3AK0A

Crystal structure of ancestral congerin con-anc'-n28k
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
132
structure length
132
Chain Sequence
GVEVKNITFKLGMYLTVGGVVNSNAKRFSINVGESTDSIALHIDHRFSYGADQNTIVLNSMVDDGWQQEQRSKNFPFTAGEHFQITITFDIDTFYIQLPDGHKVEFPNRHGDEAFNFIYLAGDARLTFVRLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords Ancestral congerin Con-anc
publication title Tracing protein evolution through ancestral structures of fish galectin
pubmed doi rcsb
total genus 30
structure length 132
sequence length 132
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3ak0A00
4R9CA 3VKMA 1BKZA 3AP9A 1ONAA 2ZGSA 1LOCA 1Z78A 1B09A 4YZ1A 2NP0A 2ERFA 5IUQA 3NV1A 1PZ7A 1U0AA 2R0FA 2H0BA 2VUAA 3M2MA 4M3CE 3KM5A 2A70A 3OJBA 1VAMA 5IK8A 3WZ1A 3ZSKA 4PQ9A 4GA9A 4YGCA 2JKBA 1CIWA 2ZGTA 4Q8KA 2VW1A 2D6MA 2E6VA 2JJ6A 4Q1RA 1YO8A 2ZZJA 2A71A 1HLCA 2TEPA 4FOWA 2WSVA 3H0OA 4XBQA 2EXHA 3PVNA 1Z0HA 1S0IA 3AZXA 1AX0A 1JN2P 1JXNA 4ATFA 4XJ9A 5KXDA 3V64A 1SLLA 3B01A 1N1YA 4L8QA 1S0GA 1DQ0A 3WCSA 3OYWA 1KDKA 1AXKA 4Y22B 2WSUA 4YM3A 4K20A 2R49A 2DU0A 3SITA 2R16A 1N3PA 1O4YA 5HCAA 3AZYA 4JC1A 3BIWE 2G4IA 5DZEA 5GZGA 3AZWA 3N35A 4ZKTB 3OBTA 3AJZA 3FFZA 1LODA 1I3HA 1QOTA 1FAYA 2GALA 3TB0A 3AFKA 5JOYA 1D0HA 1FATA 3JUUA 4AYUA 1ULDA 3U4XA 1GNHA 3A4UA 1HDKA 1PZ8A 3SLIA 4AGVA 3IPVB 2A3WA 5GZFA 1ULFA 4DQAA 1FV3A 2D3RA 2YZ4A 3D6EA 1N3OA 4NO4A 3HMYA 1GYKA 4XMAA 2GMMA 4FOQA 2C9AA 3AYDA 1MS1A 4FQZA 1DHKB 4Y24A 5CBLA 2CNAA 2R1BA 4Y1VA 2FHRA 1QNYA 1MACA 1NLSA 1CR7A 1LHWA 3WHTA 3W58A 3ZSJA 4ASMB 4AVSA 4BLJA 2UURA 2YV8A 2ZMKA 5SV8A 5IK4A 4GKYA 4BM8A 4XXAA 4FPLA 4DPNA 3FLPA 3ILFA 1AXZA 1N1VA 4FPFA 3WLUA 2YY1A 1ULEA 2WKKA 4FQ4A 1N3QA 4ISQA 2R1DA 4M3CA 1EPWA 4YM2A 3C2UA 4DRVA 1S0FA 3ASIA 2P3KA 1UZYA 1WW5A 3CNAA 3L2YA 4H55A 4BMBA 1Y7BA 2WT2A 1QGLA 3AZVA 2A3YA 2ARBA 4Y1ZA 2YROA 3AYAA 1HQWA 1S1AA 1A8DA 2ARXA 2W08A 3UJOA 3UK9A 4DFSA 5IK5A 2W68A 1GICA 3A0KA 4YZ5A 1BZWA 5H9PA 1LOGA 5E89A 1VAVA 2AENA 1SCRA 4RA0A 1Q8QA 3RSJA 4Y1YA 3VUOA 3ZXJA 3RMXA 4XYXA 1G9AA 3VKOA 1DZQA 1IOAA 1HQLA 1LOFA 1SLIA 5KXBA 2AYHA 2VXRA 4FPYA 1HKDA 1A3KA 1KJRA 4YZ3A 3VKLA 4FPGA 2B7YA 4XTMA 5EWSA 5BYNA 1SLAA 2ZABA 4BLIA 5DUUA 3ZSMA 4U36A 1LU1A 1W6PA 4Y1UA 2WT0A 3WG3A 5JMCA 2UU8A 1YYNA 5FRAA 2D7FA 1AXYA 1G9FA 4AGRA 1UN1A 1ZA4A 3HN1A 3O12A 3UL2A 4DS0A 5GZEA 3RQ0A 2DV9A 2NMOA 1IS4A 1GLHA 1JHNA 1S0CA 3T2TA 5JLVA 4RL7A 3N7JA 3TAYA 5JOXA 1C4RA 4XIKA 2NMNA 3IKWA 1Q8PA 3AJYA 4FPHA 1RIRA 3OBRA 4YG3A 3AP7A 2D6NA 3AX4A 2ZGUA 3O0WA 4YFZA 3MW2A 3N7MA 1W0PA 2ZMNA 4YZ4A 5F9TA 2PHUA 3WNXA 3LCPA 4XBLA 4GXLA 3RG0A 2EIGA 1GSLA 1MZ5A 4YGBA 1IKQA 4UW6A 4LBQB 1DQ2A 1N1TA 2VW2A 3PJQA 1X50A 1QF3A 1WBFA 2E53A 1ENSA 1V6OA 3LSEA 3GNEA 3RRDA 2KM2A 1QMJA 3OY8B 5T50A 3WDXA 3R4UA 1O4ZA 1IS6A 2AGSA 4WVWA 1GZWB 1MS0A 3FLTA 3AYCA 4YFWA 2CTVA 2LALA 3V0BA 3D4KA 1NXD1 2DYCA 2SBAA 5EYXA 3N7KA 2UWBA 4FPEA 5T52A 3N36A 5DZFA 3UJQA 3WHUA 1Q8VA 3Q9OA 2PHXA 1ZM1A 1LU2A 4GKXA 4LBKA 1URXA 5E88A 1FV2A 2D43A 3SH4A 3SNMA 2P3IA 3R05A 4XDQA 4XXPA 1SFYA 3PVOA 4Y22A 5L73A 1CONA 3B00A 5T5LA 2GDFA 3M3QA 4CTEA 3ZYPA 1LHUA 4YGDA 1WUVA 4P9YA 5CB7A 2E51A 2PHWA 3FUQA 5JOZA 3INAA 4K21A 4NOTA 4M3CF 3SISA 3O0VA 2Z42A 3NV4A 2VU9A 4YGEA 3R4SA 4P14A 4ZXKA 1QNWA 2CYFA 3V0AA 4Y20B 5DG2A 4FPKA 5GLZA 1W6MA 2LTNA 2V5YA 3OYWB 5F5QA 1GKBA 4XJWA 1Q8OA 1LHNA 2DTWA 2Q5TA 5T55A 3W59A 5JDBA 1W6NA 1ENQA 1MS4A 1LESA 1LGBA 1CPNA 5GJ6A 2ZHLA 4HANA 4GWMA 2DURA 1GBGA 1C1FA 1ULGA 4K1ZA 4WZFA 1LGNA 3KQRA 4YW3A 5GLWA 1V6KA 1DYPA 1LOFC 1OFSA 2AREA 1XQNA 1SBFA 5T5JA 2E7QA 3NV2A 3RMYA 1LCLA 1CN1A 2DVGA 3D5OA 4PBOA 3O5SA 4JCKA 3ZXLA 4W65A 2EXKA 2ZGRA 4XHXA 3ZXEA 2PHTA 1YI7A 4FOVA 4Q8LA 4LBNA 1LOEA 5DZGA 2GN3A 2DVAA 3I4IA 4FPJA 1V6IA 2DWRA 4XHBA 1DFQA 5AVAA 1H30A 4C1WA 3SH3A 2D6OX 3POYA 2JE9A 2P34A 3OPZA 5LK5A 1KJLA 2W39A 1KITA 2P3JA 3GALA 4YZ2A 3FLRA 4FP2A 3WVJA 1V6NA 5H9SA 2OUHA 2AUYA 4YW1A 2JD4A 4WV8A 5GZDA 5DUVA 5T5PA 1JUIA 1MS9A 1SLTA 1AJOA 1FNZA 1LOBA 1GV9A 2UWAA 3POSA 5GLVA 3ZXFA 1AZDA 1WBLA 1LJ7A 1W6OB 4Q2FA 2DUQA 1CJPA 2DTYA 1MS8A 4Z8BA 4YW4A 2ENRA 1GANA 2EXJA 2JE7A 1Q56A 3BOPA 1VLNA 1C1LA 1MS5A 2DVFA 3PVEA 4PCRA 5IT6A 1WLCA 1CPMA 3V65A 4YM1A 4ATEA 4Q26A 3NV3A 1G86A 5GALA 1MR5A 2EXIA 1QU0A 4F83A 4LBOA 1G7YA 2ZKNA 1LECA 1AVBA 4HL0A 2ZHNA 1C57A 1FX5A 2CY6A 3DUIA 1JOJA 1R1ZA 1QOSA 2A6YA 2P37A 4XJUA 1UPSA 5T54A 3USUA 3WG2A 3FBYA 2VW0A 2AH2A 2CL2A 1W6QA 2W52A 3B9CA 2ZBJA 4M00A 4CZSA 3ATGA 3MPPG 3M3OA 4XZPA 3AP4A 3AXEA 1DQ4A 2SLIA 2ZHMA 3ZYRA 1FYUA 3A0NA 4Q1PA 2ZACA 1DQ5A 3M1HA 1RITA 3B69A 3QCWA 3WDTA 4WVVA 5T5OA 3WCRA 3IMNA 1QDCA 1V6JA 1YXWA 4XMIA 1SBEA 1OQ1A 4XIOA 1CVNA 1MVQA 3ILRA 1VALA 2PHRA 5CA6A 3LSDA 4FPOB 5CNAA 2AR6A 4YG0A 1G9CA 2GNTA 1WD3A 3WV6A 1W0OA 2YMZA 1UAIA 1BQPA 1PZ9A 3AP5A 4KBBA 2ZGQA 3AK0A 5FREA 3WG4A 1SACA 1WW4A 2CWMA 3NWKA 1KDMA 4BMEA 2A75A 2ZHKA 4FOYA 3AYEA 1WW7A 1BJQA 4UW5A 3AZZA 2DUOA 3ZXKA 5KXCA 2A6VA 3ZPYA 3HR9A 4R9AA 2A6ZA 2ZMLA 1F9KA 1JBCA 2P2KA 1LTEA 1WLDA 4CRQA 2PELA 1QKQA 3SH5A 2ZGMA 3V0BB 1RINA 3T1MA 1FNYA 3BTAA 4XILA 4YW2A 1V00A 1DBNA 1DLLA 1V6MA 4XJAA 1IS5A 2ZAAA 