2OPKA

Crystal structure of a putative mannose-6-phosphate isomerase (reut_a1446) from ralstonia eutropha jmp134 at 2.10 a resolution
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
110
structure length
110
Chain Sequence
MDPKHGNLFADVPVGAPDEIFQPLLERKGLKIERIISNGQASPPGFWYDSPQDEWVMVVSGSAGIECEGDTAPRVMRPGDWLHVPAHCRHRVAWTDGGEPTVWLAVHCDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Hypothetical protein
publication title Crystal structure of hypothetical protein (YP_295660.1) from Ralstonia eutropha JMP134 at 2.10 A resolution
rcsb
source organism Ralstonia eutropha
total genus 16
structure length 110
sequence length 110
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2opkA01
4I02A 4Q0QA 1ZZ9A 1EYBA 2K9ZA 2PFWA 4EWAA 3CL1A 4IEOA 1YFWA 1CAWA 4WVZA 2XHKA 3PNAA 2QNKA 5BUVA 3E6CC 4QX5A 1RTVA 2BYVE 2N7GA 4YYOA 3DL3A 3I54A 3ZDSA 5JR7B 1X82A 2ATFA 4KU7A 1YWKA 4KWJA 2UYAA 5BY5A 1GQHA 4FT8A 4MGYE 3BU7A 3ELNA 2PA7A 1VP6A 4MH0E 4LUMA 3MYXA 1CAVA 2Q30A 3LZZA 1EY2A 4KL1A 3RPQA 3SMHA 3CO2A 4AVAA 4IEWA 2OYZA 2CAUA 5FDBA 1ZNPA 1EP0A 5FPXA 2VPVA 3BB6A 2PQQA 4AXOA 4A2UA 5BPXA 2B5HA 1LR5A 1O5LA 3M70A 3UKVA 4UXAA 4MV2A 3ST7A 1IPJA 4QGMA 3E5UA 1CAUA 3U0ZA 2DCTA 4EROA 1ZZCA 2IXIA 1FXZA 4HVQA 2H6BA 3QOPA 4NVPA 3WW2A 4HVOA 4QXKA 4XETA 3H7JA 1X8MA 4PIYA 1Q43A 1Q5OA 3E5QA 4KU8A 2IXCA 4R8HA 2D5FA 5CU1A 1OI6A 3UKTA 1CX4A 2O1QA 5I91A 2GC2A 3PVBB 2OPKA 2WC2A 2IXLA 3U11A 4F8AA 2Q1ZB 2ZKLA 3SCGA 1SFNA 1DZTA 2PHLA 3G7DA 3IWZA 4LLOA 2CV6A 1J58A 3M3IA 1XE8A 1NE6A 4LEJA 4XFBA 1V70A 1CGPA 4I01A 3QACA 2EAAA 4UBGA 4XFGA 2QVSB 4B29A 2UY8A 2E9QA 1X8EA 5D1IA 4J1XA 3WW4A 2Q0AA 5JAXA 2PAMA 3H1WA 3RDIA 1XRUA 1CAWB 5KHGA 5FLHA 1SQ4A 3FZ3A 3B02A 3MPBA 1ZX5A 1ZRDA 1ZRFA 2QCSB 1O3SA 1YFUA 2BNOA 4JVAA 1X7NA 4FAGA 3RNSA 4E2SA 2FQPA 3O14A 2BGCA 4XF4A 4XFHA 3E5XA 1O5UA 2BNNA 3KCCA 5C6CA 2PHDA 3UKNA 1YFYA 1ZZBA 3DKWA 3H50A 4PJYA 1QXRA 4XF0A 5JSOA 3SCFA 2B8MA 5FQ0B 4P9GA 1UD1A 4HVRA 1CAVB 1OFNA 2Y0OA 4MUVA 1JUHA 2MHFA 1WLTA 4LA3A 4X6RB 4XFIA 1I6XA 4QGLA 5EZWA 3FFQA 4I2OA 2OA2A 5I8YA 3EBRA 1LB2A 2MPFA 3FX3A 3BCWA 1U12A 2IXJA 2XLGA 1O7FA 2XGXA 1Q3EA 1L3JA 3IIAA 5JSPA 3LA7A 4KWLA 1RGSA 3TNPB 1CAUB 2ETEA 2MNGA 3E6DA 1I5ZA 3CJXA 3H8UA 1RC6A 3IDBB 3ES1A 3HIFA 1NYWA 2GAUA 4F7ZA 5I93A 3H1MA 4YRDA 5J7MA 4AVCA 3EQEA 1LKNA 3U10A 2IXHA 1ZREA 4IEXA 1SEFA 4BH9A 4XEZA 4EV0A 5LEKA 5KHHA 5JCTA 2V09A 5KHIA 1J3PA 1WA4A 5I0UA 3H7YA 2GZWA 5I0TA 1J1LA 2KXLA 1QXJA 4MGZE 4IESA 4CYDA 5KHKA 3H3ZA 4QM9A 3BALA 4YARA 2Z69A 2D5HA 2XKOA 1DGRA 1NXMA 2XLAA 2GC1A 4HSJA 4HSLA 2GU9A 3FHIB 3EJKA 1YHFA 2Q4SA 2Z2SB 4ZU4A 4BHPA 1G6NA 4R52A 2HKXA 4JTOA 2GC0A 4MZUA 4WZCA 4UBHA 3R6SA 1RUNA 3EHKA 4E2QA 3HQXA 5I0RA 4LUKA 2XKPA 5C8WA 3S0MA 2IXKA 3I59B 4LTAA 1H1IA 1ZZ8A 4BIFA 1J59A 2PTMA 4IEZA 3KGLA 4HBNA 3I7DA 3OGJA 4H7LA 4GULA 5CVRA 4DINB 1RUOA 3MDPA 4ZU7A 4HMZA 4AVBA 1DGWA 1H1MA 2BNMA 3KMHA 2CAVA 4PIZA 2H0VA 5EFUA 4Q0PA 1UW8A 2EA7A 4XFFA 3CLPA 3USSA 4EWEA 3LOIA 4L2NA 2XL7A 2UYBA 2B9UA 4D7TA 5AVPA 2WFPA 3D0SA 1YFXA 4QMAA 4X6QB 2PAKA 4O9EA 3NKTA 5I0SA 2VQAA 3KGZA 3MZHA 2EVXA 5FLIA 3TNQA 4I0AA 1IPKA 4Q0VA 3VHRA 2XLFA 3RZZA 1O3TA 5I8TA 4I0BA 4WBBA 3L2HA 4D7SA 2I45A 3OTFA 2ET1A 2IC1A 2H6CA 4XF1A 1CAXA 4XFAA 2D40A 1QY4A 1FT9A 3EO6A 4JV4A 5LEJA 4J1WA 3FJSA 3SCHA 3IDCB 4MGKE 3OCPA 5E1RA 2UY9A 1XE7A 3SXWA 4Q0SA 3FWEA 4IEVA 5T3NA 1Y3TA 5CADA 4KWKA 4I3PA 4Q0UA 4N9IA 3S7EA 4HLTA 4ZU5A 3DV8A 1WGPA 5J3UA 2QJVA 4HZFA 1O3QA 3KSCA 2D93A 5F1RA 4XFCA 5K8SA 4MX3A 1ZZ6A 3BPZA 2OZ6A 4LULA 1HW5A 4ONUA 4K8FA 3C3VA 3FE5A 3NVCA 5FQ0A 1Y9QA 4Q29A 1RL3A 2PAEA 3OF1A 3D82A 1FI2A 4FBFA 3LAGA 1NE4A 3WW1A 4META 3ACLA 3HT2A 2GH2A 3NJZA 3H3UA 1VJ2A 4IEUA 2P17A 3IBMA 2ZCWA 3JZVA 4AQ6A 2HJIA 3RYPA 4RD7A 1PM7A 3CEWA 1LRHA 1OMIA 1PMIA 4XF9A 4MGIE 1J3QA 5FPZA 3RYRA 5JSRA 5J48A 1TQ5A 3S7IA 1GQGA 4IERA 3GBFA 5HI0A 1NZCA 3H1YA 2O8QA 1UPIA 1ZRRA 3WW3A 4IEQA 1YLLA 1QWRA 2VECA 3E97A 4XF3A 4TLFA 4LA2A 3NL1A 3D0JA 3LWCA 5BXXA 5LRRA 3H9AA 3PLQA 4JTNA 4Z82A 2GC3A 4I09A 2PYTA 4ORFA 4AQ2A 1ZZ7A 4QM8A 1EPZA 1YUDA 1O4TA 4Z07A 2ET7A 4IEYA 5KHJA 1VR3A 3ES4A 4YNIA 2OZJA 3SHRA 5FCCA 4E2GA 3OD0A 1CAXB 1UIJA 4BYYA 5BV6A 3ETQA 3LA3A 4EWDA 1UIKA 4N9HA 2BEOA 4PIXA 3DN7A 1J3RA 4HN0A 1ZRCA 1ZVFA 2FMYA 5FLJA 4OFGA 1UCXA 5LRSA 4O9GA 2C0ZA 3ROUA 2CGPA 4IETA 3N4MA 4QGNA 3I59A 4L11A 2QDRA 4YSFA 3HT1A 3E6BA 5E16A 5I8SA 3RYKA 3NSTA 4HN1A 2F4PA 4OLLA 1OD5A 2K0GA 4IEPA 3NW4A 5KBFA 1DZRA 1O3RA 3CF6E 4FAHA 3GYDA 3LA2A 2XL9A
chains in the Genus database with same CATH superfamily
