3IB3A

Crystal structure of sacol2612 - coce/nond family hydrolase from staphylococcus aureus
Total Genus 192
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
192
sequence length
556
structure length
551
Chain Sequence
HLLGNPKLTVTHVNEVKAGINHIVVDSVQYGNQEMIMEKDGTVEMRDGEKLYINIFRPNKDGKFPVVMSADTYGKDNKMGALWPTLGTIPTSSFTPEESPDPGFWVPNDYVVVKVALRGSDKSKGVLSPWSKREAEDYYEVIEWAANQSWSNGNIGTNGVSYLAVTQWWVASLNPPHLKAMIPWEGLNDMYREVAFHGGIPDTGFYRFWTQGIFARWTDNPNIEDLIQAQQEHPLFDDFWKQRQVPLSQIKTPLLTCASWSTQGLHNRGSFEGFKQAASEEKWLYVHGRKEWESYYARENLERQKSFFDFYLKEENNDWKDTPHVIYEVRDQFYKGEFKSASAFPLPNAEYTPLYLNAENHTLNHAKISSAHVAQYDSEDKQQDVSFKYTFDKDTELVGNMNLKLWVSTKDSDDMDLFAGIKKLDRRGNEVNFPDFNHIENGQVATGWLRVSHRELDQEKSSIAQPWHKHETELKLSQDEIVPVEIELLPSGTLFKQGETLEVVVKGSEIVIGNSTPGMKTRYEHEETVNKGMHMIYTGGKYDSQLIIPIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of SACOL2612 - CocE/NonD family hydrolase from Staphylococcus aureus
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords CocE/NonD family hydrolase
total genus 192
structure length 551
sequence length 556
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02129 Peptidase_S15 X-Pro dipeptidyl-peptidase (S15 family)
A PF08530 PepX_C X-Pro dipeptidyl-peptidase C-terminal non-catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3020.20 Mainly Alpha Orthogonal Bundle alpha-amino acid ester hydrolase ( Helical cap domain) alpha-amino acid ester hydrolase ( Helical cap domain) 3ib3A02
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 3ib3A03
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ib3A01
4B0PA 3WNMA 4H18A 3HRHA 2C4XA 2XMBA 3OBAA 5EJZB 4Q82A 4QLAA 4Y2UA 3RM3A 4HXEB 1GPNA 1QTRA 2K2QB 5EIEA 4FHZA 2WU3A 4A16A 1YA4A 1CV2A 1J07A 4OUEA 3BE8A 2XHNA 2DCKA 4P08A 3T0DA 3WNOA 2X76A 2ID4A 1XRPA 5IFTA 1UXOA 1CZVA 1CQWA 2VC9A 4EZIA 3Q0TA 3NJVA 1UXXX 3PI6A 1AKNA 1NKGA 3DL4A 1GPLA 4J03A 2DR0A 2QS9A 4Y9SA 1CUZA 5AO9A 1IVYA 4OYUA 2XONA 4IHAA 5DNUA 3HZOA 3G0CA 4P5YA 4C01A 4UBJA 4F5ZA 3LEGA 1CVLA 4BRSA 5ALMA 4X95A 3WJ1A 3HEAA 4UHEA 3I28A 2ZSHA 1IUOA 3O4JA 2VAXA 3FYUC 4CUBA 3OEAA 4ZWNA 5T4BA 3WIBA 3FAKA 4NZZA 4MQMA 3U0VA 4GHWA 2OGZA 4BAUA 4KAAA 2WSLA 2W95A 5A2GA 2VATA 4Z2AA 3WNLA 4EY7A 4GI1A 3I3DA 5AOBA 2J1UA 3FYUA 1Y37A 1H22A 5CH8A 4V2IA 5EFZA 1R50A 1T2NA 3JYHA 2YC2A 4DM7A 4OSEA 1K42A 1ZJ4A 4KI5M 2VAVA 3GDBA 4G9GA 1OD3A 3PDCA 5LZ2A 2XUQA 1MN6A 1UX7A 1R88A 4U2BA 4RNCA 5ALXA 3M83A 5AKGA 4BC1A 4BK4A 5DYWA 2O7RA 3NNGA 3LCRA 3O0DA 4KE9A 4C4YA 2ZYSA 2XMZA 5HQ3A 3T09A 3CKHA 5AI4A 5ALUA 1YS1X 3UESA 5EIHA 2JD9A 5CT8A 4LIPD 5AK4A 2ZXQA 3B3QA 3H1AA 4RE6A 2ES4A 2IIVA 4EY4A 2Z3WA 2W91A 4H7KA 3O4IA 5JD6A 3K2IA 4BB0A 5T4EA 1GQRA 5IH7A 1UMHA 4FLFA 5LCWL 1XRQA 2HA3A 4H0CA 3C5VA 3TRDA 5EHZA 3MGAA 3UMJA 1O6FA 5D3KA 2I03A 1CUVA 1TAHA 2WJ4A 4BDVB 1JZ3A 4MADA 3STVA 1ZIYA 4MOAA 3WIOA 1UZ0A 5C70A 1X70A 3K9BA 1WB6A 4UHHA 5ISMA 2HA0A 4WY8A 3N0TA 3MBWA 1F0NA 2XT0A 1PX4A 4A3ZA 4BYMA 1GXSA 3C7EA 3KD2A 4QAWA 4U2CA 1ULOA 2EIBA 2C0PA 3WF2A 2C9KA 2LS6A 4EY6A 4X71A 5EHQA 1CUAA 4B84A 1F4HA 2WU4A 3QITA 3WWCA 1ZI6A 4TXWA 3LS2A 1QONA 4DEVA 3V9AA 2G4LA 3FHAA 5A71A 4ZV9A 4BATA 5AKLA 4HXFB 5ALIA 1JI6A 2XI4A 2DDUA 1UOPA 3T08A 2D0DA 4MYSA 1MTZA 1A8UA 4J3JA 1F0PA 1NU8A 4AB1A 2Y2VA 2XB6A 3E1F1 4BP9A 2OQVA 2GBFA 1F4AA 2IITA 5KREA 2J7MA 3E4DA 3PFCA 3FWHA 2D5LA 4Y2SA 3WYDA 3CCBA 4CU9A 2XDWA 3GXUA 2CKMA 3NWOA 5C81A 2BKLA 3HJUA 2Y6JA 4YK7A 2NW6A 1O6GA 3GELA 3HC7A 2WFMA 2ZEYA 1CUHA 1VZ2A 2BFNA 2RI6A 5AOCA 3QMWA 3WKCA 4EBBA 3NOXA 2WUDA 1UK9A 4FLEA 2BGNA 5EGNA 4FLMA 3I2KA 3X3HA 3HEIA 5JD4A 5C7YA 2OGTA 1ODTC 3A2NA 1XZIA 1W52X 3HSSA 2QQJA 3OG9A 2WO1A 2QMQA 2Q0XA 2QVBA 3R0VA 2HU8A 1YCDA 2AJLI 3ZLVA 4LXGA 2VCCA 2ZEXA 4DUWA 3STUA 4J0KA 3T4UA 2W1WA 4DXTA 1XQWA 4YPJA 4A4AA 3TEJA 1U65A 5ESRA 2VZSA 1CUFA 7YASA 2VZPA 2JGFA 1SCKA 5E4YA 3VXKA 1HQDA 3JW8A 3M3DA 4ZY9A 3PUIA 3BXPA 4MO3M 2VT6A 3MV11 3VJKA 3H2JA 1IMJA 4FTWA 4QX0A 2WG2A 3DECA 2Y2UA 1CUJA 1CIYA 4QDQA 2OXEA 3LQCA 4H7IA 4WFJA 2Y6KA 3ZLUA 4D0QA 2ORXA 4JKKA 1ZI8A 1JU4A 3AIMA 5HK9A 5K3FA 3WZLA 4Y2XA 2BGOA 1N1MA 1XZDA 3DYIA 3RARA 5D6OA 5K3CA 2QQNA 1JI3A 2R8BA 3VD3A 5EIAA 4LHSA 3HJRA 1X2EA 2OQIA 4CI9A 1UY3A 2I3ZA 2JGJA 3IAPA 3NQHA 4DUVA 4JUIA 1TCCA 4Q05A 4CU6A 4HS9A 2HU7A 5LA1A 4QX2A 2CMFA 1QIMA 1W1IA 1BCRA 4QEKA 4DYHA 5AOAA 1WPRA 3DOIA 1Q0RA 4O08A 3K6KA 1JJFA 3I3BA 3LIPA 3S2ZA 3T52A 3HPNA 4DMHA 1XZAA 3SX4A 3CXUA 4PO3X 2WAAA 3WKBA 5CT5A 5HFNA 1TKRA 2ZSIA 2H7XA 2HADA 3WWPA 1CPYA 4N5HX 2B20A 5K3EA 4LKSA 1J2EA 3DOHA 2EEPA 1DU4A 1UK7A 4KEAA 1UKCA 5JUVA 1UWCA 3GUUA 2WQZA 5KWIA 1W9TA 3FL7A 1GT6A 1EA5A 4GWLA 1YAJA 2W92A 1OF4A 1C4XA 2YFUA 5AI6A 3L1IA 1EVEA 3WNPA 5HF5A 5FP0A 2QJRA 3STXA 2GYWA 2HFKA 4F60A 1LLFA 4IH4A 1HKHA 5EHNA 1LGYA 3AFIA 3WL6A 4X7BA 4KR0A 2HU5A 1XPWA 2JE8A 4UBLA 3T0AA 3G8YA 2QQIA 2V9ZA 4A45A 4DGQA 2HIHA 1N5MA 5JANA 1UK8A 1QOZA 3BJRA 3L1HA 4J7AA 3T2PA 3ACIA 1JYNA 3BN6A 2PSHA 4J0HA 4XJVA 5AK5A 3OEBA 5ALGA 3V1NA 1JZ2A 3OURA 5YASA 1Q0ZA 1ZJ5A 3G0IA 5AKZA 4BZZA 2QT9A 5ALPA 4JHZA 5FUMA 2RONA 2VOTA 4L3WA 5JYCA 5ALHA 1GKKA 5FRDA 1UYYA 2YH2A 2VSQA 3MO4A 4CUCA 4FBLA 1MU0A 1XRMA 1D7PM 1H2XA 2CZQA 1QTIA 5FLKA 2VZ1A 1XZMA 4YASA 3C5WP 3WJ2A 2XUGA 1W75A 2OLEA 