5C4WA

Crystal structure of coxsackievirus a16
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
296
structure length
287
Chain Sequence
DPIADMIRSLTALQVLPTAANTEASSHRLGTGVVPALQAAETGASSNASDKNLIETRCVLNHHSTQETAIGNFFSRAGLVSIITMPTTGTQNTDGYVNWDIDLMGYAQLRRKCELFTYMRFDAEFTFVVAKPNGELVPQLLQYMYVPPGAPKPTSRDSFAWQTATNPSVFVKMTDPPAQVSVPFMSPASAYQWFYDGYPTFGEHLQANDLDYGQCPNNMMGTFSIRTVGIEKSPHSITLRVYMRIKHVRAWIPRPLRNQPYLFKTNPNYKGNDIKCTSTSRDKITTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VP1
publication title Structures of Coxsackievirus A16 Capsids with Native Antigenicity: Implications for Particle Expansion, Receptor Binding, and Immunogenicity.
pubmed doi rcsb
molecule tags Virus
total genus 45
structure length 287
sequence length 296
ec nomenclature
pdb deposition date 2015-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5c4wA00
2HWC1 1NCRA 1HRI2 1MQTA 5CFCC 3VBFC 5K0UA 2WFF2 5ABJA 1D4M1 1CJDA 1RUI3 5GKAC 2RS52 1QJY1 1RMU1 2XPJA 1AYM3 4Q4X3 3ZFEB 1Z7S3 1AR63 1VBD3 3VBRA 5BNNC 4CDXA 1C8NA 4CDUA 2PLV1 1NCRC 5DDJ2 1RUD3 2HWC3 4YVSA 1MQTC 5K0UC 5ABJC 1PGW2 1D4M3 1PO11 1FOD2 2WZR1 4RHV1 1NCQA 2DF7A 1FMD2 2R061 3TN91 4Q4W1 4CDXC 1ND2A 4N43B 3JBG1 4CDUC 1PIV2 2PLV3 1F2NA 1COV2 1HXS2 4CDQB 3VDDC 4Q4Y3 1EAH1 4PDWA 4RS5B 1PO13 4Q4V2 5CFDB 1NCQC 2HWE2 1HRI1 5BNOA 1RUG2 2WFF1 5C9AB 3VBOA 1QJX3 1AR81 1CD3G 1TME3 2R063 3TN93 4Q4W3 1ND2C 1ASJ3 3JBG3 1RUI2 1K5MB 1Z7S2 1AR62 1VBD2 1ND3A 4GB33 4PDWC 2BUKA 1VRH1 4IV3A 2BFUL 5DDJ1 5BNOC 1F8VA 1VBE1 3JB8A 4RFT0 3VBOC 1B35A 5ACA1 1RUD2 2HWC2 1QJU3 2WWSA 4EJRA 1ZBA1 1AR83 1FOD1 4RR3A 1AR71 5AC91 1MEC3 1D4M2 1FMD1 1E57A 5D8AB 1VBA1 2BBVA 2Y26A 1ND3C 4YVWA 3LOBA 4IV3C 1PGL1 1BBT1 1VRH3 1AYN3 1COV1 1VBE3 3ZXAC 2PLV2 2MEV3 1B35C 5J96B 5ACA3 4Q4Y2 4WM8A 3M8LA 1ZBA3 5A33A 4RR3C 1OPOA 2HWE1 3NAPA 1AR73 1NY71 4WM7A 1PVC1 1RUG1 5AC93 1PO12 4CEWA 1FMD3 4NWWA 1RB8G 1VBA3 1QJX2 4YVWC 4CDWB 1TME2 2R062 4Q4W2 1BBT3 3CJIB 3VBHA 1ASJ2 3JBG2 1AR61 1R081 1X36A 4AEDB 3ZFEA 4WM8C 3VBUB 1RUF3 5L7OB 3NAPC 4GB32 4WM7C 3ZFGC 1SMVA 1PVC3 1RUG3 1RUD1 2HWB1 1H8TB 4CEWC 2TBVA 1QJU2 3DPRB 1AR82 1BEV1 3VBHC 4QPGC 1MEC2 4QPIA 1R083 1RUH1 3ZFEC 4JGZC 1R1A1 4NWVA 1POV0 2GSYA 1HX6A 1BMV1 1VRH2 1AYN2 5CFCB 4N43A 3VBFB 2HWB3 4Q4Y1 1VBE2 4JGYA 2MEV2 2RR11 4CDQA 5ACA2 1ZBA2 1BEV3 3J8F1 2R041 4FTEA 1AR72 1EV13 1GFF2 2X5IB 4QPIC 5AC92 3VBRC 1QJX1 1RUH3 1TME1 3VBSA 4N53A 1VBA2 1V9U1 5LK7B 1R1A3 1ASJ1 1NCRB 4IV1A 1HRV1 1X33A 1PGL2 1BBT2 4N43C 4RQPB 5K0UB 4YVSC 4JGYC 5ABJB 4GB31 2RR13 4CDQC 2IZWA 1DDLA 1RUF2 4GMP0 3J8F3 2R043 1RUE3 5FMOS 1NY72 1PVC2 4CDXB 1QJU1 3VBSC 4N53C 4CDUB 1OOPB 1V9U3 4IV1C 1MEC1 2WS91 1HRV3 3VDDB 1C8M1 5JZGB 2FZ2A 1R082 4FSJA 3JD72 5C4WA 1NCQB 1AYN1 2WLPA 2MEV1 2HWB2 2XBO1 1POV1 1HQNA 2WS93 1VBB1 1BEV2 1C8M3 1EV12 1RHI1 4PDWB 1RUH2 5A32A 5C4WC 4FTBA 5BNOB 1R093 1R1A2 3VBOB 2ZZQA 1BMV2 3S6PA 1NA1A 2XBO3 1POV3 1RUF1 4AEDA 2RR12 2RS12 3VBUA 2RS31 1VBB3 1ND3B 1PO22 2R042 1RUE2 3J8F2 5C8CA 1RHI3 1RVF2 4IV3B 4GMP1 2FZ1A 1H8TA 1V9U2 1B35B 1HRV2 3JD71 1NA1C 2VQ0A 4AEDC 1AL0G 1IHMA 4GH4B 3ZFFB 1AR93 2RS33 5C8CC 4YVWB 5BNPB 4CEYB 3VBFA 1H8TC 4GMP3 1AL23 1EV11 5J98B 2BPA2 2WS92 1TMF1 4WM8B 2QQPA 1C8M2 2X5IA 3NAPB 3JD73 4WM7B 1M06G 3ZFGB 4LLFA 1R092 4RQPA 1VB2A 4BCUA 2RS11 1AUYA 3VBHB 2RMU3 2XBO2 2HWF1 4QPGB 1PO21 1RUE1 1RUC3 1RVF1 4RS5A 5BNNB 1TMF3 1VBB2 4JGZB 5CFDA 4Y4YA 2X5IC 1RHI2 5C9AA 2ZAHA 2R071 1OOPA 1MQTB 1W39A 1K5MA 3VDDA 4RQPC 1VB4A 2RS13 2RM21 5JZGA 2HWF3 4QPIB 3FBMA 1PO23 3VBRB 1QJY3 1RMU3 4RS5C 1QQP1 2HWD1 1FPN2 1RVF3 5CFDC 1AR92 2RS32 1RUJ1 5C9AC 1OOPC 4YVSB 2R073 5FOJB 4JGYB 1AL22 1ZBE1 1QJZA 1K5MC 5JZGC 5D8AA 2RM23 1VBC1 5FMOL 1R091 2WZR3 4RHV3 2BFUS 1QQP3 3VBSB 4N53B 2HWD3 1ND2B 4IV1B 1RUJ3 2RS51 3IDEA 2RMU2 1AYM2 4Q4X2 1RUC2 1ZBE3 1TMF2 5D8AC 1EAH3 1VBC3 4CDWA 1HRI3 3JB4C 3CJIA 2WFF3 4Z92B 1PGW1 2RS53 1FPN1 2HWF2 1AR91 5L7OA 1QJY2 1RMU2 4GH4A 3HAGA 3ZFFA 5C4WB 2ZTNA 1PIV1 1VAKA 5BNPA 4CEYA 1AL21 1HXS1 4CDWC 3DPRA 5DDJ3 1NG0A 2R072 3CJIC 4RR3B 4Q4V1 1FOD3 1NOVA 2RM22 3VBUC 5L7OC 1FPN3 3ZFGA 2WZR2 4GH4C 4RHV2 5A32B 3ZFFC 1QQP2 2HWD2 5CFCA 2RMU1 4SBVA 5BNPC 1RUI1 1PIV3 4CEYC 3TN92 1RUJ2 4Y5Z0 3DPRC 1COV3 1AYM1 1HXS3 1RUC1 2GH8A 1Z7S1 4Q4X1 1A6CA 1WCDJ 4QPGA 1OHFA 1NA1B 1VBD1 5A33B 1ZBE2 5BNNA 4FTSA 4JGZA 4Q4V3 2HWE3 1EAH2 5C8CB 4CEWB 1VBC2
chains in the Genus database with same CATH superfamily
