3IB3A

Crystal structure of sacol2612 - coce/nond family hydrolase from staphylococcus aureus
Total Genus 192
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
192
sequence length
556
structure length
551
Chain Sequence
b'HLLGNPKLTVTHVNEVKAGINHIVVDSVQYGNQEMIMEKDGTVEMRDGEKLYINIFRPNKDGKFPVVMSADTYGKDNKMGALWPTLGTIPTSSFTPEESPDPGFWVPNDYVVVKVALRGSDKSKGVLSPWSKREAEDYYEVIEWAANQSWSNGNIGTNGVSYLAVTQWWVASLNPPHLKAMIPWEGLNDMYREVAFHGGIPDTGFYRFWTQGIFARWTDNPNIEDLIQAQQEHPLFDDFWKQRQVPLSQIKTPLLTCASWSTQGLHNRGSFEGFKQAASEEKWLYVHGRKEWESYYARENLERQKSFFDFYLKEENNDWKDTPHVIYEVRDQFYKGEFKSASAFPLPNAEYTPLYLNAENHTLNHAKISSAHVAQYDSEDKQQDVSFKYTFDKDTELVGNMNLKLWVSTKDSDDMDLFAGIKKLDRRGNEVNFPDFNHIENGQVATGWLRVSHRELDQEKSSIAQPWHKHETELKLSQDEIVPVEIELLPSGTLFKQGETLEVVVKGSEIVIGNSTPGMKTRYEHEETVNKGMHMIYTGGKYDSQLIIPIV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CocE/NonD family hydrolase
publication title Crystal Structure of SACOL2612 - CocE/NonD family hydrolase from Staphylococcus aureus
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 192
structure length 551
sequence length 556
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02129 Peptidase_S15 X-Pro dipeptidyl-peptidase (S15 family)
A PF08530 PepX_C X-Pro dipeptidyl-peptidase C-terminal non-catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3020.20 Mainly Alpha Orthogonal Bundle alpha-amino acid ester hydrolase ( Helical cap domain) alpha-amino acid ester hydrolase ( Helical cap domain) 3ib3A02
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 3ib3A03
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ib3A01
1Y37A 1U65A 2C58A 1LBTA 3WF1A 3WKDA 1A8QA 3TGLA 2HRRA 3DDUA 2W1QA 4OCZA 2WO3A 1IUPA 1UKCA 1VA5A 2EEPA 5DN2A 4YASA 4E14A 5AOBA 4CU6A 1QO9A 1MTZA 4K6GA 2V98A 1XZBA 1ORVA 2W1UA 1WKYA 2QXUA 5I8PA 3X3HA 3V48A 2Y8KA 3H2HA 1DT5A 4MO3M 3WWOA 2RONA 3O9VA 3I2JA 2DDUA 3HOBA 4D9JA 2ACEA 1K3IA 1J2EA 2ORYA 1UY0A 1ISPA 1CIYA 4JKLA 1CR6A 1UKAA 1MU0A 5LKAA 5A7FA 1SCIA 4EY4A 1UK6A 4BZWA 4PSCA 2JEZA 3QITA 4E15A 1UYXA 3DYOA 2ZJFA 3OG9A 4KACA 1OT5A 2FJPA 5C70A 1JYNA 1VZ3A 2WSLA 2W47A 3I6ZA 3Q8WA 2VM9A 4G9GA 1SOMA 2DHCA 3VKFA 1MX1A 2ROQA 4C4YA 4BRSA 1HDEA 5JATA 3C7OA 1ODCA 4EHBA 2EIBA 4XUTA 4Y2VA 5LA0A 2ZEZA 1F0NA 4NS4A 2RV9A 3DEAA 1ULOA 1QIFA 3VDAA 1ODSA 1BCSA 3LCRA 3C8HA 3QPDA 4WJLA 1YCDA 4UPDA 4N8SA 2G5TA 1R64A 4F0JA 3I2KA 2QQNA 1UY4A 2ZXQA 1VE6A 2YH2A 4QLOA 4JYMA 1JYXA 5ALPA 3WEZA 3JYHA 1JI6A 2WFZA 2DQZA 2WU3A 4P5YA 5LZ7A 2E33A 3V1MA 1LZKA 1FFBA 1WB5A 2XMGA 1XZJA 4HG6B 3Q0TA 5AKZA 1OILA 2NW6A 3QPCA 3HNYM 5CTAA 2GBGA 2VT7A 1UZ0A 1XNTA 3OGVA 4BXSV 1VXRA 5BWCA 3EIOA 2QT9A 4QB2A 1ACJA 2CJPA 3VDCA 1AMNA 4X6YA 1JJIA 4H7HA 2LW8A 4A23A 5F4ZA 3V1LA 3DJYA 4KE8A 4UOJA 3SKVA 1BRTA 2WG2A 3WJ2A 4H0CA 2HFKA 4OB6A 3PF8A 3QYJA 5K3EA 4EZIA 2OAEA 1GOGA 2YASA 1EUTA 4ZV9A 3OGSA 2XUIA 4BBZA 4OZOA 2CZQA 5CMLA 2BZDA 5ALEA 3C8DA 4LXGA 3AZQA 5JAPA 2UZ0A 4FFWA 1YSCA 4Y2SA 5HXMA 2I3ZA 3IULA 5CH3A 3VD4A 4ARYA 3E0XA 3G0GA 3DOIA 4ARXA 2HADA 1EH5A 1YA4A 3H19A 5IFTA 4M4PA 3JWEA 5JZBA 3WA7A 1JJFA 3J7HA 2FX5A 4MEBA 4ARAA 1CUZA 4EUSA 4U2CA 3W06A 3HEAA 2WFLA 4QDSA 1ZD4A 1H2WA 3U1TA 3SKJE 2BGRA 4K5QA 3DQZA 1CX1A 4DMCA 2X8BA 5LCWL 3TJMA 2CB9A 2FUKA 2QS9A 1OF3A 2I78A 3D5EA 2VJCA 4J0JA 1YASA 2JGMA 2O7RA 5AKYA 3ACIA 5KWJA 2ZYSA 3DNMA 5ALGA 3LQCA 3WIOA 4B82A 5LZ8A 2YXPX 4FHZA 5FP0A 4KE7A 1YB7A 1Y7HA 2WFMA 2ZEWA 3HZOA 4C88A 4UHEA 4CUCA 5EHQA 1YAJA 2YFZA 5A62A 1AUOA 4ROTA 1W99A 4CG2A 3K4ZA 1ZJ4A 2XQJA 3GDBA 3LLCA 4A5SA 4B85A 4B9AA 3W2TA 3PFCA 2OQVA 5JXJA 2GZRA 4GI1A 1KU6A 4G8DA 2HU5A 2JF0A 4C4ZA 2XUGA 2VJBA 1AGYA 1XZKA 5DYTA 2GZSA 1U4NA 4ZZ8A 2RHTA 1MNAA 1ORWA 2WILA 4TVKA 2PBLA 2Y6GA 3H1BA 4HVTA 3SC2A 1CLEA 2ORZA 4L9AA 2EIEA 1WPXA 1US2A 5CT9A 4MGSA 1TCAA 3NUZA 2Y6VA 3UUFA 7YASA 4WCVA 5FKJA 5ALQA 3H2IA 5I0DA 4W9RA 4J3JA 3ZPXA 2VR4A 5EIEA 3HRHA 3MV11 2XDWA 1IVYA 4UBMA 4E11A 3ZLUA 4HAIA 1QIIA 3N2ZB 5AK6A 2LIPA 2J7MA 1N1MA 3RKSA 1QO7A 4QZVA 2HRQA 2V96A 5T4EA 3P6BA 4PQEA 4AO8A 5JARA 2HU8A 4X93A 3K4AA 1PMHX 3AIKA 3WK7A 1WM1A 3G9TA 3K2IA 4Y2QA 3HJUA 4DUWA 1E3QA 4MYSA 5AM0A 4BTVA 3QZUA 4BAUA 4KYVA 5LZ4A 3STVA 2VZUA 2QXTA 1JZ3A 1HQDA 2CDOA 1GNYA 1J06A 1O8SA 1KU0A 4G5XA 2H7YA 2XLBA 1M33A 1NU6A 3ESBA 3R3UA 4AB1A 5AH0A 4CUAA 4ZGBA 2ONCA 2QOEA 5EJ1B 3L1IA 4ITVA 4OUEA 3KWJA 4PSUA 1KEZA 5IYYA 1P0MA 2XI4A 1K45A 4ZY9A 3F2ZA 5ESRA 3BDIA 5BWBA 4M4RA 2YFUA 1W9TA 1VE7A 2VZTA 2GYVA 3IB3A 2J1UA 4QDRA 4F21A 3R40A 1CUJA 3QBJA 1IUOA 3O95A 3LEGA 4F60A 5JADA 4OYUA 2BGPA 3ACFA 3T2OA 5LKRA 2WLSA 2DCMA 5LP1A 1UYZA 1ZICA 3WF0A 4FLFA 3ICWA 1DT3A 3PICA 4W63A 2PSJA 4FBLA 1RWQA 3OURA 3RLIA 4A16A 4H7KA 5A7GA 4L72A 1MNQA 2VQ6A 5JALA 2XMBA 5DLPA 5DWDA 3QVMA 5ALDA 5AOAA 3ZLTA 3WF4A 4JNCA 2DQYA 4HZGA 4DSAA 1UWCA 5E4TA 3OM8A 3DYMA 1EB8A 1PFQA 1GPNA 1UY2A 4FTWA 4GECA 5AI6A 5DYWA 2ACKA 4KAJA 1IUNA 1PMJX 3WWCA 1OF4A 3IDAA 1LPOA 3WL6A 4B9EA 1EHYA 3KSRA 4AZ0A 4BAZA 1JT2A 2HA3A 3AIMA 5T4FA 4Z2AA 4BE9A 1G66A 4H7JA 1T2NA 5K3FA 2VJXA 4DYHA 1WB6A 3PUIA 3ZI7A 1QIDA 3C6BA 4FLMA 1WB4A 5ALYA 2WG1A 2ZYIA 4F5ZA 1QFSA 5ALMA 2JD9A 3D7RA 2Z3ZA 1XNAA 5K3BA 4X6UA 2DR0A 1ZGBA 3SEPA 2DFPA 3T09A 2OXEA 2XQFA 5JD6A 3GUUA 3BL8A 3A7QA 2VEOA 2W1SA 