3IB3A

Crystal structure of sacol2612 - coce/nond family hydrolase from staphylococcus aureus
Total Genus 192
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
192
sequence length
556
structure length
551
Chain Sequence
HLLGNPKLTVTHVNEVKAGINHIVVDSVQYGNQEMIMEKDGTVEMRDGEKLYINIFRPNKDGKFPVVMSADTYGKDNKMGALWPTLGTIPTSSFTPEESPDPGFWVPNDYVVVKVALRGSDKSKGVLSPWSKREAEDYYEVIEWAANQSWSNGNIGTNGVSYLAVTQWWVASLNPPHLKAMIPWEGLNDMYREVAFHGGIPDTGFYRFWTQGIFARWTDNPNIEDLIQAQQEHPLFDDFWKQRQVPLSQIKTPLLTCASWSTQGLHNRGSFEGFKQAASEEKWLYVHGRKEWESYYARENLERQKSFFDFYLKEENNDWKDTPHVIYEVRDQFYKGEFKSASAFPLPNAEYTPLYLNAENHTLNHAKISSAHVAQYDSEDKQQDVSFKYTFDKDTELVGNMNLKLWVSTKDSDDMDLFAGIKKLDRRGNEVNFPDFNHIENGQVATGWLRVSHRELDQEKSSIAQPWHKHETELKLSQDEIVPVEIELLPSGTLFKQGETLEVVVKGSEIVIGNSTPGMKTRYEHEETVNKGMHMIYTGGKYDSQLIIPIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of SACOL2612 - CocE/NonD family hydrolase from Staphylococcus aureus
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords CocE/NonD family hydrolase
total genus 192
structure length 551
sequence length 556
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02129 Peptidase_S15 X-Pro dipeptidyl-peptidase (S15 family)
A PF08530 PepX_C X-Pro dipeptidyl-peptidase C-terminal non-catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3020.20 Mainly Alpha Orthogonal Bundle alpha-amino acid ester hydrolase ( Helical cap domain) alpha-amino acid ester hydrolase ( Helical cap domain) 3ib3A02
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 3ib3A03
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ib3A01
5AI9A 4QX2A 5EIEA 4BTLA 2XQKA 4MWTA 4RGYA 6YASA 1PFQA 4N8DA 5AKYA 3H04A 3O95A 1MX1A 1E8MA 2GBGA 4AZ3A 5ALKA 2D0DA 2PUHA 2DQZA 3RKSA 1DT3A 3C8XA 1W1IA 4PSUA 3I3BA 3KSRA 1WB4A 4Q3OA 2W92A 1SG3A 4CU8A 2QQMA 2WN3A 3UUFA 5AI0A 1K63A 2XMBA 5J3JA 2ACKA 1MU0A 4ARYA 5ALSA 4CUCA 2FJ0A 2WUGA 4J0CA 3MO4A 1XRLA 2XMCA 3O4HA 1JU3A 2B4KA 1JZ2A 5CT8A 2BGOA 2ROQA 1E89A 1EUUA 4CIAA 1JMYA 1K4YA 4RYDA 3CCCA 2AXEA 4FOLA 3I6ZA 5HQ3B 3ILSA 4M4RA 2O2IA 3MUNA 4YX9A 5JAOA 3LPFA 4AN1A 2XMZA 3P1IA 4FBLA 2ORXA 1WOMA 1GXSA 1ZGBA 2W6CX 4B81A 1CUAA 1F0NA 1AC5A 4H0CA 1A8QA 1XKLA 3WJ2A 4HZGA 1U65A 2YASA 4BK4A 4WFIA 3WKAA 1CUWA 3GZJA 2C5GA 3VD4A 2WHRA 5IVKA 2RGUA 3DYOA 5DMYA 1KEZA 1KU6A 3H17A 4OU4A 1D07A 1XRQA 4FLEA 3STXA 1A8UA 3OG2A 1T2NA 5LP1A 5CW2A 3D7RA 2XUDA 3K6KA 1UKBA 2DHEA 3VKFA 1CIJA 1LPSA 2WUEA 3A2MA 2QZPA 5AI5A 2J7MA 3F98A 2WFLB 2JGEA 3WZLA 5LKAA 4U2BA 4P9NA 3NWOA 1O59A 1XZMA 4H7JA 2VZTA 4Q3LA 5IVIA 4FKBA 1EK2A 3STVA 2VQTA 4UBJA 4FTWA 1JZ8A 1ZIYA 2BJHA 2DFPA 3DNMA 3W5MA 7YASA 3W05A 4AAXA 4EA6A 4FI9A 3C8HA 5JZBA 5E4YA 3WEZA 3ANSA 4W1PA 3AIKA 4L0PA 1VJ5A 3ESCA 2J1AA 4ZV9A 3ZPXA 1X2EA 3DEAA 4U2CA 5B4XA 1ZD5A 1VXOA 2C0PA 5DPNA 3JXSA 1Y7IA 2E26A 2WHPA 3VVLA 4ZY9A 1I5PA 4CU7A 2RV9A 1UY1A 3MBWA 4G9GA 1UMIA 3K9BA 1W0NA 2OQVA 3VDXA 1GUIA 4J0HA 4U2GA 4ZREA 1W4LA 2VF2A 5A6VA 4BE9A 2W87A 3V1NA 1P0MA 3BF7A 4H18A 1EI9A 1N8SA 3JYHA 1VKHA 1HDEA 4J0KA 1ZJ4A 3DOIA 2PQSA 2QT9A 5AP9A 5FXMA 3EBLA 3O4JA 4KWUA 4AO7A 1WM1A 3LE0A 5EHXA 4A41A 3Q0TA 4XVHA 1AZWA 2DDUA 3I6YA 5ALPA 4D9JA 1FFDA 4MYDA 4G8BA 1LZKA 2ZYHA 3HOBA 4QAWA 1ORWA 4UBOA 1WCYA 2O7RA 2JF0A 1G66A 4P08A 4W1QA 3HC7A 4AXBA 3NOXA 1TQHA 3HYSA 4C89A 2BUBA 4BVKA 1EDEA 1CLEA 1JYNA 1L7QA 3UNPA 2OQIA 3W9UA 1LPPA 2ZVDA 3HXKA 1Z68A 2W46A 4I3FA 1USWA 3P6BA 5J1XA 3G0CA 4ZI5A 1PX3A 2JD9A 4ZWNA 1OT5A 3DYIA 3D59A 3IDAA 3WF2A 4FBMA 4IH9A 2QM0A 4MQLA 4B85A 3WYNA 2VR4A 2V96A 3FLAA 4B9EA 4N8SA 1GU3A 2QMQA 1GMMA 1PJAA 3VD7A 4GEGA 3VJLA 3I2HA 4DSAA 2H1IA 2WIKA 4Y2RA 5T4BA 3FYUC 3O0DA 5AK6A 1GPKA 2CKMA 1YS1X 3LP5A 4NVRA 3DYVA 3VVMA 3E3AA 3T52A 1QZ3A 4FHZA 2IX9A 2ES4A 2O7VA 4KYVA 1EA5A 5ALMA 3ZM8A 4J0DA 4U2DA 5KBYA 1JI3A 1WCQA 5SYNA 2ZYRA 2EEPA 4QWWA 5AM2A 2VZQA 2BZDA 2AJ8A 1JI6A 5AHXA 1W9WA 5CT6A 4CU9A 1QIKA 3D2CA 4X93A 1L7AA 1BU8A 3V1KA 2Y64A 4X94A 4AB1A 1K42A 5C7GA 1DWQA 2J3QA 2XMSA 3HACA 4Y2QA 3DCNA 4KI5M 5A7FA 3C6XA 4UBMA 4OYUA 5HK8A 1R1DA 3D0KA 4DXTA 4EBBA 3B3QA 3U37A 4V2IA 3BDVA 1JYVA 3WNKA 4LXHA 1QJ4A 4DUXA 2OAEA 4YPJA 2YC2A 1DWPA 2VQ6A 4P93A 2FJPA 2VCBA 2PSFA 4KAFA 4LHEA 4QX0A 2FUKA 3I28A 1PV1A 2RHTA 4XUNA 3KWFA 2OKXA 2JGFA 4B82A 4E8CA 3G0GA 1FFBA 1XZHA 4TTGA 1CZSA 1AX9A 2VQUA 2CUTA 2I3DA 3C7EA 3W5NA 3FLBA 5LA0A 1GPLA 1PMJX 4PSCA 4X95A 2HYXA 2OGTA 4DEQA 3WK9A 3O4GA 3GUUA 1WB6A 2W95A 2WSLA 1E3QA 3Q8WA 1H22A 4OU5A 3GM8A 4QDOA 4X92A 1J06A 4MJ3A 4F60A 5D6OA 4WDRA 1H2YA 4TGLA 1VA5A 4OYLA 5JXJA 3PF9A 1SOMA 2XUHA 4X3CA 2XMRA 2DCJA 3IAPA 2Y2VA 2QJRA 3WLAA 1ZD2P 4HRYA 4GHWA 5AI8A 4BRSA 1UY4A 5AKEA 1QOZA 5HF8A 2ZEXA 4RPCA 1GQPA 5FV4A 2HA2A 1UY0A 5C8VA 1O8SA 2C7BA 2RVAA 3SX4A 1EDDA 5AK5A 1F4AA 2WTMA 2ZSHA 1XQVA 4IO0A 4WY5A 5T4HA 3QITA 4MO3M 2VMEA 3MV01 1WKYA 3AJAA 1VXRA 1MO2A 5BV7A 5CH3A 3WL6A 5AKLA 3IA2A 4TVKA 3ESDA 2LW8A 3L1IA 3J7HA 4KAAA 1U2EA 3WIOA 1CQZA 1GQSA 5JUVA 2DSNA 3VD9A 5LIPA 1BN7A 3ESBA 3I6MA 5FOQA 5JD4A 4ET7A 4KACA 3AIMA 2OG1A 4UPDA 2WU4A 3CN9A 4QDTA 2YXPX 5HZGA 5JXIA 4XJVA 1P0PA 1W6RA 1VE7A 2X8BA 1BROA 1DX6A 4MADA 1F0PA 2GBIA 4BAGA 3C6YA 2QQLA 5AKZA 3OG9A 5I8PA 1YCDA 2HRQA 3IUQA 4QDUA 4GWIA 3FN9A 3I97A 4IH4A 3G0IA 2VO5A 3CCBA 2WO1A 2OPHA 