2OPKA

Crystal structure of a putative mannose-6-phosphate isomerase (reut_a1446) from ralstonia eutropha jmp134 at 2.10 a resolution
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
110
structure length
110
Chain Sequence
b'MDPKHGNLFADVPVGAPDEIFQPLLERKGLKIERIISNGQASPPGFWYDSPQDEWVMVVSGSAGIECEGDTAPRVMRPGDWLHVPAHCRHRVAWTDGGEPTVWLAVHCDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein
publication title Crystal structure of hypothetical protein (YP_295660.1) from Ralstonia eutropha JMP134 at 2.10 A resolution
rcsb
source organism Ralstonia eutropha
molecule tags Isomerase
total genus 16
structure length 110
sequence length 110
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2opkA01
4HVRA 4FAGA 4I01A 4WVZA 4IEZA 3WW1A 4F7ZA 1YUDA 4XFHA 2PQQA 4HVOA 5FLHA 1YLLA 1CAUA 1G6NA 2BNOA 4XFIA 2CAVA 2XLAA 4KWKA 1X82A 2UYAA 4LTAA 4I3PA 1Y9QA 5CVRA 5FLIA 4EV0A 3S0MA 1RGSA 3QOPA 1YWKA 1ZX5A 3E6CC 2Y0OA 4MGKE 1SEFA 3IBMA 2GU9A 4LUKA 3E6DA 4UXAA 5KBFA 2K0GA 3HT1A 3H9AA 3EO6A 4O9GA 4ORFA 4J1WA 2OPKA 2XL7A 1J3QA 3MPBA 1WGPA 4QMAA 3IIAA 2XLFA 3OF1A 4JTNA 5EZWA 2CAUA 4I0BA 1VJ2A 4Q0UA 1LR5A 1EPZA 4ZU4A 4QX5A 5I8TA 2P17A 4NVPA 4YARA 1UW8A 4KU8A 5LRSA 3KMHA 4LULA 2ZKLA 2XL9A 3RZZA 5D1IA 1VR3A 4LA2A 1CAWA 3SCFA 1J58A 3OCPA 1YFWA 1Q43A 2OZJA 3SCHA 3C3VA 2MHFA 4MGYE 1I5ZA 3ACLA 2I45A 3WW2A 1DGRA 2K9ZA 1ZZBA 4Q29A 4QM9A 2IXIA 2MPFA 2BYVE 5I8SA 1WLTA 1ZZ6A 4XEZA 3S7IA 3ST7A 2EA7A 1EYBA 1QXJA 2PTMA 3BALA 3I54A 1IPJA 3RPQA 3PVBB 4KWLA 4XF3A 3H1YA 2PAMA 1QY4A 4XF9A 2Q0AA 2B8MA 4IEQA 1VP6A 5I0RA 3RYRA 3BU7A 4IEVA 1NE4A 4MX3A 2V09A 3EHKA 1CX4A 4Z07A 2O1QA 2PA7A 4LLOA 2UY9A 4XF4A 4L11A 3M70A 1UIKA 3H7JA 5J48A 3EQEA 1ZZ9A 4HMZA 1SFNA 2FMYA 1PMIA 5JCTA 4Q0SA 4X6QB 3LOIA 4META 2IXJA 5FPZA 2Q30A 1FXZA 3CLPA 5FDBA 3FX3A 2CGPA 4IEXA 4J1XA 4N9HA 2FQPA 1ZRCA 4WZCA 1OMIA 3ETQA 1I6XA 4YYOA 3UKTA 2XHKA 2IXHA 3OD0A 3D82A 1WA4A 2OYZA 4YRDA 5KHHA 3IDBB 2DCTA 2ET7A 3E5QA 4TLFA 3HIFA 5E1RA 2N7GA 4AVAA 2QNKA 3TNQA 4LEJA 2Q1ZB 3I59B 2H6BA 1CAXB 4IEOA 2BGCA 3DL3A 1ZZ8A 3USSA 4LA3A 4MGIE 3KGLA 5JAXA 3SXWA 1CAUB 3U10A 2VPVA 3D0JA 3DN7A 5BV6A 1U12A 3LAGA 4JVAA 1X8MA 4BIFA 3H1MA 3HT2A 1RC6A 3H8UA 1NYWA 2ZCWA 1CAVB 1O3SA 2C0ZA 3O14A 3H1WA 4ONUA 3UKNA 2QCSB 2BEOA 3NL1A 3PNAA 3ZDSA 3ES4A 3H50A 3LZZA 5FQ0B 1YHFA 2XKOA 2GC2A 5BXXA 1O5UA 3EJKA 1Q3EA 4RD7A 4QM8A 3CO2A 3D0SA 1HW5A 2EVXA 2VQAA 4E2QA 3H3UA 3G7DA 5CADA 3LA3A 4L2NA 2IXCA 1NE6A 5K8SA 1DZRA 5BUVA 5I93A 4HLTA 4H7LA 4IEYA 2UYBA 4WBBA 2PFWA 3BCWA 4XF0A 1LRHA 3SCGA 4AQ2A 5I0SA 1O3QA 3KGZA 2GH2A 5FPXA 3M3IA 4IEUA 1CAWB 3FHIB 1O7FA 1ZNPA 4MUVA 2IXLA 1EY2A 2PHLA 2D40A 1H1IA 4Q0PA 4IESA 3WW4A 4UBGA 5BPXA 1XE8A 4I0AA 3TNPB 3E97A 4DINB 3GYDA 2CV6A 4D7SA 2WFPA 3IDCB 3E5XA 3KSCA 4ZU5A 3KCCA 3RYKA 1GQHA 5KHJA 4EWDA 4Q0VA 2D5HA 2F4PA 2GC3A 2XKPA 1J3PA 1UCXA 4MH0E 1RUOA 5C6CA 4XFAA 5KHKA 4Z82A 4F8AA 4FBFA 3R6SA 1H1MA 4XFFA 1PM7A 3HQXA 4R8HA 4PJYA 3LA2A 4XFCA 1NXMA 2O8QA 2XLGA 1ZZ7A 3UKVA 5JR7B 4YSFA 1DZTA 3QACA 2EAAA 1QXRA 1RL3A 1TQ5A 1O5LA 4I09A 1LB2A 3CL1A 3E6BA 1FT9A 2GC0A 2QDRA 3I7DA 3EBRA 4ZU7A 2UY8A 4A2UA 5HI0A 1CGPA 2HJIA 5I0UA 3LA7A 1UIJA 4HSJA 2ETEA 5LRRA 1IPKA 3H3ZA 3I59A 3BPZA 1Y3TA 4EWEA 1CAXA 3NKTA 3NW4A 1DGWA 3SMHA 4PIXA 1YFXA 1X8EA 3U0ZA 2D93A 1XE7A 1L3JA 4D7TA 1JUHA 3FFQA 4BHPA 4AVBA 1Q5OA 4Q0QA 1ZZCA 1UD1A 1YFYA 2OZ6A 4MZUA 5BY5A 4HZFA 2D5FA 1CAVA 1XRUA 4R52A 5FCCA 4AQ6A 4B29A 2WC2A 5FLJA 4EWAA 2GC1A 5AVPA 4GULA 1UPIA 4JTOA 3SHRA 3E5UA 5JSPA 2BNMA 4QGMA 1OD5A 5J7MA 4MV2A 4P9GA 5FQ0A 3PLQA 4IETA 5KHIA 3L2HA 4PIYA 3MZHA 3NJZA 4X6RB 4HVQA 4KL1A 1O3RA 1ZREA 2PAEA 1YFUA 2KXLA 3CF6E 3OGJA 1RUNA 3DKWA 4XF1A 5T3NA 4AVCA 1RTVA 4IERA 3FJSA 2H0VA 3GBFA 4BH9A 2PYTA 3VHRA 2B9UA 4QXKA 1FI2A 4OLLA 4OFGA 3JZVA 3WW3A 1ZRRA 4KWJA 2PHDA 1O3TA 4HN0A 2OA2A 3OTFA 3RYPA 3S7EA 3DV8A 1EP0A 3B02A 3ELNA 4FAHA 1SQ4A 1J1LA 2GAUA 4N9IA 2E9QA 2B5HA 5J3UA 3BB6A 1V70A 3RNSA 2GZWA 2VECA 1ZRFA 5E16A 5JSOA 3IWZA 5EFUA 4HN1A 3CJXA 4FT8A 4K8FA 3N4MA 3MYXA 1OI6A 5C8WA 2QJVA 3U11A 1GQGA 1LKNA 4BYYA 5I8YA 2IC1A 4XFGA 2ATFA 4XFBA 5LEJA 2IXKA 4MGZE 4HSLA 4JV4A 3FE5A 3RDIA 4AXOA 4E2SA 2H6CA 1NZCA 4QGNA 5I91A 5LEKA 4I02A 3FZ3A 4KU7A 2PAKA 3H7YA 4IEWA 4O9EA 3LWCA 3NVCA 4UBHA 5I0TA 3NSTA 2Z69A 2Q4SA 3ES1A 4PIZA 2Z2SB 4HBNA 4QGLA 2HKXA 2MNGA 3FWEA 5JSRA 1O4TA 4IEPA 4YNIA 2BNNA 1QWRA 5KHGA 4I2OA 1ZRDA 3ROUA 1OFNA 2QVSB 1J59A 4EROA 3CEWA 5CU1A 4CYDA 1X7NA 2ET1A 4XETA 1J3RA 2XGXA 4E2GA 5F1RA 1ZVFA 3MDPA 4LUMA
chains in the Genus database with same CATH superfamily