1J1LA 3PL0A 1XE8A 2JDUA 2JG8A 2LTNA 2YBKA 3PLQA 4AW7A 3T3YA 1HRI2 4Q29A 3V0AA 1GZTA 1MQTA 2AACA 4AHZA 5FZIA 4IW3A 4TSVA 5F6KA 1D4M1 4P9WA 4HANA 4HN1A 4URAA 4UW4A 4LE3A 3IIIA 3ZFEB 1S2EA 1Z7S3 5KXDA 1VMJA 5LATA 1LOBA 2V4VA 4XUQA 5E8AA 4XCBA 5LA2A 1W6QB 1GP5A 1SFYA 3ALQA 1MS4A 2VCAA 2Q30A 5IK5A 4HETA 4FBFA 1CONA 2PLV1 3KWVA 4JKMA 2E53A 4ZU4A 1Q8QA 1GANA 3S7IA 4FQZA 2YFUA 3FX3A 5DG1A 4YVSA 4JTOA 4LKEA 4UF0A 1YYNA 1IQAA 2G1MA 2QQJA 1O8PA 2DU1A 5K0UC 3FN9A 3N7MA 4XBNA 5ABJC 4GQ7A 4QGNA 1D4M3 3AJZA 2C4XA 3MDPA 1UU4A 3WR0A 4P9XA 4HG6B 1W8TA 3B00A 1J3QA 1U5ZA 4XDPA 5HV0A 3E6BA 3CU7A 1FMD2 4MUVA 3TN91 1SLCA 2WKKA 3ZN5A 4CDXC 1OD5A 3WG3A 4CTEA 2XLAA 4Q27A 1ODMA 1PIV2 4FPGA 4B4QA 2PMWB 2PLV3 1F2NA 2PAMA 2Z4FA 1YXWA 4CDQB 3DECA 4Q4Y3 3CO2A 4XF0A 4K8RB 3KHCA 4R9CA 4XFAA 4GWNA 4PDWA 1XC6A 3MF6A 1ACCA 2GMEA 4Q4V2 4QB6A 3H1MA 1NCQC 1H1AA 1UOBA 1YIFA 4K20A 2RJ2A 3PDQA 4M4RA 1YFYA 5ANNA 1AF9A 5LCWL 2WFF1 4DEVA 5C9AB 4IERA 1DF0A 1AR81 1CIYA 4DFSA 4QX1A 1PK6A 1TME3 3TN93 1AHSA 4DINB 3WDYA 1RUI2 3LEMA 1GICA 2WNUC 1WLWA 2NP0A 1YIPA 1DBNA 1QOTA 1W03A 2A71A 2YZ4A 3MBWA 4Y20B 5FLIA 1SCRA 1VBD2 4GWJA 2B42B 3APBA 2BUKA 1UXZA 1L7LA 1BCXA 2BFUL 3G6JB 3LWCA 4YGEA 5A7SA 3TBDA 5BNOC 4ZPIA 2Q0AA 1F8VA 1WW7A 3U37A 2IXCA 4U36A 2HLEA 3WP5A 5LK5A 3Q8CA 4OVEA 5CKMA 2Q1FA 1NX9A 1RUD2 2ENRA 2VJXA 4IE4A 1RC6A 1ZBA1 1AR83 2MPFA 4Q1RA 4CYDA 1W9SA 5C33A 5FUIA 1XNDA 3EYPA 1ZZ8A 4UWDA 1OMIA 1W9TA 2H0VA 2CWSA 2BBVA 1VBA1 3HWJA 2UYAA 1U12A 5GZGA 2BW8A 4YVWA 2HBUA 5FYSA 4IV3C 3W20A 3LOBA 4XFCA 4UBHA 2RG4A 2Y33A 3NRUA 4I0BA 2AC1A 1XBFA 5FWJA 1G9AA 2ZHLA 4ASMB 2JG9C 2W91A 1GZCA 4H55A 4M3CB 2HH9A 1B35C 2OX0A 2ZMLA 3HPNA 1HLCA 4D8MA 4K3UA 2E9QA 1ZBA3 1SDWA 3M8LA 1ST8A 5D2AA 4N9HA 3N9QA 1WLTA 1HB3A 3USSA 3ZYRA 4WM7A 1PVC1 1RUG1 1OVPA 1LEDA 1QMJA 2BYVE 2WUHA 1W0OA 3J9SA 1VBA3 4ISRA 3VD7A 2PHTA 2QZ3A 5GALA 3VD5A 3BI3A 1L7QA 3FBYA 3POSA 4XUOA 5T5JA 5JOZA 2R062 5FZ1A 4HSLA 2VECA 1DZRA 4EV0A 5FPUA 1F9KA 1AR61 1JODA 1BLZA 2A3YA 3JBG2 2D6MA 3PMEA 4IEVA 4NIAA 5DAVA 4AVVA 1C28A 1PVXA 4A45A 1FI2A 2FDHA 3R05A 4HVOA 4CUGA 3KGZA 4YWAA 4BISA 3K4AA 5L7OB 4GB32 3A0KA 2JD9A 2O8OA 1O4YA 5KHIA 2OZJA 1PVC3 1RUG3 2YPDA 3BTZA 3RZGA 1LB2A 5JCTA 1H8TB 2XKOA 3AP7A 1NKGA 5GJ6A 3FLPA 4AFMA 2WNEA 2TBVA 1UPSA 4IE7A 2WN2A 1QJU2 2BU9A 1UQXA 2YV8A 1BEV1 2VPVA 5APAA 4COUA 5JOYA 1EPWA 2ARCA 3UKVA 1ULCA 1LR5A 4L8QA 4ATFA 3GJBA 1WW6A 3X29B 3AKRA 3RZJA 4C90A 1RUH1 2CDPA 3ZR5A 2FD8A 2F4PA 1DYKA 1ULFA 1DGRN 3ZFEC 2XL7A 4FOWA 2PHFA 1PX4A 1R1A1 1XE7A 3AP6A 1HX6A 3PHMA 4DEQA 4OI0A 3T0BA 2P2KA 3NV1A 3N9NA 3N9PA 2DVBA 4BDVB 2VZRA 2Y34A 3N9MA 4QDQA 3N35A 1W0NA 5ACA2 1SLAA 1FNZA 1RIRA 4XFGA 4MV2A 3KV6A 1BEV3 2IVJA 4QXCA 1A34A 1AR72 1EV13 3A4UA 4MYEA 4FFHA 4Y22A 5F5CA 1ODNA 3I3DA 4IE6A 5E88A 5AC92 1QJX1 4XAAA 1RUH3 3HNMA 4GXLA 1JYWA 3ZXJA 5GLWA 1HDKA 3NJZA 4ZKTB 4XQWA 1R1A3 1ASJ1 3RZLA 1V6NA 4OCTA 1NCRB 4QQLA 4UT5A 1HRV1 1QF3A 3SEPA 1Q8OA 1W6NB 2JDYA 5J37A 2VZUA 1MPXA 4RQPB 5F5AA 5FY1A 4YVSC 4JGYC 1QKQA 5A7PA 3IKWA 1S0DA 4CDQC 4XUNA 5BV6A 2QDNA 2IZWA 5J48A 1DDLA 1W8HA 1US2A 2FDKA 1RUE3 1UZWA 1RINA 3RI8A 4CCCA 4KH9A 3K77A 4META 3IDBB 2MHFA 5DN2A 2Y0IA 2EALA 4L2NA 4OHWA 4IV1C 1W6OB 3KV4A 4YRDA 1HRV3 2WZPP 4Z2AA 4X8PA 2PAKA 4CPBD 3U10A 2VCMA 3QOPA 3UJQA 5A1FA 1W6MA 4C91A 3KV5A 2ZAAA 2DVDA 1S1AA 5FZ0A 5C4WA 1GNHA 1PZ8A 2PN5A 1AYN1 4FAGA 3B02A 5K9YA 3LA3A 1W8ZA 2JDNA 3BYWA 4JVAA 3ZKYA 4IEOA 5FLJA 3MW2A 4A7KA 2SLIA 4FPYA 1JTZX 2JX9A 3B5LB 3K51A 1W9FA 1AXZA 3C7EA 4M01A 2WNVB 3MO4A 5FZOB 3I59B 2LM3A 3PUIA 3DXTA 3AMNA 2VNVA 4FPLA 5K8SA 3GZTB 2JD4A 4EN9B 1WCSA 4B1LA 2YC0A 5H9RA 3VGIA 4JQRA 2BOJA 4RGGA 2IVIB 5GLZA 2PQQA 4LIUA 1VLNA 4B1MA 4FTBA 2YC4A 2W68A 3T2PA 4Q0VA 2PFWA 1N3OA 3VBOB 1JHJA 2QNKA 5DZGA 4MADA 2XH6A 4KI5M 1NAEA 2R30A 4D7TA 2VTXA 2ARXA 2JECA 1RUF1 3AYDA 4LBLA 3MIFA 4PF5A 4AF9A 2RS12 1BK0A 4AEDA 2VGDA 2B45X 3SQOA 2MNGA 4QT6A 4PT6A 3P6BA 3NV4A 4LJHA 1ND3B 2R042 3J8F2 3O1MA 1F35A 2GNTA 5F3GA 2XOMA 4GMP1 2PHWA 2XWBB 1SBFA 3RS6A 4OULA 4HKOA 2E26A 1A78A 1SACA 1CQ9A 1V9U2 3E5XA 4NAOA 5F2WA 3VHPA 4LO7A 4DXZA 3D82A 1JH5A 3D4KA 1HJFA 4TLFA 4X6QB 1URXA 3CIHA 3JD71 1HJGA 4LPLA 3A21A 1UNBA 3WINE 4G4FA 1GZ9A 2VMGA 5KXEA 4GH4B 4XJ9A 2VM9A 5C8CC 1CAXB 4PBPA 3VL8A 1POQA 4WVVA 4CEYB 3IM0A 5EV7A 1H8TC 1U5IA 4GMP3 5TSWA 3SKJE 4I2OA 4BXSV 1E5HA 1S2KA 1XJAA 2Q1ZB 2ZHKA 4I09A 2OPKA 3JUUA 4IXLA 4J6GA 1ULEA 4KWUA 4AEMA 3RWKX 1TMF1 3MV01 3WQBA 1ZRIA 4WM8B 3ZDSA 4P14A 1GYKA 4AG4A 4CP0A 3UGGA 2AH2A 2QQPA 2X5IA 3JD73 3WG2A 4YARA 1OC1A 5FP3A 3WNOA 1N3QA 3IN9A 2QQOA 2VMFA 2DU0A 4LLFA 1R092 4Q0PA 2YBSA 4QX5A 3NJVA 2CU5A 3BTXA 1WMXA 2CSGA 3MIGA 1UZZA 3AMPA 2JKBA 2JB8A 3FC0A 1SLTA 3LDKA 3VBHB 2XBO2 3AXDA 4QPGB 3PU3A 3WP4A 4LLOA 5A7NA 3OPTA 4QPWA 4YGCA 5A3TA 4V1PA 2VU9A 2VZ3A 5C7GA 2J42A 1TMF3 2VMCA 4QXBA 4JGZB 2IC1A 4QXKA 2YDEA 2XLGA 3HBKA 1Y3TA 3AK0A 4NAMA 2LW8A 1Y7BA 1UPIA 1AXKA 1RYYA 3LD8A 4OUMA 5EFUA 4E2QA 3AZXA 4DY5A 2Q1MA 2CY6A 5T3NA 1WD4A 3VDDA 4RQPC 4UFIA 5J09A 1JZ4A 3VKLA 2QTWB 5JZGA 3BU7A 2NN8A 2ZCWA 3O1RA 1C4RA 5CG9A 1YO8A 2K2SA 3SH3A 2BNMA 5A6QA 4QPIB 4D7YA 2D6OX 3FBMA 4KWLA 3AM2A 1PMJX 2GC1A 1IPJA 1RMU3 4HFSA 4RS5C 3OEAA 4WVMB 5ANQA 2HWD1 1FPN2 5FZ3A 5CFDC 2P6CA 4D69A 3KGLA 2PXJA 