4ITVA 5D3ZA 5LZ9A 3I2GA 3ZLVA 2Q0XA 3S2ZA 2VSQA 4DMKA 3R40A 3ICVA 3T09A 1UK9A 2CMFA 5AK4A 2ZEZA 1EHYA 1CIYA 1OH4A 1XLWA 2OCKA 5AM4A 5KWJA 3HNMA 3H1AA 2J4CA 3BJRA 3ACIA 4QLAA 4BB0A 3N0TA 2VTFA 1TK3A 2ZYIA 1RP1A 1P0QA 4PO3X 3H0CA 4BZZA 2PU7A 1W8OA 2JGIA 4UHFA 1P8JA 3DL4A 4JHZA 3R41A 4EY4A 1HLGA 4GWJA 2XLBA 4HS9A 3WNLA 1JYXA 3W06A 3T2QA 3WKEA 3ABZA 4H77A 4Z49A 3FOBA 3ACGA 1ZIXA 2B61A 3EQ7A 1IQDC 4CUBA 3ACHA 2BFNA 4C6HA 4Y2SA 2WO2A 4TPKA 1C4XA 1R9NA 2VTVA 1M33A 1QIJA 4PW0A 5IKXA 3RM3A 5JATA 1QO9A 4Y2TA 3LCRA 2HU7A 2ZJ6A 1UYZA 1CZTA 3PF8A 1GQRA 3EIOA 3LS2A 2WHQA 4X91A 2ID4A 1EDBA 2E31A 5LKRA 4LPLA 3QMMA 4UBLA 3BXPA 4BTVA 2GYWA 2JEZA 4PT6A 3H2IA 5BWBA 2GYUA 4XVCA 1UZ0A 5DTJA 5CH5A 3FYTA 1CRLA 2G5PA 4UBNA 3WK6A 1YA8A 3M82A 1LNSA 4OUEA 2DCMA 3M81A 4QLOA 3R3VA 1CFJA 3QPDA 3CQOA 4KEAA 4N5HX 5HFNA 3DECA 2VL4A 3M3DA 3WA6A 4E46A 1UK6A 3V1MA 4NS4A 3PI6A 2RAUA 1SDDB 3CIHA 2HM7A 3HLKA 5AJHA 5ALHA 5AM3A 5HF9A 3B5EA 2FX5A 4AX4A 2VZUA 1FFCA 5T4EA 3PE6A 4CG1A 3GBSA 5FUMA 1QLWA 5AM1A 2OAGA 3H2JA 2ZJ7A 4BC1A 2YG0A 2VA9A 1CPYA 1I6WA 2H7YA 1U4NA 4FFVA 1ETHA 3WSOA 2W5FA 3T2OA 4C87A 5ALGA 5EIAA 1VE6A 2W1UA 2XHNA 2WAOA 2I3ZA 4D8MA 4OCZA 1MX5A 3KXPA 1GZ7A 2RONA 2C26A 3G02A 3L1JA 3LQCA 3O9MA 5IHRA 3D5EA 3CDZB 2J4FA 3K4ZA 2W9XA 1F6WA 2X5XA 2BUCA 4AN0A 2GBCA 2O2HA 2WBKA 2VC9A 3GELA 3QMWA 2C4XA 1RWQA 5K3EA 4B80A 1AKNA 1ZGCA 1A7UA 3C5VA 4MYSA 1F4HA 5AOCA 2J1SA 2PKYX 4Q05A 3QPAA 2VCCA 4HAIA 2YC4A 2WDBA 2EIBA 2HDWA 2WQ8A 3QMVA 4KE7A 4JYPA 4ZGBA 5DYYA 4X97A 4LXGA 5JADA 2W91A 4LHSA 1EVQA 4GBGA 5I7UA 4UAPA 1BE0A 3FVTA 4GECA 3JWEA 3T0BA 3U0VA 1CUUA 4DM7A 4K5QA 4F21A 4BATA 4BCCA 3WF3A 2WUHA 5AKKA 2WU3A 4Q82A 3DD5A 1MPXA 4G8CA 2HA4A 3STWA 2HA6A 4NZZA 1AMNA 2QS9A 4CFSA 2XUJA 4W50A 5LA2A 1Q0ZA 4AG4A 3B12A 3C6BA 5ALDA 2XDWA 5DQ0A 2WFMA 5AI6A 1T2XA 2C9KA 4E8DA 3A2NA 5CURA 1J2EA 4UI9L 3O9VA 4JH0A 4H7EA 4UHBA 1T4MA 4OSEA 2VEOA 4WDQA 4D0QA 4N5IX 1R9MA 4JUIA 5T4FA 3OGRA 3I1IA 5DYTA 1TCCA 5AICA 4F0JA 4I4CA 1EB9A 4DIUA 5HF6A 3QBJA 1HBJA 2QKYA 1OF4A 1DQYA 3A70A 2BUAA 4JKMA 3MGAA 5AI4A 3C8DA 4QB6A 4H7HA 2LS6A 2I03A 3F9CA 5LZ4A 4H7KA 4ZRDA 3SKVA 2QJWA 4M0FA 5JAUA 1XZGA 1UKCA 2IIVA 1MT3A 4J0GA 3HEIA 2WUFA 1TCBA 4EY7A 3THCA 3BJMA 1J84A 2VM9A 5EFZA 3GA7A 2VZ1A 3M83A 5LLSA 4P00B 1JZ4A 4XX1A 4J3JA 2OCIA 1JKMA 2JKXA 3WNMA 4W9RA 2AJDA 1NAEA 3UESA 1Q83A 3ED1A 1A8SA 3R3ZA 4ARBA 3HRHA 2V5DA 2Z8XA 5AIBA 1MAHA 3MV11 3ECQA 3BF8A 5A7GA 2YH2A 4Y2XA 3SWWA 2PPLA 4WY8A 2YYSA 4DSZA 5ALOA 3PUHA 5JMOA 1IUOA 2BERA 1XZDA 5ALYA 2WJ4A 2V72A 2HRRA 3WIBA 5EHZA 5CH8A 2HA0A 3CMGA 4PQEA 4RNCA 4B0OA 3EQ9A 3STUA 1ISPA 5B4NA 4QB2A 2WJ3A 4Y2UA 2I78A 2QUAA 4XUPA 3R0VA 1QIGA 1CR6A 4K6HA 3OTQA 3F8SA 4H7DA 4RE6A 3HEAA 2HADA 3HN3A 4Y2PA 4G1FA 3H19A 4AMZA 2BKLA 1WPXA 1W8NA 2YFZA 2VJXA 2R8BA 1IMJA 4UFOA 1CUJA 1OILA 3WK4A 1X2BA 5K3BA 1YAJA 4C01A 3F96A 1QGED 5LZ7A 1W9SA 1G5FA 3D4LA 1J83A 4E15A 5LA1A 2QQKA 1OXMA 4CG2A 1CUDA 3R3XA 1HPLA 2QXUA 1DT5A 4P5YA 1MX9A 2XONA 1CUZA 1XZIA 3ZLUA 1CZVA 1CUVA 4W8JA 2XQJA 1XQWA 2WILA 4JEIA 1TVGA 1US2A 2QQNA 3A7QA 4CVUA 4OPMA 5JAPA 5ALQA 5F4ZA 4EZIA 1ZI9A 1UK8A 1CUEA 2HL6A 3R3UA 2PSHA 4MGQA 4HG6B 4KJXA 1GNYA 2XE4A 2L9LA 5D7BA 3G0BA 5C7YA 2J1TA 1K8QA 4DMFA 3G9ZA 4K2AA 4BC0A 1VA4A 2V4VA 2XUQA 3SEEA 4GWLA 3P2MA 2PUJA 4KRYA 4C4ZA 1UWCA 1U8EA 3PFBA 4YK7A 3G8YA 4KAJA 2JGJA 3V48A 1J1IA 2P8SA 3C45A 4UHCA 4FLMA 2XUGA 1UMHA 2J1EA 3T08A 5JANA 1GKLA 2PU5A 3OOSA 3DDUA 1B6GA 4WFJA 4YASA 4CCYB 2W1WA 4A4AA 3QM1A 2Y6KA 5ALLA 3EYPA 1HQDA 4HXGA 1FJ2A 3GROA 1GT6A 2HFKA 3IULA 2V97A 4BDTA 4Q3KA 2WUDA 4UHEA 4WCVA 4J7AA 4X85A 3T2PA 1R50A 2XUKA 1BS9A 3GGLA 2VMCA 3L1HA 5DN2A 5FUIA 3A22A 5FDFA 5ALJA 4DUWA 3D2AA 1DLCA 5LZ5A 1UY3A 4M0EA 4CU6A 2DCKA 2X09A 5AIAA 2HLEA 3T0DA 2VJCA 2WFLA 3W04A 1WPRA 3KDAA 2CDPA 3WK5A 4EHBA 1ACJA 1LPAB 2VJBA 2OGZA 2J1RA 3BE8A 1LPOA 3K77A 3HJUA 4IQ4A 4RN5A 1J07A 1FSSA 1MNQA 3UETA 1ORVA 3HABA 3MUOA 4OYYA 1W9TA 5H3HA 1LBTA 2WJ6A 5AKGA 4QDZA 5JXGA 1MAAA 3H1BA 4QDXA 2CJPA 3C7HA 3ZI7A 3WK8A 4FWBA 2K2QB 4OD0A 4B7ZA 2HHAA 5C81A 1DQZA 4QX1A 4PF1A 4Y2YA 4FNGA 4PV7A 2HIHA 2DR0A 1N5RA 1VLQA 4DXSA 2JGLA 1EK1A 3WWOA 4L72A 4MGSA 5C8ZA 3JW8A 5ALRA 4O08A 4S0XA 5K3FA 2ONCA 5DNWA 5DLPA 2QQIA 2XUPA 2WZ8A 1W76A 1XLUA 5HQ3A 3DYMA 4KE8A 4K6GA 3DQZA 1EH5A 2HA7A 1UOOA 1TIBA 3IVMA 3DOHA 4QEKA 3CXUA 3WMRA 3C5WP 1ZOIA 4DYHA 4W63A 4XWGA 5K5EA 4QE3A 1CV2A 4AMYA 5IVHA 3PFCA 1L7RA 4BVLA 3PDCA 2XMDA 1XZEA 1ULOA 4J0IA 5A62A 5CT5A 2VAXA 4BCBA 3BN6A 4BK5A 1QO7A 3FHQA 2WO3A 2GYVA 3EB7A 2RJ2A 1UFOA 4BAZA 4QA9A 2OXEA 1R88A 1R64A 3I3EA 1E5TA 4WFKA 4MEAA 1QFSA 3WF0A 2ZEYA 4ZZ8A 2E33A 1G4HA 3KOOA 4LQRA 1TCAA 4HVTA 4OB8A 5C71A 2VOTA 5JZSA 4KE9A 2HU5A 5AH0A 1C7IA 3A21A 4BXSV 1O6FA 1YB7A 2Y6GA 3FYUA 1US3A 1JMKC 5DNVA 4OMDA 3WK7A 1E8DA 1NU8A 2C0QA 1N5MA 2PBLA 1BEZA 2XQIA 4M4PA 3IBTA 1NUKA 4XUQA 2W47A 2OCGA 1LGYA 2QXTA 1Y7HA 3R3YA 2W3JA 4BP9A 3I3DA 5IJRA 4N8EA 2WAAA 3NRUA 1BHGA 1O6GA 5JD5A 2W1QA 2VJAA 1LPNA 5AKXA 5ALNA 4BCDA 3FSGA 2C58A 2Z3WA 2AJLI 3ZLTA 1JZ3A 3DLTA 2JEYA 1JZ5A 4U2FA 1YSCA 3WZMA 5EHNA 4GDMA 1UK7A 4QDSA 3WWPA 3WJ1A 4E14A 4UOJA 2VT7A 3VDBA 1S8OA 1XROA 1CX1A 1XKTA 2H7XA 3FCXA 2HU8A 1JT2A 2DHCA 3NQHA 3OGSA 4MOAA 3WL8A 5K3DA 4DGQA 3FVRA 4Y2JA 5D3KA 