5FY4A 2RJLA 2SBAA 3WW1A 2VNOA 4F7ZA 2D7FA 1S55A 5FLHA 2XXZA 5JOZA 3B69A 1C1FA 4MYEA 2F6BA 3POWA 4Y3OA 1IKQA 3CZJA 3M3OA 5FWJA 1NXD1 1GUIA 2YB7A 1QJFA 3O12A 2RDRA 1SZBA 2E63A 1VBE1 1G9FA 3HNMA 5D8AB 5C3SA 1BCXA 3KZ4C 2CGNA 4FPEA 1W6PA 3NV3A 5GKAC 2PELA 1BK1A 1ZX5A 2W1QA 3AKRA 3J8F2 4RN5A 2Y0OA 4XUPA 5HXVA 2OIIA 3IBMA 4UXAA 1GZTA 4XUNA 2K0GA 4N90A 1OQEA 3GXUA 3U75A 1OUXA 1MS3A 3EO6A 3USUA 1POV3 4J1WA 4QB1A 1V6MA 5K0UA 1RUI2 4XIKA 4JTNA 1W6OB 3TN93 3VKFC 3AKTA 4I0BA 1B35C 3WQBA 3ZXKA 1Z7S2 4DRVA 2AGSA 4Q0UA 1LR5A 1O91A 3N9NA 3ZFGA 5EJZB 4XXAA 1OA4A 2V73A 2YXSA 1BLZA 4UOJA 4NVPA 1WCKA 1UW8A 2ARAA 1OFSA 3MLLA 4D6QA 5LRSA 3UETA 5LCWL 3CJIB 1OF3A 1AX2A 1PO22 2JWPA 3AZWA 3PU8A 3VBRA 4JDMA 3O1TA 1H9PA 2XL9A 1VAKA 4CPBA 2VNVA 4BU2A 1SLBA 4NOTA 4DPNA 1GQPA 2JDNA 2Y8KA 2QQUA 3LEGA 1CPNA 2WDBA 1J58A 2BJSA 3KWVA 1YFWA 1AXZA 3PTYA 4MGQA 4QX8A 4Y5Z0 2WZPP 1ZBA3 3RQ0A 3WT3A 2X8KA 3C3VA 5C5TA 4DXRA 4LKDA 1W8ZA 3T3YA 1JZ5A 4QB2A 2P3YA 3MIBA 4BISA 2HLEA 5DDJ3 4D7YA 2AACA 1RUH2 4AI9A 2X5IB 4Q4V1 4Q29A 5IVCA 3I3DA 3A23A 5A7SA 3KF3A 2QQJA 3LEMA 4ZZ8A 1DQ0A 3URFA 1HX6A 4AEDA 1ND3C 3N7JA 4S2FA 5DZGA 2YC2A 1ZZ6A 1PO11 1DYOA 3AJYA 3U14A 3VDAA 1OKOA 3ZVXA 1PZ9A 3TEWA 5FY0A 2WN3A 3I54A 1IPJA 1REFA 1H2MA 4KWLA 4DXZA 1AYN1 2E51A 1QY4A 4OMCA 3S57A 1VBE2 1R083 1HB2A 1K45A 4XIOA 4YLZA 2WWUA 1LOAA 3MI8A 4YG0A 1DGWX 4IEVA 1QU0A 2EIDA 4LQRA 1NE4A 4NHKA 1QJU2 1GNZA 1LOCA 3I2GA 4B7KA 4LBMA 2VC9A 3N35A 1NLQA 2CSGA 2PHXA 2W08A 2Y6FA 4GA9A 2AEYA 2DYCA 1LOEA 3EQEA 4RGGA 4DFSA 4RQPA 1Q8SA 2FMYA 3ZFFA 3L2YA 1ZA4A 3UNPA 4NN0A 1PMIA 4CP2A 5FPVA 3IN9A 2C26A 1KGYA 2IXJA 4IW3A 5FPZA 5ACA3 2Q30A 1FXZA 3SKVA 3KB5A 1PM4A 1SLCA 2P3KA 4J1XA 1HQNA 1UZ0A 2ZGUA 4RS5C 3NAPB 4COUA 4CP1A 1RVF1 5A70A 4H14A 4E8CA 2C6SA 1KDMA 4L8QA 3FHAA 1D0GA 1OMIA 3IIIA 2ZGMA 4BCUA 3I2KA 5FZIA 5D2AA 3ETQA 1QJX1 4QPYA 5CISA 4BA6A 4WM7A 3HBZA 3K46A 4QX3A 4Y5SA 5D21A 2WZEA 5FZDA 1VBC3 2HYKA 3D82A 1LU2A 4M0HA 1WA4A 2OX0A 1XU1A 2W2IA 1XJAA 2OYZA 2ARCA 4YRDA 1JI6A 4YVSB 4Y20A 2Q8EA 2ET7A 2J22A 3LF7A 3MFCA 5KXDA 1HRV3 1REEA 3E5QA 1Y9GA 5FZAA 4YM3A 5JZGA 5LA2A 3AJZA 1DQ4A 3TNQA 1Y43B 2GP5A 1RUJ1 1ZRIA 5HV0A 5EQUA 4FPYA 4XHXA 2VCAA 2FDGA 3MW3A 1RIRA 1WD3A 2XWJB 1HXS3 5JDBA 4XJZA 1PO12 1V0AA 2OUHA 3OEAA 3AL6A 4GH4A 2VBDA 4LA3A 3CDZB 4K3UA 4MGIE 5FRAA 5A7QA 5JAXA 3GZEA 4H2AA 1JOBA 1HV0A 2DUQA 2WZR3 5IWFA 1CAUB 1DDLA 2UWBA 2JKBA 3K51A 3T08A 3D0JA 4Y4YA 3ZYFA 4YM2A 1AYN2 1U12A 5L7OB 2ILMA 4BIFA 2AZ5A 1H9WA 4QHBA 1S2BA 1QDOA 2O8OA 4UYBA 3W20A 1MR5A 1VPHA 5CFDC 1RC6A 2GN7A 3H8UA 2RMU2 3GBGA 4IV3B 2HYXA 4HANA 1UOGA 1UZZA 5FJKA 2DVFA 1M4WA 4EZHA 5BNOB 3H1WA 1UPSA 3HBKA 4ONUA 4EZ4A 3NL1A 4OI1A 1H8VA 3JCIA 1WW6A 2Y6GA 3LZZA 1CWPA 1YHFA 2VO5A 2VH9A 2W9XA 5GLVA 3I3MA 3R4DB 1QIQA 2R0HA 2W92A 3O1VA 2NQYA 2DV9A 3D0SA 3NJXA 1HQLA 4L0PA 5A7WB 5LW9A 3ZR5A 2WR9A 4FTEA 4FTSA 1JZ3A 3LA3A 2R30A 4P9IA 2JG9C 3O0XA 1JYWA 1HN0A 2DFCA 1RVF2 3OUIA 1QJZA 1NE6A 3LIHA 4YVWB 3WQ1A 1JODA 2P6CA 5IT6A 1NY71 1ZBE3 1OLRA 1Y4WA 4CDXB 3MIGA 1C1LA 1QJX2 1W6MA 4IEYA 5B2GB 1XSQA 2X05A 4XF0A 1OURA 1LRHA 1R64A 3N9PA 3WDVA 1U5YA 4AQ2A 2WNUC 3KGZA 1K5MB 4D3WA 1C28A 1I1EA 1MS5A 1OOPC 1GR3A 2B42B 3ZSMA 1D0HA 4FP2A 3VD7A 1O7FA 5IK8A 4M00A 3H3LA 3PUHA 3VBSA 3IPVB 3V56A 1VBD3 2WO7A 3MW2A 2D3PA 2ZPXA 4IV1A 3GHMA 1S0CA 3GYDA 3TNPB 5C5UA 2CV6A 2E53A 1H8TB 1AR93 2WFPA 1W0OA 2E33A 3WINE 4Q4Y1 3RYKA 1GQHA 2JDPA 1AYM1 3W21A 2D5HA 1GOGA 1AR73 2YHJA 2HEWF 2ZHKA 4MH0E 1RUOA 2B9VA 3AKSA 3C7EA 4LMFA 5C6CA 2ZZQA 4JGYC 4NRQA 3LDBA 4BE3A 2ZHLA 3AZXA 4BIOA 4XMAA 4Z82A 4F8AA 5KHKA 4DNYA 1MVEA 3BTAA 2D98A 5FPBA 2ZA9A 1H1MA 2BW8A 1ST8A 3LSDA 1QJY3 1FV3A 4PJYA 4ASKA 3MLKA 1CQ9A 4MGSA 3V0BA 2CDPA 2XLGA 2ZX3A 3FFZA 3NNJA 3RI8A 1A34A 1B09A 4YSFA 1DZTA 2A71A 1PVXA 4Q4W1 5EPAA 4N7UA 4E9KA 4YW7A 1CJDA 4NRMA 4BB3A 1TQ5A 3KD4A 5EJ3A 2VD7A 2V5DA 3LDRA 4GJZA 3CL1A 5C8CB 5AFBA 1VBA3 4GWIA 2XWBB 2YBKA 1MZFA 2QDRA 3I7DA 5GALA 4ZU7A 2UY8A 1T6BX 1UXXX 4A2UA 2ZHNA 3AFGA 2CU5A 3B9IA 1EAH2 1M06G 3X29B 1O8PA 4C1XA 3ME2A 1UY3A 1MS1A 3CHXA 3BPZA 2VMGA 1LHWA 1HLCA 3EYPA 4NE9A 1YQCA 5DUVA 4BQYA 4PDWB 4COYA 1ASJ1 1YFXA 2WQZC 2G4IA 2HH9A 5F2SA 2QQLA 1XE7A 2FBEA 2RJKA 2P37A 3FN9A 3GM8A 1L3JA 2Q8DA 3WDYA 4NHLA 3A0NA 4AEJA 1NY72 4Q1RA 4XQ4A 2W47A 3I3QA 4IXLA 1UAIA 5LZ6A 3ZFEA 5BYNA 3TYJA 2LALA 1DIWA 2FMDA 1FPN1 4X8PA 1KXGA 2OVUA 1CX1A 1RJ7A 1UD1A 1YFYA 4Y22B 3Q8FA 4GD4A 4RR3A 1ODNA 4MZUA 1F5JA 4XURA 1Q8OA 3POJA 4TWTA 5CEHA 1V6OA 2Y26A 1CAVA 4R52A 4ASMB 4AVSA 4B29A 3AXEA 2VCBA 2RS13 1QOOA 4IGQA 2VZSA 3Q8CA 3R4SA 5AVPA 4KWUA 1S0IA 3GJBA 1PVC1 4HETA 5FZ4A 4AYUA 1OD5A 4RYDA 4QX7A 3PLQA 4KNCA 4AHYA 4LXLA 5LK7B 2RJ2A 3ZSJA 4MXWA 3GJAA 3AMQA 5JLVA 1V6KA 1VALA 2IUWA 3MV11 4FTBA 5FP4A 1AYM2 1WD4A 2G9GA 3KV9A 1AR63 3FUQA 2JECA 4HVQA 3T0AA 1IKPA 1ZREA 2XUMA 1YFUA 2YYOA 2KXLA 1B35B 4XF1A 4M4PA 1RUG3 5K0UC 2JDHA 4Q27A 3KV6A 3MUY1 4YWAA 1JHJA 4LKFA 1SPPA 1RTVA 1APNA 3VBOC 4BMEA 1R1ZA 5CB7A 5A3PA 2WQ4A 2R061 1OD3A 2PYTA 1FOD1 3GBFA 3H42B 1COV3 4BH9A 4NR1A 1ND3A 1W90A 4LOTA 3JD71 4QXKA 4RHV2 4UW5A 4X8NA 3ZFGC 4MGTA 1DP0A 1H0BA 2WWJA 4CDWA 3KT1A 1FMD2 1IS5A 4Q5OA 1SG3A 4Q4W2 1ZRRA 4KWJA 4W6XA 4YM0A 5JI9A 1U5XA 1SBDA 1WCDJ 1LESA 3OTFA 5T5JA 1BEV1 2RM21 2WJSA 1EP0A 2GH8A 2R49A 2FCUA 5FP9A 1TEIA 5JIAA 3RWKX 2KA3A 4FAHA 1J1LA 1VRH1 2E9QA 3IDAA 4AK3A 2HWF2 1MEC1 1LTEA 2PLV1 3FHQA 1MS9A 2VECA 1WW5A 3OGVA 2R6QA 5DAXA 5FZ9A 1MQTB 4I0WB 2YDEA 5E16A 3SITA 2HWE1 3VLBB 4FT8A 1POQA 2Y6HA 3N4MA 1C5HA 4CCKA 1GP5A 4IUGA 4PT6A 4K6BA 4KGQA 4NMIA 1ASJ2 2VQ0A 2IC1A 4YW3A 1UO9A 4FPJA 1UU5A 3ZX7A 2D6OX 5FP7A 5A33A 4CPBD 5FYMA 3ZIWA 5LEJA 4OHYA 4URTA 1A8DA 2VUJA 1QQP1 3NV4A 5FXVA 1SFPA 1UYYA 4AEDC 4LO5B 4E2SA 