The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
192
|
sequence length |
556
|
structure length |
551
|
Chain Sequence |
HLLGNPKLTVTHVNEVKAGINHIVVDSVQYGNQEMIMEKDGTVEMRDGEKLYINIFRPNKDGKFPVVMSADTYGKDNKMGALWPTLGTIPTSSFTPEESPDPGFWVPNDYVVVKVALRGSDKSKGVLSPWSKREAEDYYEVIEWAANQSWSNGNIGTNGVSYLAVTQWWVASLNPPHLKAMIPWEGLNDMYREVAFHGGIPDTGFYRFWTQGIFARWTDNPNIEDLIQAQQEHPLFDDFWKQRQVPLSQIKTPLLTCASWSTQGLHNRGSFEGFKQAASEEKWLYVHGRKEWESYYARENLERQKSFFDFYLKEENNDWKDTPHVIYEVRDQFYKGEFKSASAFPLPNAEYTPLYLNAENHTLNHAKISSAHVAQYDSEDKQQDVSFKYTFDKDTELVGNMNLKLWVSTKDSDDMDLFAGIKKLDRRGNEVNFPDFNHIENGQVATGWLRVSHRELDQEKSSIAQPWHKHETELKLSQDEIVPVEIELLPSGTLFKQGETLEVVVKGSEIVIGNSTPGMKTRYEHEETVNKGMHMIYTGGKYDSQLIIPIV
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule keywords |
CocE/NonD family hydrolase
|
publication title |
Crystal Structure of SACOL2612 - CocE/NonD family hydrolase from Staphylococcus aureus
rcsb |
source organism |
Staphylococcus aureus
|
molecule tags |
Hydrolase
|
total genus |
192
|
structure length |
551
|
sequence length |
556
|
chains with identical sequence |
B
|
ec nomenclature | |
pdb deposition date | 2009-07-15 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF02129 | Peptidase_S15 | X-Pro dipeptidyl-peptidase (S15 family) |
A | PF08530 | PepX_C | X-Pro dipeptidyl-peptidase C-terminal non-catalytic domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | alpha-amino acid ester hydrolase ( Helical cap domain) | alpha-amino acid ester hydrolase ( Helical cap domain) | ||
Mainly Beta | Sandwich | Jelly Rolls | Galactose-binding domain-like | ||
Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | Rossmann fold |