3STTA 2W22A 3QPCA 5ALIA 3FCYA 3V9AA 4BP8A 4LKSA 1LPBB 1C7JA 3NGMA 2VAVA 1ZD3A 3C43A 5AKJA 2BGNA 3A23A 4ZXEA 1GGVA 4MQMA 2PX6A 4OZOA 4MXDA 3CKHA 4BRZA 4A45A 4UUQA 3AINA 4G9EA 3AIOA 1SCKA 4QWMA 3VD5A 1MN6A 4KRXA 5K3AA 1YS2X 5AKIA 2R7EB 2WN2A 2BGRA 2WIJA 4EY6A 3N2ZB 4UFNA 2RIPA 3PUIA 4BVJA 4YPVA 1UOPA 2VCAA 2JGMA 3IB3A 1WHTA 2QBXA 1YA4A 4LYEA 2HA3A 1DU4A 2VT6A 4LIPD 2PSDA 1W99A 3DJYA 1EINA 3AUKA 1BCRA 3F97A 4XUTA 2C5FA 1H6YA 2OGSA 3FYUB 1MJ5A 1QONA 3BWXA 2EIDA 3S8YA 5E4TA 3WWCA 3CZJA 3OEBA 4GXNA 1GPNA 5JASA 4E11A 5K3FB 4HXFB 5HKAA 3AFIA 4I19A 2ECFA 1KU0A 5ALTA 5AO9A 1UY2A 4Z2AA 3VDAA 1N1MA 4A23A 5JAHA 1CUSA 4QPWA 3OB8A 3UUEA 3BL8A 5JXHA 4WJLA 1EVEA 5CMLA 4Q34A 2JE8A 2O2GA 4H7IA 5F7UA 4DNQA 5BWCA 1ZD4A 1HN1A 2VATA 1XZBA 5ALZA 3LIIA 4GLBA 5EHQA 4J0JA 2OCLA 1UYYA 5EGNA 4B9AA 2HA5A 2AJBA 3FLEA 3K4DA 2D5LA 2XMGA 3K2IA 2EIEA 1CUIA 1XQXA 4KMQA 4C88A 3OEAA 3I2IA 1CUXA 3LPGA 2XQFA 1BN6A 4G8DA 3MUY1 1UZAA 1CUFA 1UWWA 4X90A 2XUOA 1SHWB 1UXXX 5IFTA 3GXUA 4EY8A 3MUZ1 2XLCA 1AGYA 5G05L 1LPMA 5ALFA 2AJCA 4Q1VA 1JYWA 4ZV7A 4XUOA 3WWDA 3NNGA 2ZJFA 5ALEA 3HJRA 5SYMA 4BDSA 4G5XA 3GFFA 5EIYB 4EY5A 1IZ8A 1GKKA 5DWDA 4L9AA 4DEVA 4C4XA 2J3DA 3WA7A 3IUMA 5A2GA 5AKHA 2Z4FA 3RK4A 5EJ1B 1THGA 4L3WA 3V1LA 2XI4A 1PX4A 5CT9A 3A6ZA 3IURA 2ZSIA 1FFAA 4AZ0A 3K46A 2Y6JA 2QQOA 1W75A 2JBWA 1QE3A 3F67A 1G42A 1XZLA 1BRTA 1W52X 3WL7A 2QVBA 2VZVA 2JGKA 1SFRA 2RI6A 1WB5A 3SK0A 4P02B 3DKKA 1TAHA 4L0CA 2WIDA 3BIXA 4Y9SA 1TRHA 2PSEA 2EDCA 5AM0A 3PICA 3E0XA 4A16A 2OLEA 3QZUA 4Y2VA 3IIIA 3VD3A 2X05A 3WQBA 1YASA 3STYA 4AO6A 5LCWL 4PSDA 1GOGA 3E1F1 2W1SA 1XC6A 1VOTA 3AZQA 3D2BA 3H2HA 3NJXA 5DYWA 1XZCA 2V9ZA 2ORYA 3LEGA 1DX4A 3C7OA 2XUFA 1PMHX 3OM8A 4B83A 2PL5A 1ZICA 2J22A 2VZPA 3SEPA 1JZ6A 1IUNA 5CBKA 1MNAA 1FFEA 3K4AA 2ZYSA 2IITA 4ARXA 1XZFA 1YR2A 2H9YA 5A7HA 4QX3A 5CZKA 4B6GA 2PM8A 1K3IA 4XZUG 4CUAA 1AQLA 2XQGA 5I0DA 5E4JA 2Y6VA 1XRRA 1CUHA 1F8UA 3FL7A 4DNOA 3TRDA 1QTRA 4X00A 3G0DA 2Y8KA 5FKJA 4ETWA 4BBZA 1CUCA 1CVLA 3AZPA 1JJFA 2EDAA 3AZOA 3ACFA 4H7FA 1UX7A 4JYMA 1CUYA 4G4IA 4C4YA 4OUKX 3DL7A 1MTZA 3HNBM 4TXWA 1JHJA 5A1AA 4GZ9A 3I2FA 3TEJA 1EX9A 1QIEA 4OB7A 2J1VA 3W9BA 1EXWA 1P0IA 1O8PA 5JR2A 5IVDA 1XRMA 3AILA 2QQJA 2CEKA 1VZ2A 4BDVB 4QDRA 1Y37A 3C87A 4X71A 4OB6A 2KD7A 3ICWA 4A44A 1KEXA 4W4ZA 2WG0A 4F5ZA 4DMHA 5HK9A 3FSGD 5ALVA 4W1SA 1IZ7A 2CBGA 4GI1A 5HCUA 4X6UA 4JKKA 4UBKA 2X10A 3G9XA 3QVMA 5IH7A 1E8NA 4OMCA 2E3JA 3H2KA 4IH1A 1JJIA 2WYSA 1R4ZA 2XT0A 3C7GA 2X76A 3WWEA 5EJZB 3WNPA 2ACEA 1EUTA 1BCSA 3KWJA 4J03A 3IUJA 4EB0A 1DYOA 2XMQA 5FLKA 4K6KA 1UYXA 2XOMA 3I2JA 3X3HA 3VDCA 5FPQA 1QIFA 1QFMA 3HNYM 4NMWA 2V98A 1CUBA 2UZ0A 1UOQA 1XZJA 3ZV7A 1Q0RA 3WKCA 1XQYA 1ZI8A 3OBAA 1YQ2A 4QZVA 1QIIA 4BAUA 3NUZA 4HXEB 1TKRA 4FLFA 2VMDA 4UHHA 5CXXA 1X70A 3E1GA 3DKRA 5JYCA 2CDOA 1DWOA 4IHAA 4A42A 2WIGA 2G5TA 4DXRA 1K6EA 3VISA 1QIHA 3T0AA 2QOEA 1QIMA 2J1UA 2WG1A 1K12A 3TJMA 3VJMA 4CCWA 1JFRA 1ZJ5A 1DP0A 1B41A 3THDA 5HFAA 5G04L 5FPPA 5HKBA 4Y7DA 4DMCA 1GOFA 3BDIA 2VJDA 4M0MA 5FP0A 5AOBA 4MEBA 4A5SA 1SCIA 5JIBA 3W2TA 4BYMA 4ZZ5A 4XURA 4DLNA 1THTA 5K3CA 1XLVA 1XZKA 3OC0A 5CXUA 4G4JA 1LZLA 3U1TA 3WQHA 1JU4A 1UT6A 5ALWA 3ESAA 3O4IA 1JZ7A 4RE5A 4DNPA 1DTEA 1Q84A 2WHPB 1CEXA 3OURA 3ETPA 3CZUA 4FMPA 3SC2A 1EB8A 3IUNA 4X6YA 3G9TA 1XNAA 5ISMA 3OPMA 5BOVA 3QH4A 1H2WA 2WABA 3I1YA 2Y6HA 5DNUA 4ROTA 5KWIA 1ODSA 4FDMA 5HXMA 4KE6A 1YAHA 3VXKA 2B20A 4DNFA 4EUSA 4CCYA 1OCEA 3RLIA 1TG7A 2DQYA 2PVSA 5LZ2A 1E66A 5E2IA 4BJ0A 4U2EA 5IYYA 4MWSA 1BEEA 5CTAA 4FFWA 4INZA 5CYYA 3WL5A 2BBAA 3DYPA 4GW3A 5DJ5A 2WM2A 5A71A 3BGAA 4HRXA 3NJVA 5YASA 4LXIA 4QDQA 3H2GA 1NKGA 1HKHA 2RHWA 3WKDA 3WYDA 3MVEA 1UKAA 2GBFA 3T4UA 2CB9A 3QYJA 2XUIA 2GZRA 3LLCA 2VZ3A 3G9UA 5JZ9A 1XPWA 4DTCA 2WFZA 1AUOA 4B0PA 1CUGA 3FWHA 4UHDA 1KGYA 2BGPA 2B9VA 3F2ZA 4A6OA 1YB6A 3FBWA 4IUGA 3SKJE 1XNTA 1XRNA 5DTIA 3D3NA 3C6ZA 1NX9A 1LBSA 3K75B 2Y6LA 1UXZA 1DINA 2VZSA 4X7BA 2WKWA 3OGVA 2Z5GA 5LYYA 3HZOA 1WHSA 2WIFA 3EF3A 3UMJA 2HFJA 3HSSA 5EIHA 3G7NA 3C70A 1QTIA 3E4DA 1OD3A 2VMFA 1A88A 1AURA 3DS8A 1XZAA 5IFPA 3LEKA 4DUVA 5C8XA 1ZI6A 2PSJA 4ZXFA 5FRDA 4UFPA 2QTBA 4JX0A 3C7FA 1NU6A 4PNZA 1K5PA 4XIIA 2WTNA 5CT4A 3KD2A 2QR5A 5KREA 3A2LA 4FNMA 3LEIA 2Y2UA 3HPNA 2ORZA 1IUPA 4LYDA 5AK3A 3WKBA 4P92A 4B84A 1SCQA 3CN7A 2QUBA 3WF4A 1VZ3A 3ZWQA 4A3ZA 5CRIA 4LKOA 4JKLA 3I2KA 1SC9A 1GOHA 2YFUA 1XFDA 4AO8A 1H6XA 1H2ZA 3FNBA 2XQXA 4ARAA 1ODCA 3TGLA 5ESRA 3EQ8A 2JDAA 4G4GA 4AQDA 5C70A 3BIWA 3WI7A 2BCEA 2H7CA 2EICA 5HF5A 2Z8ZA 2E32A 3R3WA 3WNNA 4KR0A 4H35A 2NW6A 2Y6UA 5LZ8A 1OF3A 1LLFA 5JALA 1CQWA 2WLSA 4CG3A 3RARA 2VZRA 1ODTC 3FAKA 3VJKA 4QNNA 2W94A 1RYYA 1QIDA 2QRUA 3GDBA 1K45A 2WG2A 2WQZA 3HI4A 1D7PM 1ULPA 2YB7A 1H23A 1UXOA 4CIBA 2G4LA 3D3AA 2DHDA 5JD6A 1ACLA 2Z3ZA 4BZWA 3WF1A 1R3DA 3ANTA 4HTAA 2R11A 3H18A 5AM5A 1JJBA 3YASA 3WNOA 2G63A 5AOAA 2BAGA 2ZEWA 2JIDA 2XUAA 2C4HA 5ALUA 1H2XA 3IAQA 5JARA 1XRPA 4UBIA 4BE4A 2VZOA 4JNCA 2LIPA 1HL7A 3LIPA 4X6XA 5EI5A 2CZQA 1IVYA 2WZEA 2XB6A 3AC0A 4W1RA 2GZSA 2ZXQA 2Y1KA 5ALXA 5I9IA 3FHAA 4CI9A 4PQQA 5HPOA 4QB1A
chains in the Genus database with same CATH superfamily