4K21A 3SH5A 1RUJ1 3OD4A 2B39A 1CPMA 2X05A 3C2UA 5HCBA 5FOJB 5EJZB 4XXAA 1N1YA 4YG0A 1MZ5A 2DCJA 2BRTA 5FPLA 5FQ0B 3AP4A 5D8AA 2Y6KA 3W5NA 1HQWA 3INAA 1I5ZA 5FMOL 4QX7A 1KITA 1XU2A 2AUYA 3CDZB 3VLBB 3HR9A 1H1MA 1BJQA 2BFUS 4XOGA 3VBSB 4N53B 2HWD3 5FPVA 1NYWA 2D6PA 1AVBA 4CU7A 3OJBA 2YG0A 4JKKA 4XILA 2NPIA 1RUJ3 2RS51 2XHNA 3M1HA 4P02B 2L9LA 2A75A 2RE9A 2WNVC 4H7MA 3R4UA 4XMAA 3ZR6A 4GWMA 2VUJA 3KT1A 2XQRA 3LZZA 2F17A 1C5IA 1PZ9A 2P34A 1KXGA 3S30A 1RUC2 4NRMA 4K40A 3USUB 1F4AA 3MIBA 5EJ1B 4LORA 1ULPA 1WA6X 5JPMB 1V00A 4HVRA 5F7UA 5I0SA 5HI0A 4CDWA 3EQEA 4CP9B 1FAYA 5DQ0A 3JB4C 4Y1VA 1XYOA 1VIWB 2JDKA 3O0WA 3RGBA 1N47A 1YWKA 2QVSB 4K6BA 2A5ZA 3TWIA 4BM8A 2FDIA 4R9DA 1G6NA 2Q8CA 4QQOA 2RS53 3POWA 5FP9A 4BQ2A 2GC3A 3AMHA 5JDBA 1FT9A 3WP3A 2HWF2 4Q26A 5A70A 5L19A 2BGCA 2C26A 5T55A 2VW2A 2DFCA 4YZ4A 1ZA4A 3MEPA 5FPXA 4NHKA 3DYMA 3ZFFA 1JMUB 2XXZA 3LGRA 4MGIE 3R6SA 1ENRA 3MYXA 4AK3A 5DUWA 3H8RA 5JR2A 3ACLA 4PLMA 1H2KA 4AZZA 2WFPA 1K12A 2RHPA 3DPRA 3WQ7A 1NG0A 3LIHA 5T5PA 4IL7A 3WNNA 4A3ZA 5KC6A 2GP5A 2VAUA 2VBBA 2XLFA 2ZGOA 1UN1A 2GALA 3T1MA 4QXHA 1EUTA 2RM22 2BTVC 2VQAA 4M00A 4PIXA 3LIGA 5DABA 3WF2A 4CCDA 4GH4C 4MGZE 2AEZA 5A32B 5CEHA 5K7PA 1VMFA 4Y1XA 5H9SA 1B09A 1QQP2 3WDUA 2V5DA 4XMIA 5GZFA 4P00B 1M4WA 2VZTA 3ON7A 5FXXA 4CEYC 4PBOA 3TN92 2XB6C 2EXKA 2XJUA 3IPVB 1GQPA 4MHRA 5CKQA 5FY7A 1NA1B 5KBFA 2HEVF 4IEWA 1ZBE2 4PQ9A 4E4DX 2CGNA 3P1IA 4FOQA 2K46A 4XZUG 4NHYA 3ES4A 4NO4A 1C1FA 2ZPXA 4C1XA 2CAUA 3LA2A 1VBC2 5LEKA 3WHUA 1NQDA 3CZJA 4SLIA 4OMDA 3UNPA 2HWC1 3I54A 5F39A 4A44A 3ZYFA 4ZY9A 5H9PA 4BLIA 5K0UA 3K46A 2WFF2 4KG0A 3T08A 5ABJA 3THCA 1CJDA 2FDJA 3WNPA 3M4FA 1PMHX 4LUKA 2VOTA 2GP3A 2WAOA 3VBRA 5FY4A 2EIEA 2Y60A 2BJSA 3ZIWA 3MFAA 4LKFA 2WR9A 5FZFA 4CDXA 1H30A 1H6YA 1C8NA 3GF6A 3M3CA 1BVVA 4PLOA 1RITA 1SLLA 3BOPA 3L2HA 2DV9A 1JZ6A 4E9KA 2C1FA 2ZGKA 1UY4A 2PQSA 4KU7A 2HWC3 5A1AA 3VD9A 1UIJA 2GH2A 5A3NA 2IXIA 1G9CA 5C3RA 1JZ7A 3JZVA 2WL1A 3IDAA 3BODA 1PGW2 1KFXL 1OLRA 2WZR1 4XJAA 2B9UA 1NCQA 4QM9A 3FJSA 2DF7A 1GLHA 3R4DB 3ZSLA 2O0OA 1C3HA 4P9JA 1UWWA 1BHGA 1CAUB 3PUQA 4QKBA 4XHXA 4Y5TA 5E16A 4N43B 1N1SA 1DCSA 2WT0A 1WBLA 2ZEYA 4GALA 1XPWA 1V6IA 4CDUC 4QU1A 4R9BA 2WNUA 5FZ8A 4QAWA 5HXMA 1HXS2 1V0AA 2DBNA 1PHMA 3CZUA 4TYSA 1IS6A 4CU6A 3VDDC 1MZEA 3Q8AA 5T50A 3T0AA 2W46A 3DV8A 1EAH1 1JU3A 1S0BA 3OB8A 3IIAA 4BQWA 4YZ3A 4TTGA 3B9IA 3LA7A 3ZMOA 3GZEA 1OA2A 1XU1A 2FHRA 1CN1A 2XQXA 4ATEA 5B4NA 5IWFA 5BNOA 1DLCA 5C8WA 5JOXA 1RUG2 4LKDA 4Y3OA 3BPSA 1KJRA 4I3PA 5HXVA 1IS3A 3GGLA 4UW5A 5T54A 1CD3G 3WQ0A 2DVGA 3NNFA 1X8MA 2LUWA 3ACFA 3UGHA 4L9BA 1RUOA 4HKLA 1K5MB 4YW4A 5GLTA 1OKOA 1AX1A 1XYNA 1UMHA 5KHGA 1AR62 1D2QA 1I5PA 5I0RA 3I2KA 2WQ8A 2WQZC 5LW9A 1H2NA 4IV3A 1L3JA 3B69A 2GNDA 2R49A 5BNPA 2XDVA 5DDJ1 3SKVA 2OA2A 2JG9A 4NE9A 1CX4A 2KM2A 4LUMA 1YLLA 1B35A 1UY0A 2A3WA 3HBZA 1MZFA 2NMOA 1FOD1 2OZ6A 3QACA 3O1OA 3QCWA 1O4ZA 2R1DA 1KDMA 4HK9A 1MEC3 2VNGA 2ILMA 3UYJA 2IXJA 4LR4A 5C3QA 3OF1A 1G7YA 1E57A 1S0JA 3LAGA 4UFMA 5JI9A 5LRRA 4O65A 4GKYA 4IE5A 1APNA 4K1ZA 5JXHA 5H9QA 2CTVA 2IUWA 1PGL1 1BBT1 2WO3A 5GLVA 4HSJA 1COV1 4YM3A 2Z42A 3W5MA 1U5YA 1SFPA 5FK7A 3ZXAC 1JZ5A 1F15A 5A7WB 5FYCA 2MEV3 4LA3A 5BUVA 5J96B 4NRPA 2WO7A 2GMMA 1DG6A 4B29A 4A42A 5A33A 1JS9A 3EHKA 1WBFA 2FCUA 3U14A 5F37A 2HWE1 1RL3A 1H2MA 3ZM8A 1PO12 3DUIA 3ZXEA 1R64A 1UX6A 2VMIA 2WSUA 2QQIA 2Y38A 1S55A 3AMMA 4XDOA 3MLJA 2H6CA 3GZUC 3ZXGA 5ERLA 1QJX2 5IVCA 4QHOA 4D6QA 1REFA 1JW6A 3J7MA 1BBT3 1V6MA 3CJIB 4Q4W2 1ASJ2 1V6LA 3K48A 1AX0A 4K9SA 1NLRA 1R081 3OSDA 4JHZA 1G9BA 2ETEA 3WDXA 3ZFEA 4LT5A 3VBUB 3CF6E 1D0GA 1KS4A 3NAPC 3IAPA 2CGOA 3T1LA 1ZZCA 4IE0A 1SMVA 1W6QA 1IQDC 3KV9A 4X6RB 3JQXA 5CZKA 2P3JA 2HWB1 3AFGA 4AHXA 4Y4RA 4DRVA 2ATFA 3HNYM 4AVTA 5KHJA 2WAAA 1UU5A 2X53S 4MGKE 5I8TA 5J3UA 2IWGB 1LHUA 2PHDA 2WJSA 4CXXA 1QIQA 2VL4A 4B8EA 4EN7B 2R16A 5LBBA 1UYXA 4P5HA 3HOBA 3E6CC 2UWCA 1UY1A 1IKPA 1R083 4YM0A 3OY8B 4DO0A 1JYTA 1PM7A 1X7NA 3T4HB 4N8MA 5KXBA 4CVUA 2E7TA 3UKNA 1POV0 2GSYA 2QQMA 4NOTA 1IGOA 2OQ6A 1VRH2 1AYN2 1BMV1 4LMFA 5CFCB 4IEUA 1G8WA 3VBFB 2HWB3 5I93A 4Q4Y1 1DLLA 1VBE2 2QCSB 1ULDA 2ORXA 4JGYA 2KD7A 2RR11 3AYEA 2VD7A 5FZCA 4CDQA 3LFMA 1MVQA 2D97A 1BZWA 3C3VA 1REDA 3ZLIA 2BWCA 2RV9A 5CU1A 4AWDA 5FY0A 3CLPA 1GFF2 3M2MA 2XONA 4JRLA 1JYIA 3OUJA 3VBRC 4YW1A 3NVCA 2YGLA 5LEJA 1TME1 1JI6A 3HMYA 5JSOA 1YEWA 2BVVA 1GP4A 4B7KA 2VC9A 1DU3D 2QQWA 1LRHA 2FBEA 5CISA 4IV1A 3DEMA 4S2DA 4QX2A 1EYBA 4N43C 2ERFA 2A70A 4WVWA 2ZJCA 3BOWA 4QX8A 4AR2A 4XACA 3H1WA 2DVFA 3RSJA 2BV4A 4ASLA 2RR13 4O9EA 4AQTA 3L9JT 1RUF2 4AI0A 5FPBA 1OFNA 5JPNB 4IESA 4YNIA 3NSTA 1NY72 5FMOS 3ZVXA 2YBPA 3TOJA 2D43A 5I0TA 1MR5A 3KMHA 2VXRA 2CL2A 1RUNA 3ZMNA 4E4ZA 5I0DA 1OH3A 1OOPB 3CNAA 3E1F1 2D44A 5BXXA 2I07B 2TUNA 4BQ3A 2E31A 5AFBA 4DXSA 1QXJA 2WS91 1JZ3A 2QJVA 3ACHA 1AJKA 1A8MA 