4Q0QA 3Q8AA 2Q8CA 4YG0A 4HOOA 4EWAA 1IG0A 1VAKA 2Z4FA 2C6SA 4CPBD 1S4CA 1MQTA 4LBMA 4NPMA 4C90A 1YFWA 1PMJX 3AMHA 3B7MA 1GWKA 2XHKA 4UF0A 1UOBA 2HH9A 1GWLA 1RUF2 4BCUA 4AVTA 3ZN4A 3NNMA 4QX5A 1AX1A 3AMQA 3MIGA 4XMIA 3I54A 2LTNA 1UZWA 2QKDA 3B5LB 3ZIXA 1GZTA 3ZXEA 5A3UA 4RS5B 1OT5A 4L8QA 1GKBA 4AAPA 4D7YA 1SACA 3T4VA 2Y6FA 4YGDA 1EV13 3GGLA 5BY5A 1JZ8A 1GQHA 4FT8A 4QAWA 1ZM1A 4MGYE 5K9YA 5DMYA 3OSDA 4YVWC 1OKOA 1VP6A 2PA7A 4LHLA 4MH0E 5DZEA 3POSA 5LA2A 3SEEA 2R1BA 1C28A 3RPQA 3SMHA 3JB8A 3UGFA 3ALQA 5ACA1 2VXRA 2VTXJ 2WFF2 2OYZA 4CUCA 2FZ2A 2WNUA 1Q8SA 2WO2A 4CSWA 1QNWA 2UWCA 4JGYC 3BB6A 4Q26A 5FWJA 1UKRA 4GH4B 1DYKA 4NIGA 2DVAA 5JZGC 1HQLA 3NKGA 2DFCA 1ULCA 3M70A 2VNOA 1SZBA 2PMWB 1W6MA 3I3QA 4MV2A 3ST7A 1QOOA 1VRH2 1LOFA 4QGMA 2AUYA 4EQVA 4IV3B 2RVAA 5JUVA 2W9XA 4JKMA 5GLTA 3MEPA 1H8TC 2BDRA 2P1BA 2PHXA 3VGIA 3W5NA 4IE6A 3THPA 4XC9A 5FZLA 4NAOA 3OGVA 4WM7C 1C8M2 1MVEA 1AVBA 1DF0A 2ZOEB 3H7JA 1X8MA 3B93A 1RVF1 2JEMA 3VLBB 5A7OA 2W95A 1TMF3 2PHUA 2IXCA 3AKTA 3E5QA 1KD7A 2RS51 3LEMA 2D5FA 2JDKA 5CU1A 2VM9A 3ZYPA 5KR7A 5I91A 4BQ3A 2ORZA 3BTXA 1NLQA 4BMBA 4RQPB 2C9AA 2OPKA 5GZGA 4CUGA 2IXLA 2AEZA 5CFDC 3H3LA 3AP7A 4DFSA 1YQ2A 1V6LA 1CQ9A 1LHWA 1UY3A 4F8AA 2R0FA 3MF9A 2Q1ZB 2ZKLA 3ZR5A 3I2KA 1JUIA 1ASJ2 2C5DA 4TTGA 1SFNA 4B7EA 1QJX3 4LBQB 1DZTA 1RJ8A 4G3YC 1HQWA 5J96B 4XUQA 2MEV2 3V0BB 1QJY3 3OGSA 4PI0A 1J58A 2TEPA 3ITQA 4W6YA 4CA9A 1RUC2 3NAPB 1VBC1 2DUQA 1K5JA 2GNBA 3RZGA 2XUEA 1CGPA 3R05A 3VL9A 2D6KA 5T5OA 2EAAA 2ZGRA 3O1OA 1UYZA 4UBGA 1PO11 3POWA 4XFGA 1O8PA 4YVWA 2GP3A 2UY8A 2W47A 4YWAA 1PGL2 1NQDA 1B35B 3A23A 4QKDA 4J1XA 3WF4A 5FR3A 3WW4A 2OIIA 3NQHA 4MSVA 1JYNA 2NLRA 4PQQA 1DIWA 1V6OA 1BMV1 5KHGA 3AB0A 5FLHA 1ZRDA 1ZX5A 4W8JA 5DUVA 5IVJA 3T08A 1LENA 2Z5WA 4JGYA 3PUIA 3IMMA 1OVSA 2WQ8A 5JZGA 2KR2A 3KHCA 1URXA 2BNOA 1KXGA 4E2SA 5K0UC 3O14A 4XFHA 3E5XA 3O0WA 4A3XA 1MPXA 3I2HA 4CDQC 4BOWA 3TYJA 1JS9A 1HDKA 3H0OA 4QXHA 4XBQA 1QQP1 4XF0A 5FRAA 1Z78A 2WUHA 4QU1A 3SCFA 1FOD1 1S0JA 5JSOA 4O7XA 1H8TA 1UD1A 4HVRA 2Y0OA 1MR5A 2W52A 1GFF2 1OSGA 4MUVA 5JOYA 2YV8A 3H42B 4WM7A 2PQSA 1MVQA 3LIGA 3A22A 3ZIWA 3ZYJB 4DPNA 4MVTA 2VNVA 4A7ZA 2D3RA 2P37A 4Q8LA 1AXYA 1ND2C 1WW5A 4QGLA 1W8FA 4YW4A 3K75B 4C8DA 5A33B 3FFQA 3K3NA 4I2OA 1VBA2 2OA2A 5I8YA 3EBRA 2MPFA 1IQDC 1XOYA 2BOJA 2J22A 4L92A 1GYKA 3WG3A 4ASMB 3BCWA 3LPGA 1U12A 2XLGA 4XJ8A 5CFDA 1O7FA 1L3JA 3NV1A 2WABA 3TN92 1PGSA 3VBSC 2ZHNA 3SH5A 4UFLA 3BN6A 5GLWA 5IWFA 3WF0A 3R4DB 1BYHA 1CAUB 5FZMA 5A3LA 1S55A 3FHQA 4UT5A 3ZXKA 3AM2A 1RC6A 1GLHA 3ES1A 3T1MA 5CKMA 1NYWA 1PO21 3WINE 4LR4A 1HRV2 4AGGA 4QDRA 1S2KA 3RMYA 1HXS2 2IXHA 5GLZA 4RHV2 1WW6A 1ZREA 1PX4A 1OPMA 4C0HA 1UZVA 1RXGA 3M8LA 4Q8KA 3QH6A 4BH9A 4HXCA 2LS6A 5GKAC 1H4HA 3AC0A 3TOJA 2QQJA 2HWD2 1QJEA 3HNBM 2JIGA 1QJFA 5KHHA 1BBT3 2VZQA 5LBBA 2V09A 5FBJA 3WG4A 3QD6A 3RWKX 2AH2A 1CZSA 2HWB3 4GMP0 5I0UA 2X8KA 4Y24A 4QX7A 4RSUA 4V1PA 2I74A 3POIA 1SCSA 2A3WA 4EN8B 2PHTA 5CFCA 4FP3A 3CJIC 2QQVA 4D8MA 2A6WA 1QXJA 1AL22 1H2KA 1GQPA 3KCYA 4IESA 2VW2A 5K0UA 4N8MA 3H3ZA 5JVVA 2A5ZA 4COWA 3AKRA 1OVPA 4FI9A 4CDQA 3AXDA 1DGRA 2PLV3 1RUD2 1NXMA 4ATEA 1JI6A 2GC1A 1OUSA 5BNPB 5JIUA 4Y1UA 2Q4SA 4XURA 4ZU4A 3AP4A 5FZGA 2VW0A 5LASA 1RHI3 1JZ5A 2KM2A 2JXAA 2BFUL 3LSEA 4MZUA 2D3PA 4JKKA 1F9KA 1RUNA 3WNLA 5JMOA 2VW1A 4R9DA 4E2QA 4P5HA 1CVNA 1XU1A 3VZLA 1S0IA 1Y4WA 3HQXA 3KF3A 4LUKA 2V4VA 2AZ5A 4JDOA 3BTZA 1ND2A 1OLQA 4OI0A 2V73A 2XJVA 4LTAA 4P08A 2JDYA 5GZFA 1R1ZA 5A3NA 4K9SA 2FCUA 4AEJA 5KXEA 1RUF1 1YC61 1J59A 4IEZA 2XBO3 3KGLA 5GZDA 3ZOIA 5AC93 2VO5A 2ARAA 3ZN6B 3JBG2 4IGPA 4Y4YA 5DDJ3 1W06A 3VBSA 4B1LA 5KXCA 1VMHA 2EIBA 1A78A 1JU4A 2O14A 3B69A 4H14A 4HBNA 4OI2A 5FXZA 4LE3A 4GULA 2BWAA 3MIDA 3LD8A 3FBYA 2Y6KA 1VBB3 1ZBE1 2BW8A 2DCKA 3MDPA 4ISRA 2DCZA 3AK0A 1S0BA 2ZMLA 4NWVA 5HV0A 4ZU7A 5FZ1A 2NMOA 4FPCA 1UF2C 3S5AA 3OOXA 4Q0PA 5D8AC 3DYOA 4UF0B 1U0AA 1TME2 5IJRA 4P9XA 1UW8A 2R042 3W9AA 2EA7A 2LM3A 4KBBA 3L9JT 3I2FA 4EWEA 3DEMA 4Z8BA 5C7GA 1AR93 1ALYA 2VBPA 4AHXA 2QQPA 2UYBA 1H4GA 2XVKA 3MIFA 3M3CA 1Z7S1 3PUHA 4BIOA 2ZPXA 2WFPA 5AVPA 4D7TA 3N9LA 2LUWA 5FY4A 1VMFA 3O1UA 4XIOA 1QMJA 1JU3A 3CJIA 1B09A 4YW6A 3DGTA 4W4ZA 2P4EA 4X6QB 1VRH1 4O9EA 1D4M3 2OQ6A 2PHFA 2YDEA 3AKSA 3MI8A 4XBLA 5T54A 5T5PA 3W20A 2CYFA 4YFWA 3MW2A 1H6XA 1VAMA 4CE8A 4Q4W3 1PIV1 1LODA 5A6QA 1CESA 4UFMA 1TE1B 1ND3B 2YGMA 2VBBA 4D7SA 1C8M1 2NPIA 1SHWB 2A6VA 5KC5A 1GZWA 2I45A 3A0KA 1DQ0A 5LA1A 4ZS2A 2H6CA 1CAXA 3GHNA 1WD4A 3EO6A 4BQ4A 3M7AA 4Y22A 4LKDA 3SCHA 4AEDB 1W6MB 2OS2A 1NKGA 1C4RA 1W6NA 3ILNA 3WG2A 1F5JA 1HIXA 1PNGA 1FMD3 2P3IA 3HAGA 4G9SB 1W9FA 3UK9A 1XE7A 2ERFA 3K77A 3RZHA 4K3UA 1ZA4A 1VIWB 3PJYA 4QXBA 5JWPA 3URFA 2R061 2Y26A 1GR3A 1W2TA 4E4HA 1W8NA 2F4LA 4FOVA 1WMEA 3M3QA 2RS33 1E57A 3DPRC 4BQ2A 2AENA 4AW7A 1ULDA 3DV8A 3POBA 4Y1ZA 4CCCA 4IV3C 2R073 3D5OA 4IE0A 4B8EA 4HZFA 5ISLA 3KSCA 1W9WA 4LXLA 3VD9A 1BHGA 2VCBA 1CIWA 2IZWA 1HB3A 5A3PA 3C3VA 5D8AA 1AYN1 2VULA 2FCTA 5FZEA 4Q29A 1E5HA 5FQ0A 3KV5A 2AR6A 2PAEA 2QDNA 1POV3 2BQPA 3BTAA 4Q4X2 2W2IA 2GMPA 3MIEA 1H0BA 4A41A 4RQPC 1W2UA 2HBUA 3LAGA 3ZO0B 3N35A 3POYA 2W5FA 3ZYRA 1MZ5A 5DN2A 3NJZA 4B1MA 1S0FA 4Q4V2 5E6HA 2ID4A 1UZYA 2TUNA 5FYHA 3ZSLA 1VBE3 1Y9MA 2QQUA 1FV3A 4OUSA 1NA1B 2ZCWA 2JDHA 2VQUA 3O5SA 2V5DA 4XCBA 1YIFA 4ET7A 4AI3A 2ENRA 2HJIA 5FUNA 4YVWB 3P1IA 1PM7A 1OF4A 1RMU3 5EQUA 2GALA 3K48A 3V65A 3D4KA 3NAPC 2A1XA 1R1A1 4YG3A 1W9SA 4NOTA 1RINA 4LORA 3VB9A 4Y1VA 4K7JA 1C57A 3ENRA 4JGYB 3C7OA 1B35C 1GQGA 2RDQA 4IERA 3ZSEA 2ARCA 4CCJA 1IQAA 4B4RA 1I1EA 3WUCA 3GXUA 3N7MA 2FDKA 1HV0A 3IAQA 1G9BA 1DCSA 2WZ8A 3WW3A 1WD3A 2BVBA 5C33A 1YLLA 5FUPA 4MYEA 5FZ4A 4OHXA 4XQDA 1QWRA 2RHPA 2R0HA 2VECA 2QZ2A 4Q1RA 5IK5A 