2QBYB 2XQKA 1XTKA 1KSHA 4N8DA 3UHOA 1N8TA 2P40A 3EDYA 1JSZA 1MX1A 1E8MA 2ZTVA 4WINA 5CB8A 3N9LA 1GA6A 1W1IA 4YRRA 1U7ZA 3UWKA 2ZSKA 2BZSA 2QQMA 2QRZA 4FMCF 3PIIA 3LVQE 4NSNA 1N0UA 1E1CA 1GRQA 4X20B 1HY3A 1PNRA 3X1YA 1VSVA 1MV8A 4TROA 1MVNA 2FDHA 1SQ5A 4Y9DA 5DG1A 3ER6A 2C8LA 2O2IA 3NNNA 1VB4A 3ZV3A 1QCCA 1N2IA 4Q3CA 4MAMA 2HF7A 1TM7E 1Y33E 4FBLA 1NW8A 3UCXA 2BEKA 4NFSA 1I3HA 3A37A 2PAAA 5A5VA 1X1CA 3DBHB 2XMPA 1U2TA 3WHLA 1VRVA 4DCJA 3DYOA 1R15A 1N6OA 2H57A 2ZYAA 1LRLA 5FEUA 3O5SA 4NE7A 5FL7D 1KDKA 1A8UA 4LQ4A 3VV2A 2RGRA 4ISQA 4I1IA 3D8BA 2QZPA 3WCRA 4ZARA 5F3WB 5B30A 2JGEA 3LV8A 1MJNA 1LK0A 3FNGA 1M6NA 3SZUA 1APNA 4WEOA 3WGYA 1Z0IA 4COYA 1YC61 2OO3A 3FB1A 3BMXA 5IVIA 5EE5B 5G3YA 1WCDJ 2HWYA 4N6OA 4AF9A 5C1OA 3DN7A 2X77A 1IN8A 4L0PA 1CGPA 3FGOA 3V0BB 3O1TA 4N9QA 3B1VA 1ZD5A 3T0FA 2HI0A 5JPNB 3JXSA 1X7YA 3MIBA 3K30A 3FWNA 1RINA 2FWMX 1B93A 1CZUA 3K9BA 1IB0A 4CVNA 1QRUA 1G7SA 4C0XA 2PQ0A 1SOWA 5HGXA 4FGKA 3JYHA 2GPBA 1GTJ1 4DIEA 1E9VA 2DPGA 1EDZA 4PAOA 4XVHA 1QJFA 2CHQA 4F5DA 2ZYHA 1GZTA 4UBOA 5F33A 1UBRS 1QHFA 3WNDA 3I01M 1PR5A 1PL7A 4ZAWA 3TUIC 3HC7A 4LGCA 1ZZ6A 5L19A 4BQFA 2RDRA 3LPLA 2BUBA 1I2DA 2W5UA 1U9IA 4QXRA 4ZANA 3B85A 1ZH8A 5FPSA 4R9DA 1L7QA 3T7AA 3RVQA 1Z68A 1BMQA 2IXFA 5IXSA 4Q4Y3 1SN7A 3AMHA 3U78A 3E03A 2PYTA 1B1CA 5EMKA 3WF2A 3K48A 1AL0G 1R091 2HD4A 3OZXA 5JCZA 3SVLA 4RL6A 4H27A 1L7EA 3M3IA 3U7IA 3FLAA 4RY9A 4NDNE 4GEGA 3VJLA 1RWPA 2BFAA 1KVRA 2FY8A 5EUBA 2P41A 5K3SA 3A4TA 1M7HA 2BH2A 4EG0A 3AX6A 2P69A 2OV2A 1F8FA 3L02A 2A7QA 3ZWOA 4FYYA 5H81A 1DAGA 1ONPA 5KSZA 4Q1CA 1OLQA 2FRXA 2RKBA 1GYPA 1W34A 4U63A 5TRTA 2HHCA 4NTZA 3LM8A 2QN7A 4X93A 1L7AA 1O4VA 1XKQA 1K42A 2FR8C 4MUGA 5HIKA 1AIPA 2WP8J 1VL2A 3QQ5A 5HK8A 1D4ZA 5LD2B 1DMSA 1QJ4A 2A4MA 1YL6A 2Q8DA 4QX0A 4LKDA 2FUKA 3KWLA 3E9RA 3ULKA 3GI1A 1H6CA 1Y6GA 3W1WA 2H4FA 3K53A 2XWPA 1LB1B 1Y6JA 1DDOA 4WXHA 5DXFA 3H1TA 4PLWA 4F93B 1UO9A 4NESA 4TTAA 3EZ2A 2CUTA 5FTMA 1VKOA 4DLUA 3AI1A 5TF0A 2M9MA 4AMGA 5KYXA 2PN1A 2FPPA 3VKLA 3OF1A 1C8M3 5BNFA 1RC8A 3BGSA 2FDJA 2Q5CA 4GMGA 2VWQA 4X92A 1IRXA 4BX2A 1N3PA 4MV2A 1G9BA 5CG9A 4RY2A 1NL3A 4LLFA 1I7SB 2QQVA 4GHWA 1UY4A 1QOZA 2HPAA 1JHAA 3WADA 4WBNF 3UH1A 5CAEA 4A6SA 5L7TA 2FX2A 4M89A 4I9GA 4QD3A 1DVRA 2W0XA 3FLPA 4GVLA 1P5JA 3R9IA 4QQ2A 4G9SB 3HCOA 1O94C 2AUMA 1SLLA 2BZ1A 4GOJA 4PVDA 5JNRA 3J7HA 5BV2P 5CFNA 4KAAA 4G84A 3T7TA 4KGVA 4AC9A 5ABJA 1CJCA 4RY8A 1TME2 4HF7A 5HZGA 4FJ1A 5DBOA 4BVGA 4QGBA 4XE5A 2TECE 3AY6A 3IUQA 1E3EA 2QG4A 2R6CA 4E5VA 5LA6A 2EFJA 2P4EA 5EJ4A 2A9OA 1YUNA 3N53A 2P30A 4M54A 3R40A 1Y8CA 3QWBA 2CMFA 3GF6A 3VDQA 1OH4A 2Z8YA 5KKAA 2HWD2 3FPHA 1SEPA 1RZ3A 4RGAA 1UJ5A 4KQWA 2YCLA 3KKNA 5K8LA 1DE0A 1FNSA 1GNQA 4WLFA 4BVHA 3TOXA 1A97A 3G8BA 3R41A 1O58A 2AC2A 1HLGA 2FDFA 3QI7A 3RIGA 4EI7A 2AOUA 3TPCA 1LLQA 4DC0A 1NHWA 2X19A 3ICEA 1N1EA 3FOBA 4XLZA 4BO3A 2WD7B 4O65A 4W6WA 5K0ZA 1MORA 2PKQP 1KZ6A 4TQ9A 1KRHA 1EGQA 1W4CA 1Y7TA 3LUDA 3KJNA 3RM3A 3HBFA 4KV7A 2V7BA 2CL0X 4AGRA 1GQRA 2WHQA 2ID4A 1EDBA 2QF7A 5LFAA 4XQGA 4EJ0A 2HTEA 2OMKA 2PKCA 4W82A 4LF8B 4C05A 1I33A 4JDPA 4LY3A 2XKBA 4J6GA 2VRCD 1FTNA 4ASLA 3O8CA 2DCMA 2GAAA 3I59B 3R3VA 4NOKA 1X7GA 3RSLA 1DWUA 1HMYA 3DECA 5ARDA 1NI4A 1U28C 3PI6A 4H4DA 3N35A 2EXIA 3D6FA 2BFMA 4NC9A 5JQWA 4QQLA 4Q5OA 5BNPA 4NHOA 3SGLA 5FUMA 3M34A 5GADl 4BC1A 1I6WA 1G5HA 2Z2JA 4J4BA 1PO23 1W1UA 3AKDA 2UYGA 4GS5A 1ETHA 4M3CB 3NKFA 3IDEA 2ZG6A 3FR7A 3TXAA 5I8WA 1MZVA 4JYZA 1ZU4A 3LTEA 4HN0A 3BFJA 4F4CA 1FX1A 1QP4A 1QRRA 4P33A 3AONB 5BSWA 4DCCA 4IJQA 4B4PA 2GBCA 3ZR6A 4DV3B 1V4VA 4MR9B 4I66A 3OTGA 1CZRA 3M3EA 4MYSA 4UMFA 2PO7A 1L7BA 1QUEA 3QVJA 1OVMA 4OUDA 3OMWA 1LX6A 2FQWA 4EPWA 3U0VA 3MTEA 4BATA 1DPFA 1NMQA 4NBRA 2JFOA 2WHXA 3GLVA 3PNKA 5CFDA 4NZZA 5BSTA 1R4NB 3GBPA 3HRIA 4MV6A 3QX7A 3MWFA 1IYZA 4URXR 4X8NA 4DRVA 3PJYA 4K0RA 2OM6A 1E60A 1J2EA 3O9VA 3P9PA 2JJ6A 2K5UA 1DHRA 3A05A 5G02A 1H2MA 4C4TA 4KI7A 4LYHA 4DRXA 1QUFA 2JI9A 3UJBA 4E70A 1G0NA 3DKIA 3A6PC 1PJ4A 1RKXA 4UXJA 1AGRA 4RKWA 2OKCA 4DMMA 4FGLA 2DU0A 4NS1A 1XVVA 4H59A 4PLPA 1AMOA 1JIIA 2GC1A 4ZYYA 2Q3BA 4J0GA 2SLIA 4MW0A 5KC6A 1J84A 1E5DA 2ODWA 1Q5OA 4MS1B 5G1OA 2CBZA 3FMIA 4KOAA 5BNZA 1NPDA 4B6QA 3C1TA 3P8ZA 3WL3A 4GYWA 2BSXA 5A7GA 2D5AA 3CIFA 4MX8A 4KQHA 3RC2A 1FDRA 2HA0A 1GLHA 3ICCA 1AN0A 1IM5A 2JJ8A 3ZCPA 1KARA 3OPQA 4MUMA 4ZVPA 1Z4IA 5NULA 3ENKA 2QORA 4RFVA 3NAZA 5EWMB 4GMP3 1H4SA 4G1FA 1DOHA 3KKOA 2AFVA 1PZ9A 1W8NA 3UG6A 3NNMA 3A4IA 4AHYA 2M98A 4IZIA 4NY1A 2XJPA 3OQHA 4KO2S 1FMCA 2VF5X 3AESB 4KI0A 2R3SA 3TRIA 1QGED 1W9SA 4LULA 5LA1A 2WZR2 5C9AB 4JP2A 2PS3A 1IXYA 1CUDA 4N7BA 3RVOA 4P5YA 4C4AA 3BA6A 4HZUA 1VLVA 3FTCA 1GILA 4W6YA 4RSGA 1H93A 4WNAA 4YR7A 1OLUA 3EWNA 3EQ6A 3PVSA 3C8ZA 3UB2A 4HHEA 4A8HA 1F9AA 2NV6A 4JMPA 3UFXB 1B26A 2IXCA 4QO8A 1GNYA 2ZS8A 3SBXA 2L9LA 1ILEA 3FLTA 4JYBA 2ADMA 4CTMA 3L93A 2UYAA 4PPGA 2P65A 3ETEA 1VA4A 1QH1A 3MERA 1N1DA 1Z8FA 1E0JA 1HYQA 2O14A 2ZIAA 4V0NA 1M10A 2PRSA 4TMKA 2G4CA 3IIEA 3HWWA 2EZ9A 1WDLA 1VPVA 1I6KA 1SCBA 4C20A 2W1WA 1A9YA 1HE4A 2PWAA 2BBSA 2W2MA 2R5WA 1LNZA 1BXGB 4CCOA 5E6SB 2JB9A 4MS3A 4PBSA 3DLHA 2XJ4A 4OG2A 4K21A 3ORYA 1GYKA 5ICCA 2ZRMA 5LZ5A 4E4YA 4MRPA 1X94A 3REQA 2WNUB 3K0BA 1UP7A 2J1RA 1LPOA 2JAPA 3ZIUA 2VUTA 4IVQA 3LYUA 5CHYA 2X29A 2NXJA 5H3HA 5EXDA 4OMUA 4QU2A 5IUKC 1RPJA 1N8NA 4GU5A 5LQJA 4IV0A 4F1KA 