3IB3A

Crystal structure of sacol2612 - coce/nond family hydrolase from staphylococcus aureus
Total Genus 192
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
192
sequence length
556
structure length
551
Chain Sequence
HLLGNPKLTVTHVNEVKAGINHIVVDSVQYGNQEMIMEKDGTVEMRDGEKLYINIFRPNKDGKFPVVMSADTYGKDNKMGALWPTLGTIPTSSFTPEESPDPGFWVPNDYVVVKVALRGSDKSKGVLSPWSKREAEDYYEVIEWAANQSWSNGNIGTNGVSYLAVTQWWVASLNPPHLKAMIPWEGLNDMYREVAFHGGIPDTGFYRFWTQGIFARWTDNPNIEDLIQAQQEHPLFDDFWKQRQVPLSQIKTPLLTCASWSTQGLHNRGSFEGFKQAASEEKWLYVHGRKEWESYYARENLERQKSFFDFYLKEENNDWKDTPHVIYEVRDQFYKGEFKSASAFPLPNAEYTPLYLNAENHTLNHAKISSAHVAQYDSEDKQQDVSFKYTFDKDTELVGNMNLKLWVSTKDSDDMDLFAGIKKLDRRGNEVNFPDFNHIENGQVATGWLRVSHRELDQEKSSIAQPWHKHETELKLSQDEIVPVEIELLPSGTLFKQGETLEVVVKGSEIVIGNSTPGMKTRYEHEETVNKGMHMIYTGGKYDSQLIIPIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CocE/NonD family hydrolase
publication title Crystal Structure of SACOL2612 - CocE/NonD family hydrolase from Staphylococcus aureus
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 192
structure length 551
sequence length 556
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02129 Peptidase_S15 X-Pro dipeptidyl-peptidase (S15 family)
A PF08530 PepX_C X-Pro dipeptidyl-peptidase C-terminal non-catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3020.20 Mainly Alpha Orthogonal Bundle alpha-amino acid ester hydrolase ( Helical cap domain) alpha-amino acid ester hydrolase ( Helical cap domain) 3ib3A02
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 3ib3A03
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ib3A01
1I5PA 4AMZA 3WK5A 4U2DA 3WLAA 4J0JA 1T2XA 5HPOA 2C9KA 1UWCA 3FCXA 3WNNA 4LXIA 4MXDA 2RONA 2WHPA 1W8NA 4L9AA 4ZXEA 3M82A 2AJDA 3MUOA 3ESDA 5F4ZA 1DU4A 1WPXA 4J0DA 1BROA 1ZJ4A 3LS2A 5E4YA 1CZVA 2DHCA 4A44A 1XROA 3SC2A 4U2GA 1JFRA 4UHDA 4BVKA 3WQHA 3F8SA 3H2IA 2VATA 4H7HA 3ACIA 4G8DA 3WYNA 2E33A 2XOMA 3G7NA 1QGED 3T2PA 3T09A 3SX4A 4FLMA 3VDAA 2VM9A 3U0VA 4BCCA 4AB1A 1CUDA 4C87A 2RGUA 1UMHA 4BK5A 3AC0A 3C87A 4WY5A 3CN9A 1TG7A 4FKBA 5CYYA 4WFIA 1U65A 3A2LA 5AHXA 5EJ1B 1ZD3A 1JU4A 4FTWA 4CG1A 3WL7A 3V48A 4OYLA 3THDA 2YC2A 2XMGA 5KBYA 3CCCA 5CXXA 2WFZA 3BWXA 5DYWA 5I7UA 1CV2A 1G5FA 4OUEA 1DINA 4TVKA 1CFJA 1YS2X 1JI3A 2DCMA 3HYSA 5JAOA 5CXUA 3MO4A 1UY0A 4GWIA 2Z8XA 3T2QA 2GYWA 4GDMA 1ZI9A 1SCQA 5JUVA 5HFNA 1XZBA 5D3KA 4CU8A 4E8CA 3BE8A 1CX1A 1CZSA 2FUKA 3G02A 2WFMA 4M4PA 4RN5A 4UBOA 2WILA 1UY4A 1THGA 4DEQA 1WHTA 4UBMA 3IURA 4DEVA 4A41A 1T4MA 2W1UA 2I78A 3D59A 1FJ2A 5AICA 1MT3A 1ORWA 3H2KA 4KE6A 5EIAA 1LPPA 1XRQA 4C88A 5HFAA 2B20A 4CIBA 2WBKA 2GBGA 1LBTA 4X6UA 4BRZA 3R0VA 4LIPD 3WQBA 1QIFA 3D2AA 5DYYA 4UUQA 2XLCA 4GI1A 1XRPA 2ORXA 4X85A 4XUPA 2OCIA 4QWWA 4AXBA 2Z3ZA 4LYDA 2W91A 4J0CA 1FSSA 5FUMA 3NUZA 1M33A 5IKXA 4K6GA 2D5LA 4E15A 1U2EA 4FI9A 1XLVA 1CUZA 1ISPA 2JGMA 3VD9A 4G4IA 2QQLA 4GLBA 2HM7A 1XZHA 5LZ2A 2BERA 3OBAA 4W1QA 1GQRA 4F60A 3I3EA 3CCBA 5JZ9A 2RJ2A 3VD7A 1N5RA 3V1NA 1K5PA 5ALYA 3TEJA 3FYUA 4A5SA 2ORYA 3FLEA 4X91A 5LZ8A 3QMWA 4AAXA 5AK3A 4H18A 5LA2A 4BJ0A 2JEYA 2QXTA 4W4ZA 4CCYA 2QUBA 2XB6A 5T4HA 3I6YA 2WJ4A 5H3HA 3WKBA 4OPMA 2YXPX 4HRXA 1O6GA 4TPKA 2W5FA 4MGSA 1MX1A 4QE3A 4LHSA 3WWOA 1C4XA 5ISMA 4KE7A 1CUBA 1EDDA 5IVKA 2XQJA 3ZLTA 2WTNA 2W6CX 1MTZA 2WG0A 2DSNA 3KWFA 5BV7A 2BUCA 1QE3A 2BCEA 1JZ8A 3LCRA 3W9BA 4KE8A 1H6XA 3MV01 1DT3A 4CU9A 1YB6A 2GBIA 1N8SA 4DUVA 4MADA 4Y2YA 5AO9A 4BTLA 2JE8A 4FBMA 3Q8WA 4C89A 4CU7A 1ZICA 4ROTA 1BE0A 3FYUB 4UBNA 5AKJA 5JD4A 2J4FA 4QDXA 1Q0ZA 3V1LA 4BVJA 3C8XA 4S0XA 4OMDA 2GBCA 3DQZA 2V5DA 4LQRA 2JGLA 1VKHA 5HZGA 4OU5A 3BJRA 3VJMA 2OGSA 3ICWA 5AKHA 4JYMA 3HNBM 5FOQA 3OGSA 2XUKA 1HL7A 3K77A 2VQ6A 5DNWA 3CZJA 1XZLA 1GU3A 3HI4A 1PMJX 3FNBA 5G04L 4HG6B 3CDZB 1J2EA 2BGRA 1YA8A 4X97A 4CI9A 2JKXA 3I1IA 1H23A 3F97A 4AN1A 1LPMA 3ZLUA 1JT2A 1RP1A 2J4CA 3A2MA 2Y6HA 5AKXA 3D2CA 4QX0A 3FOBA 2XONA 2OCGA 2WUDA 4J0IA 4BK4A 4Y2UA 3HJUA 1I6WA 4UHBA 4B81A 1UZAA 5J3JA 1IUPA 5ALDA 1XNTA 3EIOA 2ZYIA 1XKLA 3BDVA 3DYVA 1CEXA 4LHEA 4BAGA 2R7EB 1W75A 1ZI8A 2WHQA 2W87A 3E4DA 5DNVA 4UBIA 3G0CA 3WF4A 2VCBA 3PUIA 3RM3A 3WKDA 3I2GA 2QOEA 3FYTA 3QZUA 2VJAA 1ACLA 3SWWA 2VR4A 2Y8KA 3LE0A 1UY3A 4DMFA 1CR6A 3G0DA 1GGVA 1MAHA 3FSGA 5EIEA 3I6MA 1J07A 1DP0A 1KEZA 2C0PA 4PF1A 3WK9A 4L72A 3NJVA 5EHXA 4F0JA 5AIAA 2DQYA 1E8NA 1MX9A 2CZQA 5LP1A 1XNAA 2W94A 3MVEA 2WZ8A 3AZPA 5A7FA 3C7OA 1JI6A 3JYHA 1EHYA 3EBLA 2EDAA 4RPCA 1YA4A 4ARBA 3C6BA 2OAGA 1X70A 3F98A 4XVCA 3AFIA 2HA5A 3O4HA 5LZ9A 3WEZA 3BXPA 4QLAA 1GPNA 1SHWB 1XZFA 1CUCA 1MNAA 1EB8A 1AMNA 4KAFA 3I97A 3MUNA 3SKJE 4OSEA 5CT8A 1XZKA 3PF9A 2QVBA 5CT9A 4B9EA 2PBLA 5KWJA 4D8MA 4LPLA 4QDZA 3H04A 5LKAA 3OG9A 4FLFA 3L1JA 4P00B 4ETWA 3MGAA 5ALRA 1WM1A 5DMYA 3W06A 1OD3A 1KGYA 3C43A 3GZJA 1EXWA 2X5XA 4W8JA 4XX1A 4RYDA 4QPWA 3ZV7A 4G4GA 3HOBA 2WO1A 3LP5A 4LYEA 3GELA 2DDUA 4QX1A 2I03A 3WIOA 4EZIA 4HXEB 1WB5A 1DX4A 4QA9A 3L1IA 1K6EA 1UYXA 1E8MA 5K3CA 4FWBA 2HU7A 5ALVA 4G5XA 3DKRA 4OU4A 5AM4A 3ESBA 3BF8A 2ZEZA 2PPLA 3AIMA 4UBJA 2VJBA 2WQ8A 4IH9A 5C7YA 5C7GA 2DQZA 3WF0A 3G9ZA 3PF8A 5A1AA 1QIGA 1XRRA 4P08A 3QPDA 1CUAA 3ICVA 2UZ0A 4KYVA 2V72A 3K75B 4FHZA 4X95A 3BJMA 4XUTA 1YSCA 1XC6A 1YCDA 1ZJ5A 