1GR3A 2C0ZA 3VZKA 3WCRA 2WINB 2DCTA 3PMSA 1PX3A 3KCCA 1JOPA 1W9WA 3VV1A 5K4LA 4FSJA 1EPZA 1UIKA 1AZDA 1NT0A 3JD72 2XJTA 4JRAA 4EYUA 4GD4A 1H9PA 2W47A 1UYPA 4QDRA 3ZXLA 4XTPA 1YI7A 4HKWA 4IGQA 1W2TA 3PJYA 4LHNA 1ZNPA 3WDVA 4ZZ8A 1QJFA 3V0BA 1O91A 2G19A 2EICA 2VY0A 3PNAA 3PVBB 2YGMA 3CKHA 4M3CA 2VW1A 2BERA 1S0EA 2WWJA 2B8MA 5A6XA 3WNXA 2F6BA 2WS93 3BGAA 3U07A 5IW0A 3Q8FA 2VBDA 1TVGA 1NXMA 5F3CA 1RHI1 1MS3A 4PDWB 4LBMA 4DIQA 2VCBA 3PVOA 1LNSA 1X82A 2XL9A 2XJRA 3U0ZA 3M3EA 1J59A 4HLTA 1DQ4A 3ZXFA 3KT4A 4QHBA 5FREA 3HVDA 1S0IA 5F32A 2ZZQA 5FYTA 3RMYA 2DUOA 1D4VB 2Q5TA 5DMYA 4YG6A 4UFHA 3S6PA 2EIDA 5J7MA 1NLQA 3ME2A 3MI8A 2NQYA 2SBAA 3TEXA 3NV3A 3ECQA 4AEKA 4H14A 2D98A 4XZPA 4JQTA 2VZVA 1LGBA 1UX7A 5FZBA 3H3ZA 4LBOA 5IFTA 3ZKUA 3I3QA 4B7EA 5C8CA 3DF0A 4BZ4A 1RHI3 2IXKA 4EE2A 3POFA 2BGOA 1G9FA 2FZ1A 4WZCA 4XJZA 2GN3A 1H8TA 2ZBJA 5IK8A 5FTTC 2YPJA 3WUDA 5FK8A 3AJYA 1W0PA 3O1PA 5B4XA 4F7ZA 3IB3A 2QFEA 3RDIA 1W2NA 3H9AA 3KD4A 1LCLA 5EP9A 3BB6A 3LEIA 1AL0G 5FJKA 3O5SA 4CP2A 4HMZA 5CKNA 4IQPA 3HIFA 1CWPA 1AR93 4C1WA 4S2HA 1US3A 1FV2A 3TEYA 2O14A 4YVWB 1X50A 4KGGA 1MVEA 5SV5A 2BEOA 2ZEZA 1ALYA 1CX1A 2VOKA 3WW1A 4FOVA 3U4SA 1YJKA 3H42B 2KA3A 5CYYA 1AL23 1EV11 3IBMA 2DCYA 1FYUA 1UOFA 2BPA2 4NHMA 4P9YA 3EO6A 3K4DA 4JV4A 3RJRA 3VHOA 1S0GA 2HYXA 1C8M2 1CIWA 2Y6FA 4WM7B 4Y1UA 2JIJA 3ZFGB 4BB3A 3H1YA 4FXKB 4E4SA 1WUVA 1XNBA 3BVCA 4CPBA 1W6NA 4RQPA 1VB2A 3GCWA 3ENRA 4UXAA 2W1QA 1YI9A 4BCUA 4BOWA 2D3RA 3WUCA 4HZFA 1GMMA 2RMU3 4R9AA 2I2SA 2PA7A 1LOFA 3WHTA 1IG3A 3AZWA 3IZOA 1PO21 5JMOA 1WCQA 1RUE1 5FZ6A 1RVF1 4RS5A 3IT8A 4Z82A 1VBB2 3KSCA 4HXCA 5CFDA 4AVSA 2EIBA 4NIDA 5E1RA 2Y6LA 1JHNA 3ORJA 3BPZA 5C5UA 2ZAHA 2Z2SB 3VZMA 2R071 2E33A 3AKPA 4LO5B 1OF3A 4CXWA 3E97A 1DQ6A 4M3CF 1W6OA 4I01A 3UKTA 2J22A 4PQQA 1ENQA 5HCFA 3WNLA 3K3OA 4CE8A 5A3MA 5FP7A 1ZVFA 1SPPA 1VB4A 3AP9A 1ONAA 4A2UA 3PTRB 4ARXA 2B46X 2P3IA 3LOIA 3KM5A 2BNOA 4UFLA 1LHNA 1PO23 1QJY3 1U0AA 1V6JA 3F95A 5EPAA 4QQPA 1RVF3 3SH4A 4E27A 2C6SA 1NE6A 2RS32 4YGBA 2VNRA 5A3OA 5C9AC 4KBZA 1KFUL 3T4VA 4BQYA 1SEFA 2WNVA 2BQPA 1OOPC 2LRPA 3FLTA 2YB7A 1YQ2A 1GZWB 1WWYA 2R073 3I59A 5FZOA 4AI2A 4BXFA 2A6WA 3WW2A 1R1ZA 4BH9A 2KXLA 1QJZA 3WV6A 4IETA 2X10A 4O61A 2J1VA 4XYXA 4S2GA 4UYBA 3GJAA 5T5LA 1CAWA 2ARAA 4QKNA 1JYNA 4FOYA 5IYYA 2OKXA 3KCYA 4NHXA 4OHYA 1QHDA 4RHV3 1QY4A 4NIIA 2GC0A 4ZS2A 3NQHA 2WT1A 1CR7A 2R1BA 3MIEA 3GYDA 4CUCA 5J1XA 1ND2B 2W1WA 3A22A 4ONUA 4EWAA 5CAZA 2W94A 1ZZ6A 3VD3A 3ZYBA 4E2SA 2GAUA 3LCPA 2BDRA 4LHKA 4NIGA 4PLNA 4F83A 4GA9A 1VAVA 3FUOA 4LHSA 1UMZA 3WT3A 1NLSA 1VP6A 1IS4A 1LKNA 2R6QA 3I3BA 5EJ3A 4D7SA 4HONA 4LNVA 1XNCA 3U1XA 3ZX7A 3HQUA 4AEJA 3BKZA 1HRI3 5IVVA 5EWSA 1D0HA 4D3WA 1UZVA 4FFGA 1UYZA 4GAZA 3B3QE 4QB2A 4FXGB 4NRQA 3TAYA 2ZGUA 3BTYA 3T0DA 2HEYF 2VW0A 4Y24A 3J7HA 4Q8KA 5LBFA 4AAXA 4QQHA 1OA3A 1JN2P 4LO4B 1W6MB 5HCHA 5DG2A 1JYXA 5HPOA 1TNRA 4MGTA 4GH4A 2RJKA 3HAGA 5FO8B 5C4WB 1N1TA 3GHMA 4HPKA 2VBPA 3UT0A 3RZKA 2ZTNA 3H0OA 1CAXA 5IVYA 1PIV1 1VAMA 2ZEXA 4CEYA 1QDOA 4AL9A 3H8UA 3I2OA 3LEGA 4ES9A 4M3CE 3TYJA 4BYYA 4OZOA 4ITCA 1OXCA 5F6LB 4O7XA 2DUPA 4RR3B 4HBNA 4Q4V1 2G4IA 1NOVA 1A8DA 2OUJA 2EVXA 2XR4A 1OVSA 1J3PA 1O6UA 1WLDA 2IFRA 5L7OC 2WZR2 4J1XA 2P3KA 3DKWA 4XFHA 3FFQA 2WQ4A 1ULOA 4EN6B 3PTYA 4OHZA 4UOJA 2E63A 1F5FA 1GOHA 4AI3A 1RUI1 1PIV3 4Y5Z0 3THDA 4Q4X1 4FQ4A 2W0XA 4XQDA 4E2GA 5DAQA 3E5QA 2A6ZA 4QPGA 5HBAA 1VBD1 5JMCA 4K8FA 4QU2A 4PJYA 1ZYBA 1SLIA 1WW5A 1GQHA 3J7LA 5EHDA 3MZHA 3LDRA 4JGZA 4R4ZA 4Q4V3 3ZN6A 1EAH2 2VUCA 4CEWB 1Y43B 3OOXA 1TZOA 3Q8EA 3RYKA 4Y5SA 1C5HA 3V64A 1LTEA 3NMBA 1GV9A 3ILFA 1YFWA 1YJLA 2Y6HA 1RUI3 3IDCB 5GKAC 1E5IA 2B4KA 3PUAA 1O8SA 4QMAA 4RGAA 1RMU1 4Q4X3 1UD1A 3FHAA 1BXHA 2ZACA 3K2OA 2P4EA 4AFBA 1E5RA 1VBD3 4Z8BA 2BBAA 3HN1A 1O3TA 2PYTA 1WKYA 5GZEA 4W4ZA 1RJ7A 5D21A 4LBKA 4CDUA 4YGDA 5DZEA 2CWMA 2P17A 4LA2A 2ZOEB 5LBEA 3KQRA 1NCRC 1I6XA 1XSQA 1RUD3 1ZM1A 2JDAA 2YUEA 4WBBA 5DDJ2 5FPZA 1CAVB 5IUQA 4BQ1A 2R0FA 3MFCA 3POGA 3PVEA 1YC61 4J25A 4AGVA 2OW4A 3D0SA 4UW6A 5FXZA 5IK4A 2EAAA 1LOFC 3K4ZA 5GLUA 4MXWB 4BIOA 4CCNA 1FOD2 2PHLA 1VRBA 4XIOA 2DCZA 5FQ0A 3J4UH 3TEZA 1LESA 3AKSA 3N36A 1XXNA 2DFBA 4BWOA 2AYHA 4KNCA 2R061 4A41A 4WZFA 1QH6A 2CYFA 2ZKNA 3JBG1 4N90A 5IAXA 2ZGMA 3I2GA 2UY8A 3EMRA 2OQ7A 4LK7A 3KHBA 4D6SA 1COV2 4LHLA 3C7FA 2J1TA 3JXSA 3USUA 2LROA 4L97A 4OI1A 5C71A 4EZHA 1GUIA 4XC9A 4AHYA 1YQCA 2P1BA 3PUSA 2HWE2 4TLGA 2ZZJA 3OGVA 4OLLA 2WC2A 3WNKA 2WIIB 3RWNA 2W39A 5DUXA 2DUQA 2J7MA 5IHRA 4CP9A 2H0BA 5L73A 2RDRA 2R063 4TWTA 1BVP1 5FZ4A 1NE4A 1ND2C 1IKQA 5C3SA 2VMHA 3JBG3 4LQRA 2DURA 3QH6A 1HB1A 3UESA 1ZRFA 4XDQA 5LY2A 4KBBA 1Z7S2 2QQUA 5JIAA 5KR7A 3KT7A 3POYA 4XF3A 4HK8A 5SV8A 2YXSA 4GB33 2DWRA 4WVZA 4G9SB 3SCHA 4P08A 1LOGA 1BYHA 1OPMA 4URTA 1QJEA 3JB8A 4RFT0 1J84A 3VBOC 2XG3A 5GZCA 1V6KA 3N7JA 4LOSA 