3GJAA 3L0ZA 2C95A 3Q10A 5H1YA 4FGUA 1UX6A 4BNDB 2OXIA 1LX7A 3NBKA 4GD3Q 4RACA 4YQFA 1D4VB 3SHRA 3W34A 4LE3A 4IQ0A 4FSXA 5JRZA 1DFHA 2Q2QA 3L1KA 3VR4H 5A62A 1TPZA 1MIOB 3H1GA 3QEMB 2QU7A 3NIDB 2WTUA 3K9NA 4JJ7A 1FUIA 5ELLA 4YT2A 5CNAA 2AW5A 1PGW2 3OZDA 2A9PA 1IQPA 4H0FA 4OJYA 5DBIA 1RJDA 2CV6A 1MS9A 4DAEA 1R5OA 4BFWA 3EDQA 4MGIE 4IIYA 4W8OA 5JZMA 5GP1A 4ND6A 5DGIA 2GH1A 3X1WA 2ORVA 1U2GC 4CR6A 3U4QB 1LGYA 3FUOA 4BP9A 2FR1A 3LFTA 2BOVA 4UUMA 5G0UA 3UK7A 3ZW7A 3B60A 2IY7A 1Q7TA 1SQ6A 2ES3A 1EYBA 1S8OA 5FPYA 3D0RA 4MKHA 2EFEB 3TLBA 1DIRA 2G80A 2VUHB 3AOEA 5K3DA 5CLHA 4K6MA 5ILQA 1IKQA 1MS5A 5KOIA 4DPMA 5DV9A 3UN1A 3G5TA 1ZW6A 4UUQA 4E21A 4KVFA 3AFHA 1MN6A 2XYVA 3KLOA 3MIZA 1EWQA 2FDRA 1EFTA 4EQZA 2MHCA 2WB4A 3EAFA 3PVOA 2WJSA 1WHTA 2PVCA 5T8KC 1FTYA 1H9WA 4I3GA 2ZULA 2PSDA 2CHEA 4X66B 5DUWA 3DD1A 4R0NA 4AWBA 3V65A 3TKYA 2FPLA 5KHJA 1UADA 1FZTA 4EKYA 4ETIA 4E5DA 4IGFA 3I9OA 2PG3A 2EIDA 1Y0BA 2JJYA 2VNIA 5IVBA 3H1WA 3JRWA 5EEHA 4RR3B 4M1WA 4GULA 2EU8A 3NTRA 1ZUIA 1POV0 2FEMA 2YWJA 5AVWA 4LZJA 2Y0EA 1K98A 4G1CA 3AG5A 2QZZA 4MVJE 4JB3A 1KEWA 1KQFA 3H4TA 3NJRA 5LQSA 1MA0A 1WY5A 1ZUD1 5KNBA 2W2KA 2WOJA 2XEDA 3LY8A 4YP5A 5CFCB 4YQZA 1R082 3DR5A 2EXHA 3LUPA 3AV3A 3TX2A 3L0SA 3ZK7A 4CW7A 3GFFA 4BQRA 3TXXA 2WYWA 3O83A 2GH8A 3QTBA 2Z4FA 5HKLA 4LJKA 3WG2A 4OHKA 3OPZA 2O4CA 1N1YA 3ZY6A 4A91A 1IQUA 3IQXA 4XF3A 4G5SA 1FPN2 1EV12 2GPSA 2PV0A 3T1QA 1MJHA 1I51A 3BQMB 4L8VA 1TAHA 3RYIB 3ABIA 1T0UA 5CCXA 1QMGA 2YX1A 3L8FA 4WEQA 1IH8A 1Z6PA 2RH9B 4EG3A 4EN6B 4F3KA 3L8EA 1L4YA 4XYBA 5DYWA 2OKGA 2ZACA 4D5EA 4QT6A 4YVWC 1OB5A 1ZWLA 4HYTA 1NMEA 5D3QA 1W7AA 4QUIA 5E9AA 4WVZA 4ER6A 3TAYA 4RR3A 3V6LA 1OFHA 1ZITA 4MJLA 1XZFA 1UU5A 4C0QC 3ZU4A 2PQQA 5TE9A 5L7OB 4DNOA 2PE5A 1YVEI 2IYRA 4IMRA 1JJFA 3UOGA 3QPBA 1YS6A 1RGSA 1VBA2 3ROFA 3DL7A 1MTZA 5M7EA 2MYPA 4E5MA 2J1VA 3ZOKA 3OZAA 5HCHA 1M1YB 4N3AA 2WVGA 3WICA 1QU3A 4ZVQA 2QTWB 4BGDA 1XJ5A 5HK9A 3NV2A 3SF0A 2PMBA 2YXEA 3QLJA 2ONYA 1INLA 5JEEA 2WNHA 1L7OA 4DMLA 4BMEA 2IF0A 2E3JA 2W71A 3H2KA 4AJJA 2X76A 1Z3CA 3D0OA 5I9TA 5EJZB 3PC8A 1EUTA 2A67A 5F1KA 4K6KA 2JLVA 3X3HA 5GAJA 2RCNA 3TYJA 1TVKB 1JH5A 3IMFA 4OHVA 1XZJA 1NIJA 1KPIA 3G7UA 3AP5A 3M6LA 1XCLA 1XZQA 1ENSA 2OXFA 2CL6X 3F7TA 3QWFA 3E1GA 3M2TA 3PI7A 3OE4A 1K6EA 1AN9A 4Z0TA 2RGYA 4MCAA 4LSMA 2QOEA 2EKQA 4CCWA 4PYRA 1ABFA 3A7DA 4UEJA 3KTFA 4K86A 3QKRA 2CSUA 5FP0A 2VU9A 3N28A 2QBYA 2RR13 3S8EA 1AHSA 3OY7A 2VH1A 2PX2A 3U1TA 4O33A 2OA0A 1XCOA 1TT5A 3L05A 5ALWA 3M6FA 2NLRA 3F3KA 1LI7A 3I5MA 4YJGA 2WHPB 1RUI1 1QDLB 5JZGA 1EB8A 4BNVA 3LD9A 3G9TA 2GVZC 4QGMA 4YMIA 2OZ6A 1A1SA 3N07A 1H2WA 2IVJA 3L7AA 3S44A 2OHFA 1U81A 2AVNA 1BXGA 5JCTA 1WV0A 1XO1A 3D6MA 5GTDA 3QEOA 3VZDA 4CDUC 2RR12 2I4LA 2IEZA 5JVDF 1E96A 1ECFA 4FFWA 3WGNA 3R4CA 2BBAA 1TL7C 5A71A 1ISSA 4X1IB 4RK6A 3SZGA 2PQ6A 3S7TA 5KYGA 4KL8S 3G9UA 1H4QA 2W8ZA 4CDXA 1AUOA 2PZMA 5AD1A 4POOA 1IJBA 1RRCA 1NXTA 2Y1EA 1XB2A 1UXZA 1QHHB 3OCVA 4GO1A 2EG5A 4JVNA 2GWRA 2XGOA 2YR0A 4EKGA 2B4YA 3OF3A 3HZOA 4LHNA 2ZBJA 4RYLA 3EF3A 4XQEA 3BFKA 5ADHA 3IPVA 5EIHA 3DTVD 3E2MA 1EVKA 4L73A 4WAUA 4NJEB 1OD3A 5IVPA 5IAOA 3QW2A 4TRNA 3CEAA 3OIVA 5C8XA 3AKYA 1NG1A 4C0AC 4B4DA 4D8TA 5JMWA 2QTBA 1OC2A 3RWNA 1ONNA 1NCQB 5K0FA 3R4VA 4N53B 2PUGA 3EX7C 1V7ZA 5DG2A 2FRDA 4CA9A 5JJCA 5GJ6A 2X8AA 1YMUA 5T57A 4KOEC 1Z3IX 2F6RA 5I5GA 3U3XA 2ZVQX 1SC9A 4BLQA 1G41A 4E5UA 4NCAA 1F17A 3PWTA 4XX0B 4JR2A 1WNTA 4D7AA 3KV3O 4Q47A 1TZOA 1RCTE 3OX4A 3NMUF 1PK6C 3K8OE 1RT9A 3EZYA 1XVLA 2HLDA 4NMLA 4CG3A 5C3QA 3LDAA 4G26A 1XUOA 1WMFA 2O2XA 1RYYA 4ZONA 1QIDA 1X0XA 2QRUA 2B5VA 3KALA 3LKJA 4L4ZA 3EXHC 4ZCQA 4EDFA 2R11A 4EIWA 3MBKA 1Z56C 3ITNA 2RB5A 4GPBA 1STMA 1IZ0A 2OLJA 4PXYA 2XOEA 3HG7A 3BPSA 1O5OA 1CQ9A 3RFTA 1CS0B 1TGVA 2HKIA 3M1IA 2Y1KA 3QELA 2IXBA 3AEQB 1P6UA 4JLWA 2ALJA 4FC7A 3KHTA 2V0NA 5CIQA 3W5UA 4U39A 1C8M1 3CR3C 5CBPA 2VFAA 4DJEC 1E94E 4JITA 1UQUA 2D43A 5ALKA 1FY2A 1I14A 4RVDA 4MO9A 3C5CA 3OECA 2XMBA 5D51S 5ERYA 1HXS1 2ZAIA 3P0HA 1DYPA 2ZRAA 1P9OA 3AP7A 2MJLA 2QSJA 1Y42X 4DSTA 2P9CA 3CCCA 2JASA 3S1AB 3U4GA 3LPFA 1J56A 5FQ0A 4PO9A 4MCHA 3J8F3 1WOMA 2H59A 3ZQUA 1ZGBA 2WTAA 1CUAA 1JEQA 3QXXA 4HGQA 3EXEA 3ZBUA 3PC7A 2XGXA 1CUWA 4EX6A 4F9TA 1RXGA 1WEHA 2C5EA 1ITZA 4I8IA 3V7NA 4J2OA 2Z57A 4DJTA 4LY6A 1W36D 1O6ZA 5JG7A 2QNKA 3PDJA 3L40A 4ON9A 5HZKA 5KHAA 1KJLA 2JEMA 4I3PA 3K1ZA 4WZAE 5CFDB 1VDMA 5EIWA 1BWPA 3DNMA 2B83A 1P74A 4IF6A 2LCFA 4BCUA 3WEZA 3ANSA 3X29B 2FE4A 2ZI9A 3T4HB 4HX2A 4O8ZA 2YIJA 1LOCA 1L5MA 4JEHA 4YI5A 4M38A 5BN4B 4YXWA 2E26A 4JJEA 1ADYA 1TZCA 3LFIA 3U61B 4DIDA 3IIMA 4LVUA 3RSQA 2CLSA 4XH9B 3CSUA 1XVTA 2BCJQ 4I55B 3WB1A 1V1JA 1XSRA 4Y1RA 3U75A 3MHZA 1R7RA 1MO4A 2AJTA 5T8KA 1H1AA 3NAQA 4I4TB 1G66A 5A7SA 1SRQA 4P08A 2GK6A 1JZSA 1ENPA 1GUDA 4HMOA 1Y9EA 5BNQA 2ZR7A 2DYCA 1R093 3VTKA 1N34B 2AYXA 3FZGA 2YNMA 4RZ2A 3I8TA 1D0GA 2XADA 2G9QA 3RS8A 3DP7A 3J7AC 3H05A 1H5QA 2X2EA 1C1XA 4OQXA 3ZCVA 1T8PA 3LE8A 1KAOA 4ZI5A 2V55B 4ZWNA 421PA 2VLIA 1VYVA 3OAAA 2V7EA 4QKNA 3M1YA 4NK5A 4P81A 1H9CA 2VR4A 2CYAA 1L5OA 3ZHQA 3SYKA 4N0QA 1PJAA 4GKVA 5FOVA 4KGDA 2Q30A 4MKRA 1ID1A 1WDWB 5HOEA 1RKBA 2DWCA 1TTQB 4WNAB 1V16A 3SC4A 3HFSA 1Z8NA 2NUPB 2D6PA 3ZN4A 2O4UX 5C9AA 1S96A 2I3AA 5SYNA 1CR2A 2X4GA 