2VZQA 5B4XA 5BWCA 4LXHA 2WG1A 1EDBA 3STWA 1CUHA 5AKEA 1BCSA 2YG0A 2Y6KA 2PSDA 4AO6A 1DQZA 4BP9A 3EQ7A 4NZZA 1B41A 1TCAA 3WK8A 5DPNA 2BJHA 4Y2VA 3QMVA 4H7DA 1UKAA 2HLEA 2HA4A 5A7HA 3QM1A 4BDTA 3UUFA 2ES4A 3GM8A 3ED1A 2E31A 5JANA 3WK4A 4DIUA 3PFBA 4MYSA 3U1TA 4X90A 2WUFA 1MAAA 3DOHA 4A4AA 4YX9A 1ZD2P 5EIYB 4LXGA 3I2JA 3IUJA 1LLFA 4HTAA 3QMMA 2HRQA 4H35A 1JKMA 4B84A 4J7AA 5ALLA 3TRDA 4GWJA 1A8QA 1ZD5A 2Y6VA 3VDCA 4QDRA 1HDEA 3IUNA 3LPGA 5IH7A 4A42A 1ACJA 3GBSA 3EQ8A 4ZV7A 1ZOIA 4D9JA 2PL5A 3F67A 2RHTA 1QJ4A 1YB7A 1ZD4A 3T0BA 2Z5GA 4UPDA 2V4VA 3WWEA 4EY8A 1UOPA 3EYPA 4GXNA 2YFUA 3PI6A 1EA5A 4CVUA 4KJXA 4N5HX 5ALQA 3E3AA 3HC7A 2AJLI 2XT0A 3SEEA 1ODTC 5AK6A 2ZJFA 3C7GA 2LIPA 5JD5A 1DLCA 4MOAA 4IH4A 2VJXA 5EGNA 2I3DA 5HCUA 1FFAA 4HRYA 2VT6A 5AI9A 5JMOA 3WWCA 2C4XA 2XMSA 2WFLA 1XQVA 3OC0A 4Y7DA 4A23A 2VQTA 2J1VA 1QIDA 2WUHA 5ALMA 4B6GA 1XZMA 4OYUA 4UAPA 2VQUA 3A7QA 2QRUA 4H0CA 1JJIA 2OCKA 4DGQA 1Y7IA 3O0DA 4M0MA 4XUOA 1OF4A 1PV1A 4W9RA 1HLGA 5A62A 4QB1A 4PT6A 2VZPA 4NMWA 3A23A 3UUEA 2VOTA 3IAPA 2I3ZA 3AIOA 4JYPA 4N5IX 2VZRA 4Q34A 2WIGA 1LZLA 1THTA 4Q82A 5BOVA 2OQIA 3HJRA 3WKCA 3I3BA 2WYSA 3DYPA 2ONCA 4BZZA 1T2NA 1USWA 4B82A 5AKYA 4KEAA 1CUGA 1F0NA 2L9LA 4G9GA 4DTCA 2W1WA 3E1GA 1CUFA 2XUOA 3BDIA 3RLIA 4G4JA 4ZREA 5LYYA 2OCLA 3PICA 3AJAA 4E11A 5JATA 5C71A 2J1TA 3C8HA 4O08A 1OILA 2JGJA 5FPPA 3DYOA 5CT5A 3HN3A 2EDCA 4Y2XA 4EY5A 5FDFA 4W1SA 5JD6A 1UYZA 2YH2A 4YASA 1DWOA 1BCRA 1UK9A 2GZSA 1JJBA 2VA9A 3R3YA 1EH5A 4UFNA 5K3BA 1SDDB 2CDOA 3F9CA 1WKYA 2WHPB 2WABA 2DR0A 2XQIA 5AI5A 1DWPA 1OCEA 3WK6A 4DYHA 4JNCA 1JZ2A 4BC1A 4N8DA 5IVIA 2XMBA 4BVLA 3R3ZA 4BTVA 2J22A 5AIBA 3T2OA 3QPAA 2W95A 4C6HA 5EHNA 2DHEA 4K6KA 2ROQA 4L0PA 3G9TA 5F7UA 4UHCA 4AO8A 5K3EA 4M4RA 2WLSA 5HQ3A 4YPJA 3DCNA 3B12A 4CU6A 1MPXA 3LEIA 4IH1A 1QFSA 1JZ6A 2BFNA 5D3ZA 4UHHA 1F4HA 2DCKA 2JGEA 1CIYA 5I0DA 3KOOA 2E26A 1IUNA 3HRHA 5JAPA 1UK8A 3R41A 2PSEA 2VMEA 1R3DA 4DSZA 2OPHA 3T0DA 5IFPA 4OMCA 1AQLA 3D0KA 4J03A 2ZYSA 3QVMA 3QYJA 5LLSA 1XZEA 3C7FA 4J0HA 6YASA 2HA3A 1W9SA 1Y7HA 1A8SA 2PU5A 3T0AA 3GA7A 1UMIA 2HFJA 1IZ8A 3GUUA 2XUFA 5JXHA 1VJ5A 3DOIA 2P8SA 4AZ3A 4BAZA 3M3DA 1HPLA 1CUIA 2O7RA 1A8UA 1SFRA 1TKRA 2ZYHA 3OURA 3CKHA 1H2XA 4ZV9A 5HQ3B 5D6OA 2YASA 3ZM8A 5ALIA 3M81A 2XMRA 3LQCA 4G1FA 2OLEA 1VA4A 3BIXA 5JR2A 3SK0A 1IUOA 4UHFA 1UKCA 2VZ1A 5IVHA 4Y2RA 2IITA 4BDSA 2VZ3A 3C8DA 3OEAA 5ALTA 5HKAA 3ZPXA 1ZIYA 2QMQA 1O59A 3ACFA 3WMRA 1O6FA 1GQSA 1C7IA 4MGQA 1US2A 5A2GA 5AI8A 2Z3WA 3DYIA 5JYCA 1EINA 4ITVA 3NNGA 3WJ2A 3GDBA 2C4HA 1A88A 2QKYA 4QDSA 1WPRA 2CMFA 4DM7A 4ET7A 4UFOA 2PUHA 5ALEA 2BUAA 4XZUG 4DXTA 2C7BA 2BBAA 5AI0A 1GUIA 1WHSA 1TVGA 1NU8A 1W76A 2H7CA 1YR2A 4KI5M 4Z49A 3FN9A 3DNMA 2ZYRA 1F0PA 5JXGA 4Q3KA 4NVRA 3HSSA 1R9MA 1GOFA 2JGKA 2WG2A 2Q0XA 1W4LA 2PVSA 4U2BA 2C26A 3WNKA 1VLQA 1CQWA 2RI6A 3MUY1 2QQKA 2YC4A 1DQYA 1BEEA 4BAUA 1H2YA 2CDPA 4AN0A 2WIFA 1ODCA 2PSFA 5DWDA 4QB2A 3AINA 3G0BA 4CCYB 1JMYA 3I1YA 2WZEA 2VMDA 4J0KA 5ALJA 5EJZB 4JHZA 1L7RA 1N1MA 4RGYA 4K6HA 2C5FA 2R11A 2K2QB 3AZQA 3STXA 3G0IA 2H7XA 5ALZA 1R50A 1JYNA 2V98A 3ESCA 4N8EA 4BBZA 3C45A 4GZ9A 2WIDA 3OOSA 1UXOA 2XQFA 1ZGBA 4BP8A 2VMCA 1GOGA 1OF3A 5AI4A 3V1MA 4QX2A 3O4IA 3S8YA 3W05A 4DNPA 2WIKA 1XRMA 4I3FA 1TIBA 1MX5A 5FP0A 3CQOA 2C58A 3WWPA 1SCKA 1W1IA 3HZOA 1XZDA 2DFPA 3K2IA 2OKXA 3H2HA 1L7AA 1ETHA 1UYYA 4KWUA 2ZJ7A 2OGTA 5AM0A 1PMHX 3DL4A 5YASA 3LEKA 4U2EA 2XE4A 2ZEXA 1BN6A 4FOLA 3AUKA 2ZSHA 1W0NA 3W04A 4X94A 2FX5A 1UY1A 5G05L 1GOHA 4X92A 3HXKA 4QZVA 4H7FA 1YASA 2RAUA 3E0XA 1XRNA 1ZGCA 2G5TA 4OB6A 3I2FA 1XRLA 4UBKA 2G5PA 3I6ZA 4QDTA 5J1XA 3ESAA 2WN3A 2W47A 5SYNA 1E5TA 4HS9A 1ULPA 1QIKA 2QS9A 5CZKA 4KRYA 4WY8A 1LBSA 2CUTA 1IVYA 2JD9A 4ZXFA 1TAHA 4CUBA 1K3IA 5K3FA 3ECQA 3FLAA 1AZWA 1F6WA 1D7PM 3PFCA 4OD0A 1J1IA 1CVLA 3CZUA 4QDQA 3N2ZB 2VZVA 3U37A 1S8OA 4HVTA 1CRLA 2ID4A 1H6YA 1NUKA 3ETPA 1K42A 3VJLA 4N8SA 1SC9A 2EIEA 3O4JA 4MQMA 2XQGA 4BC0A 3NOXA 2HYXA 2LW8A 2Y6LA 2WSLA 1XZGA 1LPNA 1CUSA 1JU3A 1GNYA 4AZ0A 2HFKA 4P9NA 3DDUA 1B6GA 2WTMA 4W63A 2VO5A 3WSOA 2QXUA 1E8DA 1JZ7A 4MO3M 4B83A 5AK5A 3IDAA 3WL6A 1MNQA 5JIBA 3GXUA 4A16A 5ALKA 2PUJA 2WUEA 5FPQA 3HABA 5K3DA 4BDVB 3D5EA 1UZ0A 5CRIA 4XUNA 3AIKA 1J84A 3EQ9A 2G63A 1DX6A 3A21A 3F96A 1E66A 3R3XA 4V2IA 4U2FA 1CZTA 4UHEA 1J06A 4OYYA 1KU0A 1JHJA 3ABZA 2J1SA 2HA6A 2C5GA 5FLKA 4D0QA 3P2MA 2HADA 4QDUA 1VE7A 5C8XA 5AOAA 2W3JA 2DHDA 1EUUA 4OB7A 2IX9A 5CBKA 1VA5A 1GZ7A 4JKKA 1Q83A 1P0MA 3A2NA 2HA7A 3FL7A 3TJMA 3LLCA 4BATA 3WA6A 2ACKA 4ARYA 2ORZA 2W46A 2X09A 1UXXX 5FKJA 5AKZA 5ALHA 2OXEA 1L7QA 5T4BA 1EUTA 2WO3A 3UETA 4Q1VA 1CUYA 5LA1A 2WU4A 3WF3A 1GPKA 2XI4A 4HXFB 3C5WP 5EI5A 3HPNA 2V97A 1QZ3A 2ACEA 4K2AA 5DQ0A 1UK6A 5ALPA 2W1QA 4IO0A 4PSCA 2W1SA 2KD7A 3O9VA 1YS1X 3FVRA 1ORVA 4J3JA 2O7VA 1QO9A 4M0EA 4IUGA 2X76A 3IVMA 4CUAA 4ZRDA 3DL7A 3EB7A 1K8QA 4MEBA 4XURA 2WO2A 3JW8A 1BS9A 3YASA 4IQ4A 4XIIA 3VXKA 1R64A 5IJRA 4Y9SA 3CXUA 3KD2A 4ZZ8A 3K4AA 3WL5A 1LPBB 2H7YA 4MJ3A 3H18A 4A6OA 2GBFA 4OZOA 4MQLA 1US3A 3VD5A 1HKHA 3IUMA 1CIJA 2GYVA 2XMDA 2WN2A 3KSRA 1P0IA 2HRRA 3A6ZA 3GROA 2VAXA 4GHWA 4DNQA 4FDMA 5IFTA 3JXSA 4PO3X 5C81A 1SG3A 1GKLA 4PQEA 5AKLA 1QOZA 3R3VA 3TGLA 1QLWA 2JF0A 2WAOA 3N0TA 2AXEA 2OAEA 4H7IA 4E8DA 5ALSA 