5C4WA

Crystal structure of coxsackievirus a16
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
296
structure length
287
Chain Sequence
DPIADMIRSLTALQVLPTAANTEASSHRLGTGVVPALQAAETGASSNASDKNLIETRCVLNHHSTQETAIGNFFSRAGLVSIITMPTTGTQNTDGYVNWDIDLMGYAQLRRKCELFTYMRFDAEFTFVVAKPNGELVPQLLQYMYVPPGAPKPTSRDSFAWQTATNPSVFVKMTDPPAQVSVPFMSPASAYQWFYDGYPTFGEHLQANDLDYGQCPNNMMGTFSIRTVGIEKSPHSITLRVYMRIKHVRAWIPRPLRNQPYLFKTNPNYKGNDIKCTSTSRDKITTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords VP1
publication title Structures of Coxsackievirus A16 Capsids with Native Antigenicity: Implications for Particle Expansion, Receptor Binding, and Immunogenicity.
pubmed doi rcsb
total genus 45
structure length 287
sequence length 296
ec nomenclature
pdb deposition date 2015-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5c4wA00
1FOD1 2WZR2 4Q4V2 1VB2A 1FOD2 3NAPB 3VBSA 2HWB3 4RHV3 5L7OB 2R043 3VBHB 4N43B 3NAPC 4WM7A 1TME3 1RUJ3 2RM23 3CJIB 1ZBE3 2R071 2ZTNA 1M06G 1RUG3 3VBHC 1R093 4N43C 4RQPB 2R072 1V9U3 3ZFFB 1RHI1 3CJIC 3VBFA 1AL0G 1RHI2 2XBO3 4RQPC 1RUE3 2WFF3 3ZFFC 5BNNC 2HWE3 5BNOB 1OPOA 2RR13 3TN93 2RS33 2HWB1 3DPRA 4RHV1 5C9AB 2R041 2BBVA 5BNOC 4AEDB 2HWB2 4FTSA 4RHV2 1TME1 2R042 1RUJ1 2DF7A 2FZ1A 2RM21 5C9AC 1ZBE1 1RUG1 5A33A 1A6CA 1TME2 1RUJ2 1R091 4AEDC 2RM22 5K0UB 1ZBE2 1V9U1 1QQP3 1RUG2 4YVWA 1HQNA 1R092 1Z7S3 1V9U2 2XBO1 1F8VA 1RUE1 5K0UC 2WFF1 1BMV1 5LK7B 2HWE1 2XBO2 1RUE2 1AR93 5ABJA 2WFF2 1BMV2 1VAKA 2RR11 3TN91 2RS31 2HWE2 2RR12 4N53A 3TN92 2RS32 3J8F3 4N43A 1AL23 5DDJ3 5CFCB 1GFF2 4RQPA 1QJZA 4CDXB 1NCRA 3ZFFA 5BNNA 4NWWA 4CDWA 2GSYA 1Z7S1 4CDXC 1C8NA 1Z7S2 5BNOA 2ZZQA 1CD3G 3VBRA 4NWVA 5C9AA 2X5IB 4AEDA 3J8F1 1MQTB 3ZFGA 1AL21 1PO23 3VBFB 3J8F2 2X5IC 5DDJ1 1AL22 4BCUA 5K0UA 1MQTC 1NA1C 5DDJ2 1VBD3 1AR61 4SBVA 2BFUL 4FSJA 5BNPB 1AR62 3M8LA 4FTBA 1NY71 1NG0A 3VDDB 5BNPC 4IV3C 1PVC3 1NY72 2FZ2A 1PGW1 4YVWB 1PO21 3VDDC 1RUF3 1OHFA 3ZFEC 1PGW2 4CDXA 1PO22 3VBOC 4YVWC 5ABJB 1VBD1 4Y5Z0 1B35A 1VBD2 4Q4Y3 4N53B 5ABJC 5C8CC 2RS53 4PDWB 1AUYA 1R1A3 1ND3B 3IDEA 2X5IA 4N53C 1PVC1 1NCRB 5BNNB 4JGZC 1MQTA 1NA1A 4CDWB 3JBG3 2HWD3 4PDWC 1PVC2 1POV0 1ND3C 5FOJB 1AR91 1RUF1 1NCRC 4RR3C 1AR83 4CDWC 1AR92 1RUF2 4GH4A 1RUC3 3VBRB 1POV3 4Q4Y1 1VRH3 5BNPA 4Q4W3 4IV3A 1ZBA3 1HRI3 3VBRC 3ZFGB 4Q4Y2 2RS51 1K5MA 1R1A1 3VDDA 2BFUS 3ZFEA 2RS52 3ZFGC 1R1A2 3VBOA 3JBG1 2HWD1 4CEYC 2GH8A 3JBG2 4YVSB 2HWD2 1AR73 1AR81 1AYN3 1RUC1 1AR82 5C8CA 1RMU3 1COV3 4YVSC 1QJU3 1RUC2 1POV1 2RS13 4Q4W1 1ZBA1 2TBVA 3S6PA 4JGZA 4CEWC 5JZGA 4Q4W2 4PDWA 1ZBA2 1ND3A 1PO13 1FMD3 4GMP3 4RR3A 1QQP1 1X33A 5J98B 4RS5B 1QQP2 1B35B 1NCQA 2Y26A 3ZXAC 1AR71 1AYN1 2WS93 1R083 2HWF3 4RS5C 1AR72 1AYN2 5GKAC 1RVF3 1VBB3 1RMU1 1B35C 1COV1 1D4M3 1QJU1 2XPJA 3JB8A 1ASJ3 2PLV3 2RS11 1RMU2 1COV2 1NA1B 1QJU2 2RS12 4CEYA 1RB8G 1PO11 1FMD1 4GMP1 5CFDB 4GH4B 1PO12 1FMD2 1H8TC 5CFDC 4YVSA 4GH4C 2WS91 4IV3B 1AYM3 3FBMA 1R081 2MEV3 2HWF1 1F2NA 2R063 5C4WC 4LLFA 1K5MB 2WS92 1RVF1 4CEWA 1FPN3 1R082 1D4M1 2HWF2 3ZFEB 1ASJ1 2BUKA 2PLV1 1RVF2 3VBUB 1D4M2 1RUH3 1VBA3 3VBOB 1K5MC 1ASJ2 2PLV2 1NOVA 3VBUC 5D8AA 4Z92B 5C8CB 4RS5A 1HRV3 4GB33 3JD73 1VBE3 1EV13 1W39A 2MEV1 4JGZB 2R061 1DDLA 5JZGB 1FPN1 2MEV2 2R062 4RR3B 4QPGA 1VB4A 1FPN2 1RUH1 1VBA1 5JZGC 2HWC3 5ACA3 1X36A 1RUH2 1VBA2 1NCQB 1H8TA 5CFDA 1OOPA 5FMOL 3HAGA 4QPIA 1NCQC 1HRV1 5C4WA 1BEV3 4GB31 1VBC3 1RUI3 5L7OC 4RFT0 4FTEA 3JD71 5A32A 2ZAHA 2WWSA 1HRV2 4GB32 1VBE1 1EV11 2IZWA 3JD72 1HXS3 4CEYB 1VBE2 1MEC3 1EV12 5AC93 4Y4YA 3VBUA 1RUD3 4IV1B 2HWC1 1BBT3 5ACA1 2WLPA 2HWC2 4CDUB 5ACA2 4IV1C 2BPA2 4WM8A 1CJDA 4GMP0 4JGYB 4CEWB 1BEV1 4CDUC 1VBC1 1RUI1 4EJRA 1VRH1 1HRI1 1ND2B 1BEV2 1WCDJ 1VBC2 1RUI2 4JGYC 1VRH2 1HXS1 1SMVA 1HRI2 5AC91 1MEC1 1IHMA 1HXS2 1ND2C 5D8AB 1PGL1 4CDQB 5AC92 1MEC2 1RUD1 2QQPA 1BBT1 1C8M3 1PGL2 1E57A 3NAPA 1RUD2 4Q4X3 5D8AC 1BBT2 5L7OA 4CDQC 1PIV3 3VBHA 5J96B 1QJX3 2VQ0A 3JB4C 3CJIA 2RMU3 4QPGB 5FMOS 5CFCC 1AR63 3VBSB 1EAH3 1H8TB 4QPGC 1OOPB 4IV1A 1C8M1 4WM7B 4QPIB 3VBSC 5C4WB 1TMF3 4Q4X1 1OOPC 4CDUA 1C8M2 5A32B 1PIV1 4WM7C 4Q4X2 1QJY3 4QPIC 1QJX1 4JGYA 1VBB1 1PIV2 2WZR3 4Q4V3 1QJX2 2RMU1 1FOD3 1VBB2 1ND2A 3VBFC 2RMU2 1EAH1 3DPRB 4CDQA 4WM8B 1EAH2 3DPRC 2R073 1TMF1 5A33B 1AYM1 4WM8C 3LOBA 1HX6A 1TMF2 1RHI3 1QJY1 1AYM2 2WZR1 4Q4V1 1QJY2 5CFCA
chains in the Genus database with same CATH superfamily
