3IB3A

Crystal structure of sacol2612 - coce/nond family hydrolase from staphylococcus aureus
Total Genus 192
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
192
sequence length
556
structure length
551
Chain Sequence
HLLGNPKLTVTHVNEVKAGINHIVVDSVQYGNQEMIMEKDGTVEMRDGEKLYINIFRPNKDGKFPVVMSADTYGKDNKMGALWPTLGTIPTSSFTPEESPDPGFWVPNDYVVVKVALRGSDKSKGVLSPWSKREAEDYYEVIEWAANQSWSNGNIGTNGVSYLAVTQWWVASLNPPHLKAMIPWEGLNDMYREVAFHGGIPDTGFYRFWTQGIFARWTDNPNIEDLIQAQQEHPLFDDFWKQRQVPLSQIKTPLLTCASWSTQGLHNRGSFEGFKQAASEEKWLYVHGRKEWESYYARENLERQKSFFDFYLKEENNDWKDTPHVIYEVRDQFYKGEFKSASAFPLPNAEYTPLYLNAENHTLNHAKISSAHVAQYDSEDKQQDVSFKYTFDKDTELVGNMNLKLWVSTKDSDDMDLFAGIKKLDRRGNEVNFPDFNHIENGQVATGWLRVSHRELDQEKSSIAQPWHKHETELKLSQDEIVPVEIELLPSGTLFKQGETLEVVVKGSEIVIGNSTPGMKTRYEHEETVNKGMHMIYTGGKYDSQLIIPIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords CocE/NonD family hydrolase
publication title Crystal Structure of SACOL2612 - CocE/NonD family hydrolase from Staphylococcus aureus
rcsb
source organism Staphylococcus aureus
total genus 192
structure length 551
sequence length 556
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02129 Peptidase_S15 X-Pro dipeptidyl-peptidase (S15 family)
A PF08530 PepX_C X-Pro dipeptidyl-peptidase C-terminal non-catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3020.20 Mainly Alpha Orthogonal Bundle alpha-amino acid ester hydrolase ( Helical cap domain) alpha-amino acid ester hydrolase ( Helical cap domain) 3ib3A02
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 3ib3A03
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ib3A01
4K2AA 1ULPA 3DD5A 1R4ZA 3LIIA 3WLAA 4I3FA 2W95A 5JR2A 1K5PA 2B4KA 3DS8A 1CUCA 3M3DA 3ZWQA 3W2TA 2VQUA 4C01A 4H7HA 5K3AA 2BKLA 1CZTA 1VZ2A 5AI4A 4N8DA 5AM2A 2W1QA 1MNQA 5EHZA 3GBSA 2J1TA 3C7HA 3DQZA 2XONA 2V97A 2XMRA 3GDBA 3AJAA 4LXGA 5IVKA 4BDTA 1E89A 3NOXA 4ZZ5A 1UK6A 1AZWA 2QQNA 4UI9L 4RE6A 3AIOA 2PBLA 2WUHA 2EDCA 4BZZA 2H7XA 2HRQA 3ICVA 1ZI6A 5AM5A 3B12A 4ARAA 4OMDA 2PSJA 3O0DA 5C8XA 2VZ1A 4CIAA 3IIIA 3H0CA 3QPDA 2VC9A 1UZ0A 3HYSA 5EHQA 5D6OA 1UK7A 1RYYA 2VZPA 1JZ3A 3ECQA 3CMGA 3HJRA 1TKRA 2VZRA 4F5ZA 3NNGA 5HFNA 3B3QA 4BP8A 2PSEA 3STTA 1JU3A 3GGLA 3D3NA 1W76A 1L7RA 5G04L 3FAKA 2HIHA 3WK6A 2VQ6A 3V1MA 1RP1A 2Z8XA 4AZ3A 4P5YA 1WM1A 4BP9A 2BUAA 2O2HA 4PO3X 5AKKA 3H17A 4J0KA 4DEQA 3R3XA 3WL8A 4DXRA 3OBAA 1HPLA 5AHXA 3THCA 2ONCA 2XMZA 4PSDA 3IDAA 1P0IA 4A42A 5LP1A 3C5VA 4WJLA 5CZKA 2HLEA 5ALZA 1CEXA 3I2JA 2Q0XA 1XKTA 3WF0A 1W75A 2XI4A 2XOMA 2XMCA 2XMQA 1UWWA 4H7DA 3O4JA 1X2BA 4GI1A 3H2KA 4N8SA 2HL6A 5CXUA 3ANSA 2Y6VA 5K3EA 3VD9A 1XZHA 2DDUA 5DN2A 4OUKX 2VAVA 4B9AA 4BRSA 4XX1A 2DSNA 4LKOA 2OAGA 2WZ8A 4CG1A 2BJHA 4NZZA 4MQLA 4B9EA 4Q3OA 3FYUB 2XUFA 4Y2TA 4AAXA 5ALYA 5BV7A 2V96A 1JMKC 1HLGA 2VMDA 4KRYA 5JAOA 5I7UA 2Z8ZA 1P8JA 2CB9A 2RHWA 1YR2A 1XZKA 5ALKA 3EB7A 3EIOA 4H35A 2Z3WA 1QIDA 3FCYA 4Y2RA 1SCQA 5CT9A 5HPOA 4HZGA 1UKAA 4C87A 2YG0A 3E1GA 2DCJA 4DUXA 1LPOA 5IJRA 2H9YA 3FOBA 3IULA 2X5XA 1ZGCA 3K2IA 5JAHA 3WZMA 3LPGA 3LQCA 4HG6B 4EB0A 1H6XA 2ZJ6A 3QH4A 4AMYA 1TRHA 4FFVA 1G5FA 1DT3A 3BJMA 4QPWA 5AIAA 2C4HA 1JZ8A 4BAUA 4P00B 5C7GA 4I4CA 3G0BA 4ZV7A 2OGZA 3F97A 3KOOA 1EUUA 1LPMA 4Q05A 3ETPA 1RWQA 2VJDA 3QM1A 2W3JA 2LIPA 1LBTA 2O2GA 4QDTA 4BTLA 5AKLA 5HKBA 4MEAA 5K3FA 3AZOA 3U1TA 3DOHA 3Q8WA 1DLCA 5JALA 4A3ZA 4QWWA 1C4XA 3T2QA 2WAAA 3T2OA 4Q3LA 3G0DA 3MGAA 3U37A 1JJBA 4AXBA 3MBWA 1N5MA 4G4IA 1GQPA 5KBYA 1Y37A 3H2JA 3IVMA 1VXOA 3KDAA 3R0VA 3G0GA 2FUKA 3NJXA 3WA7A 1BRTA 1ZI9A 3GXUA 4QWMA 3CQOA 1XQVA 2XQJA 5D3ZA 1DWQA 3FVRA 3T2PA 4X7BA 5ALLA 4KMQA 1QFMA 1DYOA 2PSFA 4KAJA 5A7GA 1P0QA 4YPJA 4A6OA 2FX5A 3WF2A 5CURA 1WB6A 4BCDA 3L1JA 4FNGA 2EIBA 2PPLA 4ZREA 3DJYA 2IX9A 3WNKA 3G9ZA 2W46A 2ZYRA 4BAGA 5D7BA 1DWOA 2VATA 3VJMA 4WFIA 5AK6A 1EXWA 1W6RA 3V1LA 1BHGA 1ZJ5A 3I3DA 3WNLA 1ZIXA 4XVCA 3J7HA 1UMHA 1GPNA 3WNMA 5E4TA 4IH1A 2XHNA 4Z49A 1P0MA 2AXEA 3E0XA 4RN5A 2PM8A 3PDCA 2XB6A 2J4CA 2QJRA 3UUFA 3CIHA 3PF8A 5I9IA 4BK5A 5CT4A 3JYHA 2OG1A 3A70A 4X97A 1K12A 2B9VA 3K9BA 3HNYM 3I2IA 4EY4A 1KEZA 3PUHA 5C70A 5JZ9A 5ALEA 3HEAA 5LA1A 1TCAA 4EY5A 1UXXX 3WNNA 4E15A 2RIPA 1JZ6A 5E2IA 4E11A 4UAPA 4GEGA 2WIGA 5AH0A 3M83A 4HVTA 4OD0A 5JZBA 3WJ1A 1BN7A 2GYVA 5CT6A 5LZ4A 2WLSA 1UY1A 4QEKA 1XZDA 1MU0A 5HXMA 2RHTA 1UYXA 1TIBA 5CBKA 2WJ4A 4X6XA 1FFDA 1WB4A 4CCWA 4TPKA 3W9UA 2VSQA 5K3FB 4B85A 4Q3KA 2GBIA 2HM7A 3GELA 2Y6JA 4DNPA 1WCYA 1JKMA 4QNNA 2LW8A 4W1PA 1K3IA 1ODSA 1ZI8A 3HN3A 3CN9A 2XQFA 5DMYA 3H18A 4G4GA 3BWXA 3HXKA 4RYDA 4EY7A 2VZUA 2ZEXA 1FFAA 5CRIA 5EFZA 5HF9A 2YC4A 1YS2X 3U0VA 4KE6A 4W9RA 1QIEA 4UHFA 1LPBB 5LZ2A 2OXEA 2ZSIA 3DYPA 2QM0A 4DUWA 5EI5A 1QJ4A 2J7MA 5CT5A 1K63A 2QKYA 3MO4A 3MV01 4X85A 2W94A 2VMFA 4X93A 5BWBA 5ALQA 2ECFA 1ACJA 3THDA 3V9AA 3W05A 4H18A 3SEPA 2UZ0A 5DNUA 3WKBA 2QRUA 5ALOA 4B0OA 1HL7A 1VLQA 4OU4A 2WJ3A 2OLEA 2JGKA 3EYPA 2YFUA 3BGAA 2J1UA 4JKLA 4U2GA 1JU4A 4PF1A 3G9UA 4KYVA 2B61A 3UESA 5BOVA 2Y6UA 4FNMA 4UBIA 2BBAA 1CLEA 2XUOA 3W04A 3IAPA 1S8OA 1GOGA 4X94A 4UHHA 5EGNA 4Y2VA 2CZQA 1DINA 5AKYA 1VE7A 2VMEA 1UFOA 1BN6A 1EINA 4V2IA 5A6VA 2ZYSA 5AKIA 3ICWA 2ZYIA 2WILA 4MQMA 5FOQA 5H3HA 5BWCA 1EK2A 2PVSA 3DYMA 4OB7A 3JWEA 3ESDA 