2J3DA 5ALKA 1EVQA 1XZMA 4HTAA 5AKJA 5ALLA 2WN3A 3EQ8A 5AJHA 3FHAA 1G5FA 1UK8A 4DLNA 5AO9A 3CMGA 2QTBA 1GOFA 1NAEA 2X5XA 1CZTA 2HDWA 5CURA 1RYYA 1CUWA 1CVLA 1H2XA 3B5EA 2VTVA 3VD7A 5JYCA 4CVUA 2XOMA 3CCBA 4N8DA 2WUGA 1LZLA 3C8XA 3QMVA 4BDVB 4ZXFA 4GHWA 5BOVA 2WHPA 1XQYA 2XUOA 1H2YA 3ZV7A 3HSSA 3MGAA 1W4LA 1BN6A 3FLAA 1K63A 3V1KA 2G5PA 2WIFA 4H7DA 2R8BA 5DPNA 4J0KA 5AKXA 1IMJA 4AMYA 1JZ7A 4C89A 1UOPA 2WHQA 2PSDA 1CRLA 3VD3A 3GA7A 4XIIA 5CH8A 3O9MA 2OKXA 2BERA 3VDXA 5AI8A 5JZ9A 3W9UA 2O2GA 1W52X 1HPLA 2R11A 2Y1KA 4CU8A 5HPOA 3A6ZA 2WTNA 2PX6A 2W46A 4O08A 1FFAA 4OPMA 2Z8ZA 2XUKA 2W22A 5IVKA 3OEAA 4LYDA 1I5PA 2O2IA 1R4ZA 5CT6A 3PI6A 1J84A 4LYEA 3IVMA 4L0PA 4QX3A 3M82A 2WQZA 5C7YA 4MYDA 4W8JA 3DYPA 1WHSA 4AX4A 4AXBA 3IUQA 3FCXA 4IUGA 3EQ9A 3IBTA 2GBIA 5D7BA 3WF3A 3T2PA 2W92A 1JZ2A 3I6YA 2PSEA 5I9IA 4FNMA 5JAHA 3IUJA 3WYNA 3WK4A 4JHZA 2ID4A 1WCYA 3C43A 4Q34A 5AK4A 2PKYX 5IKXA 2VZ3A 1U2EA 3UETA 4H35A 1HN1A 3OG2A 3R3VA 3LEIA 1YS1X 4AO6A 3A21A 1W1IA 1UOOA 5FLKA 5AI9A 3DL7A 3E1F1 4P02B 1OXMA 3G0IA 1MX9A 3THDA 1XQVA 3VJLA 2E31A 3G0DA 4E8DA 2L9LA 3H2JA 2VO5A 2WHRA 1EX9A 1LBSA 2XMSA 2XLCA 3ZWQA 2VZSA 3I2GA 3VXKA 4KMQA 5JUVA 2DHDA 4OMDA 5ALOA 3SWWA 4BDTA 2XQIA 3FYUC 4ZI5A 4B0OA 4JUIA 3W9BA 4G9EA 3MV01 4J0GA 4MQMA 2HFJA 4UI9L 4WDRA 3ED1A 3G9ZA 2YYSA 2VZQA 4NZZA 4QDUA 3FNBA 3G8YA 1EK2A 1YB6A 5A1AA 2WIKA 2VMCA 3H1AA 3H2KA 5ALRA 1C4XA 4X90A 5AKHA 3K75B 3LIIA 3P2MA 1UYYA 5AOCA 5DNWA 1TQHA 2K2QB 4M0EA 4CCYA 5AIAA 1PV1A 4FKBA 3WNNA 3CIHA 4XUQA 4QWMA 5ALJA 1ODTC 4Y9SA 4QNNA 3WZMA 4BP8A 1I6WA 4CG3A 2QUAA 1NUKA 3VJKA 4W4ZA 4MOAA 5EGNA 4KJXA 1O59A 3DOHA 2J1TA 5FUIA 1GOHA 1KGYA 4Y2UA 3CXUA 1BCRA 1SDDB 2WJ4A 3W05A 2GYWA 2QRUA 4B7ZA 3A22A 4KAFA 1SCKA 4BYMA 2OCLA 5ALZA 4QX2A 3R41A 3WKBA 3WZLA 3WWEA 3HN3A 2W1WA 5DQ0A 3AIOA 3W04A 2QBXA 2WJ6A 2X09A 3FYUA 1QJ4A 3I3BA 4I3FA 1G4HA 2G4LA 3WWPA 3FL7A 4YPJA 3E3AA 4H7FA 5LA1A 3EQ7A 4S0XA 4BVJA 1EXWA 2X10A 2XQXA 4W50A 1VZ2A 1LPPA 1GPKA 2I03A 5KWIA 1CZVA 2WO1A 4IHAA 4OUKX 5JXGA 1UX7A 4N5IX 1JMYA 1WOMA 2RI6A 2WIJA 4WFKA 4Z49A 1ETHA 5JAUA 2WZ8A 4Q82A 5SYNA 4Q3LA 2DCKA 4OYLA 3D2BA 5HKBA 2JBWA 2LS6A 5HQ3A 2XONA 1CEXA 2ZEYA 5FOQA 4DMHA 3T0DA 1W9SA 3GGLA 3KWFA 5JZSA 2VOTA 3OEBA 3C87A 5CW2A 4Y2XA 4BCCA 1F4AA 4KAAA 2VCAA 3D2CA 3LE0A 3FWHA 2QR5A 3K9BA 5ALIA 5C71A 5IFPA 1R3DA 5AM3A 3IAPA 4UBJA 1BS9A 1K42A 2VJDA 1YAHA 3HJRA 3LPGA 2G63A 1XZHA 1PX3A 3T08A 2W94A 4QDXA 2PSHA 1CUUA 4XUNA 1CUDA 1MX5A 4UAPA 2XMQA 3STYA 2J1SA 2HA0A 2JGLA 3FVRA 1PX4A 2HHAA 2VZRA 3FAKA 4UFPA 2PUHA 5LZ5A 1DWQA 1CFJA 1WHTA 2WIGA 3VDBA 4PSDA 5JIBA 4RGYA 1E8DA 5CT4A 5CXXA 4D0QA 3PUHA 4QEKA 3H0CA 3W5MA 3NWOA 5E2IA 3WK8A 1XLWA 2HA7A 3PDCA 3NGMA 3DECA 4U2BA 1UKBA 3AZPA 5AM1A 2HU7A 1GUIA 3GELA 2Y64A 3WF2A 3WQHA 3LP5A 2H7XA 4Y2PA 1DINA 5ALVA 4PW0A 2Y6UA 4Y2RA 3KXPA 4W1QA 5HCUA 1Z68A 4CIAA 1L7AA 2AJLI 2C5FA 1LPNA 3GFFA 3WI7A 1TK3A 1YR2A 3ANSA 3R3ZA 3C7FA 5CBKA 4MQLA 5DYYA 4H7IA 4G4GA 3GROA 4UHDA 2YC4A 1JZ5A 3WK5A 5HF5A 2XT0A 3F97A 1K5PA 4DUXA 1QGED 4ZREA 4G1FA 5HK8A 3C6YA 4P9NA 4DXSA 2OQIA 4E46A 3F8SA 4KE6A 1T2XA 1X70A 4WY8A 1K6EA 1EA5A 3G02A 2HA5A 2CKMA 5AKGA 2E26A 4BVKA 1TRHA 5EIYB 2Z5GA 4QE3A 4GEGA 2R7EB 1Q0ZA 2E32A 2VMEA 5EHNA 2PPLA 1R50A 1FFCA 2PM8A 3BF7A 3BIXA 2QQKA 4HXFB 1CUHA 2VAVA 5J1XA 1MAHA 4GWLA 4ET7A 3IAQA 5AKIA 1P0QA 2JKXA 2WAOA 2VF2A 4QAWA 5CT5A 2WUHA 1H6XA 2EICA 1XRRA 4M0MA 5FV4A 1A7UA 1Q84A 2AJ8A 4LXIA 4M0FA 5DTIA 4XWGA 4LKOA 4QB6A 3STXA 1W8NA 2XUDA 5AKKA 1QIMA 4B84A 1YS2X 3A2MA 1F4HA 4AAXA 4AQDA 4XZUG 1MPXA 4ZRDA 2VZ1A 3FOBA 5LYYA 1OCEA 2HL6A 2W6CX 3D2AA 1LLFA 3IURA 3WNMA 3MUNA 3FYTA 5CYYA 4MADA 3VJMA 4ZV7A 1CIJA 1MO2A 4U2FA 5IVDA 2OGSA 2JGKA 3ANTA 5AI0A 1IQDC 2BGOA 2BJHA 3A2NA 2RIPA 3M3DA 4DMKA 3WNLA 4BJ0A 1R9NA 2HA4A 4BRZA 2EDAA 4PF1A 3ACGA 2WO2A 4UUQA 4X97A 1A8UA 2HYXA 2VA9A 1SHWB 2VCBA 1AX9A 1CUBA 2IX9A 1QFMA 2WN2A 3T52A 3WWDA 3I1IA 4INZA 2V5DA 1UT6A 1UOQA 4BC0A 1XFDA 3O4JA 5LZ9A 5JXIA 5EIHA 3KD2A 1ZI9A 1EDEA 4UBLA 1YA8A 3WLAA 4LPLA 1JFRA 4EY5A 5I7UA 1JI3A 2W95A 5G04L 3F67A 1LPSA 4QPWA 5HF9A 3R3WA 5HK9A 3OPMA 4BDSA 3KOOA 4Q3OA 3VVMA 2QQJA 5FDFA 2DHEA 5IH7A 5B4NA 4B80A 1D7PM 1QZ3A 1XRMA 2HIHA 1GPLA 5AM5A 4MXDA 2W9XA 1LPAB 1THGA 3K46A 1W76A 2W5FA 1E5TA 2WUDA 3UESA 2J1VA 2H9YA 3IIIA 2HA6A 2WM2A 4Y2JA 1D07A 1MT3A 4IQ4A 5K5EA 3NOXA 3HNMA 5EHZA 4DNPA 1W9WA 3AUKA 3OTQA 4TGLA 3S2ZA 5CXUA 4UHBA 2IIVA 5ISMA 2JEYA 1NKGA 2J1RA 3FLEA 4AZ3A 2B4KA 1ZJ5A 4FNGA 1ZIYA 4X00A 4A4AA 4XVCA 1MAAA 4YPVA 3DLTA 5AIBA 5HF8A 2W91A 3STTA 1J1IA 3ZM8A 2C7BA 2RJ2A 4Q3KA 1LPMA 1BE0A 4X91A 3D0KA 3VVLA 3WSOA 2WQ8A 3WKCA 5LLSA 3MUY1 1WPRA 3CQOA 3RK4A 4CFSA 2AJDA 5C81A 1FFDA 2YC2A 3DKKA 1UXOA 2QQMA 1UXZA 3O0DA 4A41A 2VZPA 1CUAA 4G8BA 3STWA 4RE6A 4CG1A 4DUVA 3OGRA 1XRPA 2BUBA 5ALHA 1EI9A 4QA9A 4AN0A 4P93A 1A8SA 3UMJA 1LPBB 5JXHA 4WY5A 1N8SA 2BUCA 2XE4A 4KWUA 3H2GA 4CI9A 3NJVA 5JMOA 3CZJA 1K8QA 1O6GA 5D6OA 4FDMA 3K4DA 4UFOA 2VTFA 3WNOA 1FFEA 1XZGA 2QZPA 2Z3WA 2ZSIA 4IH9A 1W75A 2EIDA 5ALUA 1G42A 3G7NA 3CCCA 4J7AA 4FFVA 5FRDA 1US3A 3T4UA 2PQSA 4WDQA 3O4GA 1WCQA 1MN6A 4NMWA 5DTJA 4C4XA 1QLWA 3C5VA 1NX9A 4W1SA 2VAXA 2H1IA 3FSGA 3BXPA 5AHXA 3I3EA 2Z8XA 2XQKA 2JGEA 1JYVA 1XLUA 3EYPA 3FLBA 3T0AA 3THCA 4K2AA 4QDQA 3I2HA 