5KOIA 4BXOB 3EWAA 5DZEA 4FN4A 1BG6A 1RC8A 1YZGA 3H42B 1JF8A 2IKSA 3PQ7A 2XX3A 4KWJA 1U6KA 1TF5A 2G5GX 1LR5A 4X1KA 3KV5A 2YJNA 4W6YA 1Z4JA 1A6CA 4OBWA 1NUKA 2JDZA 4YUAA 2PCJA 1X13A 3OSZA 4JBLA 4B3GA 1R8JA 2JHCA 4FAHA 5DN2A 3OZFA 4RZHA 2VXJA 2VPIA 3IVRA 4BQEA 2OQRA 4ZYYA 1JYVA 1GIAA 3G2IA 3GJYA 1ZRNA 2PMKA 3RHTA 1WLYA 2JIOA 2R30A 1XT6A 3VBUB 4ZZ8A 3KWJA 3JXSA 5GV8A 1ZX5A 3KJEA 2JLXA 5L6LB 2YXDA 1VBA2 2OTCA 5J36A 4JLSA 2XWBB 1G86A 1ZCJA 2P8JA 2OQ2A 1V8OA 1QMJA 1NIJA 4EITA 2INGX 1NU8A 4NU6A 1BFDA 4HGQA 2XUJA 1EJBA 5JIAA 3L4BC 4JL8A 3GQVA 2B1GA 4Y24A 2WD8A 1JHMA 1QJ4A 1MZEA 4CODB 2VZ8A 4PC6A 4X3PA 4X95A 2QQMA 4ZRMA 4Q82A 4PLNA 3N3HA 1VCIA 4BEVA 1JDJA 5GOZA 4BNYA 2IHYA 2E9QA 2AR0A 3RVPA 1CR6A 2OENG 4MOWA 5BSRA 4UW6A 1A71A 4LHKA 4RLHA 1KP3A 4L7VA 4ZMBA 1M72A 1BMTA 2JHFA 2CWSA 3LOPA 5EOVA 4GMKA 5A4FS 1TMF2 4JIMA 1CUGA 3ORFA 1AQIA 1ZQ1A 2VDNB 3KLPX 5SV2A 3IVGA 1KP2A 2QL6A 3RF6A 5C46F 5C1OA 4ASKA 2QN2A 2CYCA 4JYBA 3WLOA 3D2CA 4IKOA 2ZRFA 4HH0A 5JNRA 2AF4C 1XTUA 1WPXA 4P81A 1SQ5A 1U9IC 1DKOA 3GFFA 2H4YA 3TRDA 2FQPA 2R47A 4BRWA 1WULS 4Q0MA 2TEPA 2W1QA 2NO6A 2XNSA 4HDRB 4LE2A 5FPSA 1UBUS 1X8XA 1UDCA 1NNUA 3AZXA 1HF3A 2G17A 2QXYA 3E1GA 4ZREA 2D98A 1G8GA 3M6IA 1TM3E 2P27A 1WMXA 2OK8A 1JLLA 1D6JA 2VM9A 2BHLA 4EROA 1L6IA 5CB7A 3V8MA 3PNQA 5KVSA 4FFFA 4IGAA 2JD0A 4HAXA 1M83A 4MYUA 1HYGA 1K2VN 4OXYA 1YK1A 1UF2C 5D8AC 2YFQA 3OTQA 4WNAB 2EW1A 4CKEB 4YGYA 3AEQB 4MV7A 3ZV6A 3KS7A 3FWPA 2XUMA 4IIXA 4TLDA 6Q21A 1FRZA 1MNQA 5CFLA 2OLJA 2L9LA 3IJPA 2OV3A 4CGYA 4ND5A 2C4TA 7ABPA 1RRMA 2PHRA 4IJ6A 4S24A 2GTPA 1DRKA 2HRRA 5FMDA 3QLUA 4ZZIA 4BTVA 1TFUA 2I9KA 5AM2A 3V3TA 1NATA 4DV4B 2R97A 1O1YA 3SEQA 3ITQA 1BVUA 3KFXA 1I36A 2Q45A 3KLNA 1COV2 2AG6A 4P4NA 1JHDA 5FTWA 5C7YA 5JECA 4HT1T 4JGBA 1H1IA 1VCHA 3TBKA 3RS4A 3ZVKA 1KQPA 2VCYA 4HFRA 4HVAA 3I9V6 2YHJA 4E5KA 2VPPA 4H7PA 3ROTA 1GUDA 2XWSA 3B1ZA 4O1MA 2A7QA 2XG3A 1PNTA 1Z5PA 3QA3E 5J47A 3WP6A 4RA6B 3TR6A 5ICMA 1TEZA 2AXNA 5JI3E 2FQ1A 2P2YA 