2JIGA 2RS32 3A22A 4XJ8A 4E4ZA 5IVEA 1JTZX 3POSA 4YGDA 1FPN2 2WYFA 2X10A 1Q56A 1ZA7A 5H9PA 5EJ1B 1HDKA 5IVFA 2QQKA 2P6HA 1PZ7A 3J8F3 2PAKA 2WINB 4XUOA 4CEWB 2BZDA 1DQ2A 5CAZA 3KT4A 2VZPA 1AL0G 1OPMA 5I0TA 1V00A 3MF9A 1IZ3A 2F17A 2VUCA 1VBB1 4KG0A 3T4HB 4H7MA 4BXFA 2Q4SA 2YG0A 3WDTA 4HBNA 3JU9A 4QGLA 1PK6B 4ARXA 1RUI3 4P00B 3U4XA 2D6NA 4OZXA 1W6NA 4BQ5A 3WG2A 1OBNA 1D2SA 1ZM1A 3FWEA 1QNYA 3V65A 4DIQA 5EIYB 2WBKA 3LPFA 1G9BA 2BNNA 2OT7A 2QZ2A 1XQNA 3OBAA 1ZRDA 1Z7S3 2D43A 1ULPA 1OFNA 3H8OA 1NLSA 3V0AA 4PHZA 4QPIB 1S0GA 1H4GA 4LIVA 3BOPA 4RQPC 1N3OA 1YJLA 1N1VA 2WKKA 4Q4X1 1PO23 3ZFFC 2XGXA 1GWLA 4TZDA 1MVQA 3T2TA 5F1RA 2R062 1FOD2 3MDPA 4B8EA 4NWVA 5JMCA 3JD72 4IEZA 4FFHA 1BBT1 1YUDA 4XFHA 4YZ3A 5F5AA 5DG2A 5FZHA 1LHOA 1DFQA 3POEA 4GWJA 1S2EA 4UFLA 3KQ4B 5FZ6A 4XFIA 5BNPA 1A6CA 1RUD1 1NCRB 2XG3A 4CP9B 4YGCA 3N9QA 1BEV2 1U5IA 3BTZA 3NKGA 3DPRB 1VRH2 2VUAA 2UYAA 3CQOA 2P1BA 3OPWA 4WM7C 1JW6A 1RUE1 2JB8A 3P3PA 2PLV2 2VXRA 1PNFA 1Y9QA 1J1TA 2W0XA 3NV2A 3HJRA 1RUH3 4XJWA 5CFDA 3LEKA 5A80A 3S0MA 1RGSA 1YWKA 4GB31 1IQDC 1R1A1 2HWE2 4LPLA 4Y33A 1G9CA 4PCRA 2GMEA 3RZHA 2VNGA 3E6DA 3J7NA 3OB8A 4NO4A 3GF6A 1FX5A 4XHBA 4XTPA 1AUYA 4W8JA 5GZDA 3SEPA 4CCJA 5JZGC 2ZEXA 2HWC1 3H9AA 3THTA 2QFEA 4WM8B 4LORA 2XJRA 4ORFA 5EXOA 3C7FA 2OPKA 1DU3D 4LBLA 1QQP2 2VL4A 3MPBA 3UGGA 2RR11 3LEIA 4FVVA 4LE3A 4DY5A 3IIAA 2HWD1 2DCJA 2W1UA 3KVBA 2CAUA 4BK5A 3PUIA 1VBE3 1KFUL 1X50A 4K40A 4GH4C 5HCAA 2JG9A 5CG8A 2XBO1 1PIV1 3K75B 1EPZA 5JXGA 2CYFA 2ZGSA 4ZU4A 5I8TA 4R9DA 1JOPA 1QJU3 2P17A 3PMEA 4CDUB 2A6WA 4OHWA 3UGHA 1W8UA 1W9TA 2NPIA 3ZN5A 4XCBA 3RJRA 4Z2AA 2ZKLA 1SLLA 2WO1A 1JYXA 3RZZA 5FZGA 2WNUA 4FOQA 2AYHA 1QDCA 4QXBA 4V2WA 1CAWA 3WCSA 5J1XA 1OOPA 3T2OA 2WWSA 3N9MA 3SCFA 1GU3A 2OKXA 1R092 3N7MA 2FCTA 5J37A 3WNKA 1Q43A 4CEYB 2DU0A 2VOXA 1HB3A 2MHFA 2AC1A 3AKQA 3VBHB 3AP9A 4W50A 4E2GA 3RZKA 4ZXKA 1UU6A 5LB6A 1JU4A 1MZ5A 1LOGA 3DKQA 1ENQA 3WW2A 2K9ZA 4Q4X2 5IYYA 3KQRA 1ZZBA 3SC7X 1TMF1 3LB9A 3WV6A 1SLAA 2R32A 1D2QA 2WNVA 3UESA 2ZX4A 3WDWA 4AZZA 1BBT2 4FFIA 5I8SA 2ENRA 1CIWA 1W2NA 4R9BA 1WLTA 3RZJA 3S7IA 4OI4A 3PTRB 3ST7A 2VZOA 4B1LA 4F83A 1NA1B 2ARBA 5A6YA 4AWDA 4NRPA 3RPQA 4FFGA 1I9RA 3UYJA 1CR7A 4QQLA 3OBZA 3PVBB 5FYVA 4G9SB 3WLUA 4A41A 4QX0A 3WF3A 2Q0AA 1LEMA 1RUE2 5IW0A 2EIEA 4E4HA 1VAVA 1VP6A 4MXVA 3U1XA 4BQ1A 5EYYA 1XC6A 1A78A 1QJEA 5L9BA 5B4XA 3BU7A 1AR81 1AVBA 1BHGA 4LO7A 2DVGA 4OI2A 2FDFA 1HRI1 1UY1A 3QH7A 4G4FA 1CX4A 4I30A 3PVNA 1OA3A 1PO13 4Z07A 5F9TA 2ZACA 3VBSC 5HPOA 2UY9A 4XF4A 2FDKA 1NG0A 2J42A 3OYWA 4W4ZA 4AVVA 3VKOA 3UGFA 4IV1C 4K8RB 1G9DA 3AX4A 4PI0A 2CDOA 4QQOA 4Z2WA 1GWKA 1AL21 5J48A 5FIXA 5LA0A 3WD5A 2VQTA 3TEYA 4JGYB 4CZSA 3ZSKA 5A3LA 3MICA 1AYN3 3N9LA 2RR12 5EP9A 1ND2A 4PBOA 3THDA 5CFCC 1LHUA 4FOYA 3C8XA 3LOIA 1WLDA 5FZCA 1ULEA 5C4WC 1QF3A 1W0PA 2BVBA 2RMU3 5GZEA 5T55A 3GZUC 4IEXA 4JHTA 4QX1A 2WS92 3GCWA 2VZ3A 4JC1A 5FP8A 1UXZA 5A3OA 1CPMA 5FY5A 1ZRCA 3HNYM 3W9AA 5F8PA 4WZCA 4XZUG 4IE0A 4QDRA 4AI3A 4GMP0 1JHNA 5A32B 3VDDB 4AAPA 1I6XA 4PBPA 5JUVA 1XB9A 3V64A 4BOWA 1QH7A 3W59A 2HBTA 4CCDA 2XHKA 5D8AA 2IXHA 3VZMA 1N1YA 5KXBA 1JZ8A 5CZKA 4AGVA 1NQJA 1GNHA 3MLJA 3VHNA 3Q8BA 5KHHA 2YZ4A 5F3EA 2W39A 1WCUA 3RS6A 2PHTA 4AL9A 2D6PA 1KQRA 1DLLA 5IUQA 1RVF3 5IATA 3LGRA 3LSEA 3NNGA 5DPNA 4QU2A 5E1RA 1F2NA 4WVWA 5FP3A 4CUBA 5IFTA 4ATEA 2QNKA 3ORJA 5FY8A 2WFF1 3OJBA 2GMPA 2Q1ZB 3JBG2 2TBVA 4OZOA 1QJX3 3KHBA 1EV11 1WZXA 4Q26A 5FZ0A 2H6BA 1CAXB 4D0QA 1W6OA 4QKDA 3WHUA 4ZKTB 5FPUA 5KWRA 1ZZ8A 1QXPA 3USSA 4QXCA 5FUNA 5GLWA 2Q8CA 3B94A 1YIFA 3VBOA 1NX9A 2CGOA 4PF5A 5A3NA 3OEBA 4RGAA 3WP6A 3ZLIA 3DN7A 4QD2A 4OCTA 3ZFEC 1K5JA 2R7EB 4AFBA 3CJIA 4ZS2A 3DCQA 4B4RA 2JENA 1RUF2 2Z79A 2HWB1 1TNRA 2YV8A 1ZYBA 4RA0A 3S7EA 4RR3C 4Y5TA 4ET7A 3FBMA 4COVA 2W5FA 2ZCWA 4LHSA 4YGBA 1RMU2 1AR82 1W6PB 1O3SA 3KV4A 1SCSA 3UKNA 2YGMA 1D4M1 3N3HA 2BEOA 3PNAA 5FZOB 5A1LA 3ZDSA 1F4AA 3HQRA 5CYYA 4QPGB 4A7KA 2R041 3JXSA 4G3YC 2XKOA 4W65A 3PUSA 1AX1A 1AL22 3WG1A 4LBQB 3T2PA 3VKNA 2BERA 1Q3EA 4N53C 4Y24A 4CCEA 3WNLA 1LAJA 1BYHA 3AP6A 2VQUA 3CO2A 3J7HA 1UQXA 2ZJCA 3T1LA 3TB0A 4DS0A 2X5IA 4ISRA 4LK7A 4KMQA 3H3UA 3G7DA 3P3NA 1DG6A 5CADA 5C3PA 2AENA 3DXTA 4FPGA 4JGZA 3I2FA 5F39A 5JOXA 4JHZA 2ZGNA 1DZRA 3Q9OA 1URXA 4KBZA 5I93A 3M3QA 4S2GA 3ZYRA 5FR3A 2XJVA 4AFDA 2PFWA 2XVLA 3BCWA 4CDWC 3LD8A 4XBLA 4DB5A 4LOSA 4BM8A 4FPOB 1O3QA 1EAH3 1W2OA 2GH2A 3PIGA 1SACA 2W46A 1DGLA 1TVGA 3M3IA 5L73A 4AI2A 3FHIB 4CU8A 3WOGA 4DRRA 5BNQA 3UV9A 4UFHA 3PJYA 4CCMA 1JH5A 2RS51 3CIHA 3BKZA 2VMFA 5L19A 2IXLA 3LPGA 3AC0A 3FLTA 2PHLA 3AMPA 4GWMA 4HK8A 4CU6A 3WW4A 2VU9A 4UBGA 3JQXA 1PZ8A 1XE8A 4I0AA 4UFJA 1DHKB 1IOAA 2BOJA 4UWDA 1YQ2A 1YC61 2WFF2 4FSJA 2IVIB 5A3MA 1UZWA 3EB7A 3KSCA 4YG3A 1EV12 3KCCA 5E8AA 5KHJA 2BUKA 2LUWA 2JDUA 1C57A 4CDQA 1NCQB 4UF0A 5CA6A 3WNXA 1J3PA 4CP0A 5I0DA 4BXSV 4XFAA 2RE9A 4CTEA 4FO9A 5FAXA 1Q8QA 1VMHA 3GDBA 1JU3A 1BK0A 3NAPA 3R6SA 3WP5A 3MUZ1 3GBWA 5T50A 4XFFA 3J7LA 5G04L 3ZXAC 3D4KA 4R8HA 1UOBA 1WLCA 2ZEZA 1NXMA 1ULGA 3POFA 5KBFA 2GSYA 3M8LA 1HKDA 4MADA 4BQ3A 3UKVA 1UZYA 2JG8A 3MIHA 3BU0A 1SDDB 2RDNA 5HCBA 1FYUA 