5FZ0A 1UL9A 1CR7A 5FY9A 1JZ6A 2VVEA 1AR63 3S6PA 3OPWA 4MO3M 1TNRA 3P3NA 1H8TB 1OUXA 1ULOA 4QX0A 3OG2A 5CKNA 1ST8A 4QHOA 3DPRA 2BWCA 2D97A 4WM7B 2A7AA 1KJRA 1V9U1 4FQ4A 1ZBA3 4YW7A 2YC4A 4IV3A 1O4TA 2ET7A 1MEC3 4IEYA 4K1ZA 1VR3A 1D7PM 1ZYBA 4YNIA 3J4UH 1T6GC 3AYDA 4AFMA 5ACA2 3K4ZA 5FCCA 1PVXA 4E2GA 2DTYA 2R32A 4YZ1A 4D94A 4BYYA 4LLFA 5EJ1B 3WDTA 3WCSA 4D6QA 4J6GA 3ETQA 2VZUA 4YG6A 3RRDA 3ZXJA 2HWD1 4CCKA 4ZPIA 3VBFC 3MICA 1UO9A 4PIXA 4Q27A 3VBUC 2XJPA 4ITCA 4RQPA 5FZ6A 3WNNA 4UW3A 2IFWA 1FPN3 2FMYA 3N9QA 1UCXA 3VKFC 5LRSA 1ODMA 1BVP1 4KG8A 4O9GA 5IK8A 1SBFA 2J1EA 2G9FA 1LGBA 5H9RA 4AFBA 4QGNA 3I59A 4QX2A 4AFAA 2HWF3 5IW0A 2WYSA 3WF1A 4LBQA 4YSFA 2G19A 3NV3A 4QX3A 3KM5A 4UW6A 3RYKA 3D6EA 1YQ5A 2RMU3 2VZPA 1W90A 2TNFA 3KHBA 4XHXA 3NAPA 3O1RA 1KITA 1RVF2 1OKQA 4OLLA 1OD5A 2WAOA 4YPJA 2NQYA 1FV2A 1RITA 4S2DA 1J84A 1AYM3 3HVDA 4NPLA 4S2HA 4MOAA 5FPAA 3GYDA 4LO5B 1QU0A 3ZXLA 2HLEA 1QIQA 2BV4A 4PI2A 1ZZ9A 5C9AC 5F3GA 1MZEA 5CFCB 3RJ2X 3C7EA 2PFWA 1MS3A 4FOQA 2DV9A 2VMGA 3OJBA 1RUJ1 4QX8A 4BMEA 4FOYA 1RB8G 3VKNA 3PNAA 4BDVB 4UYBA 2QZ3A 1UY2A 1SDDB 3FUQA 1W2OA 1WLCA 1RUH1 4BXSV 2RDNA 1VBC2 3DL3A 4JX0A 3ZDSA 3AZXA 3RS6A 1LGCA 1X82A 5K4LA 4A45A 4DXZA 2DWRA 3ZMNA 2VZRA 1PO12 5CNAA 1NCQB 5JLVA 1R083 3B00A 4LO7A 5BNPC 3KWVA 1UOFA 1W04A 2UYAA 3BODA 3LFIA 3LIHA 3ZYHA 4DXRA 5FP7A 1DGRN 3BU7A 5H9QA 3FLTA 4M01A 2RDRA 4LK7A 1BMV2 2Q30A 1V6KA 5JI9A 1W3XA 5FZHA 4AVAA 1COV3 2WS91 2VD7A 1VB4A 4IEWA 4HKLA 2HYKA 5FDBA 2R7EB 3VBFA 2VPVA 5FPXA 3KZ4C 4W65A 3WDYA 4AFCA 1K42A 5A33A 3VBUA 4R9AA 5IFPA 5JPNB 1OOPB 4Q4Y3 4AHWA 2DCJA 5A70A 2JJ6A 5FAXA 5BPXA 2B5HA 3LEKA 4XZPA 1C5IA 1O5LA 1LEMA 3UYJA 3WZ1A 1O6UA 2GNTA 2ZGNA 2DBNA 3UETA 3ZYBA 4AHYA 3VZKA 1FAYA 1BZWA 1OQEA 1QQP2 2PN5A 2WNEA 4CDXC 2BZDA 1FOD2 3GDBA 3U1XA 1CAUA 4OZXA 3U0ZA 2DCTA 2VCMA 2IXIA 2ZX1A 5HXVA 1FXZA 5ERLA 3VKMA 1IG3A 3JQWA 1KS5A 3WW2A 1LCLA 3GALA 5JOXA 1Y43B 1W03A 4P9LA 4K8RB 2J1VA 3A21A 3USUB 4QXKA 4YZ3A 1GV9A 4XETA 1HRV3 2BERA 3SQOA 3RZMA 1EV11 3GZAA 4OI4A 3VN4A 4KU8A 4DRRA 4R8HA 3ZMOA 1NXD1 1CX4A 1ENRA 2O1QA 4XUTA 5T5LA 3PVBB 1FNYA 5LATA 5CAZA 5C9AA 4JGZB 1UZ0A 1STMA 2XJRA 1K3IA 3HNYM 4FSJA 2KD7A 2NZ9A 3TBDA 3QCWA 5F2SA 5FP4A 1ACCA 5F7UA 3LE0A 1VPHA 5F8PA 1BKZA 1GP6A 1W6QB 3SCGA 5FPLA 1T6BX 1PO22 2RM23 4BPZA 4CUBA 1FATA 1CJDA 3G7DA 4IDZA 2QTWB 1GZWB 2CV6A 4Q2FA 1YNAA 2JG8B 4XFBA 2VQTA 5BNPA 3QACA 3UT0A 4OUMA 4Y22B 3RG0A 4NRQA 1JBCA 3ETPA 1ND3C 1HV1A 2JDZA 2P34A 3W58A 4B29A 5HCBA 4OQ9A 3PJQA 5A6YA 3ZYIB 4FPJA 3RFRA 5D21A 3MV01 3ZXFA 1UY4A 2A6ZA 5D1IA 5FYYA 5TSWA 3ZSKA 1GP5A 2WT1A 2DCYA 2J42A 3POFA 1HRI3 3RDIA 1H2LA 2D6MA 1BLZA 1XRUA 1CAWB 1YQ8A 4Q4X1 3PVNA 3FZ3A 2PHRA 3MPBA 4AEDC 3KT4A 2C26A 4L0PA 5L19A 4FTBA 3JCIA 1CONA 1Y7BA 4XW3A 5GLVA 4P00B 2EXIA 5HXMA 2CDPA 1X7NA 2ZHMA 2FQPA 3OPZA 2BGCA 4XF4A 1O5UA 5C6CA 3K4AA 1MZFA 3ZN6A 2QQNA 4CDXA 3WX5A 1YFYA 2PXJA 2VMCA 2ZGLA 4PJYA 1D4VB 1HJFA 4QQ2A 4YW5A 4EE2A 5D8AB 1QJX1 5EP9A 4TWTA 5FQ0B 4ZHNA 2DF7A 4P9GA 4AI9A 1LU1A 1VE0A 4LK6A 1QJY1 1CAVB 2EIGA 4Z92B 2VR4A 2MHFA 3TEXA 1E5IA 2B45X 3ZXAC 4FVVA 3ORJA 4LA3A 4XFIA 2EIEA 4QQHA 4Q1PA 5C5UA 4A7KA 4OMDA 1KGYA 3I2OA 3FHAA 3HNMA 3WVJA 5EZWA 1LB2A 3A4UA 2IXJA 4P9YA 2GNDA 4QPGC 2C9KA 3ZFEC 1AR71 5GZCA 3IIAA 5A1LA 5JR2A 1YCIA 2YC0A 1Q56A 2QE3A 3KVAA 5F6KA 2VNRA 3N9NA 4AWDA 2K46A 3RMXA 1RGSA 3IM0A 2ETEA 1ZBE2 4MXVA 1NA1C 5FYTA 4H7MA 4BK5A 1RUG3 1I5ZA 3CJXA 1JHJA 1RUI3 4CCLA 3HIFA 1IHMA 3ACIA 3R4UA 4NHMA 4MG2A 1HB2A 2VUJA 4LO8A 3PUSA 2RS13 3VBRB 4V2WA 3AKPA 1WBFA 5I93A 1H9WA 1PM4A 3I3DA 4LNVA 4QQPA 4YRDA 4AVCA 5HPOA 3EQEA 3KD4A 2Q1FA 3VHPA 3IDAA 1ND3A 2WLQA 3KS7A 4IEXA 2VZTA 2D44A 2ZTNA 5LY1A 1W39A 4KGQA 4XEZA 3KV4A 1Z7S2 2WYFA 2XVGA 2AYHA 2OUJA 2WRAA 4N7UA 1F2NA 4AGRA 4EV0A 5LEKA 4CCDA 2ZBJA 3JQXA 1N1TA 4UWDA 4IE4A 3AMNA 4AEDA 2CY6A 4RFRB 2SBAA 3DPRB 5KHIA 1J3PA 1WA4A 3IPVA 4FPKA 3KF5A 3H7YA 4YM1A 5ANQA 5I0TA 2DVFA 5JXGA 3GZUC 3GZEA 3OBTA 3WQ7A 1PK6A 2K2SA 2HEYF 3SITA 4CU6A 5KHKA 4GMP3 1AHSA 3VBOA 3C8XA 3RZJA 1WLDA 1FNZA 2VG9A 1JYXA 4LHSA 1PIV2 3AVRA 3RVHA 2WZR3 2GU9A 5D2AA 1MS1A 2ADDA 3BGAA 5FYUA 1UWWA 4OHYA 5IK7A 2HKXA 2WNVC 4JTOA 2W68A 3MUZ1 4CCOA 3R6SA 3EHKA 2FDFA 3VD4A 2J1TA 2ZS6B 3OBZA 4FPYA 1Q8VA 4K40A 3NNFA 4IGOA 5FZBA 2HWE1 2ZA9A 5I0RA 3ILRA 4F83A 5SV5A 3S30A 5C8WA 3CQOA 2R062 2V72A 1UYPA 3JB4C 3I59B 2VL4A 4XMAA 2Y8KA 3P6BA 4QPGA 4DEVA 5FZ7A 3ZFEA 3VDCA 1BBT1 1JN2P 2E33A 3WCRA 4ES9A 3VD3A 4XDOA 4JZRA 3O12A 3I7DA 2D6OX 1NA1A 3J7MA 2YG0A 4AL9A 5A6ZA 4H7LA 1LU2A 1JYCA 5CVRA 4C1WA 2Z79A 1TZOA 1D0GA 4CU8A 4DINB 1RUOA 2D98A 4FFHA 5A7PA 3AFKA 4CXWA 2WDBA 2OKXA 3NO8A 3VV1A 4BQ5A 1W28A 1AYN2 3HOBA 1DGWA 2JE9A 1H1MA 2FDHA 1YO8A 2WLPA 4JHTA 1BEV1 4R4XA 1EPWA 2H0VA 2WIIB 1AXKA 5J09A 4YVSA 5LA9A 3IDEA 1RHI1 3ZYFA 1AX0A 1DLCA 1JOJA 4LOTA 4XFFA 4CEYC 5CFCC 3CLPA 4Z2AA 4NO4A 4XPVA 4AQSA 1WWYA 1Z0HA 3JD71 3LOIA 5B2GB 3GZTB 2ZZQA 4DO0A 3OY8A 2NN8A 4LBKA 1G86A 5BNOA 2VVFA 1IPSA 4IE5A 3OBRA 1JYVA 5SV8A 3POGA 2ZAHA 3BUCA 4N7IA 3NKTA 4LJHA 1R1A2 2OQ7A 2RJLA 2VQAA 3KGZA 2EVXA 4MGSA 5M0TA 3T2QA 1UU6A 4PBPA 1MS8A 2IVIB 2RJKA 4M3CE 1NCQC 4ATFA 2DUOA 