4ZPJA 1NULA 1F4AA 3TZQA 3EVBA 2C9AA 5C51B 2O7RA 3LC1O 2VSQA 1QHDA 2OSVA 4CEWA 3TPCA 2ZGSA 4OL0A 2JL1A 3ZR5A 2BP7A 2A1XA 5LLDA 5LATA 3C14C 1VCOA 4UU8A 2WVJA 2O8BA 3X43A 4L27A 4N7UA 4IMPA 1AC5A 3MBIA 1AS3A 5FZHA 1UF9A 4E2WA 3POEA 3KOOA 1Z4IA 4NBUA 1LU2A 3OOXA 4IQPA 1NAHA 4ZXEA 5KI6A 1W94A 3QMMA 1QIGA 3E48A 4W9MC 3V6MA 4B6QA 2LV8A 1M6VA 3NVKI 3UHJA 1CJTC 2FWJA 1CAVB 1NBAA 4CM6A 3MILA 2XGSA 3P0EA 3Q3JB 1JHPA 1YFLA 1JYXA 2PNJA 2BFBA 3WL8A 2ZWVA 4NBSA 5A1AA 1HR0B 5ABJA 4YG6A 1YVRA 3F67A 4A8JB 2NV2B 2X58A 5IASA 3VOBA 1W46A 2VBGA 2DSNA 3D6HA 5KJEA 4MA0A 3KV4A 2OCIA 2XB6A 3RYHA 4Q29A 4IKPA 4KZPA 5B2ZA 3ECCA 4IP0A 2O5CA 1SVWA 5IFLA 4UYBA 3RSJA 2QT0A 2ZAOA 5G1OA 5IATA 4ZZ5A 1V96A 3EF0A 4AD8A 2JDMA 4JJ4A 4UMFA 2G9NA 4BZ4A 1XZHA 3W4KA 4RKRA 3OPVA 5AKZA 2JBWA 2ZYTX 5E6UB 1QKIA 1MN6A 2GRAA 2CV2A 2ERXA 2C7PA 4RANA 5KB3A 1H9CA 5C8XA 3H3XA 2WJIA 3PLQA 1LW7A 2IX3A 2WHPB 2X0NA 5L9AA 4BQFA 1IMOA 2C54A 3LUJA 1C41A 3ZDXB 1CD3G 3I01M 3QP9A 1JTEA 1ZYUA 3L8GA 4G5XA 2EHJA 4G1FA 2GCOB 5IAEA 2OFXA 2OHIA 3A9TA 2WFLB 4Q1CA 3SMQA 4ZOCA 1IPKA 1OASA 3AP9A 2XLFA 1T0JB 3ROUA 1JQEA 1JV2B 5KC6A 2MSDB 5K5EA 2IEYA 5C18A 2YY5A 1EUUA 3LHFA 2DAPA 3AVPA 2D06A 3E97A 1QDEA 2BHNA 1SG6A 3IPYA 2I2SA 5K4HA 1TME2 4LOHA 1J8QA 1GLVA 2H4WA 5EJFA 2H1CA 2EVXA 2JCYA 4LV6A 3FUWA 1Z34A 5AW8A 3F6YA 1S3SA 3HLKA 3Q8EA 3AYXB 3HEAA 4JJEA 2VAVA 2BE9A 2JZNA 4M7OA 3OFJA 4RESA 3I54A 1YWGO 4I4TA 4QUAA 2BTQB 3NHSA 1WMAA 4TQGA 2IKQA 1CUAA 2H5IA 3BUSA 3FNGA 2FZ5A 3IMNA 2XBUA 1FNSA 2D97A 4AHXA 1L7RA 4BE9A 4ABTA 4W9NC 3FWKA 5E7QA 5F4ZA 3FXAA 3FTQA 3UJQA 3OZAA 3EBOA 1QO7A 1M2OB 1E1KA 5DU2A 2UDPA 2OAQ1 1CHDA 3KQTA 3TWIA 1N36B 4PLZA 1SBIA 3MWGA 3QPDA 1EFLA 2CWDA 3G49A 4DSUA 5MN5A 1KF0A 4QXHA 1PP4A 3NH9A 2W98A 4EAQA 4NIGA 3NP9A 1WMDA 5FMOL 1E1QA 3DR5A 4ZO8A 4MO9A 4BVEA 1CZVA 4AHYA 4CFZA 1ZK4A 4LNUA 1LPMA 1OPOA 2ECKA 4Q3EA 4LMBA 2FDGA 1ZAKA 1YZLA 1PWHA 3U11A 1FTQA 3PIJA 1DAIA 3C3JA 4FFWA 4QPGA 4M7RA 3RC8A 2XZTA 2R7EB 2A33A 2ERYA 