2JDAA 1QIIA 2BUBA 4H77A 3PDCA 3VJKA 4QX3A 3D3AA 4JKLA 2YB7A 3PUHA 3H1AA 1TRHA 2W9XA 2QT9A 3O9MA 4GW3A 3IIIA 5C70A 1JZ3A 1UKBA 4BCBA 2EIBA 4M0FA 1CLEA 1P0QA 1ZIXA 2PKYX 4BRSA 4QB6A 3OM8A 4JUIA 4H7EA 2XUGA 5CW2A 1PFQA 2XUQA 2VZUA 3AZOA 4C4ZA 4FFVA 5AKGA 4YPVA 3SKVA 4WFKA 1WB6A 2J3QA 4X00A 2XUJA 2W22A 3CMGA 3OG2A 3I2IA 5T4EA 4P5YA 3M83A 3QPCA 2BKLA 4KE9A 4FLEA 5C8ZA 5AP9A 3FLBA 4FBLA 4Q05A 4EY4A 3NRUA 4W1PA 2Z4FA 3C7EA 1BU8A 1W99A 3PE6A 2DCJA 5E4JA 4BZWA 2BZDA 3K4ZA 3BGAA 2W92A 1W9TA 2J1EA 5JASA 3RKSA 4OB8A 1K45A 1W6RA 4OUKX 3I2HA 5ALNA 2EICA 3X3HA 1GPLA 3STUA 1UFOA 2B4KA 1Y37A 2RHWA 3K4DA 3WI7A 2QBXA 5T4FA 1UY2A 3BL8A 4Y2QA 3IAQA 2WJ3A 3FHQA 5DJ5A 5HF5A 3LPFA 4C4YA 1ZI6A 2PX6A 4X3CA 2QM0A 4HAIA 3BF7A 4DSAA 1BEZA 1G66A 4RE5A 2WFLB 3BIWA 4B0OA 4DUXA 3WK7A 3VDXA 2XQXA 4Z2AA 1X2BA 1PX3A 3ACGA 5ALXA 2VZTA 5ALGA 3DEAA 1VZ3A 4PSUA 3O4GA 1QTRA 2PSHA 4CIAA 3FYUC 4QEKA 2D0DA 1XZIA 5JAHA 4XVHA 4E46A 1UWWA 1UOQA 4F21A 4X93A 5CT6A 1WOMA 1Z68A 3WZLA 3VKFA 4BYMA 5I9IA 5JZSA 4I19A 1IQDC 3WIBA 5I8PA 4LKSA 4TGLA 1XZAA 3P1IA 4IHAA 4MYDA 5EHQA 3QH4A 1RYYA 3J7HA 4RNCA 3VVLA 1QONA 3FWHA 3VISA 4AO7A 4AQDA 1J83A 3DYMA 4B7ZA 3OGVA 1EVQA 1FFDA 5LA0A 4DNOA 7YASA 5C8VA 2XDWA 3E1F1 1X2EA 3JWEA 2WQZA 5AM3A 2E32A 5JALA 4DNFA 4B9AA 2ZEYA 1WCYA 1CUEA 4DXSA 3D4LA 4WDRA 4W1RA 1DT5A 3OTQA 4QAWA 1A7UA 4XJVA 5HF8A 5K3AA 4H7KA 3WYDA 1EK1A 4NS4A 4GWLA 2VCCA 4B0PA 4C01A 5AM2A 5EIHA 1JZ4A 3ZWQA 5FRDA 5HXMA 1K12A 4MEAA 3VD3A 3AILA 2QTBA 2X05A 2RIPA 1BHGA 3STTA 4JX0A 2V96A 4XWGA 1H22A 4KMQA 1O8PA 5CURA 2RV9A 4FMPA 3HACA 4F5ZA 2CBGA 1EDEA 4JKMA 3WKAA 2QJRA 3W5MA 3T52A 4BB0A 4YK7A 4PNZA 4EB0A 5AJHA 1JJFA 2J7MA 3OEBA 3T4UA 4X6XA 2NW6A 1GXSA 4QNNA 1XZJA 1UK7A 2OQVA 2QQJA 5ALUA 2J3DA 1JZ5A 1VOTA 4EUSA 3L1HA 1IMJA 4BXSV 1H2WA 4DLNA 2X8BA 4PW0A 2VCAA 2JEZA 1YAJA 3THCA 2JIDA 2VJCA 1UX7A 1EK2A 3P6BA 2E3JA 1QTIA 4ZY9A 2AJBA 1XKTA 1U8EA 3I3DA 1XQXA 5LCWL 4ZGBA 2FJ0A 1GKKA 1GT6A 3G8YA 1IZ7A 2LS6A 1QIEA 1UOOA 3D7RA 3WWDA 5FUIA 1AC5A 3WNLA 2HU8A 4CG3A 4MWTA 2Y64A 4ZZ5A 3C70A 3F2ZA 4L0CA 3WNOA 2FJPA 1ODSA 3HNMA 5HK9A 3DD5A 4H7JA 1NX9A 5CH8A 2WHRA 2EIDA 1KEXA 1AGYA 3C5VA 5JAUA 1LZKA 4WFJA 3H2JA 2O2GA 4G9EA 3B3QA 3W9UA 5CTAA 3GFFA 1XLUA 3UMJA 1R88A 3DECA 4E14A 4B85A 5FV4A 1LGYA 1CUUA 1NU6A 3RK4A 2HA0A 4L3WA 5DTIA 5CMLA 1F8UA 2B9VA 5HKBA 2HL6A 2XUDA 2G4LA 3FCYA 3H2GA 2XMCA 4W50A 4CUCA 5LIPA 3VD4A 1JYWA 1AURA 3NWOA 4TTGA 3OB8A 5A71A 3DJYA 2VT7A 1O8SA 4Q3LA 3C6YA 1NKGA 3O95A 3H1BA 4ZWNA 4QLOA 3B5EA 1LNSA 2O2IA 3H19A 4JH0A 3CN7A 3EF3A 3ACHA 1UXZA 3ILSA 1GQPA 3A70A 2PQSA 4QDOA 1XQYA 1EI9A 4PSDA 1MO2A 1QO7A 3MV11 5EHZA 2WKWA 2ZVDA 2XHNA 5CH5A 2HIHA 3FSGD 3H17A 5ALFA 5ALOA 4G8BA 5IYYA 3WZMA 5E2IA 3LEGA 2CJPA 1XQWA 2PU7A 1AUOA 1MU0A 1OH4A 1H2ZA 5JARA 1N5MA 2VTFA 2V9ZA 5LKRA 5ESRA 4EA6A 2Y6GA 4A45A 2VSQA 4FNGA 5CT4A 1VXOA 3V9AA 2GYUA 5DLPA 3HEAA 2XUAA 1SOMA 5AH0A 4ZI5A 2HDWA 1P0PA 5JZBA 1CPYA 3FAKA 3W2TA 4C4XA 4P02B 2QZPA 2VAVA 2ZEWA 2XLBA 4ARAA 2WJ6A 2YFZA 4XUQA 3D2BA 5CH3A 4EBBA 1OT5A 3A22A 4CFSA 1TQHA 3C6XA 3DLTA 3K9BA 3H0CA 2EEPA 2BGPA 4G8CA 3FVTA 4J0GA 4QWMA 3NJXA 2AJ8A 4UFPA 4AX4A 5AKIA 1QIJA 1AKNA 2VF2A 3K46A 2WAAA 4OCZA 1DWQA 2ZSIA 4DMCA 3I2KA 2Z8ZA 3D3NA 2X10A 1WB4A 5A7GA 2QQMA 3OPMA 5A6VA 1XLWA 2YYSA 4INZA 1XFDA 3HLKA 3IA2A 1F4AA 3ANSA 3ZI7A 4EY7A 2BGOA 5HK8A 3RARA 3KDAA 4HZGA 2GZRA 5AKKA 3WKEA 1DYOA 1PX4A 4TXWA 1E3QA 1ULOA 1KU6A 4DUWA 4X71A 4BE4A 2J1UA 1LPSA 1TCBA 3WNPA 1SCIA 1R1DA 3W5NA 1DTEA 1P8JA 5JADA 3GGLA 5DN2A 4KAJA 4GBGA 5HF6A 3NQHA 2QJWA 3WA7A 5DYTA 1R9NA 2VL4A 2QUAA 4DMKA 1YQ2A 4UOJA 3STYA 5D7BA 2RVAA 4EY6A 2JBWA 1CUWA 3Q0TA 1NAEA 2B61A 1CUXA 2WIJA 3V1KA 2XMQA 3G9UA 3C6ZA 2HHAA 2Y2VA 2BAGA 2WDBA 5K3FB 4KAAA 2VC9A 4KR0A 2XUHA 1AX9A 4AG4A 1W8OA 1Q84A 3DKKA 3LIIA 4BE9A 1HN1A 2XUPA 2Y6JA 1OXMA 2J1AA 5AOBA 2VZSA 4EHBA 3IB3A 1W9WA 3UESA 3C7HA 1CUVA 4Y2JA 2XUIA 1G4HA 1W52X 3BN6A 1CUJA 1FFEA 2CEKA 2VJDA 3IBTA 1BN7A 3VVMA 2H1IA 5AOCA 1HBJA 5LZ4A 2ZXQA 3LIPA 4U2CA 2R8BA 1K63A 1VXRA 3R3WA 1YAHA 5AK4A 1LPAB 3OGRA 3G0GA 2OG1A 5LZ7A 2VZOA 4DMHA 5DNUA 2QQOA 2PM8A 2WUGA 2OGZA 2O2HA 4FFWA 4UBLA 4B80A 4WJLA 2HA2A 5B4NA 1RWQA 5BWBA 5JXIA 3S2ZA 3WJ1A 5E4TA 3STVA 3ZLVA 2QR5A 3ANTA 3I28A 2PSJA 5LZ5A 5KREA 3SEPA 2WU3A 2Y1KA 1G42A 4Q3OA 3T08A 2J1RA 1LPOA 2XQKA 4Y2TA 1FFBA 4KRXA 4PV7A 5EFZA 4WCVA 4HXGA 1EB9A 3KXPA 1QIHA 1D07A 2H9YA 4LKOA 3WF1A 4PQQA 4CG2A 2IIVA 1R4ZA 3IUQA 1UT6A 2XMZA 3FBWA 1EVEA 2WM2A 3WNMA 4A3ZA 1QIMA 4UI9L 4GEGA 5HF9A 5K5EA 4JEIA 3K6KA 3FHAA 5SYMA 2VMFA 4DXRA 1BRTA 1CQZA 2VEOA 1QFMA 2JGIA 3HEIA 1TK3A 2Y2UA 3QITA 3MBWA 1C7JA 2JGFA 1K4YA 4WDQA 5KWIA 2ZJ6A 3CIHA 3R3UA 3HNYM 1MN6A 3QBJA 3UNPA 3MUZ1 4Y2SA 1VZ2A 4X6YA 2VTVA 1XPWA 2C0QA 1JMKC 3WF2A 4K5QA 2BGNA 5AM1A 2AJCA 5DTJA 3G9XA 3VDBA 4P93A 4ARXA 1HQDA 1XZCA 4BCDA 5AI6A 3KWJA 2HU5A 5FXMA 1PJAA 5ALWA 3DS8A 1VE6A 1E89A 1GMMA 1Q0RA 2QQNA 2Y6UA 4CCWA 4I4CA 1MJ5A 4P92A 4RE6A 1JYXA 5AM5A 5JXJA 4X7BA 4KACA 4Y2PA 1JYVA 2CKMA 4GECA 3R40A 4MWSA 1TCCA 2CB9A 1WCQA 3IULA 5IHRA 4FNMA 2QQIA 1EX9A 1U4NA 3WL8A 3NGMA 1FFCA 4AMYA 2ECFA 5IVDA
chains in the Genus database with same CATH superfamily