3RZZA 2EAKA 2JX9A 5FMCA 2DVDA 2YPDA 4IE7A 1NG0A 4AEMA 1SLIA 4NHXA 3VBFB 4HETA 2WNVA 4KG0A 5FOBB 3N9OA 3Q8CA 5FKBA 5IATA 4DXTA 1VBB1 3VBUB 2WO1A 1N3QA 1DQ6A 4AFDA 2WQZC 3E1F1 4NROA 5CB7A 4CP9B 4XOGA 1AUYA 1XNCA 4QKBA 1H2NA 3AP6A 3J8F3 4J1WA 3FJSA 4I3GA 3IDCB 5LCWL 2I2SA 2B4KA 4KNCA 5E1RA 1N1VA 3FBMA 3MBWA 2JD4A 5C70A 4Q0SA 1OOPC 4D69A 3ACHA 2DU1A 4H55A 1LECA 1AR91 1V9U2 3VBHA 3C7FA 5F3CA 3GBGA 4AOCA 2XJUA 4UFKA 3FFZA 2WA4A 4GB33 4WVMA 2A70A 5HV4A 1XBFA 4HLTA 4ZU5A 2BTVC 2A75A 2ZKNA 2JDPA 2QJVA 2D6LX 1G9DA 4LKEA 2ZX3A 4WVVA 5F1RA 1W9TA 1D4M1 1QHDA 2BFUS 3K2OA 1HQNA 4OVEA 4AG4A 4AZZA 2VMEA 5IAXA 3PU3A 5C9AB 2YU2A 4LBJA 2W3JA 5IVEA 5FREA 4YGBA 3SISA 4Q4W1 3RJRA 1HW5A 2RR13 5BYNA 3RZLA 5FY8A 4WV8A 2X5IB 2RS53 2YFZA 1LTEA 4ZZ5A 2DYCA 1DQ4A 1YYNA 5E8AA 3ZFFA 5A3OA 4CEYA 3ZXGA 2XOMA 4HKWA 3GCXA 1APNA 3K3OA 1NE4A 4JGZC 1QGLA 4BA6A 3AJYA 1VBD3 3ACLA 5CISA 5JXJA 2FCVA 1YQCA 3AZWA 1AR83 3CZUA 4OHZA 1FMD1 5J1XA 4M0NA 2ZX2A 3JZVA 4BB3A 4GKYA 3BTYA 1XPWA 4SLIA 4KH9A 1J83A 1Q8PA 3H8OA 2BU9A 1EAH3 2VZSA 1NT0A 2JG8C 1A6CA 2VQ0A 1NCQA 2RS31 1I3HA 4WVWA 4XHBA 1E5SA 4CP1A 2WKKA 5FZCA 2R071 1SBEA 1J3QA 3N3HA 1ZA7A 2JWPA 5FPZA 4LBNA 1WKYA 1RUJ2 1S2BA 5DAQA 1UU4A 3ACGA 5APAA 5A7WA 3H1YA 4XAEA 2WN3A 2NMNA 2VTFA 1BQPA 1S2EA 4LO4B 1UPIA 3SH4A 1RUH2 1ZRRA 5FZAA 3T09A 3ZM8A 4EN6B 3CMGA 4CDXB 3KCXA 5L7OC 2VZ3A 4R9BA 2HWC3 4WZFA 5LY2A 1POV1 5T50A 2ZACA 4AK3A 4XF3A 1OOPA 4HK8A 4YGCA 1D2QA 4FFIA 4Y20B 4CU9A 1RIRA 4BQ1A 5DAWA 1QH7A 2XWBB 1IS4A 2KA3A 2Q8DA 3H9AA 4JTNA 4CP2A 4BZ4A 1ZZ7A 1W05A 1VBE1 5A1AA 4QM8A 1EPZA 1YUDA 4Z07A 4RA0A 1NCRA 3ES4A 2A71A 2BJSA 2WS92 4AR2A 2OZJA 3SHRA 2FHRA 1RMU1 2QQWA 1X50A 2BUKA 3QLQA 5EIYB 3USUA 3VDAA 1UIJA 3GJAA 4KGGA 3SC7X 1GOGA 1IS6A 5BV6A 4NUBA 1LAJA 5DXDA 3WP6A 4EWDA 1U5IA 1L7LA 1ULGA 3AMPA 4E4DX 4N9HA 1RUE1 3KV9A 1QDOA 1REDA 2BEOA 3RQ0A 3VZMA 1WCUA 4NIIA 3UNPA 2VXJA 4UFHA 1L7RA 4JGZA 1R093 2YC2A 4OFGA 1KRIA 2RV9A 3O1TA 4LBLA 5A7QA 3IN9A 4NPRA 4PQ9A 2CGPA 4IETA 2WBKA 2Y64A 4K6BA 3V56A 3CDZB 3WNMA 3Q8BA 1W6QA 3FMGA 3HT1A 4GWNA 4NRMA 1AR61 5IVBA 3E6BA 4XUOA 5E16A 4IV1B 4YZ5A 4PDWB 3VBRC 2JG8A 1PZ9A 1PX3A 1EV12 4MGQA 2BGPA 2K0GA 3WXPA 2JKBA 1JODA 2AREA 1ZBA1 3I2GA 4D0QA 4URAA 3QBQA 4XQWA 4A3ZA 3CF6E 3M2MA 4A42A 4QB1A 5J36A 4YLZA 3IPVB 3LA2A 2WWJA 3AL6A 3VDDB 3WP3A 2WSVA 4JRLA 4CCNA 5HCHA 1X9TA 4GZ9A 3MV11 1PK6B 1PVC3 1OF3A 5FIXA 4LBQD 4O61A 1QJU1 1R64A 4M4RA 3VBOB 5JOWA 2CHHA 1CAWA 3O1SA 3I4IA 2Y60A 2ZEXA 5L7OA 1GZCA 2QNKA 2YROA 4FPEA 4KQ7A 2J1UA 5BUVA 2J1AA 3E6CC 3TEYA 1RTVA 3JUUA 2N7GA 4AAXA 2EALA 3AVSA 1FPN1 4HL0A 3HN3A 5JR7B 3WEZA 2P2KA 1V6IA 1NAEA 3F95A 3ME2A 1NY71 2GSYA 2ATFA 1X36A 2ZX4A 5A3WA 4KU7A 3WOGA 4DUVA 2E51A 1YWKA 2ZX0A 1TVGA 2UWBA 2WO7A 5B4NA 2HWF1 4RFT0 5C71A 3UGHA 3ELNA 3HR9A 3WP5A 3P5BA 1N1YA 3T30A 2RMU1 1CAVA 1LOCA 1XNAA 3LZZA 3IAPA 3C7GA 4KL1A 2JB4A 3CO2A 2Y0IA 1JXNA 2R30A 2W08A 1CPMA 4GXLA 1LGNA 4QPGB 3ATGA 3ZFEB 2CAUA 2WA3A 3GHMA 1AYM1 1EP0A 3MLLA 4ISQA 3O1PA 3ZPYA 1V6MA 1O4ZA 5KC6A 4B4PA 4A2UA 2JB8A 2WN2A 1RUF3 3DXUA 3UKVA 3J7LA 4NJ4A 3ZFGB 4UXAA 4XDQA 5EJ3A 3HN1A 1QJX2 3OEAA 2QBXA 2YBPA 5DUWA 3EB7A 1QJY2 5F6LB 2E7AA 3T2PA 1H8VA 4EROA 4YVSB 2W87A 2H6BA 3WLUA 4HVQA 4NVPA 5C3PA 2DTWA 3GF6A 1U5XA 4HVOA 1OQ1A 3VBRA 2BVVA 4RR3B 1C1FA 2WWUA 2CWSA 2Z42A 1GMMA 5F5QA 2J1SA 5DAVA 1OLME 3NWKA 3W21A 4KBZA 1C5HA 1XSRA 1Q5OA 3OY8B 3AL5A 5H9SA 4DRVA 5BNOB 1F4HA 2WFF3 3UKTA 2A3YA 2GC2A 1JYTA 3UJQA 5CKQA 1AR72 1Y9GA 4K21A 2ADEA 3FC0A 2WC2A 1GNHA 1XNDA 1DP0A 3ZSMA 4JAAA 4N53A 3CNAA 5HCAA 2XUMA 1Z7S3 5FYCA 5AFBA 3I49A 1CPNA 1WW4A 2ARXA 2VMFA 3ON7A 2X09A 3CHXA 2QQOA 5LA0A 1QKQA 3VHOA 4JRAA 2C4XA 4AYUA 1X33A 2O8OA 4Q4Y1 5FO7B 4DEQA 1VRH3 2PHLA 2AC1A 1QJZA 2BGOA 2Q5TA 2Y6GA 2R49A 1US3A 2WNVB 5LK7B 4DNYA 2BBVA 4LLOA 4COVA 2CU5A 3M3IA 5FFOC 3DUIA 1NE6A 2VZVA 3DYPA 1V70A 2B9VA 1UKGA 2OT7A 5FJHA 3OUIA 4INDA 1H9PA 4Y1YA 1HN1A 3N9PA 4FFFA 4FXKB 3IIIA 3PU8A 4CDUC 1C8M3 2WO3A 2YY1A 4CP0A 3N7JA 3HPNA 3JU9A 1QOSA 4QB6A 5F32A 4EN0A 2NYYA 2G9ZA 2VUCA 3PIGA 5C3RA 3LEGA 1UY0A 4YGEA 4GWJA 5FMOS 5AFEA 3H1WA 2OX0A 2VH9A 4A44A 4QKFA 4TLGA 5LBEA 3VBHB 4DZGA 3SKJE 3KB5A 4WVMB 1SMVA 1S0GA 2QCSB 1O3SA 1S0EA 5FP3A 3IT8A 5JPMB 2RDSA 4FAGA 3RNSA 2A6XA 1ASJ3 4S2GA 5IUQA 1AF9A 3W5MA 2WWSA 1IOAA 4BJ0A 3UKNA 2MEV3 3H50A 2DU0A 1I9RA 2W0XA 2FD8A 1HB1A 1RUC3 4HFSA 4DOUA 1QXRA 4I0WB 2OW4A 2JE7A 4QX1A 4PF1A 2RM21 4XACA 1W99A 4PLOA 2CGNA 4BLJA 2OXBA 4W50A 5FBZA 3DXTA 5FXXA 4XJZA 1OFNA 3ZFFB 3UESA 1JUHA 4CEYB 4A6SA 1AXZA 2GDFA 3O1MA 2HWE2 3MUY1 4Y5Z0 1WLTA 2V4AA 4X6RB 4IUGA 2ZGQA 2X5IC 1JHNA 1NLSA 1WUVA 3MF6A 1OD3A 1H6YA 1XXNA 2VOXA 3FX3A 4D3WA 1BBT2 2WZPP 1OFSA 4YFZA 1HRI1 1XSQA 2HWB2 1LOBA 5FPBA 4BQYA 3J26N 1Q3EA 2D7FA 5KXDA 3N36A 3HEIA 3PMSA 1W6PB 1ODNA 2BOIA 4XVHA 4B7KA 5JSPA 4QDSA 5JIAA 2CNAA 3TNPB 5FJKA 1J1TA 4DUWA 5A32B 2MNGA 4ASKA 3E6DA 3K51A 2GN7A 3H8UA 3IDBB 2PLV2 3D3AA 1BJQA 3WNPA 1BEV2 3EYPA 1R1A3 5FK8A 3H1MA 5FXVA 2LRPA 1YQ6A 5A7WB 1RHI2 1LKNA 1MS0A 2JG9C 4CDUA 3AP9A 4XBNA 2VZ1A 1MS9A 1K12A 1W2AX 3JD72 2VCCA 4PLNA 1M4WA 5A3TA 4CP9A 3U4SA 4EJRA 1POV0 4R4ZA 1SPPA 1VBA3 3WT3A 4NE9A 