3IPVA 4Y20A 4YM0A 2D3SA 1UMZA 5H9QA 2OUJA 3RS6A 2NYYA 1GZCA 2GMPA 1DIWA 3ZSLA 2JDZA 1LHVA 1SLCA 4UW3A 1SBDA 4ITCA 2WQZC 3N3HA 4BOWA 2PHFA 1MZ6A 2GNBA 5KXEA 4XJZA 5E8AA 5GLTA 4LBMA 4YW5A 2EALA 1ULCA 3POWA 1WCSA 1F5FA 4BPZA 1CESA 2I2SA 2R0HA 4AVTA 2YXSA 1LEDA 1LGCA 4SLIA 2UWCA 5HCFA 3V0AB 3VV1A 3O0XA 4PBPA 4R9BA 1W6MB 3OGGA 5GZCA 1DQ6A 2FMDA 1KRIA 2ZGPA 1QOOA 1A78A 4MYEA 1APNA 1W6NB 4K1YA 4XOGA 3WDVA 1AF9A 4FVVA 4AVVA 3IM0A 4P9XA 1UKGA 1ENRA 1LEMA 1MS3A 1MVEA 1QDOA 5CAZA 2DVDA 4FPCA 1SLBA 2BQPA 1IKPA 2NM1A 1SCSA 2ZA9A 2CWSA 3AP6A 1WD4A 4IQPA 3T1LA 1LOAA 4XBNA 4P9WA 4BQ1A 1YIFA 4Y1XA 4UW4A 1S0DA 1S0JA 1I1EA 1S0EA 2D6LX 4M3CB 3ZVXA 3I8TA 2EAKA 1D2SA 4GWNA 4OZXA 5HCBA 1G9DA 4Q27A 1AJKA 1N1SA 4XE9A 4Y26A 1W6OA 2GMEA 5IK7A 2WJSA 2D6KA 2WNEA 4LBJA 2DVBA 2VH9A 4TYSA 4AWDA 3MW3A 2D44A 2A3XA 1IS3A 3WDUA 5DUWA 1H9WA 1TEIA 3N7LA 3WUCA 2EF6A 4LBQD 2ZGNA 2DU1A 4M01A 3M3CA 2GNMA 2D3PA 1DGLA 2ZGOA 3IN9A 4U2AA 4YLZA 2WT1A 1F31A 4FP3A 5DXDA 3JU9A 3ILNA 1AX1A 3APBA 1VIWB 4AGGA 1DQ1A 3AXDA 1UX6A 4I30A 1KQRA 4PF5A 2JECA 1BXHA 1H9PA 1YRZA 2WLQA 3MW4A 3DGTA 1CQ9A 5GLUA 3WDWA 4LBLA 2A5ZA 2A6WA 2GN7A 2HYKA 2V73A 2ES3A 4C1XA 4D69A 3WG1A 2XG3A 1DYKA 3WDYA 3VKFC 2OW4A 1W6PB 1JYCA 1WLWA 1Q8SA 1JW6A 5EYYA 2ZGKA 1OKQA 1G8WA 3B3QE 1N47A 4XTPA 1LULA 1GNZA 2VY0A 1J1TA 3VKNA 2A7AA 4JRAA 4LBQA 1GZ9A 1AX2A 2D6PA 5JVVA 2DUPA 5DUXA 3M3EA 4GALA 3QLQA 1UL9A 3USUB 1S0BA 1W6QB 3OY8A 1LENA 1JYIA 2OVUA 4R9DA 3FUOA 5JOWA 2A6XA 2E7TA 5DG1A 1LHOA 5EXOA 1G9BA 1V6LA 3PMEA 3BODA 1GZWA 2NN8A 4YG6A 1WW6A 4TZDA 2NZ9A 2GNDA 2ZGLA 1BYHA 3ENRA 3MEPA 3WUDA 4ISRA 1UZZA 2XB6C 3WOGA 4DRRA 5H9RA 2C5DA 2RHPA 5GM0A 4XJ8A
chains in the Genus database with same CATH superfamily
2VOXA 1Z78A 1OC1A 3RNSA 5FMOS 2RJKA 4XFIA 3KV5A 4ASLA 5BV6A 2WR9A 4MADA 1VPHA 3WSOA 2O8OA 4OVEA 2GZWA 1UOJA 4LOTA 4QX0A 5FZ9A 1NLQA 4QB1A 1HXS3 5CYYA 5I0TA 2VW1A 4QX1A 3LEGA 2E6VA 3H7YA 4PI2A 2FBEA 1GNYA 1ND3B 4Q0VA 1RUG3 1XYOA 3S6PA 1VBB3 1HLCA 4XBQA 1L7QA 2EXHA 1Y9QA 2RDSA 5A1FA 2F4LA 2VTFA 3AZXA 1AX0A 4JTNA 3T0AA 1JXNA 4N43C 1OH3A 2MHFA 1U5XA 4XAEA 5A6ZA 3B01A 1N1YA 3VHOA 5C6CA 1JYNA 3OGJA 1AXKA 1FPN2 1ZRRA 5K9YA 1W0NA 4K20A 2R49A 5G05L 5J98B 2J1TA 2OPKA 1N3PA 3FHAA 1O4YA 4IV3C 4KU7A 1BMV2 1TE1B 4HMZA 5LA1A 5JI9A 4RGGA 2MEV1 1UYYA 1FMD1 4GJYA 4V2WA 1JZ7A 3ZX7A 3N35A 4RR3C 4XURA 1KXGA 3HNBM 2VO5A 5IVBA 1W04A 3AFKA 1D0HA 1FATA 1RUD1 3JUUA 3SQOA 3U4XA 1GQHA 1QJX2 2J7MA 1UY2A 2IXKA 3PUAA 2QQMA 3IPVB 1Y9MA 2A3WA 5GZFA 2YZ4A 5FZMA 2FZ1A 2RS52 1N3OA 3D0SA 4P5YA 1BVVA 4LLFA 3E6BA 1GYKA 2UYAA 4YVSB 4O7XA 3AYDA 1P8JA 1DHKB 3A21A 5C8CA 4IE4A 2J22A 4CUAA 3KT1A 4NMIA 1MACA 2BRTA 3J7MA 5FZ6A 4AVBA 1CR7A 1W8UA 2RMU2 5A7SA 2JIGA 3WHTA 2QUOA 1CAWA 4Q4V2 5A6QA 1BK0A 1RUC2 4AFAA 4FPLA 3PMSA 4EJRA 2XLAA 3WLUA 2YY1A 4QPGB 2VUCA 2WKKA 4XF0A 3AC0A 3RVHA 3H3ZA 4Y5SA 3T2QA 2R1DA 3GCXA 5DABA 3N9OA 4YM2A 4B4RA 4EROA 3MDPA 3AMHA 1S0FA 3ASIA 1PVC1 1G6NA 4ZONA 3FWEA 1E57A 4BK5A 1AL22 1Y7BA 4TN7A 3MV11 4ZZ5A 1SZBA 1BMV1 4XETA 1O4TA 1NG0A 1BLZA 2DFBA 3VD5A 5C5UA 5J48A 1YFXA 2YFZA 3UETA 3KF5A 2RS33 2DCYA 5FYVA 1LOGA 2XR4A 4W6YA 3RSJA 5JPMB 3KD4A 1QJX1 4D6RA 5BY5A 2Q0AA 3NNLA 1G9AA 3L2HA 1SFNA 2OT7A 2IXIA 2RG4A 4ASKA 4TSVA 1W2NA 2RS51 1FOD1 3IAPA 3KWVA 1HQLA 5BNNC 5KXBA 3NO8A 2R043 1A3KA 5A33B 4YZ3A 2ZX0A 4UOJA 3ZSMA 5FPXA 1NCRB 4Y1UA 1YC61 3PLQA 2J1AA 4JDNA 2UU8A 3N9MA 4JHZA 5FRAA 1YQ8A 3AKRA 3WQ0A 2DBIA 1POV0 1UN1A 3QH7A 5EZWA 1RUC1 1VMJA 3UL2A 2X53S 5F5CA 1R1A3 4BYYA 5GZEA 1VR3A 1S0CA 4PT6A 1NY72 2JENA 3N7JA 5LCWL 1ND2A 2R073 4XIKA 2FDKA 2ZEXA 2H6CA 5FYUA 3E1F1 1HRI2 5A3TA 4B3NA 4IEUA 2WZR2 4IE0A 1S55A 4LULA 3POGA 4YG3A 1AL21 2BOIA 2P6CA 3AX4A 2ZGUA 1GR3A 1HB4A 4QAWA 4YFZA 3N7MA 5I8TA 1W0PA 3RZKA 1TME1 2WNUB 3KV6A 4M4RA 5T3NA 4XBLA 5A3LA 3VBOB 1JZ6A 1MZ5A 3WX5A 3KT4A 2BJSA 4OMCA 1F15A 2VCBA 4P00B 3ZXDA 4UYBA 3MIGA 4L97A 4CDWA 5LA2A 1WBFA 2BU9A 2QQNA 4D8MA 4YRDA 2XKOA 1V6OA 1XRUA 3LSEA 4PLOA 3GNEA 3HT1A 3MF9A 3B02A 4IESA 1IG0A 4MGTA 2X05A 2FMYA 3VBUA 3RYRA 2HWF1 3N9NA 1PGW2 5FPLA 3AYCA 4YFWA 2LALA 1S2KA 5F8PA 2WO1A 4A41A 3V0BA 2FDHA 1NXD1 4QGMA 5EYXA 4FPEA 4AEMA 2JDKA 1AR93 4RHV3 3WHUA 3VBRC 1T2XA 4CEWB 4ONUA 2I07B 3Q9OA 2PHXA 2XLFA 1HJFA 4LBKA 1URXA 1NY71 1VBC2 4DO0A 2YBPA 4QHBA 2D43A 2ET1A 2VMFA 1ULPA 3ACHA 3E97A 2P3IA 4Y3OA 4DNYA 1S2BA 1HRI1 2WWSA 3NNFA 2WZR1 1DYOA 1FPN3 1YQCA 4H7LA 2Q8OA 1R082 2CU5A 4AL9A 2C26A 4CTEA 3BPZA 2DF7A 1AR62 1LHUA 2JE8A 3K4DA 4H2AA 4YGDA 4P9YA 3BCWA 1UY4A 2YFUA 1UYZA 2JG9B 2PHWA 4B7EA 3PU3A 2IXCA 4ARXA 4M3CF 3ZFGA 5FLJA 2VU9A 3CU7A 1QXPA 3NSTA 4HETA 4ZXKA 2CYFA 4A4AA 3NJVA 3JQXA 5A6XA 2XL9A 4NN0A 3VB9A 3OYWB 5F5QA 1PX4A 3H8UA 1GKBA 5T55A 3BYWA 2WL1A 3TWIA 1M4WA 1XNTA 3MV01 2Q1ZB 4QKDA 2QZ2A 4CEYA 4XVHA 2BFUS 1LGBA 2WWJA 5GJ6A 4GWMA 5C70A 3BU7A 2DURA 3ZOIA 4CP1A 1LGNA 2Q8CA 1ASJ2 4YW3A 5FY1A 4BM8A 2RMU3 1J3RA 1NT0A 1XNKA 4N9IA 5EV7A 4Q4V3 2KR2A 5LEKA 5F6LB 4CYDA 1PO22 4IV1C 1XYNA 4JVAA 4QPGA 4WM7C 4JGZC 4BXFA 2VECA 4BHPA 3ZXEA 3LDBA 1CAXB 5DZGA 2GN3A 3I4IA 2Y33A 2RDNA 2ZX2A 5AVAA 5LASA 4JQRA 1H30A 4CUGA 1R081 2D6OX 3OF1A 3POYA 1KJLA 2DCZA 