3B5EA 5CRIA 2RHTA 2HHAA 2ACEA 1XNAA 1YS2X 1IZ8A 3DNMA 2HFJA 5DLPA 4C89A 1UMIA 4XUOA 2WUHA 3A2LA 5LZ9A 4P00B 3I3EA 3A2MA 5A7FA 5ALOA 4W4ZA 5I0DA 5E4JA 4P93A 5HFAA 2J1RA 3WZMA 2FUKA 2RVAA 4U2FA 5LA2A 5ALWA 4UI9L 1E8DA 2X09A 3WEZA 2ZJ7A 4INZA 1ACLA 4Z49A 3D0KA 4OPMA 4BDTA 4RPCA 3FCYA 4E8DA 1KEXA 4FFVA 4MYDA 1SCIA 3GROA 1BRTA 4TGLA 1P0QA 2PVSA 4QWWA 5AHXA 5AM1A 4QDRA 2ZJ6A 5CH3A 2WHQA 3HNBM 1MO2A 2PSDA 3ZV7A 1CUBA 4NVRA 5HKBA 5FUIA 3QPDA 1DINA 4N8DA 3UETA 5HF6A 2JGMA 2J4FA 4FI9A 5CT4A 4ZGBA 3EQ7A 2QM0A 4PQQA 3ICWA 1OF3A 4P9NA 3TGLA 1CIJA 3F97A 1ZI9A 2GBGA 1CZTA 1R9MA 1CX1A 4DSAA 3H1BA 4B6GA 4BAZA 4GW3A 1TVGA 3DYPA 2PUJA 1QFSA 2VMEA 2DQYA 2YXPX 1W0NA 2J1AA 3W06A 4CCYB 1MT3A 2QQKA 4A6OA 2Y6HA 3H19A 5AH0A 5HF9A 3WL8A 2DHCA 4DMCA 1QZ3A 2UZ0A 2XQGA 5JMOA 2ORYA 1RP1A 3IURA 2O2IA 3QPCA 1JYWA 1EK2A 3SC2A 3J7HA 4JEIA 1XROA 3W9BA 2RGUA 2WZ8A 4C6HA 1J83A 4B7ZA 1J84A 3I2GA 5HCUA 2GBIA 5JAHA 3I6YA 3HNYM 1UY4A 4H7JA 4E15A 1US3A 1QIIA 4L9AA 1H2WA 2JEYA 3A70A 3R3ZA 2WUFA 3PICA 3OPMA 2HL6A 5HF8A 5DTJA 1RWQA 4JX0A 1XQXA 1WHTA 1PMJX 3ACHA 1XZFA 2VT7A 4Q3KA 3BDVA 5AI9A 3OTQA 4UUQA 1HPLA 1E66A 2WJ3A 2Z8XA 3W9UA 1VZ3A 2YASA 4HG6B 4C4ZA 2R11A 4TPKA 1IZ7A 1K63A 3FN9A 3HACA 1QLWA 4XIIA 3ANTA 3KDAA 4XUPA 3LLCA 3VDCA 5ALTA 4XVCA 5CT6A 2W46A 4GBGA 1LPSA 5I7UA 1QGED 4J0IA 2VZ3A 1XNTA 1UY0A 3A22A 4KACA 2W47A 5HKAA 2OCLA 4G8DA 4BXSV 3S8YA 2C4HA 3NGMA 4UFPA 2ZJFA 4BC0A 3PF9A 1QE3A 2XQXA 1EVQA 4BBZA 1LZKA 5FPPA 4H77A 1M33A 3OC0A 2QQLA 3ZI7A 4FNGA 4HXGA 5FKJA 1FSSA 3F8SA 1CRLA 3WLAA 1ZGBA 5ALRA 2J1VA 3Q8WA 3D3AA 1ULPA 1DQZA 2XQIA 3FVRA 4GEGA 4K2AA 3WWEA 1BU8A 1H23A 5LLSA 3WK9A 2VA9A 2XMCA 2XE4A 2V5DA 2AJCA 4DMFA 1EK1A 3ACFA 4ARBA 4AO7A 1BE0A 2C26A 2Y6LA 4DNPA 1Y7HA 1YASA 5JXHA 3G9TA 3OGVA 5A6VA 4EHBA 2C5GA 4B81A 1TCAA 4K6KA 5DYYA 4QA9A 1CUEA 2AJBA 1WOMA 2QRUA 3A6ZA 2XUOA 5BV7A 2WUEA 2XMGA 5AM0A 2WHPA 1CUGA 5K3DA 1O8SA 1XKTA 1XZCA 5C8VA 3ETPA 2XUDA 3WWOA 4HRYA 5AICA 4W9RA 1P8JA 4ZXFA 3W5MA 5C7GA 3ESBA 1O8PA 3C7GA 2G5TA 5D7BA 4A5SA 4LQRA 4UHDA 5J3JA 1VXOA 1HBJA 3FBWA 4G4GA 3WWDA 4FNMA 1JZ5A 3B12A 3HYSA 4C88A 3GM8A 1LBTA 4J0CA 4IH1A 1D07A 1XZGA 4UHBA 1W76A 4NMWA 1ACJA 2W94A 1AZWA 1ZD3A 4J0JA 5AI5A 3HI4A 1SDDB 3DEAA 1W9WA 4ZRDA 2BCEA 2HA4A 4GZ9A 1EINA 4CIAA 4OB7A 1EH5A 3JXSA 1W8OA 4LHEA 5HZGA 4EY8A 3SK0A 4E14A 2B61A 1XZEA 3GA7A 1E8MA 5AKHA 3LPFA 1PMHX 3G9ZA 4QDXA 3WNKA 2VO5A 4QDSA 2VMFA 3LPGA 3QVMA 5K3AA 2WHRA 1XFDA 5ALVA 2QOEA 4PF1A 1UXZA 2VQUA 2VEOA 5ALKA 2C5FA 2BERA 4UFOA 5C71A 1BS9A 2VQTA 5IVDA 3FYTA 5ALYA 2Z4FA 3BF7A 2Y64A 3IUJA 3N2ZB 5LP1A 3C43A 3AILA 5CT9A 5AKYA 3K77A 3DQZA 4MEBA 4QDZA 2V4VA 2XQJA 2JKXA 1LPMA 1VXRA 4FFWA 1BEEA 2OKXA 3O9VA 1A8QA 5SYMA 4GWJA 1TK3A 2QQMA 3OB8A 3ACGA 4W1PA 4G9EA 4ZZ5A 3EQ9A 1GNYA 4KYVA 4JKLA 4PNZA 5AIAA 1L7RA 2WFZA 5IYYA 2YYSA 4L0PA 5AM4A 2DFPA 1GOFA 3WL7A 2VMDA 3W5NA 5DWDA 3NRUA 5CXXA 5ALNA 4IQ4A 1JYXA 3DL7A 3GGLA 5DPNA 2WKWA 3D7RA 4CG3A 4GDMA 1SC9A 1YB7A 3AIOA 3G9UA 4D9JA 4OB8A 5ALZA 2WO3A 3AUKA 3DJYA 1THGA 4ARYA 1XLUA 4G4IA 5DTIA 4L0CA 2VTFA 4PQEA 5HXMA 2VZRA 4CFSA 3AZPA 3M82A 3CMGA 1N8SA 3V1LA 4GWIA 3P6BA 1T4MA 3EQ8A 5EJ1B 2J3DA 2BGRA 1PX3A 2HA6A 2BUCA 5AM5A 3WI7A 1UT6A 1R64A 1YR2A 5A7GA 1JJIA 4CG1A 2HM7A 4RN5A 2J22A 3M81A 1EUUA 2AJDA 2IX9A 1TG7A 3WSOA 3PF8A 1MJ5A 2PX6A 2EIEA 3WNNA 3K75B 5AM2A 3WK6A 3MUNA 1UY1A 4W1RA 4QDOA 4N8EA 4X97A 2QTBA 3IAQA 4B0OA 1WB4A 5DN2A 3OOSA 3LEKA 2E3JA 1C7IA 4JKMA 2ZYHA 1AUOA 2RHWA 4G5XA 3BJMA 5DYTA 3PE6A 1I5PA 3ESCA 1XKLA 1LBSA 5JASA 2CDPA 1ZD2P 1BEZA 4DTCA 2XUAA 3CN9A 1G4HA 4Y7DA 4UFNA 4BVJA 4OU4A 4Y2VA 2V96A 3V1KA 4CCWA 2RJ2A 5CMLA 1UWWA 1NU6A 2G5PA 3I2IA 3BL8A 2H7YA 5LYYA 3QPAA 3KSRA 5AK3A 3DYMA 4EY5A 2W1UA 4XUTA 1JMKC 4B9EA 2X05A 3U1TA 3F9CA 1HLGA 4PV7A 5F7UA 5EHXA 1PFQA 2WLSA 2WJ6A 1DT5A 1K3IA 3VVLA 2WYSA 1SCQA 1EB9A 1GQSA 4RE5A 3H2GA 4JNCA 3D3NA 5EIYB 2W3JA 1LPOA 2GYUA 1MNQA 2JGIA 4X00A 4IO0A 1JZ8A 2CJPA 1FFBA 3RK4A 2W9XA 1MX5A 3I6MA 4PSUA 1DWOA 5T4FA 1GOGA 1R1DA 3FCXA 5JIBA 2WG0A 1GU3A 4AAXA 4BE4A 2V98A 3VJMA 3D59A 3VVMA 4CG2A 4NS4A 2C7BA 1F8UA 4LKOA 4AMZA 4BZWA 1B41A 3T0BA 1G66A 3MV01 1ETHA 1K8QA 1OXMA 1CUWA 2XUKA 5HQ3B 4DIUA 1K4YA 3I6ZA 4G4JA 3V1MA 1HDEA 4B83A 4A42A 5JAOA 4KE6A 1GZ7A 2W87A 1QJ4A 3O9MA 2BZDA 2X8BA 2DCJA 1WCYA 2OCIA 3QZUA 5IJRA 3G7NA 2CEKA 3G0BA 1OH4A 1IUNA 1OT5A 4OMDA 3BGAA 3H2HA 3WMRA 5AK6A 2Y1KA 3NJXA 1ZD4A 4UBMA 3SEPA 1C7JA 1U8EA 3LEIA 2B4KA 2HA2A 5AM3A 3QBJA 4X92A 2EDAA 1MX1A 4OYYA 2VJCA 4ZI5A 4DMKA 3F98A 2J1SA 4UAPA 3T2OA 1MAHA 3KXPA 4WJLA 3C6BA 1QIJA 2ACKA 2DHEA 4XX1A 4XWGA 1XQYA 4G8BA 1L7AA 2WFLA 4Q1VA 2WTMA 4DXRA 3R3VA 4EUSA 1JZ6A 2CDOA 1CEXA 5T4HA 4OU5A 1GPKA 5FDFA 2Z3ZA 2XUHA 3H2KA 2XMDA 2XMQA 1VA5A 4U2GA 3KOOA 1GGVA 4MGQA 2VR4A 4I4CA 4PSCA 4XZUG 3BF8A 3WKEA 3DLTA 3EYPA 3E3AA 4ETWA 2VL4A 2XMRA 5G04L 1VA4A 2WDBA 3L1JA 1PJAA 1PV1A 5AKEA 1AMNA 5FXMA 2YB7A 3V48A 2YG0A 1WPXA 4QB1A 1MAAA 4M0EA 2PSEA 2O2HA 3VD4A 5ALDA 3MUY1 5K5EA 2W22A 5HK8A 1BROA 3R3YA 3WA7A 3MVEA 1DTEA 3R3XA 2OCGA 1E89A 3FLBA 4QLOA 3HNMA 3LIIA 4UBIA 5FPQA 5HPOA 1R3DA 1B6GA 3EB7A 1QIFA 2Z8ZA 4HTAA 2Z5GA 3WL5A 3VISA 3G0DA 3K4DA 2DSNA 3F67A 3MUZ1 3IIIA 1DYOA 3AJAA 4QNNA 1Y7IA 2EICA 2LW8A 2EIDA 3U37A 4DNFA 4IUGA 4DNOA 3RKSA 2XOMA 