5EJ1B 3WF1A 2XMBA 3GA7A 2HA4A 3OC0A 3C70A 1J83A 4KJXA 2VZSA 2HA5A 2XUIA 5IYYA 4Y7DA 2ACKA 3AC0A 2EDAA 2V72A 5HCUA 5LKRA 1K6EA 4J3JA 5IH7A 3MUY1 1CUBA 2ES4A 3A7QA 4ET7A 3DL4A 4XUOA 1UY2A 4A44A 4DMKA 1CQWA 4JKKA 1WHTA 3C8HA 1U65A 1A88A 1DX6A 3CDZB 1G42A 2OPHA 2HU8A 2YB7A 4OZOA 3HJUA 1W0NA 1CUZA 2DCKA 3FLAA 3QMWA 4AB1A 4PQEA 5JAUA 2QQJA 2ZEWA 2ZEYA 4DXSA 1K45A 2QBXA 5AI0A 3AFIA 3OTQA 2PX6A 4KAFA 3D0KA 3IBTA 1NU8A 3WEZA 1ZD4A 5DTJA 5CH8A 2QXTA 1E8DA 4J0GA 3VVLA 4CCYA 4M0EA 4BDSA 5JD5A 3ACFA 1EA5A 3OB8A 3CZUA 3KWFA 3H2GA 2DHDA 2V98A 4H7JA 1EVEA 1CUEA 1VA4A 1XRMA 4U2DA 2JGEA 5AKJA 3EQ9A 3IUNA 4CG2A 5HFAA 4ZXFA 5HF8A 2BGOA 5K5EA 3D2AA 3FSGD 1LGYA 2XQXA 1QIJA 3BF7A 2X76A 3I6MA 1NAEA 2V9ZA 1G4HA 1MX9A 4ROTA 5LIPA 1F6WA 1DX4A 3IUMA 3VDAA 3W5MA 2P8SA 2ZJFA 5CXXA 3DEAA 3DDUA 5J3JA 1YAJA 5DTIA 5K3BA 3FYTA 2ZXQA 5A7HA 1YAHA 4AQDA 2WSLA 5CH3A 2HA6A 4A5SA 1A8QA 4UHEA 5DNVA 2OCLA 5A1AA 3I2GA 1VZ3A 1JZ2A 4BB0A 4DUVA 1XZFA 2VF2A 4UBJA 4WFKA 4YK7A 1W8OA 5CYYA 1CUFA 1YQ2A 1W9TA 1MJ5A 2R7EB 5LYYA 3LP5A 2HU7A 3OOSA 4X71A 5G05L 4QDXA 1Q84A 4MXDA 4P9NA 4Q82A 5AOBA 3UUEA 1ODTC 3PUIA 4FMPA 5EIEA 2HFKA 2WAOA 2QUBA 2J3DA 2O7RA 3NJVA 3FWHA 3VD4A 5FP0A 4C4XA 4FTWA 2E33A 4DLNA 5JXHA 3ED1A 3PICA 1CR6A 1XRNA 2QQKA 4G4JA 4HXGA 5JYCA 1CUYA 2BERA 2XQKA 3I6ZA 4UPDA 4CFSA 3WL5A 2GYUA 4IH9A 1DTEA 4DMCA 5LZ9A 5C81A 3H1AA 3QMVA 1SOMA 4DEVA 1E66A 1BS9A 4J7AA 1IZ8A 3SKJE 3FNBA 2VJAA 3UNPA 4UBNA 3OEBA 5EIYB 1JJIA 4EBBA 1XZJA 4AO8A 5A2GA 2EIDA 3MUNA 2GBGA 1W4LA 4YPVA 5FPQA 2VZ3A 2Z3ZA 1YA4A 1KU0A 4FLMA 2WTMA 3C5WP 2QT9A 3C6YA 3AINA 2J1AA 1BEZA 4B82A 4BDVB 1JYNA 4CCYB 4QZVA 4TTGA 4MEBA 1W9WA 1XRQA 1BCSA 1DP0A 2Y8KA 5D3KA 3F9CA 1WCQA 3T0DA 2HHAA 4EHBA 2VL4A 4H7KA 3MUOA 3R3YA 4LHEA 5DQ0A 1C7IA 3ZLUA 2OQVA 3WA6A 4H7IA 2X09A 5ALRA 3OURA 1XPWA 1JMYA 3VD7A 1CIYA 3N0TA 4K5QA 2XUJA 2Y1KA 3ZV7A 2EEPA 3SX4A 3HACA 3AILA 4BBZA 4M0MA 4XUTA 2HA0A 3X3HA 3VKFA 2WQ8A 3DKKA 3WK9A 2FJPA 2W22A 3OPMA 1X2EA 1ZD3A 1EDDA 1MO2A 5FKJA 1E5TA 3QPCA 5IKXA 4WDQA 3G0IA 5FXMA 3STVA 4OCZA 5FLKA 2J1VA 1CFJA 4B83A 4LQRA 1EDEA 3I2FA 2ROQA 3M82A 3C7FA 1PMJX 3E3AA 4A4AA 5IVDA 1YA8A 2C26A 4OPMA 2H7CA 5LA0A 3KSRA 1P0PA 4J0CA 1TG7A 3CKHA 3BXPA 1R9NA 5CT8A 4G8DA 1VA5A 1IUPA 3WQHA 3C7GA 1N1MA 4JX0A 5AKEA 3QITA 1EH5A 2HA3A 1GPKA 2RONA 3ACIA 1HKHA 3OGRA 1H22A 1R88A 2WUGA 4AO7A 2VJCA 1OF4A 1W8NA 2WO2A 4X92A 5T4FA 3SKVA 2BFNA 4N5IX 3OG9A 4QDQA 3LCRA 4Y2XA 1BU8A 3AIMA 3F2ZA 3JW8A 3DECA 1QONA 1UX7A 3F8SA 3F96A 1PV1A 4EY8A 4MGQA 1UK9A 4Y9SA 2JEZA 4C89A 3TGLA 4X90A 2W87A 4XWGA 1CIJA 3G9TA 5AKZA 4QDRA 3PE6A 3HNMA 4JKMA 3DLTA 4WY8A 1LNSA 3DCNA 2E31A 2GZSA 2I3ZA 2C0PA 2HDWA 5AK5A 3DL7A 4D0QA 2WKWA 2LS6A 1XNTA 1XLWA 3O4GA 2B20A 3AIKA 4UHBA 3WZLA 4OYYA 6YASA 3WK5A 4BC1A 4W1QA 2PUJA 3HABA 5AM1A 3ZLVA 1E8MA 4A41A 4YASA 4DXTA 1IUNA 1PFQA 4Y2YA 2WUDA 5A7FA 1AC5A 2RAUA 2J4FA 3F98A 4AN1A 4OYUA 1LPSA 1R50A 3EBLA 1SG3A 1EX9A 5AI6A 2DCMA 5IFPA 4J0DA 4MADA 4E14A 4QB1A 4W1RA 3MUZ1 3K6KA 5FUIA 5HK8A 3A21A 3H19A 1VJ5A 2XQIA 1O8SA 2QUAA 4FHZA 3RM3A 1SDDB 4ZXEA 3TJMA 2EICA 2YH2A 1QE3A 2GZRA 5DYWA 3DYOA 1JYXA 1IVYA 1YCDA 2IITA 3OEAA 3FHAA 5B4NA 1L7AA 3QBJA 1TAHA 1HBJA 2JDAA 1CUAA 1H6YA 3OGSA 5B4XA 2WTNA 3IUQA 1CUWA 1R1DA 3HRHA 4RNCA 4QLAA 1R9MA 3K4AA 3C6ZA 5AM4A 4BJ0A 3I2KA 2XUHA 3ZLTA 5JUVA 3WK8A 2CEKA 2W5FA 4HS9A 1YB6A 2WFLA 3R3WA 3UETA 4H7EA 4FLEA 3LEGA 5A71A 3JXSA 1CUUA 5T4BA 1A8UA 1GT6A 1XNAA 1UK8A 4DNOA 4C4YA 1OT5A 4DM7A 3FYUC 2AJ8A 1ETHA 4O08A 4XUNA 3OGVA 1QOZA 2VO5A 1XKLA 1DQZA 1QZ3A 3VD3A 1GOFA 5AI5A 2G4LA 4CU9A 4Y2SA 3QYJA 5JMOA 2WN3A 1O6FA 2BGNA 2G5PA 3CZJA 1XZEA 1GXSA 3SK0A 2HU5A 2VZVA 4P08A 3IAQA 1XROA 1YB7A 1PMHX 1CUVA 5ALHA 4OMCA 4E8CA 5YASA 2Y2VA 1CRLA 3FBWA 1UZAA 2V5DA 3L1IA 1EI9A 2VTFA 2JGLA 5CMLA 1UT6A 2CKMA 4JNCA 4H77A 2Y6HA 3GFFA 5HF5A 2HA7A 2OGSA 4DNQA 1UOOA 2OAEA 3T52A 1SCIA 1J07A 4H0CA 4UHDA 2Y64A 4L0CA 4WCVA 2CDOA 5ALMA 2QZPA 2Y2UA 3C6BA 4PNZA 1JFRA 3WNOA 1LZLA 1T4MA 3WKEA 1J84A 1ODCA 2RJ2A 1FJ2A 1Q0ZA 2DR0A 2QJWA 2VJBA 2FJ0A 5C8ZA 1JYWA 3BF8A 2J22A 3I28A 4HRXA 5ALUA 5KWIA 3WKAA 5KWJA 5AOAA 3BJRA 2D5LA 4GXNA 1F4HA 4B0PA 3G7NA 4QX1A 1K8QA 1N8SA 2GBFA 1GKKA 3T08A 2JD9A 2J1RA 1XZAA 1ZJ4A 3IB3A 5ALGA 1BE0A 4UBMA 1A8SA 3WF4A 1MPXA 2JGIA 1UXZA 5JXGA 4M0FA 3WWEA 4I19A 1XLVA 5ALFA 2PL5A 1QO7A 1QIMA 3G8YA 4TVKA 1NU6A 2HADA 3NWOA 3HPNA 4RPCA 2V4VA 1K4YA 2YASA 5DNWA 5EIHA 5HZGA 3O9MA 5ALDA 3WYDA 3QVMA 3D2BA 3RKSA 4EUSA 4DSAA 3WYNA 3WL6A 1NUKA 2QQIA 2WABA 3G0CA 3R3VA 3T0BA 1NX9A 3WI7A 3WSOA 2WFLB 2Z4FA 2AJBA 2WG0A 4ETWA 1MAHA 4FKBA 3DYVA 3FSGA 4Z2AA 5HQ3A 4CG3A 1CUSA 4XZUG 1CUGA 1EDBA 3WJ2A 2C7BA 2VZOA 1OH4A 4KEAA 3T0AA 1F0PA 1IZ7A 4X95A 4L9AA 2Y6LA 3ABZA 3P2MA 3D4LA 1Q83A 3WK4A 3I1YA 2YYSA 3C6XA 1F8UA 2WU3A 1CVLA 1THTA 4L3WA 4B80A 2WG1A 2XUPA 1B6GA 2QQLA 4J0JA 1CZVA 1OCEA 2HYXA 3LS2A 1SHWB 3P1IA 1JZ5A 1QGED 4K6KA 3NGMA 2WIJA 4GBGA 4JEIA 4OYLA 4PW0A 3IUJA 1XQXA 3H2HA 5T4EA 3UMJA 4GWJA 1D7PM 2E3JA 5SYMA 3W5NA 2R11A 1MNAA 3FN9A 4G8BA 4QAWA 2XUDA 1UY3A 1CX1A 1WPXA 4F60A 5LA2A 1XC6A 2XLBA 3NQHA 2OKXA 5FDFA 1EHYA 4CI9A 3VJKA 5I8PA 2QTBA 4M4RA 2ORYA 2PU7A 4FFWA 3VDXA 1ULOA 4LHSA 2WIKA 4U2FA 3GM8A 2VZQA 4N8EA 4G8CA 2WUEA 1JI6A 4Y2PA 2WBKA 1UWCA 3I3BA 3L1HA 2VOTA 3AZPA 