1K12A 4C01A 3ECQA 1CZSA 5A71A 3QMWA 4JH0A 1HLGA 5AKEA 3ETPA 4UBKA 1TAHA 3LS2A 2Z4FA 4BC1A 1GGVA 2CDPA 4PQQA 3ICVA 5SYMA 2WIDA 1AURA 3QPAA 4J03A 1C7JA 2CBGA 4KI5M 3V9AA 3SEEA 5DNUA 1CPYA 4V2IA 1UK9A 1Q0RA 2BGNA 2JGIA 3HEIA 1BN7A 5AM2A 2BCEA 2C26A 3MUOA 1CUEA 2JIDA 5C8VA 2ECFA 3G0BA 2XMZA 4QX1A 4XVHA 4E8CA 5G05L 2WFLB 3NJXA 4XX1A 3WJ1A 2J1EA 4EA6A 2WBKA 4UHCA 2OCGA 1GKLA 5K3DA 4XURA 2WJ3A 3ESAA 3FBWA 2RVAA 1ZD2P 2DCJA 2Q0XA 4TXWA 4HRYA 1USWA 1UXXX 3LEKA 4TTGA 5EJZB 2AJCA 3C6ZA 3GM8A 2B20A 4L3WA 1JZ4A 4CUBA 1CUXA 3PE6A 4EBBA 2O7VA 2VL4A 3B12A 2D0DA 2V9ZA 4MWSA 1XRLA 5DJ5A 3FCYA 4LHEA 5HF6A 5H3HA 3WNKA 2AJBA 3BDVA 4UHFA 3OOSA 1GMMA 4N8EA 1YQ2A 4XUOA 2VSQA 1TVGA 1DQYA 3HC7A 1JU4A 4FBMA 4B81A 3CDZB 4FI9A 5EHXA 3OBAA 1XLVA 1E8NA 1XZIA 1ZD3A 3MBWA 3H04A 1JKMA 2PUJA 2WUFA 1GU3A 2XUPA 4QDOA 1BROA 3DCNA 4JEIA 4EY8A 2BKLA 4QX0A 1QIJA 3E4DA 2XUFA 2C0QA 3N0TA 1UMHA 2JDAA 4WFIA 3WYDA 2JGJA 1E66A 4QB1A 4EY7A 2V72A 5C8ZA 1XC6A 1XKLA 4DEQA 4A6OA 4J0DA 4Y2YA 3BE8A 2VZOA 1CUIA 5ALXA 2XUQA 4OMCA 2H7CA 2HLEA 2QKYA 3ACHA 4UBNA 1S8OA 5HZGA 3DD5A 1ZI6A 2OCKA 1XZCA 2VZVA 1VOTA 2FJ0A 4OD0A 4BATA 1O8PA 3ZLVA 3DL4A 1BHGA 5EI5A 3C7EA 3LIPA 3LPFA 4LXHA 3YASA 2GBFA 1CQZA 4J0IA 3ESCA 1XZAA 4Q05A 4UBIA 5K3AA 5AI5A 3UNPA 1EB9A 3SX4A 5JANA 1DU4A 4I19A 4D8MA 4RYDA 2Y2VA 2ZSHA 4B0PA 4ZZ5A 4BTLA 4X95A 3RARA 1CUSA 2OGTA 4OB7A 3AC0A 2BAGA 1B41A 5ALFA 4N5HX 6YASA 5AI4A 4GLBA 2QQOA 3WMRA 3ESDA 2VCCA 1H6YA 3E1GA 2VMFA 3I6MA 1BEEA 1XKTA 3C7HA 3MO4A 5FPQA 4GDMA 4RE5A 1H2ZA 4PO3X 3TRDA 3M83A 1CUCA 4BP9A 5E4YA 1Y7IA 5JAOA 2BFNA 2VT6A 3VISA 2RAUA 3F96A 4BK4A 1UK7A 3DYVA 4P92A 5ALNA 1R1DA 5IVHA 2QVBA 4UBOA 2QMQA 4OU4A 4P00B 4EB0A 1HL7A 4HXGA 3AINA 4X92A 3RM3A 2B9VA 4QLAA 2QUBA 3HXKA 2OGZA 4BB0A 1JMKC 1QONA 4DNOA 1DTEA 1CUVA 1P0IA 1XROA 2QJRA 3HLKA 2XUHA 2C4XA 4HXEB 5HFNA 2GBCA 3UUEA 2XHNA 3AJAA 4X6XA 3NRUA 1CV2A 1F0PA 3CN7A 3GBSA 2WAAA 5CZKA 2ES4A 1THTA 4H18A 3PF9A 5K3FB 4QDZA 1W8OA 1VXOA 1UZAA 2X05A 3HACA 5CT8A 2J4FA 4KRXA 4AG4A 3KDAA 2QQIA 3FHQA 3A2LA 3I2FA 4H77A 5CH5A 2VQTA 1O6FA 4U2EA 4ZXEA 1TKRA 2Y6LA 2BUAA 1UY3A 4LIPD 1OD3A 4DMFA 4BE4A 1N5MA 5IVIA 2XMDA 4KRYA 1TCBA 1XZFA 3VD5A 4OB8A 4Y2TA 1MJ5A 5E4JA 1AC5A 4WFJA 1DP0A 2O2HA 4IO0A 3HPNA 2WABA 5HKAA 5KBYA 5C7GA 2ZJ6A 3I2IA 1HBJA 5HFAA 5T4BA 2JGFA 2OLEA 3CN9A 2WZEA 3L1JA 1SCQA 3WKEA 4XJVA 4ARBA 4PT6A 2WKWA 1CUFA 4A42A 5JR2A 3R3XA 1TIBA 3WIBA 1VJ5A 4JYPA 5B4XA 1B6GA 4TPKA 1BEZA 1JZ8A 1R9MA 3GXUA 1QOZA 4EY6A 2WHPB 1RP1A 1NU8A 4C6HA 1FJ2A 4BAGA 1H23A 1EVEA 4BZZA 5BV7A 3DKRA 5FUMA 3WKAA 2E3JA 4JKKA 5J3JA 1XRQA 1F6WA 2QJWA 5LZ2A 3DS8A 1EK1A 1QE3A 1GQSA 1P0PA 2Y6JA 3K6KA 3WL7A 1XQXA 1VKHA 2OPHA 3P1IA 4LKSA 4LQRA 3V1NA 1DX6A 1H22A 1N5RA 4Q1VA 1HKHA 1XZDA 3D4LA 4MEAA 4A45A 5CRIA 1AKNA 5YASA 3F98A 4JKMA 5AP9A 5AICA 2GYUA 3GZJA 5FXMA 4BK5A 4QDTA 4CU7A 1DWOA 1E89A 2XQGA 5AK5A 3MVEA 1OH4A 3FN9A 4PNZA 4MWTA 4A44A 1XQWA 3G9XA 4W1RA 1JU3A 1QTRA 3I3DA 3CKHA 2YG0A 1T4MA 4C87A 2CUTA 4MJ3A 2P8SA 1C7IA 3G9UA 4AMZA 1XZEA 4GW3A 3U0VA 1LGYA 2VMDA 2C5GA 2W87A 1GZ7A 3IA2A 2CMFA 3C6XA 1EDBA 4CCWA 4JX0A 1ZGCA 3WQBA 3U37A 3WK6A 1ZI8A 3AZOA 2C0PA 3JXSA 1ACLA 3M81A 1DQZA 2OG1A 5D3ZA 3AFIA 1W6RA 1FSSA 1DX4A 1CQWA 3BJMA 2X76A 4PV7A 4G8CA 3BF8A 4L0CA 4HRXA 5A7HA 1JHJA 5DMYA 5C8XA 4I4CA 4BVLA 4K6KA 3K77A 4FMPA 2PSFA 3QM1A 3H18A 4U2DA 2QQLA 2XUAA 1QTIA 2KD7A 1K4YA 5A2GA 1TCCA 4DXTA 4UFNA 3T0BA 1QIHA 2PL5A 2B61A 1UWWA 4OYYA 3F9CA 3QMMA 4ZWNA 2ZJ7A 2Y2UA 2PU5A 3NQHA 1X2EA 2WG0A 3DYIA 2OCIA 4FLEA 4KR0A 5AK3A 1SFRA 1ZIXA 4NVRA 3HABA 4X71A 3WL8A 3BIWA 3O4IA 2WUEA 1Q83A 2XMCA 4RN5A 1TG7A 4X85A 4CCYB 1SG3A 1ULPA 3FSGD 1IZ7A 1X2BA 4Y7DA 1JZ6A 5K3CA 4MGQA 3WNPA 3WL5A 3WK9A 2VATA 2OAGA 1F8UA 2ZEXA 2BBAA 5JASA 4RNCA 3I1YA 2DSNA 3HNBM 4W1PA 1QIGA 2ZYRA 3G0CA 1KEXA 1P8JA 1ZOIA 3SK0A 1SC9A 4FOLA 3OB8A 4DXRA 3FYUB 1PJAA 5JD5A 1EDDA 5ALWA 2XMRA 2J1AA 5EFZA 1AQLA 2I3DA 1XZLA 2QM0A 1AZWA 3L1HA 2HM7A 5IJRA 5A6VA 3HI4A 1R88A 1E8MA 4DM7A 3EB7A 1DYOA 2JE8A 2HA2A 1L7QA 5FPPA 4XUPA 5ALTA 2J22A 4B83A 1JJBA 3OC0A 4B6GA 1XRNA 5KREA 1CUGA 3EBLA 5AKLA 4OU5A 2WTMA 3A23A 1GKKA 3FVTA 1QIKA 3B3QA 1LNSA 4DEVA 3R0VA 1VLQA 4AO7A 3ABZA 2PVSA 5EIAA 2YB7A 3JW8A 4BCDA 5AM4A 4X94A 1GQPA 4A3ZA 3O4HA 3BGAA 4GZ9A 3D3NA 3I28A 3HYSA 3A70A 4YK7A 4DNQA 4AN1A 2ZYHA 5HQ3B 4CU9A 4DIUA 4J0CA 1UY1A 1DWPA 4QWWA 1EUUA 3CZUA 4DSZA 4K6HA 3IUMA 4G4JA 4IH4A 3NNGA 2V97A 5LIPA 1IZ8A 2Y6KA 3R3YA 4FWBA 1BU8A 3AILA 4HS9A 1A88A 1ZD5A 4KE9A 5F7UA 1XPWA 2C4HA 3STUA 2WU4A 2D5LA 3BWXA 1L7RA 2WDBA 4GWJA 5IHRA 3C70A 4KEAA 1U8EA 4LHSA 4OSEA 4IH1A 2RGUA 1W0NA 2VC9A 3VD9A 1GQRA 3EF3A 5JD4A 4U2GA 4DGQA 2EDCA 1DLCA 4GWIA 3C7GA 1EINA 4DTCA 1J07A 1QIEA 4BCBA 3IUNA 1UFOA 3T2QA 4X3CA 2W3JA 2WYSA 4X7BA 1JYWA 5DNVA 1UMIA 2XUJA 4YX9A 2CEKA 3D3AA 3WA6A 2AXEA 3S8YA 3I97A 2VQUA 4CIBA 1GT6A 5T4HA 4DNFA 3C5WP 2J4CA 1GXSA 2Y6HA 2ZVDA 1VA4A 4J0HA 3H17A 3TEJA 1CUYA 2J3QA 4ETWA 4P08A 2ORXA 3PFBA 5ALSA 3ILSA 2PU7A 2V4VA 2XB6A 5LA2A 3W5NA 2C9KA 1J83A 4GXNA 4RPCA 2RHWA 4UHHA 5D3KA 3D59A 3C45A 4GBGA 3MUZ1 2IITA 3QH4A 2VJAA 3BJRA 4H7EA 4G4IA 3BN6A
chains in the Genus database with same CATH superfamily