8MHTA 3MRTA 5BN3B 4J0JA 4F38A 3L43A 3FHOA 1P2VA 1O9GA 2ZSEA 3VTFA 4EF5A 3D0OA 2RAPA 2WHPA 3EMRA 1C30B 3DT9A 3MUOA 2CHFA 2I7CA 3MEQA 3BGVA 4ETIA 3LS2A 3WS7A 1I6MA 1P9OA 2PZAA 3QTBA 4U2GA 3A1NA 4UU1A 2VATA 4X8LA 4CCEA 4NENA 2YZ4A 3ACIA 4G8DA 5HQJA 3KD3A 1SACA 3K0HA 1I1OA 1KP3A 3LO8A 3C4VA 4B3RB 4B2LA 1GFF2 4R41A 3H86A 4QVGA 1RMU3 4ZTZB 2IZ0A 4Y8VA 4LV6A 2X8AA 4CEJA 2IYOA 1UDRA 3ILFA 1N0UA 3A2LA 4YRLA 3TZEA 2XCUA 4RZSA 4QOFA 3OX3A 4F4IA 1SMKA 2GF0A 2UKDA 1X7WB 1A9XA 3PPWA 1VG9B 3N0RA 3IPRA 4TWJA 2Y1XA 5I7UA 1PHMA 4XZ3A 1L4FA 5A9SB 1ZAKA 1JDJA 3ZN6A 5LUBA 2QVYX 2G9UA 2R4UA 3I2DA 4K46A 2WTXA 1VP9A 4LZZA 4EJSB 5C9AC 1MS4A 5T6MA 3TBKA 1JYTA 4OHFA 2UVPA 1Z34A 1HW5A 1OSGA 4B3HA 1MT3A 1YMQA 2VVTA 4QJ3A 1Y8RA 1VE1A 2DTYA 4JR1A 4E5NA 3ZIAD 1GYRA 1E9CA 4OO3A 4GI1A 6REQA 3MMNA 3I0NA 2C82A 3U07A 1PO22 1P1RA 2ACVA 3LPMA 5ERGB 2XUEA 1QH8A 1F6BA 4DLBA 4S2DA 4RAOA 4R52A 1S9DA 2BMEA 4JOBA 4E15A 4DUZB 4C0BA 1CUZA 1AKRA 2QUOA 4CTJA 5DHPA 3WDXA 5BYAA 2I2BA 3RVKA 1SEPA 3TEJA 2FV8A 4WE3A 4CV0A 4QEDA 2ORYA 4ZVVA 1W96A 4YRNA 3HN7A 1LESA 2ORWA 2I1QA 4IJKA 5C3QA 1GILA 4K6FA 1OUMA 2W5FA 4DB5A 2QQEA 3GLHB 1C4XA 1C3OB 3FOCA 1H8TC 5ISMA 4KQJA 1VM6A 2XE8A 3N3BC 3COZA 3RYHB 4UUMA 2H4YA 3B89A 4LJ5A 4YVSA 5BOSA 2J7KA 2EWWA 1RHI2 4U8HA 5LBTA 4YG3A 2PKRA 4Z1MA 5BT9A 3ES9A 2HOQA 4DUVA 4MADA 2O6LA 3VR1A 4YGDA 3N0XA 3PZBA 4FBMA 3DXYA 3Q8WA 2RCYA 2OXIA 1YCFA 2WAMA 4MRRA 4UBNA 4OQXA 3HJAA 3JATA 1IEQA 4UE2A 3V1LA 4KMMA 2IXLA 1U0JA 2WJVA 4OMDA 2PBZA 4L78A 3LU1A 4GOND 3WNCA 2MSNA 2FI1A 2A58A 3MICA 3HUUA 3VPFA 3K77A 4DSNA 2I0FA 3IA7A 3OO1A 3UAZA 3RUHA 3RJ9A 2YIDA 4GQBA 2ETVA 2FZKA 4FR0A 1R6TA 3EE6A 4AUNA 4Z9AA 4RY9A 2Q9CA 1VYVA 1CGPA 2BFMA 4L5IA 2J4CA 5B1HA 4WM8A 5EQFA 4IDAA 4GI2A 3QXSA 4LQCA 2GH8A 1B42A 3KQNA 4RD1A 1T8UA 2AUYA 4FCTA 1UOEA 3LEMA 4NEHB 4YN3A 3L0CA 3GJXC 3GLSA 5DM1A 1IUPA 1WZUA 4GOLD 3BBLA 1EUQA 4J75A 2R30A 2OC9A 4AG5A 1CJCA 2VW2A 3ER8A 1XZPA 3GD7A 3W20A 2BD0A 1S2BA 3HFJA 4OFZA 4CMBA 3U7FB 5HWSA 5EIEA 4JHXA 3AJEA 1U8TA 3MD9A 3U48A 3ZDYB 2NZUG 4K9SA 4LLOA 2CZQA 1IRIA 2YWHA 4PYQA 3KQKA 1PS8A 3EB9A 5EC8A 4WKGA 1SU4A 1VL0A 5F5XA 2AN5A 1XE3A 1TMF3 1DGWA 4V0NA 4LDQA 3IPVB 3AOGA 5CX1B 3SKJE 1XZKA 3DEFA 2FFAA 2AF4C 5DSTA 3F5DA 1TJ5A 5EUBA 5E9AA 3B1WA 1LJ7A 3GXBA 3NU1A 4YW2A 1NMEA 4W6WA 2I9KA 5DMYA 3GC6A 3TQHA 1RUNA 5BR7A 1KGYA 2CDAA 1IOVA 4EARA 5IT9A 5F1PA 1KDYA 2SICE 4Q3AA 3RHSA 4YVWB 4HXEB 5C1OA 1C4OA 1UFKA 3G6WA 1K6EA 4CCDA 2RG7A 1PO23 5K6RA 5J2UB 1XE8A 1EE9A 3O1JC 1TME2 4O4JB 2DQZA 3ZN4A 3A26A 4DV4B 1PJSA 1DTSA 1C80A 3ZFEA 4KYVA 5HTOA 1GAQA 1YFZA 2LDBA 4XIFA 3N58A 3ZK8A 5JOXA 3CZ9A 3U3ZA 4TLFA 2ESRA 3OT5A 3IOBA 3NT4A 1JYSA 3V2HA 2WP0A 3HWWA 2CCKA 1OLOA 2W42A 4IEPA 4NZZA 3B6ZA 4UQPA 3GJ8A 2QAGC 1E2HA 1USVA 3E6CC 4AT1A 4BIIA 1L7MA 1LA2A 4XAAA 4I9GA 3W7AA 3OZFA 4M8KA 1IN8A 4FKZA 5AXBA 3TB4A 4LJ4A 1RHI3 3CRW1 4AXXA 1YOVB 2X19A 1AF7A 4MXWB 2X15A 2O06A 1ZMBA 4D9JA 4P32A 2BMJA 2RAVA 3HKCA 5FAXA 1LQUA 4C1BA 5CM9C 3ZYCA 2OPKA 3C2QA 4QGBA 1YKGA 4IEIA 1MVEA 1BOOA 1K08A 2LIPA 4FE3A 5JIUA 2VJXA 3F8TA 4AW7A 1CK4A 4EZBA 3SC7X 2WWWA 1RI2A 5D8DA 3N9OA 5H4GA 3EG9B 4Q19A 1BXZA 1VLVA 1L2TA 4D6RA 4PLVA 1ZH0A 2B1GA 2VAWA 4PT6A 1CEEA 3KELA 1P7WA 4PG6A 4XFJA 3UUEA 2VOTA 3HP4A 4QYSA 2GCOA 2ACWA 4LZJA 1UXGA 3GCZA 3O0WA 4PYRA 4BMSA 1C9JA 4B82A 1N5KA 1BNCA 1PK6C 2R061 5EYXA 1U5AA 5IAAA 1RWBA 2AQ8A 2IOQA 5JISA 2NPIA 3DMHA 3JZDA 2JFOA 4EMTA 2VRCD 5FDFA 4ZDIA 3IT2A 2YH2A 2ZJCA 4KQIA 1X1DA 4HK9A 2XJQA 2DR0A 4FYHA 1Q56A 5FMCA 2NUPB 4BVLA 1WVGA 5AIBA 3N7KA 1RKXA 5JS2A 3ZW9A 1PT6A 3LDUA 2W83A 3ZD6A 4UHCA 3KYIB 1RI4A 5DX8A 2PWPA 1HY3A 2PGJA 4OATA 2PTGA 5JR3A 3B6KA 1YJAA 2C2MA 5KZMB 4UFJA 4TTSA 1J5PA 2H1WA 1QYIA 3THXA 4BMCA 1H4QA 1ZA2A 3NH9A 1Z74A 2VPYA 4HZFA 2GSYA 4KODA 5ECWA 4E4YA 4MQEB 4CDUA 1PEKE 2HFJA 5KQGA 3MAJA 3IP3A 2QTAA 3I01A 3LTNC 3IUPA 1N5IA 4RMIA 2OA0A 3J80A 3UV9A 4BAZA 3FAZA 3N7LA 1EFVB 5GLZA 2ZYHA 1C3JA 1M5UA 3TXXA 1TPZA 1FSZA 3JQCA 1F5SA 1AHIA 1G8FA 2XMRA 1QJU2 4XDPA 1GZSA 1VA4A 2WZBA 4J2HA 3TSCA 4RO0A 1NYLA 3MIDA 1WX1A 2C3UA 1JE1A 1CF2O 1DC5A 1NXPA 2ZR7A 4OSOA 3JALB 2AOXA 4BJ3A 4RPJA 2OO5A 1O77A 4AI2A 5AI8A 4PWZA 1LJUA 4CG0A 3TTUA 2RGRA 4ITVA 2CHHA 3WJ2A 3I23A 3IEKA 1ZRIA 2O48X 4IE4A 3PENA 1E63A 4ET7A 1UBCA 2H18A 5FO9B 1AUVA 4YYOA 1MPTA 1IN1A 1YJ5A 1GUIA 4JP5A 3MTAA 3TGWA 4YACA 5JOQA 1YR2A 3GXOA 1YFWA 3CZPA 4MVJA 3GBGA 2XDYA 2ZYRA 3O90A 3WBBA 1CIWA 1TAQA 1GCUA 2G70A 1UWKA 2YC4A 1DQYA 4EF4A 4NJ4A 4D6YA 3EGXA 2E5FA 2FPWA 5EJ6A 5DWDA 4NHKA 4CT5A 4YEDA 5H9SA 4DJDC 4Y6OA 4UXIA 5CFZA 3I1YA 4MSUA 4F84A 1UINA 1FYWA 1NMSA 3HVDA 2R5FA 1Z6PA 3WYEA 3STXA 3S2YA 1NVXQ 2P9GA 3RV4A 5HRAA 3FMIA 1I30A 3KHTA 1OIVA 2H8KA 2HMTA 2XYQA 4QX2A 5EMHA 5FZHA 4YRDA 2YRXA 5CX4A 4YAEA 1MX5A 2VUDA 1Q8OA 1XZDA 1FVFA 3C15C 4UFKA 4BQPA 3K1TA 3WG1A 2PSSA 3Q7IA 4MAAA 1ASJ3 3O21A 2ZHNA 4RTRA 3JWPA 4JGBA 1JHZA 4X94A 5EGSA 2XXAB 4J43A 1NW7A 5AC92 3GJSA 4H55A 5A3OA 4RHFA 1XRLA 1F5NA 4FVVA 1U8CB 5G4LA 1U0OC 4UKDA 4W4TA 4MWGA 3JBG1 4EA9A 5FQOA 4CBVA 2PX0A 5A4FS 1ULPA 5CA1F 4KUEA 4E09A 3UFXA 1EV11 2ZIFA 5AW4A 4ZXFA 1Y3AA 4WVMB 3CR3C 1KE2A 4OD0A 1CVLA 4D41A 2VG9A 1RHMA 5B58C 3R1IA 4HVTA 4E32A 2IYRA 1VJ1A 4CV3A 1JR2A 3VR6A 1CY4A 4LSWA 4PLOA 1KMHA 2ADOA 3FUQA 3BTYA 4MGYE 2WNUA 3M9WA 4N9HA 3ZBTA 2F17A 2W6IA 3WNZA 1RJDA 2BDTA 2HFKA 4CPDA 1B6GA 