1DGWX 3W20A 2G9FA 4K20A 4H55A 3T0BA 1CX1A 4LORA 1KJRA 3HWJA 3MUZ1 3BCWA 4P9GA 4UW4A 1CAUB 4XUOA 5FYYA 2V4AA 3HNYM 2O14A 3A7QA 3IIAA 4QX3A 4AI1A 3VKFC 3I2OA 1LOFA 4UW3A 4N43B 4XJ8A 1SLLA 4QX5A 1JBCA 1MS3A 2R071 3MDPA 2ZTNA 4LUKA 5CKQA 3JXSA 5IWFA 3BU7A 5LW9A 4CTEA 2J1SA 2WSUA 4N43C 5DUVA 1NLRA 3N7JA 5F2SA 1ZZ7A 4D3WA 1D0HA 3ZFFB 4ZZ8A 2H0BA 2BOJA 5A3MA 5FMBA 1UZ0A 2JECA 4HETA 3MEPA 3IAQA 4ZS3A 3A23A 5LBCA 1BVP1 1RHI2 2CYFA 3MICA 3DXUA 3ZXEA 1C5HA 5FYBA 2BYVE 1DQ6A 1XPWA 2XWJB 4P14A 3ZFFC 2PHWA 2NN8A 5FLJA 2VM9A 4Q29A 5J3UA 2W68A 2WAAA 2RR13 1JN2P 3TN93 3DXTA 1UYZA 5FPZA 3ZYPA 2HWB1 2EIGA 4PBPA 2PMWB 5KXCA 2J1RA 2R041 2RJLA 1D2QA 5I0RA 1L7RA 1JYNA 2ZEXA 5IJRA 3RFRA 4FTSA 5FBZA 2QVSB 1TME1 3IT8A 5FQ0A 2DFCA 4ASKA 2FZ1A 1OFSA 2D43A 3NO8A 1YO8A 1HB3A 5GJ6A 2Z2SB 3LDRA 5A33A 2ERFA 3MW3A 2RM22 4LHKA 1GP4A 2PXJA 2OS2A 3MGUA 5T54A 1LOEA 1QQP3 1RUG2 2DVBA 3NJXA 3RGBA 1R092 5FMDA 5T52A 1Y4WA 1WZXA 2YB7A 3S57A 3SH5A 1C57A 3LIHA 1RITA 1ULOA 2BTVC 2JDHA 1LU2A 4D7SA 3HPNA 1CESA 2B8MA 3SH3A 1RUE2 3TOJA 2WFF2 2W2IA 5G05L 2XG3A 5JMOA 2FMDA 5J1XA 2BWCA 5HV0A 5LA0A 3OJBA 1V6KA 1WLWA 2W39A 4QB6A 4QWNA 3WNMA 3GCWA 4N53A 4W6WA 4N43A 1US2A 3RS6A 5FYIA 4XCAA 1DGRA 3UGFA 1AL23 2XKPA 3A21A 3MUY1 4PQ9A 1W06A 1H0BA 2ZGRA 5DDJ3 5EYYA 3D4KA 3IKWA 2BERA 4CDXB 3ZFFA 3B00A 2LTNA 2B42B 4YW6A 3RJ2X 1OD5A 2AR6A 2YZ4A 5A6YA 4NMIA 4CDXC 2J1VA 2P6CA 2WSVA 4IGPA 3I7DA 4KMQA 1Q8PA 1NXMA 4JDOA 4O9GA 3U07A 1NLQA 1ZRCA 1R64A 3FWEA 3PJQA 3RYRA 5JXHA 4XQ4A 4Q5OA 4CCJA 1H4GA 3I49A 1W2TA 2Q1MA 2W0XA 3KV5A 3ZXDA 3AFKA 3SITA 3J8F1 1OH4A 4H3WA 3ZFGA 1JOJA 3NV3A 4HKLA 4OI4A 5EJZB 4X6RB 2P37A 1O4ZA 1WCUA 3BTZA 4Y1VA 1W28A 1WLDA 2ZS6B 3S7EA 2GZWA 5DAVA 1NA1C 3H1WA 3RI8A 5LRSA 3OEBA 2EIBA 1NZIA 2MPFA 4IDZA 1PM4A 3C8XA 2PHTA 3LB9A 5T5PA 1FI2A 4SBVA 2NYYA 5FUPA 4D94A 4EROA 5BNPB 3M8LA 1PZ9A 1U5IA 3AVSA 3CMGA 3N9NA 5C3PA 2XVLA 1W2UA 1AXZA 1O5LA 5IVJA 3FUQA 4CUCA 3WG4A 4ES8A 1QJFA 1AJOA 3N9PA 5BNPC 3AMNA 2ZHNA 3DCQA 1ZZ9A 3NRUA 2JDMA 4OZXA 2QBXA 4XC9A 5JPNB 1DIWA 2VO5A 3U4XA 3OTFA 2YFZA 4AHYA 3SEEA 4AI8A 4OYUA 4PF5A 3MIHA 2PQSA 2DVGA 1PGW2 4PBOA 2ZGMA 4CDXA 2XL7A 3WQ1A 5CYYA 4XABA 4BIFA 1GZ9A 4XJWA 2PFWA 4AEJA 2AH2A 1H9PA 1XSRA 4YM0A 2V4VA 3T3YA 4Y5Z0 1W9TA 2D98A 4Q4Y3 1LESA 5JI7A 4FPFA 2VZUA 3C7EA 3H1MA 3WNLA 2FDHA 4IGQA 2IVIB 4K21A 4FQ4A 3MFCA 4FFGA 5FYUA 3AX4A 3IDEA 2HKXA 3WP3A 5GZCA 4EN6B 2ZXQA 4O9EA 2ARBA 1LHUA 4NIDA 4JQTA 1NA1A 3LSDA 3JBG3 5CG8A 1PVC2 2AEYA 1DLCA 1S55A 3KQ4B 5KHGA 2VOVA 1N47A 3WW2A 4RR3C 4BISA 4D69A 5C5UA 1AR92 2ZGUA 2A6ZA 4H14A 1ODNA 1RUF2 3NV4A 1RUC3 3KM5A 2VCAA 4WVZA 4LJHA 4X8PA 2XJRA 3AZVA 1N1SA 3WUCA 2DV9A 4QXKA 5BNPA 1UF2C 4DXSA 1LHOA 4HVRA 3U14A 2WT0A 5B2GB 4UW5A 3VV1A 2Q30A 1K5MA 4RN5A 3IMMA 1S0JA 3K4AA 4PJYA 2BFUS 2XJUA 3GCXA 5D21A 2RS52 4FTEA 4NIHA 4QKFA 3PUHA 2ID4A 3U4SA 5C70A 1RYYA 1OBNA 3AKTA 3P3NA 4KI5M 5EP9A 3PHMA 1WW7A 3PIGA 1PNFA 5HXMA 1YCIA 4ZXKA 2VXJA 4BXFA 2XL9A 1AR81 2DCTA 1K12A 2EIEA 2QUOA 1V6NA 1TZOA 3POSA 3KT7A 1IKPA 1GNYA 2ZX0A 5FZFA 1W99A 2ZX2A 4CSWA 1RMU3 5CU1A 2VPVA 4Y24A 2JE9A 3LE0A 3PUSA 1XBFA 2YG0A 1P8JA 2HYKA 4LIUA 1POV1 3PUQA 4XXPA 1NT0A 5LA9A 4R9CA 3WX5A 4Q4W1 5FDBA 1APNA 3M2MA 2C9AA 1IPJA 2OPWA 4JRAA 4YW1A 1JUHA 3V0BB 1GLHA 1JYXA 3ZM8A 4OCTA 1ZBA2 1MR5A 3GZTB 5LBEA 4E8CA 3N9QA 4LA2A 2ET7A 3LEGA 1I6XA 1XQNA 2P2KA 4IGOA 4RR3A 5J09A 1QQP1 2RG4A 3O12A 4K9SA 4RS5B 4FXGB 4ZU4A 4DEQA 1QGLA 5FUNA 3N9OA 2FHRA 4TSVA 4L9BA 2PHUA 2W5FA 2Y26A 1A34A 2WS93 3KMHA 5ANNA 5FYMA 2HWF3 4RS5C 4QHZA 1XSQA 4P9XA 1RVF3 5APAA 5F9TA 3NSTA 1MS5A 1NZCA 2D97A 3LOIA 1ASJ3 2GALA 2RS11 1Q56A 5F3EA 1COV2 1I9RA 3ZVXA 5FP4A 3VD7A 1QJU2 2Y6LA 4ZY9A 3V0AB 1DGRN 3IZOA 1LB2A 3A22A 1FMD1 2H0VA 1DFQA 4L97A 5CFDB 5A3LA 1RUOA 1C1LA 1PO12 1LHNA 4EE2A 1NLSA 4IESA 1GWKA 2DUOA 4XTMA 5CFDC 3UT0A 4FPEA 3ZDSA 4A6SA 1GUIA 2WO1A 4IV3B 4PT6A 1VMJA 4DFSA 3BGAA 4XF1A 2YHJA 1ZZ8A 2WRAA 3PURA 4HK9A 2XR4A 1PMHX 4LK6A 4OHXA 4CP2A 5JOXA 1MZFA 1GICA 5FZKA 2ADDA 4LBQB 3VD9A 4COYA 4LXLA 4HLTA 2O0OA 3ZFEB 3JU9A 1XJAA 1XRUA 3VBUB 1J1TA 3VBOB 1JUIA 1RUH3 1VBA3 2EIDA 3WDUA 3NVCA 4Q2FA 4AGRA 4JKLA 4W8JA 2JG8B 3FZ3A 5FV3A 1KEXA 3AL5A 3VBUC 1GP6A 1VR3A 5C5TA 2OA2A 5L19A 4Z92B 4XMIA 4JCKA 2QDNA 2G9ZA 4M01A 3IBMA 2JG8C 4Z1VA 4RS5A 5C8CB 2XONA 1G86A 2XDVA 3CL1A 3RVHA 3POWA 1X7NA 2BVBA 4NRMA 2B4KA 2AZ5A 1QY4A 1UY1A 1G9FA 2P5BA 4JGZB 3I2JA 4I0BA 4XFCA 3THTA 5JZGB 1FPN1 3T2PA 2MEV2 2PELA 5L36A 2D7FA 2J1UA 3O7OA 2VOKA 4KWKA 2FDIA 3I2KA 3WDYA 5HCFA 4QPGA 1MZEA 4CUBA 2JG9B 5JZGC 2DCYA 2HWC3 4J6GA 2JD9A 4OZOA 4Y22B 1QXJA 2ZMLA 1WBLA 2CHHA 2VW2A 5FKBA 1MZ5A 4QX8A 5CFDA 4AXOA 2JG9C 2Q1FA 4OQ8A 1U5YA 4MGZE 3OUJA 3Q8FA 2GAUA 2ZGOA 1GYKA 1JZ6A 5FMOL 5IFPA 5FYZA 3RZGA 1HRV1 2YDEA 4GB31 1VBC3 1BK1A 2GMEA 1ULEA 5A32A 4FT8A 1JHJA 3RZLA 3OD0A 2VVDA 3GJAA 3AYAA 3JD72 4QXCA 1VP6A 4LBQA 4MADA 4A45A 1EV12 1MEC3 5AC93 3RZKA 4YZ1A 5LBFA 5FAXA 3T30A 2FD8A 2XVGA 3VBUA 5AVAA 5FPVA 4IV1B 3OCPA 4UBHA 1YIFA 4D0QA 5DMYA 1JODA 2WLPA 2JG8A 3AC0A 5EFUA 3WINE 2K0GA 4YLZA 4CP0A 2QQNA 4AAPA 2W1QA 3KQRA 3PU3A 5ACA2 4FI9A 3WQ0A 4IV1C 3DF0A 2QQUA 2V72A 1G9CA 4O65A 2BPA2 1VPHA 3NW4A 4G4FA 2E7TA 1CJDA 3O1UA 2C5DA 5KHHA 4GMP0 4JGYB 1G7YA 1ODMA 3NJYA 5ANQA 3ELNA 5I0TA 1FAYA 1BEV1 5JR2A 5KXBA 1W0NA 4DO0A 1XB9A 3RSJA 3J7NA 1IPSA 1ND2B 1WCDJ 3POIA 1RUI2 4JGYC 1W2NA 2VC9A 4YW2A 4NHMA 3SEPA 3VL9A 1HXS1 1SMVA 1WLCA 2X53S 4GWJA 4CXYA 2CDOA 3KSCA 2ZCWA 1ND2C 3FHIB 5LRRA 1XNDA 2NLRA 2BGOA 1PGL1 5FZ8A 3IN9A 1AVBA 1J3PA 5KWRA 3LEIA 2ETEA 3BOPA 1BKZA 5FPBA 4CCMA 4A42A 3NAPA 3LKJA 1UKGA 1RUD2 3AZZA 3EBRA 1BBT2 2VZVA 1PIV3 5T3NA 3VBHA 3FFZA 2G9GA 5L73A 1DYPA 3OGRA 4Z2AA 5JXJA 3VGIA 5A1AA 1KRIA 2QQVA 2VQ0A 3JB4C 3CJIA 3AP5A 4LBOA 4XYXA 5ERLA 1YJKA 2VUDA 2AYHA 2E32A 4QQPA 1KS4A 5FO7B 5FZ4A 3IMNA 2IVJA 1JYWA 4CCOA 4AHWA 3INAA 1H2NA 5EPAA 2D93A 1W9SA 3K77A 1UQXA 2JDPA 1UY0A 3A0KA 1ZREA 