3GHMA 3O47A 5I8PA 4FINA 2XMPA 3BA6A 2PCLA 1FMJA 1OLXB 2NIPA 2VPPA 1AZLA 3DV0B 1LWOA 4DIDA 3WGUA 5H68A 1BMFD 2RDQA 1NBEA 5FD8A 4DNXA 1JA9A 4Y20A 2Z9DA 4O61A 1IVNA 4G0PA 4J9VA 3N1UA 2PEZA 4ZO7A 3WMFA 1OROA 5LBTA 4LO4B 2NXEA 4NECA 3HCWA 1HYEA 1VPTA 4WCDA 2VQ0A 1ISMA 4QOHA 3DZ8A 3VDAA 5ABJB 4KVAA 4AU1A 5IVEA 5BP7A 4K3UA 2ET7A 1PO11 2PTMA 3K5IA 4BU0A 4D8XA 3M7IA 4D6YA 3BMOB 3G2IA 3RAPR 3WEZA 4L75A 5I4IA 4LKFA 1FA9A 4YJKA 5EXPA 2CGEA 3E53A 2WT9A 2K2WA 6GPBA 2PUGA 4GALA 1U9JA 4CKYA 1BFUA 4PAOA 2IY8A 4I9NA 5MGBA 4QB2A 1U8FO 2KYRA 5CA1A 3JARA 4FIDA 4KVGA 3D8NA 1FLVA 4KE8A 4UOJA 3SKVA 1BRTA 3HI6A 3CV3A 4A3XA 1W06A 4NK5A 4Q21A 1LFAA 1ORDA 2OAEA 3I42A 2X5OA 4IESA 2R5WA 3OTGA 3HP1A 3OGSA 2EKPA 2UUOA 5K8UA 1ZXLA 4EI9A 3K1AB 3L6UA 5H7XA 5CM2Z 2BD0A 4TLFA 4A0GA 4UM8B 1F06A 1ULBA 2PGIA 3FKSD 4GE0A 2ZWVA 3B02A 4BN4A 4NNPA 2WPNA 4QASA 3SC3A 4RJIA 5L6LB 1XPOA 2QVZX 3WA7A 5DXFA 4IEEA 3DJFA 1NIPA 1I4OA 3JU3A 4BV8A 3UENA 1AKQA 4IQ0A 3TJMA 4KBFA 5CDYA 5ULLA 3PX2A 3D5EA 3R4UA 1IM5A 1RXFA 4J1QA 4J16C 1SCBA 3DNMA 2OZJA 4B82A 2H92A 2H9IA 4RANA 1GNPA 5EYYA 1V1RA 4JU8A 2VJKA 4KE7A 2YWFA 4CUCA 2FK8A 3DFUA 2ERFA 2G1KA 1NMQA 1W99A 3TWOA 4C1WA 4AQTA 4I6GA 3OESA 4G8DA 2OBMA 3FMPB 3RDIA 3VZOA 2ZCWA 4YM1A 2OOSA 1U4NA 3UK0A 4TUYF 5L40A 5MN5A 2WILA 4Q2FA 2PBLA 4JI0B 3EC2A 3SC2A 1P80A 3TMKA 3LH5A 5LL6P 2I91A 1ZRNA 4BNIA 4W9RA 1NRWA 3ZCVA 4RF5A 4I3HA 3AMVA 1SACA 3PWKA 3H8OA 3PFNA 3EPRA 4FSXA 5EA2A 4WXEA 5JDIC 1NQUA 4HN1A 4KWIA 3VZNA 1HL3A 1SOUA 3WK7A 4EDFA 5HCFA 5EE3A 5TNXA 3F4BA 2C3PA 3N76A 3NORA 3LUHA 2B35A 5DBFA 5DSZA 1HQDA 4BM8A 2ZKLA 2VDMB 4XCAA 3CWQA 2I87A 4U0JA 3R3UA 5FL3A 5BNFA 1VBA3 4F92B 1WKVA 3OKAA 2O8FB 2WZR3 4HQ0A 2H00A 4EB6A 3IIKA 1TOAA 1EFPB 4KR7A 2AEJA 5LU9A 2GYVA 4RMGA 1IEVA 5TY0A 4QDRA 1W85A 2D1QA 3C39A 2ZIAA 3AV3A 3PR2B 1X7WB 5HS6A 4H15A 2PS3A 3NASA 1QFJA 4XIGS 1B3RA 4AEJA 1DT3A 1NW7A 1EESA 1MB4A 2PWZA 1RWQA 3CTMA 3OURA 1YR7A 3O9ZA 5A3NA 3OPVA 4YO8A 1DB3A 4BB9A 3A3NA 4AG3A 4LGMA 4L27A 4JLKA 3B7GA 4I1VA 5GIPE 2G1PA 4U7PB 1IJBA 3P9XA 3JB4C 4WZBA 1X94A 4DQLA 4GECA 4KVFA 1IY0A 1CYDA 3LSYA 1SD2A 3PUXA 5LXTF 2VWQA 5GVRA 3TOSA 3K70D 3QU9A 4IJKA 3KJFA 4O4JB 3NH9A 4EUHA 3IP1A 1COWA 4R9NA 2Q5OA 5DXAA 1U0LA 3MMSA 1F4VA 4UEWA 4YVFA 3RYIA 4DWVA 1RHRA 2FSFA 1EVQA 4ZONA 3OMLA 3ORSA 5A1TA 2NSJA 3JALB 4QPGC 2BC9A 1NT2A 5L9VA 3CU7A 5KQPA 2JFQA 1AQIA 3GRRA 4MG2A 2HDWA 3B36A 5A3QA 1QJU2 2JZCA 1H1IA 2WJAA 2H57A 3B1KA 3OD0A 4MO2A 4PHCA 1II9A 2IPLA 2E0IA 5GOTA 2OGUA 1NXVA 1R4NB 1YZHA 4M0PA 4TMVA 1JZ7A 2ESRA 5FAXA 4JJGA 3FFWA 2BV3A 1VJGA 4OP3A 3SZ3A 1RJ7A 1UIRA 1G9AA 1ZZEA 1L5MA 1AN9A 5AJWA 5C8YB 3RHFA 4J1SA 4QKQA 3W4JA 3JD72 3SKYA 2YIDA 3OICA 2XH8A 5E9WA 4WNYA 3GT4A 3AKEA 1Z7S3 4WBBA 3IP5A 4D56A 4M01A 1E0DA 1FDOA 4GX1A 1XQ9A 5I45A 3GFOA 1CVNA 2EXXA 2VDKB 5CDFA 2CV6A 3I0NA 3NIWA 1WHSA 2C4VA 3L01A 1CR1A 2Z2JA 5AFSA 3KQRA 4FOPA 3UCEA 1VPLA 5IHXA 3KNZA 1YRHA 3KB1A 1NJ6A 1H8EA 4Q7LA 1UN1A 4P0PB 2YDYA 3E1F1 3GLRA 4MRNA 3DT6A 3I01A 3U3RA 1RLUA 5FWYA 4WXPA 1D1TA 1RVF2 1WDWB 2W39A 4KMQA 1WV1A 1X80B 1XO1A 1SHKA 1SRQA 4ZI5A 2APJA 3U4MA 3P0JA 3MV01 3H86A 2P17A 3OOXA 2YHSA 4RGBA 4MYHA 5BMVA 5A4KA 1ZOSA 3LX6A 2ISSD 3FWYA 1C4XA 5JCPA 4MA4A 1VG1A 1KVSA 3V00A 1VCHA 1PV1A 4FO9A 3WNNA 2Q5QA 3KQQA 4HGRA 4GR5A 1NYRA 1R18A 2DCTA 3K2EA 3KYCB 4BP8A 1B8UA 3AP9A 1RKUA 3UKOA 1Z0JA 3QEMA 1ZC4A 1FLAA 2QRUA 2W2LA 3R41A 3HADA 3WWEA 3QJ5A 3UMVA 1TTPB 4URZR 4QBFA 1PBTA 5DVZA 4JRAA 4R3WA 3GNQA 4NCAA 2BGUA 1JR6A 3BL5A 1RAEA 4UFJA 1OAOC 1ZD9A 3G82C 4TTPA 4BFZA 3T4VA 4KDCA 2EOAA 3LLVA 1NAIA 4XUDA 1EU1A 5EJ5A 4I1UA 1Q19A 1U2RA 3O8RA 1BOFA 1LDNA 1MB9A 1DDLA 2UVQA 4RS5C 4ND8A 4ZOLB 4Z49A 2J0UA 1SKUA 4NFYA 3OZBA 4KH0A 5HQ3A 4CUJA 2BHSA 5ECYA 4QGGA 3ES1A 4ZVOA 2BN4A 3TLXA 5IFPA 1YRAA 2J7PD 3RANA 4I8DA 5AM3A 4W5WA 3TXYA 4YALA 1GRQA 1E3WA 3S29A 4U8GA 4L08A 3NVMB 5B1SA 2RJ3A 1QQP3 2OV3A 2WT0A 1RM0A 2Y0BA 2BGTA 4EW3A 3LGRA 2JGLA 2NZJA 4O2AF 3OO0A 2HHAA 3DCYA 1X9GA 2ZWOA 2QLBA 3KLNA 4XD7D 2G82A 4PSDA 4L22A 5FYDA 2QZSA 4DQDA 3USZA 1PX2A 4URXR 3PUHA 1RS0A 3DN7A 4JYZA 3NWOA 2VXRA 5D3QA 3TKAA 2O1QA 1J3QA 2R25B 1XEAA 3EZLA 3WF2A 5E16A 1BHJA 3HO6A 4YCCA 3T3MB 1UBHS 4C2AA 2PSSA 2G4IA 4GH4B 4BL5A 4C07A 5IFKA 4QVIA 2AG5A 1C80A 2NPIA 1PVC3 3CNEA 1VKZA 2WDZA 3DTNA 3ONFA 4LJLA 2ZYTX 4NIHA 2FDJA 3GALA 3U7GA 1M4WA 2P2CA 3CVVA 3UJNA 2Q9CA 4XPVA 1D6MA 3DPRA 4RZ3A 2VVEA 1K66A 3FNEA 4BO7A 3KLSA 4TL6A 4ZPXA 1Q0ZA 1GPUA 4NU0A 4GI2A 1FFCA 2W0XA 4EWLA 3CR8A 2VAVA 3D43A 4X44A 2IHNA 5FZBA 4TQUS 4Y9RA 3ZYJB 5LQJA 2GZ1A 1AYN3 3SCZA 4ONEA 5FV4A 1XCGB 2AUMA 1T2FA 4I2NA 3NMUF 4IV3C 1D04A 3JQ6A 2Z5FA 4LDRA 4KKXB 3JVVA 1YU6A 3OPXA 5K2MA 4EVIA 3NCHA 4P3YA 2E7AA 2E4VA 3D2AA 1W6PB 2RG1A 1XNCA 3PKIA 2UY9A 3W6NA 2I55A 1K5MA 3A2NA 3VHXB 2JI8A 4DMKA 3RIGA 1LOGA 1YRWA 2HA4A 2XNDA 2P2LA 4TZ6A 4S1TA 3MFQA 1HC7A 4LORA 4EMTA 1IS5A 1WSBA 4INZA 1NLMA 3DZCA 2O14A 3N8HA 3P2JA 3IPLA 1UT5A 2BKXA 4ZOQI 3T1LA 1QHSA 3KJIA 2R3SA 1WUTA 2IZOA 3NVDA 4PZUA 3NBXX 4QPWA 1FB5A 1WCV1 5AHWA 4DPLA 2Q3DA 3VVMA 4NOMA 2XVYA 4MCJA 1DIAA 5THQA 1RUE1 4RZIA 4EKGA 1SLIA 4D96A 1W76A 1GAJA 2JDKA 5JFGA 4Y2JA 3K8YA 5EHZA 1KRWA 4R8MA 4HWPA 1H6CA 3AHDA 3FLEA 1FRZA 5BNOB 4TSFD 4PVCA 2PMFA 1POXA 5U4QA 3IM0A 2FRDC 2QJOA 3NT2A 3MTEA 5LQCA 3WXBA 1BXRB 5C81A 4LHNA 3DKKA 1F17A 3TXXA 2QQMA 1M72A 1PG5A 4A2UA 3L7KA 