3AK0A

Crystal structure of ancestral congerin con-anc'-n28k
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
132
structure length
132
Chain Sequence
GVEVKNITFKLGMYLTVGGVVNSNAKRFSINVGESTDSIALHIDHRFSYGADQNTIVLNSMVDDGWQQEQRSKNFPFTAGEHFQITITFDIDTFYIQLPDGHKVEFPNRHGDEAFNFIYLAGDARLTFVRLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ancestral congerin Con-anc
publication title Tracing protein evolution through ancestral structures of fish galectin
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 30
structure length 132
sequence length 132
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3ak0A00
1DQ5A 5FRAA 1HLCA 4Q8KA 5DZFA 1PZ8A 4XBQA 3B3QE 3HR9A 2R0HA 3SH3A 2UWCA 1DIWA 2A6ZA 2ZMLA 2OUHA 2A3WA 3RS6A 1WCSA 1W6QB 4CTEA 4XJ9A 2D6OX 3WDYA 1QGLA 2CWSA 1WW5A 2WT1A 1DHKB 4YG0A 2EXJA 4AYUA 3R4UA 4Y20A 4Y1XA 1BYHA 5JVVA 5CNAA 1RINA 2PHXA 3USUB 2EF6A 4XMAA 3POWA 3GNEA 5DUUA 2DU1A 1LULA 3OY8A 3WDWA 3B01A 1LODA 5T5PA 1AXZA 5DZGA 1GZWA 4PBOA 4C1WA 5DXDA 1X50A 4DPNA 2P3JA 2CWMA 2D44A 2ZGNA 2SLIA 1UL9A 1W6OB 2OVUA 3IN9A 5F5QA 1SBEA 4R9CA 3AYCA 1JW6A 4YFWA 5JOXA 3M3CA 4SLIA 1LHWA 3ZSLA 1G9FA 1N1TA 4M3CF 4XBNA 1LHOA 2E51A 2D6LX 2VU9A 2ENRA 1DFQA 4GKYA 4Y22A 2D3PA 4Z8BA 4M3CB 2WQZC 2VW1A 3OGGA 1WUVA 4R9DA 1AJOA 1JHNA 3A0NA 4PBPA 4JC1A 4FOQA 3FBYA 3BODA 5GALA 3SH4A 3WDXA 3AJZA 3O12A 1LEDA 1SLAA 2DURA 3D5OA 3LSDA 1IS5A 5GZCA 1C1LA 1JXNA 1GANA 2DVGA 4BOWA 2YROA 1BXHA 3WHUA 1KDMA 1R1ZA 2DVAA 4ATFA 2R1BA 3NV3A 1N1SA 5JMCA 1CVNA 2A6XA 3KQRA 1WW4A 2ZA9A 1RIRA 3ASIA 3W58A 5GLVA 2D6KA 1MZ5A 1FAYA 4Q2FA 1W6PA 3N7JA 4YW1A 2WLQA 4M01A 2DTWA 2CYFA 2YZ4A 4Y20B 1C1FA 1CQ9A 1MS5A 1EPWA 5E88A 4CRQA 2LTNA 2TEPA 2I2SA 1V6JA 2D6PA 1CESA 2ZGKA 3OY8B 4DRVA 1AX1A 5JLVA 1GZWB 1BZWA 5JOWA 3M2MA 1H30A 2GNTA 3FUOA 2P3KA 1H9WA 5EYYA 3FFZA 2PHTA 4FPEA 4YLZA 3MEPA 2A6YA 2VY0A 3SITA 2G4IA 1QOTA 1IOAA 2Z42A 4P14A 3WCSA 4YW5A 1DQ2A 3WVJA 3SISA 2UWBA 2YXSA 5GLZA 3ZXKA 5CA6A 2AGSA 5T52A 3WDUA 2JE7A 2VH9A 2GN3A 1V6MA 1N47A 2E53A 1LOFA 1DQ4A 4LBNA 2V73A 4Y22B 2R49A 2ZGLA 5AVAA 2ARBA 1QDCA 1DGLA 2Q5TA 3VKNA 4NOTA 3WG4A 2UURA 3M3QA 1UZZA 2ZGPA 3A4UA 3AYDA 1UZYA 4P9WA 5CAZA 2EXHA 5EXOA 4WV8A 5E8AA 3V64A 1ONAA 3B9CA 2AH2A 3LCPA 1C57A 3H0OA 5GLTA 5IT6A 1IKPA 4XYXA 1S1AA 3RMXA 4I30A 1OFSA 1MS8A 3AZVA 2NMNA 2P34A 4FPHA 3FUQA 1S0BA 1GSLA 5DZEA 4PCRA 3VKFC 3SNMA 4LBQD 1YRZA 1AXYA 2GNDA 3WUDA 3QLQA 1CR7A 2A6WA 4R9AA 5KXCA 1A3KA 1WLWA 5GJ6A 1GBGA 3MW4A 3M1HA 3AP5A 1W6PB 3L2YA 1FX5A 1URXA 4NO4A 2DVDA 1DBNA 2DWRA 1QOSA 4RL7A 5DUVA 4P9YA 5DG2A 4K21A 1WLDA 1LOBA 3B00A 1VLNA 1VAVA 1IKQA 4M3CE 2EALA 1SLCA 3R05A 4XTPA 4D69A 1IS4A 1UAIA 1C4RA 3VUOA 4LBOA 3WLUA 1V6KA 1AZDA 1QKQA 1H9PA 1YXWA 3APBA 3AK0A 4XJWA 1G9CA 4F83A 3MW2A 1G86A 1GNZA 1Z0HA 2JECA 3ILFA 4JRAA 4K1YA 4Q8LA 1W0PA 2AUYA 4UW3A 4XIOA 4MYEA 4YW3A 5KXEA 1SBDA 1FV3A 2FHRA 3TB0A 5KXBA 1LJ7A 4BLJA 1QF3A 3PVOA 4K1ZA 3NV4A 4XHXA 5DUWA 4Q1PA 4Y1UA 3POSA 2D3SA 4DRRA 3O0XA 4OZXA 1KITA 4XJUA 4XILA 3AP4A 2D6NA 2WSVA 5GM0A 3OBTA 2JKBA 1Q8OA 3AYAA 2C9AA 4LBMA 1A78A 1SLBA 1SLTA 1ZM1A 1Q8PA 3WG3A 3UL2A 5H9SA 1LEMA 4FQ4A 1Q8QA 2ZGUA 1ZA4A 3WDTA 4FPKA 1SCSA 2DVFA 4Q26A 5GZGA 5LK5A 3DUIA 2WNEA 4FPCA 2OUJA 1MS1A 3RG0A 3WHTA 2EIGA 2OW4A 1OQ1A 1WBLA 1BQPA 2XG3A 3IM0A 3M3OA 2A5ZA 4XTMA 3UJOA 5IK5A 3AXDA 4Y1YA 2B7YA 1FATA 2E6VA 2ZBJA 1S0IA 3JU9A 1GKBA 1J1TA 3O0WA 4LBJA 4YZ2A 4XJZA 1DYKA 4DFSA 2NMOA 3LSEA 4GXLA 4Y26A 3V0AA 2DVBA 1AF9A 1V6NA 1V00A 3T1LA 3HMYA 5JDBA 5H9PA 1GNHA 2YV8A 2VUAA 1O4ZA 4Y1VA 1N1YA 3W59A 1DQ6A 1F5FA 2AENA 4ZKTB 4HANA 3NV2A 1LOAA 4M00A 1KJRA 3ZXLA 1ENQA 5CB7A 1QNYA 2GN7A 5IUQA 2GALA 4AGRA 1AVBA 2ZGMA 1N3OA 3FLTA 1LENA 1QOOA 1LU2A 3FLPA 1GZCA 4FP2A 1VAMA 4WZFA 4Y24A 2ZGSA 2DUPA 1KQRA 4FOWA 4YZ3A 4YW2A 3SH5A 1Q56A 2PHUA 2ZZJA 1LGCA 3ENRA 4TYSA 4YZ4A 4YZ5A 4YZ1A 1FNYA 2PHFA 1DQ0A 5T5OA 1APNA 3PJQA 3O0VA 2NN8A 2GDFA 2KM2A 3PVNA 2A70A 1ULDA 2ZGTA 1S0EA 3BOPA 3DGTA 4Q1RA 4ITCA 2AYHA 1JYIA 1MS0A 1LCLA 2R0FA 1OKQA 2WSUA 1QMJA 1YYNA 2GMEA 1S0DA 2A6VA 5SV8A 1CN1A 1LU1A 3V0BA 2BQPA 2D6MA 3BTAA 2WJSA 2R1DA 3N3HA 4FPLA 3UK9A 4GA9A 1HDKA 5E89A 1CPMA 4PQ9A 1I1EA 1V6LA 4FPYA 3N36A 1MVQA 3T1MA 4AVSA 2NM1A 1NXD1 2D7FA 3ZXEA 1IS6A 2A3XA 5T5LA 2ZACA 4XJAA 1KDKA 3V0AB 4YGEA 3ZXFA 3MW3A 2VW0A 3T2TA 2NZ9A 3WG2A 3AZWA 1G7YA 5GLWA 1HQLA 3AP9A 4XIKA 4FPOB 1LOCA 3TAYA 4ISRA 4H55A 1MS3A 1G9DA 3M3EA 5DG1A 4GWMA 1S0GA 4ATEA 1U0AA 1SFYA 1MVEA 2JJ6A 3INAA 2H0BA 1ULCA 5JOYA 1F9KA 4YGDA 4ASMB 3IPVA 4TZDA 3POYA 3ZSJA 2ES3A 1UPSA 2HYKA 2JE9A 2P2KA 3KM5A 3AP6A 2ZKNA 1ENSA 2VW2A 3AYEA 1LGBA 3B69A 3WZ1A 1W6NA 1WW7A 1RITA 1FNZA 1CJPA 1NLSA 1XQNA 4FPJA 5IK7A 2SBAA 2ZABA 4YM3A 3AX4A 4YGCA 5KXDA 4YM1A 1SLIA 4RA0A 3VKOA 1LHUA 1QDOA 3IKWA 3ZYRA 3C2UA 5GZEA 5CBLA 1YI7A 2AREA 3UJQA 1ULEA 1Z78A 2XB6C 4Q27A 3AZYA 2ZHKA 4GALA 4XMIA 1LOFC 3V0BB 1HQWA 1IS3A 1YO8A 2A71A 3ZSKA 4LBQA 3AP7A 5H9RA 1VALA 4YGBA 2WKKA 3SLIA 4KBBA 1UN1A 4XBLA 4LBLA 1JUIA 1QU0A 3ILNA 4FVVA 2ERFA 2CL2A 1LESA 3JUUA 4YG3A 4DS0A 2ZAAA 1A8DA 3A0KA 1MACA 1S0FA 2NP0A 4XZPA 5L73A 1B09A 1QNWA 2CY6A 1V6OA 2NYYA 2ZMNA 1UMZA 4BLIA 4P9XA 