2VT6A 4S0XA 4IH4A 4HAIA 4QX2A 1LPAB 1IUOA 2VJXA 3MV11 4XUQA 2JBWA 1UYZA 4DGQA 1UYYA 4ZV9A 1EB8A 4RGYA 5DLPA 4ARXA 3HI4A 4Y2UA 5EHXA 3A2LA 4ZWNA 1F4AA 4P02B 4JYPA 4XJVA 5C7YA 5JIBA 3V48A 1OD3A 1GNYA 4QDOA 2IIVA 4D8MA 2WYSA 4CUAA 4QLOA 4CIBA 4Q34A 4L0PA 4BE9A 3F67A 3O4HA 2W91A 5F4ZA 3M81A 5DWDA 4C88A 5SYNA 4G1FA 4OB8A 2J3QA 2CBGA 3QZUA 1ZOIA 5LLSA 2JF0A 1W1IA 4AX4A 2ACEA 3CCBA 4KE8A 1L7QA 4U2EA 4UFPA 5HQ3B 2I78A 1ORWA 3BIXA 4P92A 3STWA 1GOHA 1UKBA 2JGJA 4DNFA 2BZDA 1C7JA 3WQBA 1MT3A 4FOLA 4C4ZA 1YS1X 2VT7A 4DMHA 2EIEA 3V1KA 2PUHA 3WMRA 2PSDA 1K42A 3D59A 2WQZA 5EIAA 4LKSA 2JEYA 1OF3A 3HSSA 4IO0A 3K77A 4PT6A 1THGA 5C8VA 1H2YA 3V1NA 3AZQA 3FLEA 3FYUA 4JYMA 1JYVA 4BAZA 3ZM8A 4KACA 2CMFA 4QX0A 2BAGA 5ALWA 4W50A 1GQRA 4QB2A 3PFBA 5AO9A 3W06A 1XZBA 5JATA 3W9BA 5AJHA 2VM9A 4N5HX 4ZRDA 1PJAA 4LIPD 1DU4A 2QQMA 1GUIA 4IQ4A 3SEEA 4QDZA 1J06A 5ALPA 2O2IA 3OG2A 2BGRA 5DJ5A 3WNPA 1B41A 4U2BA 3WKDA 1H23A 5JANA 4KWUA 4LYEA 2ZVDA 2XE4A 1BROA 2JGFA 1VXRA 1WKYA 3I3EA 1CUJA 2OCKA 1MN6A 1GPLA 1IQDC 4KE9A 1O8PA 3R41A 5JXIA 1HDEA 5AI9A 4BZWA 3K4DA 1SFRA 4DSZA 3DNMA 4QA9A 3STUA 1O6GA 4QE3A 1UOQA 1XZIA 3QPAA 5I0DA 2RI6A 5AKXA 2XUKA 3K46A 4D9JA 2XDWA 4PQQA 2BCEA 1JT2A 4KR0A 3NRUA 4QB6A 1AQLA 3O4IA 2BUCA 1QIGA 1SC9A 3FL7A 5C71A 5JXJA 3WWDA 2RV9A 4B6GA 3FLBA 2GBCA 2O7VA 1OXMA 2WHPA 5LZ7A 5J1XA 1KU6A 4L72A 1EK1A 1NKGA 1BEEA 2ZSHA 1MX5A 2XUQA 1CQZA 2ORXA 2WU4A 2XUGA 3AUKA 3BDIA 3HNBM 3WWOA 4CU6A 1XZGA 4NMWA 7YASA 5CTAA 5AKGA 2G5TA 4KAAA 4MOAA 4OB6A 3GUUA 3LIPA 1XQYA 2PU5A 2AJDA 4MYSA 2HA2A 3N2ZB 4HRYA 4NS4A 3O95A 4JHZA 1YSCA 1F0NA 4GZ9A 4BE4A 3G02A 4MGSA 5AIBA 4ARBA 2C4XA 4ITVA 4INZA 5JARA 2WJ6A 5JAPA 2D0DA 2RVAA 2XT0A 1HQDA 2DHEA 3FVTA 4B81A 3A22A 5JZSA 5T4HA 5AM0A 2QXUA 2WG2A 3RLIA 4X00A 3SWWA 1Y7IA 1EB9A 1U2EA 3VVMA 3LPFA 4BYMA 3CXUA 4IUGA 3B5EA 5AKHA 4BCBA 3C8DA 1TVGA 5IVIA 1AX9A 2QVBA 1E8NA 4GLBA 1SCKA 2WO3A 4A16A 1AGYA 1J1IA 2DHCA 1N5RA 2YC2A 2XMSA 1GZ7A 4DYHA 3I1IA 5AICA 5DYYA 4GHWA 4NVRA 4UFOA 1E3QA 4FBMA 4JUIA 2ZJ7A 2Y6GA 1CUXA 3BN6A 4BVKA 2C58A 2AJCA 1CUDA 1UY0A 4MO3M 1USWA 3C45A 1QTRA 3O9VA 3S2ZA 4X6YA 1W52X 3LEKA 1JHJA 1QTIA 2RGUA 4K6GA 1JZ4A 3NUZA 4PV7A 3R3ZA 1WB5A 2ZYHA 1AKNA 1UXOA 3I6YA 5E4YA 2QS9A 5AK4A 5IFTA 1Z68A 2X10A 4HXEB 1TCCA 4DIUA 4BXSV 4TGLA 1LPNA 3STXA 2WHPB 4B7ZA 4CVUA 1CZSA 1VKHA 1UY4A 3HEIA 1LLFA 2VAXA 2WM2A 2WO1A 2W1UA 1QIFA 2E32A 1TQHA 4A45A 4XUPA 2H1IA 5A62A 4FDMA 5LKAA 1KEXA 3C8XA 2X05A 4YX9A 1CUIA 1GQSA 3RARA 3I97A 4J0IA 3R3UA 2YXPX 4XIIA 3D2CA 1MX1A 5ESRA 2QQOA 2Z5GA 3A6ZA 1GU3A 4EZIA 5FPPA 4AN0A 4X6UA 4J03A 4OSEA 4AMZA 3BE8A 4UFNA 3PI6A 2JGMA 3MVEA 3WWCA 5JD4A 5LCWL 4GDMA 5AI8A 4UUQA 2DFPA 2HFJA 4GWLA 4ZY9A 1AURA 2DQZA 3HZOA 5HKAA 2BGPA 4BATA 5ALSA 2E26A 2W9XA 3H2IA 4BRZA 2OCGA 1HN1A 5K3DA 2CUTA 1XZMA 4Y2JA 1M33A 1R3DA 4P93A 3LEIA 3VD5A 2VCAA 5HF6A 3I2HA 4FWBA 1LPPA 1T2XA 2PKYX 2VA9A 2CDPA 1XLUA 1Y7HA 3DOIA 2PQSA 3IA2A 2W47A 2QR5A 2J1SA 4MWSA 3K4ZA 2KD7A 3RK4A 5IVHA 3HLKA 5DYTA 2OQIA 3LLCA 3ESAA 5K3CA 5ALVA 1QO9A 3C7EA 4ZI5A 3GZJA 2L9LA 5E4JA 4FI9A 3WL7A 3E1F1 4UOJA 3OM8A 4F0JA 2DQYA 5AM3A 4Q1VA 4UHCA 2YFZA 3D5EA 2BUBA 4ZGBA 4B84A 1CPYA 1QLWA 5KREA 5FUMA 4FBLA 3HOBA 1XZLA 2K2QB 3EQ8A 4LXIA 4MWTA 2VR4A 2WHQA 3ACHA 1DT5A 1UOPA 1T2NA 5IHRA 5ALXA 4A23A 1ZICA 2W1WA 4DTCA 1EUTA 1ZGBA 3D3AA 3A23A 4G5XA 2C5FA 1DWPA 2VEOA 4LXHA 5ALIA 1LBSA 3BDVA 4AZ0A 5JASA 5AK3A 1EVQA 4KI5M 1H2XA 3C7OA 1LZKA 5HK9A 1AMNA 3WK7A 4C6HA 3ESBA 4WDRA 4H7FA 4W4ZA 1MTZA 4XVHA 1MAAA 2XUAA 1R64A 1W99A 2QMQA 1GKLA 4WFJA 1JI3A 3EF3A 1ISPA 3VJLA 4BCCA 1AUOA 3LE0A 3WF3A 5ALJA 1FSSA 1X70A 4MYDA 1PX3A 2J1EA 3K75B 3SC2A 3EQ7A 2WIFA 2WDBA 1J2EA 4ZZ8A 1CV2A 4CUCA 4KE7A 1VOTA 1XFDA 4E46A 2WFZA 3HC7A 2C0QA 1XQWA 3DKRA 4BC0A 3VXKA 3GROA 3FCXA 4OU5A 2HRRA 2WHRA 3KWJA 1CUHA 5AOCA 2XLCA 3ACGA 2OGTA 3T4UA 4WY5A 4E8DA 2ORZA 3STYA 4EA6A 4HXFB 4EY6A 2JKXA 4QDSA 4QDUA 2R8BA 3ZPXA 4J0HA 2G63A 5DPNA 1ZD2P 2VCCA 1QIIA 3BIWA 2QOEA 2Y6KA 3ZI7A 3S8YA 4JH0A 4F21A 5JD6A 2W6CX 3WIBA 1QIHA 4LYDA 3YASA 4W1SA 3IURA 2ID4A 3FHQA 5CH5A 2NW6A 5EHNA 2AJLI 2W92A 1DQYA 2WZEA 3DYIA 1IMJA 3QMMA 4BVLA 4FLFA 3WKCA 1KGYA 1XRRA 1XZCA 1XRPA 4PSCA 2XMDA 2VCBA 5AP9A 4X3CA 2I03A 2GYWA 2ZEZA 1WHSA 2WFMA 3D7RA 3A2MA 1JZ7A 4QX3A 2X8BA 1ACLA 1FFCA 1H2ZA 1OILA 1VE6A 5F7UA 3ESCA 4GECA 3VDCA 3ANTA 4CU8A 1XRLA 3PFCA 1U8EA 4GWIA 5JADA 2I3DA 3E4DA 1QIKA 3G9XA 1Q0RA 4AO6A 1TK3A 4W63A 3BL8A 1WPRA 2OCIA 3VDBA 2VQTA 4X91A 5LZ8A 1GMMA 3A2NA 4UBLA 2CJPA 4OUEA 1W9SA 4TXWA 3CCCA 5FRDA 3H04A 4RE5A 5ISMA 4CUBA 1UMIA 1FFEA 3TRDA 1U4NA 2C9KA 2WIDA 3H1BA 1JJFA 3P6BA 2WN2A 3ILSA 3C43A 2VMCA 2JE8A 4BTVA 4DMFA 1A7UA 4UBOA 1ZIYA 1O59A 4PSUA 4G9EA 4XURA 3VISA 1ORVA 4KRXA 5EJZB 2WUFA 1US2A 1BCRA 2XMGA 4LPLA 2C5GA 1TCBA 1I6WA 3KXPA 1D07A 4ARYA 2H7YA 2W1SA 4W8JA 1UKCA 2VTVA 4U2CA 4AG4A 3C87A 2VZTA 1WOMA 5FV4A 5ALNA 3Q0TA 4G9GA 1H2WA 1YASA 1G66A 3PF9A 3TEJA 4M4PA 1GGVA 1QFSA 3R40A 4Y2QA 5ALTA 2PSHA 1US3A 4MJ3A 3KD2A 4IHAA 2JIDA 4BVJA 4GW3A 4CU7A 3CN7A 4HTAA 1FFBA 4K6HA 2XQGA 1I5PA 3WWPA 3T09A 3WIOA 1PX4A 5CW2A 4UBKA 5LZ5A 4BK4A 1ZD5A
chains in the Genus database with same CATH superfamily