5ECGC 1GZTA 1MO6A 4GF5A 3AP4A 3CVJA 4B74A 3AXDA 2PRKA 2PUJA 4GIQA 4TRJA 1YRQA 1X1QA 2KI5A 3HHPA 2IH2A 3A21A 3HN2A 1JIQA 4ZN6A 1KU0A 3KKLA 3H5WA 4KH0A 2PMEA 3RRYA 1FW6A 3H8UA 4LOIA 4FC6A 1IKQA 1ZITA 4IW3A 4L8LA 2FR0A 3HO8A 4AHWA 3TOZA 4B1MA 1TEIA 4BV8A 5F2EA 3W4JA 4DQLA 1QJU3 4C0LA 3UMGA 1F5JA 1EUTA 1TL7C 2PGNA 2RB5A 4LZWA 4B3BA 3ICOA 2ACEA 2OUKA 4ZJPA 3RFUA 1P29A 2R8XA 2I07B 3ROGA 2YTZA 4ZGGA 1M2WA 5DABA 2IOHA 1IY1A 1G3UA 1DG6A 5K09A 1NWCA 4AJ4A 4G63A 4TUYB 2GKSA 3JWIA 2BF4A 3Q9SA 2PWAA 2ZZKA 5FOWA 4LK6A 3ZV4A 2NNLD 5DM2A 1RJ8A 4L08A 2NADA 4MV9A 3EVBA 4DUPA 2FLWA 1UYPA 5C2JB 4LOJA 2MWMA 5F2NA 1F60A 4M99A 4FUQA 5KXBA 2GYVA 1Z2NX 3ME5A 5FZGA 4PFQA 5HW0A 3MW8A 3VBRB 1P1HA 1BWPA 2ZJ5A 3WR5A 1SG3A 2XRZA 1XD9A 3KPYA 4FXPA 5EG5A 5FBKA 4EABA 4MI6A 3QTTA 1Q44A 2YB7A 4N12A 3G2JA 3IIIA 2HBQA 1KRXA 5IH3A 4M0FA 1KYVA 2XZDA 1FZTA 4H1WA 4FI3F 4FFVA 4L3OA 2HRZA 5FO0A 3LSEA 3WHUA 2EKDA 5EJFA 3C8MA 5E4JA 2CK3A 2AHOA 1YIFA 1WDLA 4IIDA 1I2BA 2FGKA 1G8KA 3T3IA 1EFKA 1K68A 4XIYA 1DZ3A 2B4KA 3DAOA 3C6QA 1SBCA 5IARA 2QPTA 4E2SA 5L7YA 3DZHA 3VJRA 5HF5A 4CSWA 3EHKA 4B0OA 4CLDA 5EPAA 2XQXA 2ZX1A 5G4KB 2ZI7A 3DEAA 1FTYA 2PSHA 5CFQA 1FTGA 3ZFGB 3VYVA 1EYZA 1K5MB 5K3OA 4O61A 3KQRA 1XWFA 1E6MA 4I0BA 2VUJA 2O2JA 4AR2A 3NNFA 5EJIA 2Z5LA 3J7HA 3HNPA 4LO5B 5C1IA 5HE9A 5LDGA 2UWBA 2ZX0A 3INAA 4AQDA 2YFHA 3M4YA 4LX0A 2PKCA 3OCVA 5C8VA 2ZIVB 5DDJ1 5AM3A 2P2LA 2WZQA 1CAUA 4Q7MB 3MUEA 4X66B 3VH4A 2FPIA 3EZ6A 1P4GA 3BMCB 3RRFA 4LWQA 4REQA 4CIYA 4KPUB 4A2WA 2PMFA 1JDBB 4RM2A 1VALA 4XLZA 2OV6A 2FMYA 1UJNA 3I2YX 4HSLA 3FCOA 1N1YA 1A27A 1FMD2 2WICA 2OOSA 1RHRA 2BEUB 4Y1RA 5KJCA 3HACA 5IK4A 2GEJA 1Y1RA 4S12A 3BE5A 3RAPR 3FIJA 2M98A 2BNMA 4WM8C 2AZXA 3GBVA 2VPVA 3PCRB 3ENRA 4XBNA 4AF6A 2VAPA 1AMUA 3ZX5A 3K51A 2IPOA 2YWXA 3VYSB 3SYLA 5ICMA 2WT4A 3O0XA 3QG5A 1QBKC 1SXHA 4PW0A 1COWA 3ND7A 4IIYA 4BUCA 4N7JA 2VJCA 2W6PA 3BI3A 3ZS9A 2EFYA 3AVOA 3ZGZA 3WWDA 3O3OB 1AC5A 3LCUA 5IVJA 4CTEA 4MZUA 2IYPA 5L9RA 1NX9A 2PHWA 2WHRA 5H9WA 1Q0SA 3IBCA 3AVPA 1FVOA 5J58A 2YIVX 1XTRA 3IQEA 1L6IA 4L8QA 4KWIA 1JSCA 2ZIGA 4MI1A 4O6VA 3UK2A 4LF9B 2AMFA 2L69A 1FCJA 1ZYBA 1VBMA 4ZVLA 5AUNB 5CMLA 2B9VA 3RGBA 1LLDA 1U3FA 1KDTA 3VPCA 1WHSB 4LBKA 5IKPA 4PFJA 3OB8A 3DJYA 2DPXA 1M0EA 5EP1A 1BTOA 2ZIUB 3W59A 3S7IA 2ZHLA 2JIMA 3WT3A 3ILSA 1K9SA 3U19A 4QDJA 4I5FA 1TI7A 3G6KA 2RH5A 5JJLA 2Q3MA 4Z4EA 2ZVDA 3DBIA 4ZU5A 3M6XA 3U14A 1H9PA 3ZDDA 2Z2KA 5K0ZA 1XEWY 1A9ZA 5LKRA 4L16A 5CBLA 2A6YA 2O8QA 4FNGA 2XA9A 1XVLA 4IILA 3RPEA 2IW3A 5I7AA 2QTRA 4FFBA 3N9PA 4OXYA 4L74A 1EUYA 2VQAA 3ZCTA 2WJ6A 3D2BA 1R5NA 5B37A 1D1TA 4E2WA 2Q7XA 4R16A 1XJQA 4AGVA 1ZD1A 3ZFEC 1T3TA 3KF5A 3DZDA 3G8AA 5TE9A 4R54A 2UUCB 3X44A 4XSVA 3WBJA 2YBPA 3RC7A 4HQOA 4GI7A 5A7GA 1QHDA 1XLWA 2V1UA 2C7QA 1TM7E 2EFEB 1OLSB 2GZRA 4LBNA 3WKEA 2DVMA 1E3QA 1E5DA 4E27A 1G8AA 2CLDX 3P1JA 3KB6A 5LQNA 1P8JA 3FNEA 1QYRA 1TJNA 2RJLA 3I7DA 2BR5A 4MUKA 3OJXA 4MYRA 3WA7A 4AFAA 4DMKA 3IP7A 3R0XA 2PVPA 4FFGA 1E2LA 2AK3A 1J1UA 5FR2A 3Q0TA 3AM3A 2EKPA 1PL0A 4CRWB 2GSDA 5DF1A 2ZUSA 5E7JA 1A8PA 1OXMA 5EXEA 3G2KA 5K3SA 4Y2JA 1W52X 4ZIRB 1ZGHA 4HL6A 3RZHA 1GZ9A 2WWTA 4NBTA 4EHDA 3AF6A 3GCXA 4JDPA 4KU4A 3CLTC 1LPAB 2FK7A 2R68A 2IYZA 3PEVA 5BO5A 5DN6D 4PYJA 1ZZ8A 2AR6A 3VHRA 2Q6OA 3AXSA 4DG5A 1D4ZA 2WUGA 2O2HA 1A3KA 2O52A 4PX9A 2VMGA 1NXXA 3DXTA 3ZY5A 1CJBA 2GPAA 1FDRA 1UKYA 2GDZA 1ZMOA 2CGEA 3K35A 1FXWA 3TCXB 3EIUA 4BMBA 4KRXA 2QP9X 2ZR8A 4CG2A 4UM9B 1SUBA 5F5CA 5AVPA 1XA0A 5SYMA 4ND7A 2G76A 1QPZA 4Y24A 2Z4SA 4GMFA 4RJIA 4TSKA 2YKGA 2EXXA 1K4YA 5FI1B 1OX4B 2O0KA 2OCYC 4QM9A 3OJLA 3DC7A 3EK2A 4P5PA 3X29B 5TIIA 5D5HA 4CFZA 3WF2A 3IUEA 3HZRA 4P93A 2GA9A 5G2OA 1UW8A 1V37A 5JOZA 2FP3A 1DLIA 4D0LB 3OJCA 1PJAA 4IS2A 3HM9A 1EG2A 2R65A 5A33B 1DAOA 5FOBB 1U1EA 3RR2A 3BH0A 2RHBA 5JXJA 3N28A 4JGGA 4LJAA 3G8DA 4P5DA 2XVZA 2O8CA 1SXGA 2XJ4A 1WZ2A 2JFYA 4OAQA 1GG9A 5IHRA 2VWHA 4QBKA 2P2ZA 1SXIA 4GXQA 3ZH2A 3WLAA 3BC1A 5KHKA 5TR9A 4CDUC 2G0NA 1L5VA 1GP2A 4AY5A 5DG2A 2PZEA 4W7SA 3JARA 3FRJA 5LP6A 2C42A 4KO3S 3AKPA 3EA0A 1BROA 1ZJ4A 2HRDA 4FPFA 3P7MA 5CU1A 1Y48E 4FSJA 1ZVQA 5K8IA 2NV0A 3O8RA 3P9XA 5HMLA 3OPYB 3U7IA 4HGPA 3GFTA 2ZJ2A 4YAIA 4PX5A 1A5SB 1Q21A 3L9WA 4GPEA 5C5DA 1KJYA 1X36A 3KJIA 4FC7A 2Q8PA 2OO5C 1UMHA 4ZU1X 4L11A 4KC0A 2AG1A 4A15A 3SHRA 4AI1A 4CG1A 5HTKA 2XEXA 1PJ2A 4KOAA 4GQAA 4K2HA 2EFDB 4DIOA 1NLRA 3A36A 4OJKA 4M3CA 1IJKA 3V8EA 3ZE8A 2XYGA 1FXZA 3V6LA 2VMIA 5EVJA 3POIA 4CEYA 4S1PA 1O96B 2FUKA 3IDQA 1ZRDA 3SJZA 1OH6A 4CM4B 3UWOA 4RMNA 1EU1A 2ILVA 1LBTA 2RR12 4MHRA 4UE6A 2P2KA 4II2A 1FOD2 3Q1KA 2C1FA 1BFUA 2E5LB 3ZXJA 3OOEA 1E6KA 4KN5A 4BM8A 5I45A 4XDQA 1T2VA 1B1AA 3HBMA 2VDVE 1KJ9A 2B2CA 2MSLA 5BWNA 1XLVA 1HM5A 3CG0A 4UVIA 1FJGB 4QRDA 2PZBA 4M1MA 2K46A 2XE7A 1T2FA 1I3NA 1E3JA 3SGLA 2JKBA 5LYJF 2HF7A 2OSBA 3H65A 3T38A 4ADSG 4IRMA 5AK3A 1H1IA 3UA4A 3R3HA 1HA3A 5FQ0B 4ZYZA 2BM1A 4GPAA 1QYVA 3EY4A 4PC3A 2WVHA 4LHSA 1T6GC 1RQLA 4CKYA 3NEYA 1Z0AA 2PXJA 4A0SA 3ITQA 5DTRA 2W6CX 3G79A 4GYKA 4QPGB 5BV7A 1YRHA 3FG9A 2OENG 4O3FA 5I47A 1V16B 1C0LA 1ECCA 2R7LA 4QXRA 1H6XA 2YFKA 3ZYJB 1N8SA 4KWJA 1FAYA 3PWSA 1Z15A 4KFUA 5DWVA 4ROTA 1Q6YA 1HDYA 1T6NA 3T5MA 1K88A 4LMFA 4Z7QB 1Q0ZA 2D6PA 2V5DA 1Z3CA 4BNKA 4Z8XA 1YB4A 3R0IA 