5C4WA

Crystal structure of coxsackievirus a16
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
296
structure length
287
Chain Sequence
DPIADMIRSLTALQVLPTAANTEASSHRLGTGVVPALQAAETGASSNASDKNLIETRCVLNHHSTQETAIGNFFSRAGLVSIITMPTTGTQNTDGYVNWDIDLMGYAQLRRKCELFTYMRFDAEFTFVVAKPNGELVPQLLQYMYVPPGAPKPTSRDSFAWQTATNPSVFVKMTDPPAQVSVPFMSPASAYQWFYDGYPTFGEHLQANDLDYGQCPNNMMGTFSIRTVGIEKSPHSITLRVYMRIKHVRAWIPRPLRNQPYLFKTNPNYKGNDIKCTSTSRDKITTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Coxsackievirus A16 Capsids with Native Antigenicity: Implications for Particle Expansion, Receptor Binding, and Immunogenicity.
pubmed doi rcsb
molecule tags Virus
molecule keywords VP1
total genus 45
structure length 287
sequence length 296
ec nomenclature
pdb deposition date 2015-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5c4wA00
1RMU3 4NWWA 1MEC1 5CFDB 1NA1A 4N53A 2TBVA 1B35C 1C8M1 1FPN3 2XPJA 1X33A 4CDUA 5ACA1 2HWD3 5ACA3 1COV1 5DDJ1 2QQPA 1RHI2 1ND2A 5LK7B 4RHV1 2HWB1 5ABJC 2HWE3 4RHV3 2RM21 2HWE1 2VQ0A 4CDQC 2RMU1 3VBOB 3M8LA 4CDXA 1C8NA 4RR3A 2RMU2 5AC91 5L7OA 5D8AA 3NAPB 1V9U2 1BEV2 5BNOB 1BMV1 2R041 2GH8A 1NCQA 3ZFEB 1M06G 1NCRA 2XBO3 4CEWB 3ZFFC 2R071 2R073 1EAH1 1RUE2 1NA1C 5BNPA 1TMF3 5A33B 4RFT0 4GH4A 3DPRB 1Z7S3 3VBRB 2ZZQA 3ZXAC 2RS52 4IV1B 5BNPC 4QPIB 4GB32 4EJRA 1NG0A 2WZR3 1VBB1 3TN91 5FMOL 1VBD3 1CJDA 1NCQB 1VRH3 3LOBA 1AR83 1PO21 3J8F1 4RR3C 5L7OC 4GMP0 4Q4Y2 2WFF1 1RUG1 4Q4W2 5ABJA 4RS5C 1VBE1 1AR82 1QQP3 1ND2C 4IV1A 1QQP1 5K0UA 4LLFA 2WLPA 5CFDC 2HWC1 1PO22 4N53C 5C4WB 1C8M2 2HWC3 1R1A1 5JZGB 2RS53 1R093 4IV3A 4SBVA 5C9AC 2RS51 4AEDA 1RUF1 1RMU1 5BNNA 1RUE3 1K5MA 4CEWA 1EV11 1FOD1 4FTEA 4YVWA 1K5MB 4JGZC 4GH4B 1MQTA 1AR92 1VB4A 4Q4V3 1VB2A 3VBUC 4Q4V1 2HWC2 2RS33 5C8CC 3VDDA 2RMU3 1RUH2 3ZFEC 1SMVA 2WFF2 2MEV3 1AUYA 4WM8A 1HQNA 2IZWA 1HXS1 5CFCB 1A6CA 1RUC3 3VBOA 1ZBE1 4IV3B 5J98B 1RUC1 3NAPC 1QQP2 1NA1B 1VBA1 3NAPA 4CEYC 4Q4W3 4Z92B 1RVF1 4Q4Y3 3VBUB 3VBFA 3ZFEA 1RVF3 1VBC2 3ZFFB 1QJU1 1RUI3 1NCRB 3JB8A 1TMF1 4FSJA 1PGL1 3VBUA 5CFCC 1ZBA3 3VBHB 2R062 2RR13 5D8AB 1HRI2 1VBB3 1AR73 5BNNC 1BEV1 4JGYA 5JZGA 4AEDC 1ND3C 1MEC3 1AL21 1AR62 1RUD3 1NOVA 4PDWC 5J96B 4JGYB 1RUD1 1OOPC 1OPOA 4RQPB 5CFDA 3VBFC 4CDUB 2XBO2 2HWD1 1H8TB 2R061 5K0UC 1COV3 2FZ1A 5DDJ3 4Y4YA 1VBE3 2RS12 1AYM1 3JBG2 4IV1C 1V9U3 1V9U1 1ND2B 1IHMA 4CDXB 2DF7A 5AC93 4WM7A 1R082 3JD72 1PGW2 5C8CA 5BNOA 1AR63 1AL0G 1R1A3 1MQTC 1RHI3 2HWD2 4YVWC 5C9AB 2R043 4CDWC 1FMD1 2X5IB 1VBB2 4YVSB 3TN92 1FMD2 1RUH1 4GB31 4CEWC 1HX6A 1EAH3 1POV0 2RR12 1EV12 3DPRA 3JB4C 4Y5Z0 4N43C 4GH4C 3VBRC 1RUJ1 1RUI2 1MQTB 1RVF2 1VBC3 3TN93 1VBC1 3IDEA 1AYM2 1BMV2 4FTBA 5GKAC 1VBA3 1QJU2 4RS5A 1RUG2 4Q4W1 1RUC2 4BCUA 1AR81 2PLV2 2MEV2 2WFF3 2BUKA 3ZFGC 2RS32 4Q4V2 4QPIC 3JBG3 2RS13 1VBE2 1COV2 5DDJ2 2RR11 1RUJ2 1POV3 5A32B 2BBVA 1B35A 1RUD2 1W39A 1MEC2 4N43A 1TME3 4CEYB 5A32A 1R091 1B35B 1C8M3 1DDLA 2HWF2 3DPRC 1D4M2 1AR72 1RUF3 2X5IA 3ZFFA 1QJZA 1NCRC 1FPN1 2WS91 4Q4X1 2R063 1FOD3 1ZBA2 1NCQC 1PIV2 2WS93 4Q4X3 4QPIA 5FOJB 1QJY1 2RM23 5D8AC 1HRV3 2RS31 3ZFGA 2FZ2A 1HRV1 4CDXC 4CDQA 1HRV2 4GMP1 1VAKA 2RM22 3FBMA 1VRH2 2HWB2 5C4WA 1RHI1 4RS5B 1QJX3 1VBD2 1FOD2 1QJX1 3VBFB 4CDUC 2XBO1 2WZR2 1RUH3 1OOPA 1RUI1 1PVC3 4Q4Y1 4JGZB 1D4M3 3VBRA 1PVC1 1D4M1 1AR91 1RB8G 1AL22 5BNPB 1AR93 1TME2 3VBHA 1Z7S1 1ZBA1 1TMF2 5JZGC 1PGL2 1OHFA 2BFUS 5FMOS 2R072 1BBT2 1ASJ1 1AYN1 1ASJ2 1AYN2 1ASJ3 1AYN3 4CDQB 4FTSA 1VBD1 1BBT3 4CDWA 4N53B 5BNNB 5CFCA 1BEV3 1AL23 1R092 3CJIC 4NWVA 1ND3B 5BNOC 4CDWB 1VRH1 4YVSC 1PO23 1PVC2 4WM7C 1PGW1 1OOPB 4QPGC 2PLV3 2PLV1 1RUG3 1QJX2 1E57A 1H8TA 5ABJB 5A33A 2HWB3 1AYM3 4RR3B 5L7OB 3VBOC 4QPGA 4PDWA 4WM7B 2ZAHA 4QPGB 1TME1 1ND3A 1AR61 1PIV3 2WS92 4JGYC 4Q4X2 3VBSA 1EV13 4RQPC 1PIV1 2Y26A 1EAH2 1RUE1 2GSYA 1FMD3 2BPA2 1GFF2 2HWF1 1RUF2 1K5MC 2R042 4GB33 4RQPA 2HWF3 1PO12 3VBSC 1Z7S2 2BFUL 1R1A2 1QJY3 3VDDB 1F8VA 1R081 1WCDJ 3JD71 1R083 3JD73 1RUJ3 2WZR1 5AC92 4PDWB 1ZBE3 2MEV1 4GMP3 1HXS3 4CEYA 3J8F2 3ZFGB 5C4WC 1H8TC 1CD3G 3VBSB 3J8F3 1HXS2 2ZTNA 1ZBE2 1F2NA 4WM8C 3VDDC 3S6PA 4YVSA 4RHV2 2HWE2 1X36A 1QJU3 1VBA2 3CJIA 1QJY2 5K0UB 4YVWB 2RS11 1PO11 4JGZA 5ACA2 3HAGA 1PO13 3JBG1 1HRI1 3CJIB 5C8CB 1HRI3 1FPN2 1NY71 1NY72 2WWSA 2X5IC 1BBT1 4AEDB 4WM8B 1AR71 1POV1 4N43B 1RMU2 3VBHC 5C9AA 4IV3C
chains in the Genus database with same CATH superfamily