1UXZA 3OBIA 1SZDA 1XRPA 2PLV2 3KQUA 4HS4A 4PC1A 5FBQB 4OL0A 2RBGA 2R68A 1UFKA 2J9GA 2IDKA 2JIPA 5JCXA 4LX0A 3BZUA 3A1NA 3N39C 1U94A 1W9FA 5GADl 2E4XA 3VH1A 5ALUA 1OZFA 2ZRDA 1CWPA 3EPLA 2ZUVA 3TXAA 3T1VA 5EJ4A 4I0BA 1RRCA 1NX9A 2ECPA 3N0VA 3QXHA 4DS0A 2Z8XA 1E5SA 3AEZA 2SCUA 1Q7BA 1C28A 1ESEA 4I6JA 4RC9A 4V24A 3WNCA 1TM5E 2H9AA 1XWIA 1ZRRA 4ZVUA 3NNDA 3R74A 2HHCA 4XB6B 3PC8A 1NCRB 3QWFA 1WULS 2DPMA 2XA9A 5IW8A 3ML1A 3QFCA 4HDMB 3G0BA 3RVPA 4TLEA 3SQLA 3MTGA 3WJ1A 3KZXA 1HNXB 1KMIY 5HJ5A 3OJWA 3MWEA 2V73A 5IDQA 2ATXA 4JP1A 1EWKA 3HFRA 3PEEA 4IXLA 4LRQA 5IC6A 3N9PA 3PE6A 4QYIA 1UOFA 1Z26A 4YDSA 3GG9A 3EGDA 5F21A 3VDRA 2IYLD 4O9GA 4LZWA 3D6NB 4BFTA 3WZ1A 4DMGA 1JU4A 2FVXA 3AB8A 4DWWA 1FPN3 4JR2A 2Q62A 1XAIA 3DDWA 4CODB 3LUBA 4HQ6A 2HMVA 3T7TA 1P8AA 1C8LA 4XM0A 2DETA 1RKVA 4UD6A 4U7WA 4FPJA 3FSJX 2JGJA 2HLDA 2V72A 2YHIB 5C8ZA 3MILA 4MI3A 3OBBA 1W35A 3VBFB 2GCOA 2ZSJA 1REQB 2ZTNA 1MDBA 4OAOA 1DC3A 2IPNA 4CDNA 1F3LA 3KT4A 3UXMA 2Q49A 1O4YA 5C4WA 1E2LA 1J22A 4FEYA 1SG6A 4NMLA 2CHFA 3K0AB 2DFTA 3UT5B 1UM8A 4KXXA 4EA7A 4A26A 5EERA 3T7CA 2Q27A 4UBIA 3SX4A 3AKCA 1XTJA 4AIIA 4H55A 2XR4A 2IUWA 1UR5A 5EQUA 2AN5A 3RARA 1JEOA 2ZREA 1KO1A 5ALFA 2G70A 2NU9A 4MUVA 4NJMA 1BMFA 2GQ0A 3ZI0A 2WU8A 1BEEA 3FDIA 3VKWA 3MO4A 4Q9IA 4BVGA 4Q1PA 3PHIA 2JJYA 1NW5A 3GF4A 4YW6A 3QBEA 2RARA 1WLSA 3IX7A 5TJHA 1TU0A 4OHMA 3RS2A 2O48X 1NQAO 2FD8A 3JU9A 3AVXA 3IKVA 3DEYX 2QX7A 1JDBC 1EVJA 2Z58A 4EYSA 3PL0A 5EXSA 4NRMA 2QTWB 1QGYA 2XGGA 1H0RA 4AZ0B 1YS4A 5B53A 1LEMA 4R54A 3N2NA 4LCBA 1GRVA 1MA0A 1Z29A 3HVJA 3RYCA 4ND7A 4HB3A 3I2FA 4XMAA 3INNA 4ZDWA 3TEMA 1E1QD 2IU0A 5TIIA 1G0OA 2AC7A 4QREA 3W58A 2R00C 1TQ8A 1QGDA 2ZTMA 4TZDA 4D8UA 2ZUWA 2H0RA 3TZHA 4PHFA 1Y63A 3DF9A 421PA 4B44A 4JLSA 2YU1A 4F4HA 3DMTC 2GMMA 1E1YA 4RF2A 1T6XA 4BIFA 4J4TA 3LCVB 2JBAA 4TLDA 3B5LB 4BKPA 4EELA 1UJMA 4HP8A 2PWAA 1VB2A 3EZXA 2E3JA 1S0EA 4E6PA 2Q0HA 3WLNA 3FKSA 4H6VA 1EK1A 3WL7A 3RC7A 4AVCA 1HG1A 1XQXA 2C00A 5KKCA 5ACA3 1GFSA 1XZDA 1W6MB 2EBHX 3FTPA 1J5EB 2NVUA 3RLFA 4J16A 4DV3B 1QXRA 3PHMA 3F98A 4YVWC 1VPDA 1IXKA 3A4YA 1TZKA 3WQQA 2QTVA 2IXGA 1JLLB 2JLRA 1G8PA 2CWSA 3OE7D 2D6NA 4UUAA 3HPQA 3P2IA 3UHAA 3UAYA 4FHEA 1LGYA 1YB5A 4N49A 4P36A 1I4EB 2FJUA 1R8JA 4FXGB 1XBTA 5I7OA 2DAPA 3IYLW 1L5LA 1H6DA 3WK6A 1JI0A 2E48A 1NG9A 3KUXA 2IIBA 3LBNA 1YQQA 4KB5A 1T3LA 1PVVA 3E3LA 1N4DA 5JOZA 5JBNA 1UZWA 1YRQA 5A7HA 5JDIA 4N54A 4L57A 3CL1A 4B4OA 5TQ2B 1PG2A 3T9DA 3G85A 2KD7A 1TPZA 1KJQA 4OLFA 1AKRA 1FLNA 5GOZA 5EE1A 4PO8A 5DBIA 1IJFA 3OLQA 1QGOA 3RRBA 1F5NA 3U10A 2ZGVA 1ONOA 3K72B 5AJYA 5JDCA 3AMMA 1AR72 4ZDJA 4PO1A 4LHVA 4N3CA 2WUEA 4PG6A 2QL9A 2XMCA 1JAIA 4MUAA 5KTMA 1Z7YA 3DEMA 1QDEA 1Q2XA 1UU6A 4IV1C 4QYMA 1G64A 2VO1A 1Z6XA 2VATA 4D0LB 2Q3JA 1RM4A 1NSFA 4ZU4A 1D4ZA 4B6PA 5I3ZA 1GKIA 4ZRMA 1JJ7A 4CUGA 4WAUA 1P8JA 1O1YA 3DTVD 3RK1A 3G1TA 4ZT3A 1RHI3 2XMRA 2VQEB 1W93A 3MRTA 3IMMA 1Q7GA 4Q02A 4LTNA 5FZ4A 4QKFA 5G53C 3KSZO 1SO8A 2FP3A 4PGMA 4E2YA 1OHHD 3BGWA 3NBKA 5AKLA 3ND5A 2O3UA 4ZQCB 1K5HA 1RZ3A 5EMJA 4NHEA 3R0VA 1VLQA 3ABZA 4Z7OB 3B60A 3HB4X 3ZCXA 3K96A 821PA 1EUUA 4P9LA 3NV7A 4LYJA 5B2ZA 2JAOA 3U5ZB 4TL8A 4QPGA 1BU8A 2L18A 2IQIA 1G55A 1YUMA 4KH1A 3OZGA 4JELA 4QGHA 4RPLA 3GARA 4WOJA 1Y6ZA 5HFJA 4O2BB 1GG8A 4DTCA 3U1XA 1JNYA 1BDBA 2CT8A 1QUEA 3E9CA 2WI8A 1O7FA 3MCUA 3OJEA 3KT0A 1NVKA 2LWIA 1UCFA 4OHOA 4B4WA 1HDKA 1RXSA 3VU9A 2GVZC 3ZC3A 2ZI9A 3ILRA 3EPHA 3M3EA 3QENA 3M1AA 5HV4A 4MVJD 2PU7A 5CLHA 3U3KA 1V7ZA 1ONSA 4PRYA 4UHHA 3M6FA 4XTRA 1CETA 1V7PC 1YQXA 1NKVA 3DXFA 5LWQA 2JX9A 1OLSB 2XNJA 5HIJA 1PJLA 4F1KA 4AGVA 5D3MA 3U3OA 2RDSA 3V4FA 1Z78A 4CV3A 2H1FA 4LY0A 3OPYA 2CUKA 3I2JA 1LUAA 5IT4A 3A1WA 1PR6A 1GPAA 3NJ4A 5INTA 3NAPC 2QGNA 4Q6WA 4CDQC 2V7TA 1CFZA 1TMKA 1RQNA 2RI0A 3H0OA 4LITA 3CF6E 2QRZA 1JYNA 5C0OE 4LO5B 3Q8WA 2VM9A 2CVPA 1MX1A 3DPIA 2V45A 4KO4S 5J4LA 3A3KA 3GBWA 2W90A 3OZWA 5JT1A 4LKEA 2O20A 2LBPA 2RV9A 3SHRA 3HXQA 1ULOA 4BUJA 3ZHZA 2VNGA 1A8HA 3PNKA 4R8VA 1OFSA 3I4FA 4ZU5A 1E92A 1GU1A 5HRAA 4TLLB 3F8WA 1OQDA 3M7AA 2B37A 1H1LA 2RJNA 2PLAA 3FFQA 2ZXQA 3BL6A 2YWGA 2YH2A 4JV4A 4QLOA 3BAZA 3U39A 9GPBA 1JI6A 2WFZA 16PKA 2JICA 1VRH3 3W21A 5FLJA 3ZZMA 3WW2A 2BHTA 1JHQA 2GBGA 1AQYA 3TLJA 4HDCA 1C1HA 5A4IS 3QE4A 4GQBA 3GD7A 3O8OB 1Q91A 3DJYA 2WWHA 3L2YA 1M6NA 3RYHB 2WG2A 2HKIA 1UBCA 2WK1A 4D02A 4XTCS 2EWVA 3QU5A 4HEJA 3AVWA 4OQQA 2I1VB 5G4KB 4HL0A 3CEHA 2XGSA 4A5OA 4ZCTA 5H9VA 3LDRA 4WVLA 3TUJC 2I3ZA 3R3SA 4MGYR 2PD6A 5A6SA 1O0SA 2YXDA 1NLQA 3OY7A 4BB3A 4WT7A 3DOIA 5HOQA 2CLMB 5JZBA 5JAZA 3DMPA 1WW8A 3LGXA 4RS5A 2X6TA 3UW3A 4LEIA 3HVDA 3HCOA 5CUQA 3FC0A 4ZS2A 5G3ZA 4ZA2A 3A8TA 5EHGA 1AB6A 1TQDA 2ZKIA 2FKNA 1F0KA 4JWTA 2ZLBA 1Q11A 4MW2A 1YR3A 1ZJYA 3IRUA 5CISA 4Y1GA 3LLCA 3EBOA 1PK6C 4JCCA 4AP5A 4UCFA 3ZEAA 1KXJA 2J7PA 1CN1A 1M8JA 4IEPA 4KGZA 4LHYA 2G8NA 3RBAA 1NNSA 1DAKA 3U16A 1PFGA 1PEYA 3ND7A 3W8FA 4DE5A 2QN9A 5SV8A 2J09A 4HSEA 4O59O 3PGXA 3UUFA 7YASA 1MXFA 4JCKA 1SKQA 3GRUA 5ALQA 2Z30A 3MINA 1SLLA 3NO8A 4F93B 2IEYA 4P6VF 1XEXB 3O3OB 5AK6A 3U5TA 4XD7A 1OPRA 3VBSA 1XD9A 1LEDA 2X8LA 5DAPA 3E35A 2NAFA 4WKBA 2EJTA 3LYHA 1PMHX 3CZQA 1XSQA 3UJOA 3B1VA 3TS1A 2NYAA 2AB0A 3STVA 3U9LA 1P60A 2AEYA 2QG4A 4IY1A 1G8MA 1ZL2A 3FOWA 4GGMX 