3NKFA 2HWC2 5E9JA 3QBDA 2WNUC 4URYR 1EFPB 1T91A 3ZCXA 2PJRA 1HQYE 5G04L 3CDZB 1J2EA 4O4IF 2POCA 5ANNA 2ZYVX 4CM9D 1JT2A 2F1KA 2M6LA 1I2MA 1XTJA 2X0NA 3CVWA 3FOBA 1QQP1 2OCGA 5A9RA 2Q0SA 4KBFA 1P91A 2ODWA 4I14A 3HJUA 1SCDA 1TUBA 2NUBA 4X8MA 3KYCB 2V73A 1T0IA 5FBQB 2QVGA 3BDVA 4LS3A 3CF4G 3KO8A 4RQPB 5CJJA 4DZGA 3AEUA 1NTRA 2OBNA 2VRNA 1NDHA 4N3BA 5DTEA 1KARA 1U2TA 4DIEA 1YR6A 5C8YF 5IC4A 3FYTA 3SWWA 2PRSA 2O0JA 1EUDB 3F5FA 3D8UA 5CFCB 3KCCA 1N6HA 1CIVA 5CIRA 2RB4A 3JRWA 1ONOA 1NSFA 2GN9A 5A7FA 2HCRA 1KAGA 1EHYA 3JD4A 3L02A 2EDAA 1KEWA 2FPGB 3IBGA 3TLBA 1AH2A 4KFCA 3PLAE 4R1MA 2C54A 3GRKA 1G3QA 1CR0A 4GWGA 4MR9A 4E1VA 4MS1A 4KAFA 4MH0R 4LOHA 1HQLA 4WLNA 4K87A 4U0JA 5FUYA 1A6CA 1MAUA 4Q4W1 1JWBB 4C5CA 1IU9A 4OK3A 4U2AA 2XWBB 4UM9D 2I1LA 4CF3A 2XXBA 2CXHA 4FLFA 2HW8A 2PJZA 1ZXXA 3LWDA 4DJAA 1OFUA 1KH1A 2QV0A 2GGSA 3OLZA 2H48A 2J3IA 4R8KA 2RHRA 1V7ZA 3VGJA 2WO1A 2QRPA 3GELA 1PDVA 4L92A 1PIV1 4G0YA 2IZOA 4WX2B 1YEWA 1RS0A 1FOD3 2L42A 1NJ5A 1AYM1 1A71A 3U9TA 2HU7A 5ALVA 3FHJA 1PX0A 2FN8A 4LRXA 3BF8A 2XH8A 4UBJA 4QJ5A 4N3NA 1HRV1 1FTQA 2G28A 1MG5A 3WF0A 2QQ0A 1U04A 1KGDA 2JCSA 4PAQA 5MFPA 1VHJA 4UNIA 3WJ7A 4DL9A 4IEEA 2Y68A 5BQ5A 4AVTA 5ITZB 2FSHA 1DC4A 4BNNA 2JCXA 2NTJA 3I6IA 1X33A 2N9UA 3ZE9A 1BCSA 2JFUA 3AKCA 4BP9A 1ZGJA 3QWHA 4B6SA 2PIAA 3D7KA 5DUWA 1CE8B 4D9BA 2VL7A 5E6HA 3GM8A 4OXKA 3SHOA 1D2HA 3QH6A 4X90A 4BXFA 3DOHA 3OZWA 2GN6A 3S0JA 2CDCA 2RJOA 2YJ5A 3SAJA 4AJ1A 3FPEA 3PXDA 1UC8A 2HRQA 2PRYA 3CB4A 2DU1A 5ALLA 3TRDA 3ILHA 3BHJA 1ZD5A 5F3IA 1DFGA 5CJPA 1B74A 2C4KA 1C1XA 3PKJA 3A3OA 1QJ4A 3IKWA 4CP9A 1IG0A 1HDIA 4XIOA 1R092 3TOVA 1QU2A 4BNYA 2ZM6B 1UOPA 3NZEA 4BQSA 1TU4A 5JZOA 2HWC3 3E3AA 1IVSA 2AJLI 1NXTA 2NM1A 4BU2A 3WLPA 4C0JA 4EYGA 5AK6A 5IABA 3ROPA 1MC5A 2PT6A 4AP6A 4IH4A 1XN4A 4PAWA 3UJ9A 2UXBB 4B3FX 1B3RA 4DM3A 3ENWA 5F8PA 4R2MA 1QGLA 4YW5A 2C00A 3HCBA 4H0CA 4TROA 1LD3A 5CA6A 3GN1A 1XXNA 3ZHCA 3Q6IA 4QQPA 2A75A 3GPIA 4A6PA 5JCZA 2VZPA 4JLSA 1QH9A 5F21A 2IYFA 1H94A 4K7JA 5B3JA 2BGWA 4K1YA 2C9ZA 3DYPA 5DGXA 5CW1A 5I3CA 1ZOSA 3ZVKA 2GCNA 1CUGA 5L45A 1Z6GA 3RLIA 2GD2A 4G4JA 4ZMRA 3TLKA 2OA2A 3GIDA 3LT1A 3ONWA 5LYYA 3PICA 1YNAA 3WHTA 1JOBA 1QO0D 3IKTA 1FUUA 5FPXA 5C1DA 3D3WB 1UKVY 3ACDA 2OXFA 4MZDA 4ALNA 2XQIA 3LT5A 3IBFA 2R1BA 1L9XA 5EHNA 2TS1A 5CNIA 3WAGA 4OFBA 3SZUA 4Z4FA 3A1TA 3KOMA 1JTZX 5E0OA 4CLOA 4JJGA 3JZAA 2EGGA 3S44A 3WSWA 3KOOA 2JGDB 2GLTA 2ZK7A 1ZGGA 3BRSA 5T57A 1R10A 1DYPA 3VQTA 2CF6A 3OQMA 1NT4A 4OMCA 3ET4A 2CXNA 2W08A 1XZEA 5B1IA 1NY71 3OU6A 3O7OA 3U0BA 1AX0A 1KY4A 1VSTA 1LNQA 3LLUA 4JHTA 4MHOA 3VZMA 1T4CA 2OD2A 2EW2A 5KNBH 5CVJA 2IH4A 3FHIB 4GXLA 1SFRA 1TKRA 3IPYA 4IV8A 4ZV9A 2Q9UA 4GZ3A 3CJXA 3AMQA 3FZQA 4PBPA 2ECOA 1H3FA 2NU8A 3CEJA 2AE2A 3Q3VA 4OJYA 3O1TA 3AFMA 1GN8A 3SK0A 1IBCA 3EEYA 2PGLA 5BNFA 2IUSA 4X1YA 4YM0A 1SHKA 1GVNB 3W3ZB 1QX4A 3CCFA 4GKXA 4MGQA 4L28A 5A2GA 4TN7A 3WQ7A 1P3JA 5AR1A 1VHWA 3T99A 2HIAA 3RW9A 3BMXA 4MKIA 2CLEB 5B3AA 3CJTA 2BBSA 4J7CA 1TZBA 1ECBA 7REQA 4NH4A 5BURA 1L4EA 4CE6A 5IATA 2ZZQA 1NU8A 1W76A 3GI1A 3UJ8A 4QD2A 2VJMA 3CNQS 1F0PA 3NONA 2ZX3A 4MA0A 5LWQA 2D00A 2C26A 4NZYA 5KJFA 3DZIA 3IHLA 5ABJB 2EKBA 1JMYA 1DUVG 2RJNA 2G71A 5EJZB 1Y7PA 1NUQA 1PNVA 4U36A 2NYYA 2HLDD 1P81A 2LBPA 2UAGA 3Q3IA 3A1SA 4PONA 1SUAA 5C5UA 3L7MA 1DKUA 2H7XA 1H8HD 1VRCA 2QY6A 2V98A 4BP3A 1R093 2PMWB 4FJ2A 4GZ9A 1BEUB 3NHRA 1GTRA 4C21A 2YXSA 5LUAA 5C1PA 2F67A 2Y1GA 5AI4A 4BV2A 1J0BA 1MVNA 3H1PA 3QKSB 4UATA 2YBKA 2PYTA 2ODEA 1SCKA 3K2IA 1UP6A 2D1TA 1CY7A 1UYYA 1O4ZA 4UCXA 4M53A 4Y1UA 3QPVA 3DL4A 4GP7A 1AR71 4QBFA 5G05L 1GOHA 2UUPA 2RM21 1C9YA 3OETA 3VGIA 3H87A 4OIMA 5EINA 5FPHA 4EHKA 3MTQA 5ECDA 1K6JA 1NONA 3RYKA 1VL1A 4J3NA 2FN3A 3RSCA 1AU9A 1YR8A 3PURA 1L8QA 1HE1C 2WK1A 5KVVA 1RC0A 4HS9A 3TIXB 2CNLA 3TKYA 4KRYA 1RMU2 1EFRA 3SISA 1OI4A 3IAAA 4P6VF 4TLBA 3BH7A 1RUI2 1AXYA 2H52A 4G25A 3PFCA 1CQ9A 4Q3EA 2DC1A 4FDAA 3GLGE 1NUKA 1TT5A 1K1EA 4OQ9A 3HB7A 1TW2A 2CMHA 1Q1BA 4KIUA 2LW8A 3H2SA 2FW6A 2XB9A 2JS7A 2BQPA 3TZCA 5CB4F 3UIEA 4CQLB 1DC6A 2CNDA 4O2BB 2XUZA 1JIKA 2WZR2 4W8HA 3SHFA 3ZDAA 2YZGA 5KNDD 3WL6A 2W00A 3RG8A 4A8JC 1C3HA 4NV1A 1XMIA 2PWZA 1AN0A 5E6SA 1PZMA 4OYYA 3KLOA 1JHJA 1OZFA 2M9MA 1JR3E 3VPHA 4D0QA 2XOKA 1HGXA 3UM9A 1BG6A 5FXXA 3BB6A 2UDPA 4RDHA 4PIPA 2WLTA 1GZ7A 2D5FA 2NMNA 2HA7A 3JQ9A 3AK4A 3EXEB 2CWDA 1BQPA 4GXTA 1ZX5A 4BE3A 3LLCA 4BATA 4HUQA 4LSZA 1RM0A 3DPIA 4Y20A 1R2QA 2IIPA 4AU1A 4EEKA 4NCIA 2KYRA 3BAFA 1N9GA 2I34A 3ZX7A 4LHXA 3IV9A 5L7TA 2VNOA 5KXDA 4ATNA 5F5LA 2HGZA 3R20A 1ORVA 5DE3A 2R1UA 3WZ1A 2VT3A 1Q1AA 4OFWA 1I7SB 3I59A 4MEBA 4IEUA 3IQWA 4OQNA 2VJNA 4Q29A 1KI3A 1SD2A 4Q12A 3A4MA 4F4UA 1XZNA 4A6OA 2BFOA 5IT4A 4RYLA 4LA2A 3C98A 1POXA 3AW8A 4MA5A 4B6OA 4HWRA 2XQVA 1UFQA 6GPBA 2YY6A 1CIJA 4XXHA 3TR6A 1W8IA 3CR7A 1PGSA 1TMKA 4YGEA 2OPBA 1K0FA 3LF1A 1R4MB 1ONSA 3MMSA 3VHLB 1KI8A 3H9AA 2V6IA 1QOZA 1NVDA 4JQSA 1WF6A 2G72A 3VYTB 4MIKA 2FBEA 1FTNA 2QUZA 4GD3Q 4QRIA 3PDCA 1ZSVA 3VJKA 4TZ0A 2VBGA 3K5PA 4MW2A 3O9MA 1XHEA 4L27A 3T12A 5CA0F 4IFTA 4CEYC 2Y0IA 1Z4KA 3GDFA 2VZ9A 5AKGA 1B14A 4YPVA 1F2UB 1WB6A 2W6QA 2UWAA 4RXUA 2QU8A 1A5BB 2P3IA 5EE9A 3GW8A 3BEDA 2MNGA 4D8XA 5BNZA 4Z51A 1G1AA 3R5JA 4B33A 4CDRA 5FZEA 2ZA9A 4TTVA 2P3SA 