3MV01 5JXHA 1RMU3 4NWWA 1MEC1 3NNLA 4Z1VA 5FYUA 3H3UA 5CFDB 2W39A 3BVCA 4CTEA 5FYBA 2PAKA 3DL3A 5BPXA 2BV4A 2J1AA 3TAYA 2V72A 2YC0A 4CUCA 4M4PA 2FMDA 1D4VB 2HWD3 4MADA 4JDNA 3ZYFA 1COV1 5DDJ1 1X50A 4I3PA 1RHI2 4XBQA 3TNQA 3WQ7A 4AFBA 5IAXA 4R9CA 5LK7B 1MZ6A 5FZKA 3TYJA 2HEVF 2HWB1 4NRPA 4YW5A 2XJUA 3RGBA 3E6DA 2ET1A 5FY4A 1QGLA 2VQ0A 1JOBA 1NLQA 2RMU1 4QM9A 2VZQA 2WO1A 1C57A 1ZZ9A 2OA2A 5AC91 2JDPA 4HK9A 4K21A 2NZ9A 3GZTB 4AK3A 1NLRA 1OMIA 3NAPB 4YWAA 5JCTA 1Q8OA 4BQ5A 5DAQA 4J1XA 4LUMA 2ZX3A 3RS6A 3UK9A 3NNGA 1W0NA 4LE4A 5F5AA 4UW4A 5FQ0B 5LZ6A 3CNAA 1XNBA 3ZSLA 5E89A 3WXPA 4FPYA 5CEHA 5FKCA 3H1YA 1A34A 2G4IA 2P2KA 3LA2A 1N1VA 4LIVA 4Q8KA 1ZRDA 3RDIA 1J59A 2ZGSA 1NZCA 3MIHA 4JVAA 1UYYA 4F83A 3KHBA 4JAAA 4E2QA 1PVXA 1KITA 1W8FA 5BNPA 5C3OA 5IK4A 2NP0A 1YO8A 2C9KA 3DPRB 4URAA 3VBRB 4Y20B 4AGGA 2GMMA 3EHKA 2RS52 5IVJA 2FCUA 3UT0A 4FBFA 4BJ0A 3POWA 4CP9A 4QXBA 5DUVA 5BNPC 4DFSA 3LSDA 1UYZA 1LOAA 3EMRA 3OUHA 2FD8A 1JYCA 3VD7A 3VDAA 1WCSA 1XOYA 2BRTA 3WDYA 3LF7A 1MS8A 3GF6A 3QD6A 5KC5A 1UMZA 5C33A 2PN5A 1TVGA 4O7XA 1J1LA 2H0VA 2JEMA 2X05A 5E8AA 4LE3A 4XHBA 5LCWL 3LOBA 1JS9A 3J8F1 3AM2A 1JHNA 4FOQA 5F3EA 4XYXA 4YNIA 3ES1A 1H2KA 3N7JA 4IDZA 2QUOA 5JR2A 4Q4Y2 3VKFC 5FZAA 4Q4W2 3C7HA 5FYTA 5BUVA 1F5FA 1O4YA 2K2SA 4XUTA 3FLPA 1ND2C 4KQ7A 4H2AA 4QQPA 1G86A 3MV11 3WEZA 1WKYA 3LA7A 1W9TA 4LA3A 5EJ3A 2FCVA 2IC1A 3H0OA 4EN7B 5K0UA 3ZXDA 2ZGNA 3AZVA 2XHNA 4LJHA 3HN1A 1PHMA 3SLIA 3AB0A 4RL7A 2HWC1 4K6BA 2EXIA 2DVFA 4N7IA 1C8M2 4HKOA 4M0NA 1W99A 2RS53 3O1OA 1REDA 5AFEA 3RWKX 2VOXA 2CGOA 3A21A 3B93A 4AFAA 1RGSA 1RUF1 3I54A 3B5LB 4OLLA 4AEDA 4E9KA 5BNNA 3AZXA 3T0BA 1DHKB 1EV11 1QDOA 4I0BA 1FXZA 2R0FA 2VTXJ 5FDBA 2OS2A 4H3WA 4OCTA 4FTEA 1SLLA 2EXKA 1GV9A 1OKQA 1XE0A 3A0KA 1K5MB 3IDCB 4JKKA 2FHRA 4QX7A 3S5QA 3BU7A 2ARCA 3H1MA 3T2QA 4A2UA 3I4IA 4H7LA 2K9ZA 2V09A 1YJKA 1OXCA 3VDDA 1NXMA 1AXKA 1RYYA 1SMVA 2WFF2 2Y34A 4WM8A 4ORFA 4JZRA 3WP4A 2GP3A 5DQ0A 1LESA 1A6CA 1UU5A 3NNJA 4KG8A 1CIYA 4DY5A 5C8WA 1HJFA 3NAPC 5A3TA 3H8RA 3ACHA 1QQP2 2WWJA 4CEYC 2TNFA 3POEA 2FDKA 2ZGMA 3ALQA 1UOFA 4MH0E 1EPWA 4UW3A 4GD4A 5FOBB 1ZRCA 1GANA 2QQWA 3LSEA 1YHFA 3W59A 3NMBA 4LK7A 5IJRA 2PYTA 3T4VA 1PGL1 2V4AA 4QX0A 5A7PA 2SBAA 4QGMA 2R0HA 3THCA 1WUVA 5IT6A 2WYFA 1XB9A 1LB2A 1NAEA 3QACA 1D2QA 4CXYA 3N3HA 1OLRA 1F9KA 4EROA 2VQTA 1GICA 3LDKA 2HEYF 5FP9A 3MW3A 3T3YA 2YHJA 1PZ8A 3GZAA 3RYRA 4AGRA 4KWJA 1BEV1 4LMFA 5FIXA 1NZIA 2WRAA 3IBMA 5D21A 4XZUG 1ND3C 3RWNA 1F4AA 3AKTA 4Y22A 4ZY9A 1IQAA 2WT0A 2RJ2A 2VCBA 3WDUA 3WDTA 1NOVA 1WLDA 4QPWA 3L9JT 4BHPA 4F8AA 3GALA 4W6WA 5CFDA 4DEQA 4XXAA 5FTTC 2VMIA 2XBO2 4PLOA 5JSPA 4R9BA 4CA9A 2R061 2JG9C 1VBE3 4W6XA 1MPXA 1AYM1 1UCXA 3D5OA 1OLMA 2CWSA 3JBG2 4IV1C 4L0PA 4FFFA 4P00B 4COWA 4NHMA 5I8TA 4HG6B 2N7GA 1HB2A 3C2UA 2YU2A 3GBFA 1IKPA 2OZ6A 3B9CA 5JOZA 2YFZA 3DKWA 4GALA 5F2WA 4I01A 4J6GA 3LPFA 3JD72 3AYEA 1E5IA 1OPMA 4QM8A 3T0AA 2RDRA 2WFPA 1V70A 3BU0A 1AR63 4K1ZA 3MIEA 1BVVA 1AL0G 3IKWA 5J7MA 2WT2A 5LA9A 3ACGA 1JZ7A 3T1LA 2R49A 2VD7A 3J7MA 3PIGA 4XVHA 4BQ1A 5C9AB 1O91A 4ZHNA 4HN1A 1RUH1 3ZYPA 3KD4A 2A70A 4CEWC 1HX6A 4DUWA 2RR12 1EV12 3DPRA 5FZ7A 4YW7A 2G19A 5KWRA 1UMIA 3C7OA 4Y33A 2R1DA 5EP9A 4WZCA 1LEDA 4GH4C 5FBZA 1T6BX 4TZDA 1W8WA 3EO6A 1MS5A 1RUI2 4BK4A 4ZXEA 1KD7A 4J25A 2YBSA 5KXBA 2OW4A 3ZN6B 4FOWA 4CCJA 1LR5A 2P6HA 1Q43A 2JDAA 4K3UA 4OZOA 2WKKA 1IGOA 3U11A 4BISA 1BMV2 1NX9A 2HBUA 3PVOA 5GKAC 1W9WA 4KWLA 4QMAA 5LRSA 5FQ0A 5J3UA 1RUC2 3BIEA 5I0DA 1O5UA 2MEV2 3OOXA 3AVRA 1DF0A 1O59A 2BUKA 1UX6A 3AXEA 4AAPA 1YQ5A 3RFRA 1W9FA 2OIIA 2Y33A 5FAXA 4FT8A 2O0OA 4A6OA 1WCQA 1YQ6A 1L7RA 5KXCA 5FZ3A 5CG9A 4FQZA 4LBKA 1VBE2 4QD2A 3RG0A 1Y9MA 1COV2 1TG7A 1W6OA 1CAUB 2C0ZA 4GIQA 5DDJ2 5FZMA 1WW6A 4YFWA 2JE7A 1W6NA 2JDKA 2V73A 2A7AA 3BCWA 3U07A 3WF3A 3VZLA 3ZYGA 5T5JA 1IS3A 5IHRA 1POV3 5I91A 4FI9A 3WT3A 2YUEA 1RUD2 3ZSEA 4V2WA 2Q1FA 2W1SA 1MVEA 4WZFA 1YIFA 4K40A 5CKMA 1JXNA 1TME3 2RVAA 3KVBA 2BEOA 4IEXA 4MXWB 3LWCA 4Q0SA 4CEYB 1PX4A 2XWJB 3CDZB 2QKDA 3DPRC 2QBXA 1UO9A 3R05A 2Q0AA 4UF0B 1CAXB 3IPVA 2DUQA 3CO2A 5A3OA 3WDWA 3A23A 3ZFFA 2VCCA 4Q1RA 1PMIA 1X8MA 3PUHA 1ZNPA 5FPUA 1FPN1 2RDQA 3MLKA 4PLMA 2OQ6A 2R063 3FUOA 2PHTA 3OD0A 4DUVA 1UL9A 3IAPA 2VAUA 4QPIA 5AFBA 5FO8B 5FO7B 3HT2A 1DU3D 4K8FA 4OHVA 1FI2A 4GZ9A 1LECA 4AQTA 1W06A 4ISRA 4U36A 1SBDA 2FZ2A 1F31A 3LEGA 4NR1A 4YW1A 5FFOC 1JN2P 1H2LA 2WN2A 3GM8A 1Z78A 3RJRA 1ZZ7A 2W94A 2WO3A 4UW6A 4Z07A 1XU1A 3HJRA 1VRH2 4YZ1A 1DQ1A 4PLNA 5G05L 2XJRA 2VMGA 1L3JA 2XL7A 3I2KA 2JENA 1QJX3 4XF0A 1UZWA 1FOD2 4MX3A 2W1WA 3LEMA 1Y4WA 1N3QA 1OT5A 2X8KA 2FDGA 1D0GA 2WZR2 4YG3A 3I3EA 3WSOA 3A7QA 4AHZA 1HLCA 1HW5A 1OOPA 4Q4Y1 1EP0A 2AGSA 2JKXA 4PHZA 1C3HA 4R4ZA 3VN4A 5ISLA 4OI1A 4EN0A 1AL22 3MZHA 1AR93 2CTVA 3VBHA 1U5ZA 4AHXA 2VQAA 4PQQA 1X82A 5FZ9A 1OHFA 5FMOS 4W6YA 1BBT2 5EWSA 4F3JA 5IK8A 2YG0A 5A7WB 2VUDA 4R8HA 1GQGA 4YM3A 3O14A 3ITQA 4CDWA 4OMDA 4D7YA 1AXZA 3K4ZA 1DQ2A 1YLLA 1UXXX 1BCXA 1RIRA 2VG9A 3ZR6A 1BEV3 1O3QA 3CJIC 2XHKA 2ENRA 2A6YA 5HI0A 1S55A 5FBJA 4UFIA 3POFA 3FJSA 1XPWA 1A3KA 1JW6A 4QQHA 2YGMA 1PGW1 3VDBA 4GWJA 4Q5OA 3FHQA 4QPGC 2PLV3 2WSUA 4XTPA 4IE4A 3OGRA 2DWRA 4LA2A 1DQ4A 1XE8A 2DVAA 4GQ7A 4XJZA 3PHMA 5H9PA 2D5HA 1H2MA 1RUG3 3ZXJA 4QB2A 2JG9B 4XW3A 3E1F1 4QX2A 2Z79A 2ZGPA 1YYNA 5A33A 3ZYRA 1AYM3 2DCKA 3VLBB 4XFBA 3VBOC 2PFWA 3RJ2X 1LHVA 2VTXA 2UURA 2BOJA 4QT6A 2CAVA 2GC1A 4QPGA 3H42B 2W1QA 4AI0A 4WV8A 1CZTA 2XVKA 4PDWA 2JDYA 2B45X 3DYPA 4ZZ8A 2VMEA 3LEIA 1TME1 3ATGA 1QWRA 1AR61 5JI9A 2XH6A 4H55A 1OA2A 3VBSA 3BPSA 1Y7BA 2Y26A 2Y60A 3C7GA 5T5PA 1EAH2 1RUE1 5HXMA 3DYMA 1OVPA 2YYOA 4CUGA 3WINE 1H6YA 2NN8A 4FPEA 2C1FA 2HWF1 4NO4A 4PIZA 4AEKA 1I1EA 4ZKTB 3VUOA 2R042 4RQPA 2HWF3 1C5IA 3VBSC 1UY3A 4LBQB 3M4FA 3E6CC 5FREA 1HIXA 2XKOA 2BFUL 1CAUA 4K8RB 1QJY3 2WO2A 4S2DA 3RNSA 3TEYA 2YBPA 3E6BA 1VJ2A 1OUXA 1WCDJ 4IEPA 3M3EA 4AI2A 5IFPA 