3ZXDA 2YHBA 3L1IA 2UYGA 3ZTTA 4OUEA 3ZYGA 3MPBA 1RVDA 3J8F3 3L18A 5HRCA 3OZIA 4QTTB 2RGCA 2XRZA 1YUNA 1R092 2AC4A 5CLGA 5DKFA 2XQRA 1TEIA 1ECJA 4Q3AA 2HB6A 2QN1A 3AOGA 3E3MA 3O8QB 1QS0A 1XA3A 1VBA2 3W20A 3NQ41 1YZLA 3QNWA 4DJJA 1G2OA 2WZR2 4JL5A 5JALA 4WD3A 2XMBA 2O5EA 3U0ZA 2P37A 2ZX2A 2W98A 3KR9A 5IXYA 1O6ZA 1EB8A 2C31A 2LP4Y 5EZYA 5DYWA 4JDNA 2M9MA 1ZPDA 1L9XA 1UCXA 1GPJA 3NKTA 2GN1A 4IDDA 4GMP3 4R9CA 3EQEA 2IHYA 3B9QA 3N7LA 3JQ8A 3D7RA 4F1WA 3SEPA 1S0UA 5JCOC 3T09A 5EV7A 3X44A 5GZ1A 4FFFA 5JNLA 5ALKA 4XTMA 2CVZA 2HTFA 1MV5A 5JOQA 1HW5A 4NENB 3GDWA 1G5FA 3W5UA 5GALA 1TYDE 4R9UC 1PJRA 2FA9A 5JSUA 3W2GA 2XZPA 1ZW6A 2Y77A 3DVLA 4ZXFA 3P9NA 4KLAA 4HK9A 2GCIA 5MDHA 2XWJI 3Q9LA 4TVOA 2IZWA 3X43A 1NURA 3PNVA 3ZE2B 5C5TA 3HL0A 3EWSA 4H7DA 4H7MA 2AE1A 621PA 2JCGA 4RV9A 1E5XA 3TVYA 1JR4A 1ACCA 3J7LA 1DV1A 5ENVA 1GZ3A 3PU8A 4G0NA 1FDVA 1D1PA 4Q4Y1 3EIHA 2FPIA 3MFAA 1KDRA 1HPLA 2Y1KA 4W8GA 1K2WA 3FWNA 5JR7B 2FZEA 5D86A 2W4QA 3O5SA 3HJFA 3RG0A 1G7YA 3RNLA 1ZH4A 4TSFA 3EOZA 1YE3A 4P3PA 2ANBA 4LYEA 2YRXA 3HJCA 4ACBA 2D4HA 4DLPA 1UX6A 4OTZA 3DFMA 4AXBA 3T3GA 3NBUA 4UU0A 2GBIA 4OXQA 2OECA 4F6CA 4G0QA 4U7GA 4PBTA 1VBKA 1WCYA 4CMKA 2VZ3A 3E84A 1Z7S2 5AUQA 4AUMA 1PGNA 2VQDA 1P4HA 4DRRA 1PK8A 3TR0A 3THDA 4AKTA 1IWPB 3H8VA 1QH9A 1RD4A 2JLUA 1IQ0A 1A9OA 2A58A 2XMSA 2VZSA 3I5MA 2GZAA 2BMWA 3KCQA 1KGDA 2PQ0A 3OU7A 1A2OA 4KXQA 2JG9A 4HNUA 5EZWA 4YAOA 1EWYA 1XC7A 2NYVA 2REQA 1TZCA 1HNWB 2JDID 1HUQA 3H2KA 5ALRA 3P2MA 4BKRA 3BOSA 3PGVA 1D2HA 3MCTA 1KO8A 4R1PA 3QH6A 4QNNA 4HD8A 2XXAB 1YCHA 2DPXA 3U4IA 1QH1B 3H9BA 1VBB1 2NQTA 5E2BA 3I62A 1X1RA 1DOZA 4ACAA 3UK2A 1QMPA 4F9GA 2EW8A 2W1WA 4Q1CA 3SLKA 3QXGA 3D8SA 5J09A 4QGNA 3WY9A 3H4MA 2HO5A 3RS7A 1DKNA 2YYYA 1CQ9A 1RT9A 4RUKA 5C9ZA 2GO7A 2VTDA 1XIVA 5BUCA 4DR5B 1DG6A 4QULA 1TT5B 3GT7A 2VJLA 1DAFA 2PJZA 4FYWA 4G1VA 1ZHOA 2D7FA 1V43A 1THMA 4L8GA 4GM0A 3RPEA 4WFKA 1Q8PA 3UWKA 4B6RA 5J47A 1DRWA 3D2BA 1V4VA 1LLUA 4HC4A 1SXHA 2LS6A 1T1JA 1AYM1 3GGLA 3WW3A 3T9AA 1ZU5A 4PS1A 4F83A 4KAAA 3D2CA 2JENA 4EHLA 3BFVA 1Z2EA 1B35B 2POQX 3II6X 4P14A 1Z5NA 2NMOA 1UAIA 1YRBA 4MS4B 4X20B 3UXYA 5EEGA 1II8A 2R4QA 4ZHQB 4X63A 2O1EA 2PSHA 1JQ3A 3A14A 2EJBA 3FFBA 3TQTA 4JGZC 4JZKA 4C2UA 2VZRA 2R8XA 1FLDA 5LZ6A 2QP9X 4PPFA 1HJFA 3TLYA 3UK9A 4O63O 4L9WA 1DO0A 2CL0X 5CXXA 1A2QA 2IZ1A 2A9VA 1X42A 3DPRC 3I8XA 3PDCA 3EGXB 3L93A 5B3AA 4KVZA 3OD5A 1QQP2 2H7XA 4XYBA 3CG0A 3KZ4C 1OLUB 3ENZA 4C7MA 2YKGA 3UV3A 1UU4A 3DKQA 4O9EA 3KKZA 3GRKA 5DYNA 1LPNA 2IPAB 4HKOA 1XNRB 2UYQA 4MJ7A 1BK1A 3IELA 1TK3A 3ANSA 4CKWB 2OCDA 1G2PA 1PCXA 3R3ZA 4EJFA 1V26A 3RJRA 1IBMB 2F4VB 4V3CA 1AGPA 1WY7A 2Y34A 1XJQA 2JKZA 3MUEA 1X1EA 3LL4A 1GZDA 4J8PA 2QK4A 4Q3EA 4MIYA 5IM4A 3NPAA 4BVKA 3QKIA 4TRJA 2WA1A 1BXGA 1K5MC 2Z5GA 3WDMA 1GNQA 1PVC2 4CM7A 5MGNA 1JT9A 2VJOA 2UURA 2VT3A 1DJPA 3P4UA 5JFOA 2IVZA 4II3A 3X2EA 1E57A 3U61B 1E1QA 4R40A 3AKDA 1VALA 2MOKA 3V56A 1G20B 4EJ6A 3OLXA 4LKOA 3HVRA 4XGQA 2FPPB 5JQWA 5DH9A 1WXIA 4UFIA 1YACA 3FYCA 4J0QA 3EC1A 4XZUG 3QF4A 4GLFA 5IANA 1QXPA 2XVXA 1NQVA 1S3GA 3CIOA 4CF4A 1VPVA 4LXLA 2ACVA 3RVRA 5FADA 2I1WA 3ZZTA 5BY5A 2ZPTX 4D81A 3H5VA 4HB0A 2GNTA 2X58A 1HTBA 3IDQA 3OM9A 3Q9OA 2LRPA 5LWHA 1AYN2 1BHSA 1TIPA 3T9FA 4MQ6A 3NJRA 2A6ZA 2DR3A 3A6KA 1J33A 2WHXA 2AACA 4J2OA 4YVWA 3JQAB 2LR0A 5DK6A 3ZJ5A 2DBRA 1WMBA 1KFXL 1JI3A 4LTAA 5E6SA 2F4LA 4HO1X 3G2OA 1PQUA 3OPMA 3HY3A 4BDSA 1GNHA 4B7XA 2QSUA 3DBRA 5IAOA 1XK6A 4RGKA 5IH7A 2AEZA 3OE7A 3ZQUA 2YN0A 3EZ7A 3OX4A 1G18A 5CNIA 3OPWA 3TRHA 3G2QA 3MK31 5CB4B 3UH0A 4FQ4A 4WEOA 1E7YA 4YVSC 2IXBA 3PX3A 3DLTA 2Y67A 4D8YA 3G5LA 1LBHA 2FUNB 1J1IA 3WLQA 3ZU5A 4URAA 1BE0A 1LF5A 4Z7NB 3GH3A 2VP5A 3TRSB 5B7GA 5BYKA 3ZGNA 1MZVA 3KFXA 4BKMA 1ZVJA 3WGMA 2O2YA 4KLCA 2Q2NA 4GNKA 2IZZA 5ALHA 5A7OA 2Y68A 4M83A 5IBQA 3H05A 2VHWA 1E6CA 4LA4A 2BUCA 2V0GA 4XTPA 3ZWDA 3T3OA 5C7OO 4I4IA 3UMCA 1QDUA 2QM3A 4OQ4A 2Z3WA 1REFA 1C3XA 5EJAA 2EW1A 3S2SA 4PZ9A 2PIDA 2PQSA 1BH2A 4LNAA 4WDQA 3QVUA 4RK7A 1CAXA 4BO2A 1GAXA 2ZRAA 2Q8NA 5FF9A 5F2KA 2ZJCA 3KQWA 1ARZA 1HTTA 5EUMA 1IOWA 5I8SA 4KTTE 3RH0A 2PX8A 1PZMA 3GLVA 3E22A 2PL1A 2GN4A 1B0UA 1IZ3A 1HLGA 1DPGA 3GLKA 3ETPA 4Z2YA 3UXHA 3ER9A 4FFBA 2Q3CA 3DAGA 4YUZA 4DKJA 2IOQA 4B3CA 2I7VA 1RI1A 4RQPB 2HCJB 3O74A 4EW6A 3DTVA 4GKAA 3AESB 1JOJA 5AM2A 1RKQA 2Q99A 5IHPA 4Y1FA 3NBFA 3PLQA 1SCDA 3HVUA 5G05L 3POSA 1OHHA 1CF4A 4KREA 1ZQ1A 1U0GA 1W48A 5F64A 3ZDYB 1I1QB 2XHZA 3CMCO 1RJEA 4BFUA 2WJ3A 1V9U1 4JJEA 2I29A 4TTRA 4O33A 1RRPA 4KPFC 2Q4SA 3BMNB 4ZI7F 5THKA 3SS8A 1MIHA 4QGMA 1RRMA 4JAVC 3SHWA 5ELMA 1XVAA 5HF6A 2NP0A 1E9AA 5C4WC 3GBFA 1U28A 2R8OA 2AI1A 3PXCX 1G9BA 2DBVO 3KPVA 2F1RA 1G38A 3JQXA 1Z7BA 2WJPA 4AWXA 2FFBA 1W9MA 2PX5A 4AFAA 1QVAA 3VNRA 5KYWA 3PVSA 2KB0A 2ZR0A 4QX0A 1QIJA 3FWPA 1U0FA 4TYWA 2IPXA 4AF6A 4IMIB 5EOVA 4YRSA 1VGQA 3NTXA 2HQ1A 2OKGA 2HAEA 1XDWA 4CTNA 3VNAA 1QJY3 1TZMA 1AMOA 4B33A 1FPN2 3AK0A 3E5RA 3FUUA 3IIAA 5AUPB 1ESNA 3HXMA 4YONB 3H8WA 2F9LA 4MVJA 2FHPA 3QFSA 2OLJA 3V8MA 3JQDA 2B98A 2ZX4A 2EFJA 4EUKA 1L4NA 1NIJA 1KDMA 3M4XA 1RWMA 4K05A 1NLUA 3O0WA 5AI5A 1EB9A 5JANA 5KTSA 5C1PA 4MPRA 3NAPA 3SXWA 4CDQA 1XB9A 2YFYA 2D6MA 3UB3A 2Z3VA 3ED5A 1CUSA 2PUWA 2JIQA 3M6LA 2D62A 4E51A 4UE6A 1BSVA 5T7BA 4GKBA 3R8XA 