4FOVA 1N3QA 2PELA 1DQ1A 1FYUA 2W39A 1BJQA 4ZXKA 1GV9A 4XDQA 4LBKA 3WNXA 3OBRA 3WOGA 4GWNA 2VXRA 3Q9OA 3AZZA 1WD3A 1Y7BA 3ILRA 4Y1ZA 2GMPA 2V5YA 2ZMKA 2UWAA 5H9QA 1BKZA 1GZ9A 4BMBA 3AXEA 3N7LA 4YG6A 1G9BA 1GYKA 5IK8A 5GLUA 5DUXA 4UW5A 1WLCA 4XOGA 3O5SA 2FMDA 1JYCA 3ATGA 3IPVB 3AFKA 3HN1A 4WVWA 2ZGQA 1KRIA 3ZSMA 4WVVA 1SLLA 1LHNA 2D43A 2PHRA 3U4XA 4HL0A 1LGNA 4FQZA 1DZQA 1W6NB 3N7MA 4UW4A 5HCAA 1CONA 1AXKA 1F31A 1LTEA 3WUCA 1LOGA 5HCBA 1N3PA 1S0JA 3I8TA 1MS9A 2ARXA 5T54A 2YMZA 1D2SA 2UU8A 2A3YA 2W52A 4GKXA 2C5DA 4YM2A 4AWDA 4XE9A 3I4IA 2GMMA 4FPGA 3WG1A 3ZXJA 4BQ1A 2ZHNA 1AX2A 3N35A 1W6MA 3PMEA 4U2AA 1CPNA 3QCWA 4YFZA 1ULFA 3R4SA 2E7QA 2R16A 2DUOA 3OYWA 5T55A 5GZFA 4UW6A 2PHWA 1LOEA 5T50A 1SACA 2GNMA 1ULGA 4BPZA 5EYXA 2EXIA 5IK4A 4LBQB 4AVVA 2DTYA 5F9TA 5EWSA 4BM8A 2DU0A 1KJLA 4W65A 4C1XA 3WDVA 4PF5A 1YIFA 3WCRA 4XJ8A 3ZVXA 1G8WA 2RHPA 1SBFA 1W0OA 2W08A 3CNAA 3IMNA 1W6QA 3ZYPA 2P3IA 2ZGRA 3NWKA 2D3RA 1WD4A 3VKLA 4XXPA 1G9AA 4YM0A 1GLHA 1JOJA 1VIWB 3USUA 3AZXA 1N1VA 1WBFA 2WT0A 1CIWA 4IQPA 3OPZA 3FLRA 4XXAA 1AJKA 1PZ7A 2DV9A 4AVTA 1I3HA 2CNAA 5BYNA 2EXKA 2DUQA 1LECA 3N7KA 1V6IA 2CTVA 5HCFA 2JD4A 3GALA 1TEIA 3RMYA 1DLLA 2AR6A 5JOZA 2YY1A 1W6OA 1S0CA 3AJYA 5FREA 1PZ9A 2DYCA 3RQ0A 3ZPYA 4JCKA 2A75A 3D6EA 3MPPG 2E7TA 4FP3A 3RSJA 1D0HA 1HKDA 4DQAA 1SCRA 3VV1A 2GNBA 1FV2A 1O4YA 3V65A 4AGGA 2A7AA 1Q8SA 3WV6A 1GICA 1JBCA 1AX0A 1DYPA 3RRDA 4L8QA 4M3CA 4ISQA 2W68A 4K20A 4AGVA 2ZHMA 1ENRA 4CZSA 1JN2P 1Q8VA 3OJBA 5GZDA 3PVEA 1MS4A 2LALA 4BMEA 3NV1A 1UKGA 4YW4A 1W6MB 2WT2A 2JDZA 2ZGOA 5T5JA 2P37A 2ZHLA 1MR5A 3D4KA 3OYWB 1MZ6A 1LHVA 4R9BA 4U36A 4XHBA 1UX6A 4FPFA 4FOYA 2EAKA 1WW6A 3BIWE 3VKMA
chains in the Genus database with same CATH superfamily
1HLCA 1BCXA 2L9LA 3AKQA 2ZX1A 1KFXL 5FPBA 4BXFA 4Q8KA 4IEUA 1OQEA 1JYVA 2LW8A 5J37A 4AR2A 3VBOA 3VN4A 2OUHA 2A3WA 3WP3A 4CTEA 3VLBB 3WDYA 3LDKA 4RQPA 2A73B 2YYOA 2Y6JA 2Z69A 1W2OA 1BYHA 2RDNA 4NR1A 2HEWF 1RINA 3NO8A 5APAA 3IIAA 2GC1A 5JVVA 5C8CA 4BZ4A 4YYOA 2VZQA 1MZFA 4OMDA 4JV4A 1NAEA 2LROA 3OY8A 5FQ0A 4XAEA 3Q8BA 5T5PA 4L99A 2MEV3 5A3MA 5FO8B 4GMP0 1CZVA 1R1A1 5AC93 3O1VA 4RD7A 4NUBA 3IN9A 4C0BA 1CAXB 4CEWB 5F5QA 4R9CA 2ZEXA 5I93A 3PURA 1DP0A 3JXSA 5DN2A 3M3CA 1H8VA 2G9ZA 3ZN5A 3AVSA 5JI9A 2RDSA 2PA7A 2VL4A 3SMHA 5FZDA 1LHOA 1W9YA 5LCWL 2VU9A 4QGLA 1DFQA 4GKYA 5EJZB 4JGYB 2WQZC 3LKJA 1REEA 2WFF3 4JHZA 5A33A 3AVRA 4LIUA 4PBPA 3WSOA 4CXWA 2RJLA 3FBYA 2QBXA 3WDXA 2JG9A 1R092 2VOVA 4XFAA 3ZKYA 3ROUA 1UY1A 4IEXA 1C1LA 1JXNA 3PTYA 2PN5A 3AKTA 5LRRA 1UZVA 1WLTA 1ZBA1 4LHKA 4GMP3 4LPLA 3KHCA 2KA3A 2R1BA 2RS31 3J8F2 3NV3A 5C5UA 1D2QA 4W4ZA 3W20A 5JMCA 1R081 4XUQA 1PNFA 3ZFGC 2WDBA 2WYFA 1CVNA 2WNVA 4JQRA 1K42A 1JU4A 5CG8A 3W58A 5A7SA 2D6KA 1A34A 1MZ5A 3MBWA 4LKSA 1Y9MA 2P5BA 4Q2FA 4JDNA 2WLQA 3I3QA 3NNFA 3B02A 4JGZA 2CYFA 4M01A 4ZS2A 4MGZE 2VQ0A 2ZOEB 1CQ9A 1MS5A 2CDPA 3IDAA 4KBZA 1YEWA 2B42B 5CFCC 5FDBA 2J1EA 5CKMA 4NE9A 5A3OA 5LATA 2Y8KA 2I2SA 4QX2A 1XE8A 1XNKA 1CESA 1ND3A 2D6PA 4PHZA 2VMIA 2ARAA 1NOVA 3I54A 3M2MA 1H30A 2GNTA 1UYXA 1AYN1 2P3KA 1H9WA 4GH4C 4IEPA 4CUBA 2HWB3 2ZKLA 4O7XA 4FPEA 5LY2A 3BGAA 3SITA 2OPWA 1W8TA 4AHZA 1QOTA 1UMHA 2E31A 4QQLA 5FLHA 1OQDA 2OKXA 3WCSA 2D5FA 1MZEA 4Q0UA 5EV7A 1WGPA 4AEMA 3K48A 1H1MA 4BQ4A 1BEV1 1GQPA 5FPAA 1K5MB 4MVTA 5HXMA 1G6NA 3FL7A 4IESA 4ZPIA 1N47A 1LOFA 2QQIA 4CEWA 4Y22B 2R49A 2ZGLA 2ARBA 3LA3A 1CJDA 2BNOA 1DGLA 2Q5TA 3VKNA 2X53S 5I0RA 2W46A 3WG4A 1LB2A 3A4UA 4DIQA 4HN1A 4X8NA 3OUIA 3ZYIB 5AFEA 2XR4A 3B9CA 2AH2A 4A45A 2J22A 2J42A 3HNMA 3BTXA 4AQSA 1IKPA 4XYXA 1OA3A 4I3GA 1F2NA 3ZXDA 2HYXA 3RZZA 2P34A 5JIUA 5JR2A 1NE6A 2Y0IA 3KVBA 4PCRA 5DZEA 3ORJA 1YRZA 1HRI2 3M8LA 3POBA 2V4VA 3Q8AA 3MFCA 1FOD3 2GNDA 5F6KA 3T2OA 1HRV3 2A6WA 1XYPA 1A3KA 1WLWA 4X6RB 2Y60A 4FFHA 2OT7A 3AP5A 3M1HA 1RL3A 1W6PB 1GU3A 3L2YA 1FX5A 4CYDA 3PIGA 4CDQC 1BK1A 5FCCA 4JRLA 1US2A 1BBT3 3CJXA 4MGKE 4P9YA 5DG2A 4AI3A 4C0HA 1WMEA 1OPMA 1PNGA 1QQP2 1WLDA 3CQOA 1KS4A 3HEIA 4PI2A 3E1F1 2D93A 4M3CE 3HAGA 4WM7C 1VBB2 4NRMA 3VUOA 1O59A 4GULA 3GHMA 3RDIA 2VM9A 2UYBA 4PDWA 4TSVA 3TN92 2BEOA 2N7GA 1YFWA 3HQUA 4JRAA 1AYM3 1UPIA 4UW3A 4XIOA 5LY1A 3RWKX 5FPXA 5IHRA 2FHRA 3TB0A 4CDUB 5FYTA 1JZ6A 5F5IA 4O61A 4BLJA 1R091 4K1ZA 3E6CC 5DUWA 4EJRA 4IE0A 3FZ3A 4O9GA 3ES1A 3VDDA 3IB3A 5FZ6A 2BNNA 1RUD2 1HN1A 2WO3A 4I0BA 3E5QA 2RS13 3KD4A 4NIGA 3RWNA 2WSVA 3J9SA 5GM0A 1Q8OA 3AYAA 2C9AA 4LBMA 1A78A 1SLBA 2CSGA 1ZM1A 2RS52 5DAXA 1ACCA 3UL2A 4JDOA 5BNNA 2YBKA 4ES9A 4FQ4A 1ZREA 1Q8QA 2IXKA 5FYZA 1OA4A 2XBO1 5GZGA 4W8JA 1TNRA 2OUJA 3UNPA 3FFQA 4O65A 5F8PA 2EIGA 4N53B 2OW4A 3H1MA 1EY2A 3MZHA 1OQ1A 1WBLA 4E9KA 5BNPB 5BY5A 1QJX2 5F6LB 4ZY9A 3M3OA 2EIEA 4BIFA 4BH9A 5I8YA 2ZPXA 3AXDA 1HXS3 2HWC1 3BVCA 4XZUG 2I07B 5FJHA 1QJY3 1S0IA 1GKBA 1LR5A 2FDGA 2LM3A 1ZBE3 2VMCA 2IXLA 1DYKA 4GXLA 4XDPA 4Z1VA 1ND2B 2DVBA 5FYYA 4OI1A 1V00A 4DEVA 5FYUA 3VBRB 4EN9B 1XYNA 1PO22 3EBRA 1GOHA 4FFIA 2BPA2 1RJ8A 3GYDA 1OMIA 4N43A 3VDBA 1ZRDA 4ZKTB 1QIQA 1IPJA 3NV2A 3TEYA 2K0GA 2WS92 3POFA 5CB7A 5JWPA 4MGTA 2GN7A 1JZ3A 3HQRA 4AEKA 1JH5A 2EAAA 1NZIA 4A6OA 4D6RA 1RB8G 3HBKA 