1BEV2 5IVCA 2RR13 1YNAA 2ZCWA 5L9BA 4YZ2A 2XWBB 4FP2A 3WVJA 2V4AA 4CXXA 2AUYA 2JD4A 3K51A 5GZDA 1CZSA 4UF0A 5CKQA 1AJOA 1FNZA 1LOBA 5GLVA 3NQHA 2BWAA 3GBWA 1WMFA 4MHRA 1WBLA 4IETA 5I93A 3UESA 4Q2FA 3LAGA 4IE5A 2BWCA 4HN1A 1UXZA 3VBFB 2DTYA 4Z2WA 2PHLA 4E4SA 2EXJA 1GANA 1BBT2 3MBWA 1RHI3 4NHYA 1C1LA 4YNIA 4D0QA 1POV3 4YSFA 3LGRA 3O1RA 1NCQA 1CPMA 4YM1A 1ASJ1 1MPXA 1UXXX 2FDFA 5A70A 1X8EA 2Q1MA 4Q5OA 2EXIA 2ZAHA 1QU0A 2VMEA 2HWB2 1X9PA 5FJKA 1GP6A 1LECA 1CX1A 1PO21 3CKHA 4GMP0 4FFHA 4HL0A 1DZRA 4HKOA 3H8OA 4FFGA 1ND3C 4UFHA 2A6YA 1UZVA 4UFLA 4MGZE 1VBE2 2VW0A 3DYOA 2CL2A 2PYTA 2W52A 3B9CA 3PIGA 3BVCA 2ZBJA 1IZ3A 3SEEA 4L2NA 2WNOA 4DY3A 2Y6HA 1ST8A 2PLV3 3ATGA 1JYWA 4W4ZA 3JZVA 3M3OA 3VBSB 4EN9B 4AAXA 3WF4A 2ZHMA 3A0NA 4Q1PA 5CFDA 5FO9B 4LUKA 4IXLA 1QJEA 3ABZA 1BEV1 3CF6E 5IAXA 3QCWA 3WDTA 1YQ5A 4XPVA 3WINE 4B4QA 3WCRA 3URFA 3IMNA 2VZ3A 1V6JA 3HWJA 1Q5OA 4MGQA 3I3MA 3OBAA 2JB8A 2HWC2 4QKFA 1RUI3 4XW3A 1RUF2 2WN3A 3UGGA 3LSDA 2AR6A 1G9CA 5E1RA 4PDWB 4Q4W2 3WR0A 2GNTA 1XSRA 2Q8EA 1XOYA 2YC4A 1UAIA 3WP6A 3WD5A 3OBZA 2VBDA 4IEVA 4KBBA 5FREA 2G9FA 3TRSB 3VL9A 4FXGB 4AOCA 4CP9A 5LRSA 3MICA 2WO2A 1KDMA 1QQP1 1Y43B 2JEMA 3IDEA 4XZUG 2A75A 2ZHKA 4YVSC 3THCA 4ARYA 4OULA 1JI6A 1BJQA 1RUE1 1WW7A 4UW5A 4G3YC 4QXHA 4MXWA 5FXVA 5FXZA 3T2OA 2HWB1 1EUUA 1DGWA 1H8TA 3CJIB 2Y34A 1WWYA 3KGZA 3LIGA 4BQ3A 1DG6A 2VQTA 5FO8B 4CXWA 2A6VA 2W94A 4COWA 2A6ZA 5JR7B 3TNPB 4ZY9A 1VBC3 4E8DA 3OGRA 2ZEZA 2P2KA 1LTEA 4LKDA 2WAOA 2PELA 4QPGC 3VBHA 3HVDA 4AZZA 5LY2A 2ZGMA 3WNLA 4KL1A 2WFPA 1VJ2A 4DUWA 3UNPA 2VOWA 2JDUA 3BTAA 3M8LA 1E5SA 3T30A 3VHRA 1AR63 1GOGA 2JG9A 2QNKA 1MQTA 5A6YA 3GBGA 1W8WA 1VBA2 2W47A 3OB8A 4RGAA 3U11A 3U07A 3V56A 2ZKLA 3CMGA 3S7EA 2HWC1 3RS6A 2XQXA 2NYYA 2GMPA 1RUF1 3ECQA 3TN93 2Y0IA 3CBNA 1LHVA 1SLCA 3LEIA 1UY0A 5LA0A 5FPZA 4Q4W1 3SCHA 1RMU3 3ACLA 2BGOA 4XUOA 1CAVA 5FXXA 3WNMA 1NA1B 4XJZA 3CL1A 4JX0A 2OYZA 2EALA 1ULCA 1UU4A 1WCSA 1F5FA 1H2LA 2R0HA 4WVMA 5B4XA 3SC7X 3U78A 2YXSA 4AVTA 1LEDA 2OPWA 4S2GA 5JZGB 4QX5A 2UWCA 2W2IA 3GBFA 4P08A 4AF9A 5K7PA 3V0AB 4CCCA 5BNOA 5GZCA 3IWZA 4JKMA 1DU3D 3VL8A 3IZOA 4QQLA 1UOFA 1QOOA 1NCRC 4QXBA 5EFUA 2VQ0A 3LDRA 1CAXA 1VBD3 2O0OA 3B9IA 2QQKA 3P3PA 1PO12 1EYBA 1QY4A 1I6XA 2DVDA 3DN7A 3KS7A 2E33A 3A22A 4HVRA 2Y8KA 1SCSA 4V1PA 5HXVA 2Q8DA 1O6UA 2YB7A 4KI5M 3U4SA 2P3YA 3BUCA 2PAMA 4EE2A 1O8SA 4AHWA 5L36A 1J83A 3OUJA 1ENXA 4RFT0 1YIFA 4SBVA 4BQ1A 4FAHA 3EO6A 4UW4A 2RS13 3KQ4B 3RWKX 2XJUA 5J3UA 1H1IA 5DAWA 4RR3B 5FUIA 1W8HA 2WNUC 1VB2A 3I8TA 1B35B 1D2SA 4OZXA 2GSYA 3DPRB 3VHPA 4A7KA 5KHKA 1N1SA 2VXJA 4HN0A 3VBOC 1CIYA 1RUH3 4LBJA 3VBFA 4EZHA 3MW3A 1WA6X 1UX7A 1OI6A 1H9WA 1TEIA 3N7LA 3OD4A 4LBQD 3THDA 1QXRA 1REEA 1UNBA 4IE7A 3T2PA 3ZFEA 4COYA 1SPPB 3M3CA 2GNMA 1DGWX 4XCAA 4LJHA 1F35A 1UU6A 4YLZA 3J7HA 4Q4X1 2WT1A 3HQRA 4FP3A 5KHHA 3JU9A 1KFUL 4LO5B 4OZOA 1W9WA 1T6BX 1DQ1A 2HEVF 4KH9A 5DAXA 4X6RB 1HB3A 1VMHA 3I97A 2JECA 2WLQA 3DGTA 3OGSA 4PLNA 2J1RA 4IEWA 2XQRA 4E2QA 1VBE3 1PO11 3FJSA 4C1XA 4CEWC 3WG1A 3EQEA 3H50A 3VKFC 1W6PB 3VBSA 1F2NA 3N4MA 2ZGKA 4L99A 4LLOA 1UQXA 1N47A 4Q4Y2 2VY0A 3SXWA 4M0NA 4AI8A 3PNAA 1R092 4LBQA 4E2SA 2D6PA 3ZKUA 3O1UA 4F8AA 4PF1A 1YQ2A 3HOBA 1VB4A 3J9SA 3USUB 1XYPA 3WF3A 1OVSA 1YUDA 2FZ2A 1LENA 2FCUA 4XUQA 3FUOA 2A6XA 5LZ6A 1UZ0A 3PMEA 4N8MA 1GZWA 2NN8A 2XGXA 1UIJA 2RDQA 4ZU5A 2NZ9A 4JGYB 2B46X 4W50A 5A7WB 4FFFA 1AR72 5FZOB 1UZZA 4NIDA 2W92A 1GWKA 3MGUA 2E7AA 3H8XA 5GM0A 4R9CA 3VKMA 1BKZA 1O3RA 2UYBA 4XFBA 3WNNA 2ERFA 1OD5A 4EV0A 3TEZA 5IUQA 5DAQA 3O1OA 2R0FA 5CKMA 4CUBA 1HXS2 1PGSA 1ULOA 4BE3A 2R32A 1VAMA 3NKGA 1NQJA 3ZSKA 4YGCA 4OI1A 4EWDA 5JAXA 1RUG2 1VBB2 2JJ6A 1SEFA 4Q1RA 4DXTA 1MEC3 4WZCA 3ZDVA 1WZXA 4BWOA 2TEPA 4FOWA 4CPBD 3H0OA 2XONA 2Y38A 3OG2A 4Q4Y1 1NZCA 3PVNA 4LHSA 1Z0HA 3AKQA 1JYXA 3P6BA 4HPKA 1ZBE1 1U5YA 4GULA 4UWDA 3WW1A 3O1PA 3C3VA 1S0GA 1VBA3 2VD7A 2WIIB 2JWPA 1ZZ9A 3ZFFB 2CAVA 1L7RA 2GC0A 2W9XA 4LO7A 2VZVA 3O1VA 2QQJA 2B9UA 2PXJA 5GZGA 5FPUA 3AZWA 5KHGA 3FFZA 1LODA 2GALA 4PJYA 5EJ3A 4JAAA 4FAGA 5C8WA 4OLLA 5JOYA 1V9U3 4IEYA 3VBFC 1AR71 4AYUA 4IEQA 2VMHA 1F8VA 3A4UA 1D4VB 1HDKA 1PZ8A 2CHHA 2QQLA 1IPKA 2D3RA 4QX2A 1BVP1 2WQ8A 3IDCB 4NO4A 1HX6A 4AQSA 5A7QA 5IVVA 5LWBA 4XMAA 1JZ5A 3NKTA 4FQZA 1MS1A 1HXS1 1XNBA 4O9GA 2Y26A 1L7LA 5CZKA 2R1BA 1SG3A 2FHRA 1ZRIA 4N43A 3POJA 3NW4A 4EN7B 1RUG1 4CCNA 1VBB1 1Y3TA 4AVSA 1JZ4A 5IK4A 2ZMKA 1IPJA 3PDQA 5FWEA 3C7EA 3FLPA 4IV3A 4PIXA 1AXZA 1N1VA 1VRH3 2O8QA 4F7ZA 3KVAA 3UT0A 3WEZA 1N3QA 4JZRA 3LE0A 1W99A 3VBSC 4CU6A 5C3OA 2W1UA 4RR3A 3C2UA 4F3JA 4CCKA 2P3KA 1WW5A 3AMMA 2VZ1A 4BMBA 1ZRDA 5BNPB 3WF2A 2VCAA 4MV2A 3IIAA 1HW5A 3AZVA 2A3YA 2ARBA 2D93A 5FP7A 1YFWA 2LRPA 3AYAA 1HQWA 3VN4A 4QB2A 3UJOA 4DFSA 3H3LA 4QKBA 4JKKA 1H2KA 2BGPA 1YEWA 2OS2A 2RS32 4CU7A 1GP5A 2WZPP 3PL0A 4PDWC 4HT1T 1BZWA 1W39A 1D0GA 2DCKA 5E89A 1VAVA 1OUSA 2D98A 1Q8QA 4RA0A 4LO4B 2Y6FA 3VUOA 3ZXJA 2ZX4A 4XYXA 4NHKA 3FHIB 5FWJA 1LOFA 3HN3A 5JPNB 2AYHA 3VDDB 3KT7A 2B7YA 5JXIA 4I0BA 2ZABA 2OZ6A 3CJIC 1ODMA 1QH7A 4PLMA 4AE2A 2JDAA 1LU1A 4ZZ8A 4N7UA 1W6PA 2XJPA 2WT0A 3DECA 1R1A2 1YYNA 3FMGA 1J59A 