5IVVA 3W5MA 2C9KA 1AYM3 3TAYA 1LOBA 2V4VA 1OHFA 2VZUA 3D5OA 3GCXA 4LBKA 3OPZA 1F31A 4ZZ5A 1LB2A 1EUTA 2C9AA 5SV5A 4YVSA 3LFIA 5A6ZA 1CZSA 2VZVA 4LBOA 1STMA 1VAMA 2R042 4IDZA 1W6QA 1PGL1 1SBFA 2HJIA 4J25A 4DEQA 5J96B 3LA7A 4HSJA 2ETEA 4OHXA 5G05L 4AFAA 4RHV3 3HVDA 2ORXA 3ZFFB 2ZGQA 3N7KA 1XBFA 3K4DA 4Y1ZA 5C9AA 4OI0A 1LCLA 4CCOA 1FMD3 1OXCA 3NKTA 4OUEA 1W06A 3CZUA 5F3IA 4Q4W3 5E6HA 2AUYA 2ID4A 1E57A 3HEIA 3VL8A 3ZKYA 3AM2A 1N1TA 3VBUA 4Q4V2 3QH6A 1MZ6A 1XNCA 5FY7A 1OH4A 3T09A 2F4LA 2CY6A 1JUHA 5EWSA 3ZXJA 1IS4A 1POV1 2DBNA 2HWF3 2BGOA 2Y6KA 2ZGOA 2D6KA 1QMJA 3U4SA 4EYUA 5GZGA 1ULFA 4Q0QA 1ZZCA 4P9YA 1C8NA 4F3JA 1RB8G 5BNPC 2OS2A 5BY5A 5LA1A 1WBFA 3OD4A 4IV3A 4B3NA 2RS52 4HZFA 4KBBA 5C3QA 2BWCA 1XRUA 5BNOA 3THPA 4AAXA 2AREA 2QDNA 3LE0A 4Y20B 4MHUA 4GULA 4JTOA 2I74A 3VGIA 3E5UA 4LITA 4CRQA 1DZQA 2IVJA 4AEMA 5J7MA 2Y34A 5DZFA 4BQ4A 5LY1A 2VG9A 3DGTA 2BRTA 2JDMA 2RS33 1SCRA 4UFMA 4M4RA 4NAMA 4OUSA 2EIBA 1QOTA 3SQOA 4KL1A 5A7WA 2HBUA 4Y26A 2PAEA 3AYDA 3OGJA 1LJ7A 3DKWA 5APAA 2XONA 4GH4B 3NNLA 4A7ZA 5T3NA 4AVCA 3AP7A 4NPRA 4NHXA 1H2KA 5DG1A 3KLSA 4S2HA 1W8OA 2RV9A 3FBYA 1XSRA 5DDJ1 5FZ3A 4A7YA 2B9UA 2DUPA 2QQNA 2W87A 3APBA 1E5HA 1H6YA 4AGRA 4CDXA 5KXCA 2JDAA 2Q1MA 4OLLA 3JZVA 2J1UA 3K4ZA 1K5MA 2D6LX 5IJRA 4AF9A 3VN4A 5FO8B 4RFT0 5FYIA 1AJKA 2Z4FA 5ABJB 4BMBA 3ELNA 2CHHA 4OHZA 1W8HA 4N9IA 1C4RA 4XUTA 3WCRA 1W8FA 5A3TA 3BB6A 2C5DA 3RNSA 2Y38A 5FUIA 3IPVA 5ERLA 2QQPA 4TSVA 2BGPA 1OPOA 1FNYA 1YQ6A 4YZ4A 2R063 1C5IA 1N1SA 2YU2A 4LR4A 4LKEA 1H8TA 5EFUA 3JD73 1R081 4D69A 1YXWA 5FO9B 3SEEA 1XNBA 3MYXA 1OI6A 5C8WA 3UK9A 4Y1XA 2W1SA 2WN2A 2JD4A 5DN2A 2W3JA 1Z78A 1E5IA 4XFBA 5JI7A 1RUJ2 1JN2P 2VE1A 4YM1A 1BEV3 2IXKA 3ABZA 3I3BA 4GMP3 5A6QA 5LWBA 1CD3G 2NN8A 1YI7A 2WUHA 4JV4A 1VRH3 1IPSA 2PN5A 3KCYA 4QX2A 3RDIA 2PHWA 2WNVC 5CFCA 3WDXA 4QT6A 2H6CA 2JICA 4Y4RA 1L7LA 1TME1 2PLV3 1QOSA 3AMMA 5C4WA 2ZGPA 3O1MA 1NZCA 2VULA 4QGNA 4C1WA 3WQ7A 5C7GA 1DQ6A 3LQCA 2JDZA 1HB1A 2HWE3 4OULA 4KU7A 2WQ8A 4FPFA 5LK5A 4IEWA 5JWPA 1OH3A 4UBHA 3NSTA 5FPLA 3O1SA 5EV7A 2XPJA 3CU7A 2Z69A 4CCNA 1XXNA 4PI2A 4PIZA 1DYPA 2HKXA 2VW1A 3LCPA 1GBGA 4D8MA 1QQP3 4IV1B 2MNGA 2OXBA 2W52A 1BXHA 2A75A 3WEZA 4IEPA 5DMYA 4P9WA 2BFUL 4I2OA 4CUGA 4QHOA 4MLOA 3N9OA 1VBC1 2QQOA 1W2TA 2P2KA 5IVJA 4LJHA 4K7JA 4HPKA 4PDWA 1J59A 2ZX2A 3ZYHA 4M3CB 2RDQA 1XNKA 1YJKA 2OUJA 4N43A 4XETA 1LOFA 1E5RA 1HRV1 1ND2C 2WT0A 3OGSA 1SMVA 2BBAA 4HVRA 2WSUA 4I01A 4WVZA 4QKNA 1L7RA 4HVOA 4COZA 1R093 3TOJA 1YLLA 4YW2A 3VZKA 1YEWA 4ZS3A 1G6NA 2BNOA 3VKMA 4Y22A 1HXS1 2XLAA 4IE6A 1XNDA 4RL7A 4KWKA 2QQMA 5DXDA 4C90A 1J84A 1PGSA 4L97A 4XJ9A 3TEXA 2WZR1 4LTAA 5GLZA 4I3PA 3U37A 2XUEA 1PNGA 1YRZA 3WUDA 4A42A 3BN6A 1NT0A 4Q4X3 5D8AC 5FLIA 2KR2A 1US2A 4OQ8A 3VB9A 2PHRA 4DUVA 5FYBA 2VW2A 3VBFA 3QOPA 4QB6A 3E6CC 3L9JT 1ENXA 1BBT3 1SEFA 3J7MA 1KDKA 5HCFA 2A6XA 2HEYF 4RSUA 4EQVA 4YFWA 1OUSA 1CN1A 4A6SA 4IL7A 1RYYA 4XE9A 2BWAA 1D4VB 3GGLA 4AHXA 2BBVA 2ZGLA 4N53A 4Q4Y2 2VNRA 4U36A 1WMFA 2XL7A 4CVUA 1WGPA 5EZWA 2XLFA 1RUE3 2VOVA 1TME2 2QZ3A 2XHNA 2QQVA 1X36A 2BQPA 1VJ2A 1GZ9A 4ISQA 3RFRA 3RI9A 4FQZA 1S0BA 2ERFA 3WF0A 5HCHA 2BPA2 4QX5A 4RR3B 1NZIA 3BVCA 2DBIA 1YCIA 3IZOA 3D3AA 3O5SA 4KU8A 4AFMA 1BMV1 2E7AA 1C3HA 3CJIC 3N7LA 4CXWA 2IWGB 2VVFA 4LULA 3CNAA 1QNWA 4YFZA 5D1IA 1ZBE1 3I4IA 1ULCA 1VR3A 2D44A 4LA2A 3CMGA 3WVJA 1WWYA 2OW4A 4QHZA 5HV4A 2RR13 4MG2A 3SISA 3WSOA 3ZIXA 1MQTA 3FMGA 4MXWB 4NIDA 1LHVA 3SCHA 5EHDA 2Y60A 3FLPA 1W2AX 3HPNA 4KQ7A 1I5ZA 4FPHA 4XBNA 2I45A 2WS93 5A7PA 3OUJA 4JAAA 4JDNA 2C1FA 3RVHA 1PMJX 2NP0A 5J98B 2KD7A 1SLTA 3AVRA 3T1MA 1DGRA 2A3XA 1GYKA 1HRV2 4O65A 1HIXA 1JYVA 1VBD1 3HWJA 2X5IC 3IMMA 3P1IA 2R071 3T30A 1K12A 1H1AA 3HMYA 3AXDA 1NAEA 5FFOC 2WAAA 1ND3B 2WIIB 2DCZA 2MPFA 5JR2A 3IDEA 4D94A 3O1UA 4JGZC 5JXIA 4L9BA 4Q1PA 1IS6A 2XVGA 2DVBA 3BIWE 2FZ2A 3S30A 2PTMA 1AR71 2YMZA 3UJOA 2A3WA 5FZBA 1LGBA 4XJUA 3I2DA 4CEWA 2YU1A 1OC1A 2QUOA 2VW0A 4XF3A 1BVP1 1ULOA 2D97A 2WZR2 3H1YA 4N7IA 4XF9A 5FXWA 2B8MA 4IEQA 1V9U1 3KF5A 2YFZA 1PK6A 5I0RA 3JBG3 3PDQA 3NJYA 4CSWA 3POGA 2ADDA 3S5AA 5AC91 4JQRA 5LATA 4JRLA 3ZXGA 1W8TA 1W05A 5CKNA 4M3CF 5L36A 2W91A 3ZDVA 3QCWA 2O1QA 2ZAHA 4LLOA 1WLWA 3QD6A 1O6UA 1PVC2 3BODA 4CUAA 3DXUA 3RG0A 4QPIA 3WG4A 2E26A 1UIKA 5FK8A 2YBPA 4ZHNA 4XACA 2JKXA 3VDCA 5A33B 5GLUA 2VMHA 3ZN6B 1SFYA 3IAQA 5IK5A 1MACA 4QDSA 1QKQA 2IZWA 2ZXQA 1RUF3 4Q0SA 4CDQC 5JCTA 3B7MA 2WA3A 4X6QB 4META 3A4UA 2Y33A 3CLPA 3FX3A 1RMU3 1AR83 1W2UA 4RS5B 2PHUA 4N9HA 2MEV1 3NAPC 5FZMA 3F95A 1US3A 1BMV2 2I07B 1GOFA 3VL9A 5A3WA 4C91A 5CG9A 1TG7A 3FC0A 3LFMA 3Q8EA 3DPRA 4XUQA 3ENRA 2DWRA 5FZEA 1VB2A 2P5BA 1AL23 3BOWA 3VD4A 2JG8C 3SKJE 4HT1T 4A45A 3W5NA 4YYOA 4A3XA 1QGLA 5FUPA 3H0OA 5JXHA 2RM22 5JPMB 3ZOIA 3I97A 4MHRA 2G9ZA 1PHMA 4P5HA 3VDBA 2VZQA 4YVSC 2Z5WA 1MEC2 1NLRA 3KT7A 2LROA 3GALA 3O0WA 2DCTA 3M3CA 4FOVA 3AZZA 3OSDA 5F5IA 4B4QA 3HIFA 2Y64A 2FHRA 5FZ8A 1TZOA 2RS11 3A7QA 4WM8A 4XVHA 2EXKA 5FYZA 4LEJA 2YPJA 3I59B 5C9AC 2R072 1C8M1 1KFXL 4KG8A 4BZ4A 4JKLA 2EXJA 1W04A 2BGCA 3PIJA 2LM3A 3DL3A 4KH9A 5LBBA 1GMMA 3PHMA 3ZR6A 1GWMA 4V1PA 5LBEA 4LE4A 5FKCA 3KGLA 