3BB6A 2W0XA 1LU2A 3FLPA 1GZCA 2JICA 1VAMA 4I0WB 4J6GA 2QDNA 2DUPA 1KQRA 2ZGSA 5ANQA 5EP9A 5JIAA 4LT5A 4OUMA 2FDFA 4NIIA 1QH7A 3FHQA 3GGLA 1HN0A 1V9U2 1JYTA 4GWJA 1VMHA 3O0VA 1VPHA 3J7MA 1CX4A 2NN8A 2KM2A 4FXGB 3NAPB 2PQSA 2VULA 2YHJA 3LD8A 2BBAA 3PVNA 3VBUA 5CFDB 3BOPA 2ZGTA 5KHGA 3DGTA 4KG8A 1JOPA 1HRI1 2AYHA 2ZEYA 2IVJA 4R52A 1LCLA 3USSA 3ZN6A 2WSUA 1QMJA 1S0DA 3PU8A 1NCRA 5FYBA 3WP5A 1YFXA 2V5DA 4ARYA 3BTAA 2WJSA 4LK6A 2R1DA 1H8TA 5DAPA 4YSFA 1LKNA 2I74A 1BVP1 2QFEA 1CPMA 5EFUA 3WF4A 1NYWA 1RUI1 2EICA 1PVC2 4AI0A 4D7SA 4CCLA 3T1MA 4AVSA 2NM1A 2Y6HA 4WM8A 2D7FA 1U5ZA 1H1AA 3H1WA 5T5LA 2D40A 4B29A 3IDBB 2XJSA 4MH0E 2VW0A 3N9LA 2XJTA 2Y26A 4ZHNA 1UX7A 3ZMNA 4XFBA 2RV9A 5FIXA 3KVAA 4ISRA 5FO7B 3A22A 4H55A 3T4VA 1MS3A 3AMQA 5FZCA 3M3EA 4AEJA 4LO7A 1W2UA 3EYPA 4GWMA 1NA1B 2ETEA 3SCHA 2JIJA 4AFMA 4UAPA 1RUD1 1F9KA 4NIHA 1X8MA 4TZDA 3RZJA 2ORXA 3K75B 4KU7A 3JB4C 3JQWA 5FK8A 2HBTA 5A3WA 4IE7A 4L92A 2DCZA 2OIIA 3T08A 3FN9A 2MPFA 4IETA 1BLZA 2OXBA 4QPGA 2VBPA 5F3CA 1JODA 3WINE 4PF1A 3AX4A 1JZ8A 2WQ4A 1I5ZA 2WFF2 3DXUA 4RA0A 1HV1A 5IW0A 3ZYJB 3M3IA 4UF0A 2VUCA 1W9SA 5GZEA 3I3MA 3WP6A 2AREA 1YQ6A 3HJRA 2W9XA 2VTXJ 1YFUA 2DBNA 2WC2A 4H7LA 3C7OA 3V0BB 2DCTA 2LUWA 2CAUA 4UFKA 1TQ5A 2MHFA 2YU2A 4CUGA 5I8SA 1CAVA 3LEMA 1VP6A 5B4XA 1R64A 3C8XA 4L2NA 5F3IA 3SLIA 2EIBA 4NROA 4XBLA 4N7UA 1DU3D 2XDVA 2BDRA 4LBLA 3IDEA 2A1XA 1LNSA 5HPOA 4BJ0A 2Y6KA 2QQMA 1TG7A 4EZ4A 1CAWA 3H8UA 1B09A 4HMZA 5A7NA 1QJU2 4AHYA 4B8EA 4E2GA 4WVMA 2AC1A 4DUVA 1UYZA 4A4AA 4XFGA 1N3QA 2XQXA 1AR72 2W39A 4ZXKA 4COYA 1GV9A 3AMPA 4RR3B 3WOGA 3L9JT 2VXRA 3Q9OA 3ILRA 1WD3A 4GWNA 4MXWB 4Y1ZA 3U75A 3VHOA 4LITA 1ND2C 4EV0A 1G9BA 3AXEA 3N7LA 4A7YA 3LIGA 4PT6A 5DUXA 4AOCA 2WN2A 4XOGA 2DFCA 3IPVB 3AFKA 1VE0A 1D4M1 2QE3A 2O1QA 2R072 5FXWA 4AHXA 1HQNA 2ZS6B 3U4XA 1ULOA 1LGNA 1UU4A 3W5NA 1STMA 4XAAA 4UW4A 1CONA 3S30A 1LTEA 5F7UA 3VL8A 1LOGA 4AEDA 3N4MA 5A3PA 2HBUA 3DYPA 1MS9A 2V72A 4QU2A 2E9QA 4YM2A 4AI9A 4AWDA 3PLQA 3I4IA 4Q4W2 5FZLA 3T2QA 3UKNA 5SV5A 4QT6A 1AX2A 2JB4A 2EVXA 3PMEA 4U2AA 1W0NA 4IERA 5C4WB 3WX5A 4IUGA 4FTBA 3D82A 5KC6A 3OYWA 2XGXA 5J7MA 1RUF3 2OQ6A 4LQRA 5FPUA 4BPZA 1ULGA 2WR9A 5EYXA 5EZWA 4BU2A 2ZAHA 4LBQB 3U10A 5IK4A 5EWSA 1F5JA 4NWVA 2DU0A 1OLQA 4W65A 5CFDC 4PF5A 1W8WA 4RFT0 3ZFFA 3ZVXA 2RHPA 3CEWA 4EN0A 1FOD2 3PUHA 4I0AA 1WD4A 4NRPA 3ZLIA 3J8F3 2MEV1 1X9TA 4RS5C 4XXPA 1JOJA 3AZXA 2ET1A 1JI6A 5AC91 3I2GA 4TTGA 1BBT2 4QPWA 4QPIA 1ZNPA 1FMD2 5DQ0A 4Z2WA 1WWYA 5IVJA 1VAKA 3VZKA 5BYNA 4FT8A 5FZFA 4N9HA 3KGLA 3N7KA 2BYVE 2O8QA 2WWUA 2WZ8A 3AL6A 1TEIA 2RDQA 1DLLA 2AR6A 3AMNA 4MGQA 4X6QB 4EWDA 5FREA 4A44A 2Q8OA 2WAAA 3ZPYA 5C3RA 4JCKA 4AQ6A 2WZEA 5EQUA 2JG8A 2P17A 3MPPG 3PUQA 4FP3A 5FYSA 3RSJA 1HKDA 3UKVA 5CG9A 3K2OA 4CCJA 4FCAA 3V65A 3ACFA 4I3PA 4XURA 2VUDA 1Q8SA 3OGVA 1JBCA 1NA1C 3H3LA 4NPRA 3DPRB 2H6BA 4LNVA 5FZHA 5FAXA 1XRUA 1W03A 2W68A 4K20A 4K8RB 3SHRA 1O3RA 4B1LA 4GMP1 4EZHA 3OJBA 3ZYHA 3VD7A 1MS4A 1TVGA 5L7OC 5E16A 2WT2A 1DGWA 4D6SA 1POV0 3TNQA 4EQVA 5FY7A 4RFRB 5T5JA 2RM23 4N7IA 1XNDA 2RMU3 4U36A 4CP0A 1L7LA 3MIDA 1COV2 3MV11 1PVXA 4R9BA 1UX6A 2PHDA 2XLFA 3J7HA 4Y4YA 3A23A 1DQ5A 3OTFA 1ZZ9A 3BALA 1HX6A 1PZ8A 4YVWC 1C8M2 5C6CA 3B3QE 1JTZX 5ERLA 4D0QA 1DIWA 4QB1A 2ARCA 4KNCA 5F2SA 5KHJA 1RC6A 3VBSC 1W6QB 3PL0A 5A7WA 3LWCA 4ASLA 3LEGA 4CDXA 1WW5A 4YG0A 1GQHA 3R4UA 4OYUA 2XKPA 4CCKA 2CDOA 5CNAA 2C9KA 2HWB1 5J09A 3VL9A 2YG0A 3F2ZA 2IXCA 4A3XA 1ZRIA 1LULA 3WDWA 1LODA 2WNUB 5DZGA 2WA4A 4PBOA 4C1WA 1NKGA 2AACA 5DXDA 1PGL1 1POV3 1WMDA 2D44A 4Y33A 4DUXA 2ZGNA 3GF6A 3VBHA 1RUJ2 1UL9A 2OVUA 2O14A 2VO5A 1QQP3 4NVPA 4QQPA 1VBD2 1JW6A 4M0HA 5A6YA 2X5IA 4SLIA 1LHWA 1VBB3 2CHHA 1G9FA 3ZSLA 5IVCA 1UU6A 2VVEA 1UXZA 4BE3A 3VD5A 1IPSA 1NCQA 3WNPA 4FTSA 3TN93 3RJRA 2ZX3A 2VW1A 3CJIA 1AL22 3E5XA 3FJSA 1GP4A 3OGGA 3G7DA 1AJOA 5B4NA 3A0NA 3AB0A 4QD2A 4FOQA 3SH4A 3KWVA 3O12A 5FZKA 2KXLA 4X8PA 2DURA 3H8XA 2DCJA 4B3NA 1IS5A 2W2IA 2BP6A 2WO1A 1I6XA 1RUE2 3E6DA 3IAQA 3Q8EA 1HRV1 3OD4A 4CU8A 4RN5A 2C0ZA 2BVVA 3WHUA 3OGRA 3ZR5A 2RS53 3I3BA 2X05A 2XMLA 2J1AA 2W47A 3KCCA 4HFSA 2XKOA 1HB2A 1BBT1 3KQRA 3PNAA 1WW4A 3VBOB 2B46X 4FO9A 3S0MA 1QHDA 3ASIA 4AAPA 3AMMA 2LS6A 3UGGA 3WW3A 4E8DA 2QVSB 1QJX3 2XOMA 4GJZA 4Q0SA 4RQPB 3O1OA 5IFPA 2DTWA 5JSOA 3LDBA 5F5CA 2JDPA 5C8CB 4HVOA 5E88A 2WBKA 3NJYA 3EHKA 4CRQA 5F3GA 4QHOA 2TEPA 1AYM1 3ACHA 1UD1A 3OY8B 5FQ0B 3FWEA 1AX1A 2WWSA 5CEHA 1BZWA 5JOWA 3GM8A 4R8HA 2Q0AA 1NZCA 3LZZA 4HSLA 1PO23 1NLRA 2A6YA 1C8NA 3EXUA 1PIV2 3CO2A 4YW5A 3S5AA 5JAXA 2RS11 2F4PA 1WMXA 3WVJA 2GZWA 3OG2A 3SC7X 1DGWX 3WF2A 2QQWA 2YXSA 2XWJB 5DABA 2D5HA 4YVSC 2FCUA 2AGSA 4MHRA 5T52A 3BOWA 4FTEA 4CCCA 2YFZA 2VH9A 3K4DA 3Q8FA 5A7QA 5HI0A 5L9RA 4QKDA 5KHHA 1DLCA 1TMF2 2E53A 4RGKA 4LORA 4K3UA 3ELNA 3ZMOA 1QDCA 2Y6FA 1HW5A 3TBDA 3PU3A 5A33B 3VDAA 4TLGA 2UURA 1WCUA 1UZZA 1X33A 1V9U3 2WZR1 1JZ7A 1HXS1 3V64A 5I0TA 1ONAA 1QJY1 1C57A 3H0OA 1RHI2 3GHNA 5I0SA 5J3UA 5JPMB 1ZBE1 1O5LA 2JDAA 2W95A 4JX0A 3THPA 5F3EA 2HJIA 2UY8A 3T3YA 1OFSA 3FUQA 1S0BA 3OEAA 1GSLA 3HD8B 1H2NA 1U5XA 1OOPA 4KWJA 1GQGA 3SNMA 4LBQD 2VJXA 4C91A 2WNVB 