4E2QA 4LOSA 3ZMOA 3JUUA 4HVQA 4IV1A 1W6QA 1IS6A 3QLQA 2Y34A 1C8M1 3LPGA 1W8HA 3OGGA 1SFNA 2C24A 2E31A 4MGQA 5JVVA 1PMJX 3GF6A 4NR1A 4Q4X2 4IERA 5GZEA 4JGYA 1GZCA 1H8VA 4QDSA 1WCKA 2WZR3 2WINB 2G4IA 3HQUA 4MH0E 1QMJA 3CF6E 1U0AA 4Y1XA 1ND2A 2VQTA 3GM8A 3SKVA 2A71A 3Q8EA 3V65A 2WO3A 4DXTA 3C7GA 4PQQA 3HVDA 3MPBA 4HL0A 1CGPA 3P3PA 5FWEA 3RMYA 3GZAA 3ZOIA 4NJ4A 2W94A 3M3QA 1W6MA 4XFGA 3Q8AA 2D6MA 4LKFA 1W05A 1UXXX 3BVCA 3I3DA 3ETQA 1EAH2 1RGSA 3OGJA 1ZRIA 3MLJA 4MGIE 1YQ8A 3K48A 1SCSA 1QJEA 2R073 2Y6JA 3OOXA 2E9QA 4Q0VA 1ZYBA 1UO9A 1JYCA 3AZWA 3CIHA 2OIIA 1TMF2 4BQYA 5FO8B 1EPZA 2DVFA 2QZ2A 2DUQA 1JMUB 1AYM2 1N3OA 2B5HA 2IXHA 1W3VA 3KCXA 5FZCA 1AR93 1J3RA 3UETA 3SISA 5H9PA 1EUTA 4L11A 4Q4V2 3I2FA 4N8MA 5FMCA 4DY5A 4GXLA 5CAZA 1SFYA 1FOD2 2WQ8A 3WUDA 4XFAA 2O8OA 2HWB3 3C7HA 5LATA 1GANA 2R043 3FJSA 3MV11 3J7LA 2PAKA 4NAOA 1GOFA 4UFJA 4NHYA 4ZS2A 1TME3 4AI0A 1J3QA 1UY3A 4I02A 4XDQA 3N4MA 3Q9OA 4DUVA 1M06G 1W90A 2UWBA 1SLBA 4YZ3A 4LBMA 3M3EA 1RHI1 2JDZA 3VDBA 4XFIA 1TVGA 1W8TA 2A3YA 4KU7A 1KJLA 4PIYA 2DFBA 3C2UA 4XJZA 2DVDA 5DN2A 5L9BA 2W87A 5A7WA 3B3QE 5CEHA 2DVAA 2B46X 1KITA 3K3OA 1DQ5A 1XOYA 3EB7A 4E8DA 2ENRA 3O0WA 1OXCA 5T55A 3BU0A 4Q1RA 1XE7A 2DURA 3ENRA 4Q8LA 1DGWA 5FY5A 1NUKA 4QXBA 3ZN5A 4AEDB 4RHV2 1VAMA 4NPMA 2R7EB 4QU1A 1S0BA 2RM21 3AM2A 2WJSA 1YC61 3POBA 4FFFA 1BVVA 2YROA 1RUG1 4ZPIA 1W2AX 1RUJ2 1R091 1L7QA 1OLME 2AREA 2C0ZA 2DYCA 5A3WA 3ZN4A 1ZBE2 1QH6A 5F5AA 3WR0A 3ORJA 4RGKA 3MIGA 5CA6A 5FZ9A 1V9U2 4Y1YA 2JDAA 5IK5A 1RUE1 1D4VB 5EV7A 1F8VA 2WFF1 1HQLA 4QB1A 3U0ZA 4EZHA 5LK7B 5BY5A 3GZEA 2XBO2 2J42A 4TWTA 4D8MA 5ABJA 4FFHA 3PL0A 1BMV2 3M3IA 5FZ0A 2HWE2 5FXZA 2VNOA 4BHPA 2E51A 1XU2A 1UYPA 2JIJA 2OT7A 1UX7A 1S2EA 2RS32 3J8F3 1X8EA 4V2WA 2HBTA 3KV9A 1DU3D 4LUMA 3SXWA 5CKNA 2BGPA 2VOTA 4AVSA 1MZ6A 5A6QA 1WW4A 2WYFA 4DRRA 4LPLA 1NCRA 4XF0A 4K8FA 5E6HA 1SBDA 4MG2A 5FZLA 2P4EA 5LZ6A 5BXXA 1SHWB 4KGGA 3MIDA 5EJ3A 1Z7S2 1M4WA 5DAQA 1F15A 2ZABA 3WF0A 3H3LA 4NWVA 1WD4A 2R6QA 2ARXA 4NOTA 1SBEA 4LBJA 2EALA 3C7FA 4IE6A 1ZZ6A 4AEDA 2IFRA 1A78A 5JLVA 1LGBA 2RDSA 4QKNA 3WP6A 4GZ9A 1ZZCA 3PLQA 4A7KA 1IG3A 2UURA 2Y6FA 4ISRA 2V5DA 1UOFA 4X6QB 5T5OA 4QGLA 5LK5A 4JX0A 2MHFA 1UKRA 4BH9A 3RYKA 3ZPYA 2WA4A 3CZUA 1GBGA 1OLMA 2QQWA 3J7MA 3I2IA 4XQDA 2P1BA 3SLIA 2BFUL 1LTEA 2LS6A 3FFQA 5LWBA 1AR62 4Y5SA 1E5SA 3GXUA 5FQ0B 1E5IA 2LM3A 4XVHA 5LY1A 3AP4A 2QZ3A 2BRTA 2ZGQA 3LFIA 2IFWA 4XW3A 4XMAA 3E6CC 4WVMA 1NY72 2IXIA 2NMOA 2VZOA 2ATFA 3H42B 2R32A 3UGHA 4E2SA 2FZ2A 1CZTA 1HN0A 1PGW1 3NNFA 3VKMA 2ZEYA 2J1TA 4K3UA 4BZ4A 4CCDA 1PO22 1ULFA 2VULA 4AVCA 3ZPOA 1O4TA 2P3IA 5T50A 4LT5A 4Y1ZA 2XVKA 4LO4B 4DS0A 2FDFA 3POFA 2E7AA 2JICA 1CJPA 3POJA 3AMHA 1YQ2A 1VBD2 2VMDA 2XB6C 4N53B 4PHZA 1LR5A 4MGYE 4JDNA 5DG2A 1RTVA 4K1YA 2YC0A 4QHBA 5C71A 1TNRA 2A73B 4B29A 4CA9A 3ZLIA 1AUYA 1HN1A 1YQCA 2ZMNA 4AVAA 4CRQA 1ND3B 1V00A 2YYOA 4N53C 4CCKA 3WDWA 1PVC1 4KG0A 4UI9L 4DRVA 1MVQA 1BYHA 3BUCA 1WW5A 3B9CA 4N9IA 2YPDA 5CISA 1ND3C 5FOJB 1AR91 1C1FA 5JSOA 1NXD1 2ES3A 1RUF1 5C3RA 1Y43B 1AR83 3MZHA 1VALA 3TAYA 2Z5WA 4GH4A 4JHTA 5LA2A 1UPSA 5HV4A 3LCPA 1URXA 2IXLA 1CQ9A 1UY2A 1WD3A 4QB2A 2R30A 3LA2A 3E97A 1DZRA 3HNBM 5SV5A 1POV3 2OXBA 3AYEA 1ZRDA 4L0PA 2HLEA 4N7UA 4Q4W3 4JHZA 5TSWA 3LFMA 4DB5A 1JU3A 1UZVA 2WNVB 3ZFGB 2OPKA 3N7KA 2Q8OA 3GNEA 2RS51 1OQDA 3KWVA 3R0RA 4AWDA 2ILMA 5DAWA 2WNVC 3ZFGC 2VOXA 5FY9A 1LNSA 1V6JA 1R1A2 2QQLA 4FOWA 4AG4A 5JMCA 2WKKA 2WLQA 1SPPA 1VMFA 3ECQA 3O0XA 3WSOA 5AFEA 3RZHA 1SCRA 4AL9A 4BQ3A 2HWD2 4AOCA 4A3XA 4M00A 4DQAA 1JOPA 2Q5TA 5A3TA 2B45X 4YFWA 4XJ9A 3NNGA 3PJYA 1W6PA 4JKMA 1G6NA 4UFMA 4CP9A 2P3JA 1US3A 2EXJA 2VD7A 2RS13 2VBPA 1JZ5A 4BK5A 1ZBA1 1GKBA 4YARA 2F4LA 4LQRA 4Y26A 5D1IA 2GC0A 4CEWC 1PK6C 2FDGA 1ND3A 1GNZA 1FMD3 1YUDA 2VBDA 2VMGA 2XLAA 3FBYA 4URTA 4UBGA 5F7UA 1X33A 5J98B 3BPSA 2WWUA 3LD8A 4Q8KA 2Z79A 5J36A 2Q8CA 1SLAA 1CZSA 4Q27A 2JB8A 2BV4A 3KVAA 2CWSA 4JAAA 2HH9A 3B93A 1UU4A 4HVOA 4XZUG 4LO6B 4E4ZA 1JI6A 1QNWA 1RXFA 2PQQA 1UD1A 3NL1A 5F8PA 1AR72 1AYN2 1UXZA 3N7LA 3VZLA 1COV1 4XHBA 1QJU1 2WNOA 3NV2A 3T2TA 3JB8A 3PNAA 5A7OA 3ZXJA 1NA1B 2WNVA 4AW7A 2GC3A 4QDRA 3H9AA 4NIIA 4OI1A 1L3JA 5IK4A 4YFZA 3I2DA 3ES1A 1PO11 1EYBA 3H50A 4RL7A 3WG1A 4GMP1 3K46A 3KCCA 1JYIA 1YFUA 5I0SA 3DUIA 3J4UH 4XF4A 3WP4A 1W8NA 3CO2A 5AFBA 2OUHA 4KQ7A 3I2HA 1O91A 1OLQA 2VAUA 3TNPB 5C6CA 1AYM3 3FBMA 4FP3A 2BEOA 1LU1A 2OZ6A 4XUTA 5CVRA 1F2NA 1K5MB 1Q8VA 3CEWA 3H7JA 1FPN3 1R082 2OQ6A 1PK6A 3WCRA 4CEWA 2HEVF 3B02A 2I74A 3ATGA 4P9IA 4IEPA 4IE5A 1D4M2 1VLNA 1K5MC 1Y3TA 1XXNA 5CZKA 3WEZA 2PLV2 3BIWE 4NHKA 1CAXB 4OMCA 3O1TA 1Q8SA 2QQMA 3I59A 4M3CE 3UESA 5D8AA 2R49A 1X8MA 2OYZA 1ZNPA 3TEXA 2XKOA 5JWPA 5FPAA 3URFA 2A6VA 4P9YA 5FXVA 1HRV3 4GB33 4DXRA 1Q43A 4MZUA 4M3CB 5EHDA 2WQ4A 4OULA 5IAVA 4ISQA 4HN1A 3IDBB 4P9LA 4C0HA 1N3PA 2CDPA 3H3ZA 2WT1A 3AP7A 2MEV1 5K4LA 4AI9A 4B7EA 4C91A 1RJ7A 4QQOA 3DGTA 1UMIA 1LHWA 2VCCA 3KT1A 1LEMA 4UT5A 2R062 1UYYA 3VKNA 1SEFA 3AMQA 4RR3B 3PVOA 1VB4A 4M4RA 3I3EA 4U2AA 4TTGA 3IWZA 4A4AA 1GZTA 3GBFA 3L9JT 2OZJA 4QAWA 1X36A 1GR3A 1JZ4A 2NZ9A 1PZ7A 1QKQA 2RHPA 1WBFA 1Z0HA 2G19A 3VN4A 2K46A 1UIJA 2L9LA 