5JCTA 1LOGA 5IVFA 4IQPA 1HN0A 1VRBA 3HQRA 1QEXA 3HBKA 4AHZA 2X53S 3U78A 1J1LA 3PIJA 4NHKA 4OQ8A 3TN93 2XBO2 3VKLA 5T52A 1NCRB 4CYDA 2ZGUA 5DDJ2 3I3BA 4QM9A 3BALA 4YARA 2VZOA 4L97A 2Z69A 4AI1A 2D5HA 2XKOA 2EIDA 3IZOA 3HWJA 4HSLA 2DVBA 1MS4A 2ZMKA 3UGGA 1VBB2 3EJKA 4CU7A 5DUUA 2Z2SB 1RUG1 2B46X 1G6NA 4QHBA 1FYUA 4BHPA 1GOFA 1RUI1 1ULEA 1HXS3 2GC0A 2GH8A 4QPWA 4RHV3 4ZONA 4AI8A 4MLOA 1KDMA 2RS11 5LBCA 3U37A 4UOJA 2VOVA 4KI5M 1F5FA 2VTXA 3VZNA 3KV6A 2HWD3 2X5IA 2XKPA 1XNKA 4F3JA 2YMZA 1PMHX 1LHOA 1AR92 1UXXX 3VUOA 1BCXA 3DF0A 4LMFA 4NMIA 3THCA 1XC6A 3O0XA 4HPKB 5FTTC 5FZ8A 2OVUA 2JDUA 4WM8B 1G7YA 1AL23 4CCMA 5LBFA 2VE1A 3ZR6A 4XCAA 3A7QA 3AKQA 3AMMA 1D4M2 3AYEA 4UAPA 5JMCA 1RUD3 3AZZA 4URTA 2JDAA 2VAUA 1SFYA 4IV1C 4Q4W2 4PDWC 5DZGA 4X8PA 4E8DA 4HMZA 4XABA 4XDPA 5DZFA 3ACFA 5FZFA 4AVBA 2WZR1 3KMHA 1SLCA 2CAVA 2JG9A 4PIZA 2HEVF 4TXWA 2UU8A 5F3EA 3NNJA 5L7OB 1TMF1 1K5MA 1XE0A 3NV4A 2Q8EA 3VDDC 3MHZA 4BE3A 3V0AA 2XQRA 1VAVA 5GJ6A 3HQUA 1PK6C 4C0BA 2C24A 2ORXA 2YBSA 1N47A 3POEA 2G1MA 1FMD2 2JD9A 3VBOC 4AF9A 4DB5A 3I2DA 4LE4A 3D0SA 4LBOA 1YFXA 4YW3A 3GM8A 1G9AA 3I2JA 3B01A 4J25A 4QMAA 3JBG3 1A8MA 4NAMA 4Y20A 2PAKA 2W1SA 1XYOA 5CA6A 1H1AA 2RS32 5I0SA 1ULPA 5E89A 3POJA 5FLIA 1RYYA 4BLIA 3TNQA 2LALA 2R072 4D6RA 4ARXA 4Q0VA 3VHRA 1O3TA 3D8CA 4I0BA 4PCRA 4WBBA 1WW7A 3L2HA 1O8SA 4ES8A 2DURA 5BNQA 3WP4A 3OTFA 1DFQA 3H8XA 4LITA 1TME3 4XFAA 1HX6A 1AX2A 3GBWA 2D40A 1QY4A 3R4SA 2R043 5FOJB 5LEJA 2BPA2 2E26A 2P6HA 4MGKE 1PGW1 3AYAA 3OCPA 2EXKA 4E9KA 4GWMA 2Y38A 4M3CA 3VD5A 1A3KA 1AL0G 2ZGSA 3BOPA 1CX1A 1F35A 2CSGA 3SXWA 1WCKA 3FWEA 4IEVA 1S0DA 5FKCA 5T3NA 5IYYA 1ENSA 2BBAA 3M3OA 4AE2A 5CADA 5IHRA 3BIEA 1UZZA 5A7NA 1VBE2 3WQ0A 5FUIA 2JKXA 3ZFGC 4DIQA 4XXAA 1KFUL 1TEIA 4Y5TA 3S7EA 4P9WA 4FXGB 4CCEA 1WGPA 2W91A 5F39A 4COZA 5J3UA 1RMU2 1A8DA 4PBOA 3A0NA 1O3QA 4YVSC 4CDWB 4NN0A 3MFCA 2E63A 2VUDA 3NMBA 1DHKB 3OEBA 4IV1A 4MX3A 4PDWA 3WHTA 4YZ2A 4RR3C 3BPZA 2OZ6A 2YBKA 3C7HA 3THTA 4XAAA 3KVBA 1PZ7A 1RUE2 2ZGMA 4LULA 2XDVA 3PUQA 4N53B 4K8FA 3MGUA 3FE5A 3NVCA 1XU2A 3EXUA 3Q8EA 5G05L 3VDDA 3OF1A 3D82A 5FZOA 1UMHA 3TWIA 4U2AA 5A6XA 5BNOC 5K7PA 2P3JA 5CBLA 1W8TA 3VDBA 3O7OA 4GWIA 1P8JA 3J8F1 4CEWB 3HT2A 4FO9A 4GJYA 1W8ZA 2GH2A 5IVYA 2ZJCA 3H3UA 4Z1VA 5C8CB 3LDBA 4QPIC 3MLJA 1AR62 2WAAA 3IBMA 1YI7A 5EYXA 4AQ6A 5KXBA 1EUTA 1LNSA 5FO8B 3R0RA 3NJVA 4RD7A 2XJQA 3U4XA 4NIHA 2ZGTA 1ZBA2 3CEWA 1XYPA 1MEC2 4ZZ8A 5FY7A 1LRHA 4GB31 1OMIA 2ZGPA 1PMIA 3ZYGA 3AZVA 3PTRB 4XF9A 1JZ2A 3WNKA 1F15A 4QU2A 2P3KA 4ZXKA 1QJU2 1REEA 3S5QA 4ZY9A 3T1LA 1UX6A 4IW3A 2IUWA 3GBFA 5FPVA 5HI0A 3RZKA 3KT1A 4Q4X3 2B39A 2RR11 1CZTA 2E32A 5C4WB 2Y34A 5FY1A 1OLRA 3VBHC 5L9BA 4IEQA 4UFIA 2VMDA 2HWB1 4N43C 1H30A 1FPN2 4Q4V3 3IMNA 1N3OA 1NY72 1KQRA 3QH7A 5A1FA 4TLFA 3NL1A 3D0JA 2YFUA 1OH4A 1VBD1 3ZFGA 5LRRA 2HWF2 1AR81 3LSDA 1ONAA 2GC3A 4AQ2A 2PLV1 4ORFA 4XYXA 1OBNA 3SEPA 2X05A 1DLLA 2RMU2 4P9IA 1GP4A 3LB9A 1WMXA 1V6NA 2ZABA 1EAH1 2ZGKA 3ZFFC 3LFMA 4RR3A 4DS0A 3N9MA 1CWPA 1AYM2 2GP5A 2GMMA 5LW9A 1GICA 1UYYA 4OZOA 4JQRA 1C3HA 1UIKA 1SFPA 3K46A 4AVVA 2CL2A 1MZ6A 1VALA 1W8OA 1Q8OA 3DN7A 2CDOA 2B42B 3BOWA 1W6OA 2YHJA 5FXWA 1ZVFA 1NLRA 2WQ4A 4P9JA 5EWSA 1ZRCA 3NRUA 5CIRA 1AR73 3HD8B 2XBO1 2DUPA 3TEWA 2C0ZA 5AC91 3ROUA 4HG6B 4QPIA 5DDJ1 3N4MA 1WCSA 2HWC1 5FYMA 4GJZA 2QDRA 4CDUB 4CPBA 4CTEA 2O0OA 1F8VA 1UAIA 3NNGA 2NM1A 2P5BA 1R082 1QXPA 5J98B 4OHVA 1OA2A 3LDKA 2ZMNA 3NSTA 4HN1A 5FMBA 2RE9A 1F31A 4LO6B 4XXPA 5DUXA 3NW4A 5ACA3 3K4DA 3PUAA 4RL7A 1SPPB 4R9CA 1DZRA 1XYNA 2VVDA 2HBTA 3OB8A 1YJLA 1VB2A 2Y6JA 1HJGA 2E7QA 5C5TA 1COV2 2XL9A 4I02A 4TSVA 1EYBA 4Y33A 4D6SA 2K9ZA 2VCAA 3OBAA 5JXIA 2NP0A 3CL1A 4IEOA 1BVVA 2Y6HA 1YRZA 4GA9A 4H2AA 3C2UA 5H9PA 1WCQA 5L9RA 4Q4Y2 4WVZA 5JI7A 1UQXA 2VU9A 3HMYA 1IS3A 4N43A 1CIYA 1S0CA 5F5CA 3BI3A 3F2ZA 3BYWA 2BYVE 3TB0A 1NCRC 4YYOA 1DQ1A 1R091 4CXXA 2BRTA 3FUOA 1W8UA 4LIVA 4QT6A 4MXWB 2VBDA 4KWJA 4DY5A 1RVF3 4ZS3A 3AZYA 4E27A 4E8CA 1CZVA 3KLSA 4XZUG 1IKQA 2XHNA 4Y26A 4H3WA 4JCKA 4LKSA 4LUMA 3MYXA 4XJWA 1HLCA 1EY2A 1VLNA 3RWNA 2FMDA 2R1DA 3OUJA 4FPFA 1DYOA 3UJOA 3X29B 3WNOA 1YJKA 4TYSA 5JDBA 1SCRA 2XPJA 3AXEA 2I07B 2HWE3 4FPOB 5T5JA 1ZNPA 3I3MA 4IXLA 3L2YA 1CN1A 1LOAA 4MHUA 2PHWA 5ABJB 3LDRA 3M4FA 2PQQA 4M4PA 1GNZA 4AXOA 4X8NA 4YM0A 4XE9A 3MPPG 1JYWA 3ZN5A 1PVC1 1LR5A 2RJ2A 3N7KA 2XMLA 4K1YA 3TRSB 1LEDA 1W0NA 3T0AA 1IS5A 2XXZA 1VBC3 4WM8C 1IPJA 5L9VA 1JH5A 1XJAA 1W6PA 2RM22 3AP5A 4MHRA 1NQJA 1V0AA 1AZDA 3OGRA 5CG9A 5FP8A 3E5UA 2JG9B 1PO13 5FZ3A 1ZZCA 5A32A 1OC1A 4NIDA 4OHWA 1WLWA 2PELA 3QOPA 3SLIA 3VZJA 1K5MB 3VHNA 3WUDA 3V0AB 4LHNA 3U14A 4AQTA 3CU7A 4BXFA 2XQXA 2QQLA 2WJSA 1BEV3 3AFGA 5FYZA 5IK4A 4PIYA 1Q43A 2ARBA 1JZ7A 4XUNA 1WZXA 3ZPOA 1OI6A 2F6BA 1HRI2 2P3YA 1JW6A 3WDVA 1GBGA 2AGSA 2FDJA 1X9PA 3JD73 1KS4A 1G9FA 3B94A 1YEWA 1YXWA 3U11A 5J37A 4DMIA 2LW8A 3IB3A 3N7LA 3ABZA 3J7NA 2ZEZA 2IFRA 1C1LA 3INAA 4OULA 5KWRA 1OLMA 5IAVA 4A4AA 2J1RA 3WR0A 1QQP3 4GIQA 4HT1T 5CZKA 1JZ4A 4PLMA 3OD4A 5FZKA 1FOD3 2VOTA 2A73B 5BNNB 3IWZA 2DDUA 4RYDA 1XE8A 2DBIA 4LEJA 5T55A 4DY3A 4EZHA 1IKPA 1Q8QA 1N3PA 1DQ2A 4I01A 1W8WA 