3AK0A

Crystal structure of ancestral congerin con-anc'-n28k
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
132
structure length
132
Chain Sequence
GVEVKNITFKLGMYLTVGGVVNSNAKRFSINVGESTDSIALHIDHRFSYGADQNTIVLNSMVDDGWQQEQRSKNFPFTAGEHFQITITFDIDTFYIQLPDGHKVEFPNRHGDEAFNFIYLAGDARLTFVRLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ancestral congerin Con-anc
publication title Tracing protein evolution through ancestral structures of fish galectin
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 30
structure length 132
sequence length 132
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3ak0A00
1W0OA 4YFWA 3AYAA 2AH2A 4FPGA 1SCSA 1WLWA 1Q56A 1C1LA 2GN7A 4XIKA 2EAKA 1JOJA 3BTAA 1DHKB 3LCPA 1N1VA 1QNWA 4XILA 1AJOA 1HQWA 1WBLA 3POWA 4K20A 4R9CA 3N7KA 1Q8QA 1QU0A 5DUVA 5T50A 1YO8A 2W08A 2ZGLA 4FP2A 5T5JA 4YFZA 3AP9A 3T1LA 1UN1A 2B7YA 1AXZA 5KXCA 2ZGQA 4AYUA 2EXIA 3OYWB 2TEPA 3HMYA 3M3CA 1SLAA 4LBQB 4FVVA 3M1HA 1KRIA 1V6OA 1BJQA 1LOFA 4ITCA 2P3KA 2GN3A 3D6EA 3PVNA 1LCLA 2ZMLA 3SH5A 3RG0A 2AYHA 4YGDA 3SH4A 5F5QA 3H0OA 1LEMA 3AYEA 5JOXA 2A6YA 2CY6A 2SBAA 2DYCA 4BMEA 3BIWE 4AWDA 3FUQA 3LSDA 5JOWA 1VAMA 3PVOA 2E7QA 4YM2A 2R0FA 3A0NA 1GNHA 5CNAA 1N1YA 2W52A 1GLHA 1APNA 1FAYA 2ZGUA 3N35A 4FPKA 1ZA4A 2YXSA 4Q1RA 2ZMKA 3IN9A 3VV1A 2ARBA 5GZGA 1QOTA 4W65A 1LOEA 5DUWA 2DTWA 4D69A 1IS3A 3T2TA 4BQ1A 1CVNA 1DQ0A 4PCRA 2YZ4A 5HCBA 1LGCA 1LOCA 4M00A 1RINA 1NXD1 1S0EA 4NOTA 4NO4A 1PZ7A 2ZKNA 2OUJA 1UZYA 3WG3A 2ZAAA 2ZGPA 4JCKA 5KXEA 4FP3A 1BXHA 4C1WA 2CWMA 4HL0A 4KBBA 1MVEA 1DQ4A 3N7MA 4Y1YA 2D6PA 3FBYA 5H9SA 3WDUA 2D6OX 2GNMA 5H9RA 1O4ZA 2ZGNA 4GKYA 4XBQA 4XXPA 1YYNA 3WZ1A 4YZ5A 5IT6A 1MS1A 3FLTA 4YZ2A 2DVBA 4XBLA 2ZZJA 2LALA 1GZCA 3B3QE 4UW5A 4PBPA 1KJRA 1MZ6A 2JKBA 3MEPA 1LTEA 3WUDA 3AXDA 4DS0A 1O4YA 4GA9A 1G86A 1LEDA 4YLZA 3AP7A 4GWMA 4DPNA 4FPOB 4Q1PA 3RQ0A 4YZ3A 5FRAA 5GLTA 1AXKA 2A3XA 2DVAA 3I8TA 3V0AB 1AX2A 4HANA 4YM3A 2OUHA 1V6NA 1JYCA 1G9FA 4Y1ZA 2OW4A 3V64A 2A6XA 3ZXLA 4CTEA 2UWAA 2A3YA 2A7AA 3R05A 1F5FA 1WUVA 2ZGRA 4GWNA 5JVVA 1LENA 1PZ9A 4YG3A 1LOGA 3RMXA 1LESA 5DUXA 1JN2P 2FHRA 4BOWA 3SISA 1MS3A 2CTVA 3OPZA 2P2KA 4R9AA 3JU9A 1SBFA 1HDKA 2GNBA 2W39A 4YG6A 3ZPYA 1FNYA 5DZGA 2ZACA 2VW0A 1IKPA 1SCRA 1ULDA 4FPHA 2ZHKA 2D44A 4M3CA 3VKLA 2XG3A 4RA0A 3D5OA 5GLWA 3AYDA 2CL2A 2V73A 2VXRA 2WKKA 3B69A 1MS5A 1LU2A 4FOWA 5E89A 1H9WA 2P34A 1URXA 2P37A 5AVAA 4BLIA 3MW2A 4CRQA 1VALA 4P9XA 1FATA 4XJWA 4U2AA 1AVBA 2R1BA 3JUUA 2E51A 3NV3A 3HR9A 1JHNA 3POSA 2R49A 2D6LX 2WSVA 3IMNA 3ZSMA 2NMNA 4YM1A 1IKQA 1GKBA 2AR6A 3USUB 2ZGMA 3MW3A 2ZGSA 2A6ZA 2ZGKA 2ZHMA 2AGSA 4DRVA 1S0JA 1UAIA 3N7LA 1QF3A 1X50A 2CWSA 3AZVA 4XJUA 1S0IA 3O12A 4FOQA 2JE7A 3FFZA 4Q26A 4YW5A 2ZA9A 3R4UA 1C1FA 2YROA 1A78A 5T5OA 5EYXA 5EYYA 4ASMB 1FV3A 1JW6A 2NMOA 4WVVA 4AVVA 4JRAA 2C9AA 2VW2A 3AYCA 1AJKA 1W6NA 1A8DA 2ARXA 3ZYRA 5T5PA 2A71A 1CONA 2EXHA 1A3KA 4GALA 4Q2FA 4R9BA 3VKOA 1DZQA 1LULA 3N36A 4AVTA 5HCAA 3V0BB 2ERFA 3ASIA 1LHUA 1W6QA 3AXEA 3N3HA 3VKFC 2JE9A 1DIWA 4XIOA 3ZYPA 1W6MA 5DZFA 3HN1A 1MVQA 4XBNA 2UU8A 3QCWA 1F9KA 1VIWB 5IK5A 2R0HA 2RHPA 1S0GA 3OY8B 1S1AA 2I2SA 2DVFA 4K1ZA 4K21A 3I4IA 1KQRA 4XDQA 1VAVA 5GLZA 3ZXJA 1SBEA 3FLRA 1WD3A 3O0WA 3QLQA 2NZ9A 4Q8KA 1HQLA 2ZABA 2WLQA 1MS9A 4XMAA 1NLSA 2WSUA 3AX4A 1LOFC 4YW2A 2WT0A 3SLIA 3WG2A 4Y20A 4Y24A 1OQ1A 1SLCA 1N47A 4XJ9A 1CPMA 4XJZA 1ULGA 3RMYA 3WCSA 2PHFA 3O0XA 1LHOA 1G9AA 2NP0A 1DQ2A 1CESA 3AP6A 1IS5A 4Q8LA 1UMZA 4BLJA 4XTMA 3T1MA 4FPJA 2XB6C 3MW4A 3ENRA 1ULEA 2GNTA 4IQPA 1KITA 1DYPA 1MR5A 4P9YA 1RIRA 2WT1A 3IPVA 3N7JA 1J1TA 4FOVA 5GLUA 4M3CB 1CIWA 2PHTA 4Y22B 3WG1A 1EPWA 1G8WA 1V6KA 4ZKTB 2VUAA 3L2YA 4YW1A 1YIFA 4LBMA 1VLNA 5GZFA 2SLIA 3OYWA 3WVJA 1IOAA 2DVDA 2EALA 1S0BA 2GALA 4LBQA 2P3IA 4LBQD 2ZHLA 3NV1A 4LBKA 1AXYA 3NV4A 4LBLA 4AGGA 3APBA 4LBJA 1Q8VA 5IUQA 1SBDA 5DZEA 1LGBA 2EF6A 1SLIA 4XJ8A 3ZVXA 4C1XA 1JUIA 2DU1A 2PELA 4R9DA 1GSLA 1KDMA 3DUIA 5GZCA 3WOGA 2ES3A 2EIGA 1ENRA 3IKWA 4WZFA 5GM0A 4XHXA 1W6OB 1N1SA 2DWRA 5CAZA 1JYIA 3WV6A 4LBNA 2EXJA 1ONAA 2D3PA 3M3OA 4XXAA 3A4UA 1LU1A 4OZXA 1MZ5A 4GXLA 3GALA 1BYHA 3RS6A 4BM8A 1BZWA 1I3HA 1V6IA 4XOGA 2G4IA 3UJQA 5L73A 1H9PA 1UPSA 2ZHNA 1UX6A 4FQ4A 4XMIA 4CZSA 3WHTA 1W6NB 1WW4A 2DV9A 4WVWA 1G7YA 4H55A 3AFKA 4FPLA 4FPYA 3WDYA 3A0KA 3U4XA 4P14A 1HKDA 2E6VA 3UJOA 2A75A 1AX1A 3AP4A 2JDZA 1UZZA 2UWBA 3O5SA 3SH3A 3W58A 3WDXA 4BPZA 4UW4A 1N1TA 3D4KA 1DQ6A 1SLTA 4PF5A 2W68A 2D43A 1Q8SA 3POYA 3B00A 2ZGOA 2DUQA 4RL7A 3WHUA 1SACA 2DURA 5IK4A 5IK8A 4FOYA 1GANA 2GMMA 2D3RA 1N3PA 3B01A 5EXOA 1PZ8A 4XZPA 1WCSA 1IS4A 1GICA 2VW1A 4YW3A 3NV2A 5JOYA 4ISQA 1Q8OA 3LSEA 1DQ5A 1DFQA 2HYKA 4M3CF 3PJQA 2D6KA 3ZSKA 1HLCA 1R1ZA 2GMEA 3AJYA 3O0VA 4ISRA 4FPCA 4DQAA 2PHXA 4P9WA 1B09A 1ENSA 2GMPA 3RRDA 1WLDA 1IS6A 2A6VA 4K1YA 3ZXEA 1I1EA 3OBTA 1ZM1A 4M01A 1CPNA 2A5ZA 5H9PA 4Q27A 5CBLA 4YM0A 1V00A 2DTYA 1ULFA 4Y26A 4YGBA 4TZDA 1BQPA 1AZDA 2WNEA 1DLLA 1DQ1A 2JJ6A 3PMEA 5SV8A 3WG4A 2A70A 1UL9A 2AENA 1Q8PA 1SLLA 2FMDA 2AREA 2D6NA 2E7TA 3ATGA 2OVUA 5E88A 1GZ9A 2H0BA 5CA6A 5JMCA 1QDOA 2YY1A 3IPVB 2GNDA 1GYKA 1LOBA 1JXNA 1QMJA 