1QIQA 5CBLA 1N1YA 5FR3A 4LO8A 2UWCA 4EN9B 2NMNA 4QPIA 1FYUA 3VHOA 1BEV3 2DCKA 1YXWA 5EZWA 5L7OC 1MS4A 2Y0OA 3N9MA 1OF4A 2YBKA 3JD71 5GLUA 5LASA 3GHMA 5HCAA 3CJXA 3FLPA 4JQRA 2Y6GA 1NX9A 1EV11 2BNOA 4XBLA 4AEDC 3D8CA 1HXS3 4SLIA 4ZHNA 3NKGA 5FZIA 3U78A 1GZWA 1VBE2 1UMHA 1Z78A 3G7DA 3T4HB 3ZDVA 4CYDA 4QX1A 3ZR6A 2XGXA 2VMIA 4ZZ5A 2D3RA 3MF6A 4TXWA 4HOOA 2UWAA 2VMFA 3CKHA 3AP9A 4PIXA 1OUXA 5GLWA 4LEJA 5ACA1 3ZYRA 4A6OA 3AL6A 1CAXA 1O59A 4R9DA 2ZA9A 2BBAA 4Q0SA 4ES9A 2F6BA 5A6XA 3WNNA 1H2LA 1R1ZA 3I3MA 2B9UA 3H8XA 1AZDA 2RDQA 4PI2A 4AFCA 2QQKA 1XYOA 4UFLA 1O8SA 1G9DA 2ARCA 2ZGSA 5A3OA 5FXXA 2CV6A 4M3CA 1RUI1 4HZFA 5KXDA 1J84A 3VHNA 3KT4A 2EF6A 3VD4A 1HJGA 3V64A 1VRH2 2P3KA 2VOWA 5FUIA 4PF1A 1HRI2 4HPKA 3E5QA 4F3JA 1IHMA 4BJ0A 5L9RA 3BOWA 3KGLA 3KHBA 1RUD1 5CNAA 3TEYA 2YGLA 3R4DB 1BBT1 1C8M3 1DHKB 4WV8A 5BV6A 3OBZA 4AEMA 1E57A 4BWOA 4KBBA 4AVBA 4S2FA 1HKDA 5IVBA 5L7OA 2E26A 2JKXA 3SCFA 3H7YA 2W1WA 4BLJA 1K42A 3ZYJB 2WBKA 2OW4A 4E27A 2GNBA 3HMYA 2YU1A 2VMEA 3FL7A 4IE7A 4QPGB 4YGDA 2D5HA 4NRQA 2WQZC 4MO3M 2JEMA 5CFCC 1AR63 4MX3A 1H30A 3VBSB 4OVEA 2DBIA 1S0FA 1G9BA 3H1YA 2IUWA 4QPGC 5FZDA 4IEWA 4D6QA 1HLCA 4BA6A 3L2YA 1GU3A 2LW8A 1XYNA 2JJ6A 2WO7A 3MPPG 5JUVA 2QKDA 5J48A 1YYNA 3DECA 1MS1A 3UYJA 2Q8EA 3VBSC 4BQ2A 3W58A 4AK3A 2KM2A 4IEZA 4Q4X1 1ULDA 1I3HA 1ZA4A 3CHXA 3U10A 3LF7A 4MLOA 1SLTA 2DTYA 5A32B 4PLOA 4HKWA 4GWIA 2D6KA 4D6RA 1FT9A 1UZZA 4DY3A 1GMMA 1REEA 1WMXA 3AJZA 5FZHA 4YYOA 1QJX2 1OMIA 2JENA 4XAEA 2P6HA 1PNGA 2GN7A 3NNJA 1YI7A 2E7QA 3ROUA 1UW8A 2RMU2 3UL2A 3VBFC 2C26A 4QQLA 2EXKA 1DQ4A 4B4RA 1A8DA 1NQJA 1EAH1 2CSGA 3DPRB 4H2AA 2Y0IA 4PI0A 3E6BA 5ISLA 1BK0A 4GD4A 4LMFA 3WDXA 1RUNA 3HT1A 5FJKA 4XETA 5FZ7A 1FXZA 2PN5A 2KR2A 1GNHA 2CL2A 2VR4A 4CU6A 1MACA 3DPRC 4LOTA 1TMF1 5FZOA 4JRLA 1DYKA 2BVVA 3GBGA 4XUPA 3ZYHA 1AYM1 4IUGA 3LOBA 1HX6A 1JZ2A 1CWPA 3QD6A 1RHI3 5CADA 2YGMA 3RRDA 4ARYA 1WCQA 4IQPA 1T2XA 1WW6A 2NP0A 2ARAA 4Q4V1 3WCSA 1OKQA 1QJY2 4NROA 4A3ZA 5CFCA 1QOTA 4A7ZA 1FOD1 1NE6A 2VXRA 4LHLA 4C90A 2XLFA 2WYSA 2WO2A 1ENQA 4MHUA 1SG3A 4XF9A 4UOJA 3NV1A 4R52A 2D3PA 3NAPB 1AHSA 3USUA 3VBSA 1NAEA 1ZRFA 1J83A 2B9VA 3BTYA 4OUEA 2ZPXA 2YUEA 5IVFA 3J26N 1GOHA 4YG6A 3VBHB 2JDUA 5GLTA 1F31A 2LUWA 3NAPC 2A7AA 2RM23 3CJIB 1I1EA 4AVVA 1RUG3 5GLZA 1R093 4RQPB 3ABZA 3IB3A 4YM2A 3V56A 1HQWA 2VZQA 2ORZA 1XNCA 2WN2A 4JTOA 4LO5B 4NN0A 5FP3A 2VQUA 3CJIC 5GZFA 3AZXA 3R4UA 3VBFA 3LZZA 4RQPC 1RUE3 2WFF3 5BNNC 2VY0A 3ACFA 5JOYA 1W6QB 4FFIA 4OI0A 1OPOA 4P9WA 3UKNA 1OQ1A 4XAAA 3IIIA 2BDRA 2LALA 4WBBA 4QGMA 4CXWA 3DPRA 4RHV1 3I3BA 5HXVA 4QU2A 5A3PA 2XJVA 2RDNA 4PLMA 1RUJ1 4CU7A 4URAA 2DF7A 2AGSA 2B39A 1ZBE1 2NM1A 4MSVA 2VECA 5FZGA 2Z69A 4K7JA 4BMEA 1A6CA 3HR9A 4RYDA 3RMXA 3TYJA 3ACHA 1V9U1 3OSDA 1ZX5A 2VE1A 4FAHA 4XHXA 4YVWA 1HQNA 3WHUA 2HEYF 1JYVA 3O1SA 5BNQA 4XPVA 1YJLA 4XFBA 1QEXA 2XBO1 2R1DA 1YI9A 3AP6A 4QX2A 3WNXA 1HB2A 1W6MB 3LIGA 4H7LA 4LIVA 4AQSA 1BMV1 5H9QA 5FYSA 2HWE1 1D0GA 1G8WA 1DQ2A 3AJYA 4N9HA 2XWBB 5F37A 1VAKA 1OA3A 1QOOA 4HFSA 2RS31 5LEKA 2WZPP 4ONUA 3VHPA 4CVUA 2RR12 3WP5A 3TN92 4IEYA 3RQ0A 5A7PA 3O1MA 3M4FA 4FOVA 3BIEA 1OQEA 2VU9A 4IW3A 3O1PA 1JOBA 5FJHA 3B94A 1ONAA 4RQPA 1QJZA 4AQ6A 4V2VA 5F6LB 3SMHA 2VGDA 5A7NA 5BNNA 3ALQA 5JIUA 4CDWA 2R0FA 2VZTA 3ACLA 2ZHLA 4XEZA 3WD5A 2GSYA 1Z7S1 4MXWB 5DUXA 3U1XA 4O7XA 2EAAA 3TEZA 1AXYA 4KWJA 2Q4SA 3WW4A 4YG3A 3PUIA 3GDBA 3UJQA 1CD3G 2JE8A 2TUNA 2AEZA 2ZGNA 5E88A 3TNQA 3VBRA 4PCRA 3NJZA 4XFHA 1DBNA 3RJRA 1OA4A 2X5IB 1TE1B 1S0IA 2QQIA 4MVTA 4ATFA 3K75B 2FQPA 2WABA 3SCHA 4GAZA 4RD7A 2ZMKA 2X5IC 3M3CA 2XOMA 2BNNA 2XHKA 4FQZA 4HBNA 4Y5TA 3H8UA 5F5QA 4I0WB 5GZDA 3FHQA 1AL22 5A7WB 3VD5A 4BCUA 1H6YA 2D6NA 1FX5A 4AGVA 1KGYA 5DDJ2 4DIQA 1GSLA 2JDYA 4LKEA 2A3XA 4IEUA 1AR61 1FATA 4MHRA 1FNYA 3K2OA 1A3KA 2GP3A 2HYXA 3PTRB 1BLZA 3KLSA 4IEQA 3PVEA 2C1FA 3CNAA 3FE5A 3IAPA 1LOAA 4JKKA 4YW3A 3VZNA 2ZHKA 2BWAA 1HV0A 2ZGKA 1NY71 3ZXKA 3NNMA 3VDDB 5M0TA 2OQ7A 1PVC3 4DUWA 4XE9A 4YM3A 3DKWA 2VL4A 2XJSA 4LKDA 1H1MA 4ASMB 1WWYA 1PO21 4YWAA 3VDDC 5BYNA 4U36A 1RUF3 1OHFA 5HCHA 2YC2A 2UY8A 1GV9A 4NPLA 4QX0A 4Y20A 3U75A 5ABJB 2WA3A 3HOBA 4KL1A 1VBD1 1DZTA 2DBNA 3CBNA 2F4PA 3I2GA 4XZPA 3MW2A 2QNKA 3SQOA 4MXWA 4DNYA 4MOAA 4CCNA 2JWPA 5KHKA 5LCWL 1KD7A 1F4HA 1B35A 4HONA 3OPWA 4QHOA 5J37A 2J1AA 1S2KA 5ABJC 1CIWA 1H1AA 5C7GA 1POQA 3GBWA 3NWKA 2RS53 1HB1A 5HPOA 3T1MA 1V6LA 2K2SA 3T2OA 2E63A 2X5IA 2BQPA 3SH4A 2XUMA 3DKQA 4FXKB 1NCRB 1WMDA 2KA3A 1IGOA 1RXGA 1SDDB 5F5IA 3U11A 2XLGA 4FPJA 4W50A 1EP0A 4XTPA 3LQCA 1POV0 4HSLA 4BPZA 1HDKA 1WMEA 3ZX7A 3IPVA 1NCRC 2JDKA 1UZYA 1KS5A 2ZGLA 3AKRA 4XACA 4RGAA 4UF0A 4NUBA 2J1EA 4XURA 2V09A 3KS7A 2RV9A 3WG2A 1SQ4A 4IXLA 2ADEA 4IEOA 4YNIA 1VRH3 1CAWB 4AQ2A 1ZBA3 2EXHA 1HRI3 3ON7A 2X29A 3PVNA 3OEAA 1UN1A 4Q4Y2 5FREA 1DF0A 1IOAA 1XU1A 4D7YA 2YC4A 1Y9MA 1R1A1 4G9SB 3VDDA 1LECA 3S5AA 1JYTA 3N36A 2GDFA 3MI8A 3PUAA 2XXZA 5EIYB 4XDOA 1IPKA 2XMLA 3ETPA 2BU9A 3IM0A 1XNAA 2HWD1 2WNEA 3OGSA 4CEYC 4I3GA 3THCA 3FLTA 3PIJA 4FPGA 1CPNA 4FPCA 5JSRA 3JBG2 4YVSB 1OF3A 4QDQA 3HBKA 2FBEA 3MYXA 3E1F1 3HBZA 5FLHA 3OYWB 3VZOA 1W04A 1COV3 4YVSC 3WOGA 5C3OA 3MO4A 