3QMVA 1TRHA 5CXUA 3H2IA 2JGLA 4E46A 2QBXA 4ZXEA 1KU0A 1WKYA 1US2A 3VD5A 2VZVA 1JT2A 2QXTA 4Y2PA 3BIWA 2XUIA 2Y8KA 1DT3A 2I78A 2OCKA 2Y6UA 2PL5A 4M4PA 4HZGA 2QUAA 2AJ8A 3WKAA 4DNQA 5JZBA 1W8NA 3O4HA 1X2BA 4W1QA 5C8ZA 1GOHA 5B4XA 1YSCA 4ARAA 2WBKA 4CU7A 1VE6A 4X90A 3C7OA 3ZWQA 5K3FB 1G5FA 3G9XA 2HDWA 3DS8A 3AIKA 1CUIA 3WA6A 3H17A 1YA8A 5E2IA 2GBCA 4DEQA 3A7QA 3SWWA 3D4LA 1R4ZA 2QR5A 2ZVDA 1HN1A 1JFRA 3D2AA 3EIOA 4Q3LA 4DXSA 1XC6A 1LNSA 2X10A 3STYA 5ALFA 5BOVA 5CURA 1P0IA 4C4XA 4N5IX 5CW2A 4FWBA 3A23A 1H2ZA 4G8CA 4L72A 2HLEA 4JYPA 1CUXA 3ANSA 3TJMA 5LKRA 4F21A 2L9LA 2W6CX 4QZVA 3O95A 5JAUA 2WAOA 4AMYA 3UNPA 4QE3A 2VJBA 1R9NA 4QDTA 1U4NA 5CH5A 5JXIA 3UUEA 1RYYA 4W63A 2RV9A 1UOOA 2VJAA 4G1FA 5LZ5A 4F0JA 3C45A 3W2TA 5ALEA 2ORZA 1QIDA 3D2CA 4DUXA 2WM2A 1LPAB 1ORWA 3H04A 5E4TA 3IULA 4AN0A 4UBOA 4CVUA 3E0XA 2G63A 2E26A 3GZJA 5IVHA 3OGSA 4D8MA 2Y6VA 5ALJA 5CZKA 2JEZA 2PKYX 1FFDA 4ZV7A 5LZ7A 3R41A 1KGYA 1GMMA 4ZREA 5LKAA 3I2FA 1UOQA 1CFJA 1XQVA 1H2YA 4WY5A 3FYUB 5AKIA 5DNVA 5JXGA 1F6WA 5A1AA 6YASA 3WF1A 4AZ3A 4MJ3A 1EXWA 2GZSA 4X3CA 5FV4A 1ZGCA 1UFOA 3O4GA 1LPBB 4BVLA 4FMPA 3DDUA 3HOBA 1WHSA 1QIKA 2WFLB 3CZUA 3FSGD 4Q34A 1UZAA 1XLWA 3FOBA 1XRRA 2QQOA 1H6YA 2RIPA 1S8OA 1SFRA 2VCBA 3FSGA 4E8CA 4GECA 3ZLTA 1H6XA 3ESAA 4ZZ8A 4U2DA 5A7HA 1NAEA 1EHYA 4K5QA 1XZJA 5IVIA 4MWSA 3VKFA 1CUCA 3C7HA 4AX4A 2ZYIA 4QPWA 2CB9A 3OGRA 4BJ0A 4HVTA 2ONCA 2JGEA 5A62A 3MUOA 2VJXA 4K6GA 4UPDA 4X85A 2VM9A 2XUPA 3W04A 4KE7A 3HXKA 2WQ8A 1XRNA 2H9YA 1Q84A 3DCNA 3WF0A 2LIPA 1EDEA 5AKKA 2O7VA 4KMQA 4W8JA 2YFZA 5JAPA 4MQLA 4OUKX 1JHJA 1YQ2A 5BWBA 4DLNA 3LE0A 1E5TA 1CUSA 1TQHA 4OD0A 2QUBA 3I2JA 4M0MA 5DJ5A 2OPHA 1J1IA 5LIPA 4JH0A 4AO8A 4WDQA 2FJPA 1NX9A 4HAIA 3R40A 1AQLA 4YX9A 2O2GA 4AQDA 1DWPA 4Y2QA 5LZ8A 1CUDA 4H35A 1K45A 4QWMA 1VOTA 3D5EA 1UKAA 2PM8A 3DYOA 1E8NA 4WCVA 3PFBA 4LPLA 1BCSA 1IUPA 5AKJA 3RLIA 1UKBA 4MWTA 1TCBA 4AO6A 2XUJA 4WFKA 2WIFA 1ODSA 3ILSA 2PSFA 4XUNA 5LZ4A 1BN6A 1E3QA 4X94A 3C8XA 1FFAA 3T2QA 1WB5A 1AURA 3C7FA 2VZOA 4DSZA 2CBGA 2J1EA 3W05A 4OB6A 1ODCA 3WYNA 4CIBA 2RAUA 2BGPA 4H7EA 4UHFA 3IVMA 1K5PA 1Z68A 2XLCA 3BWXA 5AI0A 2WN2A 4UBKA 5KWJA 4LXHA 4X6UA 2E32A 2XMSA 2ZEZA 1DLCA 2WTNA 3AZQA 1BHGA 2PSJA 2WABA 1JJBA 2E31A 1QFMA 1Q83A 5IHRA 3R3WA 2VZQA 2VF2A 4Q3OA 3BIXA 2V97A 3I2HA 4QB6A 2VCAA 1HL7A 5JATA 3AZOA 5CYYA 1EUTA 4M4RA 2VZUA 4A44A 3FVTA 5JZ9A 3ZM8A 1JU3A 2WUGA 1TIBA 2PU7A 1WCQA 5I8PA 1EI9A 5JD5A 1P0MA 1GKLA 2WZEA 1ZICA 5DNWA 1CQZA 3IUQA 3WK8A 4A41A 1QO7A 2DCMA 3VD7A 3PUHA 3HN3A 4AXBA 3STWA 3FLEA 2J4CA 1EDBA 2XLBA 4M0FA 4KAFA 4BE9A 3D2BA 5FOQA 4B85A 1FJ2A 2XQFA 4JYMA 3STTA 2QZPA 3IB3A 4I3FA 1K12A 5H3HA 3VDAA 1A88A 1BN7A 4BCCA 2JGKA 3LP5A 1CR6A 4J0DA 5G05L 3C6YA 2ECFA 4QB2A 2OAGA 3HABA 1W9SA 1I6WA 3ED1A 3H18A 4ET7A 3SEEA 1LZLA 3UUFA 3K46A 1VKHA 4OYLA 2BBAA 4BVKA 4E11A 2WIDA 3A21A 1ZIXA 4KRYA 4LXIA 1THTA 4LYEA 1J06A 3I1YA 1UYXA 3AINA 4LYDA 1CUUA 1VJ5A 3WQBA 4B80A 3GFFA 5EI5A 1YAHA 5CTAA 3VD9A 2JDAA 1MPXA 2V72A 2BJHA 2XUFA 5ALLA 5K3BA 3VDBA 5AI8A 2WN3A 3IUNA 1FFEA 1LPNA 2AXEA 3CIHA 3ESDA 4W1SA 4ARXA 1ISPA 2HA7A 3SKVA 4OZOA 1O59A 1UK6A 5ALSA 5SYNA 4XURA 1XZBA 2VTVA 4FKBA 2WIKA 5AP9A 2JF0A 1QO9A 4X6XA 4Y2RA 4OMCA 2OAEA 4WDRA 3P1IA 3DD5A 1UY2A 5IKXA 4EB0A 3THCA 1W6RA 4WFIA 4H7HA 3YASA 1YB6A 1UYZA 1N5RA 2CUTA 2WG1A 2GYVA 4J0GA 5AIBA 1L7QA 2WIGA 3EBLA 5LA0A 5I9IA 3OM8A 2HA5A 1GQPA 1NUKA 4QX1A 3CN7A 3I97A 3C6XA 4X91A 2WHPB 2FX5A 4AZ0A 1G42A 3K4ZA 1DWQA 4N8SA 3KWFA 5J1XA 3FNBA 1QIHA 1CUYA 4X6YA 1WM1A 4FBMA 3QMMA 2C58A 1JYVA 2QKYA 3F2ZA 4PT6A 3EF3A 3FLAA 1KEZA 2DHDA 1EDDA 3CCCA 3GBSA 3SKJE 4Y2JA 5DMYA 4BCBA 2W1SA 5IFPA 2PBLA 4UHCA 4I19A 3HLKA 4IH9A 5CBKA 2BUAA 1AX9A 1ZOIA 4QDUA 1A7UA 1AGYA 3ZPXA 3IUMA 4BTLA 3WF4A 3H0CA 2E33A 5IVKA 3KWJA 4BAGA 3IBTA 3K4AA 3VJLA 3CZJA 2XQKA 4ITVA 4C87A 3CDZB 4ROTA 2ZYRA 4HRXA 3I1IA 3VDXA 1VE7A 5B4NA 5ALQA 1JZ7A 2ROQA 2J3QA 4P92A 3DKRA 4Y2TA 2WO2A 1CZSA 4BTVA 2PQSA 5C8XA 5KBYA 2P8SA 4MEAA 1AC5A 1OCEA 2R7EB 2H1IA 2HRRA 4GXNA 1MX9A 4Y2YA 2OG1A 4FDMA 4EA6A 2GZRA 5BWCA 3DYVA 2VQ6A 4AN1A 4GLBA 1QIGA 2BUBA 5D3ZA 2YC4A 4KWUA 2EDCA 3CQOA 1W4LA 2VJDA 4BP8A 1LPPA 3ICVA 4H7DA 2JBWA 3JWEA 2BAGA 2C0QA 2X5XA 1QIEA 4BK5A 4YPVA 2QJWA 3C6ZA 3ECQA 2J1TA 2VZTA 3ABZA 5F4ZA 4FOLA 1FFCA 1XZKA 1JMYA 3AC0A 1OILA 2QXUA 1U2EA 1DQYA 1DX4A 1JZ4A 2HRQA 5AKXA 3OG2A 1P0PA 3R3UA 4PW0A 4BCDA 4X93A 4TTGA 2HYXA 1MNAA 2OGSA 4BRZA 2PUHA 4K6HA 3QH4A 3WQHA 4W50A 3C87A 2H7CA 4TVKA 5JALA 3C8HA 3IA2A 4B9AA 3WK7A 3QM1A 1XZLA 1EB8A 3WKDA 3P2MA 4XUQA 4CUAA 4QX3A 3WK5A 2ZEWA 4KJXA 3FHQA 3NUZA 3F96A 1XRLA 1GUIA 4S0XA 2B9VA 1T2XA 4A23A 2KD7A 2WIJA 3C8DA 4PSDA 1KU6A 4UBNA 4KRXA 1ORVA 4UOJA 4P02B 1USWA 2PPLA 2FJ0A 2W5FA 4RGYA 4BDSA 1DX6A 1W99A 2JIDA 2DQZA 4XVHA 1A8SA 5JXJA 3G02A 3THDA 3BDIA 4CU8A 3C70A 1SHWB 2PU5A 3DKKA 1ZD5A 4RYDA 1CLEA 2W1QA 3WF3A 4MGSA 1EX9A 3QYJA 3IDAA 4KAJA 4KE8A 4B82A 5DQ0A 2Y6GA 5JARA 4U2EA 1JKMA 4H7FA 3E1GA 1DP0A 1IQDC 2I3DA 5JZSA 5AJHA 1K6EA 3WK4A 4CCYA 5JADA 1VLQA 5JR2A 1SG3A 1XLVA 2VMCA 4AG4A 4OCZA 1XZHA 4MXDA 2WILA 3G0GA 1SOMA
chains in the Genus database with same CATH superfamily