5DAPA 1G9AA 1TEIA 2HKXA 2EVXA 3CL1A 4MZUA 1LOEA 5FV3A 4AFCA 4UFKA 1QJFA 4XFCA 2P5BA 2XUMA 3NV3A 1VMHA 4TWTA 4CCEA 5AC92 2C9AA 3K46A 4GKYA 3HWJA 1CESA 5FZDA 1W8ZA 3E5XA 4FCAA 2Y0OA 5A7NA 5GM0A 3W58A 1DZRA 2ZXQA 1JYVA 2HEWF 1F4HA 3E5UA 3GYDA 1H8TC 2RHPA 2XDVA 3KV6A 1CD3G 3K75B 5D2AA 2V5YA 5A70A 3BB6A 3IT8A 2CAUA 2VQUA 1MZFA 3X29B 4B1MA 3M3OA 4I09A 4YZ3A 1W9YA 2GALA 1XBFA 4TLFA 3I2OA 4W8JA 1ODMA 2YPDA 5I0UA 2BBAA 4ASLA 2IXIA 2Z5WA 3R6SA 5K0UB 5CBLA 1PK6C 1WD4A 5CA6A 2ZMKA 5L9VA 2EALA 1SZBA 5L9BA 4PT6A 5ACA2 4Q29A 1W6NB 2IXHA 4RYDA 1VLNA 2YB7A 2EIGA 3HIFA 2R7EB 3JQXA 3OSDA 4Z8BA 2E31A 1SACA 3OEBA 5FYVA 5GLTA 2QZ3A 1ZZ6A 1NY72 1NQDA 4P5YA 2X5IC 3O1RA 1FV2A 4WM8B 1AR71 1IQDC 1XYPA 1ZX5A 1RMU2 3T09A 1B09A 3W5MA 4MVTA 4YGDA 3WCSA 4NIIA 4QXKA 5D1IA 1S0CA 5HV4A 1JHJA 2IXJA 4CP1A 1HB3A 1CZVA 1UYXA 3MBWA 3WW4A 1B35C 3P3NA 2VNVA 5IYYA 1FPN3 1TNRA 4CUAA 2CDPA 1AX0A 2UY9A 3WF1A 2D93A 5K4LA 3D8CA 1PM7A 4YG6A 3FL7A 2BYVE 4R9AA 3KSCA 3KV5A 3CKHA 4BOWA 4RHV1 3OPZA 4B4RA 2P3IA 2FQPA 4S2HA 5ABJC 2AC1A 2HWE3 4KU7A 4XUQA 1JOPA 3ZN6A 2PTMA 2PHDA 1MR5A 5A3LA 2RM21 5CKQA 5FZBA 4A3ZA 3V0BA 3LFIA 3ZLIA 4CDXA 3HQUA 3P1IA 4RR3A 2RMU2 2E53A 4XAEA 1GNHA 5F37A 5L7OA 5IWFA 1ENRA 5DXDA 5A3NA 3DYOA 3JQWA 4OQ8A 3PUIA 5F2SA 4Y1YA 4COZA 4AQ2A 1BMV1 3AL6A 2VU9A 2D3SA 2R041 3ZFEB 1NCQA 2PMWB 1QH6A 1LTEA 3FFQA 3Q8CA 1PNFA 4YPJA 2TUNA 5FZ0A 3RZJA 1LU1A 2BVBA 4LTAA 3ZXEA 3RSJA 2R071 3DN7A 3SC7X 2C24A 4RGKA 2R073 1GUIA 1EAH1 1RUE2 1Y9QA 2W68A 1LHUA 3D6EA 4C8DA 3KT1A 2A5ZA 4GH4A 1O5LA 1TE1B 3CZJA 4LIUA 3ZXAC 4BZ4A 3IMNA 2XJTA 4IV1B 4M0HA 4P9WA 4QPIB 3IB3A 4GB32 3GZUC 3LDBA 2JX9A 5GLUA 3USSA 2DBIA 2W87A 2A6WA 4LR4A 2XR4A 4XF9A 4LITA 3NNMA 4EJRA 5HV0A 2AEYA 2LUWA 2WNVC 2XL9A 2QCSB 2X53S 5FYHA 4NIAA 3PLQA 1RJ7A 4IE5A 1UMHA 1GWMA 2Y6JA 1GNYA 4NN0A 1CJDA 5EIYB 2RJLA 5IATA 2WNUA 4LBMA 5JSRA 1PZ7A 2QQNA 2DCZA 3LDRA 1G8WA 2P3YA 3NV4A 1K5JA 2JG8A 5EZWA 4QXCA 3APBA 4XMAA 1X7NA 1RUG1 1FAYA 3AMMA 5FYMA 4L2NA 2HLEA 3BALA 1QQP3 2RE9A 1JMUB 1JYXA 3ZYBA 4L8QA 4IV1A 5T3NA 1QQP1 1OSGA 5FYCA 2VOVA 5DAXA 5FCCA 3UV9A 2BTVC 4OMCA 2WSVA 1KEXA 2WLPA 5CFDC 2QZ2A 3LOIA 1GMMA 1PO22 3HOBA 1X9PA 2HWC3 1GOGA 2O8QA 3THTA 1R1A1 1R093 2IUWA 5J37A 5JOYA 4HANA 3KHCA 3GJBA 2ZAAA 2RS51 3MEPA 1JZ4A 5I93A 3B69A 2FBEA 1XQNA 1GYKA 4LOSA 3AVSA 1RUE3 2WDBA 5C70A 4PIYA 1O7FA 3ZKUA 4Y5SA 1SDDB 3ZSKA 4B29A 5JIUA 2WL1A 5BXXA 4BQYA 5A6YA 2WBKA 1FOD1 3SEPA 1K42A 3LIGA 1OURA 2ZGQA 2UWBA 1WBFA 1KXGA 1BQPA 4Y3OA 4FO9A 3UESA 4XQDA 5AVPA 5FR3A 1JYNA 5L19A 1IS4A 2D3PA 5GLWA 3BI3A 2CV6A 2ZX1A 5EHDA 3ZM8A 1C1FA 1SLIA 3POGA 2K0GA 2RMU3 4CU7A 2QQVA 2RG4A 2PELA 3BTXA 4FP2A 1AUYA 4Q8LA 2VMHA 1HQNA 3NL1A 5GLVA 5T5OA 3TBDA 1DLCA 1RUC3 2I2SA 3THDA 5DPNA 1OBNA 3VL8A 4N90A 3D0SA 2BWCA 1NA1B 1HN0A 2GU9A 1H6XA 2G9GA 4Z92B 3TEWA 1RVF1 5GZGA 3VBFA 2ZS6B 1JZ5A 1XC6A 3ZFFB 2DU0A 1HDKA 2OZJA 1OQEA 1SFPA 1ZA4A 3JB8A 4HLTA 4QDSA 4OHXA 1VMFA 4FSJA 3VBUA 1SG3A 5FZ8A 4ARXA 1CAVA 4LBJA 2VUCA 3POSA 1ZZBA 1FX5A 4PIXA 4N9IA 3PU3A 4Y1UA 4AI8A 4E2SA 3VBHB 4IUGA 3O1PA 3KV9A 4LBQD 3BTYA 3FMGA 4E4SA 5FP7A 5A1AA 2ADEA 2GAUA 3UNPA 3SXWA 3TOJA 3K77A 1WGPA 2OX0A 2VVEA 3IZOA 4UFMA 5L73A 1G9BA 3UYJA 3WUCA 4EZHA 2BGOA 5LA0A 2VULA 1CZSA 3BN6A 3S0MA 1GOHA 1H4GA 2I45A 5I0RA 5FZ6A 1S2BA 3UL2A 1F35A 1MEC3 5FY0A 3LB9A 1AL21 1AR62 3AZYA 2BGPA 4IEZA 4P9IA 4PDWC 3MLLA 5J96B 1POQA 2FMYA 1OOPC 4B7EA 5LY2A 1W2OA 5FXZA 3VBFC 3I3MA 5EQUA 1GQPA 3AP9A 2HWD1 2ZACA 3M3IA 1DZQA 3PTRB 4LULA 2E26A 2VECA 4M3CB 3V64A 5GZCA 2RS12 1V6IA 2W08A 4XUOA 5B4NA 3ACFA 2W5FA 4C1WA 1CR7A 2VCAA 3KT7A 1ND2B 5LBEA 4DPNA 1IHMA 4CDXB 2DF7A 2WNVB 4FPCA 5AC93 4AQSA 1H2NA 2JECA 2A6ZA 1UW8A 5DMYA 1PGW2 2Q1MA 4J1WA 3W20A 2VXJA 4LQRA 5BNOA 1EPZA 2ZGRA 3VHPA 1CWPA 4NIDA 1IPSA 2WNUC 1RHI3 5KHIA 2BJSA 4M3CE 2HWD2 4YVWC 4MGTA 5F3GA 5FY8A 4CDWC 3N9OA 3P3PA 3TN92 1YXWA 2IWGB 1KGYA 1POV0 3HQRA 2P37A 3KWVA 4FFIA 4W4ZA 4EN8B 1AJOA 3KF3A 5EYXA 4UAPA 1U0AA 4OI2A 3VBRC 1RUJ1 3LKJA 4XQWA 2QQOA 1I6XA 1MQTB 1YC61 5J09A 2QFEA 5CVRA 1C1LA 1ODNA 3IIIA 3SCGA 5DZEA 2YXSA 5A6XA 1V6MA 3S5AA 1JOJA 1W2NA 2ZABA 5FY1A 1AYM2 4FTBA 2VW1A 2GDFA 4P14A 5JLVA 2UWAA 2ZBJA 1XNDA 4YGCA 4NPMA 2LALA 3RMYA 4BLIA 3BUCA 1IPKA 2G1MA 4BCUA 5FPAA 3G6JB 3OGJA 4X8PA 3MIGA 2PLV2 2ZX2A 4S2GA 3MFAA 2WUHA 1UY4A 4NUBA 1K3IA 2HYKA 4YYOA 4DRRA 3H8UA 3ME2A 4AF9A 1EY2A 4D0QA 5LBFA 5K8SA 2QQJA 2FDJA 3U75A 1QXPA 2NLRA 2VVDA 3SH3A 4QDQA 5JR7B 3VZKA 2WNVA 1YJLA 4HPKB 5FXWA 1RUJ2 2JB8A 1SFNA 5JOWA 1W28A 2BBVA 5FO9B 1L7LA 4IESA 2YC4A 2D6NA 5EV7A 3DV8A 2E33A 4N43A 1P8JA 1S0DA 3VKOA 5ANNA 1QOTA 2J1UA 5A32A 1O4TA 2GH2A 4A7ZA 1Q3EA 4CZSA 1C8M3 3GBGA 4EWDA 4KWKA 5LRRA 1ZA7A 1RUF3 1URXA 5FLIA 4CPBA 5BNQA 3T2TA 3ZN5A 4YW3A 1KJRA 5IVEA 1QJZA 4OUMA 1NCRC 5FWEA 2CGPA 1CPMA 1IS6A 2XWBB 3BIWE 2XLAA 4Q4X1 1FOD3 1NCQC 4AYUA 1PIV2 4Q4X3 3TNPB 4DXTA 4NOTA 1A8DA 1W6MB 3POBA 4QQ2A 4HK8A 3D4KA 3WG3A 2XJVA 4XMIA 2DYCA 1SBEA 4RSUA 5IVBA 3AMQA 5JPMB 5D8AC 1VAVA 2YMZA 1HRV1 4A45A 4TLGA 4CDXC 1ALYA 1WW4A 1BLZA 4XFFA 2KD7A 4D7SA 3BOWA 4M00A 3WX5A 4AWDA 4YM2A 5FPXA 3O1VA 1N1SA 1VAKA 2ZMNA 3FBMA 1AVBA 5FZ4A 2PHLA 4YG0A 5C4WA 5J48A 5IK5A 5A1LA 