5ACA1 1QJU3 3FE5A 4IEPA 1O3QA 2JDMA 4XFBA 1GNZA 5B2GB 4FPFA 1AR71 2BP6A 1IS5A 3WXPA 1DIWA 2O8QA 5AC91 1QOSA 1D4M2 2WYFA 3OBZA 4L99A 3WW4A 3ZO0B 1JXNA 4XURA 3WF3A 1DZQA 5D8AB 1LGNA 2Y26A 1ND3C 4LTAA 4KWKA 3FWEA 4QGMA 3MF9A 3P3PA 4ZXEA 4EZ4A 3KS7A 5C3PA 4LE4A 2JJ6A 2ZMNA 3DYOA 4FCAA 3OBTA 3UL2A 2NLRA 1UY3A 1W8UA 3WEZA 2VZ1A 3EJKA 2PLV2 1SHWB 4NVPA 3MW3A 3IPVA 1W2AX 5ACA3 2D5FA 4FP3A 2WO1A 4Q4Y2 1JOJA 2FCVA 3SNMA 4RR3C 5CBLA 1UXXX 1OPOA 1VE0A 2G9ZA 2J1SA 2VZSA 3ASIA 3NAPA 1AR73 4R8HA 5FFOC 5FZ7A 3ZOIA 4A6SA 1VPHA 5AC93 3ACGA 4ZU7A 2IXHA 1OLME 2OUHA 4QPYA 3KF3A 4DUWA 4XEZA 1H8VA 1D7PM 2NM1A 3I2DA 4M0NA 4NWWA 3O0XA 3C7GA 3D6EA 4XJUA 4CDWB 1CPNA 5A3WA 3RI9A 1TME2 2ZMKA 3I4IA 3S5AA 2WA3A 3AZYA 2OYZA 5EQUA 3Q8BA 3T30A 1F5JA 4FT8A 3UGFA 1UKGA 3ST7A 4XVHA 1YQ6A 1QU0A 4WM8C 4INDA 4XJ8A 4BQ4A 4DXTA 1MS0A 4RGKA 3WG1A 1K3IA 5F5QA 5DAPA 2VQTA 1H4GA 1PMIA 1SDDB 2A3XA 1P8JA 5L36A 3DYPA 3LSEA 1U5XA 3FHQA 4BLJA 4CEWC 3IWZA 4JCKA 3D3AA 3DPRB 1H2LA 1AR82 2WA4A 2JICA 3LKJA 3H3LA 5FYYA 3VBHC 2YROA 4RD7A 3BN6A 1AX2A 4QPGC 3I8TA 4UBGA 1YHFA 5I91A 1RXFA 3ZYGA 4AGRA 1W2UA 1UO9A 5CNAA 3LEKA 3KLSA 1QWRA 4JGZC 3HT1A 1G9DA 4XE9A 3MHZA 3VKNA 2B7YA 3VKOA 1H0BA 4XABA 2Y6GA 4N43A 5FZEA 2NZ9A 3P5BA 1WD3A 2OXBA 1TQ5A 2QKDA 2RJLA 3ELNA 3AXEA 1UY2A 3N9LA 4JZRA 1KQRA 4Q5OA 1ZBA2 2LALA 1DP0A 2C9AA 2PHRA 2Z5WA 4QWNA 3J8F1 2R041 4FTEA 2W87A 4QDSA 3SITA 4W50A 4QPIC 1SFNA 5JXGA 2AEYA 5DPNA 3SCGA 1MS5A 1W28A 3I49A 1W06A 2BOIA 1VBA2 2EA7A 1V9U1 3O0VA 4EWDA 5LK7B 2TNFA 1JZ2A 5GM0A 4ARYA 3WF4A 5I8SA 1DGLA 2A1XA 4LKSA 2VOXA 2F4LA 4N9IA 5LBCA 5K0UB 1GKBA 4XBLA 5ABJB 2ZGRA 3O1VA 2W52A 5A6ZA 2HJIA 1CZSA 3K3NA 3POEA 1O4TA 2IXLA 3POBA 4QGLA 4ZS3A 3U78A 3W59A 5A3PA 1XYPA 4GMP0 4YZ2A 2KR2A 3J8F3 1HIXA 2R043 3RVHA 3EXUA 2ZEWA 1OT5A 3OYWB 4FPKA 1PVC2 4CDXB 1H4HA 3WNMA 5FZGA 3VBSC 1WW4A 2VULA 2W08A 2WABA 3CQOA 3PURA 4N53C 4NHLA 3I3MA 1V9U3 1LOEA 1MEC1 4TZDA 4IEQA 4XBQA 2HEWF 3MPBA 1QNYA 1QGLA 1LHVA 4C0BA 1Z0HA 5FJHA 4XJWA 2FZ2A 2VZPA 1RJ8A 4U2AA 5EYXA 4CCLA 3RMXA 2UWBA 2GC2A 1NCQB 4GKXA 3ROUA 2WLPA 3DXUA 4XTMA 1O3RA 2MEV1 5JVVA 2VNOA 3OBAA 2XBO1 5FZAA 5A7WA 4XQ4A 2NMNA 2WNUB 4OZXA 4QX3A 4XCAA 4LBQB 1HQNA 1OUXA 4P9LA 1BEV2 2V72A 1SLBA 2XJVA 3SEEA 3W58A 4R52A 1EV12 4HL0A 4YM1A 3VZLA 1NQJA 2JB4A 4GJZA 1Y9GA 3AL6A 4BPZA 4CZSA 4DPNA 1C1LA 1RUH2 2C5DA 3HT2A 2XUMA 5BNOB 4IEXA 3OUIA 2AR6A 1R093 1R1A2 1JU4A 3KF5A 1AXYA 1Y4WA 4FFFA 4RL7A 4QB1A 1DGWA 4OUEA 4YW5A 1KD7A 3RQ0A 2XBO3 1W2OA 1SQ4A 2TEPA 3HQRA 3OGGA 4BU2A 5FP8A 3D5OA 3VBUA 4OMCA 4IEZA 4CU9A 4L0PA 2QQLA 1S4CA 4D6RA 1PO22 2WT2A 4MX3A 1RUE2 3BCWA 3GNEA 3KVBA 2FDGA 2G9GA 1RVF2 3ETQA 3MIDA 4IV3B 2ZGSA 4YM2A 4MGSA 5FWEA 4MH0E 3SHRA 1OKQA 2AREA 4FFIA 4MO3M 1NUKA 3WQ1A 3THTA 1B35B 1HRV2 2BNNA 3ETPA 5LA1A 5FYUA 3AYCA 5F8PA 2YFZA 2D40A 1NA1C 2ZGPA 4GJYA 1XNAA 5CVRA 2VQ0A 3ES1A 5C6CA 2Q8DA 1Q56A 2ZKLA 3NO8A 2ZX4A 1UU6A 3PIJA 4K7JA 3RYPA 2D6KA 3AMQA 3CJXA 1IHMA 3OY8A 4UI9L 4JX0A 4QX0A 3VKFC 1SCSA 3KVAA 4IDZA 4JDOA 3O1UA 2VMEA 4LIVA 4JDNA 2BWAA 2VQUA 5BNPB 3VBFA 1W8WA 3N7LA 1IZ3A 5IATA 4W65A 4AXOA 3N4MA 4KMQA 1HN0A 1J58A 1XE0A 1XSRA 1ZRCA 4IGOA 1X8EA 3RNSA 3TNPB 4E4HA 1DQ1A 4BJ0A 1Q8PA 1H1IA 3JCIA 3KCXA 3DL3A 1QOOA 3VL9A 5F3EA 1W6PB 1E5SA 1DFQA 4YPJA 1XNKA 1LJ7A 3BTAA 1AUYA 2WO2A 3KB5A 3BU0A 5CG8A 2JE7A 2HWF1 2ES3A 5FZDA 2VMDA 3V56A 1GQGA 2VXJA 2UY9A 1WCUA 1RUC3 2X29A 3O7OA 5BNNB 3S0MA 4YW6A 2VZOA 4AI1A 5A3LA 1FNYA 2ET1A 1WGPA 3I7DA 1LHOA 2ADEA 1WCKA 5C9AA 5FOBB 1QEXA 1HW5A 2C9KA 1W04A 4NPLA 3RG0A 2JG8B 3ZSKA 1OOPA 5LB6A 4LBJA 3C8XA 3V0AB 1MQTB 3CMGA 3O12A 4PI0A 5JI7A 1W39A 2EIGA 4Q2FA 1W3XA 3P3NA 1DGWX 2FQPA 2GMPA 1HN1A 2R32A 3HQXA 4GZ9A 2PELA 4JAAA 4O9GA 3SCFA 2RM21 3MGUA 3OBRA 1KDKA 3VKMA 4Y20A 3VD4A 3DN7A 3ZXDA 2HWF3 1JUHA 3ZDVA 5I8YA 3RZZA 3D0JA 1QQP1 3I97A 1K5JA 5FO7B 1IOAA 1GOFA 1Q8VA 3IAQA 2D3SA 1UW8A 5IJRA 2QBXA 3PIGA 4FPOB 1TEIA 3AX4A 4YVSB 3G7DA 1RGSA 4UF0B 4JGYB 5F9TA 4YW3A 3H8OA 1IPSA 1ZBE1 3WSOA 4OI2A 2ZHNA 5F3IA 4AQ6A 1K5MC 4I0WB 1MS9A 1W8FA 1LHWA 1S0CA 4DY3A 1OF4A 3WDWA 4CA9A 3B7MA 2RM23 3ATGA 5FZ9A 3VHNA 1VBC1 4M4PA 3ITQA 3JQWA 3GHNA 1QNWA 2QQKA 4P9IA 1QQP3 2XVGA 4DXRA 2ZGLA 3SISA 2YMZA 3MICA 5FYZA 4IV1B 5DAXA 2JDHA 1DQ2A 1ZRRA 1RXGA 3FUQA 4NROA 5FZKA 2AENA 1LECA 4JDMA 1GWLA 1ZBE3 4Q4X2 4XUPA 5KWRA 2BGPA 1TMF2 3B94A 4DB5A 2D6NA 1UL9A 5AFEA 3U4XA 3O1TA 2Q8EA 2ID4A 5LRSA 1UCXA 1VBC3 3AL5A 4BQXA 1OURA 2P5BA 2QZ2A 2YY1A 4MOAA 3LPFA 1PK6B 1FX5A 2WFF3 1PGW1 4DNYA 1YFXA 2JDZA 2JE9A 3RRDA 2W95A 2VR4A 1DHKB 4FVVA 4XF1A 3ZYHA 2GNBA 1AR91 4QKFA 5L7OA 3VUOA 2BZDA 4Y26A 1RMU2 4MHUA 5FZLA 2C24A 5C3OA 5FMCA 3B93A 4P5YA 4FPHA 1OH4A 4AVBA 2XGXA 1WA4A 4YW2A 4EROA 5LZ6A 1AL21 3QD6A 1HXS1 3VB9A 3V0BB 3S57A 1QXPA 5CB7A 2DYCA 3OPWA 4JC1A 4AI8A 3BIEA 3CJIC 3I3EA 4A3XA 2RDQA 4A4AA 4AHWA 1DQ0A 4GULA 3T2QA 1CGPA 1OQDA 