5LA9A 3OY8B 3VBUC 4BLJA 3SXWA 1VIWB 3ILFA 2GDFA 5CBLA 1G7YA 1AZDA 3AVSA 3U10A 5FV3A 4CDUA 2GNDA 1WCQA 4NROA 5BV6A 2J1AA 5L7OC 1GANA 3LAGA 3Q8AA 1F8VA 4JVAA 1ENRA 1V9U2 3H1MA 1WW7A 3B00A 1G8WA 2WFF3 4RGKA 1JYTA 3J26N 4MSVA 5CFDB 2A6VA 3POYA 4EE2A 1EV13 1UKRA 3O1RA 4IV3C 1NYWA 3IMNA 2VZTA 3AL5A 3CBNA 5AC92 1G9AA 1CJPA 1VBB2 4GAZA 5BNOC 2P34A 2Q1FA 2VTXJ 3DUIA 2X09A 3O14A 4CEYA 4XAEA 1Q8VA 1N3PA 4KGGA 4IE7A 3C7GA 1OLQA 3ES4A 2DURA 5FQ0B 1U5ZA 2OQ6A 2GC2A 1CZTA 4XILA 1Q8PA 3EJKA 4RD7A 5BXXA 4WVMA 3RMYA 3POBA 1NUKA 4QM8A 5J09A 4YZ5A 2ORZA 4GZ9A 3AMHA 5HXMA 3PVEA 1F4HA 3ZSLA 5L9VA 3ZYGA 3VZOA 2VQAA 4E2QA 4Y1UA 5FMOL 4XQDA 4UAPA 4D6SA 2JB4A 1UYXA 2JG9B 4HFSA 4XDQA 2MEV2 5F2WA 2EXHA 1W39A 1UZVA 4XDPA 1NA1A 1JOJA 5AVAA 1GSLA 2WABA 5FYYA 5K8SA 3MO4A 3ZMOA 1BKZA 5BUVA 3MHZA 4CDXC 2PHFA 2XJTA 5FMCA 4DXSA 2R043 2DVAA 4H7LA 2UYBA 4UT5A 2TNFA 4EN6B 2YUEA 3K4AA 2BFUS 2WNUB 1EUUA 1K5MC 1RUD2 5BNNA 3HN3A 4AI8A 5FPXA 1CAWB 1Z0HA 3VZNA 1OOPB 5F6KA 4XMIA 2BOIA 2XOMA 5IAVA 3OGGA 1ZNPA 3KHCA 4BQ2A 1CZVA 1EY2A 3B93A 4HG6B 3A0KA 4IESA 2ZGKA 3ON7A 1HN1A 1PX4A 2CWSA 4Q4V3 2DCYA 4GB32 2A7AA 1R1A2 3E97A 1AXYA 3BYWA 4NIAA 1H8TC 5K4LA 3IDCB 1GZWA 2GNMA 3E5XA 3U07A 3GNEA 2DUOA 2VUDA 1C8M2 4EWDA 1LGCA 4Q0VA 1IQAA 1XNTA 2FCVA 3ATGA 3PVOA 2F4PA 1PMHX 1RUC1 2HWC2 2VMCA 1MZEA 2QKDA 2WNVB 4YW4A 3S6PA 3WDUA 3JQWA 1VE0A 1XYPA 2RS53 1OA2A 3EXUA 1HJGA 2HWD2 1SLIA 4XYXA 4OMDA 2UU8A 4HXCA 3AZYA 3HQXA 2XBO2 1PO21 1PIV2 3FL7A 5FBJA 3VDDA 5A32A 1UY4A 1ZZ7A 3BTXA 5JR7B 4DUWA 2LS6A 2VAUA 3QACA 2EAAA 3KM5A 4WVVA 1QXRA 3AFKA 2ZTNA 4R4XA 1UNBA 4UFKA 1O5LA 2BP6A 4I09A 4CE8A 2Y6JA 4QXHA 1LECA 3E6BA 2CL2A 3ZPYA 4AW7A 1D7PM 1FT9A 1XU2A 4E8DA 1JZ2A 3O0VA 5HI0A 5FOJB 2E31A 4GALA 4W6WA 3T4VA 1UIJA 2ZHMA 2GNTA 5LRRA 1XOYA 2FDIA 2IFWA 1J83A 4OYUA 3H3ZA 5JXJA 1K42A 1Y3TA 4EWEA 3LIGA 1CAXA 3TWIA 2JIJA 3NW4A 1DGWA 4PDWC 4A44A 5DABA 3SMHA 1Y9MA 2DVDA 1X8EA 2VCCA 4PQQA 1S0DA 1S1AA 4FQ4A 2JE9A 3U0ZA 2D93A 4N43C 3OOXA 1LOFC 1TMF2 4FCAA 5A7NA 1AF9A 1DYKA 1UOJA 4ARYA 4MOAA 3IAPA 2Q8OA 2GN3A 3DEMA 3NV1A 3FFQA 5JOYA 4BHPA 1QEXA 2PMWB 1W03A 1WW4A 2ZOEB 3ZSEA 1F9KA 5C70A 3AMNA 2V5YA 5LBFA 2A73B 3RZLA 4LNVA 5CIRA 4FI9A 3WUCA 5KXEA 4DQAA 1RHI1 4NJ4A 3ZYPA 4URAA 1XYNA 1E5SA 4R9AA 5LBCA 2W94A 2HEVF 4AHZA 5IHRA 5FLJA 4QKBA 1VMJA 3M4FA 4EWAA 1QJU1 4XCAA 5F7UA 1RUJ3 1OLMA 5FZOA 2E6VA 1UX7A 4XC9A 2BNMA 3OUHA 4QPGA 3KCXA 4MV2A 3VBFC 4CUCA 3ACGA 3WXPA 1HRI2 5DAWA 3NWKA 4LBQA 5KHIA 3N36A 1MS0A 4FFFA 3M1HA 4PIYA 3NJZA 3MZHA 2VOKA 4C8DA 1OT5A 2J1VA 3HD8B 1RUC2 2CNAA 3ECQA 3T0BA 2WRAA 4CU9A 4ES9A 3I3EA 3WX5A 3CF6E 2VBBA 1RUNA 3USUB 5K0UB 1W3XA 3BIEA 5FPAA 3P6BA 5FZ7A 1GP4A 3NJVA 3M7AA 4QKFA 4GQ7A 4IERA 3VBOB 1W0NA 3FJSA 2H0VA 2D3RA 2Y6LA 3NRUA 1OSGA 3VHRA 5AFEA 1JUIA 3DECA 3ZFGB 1S0EA 3VZLA 1Y7BA 1FI2A 1QH6A 5CKQA 4OFGA 2QQIA 3WW3A 1HQWA 4H55A 4CXXA 2PHDA 2XQXA 2P3IA 2EALA 2D6MA 2OA2A 4HN0A 3RYPA 3VBRB 3DV8A 1UY2A 4ITCA 3B02A 2B39A 3P5BA 1SQ4A 3K77A 4ZY9A 3T2QA 4CU7A 5FJHA 2ZEWA 4KI5M 2W1WA 2B5HA 5J3UA 4DMIA 1V70A 1SDWA 1W8NA 4OVEA 3WF2A 5K9YA 2GMMA 4AQTA 1JBCA 4LKSA 4Y1VA 1MQTC 3DYMA 1FAYA 3IWZA 4AGGA 2VY0A 1OLME 5FTTC 2R1BA 2WLPA 3PL0A 3U11A 1LKNA 1NCQA 4P02B 4YG6A 5I8YA 2ATFA 4JGZB 3K2OA 1S0FA 3ETPA 4HSLA 1MPXA 3HN1A 4MGZE 4WZFA 4Y1YA 4Z8BA 1HJFA 4NHMA 4AXOA 3ZYBA 4AEDB 2AH2A 4XDOA 4LLFA 2ZABA 4K21A 4OHVA 1XNAA 2YROA 2XQRA 5FYTA 4I02A 1YYNA 3GZAA 2JJ6A 4YW5A 1RHI2 4R9CA 4CEWC 3WF4A 1RINA 2NLRA 2RMU1 2UWCA 3HAGA 2VR4A 3MIDA 3NVCA 5FMBA 3ZXLA 5FXZA 1JXNA 3RMXA 3WR0A 4QAWA 3ACIA 4AG4A 2HWB2 2PQSA 3MV01 2J1RA 2Z42A 2Z2SB 4Q4Y3 5A6XA 1PK6C 2ZMKA 5DAPA 4Q8LA 1A3KA 2FZ1A 3KS7A 3ZYIB 1CVNA 2DCKA 5JSRA 5EYXA 4IE4A 1TME3 2VZRA 1D4M2 2QQWA 1WMEA 4UFIA 1KJLA 4RFRB 1LODA 5FY9A 1HV1A 3ROUA 4YGEA 4CDQB 1TE1B 1T6GC 2QVSB 4UF0B 3POIA 4QPIC 4XAAA 3LKJA 4TYSA 3SH4A 3OBTA 4EROA 1JZ6A 5CU1A 4CYDA 1W3VA 3WHTA 4RQPB 4A3ZA 4EN0A 3KV5A 4HKLA 1X7NA 2ET1A 2VGDA 1UYPA 2ADEA 1J3RA 1JS9A 3I2HA 3OPTA 4H3WA 1ZVFA 4XZPA 4DO0A 4E4SA 5FYHA 3SNMA 4LUMA 3M2MA 3O7OA 1L7QA 2A70A 4JZRA 5IVYA 4FAGA 4K1YA 3MPPG 4CCLA 1CESA 3ACHA 4QPWA 3JUUA 4YW1A 2PQQA 3PUQA 1VB4A 2R0FA 2JG8B 5KR7A 1LU1A 1CAUA 2CAVA 1NCRC 1RJ8A 4HONA 4M01A 2ZBJA 4B7EA 1X82A 5L7OA 4FXGB 3AP5A 3DPRC 2X29A 5T52A 1IS3A 5IFPA 4UW3A 4LBJA 4WM7B 2XJSA 4XTMA 3NNFA 3TN91 5CVRA 3OG2A 1WMDA 2QE3A 4EV0A 1W6QB 2E32A 2QBXA 5FMOS 2XB6C 5DUUA 4LT5A 3FLRA 5A3UA 1ASJ3 2CWMA 2LW8A 4MGKE 4K9SA 2C4XA 1AX0A 2GU9A 4NPMA 4LUKA 1MS8A 5C9AB 3O1PA 1CIYA 4COWA 1NKGA 2XJPA 1JYCA 1GFF2 5J36A 3ALQA 3HT1A 5GZFA 5JZGB 4HK9A 5DUXA 4AOCA 3T0DA 1UMHA 4FXKB 3IT8A 4LK6A 3PJQA 4O9GA 4WM8C 3ZPOA 1DF0A 4ZXEA 1J3QA 3JB4C 3VBUB 5ISLA 1FPN3 4LHKA 4QMAA 4AR2A 2V4AA 3OF1A 3AYEA 2EIGA 1ZBA1 1V6JA 2VOTA 1JYIA 5TSWA 3ITQA 4XPVA 2R16A 4XJAA 1W9WA 2JXAA 4XABA 4YVWA 4U2AA 1N3QA 2H0BA 2UURA 4YARA 4CDUC 2ZMNA 2DFBA 3KMHA 3RGBA 1PVC3 5ABJA 1UYZA 1YNAA 2G1MA 4J6GA 1YQ5A 5T5LA 2WAOA 4EN9B 4IQPA 2IFRA 4AVTA 2WNOA 3C2UA 4QQPA 4HKOA 2NZ9A 1LEDA 3C7HA 5KC5A 3OCPA 4HKWA 1WBLA 1EAH1 3WP4A 5C71A 1W9YA 2XR4A 2OZJA 4LIUA 4XQWA 4CEYC 2K46A 4MGYE 1UOFA 2JE8A 2J7MA 3SH3A 3VBHC 1UF2C 