3GJBA 4AGRA 1OXCA 3NAPB 1ZA4A 2F4PA 5A3NA 1K12A 3J26N 3C7OA 3ZSEA 2R072 2DV9A 5JLVA 1GUIA 1LR5A 1R093 1TQ5A 2WZEA 4YW6A 5FZ1A 5JSPA 5JOXA 4W8JA 2FQPA 4A3XA 4DY5A 1D4M3 3GCWA 4ZS2A 3AM2A 4XUPA 1XNAA 2I74A 1QJU2 1EAH3 4YW7A 3MW2A 3I54A 2VBBA 4WVZA 2BERA 3LCPA 4Y5Z0 3WQBA 3TBDA 2R063 4BDVB 2VVEA 5A7WA 1IKQA 2VMIA 2PFWA 5BNNA 5FZOA 3NJXA 3PJQA 3AVRA 4I2OA 5KHJA 1X50A 1WLTA 2WNVB 1NUKA 5FMCA 1K45A 2VZTA 3AMNA 1NA1C 2KM2A 3PTYA 4UI9L 3RFRA 3WDXA 2BBVA 2R041 2OIIA 3R4UA 5IW0A 4LR4A 5JZGC 3NL1A 4HONA 3AMPA 4KU8A 5FXWA 1MS0A 2XBO3 5JMOA 3GZTB 4NJ4A 2BBAA 4LQRA 2G19A 1BCXA 3DEMA 1KGYA 4XACA 1W8ZA 5FP3A 2ZTNA 1EUTA 1AR92 4RHV2 4CP2A 1W9FA 2UWBA 1R1A1 5T52A 3PJYA 1KFXL 3T09A 3RZMA 4H7MA 2LS6A 2R071 4FXKB 5IJRA 4GKXA 2VQUA 3HPNA 3RZZA 1I9RA 5E88A 1FV2A 1ACCA 5L73A 4RGKA 3ZFFA 3VDCA 3L9JT 2VCMA 2GDFA 3WNOA 3DYPA 4L9BA 3ZYPA 3KCXA 5FP4A 3WQ1A 1B35C 3DPRC 5KC5A 4XF9A 5IAVA 3S7IA 2B8MA 3INAA 3O0VA 4DUXA 4YGEA 4Z82A 2FD8A 3R4SA 4GQ7A 3VGIA 4Y20B 5FBJA 5C71A 1W6MA 2LTNA 4XJWA 2DTWA 3W59A 1CAUB 4M0HA 3TYJA 1W6NA 2Z2SB 4MOAA 2OX0A 3MLLA 1LESA 3CIHA 1CPNA 5F6KA 1H6YA 2VPVA 3I2HA 1W2UA 3MO4A 1RVF3 5SV5A 1C1FA 1ULGA 3VBRA 3S0MA 5JR2A 4D7YA 3U10A 2XJSA 2JDPA 1LOFC 5JUVA 4AFMA 2AREA 2RM22 4LKSA 1AR91 1YJKA 4RHV1 2E7QA 2BUKA 3NV2A 3D5OA 4RQPB 4R4XA 1RC6A 1UU5A 3O5SA 4XF3A 2D5FA 3RWNA 3KV4A 2EXKA 2ZGRA 2UY9A 4ES9A 3KGLA 4FOVA 2XHNA 4Q8LA 4XDOA 1LOEA 5K8SA 1FPN1 4FPJA 2Y64A 4BISA 2WN2A 2A1XA 3DXUA 3MLKA 4OUMA 2DWRA 2WQ4A 4XQDA 2WDBA 1OLME 1ZZBA 2Y6KA 2RR12 1XU1A 5FZ0A 4C1WA 2JE9A 2P34A 3I7DA 2WRAA 3LIHA 1KITA 2B45X 2P3JA 3LZZA 3UV9A 2GC1A 5LBCA 4CCJA 3GALA 5FPVA 4BQXA 2OUHA 2ZX3A 4YW1A 5LRRA 4WV8A 2W3JA 5DUVA 4AK3A 5A1LA 1AR83 1SLTA 3EXUA 4J1XA 4QM9A 2PQQA 3PUIA 4ZPIA 2V72A 5EPAA 5FLHA 5C9AB 4JGYC 3RJ2X 3BIEA 1XE0A 5DMYA 1RJ8A 1CJPA 1EY2A 1RHI2 1MS8A 2B39A 3OD0A 4OI2A 2WS92 4XQWA 4YW4A 4DINB 3BTZA 2JE7A 1VLNA 4CP9B 3PVEA 4IV1A 4PCRA 1WKYA 4GIQA 5C5TA 4WM7A 1WLCA 4JGZA 3BTXA 2RMU1 2VMDA 4HK8A 1G86A 4Q4V1 1MR5A 1NQDA 4PIYA 4F83A 1G7YA 5FR3A 1QXJA 3LEKA 3K3OA 4PIZA 4Q29A 1W05A 3KVBA 3ZN4A 1AVBA 1C57A 3WUDA 4KGQA 4D7SA 4L92A 1O3QA 2IUWA 5LBFA 4OI4A 1W6QA 2PLV2 3HT2A 2J1SA 4QPYA 2VULA 3BI3A 4CP0A 5HBAA 4LIVA 4XZPA 3AXEA 3ZYRA 1U12A 2RR11 3IIIA 1FYUA 3PUQA 5FZAA 1QJU3 5CVRA 2XVKA 3M1HA 3ZFFC 4HKLA 4X6QB 1XC6A 1RUI2 1YXWA 4LUMA 1C8M2 4XMIA 1OQ1A 2ZPXA 5GKAC 4XIOA 2D5HA 1CVNA 1MVQA 1DGRA 1NZIA 2PHRA 2QKDA 4TLFA 4YG0A 3SCGA 2HWE2 3LWCA 3WV6A 1RHI1 4D3WA 1KD7A 1W0OA 1POV1 4MGSA 1OLMA 3OTFA 2BVBA 5J7MA 2Z79A 3AP5A 3AK0A 3WG4A 3ZM8A 4I3PA 5I0UA 2CWMA 1ND3A 3USSA 3WQ7A 5ABJB 3POBA 2P5BA 2WYFA 4GH4B 1S4CA 4BXSV 1K42A 2FCTA 2DUOA 1LRHA 1PK6B 2WABA 4LITA 5F2SA 3ZPYA 2YU1A 3O1TA 4R9AA 3POFA 1AUYA 1JZ8A 2HLEA 4LA3A 2PLV1 4NR1A 4XABA 3K2OA 4WM8B 5DDJ3 4E9KA 1JYTA 2X10A 5F5AA 5FMDA 1RINA 3T1MA 4MGKE 2DCTA 5FZ3A 3POIA 5CU1A 4YW2A 1H4HA 5A3WA 2DBNA 2QCSB 1V00A 5BNPC 1V6MA 2OA2A 3IDAA 4JDOA 1RUI1 3TN92 2ZAAA 4AHZA 2VAUA 3IPVA 4Y20A 4AI3A 2K46A 4NPMA 1XNCA 2WWUA 5EQUA 5LA9A 4LTAA 5H9QA 2OUJA 4ET7A 4AHXA 1GZCA 5LB6A 1DDLA 1RMU2 3S30A 2JDZA 4LKEA 4AQ2A 4YVSA 5FYSA 4BH9A 1PHMA 1V0AA 4OHVA 2YC0A 3N3HA 3P5BA 5AVPA 1O91A 1OOPB 4QU1A 1ZBA2 3VBUC 1MZ6A 2IXLA 4KWLA 1WMDA 2GNBA 4NPRA 1KS5A 1PGW1 3VZLA 5KXEA 5GLTA 4YW5A 3M4FA 3POWA 3AKSA 3K75B 5EP9A 1PM4A 2I2SA 3VDDC 5HCFA 2BNNA 1JU4A 1H0BA 2RM23 5FZGA 3I2KA 2IXJA 4RQPA 3IBMA 2PHDA 1VBD2 2ZGPA 2YYOA 5FZIA 2HJIA 1APNA 1ZRCA 1VBC1 1AF9A 1J3PA 3IM0A 4P9XA 4P9GA 1ENRA 3NAPC 1SLBA 2QZ3A 4J1WA 3UKVA 2NM1A 2WBKA 1EV13 2AC1A 1OFNA 2CWSA 4JDMA 5TSWA 4MGIE 5IATA 3T1LA 1AR61 1FT9A 1JZ2A 3H42B 2RS12 4P9WA 2EA7A 2XLGA 3OUHA 4S2HA 4NAMA 4ZU4A 4P5HA 4AEKA 3ZVXA 4M3CB 2VBPA 3TN91 1IGOA 1RUH2 1I1EA 3BPSA 4QDQA 3C7GA 2VOVA 5FO7B 4DZGA 2YC2A 4H14A 2WJSA 2D6KA 2DCJA 1RMU1 3T4VA 1IQDC 5AFBA 2DVBA 4OUEA 2JB4A 2CV6A 2A3XA 2WNVC 3MI8A 3KF3A 2WS93 2E26A 2EF6A 2DU1A 1NCRA 4A42A 1JYVA 4B7KA 2D3PA 5HI0A 4QD2A 3I2DA 2FDIA 3DCQA 3MIHA 5DXDA 3R6SA 4BQ2A 4ZU7A 1PNFA 3D3AA 4CA9A 4OMDA 4JV4A 1GWLA 4AW7A 3I59B 1VBD1 4A2UA 4I30A 1KQRA 4PF5A 5I8SA 2Z69A 5F2WA 3ZR6A 4HOOA 4AI1A 2VJXA 4CVUA 2ZOEB 1HJGA 5FZ7A 3VHNA 3LFMA 2HKXA 2HYXA 2XG3A 3ZIXA 2XMLA 3FBMA 3RZLA 5A33A 2VMGA 4DEVA 1WLWA 2WNUA 3NJYA 4QM8A 4K3UA 1OURA 3B3QE 4XTPA 4G9SB 1UCXA 1LULA 1ZZ8A 2NPIA 3H1MA 4UFKA 2RS11 5FZLA 3VBOA 5A32B 4XFCA 1XE7A 2VE1A 3KB5A 1AX2A 2DUPA 1TNFA 1QJY2 2O1QA 5EIYB 1RUH1 1C8M3 4MLOA 1QJFA 5JOWA 5IYYA 2E7TA 1J58A 2WA4A 4AVAA 2HWE3 1BBT1 2QQUA 3KCYA 5F3GA 1OUXA 4CU9A 4CCMA 3ENRA 4QPIC 2W87A 4KG0A 2XB6C 4R52A 2R6QA 5FZHA 4QQPA 5H9RA 2F17A 4XJ8A 3THTA 5FPAA 3AP9A 1ONAA 5ANQA 2EIDA 3A7QA 4CEWA 1NXMA 3WW3A 3NV1A 4OCTA 1PZ7A 1U0AA 2VL4A 4FT8A 4CCDA 3M2MA 4M3CE 3KM5A 5HV4A 2A70A 4CDQB 2VM9A 5IK8A 1VBE1 5FPBA 3WZ1A 4GA9A 3U14A 1CIWA 1YHFA 3WP5A 4XDPA 1MEC2 4GD4A 4RQPC 3RYKA 3ZXAC 2D6MA 1BK1A 4UFJA 2CGOA 1W3XA 3R4DB 3RPQA 1OLRA 3M7AA 1TVGA 2A71A 2B42B 2VZRA 3AKPA 4HXCA 4AVCA 2WSVA 3RI9A 4HFSA 1W3VA 1S0IA 2YBSA 3ME2A 4HKWA 1POQA 4PHZA 4ATFA 5KXDA 3OUIA 1SLLA 4JHTA 3OYWA 3CHXA 4YM3A 4LHLA 1XBFA 3RGBA 3SITA 1VP6A 5FKCA 3VZMA 