4NAMA 2OYZA 1VB2A 3QLQA 2E26A 3ZDVA 4Y5SA 2W5FA 5GJ6A 1GBGA 2RG4A 3MW4A 5L36A 3H42B 1NY71 3J7LA 2KR2A 5EJ3A 4JGZB 3RYRA 5KHKA 1DBNA 3P3NA 1PVC3 2DWRA 4CVUA 1EUUA 5LW9A 3RZMA 1IGOA 2PFWA 3BTZA 3ZOIA 1LOBA 5BV6A 2BERA 1VAVA 1IKQA 1ND3B 2EALA 1SLCA 4XTPA 1BK0A 4D69A 1UAIA 2VVDA 4IV3C 4A2UA 1V6KA 4R4ZA 4DY5A 3FBMA 4EYUA 3UGHA 3NVCA 4QXHA 1U5YA 3ZPOA 3NNLA 5JZGC 1W8ZA 1YCIA 3APBA 4XJWA 5A3LA 5KHIA 4R4XA 1G86A 1C5HA 4K1YA 1VBE2 3I2KA 5KXEA 4YW3A 4NHMA 4W50A 4MYEA 1YWKA 4AG4A 5IAXA 1FV3A 2VC9A 1VB4A 3ZFGA 1LJ7A 2WNUC 3QBQA 1QF3A 3PVOA 5KXBA 2XUEA 1XNTA 3NV4A 4LKEA 4QMAA 4XHXA 4CDWC 4Y1UA 3K4AA 4LK7A 4YW6A 4S2DA 3O0XA 2YPJA 1CIYA 4LXLA 4HKOA 5G04L 2BUKA 4IV1A 1UY4A 5C70A 3ZN4A 1B35A 3WG3A 2VZ1A 2OZ6A 5H9SA 5CFCA 5CKNA 1LEMA 2W92A 3T4HB 4BQXA 1ZA4A 1YNAA 1KGYA 4FPKA 3WDTA 2DVFA 4BK4A 4D6QA 5A3NA 3DUIA 5JXGA 2WNEA 4FPCA 5E1RA 3B5LB 3WHTA 1PMHX 2VUJA 2ID4A 3I2HA 1UO9A 1BQPA 4YARA 1RUF2 2A5ZA 3UJOA 5IK5A 4Y1YA 1UYPA 2B7YA 5J98B 5CADA 1YC61 4S2HA 3ZIXA 4K8FA 4LBJA 5FZ0A 4XF3A 4DFSA 4P5YA 1YJLA 2NMOA 1W39A 3JD72 3LSEA 1XNAA 3V0AA 3U1XA 4W6XA 3IIIA 3T1LA 3UT0A 4D7TA 5JDBA 5FZ4A 1D7PM 3VBOC 1DQ6A 4OI2A 2AENA 3VBFC 5K0UA 1I9RA 1LOAA 3ZXLA 2VD7A 3RYKA 3MF6A 1QJU3 1QNYA 4XDOA 5IUQA 1AVBA 1Y9GA 5FP3A 5ACA2 1XNCA 1QOOA 4PDWB 1AR73 4Y24A 4YZ3A 3SH5A 1O3QA 4FOWA 3UV9A 4XFHA 2FCVA 1Q56A 4MZUA 5LZ6A 4AI2A 4P5HA 3W21A 1P8JA 1VJ2A 5L9BA 1GZTA 3HT1A 3VDDB 1H0BA 2R073 4LHSA 2VQAA 3B93A 3V56A 2ZJCA 2K9ZA 4CDQA 1J3RA 1EPZA 1CWPA 2A70A 3QH7A 4B1MA 1XSQA 4BQYA 4EN6B 5BNNB 2HWE1 1MQTC 1RXGA 2GC2A 1O3TA 1MS0A 4CA9A 2GSYA 2R0FA 1JYIA 2QCSB 1CN1A 1LU1A 4L11A 2RM22 1O91A 2JDYA 2RMU2 4LO4B 4AI8A 3H7YA 4PIXA 2XVLA 4Q4W3 4Q4Y2 4UT5A 1AR82 3VZNA 1HDKA 5E89A 4BYYA 4MGIE 2ZEWA 4QHZA 4PQ9A 3UGFA 4DXSA 1I1EA 1V6LA 1XBFA 2JG9C 3N36A 2R6QA 3N9MA 2F17A 2ZACA 4JKMA 1HV0A 1KDKA 5A32A 3GCXA 2G19A 2HKXA 4PJYA 5BNOC 1AR92 3H8RA 1G7YA 5GLWA 1HQLA 3AP9A 4XIKA 3GZTB 5FZOA 2R32A 4FAHA 4LR4A 1LOCA 3TAYA 2WNVC 4XQ4A 5LB6A 1H4HA 4N43B 1ST8A 3ETQA 4MG2A 2H6CA 4ZXEA 3K46A 4NMIA 3KT1A 1S0GA 4IEQA 2WFPA 4ATEA 1U0AA 4CEYA 1SFYA 3KF5A 1MVEA 3EMRA 3K3OA 5JXJA 1ULCA 5FPVA 4QX3A 5I0UA 4ZU4A 4ASMB 1FMD3 1LRHA 1EV12 3ZSJA 5LEKA 2P2KA 2QUOA 3ZFEB 3KM5A 3WF0A 5L19A 2ZKNA 1ENSA 4AFBA 1YHFA 1NQDA 1IQAA 4GB32 5T3NA 3WZ1A 3TEXA 2JXAA 3WEZA 5TSWA 3ZYFA 1CJPA 1NLSA 4AVCA 3R4DB 4OHWA 1OI6A 1PMJX 3DKWA 3OUJA 3PMSA 5IK7A 1NLQA 2J1SA 4YM3A 1K3IA 1OPOA 1O8SA 4A42A 2R30A 1BMV2 1LHUA 4NHLA 3IKWA 3VBUB 3WF1A 3C2UA 3CDZB 1YI7A 1RUG2 1WCKA 2XONA 3ZN6B 1VRBA 2GC0A 1ULEA 2ILMA 1SDDB 2ZHKA 4GALA 4XMIA 1LOFC 5DAWA 5FPLA 1NCRB 1HQWA 4CEWC 4NIDA 1ZZBA 3J8F1 4GD4A 1H8TB 1GP6A 3R6SA 1F35A 2XVKA 1VALA 1L3JA 1FPN2 2XJVA 1RUC2 3HWJA 4Q0QA 3CL1A 3ZYGA 4HONA 5FP7A 1E5HA 2B9UA 3GJBA 4QDQA 2W3JA 1COV3 2CL2A 4WM8B 3G6JB 3S6PA 2VZPA 4CU6A 2FDJA 3LA2A 4JGYC 1OHFA 5L73A 1QNWA 5J36A 1YLLA 3PHMA 4LLFA 1OKOA 1O7FA 1C8M3 4L9BA 2PTMA 1RMU2 1UMZA 1OUSA 4P9XA 2RVAA 3HOBA 3CU7A 1FYUA 1BJQA 2ZZQA 4V1PA 4EN8B 3OCPA 3WNXA 2Y38A 3HN3A 1Y7BA 5H9QA 3W5MA 2GMPA 2V5YA 2D97A 2UWAA 2ZMKA 1QWRA 4QU1A 3T09A 2Z2SB 4UFHA 4YG6A 1XE0A 3ZFEA 1FXZA 2MNGA 3O1UA 1JYCA 3ZSEA 4GQ7A 4WVWA 1Y3TA 2ZGQA 2Z5WA 1GR3A 3ZSMA 2P1BA 2WABA 3HQXA 2PHRA 4HL0A 3RFRA 4FQZA 1DG6A 1DZQA 3H8OA 3D0JA 1RUJ3 3S7IA 3UKTA 4OI0A 1F31A 2G9FA 3WUCA 1JZ5A 4QPGB 1VBD3 4PI0A 2RM21 1N3PA 2P6CA 3I8TA 4RYDA 2RE9A 4AK3A 4KWLA 4JAAA 4GKXA 3WD5A 3WW1A 2C5DA 2VZOA 3BCWA 4XE9A 3MFAA 4BQ1A 3WG1A 3AC0A 1D4VB 4UF0B 1ZYBA 3KV6A 1W6MA 1YI9A 3N35A 4TN7A 1CPNA 5I91A 1POQA 3QCWA 2FMYA 3MIEA 5JR7B 3RPQA 1ULFA 3NKTA 1RUH3 4K6BA 3S5QA 5A1FA 2OPKA 3R4SA 1XU1A 2R16A 1AL23 5T55A 1UWWA 4XFCA 2HEVF 3ZKUA 5GZFA 2WN3A 2RDRA 3MIGA 5FK7A 3SKVA 4K9SA 1RXFA 2GNMA 1W8FA 4HT1T 2EXIA 2WYSA 1GNYA 1CAVB 1MEC3 2P3YA 4AVVA 4EE2A 3HIFA 2VTFA 4C1XA 3CMGA 3OPWA 4TXWA 3WCRA 5BNNC 1K5MC 1RUE3 3NNGA 1G8WA 1W3XA 1SBFA 4W6YA 1XJAA 4XCAA 5FWEA 3ZYPA 1JZ2A 1KD7A 3NWKA 2C24A 2ZEZA 4AHWA 3WNOA 3VGIA 3VKLA 2UYAA 1PO13 3KT4A 4XABA 1DYOA 1CAWB 4YM0A 5DDJ2 5C3QA 3USUA 4QXKA 1POV1 2FCTA 5HV4A 3I49A 2R7EB 2XL9A 3H50A 4LHLA 4WVMB 2H0VA 4ES8A 3WQ1A 1QQP1 3OPZA 1Z7S2 4AAXA 1PZ7A 3KSCA 5BXXA 3RVHA 3MPBA 1I3HA 5FLIA 1VBB1 4URTA 3VHPA 1LECA 3ON7A 1V6IA 1UF2C 2CTVA 2HWF2 5A6QA 3WQBA 4FBFA 5KWRA 2HH9A 1W6OA 2WO2A 4LOSA 5A7PA 3RQ0A 3PDQA 3TN91 4COUA 4NPMA 5FZBA 1AR62 1DDLA 2A75A 3D6EA 2E7TA 5EPAA 3I2JA 4DQAA 1BMV1 1FV2A 1SZBA 3ALQA 4N43C 2BFUS 2A7AA 4JHTA 1I5PA 1F15A 2B39A 1OF3A 3WV6A 1PIV3 1W05A 1Q5OA 4MHUA 3AL5A 1ENXA 2J1RA 3IT8A 4GWIA 4M3CA 4AEDB 2QJVA 3VB9A 2ZHMA 1ENRA 4CZSA 1JN2P 1Q8VA 2RS51 4NWWA 2QTWB 3ZFEC 4LHNA 2ZTNA 4INDA 1X36A 1RYYA 3GCWA 1UKGA 4Q0PA 4UFLA 4DXTA 5LBCA 1TMF3 1W8OA 2VQTA 5LEJA 1UKRA 1AHSA 1AUYA 1S4CA 1WMFA 3C7HA 3OYWB 2BW8A 4XHBA 4EN7B 5JXIA 1ALYA 4FOYA 1QJX1 4FPFA 2IWGB 2EAKA 4IE5A 1WW6A 3BIWE 5FJKA 3SQOA 5FRAA 5FKCA 4CDUC 3S57A 5DZFA 5J48A 4BXSV 3OBZA 4LA3A 4QX5A 5C3OA 2R0HA 2UWCA 1VBC2 2ZMLA 1RHI3 4PIZA 2DDUA 3RS6A 1OBNA 3ZFFB 1WCSA 4MV2A 3MLKA 3NRUA 4N90A 4MXVA 4BDVB 1JZ4A 1JYNA 3O1MA 4XJ9A 2D6OX 2GP3A 1QGLA 4XF1A 1KFUL 2RJ2A 1DHKB 4LJHA 2EXJA 4IEWA 