3WOHA 3LG2A 1SB8A 3B9QA 1SVKA 3MTJA 1EGQA 4IJMA 4IQGA 2I74A 5CLJA 5B7NA 3DE0X 3M0EA 3VBUA 4G26A 2FOLA 2VP3A 1T2CA 2GBPA 2VYVA 3N2GB 4M4SA 2IEZA 3ZZMA 4CMCA 1WCUA 1OZ0A 5GJCA 3ZNOA 2VLBA 3QBEA 4WINA 2P3YA 5BWLA 1WOMA 2VF4X 3GFPA 3ROZA 3VKFA 1RUI3 1B15A 2MOKA 3GZNB 4RHEA 2GPJA 3UH1A 5EV7A 4TGLA 1TMF2 5EHQA 5ESDA 4MVJP 3SDSA 2XNKA 3N5CA 2BOIA 4AO7A 2P6PA 2P40A 1V8OA 1HEYA 4LHZA 7YASA 3E1F1 1NVAA 1EAH2 3TNPB 5B2GB 1OLXB 4LCBA 2X8WA 1KYZA 1TM4E 2FMDA 1G38A 2WZR3 3D7NA 3A0RB 2WD7A 2JI7A 1L8LA 4NLLA 1A7UA 1V8DA 5K0CA 1WXGA 1G60A 1UIMA 4PVDA 3CPHA 4Q0PA 3BIJA 4E6PA 4WOPA 4MEAA 3P9NA 2OFWA 3TBDA 4M38A 2RIPA 1UZVA 4XI9A 4IEVA 5GGYA 4W65A 2ZHMA 1H22A 4L07A 3CH5A 3TL2A 2ZP1A 1QHHA 1OI3A 1GGEA 1DBVO 3W5MA 1Z2AA 4EB0A 1T8YA 2R4QA 5FV3A 5EJGA 1UK7A 2QQJA 1NFFA 4DLPA 4LBQB 2AZDA 4ZYTA 4RHXA 3T5TA 4HDKB 3KM0A 4BXSV 3O0VA 2QUHA 1ECPA 2V7QD 1HOXA 4YCJA 7GPBA 3R9WA 4BLJA 2BYTA 4AVCA 2BKEA 2FJ0A 5I6DA 2R7AA 3OPWA 2BTOA 3WLIA 2GXQA 2KS6A 3CRMA 1AL21 2BMFA 1G7RA 2Z09A 4JENA 1NRXA 3PGLA 4JS0A 4MWZA 3AR7A 4G0MA 3CLUC 3NAMA 1DO2A 4MKRA 3QUQA 1V6AA 1R18A 1LC3A 4IFBA 4U7WA 2RHHA 3FSJX 4MWOA 3S5JA 2J3MA 2ZDGA 4MS4B 4YT4A 2PO5A 4DC9A 2X1MA 3BEOA 3DECA 2PS9A 2NXCA 3RVNA 1KI6B 4CR6A 5FV4A 1T9BA 3C3AA 2IYUA 1CUUA 1G8GA 2F8TA 1MZEA 2P91A 5IVFA 3H6GA 5KPJA 5LIPA 2NUAB 1T9KA 3T4VA 3J7TA 5TPZD 2H51A 1NKTA 5FL7D 4G24A 3FJYA 4HTFB 4AS1A 1U6IA 4I09A 4XAQA 4UUPA 2C2OA 1RC6A 2UUAB 2H9AA 5H81A 3BL5A 3TMYA 5FORA 3UL2A 2AMLA 5HDQA 4ZC1A 5EJAA 4YRCA 3RV3A 5JARA 1N5MA 1KO7A 4EGFA 1NOIA 4Z0NA 1NJFA 2NOAA 1YU9A 3RVHA 2ZT6A 1TC2A 5JPMB 1G6Q1 1SOMA 3KAJA 1CJDA 4JLDA 1HRI1 1GZCA 4UJ3A 3WFZA 2OBFA 3FTCA 3NDRA 4XJXA 3DKVA 2EJWA 3A22A 1QNYA 1X80B 4J0GA 1U7HA 3NBMA 3OZXA 4UFPA 4DTIA 1IJFA 3AR6A 3OO0A 2C2GA 2KA3A 3RZJA 2X10A 4L0QA 4D4MA 3OPMA 1IPKA 5IVBA 1DIRA 1GDDA 3ZXKA 1NG1A 5JSHA 3RARA 1LRLA 2AI3A 2DR3A 3AI7A 5BQ3A 4L8GA 5IS2A 2UYAA 4AI8A 1LPSA 1WBLA 1SCIA 3RTCA 3WW1A 3ROMA 4DLAA 3VKVA 5JADA 1G2QA 3EGDA 1NBMD 3TE7A 5HF6A 2MPFA 1OXBB 3NQHA 4WZ6A 5BW6B 4FOTA 3BXGA 1GCGA 1I1QB 1EAH3 2JRCA 2ZU6A 3G9UA 3MWEA 3D4KA 4RTKA 5MDHA 1I4EB 3P4UA 2QN3A 1IS5A 2ZBPA 1KHTA 2PD4A 4XVQA 2V0NA 4ZV4A 3M4NA 4FW9A 3OQ6A 4LRSB 4FFLA 3CKMA 3ZXEA 5LN1A 4EFDA 3WIVA 4A8PA 3RAGA 2OHIA 1EZ1A 2IHBA 2XHKA 3ZWOA 4AICA 5DBHX 1S1AA 3GLFB 4QHSA 1YTUA 5F3GA 2QQ5A 1WY7A 4QGLA 5FY4A 2H1RA 1OKKD 1CWUA 2ZACA 4G1UC 4QYTA 2BJWA 4B80A 1GTMA 2FA9A 4QOIA 3L4BC 4P9XA 1M2VA 4G1MB 2QR5A 5K8LA 3NDIA 3GYBA 3S68A 4HX5A 1WD5A 2Z6UA 3P19A 3NX4A 5FTJA 3MWDB 4RIGA 3AZWA 5B3JC 4LKOA 1NN1A 2P7HA 3K6JA 1BXGA 2ZVPX 3FUVA 4B35A 1FV3A 3DN7A 5I8WA 4I9NA 3DTVA 4J1NA 1OFUX 5FKCA 1CQZA 1VG0B 2ZZMA 3D8BA 1UKGA 5J2TB 4RLSA 1ESNA 3AZYA 3L7DA 3QITA 5TB5A 3WXBA 1NZDA 4XDZA 5E1RA 2FRDA 4JGYB 2VP6A 3F73A 4G5FA 4BH9A 1MN6A 5BNPB 4YAOA 1XPWA 4YG6A 4BS9A 3OZDA 1M67A 2UXDB 3E4CA 1NQAO 1W8DA 2PV7A 5JI3E 2ET7A 1H5NA 4L9BA 1QKIA 1J7JA 4WW0A 4BVEA 2ZFUA 1K5HA 2AOUA 3UA3A 4MVCA 4E2QA 2X41A 1NV9A 2V8BA 1O97D 3NKTA 1KQ3A 4OJMX 4ZK6A 2QQIA 4QUBA 2V6GA 4LZLA 1X0XA 2NUTB 2ZAGA 1I5PA 4Q47A 4BZPA 5E95A 1XK7A 3FWZA 3HAGA 3DOUA 2P65A 4OH7A 5EMJA 2F1JA 1ASJ2 4WLFA 4D3DA 5AK0A 4ES6A 3CX4A 4MPJA 4QC2A 3MTDA 2GHTA 4A44A 1OKQA 5IYZF 4NU0A 4EAAA 2B1QA 4YW4A 3P2OA 1TYCA 3OFJA 4L5JA 2CNAA 3GRPA 2Z1DA 5FXVA 3T09A 1P0CA 3PNYA 3HR4A 2P9HA 2JVJA 1CUDA 1DFHA 4BXOA 1RAEA 2PS3A 1D4M1 2X6QA 3CN9A 3FBTA 5CITA 2XDQB 1F38A 3BMQA 4NUBA 4TMYA 5AW9A 4LBQD 1EM8B 3HA5A 3T6KA 2I7TA 4C29A 5BQXA 2W6JD 5AJUA 4OUEA 1ENRA 4OLJA 2HJIA 3IZOA 2JLCA 3EFOA 1P2GA 1R9GA 5KDDA 1Z4IA 2Z8XA 4MPTA 4YIHA 2QJOA 1PJQA 4ZKEA 3RU2A 5HJ2A 3ZMOA 2BEOA 2WILA 4FYIA 1YE5A 3OLXA 2ZQZA 2C98A 4JT9A 4XFKA 4YGYA 1Z5WA 2QLJA 1YFKA 2C8LA 3PHJA 1NWHA 2XYVA 4BRZA 2CWSA 1SQFA 2BFDA 3HA3A 3K30A 4BLPA 4ND3A 4C76A 3MFAA 3ONFA 4X6RB 2XT6A 2WEKA 3BA6A 1E6EA 5K7SA 1W8UA 3FYCA 3CNAA 5FPTA 1H6DA 1EK6A 2VK4A 1SHJA 3Q3HA 2D0IA 5FZ6A 1TKCA 5KCZA 5EZWA 1ZX1A 2LTNA 1N2BA 4Y7CA 1YRAA 4NPRA 5JZ9A 3V4RA 1F17A 5ENVA 5E3IA 5HCNA 5F2WA 4EN6B 4AVBA 1Q8VA 4WECA 3GVXA 3H75A 3I6YA 1UDWA 3WKBA 4KLRA 3T1VA 2ODPA 4I08A 2G4CA 3WWOA 1RXSA 5IT5A 3O1SA 4A1OA 1XXLA 3ZLTA 4GG1A 1VG1A 3SIWA 1GGFA 1JZ8A 3JQ7A 1DBQA 5COAA 4DLRA 1QJY1 2V7WA 4OH1A 1NRIA 2EAUA 4LORA 1W39A 2R44A 4U1RA 5DIZA 1Z2CA 2O5RA 2XH6A 4I6EA 4NF2A 2JENA 3LD9A 3UNXA 4E31A 1W05A 4O5AA 3RTDA 4DUYB 5HGXA 1JHOA 1GP5A 1VKHA 4OU5A 3RYIA 5KKAA 3PC8A 5F12A 1YJKA 4ITCA 5J2UF 4UOZA 2ZRMA 5A3NA 1UFVA 1YA8A 2AREA 5GZ1A 3LOQA 4AN1A 1LPMA 3BZWA 2GZ2A 3NOOA 3ZLUA 4LBLA 4HHEA 4HAOA 1WCIB 4QPIC 3K0FB 3A4UA 4M9XA 2HXGA 1QZUA 2H9IA 1MKYA 5A7QA 5BY2A 1XTZA 3OEHA 4PZUA 1SLBA 2X9GA 4URXR 2LALA 4PPGA 3ILRA 3UKNA 1B23P 1WULS 1W48A 2GJAA 5JAIA 4BKUA 1AQIA 4NXNB 3JQ9C 3QVGB 3I2GA 2IL1A 2QOEA 4PHHA 1GADO 2H00A 2DOKA 3PVEA 1E1NA 2C9AA 1U2DA 4C1WA 4RXMA 5CKMA 1UMKA 3UVEA 4MCIA 4PCLA 4PG5A 1UANA 4EN8B 1DQNA 3W77A 2K2WA 1X1TA 4J6GA 2FSPA 3CUYA 2W6ZA 1LK7A 2HMVA 2CLLB 3FFWA 4Z4GA 1TD1A 2FFBA 1XMJA 3GZEA 5TJ9A 1XVVA 1NVUQ 3MWJA 1PTJC 1P0FA 4P4LA 4RPCA 4YRJA 3OF5A 3HVKA 1SOAA 2GF2A 2Y27A 3FNFA 3RJ2X 1OYYA 3DAGA 4G0NA 2FWIA 4I02A 5FKBA 3I97A 5J1SB 5DP1A 4RKEA 4W5HA 2FWMX 3EF1A 4CRQA 3SZLA 1ZY2A 3RDPA 5LKAA 2EGUA 4JFRA 4CM1A 4CM3A 1YFUA 2JKYA 2RDMA 3ZWXA 3NIDB 