3DTTA 3I05A 5LB2A 4OP3A 3CO5A 4OJYA 2F64A 1E96A 4L2IB 1YI8A 5IANA 4OAQA 1JXAA 2R84A 3J8F2 2NUAB 2WA1A 3OX2A 1X39A 3BWYA 3Q3GE 1KTVA 4AW9A 3NOXA 1XOIA 5IJ0B 3SJAA 4WGGA 4NRMA 1HDYA 4P7FA 1EP1B 3PQCA 5C8XA 1TYCA 3WG9A 5D6OA 3UGTA 1NW8A 5IKOA 2HPHA 4L6IA 2EGUA 4ZAFA 2I9PA 1GWNA 3AEXA 1L7RA 4KMMA 4XJZA 2B7BA 1NJ6A 3TD6A 4AZ3A 2O2CA 3NHSA 3E22B 1MR3F 3GBWA 5CX4A 3BBLA 3IZOA 5DBIA 1KVUA 4P4TA 3RNSA 1IBRA 2L0XA 3DDSA 2O2JA 4O3FA 4ZARA 4I4TA 4N40A 5HA5A 5FOJB 2XOMA 3FHCB 3IGFA 1WW4A 2Y6VA 1HV1A 1K0FA 3W5HA 2X8JB 3LCPA 4DJFC 3G17A 4I4TF 4XX1A 2DSNA 2PQ0A 3HU1A 1PWZA 5KYTA 3R9KA 1AKTA 2XB9A 1RI4A 1CAWB 5J2TB 1T24A 2XR1A 1VKRA 5ALYA 4WLUA 5BV7A 1RM4A 4EB6A 1KR2A 1JMKC 3UV9A 2VMDA 3MF6A 1QFZA 2L42A 5IDQA 4UOZA 5FZFA 3Q8BA 1XALA 5HPOA 2ZJYA 3L9XA 4AMGA 4F1JA 2B36A 5GZFA 1CLUA 2Z1NA 1BDBA 5F6LB 4Q5IA 3QH4A 1UIRA 3HBKA 2RC5A 4DS0A 1IQUA 4UU7A 3HCEA 4DQKA 4WKBA 1OASA 4BQSA 2HMUA 1MUUA 4ZV7A 4HNUA 3DOOA 4FHFA 2O8FB 3ITNA 4QDTA 4CEYA 4MEAA 2R97A 3BZBA 1E2GA 2OQRA 1OXKB 2AQHA 3BMCB 3RSZA 1NUHA 3R4SA 1RPAA 4XCAA 3MD0A 1VBD3 2VDPB 3T2OA 1Z7GA 4FDTA 1JJBA 2WM9B 5AWFC 1B15A 3G0GA 3NO4A 4EF4A 5B4UA 1UPUA 3FSRA 4N49A 1YCFA 2WFAA 3ZHBA 2J0UA 2ZRJA 4N0QA 2O0HA 1WV1A 4ND3A 2CJFA 3OYWA 4KAJA 4YPJA 3HDQA 1Z9BA 2G6TA 2HK8A 1A2OA 1XDUA 3AUJB 3Q12A 2ZTUA 1ZJ5A 1YQ9A 4LGVA 3EPHA 4PG4A 1U7WA 4DB5A 3AOGA 4KYUA 1NI3A 3RZMA 1GPNA 2JLQA 4M9ZA 4ZDJA 3V56A 1H8EA 1VBA1 3ID6C 3NYIA 2XHNA 1LGCA 3JQAA 4NATA 5I7SA 5LDDC 3FWZA 3PD7A 3GDHA 3V0AB 3FZYA 2XE6A 4HGYA 4XYLA 1ONOA 4G36A 1HJGA 4AVYA 4N5LA 1VDMA 3DZDA 4WVWA 1JXMA 3PUHA 1XVUA 3KXIA 1KI2A 4X8NA 1E5XA 2C1FA 3WYAA 4N43C 1O96B 1EJ6A 1ZLYA 1SXIA 2I2AA 3KPUA 2K9ZA 3FLPA 3LQ1A 4O2LA 1HE4A 1ULBA 1M06G 1BOOA 1R1A3 2Z43A 2RHTA 2YWFA 1Q8VA 1G2PA 2XH6A 4CNBA 5IZCC 3GNQA 1FMCA 2FQQA 2Z4SA 4XDYA 2V5AA 2Q7OE 3SSNA 1BNCA 4Z8BA 4BS9A 4G3YC 2PJZA 3W58A 4WPGA 4EY7A 2ZREA 5T5LA 5J3UA 2GCOB 2C5SA 1JALA 1SUCA 4J0FA 4C4TA 1AR71 3IUEA 1U8TA 3ODPA 3HKDB 3RU9A 3TRIA 4X93A 1YU9A 1P7PA 3I3OA 4FI3C 3EUAA 4IXWA 2OLEA 1TF2A 2YFUA 1BXGA 2YOFA 4DLYA 3GJ3A 3ZN6A 5C1OA 3JYOA 3GEHA 4CDRA 3AJYA 2R85A 4FW9A 4DB2A 1D8TA 2Y6UA 4AEJA 2XUOA 5JPIA 2QL9A 1W3VA 3IAPA 4IMIB 1V9LA 4UHHA 2MMGA 2FH5B 4G4SO 2HO4A 2IHKA 3GR6A 2CJYA 4CPBD 3IUBA 1B35A 1YGYA 3IN9A 1JJ7A 5FZ8A 2G6BA 1UC5B 3R6WA 4RHTA 5E6SB 3WDKA 3LDUA 2BFDA 2RE8A 3C70A 3SH3A 3MF9A 3GLVA 4WVMA 2Q2VA 5CA1B 1M2EA 3AHIA 1TW2A 2AREA 3THYA 2JG9C 1PNQA 1EKXA 2VO1A 4MHSA 2MSKA 2GR9A 3H3XA 4QXMA 3NNDA 2HXYA 3SZLA 3C8HA 4GOOD 4PZDA 2AZMA 3UJBA 3MJRA 4L99A 3TGWA 4GWNA 4EQ6B 3ETQA 3D0KA 3OVMA 1WW2A 4RSUA 1THZA 1NU8A 3EJKA 5DTJA 3ST7A 4K6BA 4L16A 4DY3A 1QEXA 2PX8A 1TM5E 1OC1A 2J42A 5HG0A 2X8LA 3KUUA 1Y4DE 1LJUA 4WOJA 2J5RA 1TXGA 5KTSA 1ZN8A 3DEIA 5K3SA 5K5EA 4QQFA 2ON6A 2E87A 1T0UA 2X76A 3NUQA 4J1WA 2NZWA 4AN4A 1GDHA 4FXKB 4BZXA 3R4DB 3FFZA 4RS5A 3PJDA 1V5FA 2P8SA 1QP0A 1BVRA 2EX0A 4Q4Y1 4AI1A 3B82A 1UKZA 4BMVA 2BRUA 4F97A 3WQRA 2ZBQA 1U7PA 4Q4V3 2CJWB 4AJHA 1ZUHA 2VF2A 1Y6FA 1GNHA 4Q4AB 1ZA2A 1COZA 1HZZC 4M1SA 1OFSA 1FFYA 4MRSA 3P26A 3ZK8A 4ESEA 1ZINA 1LESA 4NDAA 1N2BA 3J4UH 4ABYA 4EB3A 3NHPA 2E33A 2O2SA 2IXIA 1IDN1 4NG5A 3I4IA 3RFXA 4DADA 4WACA 4I99A 1L5HB 5MGNA 1MO6A 5HS4A 3LCMA 3NUGA 4FE4A 3TQFA 1U9IA 3I61A 4LRXA 4PQ9A 5A2GA 1W4LA 1EUDB 4CM9A 3IVAA 1BMQA 1LXCA 2ZRGA 4FLMA 3SNMA 4E0BA 4DCVA 2VXCA 2DH6A 1W9WA 4R8MA 2UDPA 4FSHA 3DTVB 3L4BC 2VJYA 3ZIWA 3A6GA 4CYDA 3E9EA 3OURA 2CNWD 3N0TA 2OFFA 5I8TA 2XUJA 1GSOA 3SX4A 3HACA 4UDOA 3RK0A 4K8OA 1RRMA 1D04A 1SZDA 2W22A 1QWSA 1H93A 4EUNA 3PVSA 4HHEA 1RUG2 4XMIA 5FXMA 3H9CA 2JKYA 2E2WA 4L8VA 2R4QA 5ED4A 1CFJA 1PT5A 4IXNA 3E3AA 4RIHA 1L4FA 3LVFO 3QENA 2JCGA 2B83A 1FTYA 1TG7A 2TS1A 4Z86A 3UHFA 3LDFA 4FB5A 1A8DA 2KHZA 1KK3A 4BX0A 4XASA 1KZHA 1R88A 1ESZA 5J4KA 2VJCA 5T4FA 2FVYA 4CN8A 2RG1A 9GPBA 2AQIA 1N32B 1P81A 1BU8A 1RMQA 3W2IA 3C24A 3F96A 2R073 2NUPB 3GGGA 3AMMA 4Q7QA 4QDRA 5I7HA 4X66B 3DLTA 4D25A 3GFQA 3UW3A 4FJ0A 5FTWA 5IVVA 1SVSA 2B20A 5J23A 2NU9B 1NUAA 1HRV2 5FZAA 2V7WA 1IOLA 5LMUB 1PQWA 4DARA 2I99A 1XT6A 2GWHA 4YLZA 1DQ6A 4OYUA 5H1YA 3REQA 3EVAA 4RW0A 3ZYZA 3D8CA 4C6RA 2RS51 2IYAA 5DU2A 1XPOA 1KI9A 3OJOA 4MADA 1YONA 4K9SA 4EMBA 3PHLA 4LFAB 1O8SA 1UZYA 1RHUA 5JG7A 1ZFNA 4IXLA 3T5TA 3A1EA 3DWEX 4Q1FA 1MAVA 1L7AA 3QBJA 3W5SA 3ISJA 2CGEA 3VH1A 2H11A 2NMOA 4XFBA 2R25B 3NX4A 4WXRA 3AGQA 5EEHA 1RGSA 2BFPA 1PS8A 2B46X 1ZZ9A 2VECA 4OLJA 2EX4A 3P2YA 5F77A 2FWIA 1CVRA 2IGTA 3WVNA 1USVA 1OOPA 3SC6A 3FDXA 3GCWA 5A71A 4J16A 3JXSA 5T4BA 1L1QA 3DC7A 2D44A 2X41A 4RTSA 1YMQA 2CL6X 1KDVA 3VD3A 5LCXA 3ZWDA 1B7GO 1KVQA 2VF8A 2J9ZB 5D5PA 4O29A 3IQIX 3JQQA 4YVWB 1SOWA 2WWXA 1EFUA 2Z6VA 5AQEA 2TRSB 1JWLA 2VDOB 2Q5JA 3X1XA 1BS2A 1T9KA 3P94A 4F9GA 4B4KA 3GFFA 1GAEO 2I1VB 3LX8A 2OUKA 1B26A 2ZRPA 4EJ6A 2GB4A 3ZVMA 3GUYA 4OV6B 3ZCPA 3WNOA 2HN9A 1SXQA 3CLUC 4LA3A 1II8A 1QU0A 1RQGA 1BQ4A 1KSJA 3MILA 5KMGB 1JYWA 5F23A 5HRCA 4FP9A 3BGVA 4COOA 5KWIA 1WD5A 1VI5A 3BJRA 3ZKUA 4QX1A 4JBNA 2QZSA 4MMZB 3U4AA 4Z4EA 1O57A 4IGFA 4YP7A 1RKUA 2BZSA 3P2JA 3RBXA 1UXZA 1H5UA 4Q1EA 4H0NA 5ALFA 1GZVA 3IOEA 1WUHS 2C92A 2GYYA 1KMNA 3S81A 4GX0A 1YDEA 5EIHA 1YO8A 4YUAA 5A3TA 4M60A 3LQYA 1QS0B 2AA3A 2B82A 4Q29A 1TA4A 3L7IA 3ZDQA 4BBPA 1MAHA 4BGVA 5J37A 3GAFA 4CZSA 3GYGA 5HQ3A 4MUIA 3LF1A 1GCGA 2Q1XA 2XVGA 1VJDA 2CL2A 4V24A 2PUFA 