3WNMA 5I7SA 1RRVA 3KHCA 5EJZB 5K0ZA 2WZR1 2PXHA 3N1UA 4A16A 2P3LA 1G60A 5ELLA 5AJZA 5D2AA 2AEFA 5HM6A 1LSOA 2DUWA 4N8MA 3K5HA 5BN4B 1NN1A 4OQLA 1EP1B 3VGJA 2WU8A 1MT0A 4IX9A 1LLQA 3EDOA 4KYIB 3P4XA 3KJHA 2J9FA 4CCAA 3CNQS 2PUAA 3WJ1A 4LO4B 4CLXA 5CB0A 4LBYA 2Q9UA 3FHIB 3NNDA 4OHPA 3CZ9A 4UXJA 4CCDA 4BYYA 1XP8A 4W8HA 2B4QA 2ETEA 5L3SA 2V4AA 3O1IC 1ZJ4A 3ZX7A 3MIIA 1BEV3 3DOFA 4IFBA 1SK8A 1M6EX 1MN6A 3NIBA 1HV0A 2EQBA 2NO5A 4RNCA 1OA3A 3POIA 2IX3A 2FUEA 3ZJYA 4B8EA 1HK7A 1S0JA 1BOFA 5AI4A 3E9YA 2RJNA 2X8AA 4MVYA 4BN5A 1F48A 1RJ9A 2NYUA 3N6VA 3D6VA 4PGFA 1GQ2A 2D5IA 2CSGA 4DDUA 1QHGA 1NOJA 2ZKNA 2RCNA 2IU6A 1W8ZA 4ABYA 1Z22A 1PIV3 1QH0A 3ZV5A 2PXXA 4DCNA 4N40A 4OJYA 4WM8A 2I03A 1JZ3A 2QTMA 2F4VB 1DIWA 3IPYA 1PR4A 4FSDA 4D9KA 3IQZA 4UHHA 2PS3A 4QX8A 2OQ2A 3DC2A 1PX4A 2YXSA 3X2SA 1YZLA 3C3VA 5AC92 3GFOA 3U78A 3BFPA 2B5HA 2QVGA 2Y34A 1RYNA 3DBVO 4B84A 3QITA 2BBOA 3ME2A 5FP4A 4TXWA 5B6IA 3DV8A 3V9AA 4G5SA 1XSEA 3ONDA 1GZWA 3IAHA 3GQBB 1UFRA 1Y9AA 2GEDA 2X4GA 1EK0A 1QHHA 2R9VA 3RSCA 2DDUA 4ZTBA 2AZMA 3ZXKA 3F3YA 1VB5A 4BO3A 1K88A 1F0PA 2P1DA 1J90A 3OUTA 2JFYA 2OQVA 4V3CA 4G0UA 3DFIA 3ZE9A 3WGYA 4KN8A 4OKSA 1NCRC 2ON6A 4NR0A 2C54A 2K5UA 1W5AA 4I9FA 3SN6A 1UR5A 2ZS9A 3MINA 4LZZA 2HWD2 1M66A 3A6EA 3HJUA 4ZCPA 1BCRB 3W77A 1EUDB 1GYKA 2DLNA 3SJBA 2SCUA 3VC2A 4BGIA 1NG0A 2QTVB 3Q6NA 3QY9A 4ZAVA 3KD4A 4FLEA 2JDMA 2NMOA 4RPJA 4I1VA 4MW5A 4CQMA 5JPMB 2HGSA 1NLYA 1W8HA 2BVBA 2CXUA 3H50A 1YCDA 1M8FA 2H8KA 3NHPA 4YIKA 3STUA 4ZKEA 1EY2A 4ZIRB 1AT1A 3RODA 3FUUA 3S2SA 1EESA 1M34A 4UXAA 2Q5IA 1N5JA 4LXXA 1GCAA 3JW8A 2FMFA 3ENQA 1VI2A 4WBBA 1BNCA 3EWSA 4CM5A 3EDCA 3BJIC 4PO1A 4B6FA 2IY9A 3BWMA 1BMV1 2HMWA 1XAJA 3H11B 3BZBA 4QOSA 3TKYA 4WFJA 4INAA 4LDJA 1SKUA 2ORXA 5HK9A 2GP3A 1JEAA 4Y2XA 3ZCSA 4D96A 1VIWB 5TQ0B 2YZMA 4LX0A 5C52B 4QXPA 1OZ0A 4CDUB 1DFGA 3QNMA 1PK8A 3O1LA 4QEKA 4EQZA 2YTZA 4O4LF 1KAEA 5M7EA 4YREA 1Q43A 3OJLA 2J9XB 3QPVA 2CY6A 1KMHA 3N36A 3R5SA 2CBXA 3PT9A 1HOTA 3IDQA 2HADA 3HXLA 3UG6A 3AJZA 4TXJA 1O3QA 1DU4A 2FSFA 5IUJC 2V3CC 1S9HA 1RC6A 2VDKB 4BNDB 2CAUA 1PRYA 2RHDA 2FUNB 1OF4A 1Z0UA 1DC5A 1RXEA 4N90A 5DB4A 4Z4CA 4DXHA 4L9BA 4JQYA 2HKXA 1SDWA 3S8EA 1D6JA 3CRRA 4L5BA 2E63A 4QXOA 2RS12 2XNDD 1L5MA 4WERA 4LF7B 3DEMA 1SQFA 3L1HA 2V6JA 5IH3A 4DAEA 1E64A 1DYKA 2GXAA 1AE1A 3B8HA 4DPLA 2PTGA 5FUMA 1I3MA 4OP1A 1DG6A 5JYCA 3JZVA 2JB9A 2JLZA 1LI7A 1UYYA 5IYZB 3POEA 5BR8B 4E33A 1TT5A 3VTFA 2YVLA 1Z06A 2CZQA 1QR6A 3PUVA 2CNOA 3DNMA 2HFJA 5JVVA 3RC8A 4FR0A 1HLPA 4MIKA 1JPJA 1RBMA 4E03A 2H1HA 2NAPA 4U2FA 5C1DA 5LA2A 4OLLA 1E8DA 4IV1C 1VM6A 1C81A 3O1TA 1UXHA 3C7TA 3ENZA 2P75A 3UH1A 1LEHA 3EUWA 3RAPR 2HYKA 1SCIA 1JQKA 2IH4A 4CKBB 2ZFUA 3EFEA 3ZXUB 1PQWA 4BEJA 3TXAA 1QKJA 2ET1A 3VZPA 4N8DA 3WVNA 4O59O 3D8HA 4WZBB 2BISA 4ZGBA 2WFF3 3T9BA 4PQQA 1BEV1 3TGLA 2R1ZA 4KOEC 1ZCBA 2RHRA 3LSDA 1ILWA 2ARXA 1L8LA 4H14A 3H8VA 3KOYA 3CX3A 1ODMA 1GGKA 2YNMC 3BIWE 1UOJA 3VGIA 3IJEB 3URKA 4QARA 3B1JA 2IZ5A 4CM8A 2BTEA 4D56A 3IVAA 2P3OA 3FDJA 3BILA 1NRWA 4GOKA 2EHJA 5AJWA 4R9VA 1RPAA 4LZNA 1A9OA 1QE5A 4IO1A 3NI2A 4I14A 1H2WA 2JEYA 2P5UA 2HL6A 3JQGA 4W99A 4RUKA 2VJYA 3ROKA 3RK0A 4C0AC 5HOEA 3R23A 2C2MA 1KC3A 1PZFA 3ZKAA 3QUAA 3EUFA 5FD8A 2YASA 2JD4A 2QQWA 1SOVA 3C14C 4LKDA 2P9ZA 4IIFA 2ZI5A 4HOYA 1MZVA 2DWUA 4UW6A 3CO5A 1E5QA 2Z1DA 5H5JA 1KO5A 2PYDA 1NRIA 2FR8A 2QR3A 4B5LA 3ABSB 4KQIA 3A22A 3LXXA 2WS91 2X7HA 1H2LA 4K88A 1YZYA 4UFPA 5DULA 5IEBA 7AT1A 1LZKA 1W4BA 3U3RA 3OC0A 3AKCA 3HO1A 4N3BA 3GPLA 1RPTA 4HB2A 3A6FA 4L7VA 4Y67A 4YAOA 4HOOA 4BJ5A 1EM8B 3JZIA 5EIXA 1KJQA 1E3DA 2C5LA 1M2KA 4OKIA 5H9RA 5MN6A 4I2NA 2XE8A 5K3DA 4M0DA 1Z6ZA 1HDYA 4YLZA 4LISA 5SY6A 4LHYA 5AICA 3MAAC 4W9RA 4W8GA 2WZR3 3ESBA 3DPIA 3AXDA 4LQRA 4UHDA 3AWIA 2VP5A 3D7KA 1MIOB 5J2UB 1T3SA 1LU2A 2L19A 3IHTA 2RBGA 1XZGA 2FD8A 3CH6A 1U0SY 1H6AA 2SKCA 3O3MB 3Q3HA 3ICEA 1WG8A 4CIAA 2XCOA 3Q41A 1VGQA 1X1CA 1EH5A 2OKCA 4LHEA 2JGRA 4IXLA 4V0MA 4KXVA 3O8OA 1AR72 1N1TA 4BP3A 4UM8B 5ITZA 4KFCA 3GA7A 3VHOA 4XQ4A 1LTKA 4KO2S 1QUFA 3CRNA 5ERXA 1U2SA 1K7CA 3KYDB 2ZB8A 1PS8A 2CLSA 2HKIA 2QX9A 1OFVA 1XEAA 2D7DA 3IXQA 3PEEA 3L9XA 1YBAA 4KJZA 1EP3B 2AR9A 3TKAA 1CQJB 1TAGA 2XRZA 3N6XA 3D9QX 5GV7A 4Q4V2 2ID7A 3ZXIA 2YN2A 1MB0A 1DIOB 3D3WB 1PV2A 3C3BA 4GR5A 2NN8A 1GRVA 4C0XA 1RQGA 4DB4A 1G8AA 3ACGA 2C1XA 4RGKA 1XNGA 2F48A 2XZTA 4F2PA 1XAGA 4G6ZA 5A33A 3PFHA 4XF4A 3GJQA 4AK9A 5JSRA 3MMXA 5IUQA 4C0QC 3O1PA 3DAHA 5C5CA 4Q5IA 4IFTA 2NN3C 1RUC2 3F1LA 2I55A 3QOYA 2F2TA 1LJ8A 1YB7A 4F5WA 2ECPA 3O9ZA 4WM7B 4Y5SA 3AL0C 4JHLA 1RBQA 2HWE3 3QWAA 3ZDEA 3RVDA 4PIZA 2QD2A 4M9UA 4LBLA 4GL4A 2QW1A 3PC8C 3NAMA 2NU7A 4BKPA 1PX3A 5ELMA 2VJPA 5JR7B 5DTMA 4XVUA 1YR2A 4P3KA 1NCQA 5A0FA 4RN5A 2ADDA 4BP1A 4TYNA 1DS6A 3VKGA 3IEPA 1XJCA 4I1YA 8AT1A 3DZIA 3K75B 3L7LA 4O33A 4QDOA 4RTLA 4NX2A 3OQIA 1DNPA 4JI3B 1PT7A 3I8XA 4JKMA 5AHKA 1VG0B 2R072 2IIPA 2VD7A 4F4IA 4NZMA 1NW7A 1V6OA 4DIMA 5JOZA 1CZKA 1V95A 4P35A 3JALB 5FMOL 5TMBA 3RJ2X 2JAUA 1NNI1 2O7NA 5DNEA 4AEJA 3BX1A 4YY3B 4DLYA 3QU5A 5J2UA 5DFAA 2VF7A 3F78A 4AXOA 3PWSA 4DJTA 2JJ1D 1EAH1 3O1HB 1E3WB 5JIAA 3HNRA 4RE5A 3PFIA 3HB1A 2P9BA 4FEGA 4Q39A 4BQ1A 1KYZA 5FK7A 1R0YA 5JJBA 3R3SA 3B9PA 2X5JO 2ZK7A 2C9OA 2HCJB 1J8DA 3FUCA 3U10A 5K8VA 4GO1A 3RF6A 3D59A 4ZKTB 3BMQB 3S1LA 4K86A 4XPIA 2YZ4A 2PL3A 1R4MB 4RVCA 3RMYA 2KQUA 2PN5A 