1WW7A 5GZEA 1D2SA 3BODA 3Q9OA 4I30A 3USUA 1CQ9A 1GZWA 2GDFA 1W6PA 2YV8A 3B9CA 4YGCA 1JBCA 1FNZA 1LODA 2EXKA 1YRZA 1YI7A 1G9DA 1V6MA 1AX0A 1G9BA 1LOAA 2JECA 3AK0A 2VY0A 4U36A 3RSJA 3VKNA 2PHWA 1Y7BA 1V6JA 4XE9A 1LHNA 1CR7A 1XQNA 3ZSJA 1W0PA 1LGNA 1UKGA 2NN8A 2CNAA 3SNMA 1ULCA 1FYUA 1DGLA 3AZWA 2VH9A 1SLBA 4BMBA 2D6MA 2DUOA 1H30A 3MPPG 2AUYA 5BYNA 3TB0A 4ATEA 2PHUA 3W59A 1G9CA 5KXDA 2D7FA 3SITA 1Z0HA 3M2MA 5JDBA 1QOOA 3AZZA 3GNEA 2BQPA 5T52A 3V0BA 3ILRA 4FQZA 2UWCA 3AZXA 3VUOA 1QDCA 3ZSLA 5T5LA 4F83A 1MACA 1WBFA 4YZ4A 2DU0A 3KQRA 3WNXA 4PBOA 1GV9A 5EWSA 5HCFA 1MS4A 4LBOA 1OKQA 2VU9A 5KXBA 3WCRA 4L8QA 4TYSA 3OY8A 5FREA 2A6WA 1N3OA 4DRRA 2ENRA 3OBRA 1LJ7A 2WT2A 4FPEA 3WDTA 1RITA 4PQ9A 3INAA 1WW6A 4Z8BA 1QOSA 3M3QA 3PVEA 3TAYA 1DYKA 5E8AA 3ZXKA 1FX5A 1CJPA 3AZYA 2A3WA 2NYYA 2JD4A 1QNYA 4MYEA 1KDKA 3WDVA 3WLUA 1LECA 1F31A 4JC1A 5GJ6A 1QGLA 4AGRA 1LHWA 3R4SA 4XYXA 2WQZC 1S0FA 5CB7A 3ILNA 3UL2A 4Y1UA 4AVSA 4WV8A 4AGVA 3UK9A 2R1DA 1S0CA 4ATFA 2WJSA 3WUCA 5IK7A 3AP5A 3KM5A 4YG0A 1QKQA 1GNZA 3CNAA 2ZBJA 2C5DA 1BKZA 3IM0A 3V65A 2DUPA 2PHRA 2NM1A 2ZGTA 1Z78A 1C57A 1GBGA 1W6QB 4Y1XA 4M3CE 3NWKA 1DBNA 5DUUA 1W6MB 1C4RA 2Q5TA 5DXDA 3ILFA 3BOPA 3OJBA 2V5YA 1WW5A 1MS0A 4UW6A 4DFSA 1TEIA 4Y22A 2E53A 5F9TA 2LTNA 1MS8A 4XJAA 5DG2A 1LHVA 5JOZA 1U0AA 4FPFA 1SFYA 4YZ1A 3WDWA 3M3EA 3V0AA 1FV2A 3AJZA 4Y1VA 3DGTA 1OFSA 3FLPA 1KJLA 5H9QA 1N3QA 2D3SA 1YXWA 2YMZA 5T54A 3ZXFA 5GALA 1GZWB 5JLVA 1W6PB 2CYFA 5LK5A 2DVGA 1WLCA 1AF9A 1V6LA 2UURA 1ENQA 1S0DA 1WD4A 5GLVA 4Y20B 5T55A 3VKMA 4YW4A 5GZDA 1W6OA 3C2UA 5DG1A 2Z42A 4UW3A 1CN1A 3OGGA 4ZXKA 4GKXA 4YGEA 4XHBA 3FUOA 4XTPA 1D0HA 2R16A 2KM2A 4SLIA 2P3JA 2ZMNA
chains in the Genus database with same CATH superfamily
5FTTC 5FMOS 4YFWA 4QB1A 1JYWA 1Q56A 1C1LA 4IV1B 3BTAA 3LCPA 4V1PA 4YVWC 1UNBA 2ORZA 3MV11 4IGPA 1KS5A 2VULA 3KT7A 1FI2A 3N7KA 4B7EA 4TSVA 5T5JA 4NPRA 2VOXA 4HT1T 1NLQA 2XJQA 3ZDSA 1AXZA 3FMGA 2W94A 5HV4A 5KXCA 2RMU1 4AYUA 1JZ5A 5LBEA 2TEPA 4LO8A 2JDNA 2BVBA 5FPBA 1QJX1 3OSDA 2AC1A 1GNYA 1ND3A 3KB5A 1JZ3A 1BVVA 1RUH1 1UXZA 3AYEA 3IT8A 1OLME 1SG3A 5JOXA 2WFF1 4AQTA 3BIWE 2WYFA 3U37A 1NAEA 1Z7S1 3J7LA 3WQBA 5JOWA 1CZSA 1RMU3 4NIDA 4K40A 2W0XA 4L0PA 4QPGA 3I2DA 3KQ4B 1FAYA 4FPKA 1ZA4A 2YXSA 4N43A 3P6BA 4PDWA 5GZGA 2ARBA 2HWE1 3D8CA 5DUWA 1ZBA3 5F5CA 3TWIA 1QJY1 4AE2A 1OUXA 1OPOA 2YDEA 5FP9A 2Y0IA 5HCBA 1FOD1 2YZ4A 5K7PA 3KT4A 4LLFA 4M00A 4NIAA 3K4AA 5FAXA 4NOTA 3M7AA 4PIXA 1IG3A 4NO4A 2DF7A 2ZKNA 2OUJA 1ALYA 3WNNA 4O9GA 1ZRCA 2C9KA 2RM22 4HG6B 2CWMA 4XUPA 3I3DA 4CDXB 1MVEA 5FYCA 5GKAC 4Y1YA 2D6PA 2WNUC 2HKXA 2WQ4A 4YPJA 3UT0A 5JZGC 2CGPA 3GZAA 5JWPA 1O5LA 4I01A 1VP6A 4AQ2A 5FK7A 4XXPA 1PMHX 2UYBA 4GD4A 4EJRA 1O7FA 4MLOA 4IEXA 2ZZJA 3HN3A 5F39A 5KC6A 1QXJA 2L9LA 3GZEA 1MZ6A 2JKBA 1UU4A 1O4YA 2ATFA 4V2WA 3NNLA 2BGCA 1RUE3 4FPOB 1UY3A 4P9LA 1U5YA 2ADEA 5FY9A 5BNPC 1XNTA 1LR5A 4GWJA 4ZU5A 1AX2A 2YBKA 4HANA 5DDJ3 5FMBA 1JYCA 2FCVA 4K9SA 5EJ3A 3QD6A 3ZIWA 1W9WA 4NAOA 2Z5WA 2J1EA 5FZ7A 2JENA 1ZBA1 2A7AA 3R05A 1WUVA 2ZGRA 3VBSC 3ZXAC 1XOYA 3FJSA 4QD2A 5FJHA 5BNQA 3UKVA 3SISA 1F2NA 1XYOA 4HK8A 3H8UA 3JU9A 1WGPA 1SBFA 2GNBA 5FKBA 4MGQA 3ZPYA 1FNYA 4JRLA 5F1RA 3VBRB 4B4QA 4MUVA 3O1PA 4O65A 2ZHKA 2D44A 2XG3A 4RA0A 3D5OA 3PJYA 3B69A 5GLWA 2VXRA 2WKKA 5E89A 3H1WA 2P37A 3DL3A 4LOSA 4MGSA 3WNLA 2R1BA 3HEIA 1UZWA 1JHNA 3POSA 2R49A 3ACLA 1AR73 4Q0SA 2VZ1A 3USUB 2ZGMA 2WAOA 4EROA 1OPMA 1XXNA 5IFPA 1RUF3 3WW4A 3ZLIA 1V0AA 4JKKA 4JKMA 4ZZ8A 5A3TA 2PAKA 2W9XA 4HFSA 4NRQA 3AZVA 5DDJ1 1ZRIA 2OKXA 1C8M3 4CVUA 4CPBD 5A1FA 1W9FA 1X33A 2JICA 3W5MA 4IV3C 4Q26A 4V2VA 3MPBA 3R4UA 3HOBA 3KF5A 3ETPA 1VBE3 3DF0A 4RS5B 4KWJA 1JW6A 4H2AA 1MZEA 4BK4A 1W6NA 1JYXA 4QX0A 2X29A 1DGRA 1REEA 1WCQA 4JDNA 1OQEA 1W8FA 1PK6B 4GALA 4R9BA 3WX5A 4JHZA 1DZQA 1LULA 1SDDB 3LDRA 4Q0QA 5FYSA 3AXEA 1W6QA 1UIJA 2HWF2 2JE9A 1DIWA 2IXLA 2WR9A 4XIOA 3RVHA 3VDDB 4GQ7A 3WNMA 4COUA 5EIYB 3HN1A 3GCWA 5FMCA 5J09A 1MVQA 3SKVA 5LA0A 2UU8A 1GOGA 5DAVA 1VIWB 1JZ4A 4FFGA 2QQKA 3MIHA 4CDWC 3UNPA 3LA7A 1UWWA 2ZX1A 3UGGA 3OY8B 4IDZA 3ZYHA 5JXGA 4DEVA 3IBMA 4GMP0 1T2XA 2I2SA 1AR63 2RDNA 2DVFA 2VZTA 3DV8A 1AR71 3MIDA 1KQRA 4DOUA 1VAVA 5GLZA 1R093 1WCDJ 3ZXJA 4CEYA 3SEEA 1RUF1 5CFDA 2PN5A 4PLMA 1OLMA 3CHXA 3QLQA 4S2FA 3VHRA 4B4RA 1VBA2 2ADDA 5F3IA 3BTXA 4ZS2A 1UKRA 5A3MA 1O59A 1C8M1 2ZABA 4UFIA 1XRUA 4NAMA 3VBSA 3M3IA 1ZZBA 4M0NA 2OIIA 2V4VA 1QXRA 1PO22 1W39A 2XJSA 4X8PA 5FY8A 4Q0PA 3L9JT 2VCMA 2WO3A 5FZOA 2WT0A 4R8HA 1VBE1 4Y20A 3SLIA 1ZZ9A 1ND3C 5ACA2 4HZFA 3WP3A 2JG9B 3I3BA 3MYXA 1UF2C 1D7PM 3QACA 3LEIA 3O0XA 1ZBE3 1OHFA 1G9AA 3ZIXA 1DQ2A 1CESA 3AP6A 1IS5A 2RVAA 4BLJA 2ARCA 2PLV2 1XE7A 4IV1A 2XB6C 3GHMA 3TNPB 4B8EA 5FPUA 4IQPA 4N43C 1JOBA 3NQHA 4PDWC 2XUMA 1EAH2 1BEV2 3LOIA 4M3CB 2FZ2A 2D5HA 1W8TA 2PHTA 2PYTA 1RTVA 3RGBA 2PXJA 5F2WA 2CV6A 2PHLA 1AR61 1NZIA 3WP4A 3IWZA 3HNBM 2XJVA 2DVDA 3IIIA 1S0BA 3LF7A 2HWB3 3K48A 5IHRA 1JYTA 2VCBA 5FIXA 2P5BA 3NV1A 3PIJA 4HK9A 4RFT0 3VB9A 4AGGA 2R043 2RJKA 2ORXA 4RYDA 5DZEA 1SLIA 4C1XA 1JUIA 4R9DA 4UOJA 1W03A 5GZCA 5JSOA 2D93A 5A7WB 3PURA 1W90A 4XCBA 3B94A 5FZ3A 