1CX1A 1VBD2 2A6XA 4HONA 2DTYA 3VBFB 4EN6B 4FPLA 5FZIA 4E4HA 4MV2A 4PI0A 2XBO1 5JMCA 5LEJA 1RUH3 1W8OA 4NJ4A 5F6LB 2GMEA 3WG2A 1PVC3 1US3A 2JDMA 4F7ZA 4NHLA 5JMOA 1D4M1 1AR91 1J3QA 4DOUA 3H7JA 3V0AA 1RB8G 1TME2 1Z7S1 1GZTA 5FMDA 1RC6A 1DQ0A 3J9SA 2P1BA 5FY5A 5H9QA 1FT9A 1OKOA 4CDQB 3CZUA 1JYTA 4L99A 2DVGA 2QTWB 3DKQA 1VBD1 4YLZA 4FTSA 3AKSA 4PBOA 3KCCA 5KBFA 4L92A 3MF6A 1ULEA 5DABA 4I30A 2H0BA 3FHIB 1CONA 2C5DA 1ACCA 1JTZX 1PK6A 3MUY1 5F6KA 2F6BA 5HCFA 4CU6A 5CFCA 1ND3B 2QQMA 4OHYA 2C26A 4AGVA 3OG2A 3WQ1A 1PVC2 2ORZA 1E5RA 4QB6A 4LUKA 4E8CA 1SDWA 1UPIA 4N8MA 4UWDA 3CMGA 1WMDA 1OOPB 5FZFA 1RXFA 4LO6B 5A7SA 2VZ1A 2DTWA 5ABJB 1H8TA 1LOBA 2HWB3 2WO7A 2ZHNA 1RUNA 2GNMA 2UU8A 3NKGA 3ZDSA 2CSGA 5AVAA 3K4AA 4QWNA 4LO8A 3S7EA 4EWEA 5I8SA 3SCHA 4OVEA 1WLWA 3ROUA 2XLGA 3JCIA 2VOKA 4Q0QA 1GP5A 2VZ3A 2WC2A 3Q9OA 3SITA 5LA1A 3HT1A 1YI9A 2EA7A 2W92A 2ZAHA 3CHXA 3OGSA 4FPJA 5FZHA 1AX1A 3THPA 1UU6A 4IEOA 4BPZA 1LEMA 3MI8A 1REEA 4KWUA 3I8TA 1PIV3 3HR9A 4JGYC 2YROA 4Q4X2 3RZZA 1EV13 3VZNA 1IS5A 1OQ1A 3TRSB 2PHFA 4Y4RA 1UOBA 5H9RA 3S7IA 1UXZA 4GXLA 3CIHA 4TSVA 5EXOA 2X09A 3ZO0B 4X8NA 4OQ9A 1PO12 2E7AA 2JD9A 2D6PA 3WHUA 4BQ3A 3OY8A 3WP3A 2E51A 2PA7A 4XXPA 4DEVA 4D7TA 5K7PA 2ZGUA 1GP6A 4NRMA 1OD5A 3VDDB 1LHOA 3JZVA 1YQ2A 3ZMOA 3JD71 1F8VA 2DUPA 4LHKA 4LPLA 3DUIA 3UGHA 1Q8SA 4KMQA 3JD73 3WD5A 4DNYA 1RUJ3 4IE7A 2WZR1 3IN9A 1KS5A 2WAOA 3I59A 5KXEA 2F4PA 3PNAA 4PF5A 5FMBA 2J7MA 4GMP3 4UT5A 1C28A 1MS9A 5JXIA 3H9AA 2YPJA 1JZ8A 3MLJA 2VJXA 4KL1A 2OYZA 3UGFA 5FYIA 2WA3A 3J8F3 4XDOA 5F32A 3WF2A 4DMIA 1G7YA 1HV1A 1SLBA 3VZJA 1F2NA 1BZWA 3R4SA 4JTOA 3TWIA 1D0HA 2A1XA 4ARYA 4N7UA 3OBAA 1K12A 1UU4A 3WR0A 1H9WA 2D6LX 3HPNA 2ZA9A 3VD3A 2AUYA 2HWE2 2Q4SA 4IL7A 2P17A 2XLFA 3CJIA 4AVSA 5I8YA 4YVWB 3OB8A 2RS11 1R1ZA 2GN3A 2VW2A 5JPNB 4A42A 1PO11 3HBZA 3AP4A 3K3NA 3HAGA 3FN9A 5T52A 4A7YA 5A6ZA 1LOFC 2YBKA 2WZPP 4PCRA 1JODA 4YM0A 2UYBA 4K9SA 4JRLA 3UJOA 3V0BB 2Q30A 3HNMA 1CPNA 1W0PA 2D6MA 4IW3A 4JKMA 4LKSA 3ZMNA 1N3PA 5KHHA 1UQXA 4AEDB 2BERA 1O4ZA 2Z69A 4R4XA 1W03A 4UFJA 4D3WA 1OH3A 3OJBA 2R16A 3KCXA 3J26N 2TBVA 3OGGA 4UBHA 2ARXA 1C8M1 5A7QA 4A4AA 2GNBA 4IQPA 4M01A 4A6SA 1I5PA 4XDQA 2XPJA 1H4HA 2B46X 3JUUA 4CDUA 2VVFA 2VOTA 4A7KA 1YIPA 1JU3A 5ACA3 1JUIA 1HB4A 2CHHA 1V6NA 4E4DX 1ND2A 4EQVA 1U5IA 5CG8A 4QKDA 1E5HA 2JD4A 5TSWA 4RHV3 1W8TA 3LZZA 4YRDA 3O5SA 4AW7A 1XNCA 2HWE1 4CDQC 4XACA 5A3UA 2D44A 3VBOB 4CU9A 1QKQA 5C3PA 5GJ6A 2ZMLA 3RI9A 2NQYA 1LU2A 1NQJA 2WZ8A 5D8AA 5GZFA 4N9HA 1X8EA 4HPKA 4IEYA 3ZSMA 1KDKA 4RGAA 3QBQA 2Q8DA 2WQ4A 2VPVA 3OPTA 4P9XA 3WG1A 4TYSA 2VH9A 5FXVA 3WP6A 3NW4A 1M06G 1OFSA 2KA3A 2VZRA 4QKNA 1WLCA 5GZDA 4DRVA 3LAGA 1IZ3A 4EV0A 1NCRA 4CEWB 3DCQA 3ZFFC 4ONUA 1AF9A 2E7TA 3AMNA 2ZKNA 1BK0A 1MZ5A 1ONAA 2OXBA 4CP9B 5JAXA 3RZKA 3PU8A 4MGIE 4DUXA 4COVA 1TMF3 3EB7A 3KV4A 3OBZA 4O9GA 4RFT0 1CAWA 2GN7A 2VY0A 1Z7S3 4ZS2A 2O1QA 2VBDA 3ASIA 4NHKA 5C7GA 3OY8B 1V6OA 4LKFA 1MS4A 1OH4A 3AK0A 1AX2A 4MG2A 4GJYA 1H9PA 1UZYA 2YFUA 1VBB1 3DEMA 1DG6A 1MZEA 3KGLA 4WBBA 3TN91 2B42B 5B2GB 1W6QB 3RZGA 4CRQA 5LATA 2VL4A 1VBD3 3I2IA 3IDAA 1D7PM 4AQ6A 3WW1A 2J1SA 1BVP1 3HD8B 3PUQA 4Z2WA 1NCQB 1VP6A 1AR83 3MYXA 4EZ4A 3ZR5A 3DXUA 1M4WA 3O1UA 4RR3C 5L7OC 1ZM1A 3VD4A 2GNTA 1OLQA 5GLZA 1JYWA 2G9FA 3B01A 4QDRA 4ZONA 2X10A 1U5XA 4RS5C 1VBE1 3J7LA 5ABJA 1AR82 3O7OA 3I49A 3VHNA 2C6SA 2GNDA 4NVPA 1GR3A 2PHUA 1GP4A 2PHRA 4HZFA 2CDOA 1ENXA 4Q27A 4GA9A 4CCMA 1WA4A 3CLPA 1ENQA 4EYUA 2XQRA 1IKQA 3WNPA 1I5ZA 4LHNA 4N53C 2Q8EA 4DIQA 3VD5A 5C4WB 4FOVA 5ANQA 4I0WB 5JZGB 4IV3A 3E5QA 5FP4A 1U5YA 4SBVA 2YC2A 3QH6A 4FQ4A 4MGYE 4BXSV 2VTFA 2VM9A 3O0WA 2VBBA 1VALA 1K5MA 4XIOA 1ZYBA 5FLJA 1QHDA 1LGBA 3FE5A 3E97A 2W0XA 2IFWA 2CYFA 3AMHA 2RDNA 2R30A 3N9LA 5FPBA 5IVYA 1WA6X 4BQ4A 4CCDA 4DXSA 3O1TA 2PXJA 4JGZC 4GH4B 1VMJA 1V6KA 1MQTA 1AR92 1MS1A 1PZ9A 1BJQA 1UY1A 1VB4A 4Q4V3 1FATA 4X6RB 4JV4A 3VBUC 1QOOA 4Q4V1 1N47A 2HWC2 1E5SA 2WYSA 3CJXA 1DGRN 2W95A 1H1IA 2NMOA 4WVWA 5A7WA 1N3OA 2EAKA 2PHWA 3R0RA 4YGBA 3PJYA 4META 2VZUA 4QGNA 4ITCA 5IUQA 4EN9B 1G9DA 2IZWA 1O6UA 3H1WA 4CCLA 2ZEWA 1HXS1 5CFCB 4XF1A 1NKGA 1SEFA 2E63A 1UOJA 2HYXA 2J1VA 1RUC1 2WABA 4IV3B 3WP5A 3BTZA 1VAMA 3H50A 3NWKA 1IOAA 1D2SA 4HSJA 3WZ1A 1WWYA 1VE0A 1UZ0A 1Q8VA 4YW6A 2P3JA 4NAMA 1QIQA 1UPSA 5JVVA 2QNKA 4BK5A 2ATFA 4CU8A 1SPPA 4XJ9A 3CQOA 3USUB 1UAIA 1YFUA 1WLTA 3OUIA 3SISA 3GCXA 4Y1XA 2H6BA 4AVVA 1HKDA 1OD3A 2KM2A 1US2A 1XNTA 4HVOA 1GZCA 1VIWB 5CISA 4JDMA 2WT1A 4AG4A 1DCSA 5EJZB 2ET7A 3B9IA 2Q8OA 3V56A 4BQXA 1W6MA 1LAJA 2R062 2YY1A 3ZIWA 4CCCA 3NQHA 4XHXA 3MPBA 4LBNA 3RRDA 3WQ0A 3NO8A 5L9RA 4QGLA 3ILRA 4OULA 4BIFA 4ISQA 1HRI2 2YGLA 1VBB3 1KDMA 1FNYA 2XUEA 4SLIA 1AR73 4CUBA 5JOXA 2DBNA 5FZCA 3UJQA 5C4WC 3POIA 3AYDA 4JGYA 4BQWA 5JZGA 3VD9A 3I3DA 4QXHA 4AEDC 4AE2A 3ZPOA 1J58A 4I3GA 4HOOA 2GZWA 1W6QA 4BMBA 2IXCA 3B94A 3BTAA 3MIFA 1RUD3 3N36A 3FUQA 4H14A 4XTMA 3NJYA 3KQ4B 4D6SA 1XXNA 5C6CA 1RUD1 1SPPB 1CN1A 5LASA 3ETPA 4OHZA 2MNGA 3ZXFA 2Y6GA 1COV3 1JI6A 2FZ1A 3FFZA 3NRUA 4Y4YA 5DDJ3 1LHWA 5A80A 4WVMB 1V9U3 3FLRA 2ZEZA 4YZ4A 4XAAA 4AI3A 1KQRA 4PQ9A 1VPHA 1Q5OA 2ETEA 3PUSA 3O1SA 4AXOA 4AVBA 