1LNQA 3O74A 3TRJA 3VHRA 2WJYA 1QFJA 3B94A 4AKHA 1VHLA 5B36A 4JJZA 2ZGKA 1BS2A 4DCGA 2QTLA 2J3QA 1XMQB 2A5LA 2VWHA 2A86A 4IVRA 1GAXA 3C6XA 2Q7XA 3WX0A 4GZ3A 1KA9H 5ERLA 4J0EA 2QLNA 1MC4A 4JSYA 2EKDA 3LX5A 4URZR 5AK0A 1PW5A 1A9XA 2VCBA 3WLSA 4EWAA 4LHKA 1E69A 4JL6A 1E4YA 4H7MA 5F1PA 1RXEA 2ZBPA 3T12A 5IBQA 4D8YA 3UK9A 5FZ8A 1WHSB 3EGEA 2RHTA 2VT3A 1GAJA 5SZKB 1QE0A 5H9VA 1V3QE 3WIVA 2O5CA 1J25A 2UVDA 4FO9A 2GUGA 4QODA 2I65A 3JRNA 4EMTA 1M6YA 1SH7A 3PBKA 3GVCA 2G9UA 1C7RA 2HYXA 2OGTA 2WJJA 5K0GA 2YJZA 3G13A 5HE8A 1KR5A 3KSUA 2WSLA 3WWYA 2VGDA 4CODB 3K0FB 3KJZA 1GIAA 4OX9B 1VA5A 2A88A 3PNBA 3AIIA 2OV3A 2N7GA 3JYLA 3HMKA 2V4ZA 1D4AA 4HRYA 2UXCB 1C3OA 1UOBA 1HQKA 1U0NA 4FKZA 4KITB 1RUC3 5H5JA 1VB3A 1UMCB 5AK5A 2GF0A 2VTBB 5K4LA 5K3OA 1U63A 4YRCA 1LTQA 1RFGE 4KTVE 2UUAB 1JHUA 2B7BA 4BQXA 3L1IA 1NVVQ 3H8XA 5JAIA 4CKCB 4NIHA 1NI4B 1H42A 4QU0A 1CIVA 3SXJA 2NYYA 3DTVA 4QDTA 2ZMNA 4QU9A 2ZSDA 1LECA 2GBIA 3OLXA 3ZE9A 1I1NA 1E3WB 1PYDA 4AT1A 1NC3A 4ZGGA 3KQUA 4MDFA 1XLWA 4K1XA 3I12A 1GGFA 3EWAA 3PURA 5FIXA 4HLTA 4W5OA 5KUTA 2LV8A 4DZTA 4JSTA 4Q4V3 1T5LA 2PAKA 1OFVA 5B64A 4FVTA 4UVDA 2D40A 4EVQA 3CLRC 3EQ7A 1H2HA 2GM9A 1NUUA 3JZVA 3PNQA 3WWZA 1R9NA 2JG3A 1HOTA 3L7YA 4Y20A 1K68A 1K7YA 2GH2A 1RJWA 3ADDA 3CKMA 3AJRA 4ADSG 1VIDA 2LPMA 2W6IA 3T5MA 3EIOA 3Q2KA 3HR8A 1S01A 2C9ZA 2JA1A 3GAZA 1QXPA 5DTJA 3RBAA 3R77A 2AL7A 2LTNA 4EQ6A 3IH5A 4P4SA 3WLOA 1FQKA 2F8SA 1TQ2A 5DAXA 4MRRA 3PITA 3OQBA 4DV7B 5AJZA 3QPDA 2OK7A 4UCFA 3W2EA 1UKEA 4IJ5A 1FNYA 2GALA 2PHLA 3O1SA 5FWXA 2Z6VA 3B5EA 1FP1D 1SUAA 3KC2A 3LYHA 1W05A 3MD9A 4W65A 2EXXA 2M1XA 3LPDA 2VWPA 4YWAA 1KDOA 3RRZA 4QXPA 2GJ8A 3DFZA 4WN9A 1CHDA 4ZKTB 1Y4SA 3E7DA 1QJX1 2Y0IA 1V3TA 5HS4A 4K87A 3LU1A 2JFFA 2WAOA 4JDUA 1XDGA 4YP9A 2GWHA 2PTHA 4DFSA 4AN0A 3Q8MA 3VR6H 2O2HA 3I64A 3OZTA 2IEGA 1IBMB 2RGCA 1UL1X 2ZUWA 1PYOA 3DMTA 1EUQA 1N0WA 2X40A 1F4HA 1WBFA 5J2UB 1U1FA 4CUJA 2GPTA 1UAGA 4LY0A 3P2IA 3WLUA 2WQ8A 1OXBB 1UMBA 3R8FA 4FMCB 3KR2A 1E9EA 2G83A 3C74A 4EJSC 4NROA 5C6CA 3IWZA 3H16A 2QRKA 1JPVA 3BEDA 3HXLA 3GFSA 3PQ8A 2A4KA 2IWGB 2PA0A 3BSSA 2WFMA 4OOFA 1KMNA 1NP7A 1Z45A 4QYIB 1PNVA 2FXVA 5CURA 1VI5A 4F8JA 3HQUA 4N5IX 4FAGA 2BMJA 1VIWB 4JUIA 5T4FA 1WCSA 4F0JA 3RHTA 2HH9A 4UDXX 5LLTA 1OA0A 4CM5A 4RIHA 3O1VA 1H8VA 3THWB 3BOSA 1TW2A 3MGAA 1GCGA 1RI4A 4NJOA 4KFTA 4EHFA 5HDBB 1KQRA 3TLGB 2O0HA 4XQ4A 4D69A 1ZMOA 3G0OA 4EYUA 2OCXA 2VJLA 2W93A 4LYFA 3GCXA 4P00B 1NWCA 3JZIA 1JKMA 1WF3A 2J3LA 1ULGA 3SBDA 3SJAA 4LF7B 3JQEA 3IXMA 3HRHA 1G19A 1XCGB 4Q4AA 3QLTA 3ECQA 1X86B 2HYIC 1IEQA 4ASKA 1HQYE 1QGAA 2BERA 2YHIB 5ALYA 3QFRA 4RGGA 1VBKA 5JLAA 2C29D 4PGHA 1YHFA 1E6WA 4FZVA 4FW8A 2I78A 3KJHA 4RAOA 5D1NA 3N7UA 3E9EA 3KF3A 3FRHA 3FSEA 2D6MA 4JJKA 3RC9A 2AC4A 3EY4A 4L78A 2PGDA 5I7RA 1JSLA 3H7YA 2EERA 5GLWA 3MYRA 3JV7A 4H1WA 1A95A 2QX4A 5L6MB 1YC5A 2RDMA 4O25A 3GUZA 1O96A 1SAYA 4O4JF 5C46F 1ODLA 3LDUA 4E5NA 2Y38A 5JAPA 3KOYA 3HDVA 4EI2A 2FW9A 3EG9B 2C2ZA 1ECCA 3UIEA 3C97A 3GGOA 1U0OC 3UGKA 1GOTA 2YMQA 2QN9A 4AW7A 1AZDA 4AJPA 2R25B 4I8DA 4MIYA 1QG2A 3IT8A 4C7BA 1CZHA 4Y67A 2ZZQA 3NO4A 4Q7JB 2X1VA 4ZT3A 5IXYA 1PL0A 4QXBA 2PD6A 1U8EA 4YK7A 3G8YA 3I34X 2E4ZA 4DINB 2BFPA 5M2QA 5L9BA 5F52A 4N90A 4DA8A 4RA9B 3LBHA 1YQXA 1I2AA 1Z6GA 1NVFA 3N2LA 1HG1A 1W3VA 3DDUA 1CONA 4UAJA 3JU9A 1Q0PA 4EFLA 3AJEA 2PGLA 3JYNA 2ET1A 3EYPA 4U2KA 4CG0A 4LV6A 4RIEA 4IEOA 2FBEA 3M5CA 2BKVA 2XUKA 1MA3A 1M54A 1F15A 4A6XA 1CAUA 2HBQA 4DLTA 2YDYA 3EIFA 4KX5A 5GIPE 4DJJA 3FRJA 4KMRA 2FDIA 2PCLA 1R4MA 2A3WA 5TXGA 3H4IA 4RIFA 2I6QA 4F1WA 3L0PA 5CITA 2O1EA 1N4AA 3K1TA 3UETA 1ORVA 3C3CA 4YZ3A 1X14A 4MG2A 3G1WA 3ZI7A 4E2QA 4ZI7B 4Y1VA 4KUGA 1CJMA 5JPIA 4ER0A 4QTYA 2YFHA 2O2DA 1BKYA 2ZSAA 3CA8A 2UY8A 1U9ZA 5EJMA 5DLPA 2RS53 3IDSA 2HWXA 4YRAA 4MYCA 1HFJA 2FWRA 2DPLA 1L8QA 1AR72 5IVEA 2VNAA 4XWGA 4MYEA 4BLSA 3B3QE 4GX5A 2JECA 1OLSA 3QSGA 4KNCA 1YUDA 2FFBA 5CJPA 2I4NA 4RA9A 1EQ2A 1MOQA 4BKRA 2P2LA 3BN6A 3O1LA 4REMA 1CRPA 2YQ5A 3GDOA 1COWD 1JN2P 3PHJA 4M9XA 5FZHA 1YL5A 3LT2A 4P9YA 5LXTF 3TEXA 4UC0A 1G4HA 1TCAA 4L27A 3ZDQA 2IA5A 1I94B 1BW9B 5C0OE 4BXSV 3UOAB 3ES4A 1Q1QA 4RVHA 3DVSX 5DNVA 3A2KA 3VKMA 4PICA 4HNSA 4BO0A 2IT1A 1MOPA 3GLUA 2XQIA 4RTSA 1SCUA 2B3DA 4R9CA 1O95A 1V43A 2WAAA 3F47A 2EJWA 3NALA 2ENRA 1DXQA 1G21A 3QU5A 4XE9A 2RM22 2ILVA 1C0IA 2RGNA 3WZMA 2ZPXA 4FP3A 2A1TS 2IU3A 1GN9A 3A06A 1QZTA 5DABA 1KQOA 1JQBA 4DQKA 2QWXA 3C8UA 3IALA 4DGQA 3FVRA 4Y2JA 3H8VA 2Q8PA 4MGHA 4IJMA 1Z16A 1E79A 1PVC3 4U7PB 3U56A 4JTOA 3QFCA 3ZEIA 5FNVB 3ISTA 4WXPA 4HPXB 4MQMA 2PX6A 1X8EA 1L4KA 1V7QA 5HILA 3SBOA 3PUZA 4GKXA 4GKJB 4I08A 1VCOA 3W8EA 2A84A 4US1R 4O29A 3OE5A 1ZVJA 2VD7A 2ZJCA 2MINB 3OZIA 1BH2A 1I36A 3CJRA 1VBC3 4BE3A 4ALJA 1E6KA 1S8NA 1ZCZA 1Z7BA 4DIKA 1E1DA 5K8VA 4CPBA 5HXAA 1GYRA 2OBMA 2VW2A 5FO8B 3F97A 3HGQA 3WDWA 3CLTC 2V45A 1C7QA 2IUSA 1KQ3A 1RLTA 2BGCA 3TUJC 2IFWA 4JXKA 4BNIA 2V59A 1EGVB 2VZ8A 4NECA 2R1TB 1IM2A 3CMCO 1Q7RA 1MEC2 3MI8A 2FPOA 5EJEA 3DT6A 3QYAA 4RO0A 4FKMA 1JHNA 3PVZA 3W4KA 2HQOA 1OLSB 3GZTB 2FETA 4BKMA 1ICIA 3R3SA 2AJBA 2C42A 4AUKA 1XBFA 4D46A 4C88A 3HUFA 4WK4B 3ZDXB 2ECOA 4WCFC 4YDRA 2E1PA 1JV2B 3JQGA 1J0XO 2JIRA 2O0OA 4MW4A 3OU7A 4LBOA 1FFYA 1JQ5A 2IK8A 1G3MA 3WWDA 5B6IA 2R7NA 