3KV9A 3KQ4B 1O4TA 1XXNA 4Y20A 4Y1XA 5JXHA 1XE7A 1H8TC 3FMGA 1PO21 4Y4RA 3RZHA 1CX1A 3GNEA 5DUUA 3ZDSA 2DU1A 4KWUA 4QPIB 1T6GC 5F2WA 1AXZA 5HCHA 2WS91 1GZWA 4WM8C 1Y4WA 3OUHA 4N53C 5BNPC 2CWMA 4P9GA 4OHZA 2BGPA 4P9LA 2J1TA 4Q4X2 2PYTA 1SBEA 5C71A 3P6BA 1W9WA 2JG8B 4N9IA 2VNVA 2CGPA 4JVAA 1WA6X 1W28A 4RSUA 3N9QA 1V9U1 3B7MA 2ZX4A 3H1YA 2QQVA 3NNJA 4M3CF 4IGQA 2E51A 2D6LX 2ZX2A 2ENRA 2D3PA 5FLJA 3VBRC 1W06A 3OF1A 1VBE3 4RS5A 1OLME 5FY4A 3WQ0A 4I09A 1JHNA 2JEMA 2YGMA 4IEZA 3QH6A 1EUTA 1W90A 4JC1A 4UYBA 1JYXA 1O8PA 2CV6A 4K7JA 2XL7A 4AW7A 3D5OA 3LSDA 2G9GA 2D98A 2DVGA 1VRH3 3I3EA 2B4KA 4CCEA 1QJFA 5D8AA 3W9AA 1KDMA 3MO4A 1R1ZA 4Q5OA 4RHV3 4YPJA 2JWPA 2YB7A 3KV5A 4KU8A 4OHXA 4ATFA 2FZ1A 1HIXA 4Z2AA 1PVC1 1TZOA 3WY6A 1QXJA 3I59A 4HLTA 1OA2A 3RI9A 3D3AA 3T0BA 1FAYA 5A7WB 4TWTA 1EAH2 3U78A 4J1XA 3N7JA 4YW1A 4CDXB 3BKZA 3DL3A 4V2WA 2YC0A 4P08A 4Y5Z0 3NAPC 2JENA 4FFFA 5ANNA 5IATA 1JYWA 2BFUL 3R0RA 1V6JA 2PLV2 3DN7A 1CZSA 4OZOA 1L7QA 4LMFA 1W04A 3BU0A 5L7OA 3JD73 1VR3A 3H9AA 5JLVA 1W8HA 2VAUA 2XJUA 4ARXA 5CISA 5ABJA 1SMVA 5DAVA 4BCUA 4NIAA 3VBHB 1IOAA 4P14A 3F95A 3AKPA 4UOJA 1YJKA 1H2LA 3SISA 3QACA 2OX0A 2X5IB 4IDZA 4YVWA 3T2PA 3NJVA 1XYOA 2GN3A 2OA2A 1NCQB 3VBSA 4COVA 5ACA3 1V6MA 1DQ4A 4LBNA 2V73A 5AVAA 2IFRA 5DMYA 3CJIB 2WFF1 3TEZA 3ACIA 2FQPA 4IGPA 4Q4V2 1UZYA 3LGRA 5F32A 3DKQA 2VNGA 3ACLA 5EXOA 5E8AA 4AQ2A 4BIOA 2C1FA 4XEZA 5E6HA 5KC5A 3D8CA 2R062 3LCPA 2BV4A 3U4SA 3GDBA 3TOJA 5IT6A 3LAGA 4AEDC 2FDHA 4UWDA 4XUOA 4I30A 4WVZA 1MS8A 3AZVA 2NMNA 4Q29A 1XU2A 4XW3A 3ZO0B 4FI9A 2VCAA 4QWNA 1AXYA 3UESA 3P5BA 3CLPA 4R9AA 3T0AA 4URAA 5KXCA 4Q4Y3 4XUPA 2CGNA 3CZJA 3HT2A 1AR83 3DYOA 2QQJA 3SEEA 2PXJA 5FUIA 1QJU1 4HVRA 4HXCA 4NO4A 2VZRA 1W8NA 3FE5A 4LKFA 3B94A 4ET7A 5K9YA 5DUVA 1PX3A 2VNOA 4YWAA 1AR71 5FOBB 2K2SA 4AYUA 2AEZA 1DGRN 3B00A 1VLNA 2Y0OA 3ZFFC 3R05A 3WW2A 5A1LA 5AVPA 4H7MA 4LBOA 3WLUA 2HWD2 3NSTA 4AQTA 2BWAA 1AR93 1OXCA 3NKGA 5FZIA 4F83A 2R071 1Z0HA 4Q8LA 2V4AA 2RR12 3EO6A 2QQKA 4H14A 4LUMA 3WP4A 4QPIC 3LQCA 3OD0A 2W1QA 3E6BA 4E4SA 1SPPA 1TME2 4CE8A 4MSVA 4XPVA 3IMMA 5FFOC 2VE1A 4Q1PA 1XPWA 4DXRA 2XJQA 4D94A 5FOJB 3POSA 3NW4A 3GBGA 3TEWA 1EV13 4DRRA 4OZXA 2R042 1KITA 2XLGA 4OI4A 3AP4A 4LKDA 5FZ8A 3ZXGA 2JIGA 4Q4W1 2XWBB 4CUAA 4GB33 1Q8PA 1QH6A 1OUXA 4B4QA 4RR3C 1T2XA 2ZGUA 2TUNA 4E4DX 4CU7A 1SCSA 3JBG2 1RTVA 3ACGA 3KZ4C 4OVEA 4Q26A 1RUH2 1MS1A 3RG0A 2X09A 3BTYA 1BVVA 1ASJ2 2GH2A 4O9EA 4QX1A 2XG3A 5FZAA 3VD3A 2VCCA 4Y3OA 3OBAA 1RUG3 1MEC2 2BTVC 2W1SA 1OOPB 3EQEA 3OPTA 5LBFA 4COZA 1FATA 2E6VA 3VZOA 1FOD1 4CCDA 4YVSA 1J1TA 4YZ2A 2IC1A 4XJZA 2JDNA 5F1RA 4Y26A 1FPN3 4CCMA 1AF9A 1X9PA 1RUC3 2WA3A 3HNYM 1PO12 5CYYA 4B7EA 3HMYA 1RJ7A 3GZUC 1GNHA 3E5UA 2VVFA 3HNBM 4WZCA 1FMD1 4ZU7A 1CD3G 2OZJA 1KS5A 2VUAA 2Y33A 2C6SA 4YW7A 3WNNA 1F5FA 5FZ3A 4OCTA 5C4WC 5C9AA 4UXAA 4ASKA 4M00A 1KJRA 1ENQA 1ODNA 3CIHA 4QPYA 4AGRA 2GALA 2IZWA 4LO5B 1RMU3 1N3OA 3DF0A 3FLTA 1LENA 5EYYA 4KMQA 4YLZA 4FP2A 3ITQA 3TRSB 4IE4A 4DUWA 4HKWA 1DCSA 3MLJA 4YW2A 1PK6A 5C7GA 2YPDA 2Z4FA 2PHUA 4PQQA 3ZFGB 2ZZJA 1J3PA 3OGSA 1LGCA 3O1RA 3ENRA 4TYSA 5EIYB 4YZ5A 3U11A 3EB7A 4FAGA 1CAUA 1UOJA 3GBWA 4XUNA 2VMGA 1NT0A 1FNYA 2PHFA 1DQ0A 1VBA3 1APNA 2QQNA 2YC2A 3C3VA 4HPKA 2B45X 3PJQA 5G05L 3VBHC 1HJGA 1ULPA 1WKYA 4KGGA 2GDFA 4V2VA 3WQ7A 1GWMA 4IV1B 5FYMA 1B35B 2X5IC 4XF4A 1S0EA 3LPFA 4Q1RA 3DECA 5FMCA 5CFCB 4ITCA 3THCA 1UMIA 4XQWA 1OKQA 1NCQC 1ZVFA 2XXZA 2GMEA 2BGOA 2A6VA 2G1MA 1COV1 2WIIB 5FWJA 4IV3A 2BQPA 2D6MA 5FY8A 3P1IA 1ZBA2 3N3HA 1C3HA 2PAEA 3UK9A 5HBAA 3HVDA 2VBBA 5JZGA 1UQXA 2XUMA 2RS32 4GA9A 2Q8EA 4CCNA 1C8M1 4E27A 3IZOA 4IXLA 3OOXA 1R082 3QOPA 3WNLA 1MVQA 3JQXA 2DCYA 2ET7A 3GXUA 3DPRC 2VNRA 4BA6A 2GC3A 3ZXEA 1IS6A 2A3XA 3MDPA 4J25A 1SG3A 5FMBA 4CDWA 2GH8A 4TLFA 3V0AB 4AVBA 3CKHA 3ZXFA 5FBZA 3MW3A 2F6BA 3T2TA 1UZ0A 2NZ9A 5FV3A 3WG2A 3AZWA 3EJKA 3WF3A 5J1XA 5T5OA 4XUTA 1E5SA 4SBVA 2BBVA 1Y9QA 5K0UB 3I2FA 2JDMA 2VOTA 1LAJA 5DDJ3 3IAPA 4A3ZA 5IVFA 1AYN2 5JCTA 2JJ6A 1RUJ1 4XVHA 2H0BA 4LULA 3VZLA 3KCXA 4YGDA 1Z7S3 3KF3A 5FY5A 1VBD1 2WUHA 3PIJA 3H3ZA 3POYA 1UPSA 3RYPA 4JQTA 3PUAA 3C7GA 3OGJA 5FPZA 3BIEA 4XF9A 2VW2A 1S2EA 3RZKA 3VHNA 2HWF3 3POJA 2VMEA 2DFBA 1W6NA 2JX9A 1BEV2 4META 1FNZA 4FPJA 1AR63 4XQDA 1RUH1 3NL1A 2F4LA 3JCIA 1AL21 2ADDA 4G4FA 5KXDA 3O7OA 4YM1A 1SLIA 4JKKA 2Q1FA 1RVF3 1VMFA 4CDQB 3VKOA 5EJ1B 1MEC1 3MYXA 1XOYA 5CBLA 4P9JA 4CP9A 1GWLA 4D3WA 1UIJA 3VBFA 3DEMA 1RUE1 4UFIA 3UJQA 2XB6C 3AKSA 4P9IA 4UFMA 4KH9A 3DV8A 4WM7B 4QQ2A 3O1TA 1VRH2 2QZ2A 3NJZA 1IS3A 3O1PA 4IEVA 2A71A 1PO11 4RHV2 4I02A 4YGBA 2WKKA 1UU5A 1JUIA 2J1VA 4AL9A 4PLOA 2E7AA 2JE8A 4FVVA 1F4AA 4MADA 5JSPA 1UOFA 1K12A 3JUUA 4GH4A 4DS0A 2YU1A 1S0FA 2NP0A 4LIVA 4XZPA 3LDRA 4K40A 3DYMA 5A32B 1V6OA 2GAUA 1XB9A 2TBVA 4QB6A 2ZMNA 1VBC3 4MUVA 2ATFA 5IVVA 4C8DA 4FOVA 2IXJA 2YBPA 5FZ7A 5FZOB 1OOPC 1H2KA 2XH6A 1RUNA 4LBKA 5FXXA 5LA9A 1NXMA 1E5RA 1MQTA 3OBRA 2PAMA 3AZZA 1J83A 4BMBA 5BUVA 4CEYB 1GZ9A 4DINB 5FBJA 1GYKA 1IQDC 3ES4A 5GLUA 1PIV1 2IVIB 4CP1A 3U14A 1UW8A 2CGOA 2DF7A 2Y6LA 5DAQA 1KRIA 2YUEA 4BHPA 5LA0A 1LHNA 2BU9A 1DZRA 2D43A 2YFUA 