3OECA 3CNEA 1JDBB 4J2TA 3T0AA 5HJ7A 3ILXA 4CCNA 1GXSB 5F3CA 4B4QA 3AP5A 2X58A 1BXRB 3NT5A 4B44A 1ABEA 4NPMA 1YQQA 1HNZB 3EMDA 2PEZA 1MQTB 3M5WA 3P9SA 4OLBA 1V11A 4PW0A 3K5PA 1JEYB 4DILA 2EJVA 4Q1BA 3W5NA 3P0HA 4BFXA 1NY71 1Q0LA 1JVSA 5HUJA 4KDEA 3O3OB 4N76A 3PDHA 3UXMA 3QKRA 1KYWA 2OKXA 1U4OA 1DIBA 3R0XA 5I8PA 3OEED 3H97A 4DNXA 3DXUA 4FZRA 3ZSEA 2PRSA 1F15A 1G18A 1AKRA 1PVXA 3NHUA 3QELB 2ZT5A 3G79A 3GW8A 4PX5A 2YIJA 4CIYA 2F3RA 4Z8YA 3VDDB 4ARXA 5A70A 5IYZB 4XJVA 1E2IA 4RTOA 2RB4A 1SVUA 1AXGA 5FL7D 4XWTA 3BXFA 2FPRA 1D0IA 3ETNA 1H30A 3O4HA 4FOSA 4KG8A 4C88A 1EQAA 3MYRA 2CVHA 3HCBA 1TMKA 4ZVSA 4URAA 5A1JA 2ACEA 2R1DA 3NANA 1Z26A 1ORWA 3ASIA 3PU8A 1GCOA 1GOHA 1E7QA 3POGA 1JHMA 5T8KC 4DA8A 4FPYA 3ZFFB 3ABQB 5C8YF 3U1BA 4RTNA 3MCWA 3NBAA 1USKA 1L0BA 1Y8QA 3GDWA 3Q8MA 3O4FA 3WMRA 2PSDA 4PWYA 3GLGE 3R5FA 4LDNA 4Y3UA 1RIFA 1N1GA 2D2FA 3V8NA 2JVJA 4DABA 1JYVA 3CVWA 1XU7A 3OEHD 1NZDA 2VPPA 5TQJA 3V0BA 3U5TA 2QQMA 3N07A 2GK3A 3IEIA 2JC3A 5FZOB 1TKBA 5CAEB 1URXA 5D8AB 2ZGTA 5CPBA 3ZX5A 4I1RA 3C3MA 2SKEA 4H6PA 3U1VA 3J9SA 4GQ7A 2GAAA 2ZVDA 4GVPA 2BISA 2QVLA 3NTUA 1M2HA 4D4MA 3LDHA 3K4DA 3NNMA 1C80A 3UK7A 2C42A 3RIMA 2XRYA 3NRJA 5ICGA 1PJSA 1RPTA 4NOLA 1KOJA 2WWGA 1Q5PA 2PYIA 4JAVC 2HJSA 1ZRSA 3KE8A 5IRCD 2XT9A 5EQDA 5T55A 1OI4A 4B6GA 3W4JA 3NHYA 2O20A 4NFSA 3C8ZA 3PC2A 2ZTSA 4GPEA 2B0CA 3AUKA 1G3RA 4QU2A 1ZNYA 2G1UA 2BJWA 5FK7A 4MA0A 4GXRA 4GMHA 2G5TA 3LQ4A 1U99A 1U3DA 3TINA 4CDXA 3UFXA 1P29A 4MOWA 1SPBS 4FI3F 1SH7A 3C98A 1UIJA 5F3WB 4KVFA 5CFZA 3U7IA 3CISA 4Z9AA 4ND8A 4GZ9A 4IL7A 1R082 1NI5A 3QLVA 3FUQA 2D0DA 4AJ1A 2BR5A 4HGOA 4RD7A 1HQDA 4B81A 2V65A 1ULHA 2A8YA 5GV7A 2QXUA 3U19A 3UJQA 2QLBA 5D51S 2PX3A 5KC9A 3WE7A 2LUOA 3TLCA 1JYIA 1X7HA 1SCKA 3L0CA 2J7PA 2Z5FA 4IBOA 4RHV2 2G80A 5FYCA 2IXBA 4EUEA 3OCPA 4RF2A 2P0EA 2GM5A 5FPKA 5ENVA 3RASA 4D9NA 1E3QA 3BN6A 2ACWA 2HQOA 2PXCA 3RU7A 1X7ZA 1MVOA 3F46A 4MUBA 2WR9A 1KY2A 1N0WA 3K05A 3C6MA 5I01A 1T35A 2Q5EA 2EFEB 5K9ZA 5DGDA 4YONB 4YRAA 4EV0A 1YZ3A 1W03A 4AY4A 3GG9A 4C5AA 1KDTA 2W1UA 2WM2A 1MJHA 1CJVC 3RRYA 2IZWA 2QTWB 4Z07A 4QJ5A 1L4KA 4PZCA 2X05A 3JSAA 4X45A 2FZGA 1LSUA 1E79D 1NM5C 2IELA 1F2TB 1RXYA 4XQEA 2MINA 3T8YA 4BWFB 2YRWA 1K6MA 4R8HA 1C9MA 2W2MA 5JD4A 1NRXA 5AI8A 2XCSB 4GWLA 1EWVA 4UREA 1I4DD 5IZ4A 5AW6A 4XRRA 5AOVA 1EFCA 4QSHA 4MUYA 2ZI7A 2HSEA 3Q3VA 1R10A 3EDQA 2IWRA 3H8WA 3V80A 1HZZA 3LEIA 1NW7A 4QODA 5HF6A 3B1WA 4WXEA 5DSTA 3W4IA 3PTRB 4II3A 2ZJBA 1WSAA 4RUKA 4D7AA 3TLGA 5L7OC 2FHPA 2PL9A 1RUI3 3UJ3X 4Q4DA 1PNFA 1E92A 1LJ8A 3WL7A 4QC2A 4JIGA 3BIWE 4UHCA 4C6SA 3IPVB 3AJRA 3NNSA 3BU7A 1KI6B 1NG9A 3FKJA 4FBLA 5MFPA 2OWEA 3OGGA 5U4QA 3R6GA 1XCMA 3C7CB 2EWMA 2Y8EA 1AA6A 4GWKA 4MS3A 3NW4A 3PXUA 1DZIA 3HZHA 4DV1B 2HK7A 4ROSA 5CG8A 3EGXB 1AXYA 1YQCA 1MTZA 4XVHA 5B53A 1N2CE 1GKLA 1HOTA 1FFSA 4PSVA 1AUOA 4JYBA 3HM2A 2LUWA 4JJIA 5ALJA 3VNSA 5ABPA 1PJ2A 5FMBA 3BERA 4Y6PA 5JCOC 1CR1A 2IEIA 3KSZO 5A7NA 5F2SA 3HC7A 5L95A 4H3WA 4JB3A 4MDFA 5HE8A 1CUHA 4N3GA 2XLCA 3B9IA 1NJ5A 2ZIWB 3VX3A 5FLEX 2XY4A 2F3QA 2E53A 1HT3A 4QDUA 1MT0A 1E1KA 2G63A 1UMKA 1DXOA 5A1LA 4EELA 4YYOA 3IKVA 3HNRA 1U3CA 3QUAA 2YDEA 5A6SB 1I10A 1COV1 5CH5A 5HCIA 1M2NA 2ZACA 3ZKAA 3DYIA 1U0SY 1SAYA 2ZP1A 4WZBB 1NLYA 1OQAA 1GNZA 4L2IA 1YNSA 1HB2A 4F8AA 1H1AA 2XMDA 4DLAA 3NHKA 2NUAA 1J2UA 3VV3A 1F8FA 2QMYA 2H0QA 4K40A 2V7GA 4EYEA 2ETXA 2D8MA 3ROEA 4COKA 3GCXA 5E38A 4ZYVA 1OILA 2JDZA 3VR5A 5FBKA 2B1JA 4HH3C 4GWIA 2G77B 1PIV2 5FFFA 3BMOB 1TK3A 1KI4A 1C0LA 2ET1A 5DDIP 8MHTA 4WLVA 3BSWA 4DAEA 5FRDA 1Q14A 4E5UA 1JHOA 3BWMA 4WN9B 4EJMA 1ZK2A 1OWLA 2GAOA 1Y5IA 3H1BA 4KLZA 2JE8A 2XGMA 3KKQA 2AC4A 2VT2A 4LPLA 3E22A 3IAHA 5JOXA 4JL6A 4GMKA 2VTVA 4DBZA 3VSBA 1P9OA 3WQ1A 4XDGA 3IS3A 4N82A 5C46F 2EF6A 1CPMA 4YO8A 2W48A 3T3DA 3ECAA 2X0RA 4RX1A 2J31A 1OPXA 4M98A 4Q47A 4B6OA 2ADOA 1OA2A 4GMXA 4MVTA 1GYPA 1D5CA 4F06A 2JIDA 3PFHA 1P5JA 5JFOA 5KOIA 3VSEA 2AS0A 4IEYA 4IEPA 3I2DA 2PHTA 2X8JA 3O8LA 4MVJG 1MHTA 4BPZA 5C3RA 1CRQA 1JG7A 2BBOA 4I3FA 2WEKA 1CAWA 5J2TA 2W95A 1CUCA 5A4KA 2R00C 1CZTA 2YY6A 2Y1EA 5EHZA 3ZLIA 2O8CB 4ZQHA 2CLLB 4F3YA 1BDHA 4KBYA 1BQPA 1UK6A 1AZWA 4MCAA 2J9FA 3DR3A 2HWD2 3DZJA 3ICVA 4ARAA 2LRHA 4BJ3A 4IDAA 4LOLA 1NMXA 2QTMA 2VNVA 3H0CA 2OFPA 4AJ9A 4JVLA 1ZAYA 1JZ3A 1JFSA 2Z8YM 3B3JA 1XEXB 5F5NA 3LUKA 4GALA 2O8FA 5BQPA 1EV11 1AUXA 4ND7A 3QK7A 4XFGA 4JBLA 4DWJA 1IOAA 2ZX1A 3BMCA 2HF2A 3G2NA 4C78A 2CFRA 4CKWB 4BP9A 3H9QA 4N39A 3V64A 4R68A 2KE5A 4B2YA 4UPVA 4WSOA 3VI3B 4A42A 3E5XA 1FS4A 4CEHB 2HJ9A 3E53A 2B45X 5JAMA 1CNEA 5FX2A 2XI4A 2XMCA 4QOFA 3DPUA 1IEWA 1EE2A 2GWRA 4IEWA 4ASUA 5CXUA 2VNKA 4L5JA 3WZ2A 1FOEB 1PO12 2B3TA 1Q0PA 2JHCA 3JZVA 1A4RA 2F48A 1W35A 2XJQA 3IRUA 3OWHA 4YW5A 3DT9A 2RDQA 5J5AA 3JWGA 2HQRA 3AR6A 1P8JA 2RHWA 3ZFFC 4BQNA 3V0AA 2LZ0A 3AB0A 2GC1A 2VBPA 5D1NA 4Z0TA 1YRQA 2KJQA 1RL3A 3SS7X 4E5DA 5H3CA 1NOVA 3LT5A 1NDUA 5A5FA 2ZJ6A 1O96A 1T8WA 2A7XA 2X22A 2BM9A 5CD9A 1TX4B 4B71A 5K0EA 5SY9A 3S1SA 3HIFA 1MTOA 1FP6A 1AHHA 3MFQA 4ZVLA 3HUEA 3WNVA 5BSGA 1WZEA 2W52A 3OP4A 5FF9A 3WLJA 3ORQA 1MEC2 3M6XA 1X7YB 5E2BA 2AH2A 2GT1A 5K8VA 1R0SA 2ZW9A 3AU8A 4KX5A 4PPGA 1N5MA 3DT8A 3U3ZA 2GFQA 3L46A 1XP8A 2H2AA 1TYBE 3M8LA 2FUKA 5WRFA 4XFDA 1ST2A 2OAP1 3GXUA 5IK2D 1DC8A 