1QJU3 1RUC2 4IEXA 1O3RA 2PAEA 3Q8BA 4NO4A 3WF3A 4WVMB 5F3CA 1U5ZA 1MVEA 1FNZA 5JSPA 3T4VA 3S6PA 1LJ7A 2EVXA 4OQ9A 3VZKA 4KNCA 2YXSA 1X50A 3HN1A 1PO13 4WVVA 5JDBA 5KHIA 4GMP3 3WNKA 4BQWA 1O8PA 4FP2A 1DZQA 2XJPA 2KD7A 1JZ8A 2ZAAA 1Y7BA 4XUQA 1EY2A 2DU0A 1UL9A 1QF3A 1YQ6A 2V73A 4H7MA 1LGCA 3VUOA 3ZSLA 4LLOA 5CG9A 1NCQA 3AKQA 1AR71 1AYN1 1LAJA 2WIIB 4UFKA 1GWMA 1OI6A 4GULA 5I0DA 3P5BA 4QMAA 2VUAA 3HQXA 4KWLA 1IQAA 2UY9A 5C3SA 4FPLA 3O0VA 5F32A 1K3IA 3T0DA 5E1RA 1CAWA 1IS4A 1RMU2 4CCCA 4Q1PA 2X10A 1UU5A 2DDUA 2GNTA 5CIRA 3S5QA 5HBAA 4CUAA 3C3VA 4CEYA 5LEJA 3MLKA 3FC0A 1RB8G 4GJZA 4FOQA 2W9XA 4I2OA 1KFUL 4WZCA 3FLRA 1RL3A 2A75A 4LHSA 2WC2A 4XOGA 1GP5A 3WQ7A 4GH4B 5J7MA 2QJVA 4P00B 5C3QA 1H8TC 4CU8A 4YVSA 3PU8A 3E5XA 1MS0A 4IEVA 4JTNA 5DQ0A 2X8KA 4GH4C 5IK8A 3UGGA 3LAGA 5CB7A 1R081 2MEV3 5F6KA 1TNFA 5C4WC 1H1IA 4LLFA 3OYWA 5FPLA 2WS92 3MLLA 4M0NA 2IXKA 3KF5A 3T08A 1D4M1 5F5CA 1BJQA 2HWF2 3ZXGA 1ACCA 4BMBA 3KB5A 2PLV1 1RVF2 1UIKA 4PLNA 4A2UA 4AAXA 4AHZA 3T09A 2ZKNA 3LPFA 1SPPB 4LBKA 3RZMA 5EXOA 1ASJ2 1ZA7A 3SNMA 1I5ZA 2ZEZA 1W8FA 1PX4A 4CPBD 4M3CF 4KBZA 1W03A 4ZU7A 1UAIA 5E8AA 3ZO0B 4FPKA 3R05A 3MF9A 4P5HA 1VRBA 2VMHA 2Y6KA 1HV1A 1W6PB 4N7IA 4AFDA 4AF9A 4CP9B 2VZ3A 3I97A 3JD73 5IYYA 4Q0QA 5KHJA 1GQPA 4NHLA 3HEIA 4UFHA 1EV13 1F5FA 1RINA 4I3PA 4LKSA 2R061 4V1PA 1DDLA 3QBQA 4JVAA 4QKBA 3VBHC 3ZXLA 2DCZA 1B09A 4YW7A 4AI2A 1JTZX 1SFPA 2ZX3A 3GYDA 2XQRA 1S2BA 1YFXA 3K4DA 3ZIXA 3AKPA 5ACA3 1CAVA 3RI9A 3CDZB 3UNPA 1QDOA 4BU2A 2JX9A 1OURA 1RUH2 1U12A 1VBA2 3OD4A 1SDWA 1CZVA 5KXEA 1H8TA 3TEWA 2UYAA 4ZXEA 2VCMA 2D3SA 1OOPA 2GH2A 3HD8B 4R8HA 3FUOA 3WVJA 4K40A 4NE9A 1XYPA 4UYBA 4XXAA 4BQXA 3S0MA 3RWNA 3HAGA 3HNMA 1H2KA 3N9LA 2AENA 3QH6A 4C0BA 5C4WA 4CUGA 5LB6A 1RUI3 4RFT0 1OPMA 3W9AA 2WWSA 1IKQA 4CP1A 4Z8BA 5JXGA 2GC1A 1VBE1 3AXDA 5E89A 1OUSA 5B4NA 4RGGA 2IZWA 3D0JA 5H9RA 2JE7A 1O5UA 3WW3A 1NKGA 2BJSA 4QQ2A 4I0AA 2BZDA 5I93A 1UY4A 3KV6A 2GMMA 1UPIA 4EV0A 4LR4A 1RUD3 2D40A 2PHLA 2DU1A 1XNKA 5D2AA 3SC7X 4B3NA 1BBT3 3OF1A 2VVFA 5I8SA 3D6EA 3P6BA 4LTAA 1NQDA 2HWC2 2ZOEB 2SLIA 2VNVA 4XDPA 1T6BX 5A80A 3BYWA 5F2WA 4WM8A 3ILRA 3QH7A 3APBA 2ZGPA 5IVYA 4CEWB 1V6OA 4K8RB 1PK6B 4EJRA 1VRH1 2UU8A 4LBLA 2G1MA 1HRI1 3HIFA 1VBC2 4QKDA 3RWKX 4AR2A 5FPXA 2W1UA 2E53A 3DYPA 4W4ZA 3JZVA 1S1AA 3I54A 4E4SA 3N3HA 4YW4A 1WMFA 1Q8OA 3I59B 5FXWA 3S30A 5D8AB 3O1RA 4E4DX 5AC92 1MEC2 2TNFA 2QQPA 1STMA 3M1HA 5L9VA 3OUIA 5FY7A 4L99A 4MYEA 4QPWA 2D6OX 5FOBB 2LRPA 2PAMA 1CAUA 2JB4A 3CZJA 1W6OB 3FN9A 4Q4X3 2A6YA 5T5LA 5D8AC 3RZZA 4XJAA 3BN6A 1N1VA 3MIBA 5J96B 4AYUA 1IS3A 5FY1A 1RIRA 3J7HA 3IDAA 4Z82A 1F9KA 4RA0A 2VW1A 1JXNA 1JW6A 4C8DA 4NVPA 4Y3OA 5A6ZA 3KF3A 2RJKA 4DPNA 4MUVA 2VTFA 2WT2A 2ZX1A 2QCSB 2P34A 4LE3A 4OHWA 4S2HA 2O8QA 4WZFA 1H6XA 3FMGA 1EAH3 2ZX4A 3OPTA 5FP8A 5A3NA 4C1WA 2JKBA 1OT5A 4LA3A 1DG6A 3SHRA 3LSEA 4WM7B 4QPIB 1YLLA 2WWJA 5DG1A 1TMF3 3CQOA 5IVVA 3BODA 3Q8CA 1Q3EA 3B5LB 3H3UA 4QT6A 4QXHA 4JDMA 4GWNA 4TLFA 4I09A 4WM7C 2PA7A 4QPIC 1QJX1 2BOIA 1GZWB 2AC1A 1PIV2 4Q4V3 4CU9A 3H0OA 2P17A 1WA4A 3OUHA 1OD3A 1N3QA 2RMU1 1FOD3 3MIFA 4YG0A 1VBB2 5IW0A 2HEWF 4AGGA 4CXXA 4UW6A 2IXCA 1YRZA 1U5XA 4LK7A 1AX1A 3CU7A 4TN7A 2BGCA 5GM0A 1OVPA 2W08A 4KU8A 4EN0A 3O1OA 1ENSA 3RG0A 3NQHA 2VZPA 4AEKA 4AFBA 4MGSA 4YPJA 1OKOA 2OUJA 3AYCA 3B01A 1H2MA 1W6OA 2JDNA 3AK0A 4XBNA 3WF4A 2I45A 5JR7B 1LULA 2PHDA 3DEMA 4OMDA 1Q5OA 3W21A 3AFGA 5H9SA 1MPXA 1QJY1 1W2OA 2D44A 3VDCA 1OA2A 3WQBA 2RJ2A 4HPKB 1N1TA 3WV6A 4XIKA 1JZ3A 3GJBA 1UOBA 5KC6A 2KXLA 1WKYA 4XUNA 3RZJA 1CN1A 5F3IA 3W5MA 2WZR2 3HQRA 4FPYA 1VB2A 2W92A 2RVAA 5IT6A 1O3TA 5C8WA 1F5JA 2QQOA 3U37A 2VUJA 2ZJCA 2J22A 4YM1A 3E6DA 3OGVA 4XF3A 2WNUB 3PTYA 3T2QA 4RHV3 2C9KA 1L7LA 3ST7A 5L7OB 4BYYA 3BTXA 3UKTA 4DEVA 1V0AA 1JHNA 2FCVA 3ZKUA 5E16A 3SKJE 4WM7A 1RUJ3 2WNUC 4R4XA 2F17A 5I91A 1ZBE3 4NRPA 5IVEA 4NHXA 4XILA 3WW1A 4CCLA 5JI9A 2C6SA 4YGEA 5JOZA 3WF2A 2R072 1V9U3 5SV8A 4LHNA 5KC5A 4OI2A 3TRSB 5FRAA 1W9FA 1D7PM 3ZXFA 3MV01 1AL0G 3KZ4C 4M4PA 2XBO3 1AX2A 1HW5A 2A5ZA 4DINB 1OH3A 1AXKA 1X9TA 1ZVFA 3H8OA 1CONA 1CR7A 2HWE3 3G6JB 3M7AA 5DABA 4BLIA 3RDIA 3ZR5A 1MS9A 4BQ4A 3J9SA 5BNOB 4NIGA 4J1XA 2AACA 1S0DA 4I01A 5FYCA 1GQGA 2RS33 5KR7A 2X05A 2GNMA 5C9AB 4ORFA 2W1SA 2VZSA 5LA1A 5FZ3A 3LEKA 2BBVA 3I4IA 4ZU5A 3VL8A 4EN8B 3USSA 5BNOC 2HWB2 3C7OA 2Q0AA 2IWGB 1F35A 1KDMA 2R042 3H8RA 3W59A 3LGRA 4IE4A 1DGLA 2EICA 5C9AC 3UKVA 1MS8A 5FKCA 3ACIA 3I8TA 4NPRA 4Y33A 1E5RA 1TME2 2A1XA 2CGNA 1OSGA 1ST8A 4AVTA 5K0UB 4A7YA 1W0PA 3RPQA 4AE2A 5K7PA 5HCBA 1JZ7A 5IUQA 4DUXA 1Z7S3 3HN3A 2ZKLA 2WZ8A 5CKMA 5K0UC 2VZRA 1DCSA 4K6BA 1RJ8A 4YZ5A 2IC1A 1VMHA 4NIAA 4D6SA 2RR11 4UXAA 2TEPA 3NMBA 5GALA 3TN91 2WNUA 5FZOB 1HB4A 1BHGA 2P3YA 4FCAA 1D2SA 1BCXA 2PTMA 3VB9A 1ZM1A 1Y9QA 1E5HA 4EQVA 2VMCA 2YBSA 3OY8B 1QWRA 4YZ2A 3WNPA 5CFCB 4Y1UA 1GFF2 2QE3A 3CLPA 1VAVA 3ZSMA 4NWWA 4XFFA 2A3WA 2VW0A 1UOJA 1W3XA 4YRDA 4QX7A 2XUEA 2R0HA 3N35A 4QM9A 4XJUA 5EYXA 3USUB 4D7TA 1IG0A 4Z2WA 5F39A 4UFIA 3PMEA 3B9IA 1C8NA 1WUVA 1VIWB 4G3YC 3ZN6B 5BNOA 2VVEA 1AX0A 2ZZQA 3ASIA 4AZZA 2VNRA 4FVVA 4DZGA 5G04L 5C9AA 1CX4A 1XC6A 2OKXA 4CZSA 1ULGA 1LOCA 