3ALQA 3ZYGA 5HCAA 3T0DA 3BIWE 2G4IA 2GH8A 4FFIA 2PMWB 2X5IB 1V9U2 4CCLA 4K7JA 4IW3A 1ZBA3 5C9AC 2BPA2 2W1WA 5FYYA 4O65A 5FZFA 4DXZA 1NYWA 3HQXA 4MX3A 1GNHA 3S5AA 4C0BA 4AGVA 4AEDB 2JG8B 2QQWA 2VNVA 3ACIA 1KEXA 3HMYA 3G7DA 5ACA2 2WYSA 3TEWA 4Y24A 4J25A 1UY3A 2CNAA 3NVCA 3U1XA 2IXHA 1DGRN 3K77A 1QNYA 2WAAA 1MEC1 2IFRA 1LHWA 4RFRB 5K0UB 3ZSJA 3DKQA 2YV8A 5SV8A 4EN0A 1VRH2 5B2GB 4GKYA 4FTEA 4RSUA 4N90A 4KWUA 2DDUA 3MIBA 3ILFA 4Y4RA 4AFDA 2WFF3 3T0BA 1X36A 3LOBA 4UBGA 1VBA1 2C6SA 4FBFA 2TUNA 2VZPA 3O7OA 3BALA 4HK9A 4M3CA 1EPWA 3WNKA 5F7UA 4HVOA 4DRVA 1NOVA 5CG8A 4FTBA 3T4HB 4LPLA 1UZYA 3ZN6B 1UOGA 4AI9A 5FZ8A 3B5LB 2YHJA 4BIFA 2GAUA 1QEXA 1S1AA 2ARXA 2W08A 3HBZA 4XUTA 5I8YA 1O7FA 5IK5A 5KHIA 2JKXA 4GMP3 4MHUA 2W68A 1GICA 1TG7A 2RVAA 5F1RA 5C7GA 5H9PA 3MHZA 3VLBB 5CFCB 1SCRA 2AENA 4Y1YA 1O5UA 4BJ0A 3SEPA 3VKOA 5F3EA 4Z92B 2RJ2A 3FFQA 1DZQA 1IOAA 2BYVE 2VOKA 3ES1A 5ABJC 2VXRA 1HKDA 1KJRA 1OT5A 4GH4C 4HBNA 4XFHA 5BPXA 3VKLA 4FPGA 1LB2A 4BLIA 4OFGA 5DUUA 3EJKA 4RS5C 1PK6C 1UMHA 3AB0A 1XNDA 4XEZA 5FYIA 3JD72 5JMCA 2JDYA 4LEJA 5ANNA 5BXXA 4QDRA 1AXYA 1G9FA 1VRH1 3EHKA 4JQTA 2AZ5A 1UYXA 3O12A 1WCDJ 1RXFA 2ZXQA 5A32A 4WM8C 2G9GA 2W0XA 1GLHA 3LPGA 1JHNA 1D4M2 2RE9A 1RUJ3 4QHZA 5JXHA 1J84A 2ATFA 1W9SA 2QE3A 1Q8PA 1NAEA 4UXAA 5FKBA 1QJY3 1EAH2 1RIRA 3OBRA 3BB6A 3I2OA 4C91A 4PDWA 1IHMA 1O8PA 4CDXB 2J1UA 3IT8A 5FYBA 2LROA 2R062 1UKRA 2ZEYA 4CU8A 2ILMA 2V09A 5CISA 1GSLA 1JUHA 2JICA 3OEBA 4UW6A 1DQ2A 1N1TA 3DF0A 4COVA 1REDA 4XC9A 2QDRA 1OOPC 5HPOA 2E53A 1ENSA 3LF7A 2QQPA 2WC2A 1C5HA 3CJIA 1GOFA 2JDNA 1RYYA 3KHBA 3OY8B 1YCIA 4XQ4A 5T50A 2XBO2 1O4ZA 4AEJA 2Y60A 3D0JA 4AHYA 1IS6A 3OSDA 5FZDA 2AGSA 4WVWA 3AL6A 2XUEA 4NIIA 1Q3EA 2XKPA 3WF0A 5FZBA 2PAEA 1REFA 5DAVA 3D4KA 5FY5A 4A44A 3GYDA 2WLPA 2DYCA 5FYHA 3DYMA 1JHJA 2I45A 3N7KA 3N36A 3K4AA 5FQ0B 3UJQA 2K2SA 2JD9A 1Q8VA 1R091 1LU2A 5LBBA 1IPSA 1D4M1 1H4GA 3QD6A 3ZXFA 3VD7A 3BGAA 3C7FA 4E4HA 2RJLA 3PVOA 3BN6A 5FYZA 5BUVA 1CONA 2IVIB 2EIBA 1EAH1 3B00A 4META 5T5LA 4COZA 4URTA 1PMJX 2ORZA 1WUVA 1NA1A 2KD7A 2R061 5LEJA 5CG9A 1TMF3 5CB7A 4PQQA 3ZMOA 3B93A 4K21A 2VGDA 2QTWB 4NOTA 2G9ZA 3GM8A 5DN2A 3SISA 5JZGA 4P14A 4K6BA 3V0AA 5KBFA 2PN5A 1Q43A 3F2ZA 4FPKA 4LOSA 5DG2A 5GLZA 2V5YA 5JSRA 1Q8OA 1LHNA 2Q5TA 4I09A 4BU2A 3SHRA 1F4HA 2P17A 1RVF2 1ENQA 3W5MA 2XBO1 1MS4A 4RN5A 5FP9A 5ACA3 2BNMA 1O5LA 2YDEA 5LW9A 1GBGA 4WZFA 1K5MC 5GLWA 4C90A 1V6KA 1EP0A 2X29A 3J8F3 1OFSA 1HV1A 3K4ZA 5T5JA 4IL7A 1UIKA 3RMYA 4UFMA 3ZLIA 1CN1A 2DVGA 4MH0E 4PBOA 4OQ8A 1L3JA 2IVJA 3ZXLA 4W65A 3MIDA 1GU3A 4XHXA 3ETPA 2PHTA 1COV3 4LBNA 1B35A 1XB9A 3DPRA 5C8CB 2DVAA 3VZJA 5C33A 1STMA 4LORA 1LKNA 4XHBA 1CJDA 4AR2A 1RXGA 1OPOA 2OXBA 2NLRA 3POEA 1CAWB 3OPZA 1RTVA 2EVXA 3SKVA 2W39A 2YU2A 2H0VA 5F5IA 3R0RA 5IVFA 1SPPA 2XPJA 2D97A 4CDUC 1AR82 3FHQA 3HNMA 1V6NA 1FI2A 5KC6A 2R30A 3DL3A 4MGYE 2Z5WA 1HN0A 4QDSA 1GV9A 1U5IA 1HV0A 2YPDA 2VUDA 1AYN2 4Y5TA 5FCCA 1LJ7A 2B5HA 1AYM2 3QBQA 3AMQA 4AQ6A 5A3MA 2LUWA 1CZVA 4EQVA 1CWPA 4Z8BA 5L19A 1RVF1 1KS4A 2E32A 2DVFA 3RYPA 4CSWA 5ERLA 2VVFA 3N9LA 3V65A 2WINB 2XJRA 3CO2A 5KWRA 3GZEA 4Q26A 4H3WA 4S2DA 3NV3A 1Z7S2 4MVTA 4CDQC 3X29B 3ACGA 3JD73 2XHKA 4GZ9A 4NVPA 4YARA 4QU2A 1MZEA 1OLQA 2BW8A 2CY6A 1FX5A 1VMFA 1JOJA 4XJUA 3UKNA 4ASMB 3USUA 2P1BA 3P3NA 1OA4A 3FBYA 5FIXA 4NHMA 2AH2A 3WG2A 1IG3A 3HEIA 4ZHNA 4DXSA 4QT6A 4HLTA 1GQGA 3MUY1 4LA2A 3MPPG 4QQ2A 3SKJE 5HV0A 3Q8AA 5FK8A 1DQ4A 1UY1A 2PAKA 3RDIA 1GWMA 1UF2C 1WCKA 2ZACA 4JGYA 2RS31 4QXCA 1DQ5A 1H2MA 1RITA 3B69A 2Y6JA 3H1WA 5T5OA 1XSQA 1AR81 3WW4A 1HB1A 1H1MA 1UMIA 3OCPA 1SBEA 4OHWA 1ND2B 3NNGA 5FJHA 2VQAA 3GHMA 5J36A 2X5IC 3E6DA 5L9RA 3JXSA 3ILRA 4NE9A 2QBXA 5CNAA 5CA6A 4K8FA 2ADEA 2P4EA 2TBVA 1WD3A 1FXZA 1HN1A 1ZNPA 3DXTA 5AC93 1QH6A 5BNQA 4BB3A 1BQPA 3AL5A 2VNRA 3ZYJB 4AEDC 4URAA 2JG8C 2XJTA 1SACA 1DF0A 3NWKA 4KG8A 3ST7A 4FCAA 3KSCA 1ZZCA 4FOYA 3AYEA 4CDWB 1J3QA 5CIRA 3AZZA 3KHCA 2XH6A 5JCTA 3W20A 5K0UC 3LOIA 5KXCA 3J7LA 3ON7A 4IEOA 4K40A 4XCBA 5DDJ2 2BFUL 5IFPA 3O1MA 2ZMLA 5FDBA 1F9KA 1RGSA 3KMHA 3VBUB 1JBCA 2IZWA 1UO9A 3I2GA 1WLDA 1QJU1 2Q4SA 2BGCA 3SH5A 3V0BB 2OQ6A 5F3CA 1FNYA 4E27A 3ZDSA 4O9EA 2CSGA 4XILA 4N53B 1JOPA 1WA4A 1DBNA 4NAOA 1XPWA 1DLLA 2BDRA 3LKJA 2EICA 1XU2A 1IS5A 4QQOA 4A6SA 4UT5A 4YM0A 4NHLA 3K3NA 4QPIB 1PVC2 2IWGB 3I3EA 2C0ZA 1DIWA 2XXZA 4I01A 1HRV3 4OHYA 4UW3A 4QKNA 1RL3A 4BZ4A 3RJRA 5J96B 2WQZC 5CFCC 4XAAA 2AACA 2E31A 2HWD3 2V5DA 1MZFA 1YJLA 4EWAA 4LBMA 4R4ZA 2IC1A 5FFOC 1PIV3 2PTMA 1CESA 2ZEWA 2GP3A 3ZFGB 2YPJA 2VZOA 1LGCA 2HEWF 3B94A 1CZTA 4MSVA 5FUPA 4I0AA 1DQ6A 1LNSA 1FOD2 2AEZA 3SMHA 2W5FA 1NE6A 4MYEA 4AVVA 3WDVA 2H6BA 4CEYB 3FN9A 4FVVA 3UGFA 4HVQA 1UKGA 5M0TA 5DDJ1 1MS3A 1EV12 1H6XA 5BNPA 3BKZA 3KV9A 2A73B 1IKPA 3CZUA 3AP6A 2ARCA 3WP4A 2Z4FA 3WW2A 2VNGA 2W95A 2MNGA 3C8XA 4XBNA 3H8RA 4NIGA 1YQ6A 1D2QA 1S0DA 4Y4YA 1UZWA 4CDXC 5D1IA 1S0JA 4GB33 1S0EA 2D6LX 5FYTA 4LXLA 5HCBA 1Y4WA 2FDJA 3G6JB 3H3UA 4Q27A 4Y26A 1AYN3 1WCQA 1AYM3 3DV8A 1YWKA 3VDDA 3Q8BA 4YWAA 4AWDA 1IS3A 5DUWA 1TME2 1AHSA 2WO7A 2QVSB 3OGVA 3JBG3 5K4LA 4M01A 1DGLA 2ZGOA 2ARAA 2RM21 2G1MA 4JKLA 