4AFDA 4LK6A 1S0BA 1S2KA 1RL3A 4U2AA 5FP3A 4WM7A 1R082 1U12A 3HNYM 5C8CA 1JZ2A 2GP5A 3PURA 5EYYA 4D8MA 4AI1A 1R1A3 3MUZ1 2ZGOA 1NLSA 1EUUA 2X29A 2D97A 1FMD1 2NM1A 5KXDA 4HFSA 2X5IB 3RZMA 3AYAA 4YVSB 3TB0A 1A78A 5FXXA 3MPPG 3O0VA 2BDRA 3O0XA 3SEEA 5H9SA 4FPFA 4QHBA 3W9AA 2LM3A 2AZ5A 1CAWB 5DZFA 5K9YA 3L2HA 4Y5Z0 3VL9A 1QDCA 2JDNA 5LY1A 1X9TA 5FZEA 3LE0A 5FZOA 2HBTA 4EWAA 4IGQA 4IERA 3PVNA 1RITA 1IPJA 4Y20A 5FYZA 2OKXA 4INDA 1RVF2 1VBC3 4XUNA 1DZTA 4KGGA 1YI7A 1NXD1 1VBC1 3WNLA 4HXCA 3VGIA 3AKPA 2A73B 2W9XA 4Z82A 4BU2A 2UYAA 4C1XA 1V6LA 1UZZA 4RFRB 2AEZA 4NIGA 4XILA 4RN5A 1DIWA 4QU1A 2ADDA 4OYUA 1VBA3 3POJA 1OA4A 4XF4A 4HKWA 3T1MA 5LB6A 4Q4W1 3W5NA 1H30A 3M7AA 1AR81 4Y1VA 4NROA 5DZGA 3OPWA 2DFCA 1VR3A 3ZFGC 3MF9A 1HQLA 4LHSA 3WY6A 2RS32 3MFCA 4CYDA 4XIKA 2XVGA 2ZX4A 4DZGA 4QPIC 3JBG3 3GXUA 3T08A 4ATFA 1W8NA 1I9RA 2LW8A 2RR11 2G9ZA 3A0NA 2JDZA 4XE9A 3T2PA 1STMA 4XOGA 4K1YA 1WCKA 1AJKA 3NSTA 4A41A 1B35A 2QQKA 5JI7A 2ID4A 5JXGA 1W39A 1PMJX 3ZXKA 3OGVA 4GJZA 3BOPA 2CY6A 5IVFA 3BPZA 5LEKA 1ZRRA 1R091 2BZDA 4LO4B 2HWF2 2Y38A 1T6GC 1AR72 4NPLA 1SLCA 4XFAA 4MO3M 4O9EA 4RA0A 1CGPA 3DGTA 3OUJA 1GOFA 2VW0A 1O3SA 3I3QA 2WIIB 1XNAA 1EYBA 1LOFA 4QX1A 1BXHA 4IEUA 2OPWA 1QU0A 1PGSA 5BY5A 3WF0A 5HXVA 5FOJB 2BNOA 1HV0A 3NJZA 5FZOB 3ZDVA 2DDUA 2WLQA 1KFUL 2DFBA 2P6CA 2VBPA 4QHOA 4AOCA 3C7EA 5GZEA 4CP0A 2RS31 4PI2A 1JBCA 1W2AX 4G9SB 5EPAA 1LULA 5A7OA 2EICA 1HRV2 5DAVA 4GMP1 5HBAA 1Y3TA 1FYUA 5C3SA 2JXAA 3N7LA 1QY4A 3SNMA 2RM22 4FXKB 4YW4A 4RGGA 3ZXLA 2D5FA 3C8XA 3FC0A 3GDBA 1RHI1 2UWCA 4CCKA 1MACA 5A3PA 4HL0A 1QJX1 3EXUA 1QMJA 2Z4FA 4KI5M 1DFQA 1GLHA 2QE3A 3KZ4C 1RUI1 4FPHA 4JGZB 1D4M3 3VBRA 3WHTA 4E8DA 3I2FA 2JE9A 5BNPB 5JUVA 3ZX7A 4AEMA 1OI6A 2WWUA 2W2IA 3KVAA 4OI0A 1PGL2 3AYCA 3UKVA 2BFUS 1G9FA 4XFIA 3P6BA 4CE8A 2R072 4ATEA 2XOMA 1AYN1 3OYWB 3B3QE 2JJ6A 2BU9A 5LBCA 1ASJ2 1ASJ3 4IEWA 3K48A 4D6RA 4Z2AA 1BBT3 2O14A 4PBPA 1LJ7A 2OT7A 4N53B 2QDNA 2AH2A 3LQCA 1WCUA 2BP6A 4A44A 1S0EA 1ZZCA 2ZGKA 1S4CA 1AL23 4P5HA 4BB3A 1G9CA 3MDPA 2XXZA 1OF4A 1VRH1 4YSFA 3B02A 2VCMA 2IVJA 1S0IA 3K3OA 3WLUA 2W91A 4WM7C 2Y6KA 1TZOA 1Q8PA 3VKLA 2B4KA 1PNGA 1R64A 3OTFA 4MGQA 4P08A 2Y8KA 1LKNA 1QJX2 3NVCA 1HN1A 1OA3A 4JX0A 4LXLA 1E57A 2JB4A 3AMPA 3N9MA 3PDQA 3HNBM 1YQ8A 4JQTA 4MSVA 4P9GA 4Q2FA 4GKXA 3NV1A 3KF5A 2QQLA 4RR3B 5L7OB 4XCAA 1SLTA 1CVNA 3OYWA 4B8EA 3N9NA 3RVHA 1ULFA 3N7MA 3FX3A 3HN3A 3QCWA 4LOTA 4UW5A 2MHFA 5C5UA 4HETA 1O3TA 2PAEA 3AJZA 5IFTA 3ZYHA 3KT4A 4WM7B 1W9SA 1LHNA 2A3YA 1WMFA 5FYSA 3VKMA 1Z0HA 3PTYA 2OQ7A 1ND3A 2WNUB 1J3PA 3CEWA 2NPIA 4L9BA 4RQPC 3U4XA 4YFZA 2XVLA 4JC1A 2P4EA 2XMLA 3PUAA 5FJHA 2RV9A 4C0HA 1FMD3 1GFF2 5FUPA 5B4XA 1K5MC 3MO4A 4Y24A 1NE4A 4ES9A 2VGDA 2XKPA 2ZEYA 1ULDA 2PHXA 1Z7S2 2VZOA 2JE8A 4LBLA 1LRHA 3U14A 4K7JA 2YV8A 3U10A 2GMPA 1KS4A 3D0JA 4YW2A 1SHWB 3EBRA 3WNKA 4HVQA 5KR7A 1H8VA 4YGEA 4EE2A 1GQHA 2VR4A 1ZBE3 2MEV1 1YRZA 2IXKA 4OUSA 4TN7A 5CYYA 1ZVFA 2DCJA 4QKFA 4CP2A 3B00A 4DINB 3R4DB 4BDVB 2AYHA 3VBSB 2EXHA 3KCYA 4AI9A 5I0TA 2ZTNA 1H1MA 4DY3A 5ERLA 1ZBE2 2HJIA 5J36A 1RJ8A 5LWBA 2JG8C 3SHRA 1GBGA 2JDHA 3S6PA 4YVSA 2FDFA 4RHV2 1OC1A 3SH4A 1VBA2 1QJY2 4L97A 4NHYA 2BW8A 3WDXA 3I2JA 4JQRA 3PL0A 3Q8BA 2ERFA 4JGZA 4NHXA 3U78A 2GC3A 2B5HA 3JBG1 1BK1A 1DLLA 3M70A 3CJIB 4TXWA 5C8CB 5JWPA 1F15A 1Q8QA 4I02A 5FUNA 3WOGA 2L9LA 2WWSA 1MS3A 1BBT1 4N43B 4COUA 3N9PA 3AJYA 5C9AA 4QAWA 4FPKA 4IV3C 3FLTA 5IVCA 2XG3A 5T54A 1RUOA 2TEPA 4L11A 1NA1A 4N53A 2A3WA 3AP5A 1HQWA 3NV2A 3PVEA 3WF4A 3UKTA 3ZOIA 5C3RA 4IEQA 2VXRA 5FZ1A 3TEZA 1X33A 1MS0A 5ACA1 4NPRA 4LNVA 1QXJA 2EIEA 2QQPA 3AX4A 5DUUA 2R32A 2J22A 2A75A 1XJAA 1DYOA 4UBGA 2VZVA 1SQ4A 3BGAA 3RZLA 4XZPA 1YWKA 1ZRFA 3J4UH 5JXJA 3CF6E 3GBWA 3M8LA 3ON7A 5CAZA 3NJVA 1C8NA 1YEWA 3ECQA 4OI4A 4CCNA 2SLIA 3TEXA 4ZS3A 4UYBA 2VMCA 1NUKA 4DXZA 5M0TA 1O3RA 4HKLA 3I2DA 1ULCA 3LPGA 3K51A 3PMEA 2E9QA 4ZXKA 3MW4A 3PMSA 3NJXA 4LT5A 1V9U2 1BEV2 1WD3A 4Q26A 3SCFA 1W05A 4BM8A 5BNOB 4QB1A 4NIHA 1DBNA 3QH7A 2GH8A 3ELNA 3WNXA 1OF3A 2VE1A 5C71A 2ZJCA 3RYPA 1H1AA 3RI8A 3MIDA 2XBO3 4KBZA 5FP8A 4XFHA 2Y64A 5IW0A 4BA6A 4QX5A 1IG0A 2QDRA 1GWLA 4D94A 1W8UA 4KBBA 3U0ZA 4ASMB 4LKEA 1NA1C 2Y0IA 1S1AA 3PJQA 4KH9A 4CCOA 4XF3A 5A33B 5FPZA 2C4XA 1APNA 5JSOA 1S2EA 4TTGA 2ZZQA 3J7HA 4JRAA 2ORXA 1UX7A 5KHKA 4QX3A 4LBQA 1Y9GA 3SQOA 2AENA 3HMYA 4JHTA 4W50A 4JTNA 1GU3A 1NG0A 2O8OA 2WZR3 4XJWA 1W3XA 3H7YA 4UI9L 2NMNA 3KQRA 3G7DA 1SFYA 2I07B 4KG0A 5FMOL 1JZ6A 1UIJA 2AR6A 4AAXA 5J1XA 2Z2SB 2F17A 1OVSA 1UD1A 3IWZA 2W1UA 1ZREA 4FFHA 1VRH3 1PO21 1WW5A 3HEIA 3LCPA 4P02B 2R6QA 1PK6B 2B9UA 4ASKA 5DAWA 4B3NA 3N9QA 4YZ2A 5A1FA 4GMP0 2WFF1 1XSRA 2BNMA 3U4SA 3T2OA 5FYYA 5LBBA 2XONA 4MXVA 4AL9A 2JIJA 3O1MA 4FAGA 2W3JA 3P5BA 2ZHLA 1QNYA 2VZTA 4E2GA 3IDBB 4E4ZA 2JG9A 3GZEA 1QEXA 2JICA 4S2FA 2WA4A 3M3CA 3DECA 4LLFA 2A71A 2QJVA 1SCRA 3FHAA 4Y5TA 4DB5A 3H8XA 3HVDA 2JWPA 3ZIXA 2B7YA 2CGNA 4XQ4A 4BMEA 3U37A 3VZMA 1O8SA 3ILNA 4Q1PA 2EF6A 1UY0A 1UIKA 4XJ8A 1ULPA 4BE3A 4Q0VA 1LNSA 2W47A 4V2VA 4AHWA 3MHZA 2D40A 3ILFA 3OBTA 1DGLA 5C9AC 1BHGA 2VMFA 1RMU1 3AXDA 3DF0A 3ZN4A 5E6HA 3I2HA 4AVAA 5KC6A 4CEWA 2IXLA 2OUJA 2VC9A 