4ZPIA 2J1SA 3U78A 3ACLA 2TUNA 2ZGRA 1PGL2 4Q2FA 4HL0A 1FV2A 1W9FA 3IKWA 2A3YA 1FOD3 1SBEA 2ZX0A 3WNNA 4DEVA 5DZEA 5F32A 1O8SA 5FWEA 1LENA 1JZ4A 2YFUA 4QM9A 1H2NA 2IXIA 2KM2A 3ZMNA 1LNSA 2BYVE 2RHPA 4W6YA 4XEZA 2RM23 5FKBA 5C3OA 4L92A 2EA7A 5FZKA 1EYBA 1NA1C 1AXKA 1KEXA 1QXJA 2LRPA 4JCKA 4LO8A 4AEKA 3BALA 3PURA 3VD3A 5H9RA 1MEC3 2B46X 2JD9A 2XDVA 5FZFA 5T5PA 4FOWA 1W6MB 2VMDA 3NNMA 4C0BA 5JOWA 2B45X 2AEZA 2PAMA 3HR9A 3TN92 5E89A 2ZEYA 3I8TA 4CA9A 4SLIA 1A8MA 2EXIA 5BNNC 1ONAA 5ACA1 3ZYJB 1O59A 5B4NA 3RYRA 2R073 4EN8B 3J9SA 3VUOA 3D8CA 4QWNA 4MX3A 2V09A 5C8CA 4A6OA 3EHKA 1W9SA 2PA7A 1YI9A 2C24A 3VBSB 4IGOA 1UX6A 3AK0A 4AQSA 5C33A 4L11A 1X33A 3M70A 4JRAA 1UMIA 3RWNA 2BVVA 2VMEA 3R4UA 4JKMA 3H7JA 3S5QA 4M3CA 3I49A 4PQ9A 1ZZ9A 2B4KA 4HMZA 1SFNA 4EJRA 1OQ1A 4BLIA 1OQDA 5CFCB 3ZXFA 1KD7A 1QHDA 1V9U3 5SV8A 1W28A 1GLHA 1ZBA2 4JKKA 5C4WB 2JDYA 1ACCA 1TNFA 2XJUA 2D3SA 2GNBA 2YBSA 4RHV1 5FDBA 2A6ZA 5AC93 2CGPA 4DZGA 3MEPA 5GLTA 4FP3A 2FQPA 1VBB3 1FMD1 1S2KA 2VVEA 5DDJ2 1OF4A 3RSJA 4B1MA 5FO7B 3V0BB 1WA6X 3VDDC 1H4HA 3PMSA 2FD8A 1UN1A 2WT2A 4IE5A 3ZKUA 3WF1A 3UKTA 2HWF1 1K3IA 1EPWA 4MO3M 3OD0A 3WNPA 4DUXA 4GWNA 2WSVA 5IAXA 4M0NA 3BPSA 4GIQA 3G6JB 3OBRA 2NM1A 3DYOA 3IDBB 2BU9A 2MEV3 4JQTA 1YQ8A 4HPKB 3UJQA 4TLFA 3FUOA 4BDVB 2N7GA 5FZLA 5GZCA 3TEZA 4AVAA 5FOBB 1R082 4L99A 3QBQA 3MBWA 4N43B 2V72A 3I2JA 1CONA 1W8WA 2ZAAA 3OGRA 4IEOA 1DGRN 2G9FA 4M3CE 4Z92B 1RUD3 5FK7A 2RS31 1B35A 2A6YA 5FBZA 4NUBA 3W58A 1IHMA 1WUVA 3PUAA 5H9SA 3M3EA 3ACFA 5FYCA 5FXXA 2VJXA 3B3QE 1ODMA 2VPVA 5H9QA 2G19A 3IB3A 2L9LA 3ZFEB 5LASA 2X53S 4LHLA 3NO8A 2VMIA 1X8MA 1R1A3 2WZ8A 1BVVA 2B7YA 4GB33 4N8MA 5ACA2 2VTXA 4WV8A 3HT2A 4NIGA 3HNBM 3TBDA 1C8M3 3VBFB 5LY2A 1UKGA 5IK4A 4K20A 3RZGA 1CAVB 2K2SA 2WT1A 3I2IA 4P9LA 2HWC3 3K48A 4YZ1A 2C0ZA 3HQUA 1O4ZA 5KC6A 2QCSB 1JYNA 5F5CA 5F37A 3VD9A 5JIUA 1N47A 4QPGC 3H50A 2HWD3 2XVKA 2YPDA 2A1XA 1O5UA 4N53B 1JZ7A 3MW4A 3BUCA 3MGUA 1KS4A 3ZM8A 3KVAA 5GJ6A 3BI3A 4P9XA 1HW5A 1VBC2 1X9PA 2XBO3 1PIV3 4GKXA 2EVXA 3B01A 4P08A 2OQ7A 5DUWA 1PGW1 2WYSA 4L2NA 5A1FA 3VHPA 2BDRA 2ZMLA 3PU3A 4YPJA 1SPPB 4TLGA 2IXCA 5ANNA 1FNZA 5DAVA 1VLNA 2J1TA 2VTFA 4XW3A 1DLCA 2ZGTA 3UL2A 2Y0IA 1AR91 1POV0 2W68A 4LBQD 4HLTA 3WQ0A 4GMP1 2LTNA 1OKQA 2VOWA 4WBBA 4CDWB 4PF1A 1GP6A 2WL1A 5JPNB 3SCGA 5I0SA 2WNEA 2E7QA 2XJQA 4MVTA 2FDHA 4NWWA 1HXS2 3MIFA 4IEUA 2GP3A 2DTWA 2NYYA 3EMRA 4DY3A 4MUVA 2ZS6B 5L9RA 2BV4A 5FREA 1GICA 1JMUB 3RRDA 3J4UH 2D40A 5K7PA 1H1IA 2UWAA 3R0RA 1IGOA 1PX3A 4HOOA 2ES3A 4NHYA 4Q0PA 1QJY1 1XPWA 1TMF3 5F3GA 1KITA 1WKYA 5BPXA 3TRSB 3BGAA 4AHWA 4DINB 5JMOA 4P5YA 1V6LA 3DYPA 4D7SA 1LULA 2I2SA 4O7XA 1GOHA 4ZU5A 2J1EA 3ZN6A 2O14A 2YC0A 1LHNA 2GC3A 1F15A 1NCQC 2XKPA 1DCSA 1S4CA 1O4YA 1UCXA 3AKPA 1VBA1 2EF6A 4SBVA 1GZCA 5FYUA 4RS5A 2XMLA 4FPLA 1ENSA 4R4ZA 5DQ0A 4FBFA 2VXJA 1PM7A 4UW6A 2BTVC 2JDKA 1IG0A 4DOUA 2DTYA 2WO2A 1G86A 3LA2A 5C3RA 4XFCA 3SLIA 2O8QA 1H30A 1HRI3 1RXGA 4INDA 4O61A 2NMNA 2TEPA 1UWWA 1YO8A 2CTVA 2O0OA 1T2XA 1VMFA 3ZXEA 1FATA 1NCRA 4CP9A 4NIHA 1RL3A 1RUC3 2WLQA 3NMBA 2ZKNA 2RDSA 1R091 2EAKA 5F5QA 4AFCA 1ZBE2 4D6RA 2QTWB 3ILRA 2GC0A 3AB0A 3EBRA 4UI9L 1SHWB 2R1DA 1W6NB 1DQ5A 1CGPA 1OVPA 2NMOA 2VBPA 5I0UA 4LO6B 4PLOA 4BPZA 4P14A 5GM0A 1IPKA 2P4EA 3I59A 2YY1A 4NAOA 1VRBA 3V0AB 4A4AA 1UMZA 1NQDA 1PGW2 4FPKA 4PIXA 4DXTA 3VKLA 3NQHA 4GJYA 1VBD2 3OY8A 5CKMA 5F3CA 2WA4A 2VVDA 4ASLA 1YIPA 1XE0A 3ZO0B 4ES8A 1LGNA 4D7TA 5FZ1A 5FMDA 1AR92 2ZX1A 3D6EA 5DAQA 1ULDA 3VD5A 2FDJA 1BZWA 4AVBA 1KS5A 2YC4A 1H2LA 1Q5OA 1KJRA 1IG3A 3B9CA 1AR61 1AR72 1BQPA 3LOBA 2VCMA 4Q8KA 2OZ6A 5BNPB 1BJQA 3THCA 4QDQA 4GXLA 1P8JA 1XYOA 1RUG1 3HOBA 2D5FA 2E7TA 2AR6A 5FCCA 4AQ6A 4BQWA 4XBQA 2WC2A 5CNAA 4CCCA 2GC1A 3WY6A 1COV1 1QJY2 1UPIA 1REDA 3SHRA 4TTGA 2RG4A 4AI0A 1F5FA 5JSPA 4ZONA 1AJOA 2OPWA 2JEMA 4P9GA 4QGMA 5FQ0A 4IETA 3VV1A 3BTYA 4TN7A 5FYSA 4B4PA 2VZ1A 3L2HA 3MFAA 4E27A 1UL9A 4X6RB 4YW6A 4PLMA 3VBHA 1WCSA 2ARXA 4BK4A 1DBNA 1O3RA 1GNYA 1VBA2 1RHI3 4PLNA 2DF7A 4Z1VA 3GZTB 1GKBA 1RITA 2WS91 4JDOA 3LDKA 2HWB3 4NPLA 2ZZJA 2XH6A 4XOGA 5FY1A 3H8RA 5IVBA 1UY0A 2JE7A 1OVSA 3VBRC 1MS4A 1F35A 4XXPA 3ZXDA 4ATFA 3K3OA 4P9JA 4YVWC 3AYCA 1D4M3 5F6LB 4LO4B 4V2VA 1O3TA 2RVAA 5ABJC 4IGPA 1AHSA 1DQ1A 5E88A 3AYAA 4QQHA 4QU1A 3GHNA 2GAUA 2DDUA 1H6XA 5A1AA 3B5LB 4FPCA 1I3HA 2GZWA 3ZN4A 1ZRFA 5T54A 2VM9A 3INAA 3RJ2X 4EN7B 5M0TA 4JX0A 4WVMB 5JSOA 4HN1A 3J8F1 3CJXA 4CXYA 3VZJA 4K8FA 3F2ZA 2EICA 1I5PA 3JBG1 4OUMA 3WNOA 5IK7A 3IM0A 2QJVA 1GQGA 3WNMA 4BYYA 2JX9A 1UU4A 1X9TA 2RS12 4XFGA 3E1F1 3SH5A 2P3JA 1U0AA 4QQ2A 1W99A 2SLIA 4NIIA 4JGYA 1RUI1 5ANQA 3FE5A 3ILNA 5A7OA 3H8XA 3WP3A 1HB4A 4BQXA 1AR62 1Z7S1 4C0HA 4E4DX 4BJ0A 1S0JA 5I91A 3O1OA 5LEKA 1V6NA 1RUF1 3AP4A 3WZ1A 4LBNA 3FZ3A 3A21A 3DF0A 5BNNB 1ALYA 2A5ZA 5HBAA 3H7YA 2W95A 1V6IA 4I3GA 2WO3A 1RUG2 4O9EA 3WG3A 2YGLA 3LWCA 5JVVA 3RZMA 3MIEA 1RMU1 1WMXA 4UW4A 4TXWA 3ES1A 1COV2 4LHNA 4YZ2A 3C7OA 1O4TA 4YNIA 3VHOA 2GALA 5C8CC 4OQ9A 1GZWB 3R05A 1QWRA 5KHGA 3MF6A 1GV9A 3AZVA 3OYWB 4BWOA 4AI1A 3I2OA 3ASIA 2DU1A 3CEWA 3K3NA 4AE2A 1KRIA 1NOVA 2Q5TA 3QLQA 5T5OA 4GKYA 1RUH1 1ND2B 3JB8A 1RXFA 4S2DA 3UT0A 2PXJA 3CKHA 4K1ZA