3AKTA 1F4AA 5J1XA 5ISLA 4D94A 5FP8A 1F31A 3NAPA 4UF0B 5L7OB 1Z7S3 5FK7A 5JIUA 1OA3A 2VOTA 4ZS3A 4MXVA 3MZHA 1UOBA 3AXDA 2VCCA 3RI8A 3MW4A 1H9PA 3OPWA 3PURA 5IWFA 3KCCA 3W21A 2HWF2 2HYKA 2ES3A 1EV11 1NCQB 4PI0A 1SQ4A 4D69A 4IGQA 2ET7A 4NPLA 1DYKA 4EZ4A 3EYPA 2OW4A 4UBHA 3J4UH 4TWTA 5JI7A 4BQYA 1X8MA 5EYYA 1JODA 1OKQA 5FZCA 3VKNA 4B4PA 1O3SA 2A7AA 4IERA 5APAA 2MPFA 5DUXA 3M3EA 2WNVA 3QLQA 1OH4A 4A6OA 3NMBA 4LT5A 1UL9A 1PGL2 3FE5A 1S0BA 3UKTA 1GQPA 1TZOA 1JYIA 3ZO0B 5EHDA 2OVUA 4R9DA 1LHOA 4L11A 3IB3A 2WS91 4LNVA 3BODA 4TLGA 4XF4A 4YG6A 5CFDB 1YFUA 2K0GA 2MEV3 3FC0A 2YGMA 1FMD3 3CZJA 2GNDA 2ZGLA 1BYHA 1JMUB 1XJAA 2BNOA 3MEPA 3VD3A 1W8FA 4ISRA 3WOGA 3LA7A 4AFBA 1RUD3 2XVGA 2RHPA 5D8AB 1J1LA 4LHNA 4YZ1A 2NP0A 2ZGSA 1LOCA 1B09A 2Y6GA 2YBKA 4RS5B 3ZPOA 1PMIA 2HBTA 4HZFA 2H0BA 2VUAA 2GP5A 1DCSA 3HAGA 3OJBA 1W28A 2J42A 4PQ9A 1VAKA 2JKBA 4OQ9A 4MUVA 2ZGTA 4Q8KA 3KLSA 2VC9A 2Y0OA 1YO8A 2ZZJA 4Z2AA 1QIQA 1W9TA 2EAAA 5C8CC 4MG2A 1SMVA 4N53A 3AFGA 4MXWB 4E2GA 1JN2P 5I0DA 4XJ9A 1H8TB 3V64A 2HBUA 4L8QA 5I0RA 1C8M1 1DQ0A 3WCSA 4AXOA 1KDKA 4DUVA 5FYMA 1F5JA 2RDRA 2JIJA 2WSUA 4P9LA 1YLLA 4QPIA 4Y22B 1CAUA 3S5QA 2DU0A 2JDMA 2R16A 2XWJB 5EJ1B 1PVC3 3AZYA 2HWE1 3VBHB 4JC1A 3O1SA 4B1MA 5DZEA 4ZKTB 3C7HA 3EB7A 4N7IA 3OBTA 3AJZA 4QQHA 4B8EA 1QOTA 1I3HA 1ALYA 1FAYA 3I2FA 3TB0A 1MQTB 1ZA7A 2NQYA 1ULDA 4NWWA 5FY0A 2QQOA 1TNRA 3DKWA 1M06G 1CGPA 3SLIA 5A3UA 5E6HA 5C4WB 1ULFA 4DQAA 1FV3A 3D6EA 1W9YA 1QJX3 2GU9A 3PHMA 1HIXA 1GOHA 1WMEA 2VG9A 4Q0PA 5HXMA 2BVVA 5I91A 2GMMA 2VZQA 2K9ZA 2C9AA 2XJQA 2RS53 4FOQA 1FOD3 5CBLA 1O3TA 1ZX5A 2VR4A 4Y1VA 3VDAA 1CAVB 3VD9A 2D40A 1NLSA 1W8NA 4NUBA 3AVSA 3W58A 1OQDA 3TNQA 4BLJA 2UURA 4WVMB 5LK7B 1OA2A 1ZVFA 3MIEA 2WFF2 4QGNA 4TXWA 2GC3A 3NNJA 4BIOA 4LO8A 4XXAA 4DPNA 1GMMA 2J1VA 5C3PA 3KZ4C 3ZXGA 4QB6A 5BNOB 4FPFA 1RUC3 1OBNA 1GZTA 1ULEA 3HIFA 4FQ4A 1OKOA 4CE8A 4ISQA 3U0ZA 4EYUA 2J1EA 4KMQA 2BZDA 1W2OA 2Q30A 4XUNA 4AI0A 3BU0A 4X8PA 5C9AA 4YVWB 3CNAA 4H55A 3L2YA 4KWJA 1PGL1 3WF1A 3TEYA 4IEXA 2WT2A 4KQ7A 1QGLA 5A1AA 2BP6A 3OPTA 2YROA 4Y1ZA 5DQ0A 1AL23 2XL7A 5DPNA 5A80A 1A8DA 1ZBA1 1ND2C 1T6GC 5FAXA 3GJAA 3UK9A 1SFPA 1US3A 3HBKA 1TME3 2KXLA 1UW8A 3M70A 4I0WB 5E16A 4JRLA 4XFAA 5FOJB 3A0KA 1U5ZA 1Y9GA 4YZ5A 2XUMA 4KBZA 1K5MB 5L7OA 3RMXA 3I2JA 1RUNA 4OUSA 3LPFA 1DP0A 2O14A 4HSLA 5FBZA 1UPIA 1SLIA 4FPYA 2E9QA 4CDWC 2ADDA 4N9HA 4YYOA 1ZREA 1X7NA 4XTMA 5EWSA 5BYNA 1SLAA 1UYPA 1RJ7A 2HWF3 3Q8CA 3THPA 3ZFEB 4U36A 2C9KA 1QQP2 5G04L 3WG3A 3MUZ1 1NKGA 2D7FA 1C8NA 1RUE2 2B4KA 3EMRA 2WFF1 3HN1A 4LE3A 4P9IA 5A7NA 3OOXA 1RUJ2 1SDWA 1W8OA 2GH2A 3K48A 4BQ4A 3RQ0A 2NMOA 3T2TA 1IS4A 3QOPA 4DS0A 4RL7A 4IDZA 3TAYA 1C4RA 4BK4A 3MF6A 4FO9A 3FL7A 5FOBB 5FZKA 5JXGA 4OHZA 2NMNA 3IKWA 3AJYA 4FPHA 4N53C 4CDUB 3ZMNA 3AP7A 3PUHA 1HRI3 2D6NA 2WZR3 3O0WA 3ZKYA 2ZMNA 5J09A 4YZ4A 3U75A 5F9TA 1I5ZA 4GMP1 2PHUA 5FY4A 3WNXA 4QWNA 4J6GA 4GXLA 3RG0A 2EIGA 3U37A 4GJZA 5CKNA 4YGBA 2HEYF 3I3DA 4LBQB 2VW2A 5ABJA 1W8TA 3Q8EA 1JTZX 4NRPA 5FLIA 1QF3A 4GH4A 1A6CA 5D8AA 4KWKA 1DZTA 3RRDA 5J37A 5FY8A 1QMJA 4RS5A 1PK6A 3Q8FA 4QHOA 3ZFGC 2RV9A 3ZYBA 1C3HA 1GZWB 2JX9A 3FLTA 2VTXA 1OQEA 4WM8A 4COUA 3CQOA 2CTVA 4D6QA 4EN8B 4I3GA 1OF3A 2YGLA 3UGHA 2SBAA 4CEYC 3N9QA 2ORXA 4R8HA 3PIJA 4FI9A 4IUGA 2W1SA 5DAPA 5DZFA 2VZUA 1RUJ1 2V4VA 1JZ3A 1ZM1A 3GDBA 3LDKA 4W6XA 2Q1FA 4QXKA 1QJY1 3A23A 4QPWA 5C3QA 1QWRA 4ES8A 4UFIA 3SH4A 3SNMA 4XDQA 3R05A 4NHXA 4LIUA 1SFYA 3JB4C 4XXPA 4Y22A 2JXAA 2DFCA 3MFCA 4D6SA 1S2EA 5FV3A 3M3QA 1OOPA 1TMF2 1YIPA 3ROUA 3I3QA 1R083 4P9JA 1VE0A 4NRMA 2E51A 5JOZA 3FUQA 1XXNA 4Q0UA 3HQUA 1ZYBA 3WT3A 2Z42A 3NV4A 4HPKB 3I2IA 1QNWA 5FTTC 5C4WA 4IE6A 4UAPA 1QJZA 3MFAA 5JDBA 1YI9A 5D2AA 2L9LA 4TTGA 4M4PA 5A7OA 2F6BA 4EN6B 2ZHLA 4HANA 5L7OC 3J8F2 4K1ZA 4NIHA 3KQRA 3CLPA 3GGLA 1DYPA 3MIFA 5F39A 4E4ZA 1XQNA 1ASJ3 1D7PM 1SBFA 2ETEA 4EWEA 4Q4X2 5I0SA 2QJVA 3LD8A 1LCLA 1VRBA 1COV2 1JH5A 1NCQC 2BTVC 1O59A 2OQ7A 4JCKA 4W6WA 3WP3A 2X09A 4CXYA 1PO23 1NX9A 4C0HA 1YI7A 2OZJA 4LO6B 4A3ZA 4ZXEA 1ODNA 3OEAA 1V6IA 1UWWA 4YVWA 3VZOA 1WCUA 2E63A 4N43B 4NIAA 1DFQA 2ZZQA 3NRUA 3E5XA 4KNCA 3SH3A 2QQVA 5FY9A 1TMF1 4QX7A 5LK5A 3T08A 1V9U1 1H8VA 1YFYA 3K46A 1JOBA 4JTOA 4MO3M 4IV3B 5JWPA 3F95A 3FLRA 1BEV3 2C4XA 5H9SA 4IGPA 5T5PA 1NE4A 1JUIA 1MS9A 2UWAA 3CJXA 3POSA 4KGGA 1K5MA 5C3SA 5CFDC 2ZJCA 4QMAA 4NROA 1AZDA 1SHWB 1W6OB 3I59A 2AEYA 3MLJA 5C3RA 5F3IA 5ACA1 2DUQA 1C28A 2ENRA 1Q56A 5D8AC 4Z1VA 3BOPA 1MS5A 1OVPA 5IT6A 4C8DA 2FCVA 3J8F1 3CDZB 4IEZA 1BBT3 4AQTA 4ATEA 1NLRA 1RUOA 2C24A 3HJRA 5GALA 3ZR5A 4BQ5A 5EJZB 4AFCA 4DB5A 1R64A 1E5HA 1QQP3 2ZKNA 4LBOA 1X82A 3ELNA 3ES4A 4QX8A 5B4NA 2IFWA 5FMOL 1RUE3 1ZRFA 4DEQA 4Y33A 3ETQA 1COV1 2ZHNA 2HWB3 3DUIA 1JS9A 1R1ZA 1QOSA 2P37A 5T54A 1UPSA 3PTRB 3EBRA 4WBBA 4M00A 1V70A 1OF4A 4CDUA 4CZSA 3S57A 4I02A 1C5IA 5FZEA 1H8TC 1DLCA 4DIQA 4G4FA 3AP4A 2EIEA 2SLIA 2QQIA 3JCIA 2WZ8A 3GXUA 3HD8B 5D21A 2CAUA 2XJVA 3E5QA 4DOUA 4WVVA 1W2TA 1ZBE2 2HH9A 1QDCA 4NRQA 3VBHC 3IDBB 1A34A 4HSJA 3JQWA 2X8KA 3J7NA 1AL0G 3QACA 4RD7A 1SDDB 1VALA 4FPOB 2JG9C 5AC92 2HWC3 4Z07A 1MQTC 4LE4A 5FY7A 1RUF3 1EPZA 