4E27A 3ST7A 3WQBA 1XYNA 2EIBA 4AZZA 4CVUA 1LGCA 1LOCA 1SCSA 2XQXA 1W6PB 3OBRA 4IEVA 4YVWA 4BIOA 3N35A 2VNRA 5CZKA 5A6QA 2EIDA 4FPOB 3WW3A 2ZX0A 4OZXA 1VB2A 3F2ZA 4OUEA 1UZVA 3RYKA 2RS33 4FVVA 1S0GA 1CQ9A 2B39A 4FXGB 4BWOA 5C8CC 1W6OB 1EUTA 2Z42A 1RUH2 5E88A 3ZFEC 3VB9A 4G3YC 5FK7A 2MEV3 4DXRA 5A3MA 4D6QA 4UOJA 4FAHA 3M2MA 2WQZC 3U1XA 3BYWA 4P9LA 3A22A 4JCKA 3VBOA 1ZBE1 2ILMA 3ORJA 5DN2A 5J98B 3AFKA 4XFGA 1DP0A 4YARA 2V5DA 2DCYA 3WNOA 1OUSA 1LCLA 3AZZA 1DGRA 4ET7A 1VBA1 3NAPA 4PJYA 4NE9A 1DGWA 4Q4W3 5HCHA 1LGNA 1S0FA 3H8OA 4NRQA 4LORA 3VBUB 4Q4Y3 2MPFA 2J1EA 2E6VA 4AEJA 3ZFEA 1RVF3 1VBC2 4GWMA 2XB6C 4FFGA 2A6VA 4I2OA 1QJU1 1RUI3 1NCRB 3D82A 4Q0PA 2DURA 4C91A 5LW9A 1TMF1 5F3IA 5FPVA 3GCWA 5F8PA 1PX3A 5CFCC 4DO0A 3ETQA 1DQ5A 1ZBA3 3W21A 2RR13 4AHYA 1TNFA 5T55A 1AHSA 1GKBA 2F4LA 1ZZ8A 1CJPA 2CL2A 4QQOA 5D8AB 5JIAA 2A3XA 2GC2A 2Q5TA 3ZPYA 1L7QA 2VUAA 5BNNC 3LEKA 5FJKA 4UF0A 4I0AA 4K20A 2D6OX 2E7QA 4NMIA 4HMZA 1GNZA 2Q8CA 4KNCA 1QJEA 2D3RA 4KU8A 4IGOA 1BKZA 4JGYB 4M3CA 1OPOA 1XNKA 4URTA 4OFGA 2BNNA 2VO5A 4RQPB 4MGSA 5E1RA 4CDUB 3KB5A 1ENSA 4R52A 1H8TB 5K0UC 1H0BA 3L2YA 5T5LA 2D98A 5CU1A 4B4QA 1CIWA 2ZHKA 1GZWA 2HH9A 3KS7A 4B1LA 5C3QA 1HB1A 1V9U1 1W3VA 2LTNA 1W90A 2DVDA 2AREA 2XJSA 1RTVA 2Y6LA 3I59B 3B7MA 3QLQA 2CNAA 4A3XA 4ZZ5A 2OUHA 2QQUA 1OLME 1IG3A 3MGUA 5IAVA 2D6KA 3ZYIB 2RJKA 3LIHA 2V4VA 4B4PA 4DS0A 3K2OA 1MQTC 4LO7A 3FZ3A 3ACIA 3AP7A 5F7UA 3WV6A 4HT1T 1XRUA 5EFUA 3UGGA 4YZ5A 2R043 4CSWA 1VBB2 1DGWX 1FMD2 4B7KA 2J1TA 4GB31 2VNGA 4AR2A 4UFLA 2J42A 4XETA 1EAH3 1V0AA 1JZ3A 4WVVA 5GALA 1K45A 3JB4C 4C0BA 2WJSA 1ULOA 3J7NA 4G4FA 4N43C 2W46A 3I7DA 3EQEA 1GWKA 2D7FA 2DU1A 3ZKYA 4W65A 5F5CA 1DYPA 2H6CA 3NNFA 5A3WA 5KHGA 3RZHA 3AFGA 3I3BA 2IVIB 3TN93 2VOWA 2XGXA 2E32A 4PF1A 3WVJA 5SV8A 3IDEA 2BVVA 3BODA 2W52A 4XJAA 4Y22B 5F39A 4LKDA 1LOGA 1YFWA 4XC9A 2UY8A 1G6NA 1QJU2 4RS5A 1UKGA 1RUG2 4LLOA 2Q1ZB 4BLJA 2P3KA 5T50A 3AKRA 4GAZA 4LEJA 5FKBA 2JG8B 4HN0A 5DG2A 1A8MA 3WCRA 1JH5A 4KGQA 2WFF3 4Y1ZA 1WMEA 5FUIA 3Q8AA 5IK7A 1XYOA 1NYWA 4NAOA 1SBFA 5FY9A 4P9JA 2DV9A 1PM4A 4XDPA 4RD7A 2EAAA 3POYA 5LA2A 2EXJA 4Q4V2 3H3LA 4UFHA 3WUDA 3R4UA 2RS13 4FPGA 1UYPA 3C7FA 1YFXA 3Q8EA 5FK8A 3KLSA 2ZKLA 5I0SA 3C3VA 5FMCA 2WZEA 2WQ8A 2VZSA 3GNEA 5FWJA 5FY7A 3FBYA 4ZU5A 1ULGA 1FV3A 5A32B 1NT0A 2D43A 4X6QB 1NE6A 2QVSB 2XJQA 3LFMA 3WNNA 4GWIA 4M3CF 5CIRA 1UWWA 4O61A 3MW2A 1MEC2 5C5TA 1V6JA 3JU9A 2J1RA 1B35B 3JXSA 2CWMA 3GHMA 1DDLA 4Q0UA 4IGPA 3BKZA 1D4M2 2X5IA 2FDIA 1LENA 4QHZA 5HPOA 1QOSA 2KR2A 5DUXA 2PAMA 5FZLA 1Y43B 1HJGA 2WS91 1ZBA2 2R1BA 2XJPA 1CAXA 3IPVB 1WW7A 2WS93 3RPQA 3ZYJB 1YNAA 4IETA 4Y26A 1JU4A 1QJY1 3OF1A 2JIGA 1W2TA 4IE0A 2RM23 3PIJA 3WNMA 3AKQA 3GJAA 1HRV3 4WVMA 3VHRA 1VRBA 2ES3A 2ZGLA 3ZFGA 5FPLA 4CXXA 2B8MA 1N1YA 4JDOA 1W8HA 4CDQA 3QOPA 3Q8FA 4JKLA 5SV5A 3SMHA 4MYEA 2HWB2 3ZSJA 2BWAA 1JYIA 2B9VA 3K4DA 2IFRA 4HBNA 4HVRA 4FP3A 3HQXA 4GWNA 5CKNA 1YFYA 2FCTA 4QU2A 4RS5B 4COYA 1UY2A 5L36A 1KRIA 1J84A 3F95A 3KGZA 3ACLA 3IMMA 4CDUC 2K46A 5E16A 2AACA 3SH5A 1O8PA 1RINA 3RMXA 1S0JA 3GGLA 4XURA 3A4UA 3I2GA 2LS6A 1AZDA 1PVC1 1QNWA 2LROA 2FDHA 3OD4A 1LODA 5BYNA 5APAA 3WW2A 4CPBD 4XPVA 3UETA 1ZBA1 3VZOA 1TMF2 3IAQA 5JZGC 4MLOA 2OPKA 4OHWA 2RDSA 4FOYA 1DQ6A 1ASJ1 3V0AB 1QH7A 1AYN2 1AYN3 4H7MA 3EJKA 5DG1A 5FLHA 2JKBA 2JDUA 4ZPIA 4MUVA 4GULA 1KFXL 2PQQA 4LHLA 1C5HA 2ZOEB 5BNNB 3T4HB 4XEZA 3RQ0A 2ARAA 1R092 2BQPA 2Y6HA 4NWVA 1YQCA 4MHUA 1XSQA 2VUJA 4CDWB 5BNOC 1DYKA 3ES4A 4YVSC 1PO23 2ARBA 1YUDA 4AVCA 3KMHA 1GZ9A 4BYYA 5KHJA 4MOAA 4LBOA 2WNOA 3M3QA 3ZVXA 2GC0A 3VDCA 2VZPA 2OVUA 4MHRA 2ZGTA 2DVBA 3IM0A 1J83A 4QKBA 4IXLA 2PLV1 1UKRA 1WZXA 4XUPA 1C4RA 1GSLA 1J3RA 1V00A 2VNOA 1PMHX 2CU5A 2ZHMA 1ST8A 2BGCA 1I3HA 2PQSA 3OCPA 3AP6A 5FZGA 1YCIA 4MGZE 3O12A 3M1HA 1Q56A 3LGRA 1W0OA 1ZRIA 4CXWA 2YDEA 3ZXGA 1SLAA 1UOGA 4AVTA 3FWEA 3PVBB 5F5QA 3S57A 2WNEA 2WN3A 4IE6A 1QF3A 3CU7A 2ZEXA 4QPGB 3T0DA 5CADA 5G04L 2WS92 3GHNA 4ZU7A 3USUA 4LO5B 3V65A 2QQIA 2KXLA 1PIV1 4AFMA 5F1RA 1AXYA 4D69A 1W04A 2GSYA 1BYHA 1T2XA 3AZWA 2YZ4A 1W6PA 3CBNA 3DXTA 4QX8A 5CNAA 4XCBA 3VHOA 2DCTA 4BH9A 3OEAA 3EYPA 2BPA2 4BQ2A 1XE7A 5BV6A 1RUF2 3HBKA 5IVVA 1CAVB 4GB33 2WR9A 4HSLA 3N7KA 3ABZA 1OFNA 1R1A2 3I97A 2ZCWA 1R081 3N4MA 2I74A 3LA3A 2VMDA 1R083 3AL5A 1J1TA 1UN1A 2YU1A 3UKNA 4BXFA 4C90A 4PDWB 5F3CA 1JUHA 4JHZA 1QXRA 5CB7A 4R9DA 3KM5A 1HXS3 5FRAA 4MXWA 4CEYA 1REFA 3J8F2 3ZFGB 4XJUA 5EJ1B 1MVQA 3INAA 1TQ5A 4O65A 2Y6FA 1HXS2 2WINB 2ZZJA 4UXAA 1N1TA 2WAAA 4V1PA 5F5IA 3VKNA 4ES8A 1F5JA 4QPYA 4WM8C 5HCBA 3URFA 3VDDC 1OQDA 3IIAA 1UF2C 1XU2A 3MIBA 4P9YA 2BOIA 4WVZA 1WMXA 2DUOA 1GZWB 2P34A 1X36A 1QJU3 5DUWA 1UNBA 3WDVA 4XBNA 5HCAA 4M4RA 1W2UA 4XBLA 3ENRA 3H3ZA 3WG4A 1CX4A 1PO13 3SKVA 1HRI1 2LRPA 3NKTA 1RXGA 4XABA 1HRI3 1FPN2 1NY71 3AC0A 1FNZA 5F9TA 3VV1A 4QQLA 3T30A 3SKJE 1KJLA 4YM1A 1WBLA 1POV1 2ZPXA 3D3AA 3LD8A 3MICA 4MGKE 5LK5A 3S30A 4ZU4A 3VBHC 4DQAA 5JDBA 2NYYA
chains in the Genus database with same CATH topology