1QF3A 4NRPA 4FQZA 2ILMA 4DQAA 5E88A 3V64A 2HYXA 3KT7A 2QVSB 3NJYA 4FP2A 1IZ3A 4M3CB 1UXZA 4XTMA 2E9QA 2WT0A 1UNBA 1X8EA 2YGLA 3BPSA 5FYBA 1SLBA 1FX5A 2Q0AA 5JAXA 2JICA 5FO9B 2VC9A 2PAMA 1PHMA 4QD2A 4OI1A 4YW1A 1MQTB 3NJXA 4PF5A 4O65A 4FFGA 1GUIA 1EUUA 1MS5A 1SQ4A 2OUHA 1D2SA 3B02A 3KQRA 1ZRFA 2XWJB 4A7YA 2WFF1 3T0BA 1DYPA 4P02B 3WSOA 5JOZA 1JOPA 1YFUA 2FZ1A 3PVEA 2WL1A 4HPKA 4JVAA 3TEZA 2IWGB 4JQTA 1WA6X 1NX9A 2BNNA 2W46A 2W94A 3GJBA 1PO23 3KCCA 1OH3A 3AYCA 4GALA 4WM8A 5FPUA 3CZJA 2PHDA 1UY1A 3CIHA 1ZZBA 1RUG2 3DKWA 4AI2A 3PTYA 1WBLA 4CVUA 2JDMA 1RUI2 3U07A 1KJLA 2JECA 3WF3A 1G9CA 1MEC1 1U5YA 2ZZJA 2B8MA 2RS12 2R16A 4XILA 5G04L 5A3MA 4QKNA 4RGAA 3EMRA 1E5RA 3AX4A 2WT2A 5FZOB 4CDWC 4RS5C 3UL2A 3J9SA 3M1HA 1JMUB 4XJAA 3FL7A 4JKLA 3OYWA 2YYOA 4Z2WA 4YM3A 4N53C 1H2MA 1I6XA 2WNUB 3ASIA 3J7HA 2D3SA 1SBDA 1LULA 2IVJA 3LOBA 1BXHA 1CJPA 1UMZA 2W39A 1OHFA 2UWAA 2XGXA 3I3EA 5EHDA 4E4SA 3S57A 4CEWC 1TNFA 4LT5A 4UI9L 1UX7A 5C8CC 3LA7A 5GZEA 4KWLA 2VGDA 5IVVA 3VL8A 1A34A 4GH4C 4M00A 3PDQA 2QQKA 1OA4A 3Q9OA 1GWMA 5CYYA 3G6JB 1ASJ1 1O91A 2GAUA 1HKDA 2Q1MA 2WZR2 4F7ZA 2VJXA 5DABA 5HBAA 4BM8A 5GM0A 2MEV1 5J7MA 1LOEA 3MFAA 1TMF2 1RUC1 3U10A 2CGOA 2AEYA 5DQ0A 2EF6A 3LGRA 3RGBA 1SEFA 1KEXA 2L9LA 1GU3A 2JDNA 5GLUA 1M06G 4XUPA 5EXOA 2ZAAA 4P5YA 3FN9A 4NIAA 1PGL1 2ZGOA 4KMQA 1C8NA 2ZHLA 5FYSA 3VD7A 2GN3A 5LK5A 5C4WC 3U75A 4MGTA 2C1FA 5DAXA 5FZIA 2WNOA 1SLLA 1W8HA 2GZWA 1W2NA 4NHLA 3UV9A 1WMFA 2KXLA 4DUXA 4LPLA 4MGZE 3T2TA 2A3XA 2Q8OA 1DQ5A 1GZ9A 4GKXA 3MW3A 4M0HA 1ZBE3 4L99A 2VOWA 3T2OA 4NR1A 2XLAA 2YUEA 4HSJA 1R081 1WCDJ 5DAPA 3WD5A 1RXFA 2X10A 3FHIB 5JXHA 1YHFA 4FPGA 3SH3A 5FY5A 2E53A 4L9BA 4CDWA 2XONA 4R52A 3KQ4B 4WZCA 2VUAA 1D0HA 4RS5A 4UBHA 4CXYA 4ZKTB 1UU5A 1PGW2 1W6OB 4KWUA 4FTSA 4M3CF 2EICA 1COV1 3DYMA 1DZQA 2XB6C 1QH6A 1RUE3 2CWMA 2YB7A 1UOJA 2XVLA 2A6YA 4QPIB 4EN9B 2AACA 3ZLIA 2IXKA 3S0MA 3WDXA 5JZGB 4JHZA 4ASLA 1F4AA 1H1IA 1ZZ8A 3SKVA 4BIFA 4TN7A 1WMDA 5C3OA 1YIPA 2GNMA 4UW5A 1REFA 2XG3A 2PTMA 1VBA1 1O59A 4CEWA 5DG1A 1S1AA 1JZ3A 4B4QA 4W6XA 5C8CA 2W1WA 3RI9A 2HEWF 1SLAA 3BIWE 1PIV3 4GH4A 2TBVA 4XJUA 3W59A 4LOSA 1JTZX 3ZX7A 4BWOA 1V00A 4QHZA 3OGJA 3TN91 2FDIA 2LROA 2XR4A 5I0DA 3I8TA 3DKQA 3H8RA 2X29A 3DCQA 1OPOA 3O1VA 5FP9A 2QQIA 2D6PA 4MADA 3GCWA 2BNMA 4XQ4A 2H0BA 2QUOA 2G4IA 3GNEA 1T2XA 1HRV1 1LJ7A 5EFUA 1W0OA 2WSUA 2OPWA 2YZ4A 3HJRA 4N43B 2Y6LA 4OMCA 1HXS1 2XJTA 1UYXA 4RHV1 3J8F2 5B4XA 1QOTA 2R063 3USSA 1QJU3 5CFDB 3IKWA 1DDLA 4L2NA 4NWWA 2XL7A 3I2IA 3LKJA 3O0VA 3LF7A 1O4YA 1TG7A 3Q8FA 5C4WA 2B9UA 3RSJA 4AVSA 2ZEYA 5DG2A 1L7QA 5LWBA 2J7MA 4LIUA 5F2WA 5ANNA 1BK0A 4Q5OA 3PHMA 4K20A 2YPJA 4JC1A 4AEKA 3ZSJA 2ES3A 3WDUA 2F17A 3ZVXA 3LQCA 4GB32 3TAYA 3MZHA 3LCPA 1AL21 1JYIA 1NZIA 4BU2A 4I0AA 1IPKA 2XLFA 2E7TA 3WNXA 5I8TA 1LHNA 4HONA 4NHYA 4DXSA 1AYN3 4XTPA 2V5YA 4U36A 1RUD1 4CRQA 3T0DA 1DU3D 3AJZA 3I97A 4FTEA 1GNYA 3OUHA 4PT6A 1LHVA 2D6NA 3BVCA 2VOKA 3HBZA 3OPTA 2ZEWA 4Y3OA 3V0BA 2ET1A 2IC1A 4EYUA 5IT6A 2EXJA 1DGWX 2RR12 2ZHKA 4XF1A 3RI8A 4ARYA 2Y33A 1AJOA 2DFBA 3PMEA 3ZKYA 4JV4A 5F9TA 1FT9A 2RS52 1ENQA 3VKOA 1ZRIA 1BK1A 2UY9A 3MIHA 4GQ7A 3B9CA 5ABJC 1B35A 3LPFA 3WQ1A 4P14A 4CUAA 1GSLA 2E31A 2W1UA 2WZEA 1VBD2 3SNMA 2WR9A 5K0UB 4HK9A 1AR82 1Y3TA 4EZ4A 3FLRA 1DGLA 2FBEA 5FMOL 4KWKA 5C3SA 4I3PA 3WHUA 4CDQB 2CTVA 4PHZA 4Q0UA 4RGKA 3T3YA 4Y1XA 3NV2A 4N9IA 3WF2A 1SG3A 1CD3G 1ULFA 1OURA 3FLPA 1EAH2 1JOBA 1PZ8A 3JBG1 4RN5A 3WDWA 2YU1A 4QQLA 1KDKA 2D93A 3NNLA 4OCTA 5LB6A 4BQXA 1K5MC 2W92A 4XFCA 5K8SA 5F5AA 5AVAA 4YW2A 1ZZ6A 1NOVA 4G4FA 1OXCA 2W1QA 3WV6A 4I30A 4ONUA 2R6QA 4CZSA 1Y9QA 4UW4A 4BQWA 1RL3A 1ND2B 2DVGA 2WINB 4JDNA 5EYYA 5FK7A 2VY0A 1GOHA 1FI2A 3DECA 3ZDVA 4FBFA 5IFTA 1IGOA 4FPHA 1TME1 1W9YA 5AC92 2B7YA 4AI0A 2R041 4HANA 4META 4QB2A 3WW1A 2HWC2 1OQDA 4GAZA 4GD4A 1VJ2A 3VBSB 2QFEA 4RGGA 4IEUA 2P17A 1V9U3 5IVCA 2QQMA 3P3PA 1US2A 2JIJA 4B3NA 5L36A 3ZKUA 1UMIA 4IGQA 3RYPA 4S2FA 5BNNC 2BP6A 1SLTA 1KFXL 3APBA 4AGVA 5CG8A 3ZXDA 5F37A 4FCAA 4QQOA 4OYUA 1DBNA 4XIKA 4HKOA 4MXWA 2XH6A 2GMEA 4MGIE 2E6VA 4Y5SA 3RYRA 2YXSA 3OGGA 5JSRA 5J48A 5FMDA 1TQ5A 5FZ9A 1W0PA 3S7IA 2G9GA 4JDMA 3T4HB 1NZCA 1PNFA 1MQTC 2O8QA 2FDGA 4COYA 5A80A 1POQA 5EJZB 1NUKA 5FWEA 5FY0A 5ABJA 1UOGA 3E97A 3CKHA 1R092 4W6WA 3CJIB 3CBNA 4ZXEA 5F3IA 1UPSA 2JENA 2RG4A 4LHKA 2ZXQA 4BK4A 4COUA 3JXSA 4LA2A 1HB4A 4GMP1 5A7SA 4FOWA 3LWCA 1LHUA 3M3EA 4IL7A 5BXXA 3PLQA 4Z82A 4I09A 2PYTA 5EV7A 5F5IA 4N90A 3WY6A 1U5ZA 3OYWB 2VMIA 4QXCA 5EPAA 3B9IA 5KHJA 1K45A 5CEHA 3PURA 5L73A 2UURA 1G8WA 3B3QE 3MW4A 3OD0A 1CAXB 1MACA 2P6CA 5C3QA 3ECQA 3WG1A 2XJSA 1RUJ3 4LKFA 5FV3A 4C91A 3LA3A 1W6NB 2WNUC 4A6OA 4Y4RA 5HCFA 5LZ6A 1PVC2 4QDQA 4LQRA 1RJ7A 1RUH3 4XJ9A 3WQBA 1XNTA 2SLIA 4YM2A 1J3RA 4QWNA 2VMHA 3MIBA 3MO4A 4QPYA 5FYVA 4HN0A 1ENXA 4SBVA 5FLJA 2D43A 4OUEA 1W3VA 1XB9A 1DG6A 3PVOA 4C1XA 1SDWA 4V2VA 1LESA 1LOFC 1QDCA 4L11A 5GALA 3THDA 1QNYA 1AJKA 2EXHA 4UFJA 4Q4V1 3LEIA 4TZDA 5I8SA 1OA3A 5BNNA 4YZ4A 1VMJA 4BISA 4EN7B 5FYIA 4FPLA 5DPNA 2VNGA 2F4PA 2WS93 1I5PA 4IEPA 3MLKA 4E4ZA 5KBFA 2JE8A 3PL0A 1UN1A 1XQNA 5FZDA 3BKZA 1O3RA 4FAHA 1YI9A 1V6JA 3ILFA 3BU0A 1GANA 3VZOA 1XNBA 1N1SA