1DWQA 3EMRA 4KMQA 3Q9SA 1DYOA 4AQ6A 1W49A 3WF2A 3LL4A 4ZREA 1CU1A 2W46A 3HKDA 3OJXA 3NCTA 5DMXA 3WB2A 2ZQYA 3TEXA 4UEWA 1E5HA 4XVCA 4EW6A 2OHXA 1CAVB 4V3BA 1Q6ZA 3UA3A 5GOZA 1PZ9A 3PIIA 4EHIA 5K4GA 5CT4A 4YROA 1I1NA 3ZDSA 3ZWYA 4NAOA 4FGLA 4R1LA 2A9JA 2ZGVA 1SPPB 2O8QA 4K0RA 1TNFA 4EY3A 1YVUA 4BJ5A 1GA1A 1FMD1 5A4MS 3WISA 1LFDB 4NU0A 2V1XA 3T7JA 4OXNA 3V4FA 5E6HA 5IDVA 3H7AA 1JHQA 5DXJA 3DDOA 2XB8A 3KHKA 5F35A 1S2KA 5CA1A 2RH8A 1Z4OA 3ZYCA 1PAUA 5DNYB 2DEUA 3H9EO 4RWZA 2JLXA 4XOIA 2VSQA 1RBZA 3GRKA 3L6DA 4LWQA 3SYLA 2P9EA 4ND2A 4QNNA 3BE6A 2MR6A 2YQZA 4FHDA 3QIAA 2VZ9A 4TN5A 2XGJA 1JAXA 1IY8A 1W25A 2AHOA 2FDKA 2C97A 4JGYB 3VYVA 1RQXA 4IOLA 4KE6A 4B6PA 4AVSA 3CLSC 5DBHX 5D7NA 3RS7A 3RQIA 3LEMA 2Q3CA 1PDVA 3A28A 3MW8A 1J5XA 4B4PA 3GFOA 3RRNA 4RY2A 4FT8A 1KETA 4Q8KA 2B8MA 3QKIA 4DREA 4J9VA 1KNQA 2ZDQA 1VBE3 3GHYA 4QYIB 3BMNB 1TIPA 3WQQA 2WJ3A 5JC8A 4PX9A 1RKXA 1EFLA 4HOYA 4NBVA 4PF1A 5BSFA 1M0SA 1BQ3A 4TWAA 2NXCA 1T43A 1ZK3A 4TVOA 4HD8A 4UBIA 2G9QA 5BT8A 1GQGA 2A6PA 5BWOA 1GICA 1TVEA 3I8OA 4M8IA 4D45A 2CJWA 1PO7A 3KKNA 4YAIA 4BZPA 1LECA 4M1OA 4Q4AA 4MQMA 4OB7A 3DDZX 3JWEA 2QTTA 1JHXA 4OLLA 2G0TA 3OC0A 4QGMA 4K87A 2XGOA 2Q4SA 4CW7A 5EJMA 2XUIA 3AC0A 1R092 1L9XA 2ZPAA 2V6JA 1ACMA 3S1LA 4A44A 4QG7A 1L5HA 5DOZA 4HANA 1A88A 1JSZA 3VN4A 2OPHA 1L8QA 1VPDA 3FLAA 2J0QA 4QECA 3MLBA 2ZEWA 5FI5A 4DXSA 4TM8A 1CJCA 3N9NA 5IVBA 2ZX3A 1EUDA 4BMXA 5KTOA 3WEZA 3GCGA 5FCDA 3J7MA 2M2IA 1PFGA 1OVSA 2F90A 3VYTB 4X3OA 1GL7A 4M0EA 3GLIB 1P80A 5F73A 4BNMA 3DE0X 3Q8XB 3A4LA 1VA4A 4XEZA 4WGFA 3AUAA 2SICE 3DTVA 4BASA 5HFAA 1ZRIA 5HBGA 4KL1A 1OV4A 2RBEA 2HRDA 5F7ZA 1RWVA 1JIUA 1PUJA 4MUGA 1IPFA 3N7TA 1FVOA 1KFEB 2QRLA 4Z2WA 2P6HA 3TLEA 5J3JA 2BWCA 2ZXQA 3KYCB 1XTBA 5AVZA 3P8ZA 2JHPA 1TQ4A 2R041 2C6SA 3H9BA 4YN3A 1E69A 3W77A 3QVWA 3O12A 2IVZA 1LBQA 5IK7A 3ECSA 4M4SA 1JH5A 1MC4A 3T7TA 2WS91 3JD1A 1XU9A 2OAQ1 3QPVA 3KVOA 3GD5A 2YYAA 4C4XA 2P34A 2FPLA 4LZNA 1KP2A 3LA8A 4CN9A 3ADCA 2QQKA 4NCNA 4CCDA 2G4IA 1DTEA 1UL9A 3OBZA 2QB5A 3UKDA 4U7JA 1IH8A 5A6QA 2WBLC 5B1HA 2NUPA 1GN8A 3GCZA 3V46A 1I3CA 4X1YB 4GOMD 1K5JA 2D00A 4A7YA 4GIBA 4OP1A 4TLCA 2NU9A 4CDWA 2GLXA 2XGSA 5D5QA 4EM6A 2F8LA 2VW2A 2HF9A 2HYKA 5K6TA 1XPWA 1S2IA 1XA0A 3ZV7A 1LEDA 2CNOA 3QHAA 4YAWA 4Y9TA 4IEIA 3S7TA 5C8YB 3AKZA 4XUTA 4IG9A 4QYMA 1Z47A 5HKOA 2WQ8A 5EPOA 5DT2A 5C4GB 2C31A 3ZMOA 5TQ2A 4RANA 3T7DA 5IJZA 1F1BA 3BHMA 4DA0A 1LOFA 1GR1A 3NGXA 1AG9A 4FFMA 2P7HA 2FP4B 4HN0A 2BGGA 4QXCA 1NYQA 1P0PA 4B3MB 2R751 1CY2A 4IX1A 3LRPA 5FY1A 4N43B 2XXZA 1YVDA 2MWMA 1U12A 2CXPA 3FKSD 3DL2A 4M0NA 4O1MA 1T5SA 5HFJA 2ZX2A 4WH0A 1FL9A 3UXEA 3F2ZA 5SICE 1UX7A 2NO0A 2ZX4A 3TGLA 4IICA 4HLTA 4EA9A 4YVWA 5M5BA 2J9GA 2QQFA 3VUEA 5KWEA 3TOZA 3NVMB 4HB2A 4QX8A 1KY4A 3B3GA 2OQ6A 1AYN3 1E9EA 4NV3A 3DPIA 3OBBA 1IXZA 2C4UA 1H6BA 5I9TA 5GGYA 2Z79A 2Y0PA 2ZRNA 5DCYA 1UQXA 2YKGA 3WSWA 3ANYB 4MH0E 3G5TA 4MZDA 4C22A 3Q41A 3OT5A 3EBLA 3FPLA 4AGVA 1V3VA 3QPBA 3OU7A 1FYWA 4IMJB 5KMGA 2ZDGA 4E14A 1TEXA 2Q8QA 2W00A 4HEA1 1B1AA 1JS1X 2ZXEA 3GVXA 3D8NA 1NR7A 1PTJA 1CEEA 4AJLA 2YH2A 1NCQB 4IV5A 2ZGOA 5FD8A 5IXSA 3PIJA 5IAJA 2J08A 1FP1D 3EXEB 4ECEA 3V65A 4LWZA 1GWLA 3K9LA 4MS4B 3K9NA 3GEIA 3I9LA 4RNCA 5ESDA 5HQJA 3RRJA 2DPLA 1LRLA 1QS0A 4KX3A 3V32A 1Z7EA 3N86A 4H7EA 2VMIA 1QX3A 3EEOA 1Z4PX 1BBT1 1ST3A 3PBKA 3E7WA 1NUPA 2H07A 2V55B 2Q28A 3IM0A 4CU9A 3GDOA 1PJZA 4H1UA 1GXSA 2VZVA 3PPWA 4RJLA 2XTNA 4PBPA 2JG9B 1TT5B 1H8HA 2QD1A 1QQ7A 4I3HA 1BXRA 5ALHA 1G5PA 3KDSE 5EXXA 1UZAA 1VGRA 1MQTA 3UB2A 3N4MA 4DLPA 1FDOA 3T0FA 2YY1A 1EFHA 1NGSA 4LHXA 4Z92B 1JEYA 3TRFA 2PCLA 2PWZA 3T52A 1NBIA 3GL9A 1UKEA 3OQJA 2X9LA 3U9LA 4B3SB 3RF7A 1K8XB 1E7RA 3JPYA 2ETEA 1IS4A 2XVAA 1IZ3A 3Q8CA 4ISQA 3QELA 4B2LA 1KVTA 3G7NA 3H1TA 2TMKA 4Q7LA 1X0XA 1NSFA 2RS13 1N8TA 2CF6A 1NN3A 3K70C 1OX4B 3VDDA 1XU4A 3K9GA 3AK0A 1QIMA 3F4LA 5IYZA 2H8GA 1DZQA 5DNWA 3FOEC 3EWSA 3VNAA 4IIVA 2UY9A 2I66A 4XETA 2AJBA 4FKBA 5KHHA 4XKJA 4IDPA 3VSCA 3ZFFA 1FOD3 2G08A 3GRPA 3DZHA 4BVGA 3KV9A 4IEEA 1QNLA 3A3KA 1ISHA 3D4LA 1HH4A 1E7MA 3AP1A 3LC2O 2GXQA 4RD1A 1H05A 1BS1A 3TFWA 1CZVA 3HJAA 3MERA 1YFUA 4AVTA 2FN7A 1WDWB 2ZPUA 2NT4A 5DV9A 2BMWA 2ZAOA 2GI4A 2IS6A 3W9YA 1ODIA 1NA1C 2N1BA 1SA0B 4G8JA 5FZOA 3R9WA 1JDTA 5CVRA 3NV4A 5CAEA 5D8AA 5MN5A 4JQYA 1UY3A 5B1SA 1HRI3 4WLFA 1D9XA 4GKJB 3HQUA 1S96A 3AG5A 3FGZA 3UA4A 5C33A 5HIKA 3EFOB 5CVEA 2ORYA 3S0MA 4B74A 1U0BB 5C32A 1SUAA 5IASA 1Y33E 1FNBA 1JDZA 4IH4A 4J7XA 1E7WA 4C90A 1S0BA 1Q77A 3G13A 1X7NA 1LI7A 4CTMA 2PJRA 3UGGA 3X1YA 4OQ8A 4ND5A 4E6EA 1R6XA 4JGYC 1LDYA 3S6PA 1AHIA 4Y1VA 1W0OA 5F8PA 2VDRB 1ULSA 2RR12 1COWD 3NHZA 1I0ZA 1SKAA 5AC92 1Q7EA 2IE0A 3WIDA 2C8VA 4L3VA 1YVEI 2N42A 4DEYA 1XPRA 3TFOA 4X7MA 4HGPA 5LQCA 3N5CA 4PFJA 1EP3B 4BWGA 1MZVA 2V59A 3FTEA 5KWRA 1T25A 4AYUA 4NXNB 3ZYBA 1PWEA 1HT0A 4MIEA 3SJCA 1CR2A 1Y7PA 3WP0A 2RKOA 2D13A 1WUKS 2MSWA 1G8FA 2OYZA 2R8RA 5JTTA 4PS0A 1R5BA 2A0WA 5LXTF 1E5SA 3F74A 1H2YA 4BVHA 3Q1LA 4WM7B 3WC4A 3G82C 2Z6QA 1IY9A 2D6NA 1ZYUA 2AN3A 4FQ5A 4YRZA 2G09A 4QDZA 3W2GA 2JD2A 2I2XB 4JVSB 2LW7A 3B85A 1JG1A 5ALPA 3RYFA 5DJ5A 2A6VA 1P4AA 3QJ5A 5H9RA 3A3PA 2KSQA 3IQEA 5KNBD 4DR1B 4LX0A 1C0EA 4JTNA 4YDHB 4QDJA 4HLCA 5JXIA 5AW0A 1IKPA 2CLOB 3QUTA 3RS9A 3HY3A 