3WOGA 1ENRA 1COV2 3IKWA 2VXJA 3B93A 2P1BA 3FC0A 5CAZA 3X29B 4FCAA 2D40A 3GGLA 3POEA 5M0TA 2JDMA 3LE0A 2EXJA 5C3SA 2D3PA 1RUOA 2F17A 1CAUB 3K46A 4GH4B 3RNSA 5BUVA 3GJAA 4OZXA 1RUJ2 2ZZQA 3Q8EA 4A7YA 2X05A 1Y43B 1BZWA 1I3HA 1OFNA 1OURA 3NJZA 3WXPA 4MX3A 5L73A 3T09A 4OQ8A 1J83A 3GCXA 4CZSA 2JWPA 2XKPA 4EQVA 5JIUA 1VB4A 4H55A 4BE3A 1JYNA 1EV13 3N4MA 4WVMA 1CZTA 1HN0A 3H50A 3J8F1 3H9AA 3SXWA 2CAUA 4XFAA 2PTMA 2W46A 4Z07A 4XURA 4FTBA 1AX1A 3O5SA 2W87A 3CIHA 2XBO3 4QAWA 4EWEA 2FBEA 4FAHA 1Q3EA 4UW4A 4A4AA 2FMYA 1HV1A 3Q8CA 1SLTA 4AVCA 5I0TA 4IE7A 3Q8FA 3POYA 2HWB1 4QQLA 2Q8EA 5FZEA 3TRSB 1NLRA 2R041 4CP9B 2DURA 5IK4A 2HH9A 5DMYA 4P02B 2XHNA 4FOYA 5JMOA 3LEMA 4IEWA 1OVPA 3ON7A 2VZ3A 5C3OA 5L7OA 2XLFA 3TYJA 2IVJA 4EZ4A 1O3SA 4QX8A 2ZXQA 5KHKA 1WCSA 2VW1A 3ZYBA 4DXZA 1TNRA 3NV2A 5JOYA 1BMV2 4ISQA 2UY8A 1BK0A 3LSEA 3WNPA 1DQ5A 2JE8A 2ZX2A 2D6KA 1W3VA 4OHWA 2GMEA 3MBWA 4ISRA 4J25A 5E16A 5JIAA 5F7UA 1GQPA 2GZWA 5ANNA 1XNCA 1D4M2 1IS6A 1NCQA 2B42B 4UFHA 3ZXEA 1K3IA 5I8SA 1ZM1A 1CPNA 2A5ZA 3MLKA 1QXPA 3T2OA 5CBLA 3U11A 1V00A 1ULFA 5G05L 1VRBA 1EV11 1AR93 3VBRA 2BUKA 2JJ6A 3WG4A 5SV8A 4URAA 5C3RA 1UL9A 1OH3A 2YUEA 1Q8PA 1SLLA 3NAPC 3THCA 2R062 2AREA 2E7TA 2VUCA 2OVUA 3KV4A 4CEWA 3TN93 1ND2B 1GZ9A 3E5UA 3N9PA 4BIOA 5CA6A 1NKGA 1W99A 5KHIA 3LPGA 2YY1A 1WZXA 5L36A 1ZA7A 2RJLA 1LOBA 2WA3A 5IVBA 4NHXA 1ZRDA 3AMMA 1AR83 1D2SA 2C24A 4B3NA 2Q8CA 2A73B 2IC1A 3Q9OA 2BDRA 3WF3A 3USUA 1B35B 5BPXA 2YC0A 1W6PA 3ZKYA 3B9CA 4YGCA 4FTSA 3FZ3A 1DU3D 1FNZA 3PL0A 1K5MA 1LODA 2BFUL 4UFKA 2QQUA 5FLHA 4MVTA 1IHMA 5FXZA 1G9DA 2JECA 2VY0A 1OXCA 1ZZ6A 2XMLA 3OPWA 4INDA 4ZXEA 3T0AA 4FSJA 2VECA 1XQNA 5C71A 1ZRFA 4XVHA 1UKGA 3DEMA 4OCTA 5FLIA 1ULCA 4XQ4A 5JPMB 2IXJA 3THDA 4META 5CFDC 3MV01 4QHZA 5J36A 4OUSA 5LBCA 4AVBA 5LY1A 4BMBA 3KV6A 1RUNA 1NT0A 3D82A 4CXXA 4ATEA 5BYNA 4YYOA 2Q8OA 5FPXA 4CCLA 4NE9A 4D6QA 4NIGA 1DDLA 1DZTA 1NG0A 2RR12 1RUE2 2WIIB 2BV4A 3OOXA 3SITA 4C91A 5LA9A 5JDBA 1AR91 1QJU3 3SCHA 1V9U3 4I0WB 2BQPA 4NWWA 4RFRB 3W9AA 1HRI3 1O4TA 3OGRA 3OBZA 1RUI3 2G19A 2B45X 4BXSV 4NRPA 3PU3A 5LW9A 5C3QA 2XVKA 3GHNA 3KGZA 3S57A 1MACA 3WNXA 4XFFA 1ASJ3 1AL0G 1ZX5A 4MGIE 1MS4A 5KXBA 3O1TA 3WCRA 1AUYA 4FFFA 1ZREA 3OY8A 2Y6GA 5FREA 3WF0A 1HJFA 1XNKA 3KGLA 1AL23 1N3OA 4DRRA 5FY4A 2WT2A 4XFCA 3INAA 1WW6A 3M3QA 3IDAA 2WS93 3H8OA 4XF3A 1UYZA 2H6BA 5ANQA 5E8AA 4LITA 2NYYA 4AW7A 3UKNA 4JGYA 3WDVA 3RFRA 2QQMA 3K2OA 5LA2A 4A41A 3LFIA 1F31A 5LRSA 1J59A 3BU7A 1QGLA 2QJVA 5CZKA 3R4SA 5A32B 3AMNA 3KHCA 1X36A 5C4WA 1GR3A 2WWJA 3JQWA 1UOJA 4KGQA 4Y1UA 5FJKA 5T3NA 4FBFA 3UK9A 5JXJA 1S0CA 2JG9A 4ATFA 4XCAA 1RHI3 4RQPC 1UU6A 5FYHA 4LA3A 1QKQA 1GNZA 2CSGA 3CNAA 1H8TB 1HV0A 4JKLA 2C5DA 1BKZA 3IM0A 1NA1A 5FZGA 3RYRA 3WNOA 3TBDA 2NM1A 1QJU1 1DP0A 2ZX4A 1GBGA 1GP4A 1V9U1 3OG2A 1HRI1 3NNJA 5DUUA 3D0SA 3B5LB 1RUI1 2QQWA 3KCYA 2IUWA 2OZJA 2GC3A 1IZ3A 3PUSA 4BQ2A 2WUHA 3MICA 1WW5A 4UXAA 3ES1A 2VNOA 1ASJ1 4LIUA 4HLTA 4CUAA 5F9TA 4PIZA 2VMDA 4XJAA 1AL21 1SFYA 3OCPA 3HT1A 4YZ1A 1K5JA 2WS91 3AJZA 3WQ7A 1C8NA 5H9QA 3E97A 4LK7A 1YXWA 5D21A 5T54A 1X9PA 5JLVA 4LKFA 2VC9A 4J1XA 2XHKA 2XKOA 1OSGA 1STMA 5FXXA 5FZ8A 3C7HA 2DVGA 5A7WA 2W1UA 3I3EA 4BQYA 1AF9A 1J3PA 5T55A 1FPN2 5K8SA 1I5ZA 5FMOL 2QVSB 3E5QA 5DG1A 4UW3A 4F7ZA 3E6DA 3OGGA 2EVXA 4S2GA 1Y9MA 3NJXA 4YVSB 2MEV2 4RHV2 1S2BA 4GKXA 4OYUA 2G9ZA 3CBNA 1YQCA 3LD8A 1RHI1 2R16A 3PHMA 4GH4A 3OEAA 1HRV3 5FUIA 3ZMOA 4AAXA 5L7OC 2JDPA 2Y0OA 3LZZA 4LLOA 1R092 3ALQA 2QQNA 4XETA 1WLWA 4I3PA 5F5QA 3VHOA 5EQUA 1JOJA 3AC0A 1DHKB 1QNWA 5A7NA 3ACFA 1AJOA 1WBLA 1OA2A 1YC61 2E31A 5IYYA 3NKGA 1YO8A 3M70A 1MQTC 1OKOA 3P1IA 3AP9A 2UY9A 1R083 2RDRA 4YFZA 5J1XA 1O3QA 1PGL2 2BJSA 2B7YA 4IEYA 1NCQC 5FP8A 2DDUA 2VUDA 3FHAA 3OYWB 4NIHA 4DUXA 2FZ1A 5A7PA 2VR4A 3HMYA 3K3NA 4AHWA 2Y6JA 1RC6A 3M1HA 2J1UA 1V6OA 1BJQA 3H3LA 3VBUA 1A6CA 2P3KA 2GN3A 3D6EA 3PVNA 1LCLA 4YW7A 1ENXA 4BIFA 2ETEA 1YQ2A 2AYHA 1OBNA 4YGDA 4AVAA 2RS12 1LEMA 4CP9A 1LNSA 5IJRA 4I3GA 2JG8B 3F2ZA 4CEWC 4AWDA 1VAMA 2P6HA 4YM2A 2VOKA 1GWLA 3A0NA 3RYKA 4QPIC 4A3ZA 1GNHA 1ZVFA 4I0BA 1N1YA 2W52A 1APNA 1VRH3 3NSTA 5A3LA 1OLQA 3IN9A 3VV1A 1NCRA 1OF4A 4W65A 3S6PA 3KWVA 3MIEA 4IE5A 2DTWA 1PVXA 2VO5A 4D69A 1WMDA 1IS3A 1K45A 2YBPA 4E2SA 1DQ0A 2ZS6B 1HRV1 1K5MC 3MF9A 1F5JA 1VMJA 3JQXA 4M0HA 2JDUA 2BBAA 4NHMA 4NN0A 1UXXX 2ZMNA 1YQ8A 1W0NA 4JX0A 5FZAA 4DNYA 2YBSA 2JDYA 2WDBA 5IVEA 4C1WA 4NHLA 4NIIA 1DQ4A 5F3CA 1R081 3FBYA 3POGA 5H9SA 2R072 3JBG3 2XJPA 3WP6A 4JDOA 4AEDC 2D6OX 2GNMA 1SEFA 1R1A3 3E6CC 3CQOA 3OUJA 2ZGNA 2YG0A 4XBQA 3WZ1A 2OT7A 5IT6A 2YU1A 4YZ5A 1MS1A 2X10A 2XDVA 4NJ4A 2BNNA 4YZ2A 5C5UA 5IVJA 4QQPA 1UCXA 3B3QE 4UW5A 3ZN6B 1BBT2 1UYYA 3DXUA 5EV7A 4DPNA 1TZOA 4Q1PA 3RQ0A 1B35A 2FDJA 4AAPA 4MGYE 2PA7A 1JU3A 4R4XA 5GLTA 2DVAA 1F15A 1QQP2 1YJKA 2A3XA 3BALA 3CDZB 3I8TA 4C0BA 3KVAA 4XF9A 3VBHA 5HV0A 5LEJA 1V6NA 1G9FA 1GUIA 1OT5A 4KL1A 4Y1ZA 1VRH1 1RJ7A 3ZXLA 4ASKA 3MIFA 4QKFA 2GC2A 3BTYA 4IGQA 1OD5A 2A3YA 3E5XA 3ZR6A 4K8RB 1F5FA 3JB8A 1LENA 4YG3A 4R4ZA 4EYUA 5DUXA 1JN2P 2FHRA 2HWF1 5DAQA 1IPKA 1MS3A 2VAUA 4XF1A 3POBA 5DAWA 1UMIA 3OPZA 4JGYC 4MXVA 