2FDKA 4NAMA 1CVNA 3BPZA 3POYA 5FK7A 1IS5A 1MQTB 2Q1ZB 1AL21 1PO23 1YFWA 3VBFB 2O1QA 3VZMA 1OLRA 2QFEA 2FCUA 3J8F2 4F8AA 5DDJ1 3K51A 4PIZA 2RDRA 4RSUA 2GP5A 5K0UA 3MFAA 1MQTC 3O5SA 4HG6B 5FZAA 5A70A 3PMSA 2WR9A 3VHRA 1DYOA 1VBD3 4FOYA 5FY0A 3X29B 4CCEA 2Y60A 1O3SA 2CTVA 1QNYA 1FV2A 1X82A 1V70A 4Q26A 4FSJA 1DLLA 4GIQA 1TEIA 1WCSA 3PVBB 1UZWA 3KD4A 5A7SA 2A6WA 4FTBA 1C5IA 2I2SA 1LENA 4YGBA 1LOBA 3ZSEA 3QCWA 4FPHA 1NG0A 3GALA 2B7YA 2D6LX 5IATA 2C4XA 3EQEA 1RC6A 3EYPA 4IV3C 4K1ZA 1W8UA 4J1WA 5DXDA 4CE8A 3V0BA 3BTAA 3K4ZA 4YVWB 3OY8A 4J25A 4BXSV 4MV2A 2EA7A 3R4SA 1ENRA 2W46A 4BDVB 1S4CA 3SCGA 3ZFEC 4FAGA 3VDAA 1Q8QA 3BKZA 3WHTA 1W8OA 1EPWA 3VBOC 3AVRA 1ZZBA 3I3QA 4YVWC 3AXEA 4AI3A 3UK9A 4LNVA 3KVBA 1LEDA 2N7GA 4JV4A 3PDQA 3VZJA 1JS9A 3EXUA 3JQXA 3LWCA 1JH5A 3LDKA 4TLGA 4COZA 1GWLA 3M70A 1W9WA 3N7MA 1UMZA 3ZN6A 5FPUA 2ZBJA 5C8CC 4XQWA 5K9YA 5I8TA 1V6MA 2E6VA 2XH6A 4PDWB 1PZ8A 1LHVA 1R1A3 1PHMA 3NKTA 1W6NB 1ALYA 1S0CA 3F2ZA 1YHFA 1PMIA 5BNNB 4JGZC 3JQWA 1MQTA 2ZEWA 4CDWB 2Y38A 4P08A 2HWD3 4KGQA 2QTWB 4PDWC 3V0AA 3MIEA 1S0EA 4HXCA 5F1RA 4HN0A 4OFGA 2PHXA 3M3OA 2WL1A 2W52A 1QOSA 4F83A 2PHRA 3DN7A 4FPOB 4CDWC 3P1IA 3ZIWA 3VBRB 1GQHA 1YWKA 2Y8KA 4COUA 1JU4A 4MGTA 4LBQD 3ZYIB 4OUSA 2QQJA 4Q4Y1 2HJIA 4HKOA 4IV3A 2K9ZA 3DV8A 4P02B 3AKSA 3D3AA 3VBRC 1V6IA 2OVUA 5FK8A 1GOGA 5FO9B 2I07B 2DUPA 3EHKA 4ARXA 4L8QA 2E33A 5A7QA 3OPZA 1W8ZA 1ULPA 2XJTA 2BNMA 3EMRA 3ZFEA 3THDA 2CAVA 3VBOA 3JCIA 1UOGA 2WZEA 3JBG1 4L2NA 4KG8A 2DWRA 3B69A 3MHZA 4ITCA 3E5UA 2GH8A 3K3NA 3WY6A 5FFOC 2ZHMA 4TZDA 1AR73 1AYN3 2EXIA 5EWSA 3WG3A 2DCJA 3TBDA 4A41A 3WXPA 5LY2A 1RUC1 4Z07A 3EJKA 3O1VA 1AR82 4ZKTB 4YGCA 5C8CA 5DAPA 5JOWA 1J59A 3OBTA 2GU9A 5DPNA 5FZMA 2CGOA 4MXVA 4O61A 5GLVA 4B8EA 1HJFA 2TBVA 4XIOA 5IHRA 4JGZA 4QPYA 1F4AA 1K5JA 5FP9A 4Q4W2 4P9JA 4PDWA 5JZGA 1O7FA 1J1LA 1W6NA 2VH9A 5FCCA 2WUHA 1S0GA 4Y20B 2W3JA 4P5YA 2JG9A 1PM7A 2YPJA 1SLIA 1SACA 2R16A 4Y22A 4OHZA 2GN3A 3VLBB 4IL7A 2D5FA 4A44A 1UYXA 1QQP2 4E9KA 1B35B 2BP6A 2ZACA 3ZXAC 3A0NA 3GGLA 4FO9A 5IFTA 4L92A 4HT1T 3GZUC 3ES4A 1FV3A 1R083 3ZYFA 2VBBA 4EZ4A 3R6SA 5GKAC 2YY1A 3OG2A 5JXIA 1VBB3 1RMU1 1B35C 2CNAA 4KWUA 1D4M3 5FZ1A 3S7IA 2W91A 3KGZA 2XPJA 1UNBA 2PLV3 2AUYA 1XE0A 4C1XA 1YQ5A 4ASLA 4GJYA 3RNSA 1O6UA 2RS12 2VUCA 4TYSA 3IPVB 3ZMNA 4R4ZA 1BQPA 1SZBA 4UF0B 3W5NA 4IE0A 5FWJA 3AZYA 2VNGA 1KFXL 1REFA 1FMD2 3AYDA 1EUUA 1OVSA 4B1MA 2XQXA 3VKOA 1QXPA 2FCTA 4EWAA 3GHNA 4BQ5A 5IVCA 2WS91 1CIYA 4YZ4A 4QQHA 2Z42A 5C33A 4X8NA 2HWF1 4HANA 3ZYBA 2R063 4R9AA 3WLUA 1RVF1 2D6PA 5LBBA 2R1BA 3LA7A 3ILNA 4E4HA 4BQ1A 2QDRA 2BUKA 1ASJ1 1ENXA 5FTTC 1YIPA 1NE4A 2ZGTA 5I8YA 4BE3A 1W8WA 2W47A 2W95A 5A1LA 4Q0UA 4EWEA 3KHCA 1NOVA 4HK8A 5AVPA 1UCXA 4META 4B4QA 3NNLA 1XE8A 1DQ0A 5GZGA 5DAXA 1UU6A 4DMIA 4BIOA 1W0OA 1LKNA 1PX3A 3DYOA 4S2GA 2YBPA 2ORXA 3TWIA 2IXJA 1C28A 2FDJA 4QGNA 1VBE3 2DTWA 1W39A 1PGSA 2Y64A 4QM8A 2Y6HA 1LCLA 1SLCA 4BB3A 3OBRA 4HSJA 5B4XA 1FPN2 2VZ1A 1RUH1 1VBA1 1WGPA 3RYPA 3T0AA 3KV4A 3MBWA 1QXRA 1K45A 1PVXA 4ZONA 3BI3A 1QU0A 1T6GC 1NCQB 5KBFA 1YEWA 1ULCA 2VTXJ 2VCBA 3QOPA 3LDBA 5DUWA 5FY8A 4EN7B 1UX6A 4EYUA 5JPMB 4I30A 4B4PA 3UV9A 3WNOA 2JD4A 3ME2A 4LBNA 5I0UA 1QDCA 1NCQC 3L2HA 5T5JA 2GNDA 2FMYA 4AFAA 4E2GA 4GA9A 1X9PA 2CGPA 1KXGA 2WDBA 2OX0A 5FZBA 2ZAHA 5FBJA 1HRV2 4Y4RA 4GB32 2X09A 4AHXA 5FP7A 3DL3A 1YNAA 1LODA 4CEYB 5FLIA 1DQ1A 2VQAA 3D82A 2YV8A 2GC2A 3NJVA 5K8SA 5DUUA 4Y4YA 2JXAA 2PHFA 3D0SA 4OHVA 5EQUA 1OC1A 2HWC1 4IETA 5DZFA 5IK7A 2YU2A 5JAXA 5DZGA 3T1LA 3VD3A 4CDUB 1TQ5A 5FY4A 1DP0A 2CU5A 5F3GA 3D5OA 4M0HA 5BUVA 4FBFA 4OHYA 2ET1A 4R9BA 2WFPA 1KQRA 1UWWA 2Q8DA 3WZ1A 4CDUC 2XHNA 1H4HA 1VBC1 4UAPA 3QACA 1LRHA 4GKYA 5FZEA 3FHAA 3OBAA 1BEV2 4DXZA 1OFNA 2MNGA 5EJ1B 2RE9A 1TG7A 3F95A 4XBQA 1CPMA 1WA6X 2Z4FA 3WDVA 5DZEA 4MGKE 4GALA 1Y9GA 2YFUA 1MEC1 5AC91 3LA3A 3B7MA 2WN3A 1HXS2 1VJ2A 1I5PA 3DYMA 4GQ7A 1QHDA 2CWMA 3A4UA 3KCYA 4CDQB 2VG9A 2XJQA 5JIAA 2H6BA 4BK4A 1PGL2 3BB6A 5FZ6A 4JC1A 1O3QA 2Y33A 4CDQC 3ITQA 4Q0PA 2HBUA 1IZ3A 4EWDA 1BZWA 2GMPA 1QJX3 2BW8A 1WLTA 4INDA 4W6YA 3UJOA 1H9WA 4LULA 3POEA 3O14A 4KH9A 2RMU3 5A3UA 3HT2A 3OB8A 2NPIA 4YW5A 4F7ZA 1AF9A 1VE0A 2EAKA 1CAVB 3AMPA 5FMOS 2J7MA 3TB0A 1SBFA 3EO6A 2ZZJA 1XNTA 1H8TB 5FYTA 1C4RA 1O4YA 3ZSKA 1OOPB 3ZSJA 5BPXA 1J58A 3THPA 4UWDA 1ZRRA 5C4WB 4COVA 2VTXA 1OOPC 3WDTA 1C8M2 4BM8A 4CDUA 5HI0A 1G9AA 1LOFC 1PIV1 4GKXA 3ZYGA 1QJY3 2A70A 3WT3A 5FYVA 3IDCB 1BXHA 2UYBA 4B1LA 1VBB1 4JZRA 4LO7A 2SBAA 3ILFA 4GWMA 1YFYA 4LITA 4BOWA 2NQYA 3WF1A 3ZKYA 4WVWA 3VKLA 2LROA 1W9YA 2JIGA 2V5YA 4RFRB 4XCBA 4B7KA 3BALA 1NYWA 3LEMA 3AB0A 1KDKA 2PYTA 2VJXA 3HJRA 1C3HA 4YSFA 4CDQA 1IQDC 4WM8B 2YMZA 4LE4A 4COWA 2CY6A 4W6XA 5IAXA 4S2DA 4DOUA 4QD2A 3ACGA 3MW4A 5FYHA 4CPBA 2A6XA 1LOGA 2H6CA 4OUMA 5A33B 1AJKA 3AMMA 5JCTA 4ET7A 3POGA 4HMZA 1REDA 4WM8C 1HIXA 4W65A 2CAUA 4AFMA 1QH7A 5FIXA 4ATEA 1LGNA 5A1FA 1A8MA 4N90A 2WAOA 2WZR1 4OLLA 4AQTA 3FX3A 1XNBA
chains in the Genus database with same CATH topology