1M6WA 2H5LA 1N9ZA 4KGDA 1NLRA 5A9SA 3GLFA 2PA0A 1AGRA 2BMVA 3GLGE 2OCYC 5JG7A 3F3MA 1LKZA 3LO8A 4E2GA 1NE4A 2JK0A 2IQIA 5IJRA 2IDJA 5KZMB 3UN1A 4RVOA 1IUNA 2GSWA 5I7OA 1HYEA 3HMKA 3JSXA 3CLRD 3B7PA 4CR7A 4DMKA 2O06A 1ECPA 5AESA 1MAHA 3KXPA 1GNPA 3X1MA 2YDYA 4E32A 3OD4A 4Z2WA 3IBMA 4AL4A 5AJXA 3VR4D 2VPVA 2XUHA 2XMDA 4BGDA 3NDBB 3L6BA 3KL4A 3V7UA 5L7TA 5G2OA 3D0SA 1D9ZA 2CUZA 2YB7A 1ZN2A 2YG0A 4L28A 4Q9KA 2PKXA 3BRWD 5D5PA 3P0RA 2FRDC 4YT5A 1A8IA 2QU8A 4LTMA 5GV8A 2DZDA 3FLBA 2H1SA 3LUGA 4CWAA 1NHWA 4HTAA 3O1JC 3RV4A 3TLGA 2CWWA 1J21A 1ZBA3 2EF0A 2R62A 3CGGA 5JFGA 1A76A 3E1SA 4B7EA 3ROGA 1US2A 1VSUA 3HY6A 3K1AA 1P3DA 2ZBDA 3I59B 2ZACA 2HUPA 4M37A 1SUCA 1WD4A 3B13B 2WBKA 1KJWA 3GUYA 2UXBB 1I7PA 4BNNA 2OP0A 3AHCA 1SOAA 3BL5A 3CJTA 3DFMA 4FVTA 3STYA 1QMPA 2FVYA 3N75A 4C4XA 1CVIA 3LL7A 1UN1A 2A3XA 1QANA 3F6BX 1ZR2A 3ANSA 2NSLA 1EWVA 2F1OA 5GZGA 4PIMA 3ET4A 1LK5A 1SZCA 3I5XA 5E4TA 1M2WA 4LKRA 1AMUA 3IKLA 5GZFA 3SZLA 5J1TB 2NUAB 2M9MA 1LDEA 1C0PA 3P2IA 3AR4A 3KQNA 4IV1A 2Q5QA 2A92A 3QVJA 1Q6ZA 1QX4A 3MELA 1JH9A 1S4MA 3POSA 3AMNA 1H2YA 5CVJA 3K9CA 2RAVA 4AZ3A 3OIUA 3B3AA 1B35B 4U7PB 1UIMA 2GZSA 1QB8A 3D64A 1QMGA 3EQEA 3KJEA 1ZEMA 3CNLA 3TIXB 3L8EA 3ECCA 1YCFA 3JQFC 4DLSA 2X5IC 4CKCB 2JIQA 4HK9A 4QQ8A 4R98A 5BSTA 2WLQA 7GPBA 1T0HB 2E6VA 1I2ZA 1Z0AA 5LY2A 3KAQA 2WB2A 1NAEA 4R7ZA 3G0OA 4WPGA 3ZE6A 3IBGA 1X87A 2WC1A 4LRQA 4HVTA 2ONCA 1GLHA 3DOJA 5BT9A 1RUF3 3IHLA 3HXKA 3BTOA 3NCTA 4L0QA 2IXKA 3D2LA 1CZUA 1CJBA 2PT7A 3NMBA 1YS9A 4TVBA 2G3YA 4OUKX 5IAVA 3OUUA 3TW8A 2W6QA 3JYNA 1XTUA 3MCTA 2PUEA 4M86A 2QYTA 5L51A 1YFYA 3MHPA 1PZEA 4FDUA 5EIBC 4MJXA 3CWCA 1SFYA 3RIYA 1C4OA 4IG4A 1QFYA 1PWYE 2AGSA 5EKTA 1X82A 1WMSA 4FYXA 1PZHA 3KKQA 3ZXAC 1SCSA 1U7HA 2NM0A 1F9AA 2HIAA 1C5HA 1PS0A 5K99A 3KSMA 3H9QA 1GO2A 3DNPA 3PXEA 5A33B 3C7FA 4M8NE 2W58A 1JFFB 4YN3A 3CX7A 2KLBA 4H7EA 4GX5A 1OE0A 4B09A 4F56A 1YCHA 4NNJA 3GEGA 1K8XB 3W8RA 4JEUA 3TNQA 3RZKA 4P9IA 1IPEA 2VCAA 4XLZA 1SUPA 1EUDA 4DIQA 5EL0A 1ZRHA 1TIBA 2CL6X 2Y1LA 4MRVA 4P4NA 2DULA 4ZZ0A 2XCSB 2C5EA 1QQP2 4YI5A 4RD7A 3VHNA 2UZIR 1NT2A 1P1HA 3VZSA 3VKUA 5F1RA 1HDXA 3AWDA 2YV8A 1GSLA 1QEXA 1VB4A 5J4KA 3NW9A 1JWBB 5DM70 4JV5B 2ECFA 4A3SA 4B3RB 5BW6B 1HEUA 1NXWA 1NL3A 3LT5A 3AMMA 1NR5A 4LDRA 5ANNA 1WZXA 4KRYA 3GVXA 4EECA 1UYXA 3AINA 2OK7A 1PDWA 4MV4A 2QN6A 4QKDA 3NPMA 4ZAFA 3TUZC 5KTSA 5JJ5A 5EWMB 3MOGA 2HIGA 5GPBA 2AXEA 5DVZA 3UB4A 1FRFS 3IBSA 5ALSA 3UFXB 3EF0A 3PVSA 4PI0A 4BMXA 3HLTA 4BQNA 2PSSA 3PVNA 3N6RA 3EJ6A 1F2TB 5GJ6A 5E8JA 4EZBA 2B82A 1QYIA 2D40A 2CUTA 2WG1A 5AIBA 1XU2A 4K8OA 4HXCA 4CLOA 1L1RA 4GI5A 2Z5WA 3S2EA 1G3IA 2WHPB 1U02A 3U4AA 1DWQA 2GK4A 3FOCA 1ZA2A 2PHFA 5GM2A 3WJAA 1M2OA 1AZLA 3LFIA 1DOHA 4YEDA 4TKMA 3Q7IA 1JYVA 3F2ZA 3SEAA 3FLAA 2JNWA 3GBSA 1COV3 3BDAA 1FRZA 4G26A 2YXLA 4UMDA 2GA9A 4GXTA 3H0CA 1O5OA 1UZMA 2XQKA 5TMPA 3U3DA 5B53A 4BA6A 3PRJA 2WO2A 3N70A 1AC5A 1I6LA 6LDHA 1XBFA 1OCEA 5DNYB 5CEHA 4MGIR 2WV9A 4D79A 5BWCA 4FDMA 2GZRA 2Y4NA 2G9RA 2CFIA 1S4CA 1LF5A 3ICVA 1NUTA 1O0SA 4PAQA 2X5XA 4BK5A 4RQPC 4GPTA 5F4ZA 3T35A 4D4KA 1Z7S2 1BK1A 3UCFA 3OZDA 3WAKA 3DLHA 1DQYA 3OUZA 2HXYA 2F9LA 4TSKA 4QXRA 3J81k 1UZUA 1DDLA 3CVWA 2QQ5A 3GJYA 4EQ6B 2BBSA 3B01A 3V7NA 1JT9A 1RQNA 1W0KD 3UKVA 1P60A 4C05A 2DJIA 1P1JA 1IPJA 4CUAA 2EJBA 3KV3O 3KCXA 3KSBC 1XXLA 4BLTA 4S0XA 9LDTA 3AESB 2A1IA 1KL7A 3QX8A 5CFMA 5ICSA 4XW3A 4YRCA 3LU1A 5JUWA 1USWA 4ABTA 2W6JA 4H17A 1YMUA 3C3JA 3UK9A 2XWPA 3J8F3 2R8EA 5FJHA 2XNSA 1U12A 3H65A 4F84A 1YR6A 1NDHA 4POAA 4AN4A 4X60A 4M7PA 2FWMX 4L3VA 4R41A 1G20B 4MH0E 1SG3A 2CMHA 2ZQ5A 3V4RA 1R083 3M3OA 3RVNA 5IJ9A 3L7YA 1SIBE 1ZVMA 3WNDA 4N82A 1Z5PA 1G3RA 1OF1A 1B8NA 3DE2X 5CKNA 2M6KA 3PURA 4QLAA 2FI1A 3ILFA 4NJMA 2V4UA 1PM7A 1YA4A 1CV2A 1NY6A 3USSA 3HUUA 4GKYA 1E92A 3WMEA 1F38A 4ND2A 1MS5A 2O8BB 4L8YA 4TT3A 1NKGA 2ONZA 3NDIA 3IE1A 1OXTA 3P27A 3RAEC 4QU1A 4Z4IA 2FSVC 4IHAA 1ESZA 4UBJA 4WW0A 5D21A 5F73A 4J49A 1Y8CA 1WL8A 2G36A 2XB4A 3VR3D 1B0ZA 4GVXA 2D6NA 2Q8OA 3NBYC 4XARA 3ET5A 3W4JA 2W8BB 3M6IA 4AJLA 5A2GA 2IW1A 3MZ0A 1EJBA 5A1FA 3WNLA 1RCUA 3KT0A 5IJ0A 1TAQA 3FYUA 4HGRA 1LS6A 5UKDA 2WJGA 4PGAA 1WMBA 2VKQA 5KOJB 3CRVA 2YN0A 1POV1 3T61A 4U2BA 3UKJA 4HEA1 4CT0A 1H93A 5A4DA 3GX1A 5TGDA 4JJ8A 4NCNA 1M2VA 2J0SA 3N7MA 5REQA 3ZY4A 4Z3DA 5ALUA 4Y1ZA 3VSEA 5CT8A 2J6IA 3TR6A 1PYDA 4EA7A 3OEHD 4QUIA 5T4EA 4HC4A 2HA3A 5EHZA 1DE0A 3MGAA 4FDVA 3PEYA 1JUIA 3BZWA 4X65B 3FZ3A 3IS3A 5FYDA 4HX5A 1BXGA 3GGCA 2IBTA 1R4NA 3AM5A 4G8JA 1QF7A 3SJAA 1Z0SA 3G89A 1QXJA 2V0NA 3L02A 4Y6RA 1ENRA 1AZDA 3CSSA 2WU4A 3UGKA 2QN8A 4M1ZA 4JX9A 1SUDA 4DEVA 5A71A 3W6NA 1Y63A 4OQ4A 1CB0A 1TVMA 3IQHX 4FGLA 4QPJC 1M6VB 1XCLA 5CHYA 1MTZA 4J3JA 4HQ0A 4RS5B 3FDZA 4OSPA 3V5NA 2XYQA 3GZNA 3SYRA 4YAIA 1TJ5A 3ORYA 5CDUA 1M74A 1UJ6A 1KDKA 2Q1WA 3NWOA 2WT1A 2AFHA 2ZDGA 3RHZA 4YHBA 3HC7A 3CEWA 5F6KA 3PU6A 2BFNA 4KO3S 3QMWA 4EJFA 1VG8A 4PYLA 3S5QA 4OX9B 3DVAB 5IU6A 1TEZA 2HBRA 2OGTA 3MGGA 1D9XA 4FMCB 2ZGTA 4B3HA 4MAMA 2NUBA 2O8VA 1CS4C 1XQWA 4YPJA 4HLCA 3TEJA 4DR3B 2LV8A 3WNVA 2W6ID 1V6IA 2JGFA 1X7YB 4RKQA 1DQ1A 3VO1A 1PT9A 5KNCH 3H4TA 2WYHA 4EYUA 3TSAA 1IMJA 1ULTA 3HM2A 3G2HA 1F5NA 4RJIA 6AT1A 1CUJA 5GM1A 1MVNA 2RS31 4Y6PA 3KYCA 2ET7A 1ATIA 3ZLUA 1MVEA 1XYOA 