4R9AA 3MDPA 3LEGA 5IAXA 2W39A 1JUHA 4WM7A 3BB6A 5FZ6A 3VD3A 5DZGA 1S2EA 3TOJA 2JDKA 1FMD2 3THTA 3O14A 5C4WC 3RI8A 1XPWA 1MEC3 2CL2A 4FOWA 1RUC3 1LU2A 1NQDA 3JBG1 4BQ5A 1L3JA 2CGNA 2WABA 4MHRA 4DY5A 1R1A1 5FZ1A 4CRQA 1VALA 3BVCA 4HN0A 3I2JA 1FATA 4RN5A 4Z2AA 4Z82A 2ZCWA 2KA3A 3HR9A 1NA1C 4XFGA 1PGSA 3IMMA 2V5DA 2WZEA 3IMNA 2CU5A 2JIGA 1IKQA 2NMNA 3ZSMA 5F37A 1F4AA 2ZGSA 2ZEWA 2VVFA 3D3AA 2AGSA 1VBD1 5FCCA 4UFLA 4DRVA 3N7LA 1R64A 5F3EA 4D6RA 3HD8B 3RYPA 1X50A 3VHNA 3CJXA 4A3XA 4Y5Z0 4XABA 2X5IB 5FR3A 4XJUA 2ARAA 4XACA 1S0IA 4FOQA 3C7EA 4QKDA 4L92A 3MIBA 4YW5A 2XWJB 4HKLA 3POFA 2DCTA 2BEOA 1A78A 1CX4A 5T5OA 5A32A 4LHNA 4WM8A 5EYXA 1FV3A 2RJ2A 1W2OA 4AVVA 5FZHA 4OQ9A 3AYCA 1S4CA 3ZFEB 4G4FA 4LJHA 4NHKA 2OX0A 4J6GA 4BXFA 1RYYA 2DBIA 4Q2FA 1H8TA 2Z79A 4HXCA 2JD9A 1UZ0A 4HVQA 2Y6KA 3N36A 1RVF3 1VBB2 1LHUA 2JB4A 2W2IA 1MEC1 3N3HA 5A1LA 5BNOA 3G7DA 1YWKA 4D94A 1RUC1 3ELNA 2D98A 1QIQA 5DABA 1OH4A 2WZR2 1UIKA 2Q1ZB 3QCWA 5FZLA 5AFEA 3GXUA 4NWVA 5IK5A 2R0HA 1X9TA 5ABJC 1S1AA 1KS4A 5CEHA 4K1ZA 1H8VA 3OF1A 1QJEA 4Q0UA 2HWC2 3ES4A 3QH6A 3FLRA 5HI0A 2RS52 3ACIA 4EN9B 3Q8AA 1NY72 4JGZB 4MO3M 1JOPA 1UOBA 2NZ9A 4Q8KA 2CDPA 2J7MA 4AI9A 5FPVA 5IVVA 3JD73 4Q4X3 4CE8A 4QXKA 3VBOA 3MZHA 5KHJA 3BKZA 3FE5A 1OA4A 3VBUC 1XBFA 4P9GA 3AX4A 4MV2A 1JZ8A 4ES8A 2B39A 4I02A 1OQ1A 3BGAA 4XJ9A 3MFCA 5FPAA 1X8EA 5EPAA 4CP1A 4OHZA 3HVDA 1C5HA 1A8MA 3H8RA 5A6YA 4KG8A 1LHOA 2YB7A 2YFZA 3EJKA 4QMAA 3V56A 4Q8LA 4AG4A 1UMZA 2E63A 3KT1A 4CDUA 1RVF1 4LOTA 3WW3A 4R52A 1DZRA 1SPPA 4ZY9A 1ULEA 1CAWB 2GNTA 2JIJA 3MLLA 3SEPA 1KITA 1NCRC 4GIQA 4CA9A 2CDOA 1RIRA 2WT1A 3IPVA 3N7JA 5BY5A 5GLUA 4CU7A 4Z1VA 3VZOA 5J7MA 1TME2 3WEZA 4MGKE 2IXIA 4CUCA 2VUAA 4B1LA 4C90A 1TE1B 1YIFA 1PVC3 1F4HA 1VLNA 4XW3A 1YLLA 3T0BA 2SLIA 3OYWA 5FO8B 3MUZ1 3HBZA 1IOAA 4QQOA 5FZ4A 2GALA 3NMBA 1JMUB 2GU9A 4YNIA 1OOPB 4E8CA 4CUBA 1ODNA 4LBLA 3APBA 2HJIA 4LBJA 2C4XA 3U0ZA 3RZJA 1Q8VA 3ZVXA 2EF6A 1DGWX 4DO0A 2JG8A 1KDMA 2OPKA 2GH8A 3JD71 1W8HA 2ES3A 4Q4X1 2EIGA 4AQ6A 3MLJA 5FZKA 5BV6A 3LOBA 4HVOA 4XHXA 1W05A 1N1SA 1JYIA 3IAPA 3WV6A 4LBNA 5A7SA 1YEWA 5DQ0A 4NR1A 5AC91 3FHIB 1UY1A 5C8CB 2RS33 2NPIA 3PNAA 1PNFA 5LBBA 1G6NA 4LHSA 3A4UA 4D0QA 1LU1A 4NHYA 4CXWA 3WSOA 3HAGA 1MZ5A 2FQPA 4GXLA 2I07B 3GALA 4QKBA 3RS6A 4BM8A 4UBGA 2XR4A 4NMIA 1CAXB 1V6IA 4XOGA 2G4IA 3UJQA 3ZOIA 3VBHC 1H9PA 1UPSA 3G6JB 5C33A 2AACA 1H2NA 2EA7A 3WHTA 2O1QA 4WVWA 4BH9A 1G7YA 3AFKA 5IVYA 2GP5A 2HEVF 3CJIB 3GM8A 4ORFA 4OUEA 4A7ZA 5FP4A 5LCWL 3A0KA 3U4XA 5D8AA 1HKDA 1JZ2A 4B4PA 1MZFA 3B7MA 3ZFFC 5D2AA 5I0SA 1UZZA 3WDXA 3W58A 4N7UA 4XFHA 5DN2A 4W6YA 1PVC1 3J7NA 2FDGA 1N1TA 2XLAA 2BBVA 2IXHA 3B02A 5DAXA 3ZDVA 4WM7C 2JDHA 3I59B 4HKOA 5IAVA 3IB3A 3B00A 3WHUA 4CCNA 1NE6A 1OMIA 3HQUA 3URFA 1NE4A 1PO13 5K0UB 3ZFGB 1GANA 3B01A 2OZ6A 1N3PA 1D4VB 1TMF2 2QQVA 3HWJA 4JZRA 1JH5A 4XDOA 3WT3A 3VBFC 3KS7A 1PZ8A 4OI1A 1US3A 1PX4A 1X7NA 3H1YA 5LK7B 4YW3A 5FFOC 4LHLA 4CU8A 1XNBA 4LIVA 2WNVB 4LKSA 2QTWB 2HYKA 1YHFA 2RS31 3LB9A 3OBAA 3ZSKA 2JEMA 3T3YA 3GF6A 1R1ZA 3AJYA 3MUY1 2J1AA 2WC2A 5J96B 1US2A 1WLDA 4K1YA 2YGMA 2XPJA 1I1EA 3DPRB 3VL9A 4QXBA 3O1UA 3KD4A 4Q27A 4COYA 4YGBA 2VZUA 1BQPA 1AZDA 2WNEA 1DLLA 1H4HA 3GYDA 1DQ1A 1NOVA 1W8WA 2C1FA 2AENA 4UFJA 2QE3A 3LEKA 4QWNA 2OXBA 4WM8C 3WNKA 3LFMA 5A3UA 1W2UA 2H0BA 2PQQA 4Y5TA 3W20A 2WWSA 4AOCA 2LW8A 2GNDA 1Q43A 1VBC2 4C0HA 2WQ8A 3GBFA 1ODMA 5GZEA 4COVA 4XFIA 2WINB 4LULA 3BODA 2IXCA 5A3OA 4E9KA 4XUNA 3TNQA 1PO11 2GSYA 4I30A 1CQ9A 3PIGA 5BNOC 2GDFA 3DYOA 2EAAA 1PMIA 4FFIA 1YRZA 3BU0A 4FXGB 1V6MA 5AVPA 1LOAA 3AK0A 4U36A 5I8YA 1J1LA 3GBWA 4RGGA 4Q4V2 4FAGA 3AFGA 1XE8A 4Q4W3 3P5BA 4Q5OA 1PIV2 1CR7A 3BCWA 3GZUC 3ZSJA 5FY5A 2CNAA 4N53B 3UV9A 3ZX7A 4CDQB 1DGLA 4DIQA 4XFBA 4GMP3 2VH9A 1SLBA 5FYUA 4QPGC 5FKCA 1W8OA 3FWEA 4WZCA 4BK5A 5A3PA 2JKXA 4CCKA 3TB0A 3TEWA 2VBPA 3ZFEA 4UAPA 1G9CA 3J8F3 2AZ5A 2D7FA 3VBOC 2J22A 4CSWA 3N9MA 1Z0HA 1W9TA 1DLCA 1RUG1 1QOOA 2B9VA 1GQGA 3E1F1 5FZFA 1TQ5A 1PMJX 5A33B 4RR3B 4URTA 5T52A 2BYVE 1OUSA 2UWCA 3AZXA 3ZSLA 5JSRA 1HW5A 4P5HA 1BK1A 1W2AX 1WA6X 1OF3A 2G9FA 4GB33 4QDQA 3KQRA 4YZ4A 4AI1A 5A70A 1GV9A 5CKNA 2BWCA 5EWSA 1OKQA 1HXS2 4YSFA 5F8PA 3K75B 2BGPA 3OGJA 3S0MA 5CFCB 2Y8KA 2A6WA 3KV9A 4CDUC 4IETA 4QGNA 4TXWA 4LMFA 1LJ7A 1YQ6A 3OD4A 4FPEA 1RITA 3VGIA 5BNNB 4J1WA 3S5AA 2ZX3A 3T4VA 2C6SA 4KWKA 4BISA 1FX5A 4QX3A 3WW1A 4MYEA 4K8FA 2HWD3 4Q4W1 4Q4Y3 3DN7A 2RMU2 3O1MA 4CU9A 1LHWA 2VMEA 3K4ZA 5JCTA 1QJX2 1VJ2A 5CB7A 4KBZA 1H4GA 4YVWB 1S55A 1VAKA 5E1RA 4AGVA 4DINB 1GP5A 4GMP1 3ROUA 1RUH2 5FZBA 1J3QA 2CHHA 2WJSA 1L7LA 2RV9A 1UY2A 2WFF2 4UWDA 1Z7S2 3VDAA 2XVGA 2I74A 2VQAA 4BZ4A 2PHRA 3H1MA 4CDXA 1C5IA 1UW8A 4M3CE 1QJFA 3QH7A 4KWLA 4IEQA 1C4RA 1H2MA 2HWE2 4BJ0A 4EWDA 5DXDA 1QJY2 1AYN3 4L2NA 5L9VA 4GB31 4UW6A 5IVFA 1VPHA 1FOD2 4G9SB 3O1VA 1XU2A 2DBNA 2E53A 4F3JA 1YCIA 1YI9A 2LM3A 5JOZA 1U0AA 4FPFA 2WNOA 3KVBA 3M3EA 4N90A 2BU9A 1OOPA 2PQSA 5D8AC 1RUD1 5FQ0B 4E4DX 2D3SA 4AI2A 1GZWB 1H2KA 1Q5OA 4KQ7A 2CYFA 2HWD1 3LPFA 4Q4Y1 1PHMA 1WLCA 4QHBA 1V6LA 2LUWA 3QBQA 3VKMA 1WWYA 2W47A 3A23A 3PUAA 2WAAA 4YGEA 2DCYA 1GWMA 4BQ4A 3FUOA 1WLTA 