1DGWX 2G9FA 4K20A 4H55A 1KJRA 3HWJA 3BCWA 4P9GA 4UW4A 1CAUB 3IIAA 4AI1A 3VKFC 1LOFA 4UW3A 4N43B 4XJ8A 1SLLA 4QX5A 1JBCA 1MS3A 2R071 3MDPA 2ZTNA 4LUKA 3BU7A 4CTEA 2WSUA 4N43C 5DUVA 1NLRA 3N7JA 1ZZ7A 4D3WA 1D0HA 3ZFFB 2H0BA 5A3MA 2JECA 4HETA 3MEPA 1BVP1 1RHI2 2CYFA 3MICA 3ZXEA 1C5HA 2BYVE 1DQ6A 2XWJB 4P14A 3ZFFC 2PHWA 2NN8A 5FLJA 4Q29A 5J3UA 2W68A 2RR13 1JN2P 3TN93 5FPZA 3ZYPA 2HWB1 2EIGA 4PBPA 5KXCA 2R041 2RJLA 1D2QA 5I0RA 4FTSA 5FBZA 2QVSB 1TME1 3IT8A 5FQ0A 2DFCA 2FZ1A 1OFSA 2D43A 3NO8A 1YO8A 5GJ6A 2Z2SB 5A33A 2ERFA 3MW3A 2RM22 4LHKA 3MGUA 5T54A 1LOEA 1QQP3 1RUG2 2DVBA 1R092 5T52A 3SH5A 1C57A 1RITA 2BTVC 1LU2A 4D7SA 1CESA 2B8MA 3SH3A 1RUE2 3TOJA 2WFF2 2XG3A 2FMDA 2BWCA 3OJBA 1V6KA 1WLWA 2W39A 4N53A 4W6WA 4N43A 3RS6A 1DGRA 1AL23 2XKPA 4PQ9A 1H0BA 2ZGRA 5DDJ3 5EYYA 3D4KA 3IKWA 4CDXB 3ZFFA 3B00A 2LTNA 2B42B 3RJ2X 1OD5A 2AR6A 2YZ4A 4CDXC 2WSVA 3I7DA 3U07A 1Q8PA 1NXMA 4JDOA 4O9GA 1ZRCA 3FWEA 3PJQA 3RYRA 4XQ4A 1H4GA 2Q1MA 2W0XA 3ZXDA 3AFKA 3SITA 3J8F1 4H3WA 3ZFGA 1JOJA 3NV3A 4HKLA 4OI4A 4X6RB 2P37A 1O4ZA 4Y1VA 1WLDA 2ZS6B 3S7EA 2GZWA 1NA1C 3H1WA 3RI8A 5LRSA 2MPFA 2PHTA 3LB9A 5T5PA 1FI2A 4SBVA 2NYYA 4D94A 4EROA 5BNPB 3M8LA 1PZ9A 1U5IA 2XVLA 1W2UA 1AXZA 1O5LA 3FUQA 4ES8A 3WG4A 1AJOA 5BNPC 3AMNA 2ZHNA 4OZXA 1ZZ9A 5JPNB 1DIWA 3U4XA 3OTFA 4AHYA 4AI8A 4PF5A 3MIHA 2DVGA 1PGW2 4PBOA 2ZGMA 4CDXA 2XL7A 3WQ1A 4BIFA 1GZ9A 4XJWA 2PFWA 4AEJA 2AH2A 1H9PA 4YM0A 4Y5Z0 2D98A 4Q4Y3 1LESA 5JI7A 4FPFA 3H1MA 4K21A 4FQ4A 3MFCA 3AX4A 3IDEA 2HKXA 3WP3A 5GZCA 4EN6B 4O9EA 2ARBA 1LHUA 1NA1A 3LSDA 3JBG3 5CG8A 1PVC2 1S55A 5KHGA 2VOVA 1N47A 3WW2A 4RR3C 4D69A 1AR92 2ZGUA 2A6ZA 4H14A 3NV4A 1RUF2 1RUC3 3KM5A 4WVZA 4X8PA 2XJRA 3AZVA 1N1SA 3WUCA 2DV9A 4QXKA 5BNPA 1UF2C 1LHOA 4HVRA 2WT0A 5B2GB 4UW5A 3VV1A 2Q30A 1K5MA 1S0JA 4PJYA 2BFUS 2XJUA 2RS52 3AKTA 3P3NA 3PHMA 1WW7A 1PNFA 1YCIA 4ZXKA 2XL9A 1AR81 2DCTA 2QUOA 1V6NA 3POSA 3KT7A 1IKPA 2ZX0A 2ZX2A 1RMU3 5CU1A 2VPVA 4Y24A 2JE9A 4CP0A 2HYKA 1POV1 4XXPA 5FDBA 4R9CA 3WX5A 4Q4W1 1APNA 3M2MA 2C9AA 1IPJA 4JRAA 4YW1A 3V0BB 1JUHA 1GLHA 1ZBA2 1MR5A 3GZTB 4LA2A 2ET7A 1I6XA 1XQNA 2P2KA 5J09A 4RR3A 1QQP1 4K9SA 3O12A 4ZU4A 4RS5B 4FXGB 1QGLA 2FHRA 4TSVA 4L9BA 2PHUA 2Y26A 2WS93 3KMHA 2HWF3 4RS5C 4P9XA 1RVF3 5F9TA 3NSTA 1MS5A 1NZCA 2D97A 3LOIA 1ASJ3 2GALA 2RS11 1Q56A 1COV2 1I9RA 3ZVXA 1QJU2 3V0AB 1DGRN 1LB2A 1FMD1 2H0VA 1DFQA 4L97A 5CFDB 5A3LA 1RUOA 1C1LA 1PO12 1LHNA 1NLSA 4IESA 2DUOA 4XTMA 5CFDC 4FPEA 3ZDSA 4IV3B 4DFSA 4XF1A 2YHJA 1ZZ8A 4HK9A 5JOXA 4OHXA 4CP2A 1MZFA 1GICA 4LBQB 4COYA 4HLTA 2O0OA 3ZFEB 3JU9A 1XRUA 3VBUB 1J1TA 3VBOB 1JUIA 1RUH3 1VBA3 3WDUA 3NVCA 4Q2FA 4AGRA 2JG8B 3FZ3A 3VBUC 1VR3A 2OA2A 5L19A 4Z92B 4XMIA 4JCKA 2QDNA 4M01A 3IBMA 2JG8C 4Z1VA 4RS5A 5C8CB 1G86A 3CL1A 3POWA 1X7NA 2BVBA 2AZ5A 1QY4A 1G9FA 4JGZB 4XFCA 4I0BA 3THTA 5JZGB 1FPN1 2MEV2 2PELA 5L36A 2D7FA 3O7OA 4KWKA 2VOKA 3WDYA 5HCFA 4QPGA 1MZEA 2JG9B 5JZGC 2DCYA 2HWC3 4J6GA 4Y22B 1QXJA 2ZMLA 1WBLA 2VW2A 5CFDA 1MZ5A 4AXOA 2JG9C 1U5YA 4MGZE 2GAUA 2ZGOA 1GYKA 5FMOL 1HRV1 2YDEA 4GB31 1VBC3 1BK1A 2GMEA 1ULEA 5A32A 4FT8A 3OD0A 2VVDA 3AYAA 3JD72 1VP6A 4LBQA 5AC93 1EV12 1MEC3 4YZ1A 5FAXA 2XVGA 3VBUA 5AVAA 4IV1B 3OCPA 4UBHA 1YIFA 2WLPA 2JG8A 3WINE 5EFUA 2K0GA 4YLZA 3KQRA 5ACA2 3WQ0A 4IV1C 3DF0A 1G9CA 2BPA2 3NW4A 4G4FA 2E7TA 1CJDA 2C5DA 5KHHA 4GMP0 4JGYB 1G7YA 5I0TA 3ELNA 5KXBA 1FAYA 1BEV1 3RSJA 1ND2B 1WCDJ 1RUI2 4JGYC 3VL9A 4YW2A 4NHMA 1HXS1 1SMVA 1WLCA 2X53S 3KSCA 2ZCWA 1ND2C 3FHIB 5LRRA 1XNDA 2NLRA 1PGL1 3IN9A 1AVBA 1J3PA 5KWRA 2ETEA 3BOPA 1BKZA 3NAPA 3LKJA 1UKGA 1RUD2 3AZZA 3EBRA 1BBT2 1PIV3 5T3NA 3VBHA 3FFZA 2G9GA 5L73A 1DYPA 3VGIA 1KRIA 2VQ0A 3JB4C 3CJIA 3AP5A 4LBOA 4XYXA 1YJKA 2AYHA 4QQPA 1KS4A 5FO7B 3IMNA 4AHWA 3INAA 1H2NA 2D93A 1ZREA 3A0KA 4E2QA 3ZMOA 3JUUA 4HVQA 4IV1A 1W6QA 1IS6A 3QLQA 1C8M1 3OGGA 1SFNA 5JVVA 3GF6A 4NR1A 4Q4X2 4IERA 5GZEA 4JGYA 1GZCA 1H8VA 1WCKA 2WZR3 2WINB 2G4IA 4MH0E 1QMJA 3CF6E 1U0AA 4Y1XA 1ND2A 2A71A 3V65A 1CGPA 4HL0A 3MPBA 3P3PA 3RMYA 3GZAA 3M3QA 1W6MA 4XFGA 2D6MA 3ETQA 1EAH2 1RGSA 3OGJA 3MLJA 4MGIE 3K48A 1SCSA 2R073 4Q0VA 2E9QA 1ZYBA 1JYCA 3AZWA 2OIIA 1TMF2 5FO8B 1EPZA 2DVFA 2QZ2A 2B5HA 1AYM2 2DUQA 1N3OA 2IXHA 3KCXA 1AR93 1J3RA 3SISA 5H9PA 4L11A 4Q4V2 4DY5A 5CAZA 4GXLA 1SFYA 1FOD2 3WUDA 4XFAA 2O8OA 2HWB3 1GANA 2R043 3FJSA 2PAKA 1TME3 4AI0A 1J3QA 4I02A 4XDQA 3N4MA 3Q9OA 1M06G 2UWBA 1SLBA 4YZ3A 4LBMA 3M3EA 1RHI1 2JDZA 4XFIA 2A3YA 4KU7A 1KJLA 4PIYA 2DFBA 3C2UA 4XJZA 2DVDA 3B3QE 2DVAA 2B46X 1KITA 1DQ5A 2ENRA 3O0WA 5T55A 4Q1RA 1XE7A 2DURA 3ENRA 4Q8LA 1DGWA 4AEDB 3ZN5A 4RHV2 1VAMA 1S0BA 2RM21 3AM2A 2WJSA 1BVVA 2YROA 1RUG1 1RUJ2 1R091 2C0ZA 2AREA 2DYCA 3ZN4A 4AEDC 1ZBE2 1QH6A 3WR0A 3MIGA 5CA6A 1V9U2 4Y1YA 5IK5A 1F8VA 1RUE1 1D4VB 5EV7A 2WFF1 1HQLA 3U0ZA 5LK7B 5BY5A 2XBO2 4TWTA 5ABJA 1BMV2 3M3IA 2HWE2 4BHPA 2VNOA 2E51A 1XU2A 2RS32 3J8F3 1X8EA 1DU3D 4LUMA 3SXWA 4AVSA 1MZ6A 1WW4A 4DRRA 1NCRA 4XF0A 4K8FA 1SBDA 5BXXA 4KGGA 3MIDA 5EJ3A 1Z7S2 1M4WA 2ZABA 4NWVA 1WD4A 2R6QA 2ARXA 4NOTA 1SBEA 4LBJA 2EALA 1ZZ6A 4AEDA 2IFRA 1A78A 5JLVA 1LGBA 3WP6A 1ZZCA 3PLQA 4A7KA 2UURA 4ISRA 4X6QB 5T5OA 4QGLA 5LK5A 4BH9A 2MHFA 1UKRA 3RYKA 3ZPYA 2WA4A 1GBGA 4XQDA 3SLIA 2BFUL 1LTEA 3FFQA 1AR62 5FQ0B 2LM3A 3AP4A 2QZ3A 2ZGQA 2IFWA 4XW3A 4XMAA 3E6CC 4WVMA 1NY72 2IXIA 