1RMU3 4NWWA 1MEC1 5CFDB 4Z1VA 3H3UA 2W39A 4CTEA 2PAKA 3DL3A 5BPXA 3TAYA 2YC0A 2FMDA 1D4VB 2HWD3 4JDNA 1COV1 5DDJ1 1X50A 4I3PA 1RHI2 4XBQA 3TNQA 3WQ7A 4AFBA 4R9CA 5LK7B 1MZ6A 3TYJA 2HEVF 2HWB1 4YW5A 2XJUA 3E6DA 2ET1A 1QGLA 2VQ0A 2RMU1 4QM9A 1C57A 1ZZ9A 2OA2A 5AC91 4HK9A 4K21A 2NZ9A 3GZTB 4AK3A 1NLRA 1OMIA 3NAPB 5JCTA 1Q8OA 4J1XA 4LUMA 2ZX3A 3RS6A 3UK9A 4LE4A 4UW4A 5FQ0B 3CNAA 1XNBA 3ZSLA 5E89A 3WXPA 4FPYA 3H1YA 2G4IA 2P2KA 3LA2A 1N1VA 1ZRDA 4Q8KA 3RDIA 1J59A 2ZGSA 1NZCA 3MIHA 4JVAA 4F83A 4JAAA 4E2QA 1PVXA 1KITA 5BNPA 5IK4A 2NP0A 1YO8A 3DPRB 3VBRB 4Y20B 4AGGA 2GMMA 3EHKA 2RS52 4FBFA 5BNPC 3POWA 5DUVA 4DFSA 3LSDA 1LOAA 1JYCA 1WCSA 3WDYA 1MS8A 3GF6A 3QD6A 5KC5A 1UMZA 5C33A 2PN5A 1J1LA 2H0VA 2JEMA 5E8AA 4LE3A 4XHBA 3LOBA 3J8F1 3AM2A 1JHNA 4FOQA 4XYXA 4YNIA 3ES1A 1H2KA 3N7JA 2QUOA 4Q4Y2 3VKFC 4Q4W2 5BUVA 1F5FA 1O4YA 2K2SA 3FLPA 1ND2C 4KQ7A 4QQPA 1G86A 3LA7A 4LA3A 5EJ3A 4EN7B 2IC1A 3H0OA 5K0UA 3ZXDA 2ZGNA 3AZVA 3HN1A 1PHMA 3SLIA 3AB0A 4RL7A 2HWC1 4K6BA 2EXIA 2DVFA 4N7IA 1C8M2 4HKOA 4M0NA 2RS53 1REDA 5AFEA 2VOXA 2CGOA 3B93A 4AFAA 1RGSA 1RUF1 3I54A 3B5LB 4OLLA 4AEDA 4E9KA 5BNNA 3AZXA 1DHKB 1EV11 1QDOA 4I0BA 1FXZA 2R0FA 5FDBA 4H3WA 4FTEA 1SLLA 2EXKA 1GV9A 1OKQA 3A0KA 1K5MB 3IDCB 2FHRA 3BU7A 3H1MA 4A2UA 3I4IA 4H7LA 2K9ZA 2V09A 1YJKA 3VDDA 1NXMA 1AXKA 1SMVA 2WFF2 4WM8A 4ORFA 3WP4A 1LESA 1A6CA 1UU5A 4KG8A 4DY5A 5C8WA 3NAPC 1QQP2 4CEYC 2TNFA 2ZGMA 3ALQA 4MH0E 1EPWA 4UW3A 5FOBB 1ZRCA 1GANA 3LSEA 1YHFA 3W59A 2PYTA 1PGL1 2SBAA 4QGMA 2R0HA 5IT6A 1WUVA 1LB2A 3QACA 1D2QA 3N3HA 1OLRA 1F9KA 4EROA 1GICA 2HEYF 3MW3A 2YHJA 1PZ8A 3GZAA 3RYRA 4AGRA 4KWJA 1BEV1 3IBMA 3RWNA 1ND3C 4Y22A 3AKTA 1IQAA 2WT0A 3WDUA 3WDTA 1NOVA 1WLDA 3L9JT 4BHPA 4F8AA 3GALA 4W6WA 5CFDA 4XXAA 5FTTC 2VMIA 2XBO2 4PLOA 5JSPA 4R9BA 2R061 2JG9C 1VBE3 4W6XA 1AYM1 1UCXA 3D5OA 3JBG2 2CWSA 4IV1C 4COWA 5I8TA 4NHMA 2N7GA 3C2UA 3GBFA 1IKPA 2OZ6A 3B9CA 5JOZA 3DKWA 4GALA 4I01A 4J6GA 3JD72 3AYEA 1OPMA 4QM8A 2WFPA 1V70A 1AR63 4K1ZA 3MIEA 1BVVA 1AL0G 3IKWA 5J7MA 2WT2A 3T1LA 2R49A 5C9AB 4BQ1A 1O91A 4HN1A 1RUH1 3ZYPA 3KD4A 2A70A 4CEWC 1HX6A 2RR12 1EV12 3DPRA 5KWRA 2R1DA 4WZCA 1LEDA 4GH4C 5FBZA 4TZDA 3EO6A 1MS5A 1RUI2 1KD7A 5KXBA 2OW4A 3ZN6B 4FOWA 1LR5A 1Q43A 4K3UA 2WKKA 1IGOA 3U11A 1BMV2 3PVOA 5GKAC 4KWLA 4QMAA 5LRSA 5FQ0A 5J3UA 1RUC2 1O5UA 2MEV2 1DF0A 2BUKA 1UX6A 3AXEA 2OIIA 5FAXA 4FT8A 2O0OA 5KXCA 5CG9A 4FQZA 4LBKA 1VBE2 4QD2A 3RG0A 1COV2 2C0ZA 1W6OA 1CAUB 4GIQA 5DDJ2 1WW6A 4YFWA 2JE7A 1W6NA 3U07A 2V73A 2A7AA 3BCWA 3ZYGA 3VZLA 5T5JA 1IS3A 1POV3 5I91A 3WT3A 2YUEA 1RUD2 3ZSEA 1MVEA 4WZFA 1YIFA 4K40A 3SHRA 1JXNA 1TME3 4IEXA 4MXWB 2BEOA 4Q0SA 4CEYB 3LWCA 2XWJB 2QKDA 3DPRC 3R05A 2Q0AA 1CAXB 3IPVA 2DUQA 3CO2A 3WDWA 3ZFFA 4Q1RA 1PMIA 1X8MA 1ZNPA 1FPN1 3MLKA 4PLMA 2R063 3FUOA 2PHTA 3OD0A 1UL9A 5AFBA 4QPIA 5FO8B 5FO7B 3HT2A 1DU3D 4K8FA 4OHVA 1FI2A 1LECA 4AQTA 4ISRA 4U36A 1SBDA 2FZ2A 1F31A 4NR1A 4YW1A 5FFOC 1JN2P 1H2LA 3RJRA 1Z78A 1ZZ7A 4UW6A 4Z07A 1XU1A 4YZ1A 1VRH2 1DQ1A 4PLNA 2XJRA 2VMGA 1L3JA 2XL7A 2JENA 1QJX3 4XF0A 1FOD2 4MX3A 1N3QA 2X8KA 1D0GA 2WZR2 4YG3A 4AHZA 1HLCA 1HW5A 1OOPA 4Q4Y1 1EP0A 2AGSA 3VN4A 1C3HA 4R4ZA 4OI1A 4EN0A 1AL22 3MZHA 1AR93 2CTVA 3VBHA 1U5ZA 4AHXA 2VQAA 1X82A 1OHFA 5FMOS 4W6YA 1BBT2 5EWSA 4F3JA 5IK8A 4R8HA 1GQGA 4YM3A 3O14A 4CDWA 4D7YA 1AXZA 1DQ2A 1YLLA 1BCXA 1RIRA 2VG9A 1BEV3 1O3QA 3CJIC 2XHKA 2ENRA 2A6YA 5HI0A 1S55A 3FJSA 1A3KA 1JW6A 4QQHA 2YGMA 1PGW1 4QPGC 2PLV3 2WSUA 4XTPA 4LA2A 2DWRA 1DQ4A 1XE8A 2DVAA 4GQ7A 4XJZA 3PHMA 5H9PA 2D5HA 1H2MA 1RUG3 3ZXJA 2JG9B 4XW3A 3ZYRA 5A33A 2Z79A 2ZGPA 1YYNA 1AYM3 2DCKA 3VLBB 4XFBA 3VBOC 2PFWA 3RJ2X 1LHVA 2UURA 4QT6A 2CAVA 2GC1A 4QPGA 4AI0A 4WV8A 4PDWA 2XVKA 2B45X 1TME1 3ATGA 1QWRA 1AR61 5JI9A 2XH6A 4H55A 1OA2A 3VBSA 1Y7BA 2Y26A 5T5PA 1EAH2 1RUE1 2YYOA 3WINE 2NN8A 4FPEA 4NO4A 2C1FA 2HWF1 4PIZA 4AEKA 1I1EA 3VUOA 4ZKTB 2R042 4RQPA 2HWF3 1C5IA 3VBSC 4LBQB 3M4FA 5FREA 1HIXA 2XKOA 2BFUL 1CAUA 4S2DA 1QJY3 3RNSA 3E6BA 1VJ2A 1WCDJ 4IEPA 3M3EA 4AI2A 1G9AA 1TEIA 2HKXA 2EVXA 3CL1A 4MZUA 1LOEA 4AFCA 4XFCA 3NV3A 2XUMA 4TWTA 5AC92 2C9AA 4GKYA 3HWJA 1CESA 3E5XA 4FCAA 2Y0OA 3W58A 5GM0A 1DZRA 2HEWF 5C4WC 3E5UA 3GYDA 1H8TC 2RHPA 1CD3G 2V5YA 3BB6A 3IT8A 2CAUA 1MZFA 3X29B 3M3OA 4I09A 2GALA 4TLFA 5I0UA 4ASLA 2IXIA 2Z5WA 3R6SA 5K0UB 5CBLA 1PK6C 1WD4A 5CA6A 2ZMKA 2EALA 5ACA2 4Q29A 1W6NB 2IXHA 1VLNA 3HIFA 2EIGA 3JQXA 4Z8BA 1SACA 5GLTA 2QZ3A 1ZZ6A 1NY72 1NQDA 2X5IC 1FV2A 4WM8B 1AR71 1XYPA 1ZX5A 1RMU2 1B09A 4MVTA 4YGDA 3WCSA 4QXKA 5D1IA 1S0CA 2IXJA 4CP1A 3WW4A 1B35C 3P3NA 1FPN3 1TNRA 1AX0A 2UY9A 2D93A 3D8CA 1PM7A 4YG6A 2BYVE 4R9AA 3KSCA 4BOWA 4RHV1 3OPZA 4B4RA 2P3IA 2FQPA 4S2HA 5ABJC 2HWE3 4KU7A 3ZN6A 2PTMA 2PHDA 1MR5A 5A3LA 2RM21 3V0BA 4CDXA 4RR3A 2RMU2 2E53A 5L7OA 1GNHA 1ENRA 5DXDA 3JQWA 4Y1YA 4COZA 4AQ2A 1BMV1 2VU9A 2D3SA 2R041 3ZFEB 1NCQA 1QH6A 1LTEA 3FFQA 1PNFA 2TUNA 1LU1A 2BVBA 4LTAA 3ZXEA 3RSJA 2R071 3DN7A 2R073 1EAH1 1RUE2 1Y9QA 2W68A 1LHUA 3D6EA 3KT1A 2A5ZA 4GH4A 1O5LA 1TE1B 3ZXAC 4BZ4A 3IMNA 2XJTA 4IV1B 4M0HA 4P9WA 4QPIB 4GB32 3GZUC 5GLUA 2JX9A 3USSA 4LR4A 2A6WA 4XF9A 4EJRA 2LUWA 2WNVC 2XL9A 2QCSB 2X53S 3PLQA 1RJ7A 4NN0A 1CJDA 2RJLA 2WNUA 4LBMA 5JSRA 1PZ7A 2DCZA 1G8WA 3NV4A 2JG8A 5EZWA 3APBA 4XMAA 1X7NA 1RUG1 1FAYA 3AMMA 4L2NA 3BALA 1QQP3 2RE9A 