4XTPA 4SLIA 4CP0A 4Q0VA 2G9GA 2WNUB 5JZGB 1DF0A 1CAXA 1RMU2 1SCSA 4FPGA 4XIKA 4E27A 1N1VA 2VBBA 3AMHA 2WA4A 4XILA 4DXSA 1XYPA 3THPA 4K20A 4R9CA 1LB2A 3CJIA 1ZBA2 1QU0A 5DUVA 1AYN1 5T50A 2W08A 2ZGLA 1UN1A 2VE1A 3IDEA 1UU5A 4GZ9A 2QFEA 1UD1A 2ZGQA 5BNPB 3LWCA 3E6BA 4LBQB 1D2QA 1LRHA 3BN6A 4LUKA 4HMZA 1LOFA 4ITCA 2YGLA 2ZMLA 3SH5A 1U5IA 2VZSA 3I59A 3OGSA 1RL3A 3AL5A 5AFBA 3RZGA 3BI3A 4QGMA 5E6HA 3SH4A 4IW3A 2HBUA 2CY6A 5A6XA 5K0UA 3ZKUA 2SBAA 2DYCA 4BMEA 3MI8A 3OUHA 3ZFGA 4QHOA 3VBSB 4IESA 3VLBB 5CADA 3MF6A 3PVOA 2E7QA 1ZYBA 2R0FA 4IEPA 4CEYC 1PGW1 2FDFA 3I3MA 4LT5A 3ACHA 3LAGA 4RS5A 5I8TA 2ZGUA 2VQTA 3N35A 4Q1RA 5JR2A 1XJAA 3NRUA 4K3UA 4E2QA 5KHGA 4BQ1A 3T2TA 2VTFA 3FFQA 2NLRA 4PCRA 3DXTA 1LOCA 1PK6A 3IAQA 4JDMA 1RINA 1NXD1 1S0EA 5DPNA 2K46A 3I2HA 1T6GC 2BOJA 1WCKA 1UZYA 5DDJ2 4CUGA 3WG3A 2ZAAA 2O0OA 2ZGPA 3JZVA 3VDDA 5ERLA 5KXEA 3AMPA 5KBFA 2WBKA 5CG9A 2C26A 4EZHA 4KBBA 4RGKA 5FXWA 1W2NA 3N7MA 1WKYA 1AYM1 4QM9A 3POJA 3VZKA 3PUQA 4IL7A 4JTOA 4EN7B 4PIYA 4IV1C 5H9RA 3CU7A 1BLZA 4GKYA 1JZ6A 4Z2WA 2XJUA 2VUJA 2FD8A 3KF3A 1GZCA 3WUDA 4PBPA 1KJRA 5HPOA 1IPSA 4DS0A 4IV3B 1LEDA 4BHPA 4GWMA 4X6RB 2VZPA 5LY2A 3H7JA 1QWRA 4YZ3A 3ZYJB 1AXKA 5IATA 4LORA 4OFGA 2W1WA 2BZDA 3ZXGA 4LA2A 5KHHA 2OUHA 4YM3A 4OLLA 2VTXA 3PLQA 3V64A 3VD4A 2OW4A 4XPVA 1O8PA 1UZVA 2A6XA 2BNOA 2C0ZA 1SQ4A 2RM23 4MADA 2UWAA 1AR72 3KHBA 4XZUG 1WMFA 4GWNA 4QQ2A 1PZ9A 4N53A 5K4LA 4CDQA 1LOGA 1RUF2 5F32A 4BOWA 2P2KA 1BHGA 4YG6A 1C8M2 4CDWB 2VVEA 1VE0A 3I2FA 1GU3A 2ZACA 4QU1A 1IKPA 1JODA 4FPHA 4M3CA 1EPZA 1CWPA 5EHDA 3I2KA 4CP2A 1VBE2 3NJYA 2V73A 2O14A 3LA3A 1EP0A 3R4DB 4RR3A 1KFUL 5F2SA 2P34A 1URXA 5AVAA 4BLIA 3HT2A 3MW2A 5I0UA 1ZRRA 3DKWA 5FOBB 1UMHA 1TVGA 4XJWA 1EUTA 2Z69A 1AVBA 3ITQA 3JUUA 2E51A 1W04A 5I0DA 3NV3A 1EUUA 3USSA 4D8MA 1UX7A 2WSVA 4CDXC 1XYNA 3CKHA 3N9LA 5CFCA 4GULA 5IWFA 2ZGKA 1XNAA 5FP7A 3EHKA 2Q1MA 1WMXA 2F6BA 2GP3A 4HN1A 1ND3B 1YFUA 5FYIA 1K42A 1ULOA 1DCSA 1TG7A 1QEXA 5JAXA 3O12A 1A34A 4IE0A 1YFYA 1CAUA 2HBTA 4AEJA 2RM21 1AR62 1T6BX 1XC6A 2ZA9A 1PM7A 2YROA 5CISA 3KCCA 3I2IA 4XQWA 2NMOA 4WVVA 4QX2A 1SFNA 4N43B 4JRAA 2VVDA 4PDWB 1POV0 2VW2A 1AJKA 1A8DA 2ARXA 1IQAA 1W9YA 2J1TA 5LASA 5T5PA 3POIA 2EXHA 1A3KA 2Y6LA 3HNMA 4P5YA 3VDCA 3FL7A 3V0BB 2VCCA 5FV3A 4E4SA 3ZYPA 4BCUA 1CX1A 1OQDA 4XBNA 2GH2A 1F8VA 1F9KA 3VBRC 1ZZ7A 1ZBE2 1UY4A 5EFUA 3HPNA 2W92A 5FZ0A 4N9HA 2V4AA 3AKTA 1I5PA 1QHDA 4K21A 4DUVA 3LGRA 2B9UA 1U5ZA 1HN1A 2EIBA 3T2PA 3OEBA 1O3RA 1SBEA 3GJBA 1WD3A 2FDHA 5A6QA 3J8F2 2EIEA 5FQ0A 1C28A 4QX1A 4W4ZA 4E4HA 1HQLA 5F5AA 1PX3A 2BW8A 3A22A 4TLGA 1MS9A 2BP6A 2XUEA 3L2HA 2WYSA 4XMAA 1NLSA 2WSUA 1LOFC 3OGVA 2HWF3 4AFMA 3WG2A 1J58A 2HWB2 2OQ6A 3KMHA 4COZA 4PI2A 3SC7X 1CPMA 2R042 4ZU4A 4IEVA 4MXWB 4LKDA 1FXZA 5JI7A 1LKNA 2BFUS 2P17A 3LIHA 4S2HA 4CCDA 3T0DA 1X82A 4D3WA 3W21A 1VMHA 1Y3TA 5JZGA 4TLFA 4OMDA 3T1MA 1DYOA 4RS5C 3O1OA 4FPJA 5HXVA 1GZTA 1ND2A 1DYPA 1RJ8A 2VOTA 2XWBB 1MR5A 5LWBA 2XQRA 1J1TA 2VNRA 4OMCA 1VBA3 5L9BA 2CAVA 3S7IA 1PK6C 1GWKA 2XL9A 1V6KA 3OUIA 1J84A 4Y22B 3L2YA 2GC1A 3LDBA 3NNFA 1CAVB 2IFWA 4P9JA 1PO23 4ZONA 5BNPA 1IQDC 1VBD3 3ZM8A 2EALA 2JDAA 4FT8A 3VDDC 2IWGB 2ZEXA 4LBQA 5ACA3 2P3IA 3R6SA 2MNGA 2ZHLA 1EV12 4TTGA 3SHRA 3C3VA 1SHWB 5FYYA 4LO6B 4ZU7A 3KLSA 3EB7A 4MH0E 5IUQA 1LGBA 4AQSA 3TEZA 2DU1A 1GSLA 3DUIA 4WBBA 2XBO2 4KWUA 4QXCA 3A21A 5C9AB 2PFWA 2VMCA 5GM0A 1L7RA 1W6OB 1QH6A 2DWRA 2PLV3 3ME2A 5F3GA 5KC5A 4M4PA 4D7SA 1ULPA 1AHSA 2QQJA 5HXMA 3I97A 4F8AA 1EAH3 4ZZ5A 1BEV3 4MHUA 2LS6A 3M3OA 1FT9A 2R7EB 5FO7B 4YW6A 3M8LA 4N7IA 3ZO0B 3NAPB 4GJYA 4CCEA 3AL6A 4NRMA 4YWAA 2K2SA 4FQ4A 4LUMA 2WN2A 5J37A 4K7JA 4LKEA 1W6NB 1WW4A 4UYBA 3J26N 2ZAHA 1W9SA 2JG9C 3Q8BA 4FPYA 5A1AA 5EJZB 4AF9A 4FO9A 2XJTA 1HIXA 4Y4YA 3UJOA 1VBA1 2A75A 1KXGA 3HBKA 3AP4A 5IFTA 4EN8B 4OHVA 4PI0A 1COV3 5I0RA 1DQ6A 1PO21 4HBNA 2W68A 4N8MA 2ZPXA 2D43A 5LZ6A 1UQXA 1DGWA 2QDNA 5ACA1 2KD7A 5J48A 4RL7A 1AR92 1YFXA 2YC4A 2ZJCA 3NKTA 4TN7A 3ZXDA 4HSJA 2JXAA 1RUJ3 4IV3A 5FWEA 2VZQA 4QU2A 3N9OA 4D7YA 3TN92 1XSRA 3GBGA 5CFDB 4XZPA 2VBDA 1EYBA 1IS4A 1GICA 1YNAA 2PLV1 3HNYM 5F6LB 1E57A 1H6YA 3S30A 4CCCA 1AR82 2VNGA 1EAH1 1DFQA 4QB6A 1BEV1 4HOOA 3RZZA 5C8WA 5CFCC 4LTAA 5EJ1B 2OPWA 1O8SA 3LIGA 3O0VA 3S5QA 3WR0A 2IXKA 4IEZA 4P9WA 1B09A 1ENSA 5DAPA 5FUNA 4DY3A 1GQHA 2BNMA 4AI0A 1W8UA 4DEQA 5C70A 3OBTA 1WMEA 4M01A 3U1XA 5FYTA 4TZDA 4GH4C 3ZPOA 4CDWA 3PMEA 4AFAA 3RJ2X 1K12A 3D0JA 4HVRA 4BB3A 1X8MA 4QT6A 1H1AA 3WQ0A 1QDOA 2XONA 1COV1 1GYKA 1WW7A 2WO7A 1JI6A 3ACGA 3J7MA 3ZN4A 1QJU2 2HYXA 2ET7A 1V9U2 2DFCA 3EQEA 3R0RA 1HRI2 2ZEYA 3FBMA 2YV8A 1RUJ1 3UGFA 1RUI2 5TSWA 1D4M3 1YI7A 1G9BA 3RWNA 2BOIA 2LRPA 1IG0A 4NUBA 3RSJA 5ISLA 1Y4WA 1ASJ2 2PHWA 1W06A 5AC93 2QCSB 4AFCA 4RQPB 1V6JA 5FOJB 4YVSA 2OQ7A 2ID4A 3M4FA 1LHNA 4XE9A 3SQOA 3BPSA 3IDCB 4H7MA 4XUQA 1W0PA 5CG8A 1AL22 3J7HA 5IVCA 3SNMA 2K0GA 2R063 3A7QA 4OI2A 4AEKA 2VL4A 1JZ7A 3I7DA 2WS92 3AZWA 3MPPG 1H30A 5LEKA 1U5XA 2AUYA 3UETA 1CZVA 1H1IA 1QY4A 2PHUA 3W59A 5KXDA 4N9IA 3M2MA 4BWOA 3V0BA 3ILRA 4D6SA 4KU8A 1QDCA 1WCUA 1XNDA 4WVMB 3UGHA 2VMGA 1WBFA 3JXSA 1RHI2 5FZMA 5HCFA 