4FXKB 1JU4A 2WKQA 3AIMA 3BE5A 1HWYA 1EU1A 3P2JA 1XZDA 3V2HA 3N0RA 3PQ6A 2W48A 3VBRC 1JSXA 3AHFA 1W35A 2CFTA 2FPPA 4P34A 3IAPA 3GZTB 4C8DA 1JLRA 4DUVA 2D2FA 4R6XA 4XASA 4G4SP 5LA1A 4GH4A 2CUKA 3A05A 1C8KA 2H0BA 4C3OB 1GV9A 3DF0A 5DWVA 4ZU6X 2C78A 4K3UA 2Q1TA 3SX4A 3EDRA 3WKBA 1F2VA 3BA6A 3U4QA 2H7XA 3AEUB 3WWPA 3UQZA 1Y34E 3DOHA 2VTXA 1IOAA 4EKEA 1UWCA 4XGQA 1D6NA 5IXSA 2IP4A 4A8JC 3JCIA 3TGPA 5LP6A 2AQIA 3AJYA 1EFVA 1DAKA 3KXIA 3HWWA 4J1XA 4RZSA 2I6TA 1LDBA 2E7AA 4CLDA 10MHA 1SH7A 4L73A 4OK5A 4LBVA 1W85A 2XH8A 2F90A 1Z2PX 5IK2A 3O5AA 4OUSA 1USIA 3EC7A 2ZRPA 3V8NA 1LRJA 5LPNA 3SNMA 3Q9UA 3TINA 1ND3C 1E62A 3ACIA 3C48A 1QQTA 4ESOA 1SVLA 3SISA 5JS2A 3ZYRA 3CLTC 4BZZA 3JQAA 1XSQA 3L1VA 1YQCA 5ALPA 3RC1A 2RONA 2Z4SA 3WG1A 2VOTA 3P4UA 4B40A 2FOXA 5FRDA 4PC6A 2P4SA 1QF3A 3KF5A 1Z4MA 1UM8A 4B3CA 4RWZA 4KQMA 1XRMA 3W2IA 5ICCA 3I62A 1OPRA 1RJ7A 2XJVA 1Y5LA 3I3MA 3CB4A 4N9QA 3VR0A 2XUGA 1W75A 1GL6A 4EGFA 2VNVA 2VP2A 2RHTA 4PAMA 2EQAA 3V0BB 1E1CA 4A6EA 5AJUA 1LJLA 1LSUA 4YAEA 5DI3A 3F95A 5ALWA 3EBPA 5EZQA 3MRVA 1RMU2 3HVDA 4NARA 3VSCA 2PVSA 2A7AA 3WYAA 4ZCSA 4K6BA 4KV9A 2GMEA 3KFVA 3WYGA 4KGZA 3R0RA 3ELUA 5G1NA 3IOBA 1TQDA 4Q4JB 1LBQA 2E5FA 2DVGA 1EGVB 5TF4A 2GBGA 4CEJA 1VBFA 1TZKA 1CX1A 2RKWA 1ZBE2 1ZOSA 4NIHA 1SPXA 4KU7A 5IF9A 5JNUA 4OQQA 3PXGA 4YT4A 3LHSA 2I54A 3HKEB 1ONAA 2EFJA 2BTQA 1Q0PA 4IV3B 4O02B 3KTFA 2P6HA 1DZQA 3TTWA 2O0JA 1TK2A 3AETA 2R8XA 3OM9A 2Q62A 4COUA 5A5EA 1YONA 1PMJX 1ISFA 4WLUA 1KQ3A 3MCUA 1THMA 1TEHA 4ZPIA 1M8PA 1K0UA 1D5CA 5ADWA 3V4FA 3K0FA 1UPTA 3O8DA 1S1CA 2Z8XA 4KVFA 1FP2A 4YMLA 4M3CB 4PX3A 3TZHA 4C76A 3LWCA 3D02A 3H2SA 3IELA 5FNZA 4XUPA 2D3WA 2Q0HA 5DF1A 3VDCA 2FOIA 3ROPA 2MEV3 1OFNA 2JK1A 1CRWG 3PTRB 1YLLA 3P96A 1XTRA 2H16A 2JI7A 3RB8A 5K7PA 3D1JA 1GIAA 1WS6A 1MMFB 3GHNA 1E7YA 2JW5A 1RD4A 4RVGA 2QPLA 2Q7OE 3IHWA 2UZAA 4F6RA 5FPPA 1M33A 3O1OA 1P9WA 3N2LA 3TFOA 2ERCA 5AC93 2XMCA 2H48A 3L4KA 4PCLA 3QU9A 3N2KB 4EL5A 1V5EA 1O6ZA 4UOZA 3QUTA 2PRSA 4MWZA 3PHJA 5A6VA 1QGOA 3BCHA 4IS2A 4R2LA 1WOMA 3A6ZA 5GGXA 1YEWA 3PJEA 3PFWO 4JIMA 2LROA 4RLFA 2G72A 1FYUA 3OAAD 1JYFA 1XD8A 4V1CB 4HWTA 1G64A 3ND5A 3O14A 1P8JA 3LA3A 2MYPA 2BSXA 4JB0A 2TUNA 1N1YA 3B1ZA 4G4GA 5LYJB 2YWRA 1LBTA 1RQ2A 4ZAXA 3NWJA 3F5QA 1LOCA 1OBVA 3HI4A 3IAS6 4TMTA 3H9BA 4LC0A 1X94A 1HV1A 1WKCA 3IO3A 4I9NA 3H4MA 4Z4QA 1F6DA 2VF8A 3KLNA 1XT6A 1QHFA 4D9HA 1ZJZA 4D7TA 1VBMA 4JUDX 2CEAA 4CEJB 3T0FA 4DQDA 2D62A 5K3AA 2PGJA 5HRCA 3SQXA 4QRIA 2QOEA 4GU5A 5A7WA 4IJ5A 1H42A 5FNVF 4HKOA 1FJHA 1E69A 3IP8A 4Z6KA 3L4JA 1DOAA 1JIXA 3PC6A 3J7AC 3AF6A 4HX2A 5LBUA 1V9LA 3IUJA 3CB2A 1UJMA 5D8DA 4DUGD 1ORIA 4ZJPA 2OMEA 2YVAA 1ZRMA 2JKBA 4BXOA 3Q9NA 1ZH2A 1ND3B 5SYMA 4CEWC 5K7SA 2EOAA 1Q95A 4EJMA 2BRUC 4HPJB 4RZ3A 2DFPA 3W5NA 4ZCQA 3NRUA 1CP3A 3G5AA 3OU2A 5LOVB 3FHJA 3JD71 4AY4A 2JLYA 1SFPA 4ZYYA 3ITDA 4PLMA 3F5SA 1BA2A 2VJKA 4L0CA 4GPAA 4PQEA 3NNJA 5CG9A 1N1GA 3RS6A 4WA8A 4J4TA 3OA2A 1T4MA 3H1FA 5EJ1B 3H4VA 4XJ9A 2OZVA 1W39A 1H9CA 5FZ0A 4QTTB 2XGSA 4R9UC 4CM4B 5DGCA 4WN3A 2FCRA 1Q7CA 4GPIB 1Z0HA 3P52A 4YT2A 1O9HA 1HDIA 1OPXA 2EJTA 5LBEA 3ORSA 2PIAA 4AVCA 4YCBA 4CA9A 3N2YA 5BVGA 2IHNA 4C90A 4AYTA 1U3DA 3AI7A 3MUNA 5EQFA 3SFZA 2IXBA 5GONB 4JI2B 1ZEJA 2O07A 3OM0A 2VK1A 3TEWA 3IC5A 4JDUA 4ZZ1A 2B9UA 4XAQA 4DSNA 4JLSA 2GJ8A 3RRXA 2O5EA 1YOVB 4ASMB 2GUWA 1OZAA 3EGOA 3UFXA 4YVWC 2K6GA 5ARDA 1GGMA 4IMRA 1OI3A 2ISQA 1XDGA 1UL9A 3RYTC 3AHDA 2KA3A 1U81A 2J9FB 5ENDA 3UJBA 4YRAA 1DT5A 4LPKA 3H1WA 1MFZA 1KVSA 4K20A 1ZP6A 3TMYA 2K0GA 3FVVA 3CONA 5FPBA 4QOGA 4IO0A 2D3PA 1I4DD 2CXHA 3A36A 3E3LA 4JX8A 4HKWA 3THYA 2EJVA 4M9ZA 3ZCTA 3R24A 2PWPA 2FLKA 1C3OA 5MGBA 4NU6A 5ECWA 1ZMBA 5BQXA 2ZAIA 3L9WA 1KHHA 2UVPB 4US1R 2FR0A 2X5KO 2R7NA 4R51A 1N2XA 4P32A 4YYZA 1PQPA 4DIUA 1G5TA 2ZBUA 1UBCA 4B83A 1JBQA 5JAOA 4M1EA 1ZU5A 1IN5A 1UODA 2X8BA 3MIHA 2BOIA 4PPQA 2C4VA 3V9PA 4PQRA 1P3JA 5IW0A 1C2YA 3REQB 3LEIA 1U1GA 4IUDS 4TVOA 1CPMA 3BS4A 2LE0A 2OSVA 4BU1A 3ZVNA 4N0DA 1AHHA 5FYTA 4AKGA 2WWWA 3N87A 1I36A 1JZ6A 3RZMA 2CDOA 4A2UA 1M1YE 3THRA 5FDFA 5JHGB 3AW9A 3WLNA 2RGCA 2ZZMA 4C6TA 3ZUGA 1V7PC 2Q30A 2P2YA 1OKQA 1KO8A 4ASKA 2QFEA 3MUY1 1LCIA 2XEDA 2CLMB 4B3DA 1Z4LA 3MVEA 5E6SB 4EHHA 4FPFA 4ZQGA 1RHMA 2FB9A 4RK6A 5IKMA 2NTNA 3TYJA 2O8DA 1AHPA 4N43A 3KVYA 1YZ3A 1ECFA 3MF6A 3R5KA 5BSFA 3EVDA 1BXRB 3AUSA 3F67A 1DJMA 3NHUA 1N2EA 2BHRA 4JXXA 3H2IA 2JGLA 1Y9GA 3VD5A 3LA6A 5KNDD 5AXDA 5BVHA 3HB4X 3KEQA 4PBRA 3OQJA 4US0R 4TTQA 3JARA 4RO0A 3PNSA 4MVXA 3L92A 2X7XA 4OVKA 2IH2A 2NQ8A 2HXGA 3D4OA 2ZWVA 4AECA 1SZBA 3MTGA 3ZIAA 4OXIA 3AZXA 2FUG1 3RUPA 1GADO 1VGRA 4PGGA 3VH2A 3TEFA 4MV3A 3DG9A 1I2CA 2O48X 3A7QA 5CFRA 3E5NA 4CEWB 3NJ8A 4A1OA 4OHVA 4L78A 4Z92B 1TMF3 5BOVA 4G1EB 2ACVA 3NC0C 4V2UA 4ICIA 4G8CA 2AN3A 5E7JA 1DEAA 4ZQBA 3ZKUA 2B8EA 2GK6A 5IVPA 4UVEA 5CH5A 2DSTA 4A26A 3BMQA 2VQEB 1I7NA 3HU1A 4D0LB 4OHFA 3RUDA 1QIDA 4S0ZA 4DM4A 2XRFA 4TQ9A 4K9OA 1G6Q1 1B8UA 3AHGA 4XCXA 5LA6A 1WUKS 1V9SA 5HMMA 3TLKA 1MEOA 4ISBA 4MV9A 1V0JA 5EIWA 5E95A 4HBNA 1Y89A 2WYWA 3IEKA 5HGJA 1FCJA 2HJHA 2WPDA 4Y0AA 4G07A 4KHZA 1YXMA 4EYSA 4W5HA 1KI1A 1RKBA 2G08A 1XQNA 1CDDA 4M1SA 1AYN2 4YLGA 1Y5NA 4J6GA 1EQ2A 2K2WA 2A3YA 1HXS3 3DPRB 4RGBA 5IM5A 4ZVUA 1ZGCA 2ZHKA 1MRZA 4LBKA 