chains in the Genus database with same CATH topology
2RJLA 2SBAA 3WW1A 2VNOA 4F7ZA 2D7FA 1S55A 5FLHA 5JOZA 3B69A 1C1FA 4MYEA 2F6BA 3POWA 1IKQA 3M3OA 1NXD1 3O12A 2E63A 1VBE1 1G9FA 5D8AB 1BCXA 3KZ4C 2CGNA 4FPEA 1W6PA 3NV3A 5GKAC 2PELA 1BK1A 1ZX5A 3AKRA 3J8F2 2Y0OA 5HXVA 2OIIA 3IBMA 4UXAA 2K0GA 4N90A 1OQEA 1MS3A 3EO6A 3USUA 1POV3 4J1WA 1V6MA 5K0UA 1RUI2 4XIKA 4JTNA 1W6OB 3TN93 3VKFC 3AKTA 4I0BA 1B35C 3ZXKA 1Z7S2 4DRVA 2AGSA 4Q0UA 1LR5A 1O91A 3ZFGA 4XXAA 1OA4A 2V73A 2YXSA 4NVPA 1WCKA 1UW8A 1OFSA 3MLLA 5LRSA 3CJIB 3VBRA 1AX2A 1PO22 3AZWA 4JDMA 1H9PA 2XL9A 1VAKA 1SLBA 4NOTA 4DPNA 1CPNA 1J58A 1YFWA 1AXZA 3PTYA 2WZPP 4Y5Z0 1ZBA3 3RQ0A 3WT3A 2X8KA 3C3VA 3MIBA 5DDJ3 4D7YA 1RUH2 2X5IB 4Q4V1 4Q29A 1DQ0A 3URFA 1HX6A 4AEDA 1ND3C 3N7JA 4S2FA 5DZGA 1ZZ6A 1PO11 3AJYA 3ZVXA 1PZ9A 3I54A 1IPJA 1REFA 1H2MA 4KWLA 4DXZA 1AYN1 2E51A 1QY4A 1VBE2 1R083 4XIOA 4YLZA 1LOAA 3MI8A 4YG0A 1DGWX 4IEVA 1QU0A 1NE4A 4NHKA 1QJU2 1GNZA 1LOCA 4B7KA 4LBMA 3N35A 2PHXA 2W08A 4GA9A 2DYCA 1LOEA 3EQEA 4RGGA 4DFSA 4RQPA 1Q8SA 2FMYA 3ZFFA 3L2YA 1ZA4A 4NN0A 1PMIA 4CP2A 3IN9A 5FPZA 2IXJA 5ACA3 2Q30A 1FXZA 3KB5A 1SLCA 2P3KA 4J1XA 1HQNA 4RS5C 2ZGUA 3NAPB 4COUA 4CP1A 1RVF1 4H14A 1KDMA 4L8QA 1D0GA 1OMIA 4BCUA 2ZGMA 3ETQA 1QJX1 4QPYA 4BA6A 4WM7A 3HBZA 1VBC3 2HYKA 3D82A 1LU2A 4M0HA 1WA4A 1XU1A 2OYZA 4YRDA 4YVSB 4Y20A 2ET7A 3MFCA 5KXDA 1HRV3 1REEA 3E5QA 5JZGA 3AJZA 1DQ4A 3TNQA 1Y43B 1RUJ1 4FPYA 4XHXA 3MW3A 1RIRA 1WD3A 2XWJB 1HXS3 5JDBA 4XJZA 1PO12 2OUHA 4LA3A 4GH4A 4MGIE 4K3UA 5FRAA 5JAXA 1DDLA 1HV0A 2DUQA 2WZR3 1CAUB 2UWBA 2JKBA 3K51A 3D0JA 4Y4YA 4YM2A 1AYN2 1U12A 5L7OB 2ILMA 4BIFA 2AZ5A 1H9WA 4QHBA 1S2BA 1QDOA 2O8OA 1MR5A 5CFDC 1RC6A 2GN7A 3H8UA 2RMU2 3GBGA 4IV3B 4HANA 1UZZA 2DVFA 1M4WA 5BNOB 3H1WA 1UPSA 4ONUA 3NL1A 4OI1A 1H8VA 3JCIA 1WW6A 3LZZA 1YHFA 2VH9A 5GLVA 3R4DB 2R0HA 2NQYA 2DV9A 3D0SA 1HQLA 4FTEA 4FTSA 3LA3A 2R30A 4P9IA 2JG9C 3O0XA 2DFCA 1RVF2 1QJZA 1NE6A 4YVWB 3WQ1A 5IT6A 1NY71 1ZBE3 1OLRA 4CDXB 3MIGA 1C1LA 1QJX2 1W6MA 4IEYA 5B2GB 4XF0A 3WDVA 1LRHA 4AQ2A 1U5YA 2WNUC 3KGZA 1K5MB 4D3WA 1C28A 1I1EA 1MS5A 1OOPC 1GR3A 2B42B 3ZSMA 1D0HA 4FP2A 1O7FA 5IK8A 4M00A 3VBSA 3IPVB 3V56A 1VBD3 3MW2A 2D3PA 2ZPXA 4IV1A 3GHMA 1S0CA 3GYDA 3TNPB 2CV6A 2E53A 1H8TB 1AR93 2WFPA 1W0OA 3WINE 4Q4Y1 3RYKA 1GQHA 1AYM1 2D5HA 1AR73 2YHJA 2HEWF 2ZHKA 4MH0E 1RUOA 3AKSA 5C6CA 2ZZQA 4JGYC 4BE3A 4BIOA 2ZHLA 3AZXA 5KHKA 4XMAA 4Z82A 4F8AA 4DNYA 1MVEA 3BTAA 2D98A 2ZA9A 1H1MA 2BW8A 3LSDA 1QJY3 1FV3A 4PJYA 3MLKA 1CQ9A 3V0BA 2XLGA 2ZX3A 3FFZA 3RI8A 1B09A 4YSFA 1DZTA 2A71A 1PVXA 4Q4W1 4N7UA 4E9KA 1CJDA 1TQ5A 3KD4A 5EJ3A 5C8CB 3CL1A 5AFBA 1VBA3 5GALA 2XWBB 3I7DA 1MZFA 2QDRA 4ZU7A 2UY8A 4A2UA 2ZHNA 3AFGA 3B9IA 1EAH2 1M06G 3X29B 4C1XA 3ME2A 1MS1A 3BPZA 2VMGA 1LHWA 1HLCA 5DUVA 4PDWB 4COYA 1ASJ1 1YFXA 2WQZC 2G4IA 1XE7A 2FBEA 2RJKA 2P37A 1L3JA 4NHLA 3A0NA 4AEJA 1NY72 4Q1RA 4XQ4A 4IXLA 1UAIA 3ZFEA 5BYNA 3TYJA 2LALA 1DIWA 2FMDA 1FPN1 4X8PA 1KXGA 2OVUA 1RJ7A 1UD1A 1YFYA 4Y22B 4RR3A 4MZUA 1F5JA 1Q8OA 4TWTA 1V6OA 2Y26A 1CAVA 4R52A 4ASMB 4AVSA 4B29A 3AXEA 2RS13 1QOOA 3R4SA 5AVPA 1S0IA 1PVC1 4HETA 4AYUA 1OD5A 3PLQA 4KNCA 4AHYA 5LK7B 3ZSJA 4MXWA 3AMQA 5JLVA 1V6KA 1VALA 4FTBA 1AYM2 1WD4A 2G9GA 1AR63 3FUQA 2JECA 4HVQA 1IKPA 1ZREA 2XUMA 1YFUA 2YYOA 2KXLA 1B35B 4XF1A 1RUG3 5K0UC 4Q27A 3VBOC 4BMEA 1RTVA 1APNA 1R1ZA 5CB7A 2WQ4A 2R061 2PYTA 3GBFA 1FOD1 4BH9A 1COV3 4NR1A 1ND3A 4QXKA 3JD71 4RHV2 4UW5A 4X8NA 3ZFGC 1H0BA 4CDWA 3KT1A 1FMD2 1IS5A 4Q4W2 1ZRRA 4KWJA 4W6XA 4YM0A 5JI9A 1U5XA 1SBDA 1WCDJ 1LESA 3OTFA 5T5JA 1BEV1 2RM21 2WJSA 1EP0A 2GH8A 2R49A 5JIAA 3VZLA 1TEIA 4FAHA 2KA3A 1J1LA 1VRH1 2E9QA 4AK3A 2HWF2 1MEC1 1LTEA 2PLV1 1MS9A 2VECA 1WW5A 2R6QA 1MQTB 4I0WB 2YDEA 5E16A 3SITA 2HWE1 3VLBB 4FT8A 3N4MA 1C5HA 4K6BA 4KGQA 1ASJ2 2VQ0A 2IC1A 4YW3A 4FPJA 1UU5A 3ZX7A 2D6OX 5A33A 3ZIWA 5LEJA 4OHYA 4URTA 1A8DA 2VUJA 1QQP1 3NV4A 4AEDC 4LO5B 4E2SA 2RS32 4XJ8A 4E4ZA 1JTZX 3POSA 4YGDA 1FPN2 1Q56A 5H9PA 1HDKA 1PZ7A 3J8F3 2PAKA 2WINB 4CEWB 1DQ2A 5CAZA 3KT4A 1AL0G 1OPMA 5I0TA 1V00A 3MF9A 1IZ3A 4KG0A 1VBB1 4H7MA 2Q4SA 3WDTA 4HBNA 3JU9A 4QGLA 1PK6B 1RUI3 3U4XA 2D6NA 4OZXA 1W6NA 3WG2A 1ZM1A 1D2SA 3V65A 3FWEA 1QNYA 1G9BA 2BNNA 2QZ2A 1XQNA 1ZRDA 1Z7S3 2D43A 1OFNA 1NLSA 3V0AA 4QPIB 1S0GA 1H4GA 3BOPA 4RQPC 1N3OA 1YJLA 1N1VA 2WKKA 4Q4X1 1PO23 3ZFFC 2XGXA 4TZDA 1MVQA 3T2TA 5F1RA 2R062 1FOD2 3MDPA 4B8EA 4NWVA 5JMCA 3JD72 4IEZA 1BBT1 1YUDA 4XFHA 4YZ3A 5DG2A 1LHOA 1DFQA 4XFIA 5BNPA 1A6CA 1RUD1 1NCRB 2XG3A 4YGCA 1BEV2 1U5IA 3NKGA 3DPRB 1VRH2 2VUAA 2UYAA 4WM7C 1JW6A 1RUE1 3P3PA 2PLV2 2VXRA 1PNFA 1Y9QA 1J1TA 2W0XA 3NV2A 4XJWA 1RUH3 5CFDA 4YM3A 3S0MA 1RGSA 1YWKA 4GB31 1R1A1 2HWE2 1G9CA 4PCRA 2GMEA 2VNGA 3E6DA 4NO4A 5KBFA 3GF6A 1FX5A 4XHBA 4XTPA 1AUYA 5GZDA 5JZGC 3H9AA 2HWC1 3THTA 2QFEA 4WM8B 2XJRA 4ORFA 5EXOA 2OPKA 1DU3D 4LBLA 1QQP2 3MPBA 2RR11 4FVVA 4LE3A 4DY5A 3IIAA 2HWD1 2DCJA 2CAUA 1VBE3 1KFUL 1X50A 4K40A 4GH4C 5HCAA 2JG9A 5CG8A 2XBO1 1PIV1 1EPZA 2CYFA 2ZGSA 4ZU4A 5I8TA 4R9DA 1QJU3 2P17A 3PMEA 4CDUB 2A6WA 4OHWA 3ZN5A 2NPIA 3RJRA 2ZKLA 1SLLA 3RZZA 2WNUA 