1BMV1 4AXOA 4L8QA 4IE6A 4TYSA 4OI0A 3C8XA 3HQRA 1NYWA 4A44A 4ZPIA 4IUGA 1ND2C 5F5IA 1QOSA 5FY7A 5APAA 3TAYA 3WF4A 2JB8A 1D4M1 2VNVA 2QUOA 1CJPA 3ZXKA 2A3WA 3ZYIB 1QNYA 3H3UA 1RXFA 2RR13 1LECA 3MGUA 5L7OB 5B4XA 3JB4C 5GJ6A 1B35C 3AVSA 2BPA2 4XYXA 2Q0AA 1RMU1 1S0FA 2V09A 2FDIA 2R061 3ILNA 4AI3A 4GAZA 4AVSA 3LKJA 4WV8A 1PNGA 4XAEA 4DXRA 5L9RA 3I2OA 4LPLA 4JTNA 5FXVA 2Q1FA 3ZYGA 3SMHA 3AP5A 4YG0A 4MXWA 1MQTB 4XC9A 3V65A 3RWKX 2DUPA 5CYYA 3RPQA 3J9SA 3T30A 1C57A 1NCQB 2J1RA 1TNFA 3HJRA 1HX6A 2YYOA 3K77A 1W6MB 3I3QA 2Y6FA 2Q5TA 3ILFA 2YPJA 3BOPA 3OTFA 3OJBA 1IPJA 5JXIA 1CJDA 2TNFA 1HRV2 4AR2A 5HCHA 3ZN6A 4Y22A 4CEWB 2LTNA 4IXLA 1QJZA 1ACCA 2Y26A 4RD7A 3WW2A 1CAVA 2HEYF 1LHVA 2VOWA 5DG2A 3T4HB 4A45A 4LO7A 3I2GA 4QPIB 3WDWA 3V0AA 1NXMA 2RE9A 3AMQA 3DGTA 5LA1A 4RGAA 2Q4SA 2JX9A 4HONA 4XF4A 2YMZA 4LK6A 4X6QB 3ZXFA 5GALA 1R082 1W6PB 1VR3A 3VZMA 2RR11 1RUE1 5EP9A 1K5MB 1XE0A 3NNGA 2DFBA 1JYVA 5C9AA 1WD4A 3DYPA 3AM2A 3CO2A 1W6OA 4GWIA 3U78A 3UYJA 2Z42A 2XOMA 5KR7A 1GFF2 1VMFA 2W5FA 4ZXKA 4IE4A 1JS9A 4XHBA 2VG9A 2HEWF 1D0HA 4KH9A 2P3JA 4EV0A 1RUG3 1CGPA 3NAPA 1W0OA 4MGZE 2BERA 3AYAA 3MIGA 1NX9A 2AH2A 4AEDB 2GN7A 4D7TA 4AL9A 5JPNB 3GDBA 2EAKA 2QDRA 4ES9A 4L9BA 4A7KA 4PJYA 1HQWA 4EN0A 1VRH2 2H0VA 3POWA 4G3YC 5FZDA 4SBVA 1Q8QA 4IEUA 2FDKA 4FP2A 5B2GB 1H8TC 2XVLA 3IDBB 3T1LA 1EY2A 4HKWA 4HPKB 3T08A 2VCAA 2EXIA 3M3CA 1FPN3 4AHXA 1SLAA 5KWRA 4FVVA 2YFUA 5CU1A 1KRIA 3AKRA 1VB2A 1W28A 2IZWA 2DCZA 3RG0A 3P3NA 2MEV3 4RHV3 2AEZA 3H0OA 3WINE 2X5IA 1S2KA 2A6YA 1V70A 1W3XA 2YC2A 3H7YA 3FUQA 3LSDA 1O91A 3JBG2 4JQTA 4OUMA 5C6CA 3SCFA 3W5NA 1SFPA 1R1A2 3RZLA 2J1VA 4Y33A 2OA2A 3NO8A 4MOAA 3BPZA 5CNAA 4JGYB 1GLHA 5CVRA 1M4WA 1ZNPA 3S7EA 2ZMKA 3UKTA 3ZR5A 1QOTA 1LOEA 2YPDA 1J3RA 1GOHA 2G1MA 4AFDA 1CVNA 1VBD2 5C4WB 4GJZA 4FTEA 1LGCA 3WF2A 2F4PA 2QNKA 3K3OA 3MHZA 2WWUA 1PZ7A 1MPXA 3ETQA 3ZSEA 4JCKA 4IERA 4YVSC 4QX5A 4JVAA 5FMDA 4FP3A 1BXHA 1NA1B 2RS13 1NQJA 4HL0A 4KI5M 4QDSA 5HBAA 4LQRA 3WDUA 4CCMA 3C7OA 4LNVA 1GMMA 3P3PA 2KR2A 1O4ZA 2XL7A 5FYZA 1YYNA 3U10A 1FPN1 3FLTA 2PAEA 2DVBA 2IVIB 4XBLA 4DMIA 1RUD3 2LALA 2V72A 2XGXA 3PMSA 2VZRA 3MEPA 1LTEA 2MEV1 3AXDA 4RHV1 2ZKLA 4JGZA 4GA9A 1G86A 4YLZA 3AP7A 3ORJA 1MEC2 5C3PA 3CEWA 2VOVA 3RDIA 1RUC2 4OHYA 5FRAA 3BOWA 4NROA 1R091 4P00B 2AEYA 4KG0A 2W3JA 4H3WA 4RQPA 4CTEA 1HB1A 1ST8A 4DUWA 2JG8C 2E9QA 5JVVA 4HETA 5A80A 3LDKA 4JV4A 1UYPA 2R073 5K9YA 2Q8DA 1LESA 3RMXA 3IZOA 1PGL1 3PTYA 1HB4A 3LA2A 3U07A 2CTVA 1CAWA 1HDKA 4Z92B 2BVVA 3VZLA 1BBT3 5BXXA 1ZBE1 2VW0A 1SCRA 1ULDA 5ABJB 2RS11 3VKLA 3U4SA 2VQUA 3QOPA 3JCIA 3AYDA 5FWJA 2FCUA 1MS5A 1H9WA 4XUOA 1F35A 1QQP3 3BUCA 3NJVA 1H6XA 2ILMA 4C8DA 4P9XA 4PLNA 4U2AA 5FBJA 4A2UA 2QBXA 3VD5A 3VDBA 2D6LX 2WO2A 3CL1A 5FZ9A 3U14A 5J3UA 3OPTA 1GKBA 2OS2A 2AR6A 4QPWA 4YM1A 1RVF2 2YHJA 3MW3A 2A6ZA 2ZEZA 2ZHMA 3VBUB 5D1IA 1CIYA 5JI9A 1S0JA 1UAIA 1KD7A 2BTVC 2WZ8A 3EBRA 1QF3A 4O7XA 1RB8G 4I2OA 4O61A 2MHFA 2CWSA 3BTZA 3CF6E 3MFAA 2Y6HA 4CPBA 5C5TA 2VQ0A 2WL1A 5C8CA 2JE7A 3FFZA 2J1SA 1HB2A 1FMD3 2XH6A 3SCGA 2P4EA 1C1FA 3V0AB 4LXLA 4BQWA 5CIRA 3AKQA 4MZUA 4JQRA 5EYYA 4ASMB 2R071 5IW0A 2EICA 1O5UA 2C9AA 1NCRB 1POQA 4CCOA 1W8ZA 3ZYRA 2A71A 1CONA 1MQTA 3CZUA 3JD72 1BBT1 4Q4X2 3VKOA 2VZOA 5C9AC 3AKSA 1AYM3 2O8QA 4AVTA 5HCAA 3H8XA 2ERFA 1HB3A 2ZTNA 3ASIA 4H7LA 3VKFC 2OYZA 4MSVA 5AC92 1W6MA 5DZFA 1QQP1 1YFWA 1H0BA 4XQDA 2YU2A 1SMVA 4BQXA 5A3NA 3TEXA 2RHPA 1S0GA 1KEXA 4CCJA 1KFXL 3I54A 5JXHA 4QQHA 2QZ3A 4XDPA 3I4IA 2XBO1 1P8JA 2E26A 3RJRA 4KMQA 4XDQA 5FY0A 3RI9A 4AHZA 4QPIA 1HQNA 1DG6A 1O6UA 2WN3A 5JSPA 3O0WA 3VN4A 3DECA 5J98B 2WLPA 4TWTA 3PUHA 4ET7A 2RDSA 3WQ1A 3VD7A 2WNVA 2WLQA 1L7QA 3DKQA 1PVC2 3U75A 5A6ZA 2VZVA 2RDQA 1ZZCA 3FX3A 1FMD1 1VBB3 4P9IA 1OC1A 1GP6A 3VBHB 4YW2A 4Y24A 2KXLA 1SLCA 1N47A 2O8OA 2WZR3 5LBFA 2X5IC 4UF0B 4XJZA 3DPRA 4UT5A 3UESA 4A6OA 4AK3A 3NNMA 5I91A 4QDRA 3F95A 1ULGA 4W8JA 3RMYA 2PHFA 3WCSA 2NP0A 1ZZ8A 3ZFFB 3PVBB 3VZJA 5FPZA 2LROA 3KV5A 4XTMA 3VZNA 4AEDA 2FCTA 3TEYA 2P6CA 1BCXA 2R6QA 3ENRA 3MW4A 2HWC3 4WM7B 2RS53 4IEOA 3WD5A 5LB6A 2RS32 4P9YA 3ZFEC 4YARA 1OI6A 2Z4FA 4BDVB 4FOVA 2Y38A 4OI4A 3O1SA 1CIWA 2VMFA 3WG1A 5FUPA 1EPWA 1G8WA 3VHPA 4HPKA 4YW1A 4LE4A 4ZKTB 4LBMA 3AVRA 5F6KA 4BA6A 3GZTB 5FYBA 1JTZX 3VBFB 5GZFA 3TN91 4KU7A 3HIFA 3WVJA 3NVCA 3N9QA 4A6SA 4LE3A 4EN6B 2ZX0A 5C7GA 4Q29A 4LBQD 1QH7A 3AKPA 1AXYA 3NV4A 4LBKA 3BIEA 3SKJE 1AR81 1SBDA 4XJ8A 1OA3A 4ZS3A 2PELA 2Z2SB 5FYVA 3ECQA 4WZFA 2RG4A 1VBB1 4BYYA 3WY6A 4IGOA 2W1QA 4NPMA 1ONAA 4JGZC 3VL8A 4XXAA 2WZR1 4WVZA 5FO9B 4QXHA 1PO12 2W91A 4QGLA 1TME3 1BYHA 2QKDA 1UYXA 2BWAA 4WM8B 3OB8A 5FZIA 4XMIA 2X53S 1UX6A 2ZHNA 5FK8A 4ASLA 3OD0A 5A33A 2XLGA 2DV9A 4B29A 3PU8A 2HWC1 4FPLA 4QM8A 4OULA 4DB5A 2RS51 3T2QA 3WDYA 4P14A 2E6VA 1NY71 4M4RA 3FN9A 4MG2A 2HLEA 4OZOA 1W8NA 2JDZA 2UWBA 5FPLA 3SH3A 5BNOB 4BPZA 5L19A 2QQIA 4H14A 3VD9A 2WRAA 3NW4A 1UOFA 3D4KA 4PF5A 4AEMA 3WP5A 5BNNA 2W95A 1Q8SA 1M06G 2ZGOA 2DUQA 1E5IA 2XXZA 2QQPA 1RUG2 3FHQA 1SACA 3N9NA 2X8KA 1UY0A 2GAUA 3PDQA 1RXGA 1OD3A 4L97A 2PMWB 4EWAA 5IK8A 4OHXA 2GMMA 2D3RA 5FY1A 3O1RA 2TBVA 4I0AA 2GC0A 5EXOA 