4ZAYA 4DUZB 1WHSA 5I4CA 3GV0A 2COUA 1TJNA 1O4VA 2JI8A 3HVJA 2OXIA 2Y77A 3CBNA 3P5BA 3ZLTA 5F1YA 1NF3A 3HZRA 4TSVA 2VS1A 2FKNA 2JGEA 3KWVA 3ADPA 1NMEA 3IBCA 2ZJYA 3ZY6A 4FYVA 1RIRA 1BH6A 4NAHA 4G0QA 2HLPA 3IKVA 4YUZA 1XRJA 3DPUA 2AQ8A 1NJSA 5A7WB 2QRVA 4WLEA 4ONEA 1C1FA 1VR3A 2JG3A 1KQRA 4IGFA 3GDHA 1I5EA 1TIPA 4HEHA 1K6JA 3EVZA 2VHUA 3BBPA 1UKAA 3D6JA 1NUAA 2XJQA 3PFBA 3SICE 1BCSA 3EGDA 4FUQA 4TUYA 3G5LA 3QOPA 1E5XA 2VW0A 1K7SN 4YNBA 1E3QA 2QE3A 3A25A 3LX4A 4CLHA 2NSYA 3MMNA 5TVKA 2XDAA 4QT4A 1J5XA 4YGCA 4DINB 2BEWB 3O12A 3Q5DA 2RAUA 2HF8A 5A3NA 3LKBA 3TIVA 1JZSA 1POQA 2BDEA 1B09A 4NE7A 2VZQA 4G1UC 1R12A 1W88A 5JATA 1ODKA 2QI9F 1A97A 4A44A 2VZUA 5JPCA 3DEFA 3ZPOA 3QENA 3GJXC 4UFJA 2H11A 4HETA 1A50B 4XJ8A 1P0MA 4P9XA 1X1BA 1LR5A 4XM2A 4A73A 3AQ4A 1QYWA 2PZJA 5EE5B 3AVXA 3AHHA 2DM6A 4G9BA 4BUCA 4RULA 1EDBA 2GZDA 5AXAA 3ZXFA 3DDOA 4XJWA 3K6SB 2DWQA 3L7NA 5K0UB 3A6GA 5EGSA 1BN7A 2PX8A 3ZGZA 4BCCA 3T7DA 1CR6A 1QDLB 2FPRA 3PUAA 2FZCA 3VKVA 4IE0A 1LVGA 4HN0A 1J1UA 5J40A 2WIDA 2Z08A 3R7FA 4D46A 1J06A 4X7PA 4WM7C 2GJ4A 1R8QA 2P6UA 3I1FA 3LWZA 3A0RB 1J2YA 4AIIA 3EWNA 2PVCA 2BQPA 2EYQA 3SEQA 3UBTA 1JFTA 4R2JA 1V5WA 2A4MA 2ATXA 1U7OA 4PGHA 1SU4A 2RHGB 2V0GA 3N9MA 3NHSA 3B6IA 4KDFA 3DD5A 1FFXA 4EB0A 2ZB2A 2PCLA 3VKLA 1ZK3A 4BCUA 4YW3A 4M76B 5I9IA 4JP1A 3QE3A 3FE2A 3L0SA 2NUTA 1FE8A 2WJAA 4M0PA 1TQ6A 2XLAA 4XA8A 3K4ZA 3GMSA 4LFAB 4GSYA 2QD3A 1WLCA 2ASVA 2EF6A 1GVHA 1ZVFA 3LH5A 2FG5A 1JHPA 1T1GA 4Z1MA 2WJZB 3TPFA 5EZ6B 4AVAA 5IFPA 5KJCA 1KC1A 5D8AB 2XIQA 4QDUA 2NMVA 3KWJA 4ZCLA 4ROTA 3OICA 4QQNA 1JZ7A 2OUKA 1N7HA 4TN7A 4Z0NA 3N9IA 1XNCA 5LYJA 1XDUA 5LCXA 3PQFA 1DC3A 3BK7A 5D3ZA 2F4LA 4JITA 2EDCA 2Q5CA 3CQOA 1WX1A 1S2KA 2WWFA 2IP2A 4RC9A 1D0IA 3MYYA 3C1AA 3CVVA 1SBFA 4FE4A 1FY2A 1UC4B 2GEJA 3L40A 2ZRQA 5F2SA 4HFNA 1O5TA 1WCSA 2C7QA 1MS0A 4DLBA 3Q8FA 1JZ4A 4Z8BA 1P0PA 3C3EA 3R5JA 4ENTA 1UMBA 5EPAA 3AP6A 3O4RA 4Q9IA 5HCNA 5JZVA 4ATEA 4YRGA 3DVSX 2FEPA 5CA0A 3BMNA 5LM3A 1UM9B 1A9TA 5F7OA 1F2UB 3PWZA 3I3QA 1I9GA 4DS0A 1JV2B 3WGOA 4JI1B 2E6KA 3HUDA 1D2NA 1RKVA 2O8BA 1EB8A 4KN6A 4BKQA 4XUQA 4AC9A 3VPFA 3WK5A 1NLUA 1P74A 4KJXA 3IAFA 4P0PB 1TXGA 4F4HA 1YKSA 1NW8A 4IHJB 3KJZA 4HNAB 2AZXA 4DV1B 2FHRA 1QJEA 3OY8B 2BEVA 4RYLA 4FSXA 2PPLA 3X29B 1QWSA 1JH5A 5E6UA 4F9EA 4BOWA 2Q9BA 5EKSA 1A5AB 5E7MA 1SPPB 2ZKIA 1Y43B 4TM7A 4RYDA 4BLUA 4MGSA 2Y6GA 2WLTA 1ODNA 1U7PA 3BB3A 1VMKA 2C3MA 4H7FA 5JZSA 4GKKB 4E22A 1I01A 1JHAA 2D6PA 3JQ8B 2D74A 1Z45A 2IEGA 2F3UA 4N53B 3GGOA 2QTFA 4AUKA 4KKXB 4A5OA 3TBDA 2XOEA 3KOUA 2I4MA 1GA4A 1GDDA 3Q1LA 5F3DA 1BMDA 1IS6A 1G8WA 1XD2B 2DE0X 2XDQB 5EP9A 3ZFFA 1CZVA 4DPKA 4X8NA 5FZHA 1OTHA 1AR93 3RFVA 3WQRA 3NT2A 4QJIA 4MDYA 4YACA 4B7UA 1FXWF 5A1LA 1S3GA 4EEZA 4KQ6A 3MHTA 2X0RA 5L9VA 4BQ5A 1FYWA 3GYBA 4BJ1A 1J0CA 3HEAA 3UA3A 4EKYA 1GLVA 4EPRA 4JC8A 2C2OA 5F5QA 2NZ8A 4EO7A 4GHWA 4CTNA 5LQMA 3VUEA 3JB4C 4WXMA 4F3YA 2CFSA 2VQAA 1QNFA 4XLLA 4ODIA 2D5HA 3I3DA 3MPBA 3HVKA 2YINC 3PHCA 4EAAA 1HORA 2Y1FA 4E0BA 1XU9A 1RLTA 2UWCA 2C2XA 3OBBA 2AI1A 5JC1A 4JGZA 1S7CA 3WP4A 1NW9B 2XUQA 1QDCA 1A9ZA 2UVPA 3M83A 2GZWA 1KVTA 2V74B 3B69A 2QX8A 4NULA 2UYAA 3H6HA 4PLGA 1R0LA 3K05A 1OA0A 2CGEA 5EIHA 2JD9A 5DSXA 5EZSA 1GFWA 4MCJA 5IH7A 4QASA 2QM7A 3DWEX 4D3YA 3GO4A 4O4JA 4BDVB 4B4OA 5DMXA 2ONYA 1WDLA 2Y1OA 1G7YA 2ZBGA 2ERXA 5ISMA 1CT9A 4RY8A 4MXWA 4U6QA 3Q8MA 3CE9A 2YGLA 4AFAA 4QAJA 2OD7A 1IHOA 4GRAA 5L3QB 4XQEA 1OB5A 3DMTA 1D0SA 1ZNYA 4I5DA 2X6TA 2ZGOA 4CLRA 1KDOA 4BXFA 1HJGA 2XYVA 2BFBB 4G2TA 3T08A 4K8FA 4BV3A 4E5NA 4EPWA 5B2EA 2YYAA 5FYQA 4AHXA 3PQ8A 3PFCA 2YY1A 4YCMA 4CG0A 1U0GA 4XMAA 4JHXA 4FFFA 1CY6A 3WIEA 5CGZA 1O6GA 2FQ1A 3I9NA 5U9CA 1XA4A 1Q3TA 2DBRA 1MEC1 4FOOA 1AUXA 4HS4A 2JH9A 1M2EA 1RUD1 2V73A 3DWGA 5JD4A 2NXNA 1UIJA 4D7YA 2GDZA 4M1QA 1E6KA 1ML4A 1TVEA 4TTJA 1J9GA 4CM3A 2F64A 3ZLVA 1PO13 2W1WA 3GNTA 3ZR5A 3CGWA 1U65A 2AK3A 5JZMA 1DHRA 5TPZA 3SHWA 4LYJA 1HQDA 4CXMA 1RHQA 5FNVB 4XDYA 2QN2A 3LX6A 2D8MA 3RVSA 2PHTA 2VT6A 4NMXB 3AEZA 1MHPA 4OQMA 2Y6KA 4C30A 1KEEA 4EB6A 2QJOA 1WMDA 2EBUA 2GA8A 2AQKA 1HT2E 3RARA 2QBYB 3C15C 4H4CA 2AHRA 4BU0A 4X8HA 5MN5A 3ABIA 1FS6A 1XU4A 1N2HA 1AQJA 4EWAA 4Q05A 2AN5A 1PGOA 3ZFEA 4I09A 1RR6A 1U8ZA 3B7GA 3HO6A 3OBIA 1RU3A 4Y22A 1T2DA 3A9WA 1W3XA 3GT0A 3QXXA 3PUJA 4EKNB 4XGRA 1X8KA 2LWIA 4JVSB 1TKRA 1U0NA 3TDNA 4V3BA 2MJLA 4N43C 1IVSA 2JD2A 1BXGB 4TKUA 4S1OA 4MGYE 3TQIA 2GGSA 1QRAA 5HUQA 2HWB2 4TMWA 4OLHA 5EHNA 5KHOC 1DXOA 4D0SA 3DBIA 1LI4A 3L6UA 1UPSA 3NKVA 1LTQA 4P7GA 3NNFA 2CHHA 1VKZA 2GO7A 2QDXA 3GQBA 5G0TA 3UY4A 2YN4A 4ZI7F 5J09A 4DWOA 2YOFA 3RS4A 1SVMA 3BN6A 3I30X 1JZ2A 4L4UA 5YASA 4A92A 4E51A 1QTQA 2SHKA 1B8OA 4TZ0A 1PX0A 2VSQA 4RPIA 4Q16A 4O4IF 2Z3VA 2OHVA 3R09A 3C5WP 5GZEA 1J7JA 4GD3Q 3ESRA 4HPWA 1QWOA 4PZ0A 1JQAA 2WD8A 5KC5A 2JZOA 2Z6VA 3DT8A 3ANLA 1YS2X 2QRGA 4YB8A 3QKSB 2W2LD 5M3BA 4PFJA 5JD3A 1QG4A 2MSLA 1OAOA 5A7FA 2YV4A 3IIEA 4J1TA 4DC1A 3BEOA 4MZXA 5FPLA 1T4CA 3CW9A 1C3EA 4JGYC 5IK4A 3FMPB 3LQRA 3GROA 2B30A 5K0LA 3TRKA 5C1PA 1O3RA 1T1EA 4RK7A 5JJKA 4HLUC 2ZT5A 1M5TA 1KZYC 5SZKB 2ZBRA 3IDBB 4U5XA 2G9FA 3QPDA 2IV7A 1BHQ1 3O38A 2Y0DA 1WVMA 1U2GA 2R8ZA 3HYCA 3LGXA 2GPTA 4J25A 1TKAA 1VBNA 1I7LA 2VL7A 1CYEA 1IHXA 1PG0A 3H1BA 4B48A 4B6GA 