4FOQA 2AYHA 1QDCA 1CAWA 3WCSA 1OOPA 2WWSA 3SCFA 1R092 3N7MA 5J37A 1Q43A 4CEYB 2DU0A 2VOXA 2MHFA 3AKQA 3VBHB 3AP9A 4ZXKA 1UU6A 1MZ5A 1LOGA 1ENQA 3WW2A 2K9ZA 4Q4X2 3KQRA 1ZZBA 1TMF1 3LB9A 3WV6A 1SLAA 2R32A 1D2QA 2WNVA 2ZX4A 3WDWA 1BBT2 5I8SA 2ENRA 1CIWA 4R9BA 1WLTA 3S7IA 4OI4A 3ST7A 4F83A 1NA1B 2ARBA 4AWDA 3RPQA 1I9RA 1CR7A 4QQLA 3PVBB 4G9SB 3WLUA 2Q0AA 1LEMA 1RUE2 1VAVA 1VP6A 4MXVA 4BQ1A 5EYYA 1A78A 3BU7A 1AR81 1AVBA 4LO7A 4OI2A 2DVGA 1HRI1 3QH7A 4G4FA 1CX4A 4I30A 3PVNA 1OA3A 1PO13 4Z07A 5F9TA 2ZACA 3VBSC 2UY9A 4XF4A 1NG0A 4AVVA 3OYWA 3VKOA 1G9DA 4IV1C 3AX4A 4QQOA 4Z2WA 5J48A 1AL21 3WD5A 4JGYB 4CZSA 3ZSKA 5A3LA 3MICA 1AYN3 2RR12 1ND2A 4PBOA 5CFCC 1LHUA 4FOYA 3LOIA 1WLDA 5C4WC 1ULEA 1QF3A 1W0PA 2BVBA 2RMU3 5GZEA 5T55A 3GZUC 4IEXA 2WS92 4JC1A 1ZRCA 1CPMA 3W9AA 4WZCA 4AI3A 4GMP0 1JHNA 5A32B 3VDDB 1I6XA 4PBPA 3V64A 4BOWA 1QH7A 3W59A 2XHKA 5D8AA 2IXHA 3VZMA 1N1YA 5KXBA 4AGVA 1NQJA 1GNHA 3MLJA 3VHNA 5KHHA 2YZ4A 2W39A 3RS6A 2PHTA 2D6PA 1KQRA 1DLLA 5IUQA 1RVF3 3LGRA 3LSEA 4QU2A 5E1RA 1F2NA 4WVWA 4ATEA 2QNKA 2WFF1 3OJBA 2GMPA 2Q1ZB 3JBG2 2TBVA 1QJX3 1EV11 4Q26A 2H6BA 1CAXB 1W6OA 3WHUA 5KWRA 4ZKTB 1ZZ8A 1QXPA 3USSA 5GLWA 3B94A 1YIFA 3VBOA 2CGOA 4PF5A 4RGAA 3WP6A 3DN7A 4QD2A 3ZFEC 4AFBA 3CJIA 4B4RA 2JENA 1RUF2 2Z79A 2HWB1 1TNRA 2YV8A 1ZYBA 4RA0A 3S7EA 4RR3C 3FBMA 4COVA 2ZCWA 4YGBA 1RMU2 1AR82 1W6PB 1O3SA 1SCSA 3UKNA 2YGMA 1D4M1 3N3HA 2BEOA 3PNAA 3ZDSA 4QPGB 4A7KA 2R041 4G3YC 2XKOA 4W65A 1AX1A 1AL22 3WG1A 4LBQB 3VKNA 1Q3EA 4N53C 4Y24A 1BYHA 3AP6A 3CO2A 3T1LA 4DS0A 2ZJCA 3TB0A 2X5IA 4ISRA 3H3UA 3G7DA 3P3NA 1DG6A 5CADA 2AENA 4FPGA 4JGZA 5JOXA 2ZGNA 1DZRA 3Q9OA 1URXA 5I93A 3M3QA 4S2GA 3ZYRA 2XJVA 4AFDA 2PFWA 2XVLA 3BCWA 4CDWC 4XBLA 4DB5A 4BM8A 4FPOB 1O3QA 1EAH3 2GH2A 1SACA 3M3IA 1DGLA 5L73A 4DRRA 5BNQA 4AI2A 3FHIB 3WOGA 3UV9A 3PJYA 1JH5A 2RS51 5L19A 2IXLA 4GWMA 3FLTA 4HK8A 2PHLA 3AMPA 3WW4A 2VU9A 4UBGA 3JQXA 1PZ8A 1XE8A 4I0AA 1DHKB 1IOAA 2WFF2 4FSJA 5A3MA 3KSCA 4YG3A 1EV12 3KCCA 5E8AA 5KHJA 2BUKA 2LUWA 1C57A 4CDQA 1NCQB 5CA6A 3WNXA 1J3PA 4CP0A 4XFAA 2RE9A 4CTEA 4FO9A 5FAXA 1Q8QA 3NAPA 3R6SA 3WP5A 3GBWA 5T50A 4XFFA 3ZXAC 3D4KA 4R8HA 1WLCA 1NXMA 1ULGA 2GSYA 3M8LA 1HKDA 3UKVA 1UZYA 2JG8A 3MIHA 5HCBA 1FYUA 1AYM3 3TAYA 1LOBA 1OHFA 4LBKA 3D5OA 3OPZA 1F31A 1LB2A 2C9AA 5SV5A 4YVSA 4LBOA 1VAMA 2R042 1W6QA 1PGL1 1SBFA 2HJIA 5J96B 3LA7A 4HSJA 2ETEA 4OHXA 4AFAA 4RHV3 3ZFFB 2ZGQA 3N7KA 5C9AA 4OI0A 4Y1ZA 1LCLA 1FMD3 3NKTA 4Q4W3 2AUYA 1E57A 3VL8A 3AM2A 1N1TA 3VBUA 4Q4V2 3QH6A 1MZ6A 1XNCA 2CY6A 1JUHA 5EWSA 3ZXJA 1IS4A 1POV1 2HWF3 2ZGOA 2D6KA 1QMJA 5GZGA 1ULFA 4Q0QA 1ZZCA 4P9YA 1C8NA 4F3JA 1RB8G 5BNPC 5BY5A 1WBFA 3OD4A 4IV3A 4B3NA 2RS52 4HZFA 4KBBA 2BWCA 1XRUA 5BNOA 3THPA 2AREA 2QDNA 4Y20B 4GULA 4JTOA 2I74A 3VGIA 3E5UA 4CRQA 1DZQA 4AEMA 5J7MA 5DZFA 2VG9A 3DGTA 2RS33 1SCRA 4OUSA 1QOTA 4KL1A 4Y26A 2PAEA 3AYDA 3OGJA 1LJ7A 3DKWA 4GH4B 4A7ZA 5T3NA 4AVCA 3AP7A 4NPRA 1H2KA 5DG1A 3KLSA 4S2HA 3FBYA 5DDJ1 4A7YA 2B9UA 2DUPA 4CDXA 3APBA 5KXCA 4AGRA 2Q1MA 4OLLA 3JZVA 1K5MA 2D6LX 4AF9A 3VN4A 5FO8B 4RFT0 1AJKA 5ABJB 4BMBA 3ELNA 4OHZA 4N9IA 1C4RA 3WCRA 3BB6A 2C5DA 3RNSA 2Y38A 3IPVA 2QQPA 4TSVA 1OPOA 1FNYA 4YZ4A 2R063 1C5IA 1N1SA 4LR4A 5EFUA 1H8TA 3JD73 1R081 4D69A 1YXWA 5FO9B 1XNBA 3MYXA 1OI6A 5C8WA 3UK9A 4Y1XA 2JD4A 1Z78A 4XFBA 5JI7A 1RUJ2 1JN2P 4YM1A 1BEV3 2IXKA 4GMP3 1CD3G 2NN8A 1YI7A 4JV4A 1VRH3 2PN5A 3KCYA 3RDIA 2PHWA 2WNVC 5CFCA 3WDXA 4QT6A 2H6CA 2JICA 1TME1 2PLV3 3AMMA 1QOSA 5C4WA 2ZGPA 1NZCA 2VULA 4QGNA 4C1WA 3WQ7A 1DQ6A 2JDZA 2HWE3 4OULA 4KU7A 5LK5A 4FPFA 4IEWA 5JWPA 4UBHA 3NSTA 5EV7A 2XPJA 3CU7A 2Z69A 1XXNA 4PIZA 1DYPA 2HKXA 2VW1A 3LCPA 1GBGA 1QQP3 4IV1B 2MNGA 2W52A 1BXHA 2A75A 4IEPA 4P9WA 2BFUL 4I2OA 4MLOA 1VBC1 2P2KA 4K7JA 4HPKA 4PDWA 1J59A 2ZX2A 4M3CB 1XNKA 1YJKA 2OUJA 4N43A 4XETA 1LOFA 1HRV1 1ND2C 2WT0A 1SMVA 4HVRA 2WSUA 4I01A 4WVZA 4HVOA 4COZA 1R093 3TOJA 1YLLA 4YW2A 3VZKA 1G6NA 2BNOA 3VKMA 4Y22A 1HXS1 2XLAA 4RL7A 1XNDA 4KWKA 4C90A 5DXDA 1PGSA 4L97A 4XJ9A 2WZR1 4LTAA 5GLZA 4I3PA 1PNGA 1YRZA 3WUDA 4Q4X3 5D8AC 5FLIA 2PHRA 3VBFA 2VW2A 3QOPA 3E6CC 3L9JT 1ENXA 1BBT3 1SEFA 5HCFA 1KDKA 2A6XA 2HEYF 4RSUA 4YFWA 1CN1A 4IL7A 4XE9A 2BWAA 1D4VB 4AHXA 2BBVA 2ZGLA 4N53A 4Q4Y2 2VNRA 4U36A 1WMFA 2XL7A 1WGPA 5EZWA 2XLFA 1RUE3 2VOVA 1TME2 2QZ3A 1X36A 2BQPA 1VJ2A 1GZ9A 4ISQA 3RI9A 4FQZA 1S0BA 2ERFA 2BPA2 4QX5A 4RR3B 1YCIA 4AFMA 3O5SA 4KU8A 1BMV1 2E7AA 1C3HA 3CJIC 3N7LA 2IWGB 2VVFA 4LULA 3CNAA 1QNWA 4YFZA 5D1IA 1ZBE1 3I4IA 1ULCA 1VR3A 2D44A 4LA2A 3WVJA 2OW4A 2RR13 3SISA 3ZIXA 1MQTA 3FMGA 4MXWB 1LHVA 3SCHA 3FLPA 4KQ7A 1I5ZA 4FPHA 4XBNA 2I45A 2WS93 4JAAA 4JDNA 2C1FA 2NP0A 5J98B 3T1MA 1SLTA 1DGRA 2A3XA 1GYKA 1HRV2 1HIXA 1VBD1 3HWJA 2X5IC 2R071 1H1AA 3HMYA 3AXDA 5FFOC 1ND3B 2WIIB 2DCZA 2MPFA 3IDEA 4D94A 4JGZC 4L9BA 4Q1PA 1IS6A 2XVGA 2DVBA 3BIWE 2FZ2A 3S30A 2PTMA 1AR71 2YMZA 3UJOA 2A3WA 1LGBA 4XJUA 3I2DA 4CEWA 2QUOA 2VW0A 4XF3A 1BVP1 2D97A 2WZR2 3H1YA 4N7IA 4XF9A 2B8MA 4IEQA 1V9U1 1PK6A 5I0RA 3JBG3 5AC91 4JQRA 4JRLA 3ZXGA 4M3CF 5L36A 3QCWA 2O1QA 2ZAHA 4LLOA 1WLWA 3QD6A 1PVC2 3BODA 3RG0A 4QPIA 3WG4A 1UIKA 5A33B 5GLUA