2NMOA 4E2SA 2ATFA 2FZ2A 2R32A 1PGW1 3VKMA 4K3UA 4BZ4A 1PO22 1ULFA 2VULA 4AVCA 1O4TA 2P3IA 5T50A 4LT5A 4Y1ZA 2XVKA 4LO4B 4DS0A 2E7AA 2JICA 1CJPA 3AMHA 1VBD2 2XB6C 4N53B 1LR5A 4MGYE 4JDNA 5DG2A 1RTVA 4K1YA 2YC0A 4QHBA 1TNRA 2A73B 4B29A 4CRQA 1AUYA 2ZMNA 4AVAA 1ND3B 1V00A 2YYOA 4N53C 3WDWA 1PVC1 4KG0A 4DRVA 1MVQA 1BYHA 1WW5A 3B9CA 4N9IA 1ND3C 5FOJB 1AR91 1C1FA 5JSOA 1NXD1 2ES3A 1RUF1 1Y43B 1AR83 3MZHA 1VALA 3TAYA 2Z5WA 4GH4A 1UPSA 3LCPA 1URXA 2IXLA 1CQ9A 1WD3A 2R30A 3LA2A 3E97A 1DZRA 5SV5A 1POV3 3AYEA 1ZRDA 4N7UA 4Q4W3 4DB5A 5TSWA 2WNVB 3ZFGB 2OPKA 3N7KA 2Q8OA 3GNEA 2RS51 1OQDA 3R0RA 4AWDA 2ILMA 2WNVC 3ZFGC 2VOXA 1V6JA 1R1A2 4FOWA 4AG4A 5JMCA 2WKKA 2WLQA 3ECQA 3O0XA 5AFEA 1SCRA 2HWD2 4A3XA 4M00A 4DQAA 2Q5TA 2B45X 4YFWA 4XJ9A 3PJYA 1W6PA 1G6NA 2P3JA 2EXJA 2RS13 1ZBA1 1GKBA 4YARA 4Y26A 5D1IA 2GC0A 4CEWC 1PK6C 1ND3A 1GNZA 2VMGA 1FMD3 1YUDA 3FBYA 2XLAA 4URTA 4UBGA 1X33A 5J98B 4Q8KA 2Z79A 5J36A 1SLAA 4Q27A 2CWSA 4JAAA 3B93A 1UU4A 4HVOA 4LO6B 4E4ZA 2PQQA 1QNWA 1UD1A 3NL1A 1AR72 1AYN2 3N7LA 3VZLA 1COV1 4XHBA 1QJU1 3NV2A 3T2TA 3JB8A 3PNAA 3ZXJA 1NA1B 2WNVA 4AW7A 2GC3A 3H9AA 4OI1A 1L3JA 5IK4A 4YFZA 3I2DA 3ES1A 1PO11 1EYBA 3H50A 4RL7A 3WG1A 4GMP1 3KCCA 1JYIA 1YFUA 5I0SA 3DUIA 3J4UH 4XF4A 3WP4A 3CO2A 5AFBA 2OUHA 4KQ7A 1O91A 1OLQA 3TNPB 5C6CA 1AYM3 3FBMA 4FP3A 2BEOA 1LU1A 2OZ6A 5CVRA 1F2NA 1K5MB 1Q8VA 3CEWA 3H7JA 1FPN3 1R082 3WCRA 1PK6A 4CEWA 2HEVF 3B02A 2I74A 3ATGA 4P9IA 4IEPA 1D4M2 1VLNA 1K5MC 1Y3TA 1XXNA 2PLV2 3BIWE 4NHKA 1CAXB 1Q8SA 3I59A 4M3CE 5D8AA 2R49A 1X8MA 2OYZA 1ZNPA 2XKOA 5JWPA 3URFA 2A6VA 4P9YA 1HRV3 4GB33 1Q43A 4MZUA 4M3CB 2WQ4A 4OULA 4ISQA 4HN1A 3IDBB 4P9LA 4C0HA 1N3PA 3H3ZA 2WT1A 3AP7A 2MEV1 4C91A 4B7EA 1RJ7A 4QQOA 3DGTA 3KT1A 1LHWA 1LEMA 2R062 3VKNA 1SEFA 3AMQA 4RR3B 3PVOA 1VB4A 4U2AA 3IWZA 3GBFA 3L9JT 2OZJA 1X36A 1GR3A 2NZ9A 2RHPA 1PZ7A 1QKQA 1WBFA 1Z0HA 3VN4A 1UIJA 5CBLA 1N1YA 4LO8A 2UWCA 4EN9B 2NMNA 4QPIA 1FYUA 3VHOA 1BEV3 2DCKA 1YXWA 5EZWA 5L7OC 1MS4A 2Y0OA 5GLUA 4FTEA 3JD71 3GHMA 5HCAA 3CJXA 3FLPA 4JQRA 1EV11 2BNOA 4XBLA 3D8CA 1HXS3 4SLIA 3NKGA 1GZWA 1VBE2 1Z78A 3G7DA 4CYDA 2XGXA 2VMIA 2D3RA 3MF6A 2UWAA 5GLWA 3AP9A 4PIXA 4LEJA 5ACA1 3ZYRA 1CAXA 4R9DA 2ZA9A 4Q0SA 4ES9A 2F6BA 1H2LA 1R1ZA 2B9UA 1AZDA 4AFCA 1XYOA 1G9DA 2ZGSA 2CV6A 4M3CA 1RUI1 4HZFA 5KXDA 3VHNA 3KT4A 2EF6A 3V64A 1VRH2 2P3KA 2VOWA 1HRI2 4HPKA 3E5QA 4F3JA 1IHMA 3BOWA 3KGLA 5CNAA 1RUD1 2YGLA 3R4DB 1BBT1 1C8M3 1DHKB 4WV8A 5BV6A 4AEMA 1E57A 4BWOA 4KBBA 4AVBA 4S2FA 1HKDA 5L7OA 3SCFA 3H7YA 4BLJA 3ZYJB 2OW4A 4E27A 2GNBA 3HMYA 4QPGB 4YGDA 2D5HA 2WQZC 2JEMA 5CFCC 1AR63 4MX3A 1H30A 3VBSB 4OVEA 1S0FA 1G9BA 3H1YA 4QPGC 4IEWA 1HLCA 4BA6A 3L2YA 1XYNA 2JJ6A 3MPPG 2QKDA 5J48A 1YYNA 1MS1A 3VBSC 3W58A 4AK3A 2KM2A 4IEZA 4Q4X1 1ULDA 1I3HA 1ZA4A 3U10A 4MLOA 1SLTA 2DTYA 5A32B 4PLOA 4HKWA 2D6KA 1FT9A 1UZZA 4DY3A 1REEA 3AJZA 4YYOA 1QJX2 1OMIA 2JENA 1PNGA 2GN7A 1YI7A 2E7QA 3ROUA 1UW8A 2RMU2 3UL2A 3VBFC 4QQLA 2EXKA 1DQ4A 4B4RA 1A8DA 1NQJA 1EAH1 3DPRB 2Y0IA 3E6BA 3WDXA 1RUNA 3HT1A 4XETA 1FXZA 2PN5A 1GNHA 2CL2A 1MACA 3DPRC 1TMF1 4JRLA 1DYKA 2BVVA 3GBGA 1AYM1 3LOBA 1HX6A 3QD6A 1RHI3 5CADA 2YGMA 3RRDA 4IQPA 1WW6A 2NP0A 4Q4V1 3WCSA 1OKQA 1QJY2 5CFCA 1QOTA 4A7ZA 1FOD1 1NE6A 2VXRA 4LHLA 4C90A 2XLFA 1ENQA 4XF9A 3NV1A 4R52A 2D3PA 3NAPB 1AHSA 3USUA 3VBSA 1ZRFA 2ZPXA 2YUEA 3J26N 4YG6A 3VBHB 5GLTA 1F31A 2LUWA 3NAPC 2A7AA 2RM23 3CJIB 1I1EA 4AVVA 1RUG3 5GLZA 1R093 4RQPB 4YM2A 3VBHC 3V56A 1HQWA 4LO5B 4NN0A 1XNCA 4JTOA 3CJIC 5GZFA 3AZXA 3R4UA 3VBFA 3LZZA 4RQPC 1RUE3 2WFF3 5BNNC 2VY0A 5JOYA 1W6QB 4OI0A 1OPOA 4P9WA 3UKNA 1OQ1A 2LALA 4WBBA 4QGMA 3DPRA 4RHV1 5HXVA 4QU2A 2XJVA 4PLMA 1RUJ1 2DF7A 2AGSA 2B39A 1ZBE1 2NM1A 4MSVA 2VECA 2Z69A 4K7JA 4BMEA 1A6CA 3HR9A 3RMXA 3TYJA 1V9U1 1ZX5A 4FAHA 4XHXA 4YVWA 1HQNA 3WHUA 2HEYF 5BNQA 4XPVA 1YJLA 4XFBA 2XBO1 3WNXA 2R1DA 1YI9A 3AP6A 1W6MB 4H7LA 4AQSA 1BMV1 5H9QA 2HWE1 1D0GA 1G8WA 1DQ2A 3AJYA 4N9HA 2XWBB 1VAKA 1OA3A 1QOOA 4HFSA 2RS31 5LEKA 2WZPP 4ONUA 3VHPA 2RR12 3WP5A 3TN92 4IEYA 3RQ0A 3M4FA 4FOVA 1OQEA 2VU9A 3B94A 1ONAA 4RQPA 1QJZA 4AQ6A 5F6LB 3SMHA 2VGDA 5BNNA 3ALQA 5JIUA 4CDWA 2R0FA 3ACLA 2ZHLA 4XEZA 3WD5A 2GSYA 1Z7S1 4MXWB 5DUXA 2EAAA 1AXYA 4KWJA 2Q4SA 3WW4A 4YG3A 3UJQA 1CD3G 2ZGNA 2TUNA 5E88A 3TNQA 3VBRA 4PCRA 3NJZA 4XFHA 1DBNA 3RJRA 2X5IB 1OA4A 1TE1B 1S0IA 4MVTA 4ATFA 2FQPA 3SCHA 4RD7A 2ZMKA 2X5IC 3M3CA 4HBNA 2BNNA 2XHKA 4FQZA 5GZDA 3H8UA 5F5QA 4I0WB 1AL22 4BCUA 4AGVA 2D6NA 1FX5A 5DDJ2 1GSLA 2A3XA 4IEUA 1AR61 1FATA 1FNYA 1A3KA 3KLSA 4IEQA 3PVEA 2C1FA 3CNAA 3FE5A 1LOAA 3VZNA 4YW3A 2ZHKA 2BWAA 1HV0A 2ZGKA 1NY71 3ZXKA 3VDDB 1PVC3 4XE9A 4YM3A 3DKWA 2XJSA 1H1MA 4ASMB 1PO21 3VDDC 5BYNA 4U36A 1RUF3 1OHFA 2UY8A 1GV9A 4Y20A 5ABJB 2WA3A 4KL1A 1VBD1 1DZTA 2F4PA 4XZPA 3MW2A 2QNKA 4MXWA 4DNYA 5KHKA 1KD7A 1B35A 5J37A 1S2KA 5ABJC 1CIWA 1H1AA 3GBWA 3NWKA 2RS53 3T1MA 1V6LA 2K2SA 2E63A 2X5IA 2BQPA 3SH4A 2XUMA 4FXKB 1NCRB 1WMDA 2KA3A 1IGOA 3U11A 2XLGA 4FPJA 4XTPA 1EP0A 4BPZA 1POV0 4HSLA 1HDKA 1WMEA 3ZX7A 3IPVA 1NCRC 1UZYA 1KS5A 2ZGLA 3AKRA 4RGAA 2V09A 3KS7A 3WG2A 1SQ4A 4IXLA 4IEOA 4YNIA 1VRH3 1CAWB 4AQ2A 1ZBA3 2EXHA 1HRI3 2X29A