3PQ7A 5IYZF 4ILKA 1W94A 4YP6A 3JXEA 2NVUA 2J1AA 4URZR 1VL8A 5HTKA 2AMJA 2TMKA 5TIIA 2V09A 1FV2A 2UZ0A 4IEXA 1RP1A 2NU8B 2HNKA 3LY7A 3BFKA 4Z7NB 3U7RA 2VJOA 2Q6VA 2BFCA 4MR9A 3ASUA 1J84A 4DYVA 1OX4A 2Z04A 4RJJA 4PG6A 3HKCA 1DBVO 2H1CA 1TKBA 3A70A 2ZTMA 1TQ4A 4GUAA 4MHRA 1DIRA 4RHV2 2TYSB 3EAQA 3OFSA 1K4MA 2RMU2 2J30A 1NVVR 4K1LA 1OH6A 5B2GB 3DKWA 3DFZA 1E66A 3MJRA 3D81A 3NBXX 2FWPA 1QF9A 5DHAA 4ZU1X 1EG7A 4C7BA 4CF7A 3JQRA 2R6QA 4BVBA 3FWEA 1BHSA 4D6SA 4XIIA 2I4IA 2TECE 2K87A 3FYHA 1NXTA 3FNQA 2W0SA 4GRIA 3S0JA 1LPSA 3V0AB 4WLFA 3KUCA 5I7UA 2VE1A 3E3MA 4DA6A 1F8GA 2X15A 1CJDA 1C4KA 1PNRA 2W47A 3K31A 4B74A 5JSZB 4O4IA 3PF9A 2GCPA 4WI1A 4PNHA 2J1VA 3RZJA 4O3FA 3SM3A 3FWKA 3WWEA 1H8VA 1G98A 2PV0A 4PE5B 3L9JT 4BNTA 4L8VA 3ND6A 5J4VA 2C26A 4DNPA 3L0PA 1W30A 2P3SA 4OQYA 3O0XA 4P81A 4EHBA 3TAYA 3PQ2A 4K6KA 5DYYA 4QM9A 3D3WA 4BO7A 3AHIA 3OTGA 2P11A 4RVUA 3C7AA 3HNPA 2WSBA 4FGUA 2JD1A 5I9MA 1XKTA 3W90A 1IJFA 3JQGB 4B76A 5L3VA 3OZ7A 2E9QA 1AD2A 3UM9A 2G5TA 5DZSA 4A5SA 1DADA 3BYWA 2IS1A 4ID3A 1L8QA 3B12A 2F1KA 3NNNA 3GM8A 4CXYA 1KPHA 1A9PA 3LBFA 3KKOA 4CP1A 1P75A 3TLXA 2XZOA 3W5CA 3POYA 4YNIA 1AZWA 5IRCD 4YRSA 2FZ1A 3E9QA 5TS3A 3U61B 1Z0DA 1LOAA 1MF7A 4CMHA 2XBUA 1E8MA 3O1UA 1R0CA 2VO5A 2XE7A 5EIOA 4RMNA 1NVKA 1FTSA 2GRUA 2H1RA 2X6RA 1DRJA 2QRVB 1SCUA 5C4WA 3KQOA 2W42A 4I0BA 4P3XA 3JQ7B 4C0HA 4MVJE 1E1QA 3QFHA 5T5JA 1N25A 4L6IA 1JDZA 5IVDA 5ALYA 1FNDA 4YP7A 4MA0A 2R1TB 3QQPA 2GAUA 1AG9A 3DFUA 3AILA 4A0SA 1GR3A 5HBRA 2CVPA 4QPYA 2DBNA 1DRKA 1BEEA 3COJA 1H8EA 4J8PA 1KETA 4L2NA 4HANA 4PIVA 1Q3KA 4UTVA 3M5WA 1L3IA 1Y4UA 1UZZA 2IHZA 2NWQA 4DXZA 2VH2A 3DL7A 1ENXA 5F2OA 2X14A 4R6WA 1MGPA 4YVFA 2BGWA 3AIOA 2WO3A 3FH0A 3AUKA 2J5XA 1KYTA 1XLUA 3KPUA 2TEPA 5G02A 1G6HA 2GLTA 3ELNA 2VZRA 4PJYA 4IDOA 1YHFA 3DEHA 3C4QA 1NQ5A 5AM5A 2RDNA 2B35A 4KDEA 3H83A 3UJ8A 4QNMA 2CLCX 1UU5A 2IX9A 3WSOA 3PF8A 4W82A 2IYNA 3MIDA 1SUSA 2ZJ2A 4EFLA 3E84A 3P71T 3IE0A 3ND9A 1UBLS 3CLKA 5JU6A 1G9XA 4TRMA 1Q12A 3KTDA 5JH7B 3OGGA 4EG5A 3PE6A 1AQNA 3GRZA 2JC3A 4HONA 1BWQA 1LBSA 2MINA 2YHAA 4PZAA 1MZ5A 1P5RA 3L7IA 2JFUA 4BQSA 1WUVA 1U2PA 4BVJA 3UMBA 3ZBQA 1XVTA 3KHBA 5KKAA 2FZ5A 1SELA 2C5SA 4MQEA 4PZEA 1Y9DA 3UEOA 5CMLA 1Y8RB 3CZ5A 4RHCA 2WFAA 3VLBB 4GOMD 3U40A 4ITUA 4GGMX 2P2GA 4ZI7B 2CNWA 1TF2A 1Y7BA 3VDRA 5CKMA 1ZW6A 1YI7A 2ZPTX 4EFMA 3WTBA 3D3NA 5FY9A 2HU2A 1IRXA 4AS2A 2R043 4N39A 4O2BA 1O9BA 2IYWA 2ZWOA 3TBKA 5D6NA 1FFBA 1R18A 3A6LA 5JAIA 1JKJA 3NHJA 2HMTA 5TS2A 4QPPA 1PE0A 4I46A 3C7DB 4BE4A 3AH8A 4FFBA 2DQ4A 4G0MA 1G6NA 2JCVA 2JDHA 1FFHA 2RHMA 1ENPA 3TK1A 2HJSA 4YR9A 4DCPA 4OFGA 1B41A 5I93A 1G66A 1ETHA 1R4NB 1U9ZA 2FMTA 3JD3A 4O0MA 1GLGA 5FI1B 2ZZNA 5JFTA 3OMLA 3FI0A 5CBLA 1HDEA 3JQWA 3EXEA 4EIWA 4G84A 5FZ8A 2H57A 2OBYA 2YV2A 2EFEB 2HWYA 2Q2VA 1UMDA 2DCJA 1NBWB 1ESEA 4I6GA 3AGQA 4D94A 3PNLA 5EXEA 4UZFA 4YMTA 4ZOBA 1Y33E 4UBMA 1FPN2 3FDFA 1H0BA 2ZM5A 2WHEA 1MQAA 3QBJA 3H5VA 4OYYA 4XQDA 4U7TB 4PAOA 3C6BA 2X3YA 3R4CA 4Z51A 5T4HA 4DM3A 3KJQA 1B23P 3K1JA 4IEQA 1GPKA 3OZSA 4Y98A 3IESA 1H8TA 1VA5A 1GGVA 2VZEA 2RIRA 1PO21 2JGAA 3UOGA 1T9BA 1HXS1 1MJGA 4UE6A 3AI3A 4YCAA 3FZGA 1L5GB 4XXHA 3DTTA 1YTUA 2EXJA 4JC4A 1MQTC 1U2DC 4CCLA 2VUHB 4U7GA 1W1UA 3EZ7A 1H4HA 5BVGB 5IVJA 3L5KA 1O91A 4QYSA 4H6WA 3EB7A 2DBIA 2VU9A 3H9JA 5E8RA 3ZHZA 8MHTA 3U3OA 3EYAA 4JA2A 1KJNA 3I9MA 8ABPA 2LTAA 3RBVA 3ZHRA 3C5HA 3VU1A 2J6BA 1S0DA 5BOSB 4PXYA 2JFXA 1FDVA 4ZHSA 2YVUA 2A3NA 1BJQA 3KV4A 4M83A 2XYPA 5EJAA 1WR8A 1ZXXA 2HDWA 4BFWA 1I3LA 3PEWA 1CUIA 1MS9A 2XJ4A 2VYNA 1YA8A 1HE2A 4EA8A 2ZVDA 3D2AA 3EIOA 1KI9A 4EG0A 3E8XA 1IN4A 3U4DA 3GG9A 4FWBA 5TQ2B 1SQGA 1RAFA 1ECLA 1E9SA 4M8KA 2O0MA 4FFPA 2V6FA 3AVUA 3BOSA 1PFVA 2HMAA 2ZVPX 3JVVA 1XMIA 3D8SA 4AQSA 3PI7A 5FY0A 5JECA 2WM2A 4YT8A 2IDZA 1LOFC 2YFKA 5KQLA 4IQGA 4D8MA 1XWIA 2Y6VA 4Z1OA 4Q3BA 5HJ2A 3PD7A 1AV6A 2EGGA 5LZ7A 1G5IA 4QOFA 3EIHA 1J5EB 2A9FA 3FYUB 4KWCA 3HPRA 2BIFA 4DZGA 5A1AA 1H2MA 4NXNB 5DNAA 4MJ3A 3F5MA 4GQAA 3AL6A 2EBWA 4YGBA 4CDRA 3VR2D 3OPYB 3MZHA 2MTBA 1F1BA 1EAMA 3GPIA 4IL5A 1Q0UA 1OYOA 1A0OA 4YTEA 1U90A 3ZSKA 1L9XA 3HFJA 4ZU7A 5DISB 3OF5A 5IVIA 1ZUD1 3TW0A 4EELA 3T6KA 4QRHA 1PJTA 1TECE 3DEYX 2JA1A 1CQ9A 5EXPA 2RE8A 2O7VA 3N2EA 2RI0A 5KAPA 3QKSA 4XDHA 2ZDHA 2X2FA 3V80A 1E5TA 2GKOA 2QUBA 3FFTA 4H16A 4LHZA 1QYCA 4NG5A 2H2FA 3KTAA 1AM4D 3R75A 2O2GA 3PDHA 1NJ5A 1FYXA 3R8XA 3QUCA 5C32A 1IM8A 4NUBA 3PV0A 3RTGA 4EGJA 5EZYB 5AKJA 4MWTA 4CEHA 1TCBA 1RXYA 3Q9OA 1WKVA 1GTZA 4UREA 2PSFA 5K8IA 3TAHA 3A28A 6PFKA 3C3AA 1C8NA 5FWYA 2A0WA 2GHRA 2VZOA 1ZZ6A 4UJ3A 2VOEA 3OCZA 1J97A 2I33A 3D6TB 2A6YA 4I99A 2Z4TA 2FEMA 1ULHA 4HKLA 2WTNA 3AZQA 1VB2A 5DDJ1 5T54A 1Q7BA 3EAGA 2VBIA 5KS2A 3VPDA 2CMDA 2WVGA 5TQ2A 5DXDA 5I8PA 1EI9A 1FT9A 1AL21 2FLWA 3GN2A 2VULA 5LBBA 2XGOA 2G1JA 3KQRA 3M1HA 2YOHA 2P0YA 3H8WA 1XQ6A 4D3SA 2J4CA 1W8DA 4CQMB 2DF8A 4PONA 5FOQA 4LHLA 4W7IA 3VDAA 3X1JA 4MWOA 3N7JA 1ZOPA 2DFDA 3ZWVA 3A0NA 3UB3A 4QBHA 3H2BA 3WB2A 4Q4W3 1T6NA 4TUYB 4BIMA 4EWEA 1YRQA 2F3SA 3ZWMA 1MQTB 4U0KA 3I1YA 4M9QA 4F8AA 1PVVA 4LYDA 3U19A 3JVIA 4D74A 1YAHA 5P21A 5K3BA 1YZKA 4WVVA 3ZFGC 3S6PA 1SMVA 2F8TA 1P33A 5CD9A 5JROA 3CH4B 2MWMA 4OMCA 4WDRA 1HX7A 1E2DA 4OXYA 4W8OA 4LO8A 1X13A 1WXHA 3N9QA 1AN9A 3QACA 4MB6A