4L8QA 4IV1A 5T3NA 1QQP1 1OSGA 2VOVA 5FCCA 3UV9A 2BTVC 2WSVA 2WLPA 5CFDC 2QZ2A 3LOIA 1PO22 2HWC3 2O8QA 3THTA 1R1A1 1R093 5J37A 5JOYA 4HANA 2ZAAA 2RS51 3MEPA 5I93A 3B69A 2FBEA 1XQNA 1GYKA 1RUE3 4PIYA 1O7FA 3ZSKA 5JIUA 4B29A 2WL1A 5BXXA 1FOD1 2ZGQA 2UWBA 1WBFA 1KXGA 1BQPA 4FO9A 4XQDA 5AVPA 5L19A 1IS4A 2D3PA 5GLWA 2CV6A 2ZX1A 1C1FA 1SLIA 2K0GA 2RMU3 2PELA 4FP2A 1AUYA 4Q8LA 2VMHA 1HQNA 3NL1A 5GLVA 5T5OA 3TBDA 1RUC3 2I2SA 3VL8A 4N90A 3D0SA 2BWCA 1NA1B 2GU9A 2G9GA 4Z92B 1RVF1 5GZGA 3VBFA 2ZS6B 3ZFFB 1HDKA 2DU0A 2OZJA 1OQEA 3JB8A 1ZA4A 4HLTA 4OHXA 4FSJA 3VBUA 1CAVA 4LBJA 3POSA 1ZZBA 1FX5A 4PIXA 4N9IA 4AI8A 4Y1UA 4E2SA 3VBHB 4LBQD 3FMGA 4E4SA 2GAUA 3SXWA 3TOJA 1WGPA 2VVEA 5L73A 1G9BA 3WUCA 2VULA 3S0MA 2I45A 1H4GA 5I0RA 1S2BA 3UL2A 1MEC3 3LB9A 1AL21 1AR62 3AZYA 4IEZA 4P9IA 4PDWC 3MLLA 5J96B 2FMYA 1OOPC 4B7EA 3VBFC 3AP9A 2HWD1 2ZACA 3M3IA 1DZQA 4LULA 3V64A 2VECA 4M3CB 5GZCA 2RS12 1V6IA 2W08A 4C1WA 1CR7A 3KT7A 1ND2B 4DPNA 1IHMA 4CDXB 2DF7A 2WNVB 4FPCA 5AC93 4AQSA 1H2NA 2JECA 2A6ZA 1UW8A 1PGW2 2Q1MA 4J1WA 5BNOA 1EPZA 2ZGRA 3VHPA 2WNUC 1RHI3 5KHIA 4M3CE 2HWD2 4YVWC 4CDWC 3P3PA 3TN92 1YXWA 2IWGB 1POV0 2P37A 4EN8B 1AJOA 5EYXA 1U0AA 4OI2A 3VBRC 1RUJ1 3LKJA 4XQWA 1I6XA 1MQTB 5J09A 2QFEA 5CVRA 1C1LA 3SCGA 5DZEA 2YXSA 1V6MA 1JOJA 2ZABA 1AYM2 4FTBA 2VW1A 2GDFA 4P14A 5JLVA 2UWAA 2ZBJA 1XNDA 4YGCA 2LALA 3RMYA 4BLIA 1IPKA 4BCUA 3G6JB 3OGJA 4X8PA 3MIGA 2PLV2 2ZX2A 4S2GA 3MFAA 2HYKA 4YYOA 4DRRA 3H8UA 3ME2A 4AF9A 1EY2A 5K8SA 1QXPA 2NLRA 2VVDA 3SH3A 5JR7B 3VZKA 2WNVA 1YJLA 4HPKB 1RUJ2 1SFNA 5JOWA 2BBVA 5FO9B 4IESA 2D6NA 5EV7A 3DV8A 4N43A 1S0DA 3VKOA 1QOTA 5A32A 1O4TA 2GH2A 4A7ZA 1Q3EA 4CZSA 1C8M3 3GBGA 4EWDA 4KWKA 5LRRA 1RUF3 1URXA 5FLIA 5BNQA 3T2TA 3ZN5A 4YW3A 1KJRA 1QJZA 4OUMA 1NCRC 2CGPA 1CPMA 1IS6A 2XWBB 3BIWE 2XLAA 4Q4X1 1FOD3 1NCQC 4AYUA 1PIV2 4Q4X3 3TNPB 4NOTA 1A8DA 1W6MB 3WG3A 4QQ2A 4HK8A 3D4KA 2XJVA 4XMIA 2DYCA 1SBEA 4RSUA 3AMQA 5JPMB 5D8AC 1VAVA 2YMZA 1HRV1 4CDXC 1ALYA 1WW4A 4XFFA 4D7SA 3BOWA 4M00A 3WX5A 4AWDA 4YM2A 5FPXA 1N1SA 1VAKA 2ZMNA 3FBMA 1AVBA 2PHLA 4YG0A 5C4WA 5J48A 5IK5A 1VBD2 2A6XA 2DTYA 3VBFB 4EN6B 4FPLA 4MV2A 2XBO1 5JMCA 5LEJA 1RUH3 5F6LB 3WG2A 2GMEA 1PVC3 4F7ZA 4NHLA 1D4M1 1AR91 1J3QA 4DOUA 3H7JA 3V0AA 1RB8G 1TME2 1Z7S1 1RC6A 1DQ0A 3J9SA 5H9QA 1FT9A 4CDQB 4L99A 2DVGA 4FTSA 4YLZA 1VBD1 3AKSA 4PBOA 3KCCA 5KBFA 4L92A 3MF6A 1ULEA 4I30A 2H0BA 3FHIB 1CONA 2C5DA 1JTZX 1PK6A 5F6KA 5HCFA 5CFCA 2F6BA 4OHYA 1ND3B 4AGVA 3WQ1A 1PVC2 4LUKA 1SDWA 1UPIA 1WMDA 1OOPB 4LO6B 2DTWA 5ABJB 1H8TA 1LOBA 2HWB3 2ZHNA 1RUNA 2GNMA 2UU8A 3NKGA 3ZDSA 5AVAA 4LO8A 3S7EA 4EWEA 5I8SA 3SCHA 4OVEA 1WLWA 3ROUA 2XLGA 3JCIA 2VOKA 4Q0QA 3Q9OA 3SITA 2WC2A 3HT1A 1YI9A 2EA7A 4FPJA 2ZAHA 3THPA 1AX1A 1UU6A 4IEOA 4BPZA 1LEMA 3MI8A 1REEA 3I8TA 1PIV3 3HR9A 4JGYC 2YROA 4Q4X2 3RZZA 1EV13 3VZNA 1IS5A 1OQ1A 3TRSB 2PHFA 5H9RA 3S7IA 4GXLA 5EXOA 4TSVA 3ZO0B 4X8NA 1PO12 2E7AA 2D6PA 3WHUA 3OY8A 3WP3A 2E51A 2PA7A 4XXPA 4D7TA 5K7PA 2ZGUA 1OD5A 3VDDB 1LHOA 3JZVA 3ZMOA 1F8VA 3JD71 2DUPA 4LHKA 3DUIA 1Q8SA 3WD5A 3JD73 4DNYA 1RUJ3 2WZR1 3IN9A 1KS5A 3I59A 5KXEA 2F4PA 3PNAA 4PF5A 4GMP3 1C28A 1MS9A 3H9AA 2YPJA 3MLJA 4KL1A 2OYZA 2WA3A 3J8F3 4DMIA 1G7YA 1HV1A 1SLBA 3VZJA 1F2NA 1BZWA 3R4SA 4JTOA 3TWIA 1D0HA 4N7UA 1UU4A 3WR0A 1H9WA 2D6LX 2ZA9A 2AUYA 2HWE2 2Q4SA 4IL7A 2P17A 2XLFA 3CJIA 4AVSA 5I8YA 4YVWB 2RS11 1R1ZA 2GN3A 2VW2A 5JPNB 1PO11 3HBZA 3AP4A 5T52A 3HAGA 4A7YA 1LOFC 2WZPP 4PCRA 4YM0A 2UYBA 4K9SA 4JRLA 3UJOA 3V0BB 2Q30A 1CPNA 1W0PA 2D6MA 3ZMNA 1N3PA 5KHHA 4AEDB 1O4ZA 2Z69A 4R4XA 4D3WA 3OJBA 2R16A 3KCXA 3J26N 2TBVA 3OGGA 4UBHA 2ARXA 1C8M1 2GNBA 4IQPA 4M01A 4XDQA 2XPJA 1H4HA 2B46X 3JUUA 4CDUA 2VVFA 4A7KA 1YIPA 5ACA3 1JUIA 1V6NA 4E4DX 1ND2A 1U5IA 5CG8A 2JD4A 5TSWA 4RHV3 3LZZA 4YRDA 3O5SA 4AW7A 1XNCA 2HWE1 4CDQC 2D44A 3VBOB 1QKQA 5GJ6A 2ZMLA 3RI9A 2NQYA 1LU2A 1NQJA 5D8AA 5GZFA 4N9HA 1X8EA 4HPKA 4IEYA 3ZSMA 1KDKA 4RGAA 3QBQA 2WQ4A 2VPVA 4P9XA 3WG1A 4TYSA 2VH9A 3WP6A 3NW4A 1M06G 1OFSA 2KA3A 4DRVA 4EV0A 1WLCA 5GZDA 3LAGA 1IZ3A 1NCRA 4CEWB 3ZFFC 4ONUA 1AF9A 2E7TA 3AMNA 2ZKNA 1MZ5A 5JAXA 1ONAA 4MGIE 4COVA 1TMF3 4O9GA 4RFT0 1CAWA 2GN7A 2VY0A 1Z7S3 2O1QA 3ASIA 4NHKA 3OY8B 1V6OA 1MS4A 3AK0A 1AX2A 1H9PA 1UZYA 1VBB1 1DG6A 1MZEA 3KGLA 4WBBA 3TN91 2B42B 5B2GB 1W6QB 4CRQA 1VBD3 4AQ6A 3WW1A 1BVP1 3HD8B 4Z2WA 1NCQB 1VP6A 1AR83 3MYXA 1M4WA 4RR3C 5L7OC 1ZM1A 2GNTA 1OLQA 5GLZA 2G9FA 3B01A 1U5XA 4RS5C 1VBE1 5ABJA 1AR82 3O7OA 3VHNA 2GNDA 4NVPA 1GR3A 2PHUA 2PHRA 4HZFA 1ENXA 4Q27A 4GA9A 1WA4A 3CLPA 1ENQA 1IKQA 1I5ZA 4LHNA 4N53C 5C4WB 4FOVA 4I0WB 5JZGB 4IV3A 3E5QA 1U5YA 4SBVA 3QH6A 4FQ4A 4MGYE 3O0WA 1VALA 1K5MA 4XIOA 1ZYBA 5FLJA 1QHDA 1LGBA 3FE5A 3E97A 2W0XA 2IFWA 2CYFA 3AMHA 2R30A 4JGZC 4GH4B 1V6KA 1MQTA 1AR92 1MS1A 1PZ9A 1BJQA 1VB4A 4Q4V3 1FATA 4X6RB 4JV4A 3VBUC 1QOOA 4Q4V1 1N47A 2HWC2 3CJXA 4WVWA 4YZ3A 1DGRN 1H1IA 2NMOA 1N3OA 2EAKA 2PHWA 3R0RA 4YGBA 3PJYA 4META 4QGNA 3WG4A 4ITCA 5IUQA 4EN9B 1G9DA 2IZWA 3H1WA 1HXS1 5CFCB 4XF1A 1SEFA 2E63A 3WP5A 4IV3B 1RUC1 1VAMA 3H50A 3NWKA 1IOAA 1D2SA 4HSJA 3WZ1A 1Q8VA 2P3JA 1UPSA 5JVVA 2QNKA 2ATFA 4XJ9A 3USUB 1UAIA 1YFUA 1WLTA 3SISA