1W2TA 3MO4A 1XSQA 4ARXA 4QPGB 4YVWA 1OOPC 1LAJA 4Y4RA 1Q8OA 3EMRA 1YQ5A 4M3CF 3VBOB 3PJQA 2VMIA 4L99A 4FXKB 1HLCA 4DQAA 1TME1 4FPCA 3HQXA 2PHXA 1DGRN 3ZN5A 3C7FA 3O7OA 2GMPA 3RRDA 2A6VA 2X09A 4KNCA 1CD3G 1UOGA 4Y5SA 5H9PA 1OLRA 4YM0A 2DTYA 4Y26A 4Q4W2 2VM9A 5C8CC 4W6WA 2XJRA 3J4UH 2ZOEB 4AHYA 1YUDA 2A70A 1O3TA 4X8NA 4XEZA 1Y9QA 4JAAA 4PHZA 4CDUB 2FMDA 4LO5B 5ABJA 1TMF3 2D6NA 4CU6A 1H2LA 1SPPB 3ATGA 4RSUA 1E5HA 1REDA 5E88A 2J42A 4HSLA 5JMCA 2PAMA 4I09A 3IPVB 4CYDA 4E2GA 1QMJA 1JXNA 1REFA 1NUKA 3CJIC 3K4DA 5FLJA 3H42B 4BU2A 1POV3 4LR4A 2F4LA 2ET1A 1GOFA 1E5RA 1GZWA 1XU1A 4ARYA 4E8DA 1JBCA 4NVPA 1BVP1 2EXKA 1SZBA 4O9EA 1AX0A 2VD7A 3H3ZA 1RGSA 2QZ2A 4GB32 1SDWA 3DYMA 3VKNA 3ZYFA 5LRRA 1D0GA 1Y7BA 5SV5A 1HJGA 2B46X 5JUVA 3KCXA 4B1MA 5K0UC 1U12A 3BYWA 3RZHA 1LGNA 2DCKA 2EIDA 3ZFGC 2NN8A 2I45A 3ST7A 1FYUA 2NQYA 2PHDA 4UBHA 4AI8A 5JR7B 2WNUA 4A42A 1RUD2 2E7AA 2D6MA 2DUOA 1Y9GA 4AZZA 4QX7A 1OVSA 4FFHA 4EE2A 3IIAA 1C3HA 1VBC3 5G04L 2E32A 2B5HA 2WNVC 2D97A 3C7GA 3CMGA 5A3WA 2HWD2 4XF0A 4Q4Y2 4AFBA 4QKNA 1E5SA 3AZZA 2N7GA 3GNEA 4ONUA 4JHTA 3K51A 2Y33A 5EZWA 1TMF1 4W6XA 4FQZA 1UO9A 5FDBA 3VUOA 5T5LA 3DPRC 4XAAA 2Y34A 4F83A 5B4NA 2Y64A 2DU0A 4FI9A 5D8AB 4PBOA 1PM4A 4Q4V3 2R32A 4K6BA 5I93A 4LBOA 4QPYA 2VU9A 4MGTA 1PIV3 1POV1 2ENRA 1I9RA 2VMHA 3OBRA 3RZMA 4UFMA 4E4ZA 3B9IA 3WDTA 1IGOA 4PF1A 4PQ9A 5FYMA 5A7QA 2UYAA 2BGOA 3PVEA 4LEJA 2WFPA 1JHJA 4Z8BA 1DYKA 3LQCA 4S2DA 3AZYA 1AYN2 4OVEA 2JD4A 4CXYA 5A7OA 1KDKA 3WLUA 2VGDA 4P08A 2Y60A 3DCQA 4XUTA 1I6XA 4JC1A 4AGRA 2BRTA 4DXTA 4NPLA 2WQZC 4KGGA 3UL2A 3NL1A 3AB0A 2R1DA 5CKMA 5CKQA 4Y3OA 3WUCA 3KSCA 4UF0A 5IK7A 3KM5A 1VBC1 2WO1A 1HXS3 4COWA 2ZBJA 2IFRA 5FP3A 4DZGA 2W1SA 3ZFFA 4N53C 2ZGTA 1PGW2 1Z78A 4W50A 4CDQC 1W6QB 2XQXA 4L11A 3NWKA 3CZJA 4Y1XA 5FBZA 1DBNA 1XB9A 1H1MA 2P3YA 2D5FA 1YIPA 4QB2A 3EXUA 1WA4A 2DCJA 2VJXA 4YRDA 3EYPA 2V5YA 2H6CA 1MS0A 4DFSA 4Q4V1 1TEIA 2RMU3 3PTRB 1PIV1 2QQLA 2E33A 1MS8A 3RZKA 2B8MA 4RR3C 3VBFA 3EO6A 3ZMNA 1QJX3 4CEYB 1KGYA 4PQQA 3KZ4C 3PUIA 1UPIA 1FV2A 2B4KA 4Y1VA 1OFSA 3FLPA 1RUH3 1KJLA 5FZCA 1N3QA 2VPVA 2WFF3 3ABZA 1AYM2 2MPFA 4B7KA 5LK5A 1Z7S3 2R30A 1JU4A 5LATA 3WF1A 2TUNA 2Q30A 2WZPP 5BNNC 2CGOA 2UURA 5GLVA 4BQ3A 1ENQA 1S0DA 5FZOB 4Y20B 4YW4A 5GZDA 3C2UA 3CLPA 1CN1A 4PT6A 4PLOA 4ZHNA 2HWE3 3I49A 4UI9L 1QJY3 4LO4B 2A1XA 1YJLA 2KM2A 2VTXJ 1FOD3 2QQOA 4LHKA 1HXS1 2K9ZA 1NZCA
chains in the Genus database with same CATH topology
5FTTC 5FMOS 4YFWA 1Q56A 1C1LA 4IV1B 3BTAA 3LCPA 4V1PA 4YVWC 1KS5A 2VULA 3KT7A 1FI2A 3N7KA 4B7EA 4TSVA 5T5JA 4NPRA 2VOXA 4HT1T 2XJQA 3ZDSA 1AXZA 3FMGA 5KXCA 2RMU1 4AYUA 2TEPA 4LO8A 2BVBA 1QJX1 1ND3A 3KB5A 1BVVA 1RUH1 3AYEA 3IT8A 5JOXA 2WFF1 4AQTA 3BIWE 1Z7S1 5JOWA 1RMU3 4K40A 2W0XA 4QPGA 3I2DA 1FAYA 4FPKA 1ZA4A 2YXSA 4N43A 5GZGA 4PDWA 2ARBA 2HWE1 3D8CA 5DUWA 1ZBA3 3TWIA 1QJY1 4AE2A 1OPOA 2YDEA 2Y0IA 5HCBA 1FOD1 2YZ4A 5K7PA 3KT4A 4LLFA 4M00A 5FAXA 4NOTA 3M7AA 4PIXA 4NO4A 2DF7A 2ZKNA 2OUJA 1ALYA 1ZRCA 4O9GA 2RM22 2CWMA 4CDXB 1MVEA 5GKAC 4Y1YA 2D6PA 2WNUC 2HKXA 2WQ4A 5JZGC 2CGPA 3GZAA 5JWPA 1O5LA 4I01A 1VP6A 4AQ2A 4XXPA 2UYBA 4EJRA 1O7FA 4MLOA 4IEXA 2ZZJA 5KC6A 1QXJA 1MZ6A 2JKBA 1UU4A 1O4YA 2ATFA 2BGCA 1RUE3 4FPOB 4P9LA 1U5YA 5BNPC 1LR5A 4ZU5A 1AX2A 4HANA 5DDJ3 1JYCA 4K9SA 5EJ3A 3QD6A 3ZIWA 2Z5WA 2JENA 1ZBA1 2A7AA 3R05A 1WUVA 2ZGRA 3VBSC 3ZXAC 3FJSA 4QD2A 5BNQA 3UKVA 3SISA 1F2NA 1XYOA 4HK8A 3H8UA 3JU9A 1WGPA 1SBFA 2GNBA 3ZPYA 1FNYA 4JRLA 5F1RA 3VBRB 4B4QA 4MUVA 2ZHKA 2D44A 2XG3A 4RA0A 3D5OA 3PJYA 3B69A 5GLWA 2VXRA 2WKKA 5E89A 3H1WA 2P37A 3DL3A 2R1BA 1JHNA 3POSA 2R49A 3ACLA 1AR73 4Q0SA 3USUB 2ZGMA 4EROA 1OPMA 1XXNA 1RUF3 3WW4A 2PAKA 4HFSA 5DDJ1 3AZVA 1C8M3 1X33A 2JICA 4IV3C 4Q26A 3MPBA 3R4UA 1VBE3 3DF0A 4RS5B 4KWJA 1JW6A 1MZEA 1W6NA 2X29A 1DGRA 1REEA 4JDNA 1OQEA 4R9BA 1PK6B 4GALA 3WX5A 1DZQA 1LULA 4Q0QA 3AXEA 1W6QA 1UIJA 2HWF2 2JE9A 1DIWA 2IXLA 4XIOA 3VDDB 4COUA 4GQ7A 3HN1A 5J09A 1MVQA 2UU8A 1VIWB 3MIHA 4CDWC 3LA7A 2ZX1A 3OY8B 3IBMA 4GMP0 2I2SA 1AR63 3DV8A 2DVFA 1AR71 3MIDA 1KQRA 4DOUA 1VAVA 5GLZA 1R093 1WCDJ 3ZXJA 4CEYA 1RUF1 5CFDA 2PN5A 4PLMA 3VHRA 3QLQA 4S2FA 4B4RA 1VBA2 1UKRA 5A3MA 1C8M1 2ZABA 1XRUA 3M3IA 1ZZBA 4M0NA 2OIIA 2XJSA 1QXRA 1PO22 1W39A 4X8PA 4Q0PA 3L9JT 2WT0A 4R8HA 1VBE1 4Y20A 3SLIA 1ZZ9A 1ND3C 5ACA2 4HZFA 3WP3A 2JG9B 3MYXA 1UF2C 3QACA 3O0XA 1ZBE3 1OHFA 1G9AA 3ZIXA 1DQ2A 1CESA 3AP6A 1IS5A 4BLJA 2PLV2 1XE7A 4IV1A 2XB6C 3GHMA 3TNPB 4B8EA 4IQPA 4N43C 4PDWC 2XUMA 1EAH2 1BEV2 3LOIA 4M3CB 2FZ2A 2D5HA 2PHTA 2PYTA 1RTVA 2CV6A 2PHLA 1AR61 3WP4A 3IWZA 2XJVA 2DVDA 1S0BA 2HWB3 3K48A 3NV1A 4RFT0 4HK9A 4AGGA 2R043 2RJKA 5DZEA 1SLIA 4C1XA 1JUIA 4R9DA 5GZCA 5JSOA 2D93A 3WOGA 3B94A 1ENRA 1COV2 3IKWA 3B93A 3FC0A 5CAZA 3X29B 4FCAA 2D40A 2EXJA 2D3PA 1RUOA 1CAUB 4GH4B 3RNSA 5BUVA 4OZXA 1RUJ2 2ZZQA 4A7YA 1Y43B 1BZWA 1I3HA 1OFNA 3NJZA 3WXPA 4MX3A 5L73A 4CZSA 2XKPA 5JIUA 1VB4A 4H55A 4BE3A 1EV13 3N4MA 4WVMA 3J8F1 3H50A 3H9AA 3SXWA 2CAUA 4XFAA 2PTMA 4Z07A 4FTBA 1AX1A 3O5SA 2XBO3 4EWEA 2FBEA 4FAHA 1Q3EA 4UW4A 2FMYA 1HV1A 1SLTA 4AVCA 5I0TA 3POYA 2HWB1 4QQLA 3TRSB 1NLRA 2R041 2DURA 