4FOPA 9MHTA 1E9BA 4TRRA 1UBKS 3VDRA 1JZ6A 1PS9A 2GJSA 4Q7LA 1ENSA 2KI5A 1XYPA 1SBFA 4WBNA 1PGW1 2GFHA 4GW3A 2YHSA 5JS2A 4AVAA 5KYNA 3OT1A 3ZVRA 4IXWA 1VA4A 3IUNA 3JWJA 1PFQA 1R093 4YA6A 3QYAA 2C00A 3H7AA 2ZYSA 5FPAA 2HDNB 3G1TA 1VHLA 2O2SA 4MHUA 1R1A2 3OIYA 1KYZA 1N8TA 3KKMA 1CZSA 4CKWB 5LA0A 3IIAA 3U3JA 5ES3A 1VBB1 2C77A 4ZEWA 1ECJA 4OHKA 5FQNA 3THTA 2JIBA 4D6XA 3AM4A 4ZQEA 2XWJB 1L3IA 1EE9A 2FPGB 1R081 1DBRA 1I4LD 3T9AA 4LO6B 5LKAA 1LRKA 1OLXB 2V4ZA 4YUVA 1XC7A 4NK5A 1T8UA 4CKCA 4GWIA 3ZIWA 1G3IA 2AX4A 1DBQA 1Z8NA 1I6WA 4BLVA 4C05A 2NUPA 2R073 1ZP6A 4JP3A 3EXFB 5LA6F 3DYBA 1PW5A 3MPUA 1EBUA 2WFPA 5TLSA 4PLOA 3MOGA 1GAJA 2JA2A 3C98A 4ZS2A 5BV1A 5KKNB 1L4LA 2F3PA 2BJSA 1VFNA 1QOPB 1S0IA 3TLXA 5B7NA 3LIIA 3FDZB 2QX9A 3N5CA 4UUMA 2C03A 3CUWA 5K0CA 1OA2A 4JROA 3ZX7A 2MR6A 3KOYA 4MP8A 1D6MA 2PEZA 1O9BA 2XQJA 2FDRA 4MH0E 1GPKA 4CEYB 2WM3A 4FPGA 2Z83A 3PQ8A 2XW6A 3CVJA 1L5SA 5AXCA 3VGIA 1NRWA 3R4SA 1CU1A 3V0AB 4X91A 1WS6A 3EQ7A 2HWC1 1HLGA 3BU7A 4XDOA 3C3BA 5EIYB 4J6GA 1GARA 1T0IA 3GFVA 1D2HA 2R8EA 2X8WA 1PVC1 4ARCA 1RRVA 4P32A 2HWWA 1KK3A 4FILA 4YB8A 3E2MA 2O20A 3GNTA 3TJRA 2IOFA 3GX1A 3OU7A 1GYPA 4AJJA 5BNPA 3LXUX 1PK7A 1IOZA 4TLLB 1E2EA 4R4ZA 3FOCA 2P2SA 2FZCA 4M1ZA 4M98A 1V3VA 2EIHA 1W96A 3MF9A 4L4XA 4HJRA 2Q3LA 3A58B 5J4YA 4LR4A 4E6EA 3K4QA 3ZIAA 4AQ2A 2AFIE 5HS6A 2R5FA 4OP1A 2HQRA 1S8AA 4IGOA 2IY9A 1QNYA 2AB0A 1A97A 1WR8A 5DH9A 3T3DA 2R87A 4GXTA 1BKDR 1J09A 4CUZA 3NSTA 4F3RA 1MG5A 4MVJP 4HC4A 2D7FA 5LC1A 1LPOA 4YJHB 5FJKA 3T3HA 4IIYA 4IS2A 1DGRN 2QRNA 3SBOA 1V4VA 4WV8A 5A3JA 4MV2A 2DB3A 2GZWA 4F83A 2Q27A 1J7JA 4QRHA 3MLEA 2JGAA 3DFFA 3QNUA 2JE8A 2WRZA 2NPOA 2YH2A 4Q12A 4WK2B 4LT5A 5CG8A 4XVCA 1N6OA 2QVGA 4AVTA 1LGBA 4QGNA 4WMLA 1I4EB 3R0XA 1KE2A 5AW6A 3K51A 2E4UA 1DQPA 1H4GA 3M3IA 2BKAA 3WX0A 3PL5A 4EATA 4IILA 3BFVA 4ZGGA 4YJGA 2E1PA 3N2ZB 1B0UA 1CVLA 3DD5A 2RGXA 3C74A 3DKQA 4JY7A 1Z9BA 4CT0A 1W9TA 2G88A 1JNYA 3WAJA 5LDHA 4G2NA 3AKYA 4I8IA 2RHRA 5A7QA 2ADOA 