4LO8A 4AGGA 4COWA 3M7AA 4H7LA 4XPVA 5FYMA 2H6BA 3VBUC 1KJLA 2E6VA 3LSDA 3ZFGA 3C7OA 4ZHNA 2J1UA 3OD0A 3H3UA 4AOCA 2YYOA 2HWD2 1LOCA 5FUNA 2RDNA 2RMU1 1XNTA 3TEWA 2ZS6B 5BNPC 2G9FA 4ASKA 1RUJ2 1HKDA 2OT7A 3T2OA 3UETA 2QUOA 1HXS3 1AYM1 3HNBM 4DMIA 3DCQA 1PNFA 1W99A 4L92A 2W1SA 3JU9A 3ZN4A 4YZ5A 1S0FA 3VDAA 1X9TA 3BUCA 1NXD1 1OSGA 2WZ8A 1W3VA 1HB4A 4XHBA 1J83A 2PAEA 4UFKA 1F31A 4FTSA 1FV3A 3R0RA 1MS1A 3S7EA 1LU2A 3GCXA 4YFWA 5C8CB 3V65A 4AYUA 3PVNA 4DUXA 1ZRDA 1PNGA 1NCRA 4BHPA 5FDBA 5CFCC 5L9VA 2DTWA 3VBFC 1L7RA 1W05A 3L2YA 2DTYA 4MSVA 2VCCA 2RS52 1ZREA 1QJY1 5FY9A 4OHVA 5HCAA 1AYM3 2XPJA 3M70A 1AR63 3KZ4C 3GZAA 5JLVA 3MUZ1 3NKTA 4QD2A 3URFA 5BNNC 2JKXA 5JIUA 4I30A 3CL1A 4W8JA 3VHRA 5IVEA 3ACIA 3GDBA 1LULA 2JG8C 3ABZA 3LE0A 1PGSA 1GZWA 5FBZA 1KS5A 1MQTC 4CUAA 3A0NA 4OI4A 1LEMA 3RPQA 1PO11 4Y1YA 1UMIA 3LFIA 4RHV1 4ZU5A 3TB0A 3NKGA 2OIIA 3ZXKA 1J1TA 2CHHA 2ZX2A 4E8CA 1O3SA 3IMNA 4Q4W1 5IVFA 1ZX5A 4ZONA 1ND2A 5LA0A 4XW3A 2A7AA 3H7YA 2GZWA 2UURA 4MGQA 3WP6A 1RTVA 3GXUA 4BIFA 2DCKA 3HN3A 4QKDA 3CBNA 2E51A 2EXHA 2BVBA 4N7UA 2ZHMA 1SG3A 3GM8A 4Y22B 5I0UA 2Z69A 4RS5B 1PO13 4D94A 2Y0OA 3UV9A 5CFDB 4BK4A 1HRI1 1NZCA 2WNOA 1Q5OA 3BIWE 2WN3A 4COYA 3VBOA 3H8XA 1QJX3 4LEJA 5LWBA 3U75A 3W21A 5JR7B 5A1LA 4Q4W3 2DBIA 1ASJ3 1MZ6A 1V6OA 1YUDA 5FZHA 2WZEA 2E32A 4FPCA 1SPPB 4PIZA 1MS8A 1YQ8A 1ND3A 2WWUA 1O59A 4PDWC 5FUPA 4NIHA 4LULA 1VRH1 1WMDA 1OLMA 2XVLA 2ZX0A 3AYAA 5E6HA 1CZVA 5BYNA 2FDFA 2Y6JA 1VBE1 1YRZA 1QH7A 1VMHA 4OQ8A 2HWC2 4EJRA 2WWSA 5CA6A 1K42A 1PK6C 3ZYJB 5A3UA 4RR3A 1EP0A 3ZSJA 2D7FA 3MIHA 1Q43A 4Q0SA 1D2SA 4C8DA 5BPXA 1O5UA 1FMD1 4HVQA 1J3RA 5EZWA 1WZXA 3LDBA 1CAWB 5FYBA 4OQ9A 4AVAA 4Y33A 5JXIA 2DDUA 3NW4A 4KQ7A 2YHJA 1LU1A 3LF7A 2W1UA 4Q0QA 1VRH3 1AYN3 1N1VA 2OPWA 2XKPA 2EF6A 3AZZA 3C7HA 3ILNA 3WF1A 4F3JA 1VBE3 3WW3A 1V70A 4LXLA 2QQNA 3SLIA 2ZABA 4J1WA 3EBRA 4WM8A 3AVRA 1IG0A 4DOUA 4EWEA 2X8KA 3WZ1A 4CU8A 2E7AA 1NY71 4XETA 1STMA 2EAKA 2VVEA 1HQLA 4BA6A 5AVAA 4TXWA 4CEWA 1FMD3 4NPRA 2CV6A 1GBGA 4OYUA 4CSWA 1RB8G 3OGRA 2P37A 1N3PA 3OGJA 4YVWC 5FAXA 3THPA 3CEWA 4FI9A 4MLOA 1EUUA 3S5QA 3VZNA 3U11A 1TNFA 3VBHA 4I02A 2A73B 1X36A 1JYCA 5FIXA 4CUBA 1GU3A 4AEDB 4F8AA 2VUDA 5JUVA 4KWJA 2W9XA 3LPGA 1RUF3 3ZYPA 2YU2A 3FZ3A 3TNQA 3VDCA 4CXYA 4WM7C 4AE2A 1FATA 3ZFGC 3ILRA 3RZMA 4HPKB 3HEIA 3B01A 1RUD1 4GWIA 4KGQA 4I0AA 5FY5A 1OBNA 5KHKA 4BK5A 3A7QA 3N3HA 1DZTA 5LASA 2PHUA 1GP6A 1CAVA 5FY8A 3OPZA 4KU8A 2K0GA 2P6HA 1LAJA 5T52A 4AQ2A 4HN0A 1JYVA 4H2AA 1MEC2 4MXWA 2Q8OA 5FKCA 4AFCA 1T6BX 2N7GA 4QPIA 3J7NA 4WVMA 3ZYIB 5FPAA 2V73A 4BMEA 1KRIA 4NWVA 3O1SA 2RDSA 3QLQA 2VG9A 2VVDA 1I9RA 2ZX1A 2FMYA 2ZXQA 3F2ZA 4FP2A 4OFGA 3WD5A 3WOGA 2W5FA 4YFZA 5DAWA 2FMDA 4NMIA 1XQNA 1UF2C 3AVSA 1DQ5A 2MEV2 1ZZ9A 2W3JA 3B9CA 1IPKA 4W6YA 4CCEA 3M3OA 1HV1A 5JAXA 3I2JA 2CAVA 2A6XA 4XUTA 2X5IB 3I2IA 1JUIA 1F4HA 1K45A 4EQVA 3Q9OA 2XMLA 3ZN6B 2CNAA 4N53A 4YW7A 1SZBA 1HV0A 1OA4A 3VBSA 4COZA 3UJOA 1CVNA 4LO6B 2XWJB 2ZX3A 4YZ1A 3MLKA 4LBNA 5F2SA 3WG4A 2AGSA 1X33A 2HKXA 1BBT2 3WF0A 3QH7A 1PGL2 4TN7A 5IVJA 3OTFA 2PHXA 1PM4A 4GB31 2DVAA 2VOVA 4BMBA 3VDBA 4W6XA 2VOWA 4N7IA 4AVCA 5FV3A 3T09A 5JSRA 4PI2A 4LOTA 3UK9A 4JTNA 1LENA 5J36A 4ZXKA 3SXWA 4MG2A 3PUHA 1OLQA 4AQSA 3AB0A 1QXRA 1DYPA 1QJU1 2YC2A 2WLQA 2W2IA 5FZMA 4CDUB 4CP1A 5HV4A 4CCMA 1XRUA 1JZ8A 4CCKA 3NNMA 5GZDA 3VDDB 3DKQA 1I1EA 1C8M1 4MZUA 3MV11 5JZGB 1H6XA 2VE1A 2RVAA 4KG8A 1R082 2XJPA 4YLZA 5FO9B 4Z1VA 3IMMA 5FXWA 2W92A 4A6OA 4AAPA 2QQVA 2J1AA 4A7ZA 5FRAA 4NR1A 1C57A 2JEMA 1CESA 4PF1A 3RZHA 4BE3A 4JKLA 2LS6A 2HWB2 2XHKA 3OG2A 1POV1 5FYIA 1ZA7A 3MPPG 4DRRA 2XJSA 1T2XA 4HT1T 4NPMA 1OI6A 2WDBA 4QM8A 4NJ4A 5FMBA 5T5OA 3WLUA 4MXVA 4CCOA 1VBB1 2JWPA 5JXJA 4H3WA 4B4PA 1C8M3 5A7OA 1BK1A 1MACA 1CZTA 5IVBA 2R0HA 4RA0A 1H9WA 5L9BA 4AI9A 5A32A 5JWPA 4OUSA 5C4WC 2Q4SA 2I74A 1WLCA 1HB2A 2ZGQA 3AFKA 4DZGA 1Y9QA 4RYDA 2QE3A 2J1EA 5ISLA 1UKRA 5IAVA 3WVJA 4I3GA 1BMV2 2UYBA 3GALA 2V09A 4MVTA 3PJQA 3MLLA 1NA1A 1POV3 3OUHA 4HOOA 1GOGA 1GNYA 1Q8SA 4AFDA 2RR12 3GBGA 2VTFA 3FLRA 3A23A 2V5YA 5E89A 2RS31 1VBB3 2ZA9A 4AFAA 2O1QA 3AP5A 2HYKA 2VO5A 2A6YA 4Z2WA 2Y8KA 4FPEA 4IEYA 1GWKA 2ZGTA 5EYYA 1FXZA 3E6DA 1ENXA 3I2FA 2D3PA 2OVUA 3AC0A 4GIQA 3FFZA 2Y64A 3D8CA 5DXDA 2WYSA 2GN7A 2R7EB 2E7QA 4AEDC 2QDRA 1GWMA 2D93A 4FO9A 4WV8A 2JXAA 3ZFFB 2WRAA 5IT6A 4ZZ5A 2RS33 4UW3A 5DUUA 4UAPA 5JSPA 1TG7A 4XAEA 4E8DA 2CDOA 2VUAA 5M0TA 1UOGA 5BY5A 3SC7X 2EXIA 1YFUA 2GU9A 2J1RA 4Z07A 5J98B 2WS92 3N7KA 2JE8A 3GBWA 3WY6A 1TE1B 5F1RA 3LB9A 3NAPB 1O5LA 1M06G 2NYYA 5JOWA 4V2VA 1VR3A 2GDFA 2ZGNA 1CAUA 4UFJA 3R4SA 4W6WA 2A6VA 4KL1A 4Q1PA 1YNAA 3OEBA 3K75B 2JIGA 1Y9MA 1OD3A 3OCPA 1XOYA 2RS11 3HD8B 3FL7A 4FPJA 3TRSB 3NNLA 1XB9A 3QBQA 1W9YA 4M0HA 5FMDA 3RJ2X 4XF9A 5FYVA 3WX5A 3SMHA 5KC5A 4Y4YA 2X5IC 4XF4A 3OYWA 3W9AA 5BNQA 1RHI2 2XVKA 