5IVEA 3N7MA 4RQPC 3RNSA 1TMF1 2ZX0A 4Q4X3 4G9SB 3BUCA 4XF0A 4M4RA 4GAZA 4LUKA 4MGYE 5HCBA 5C8CC 2ARXA 1HJFA 1D2SA 5C5TA 2A3YA 2VBDA 2W52A 1GMMA 4LLOA 4IEOA 3A21A 4FPGA 4JZRA 5BNOA 4EROA 4BQ3A 5JI7A 2YGLA 3BN6A 1IZ3A 1KEXA 1O5UA 3Q8CA 1RHI1 2XQRA 5FP9A 2Q30A 2XBO2 3WNMA 2E7QA 3ZR6A 2DUOA 3AKRA 3ST7A 4UW6A 2PHWA 3K3NA 5T50A 3LOIA 1CGPA 1WZXA 2WQ8A 5A6XA 5F9TA 3AFGA 4IV1C 1B35C 4P02B 2NPIA 3WDVA 2HWC2 3PUSA 3CZUA 5JOXA 4WM7A 1F8VA 2D3RA 3C7EA 4MO3M 1G9AA 1GLHA 2OS2A 4AF9A 2WT0A 4FSJA 5K7PA 3TWIA 4IQPA 2FD8A 4XXAA 2DV9A 5FZ1A 1REFA 1SQ4A 1EAH3 1SEFA 2CNAA 4CUCA 2EXKA 3M4FA 2DUQA 4EWAA 5IFTA 2QDRA 3GALA 1QXPA 4ORFA 3RMYA 3CBNA 4DY3A 2Z79A 3AJYA 3RZGA 5FY9A 1CAXA 2DYCA 1ZZ6A 5FO9B 1PM7A 4OUSA 1WA4A 1VBE1 2PLV3 4ZZ5A 1F4HA 5A1AA 2VMDA 3ECQA 4PIYA 4HK8A 5LA1A 3I2OA 5K0UC 4HETA 2VOKA 2WLPA 3WW4A 3J26N 4AGGA 4DB5A 1WCQA 2P4EA 4JGZC 1IG3A 4XACA 3RRDA 2X10A 4AXOA 4QKNA 4L8QA 3VD4A 4JGYA 1VRH1 4IE6A 4ISQA 3ZXAC 1Y43B 1BHGA 4COWA 4IGOA 4RHV1 3LOBA 3B9IA 3LFIA 5GZDA 4F7ZA 1ND3C 2LALA 2VECA 4YW4A 1W6MB 5IVBA 4CP2A 5A80A 4QHBA 3TYJA 3THDA 1SFNA 2HEYF 2ZHLA 4OQ8A 3IBMA 5I8TA 1MZ6A 1LHVA 4Y5TA 1RUF1 2VZ3A 4Q4V3 3AMHA 4IEYA 3SCFA 1O6UA 4EWEA 2BJSA 1PX4A 2IXHA 4XBQA 1JS9A 3HR9A 3ZX7A 3VD9A 2R063 3SH3A 1RUI2 2A6ZA 1X8EA 3NQHA 5LWBA 1YQ5A 2ZCWA 4QXCA 2IUWA 5HXVA 1W2NA 3JD71 4I2OA 2CWSA 2WT1A 4JDMA 1XC6A 5FZEA 2W1WA 3J7NA 4KL1A 2W91A 4OHYA 2PHXA 3USUB 1Q3EA 2XPJA 2EF6A 4XMAA 3H7JA 3POWA 2VTXA 5BNQA 3LB9A 2X29A 2QZ3A 4HZFA 3PTRB 3B01A 5A3UA 4CXYA 4I01A 4MX3A 5J96B 3OB8A 2O8OA 4A7KA 1X50A 4DPNA 2P3JA 4RGGA 2QQOA 4HN0A 3KB5A 2PQQA 5ACA1 4DO0A 2SLIA 1W6OB 4NHKA 4BQ2A 3AYCA 4XETA 4YFWA 5A3TA 4JTNA 4RGAA 3POIA 4B7KA 3URFA 1N1TA 2CU5A 3VZMA 1K5MA 1IG0A 2HWD3 4IW3A 1YQ2A 5BPXA 4XBNA 1GUIA 1ZX5A 1DZTA 4LE4A 4BWOA 4Y22A 4CEYC 3MHZA 1ZRFA 5K4LA 4Z8BA 1GOFA 2RR13 4M3CB 4QGMA 4BISA 1VBA2 1WUVA 4R9DA 2XVGA 2VOWA 1TME3 1OH3A 2WZR3 3BODA 3HBZA 1US3A 5GALA 3AJZA 1LEDA 1SLAA 4FFGA 5CVRA 2WZPP 5GZCA 2R043 3FC0A 1GANA 3O14A 2RMU1 4BOWA 2YROA 4Q4Y1 5KBFA 1BXHA 4PDWC 1V0AA 3BI3A 2VG9A 1AR81 5JPNB 3WT3A 2DVAA 4S2GA 1E5IA 1N1SA 1UOGA 1X82A 3AM2A 4QAWA 3JBG3 2A6XA 3MUZ1 4LEJA 1PGSA 4E2QA 2ZA9A 1OF4A 1RIRA 3SKJE 5GLVA 2BZDA 3VDDC 1ASJ3 1L7RA 2BGCA 4BQ5A 2JB8A 1W6PA 1V70A 2YZ4A 4Y20B 4ZONA 1C1FA 1AR91 4OFGA 1ZZ8A 1EPWA 1W2AX 2XLAA 1IPKA 1TE1B 2LTNA 4UI9L 1W9FA 1Q43A 4QKFA 4DRVA 2ZGKA 4QKBA 1GZWB 3UETA 4QDRA 1YQCA 3FUOA 2GU9A 5LA2A 2XJPA 1YFYA 2J1UA 3FFZA 1OC1A 2PHTA 1QEXA 2VPVA 3LEKA 3MEPA 2VY0A 2G4IA 1S2BA 1H2MA 1EV11 2Z42A 2C26A 3MF9A 4C90A 1DQ2A 5FP8A 1DGRA 5LRSA 2UWBA 1D4M2 4CDUA 3MI8A 4GB31 5GLZA 1UYYA 2XHNA 3ZXKA 5CA6A 3WDUA 1UZWA 4D7YA 2JE7A 4DNYA 2Q1ZB 4QX7A 3SXWA 1R1A3 5I0DA 2VZUA 4OQ9A 3U07A 3GZAA 2E32A 2VMHA 3BPZA 2VZVA 4RS5B 3QD6A 4NOTA 1KXGA 1T6BX 4QB2A 1RVF2 3M3QA 2ZGPA 4DMIA 4P9WA 3AYDA 1OD3A 4NN0A 1RUG1 3FHAA 2EXHA 4AE2A 5CAZA 4WV8A 1NG0A 2DBIA 5CZKA 5D21A 1RUOA 1OD5A 3N9OA 3MLLA 4QDSA 5GLTA 4N53A 2PAKA 5BNPA 4Q0VA 5D8AB 1S1AA 3RMXA 2VCBA 2YC4A 3DXTA 1FPN1 1TNFA 1W8UA 4NRQA 1RUC1 4FPHA 4UBGA 4CCOA 2JDKA 3VKFC 3WUDA 4LTAA 1HB4A 2WL1A 3I59B 1CR7A 4BK5A 1OFNA 2B8MA 2ZXQA 1OT5A 1ZBA3 5LBBA 3RGBA 4MGSA 5L9VA 1ND2A 2BNMA 5A6ZA 4A6SA 2RS33 2MEV2 1NX9A 1URXA 4Z92B 3VBRA 2DVDA 1RMU1 2WO7A 1R083 1U5IA 4L0PA 4QM9A 4KGQA 1QOSA 4RL7A 3VBUC 4E8CA 5AC92 4K21A 2B9VA 1ZA7A 4QM8A 4JTOA 3KV4A 4IL7A 2XJRA 5FYCA 2BWCA 1U12A 1IS4A 4OHVA 5L7OB 1C4RA 5FMDA 1NCRC 3LEIA 4NJ4A 2QNKA 1UY2A 1AZDA 5ABJB 1QKQA 1H9PA 1YXWA 1NE4A 3AK0A 1G9CA 1VBA1 1GNZA 3ILFA 2JECA 3MW2A 4YRDA 5IYYA 1W0PA 2AUYA 1W3VA 5FTTC 2FDKA 1SBDA 1K5JA 4YVWB 1AYN3 4M4PA 4PLMA 4B4PA 4HK9A 3VBSB 4LO8A 2D3SA 5DPNA 2X8KA 4XJUA 2QQUA 2LRPA 4XILA 2D6NA 4Z82A 3HPNA 3OBTA 2JKBA 3NAPA 1JMUB 3K51A 3LIHA 1EP0A 1SLTA 3LPGA 3K77A 3MUY1 4NHYA 5CFDA 1BEV3 5CU1A 2HWE3 1J1LA 2Q4SA 5LK5A 4DXZA 1GOGA 1YIPA 1OLRA 4J1WA 1YQ8A 3CF6E 3S7EA 2VZTA 4KG0A 3IM0A 4LO6B 4XTMA 2V09A 4ZZ8A 3U37A 5IVYA 1J58A 2FDIA 3BU7A 1QY4A 2ZBJA 3M70A 2WRAA 3JU9A 2VQUA 4LA2A 3O0WA 4QPGC 4OLLA 3X29B 3DCQA 4F3JA 3T0DA 5DDJ1 5FXZA 1V6NA 2I45A 3NJXA 5K8SA 2HWB2 4QX8A 2BVBA 5F39A 1H6YA 3LE0A 1Z7S1 5H9PA 2YV8A 5FZ9A 2J7MA 3PUIA 1O4ZA 4Y1VA 1N1YA 4ZS3A 5FXVA 3W59A 1AL0G 4HANA 1ZRRA 5C33A 2Q8DA 2VXJA 2HWF1 1NA1A 3ABZA 5FKBA 2ZGMA 1PGL2 1J3QA 4GIQA 3ZYBA 1AR61 3H3UA 3ZM8A 4DEQA 4OULA 4M0NA 3VDCA 3VKMA 4WZFA 1A6CA 3T30A 2XHKA 3IWZA 3ETPA 5F37A 1RVF1 5C3SA 1HB1A 4HVQA 1SPPB 4ZU5A 2VR4A 3MICA 5LBEA 4DZGA 5M0TA 2PMWB 5FUPA 4YZ4A 3TNPB 5LK7B 4BQWA 2Y64A 3CHXA 4XC9A 5ISLA 4YZ1A 4OMCA 1REDA 5F5AA 4AI1A 3MV01 2YDEA 1JU3A 4CPBA 4NHXA 1R093 1ULDA 3THTA 4HBNA 5FY0A 3ZIWA 1QJZA 1IHMA 1E57A 3OSDA 1YYNA 5SV8A 5IJRA 4HG6B 3V0BA 3L2HA 1HRV2 2ADEA 4LE3A 2Y34A 4FPLA 5C8WA 2VCMA 1SFPA 3MIFA 3RJ2X 4AFCA 2VOXA 3UYJA 1GP5A 3VZJA 3BPSA 1VBC1 2XBO3 2VMFA 4FPYA 4UBHA 1QXRA 4D8MA 2E63A 4YVSB 1NXD1 5FUNA 3ME2A 3KT7A 4XJAA 3I2IA 5D8AC 4YGEA 5HV0A 2WINB 5FMOS 2CAVA 2HWC3 3NMBA 2JD9A 2RJKA 4FPOB 4KI5M 1XSRA 3GZEA 2Q8CA 1AYM2 5C9AB 1G9DA 1FI2A 2HLEA 4E4HA 4RR3A 4OUEA 4MXWA 1XNBA 5DG1A 4NAOA 5CIRA 1EYBA 2WWJA 3KS7A 3NNMA 1H1IA 1S2KA 