1DZTA 4PS0A 4A6SA 4TX1A 1PJZA 1US8B 4QFCA 3JQGB 3H5IA 1UMCB 5E4YA 5BVHA 2VT6A 3ILYA 1JR2A 1RRGA 3F96A 2X2FA 4E4DX 1NRIA 4ZVQA 5F1YA 2C1ZA 3CA8A 4OU4A 1IK4A 2R8EA 1MS9A 2F90A 5KHOC 2ENRA 4ZS3A 4DNOA 4D4JA 2QJRA 4M0UA 2XYPA 4KDRA 2XL9A 4YC7A 3UJ8A 1DHKB 2AI3A 3HUDA 5A04A 4GPTA 2PUBA 3ZTWA 1XTTA 2XLAA 3FOEC 2X05A 1EP1B 1SAYA 1FS5A 3N58A 2YDXA 3ZXIA 3FDZB 4H77A 3MLLA 1PGPA 4NP6A 4CF6A 4YV1A 3PTRB 4ZXEA 1DAOA 2NSDA 2WWIA 1EBUA 5FFFA 4M8LA 1XZFA 1UOBA 4WFJA 4Z0PA 4EVRA 2JGFA 2IIPA 3TDNA 4RPGA 1SCQA 3PQ6A 4GXTA 3R3XA 1TIBA 1VJ5A 3TN93 4K81B 3BWBA 2Y93A 2ZRGA 1PNTA 4PYLA 4MRVA 3SP1A 3T41A 2WHPB 3EWAA 4JEHA 4JROA 1N3BA 3L06A 1KORA 3G2NA 4WLEA 3L6OO 2QR3A 1JQEA 4NS1A 4OJYA 4M9UA 3TZQA 3ZJVA 3E7FA 4PCRA 2C78A 2JH9A 1NOIA 2OOKA 3HNPA 1VKRA 2KA3A 3U14A 1GQSA 4RU1A 3ZN6B 2PT6A 4LKSA 1S8FA 3SJAA 2QX9A 4LWZA 2D93A 3I9V6 4XGNA 3KVAA 2HK9A 4QUDA 1JFFB 2QY9A 3D4LA 3OFND 4CLOA 1XT6A 3C15C 3QGMA 2PJRA 5JY6A 3T1OA 1FW6A 3ELDA 2PA7A 1OLQA 2VUIB 1OH4A 3P94A 2C9ZA 4QM7A 1PK6A 1UU5A 1E6LA 2WEKA 5HQJA 3TMAA 5T6MA 2VDNB 4K9RA 4AR2A 5KHLB 1H4HA 3VL8A 5J2UF 5ACA2 5JDCC 4BXOA 4G85A 3Q3IA 2WZQA 5DXDA 5EYPB 4FS8A 1O6CA 2F3UA 5F3CA 4UAUA 3DM5A 1N5LA 5BNNC 3V2GA 4B8EA 5E38A 1RQRA 5KINB 1U2QA 3TE6A 2YWBA 3H16A 4H3SA 2BJWA 3T3PB 1JEQA 3DTYA 1C0IA 1LULA 1P77A 4FMPA 4FDVA 4TUYB 2VBFA 1NI4B 1VSUA 4GKYA 1A97A 3DMYA 1M2GA 3CQ9A 1D2AA 1UWWA 1JDNA 4OYYA 3RZZA 3LQFA 1LJUA 1X87A 5FOUA 2Q5EA 2X1MA 3LPLA 1ZIXA 3KKQA 3QUQA 3BMQA 5C5UA 3OCWA 1AF4A 1EE9A 1RSZA 2NLRA 4CCYB 2WJWA 4BQOA 3WNPA 2VHTA 5JVDA 4RIGA 3MTDA 3GX1A 3RU7A 4CN8A 4EZBA 4CKXA 3KXIA 4UZEA 3ASIA 4WLOA 3K70C 3MSCA 1RMYA 2VDWA 3DLCA 4U3JA 3I1YA 4BU2A 3OF3A 3WQRA 3NHAA 1XDSA 4OHYA 2BJVA 4DXRA 2I3DA 3G8BA 3WDTA 2Y05A 2FW7A 4ZHNA 4XW2A 4YI3A 1BVUA 2Y4NA 4PXYA 4EG0A 4BJ5A 4ENRA 3OU2A 4FGKA 4JI1B 5AW0A 1P19A 2WTMA 1JDVA 1N2CA 3A27A 5LBEA 4WW0A 4B5LA 5CU1A 1NBWB 1M76A 1BJTA 2G40A 1SIUA 4I08A 1VB5A 1RHI2 3QKUA 5EQJB 5JCOA 1Y3HA 3CW9A 2ZJOA 4XILA 4K6HA 3T1YB 3R3YA 3U4CA 5EP2A 2X9NA 5LXTB 1ODMA 1PL0A 1E9BA 5JCTA 2MINA 2Q5IA 2RC6A 3AF0A 3ILHA 1PUXA 2C4WA 3DE7X 3BWXA 3GLGA 2WDBA 3I3QA 2ISQA 1XN1A 1EGQA 5FBZA 1W0NA 3NNNA 1U6KA 1W2TA 1DLCA 4MDFA 1W90A 1OV6A 1U0TA 4B40A 3UCXA 1Z0ZA 2X1HA 2DP4E 3WLRA 3IQIX 2CEKA 4AQYB 1U1CA 3ICOA 4IJWA 2TECE 2YY1A 3TQIA 1GXSA 4WZZA 5KEIA 5AUNB 4FXKB 5A7WB 4ETWA 4XAAA 3QX7A 2A75A 1NATA 1LS1A 2AREA 4GXNA 3MN1A 1LB2A 1PGSA 2GRUA 2IYRA 1E3IA 1FTQA 2HRRA 2JK1A 2BNNA 1ZW1A 4RPHA 1EXMA 1FNNA 3KAQA 4JB2A 3A1TA 3GYDA 4NBKA 2OCBA 1N1SA 1CZUA 3V48A 2VG9A 2COUA 3QY0A 3M6IA 3LM8A 4C7VA 2AOXA 5DF1A 3OWXA 3MD0A 4KXNA 5D8AC 3OPQA 1C3EA 4BZWA 2QSJA 2JEZA 3ILVA 1NFQA 3RS3A 6Q21A 2SLIA 1M1NA 1IEWA 1VSTA 1N9GA 4D26A 1OI4A 1AKTA 4IR7A 4KGGA 1RVF1 3CUVA 1A5BB 3NHRA 1GTSA 1TJ3A 3VVCA 5FTNA 2ZB3A 4L4YA 2VP0A 5CD1A 1E2FA 2CMHA 3FMGA 1SU6A 3MEQA 3ET5A 2W4MA 4XYMA 4BMOB 3KAPA 1ULFA 1K68A 4RK5A 2ZCUA 5B1IA 3TD9A 3H9GA 2CGNA 5LJLA 4LZJA 4FAHA 1Q0LA 3TW0A 3VAZA 3LLMA 2O0JA 4DA6A 2VT7A 1UZ0A 3LQ2A 3QE0A 2JDIA 1VCOA 3VDCA 2GEJA 2Q5HA 5JLAA 2JLAA 1RHMA 2GFIA 4QFMA 2FX2A 3V64A 4CM3A 2RDRA 4ZCPA 1SA0A 5E6UB 2ZOEB 1G5RA 5G0WA 1YLLA 1RRVA 1VRH2 2YASA 1VYHA 1ISHA 3AX6A 4OSPA 2PGDA 4LLOA 3H4TA 3B38A 3VZRA 1WCXA 5JTUA 5DHSA 3FUCA 5HXMA 3T5PA 4P81A 1VBNA 2RKWA 3OUUA 3D8RA 3OCPA 1EH5A 4DLTA 3E9MA 4FTSA 2W58A 4EUSA 5EIOA 4QDSA 1ZD4A 5TMDA 3PJEA 2Z4RA 2IODA 3DQZA 3HD8B 1Y8RA 4IE4A 4W8HA 2ZGKA 4QODA 2ZB8A 1R74A 3RTAA 1IYZA 3VBSC 1CY1A 3FWEA 2Q4TA 4FJ2A 2WFMA 5IBRA 3EVBA 1L6IA 2YWHA 4DAEA 1TT7A 2B82A 2PVCA 1RYEA 3AKSA 4RL4A 3VZLA 2XB4A 3PLNA 3SXJA 5FP9A 3M1HA 2BYVE 4LHKA 1NW8A 2YXSA 4MQ4A 3THRA 1MG0A 2I1QA 1YVRA 2GZSA 4JGZA 3OT1B 1DAEA 4QKNA 1LU1A 4F84A 4YV2A 1EXDA 4C20A 4X3OA 3QVOA 2PRIA 3DDSA 1V8BA 3FY4A 3MWDB 3B3GA 2UYYA 2IXFA 5A5EA 1Y8AA 4IZOA 2P40A 4NIDA 4FPKA 4LKRA 2YJ6A 2YHUA 1AXYA 4B4DA 4QZVA 4MUGA 4O2AB 3S8MA 3GLFA 1JL3A 1PL6A 1A9QA 4UXAA 1DQPA 5FEMA 1KXZA 1KOLA 1CQJA 4MKZA 1KYZA 1Q50A 3RYFB 5IS2A 1Z8DA 4HNAA 1TO2E 5AM0A 1RM3A 4RX1A 1TK9A 3B2EA 2CVFA 1O7JA 3HMQA 3PDIB 5A6XA 4ZGBA 5LDHA 1P4AA 2CYCA 4M21A 2PYTA 1OLME 1G8FA 5BWBA 4F04A 2VZTA 1T8PA 2Q5JA 1D0HA 4MV2A 5IKMA 2DFLA 4KFUA 5LU8A 2F1HA 1CUJA 3QBJA 1DRVA 5JJIA 3KF3A 5JADA 5JH7F 4RHXA 4UASA 3K1JA 3BTOA 1UUFA 6ADHA 3QD6A 3OVMA 3VL9A 5FZHA 3AL3A 2XLFA 1LLQA 2DOKA 4RKRA 3OJLA 4LOJA 2IDMA 2A5DA 3DWGA 1SKYE 3KXLA 5DLPA 3J8F2 4UDYX 3GQBB 4EN0A 4YS6A 1IIRA 4HZGA 5K8LA 1NNLA 2Y0OA 5IM5A 3OY2A 5FOXA 1M8FA 3IQEA 4WVVA 1IHOA 2QZJA 4OKIA 2GNBA 5EG5A 5J5AA 2Q3EA 4IIFA 2CJWB 2FYTA 1U5BB 1R15A 2P5SA 4BNDA 3C48A 4DYHA 4N6NA 4KSCA 2VEDA 3CJRA 2IYXA 4GVLA 1RXWA 3SYLA 5FY8A 1Y8ZA 1JS9A 3H11A 1NVFA 3CO0S 5JOXA 1D0GA 2XQFA 3S3TA 1OZ0A 2VHYA 1X1TA 3DWFA 1QYXA 4RVGA 5J4YA 3NX4A 5JRDS 5I7HA 1NQOA 2PEYA 1Q6ZA 1V45E 3E7XA 4TMWA 4QPYA 1L8OA 3D5TA 5HBGA 4CVUA 4RHV1 3NWEA 5LDDC 3SC7X 1UPXA 4FCVA 1RU3A 2E4YA 4GHWA 3W5SA 5HE8A 4AZZA 4IDQA 1ZVQA 4G0WA 3V1KA 2ZSKA 1KI6A 7ADHA 4V0ME 4JFAA 4V03A 4GMKA 1A6CA 2ZHKA 4DSOA 3O2NA 3VU1A 3ABQB 1N2EA 4KNWA 2R6QA 5AI8A 4YVSA 1ZAYA 2R11A 1QK4A 2GPTA 2ADMA 4D57A 3ZCRA 3TD2A 1R0LA 5C7IO 2VQ3A 4MS1A 4N4AA 3T5GA 5ARDA 1IZ9A 3LDFA 4QX7A 4KMSA 2MMCA 3IVMA 3TIIA 4AY2A 4L4SA 1RWBA 4TLGA 3DUIA 1VHWA 3L7YA 2JG9C 