1U04A 5IBRA 3TZKA 2Q49A 3FRHA 2XVMA 1FYDA 3VNAA 4I2VA 2FVXA 5H81A 1NHGA 4CIAA 4QFMA 1XNCA 5FYIA 2FJPA 4LY6A 1I9RA 1G1AA 4H35A 2R49A 4OQPA 5KMGB 1J83A 2AQIA 1MMFB 3QQPA 4ZCRA 2OPKA 1KIFA 1JU3A 2EP8A 2W6MA 3PGJA 1JFFA 3GO4A 4GQ7A 4IJQA 3KHSA 4CCEA 3GZ4A 1MEC3 2NTVA 3SZLA 3P94A 4P34A 3JD2A 1RYBA 3MUY1 3O94A 2O06A 2MYUA 4XYGA 1YYNA 3KF3A 2G70A 3C5CA 4DY5A 2BC9A 3W1EA 1X6VA 4V0ME 4MA5A 5BNFA 4G4IA 5KPJA 1FQJA 4V2UA 4WLNA 4NFHA 2V9ZA 3B70A 4F7WA 4XM1A 1ESMA 3HXKA 2N7GA 1RB8G 4GI7A 4MI3A 2FPIA 3MUOA 1F60A 1BCSB 2X8JA 3BOSA 3FRJA 3AUUA 4CRWB 1FFYA 4HRVA 4Q5OA 3N2GB 4PXAA 1XVTA 5EHQA 3DLPX 1IHOA 3OEEA 4B0OA 3MIHA 3DF7A 5LDGA 5J98B 1SDWA 4KQGA 3GCZA 1VL8A 2A3WA 4M55A 4AMZA 3QXSA 2OP0A 2JCSA 2VAUA 2QM7A 4G0UA 4Y6PA 1MC5A 4ZEMA 4QASA 4ZU5A 4K6MA 1TJ4A 4EKGA 3TYJA 4RKEA 3KU4A 5JY1A 3QEAZ 3RI3A 4D0LB 4I09A 2FOIA 5L51A 4ZYUA 4AG5A 3NRBA 1QHNA 2X19A 4C6SA 2R751 2PEYA 5FWYB 1CIWA 2YBEA 4ZAVA 1NW7A 2ZYAA 4MUYA 1XRNA 3GFOA 1XL0A 1ZBDA 1I3HA 2RMU1 1HFJA 1X9TA 3UXYA 5KSZA 3HD8B 4LOAA 1RVDA 2NMNA 2C61A 3NI2A 1EXVA 1I13A 1G0OA 1QWOA 4XUGB 4POOA 4R0NA 4INJA 2YHUA 2HBTA 3QG1A 4AF7A 4LSWA 4PBRA 4HN1A 5BSUA 4R69A 3RWNA 2Y1GA 3ORJA 3KMHA 4DCJA 1A8IA 2W8ZA 4YZ1A 3MRSA 4KVAA 5FTMA 2WWSA 2NVBA 3UICA 2KA3A 4RVFA 2DC1A 2P0YA 3L0PA 4V0RA 2WIIB 2Q6IA 4J4TA 3VSBA 1JZSA 4PLFA 2B83A 2PAKA 4I99A 2BW0A 3B9BA 4JL5A 1GOGA 3DW3X 3IOEA 5EXEA 4MW9A 4MHSA 1QOZA 4D6PA 1WMEA 1A82A 4LQ4A 4PAGA 4Q34A 4OSPA 1BVVA 1YB2A 2GM9A 1KU6A 1WSWA 4AM8A 1R00A 4QM7A 2HV9A 4QBKA 5JANA 3V7WA 3NXSA 2YZMA 1OROA 5FEMA 1QGAA 3WNNA 1NVKA 3TAUA 1INLA 1A2BA 1P9WA 4XCVA 5DDJ3 3N2KA 4PIXA 3EDRA 3QJYA 2X3FA 1T6YA 2W4MA 4KQIA 3ZVMA 5JIUA 3F8TA 3TLYA 5K4GA 1J8MF 3ZXXA 4B80A 1ECFA 5H0IA 3DB2A 4AROA 1WUTA 4WZAA 3H50A 2XRZA 5IZCA 2A5ZA 1LBHA 4ZIRA 1IG0A 3SIWA 3L6RA 1FW6A 4QQRA 1W2OA 2Z8XA 1USKA 4Z4QA 3V4SA 1PNVA 2J5QA 3A6FA 3PBKA 1Y6GA 2JLYA 5EHGA 4MVJM 1MO4A 3UV3A 1LQTA 2EKQA 1K5PA 2WZR1 4DRRA 4LKDA 1GT91 3ZPOA 4XIKA 1HG1A 3ZYCA 1OTYA