1IIRA 4IYRA 5SYMA 5EMHA 1YC2A 3H3JA 5DBGA 1KH1A 4BWYA 5AKHA 1MPTA 1HX6A 3QUCA 4W7SA 2MWMA 5B1EA 4QWNA 5EZ6B 1T5HX 5BN5A 1DX9A 2WIDA 2YZGA 3BIXA 5CFZA 2PSEA 1H9AA 2OLEA 4FQZA 2PS1A 2X05A 3UHJA 2PQ2A 4HKTA 2JLUA 4RWZA 4BUJA 4WBNA 2YWGA 3AZQA 3H2HA 2ODQA 3LA7A 1EUDB 3TXYA 5BSRA 4BUZA 1S2EA 3V7YA 3WFIA 2EXKA 4NLLA 5DGCA 1FFEA 3K4AA 2OCPA 1SEVA 4NRMA 3U5ZB 4ARXA 1YR2A 3PGKA 5CZKA 4EH1A 1K3IA 1MLDA 5HQTA 2JHGA 2UU9B 3AOGA 4CZ2A 4Q4JA 3ZDBA 2PGIA 1OW3B 3BFPA 3V42A 3FX2A 1YRWA 3S0MA 4ZPIA 1S9HA 5EINA 2J3IA 3RRJA 5ABJC 4QO7A 5A1AA 1W5SA 5A7NA 3I2FA 4C1NA 5IK7A 3WGQA 5JROA 4C29A 5HJ5A 4O9EA 2F43B 4IF4A 4UMDA 1S0GA 1FSPA 3PQ5A 5KX5A 3KZMA 3GEEA 5C3PA 1L1FA 4MW5A 1LOBA 3RZMA 5FI1B 3WWEA 4MP8A 3KYIB 1RQXA 4IVPA 1QKIA 4BVFA 2CAUA 4YXFA 4ZOAA 2ZCVA 4UM9B 1J99A 2GLTA 5AVTA 3B7PA 5KOJA 2XOMA 3VDCA 2QJFA 4NBSA 3MMNA 3OTOB 2XWJB 3I61A 1PVDA 1U8TA 1UOQA 1K3TA 3JBG2 2WEKA 1Q2XA 3FKJA 2HMTA 3KB6A 4KO3S 3NUZA 2XCOA 2PUBA 4BB9A 4IHAA 4LDPA 2HHJA 5ECWA 2ERFA 5C5TA 1LF0A 1X9GA 4MDEA 3H1FA 3C98A 4D99A 2HR1A 5LU9A 2HGSA 1P6QA 4DY3A 3S68A 4ARIA 5HKBA 5CG2A 3GU3A 2I6FA 3MZ0A 3OBRA 2KWIA 3QU9A 3DE0X 3OZFA 5I8ZA 3JWIA 4QFBA 2ZJZA 1CB7A 2AIRA 2PEYA 5BT9A 2YRWA 1BX3A 1BS1A 2AOVA 1NI5A 5FLEX 1LBEA 3PGXA 1ORRA 5F7OA 2LUOA 4KIGA 4Y9TA 3VBUB 4E5PA 5EXXA 4YR9A 1KJIA 2BMVA 3OPMA 4JC4A 2J6BA 5ERXA 4PU0A 2A1XA 4JCKA 2XIJA 1JW9B 1AYM3 4EUSA 3D64A 4LNAA 2WSYB 3WW4A 1NVGA 3RVSA 4UAUA 5YASA 1A9XB 4K9SA 2X8WA 4YMGA 2GBFA 1FQWA 4AEKA 4X8MA 1S0EA 1OWOA 2GZRA 3LLCA 1BMFD 1LSUA 1CUGA 5K01A 4RK5A 3I6QA 1YB6A 1B09A 2HSEA 5ED4A 3C1UA 3HJHA 2FWBA 3WYBA 1P7CA 2QZJA 3D4IA 4Q7QA 1TYEB 4G1VA 2W83A 3WR0A 4JLJA 3V55A 1NT4A 1V1MB 3SHTA 2VMFA 2KXLA 4KODA 1GYQA 1XZAA 4ZK2A 3FOWA 4AGVA 5HCAA 1XOYA 2H52A 2Q45A 2BFUS 4EJFA 4KW7A 4MRMB 1CAVB 1U7TA 3C15C 5K1ZA 1XTRA 1QQP3 2ORZA 2ZUBA 4OHYA 4WECA 2YOFA 4DNYA 3CTMA 1VRCA 2I1QA 3T1YB 3WINE 2QUBA 3ZD9A 1FSZA 4PYMA 4NPRA 4LKOA 3LCCA 4FX5A 3CQ9A 3JQAA 3M89A 4A2CA 4ZAFA 4P53A 4YQYA 1V4NA 3TGLA 1GZ4A 3WO1A 1J20A 4C22A 5TVGA 2Q4BA 2XVAA 5IK2A 1M6VB 1V6IA 3OGJA 4NXMB 3AFGA 1LLFA 2P34A 4KFSA 4BS9A 5KKCA 1Z6XA 1RRFA 3QG5A 2XE8A 5JUWA 4Q16A 1IDN1 4ZN6A 1OLXB 4BO8A 2Z3ZA 1HRI2 3KXDA 1V5FA 5K6RA 1YI8A 2HWC3 3NEJA 4C76A 4KPGA 1AYN2 1TF5A 3WNOA 2G63A 2IEYA 4M3CF 4TSVA 5ALUA 1WKVA 3SLIA 1F5NA 5JARA 1FDUA 5DNDA 2LIPA 3D7KA 4G97A 3VU8A 4CZSA 4AI9A 1EWKA 1UN1A 4L0QA 4HWTA 3MINA 2G6BA 1TO2E 4IIUA 4CI9A 5JBNA 1TLFA 4QB1A 2X58A 1JDTA 4I30A 3COYA 5JO9A 2C5SA 3VDDB 4A2UA 2WZR3 5JSPA 1VLJA 3RNOA 4TLCA 3LY5A 4QXAA 1SG6A 2I7TA 5IM4F 2XMCA 3P94A 2CDAA 2ZI5A 2QAIA 2DF7A 4R8SA 2O06A 1Y1QA 1FP2A 3OIDA 5J3UA 4F3JA 1XHLA 3PJDA 4G63A 4AN1A 1OB2A 5KNBD 1GXSA 4YFWA 1PEYA 1V45E 2Y0BA 2RHRA 2XQRA 4HTFA 4I4NA 4HZGA 1OXSC 4YCDA 3WDLA 4IJ6A 4JLAA 2B1QA 2FEAA 5DRYA 4UYBA 2X22A 4FTEA 1WA5A 3ZQKA 2FCRA 1GGEA 3KJGA 1VBMA 1D07A 1T2NA 5LP1A 4LJ7A 3PV0A 5COAA 5JNLA 3IPRA 3PSHA 3PC8C 3AB3A 1ZD8A 2CL2A 5BMVF 3DE5X 2RI0A 2FF7A 3I3MA 1XZMA 2QX7A 1A5AB 2HQSA 2ZBEA 5EFUA 1KFUL 3AW9A 1C4OA 2NZXA 1J8MF 5KWEA 2V58A 1UQRA 4EA6A 3QE0A 4XLTA 3LPAA 1DIBA 1AR63 2X1LA 3FVWA 3B1ZA 3MJSA 4XXAA 1AKQA 5T54A 1L5HA 1NLUA 5AW9A 5B4XA 1OTHA 3ELUA 4D8UA 5K8JB 3U5TA 4K9NA 3ZFEB 2D4HA 1GJRA 2HJSA 2P2NA 2HMSA 4MARA 1W4LA 4X54A 3Q72A 4UUBA 2GC0A 5CEHA 2K7ZA 4AO7A 3CJQA 3P45A 4MRVA 4DZRA 3Q0TA 1MC1A 5IF3A 1AVTA 3GK3A 2GD1O 4CMEC 1LY1A 3K6SB 3HWX1 2DVDA 1QDUA 4P80A 3PG5A 1SBTA 5KQGA 4YV1A 5UKDA 1YCGA 3MCAA 4QECA 2NZVG 1J8YF 2PBRA 4CEHB 4RVNA 1QHSA 5G3ZA 1P7YA 3QRWA 2RGNC 3DKPA 4G07A 2CSXA 2WBLC 4PYNA 1LS6A 1CIWA 1ZNYA 3RI8A 3R5SA 4IOLA 2DF8A 2P3IA 4L2IB 2GN4A 3R23A 3PD7A 3KYCB 3HKDB 1QVRA 2QZ3A 1CQIA 4Y2RA 4FJ0A 1AZLA 3B48A 4P4GA 5J5CA 3JQWA 1PTKA 3MMPA 1SG0A 1Q22A 1UAIA 4GZ5A 5BYJA 3CUTA 3NMBA 2PUFA 5FMOL 9ABPA 1JI3A 3HQXA 1BMV2 5K8UA 3U48A 3LF1A 3LXMA 1G8HA 4O2AB 4CLOB 5JQGB 3PHLA 5DM2A 1KAGA 2QVSB 4NBTA 1UBEA 3G2LA 4RD1A 2QTHA 4MIKA 2MMGA 3LWDA 1Z28A 3KUUA 2X42A 3BDVA 3AR7A 3NQ41 4LXHA 5EZWA 5JDIA 4INDA 2YC2A 4IL5A 1DS6A 1CR7A 2CVHA 2W6MA 4ITCA 1JQ3A 2GT1A 1IPHA 4J3FA 3PIGA 4XUNA 3AR9A 4X8HA 5FO1A 3GLHE 1BHQ1 1FFBA 3FNEA 3R6GA 3NPAA 4QNMA 1LDGA 2W2NA 1CZSA 1Y80A 2HSZA 2UWCA 1GPJA 3C7EA 1J8FA 3FLBA 3TWIA 2JPDA 4PQGA 1SG9A 1M8JA 5FZKA 4MICA 4F83A 4JGYA 3WK9A 3X1KA 4REQB 2Q1YA 2BM0A 5AVRA 1H22A 3BBLA 4IRMA 3ZN6A 1UMDA 3FVQA 3RJRA 3HJGA 2HRCA 1JDVA 1W8FA 1JQEA 1NW9B 1VBNA 4X3CA 2A6ZA 3P32A 4BXOA 3S28A 5GLUA 3SCHA 2A30A 3IN9A 4DSNA 5JJLA 2IHBA 2C7BA 2WF9A 2BFEA 3JQFC 4IQ8A 2ZMLA 1TJPB 4LRYA 1EUYA 5IC4A 2VMEA 4N6GA 3AP1A 3M70A 4Q7MB 2I2CA 3LK7A 1RPNA 1E5SA 2AOUB 3OOYA 1ZVVA 1NW6A 3EPKA 5FPBA 2NQTA 3WBBA 1A2BA 3WIOA 1DZQA 4UUOA 2ZRPA 4BU0A 1POQA 5TQ0B 3UXYA 5KTNA 1DKOA 2WU4A 3NAGA 2J5KA 2NU7B 2CXQA 4RFRB 1A8HA 1F51E 5IWFA 4EUKA 4OZXA 1JAYA 5BV8A 2AI2A 4D9IA 4B6SA 1YZHA 1L5KA 2BNNA 3G2OA 4A0GA 2EBHX 1EAH2 2H1VA 5NLLA 2Y92A 2Z2YA 1ES9A 4I1UA 3UXMA 2YJ3A 3DFFA 3H1AA 2NNLD 1E2UA 4QLAA 4BB0A 1O5LA 4XZPA 1GVNB 3E15A 2ZJOA 4TXMA 3HBMA 1AZSC 1T3HA 1P8JA 5HCIA 3C2UA 4EPTA 4HS9A 4DT1A 1CPMA 1QG6A 3AKPA 1YRYE 4L8GA 2I22A 2O8DA 4FPFA 3ROGA 5M0TA 2PZJA 4KB5A 3CUKA 3O94A 4YO7A 5SZHB 2GEDA 1KBQA 4AOCA 4Q66C 4QM6A 3NR2A 2GNMA 4P9GA 2VNOA 4BN0A 4X91A 1IVSA 2AE1A 5BW4A 