4CDQA 2QFEA 2YMZA 4LK6A 2LW8A 3M3IA 5C4WC 4E4DX 2VZSA 4Q4W3 1PZ9A 2ID4A 3TEXA 5KR7A 3LB9A 4V2VA 2ZGQA 1GFF2 1WW4A 3ORJA 1LAJA 2XVLA 4NWVA 4OHXA 4QX3A 5FUNA 5BNNB 4BMEA 5F37A 3JD71 3N9PA 2PA7A 2CDOA 3FZ3A 4K8RB 1X9TA 3LA3A 4A7YA 3IMMA 3MPBA 3PVBB 5FYCA 5IVYA 2P6HA 3BOWA 4MZUA 4XF1A 1CX4A 3ZXKA 3HR9A 4E8CA 3PUSA 2KA3A 4BA6A 1HQNA 1BHGA 3HNYM 4IGOA 5BNOC 5FZ4A 1PM7A 4OYUA 1QKQA 4CRQA 4LHKA 4QGLA 3GHNA 1OD3A 3GZUC 2X5IA 4FSJA 5JSOA 4YVWC 2TNFA 3O14A 2LM3A 3T3YA 4Q0SA 2ZX1A 1QHDA 4XJAA 3D82A 2WO3A 1HRV2 2UY8A 5HCHA 2D3SA 1UMZA 4AEDA 2BEOA 2JG8A 3ZSLA 3JB8A 3NNMA 2HWD2 5AC91 4S2FA 2CGPA 1SBDA 4ITCA 4CUCA 4XFGA 4BOWA 3W5NA 2PHFA 2WUHA 1PIV2 4LK7A 1OHFA 5IVEA 5E8AA 4LKFA 3ITQA 5K0UA 1A8MA 1PNGA 4BPZA 4CCEA 1PX3A 2B9VA 3NJZA 2PQSA 4SLIA 3E5UA 3VV1A 3O0XA 2C1FA 1CD3G 4PBPA 4R9BA 1W6MB 3OGGA 4Q4X3 1KRIA 2FMDA 4CPBA 1JU3A 3I49A 5A7PA 3ZFEC 1HB2A 2CDPA 3RZJA 1XE8A 1A78A 4XOGA 1W6NB 4K1YA 4L0PA 1UD1A 5A3OA 4DMIA 4K9SA 1LEMA 4HG6B 3ZYHA 1MVEA 1QDOA 3ZN6A 5CAZA 4FPCA 4GWJA 3VBRB 4O61A 5LATA 4CCOA 2BQPA 3RZHA 2ZA9A 1PO13 4Q0QA 1OMIA 1WD4A 2YUEA 4IQPA 2CGNA 1E5IA 3WXPA 1LOAA 4GB32 1K3IA 4X8NA 4Y1XA 5F32A 2VVDA 3BTYA 5JXJA 5CFCA 1OSGA 2XOMA 4IEPA 3WNPA 2Y6LA 2W1QA 3W9AA 2W46A 2FDGA 2EAKA 1HRV1 4GWNA 1G9DA 5IVJA 1AJKA 4XE9A 1GP4A 2GC2A 1W6OA 2GMEA 2YG0A 5IK7A 2WA3A 2WNEA 2HWD1 2N7GA 2VH9A 3GF6A 4TYSA 4AI2A 5A3PA 2D44A 3CEWA 3WDUA 3JBG2 3WUCA 3QH6A 1PIV1 2ZGNA 5IFTA 1K5JA 3PU8A 4AAPA 4BCUA 4AG4A 2VMCA 3IN9A 3MYXA 1IQAA 4LMFA 4XFFA 4B29A 4U2AA 4FTSA 2XDVA 3LEMA 3UYJA 3ZYIB 4INDA 3ILNA 1I5PA 1AX1A 3APBA 1VIWB 1ZZ7A 2BOJA 4AGGA 1E5RA 3I3BA 5FMBA 3VZKA 2VTXJ 3ACFA 1UX6A 1US2A 2R042 2R7EB 3H9AA 1WMXA 3SCFA 1BXHA 5GLUA 1YRZA 1OPMA 3GZAA 3ZYFA 1CQ9A 3VZNA 3ZIWA 3WDWA 1W06A 2A5ZA 1W90A 2A6WA 2GN7A 2V73A 3P1IA 4LBLA 4IV1B 4P02B 5LBEA 3H7JA 3VD4A 4WM7B 4BQWA 2VUJA 3LA2A 4JGZB 3WDYA 1PMHX 4CDXA 5LY1A 1JYCA 5CEHA 3H1YA 1Q8SA 1JW6A 5AFEA 2OKXA 1G8WA 3B7MA 2JDHA 3IAQA 4OI0A 1GNZA 1J1TA 4ORFA 3RZGA 4JRAA 1GZ9A 4GB31 4Q4Y3 5JVVA 4GALA 1W03A 2ZS6B 1PVXA 1H1AA 5IHRA 1ZBE3 1RB8G 4A7ZA 1ZZ6A 3D8CA 4GAZA 4YPJA 2W91A 4GWIA 1W6QB 1AYN1 3ZN5A 3OY8A 2QDNA 2VNOA 1AYM1 3TOJA 3VDBA 5DG1A 5EXOA 1G9BA 1V6LA 2MEV2 4D7TA 1FMD2 1X33A 4A45A 2BV4A 3JBG1 1WW6A 3LQCA 3FX3A 5JIAA 4TZDA 3LFIA 3E6CC 1WGPA 4DXRA 1RUD2 4RYDA 5L9VA 3WY6A 5CADA 1H2NA 4DRRA 1W2AX 4B1LA 1Z7S1 2C5DA 1AR73 5FQ0A
chains in the Genus database with same CATH topology
2VOXA 1Z78A 3RNSA 5FMOS 2RJKA 4XFIA 4ASLA 5BV6A 2O8OA 4OVEA 2GZWA 1HXS3 5I0TA 2VW1A 2E6VA 3H7YA 2FBEA 1ND3B 4Q0VA 1RUG3 1XYOA 3S6PA 1VBB3 1HLCA 4XBQA 2EXHA 1Y9QA 3AZXA 1AX0A 4JTNA 1JXNA 4N43C 2MHFA 1U5XA 3B01A 1N1YA 3VHOA 5C6CA 3OGJA 1AXKA 1FPN2 1ZRRA 5K9YA 4K20A 2R49A 5J98B 2OPKA 4IV3C 1N3PA 1BMV2 1O4YA 4KU7A 1TE1B 4HMZA 4RGGA 2MEV1 1FMD1 3ZX7A 3N35A 4RR3C 1KXGA 3AFKA 1D0HA 1FATA 1RUD1 3JUUA 3U4XA 1GQHA 1QJX2 2IXKA 3IPVB 2A3WA 5GZFA 2YZ4A 2FZ1A 2RS52 1N3OA 3D0SA 1BVVA 4LLFA 3E6BA 1GYKA 2UYAA 4YVSB 3AYDA 1DHKB 5C8CA 3KT1A 1MACA 4AVBA 1CR7A 2RMU2 3WHTA 2QUOA 1CAWA 4Q4V2 1RUC2 4AFAA 4FPLA 3PMSA 4EJRA 2XLAA 3WLUA 2YY1A 4QPGB 2WKKA 4XF0A 3H3ZA 2R1DA 4B4RA 4YM2A 4EROA 3MDPA 3AMHA 1S0FA 3ASIA 1PVC1 1G6NA 3FWEA 1E57A 1AL22 1Y7BA 1BMV1 4XETA 1O4TA 1NG0A 2DFBA 5J48A 1YFXA 2RS33 2DCYA 1LOGA 4W6YA 3RSJA 5JPMB 3KD4A 1QJX1 5BY5A 2Q0AA 1G9AA 3L2HA 1SFNA 2IXIA 4TSVA 2RS51 1FOD1 1HQLA 5BNNC 5KXBA 3NO8A 2R043 1A3KA 4YZ3A 2ZX0A 3ZSMA 5FPXA 1NCRB 4Y1UA 3PLQA 4JDNA 2UU8A 5FRAA 3AKRA 3WQ0A 1POV0 1UN1A 3QH7A 5EZWA 1RUC1 5JI9A 3UL2A 2X53S 1R1A3 4BYYA 5GZEA 1VR3A 1S0CA 1NY72 2JENA 3N7JA 1ND2A 2R073 4XIKA 2H6CA 1HRI2 4B3NA 4IEUA 2WZR2 1S55A 4LULA 4YG3A 1AL21 3AX4A 2ZGUA 1GR3A 4YFZA 5I8TA 3N7MA 1W0PA 1TME1 2WNUB 5T3NA 5A3LA 4XBLA 3VBOB 1MZ5A 3WX5A 3KT4A 3ZXDA 3MIGA 4L97A 4CDWA 1WBFA 4YRDA 2XKOA 1V6OA 1XRUA 3LSEA 4PLOA 3GNEA 3HT1A 3MF9A 3B02A 4IESA 2FMYA 3VBUA 3RYRA 2HWF1 1PGW2 3AYCA 4YFWA 2LALA 1S2KA 3V0BA 1NXD1 4QGMA 5EYXA 4FPEA 4AEMA 1AR93 4RHV3 3WHUA 3VBRC 4CEWB 4ONUA 2I07B 3Q9OA 2PHXA 2XLFA 4LBKA 1URXA 1NY71 1VBC2 4QHBA 2D43A 2ET1A 3E97A 4DNYA 2P3IA 1S2BA 1HRI1 2WWSA 2WZR1 2Q8OA 1FPN3 4H7LA 1R082 4CTEA 3BPZA 2DF7A 1AR62 1LHUA 4YGDA 4P9YA 3BCWA 2JG9B 2PHWA 4B7EA 2IXCA 4M3CF 3ZFGA 5FLJA 2VU9A 3CU7A 1QXPA 3NSTA 4HETA 4ZXKA 2CYFA 3JQXA 2XL9A 4NN0A 3OYWB 5F5QA 3H8UA 1GKBA 5T55A 2WL1A 3TWIA 1M4WA 2Q1ZB 2QZ2A 4CEYA 2BFUS 1LGBA 5GJ6A 4GWMA 3BU7A 2DURA 4CP1A 1LGNA 1ASJ2 4YW3A 2RMU3 1J3RA 1XNKA 4N9IA 5EV7A 4Q4V3 5LEKA 5F6LB 4CYDA 1PO22 4IV1C 1XYNA 4JVAA 4QPGA 4WM7C 4JGZC 2VECA 4BHPA 3ZXEA 1CAXB 5DZGA 2GN3A 3I4IA 2ZX2A 5AVAA 4JQRA 1H30A 1R081 2D6OX 3OF1A 3POYA 1KJLA 2DCZA 1BEV2 2RR13 1YNAA 2ZCWA 4YZ2A 2XWBB 4FP2A 3WVJA 2AUYA 2JD4A 3K51A 5GZDA 1AJOA 1FNZA 1LOBA 5GLVA 2BWAA 3GBWA 1WMFA 1WBLA 4IETA 5I93A 4Q2FA 3LAGA 2BWCA 4HN1A 3VBFB 2DTYA 4Z2WA 2PHLA 4E4SA 2EXJA 1GANA 1BBT2 1RHI3 4YNIA 1C1LA 4YSFA 1POV3 3LGRA 1NCQA 1CPMA 4YM1A 1ASJ1 1X8EA 2Q1MA 2EXIA 2ZAHA 1QU0A 2HWB2 1LECA 1PO21 4GMP0 4HL0A 1DZRA 4HKOA 1ND3C 2A6YA 4MGZE 1VBE2 2VW0A 2CL2A 2PYTA 2W52A 3B9CA 2ZBJA 1IZ3A 4L2NA 4DY3A 2PLV3 3ATGA 3VBSB 3JZVA 