4EN0A 3CHXA 5FP4A 1W8OA 5D1IA 3VN4A 2HBTA 3H50A 4RSUA 1K5MA 2VVFA 1LODA 1WMEA 3VZOA 4V2WA 2RS13 4A7YA 5CADA 5AVPA 5IK7A 2ARBA 1YCIA 3GBFA 4K1YA 3WDTA 1AJOA 1NZIA 3VBRB 1ZZBA 2JENA 1W90A 3NL1A 5FXVA 1AR92 1BKZA 2IFWA 5C5TA 1VALA 1YQ5A 1WMFA 1S2BA 3EB7A 1VJ2A 1AL22 4LBQA 3J26N 5G04L 1UOJA 2VZQA 3N9OA 4LK6A 3AKQA 3BALA 4XFIA 3AKTA 4ES8A 5JZGC 2FCTA 4PHZA 4NUBA 2ADDA 1R091 2VTXJ 3KQ4B 4XXPA 5FYHA 2WZR3 3ZIXA 4NN0A 5EIYB 4R4XA 4Q0UA 3NNJA 5DUVA 1BQPA 4RN5A 5LA9A 3H7JA 3VZJA 3IDEA 5CIRA 5FLHA 4C0HA 1JBCA 2ET7A 2OS2A 2RMU2 1T6GC 4COVA 3NV2A 2K9ZA 1X9PA 1LGCA 3M3QA 1ENSA 1QDCA 1AYM2 4YYOA 3M3IA 3AZVA 4XIKA 1I3HA 1REEA 1UZYA 5D8AC 5A6YA 3ZPYA 1EAH3 2VH9A 2UWAA 1DGRA 2V4AA 5A80A 3RFRA 5FR3A 3E5UA 3POJA 3CJIA 5IFPA 1SBDA 5G05L 4CCJA 2XJQA 5FCCA 4Z92B 1UYYA 1LOAA 4S2FA 3ZPOA 4LITA 1OFSA 5LY1A 4QQ2A 4L11A 1G86A 5F5IA 3ZSEA 1FPN1 4LBQD 3NJXA 4B3NA 3ZSMA 4ET7A 5C70A 5A7QA 2B9VA 1QJY2 1PZ7A 1KEXA 4JHTA 4XFFA 2X09A 4EN8B 4OHXA 3NJYA 1VAKA 1OQEA 1W8NA 3DGTA 3FHIB 2JG9B 3MUY1 2XUEA 2D5HA 3O14A 3PU8A 4P9GA 4CDWC 4DUVA 3MW4A 4X8NA 5DDJ3 2EXJA 4IGPA 3I2HA 4BQ5A 2R072 3NWKA 4YSFA 2AZ5A 4QHZA 3HJRA 4PIYA 2D6LX 4IUGA 1EY2A 1OQ1A 5KXCA 4ORFA 4Q8LA 4Y1ZA 1FOD3 4MGYE 1SBEA 2I45A 1ZZ7A 2YU1A 2Z79A 1DYOA 1GSLA 3POIA 1FPN3 1UZ0A 3WCSA 4CRQA 3FMGA 4RHV2 1Q3EA 1ULGA 3ZFFC 3RYRA 1OUSA 5L9RA 1UAIA 1W6PA 5CFCA 2JDPA 2GNMA 4FAHA 1Z78A 5KHHA 4SBVA 4YG3A 5DZFA 5FBJA 2WBKA 3DPRC 1COV3 4RFRB 1O7FA 1RUC1 2GH8A 1Z7S1 4D0QA 1A6CA 1WCDJ 2WSVA 1OHFA 4PCRA 5EXOA 5A33B 5FKBA 3LQCA 2B5HA 3OGSA 4DQAA 5BNNA 2PTMA 4G3YC 3NNGA 4B4RA 2CGPA 1JOBA 1KGYA 2HWE3 2ORZA 4ISQA 1CJPA 4DS0A 2P3YA 2UU8A 3T2TA 1A3KA
chains in the Genus database with same CATH topology
1J1LA 1XE8A 2JG8A 4AW7A 2LTNA 3PLQA 1HRI2 4Q29A 3V0AA 1MQTA 4AHZA 4TSVA 5F6KA 1D4M1 4P9WA 4HANA 4HN1A 4UW4A 4LE3A 3ZFEB 1Z7S3 5KXDA 1LOBA 5E8AA 1W6QB 1SFYA 3ALQA 1MS4A 2Q30A 5IK5A 4HETA 4FBFA 1CONA 2PLV1 2E53A 4ZU4A 1Q8QA 1GANA 3S7IA 4FQZA 3FX3A 5DG1A 4YVSA 4JTOA 1YYNA 1IQAA 5K0UC 2DU1A 3N7MA 4XBNA 5ABJC 4GQ7A 4QGNA 1D4M3 3AJZA 3MDPA 1UU4A 3WR0A 4P9XA 3B00A 1J3QA 1U5ZA 3E6BA 3CU7A 1FMD2 4MUVA 3TN91 1SLCA 2WKKA 3ZN5A 4CDXC 1OD5A 3WG3A 4CTEA 2XLAA 4Q27A 4B4QA 1PIV2 4FPGA 2PLV3 1F2NA 2PAMA 1YXWA 4CDQB 4Q4Y3 3CO2A 4XF0A 4R9CA 4XFAA 4GWNA 4PDWA 3MF6A 2GMEA 4Q4V2 3H1MA 1NCQC 1H1AA 1YIFA 4K20A 1YFYA 1AF9A 2WFF1 5C9AB 4IERA 1DF0A 1AR81 4DFSA 1PK6A 1TME3 3TN93 1AHSA 4DINB 3WDYA 1RUI2 1GICA 2WNUC 1WLWA 2NP0A 1YIPA 1DBNA 1QOTA 2A71A 2YZ4A 4Y20B 5FLIA 1SCRA 1VBD2 2B42B 3APBA 2BUKA 1BCXA 2BFUL 3G6JB 3LWCA 4YGEA 3TBDA 5BNOC 1F8VA 2Q0AA 1WW7A 3WP5A 2IXCA 4U36A 5LK5A 4OVEA 1RUD2 2ENRA 1RC6A 1ZBA1 1AR83 2MPFA 4Q1RA 4CYDA 5C33A 1XNDA 1ZZ8A 1OMIA 2H0VA 2CWSA 2BBVA 1VBA1 3HWJA 2UYAA 1U12A 5GZGA 2BW8A 4YVWA 3LOBA 4IV3C 4XFCA 4UBHA 4I0BA 1G9AA 2ZHLA 4ASMB 2JG9C 1GZCA 4H55A 4M3CB 1B35C 2ZMLA 1HLCA 4K3UA 2E9QA 1ZBA3 1SDWA 3M8LA 4N9HA 1WLTA 3USSA 3ZYRA 4WM7A 1PVC1 1RUG1 1LEDA 1QMJA 2BYVE 1W0OA 3J9SA 1VBA3 4ISRA 2PHTA 2QZ3A 5GALA 3FBYA 3POSA 5T5JA 5JOZA 2R062 4HSLA 2VECA 1DZRA 4EV0A 1F9KA 1AR61 2A3YA 3JBG2 3PMEA 4IEVA 2D6MA 4AVVA 1C28A 1PVXA 1FI2A 3R05A 4HVOA 3KGZA 5L7OB 4GB32 3A0KA 2O8OA 1O4YA 5KHIA 2OZJA 1PVC3 1RUG3 1LB2A 5JCTA 1H8TB 2XKOA 3AP7A 5GJ6A 3FLPA 4AFMA 2WNEA 2TBVA 1UPSA 1QJU2 2YV8A 1BEV1 2VPVA 4COUA 5JOYA 1EPWA 3UKVA 4ATFA 1ULCA 1LR5A 4L8QA 1WW6A 3X29B 3AKRA 4C90A 1RUH1 2F4PA 1DYKA 1ULFA 1DGRN 3ZFEC 2XL7A 4FOWA 2PHFA 1R1A1 1XE7A 3AP6A 1HX6A 3PHMA 4OI0A 2P2KA 3NV1A 2DVBA 3N35A 5ACA2 1SLAA 1FNZA 1RIRA 4XFGA 4MV2A 1BEV3 1AR72 1EV13 3A4UA 4MYEA 4Y22A 5AC92 5E88A 1QJX1 1RUH3 4GXLA 3ZXJA 5GLWA 1HDKA 3NJZA 4ZKTB 4XQWA 1R1A3 1ASJ1 1V6NA 1NCRB 4QQLA 1HRV1 1QF3A 1Q8OA 1W6NB 5J37A 4RQPB 4YVSC 4JGYC 1QKQA 3IKWA 1S0DA 4CDQC 5BV6A 2QDNA 2IZWA 5J48A 1DDLA 1RUE3 1RINA 3RI8A 4KH9A 4META 3IDBB 2MHFA 2Y0IA 2EALA 4L2NA 4OHWA 4IV1C 1W6OB 4YRDA 1HRV3 2WZPP 4X8PA 2PAKA 3U10A 3QOPA 3UJQA 1W6MA 4C91A 2ZAAA 2DVDA 1S1AA 5C4WA 4FAGA 1GNHA 1PZ8A 2PN5A 1AYN1 3B02A 5K9YA 3LA3A 4JVAA 4IEOA 5FLJA 3MW2A 4A7KA 2SLIA 4FPYA 1JTZX 2JX9A 3B5LB 3K51A 4M01A 1AXZA 2WNVB 3I59B 2LM3A 3AMNA 4FPLA 5K8SA 3GZTB 2JD4A 4EN9B 1WCSA 2YC0A 5H9RA 3VGIA 4JQRA 4RGGA 5GLZA 2PQQA 1VLNA 4FTBA 2W68A 4Q0VA 2PFWA 1N3OA 3VBOB 2QNKA 5DZGA 2XH6A 2R30A 4D7TA 2ARXA 2JECA 1RUF1 3AYDA 4LBLA 3MIFA 4PF5A 4AF9A 2RS12 4AEDA 2VGDA 2B45X 2MNGA 4QT6A 3NV4A 1ND3B 2R042 3J8F2 2GNTA 4GMP1 2PHWA 2XWBB 1SBFA 3RS6A 4OULA 4HKOA 1A78A 1SACA 1CQ9A 1V9U2 3E5XA 3VHPA 4LO7A 4DXZA 3D82A 1JH5A 3D4KA 4TLFA 4X6QB 1URXA 3JD71 3WINE 4G4FA 1GZ9A 2VMGA 5KXEA 4GH4B 4XJ9A 5C8CC 1CAXB 4PBPA 3VL8A 4WVVA 4CEYB 3IM0A 5EV7A 1H8TC 1U5IA 4GMP3 5TSWA 4I2OA 1S2KA 2Q1ZB 2ZHKA 4I09A 2OPKA 3JUUA 4IXLA 4J6GA 1ULEA 4AEMA 1TMF1 3ZDSA 4CP0A 4WM8B 2QQPA 4P14A 1GYKA 4AG4A 2AH2A 2X5IA 3JD73 3WG2A 4YARA 1N3QA 3IN9A 