1S1CA 1I7QB 4QARA 2RJOA 1Z16A 4KGQA 3KLMX 3H86A 3L7LA 4S0ZA 3NRUA 1TUBB 1P3Y1 4AE2A 1VBB1 2ZQ5A 1ADGA 4JDMA 1M1ZA 1SXJE 3KB1A 2NSHA 2D1QA 1KIAA 5IBCA 3WO1A 1MX5A 2XUQA 1CQZA 4XF3A 5TPWB 4CCKA 4OXIA 3BA6A 2X0DA 5E1OA 5CBLA 3OZDA 3DVSX 1M2VA 1F2TA 5KVAA 2OM2A 2SNIE 1U5ZA 4ZOCA 4CQMD 1SUSA 4JHZA 1PVDA 3A4YA 2IYOA 4B3GA 1O9HA 3Q8KA 1M1NB 2F1OA 5C52B 3MTDA 1VBC1 4LIUA 4R84A 4UU0A 1J8YF 3VPXA 5H9VA 3O75A 4FPJA 3BWCA 3ZXDA 1L9KA 4PO1A 3H6GA 4EVSA 5BV6A 2XVZA 3LPFA 1F20A 1WUJS 2WSSD 4R5HA 5AKHA 1AX9A 1VALA 1RUC1 2I7TA 4EQVA 4JOBA 1J1IA 2HJWA 1W05A 4AS1A 1XNGA 4M1WA 4JT9A 1NQDA 3AR9A 1J0AA 2H6CA 3KSBC 3X29B 3V8QA 3NIWA 4OQNA 4CUKA 4FHGA 5B3AA 2GBLC 4NUBA 2Y1WA 1FXSA 3IPVA 3JBG3 4MO3M 4PLZA 4X6YA 1KI6A 1H3FA 2CXHA 1SU7A 1RI3A 1KYXA 3HZRA 5DX8A 5CCXA 4K6GA 1E9SA 3GJQA 5KHKA 3I6YA 4CHTA 2X2FA 4UHJA 2MR5A 4GL2A 1T1EA 2VJPA 5FIXA 2EAKA 3STXA 1GGNA 1VKHA 2GBPA 3WT3A 1SKQA 3EGXA 4EZBA 2W90A 2H1IA 5L9BA 2XZLA 3CUVA 4KXMA 3OJCA 1UIMA 3EHKA 2HC9A 5T6MA 5E8JA 4AI3A 1GQYA 2Q5OA 3D2CA 3RNLA 5TF0A 4MDEA 2CWDA 4HDMB 3TIIA 1IS6A 1OBCA 4KVAA 1MS0A 1XUOA 3SZGA 2DFPA 2HFJA 5CJJA 1AURA 1H4TA 3HZOA 1LV7A 2BGPA 4NS1A 3FE2A 3H87A 4Y2JA 1RMU1 2WDPA 1JG3A 2FPOA 1A7KA 1VMFA 1BEV1 1XLUA 4U8GA 5A6SA 4D0NA 3ICQB 1AR83 2WVJA 4YECA 1ISIA 2FDRA 3MJ4A 3WGVA 4WZBA 1G0OA 3A7EA 2VP4A 2DSTA 1UDWA 4K9PA 1AL22 3R5KA 4AICA 2PUWA 4RL6A 5KJFA 4NMIA 4A2QA 1C3OB 3ZXIA 1ZBE1 5FB3A 4DUYB 2IZZA 4DLLA 1E3WB 1IVSA 4GQIA 4BV8A 3JD72 4TT3A 3BMOA 4OMFG 2Z1DA 1OLME 1LBSA 1XFAA 1BE6A 3NONA 3DLIA 1VP9A 1S0GA 3WK7A 4QXQA 2Z2YA 3NNLA 4RNDB 4E13A 5LOVB 1P4RA 3A8TA 5EJGA 2ZIUB 4FSDA 2Q1UA 3VPFA 5C5TA 5ANQA 3K75B 1V6OA 3QTLA 1Q57A 4BBAA 3KHSA 1KDOA 3FI0A 1H9CA 1ZHFA 1FA9A 4FPGA 1PVC1 4WZ6A 3K9CA 1GVNB 4QU8A 5AOCA 2CXUA 3WGQA 4E8DA 1AV6A 3IUSA 3STYA 4TXMA 1NCQC 4QDSA 1LEHA 2GCGA 5DPNA 3ZXYA 3FPJA 3GN2A 5FBLB 5G2OA 3I9MA 3SOPA 1RHRA 3H4TA 4EZEA 4RIIA 1U0AA 3QW4B 3POIA 3CUSA 3Q4GA 1IMJA 1KGYA 1VIWB 3OZGA 1N9KA 3NTLA 5AP9A 2GHTA 4EKGA 3UN1A 4NWWA 2O8CA 1ZHOA 4I09A 5CDHA 2JCXA 3V4VB 1QKJA 3LT4A 1FNZA 3EXUA 3O8OA 4I7EA 4FGSA 3P9ZA 2B8EA 1BWPA 1QIKA 1I5EA 3ZE8A 3AKDA 2I6GA 4YCCA 4AZ0B 2IUUA 4UBLA 1QK4A 2CJPA 3OC6A 2H4JA 3CCCA 5I7VA 2ZAMA 1FJGB 1XEXA 2GM3A 2DM6A 2C9KA 3I92A 2WFF1 3CX8A 1NVWQ 4H15A 3FWKA 1Y0BA 1FU4A 4DIKA 1C9NA 4TKMA 4CKWA 4XOUA 5DP1A 1AR92 1D07A 3KXPA 2H7YA 2W1SA 5ILOA 3BXHA 1E5RA 4HAVA 4M36A 3M34A 5L73A 4B47A 2ISSD 5F76A 4GLFA 2D3PA 2XCOA 2IYLD 1YASA 1G66A 1NBOA 4ZVRA 1C8NA 5DDJ2 1DZ3A 2ZGNA 3UGFA 1WVMA 2M98A 4BVJA 2Q7XA 2PS0A 1WAMA 2XQGA 2XGGA 3T09A 1PX4A 4BU0A 1N5IA 1BC5A 1U0EA 5B3JC 1JSXA 2JJ6A 1GR0A 1J5EB 5BW4A 4Q27A 1UINA 1XG5A 1FT9A 3FFQA 3DCJA 3BWDD 1C1HA 1R00A 1PGOA 4NEQA 3DQZA 1BCXA 2KWIA 1C3LA 3F6PA 1RUE2 1V3UA 2ONZA 3JZIA 2HRQA 4YRQA 5FI3A 1JJAA 4QAJA 1ZRDA 2IDZA 4J1TA 1J09A 2OLJA 5G1OA 2VZ1A 4MUKA 4TS3A 3QPDA 3AVPA 2RD2A 4IGIA 5DHQA 2C8LA 3ECQA 2VZRA 5ENDA 3CT6A 3QYPA 2GN6A 2WINI 4MKXA 3HXQA 2QD5A 1IK4A 3PC8A 3EVZA 4IKOA 4NCIA 3U11A 4R2WA 3ZHRA 1FVXA 2Z8XA 1X7YA 5KVQA 3U4MA 5AKKA 3NEJA 3CINA 3GZUC 2BNOA 3AI2A 3N6RA 4YCDA 1VRH1 4PSDA 3KZOA 1G64A 1NOKA 4WJLA 1SBHA 2WF5A 3FUWA 3GEBA 1G7CA 3LQRA 2PLV2 3LIGA 2CFSA 4GI1A 1HMPA 5TB5A 2NZ2A 1RQ7A 5BNOB 2I2WA 4IIXA 2XB4A 3HUUA 4AX8A 1TGVA 1EGMB 3AETA 1TMYA 3KTOA 5HBAA 1OF1A 5KSZA 3RBZA 1E1MA 3E9ZA 5L19A 4AAXA 2FPPB 4RKWA 5JCXA 4MKIA 1IC6A 3A9TA 3L2YA 3ONDA 5JAOA 3SR3A 4MO9A 2ENWA 5BV1A 4R9RA 4H35A 4DLZA 5L7OB 1F4LA 2CNKA 2PLRA 2AB0A 1TF5A 1JILA 3G2MA 4ON9A 1G4UR 4C87A 4ZU5A 2PQ6A 3VDNB 5BNZA 3QBQA 3PI7A 2GUWA 1SPPA 3LF2A 1EFVB 2O1XA 4KKVA 4WM7C 1WX1A 2B35A 3KS7A 5JVDF 1NRIA 3PFIA 3WRXC 5B7NA 2FWRA 3Q9NA 2IQ5A 2GJSA 2E6KA 2OGZA 3VR4H 1VIMA 1PNRA 5EIBD 2YXSA 2Q4EA 2JVIA 1VMKA 4JI2B 3IQZA 3ZE1B 3H7JA 3PDWA 3KOUA 1ZXXA 1Z6TA 3M1IA 2GF0A 1YWKA 1C4XA 2I4MA 2X8WA 1SBCA 4HQ0A 2FEWB 2JLBA 4KWHA 4JGYA 2PGLA 4HATA 2OBLA 4TWBA 3IV6A 3KDAA 3UUWA 3H84A 3OKCA 3A3YA 3TIVA 3VSAA 4QWMA 3DVLA 2JCSA 3GALA 3U7QB 1U31A 2PSFA 1DWUA 4WCDA 1G2QA 4CP2A 4BCDA 3WHIA 4EN7B 5D7BA 4LE0A 4W99A 1QK3A 4XWWA 3G49A 3AP6A 1I14A 2JNWA 3BMNA 4Q7JB 4LRUA 3T5DA 1QX4A 1IMOA 3MJDA 4E94A 1JIJA 4RVSA 3ABOB 1P0MA 2QJRA 4XIJA 4B3RB 1GVHA 2ZBGA 3NTOA 3O0VA 3TKLA 5AVOA 3L82B 1LU2A 3OJEA 4ARUA 1LF0A 4H4EA 5JZ9A 5LATA 1WW5A 5ALEA 1I6XA 1TCAA 1UXXX 3A1DA 3VPDA 1YR9A 3LNCA 3L49A 5C18A 3RIYA 1TLFA 3GEMA 2BMJA 3M83A 3FTNA 3OH8A 3IE1A 1M5TA 3V4ZA 4FT4A 3X0DA 1UBRS 1F5SA 5A7SA 2J5KA 5ILQA 3RC1A 3GELA 2Y6JA 2QUZA 1M0WA 1WMFA 1I7PA 3P9KA 3AXEA 1ZI8A 2XCUA 1VAKA 1CF4A 3H18A 4CM6A 3MC1A 2ZEXA 5EMNA 1P2SA 4B1LA 3VYSB 4ENSA 3UHOA 4MVJP 1O3QA 4I1OA 4UZSA 3W9AA 3EH2A 5JHHB 1ENSA 4YUYA 4XABA 1JR2A 3GLIA 3HGMA 2VMFA 2Y66A 2FMTA 2ECFA 4H18A 2CDRA 2O07A 2EZ9A 4NTZA 1ZITA 1Z3IX 2Y0BA 3DOEA 2EC5A 2F55A 3KVBA 4JLNA 1Z88A 4R1TA 1Q8OA 4WVLA 1QGOA 4KREA 3OOXA 4XIYA 4PLPA 1CIWA 1FRQA 3IBYA 4JBXA 3KYCA 2VPQA 1WABA 4BO3A 3ZU2A 2I1QA 1E60A 4Y2VA 2AX4A 2COUA 1VG9B 1UFOA 3ZJTA 2IXEA 4NBWA 1ZJZA 1JTZX 2BT4A 3LC1O 4H9GA 4MGZE 3P2OA 4YAOA 2BKEA 3OHMA 1J42A 3PEFA 1HWYA 3GA7A 1PQYA 3BT7A 3KCCA 2M6LA 2VZSA 4Y7DA 1TM3E 1XEWX 1OV6A 3GUHA 4K9RA 3IMCA 5DSZA 3FW1A 5LWHA 4F2PA 3THPA 4FZJA 4ES9A 4ZMBA 5FP4A 3WNXA 2Q0SA 3DEMA 4WOBA 3ELYA 3TRHA 1NWHA 3RHZA 