3M3OA 4EN9B 2ZHMA 3A0NA 4Q1PA 5CFDA 5FO9B 4LUKA 4IXLA 1BEV1 3CF6E 3QCWA 3WDTA 4XPVA 4B4QA 3WINE 3WCRA 3URFA 3IMNA 1V6JA 3HWJA 1Q5OA 2HWC2 1RUI3 4XW3A 1RUF2 3LSDA 2AR6A 1G9CA 5E1RA 4PDWB 4Q4W2 3WR0A 2GNTA 1UAIA 3WP6A 3WD5A 4IEVA 4KBBA 5FREA 3TRSB 2G9FA 3VL9A 4FXGB 5LRSA 3MICA 1KDMA 1QQP1 1Y43B 2JEMA 3IDEA 4YVSC 2A75A 2ZHKA 4OULA 1WW7A 1BJQA 1RUE1 4UW5A 4G3YC 4MXWA 2HWB1 1DGWA 1H8TA 3CJIB 3KGZA 1DG6A 5FO8B 2A6VA 4COWA 2A6ZA 5JR7B 3TNPB 1VBC3 2P2KA 1LTEA 4QPGC 2PELA 3VBHA 2ZGMA 4KL1A 2WFPA 1VJ2A 2VOWA 3M8LA 3BTAA 3VHRA 1AR63 2JG9A 2QNKA 1MQTA 3GBGA 1VBA2 4RGAA 3U11A 3U07A 3V56A 2ZKLA 3S7EA 2HWC1 3RS6A 3TN93 2NYYA 2GMPA 1RUF1 3ECQA 2Y0IA 1LHVA 1SLCA 5FPZA 4Q4W1 3SCHA 1RMU3 3ACLA 1CAVA 1NA1B 4XJZA 3CL1A 2OYZA 2EALA 1ULCA 1UU4A 1WCSA 1F5FA 1H2LA 2R0HA 4WVMA 4AVTA 2YXSA 5JZGB 1LEDA 4S2GA 4QX5A 2UWCA 3V0AB 3GBFA 4AF9A 5K7PA 5BNOA 5GZCA 3IWZA 1DU3D 3VL8A 4QQLA 1QOOA 1NCRC 5EFUA 2VQ0A 1CAXA 1VBD3 2O0OA 3B9IA 3P3PA 1PO12 1EYBA 1QY4A 1I6XA 2DVDA 3DN7A 3KS7A 4HVRA 1SCSA 4V1PA 5HXVA 2PAMA 4AHWA 5L36A 4SBVA 4RFT0 1ENXA 4BQ1A 1YIFA 4FAHA 3EO6A 4UW4A 2RS13 2XJUA 5J3UA 1H1IA 4RR3B 2WNUC 1VB2A 3I8TA 1B35B 1D2SA 4OZXA 2GSYA 3DPRB 3VHPA 4A7KA 5KHKA 1N1SA 4HN0A 3VBOC 1RUH3 4LBJA 3VBFA 3MW3A 1OI6A 1H9WA 1TEIA 3N7LA 3OD4A 4LBQD 1QXRA 1REEA 3ZFEA 4COYA 3M3CA 2GNMA 1DGWX 1UU6A 4YLZA 4Q4X1 2WT1A 4FP3A 5KHHA 3JU9A 1KFUL 4LO5B 1DQ1A 2HEVF 4KH9A 4X6RB 2JECA 2WLQA 3DGTA 4PLNA 4IEWA 4E2QA 1VBE3 1PO11 3FJSA 4C1XA 4CEWC 3WG1A 3EQEA 3H50A 3VKFC 1W6PB 3VBSA 1F2NA 3N4MA 2ZGKA 4L99A 4LLOA 4Q4Y2 1N47A 2VY0A 3SXWA 4M0NA 4AI8A 3PNAA 1R092 4LBQA 4E2SA 2D6PA 4F8AA 1VB4A 3J9SA 3USUB 1XYPA 1YUDA 2FZ2A 1LENA 3FUOA 2A6XA 3PMEA 1GZWA 2NN8A 2XGXA 1UIJA 4ZU5A 2NZ9A 4JGYB 2B46X 1AR72 1UZZA 3MGUA 2E7AA 5GM0A 4R9CA 3VKMA 1BKZA 1O3RA 2UYBA 4XFBA 4EV0A 2ERFA 1OD5A 5IUQA 2R0FA 1HXS2 1PGSA 4BE3A 2R32A 1VAMA 3NKGA 1NQJA 3ZSKA 4YGCA 4OI1A 4EWDA 5JAXA 1RUG2 1VBB2 2JJ6A 1SEFA 4Q1RA 1MEC3 4WZCA 4BWOA 2TEPA 4FOWA 3H0OA 2Y38A 4Q4Y1 1NZCA 3PVNA 1Z0HA 3AKQA 4HPKA 1ZBE1 1U5YA 4GULA 3WW1A 3C3VA 1S0GA 1VBA3 2WIIB 1ZZ9A 3ZFFB 2CAVA 2GC0A 4LO7A 2B9UA 5GZGA 3AZWA 5KHGA 3FFZA 1LODA 2GALA 4PJYA 5EJ3A 4JAAA 4FAGA 5C8WA 4OLLA 5JOYA 1V9U3 4IEYA 3VBFC 1AR71 4AYUA 4IEQA 2VMHA 1F8VA 3A4UA 1D4VB 1HDKA 1PZ8A 1IPKA 2D3RA 1BVP1 3IDCB 4NO4A 1HX6A 4AQSA 4XMAA 3NKTA 4FQZA 1MS1A 1HXS1 1XNBA 4O9GA 2Y26A 2R1BA 2FHRA 4N43A 3NW4A 4EN7B 1RUG1 1VBB1 1Y3TA 4AVSA 5IK4A 2ZMKA 1IPJA 3FLPA 4IV3A 4PIXA 1AXZA 1N1VA 1VRH3 2O8QA 4F7ZA 1N3QA 3VBSC 4RR3A 3C2UA 4F3JA 2P3KA 1WW5A 3AMMA 4BMBA 1ZRDA 5BNPB 4MV2A 3IIAA 1HW5A 3AZVA 2A3YA 2ARBA 2D93A 1YFWA 3AYAA 1HQWA 3VN4A 3UJOA 4DFSA 1H2KA 2RS32 2WZPP 4PDWC 4HT1T 1BZWA 1W39A 1D0GA 2DCKA 5E89A 1VAVA 2D98A 4RA0A 1Q8QA 4LO4B 3VUOA 3ZXJA 2ZX4A 4XYXA 4NHKA 3FHIB 1LOFA 5JPNB 2AYHA 3VDDB 3KT7A 2B7YA 4I0BA 2ZABA 2OZ6A 3CJIC 4PLMA 1QH7A 4AE2A 1LU1A 4N7UA 1W6PA 2XJPA 2WT0A 1R1A2 1YYNA 3FMGA 1J59A 4AGRA 3NAPB 1ZA4A 2F4PA 3J26N 3ZSEA 2R072 2DV9A 5JLVA 1R093 1LR5A 1TQ5A 5JSPA 5JOXA 2XPJA 4A3XA 2FQPA 4DY5A 1D4M3 3AM2A 2I74A 1QJU2 1EAH3 3MW2A 3I54A 4WVZA 3LCPA 4Y5Z0 3TBDA 2R063 2VVEA 5BNNA 1IKQA 2VMIA 2PFWA 4I2OA 3PJQA 5KHJA 1X50A 1WLTA 2WNVB 3AMNA 1NA1C 2KM2A 3PTYA 3WDXA 2BBVA 2R041 2OIIA 3R4UA 4LR4A 5JZGC 3NL1A 3AMPA 4KU8A 1MS0A 2XBO3 3GZTB 1BCXA 2ZTNA 1AR92 4RHV2 4CP2A 2UWBA 1R1A1 5T52A 3PJYA 1KFXL 4H7MA 2R071 4FXKB 4GKXA 3RZZA 1I9RA 5E88A 1FV2A 5L73A 3ZFFA 3L9JT 2GDFA 4L9BA 3ZYPA 3KCXA 3WQ1A 1B35C 3DPRC 5KC5A 4XF9A 3S7IA 2B8MA 3INAA 3O0VA 4YGEA 4Z82A 3R4SA 4GQ7A 3VGIA 4Y20B 1W6MA 2LTNA 4XJWA 2DTWA 3W59A 1CAUB 4M0HA 3TYJA 1W6NA 2Z2SB 3MLLA 1LESA 1CPNA 5F6KA 2VPVA 1W2UA 1RVF3 5SV5A 1C1FA 1ULGA 3VBRA 3S0MA 4D7YA 3U10A 2XJSA 1LOFC 4AFMA 2AREA 2RM22 1AR91 1YJKA 4RHV1 2E7QA 2BUKA 3NV2A 3D5OA 4RQPB 4R4XA 1RC6A 1UU5A 3O5SA 4XF3A 2D5FA 3RWNA 2EXKA 2ZGRA 2UY9A 4ES9A 3KGLA 4FOVA 4Q8LA 1LOEA 5K8SA 1FPN1 4FPJA 3MLKA 4OUMA 2DWRA 2WQ4A 4XQDA 4C1WA 1ZZBA 2RR12 1XU1A 2JE9A 2P34A 3I7DA 1KITA 2B45X 2P3JA 3LZZA 3UV9A 2GC1A 3GALA 2OUHA 2ZX3A 4YW1A 5LRRA 4WV8A 5DUVA 4AK3A 1AR83 1SLTA 3EXUA 4J1XA 4QM9A 2PQQA 5FLHA 5C9AB 4JGYC 3RJ2X 1RJ8A 1CJPA 1EY2A 1RHI2 1MS8A 2B39A 3OD0A 4OI2A 2WS92 4XQWA 4YW4A 4DINB 2JE7A 1VLNA 3PVEA 4IV1A 4PCRA 4GIQA 4WM7A 1WLCA 4JGZA 2RMU1 4HK8A 1G86A 4Q4V1 1MR5A 1NQDA 4PIYA 4F83A 1G7YA 1QXJA 4PIZA 4Q29A 3ZN4A 1AVBA 1C57A 3WUDA 4KGQA 4D7SA 4L92A 1O3QA 4OI4A 1W6QA 2PLV2 3HT2A 4QPYA 2VULA 4CP0A 5HBAA 4XZPA 3ZYRA 3AXEA 5A33B 1U12A 2RR11 1FYUA 1QJU3 5CVRA 2XVKA 3M1HA 3ZFFC 4HKLA 4X6QB 1RUI2 1YXWA 4LUMA 1C8M2 4XMIA 1OQ1A 2ZPXA 5GKAC 4XIOA 2D5HA 1CVNA 1MVQA 1DGRA 2PHRA 2QKDA 4TLFA 4YG0A 3SCGA 2HWE2 3LWCA 3WV6A 1RHI1 4D3WA 1KD7A 1W0OA 1POV1 3OTFA 2BVBA 5J7MA 2Z79A 3AP5A 3AK0A 3WG4A 4I3PA 5I0UA 2CWMA 1ND3A 3USSA 3WQ7A 5ABJB 4GH4B 2DUOA 1LRHA 1PK6B 3ZPYA 4R9AA 1AUYA 4LA3A 2PLV1 4NR1A 4WM8B 5DDJ3 4E9KA 1RINA 3T1MA 4MGKE 2DCTA 5CU1A 4YW2A 1H4HA 2QCSB 1V00A 5BNPC 1V6MA 2OA2A 4JDOA 1RUI1 3TN92 2ZAAA 4AHZA 3IPVA 4Y20A 4AI3A 1XNCA 4LTAA 5H9QA 2OUJA 4AHXA 1GZCA 1DDLA 1RMU2 3S30A 2JDZA 4AQ2A 4YVSA 4BH9A 1PHMA 4OHVA 2YC0A 3N3HA 5AVPA