4D42A 1OFNA 3WF3A 4CF3A 3NNJA 5F2EA 3THXB 4XFHA 3QPVA 4IMPA 1QH6A 2ZZMA 2ID7A 4AAYA 2IVJA 2TRSB 3KQNA 4ZI3A 4H35A 5EPOA 1GG2A 4AO6A 3J9SA 4HDQB 3L0ZA 1RP7A 3LUPA 1UMDB 4OMUA 4AI9A 3WG9A 1KZGB 1TECE 2V3VA 3R5TA 2VHQA 1LW7A 3LKZA 2EP5A 2I6TA 1BVYF 5D7NA 5JUVA 1C9MA 4HXYA 4XZ3A 4DCTA 2FHRA 1RI2A 4QOEA 1U12A 4CDRA 1HORA 4JUIA 4UI9L 4WDRA 5GJBA 3H3LA 4DJFC 2X77A 2X41A 1TL7C 4EFKA 4XGRA 2J6BA 1RQGA 4EEXA 2ZBDA 4I09A 1NNI1 2JLQA 4Y9SA 3BHMA 1P3Y1 2V6FA 4RV5A 1QY4A 3K2OA 2CL7X 3GNEA 4ARZB 1U3CA 5BXXA 4N65A 1S4CA 1BCRA 8GPBA 5IJ9A 3U7RA 1YYNA 3NDJA 2W42A 2DUPA 3VPXA 5DQ0A 1CIWA 1DBPA 5G0SA 2G4LA 2WZCA 2WNHA 2VXOA 5FPAA 2HTEA 2Z04A 2ZXFA 1Y4ZA 5B4VA 1KQ3A 4QOFA 4BVJA 2ZR9A 4QTYA 3AUSA 4W50A 3L0YA 3P3PA 4WMLA 3QELB 2ZQZA 5L4LA 2YJ4A 2ECQA 3NDBB 1E0KA 3WYEA 1E2PA 3N75A 4BV2A 4FCCA 2A3NA 2HHHB 4N41A 1W94A 1ZR4A 4UEQA 3DT8A 3BTUA 4S2FA 3T0DA 4KMMA 2HK6A 5DB4A 4Y2XA 2FQXA 5ALIA 4A0QA 2G6TA 1Z4JA 3IAAA 3OZAA 3W8NA 3H9UA 4MS3B 1B1AA 4UBJA 3GHYA 1RJ9B 4BQPA 5H9SA 1XE8A 5LBUA 1OGJA 5EFOA 1R4MA 1WUIS 1LSSA 4IXNA 2JIMA 3OCJA 2VUJA 3REOA 1DUIA 4YM0A 4V0QA 3N6VA 3TM4A 3HM2A 1DQ5A 4RR3B 4ISBA 3ZWVA 5FYMA 3DAPA 4JBYA 1SVUA 3GXOA 5E95A 5E2IA 2XVAA 1XLWA 2HU7A 4IZIA 1ZVKA 2RHDA 4QDKA 3W3ZB 4BX0A 4AI6A 4GC9A 4L5CA 3ON5A 1SPBS 2DTXA 5IUNC 3KXPA 4TZKA 3SFTA 3SZMA 1X8LA 2Y33A 2C24A 1K27A 5IJAA 4Y4RA 3ZOIA 1PMIA 5C1IA 3KQLA 2QVCA 5FI0B 1SVKA 2Q45A 1T43A 1KYVA 3J80A 3LDAA 2ZRQA 4CEJB 3POWA 4HVAA 5JS7A 3JWGA 3B9RA 1O03A 3O92A 5B2FA 1BDHA 2E1RA 5J96B 1P0FA 2EFDB 3DBVO 1B09A 3MWYW 4WLFA 1WWYA 1IY2A 3GBVA 4UU1A 3AFNA 2OZLB 1TRHA 3HKEA 4NCJA 2P2ZA 4AT1A 3X2SA 1LVGA 4JB0A 2PPLA 3LHDA 2PM8A 3ENVA 4U7TB 2P0AA 3RHTA 1VJRA 4H6WA 1LTHR 4GWLA 2PYZA 4WVZA 1KO5A 1E1CA 1RC6A 4TLAA 1FNZA 5C4MA 1K6JA 3ZW7A 2Z2ZA 3RVSA 3SF0A 4GH5A 1W8NA 2YUEA 2L82A 4I02A 2FCRA 1G9XA 1S2GA 4AQ7A 3ANLA 1QLJA 5KXEA 5C5CA 4I50F 4OYHA 4QUGA 1PU2A 4PLCA 5LQSA 4Z3OA 3OOYA 1IQDC 4Z0NA 4I36A 2RIPA 3O3MB 4B6SA 4OHFA 1R9NA 1MGOA 3USUA 3ACGA 3NC0C 4DLUA 4JUAA 4TSRA 2EU8A 1AX9A 1CUBA 4FBFA 3A4TA 4LFAB 1EFAA 1KETA 3BALA 3FVWA 3MLJA 5GY7A 3KD2A 5BR8B 4UW9A 1C30A 1S0JA 4MUJA 1IDN1 4Q93A 3OFNA 1ZZBA 4DJ5X 4YPOA 4YZ3A 2E7ZA 5IT5A 1N8KA 4LR4A 3W9YA 3O1SA 3RTCA 4K8FA 2HJVA 4MCHA 4YZ4A 4CEWB 1LV8A 5CFQA 3T7IA 4YAWA 2HA6A 2ZB2A 1GPBA 4U63A 1Z0SA 1BX1A 3K30A 1RIIA 5HILA 1W9WA 5BNNA 3DCIA 2P1BA 4QTXA 4P4SB 4TRMA 3KT8A 1ZX1A 3K6SA 1C2TA 1JXAA 2W91A 1NKTA 3S81A 3P4YA 4CG0A 5EKSA 1JG6A 1BGVA 4EYKA 2ZUEA 3M3PA 2OA0A 5FZ7A 3GGGA 3ASYA 4UM5A 1TZ2A 2E87A 3G5TA 1H85A 1XNGA 3STWA 2PMDA 1QHDA 5FLEX 2VF7A 1G20E 3TSAA 3JPYA 1FNDA 2ZE8A 2W2KB 3I05A 1JAHA 4P83A 4ISCA 5DK4A 1JQJC 1ZIOA 3REQA 3HJAA 4ZOAA 2X9LA 1HLPA 1LQUA 4OOFA 1RLMA 2EIDA 3VYVA 3I59B 3VTAA 1D2QA 5AVRA 3DFKA 1UF9A 4O3FA 4KRFA 4EB8A 1G3QA 5DTJA 4INJA 1IXYA 4YJ3A 3LT5A 2GC1A 2PFKA 2IHZA 4XBQA 2GAOA 3FLBA 4LVUA 5FNVF 1CY4A 1FCJA 1JIKA 3HR8A 4LT5A 1QHGA 5FJHA 1CWUA 3I12A 2QN6A 5EUBA 4TYNA 5LK7B 1U28C 1AURA 4LC1A 4MIOA 1MQAA 2IDJA 4DIMA 1CPYA 1J8MF 1UK9A 1YCIA 1CJDA 2NTNA 3QACA 1DQ2A 5B7PA 1BX0A 4EHHA 2IXDA 4NYMR 4QX1A 5ELLA 3V80A 2GNDA 3LFIA 4CHTA 2WIAA 4WTOA 1E2HA 2HNBA 4MV7A 4UM9B 3AI7A 4QYSA 3C6MA 2JZNA 1YVEI 5EJZB 2GHIA 2H18A 4IRXA 3L0SA 2B20A 3EEYA 1INLA 4GXQA 4B34A 5I4CA 3D3EA 3M0EA 4M1OA 2I6UA 1FYUA 1NJ1A 3ROUA 4GOKA 4OA5A 4YV0A 4V0SA 1BFKA 2GN9A 1JZQA 2DX7A 3QSYA 3O1RA 4HGPA 1XBFA 3FUWA 3EMRA 2ZT6A 1PS9A 4XOIA 1ZOOA 4E94A 3WGTA 3LT0A 2P3OA 1UQTA 3PQFA 1GU3A 4D79A 4HNGA 5DAQA 3R0JA 3RSSA 4NOLA 1UMHA 1V16A 2A9JA 2A1TR 1V3UA 4DUZB 5IEBA 4A6OA 4X8NA 1N78A 4CUKA 1F31A 4OMCA 1ADYA 4CM4B 1ZK0A 3A9SA 1L5RA 1DAHA 4RFVA 2VZVA 2FJ0A 4BGVA 3KPJA 3DL4A 1RJWA 1KKUA 3GEDA 2AH2A 1QNLA 4AUKA 2EP8A 3JATB 4ZXPA 3PGJA 1LBQA 3U3DA 3N7JA 2EFHB 4PYMA 5D8AA 3ABRB 1J1LA 2KBFA 1QJY2 3SX0A 4DLKA 2G06A 4E7PA 4W5JA 2BEVA 2HN9A 2BAGA 2HLNA 4GLBA 4R01A 3HB7A 4ZYYA 1REDA 3VNQA 5UKDA 2VHUA 2YROA 1RUOA 2IBSA 3NHUA 3LDUA 4LBQB 4XWKA 1HYHA 1KRIA 2YUTA 4GMGA 2C84A 3BFJA 3CW8X 1SR8A 3TRDA 3M83A 1BJQA 4V2UA 1GO2A 2DWQA 4IILA 2VRNA 4P92A 1S0DA 2CFTA 1N57A 4UW6A 5CIQA 2AOWA 1WVGA 2QUBA 2R2AA 5DDIP 1C1XA 4CCCA 4KMRA 4W5RA 2ZMKA 4ZCMA 3WV4A 4O1MA 4Q7MB 3JCIA 2GK7A 3EB9A 1GU7A 2N1BA 3WYFA 2ZGPA 3CKMA 3BFPA 4IIGA 4Z1VA 2QQIA 3FMVA 1G6KA 1O6FA 3AB7A 4RK4A 2D54A 1V0JA 2IV2X 5BWMA 1V41E 2J5BA 3RMXA 3CEAA 3UFXA 4TKVB 1DP0A 2O2HA 3U44B 3RWBA 4BV3A 1SKYB 2WZEA 4JVMA 3L1JA 4P4UA 1QOPB 4JA0A 4GP6A 5FO9B 1USGA 2AC2A 4NRQA 1RVV1 1WLWA 2GBLC 4WUVA 4WPGA 3VKVA 1VJ0A 4E2SA 4GJYA 1H23A 5TMEA 1RZRD 4C78A 1USVA 1V3VA 1H4QA 4FC7A 3LAWA 4CGZA 3PIDA 1GDHA 3TGWA 4OUDB 2LTAA 2IOHA 1YJBA 3AL6A 3KAJA 1P4JA 5AVZA 5BRAA 2XB2A 4LV5B 3GLHA 5F76A 3TN92 1ENRA 1DX6A 1LODA 5FKBA 4RAOA 4R1LA 2GEKA 4LUKA 4PYOA 5AVOA 5F3IA 4XHBA 1FK8A 3DKIA 5FXMA 3VAYA 4CDUB 1DXYA 2REXB 2PFSA 4FI3C 4DLYA 4IIJA 2AQKA 4M8SA 2XZOA 2PIAA 4GP9A 3ONNA 2P4HX 5FBHA 4LFCB 2UXCB 2B6HA 1X7ZA 4G41A 4AEDB 3IA2A 1OBOA 3U40A 1LDYA 1BWPA 1JE1A 2GERA 1AT1A 5JJBA 1V95A 4OQXA 3SISA 2PH3A 3LRPA 1L8AA 1W6RA 3MCZA 3V55A 3BJMA 4O4HF 5FMOL 4I4TA 2XKAA 4I5DA 1JHJA 1T5OA 4BVLA 1RUD3 4R9AA 2MYPA 1JA0A 4Y26A 1YTLA 4K03A 1QDLB 3P2KA 2PL5A 5KJFA 4YP5A 2BFBB 2QCSB 2W6PA 3RWKX 2I1LA 5KPJA 2Q1FA 5EPAA 2HSEA 1U4SA 5EHDA