1UWKA 4F4UA 5K20A 4ZHSA 1RIFA 3UKOA 1VALA 4ZOCA 5EWLB 4G0PA 3ZHYA 1D2CA 1XNRB 3K3PA 5SV8A 3PYLA 2P75A 1CFJA 2ZZKA 4AQ2A 2CXNA 1K89A 1UAAA 4E5YA 2QZ9A 4Y5Z0 2MEV2 3WA6A 1UK6A 4MEJA 1BDHA 1KXZA 5AUPB 5AJHA 5A4JA 1T6XA 2FX5A 3PPVA 4NN0A 4IGPA 4O3MA 3UG7A 1GV9A 3LQFA 3CLPA 1ND3B 2NUAA 1SIBE 1U1GA 1A71A 2FUG6 2FA9A 4PXAA 2ASEA 3WSOA 2PEZA 1CY6A 3T2OA 4JMLA 2W1UA 4JQRA 3ONWA 2IDMA 4JS0A 5FUBA 1C0PA 2I74A 1ZBA3 3T9EA 3UUWA 3O3OB 2A5YB 1BEV3 1HDCA 2WPDA 2P2CA 3SM3A 3GELA 1DARA 3GLSA 3L0YA 5BNPB 4WOJA 5IJXA 3R7NA 3UV6A 1RUF1 4B4OA 3DCJA 3I3SR 1EVLA 1PHPA 4NRDA 1KFJB 1G20A 2HDNB 4OI0A 2I34A 2QXYA 4G24A 1EVQA 4ZKDA 3AP2A 4BCCA 3IHTA 4H15A 3O1HB 5CKQA 4L07A 1LJ8A 3STWA 3ETGA 1Z62A 4IDCA 3L7CA 1Y9MA 2ZWMA 2ET7A 2YN0A 1PZGA 2H16A 2QUZA 4MLPA 1G63A 1ULAA 4JH0A 4PAMA 1D4OA 3MQFA 4RL7A 3TVDA 3IOEA 1T91A 1TCCA 2QRNA 3NUGA 5A1LA 5GPBA 1IHMA 4RTKA 3GR6A 1ZBA1 2P8JA 2PUTA 5A6SA 3NHJA 5LJLA 1CJTC 1L4NA 4AEDA 4ZRDA 1L7MA 3PJEA 3RSHA 5JAUA 3MFQA 2FWNA 3LH5A 3WLHA 3HEIA 1E5QA 4RSMA 3GG2A 3M2MA 2YV1A 2OCIA 1G6Q1 1Q1BA 4D56A 1P3JA 3U7QB 3THRA 4XPIA 4BXOB 2HT1A 5EG5A 1A8SA 3R3ZA 2F8TA 3IJRA 1JG7A 4JJFA 2AOTA 5C3OA 3Q5GA 4K6CA 1BKDR 4BFLA 5ALOA 5HS6A 3HA3A 3F46A 1P4GA 1XZDA 1XAHA 2ATEA 4NEQA 2R16A 1XMSA 4XWWA 4CCMA 3JSXA 3EQ9A 4QB2A 2WJ3A 1ULDA 1UXIA 4B7CA 1GNSA 3RANA 1FXWA 2GLXA 2ZKNA 4B79A 3B53X 1YR9A 4ZO9A 2HT6A 3RG8A 1Z35A 5HUJA 5K4HA 4FPOB 3UAOA 1XE7A 1RUJ3 2P37A 1II8B 5FV3A 1X1QA 2B35A 3FPEA 4N82A 1T5IA 1AQ6A 4OBWA 2AFHB 4S0ZA 3VQTA 4XHBA 1WUYA 3HSKA 5B55A 3BH6A 4TLAA 3AEXA 5FXZA 3RS7A 1F31A 3AEYA 1XZPA 4TTTS 5ICMA 1GRRA 4UKDA 2ANCA 3KF5A 2OV8A 5F4ZA 1UK8A 2JNWA 1DO0A 1DG6A 1CQIB 2ZA9A 4PJYA 4Z0HO 2FSVA 3VBOB 2PMWB 3GUYA 2VHXA 4KJXA 1TUGA 1V48A 3EXHA 4EABA 2VHJA 1I2MA 1WPQA 2JIQA 3G2PA 4BC0A 1ZUNA 1AA9A 1A9QA 2G0NA 5BNOB 3VR5H 1VLMA 4D9BA 3U7GA 1YBAA 1NVWQ 3EEQA 1OIVA 3P2YA 1OX4A 2F1HA 3NNFA 4M8LA 4MWDA 5A4AA 3DOEA 4OHFA 4QBHA 4WSOA 5DLDA 1NXXA 2CXRA 2CNNA 1ZGGA 4X1YB 2C5AA 4Y22B 3RBXA 4J7AA 2C99A 3ZTTA 2P2GA 2VMCA 3T99A 5EUQB 3A22A 2WE8A 4B17A 2V5YA 4YMLA 5JV5A 5GJBA 2V4UA 5CB4A 1W87A 2G8LA 2X09A 2PRIA 1CJPA 3VHLB 1U0SY 2Z2IA 4XJAA 2JLRA 4I1SA 2EL7A 4XPIB 2Z69A 4OYRA 1Q12A 2FMIA 3DR3A 1ND2A 2HW8A 3PUQA 1UOEA 1XXHE 5F9FA 1PR1A 5SV2A 4LCJA 2WZBA 2H00A 2QN1A 3GEIA 3OLWA 4X1IA 4B7ZA 1J1UA 2Y71A 3V2HA 2JLCA 4R1PA 4PV7A 3TSOA 1VLQA 1EK1A 3L6UA 1E2MA 4MGSA 1ABEA 1XMVA 3OD0A 1PZNA 3WTCA 4ARUA 3S7EA 1U98A 4FYMA 1G98A 3SMVA 5CK5A 3ERCA 1EK0A 2P9JA 2EVWX 2D98A 4IETA 1Q57A 4AMYA 4HNVA 2VYVA 2QQWA 3M8KA 4FDUA 4ZO6A 5HCFA 4P84A 1U80A 2GYYA 1JDUA 1PJ8A 3E9CA 3EB7A 4UATA 3LDRA 4YAFA 2HWC2 3M0EA 4QRIA 1UUFA 5JOZA 3OYWB 1XXLA 1OAKA 2Y0CA 1ZVKA 3JBG1 3DAFA 4KE9A 1ZISA 1QBGA 2A58A 2A59A 2J0EA 3WNQA 5I3ZA 3WK7A 1SBHA 4JT2A 4HLQB 2ZYUX 3VZQA 5M5BA 5F7XA 3SZOA 3IBTA 4XUQA 4CQMB 3LKDA 1PNGA 2OCGA 2XNHA 3BMCA 2W3JA 4MUYA 2W1QA 2VJAA 3JVIA 3U16A 2JI7A 3CMMA 2OVUA 2I2DA 4NMMA 1JZ5A 3D1LA 4G89A 3WWPA 3WJ1A 1DKUA 4UOEA 1DZIA 3IZOA 1LGCA 1HF3A 4GRIA 5CNJA 4E1BA 4FZJA 3OGSA 2WF8A 3WYFA 4TMTA 4U7HA 2X6QA 3AKTA 2G9GA 1RRGA 2XT6A 1PS8A 2ZREA 2RHGB 2C98A 1T1RA 4KXQA 5KMGA 3QUBA 4QPGA 2JLXA 3WCSA 1EDOA 1UIRA 5K3AA 1KMHB 1PJBA 3L7KA 4AVCA 3BFXA 3M3QA 1EQUA 1R6BX 1YULA 4RSHA 4PLZA 5JDCA 4PHHA 2XXBA 1VSQA 5K0NA 2VOVA 1DU4A 2VT6A 3ZYJB 1OX5A 4COKA 2W4QA 1HXS3 4PIVA 4ND7A 1TZ2A 1TF7A 3PR1A 4EHNA 2NPOA 3SSMA 2RD2A 3VO1A 2HIGA 3W9SA 1W90A 2K7FA 5K3FB 1YXMA 2QVZX 1KU0A 4JL5A 4TLBA 1DGLA 3QYPA 3ZYBA 3RFFA 4PG6A 4CDUA 1MRZA 2UVPA 2Z2XA 1SUDA 1Z5UA 1HN1A 1K7XB 4J0JA 3DLIA 2GRJA 4INPA 2R751 1DQ5A 2Q4TA 3J8F2 4QL3A 1AR91 1WBBA 2AMVA 1OH5A 4H6VA 1VRH1 3QFFA 3VBRB 2F3PA 3JB4C 3PQ4A 5FZ0A 4M49A 1QYDA 4C1BA 3NHRA 1KY4A 2Q8CA 1T8YA 1ZUNB 4JA2A 2BKEA 3PCTA 4C4XA 5CGZA 1ZAKA 3CWQA 3TOVA 3RS5A 3E9QA 3V1LA 3ZN5A 3IQEA 5FORA 2EIGA 1E1CB 2CLCX 4O4HB 3OE7D 4Q39A 1V11A 3CLTD 3FIUA 4EENA 3MT8A 4AKGA 3DKKA 4D3YA 5THQA 3HM9A 1MAVA 1KJJA 1EFVA 2BHNA 1O7JA 5JAZA 3OZCA 1FYWA 1FUUA 5DN9A 4CYMA 1YB1A 3GAMA 3HWSA 3Q1LA 1VL5A 1IM8A 3L7MA 2PHFA 2MSWA 1NBMA 3FNRA 2LKDA 3KQSA 2HMVA 5KMGB 4WESA 3DVAA 4EGJA 4UVIA 2VK4A 3MPUA 4L85A 3E5NA 3KPJA 3C3KA 1DKNA 4TLEA 3H4MA 2Z6UA 2ZB2A 1KI7A 2XWBB 1KYZA 4R1NA 1B16A 2COKA 4R0MA 1CUYA 3HDYA 1V6CA 4DR6B 3RBVA 1E2EA 5IT9A 5LNK6 3H8UA 3RVHA 2JLBA 2ON6A 4GZ9A 1RHI1 1Y8RB 3VR4A 5FBKA 4BDVB 3QLUC 1T9GR 3ICWA 2PV7A 3KQ4B 3GLFE 2XV1A 2RS12 2Q3HA 3CUSA 2PWBA 1ENQA 3MPBA 5I9MA 3MWDB 3T34A 5TPZA 2NQYA 3EIXA 1X92A 1XD2A 3CV3A 5C5EA 1GTVA 4KQJA 1BCSA 2OHGA 1SC1A 2YYYA 4S2GA 3QLUA 4Q4Y1 1PO22 3TQIA 3I2JA 1V0JA 1QFMA 2CE2X 4NMWA 5KNCH 2J3MA 2F4VB 1A9SA 4GMFA 3WQQA 1CYEA 1Y82A 4FLFA 4BIOA 1T4CA 3EZXA 2EHDA 1RMQA 2JI6A 4L8QA 3VISA 3HDGA 2YV4A 2ZIXA 2ZPAA 1KOJA 3BGWA 1QQ7A 2H3HA 2ZETA 4V0ME 3GRVA 5C4MA 1W4ZA 3LAWA 2IODA 3TM4A 2GDJA 3AJ9A 2GAOA 1SCIA 2AN3A 1W8HA 3AM4A 2IJGX 4G4JA 3PXAA 1W3XA 3IE1A 3V4PB 4WASA 3LBNA 1O95C 2ZLBA 3SS7X 2YQ4A 1DL5A 3TL6A 1MEJA 2SCUB 3HLTA 4X7RA 1GEGA 2OZPA 1OXKB 3KT3A 2WABA 3OFND 3TTXA 1KKUA 1XDZA 5T5JA 3VXKA 3QNMA 3B7GA 4XIKA 2AF4C 1J2YA 4O4IA 3GPLA 1M8FA 4MWSA 3KV9A 3OKPA 4CCCA 3HDJA 2I33A 1A0OA 2QGNA 4INZA 3DYPA 2N3ZA 4N47A 4LGYA 3DGFC 4KYTA 4PSAA 1CZKA 3Q6NA 1I1QB 4LBMA 5FYYA 1PF7E 2W11A 3AG6A 3DHNA