3INAA 4Q4X1 5JOYA 1UXXX 2TNFA 1OURA 3IPVA 3KCYA 4CXXA 2ES3A 3JB8A 2HYKA 2JE9A 2KD7A 3D0SA 4B4RA 2RS12 3AP6A 1PK6B 1ZZ7A 3KMHA 4MOAA 2W94A 1JHJA 2BOJA 3PVBB 3AYEA 4PLNA 4QQHA 5D2AA 3I97A 1LGBA 3B69A 5LASA 1NUKA 3WNKA 1WW7A 1RITA 2E33A 3OEBA 3MGUA 1XQNA 3I3DA 2FZ2A 1CAUB 3FHIB 2FBEA 5ABJC 2SBAA 4HPKB 2ZABA 4GJYA 4YGCA 4H3WA 1UNBA 1QDOA 3KGZA 4A41A 4QQOA 4XFIA 3ZYRA 2VGDA 2WZR2 5FZMA 5C4WA 1HXS2 5EHDA 3GBFA 1Z78A 4UFJA 1UY3A 1QJY2 3AZYA 3E97A 1W9TA 1HB3A 3I7DA 4Q27A 1UY0A 2YBSA 2VZSA 3J4UH 4IV3B 1ZBE2 3LF7A 1YO8A 2Y6GA 2Q1MA 1D0GA 2JG8C 3ZSKA 1UOBA 3AP7A 4LBQA 4P00B 5H9RA 5FZGA 1A8MA 5JZGB 4S2FA 2NLRA 1OVPA 1UIKA 1HRI3 4KBBA 1UN1A 1ODMA 1J84A 1OLMA 4JKLA 1QU0A 1RGSA 5FYIA 3ILNA 5FYHA 5JSRA 2ERFA 1LESA 1YUDA 1EAH1 4YG3A 3I2DA 2ZAAA 1A8DA 2QKDA 1MACA 2JDUA 2PHLA 2W87A 3A0KA 4CDWB 2QQPA 2CY6A 1CZTA 1PGW2 1NY72 2P6HA 2NYYA 4E4ZA 3LFMA 4WBBA 1RUI3 1DF0A 3K4ZA 4KWKA 4BLIA 2PELA 2PLV1 1DQ1A 1GFF2 4GZ9A 4XDQA 5IAVA 4A7ZA 1PM4A 4H2AA 3WXPA 1JUHA 1BKZA 3N9PA 3KLSA 4AFDA 2GP5A 3MIBA 5B2GB 5IK8A 1X7NA 4UW5A 1WLCA 3POEA 3O5SA 2FMDA 2IXIA 3ATGA 2BOIA 3HN1A 4YNIA 4WVVA 3RI8A 5D1IA 1JOBA 1SLLA 4NPLA 3LA7A 1PMIA 1W6NB 3A7QA 4CPBD 1M06G 4CDXC 1O3SA 1QJEA 1PHMA 5HCAA 3DPRA 1AXKA 1RUD3 3GJAA 3KHBA 3N9NA 1R1A2 4E2SA 1S0JA 5CKQA 2OQ7A 4N8MA 5T54A 1GWKA 2YMZA 2UU8A 5AFBA 4Q4V1 1SDWA 2BRTA 2GMMA 3SEPA 3ZXJA 4ONUA 2ZHNA 4KQ7A 4CP9B 4MLOA 4YFZA 2R061 3VBFB 3M7AA 4QGNA 4CU9A 1LOEA 5FMOL 1SACA 1J59A 1NQJA 4FXKB 2QQLA 3VHRA 4F8AA 2DTYA 2W1UA 4BM8A 3U0ZA 1KJLA 4Z07A 4HOOA 1YIFA 4XJ8A 4QX0A 3IMNA 2W08A 1C5IA 1W0OA 2JKXA 3CNAA 3P3PA 1W6QA 1W99A 1M4WA 2P3IA 2ZGRA 1C28A 2WNOA 4GH4B 5FYVA 5FR3A 3CJIC 1H6XA 5KR7A 1ZRCA 1OSGA 1VIWB 5JUVA 1N1VA 1WBFA 2EA7A 1CIWA 5A7OA 2DCKA 4QXBA 3FLRA 3WR0A 3FX3A 1AJKA 2O0OA 4AVTA 4XCBA 4XFFA 1UCXA 1WCDJ 2WNUA 5GKAC 2WS93 5FP4A 1OVSA 2IFWA 3RZLA 1MQTB 3MIHA 2HWD1 2JDHA 2AZ5A 2NQYA 2JD4A 1H4GA 3JZVA 5HCFA 4AVAA 5A70A 5JOZA 2YY1A 1S0CA 3O1SA 1PZ9A 2EIDA 4LOTA 4G3YC 4HSJA 4DOUA 2RR11 1VMJA 1D0HA 1ZZCA 3C7FA 5IWFA 1SCRA 3VV1A 3BYWA 2GNBA 1TME1 1O4YA 5C9AC 5FY1A 2K46A 1MPXA 4HKLA 4AZZA 2JG9B 4BB3A 3POGA 1GICA 2UY9A 3SCGA 1AX0A 1DYPA 1SHWB 1W2TA 2AEYA 4AFAA 2R041 4AGVA 2WAOA 1D4M3 2C4XA 1S55A 3PVEA 1PK6C 5BNOB 4BMEA 1OH4A 3NV1A 1FT9A 5JMOA 2B5HA 5C3PA 3JBG1 2HWE2 4CSWA 2JDZA 2ORZA 2ZGOA 3PJYA 3IDCB 2P37A 1MR5A 3D4KA 1ASJ1 4W6WA 1K45A 1PGW1 4L97A
chains in the Genus database with same CATH topology
1HLCA 1BCXA 3AKQA 4Q8KA 2ZX1A 1KFXL 5J37A 4IEUA 1OQEA 3VBOA 3VN4A 2OUHA 2A3WA 3WP3A 4CTEA 3VLBB 3WDYA 4RQPA 2A73B 2YYOA 2Z69A 1BYHA 4NR1A 5JVVA 2HEWF 1RINA 3NO8A 5C8CA 3IIAA 2GC1A 4BZ4A 4YYOA 1MZFA 4JV4A 3OY8A 5FQ0A 5T5PA 4L99A 2MEV3 5A3MA 5FO8B 4GMP0 1R1A1 5AC93 4RD7A 3IN9A 4C0BA 1CAXB 4CEWB 5F5QA 4R9CA 5I93A 3M3CA 1H8VA 3ZN5A 5JI9A 2PA7A 3SMHA 1LHOA 2VU9A 4QGLA 1DFQA 4GKYA 4JGYB 2WQZC 3LKJA 1REEA 2WFF3 5A33A 4PBPA 2RJLA 3FBYA 3WDXA 2JG9A 1R092 2VOVA 4XFAA 3ROUA 4IEXA 1C1LA 1JXNA 3PTYA 2PN5A 3AKTA 5LRRA 1WLTA 1ZBA1 4LHKA 4GMP3 2KA3A 2R1BA 2RS31 3J8F2 3NV3A 1D2QA 5JMCA 1R081 1PNFA 3ZFGC 1CVNA 2WNVA 4JQRA 5CG8A 3W58A 2D6KA 1MZ5A 4Q2FA 4JDNA 2WLQA 4M01A 4JGZA 3B02A 2CYFA 4MGZE 2VQ0A 2ZOEB 1CQ9A 1MS5A 2B42B 5CFCC 5FDBA 2I2SA 1XE8A 1XNKA 1CESA 1ND3A 2D6PA 2VMIA 1NOVA 3I54A 3M2MA 1H30A 2GNTA 4GH4C 1AYN1 2P3KA 1H9WA 4IEPA 2HWB3 2ZKLA 4FPEA 3SITA 4AHZA 1QOTA 4QQLA 5FLHA 3WCSA 1OQDA 2D5FA 1MZEA 4Q0UA 5EV7A 1WGPA 4AEMA 3K48A 1H1MA 1BEV1 1K5MB 4MVTA 1G6NA 4IESA 1N47A 1LOFA 4CEWA 4Y22B 2R49A 2ZGLA 2ARBA 3LA3A 1CJDA 2BNOA 1DGLA 2Q5TA 3VKNA 2X53S 5I0RA 3WG4A 1LB2A 3A4UA 4HN1A 4X8NA 3ZYIB 5AFEA 3B9CA 2AH2A 4AQSA 1IKPA 4XYXA 1OA3A 4I3GA 1F2NA 3ZXDA 3RZZA 2P34A 5JIUA 1NE6A 2Y0IA 5DZEA 4PCRA 1YRZA 1HRI2 3M8LA 3MFCA 1FOD3 2GNDA 5F6KA 1HRV3 2A6WA 1XYPA 1A3KA 1WLWA 4X6RB 3M1HA 3AP5A 1RL3A 1W6PB 3L2YA 1FX5A 4CYDA 4CDQC 1BK1A 5FCCA 4JRLA 1BBT3 3CJXA 4MGKE 4P9YA 5DG2A 4AI3A 4C0HA 1WMEA 1OPMA 1PNGA 1QQP2 1WLDA 1KS4A 4M3CE 2D93A 3HAGA 4WM7C 1VBB2 3VUOA 4GULA 3GHMA 3RDIA 2UYBA 4PDWA 4TSVA 3TN92 2BEOA 2N7GA 1YFWA 4JRAA 4XIOA 1AYM3 1UPIA 4UW3A 5FPXA 2FHRA 3TB0A 4CDUB 4BLJA 1R091 4K1ZA 3E6CC 5DUWA 4EJRA 3FZ3A 4O9GA 3ES1A 3VDDA 2BNNA 1RUD2 4I0BA 3E5QA 2RS13 3KD4A 3RWNA 2WSVA 3J9SA 5GM0A 1Q8OA 3AYAA 2C9AA 4LBMA 1A78A 1SLBA 2RS52 1ZM1A 3UL2A 4JDOA 5BNNA 4ES9A 4FQ4A 1Q8QA 2IXKA 1OA4A 2XBO1 5GZGA 1TNRA 2OUJA 3FFQA 2EIGA 4N53B 2OW4A 3H1MA 1EY2A 3MZHA 1OQ1A 1WBLA 4E9KA 5BNPB 5BY5A 1QJX2 5F6LB 3M3OA 4BIFA 4BH9A 5I8YA 2ZPXA 3AXDA 1HXS3 2HWC1 2I07B 1QJY3 1S0IA 1GKBA 1LR5A 2LM3A 1ZBE3 2IXLA 1DYKA 4GXLA 4Z1VA 1ND2B 2DVBA 4OI1A 1V00A 3VBRB 4EN9B 1XYNA 1PO22 3EBRA 2BPA2 1RJ8A 3GYDA 1OMIA 4N43A 1ZRDA 4ZKTB 1IPJA 3NV2A 2K0GA 2WS92 5CB7A 5JWPA 2GN7A 4AEKA 1JH5A 2EAAA 1RB8G 3BB6A 2W0XA 1LU2A 3FLPA 1GZCA 2JICA 1VAMA 4I0WB 4J6GA 2QDNA 2DUPA 1KQRA 2ZGSA 5JIAA 3ZFEA 4Z2WA 4LT5A 4OUMA 1QH7A 1V9U2 3O0VA 1CX4A 2NN8A 2KM2A 4FXGB 3NAPB 2VULA 2YHJA 3PVNA 3VBUA 5CFDB 3BOPA 2ZGTA 5KHGA 3DGTA 4KG8A 1HRI1 2AYHA 4R52A 1LCLA 3USSA 3ZN6A 2WSUA 1QMJA 1S0DA 1NCRA 3WP5A 1YFXA 3BTAA 2WJSA 2R1DA 1H8TA 4YSFA 1LKNA 2I74A 1BVP1 2QFEA 