chains in the Genus database with same CATH topology
4Q0QA 4YG0A 4EWAA 1VAKA 1MQTA 4LBMA 4C90A 1YFWA 3AMHA 3B7MA 2XHKA 1RUF2 4BCUA 4AVTA 3ZN4A 4QX5A 1AX1A 3AMQA 3MIGA 4XMIA 3I54A 2LTNA 3ZXEA 2QKDA 3B5LB 3ZIXA 4RS5B 4L8QA 1GKBA 4D7YA 1SACA 4YGDA 1EV13 5BY5A 1GQHA 4FT8A 5K9YA 1ZM1A 4MGYE 4YVWC 2PA7A 1VP6A 4LHLA 4MH0E 5DZEA 3POSA 2R1BA 1C28A 3RPQA 3SMHA 3JB8A 3ALQA 5ACA1 2VXRA 2OYZA 2WFF2 2FZ2A 2WNUA 1Q8SA 1QNWA 2UWCA 4JGYC 3BB6A 4Q26A 1UKRA 4GH4B 1DYKA 2DVAA 5JZGC 1HQLA 3NKGA 2DFCA 1ULCA 3M70A 2VNOA 1W6MA 4MV2A 3ST7A 1QOOA 1VRH2 1LOFA 4QGMA 2AUYA 4IV3B 5GLTA 3MEPA 1H8TC 2PHXA 3VGIA 3THPA 4WM7C 1C8M2 1MVEA 1AVBA 1DF0A 2ZOEB 3H7JA 1X8MA 3B93A 1RVF1 2JEMA 3VLBB 3AKTA 1TMF3 2PHUA 2IXCA 3E5QA 3ZYPA 1KD7A 2RS51 5CU1A 2D5FA 5I91A 4BMBA 4RQPB 2C9AA 2OPKA 5GZGA 2IXLA 5CFDC 3AP7A 4DFSA 1V6LA 1CQ9A 1LHWA 4F8AA 2R0FA 3MF9A 2Q1ZB 2ZKLA 1JUIA 1ASJ2 2C5DA 1SFNA 4B7EA 1QJX3 4LBQB 1DZTA 1RJ8A 4G3YC 1HQWA 5J96B 2MEV2 3V0BB 1QJY3 1J58A 2TEPA 4W6YA 1RUC2 3NAPB 1VBC1 2DUQA 2GNBA 1CGPA 3R05A 3VL9A 2D6KA 5T5OA 2EAAA 2ZGRA 4UBGA 1PO11 3POWA 4XFGA 4YVWA 2UY8A 1PGL2 1NQDA 1B35B 4J1XA 3WW4A 2OIIA 4MSVA 2NLRA 1DIWA 1V6OA 1BMV1 5KHGA 3AB0A 5FLHA 1ZRDA 1ZX5A 5DUVA 1LENA 2Z5WA 4JGYA 5JZGA 1URXA 2BNOA 1KXGA 4E2SA 5K0UC 3O14A 4XFHA 3E5XA 3O0WA 4A3XA 4CDQC 4BOWA 3TYJA 1HDKA 3H0OA 4XBQA 1QQP1 4XF0A 5FRAA 1Z78A 5JSOA 3SCFA 1FOD1 1S0JA 1H8TA 1UD1A 4HVRA 2Y0OA 1MR5A 2W52A 1GFF2 1OSGA 4MUVA 5JOYA 2YV8A 4WM7A 1MVQA 3ZIWA 3ZYJB 4DPNA 4MVTA 4A7ZA 2D3RA 2P37A 4Q8LA 1AXYA 1ND2C 1WW5A 4QGLA 4YW4A 5A33B 3FFQA 4I2OA 1VBA2 2OA2A 5I8YA 3EBRA 2MPFA 4L92A 3WG3A 1GYKA 4ASMB 3BCWA 1U12A 2XLGA 4XJ8A 5CFDA 1O7FA 1L3JA 3NV1A 3TN92 1PGSA 3VBSC 2ZHNA 3SH5A 5GLWA 3R4DB 1BYHA 1CAUB 5A3LA 1S55A 3ZXKA 3AM2A 1RC6A 1GLHA 3ES1A 3T1MA 1NYWA 1PO21 3WINE 4LR4A 1HRV2 4AGGA 1S2KA 3RMYA 1HXS2 2IXHA 5GLZA 4RHV2 1WW6A 1ZREA 1OPMA 4C0HA 3M8LA 4Q8KA 3QH6A 4BH9A 5GKAC 1H4HA 3TOJA 2HWD2 5KHHA 1BBT3 2V09A 3WG4A 3QD6A 2AH2A 2HWB3 4GMP0 5I0UA 2X8KA 4Y24A 4RSUA 4V1PA 2I74A 1SCSA 2A3WA 4EN8B 2PHTA 5CFCA 4FP3A 3CJIC 2A6WA 1QXJA 1AL22 1H2KA 3KCYA 4IESA 5K0UA 2VW2A 3H3ZA 5JVVA 2A5ZA 4COWA 3AKRA 4CDQA 3AXDA 1DGRA 2PLV3 1RUD2 1NXMA 4ATEA 5BNPB 2GC1A 5JIUA 4Y1UA 2Q4SA 4ZU4A 3AP4A 2VW0A 1RHI3 2KM2A 2JXAA 2BFUL 3LSEA 4MZUA 2D3PA 1F9KA 1RUNA 2VW1A 4R9DA 4E2QA 4P5HA 1CVNA 1XU1A 3VZLA 1S0IA 3HQXA 4LUKA 4JDOA 2AZ5A 1ND2A 1OLQA 4OI0A 2V73A 2XJVA 4LTAA 5GZFA 1R1ZA 5KXEA 4K9SA 4AEJA 1J59A 1RUF1 4IEZA 2XBO3 3KGLA 5GZDA 5AC93 3ZN6B 3JBG2 4Y4YA 5DDJ3 3VBSA 5KXCA 3B69A 1A78A 4HBNA 4OI2A 4H14A 4LE3A 4GULA 2BWAA 3MIDA 3FBYA 1VBB3 1ZBE1 2BW8A 2DCKA 3MDPA 4ISRA 2DCZA 3AK0A 1S0BA 2ZMLA 4NWVA 4ZU7A 2NMOA 4FPCA 1UF2C 4Q0PA 5D8AC 1U0AA 1TME2 4P9XA 1UW8A 2R042 3W9AA 2EA7A 2LM3A 4KBBA 3L9JT 4Z8BA 4EWEA 1AR93 1ALYA 4AHXA 2QQPA 2UYBA 1H4GA 2XVKA 3MIFA 3M3CA 1Z7S1 4BIOA 4D7TA 2ZPXA 2WFPA 5AVPA 2LUWA 4XIOA 1QMJA 3CJIA 1B09A 3DGTA 4X6QB 1VRH1 4O9EA 1D4M3 2PHFA 2YDEA 3AKSA 3MI8A 4XBLA 5T54A 5T5PA 2CYFA 4YFWA 3MW2A 1VAMA 4Q4W3 1PIV1 1LODA 1CESA 1TE1B 1ND3B 2YGMA 4D7SA 1C8M1 2NPIA 5KC5A 2A6VA 1GZWA 2I45A 3A0KA 1DQ0A 2H6CA 1CAXA 3GHNA 1WD4A 3EO6A 3M7AA 4Y22A 3SCHA 4AEDB 1W6MB 3ILNA 1C4RA 1W6NA 3WG2A 1F5JA 1HIXA 1PNGA 1FMD3 2P3IA 3HAGA 4G9SB 3UK9A 1XE7A 2ERFA 4K3UA 1ZA4A 1VIWB 3PJYA 5JWPA 3URFA 2R061 2Y26A 1GR3A 4FOVA 1WMEA 3M3QA 2RS33 1E57A 3DPRC 2AENA 4AW7A 1ULDA 3DV8A 4Y1ZA 4IV3C 2R073 3D5OA 4B8EA 4HZFA 3KSCA 1CIWA 2IZWA 3C3VA 5D8AA 1AYN1 2VULA 5FQ0A 4Q29A 2AR6A 2PAEA 2QDNA 1POV3 2BQPA 3BTAA 4Q4X2 3MIEA 2GMPA 1H0BA 4RQPC 1W2UA 3LAGA 3ZO0B 3N35A 3POYA 3ZYRA 1MZ5A 3NJZA 1S0FA 4Q4V2 1UZYA 2TUNA 3ZSLA 1VBE3 1FV3A 4OUSA 1NA1B 2ZCWA 3O5SA 1YIFA 4AI3A 2ENRA 2HJIA 4YVWB 1PM7A 1RMU3 2GALA 3K48A 3V65A 3D4KA 3NAPC 1R1A1 4YG3A 4NOTA 1RINA 4Y1VA 4K7JA 1C57A 3ENRA 4JGYB 1B35C 1GQGA 4IERA 3ZSEA 1I1EA 1IQAA 4B4RA 3WUCA 3N7MA 1HV0A 1G9BA 3WW3A 1WD3A 2BVBA 5C33A 1YLLA 4MYEA 4OHXA 4XQDA 1QWRA 2RHPA 2R0HA 2VECA 2QZ2A 4Q1RA 1UL9A 1CR7A 2VVEA 1AR63 3S6PA 1TNRA 3P3NA 1H8TB 3DPRA 2BWCA 2D97A 4WM7B 2A7AA 1KJRA 1V9U1 4FQ4A 1ZBA3 4IV3A 1O4TA 2ET7A 1MEC3 4IEYA 4K1ZA 1VR3A 1ZYBA 4YNIA 3J4UH 1T6GC 3AYDA 4AFMA 5ACA2 5FCCA 1PVXA 4E2GA 2DTYA 2R32A 4YZ1A 4D94A 4BYYA 4LLFA 3WDTA 3WCSA 4J6GA 3ETQA 4YG6A 3RRDA 3ZXJA 2HWD1 3VBFC 3MICA 4Q27A 4PIXA 3VBUC 2XJPA 4ITCA 4RQPA 4UW3A 2IFWA 1FPN3 2FMYA 1UCXA 3VKFC 5LRSA 1BVP1 4KG8A 4O9GA 5IK8A 1SBFA 2G9FA 1LGBA 5H9RA 4AFBA 4QGNA 3I59A 4AFAA 2HWF3 4LBQA 4YSFA 3NV3A 3KM5A 4UW6A 3RYKA 3D6EA 2RMU3 2TNFA 4XHXA 3NAPA 1KITA 1RVF2 1OKQA 4OLLA 1OD5A 2NQYA 1FV2A 1RITA 4S2DA 1AYM3 4S2HA 3GYDA 4LO5B 1QU0A 3ZXLA 5CFCB 1ZZ9A 5C9AC 1MZEA 3RJ2X 2PFWA 1MS3A 4FOQA 2DV9A 2VMGA 3OJBA 1RUJ1 4BMEA 4FOYA 1RB8G 3VKNA 3PNAA 2QZ3A 3FUQA 1WLCA 1RUH1 1VBC2 3DL3A 3ZDSA 3AZXA 3RS6A 1LGCA 1X82A 4DXZA 2DWRA 3ZMNA 1PO12 5CNAA 1NCQB 5JLVA 1R083 3B00A 4LO7A 5BNPC 2UYAA 3BODA 1DGRN 3BU7A 5H9QA 3FLTA 4M01A 1BMV2 2Q30A 1V6KA 5JI9A 4AVAA 1COV3 2WS91 1VB4A 4IEWA 4HKLA 2HYKA 5FDBA 3VBFA 5FPXA 2VPVA 3KZ4C 4W65A 3WDYA 4AFCA 5A33A 3VBUA 4R9AA 5JPNB 1OOPB 4Q4Y3 4AHWA 2DCJA 