4DR2B 1OD3A 5CXQA 4KN8A 4Z8YA 4UBHA 2GH2A 2CNOA 2A5GA 1OU4A 2WZDA 4OGLA 3NBZC 2XJTA 2FPPA 1E8MA 1UF2C 4G5XA 1JBQA 3QELA 4RD3A 4YW7A 1OFIA 2N75A 3VR5D 2IS6A 2PBFA 3MG9A 5CLHA 4FQ8A 5JFOA 3DZKA 1XBFA 2AD5A 3VNSA 4MHSA 1H05A 1DCTA 1HNZB 1HNWB 1YCDA 4X45A 4TYWA 3NIBA 1YONA 3S81A 1U6JA 3ZXGA 4H27A 1L5YA 2QQGA 1S2GA 2BP7B 3ASZA 5L3SB 4QJ4A 5TT0A 2P2GA 3M3HA 2AYHA 5L4LA 1BS1A 5IZCA 1G19A 4PRYA 1EUZA 3ZKWB 4NV3A 2V4ZA 3UT5B 3VBUC 3KV5A 1N3PA 4NIDA 4AURA 1HYHA 1RXEA 1YRLA 4MLZA 4WNIA 4RIIA 3E9RA 2DUNA 1JFSA 2OHOA 3A4TA 4RPKA 1O9BA 3VKFC 1Q17A 4M9CA 2QMYA 2QPOA 5DAVA 1J2TA 2Q45A 1SLCA 1DEXA 5F3RA 2AS0A 4DQAA 1KK0A 3U4QB 3Q2IA 1L1RA 4AFCA 1GWNA 4M76B 4YDQA 3FKSA 3M6IA 3LQQA 1V4NA 4R9DA 1EIWA 3IP8A 3FYSA 5BORA 2XTJA 2EG5A 1JF8A 1MS8A 3QFCA 2YGMA 4BQYA 1QIDA 2BFFA 1CAVB 4TTRA 1RUC2 4XUOA 1JODA 3ZXXA 2PHLA 1R6BX 9ATCA 2QL6A 4BJ5A 4HDMA 1WDTA 2Q4EA 2WYSA 2V58A 4P0PB 3N7MA 4PZPA 3OTIA 4WZAB 4KXVA 3EDCA 1TADA 1ZZCA 2X77A 1QFYA 3VM6A 1OSNA 2P5UA 4HV4A 2N7GA 4RD0A 2R1VB 1UIRA 1OXVA 5B57C 1UK9A 1V2GA 2VA9A 2F9MA 3UWKA 1XNHA 1NF9A 3R3ZA 4JQRA 2WVAA 5TT1A 5PGMA 5EAIA 4G5RA 2VH9A 4URHA 3P3PA 5HQ3A 4E33A 3E9DA 3BYZA 1U1CA 3PVNA 4QPCA 2GEKA 4JMLA 3W5JA 2BFNA 4NZNA 2AXQA 2QTMA 3CKYA 1GU0A 1WNTA 4Y6RA 2Q3BA 4MGTA 4DB4A 2E26A 3F3KA 5AJZA 5JAPA 2DWCA 4E88A 3VNRA 2OPHA 3F74A 2XLAA 4MR8B 2EYQA 1AQLA 3LOBA 3JQXA 4I1RA 2JASA 1K66A 2V9PA 4RZQA 1G5RA 4UW3A 3RFXA 2CLFB 1ZEMA 3GG9A 4IX1A 4QUAA 3DOIA 3IQHX 2F1HA 4PYNA 3MB5A 5NULA 4KIGA 2QW1A 3OIFA 1V6OA 3JQAB 3ZY6A 1FFSA 2QMOA 3ORYA 3P27A 2OLEA 2H0RA 4PGGA 3MYXA 1KFJB 1DXQA 1BE8A 4KNWA 4RPLA 2C3MA 3S7ZA 2VPQA 2C96A 4I3PA 4H4EA 1I5RA 1K7SN 2WFF1 1HQKA 4KIWA 3CF2A 1GFWA 1IUKA 4MGKR 1ISGA 3A27A 2H4ZA 4FGSA 1AA6A 1T1GA 2PJDA 5ALEA 4Z9FA 1TVGA 2DLDA 4AE2A 3GHHA 3QY9A 4Q2FA 4FFIA 1GZ4A 2QZ2A 3Q3CA 4H1VA 4RHV3 1R9MA 3ELWA 2UVDA 4C4RA 3HVJA 4MP8A 1CQWA 4EFMA 5BSWA 4ZTUB 4CQNA 4JSYA 2W8BB 2FMKA 4WACA 1QS0B 1UBJS 1V26A 1LVUA 4HQFA 1N6KA 2LD4A 4JC0A 2R11A 3O84A 4E4ZA 3U5TA 1W59A 4CUJA 1S0GA 2PAKA 1DL5A 2DWOA 2IYTA 3TVDA 3UMVA 5IJ9A 4L22A 4QQHA 1FFXB 2EX0A 3TKLA 1HOTA 5JAMA 5ELLA 3DE1X 2OR3A 4ON9A 1NLFA 4DNPA 3L04A 1P5ZB 2JVKA 1NNLA 2K2SA 4NP6A 4NBUA 5DASA 3CQOA 1ONBA 3KVOA 2ZBFA 4NWWA 2RS51 3REQB 1RUC3 2OGTA 1RINA 1LENA 2VXCA 4D9GA 2R5NA 3AUKA 4IV5A 3W04A 4NS1A 1K7YA 2OZLB 3BD6A 5FYQA 1BVRA 1QCZA 1Y6FA 1O3SA 4PCAA 3NL1A 2BGLA 2WS91 1ABEA 4Q7QA 5ULLA 3LHKA 2NVWA 1HE3A 4IIJB 3I6ZA 4EGCB 4N01A 4F7WA 3GLKA 3EARA 4HZUA 4C91A 4B6JA 1QDLB 1F2TB 1H85A 1OOEA 3OYWB 4CDGA 1TYDE 1UCXA 1NJGA 3S2GA 4O65A 1D7PM 2E4XA 3FBGA 1G2PA 1Q1EA 2R48A 3KJXA 4DF3A 1AUQA 3SE7A 1RL3A 5JBIA 2CHUA 3JUUA 1VPTA 4V1CB 1GLVA 3HBZA 2DGDA 5T3UA 3QEMA 3W4KA 1M1YE 3BIFA 5DN9A 2FRDC 2O1WA 3W8NA 5L3QB 2ZGLA 3SXWA 1ZBE1 3PHHA 4RPGA 4FX2A 4M7PA 1CS4C 3RS5A 2H11A 5J37A 5FPQA 4CUZA 3HABA 4FBGA 3V7UA 4KWEA 3ZH9B 4Q4AA 3AF2A 4AEDA 1TQ6A 3QXHA 3NNDA 4JL8A 2QROA 4D94A 4QOEA 2X29A 4MDEA 3HSKA 2DPYA 2WA4A 2RAFA 5T41A 1DZQA 5H9VA 1NCQB 1ICIA 1TIPA 1OBOA 1VA5A 4J1SA 4BV9A 1MJGM 5TF0A 3U81A 3BOSA 1NRJB 5F2KA 3NAPA 3WLLA 5FMOS 2IYLD 5DO9A 4WJKB 4HDQB 3L8GA 2WO3A 5TPWA 4C5BA 1I7LA 5LA1A 2WU4A 4G2NA 3ND9A 5G0WA 1NQTA 3AFHA 3HDTA 3ZZ1A 1UKZA 3N2NA 3I3SR 1Y8ZA 3AK0A 1DGWX 1P3DA 3UKTA 5E1BA 2HBUA 1T6YA 3K31A 2D7JA 3MXTA 3VMMA 3QVKA 1J8DA 2OESA 3WDMA 1YI8A 3ME2A 5F51A 1CN1A 3BFJA 1IXYA 3GLIA 3VXKA 4OHOA 2UU8A 3I9V1 3LA8A 5TXGA 4LO4B 1WU7A 3K4AA 4N1AA 4NATA 3QK7A 3GJ6A 3CVXA 3RBZA 1ZH6A 3IEXA 3IEIA 3DT8A 1PVDA 4KVAA 1E94E 1P5HA 4RJTA 5M04A 1ZMTA 3HK2A 1P0IA 3GROA 4P0TA 4BKPA 4DNQA 1AY0A 4A8JA 4WIAA 1L5RA 3TTSA 5TJHA 3WGOA 4Y1YA 3C3DA 5IHPA 2AXEA 2JBAA 4H7IA 5I4BA 2JDAA 2BHSA 1WVMA 3PQ3A 4HN4B 4QX3A 5D8AC 4JKLA 1C8M1 2GPSA 2W9XA 1HDXA 4GBMA 4LE1A 2OQRA 5B4TA 1UBFA 2HSWA 1IFXA 2R86A 3P8ZA 2VHXA 4I1UA 4RF2A 3LWNA 3GALA 2O1EA 1YBVA 4CDNA 1Y89A 4FBLA 1TTHA 4B44A 5BSTA 1H2AS 1E1QA 3R23A 3HMQA 2W92A 2NU7A 3GU3A 2HCFA 4R1UA 4QQRA 4OB8A 2H63A 2EICA 2QZ9A 1HI9A 4BP1A 2XAUA 2QBXA 5T4FA 1SCBA 3RYCB 1ZONA 5BV0A 1QQAA 4LDRA 2PX6A 4X3CA 4HAIA 2B7LA 2PIDA 4DSAA 1G66A 4YPFA 3PJFA 2ZBVA 4F85A 3TEWA 3JQAD 1T1IA 1YI1A 4Q0SA 3IOEA 4CIAA 1T25A 1KI7A 3G0OA 4TQAA 3D1JA 3AEKB 3LC2O 3EISA 5I8PA 2P0EA 4IHAA 4W9MC 4G4SO 5JPDA 2NO9A 5EIFA 3VISA 4UVEA 1RJEA 2O0MA 3LPNA 4COUA 4Z82A 3EXHA 1TNRA 1R5BA 4BMYA 1OI7A 2XDWA 3IR6A 1DOAA 3VU3A 1XEWX 1QRAA 1U98A 5C3OA 4A2UA 1WCYA 4DXSA 3UOWA 3VU9A 1BDHA 2G1PA 3AMVA 4JI5B 5JRDS 5HF8A 2KWIA 4M0CA 4RW0A 1W2OA 4A3XA 4OHYA 2QR2A 4X8HA 1J23A 4OL9A 5FRDA 4QWNA 4E9KA 1NHGA 2OZKA 5FFNA 4MMYB 1GWLA 3EH1A 1XGKA 3PC8C 2V96A 5JTUA 1OBCA 1CJPA 2PCJA 1XTVA 1R081 1HYGA 1PR4A 4JKMA 1UJ5A 1HDZA 1FPN1 3QEJA 2FMFA 4XJTA 3RIMA 1J8MF 4BB0A 4UTZA 5KHJA 4X6XA 5LD2C 4HDNA 2OQVA 5ALUA 4EA7A 2Y38A 3BTAA 1XOIA 1IMJA 5CISA 3DBHB 4FOYA 4KQ9A 1ODJA 2PA0A 3MAGA 4EP1A 2NM0A 2ECPA 5CR9A 4MUMA 1TUIA 4GO1A 3UTCA 3W5HA 1C0EA 1BBT3 1GKKA 1QH1B 5IEBA 3TDMA 5JMCA 5I9SA 1Z5UA 1IVNA 2Y64A 4ZZ5A 4L0CA 5IN5A 3T7EA 1SVUA 1IAQA 1U2DC 1ZM2A 3WMGA 3C5VA 4WFJA 1P6XA 1PR9A 4LYAA 1QOQB 5G02A 2PWBA 4JWTA 2FEXA 4D6QA 1ENSA 4XD7D 2GCGA 1JT9A 3V7FA 4MDYA 3BD7A 3EEOA 1NU6A 2XZLA 2UZ4A 1YS7A 1E77A 1F8UA 1YJ8A 2X53S 1KJJA 2BWJA 3L0BA 3ZEAA 3MCAA 3K0EA 1O8SA 1A2BA