1CPMA 5EFUA 1NYWA 1RUI1 4AI0A 1PVC2 4D7SA 3T1MA 4AVSA 2NM1A 4WM8A 2D7FA 1U5ZA 1H1AA 3H1WA 5T5LA 2D40A 4B29A 3IDBB 2XJSA 4MH0E 2VW0A 2XJTA 2Y26A 3ZMNA 4XFBA 4ISRA 5FO7B 4H55A 1MS3A 3AMQA 4AEJA 3M3EA 4LO7A 1W2UA 4GWMA 1NA1B 2ETEA 3SCHA 4AFMA 1RUD1 1F9KA 1X8MA 4TZDA 4KU7A 3JB4C 3JQWA 4L92A 2DCZA 2OIIA 2MPFA 4IETA 4QPGA 3WINE 3AX4A 2WQ4A 1I5ZA 2WFF2 4RA0A 1HV1A 3ZYJB 3M3IA 5GZEA 3WP6A 2AREA 1YFUA 2WC2A 4H7LA 3V0BB 2DCTA 2LUWA 2CAUA 1TQ5A 2MHFA 5I8SA 1CAVA 1VP6A 4L2NA 3SLIA 4XBLA 4N7UA 1DU3D 4LBLA 3IDEA 1CAWA 3H8UA 1B09A 4HMZA 4AHYA 1QJU2 4B8EA 4E2GA 4WVMA 4XFGA 1N3QA 1AR72 2W39A 4ZXKA 4COYA 1GV9A 3AMPA 4RR3B 3WOGA 3L9JT 2VXRA 3Q9OA 3ILRA 1WD3A 4GWNA 4MXWB 4Y1ZA 3VHOA 1G9BA 1ND2C 4EV0A 3AXEA 3N7LA 4A7YA 5DUXA 4XOGA 2DFCA 3IPVB 3AFKA 2R072 1D4M1 2QE3A 2O1QA 4AHXA 1HQNA 2ZS6B 3U4XA 1LGNA 1UU4A 4UW4A 1CONA 3S30A 1LTEA 3VL8A 1LOGA 4AEDA 3N4MA 1MS9A 4QU2A 2E9QA 4YM2A 4AWDA 3PLQA 3I4IA 4Q4W2 3UKNA 5SV5A 4QT6A 1AX2A 2EVXA 3PMEA 4U2AA 4IERA 5C4WB 3WX5A 4FTBA 3D82A 5KC6A 3OYWA 2XGXA 5J7MA 1RUF3 4BPZA 1ULGA 5IK4A 5EYXA 5EZWA 2ZAHA 4LBQB 3U10A 5EWSA 1F5JA 4NWVA 2DU0A 1OLQA 4W65A 5CFDC 4PF5A 3ZVXA 4RFT0 3ZFFA 2RHPA 3CEWA 4EN0A 1FOD2 4I0AA 1WD4A 3J8F3 2MEV1 4RS5C 4XXPA 1JOJA 3AZXA 2ET1A 5AC91 1BBT2 4QPIA 1ZNPA 1FMD2 1VAKA 3VZKA 5BYNA 4FT8A 4N9HA 3KGLA 3N7KA 2BYVE 2O8QA 1TEIA 3AMNA 1DLLA 2AR6A 4EWDA 4X6QB 5FREA 2Q8OA 3ZPYA 4JCKA 4AQ6A 2JG8A 2P17A 3MPPG 4FP3A 3RSJA 3UKVA 5CG9A 1HKDA 4FCAA 3V65A 4I3PA 1Q8SA 1JBCA 1NA1C 4NPRA 4LNVA 3DPRB 2H6BA 5FAXA 1XRUA 2W68A 4K20A 3SHRA 1O3RA 4GMP1 3OJBA 1MS4A 5L7OC 5E16A 2WT2A 1DGWA 1POV0 3TNQA 5T5JA 2RM23 4N7IA 1XNDA 2RMU3 4U36A 4CP0A 4R9BA 3MIDA 1COV2 4Y4YA 1PVXA 1UX6A 2PHDA 2XLFA 1DQ5A 3OTFA 1ZZ9A 3BALA 1HX6A 1PZ8A 4YVWC 1C8M2 5C6CA 3B3QE 1JTZX 1DIWA 4KNCA 5KHJA 1RC6A 3VBSC 1W6QB 3LWCA 4ASLA 4CDXA 1WW5A 4YG0A 1GQHA 3R4UA 2XKPA 5CNAA 2HWB1 5J09A 3VL9A 2IXCA 4A3XA 1LULA 3WDWA 1LODA 2WNUB 5DZGA 2WA4A 4PBOA 4C1WA 5DXDA 1PGL1 1POV3 1WMDA 2D44A 2ZGNA 3GF6A 3VBHA 1RUJ2 1UL9A 2OVUA 4QQPA 1QQP3 4NVPA 1VBD2 1JW6A 4M0HA 2X5IA 4SLIA 1LHWA 1VBB3 3ZSLA 1G9FA 1UU6A 2VVEA 4BE3A 1NCQA 4FTSA 3TN93 3RJRA 2ZX3A 2VW1A 3CJIA 1AL22 3E5XA 3FJSA 3OGGA 3G7DA 1AJOA 3A0NA 3AB0A 4QD2A 4FOQA 3SH4A 3O12A 2KXLA 4X8PA 2DURA 2DCJA 4B3NA 1IS5A 4FBFA 3E6DA 1I6XA 1RUE2 1HRV1 3OD4A 2C0ZA 2BVVA 3WHUA 2RS53 3KCCA 4HFSA 2XKOA 1BBT1 3KQRA 3PNAA 1WW4A 3VBOB 2B46X 4FO9A 3S0MA 1QHDA 3ASIA 3AMMA 3WW3A 2QVSB 1QJX3 4Q0SA 4RQPB 2DTWA 5JSOA 5C8CB 4HVOA 5E88A 3EHKA 4CRQA 2TEPA 1AYM1 1UD1A 3OY8B 5FQ0B 3FWEA 1AX1A 2WWSA 1BZWA 5JOWA 4R8HA 2Q0AA 1NZCA 3LZZA 4HSLA 1PO23 1NLRA 2A6YA 1C8NA 3EXUA 1PIV2 3CO2A 4YW5A 5JAXA 2RS11 2F4PA 3WVJA 2GZWA 1DGWX 2YXSA 2XWJB 4YVSC 2D5HA 2AGSA 5T52A 3BOWA 4FTEA 2VH9A 5HI0A 5KHHA 1TMF2 2E53A 4K3UA 3ELNA 3ZMOA 1QDCA 1HW5A 3TBDA 5A33B 2UURA 1X33A 1UZZA 2WZR1 1V9U3 1HXS1 3V64A 5I0TA 1ONAA 1QJY1 1C57A 3H0OA 1RHI2 3GHNA 5I0SA 5J3UA 5JPMB 1ZBE1 1O5LA 3THPA 2HJIA 2UY8A 1OFSA 3FUQA 1S0BA 1GSLA 3HD8B 1H2NA 1U5XA 1OOPA 4KWJA 1GQGA 3SNMA 4LBQD 4C91A 2WNVB 2OYZA 1VB2A 3QLQA 5GJ6A 1GBGA 3MW4A 5L36A 5KHKA 1NY71 5EJ3A 3RYRA 4JGZB 1DBNA 3P3NA 1PVC3 2DWRA 1IGOA 2PFWA 1LOBA 5BV6A 1VAVA 1IKQA 1ND3B 2EALA 1SLCA 4XTPA 4D69A 1UAIA 2VVDA 4IV3C 4A2UA 1V6KA 4R4ZA 4DY5A 3FBMA 3NVCA 1U5YA 5JZGC 1YCIA 3APBA 5KHIA 4XJWA 5A3LA 4R4XA 1G86A 1C5HA 4K1YA 1VBE2 5KXEA 4YW3A 4NHMA 4MYEA 1YWKA 4AG4A 1FV3A 1VB4A 3ZFGA 1LJ7A 2WNUC 3QBQA 1QF3A 3PVOA 5KXBA 3NV4A 4QMAA 4XHXA 1ZREA 4CDWC 4Y1UA 4S2DA 3O0XA 2YPJA 4HKOA 2BUKA 4IV1A 3ZN4A 1B35A 3WG3A 2OZ6A 5H9SA 5CFCA 1LEMA 1ZA4A 1YNAA 4FPKA 3WDTA 2DVFA 3DUIA 2WNEA 4FPCA 5E1RA 3B5LB 3WHTA 2VUJA 1BQPA 4YARA 1RUF2 2A5ZA 3UJOA 5IK5A 4Y1YA 2B7YA 5J98B 5CADA 4S2HA 3ZIXA 4K8FA 4LBJA 4DFSA 4XF3A 1YJLA 2NMOA 1W39A 3JD72 3LSEA 3V0AA 4W6XA 3T1LA 4D7TA 5JDBA 3VBOC 1DQ6A 4OI2A 2AENA 3VBFC 5K0UA 1I9RA 1LOAA 3ZXLA 3RYKA 3MF6A 1QJU3 1QNYA 5IUQA 1AVBA 5ACA2 1XNCA 1QOOA 4PDWB 1AR73 4Y24A 4YZ3A 3SH5A 1O3QA 4FOWA 3UV9A 4XFHA 1Q56A 4MZUA 4AI2A 4P5HA 1VJ2A 3HT1A 3VDDB 1H0BA 2R073 2VQAA 3B93A 3V56A 2ZJCA 2K9ZA 4CDQA 1J3RA 1EPZA 2A70A 3QH7A 4EN6B 5BNNB 2GC2A 1MQTC 2HWE1 1O3TA 1JYIA 1MS0A 2GSYA 2R0FA 2QCSB 1CN1A 1LU1A 4L11A 2RM22 1O91A 4AI8A 2RMU2 4LO4B 3H7YA 4PIXA 2XVLA 4Q4W3 4Q4Y2 1AR82 3VZNA 1HDKA 5E89A 4BYYA 4MGIE 4PQ9A 1I1EA 1V6LA 2JG9C 3N36A 2R6QA 2ZACA 1HV0A 1KDKA 5A32A 2HKXA 4PJYA 5BNOC 1AR92 1G7YA 5GLWA 1HQLA 3AP9A 4XIKA 3GZTB 4FAHA 2R32A 2BBVA 4LR4A 1LOCA 3TAYA 2WNVC 4XQ4A 1H4HA 4N43B 3ETQA 2H6CA 3KT1A 1S0GA 4IEQA 2WFPA 4ATEA 1U0AA 4CEYA 1SFYA 1MVEA 1ULCA 5I0UA 4ZU4A 4ASMB 1FMD3 1LRHA 1EV12 3ZSJA 5LEKA 2P2KA 2QUOA 3ZFEB 3KM5A 5L19A 2ZKNA 1ENSA 4AFBA 1YHFA 1NQDA 1IQAA 4GB32 5T3NA 3WZ1A 2JXAA 5TSWA 1CJPA 1NLSA 4AVCA 3R4DB 4OHWA 1OI6A 3DKWA 3PMSA 5IK7A 4YM3A 1OPOA 2R30A 1BMV2 1LHUA 4NHLA 3IKWA 3VBUB 3C2UA 1YI7A 1RUG2 1WCKA 3ZN6B 2ILMA 2GC0A 1ULEA 2ZHKA 4GALA 4XMIA 1LOFC 4CEWC 1NCRB 1HQWA 1ZZBA 3J8F1 1H8TB 3R6SA 2XVKA 1VALA 1L3JA 1FPN2 2XJVA 1RUC2 3HWJA 4Q0QA 3CL1A 3ZYGA 2B9UA 1COV3 2CL2A 4WM8B 3G6JB 3S6PA 3LA2A 4JGYC 1OHFA 5L73A 1QNWA 5J36A 1YLLA 3PHMA 4LLFA 1O7FA 1C8M3