5IK4A 4FOYA 4IEWA 5L7OA 2XLFA 3TYJA 1O3SA 5KHKA 1WCSA 2VW1A 4DXZA 1TNRA 3NV2A 5JOYA 1BMV2 4ISQA 2UY8A 3LSEA 1DQ5A 2ZX2A 2D6KA 4OHWA 2GMEA 5JIAA 4ISRA 5E16A 2GZWA 1XNCA 1D4M2 1IS6A 1NCQA 2B42B 3ZXEA 5I8SA 1ZM1A 1CPNA 2A5ZA 3MLKA 1QXPA 5CBLA 3U11A 1V00A 1ULFA 1EV11 1AR93 3VBRA 2BUKA 2JJ6A 3WG4A 5SV8A 1UL9A 2YUEA 1Q8PA 1SLLA 3NAPC 2R062 2AREA 2E7TA 2OVUA 4CEWA 3TN93 1ND2B 1GZ9A 3E5UA 4BIOA 5CA6A 5KHIA 2YY1A 5L36A 2WA3A 2RJLA 1LOBA 1ZRDA 3AMMA 1AR83 1D2SA 4B3NA 2A73B 2IC1A 3Q9OA 3USUA 1B35B 5BPXA 2YC0A 1W6PA 3B9CA 4YGCA 4FTSA 3FZ3A 1DU3D 1FNZA 1K5MA 1LODA 2BFUL 5FLHA 4MVTA 1IHMA 1G9DA 2JECA 2VY0A 1ZZ6A 4INDA 4FSJA 2VECA 1XQNA 1ZRFA 1UKGA 5FLIA 1ULCA 4XQ4A 5JPMB 2IXJA 4META 5CFDC 5J36A 4OUSA 4AVBA 4BMBA 1RUNA 3D82A 5BYNA 4ATEA 5FPXA 4YYOA 2Q8OA 1DDLA 1DZTA 1NG0A 2RR12 1RUE2 2WIIB 3SITA 4C91A 5JDBA 1AR91 1QJU3 3SCHA 1V9U3 4I0WB 2BQPA 4NWWA 3W9AA 1HRI3 1O4TA 1RUI3 2B45X 2XVKA 3GHNA 3KGZA 1MACA 3WNXA 4XFFA 1ASJ3 1AL0G 1ZX5A 4MGIE 1MS4A 5KXBA 3WCRA 1AUYA 1ZREA 3OY8A 5FREA 1XNKA 3KGLA 1AL23 1N3OA 4DRRA 2WT2A 4XFCA 3INAA 1WW6A 3M3QA 2WS93 4XF3A 2H6BA 5E8AA 2NYYA 4AW7A 3UKNA 4JGYA 3WDVA 1F31A 5LRSA 1J59A 3BU7A 1QGLA 2QJVA 3R4SA 5A32B 3AMNA 1X36A 5C4WA 1GR3A 3JQWA 4KGQA 4Y1UA 5T3NA 4FBFA 3UK9A 1S0CA 2JG9A 4ATFA 1RHI3 4RQPC 1UU6A 4LA3A 1QKQA 1GNZA 3CNAA 1H8TB 1HV0A 2C5DA 1BKZA 3IM0A 1NA1A 3RYRA 3TBDA 2NM1A 1QJU1 2ZX4A 1GBGA 1V9U1 1HRI1 5DUUA 3D0SA 3B5LB 1RUI1 3KCYA 2OZJA 2GC3A 1IZ3A 3MICA 1WW5A 4UXAA 3ES1A 2VNOA 1ASJ1 4HLTA 5F9TA 4PIZA 4XJAA 1AL21 1SFYA 3OCPA 3HT1A 4YZ1A 2WS91 3AJZA 3WQ7A 1C8NA 5H9QA 3E97A 1YXWA 5T54A 5JLVA 4J1XA 2XKOA 2XHKA 1OSGA 2DVGA 5K8SA 1AF9A 1J3PA 5T55A 1FPN2 1I5ZA 5FMOL 2QVSB 3E5QA 5DG1A 4UW3A 4F7ZA 3E6DA 3OGGA 2EVXA 4S2GA 4YVSB 2MEV2 4RHV2 1S2BA 4GKXA 4GH4A 1RHI1 2R16A 3PHMA 1HRV3 3ZMOA 5L7OC 2Y0OA 3LZZA 4LLOA 1R092 3ALQA 4XETA 1WLWA 4I3PA 5F5QA 3VHOA 1JOJA 1DHKB 1QNWA 1AJOA 1WBLA 1OA2A 3NKGA 1YO8A 3M70A 1MQTC 4YFZA 3AP9A 2UY9A 1R083 1O3QA 1PGL2 2B7YA 4IEYA 1NCQC 3OYWB 2FZ1A 3HMYA 4AHWA 1RC6A 3M1HA 3VBUA 1V6OA 1BJQA 1A6CA 2P3KA 2GN3A 3D6EA 3PVNA 1LCLA 1ENXA 4BIFA 2ETEA 2AYHA 4YGDA 4AVAA 2RS12 1LEMA 4I3GA 2JG8B 4CEWC 4AWDA 1VAMA 4YM2A 2VOKA 3A0NA 3RYKA 4QPIC 1GNHA 1ZVFA 4I0BA 1N1YA 2W52A 1APNA 1VRH3 3NSTA 5A3LA 1OLQA 3IN9A 3VV1A 1NCRA 4W65A 3S6PA 3MIEA 2DTWA 1PVXA 4D69A 1WMDA 1IS3A 4E2SA 1DQ0A 2ZS6B 1HRV1 1K5MC 3MF9A 1F5JA 3JQXA 4M0HA 4NHMA 4NN0A 2ZMNA 4DNYA 4C1WA 4NHLA 1DQ4A 1R081 3FBYA 5H9SA 2R072 3JBG3 2XJPA 3WP6A 4JDOA 4AEDC 2D6OX 2GNMA 1SEFA 1R1A3 3E6CC 2ZGNA 4XBQA 3WZ1A 5IT6A 4YZ5A 1MS1A 4YZ2A 2BNNA 4QQPA 1UCXA 3B3QE 4UW5A 3ZN6B 1BBT2 5EV7A 4DPNA 4Q1PA 3RQ0A 1B35A 4MGYE 2PA7A 4R4XA 5GLTA 2DVAA 1QQP2 2A3XA 1YJKA 3BALA 3I8TA 4C0BA 3V0AB 4XF9A 3VBHA 5LEJA 1V6NA 1G9FA 4Y1ZA 4KL1A 1VRH1 1RJ7A 3ZXLA 3MIFA 2GC2A 1OD5A 2A3YA 3E5XA 1F5FA 3JB8A 1LENA 4YG3A 4R4ZA 5DUXA 1JN2P 2FHRA 2HWF1 1IPKA 1MS3A 4XF1A 3OPZA 4JGYC 4MXVA 4R9AA 3MDPA 2W39A 1JUHA 4WM7A 3BB6A 5DZGA 3TOJA 1FMD2 3THTA 3O14A 5C4WC 3RI8A 1MEC3 2CL2A 4FOWA 1RUC3 1LU2A 1NQDA 3JBG1 1L3JA 2CGNA 4DY5A 1R1A1 4CRQA 1VALA 4HN0A 1FATA 4Z82A 2ZCWA 2KA3A 3HR9A 1NA1C 4XFGA 1PGSA 3ZSMA 3IMNA 2NMNA 1IKQA 2ZGSA 2VVFA 2AGSA 1VBD1 5FCCA 4DRVA 3N7LA 3HD8B 3RYPA 1X50A 3VHNA 3CJXA 4A3XA 4Y5Z0 2X5IB 4XJUA 1S0IA 4FOQA 4L92A 3MIBA 4YW5A 2XWJB 4HKLA 2DCTA 2BEOA 1A78A 1CX4A 5T5OA 5A32A 4LHNA 4WM8A 5EYXA 1FV3A 4AVVA 3AYCA 3ZFEB 4G4FA 4NHKA 4J6GA 4Q2FA 1H8TA 2Z79A 4HVQA 3N36A 1RVF3 1VBB2 1LHUA 3N3HA 1MEC1 5BNOA 3G7DA 1YWKA 4D94A 1RUC1 3ELNA 2D98A 2WZR2 1UIKA 2Q1ZB 3QCWA 5AFEA 4NWVA 5IK5A 2R0HA 5ABJC 1S1AA 1KS4A 4K1ZA 1H8VA 3OF1A 4Q0UA 2HWC2 3ES4A 3QH6A 3FLRA 5HI0A 2RS52 4EN9B 1NY72 4JGZB 2NZ9A 4Q8KA 3JD73 4Q4X3 4QXKA 3VBOA 3MZHA 5KHJA 3FE5A 1OA4A 3VBUC 4P9GA 3AX4A 4MV2A 4ES8A 2B39A 4I02A 1OQ1A 4XJ9A 3MFCA 1X8EA 4CP1A 4OHZA 1C5HA 1A8MA 4KG8A 1LHOA 3EJKA 4QMAA 3V56A 4Q8LA 4AG4A 1UMZA 2E63A 3KT1A 4CDUA 1RVF1 3WW3A 4R52A 1DZRA 1ULEA 1CAWB 2GNTA 3MLLA 1KITA 1NCRC 4GIQA 1RIRA 2WT1A 3IPVA 3N7JA 5BY5A 5GLUA 4Z1VA 3VZOA 5J7MA 1TME2 4MGKE 2IXIA 2VUAA 4C90A 1TE1B 1YIFA 1PVC3 1VLNA 4XW3A 1YLLA 2SLIA 3OYWA 5FO8B 3HBZA 1IOAA 4QQOA 2GALA 2GU9A 4YNIA 1OOPB 4LBLA 3APBA 2HJIA 4LBJA 3U0ZA 1Q8VA 3ZVXA 2EF6A 1DGWX 2JG8A 1KDMA 2OPKA 2GH8A 3JD71 4Q4X1 2ES3A 5BV6A 2EIGA 4AQ6A 3MLJA 4HVOA 4XHXA 1JYIA 1N1SA 3WV6A 4LBNA 4NR1A 5AC91 3FHIB 5C8CB 2RS33 2NPIA 3PNAA 1PNFA 1G6NA 3A4UA 1LU1A 3LOBA 5KC5A 3HAGA 1MZ5A 2FQPA 4GXLA 2I07B 3GALA 3RS6A 4BM8A 4UBGA 1CAXB 1V6IA 4XOGA 2G4IA 3UJQA 5C33A 3VBHC 1H9PA 1UPSA 3G6JB 1H2NA 2EA7A 3WHTA 2O1QA 4WVWA 4BH9A 1G7YA 3AFKA 2HEVF 3CJIB 4ORFA 4A7ZA 3U4XA 3A0KA 5D8AA 1HKDA 4B4PA 1MZFA 3B7MA 3ZFFC 5I0SA 1UZZA 3WDXA 3W58A 4N7UA 4XFHA 4W6YA 1PVC1 1N1TA 2XLAA 2BBVA 2IXHA 3B02A 4WM7C 3I59B 4HKOA 3B00A 3WHUA 1NE6A 1OMIA 3URFA 1NE4A 1PO13 5K0UB 3ZFGB 1GANA 3B01A 2OZ6A 1N3PA 1D4VB 1TMF2 3HWJA 1JH5A 3WT3A 3VBFC 3KS7A 1PZ8A 4OI1A 1X7NA 3H1YA 5LK7B 4YW3A 5FFOC 4LHLA 1XNBA 2WNVB 2HYKA 1YHFA 2RS31 3LB9A 3ZSKA 2JEMA 3GF6A 1R1ZA 3AJYA 2WC2A 5J96B 1WLDA 4K1YA 2YGMA 2XPJA 1I1EA 3DPRB 3VL9A 3KD4A 4Q27A 4COYA 4YGBA 1BQPA 1AZDA