2JJ6A 5FAXA 5BPXA 2B5HA 3WZ1A 4XZPA 1C5IA 1O5LA 1LEMA 2GNTA 2ZGNA 4AHYA 3VZKA 1FAYA 1BZWA 2WNEA 1OQEA 1QQP2 2PN5A 4CDXC 1FOD2 1CAUA 4OZXA 3U0ZA 2DCTA 5HXVA 2IXIA 2ZX1A 1FXZA 3VKMA 3JQWA 1KS5A 3WW2A 1LCLA 3GALA 5JOXA 1Y43B 4P9LA 3USUB 4QXKA 4YZ3A 1GV9A 4XETA 1HRV3 1EV11 3GZAA 4OI4A 3VN4A 4KU8A 4DRRA 4R8HA 3ZMOA 1NXD1 1CX4A 1ENRA 2O1QA 5T5LA 5CAZA 3PVBB 1FNYA 5C9AA 4JGZB 2XJRA 4FSJA 2NZ9A 3TBDA 3QCWA 3SCGA 1BKZA 1W6QB 1PO22 2RM23 4BPZA 1FATA 1CJDA 3G7DA 1GZWB 2CV6A 4Q2FA 1YNAA 2JG8B 4XFBA 5BNPA 3QACA 4OUMA 4Y22B 3RG0A 1JBCA 1ND3C 1HV1A 2JDZA 2P34A 3W58A 4B29A 5HCBA 3PJQA 3ZYIB 4FPJA 3ZXFA 2A6ZA 5D1IA 5TSWA 3ZSKA 2WT1A 2DCYA 1HRI3 3RDIA 1H2LA 2D6MA 1XRUA 1CAWB 4Q4X1 3PVNA 3FZ3A 2PHRA 3MPBA 4AEDC 3KT4A 5L19A 4FTBA 3JCIA 1CONA 1Y7BA 4XW3A 5GLVA 2EXIA 1X7NA 2ZHMA 2FQPA 3OPZA 2BGCA 4XF4A 1O5UA 5C6CA 1MZFA 3ZN6A 4CDXA 3WX5A 1YFYA 4PJYA 2ZGLA 1D4VB 4QQ2A 4YW5A 5D8AB 1QJX1 5FQ0B 4TWTA 2DF7A 4P9GA 1LU1A 1QJY1 1CAVB 2EIGA 4Z92B 2MHFA 2B45X 3ZXAC 4FVVA 4LA3A 4XFIA 4QQHA 4Q1PA 4A7KA 3WVJA 5EZWA 1LB2A 3A4UA 2IXJA 4P9YA 2GNDA 4QPGC 3ZFEC 1AR71 5GZCA 3IIAA 1YCIA 2YC0A 1Q56A 2QE3A 5F6KA 2VNRA 4AWDA 3RMXA 1RGSA 3IM0A 2ETEA 1ZBE2 4MXVA 1NA1C 4H7MA 1RUG3 1I5ZA 3CJXA 1RUI3 3HIFA 1IHMA 3R4UA 4NHMA 2VUJA 4LO8A 3VBRB 2RS13 3AKPA 1WBFA 5I93A 1H9WA 4LNVA 4QQPA 4YRDA 4AVCA 3EQEA 3KD4A 3VHPA 1ND3A 2WLQA 3KS7A 4IEXA 2D44A 2ZTNA 1W39A 4KGQA 4XEZA 1Z7S2 2XVGA 4N7UA 2AYHA 2OUJA 4AGRA 1F2NA 4EV0A 5LEKA 2ZBJA 3JQXA 1N1TA 4AEDA 3AMNA 2CY6A 2SBAA 3DPRB 5KHIA 1J3PA 1WA4A 3IPVA 4FPKA 4YM1A 3H7YA 5I0TA 2DVFA 3GZUC 3OBTA 3WQ7A 1PK6A 2K2SA 2HEYF 3SITA 5KHKA 4GMP3 1AHSA 3VBOA 1WLDA 1FNZA 2VG9A 1PIV2 2WZR3 2GU9A 1MS1A 4OHYA 5IK7A 2HKXA 2WNVC 4JTOA 2W68A 3R6SA 3EHKA 2ZS6B 4K40A 4FPYA 1Q8VA 2HWE1 2ZA9A 5I0RA 3ILRA 4F83A 5SV5A 3S30A 5C8WA 2R062 3JB4C 3I59B 4XMAA 4QPGA 3ZFEA 1BBT1 1JN2P 3WCRA 4ES9A 3O12A 3I7DA 2D6OX 1NA1A 4H7LA 1LU2A 1JYCA 5CVRA 4C1WA 2Z79A 1D0GA 4DINB 1RUOA 2D98A 3AFKA 3VV1A 3NO8A 1AYN2 1DGWA 2JE9A 1H1MA 2WLPA 1YO8A 4R4XA 1BEV1 1EPWA 2H0VA 2WIIB 1AXKA 5J09A 4YVSA 3IDEA 1RHI1 1AX0A 1JOJA 4CEYC 4XFFA 5CFCC 3CLPA 4NO4A 4XPVA 4AQSA 1Z0HA 3JD71 3LOIA 5B2GB 3GZTB 2ZZQA 3OY8A 2NN8A 4LBKA 1G86A 5BNOA 2VVFA 3OBRA 5SV8A 2ZAHA 4N7IA 3NKTA 1R1A2 2RJLA 2VQAA 3KGZA 2EVXA 1UU6A 4PBPA 1MS8A 2RJKA 4M3CE 1NCQC 4ATFA 2DUOA 3RZZA 2EAKA 2JX9A 2DVDA 1NG0A 4AEMA 1SLIA 5FOBB 3VBFB 4HETA 2WNVA 4KG0A 1VBB1 3VBUB 1N3QA 1DQ6A 4AFDA 2WQZC 5CB7A 4XOGA 1AUYA 1XNCA 1H2NA 3AP6A 3J8F3 4J1WA 3FJSA 4I3GA 3IDCB 2I2SA 4KNCA 5E1RA 1N1VA 3FBMA 2JD4A 4Q0SA 1OOPC 4D69A 4H55A 2DU1A 1LECA 1AR91 1V9U2 3VBHA 3GBGA 2XJUA 3FFZA 2WA4A 4GB33 4WVMA 2A70A 4HLTA 4ZU5A 2BTVC 2A75A 2ZKNA 2QJVA 2D6LX 1G9DA 2ZX3A 4WVVA 5F1RA 2BFUS 1D4M1 1QHDA 1HQNA 4OVEA 4AG4A 5C9AB 4LBJA 5FREA 4YGBA 3SISA 4Q4W1 3RJRA 1HW5A 2RR13 5BYNA 4WV8A 2X5IB 2RS53 1LTEA 2DYCA 1DQ4A 1YYNA 5E8AA 3ZFFA 4CEYA 3ZXGA 4HKWA 1APNA 4JGZC 1NE4A 1QGLA 4BA6A 3AJYA 1VBD3 3ACLA 3AZWA 1AR83 4OHZA 1FMD1 4M0NA 2ZX2A 3JZVA 4GKYA 4SLIA 4KH9A 1Q8PA 1EAH3 2JG8C 1A6CA 2VQ0A 1NCQA 2RS31 1I3HA 4WVWA 4XHBA 4CP1A 2WKKA 2R071 1SBEA 1J3QA 3N3HA 5FPZA 4LBNA 1RUJ2 1S2BA 1UU4A 3H1YA 2NMNA 1BQPA 4LO4B 1UPIA 3SH4A 1RUH2 1ZRRA 4EN6B 4CDXB 3KCXA 5L7OC 4R9BA 2HWC3 4WZFA 5T50A 1POV1 2ZACA 4AK3A 4XF3A 1OOPA 4HK8A 4YGCA 1D2QA 4Y20B 1RIRA 4BQ1A 1QH7A 2XWBB 1IS4A 2KA3A 3H9AA 4JTNA 4CP2A 4BZ4A 1ZZ7A 1VBE1 4QM8A 1EPZA 1YUDA 4Z07A 4RA0A 1NCRA 3ES4A 2A71A 2WS92 2OZJA 3SHRA 2FHRA 1RMU1 1X50A 2BUKA 3QLQA 3USUA 1UIJA 4KGGA 1IS6A 5BV6A 5DXDA 3WP6A 4EWDA 1U5IA 1ULGA 3AMPA 4E4DX 4N9HA 1RUE1 1QDOA 1REDA 2BEOA 3RQ0A 3VZMA 4JGZA 1R093 4OFGA 1KRIA 4LBLA 3IN9A 4NPRA 4PQ9A 2CGPA 4IETA 4K6BA 3V56A 1W6QA 3FMGA 3HT1A 4GWNA 1AR61 3E6BA 5E16A 4IV1B 4YZ5A 4PDWB 3VBRC 2JG8A 1PZ9A 1EV12 2K0GA 3WXPA 2JKBA 2AREA 1ZBA1 3QBQA 4XQWA 3CF6E 3M2MA 5J36A 4YLZA 3IPVB 3LA2A 3VDDB 3WP3A 2WSVA 4JRLA 1PK6B 1PVC3 4LBQD 1QJU1 3VBOB 5JOWA 1CAWA 3I4IA 5L7OA 1GZCA 2QNKA 2YROA 4FPEA 4KQ7A 5BUVA 3E6CC 1RTVA 3JUUA 2N7GA 2EALA 1FPN1 4HL0A 5JR7B 2P2KA 1V6IA 3ME2A 1NY71 2GSYA 2ATFA 1X36A 2ZX4A 4KU7A 3WOGA 2E51A 1YWKA 2ZX0A 2UWBA 2HWF1 4RFT0 3ELNA 3HR9A 3WP5A 1N1YA 2RMU1 1CAVA 1LOCA 3LZZA 4KL1A 3CO2A 2Y0IA 1JXNA 2R30A 2W08A 1CPMA 4GXLA 1LGNA 4QPGB 3ATGA 3ZFEB 2CAUA 2WA3A 3GHMA 1AYM1 1EP0A 3MLLA 4ISQA 3ZPYA 1V6MA 1O4ZA 5KC6A 4B4PA 4A2UA 1RUF3 3UKVA 3ZFGB 4UXAA 4XDQA 5EJ3A 3HN1A 1QJX2 5DUWA 1QJY2 5F6LB 2E7AA 1H8VA 4EROA 4YVSB 4HVQA 2H6BA 3WLUA 4NVPA 2DTWA 3GF6A 1U5XA 4HVOA 1OQ1A 3VBRA 2BVVA 4RR3B 1C1FA 2CWSA 2Z42A 5F5QA 3NWKA 1C5HA 1Q5OA 3OY8B 5H9SA 4DRVA 5BNOB 2WFF3 3UKTA 2A3YA 2GC2A 3UJQA 1AR72 4K21A 3FC0A 2WC2A 1GNHA 1XNDA 3ZSMA 4JAAA 4N53A 3CNAA 5HCAA 2XUMA 1Z7S3 5AFBA 1CPNA 1WW4A 2ARXA 1QKQA 3VHOA 4JRAA 4AYUA 1X33A 2O8OA 4Q4Y1 5FO7B 1VRH3 2PHLA 1QJZA 2Q5TA 2R49A 2WNVB 5LK7B 4DNYA 2BBVA 4LLOA 4COVA 3M3IA 5FFOC 3DUIA 1NE6A 1V70A 1UKGA 4INDA 1H9PA 4Y1YA 4FXKB 4CP0A 4CDUC 1C8M3 2YY1A 3N7JA 3JU9A 1QOSA 4EN0A 2NYYA 5AFEA 4YGEA 5FMOS 3H1WA 2VH9A 3VBHB 4DZGA 3KB5A 4WVMB 1SMVA 1S0GA 2QCSB 1O3SA 1S0EA 3IT8A 5JPMB 4FAGA 3RNSA 2A6XA 1ASJ3 4S2GA 5IUQA 1AF9A 2WWSA 1IOAA