3CDZB 5CB6A 1M6EX 2FLVA 5GKAC 3QMWA 4X1YA 2B42B 3M49A 1G8YA 2EP8A 4OHMA 1GA6A 2GAJA 2ARKA 1EXVA 2DECA 3BIJA 1RWPA 2UYQA 3CZQA 3SITA 3TSCA 3TAXA 5JD5A 3DMHA 1EA5A 1DAMA 5IC6A 1OIVA 5K0SA 1ZZBA 4JBGA 5FAXA 2QP9X 2AC7A 3EARA 2EBWA 1N0HA 3I45A 4F11A 1P7CA 3MT0A 2QZ9A 5A4DA 4N54A 3BF7A 1TADA 3MHPA 1G4HA 1MX9A 5LIPA 1Z7S3 4L4RA 1Z8DA 3AEQB 1QGAA 1BK0A 2DY1A 5C8YA 4PYJA 3GNLA 5K3BA 1G5QA 1HE1C 2YHIB 2KA3A 3QNWA 1XYYA 1APBA 3MTBA 3OPZA 1H2MA 2OECA 1P0FA 5JS8A 3Q87B 4YIHA 1NXD1 1N78A 1YQ2A 2R7EB 3AV3A 1WXQA 1SCSA 2PT7A 3TRSB 4R52A 2HU7A 3OOSA 1Y81A 1ZU5A 2FP4A 2PKEA 1KOFA 5E7IA 2GEUA 2WWWA 1SLBA 2R8OA 3VD4A 4EUKA 2AG8A 4N43A 4E5YA 3LT2A 4AEMA 1WLDA 4ML3A 1WKBA 1XRNA 3HK2A 2IWGB 4L1KA 3NI2A 1CUYA 2P17A 4XQGA 3DH0A 3LY7A 3MTQA 1AX0A 4DMCA 5FXWA 4A82A 2J87A 3NAGA 4DCPA 3CF6R 4PTZA 3SD7A 4QASA 1XTKA 3SSMA 5IZCA 3OEBA 1OB5A 1IU9A 5HTKA 1VE0A 3NOOA 1HYGA 4IV3C 3ACCA 5A3PA 2GBGA 1ZOSA 2PGXA 3WSTA 2BEWB 2B5VA 4FFSA 1YEWA 4WW0A 1AV7A 2QT9A 4JC1A 4BQYA 3RRDA 5BNNB 1BEZA 3C5CA 1L5SA 1O6BA 2ZCWA 4CM1A 1HEYA 4DIBA 4AG3A 1ISJA 3NKLA 1W90A 2R6GA 3N59A 2X9GA 4RL4A 1GT91 1WDKA 5IFKA 3DVQX 2VW1A 5EJ4A 3A9VA 2GF2A 2OD9A 4N8MA 1A9XB 5BSEA 5F1YA 3DKKA 3WK9A 3ZDXB 5H4HA 4BNTA 1P9NA 2Q1YA 2I33A 2A3XA 1NCQA 4CFYA 3R8FA 1VJCA 1NYTA 2W08A 5LXTB 3KKLA 3SKXA 3NS7A 3A6DA 2JA1A 3CHYA 3EXEA 5DX0A 3T15A 4MS4A 3PA8A 2HIGA 4D80A 4DY4A 1WKCA 2PRYA 1RAIA 1VA5A 3R23A 4JX0A 4GPTA 2HA3A 1ZJ6A 3VBHC 4IE4A 1ITZA 1ZBA3 5CJ2A 3KJGA 5I4KA 1JOBA 3QYAA 3I59B 1PW5A 1L7PA 1UK9A 5IU6A 4DXAA 2VWPA 2JG9A 1TT5A 1ZIOA 1CZRA 3L40A 4HYTA 2DVAA 1MORA 2OA0A 3WDYA 2UUOA 2AI3A 2QQPA 4A6PA 3QEMB 4M8KA 4PLTA 1SY7A 1E6MA 4AP5A 4KPYA 4V39A 3WK5A 5AM1A 1QR6A 2A7QA 2IZ5A 4E1AA 2G1JA 3ZZ0A 3COPA 2YWEA 1HV8A 4IEFB 2PZBA 1EX9A 4YRKA 2YBDA 4COWA 3HN2A 4J0DA 4E7PA 4Z0HO 1WQ4A 3IHTA 4OJQA 4QHBA 1J9EA 2AYZA 4CR7A 2VQEB 3AMHA 1B8OA 5EKUA 4I30A 3E5MA 2XF2A 3A1TA 1QVVA 1ZMXA 3DZBA 1WCSA 3TMKA 4PM4A 2VDQB 3A6EA 5G40A 2DF8A 2HDNB 4PLGA 1LH0A 1R1DA 3Q7RA 1T8YA 3AVYA 4RV9A 2RJNA 4BJ0A 5CFLA 3ZLTA 3ENQA 1DLLA 5BNOC 2BMFA 4U9UA 3R3WA 2BUKA 3UETA 4WNCA 3NH9A 2IHNA 1HM5A 2EF1A 4C3OB 3S55A 5A6ZA 4CCLA 1ZJJA 1XDSA 4NYMR 1ZQ9A 1HE5A 4MS1B 3U49A 4RPJA 4TYWA 3H9AA 3D7LA 3E9DA 2NZJA 3OBTA 3PA6A 2OY0A 4OMCA 1X87A 4KG7A 2Z5LA 3A4IA 1GFSA 4L07A 4LV5B 3OCCA 3MQ4A 1MGOA 5CG2A 1WQ1R 3OPYB 1UT6A 2CKMA 1ATIA 3OUIA 1ZNPA 2PRIA 3ORFA 1SA0A 4L0DA 3FG9A 4MRAA 1TI7A 4MTLA 4MV9A 2HQ1A 2Y2UA 1YI7A 4L8GA 3QOYA 4W5JA 1QPBA 4L9BA 2WZPP 4D0GA 3AJ8A 1AZSC 2NV6A 3GRRA 3EFOA 3OE7D 1L3JA 4L6CA 2C9YA 4OMUA 5GP1A 4KOEC 4L75A 1D09A 3N0WA 3E82A 3PKIA 4I8DA 2NPFA 1K8QA 4XQCA 3ITKA 2GBFA 5BMVB 1IRIA 3L4BA 5L4LA 3WLLA 1GFF2 4DCMA 4LJ5A 5ALGA 2B6NA 1A69A 2JGIA 5T3UA 1BD3A 1V48A 4GEKA 3N0RA 2H9AA 5DMHA 1NJ8A 4F3RA 3ZJYA 4LQLA 4UBHA 1JTEA 4B3IA 2OG2A 1B73A 2HWE1 3S8MA 5CDGA 4CTKA 4FCWA 2FCRA 4ER7A 1N3PA 4M8NE 3W3AH 3EF0A 4M1EA 1EX7A 3CURA 1KC3A 1RAFA 3OU6A 3OZSA 5DO9A 2HWB3 2B69A 4RF3A 3FSJX 2VZOA 2IH5A 1OH4A 1ONPA 3K9QO 3JQRA 3UICA 4OQDA 3ZKWB 1HFJA 1BKSB 5JS2A 5LWQA 1JMVA 5TX7A 4R4ZA 1GITA 2Q2NA 2AQKA 3WRXA 1T2EA 3P71T 2JIBA 4J75A 3EC2A 4H17A 4JGIA 3ORYA 2Q5QA 4QU9A 2WHEA 4G8BA 1JKXA 5IJ0A 1XC6A 4OEHA 1JSLA 1ZN7A 4BNYA 1Z7WA 4PLNA 1K7EB 3ZN5A 4YT8A 3LH5A 5A4IS 1U3UA 3KV3O 3N8HA 4BCUA 2PQQA 1Y48E 4P7GA 4D5EA 3ZVNA 1EPUA 4W5TA 4MXWB 2ZAIA 1UYZA 3LHIA 5EJ7A 1RQNA 4ZV9A 5FUBA 1TUBA 5JQGB 4P02B 1P2DA 1NPYA 1GNYA 5DLQC 3EHEA 3UKTA 2WYSA 1TC2A 3E2IA 5FADA 3IMMA 3NRBA 4BE9A 1R8XA 2QX9A 4DMMA 2W91A 5IH3A 3M81A 2FWAA 2EJTA 3JVEA 2XKKA 4Q21A 4BNLA 5LLSA 5TPWA 3UJ9A 1A9QA 1DRUA 4AX4A 1X1RA 2OCXA 1EJBA 5CG9A 1SURA 1WW3A 5CLHA 1HKDA 4D79A 4DF3A 1PFKA 4WY2A 3IVCA 4HAOA 4KPFC 3M6UA 2XKBA 4FFRA 4S1WA 3L1UA 5EIAA 1JYTA 3RRBA 4E2FA 1FW6A 4YA6A 3LWZA 3N0XA 3VR6D 1THGA 2VDUE 4W5QA 4II2A 4DZZA 4R2MA 4P33A 2V9CA 1TQ2A 4UFLA 1X33A 2W2PA 2DBIA 4YDQA 1J06A 3GJTA 2QY6A 5DW3A 3O1VA 2XWJI 5KXBA 2O2DA 1E7SA 1FNNA 3UPUA 1YUNA 3O82A 3KEQA 1GGMA 1GPLA 1IQDC 2PKCA 3HADA 1Z73A 2YIDA 3C3BA 3NOQA 3SZ3A 1Q1NA 5AKXA 2G9NA 2XUKA 1XU1A 1ZA4A 3KT6A 4X1OA 4PQQA 1DEOA 1AQLA 4JLWA 3BOPA 1WA4A 3N7JA 4WA8A 5IT0A 4F6LA 3TB0A 3DHYA 1VIAA 4ZU4A 1PGSA 1EK1A 4JKIA 1ZAKA 1P1RA 2XQRA 5C3QA 4HLNA 7YASA 3B36A 1TFRA 5IX8A 5KC5A 1GSAA 4O9GA 3DD1A 2HA2A 1E58A 1YZFA 1HOXA 4HDMA 3Q5DA 3Q7IA 3G23A 3H8VA 2C4XA 5B3LA 1W94A 2P69A 4QKQA 2FEKA 2DBYA 3RAGA 3BALA 1GNQA 1ZX5A 1WXEA 5JZGC 1EFKA 1RPNA 2C07A 4IUGA 1GRRA 1TJ3A 1DFHA 3OE5A 1AKEA 3E9YA 1E8NA 1QPZA 4AEDB 3UMCA 2QV0A 2A6ZA 1SEVA 2K6GA 2JL1A 4Q6WA 1GZ7A 1QJU3 4G0PA 5CPFA 4N3BA 2HJVA 5CR9A 1S0EA 3A3NA 2X29A 1ULZA 8AT1A 4LOHA 1E20A 1QDLB 2XUMA 4KXLA 3THSA 3QU4A 2UYHA 1G8WA 1OD5A 1JR3E 4RSHA 4B48A 4DXDA 3H50A 1LCIA 3IX7A 4F1WA 3HU2A 3QLUC 1A77A 2HIAA 4DQXA 1LI5A 2GCEA 3RVQA 3OIYA 4GQAA 1UXOA 5E2AA 1E3WA 1WULS 2OV3A 2X10A 2ZB7A 4XDPA 3BD8A 4MUAA 4I6JA 3OFND 2GA8A 4DTIA 2GDZA 3I52A 2Y1GA 3GLGB 4HH4A 3HEIA 3K70B 1C4WA 3N2IA 1MOQA 5BNNC 1QZXA 4TN7A 4FYMA 1Z62A 4EMTA 1L4LA 2GCOA 4XDOA 2EYQA 1NMQA 1LNZA 2IOYA 2HO5A 1OFTA 1GN9A 2D6OX 1QOPB 4RTRA 3OD4A 4KSCA 2HTFA 3NGLA 5LOVF 1JR6A 2QIOA 4EG8A 4NCBA 4R7TA 4IKEA 3RZZA 3MVEA 2O57A 2YFYA 4JU9A 5T8KA 5JC1A 3KG2A 4QELA 1MOZA 1ML4A 3AZZA 4OOFA 4X6RB 4BRZA 1ZR2A