2DU0A 4LLFA 1R092 4Q0PA 4QX5A 3MIGA 1UZZA 3AMPA 2JKBA 3FC0A 1SLTA 3VBHB 2XBO2 3AXDA 4QPGB 3WP4A 4LLOA 4YGCA 4V1PA 2VU9A 1TMF3 4JGZB 2IC1A 4QXKA 2YDEA 2XLGA 1Y3TA 3AK0A 1Y7BA 1UPIA 1AXKA 4OUMA 5EFUA 4E2QA 3AZXA 4DY5A 2Q1MA 2CY6A 5T3NA 1WD4A 3VDDA 4RQPC 5J09A 3VKLA 5JZGA 3BU7A 2NN8A 2ZCWA 5CG9A 1C4RA 1YO8A 2K2SA 3SH3A 2BNMA 4QPIB 4D7YA 2D6OX 3FBMA 4KWLA 3AM2A 4HFSA 2GC1A 1IPJA 1RMU3 4WVMB 4RS5C 2HWD1 1FPN2 5CFDC 4D69A 3KGLA 4K21A 3SH5A 1RUJ1 3OD4A 2B39A 1CPMA 3C2UA 5HCBA 5FOJB 4XXAA 1N1YA 4YG0A 1MZ5A 2DCJA 5FQ0B 3AP4A 5D8AA 1HQWA 3INAA 1I5ZA 5FMOL 1KITA 1XU2A 2AUYA 3VLBB 3HR9A 1H1MA 1BJQA 2BFUS 4XOGA 3VBSB 4N53B 2HWD3 1NYWA 2D6PA 1AVBA 3OJBA 4XILA 2NPIA 1RUJ3 2RS51 3M1HA 2WNVC 2A75A 2RE9A 4H7MA 4XMAA 3R4UA 4GWMA 2VUJA 3KT1A 3LZZA 1C5IA 1PZ9A 2P34A 1KXGA 3S30A 1RUC2 3USUB 4K40A 3MIBA 5JPMB 1V00A 4HVRA 5I0SA 5HI0A 4CDWA 3EQEA 1FAYA 3JB4C 4Y1VA 1XYOA 1VIWB 3O0WA 1N47A 1YWKA 2QVSB 4K6BA 2A5ZA 3TWIA 4BM8A 4R9DA 1G6NA 4QQOA 2RS53 3POWA 2GC3A 3AMHA 5JDBA 1FT9A 3WP3A 2HWF2 4Q26A 5L19A 2BGCA 5T55A 2VW2A 2DFCA 4YZ4A 1ZA4A 3MEPA 5FPXA 4NHKA 3ZFFA 3LGRA 4MGIE 3R6SA 1ENRA 3MYXA 4AK3A 5DUWA 3ACLA 4PLMA 1H2KA 2WFPA 3DPRA 2RHPA 3WQ7A 1NG0A 5T5PA 4IL7A 5KC6A 2XLFA 2ZGOA 1UN1A 2GALA 3T1MA 2RM22 2BTVC 2VQAA 4M00A 4PIXA 4GH4C 4MGZE 5A32B 5K7PA 4Y1XA 5H9SA 1B09A 1QQP2 3WDUA 4XMIA 5GZFA 1M4WA 4CEYC 4PBOA 3TN92 2XB6C 2XJUA 2EXKA 3IPVB 5KBFA 1NA1B 2HEVF 4IEWA 1ZBE2 4PQ9A 4E4DX 2CGNA 4FOQA 4NO4A 3ES4A 4C1XA 1C1FA 2ZPXA 2CAUA 3LA2A 1VBC2 5LEKA 3WHUA 1NQDA 4SLIA 2HWC1 3I54A 5H9PA 4BLIA 5K0UA 2WFF2 4KG0A 5ABJA 1CJDA 3M4FA 4LUKA 3VBRA 3ZIWA 3MFAA 4CDXA 1H30A 3GF6A 1C8NA 3M3CA 4PLOA 1BVVA 1RITA 1SLLA 3BOPA 3L2HA 2DV9A 4E9KA 2C1FA 2ZGKA 4KU7A 2HWC3 1UIJA 2GH2A 2IXIA 1G9CA 3JZVA 2WL1A 3BODA 1PGW2 1KFXL 1OLRA 2WZR1 4XJAA 2B9UA 1NCQA 4QM9A 3FJSA 2DF7A 1GLHA 3R4DB 3ZSLA 2O0OA 1C3HA 4P9JA 1CAUB 4XHXA 5E16A 4N43B 1N1SA 2WT0A 4GALA 1WBLA 4CDUC 1V6IA 4R9BA 2WNUA 1HXS2 1PHMA 4TYSA 1IS6A 3VDDC 1MZEA 5T50A 3DV8A 1EAH1 1S0BA 3IIAA 4YZ3A 3B9IA 3LA7A 3ZMOA 1OA2A 1XU1A 2FHRA 1CN1A 4ATEA 5BNOA 5C8WA 5JOXA 1RUG2 4I3PA 1KJRA 5HXVA 1IS3A 4UW5A 5T54A 1CD3G 3WQ0A 2DVGA 1X8MA 2LUWA 4L9BA 1RUOA 4HKLA 1K5MB 4YW4A 5GLTA 1AX1A 1XYNA 5KHGA 1AR62 1D2QA 5I0RA 2WQZC 1H2NA 4IV3A 1L3JA 3B69A 2GNDA 2R49A 5DDJ1 2OA2A 2JG9A 1CX4A 2KM2A 4LUMA 1YLLA 1B35A 2A3WA 3HBZA 1MZFA 2NMOA 1FOD1 2OZ6A 3QACA 3QCWA 1O4ZA 2R1DA 1KDMA 4HK9A 1MEC3 2VNGA 2ILMA 2IXJA 4LR4A 3OF1A 1G7YA 1E57A 1S0JA 3LAGA 5JI9A 5LRRA 4GKYA 1APNA 4K1ZA 5H9QA 2CTVA 1PGL1 1BBT1 4YM3A 5GLVA 4HSJA 1COV1 2Z42A 1U5YA 3ZXAC 2MEV3 4LA3A 5BUVA 5J96B 2GMMA 1DG6A 4B29A 5A33A 3EHKA 1WBFA 2HWE1 1RL3A 1H2MA 1PO12 3DUIA 3ZXEA 1UX6A 2VMIA 2WSUA 2Y38A 1S55A 3AMMA 3MLJA 2H6CA 3GZUC 3ZXGA 1QJX2 1REFA 1JW6A 4Q4W2 1BBT3 1V6MA 3CJIB 1ASJ2 1V6LA 3K48A 1AX0A 4K9SA 1NLRA 1R081 1G9BA 2ETEA 3WDXA 3ZFEA 4LT5A 3VBUB 3CF6E 1D0GA 1KS4A 3NAPC 2CGOA 3T1LA 1ZZCA 1SMVA 1W6QA 4X6RB 3JQXA 4AHXA 2P3JA 2HWB1 3AFGA 4DRVA 2ATFA 4AVTA 5KHJA 1UU5A 2X53S 4MGKE 5I8TA 5J3UA 2IWGB 1LHUA 2PHDA 2WJSA 4EN7B 4B8EA 2R16A 4P5HA 3E6CC 2UWCA 1IKPA 1R083 4YM0A 3OY8B 1PM7A 1X7NA 5KXBA 2E7TA 3UKNA 1POV0 2GSYA 4NOTA 1IGOA 1BMV1 1VRH2 1AYN2 5CFCB 4IEUA 1G8WA 3VBFB 2HWB3 5I93A 4Q4Y1 1DLLA 1VBE2 2QCSB 1ULDA 4JGYA 3AYEA 2RR11 4CDQA 1MVQA 2D97A 1BZWA 3C3VA 1REDA 2BWCA 5CU1A 4AWDA 3CLPA 1GFF2 3M2MA 1JYIA 4JRLA 3VBRC 4YW1A 3NVCA 2YGLA 5LEJA 1TME1 3HMYA 5JSOA 2BVVA 4B7KA 1DU3D 1LRHA 2FBEA 4IV1A 4S2DA 1EYBA 4N43C 2ERFA 2A70A 4WVWA 2ZJCA 3BOWA 3H1WA 2DVFA 3RSJA 4ASLA 2RR13 4O9EA 4AQTA 3L9JT 1RUF2 4AI0A 5JPNB 1OFNA 4IESA 4YNIA 3NSTA 1NY72 5FMOS 3ZVXA 3TOJA 2D43A 5I0TA 1MR5A 3KMHA 2VXRA 2CL2A 1RUNA 3ZMNA 4E4ZA 1OOPB 3CNAA 2D44A 5BXXA 2I07B 2TUNA 5AFBA 1QXJA 2WS91 2QJVA 1AJKA 1A8MA 1GR3A 2C0ZA 3VZKA 3WCRA 2WINB 2DCTA 3PMSA 3KCCA 3VV1A 4FSJA 1EPZA 1UIKA 1AZDA 3JD72 2XJTA 4JRAA 1H9PA 3ZXLA 4XTPA 1YI7A 4HKWA 3PJYA 4LHNA 3WDVA 1ZNPA 3V0BA 1O91A 3PNAA 2VY0A 3PVBB 2YGMA 4M3CA 2VW1A 1S0EA 2B8MA 3WNXA 2F6BA 2WS93 3U07A 1NXMA 1RHI1 1MS3A 4PDWB 4LBMA 3PVOA 1X82A 2XL9A 2XJRA 3U0ZA 3M3EA 1J59A 4HLTA 1DQ4A 3ZXFA 3KT4A 4QHBA 5FREA 1S0IA 2ZZQA 3RMYA 2DUOA 1D4VB 2Q5TA 4YG6A 3S6PA 5J7MA 3ME2A 3MI8A 2NQYA 2SBAA 3NV3A 3ECQA 4AEKA 4H14A 2D98A 4XZPA 1LGBA 3H3ZA 4LBOA 4B7EA 5C8CA 3DF0A 4BZ4A 1RHI3 2IXKA 2FZ1A 1G9FA 4WZCA 4XJZA 5IK8A 2GN3A 1H8TA 2ZBJA 5FTTC 2YPJA 3WUDA 3AJYA 1W0PA 4F7ZA 2QFEA 3RDIA 3H9AA 3KD4A 1LCLA 3BB6A 1AL0G 4CP2A 3O5SA 4HMZA 4IQPA 3HIFA 1AR93 4C1WA 4S2HA 1FV2A 4YVWB 1X50A 4KGGA 1MVEA 5SV5A 2BEOA 1ALYA 2VOKA 3WW1A 4FOVA 1YJKA 2KA3A 1AL23 1EV11 3IBMA 2DCYA 1FYUA 2BPA2 4NHMA 4P9YA 3EO6A 3VHOA 4JV4A 3RJRA 1S0GA 1C8M2 1CIWA 4WM7B 4Y1UA 3ZFGB 3H1YA 4FXKB 4E4SA 1WUVA 1XNBA 1W6NA 4RQPA 1VB2A 4BCUA 3ENRA 4UXAA 1YI9A 4BOWA 2D3RA 3WUCA 4HZFA 2RMU3 4R9AA 2I2SA 2PA7A 1LOFA 3WHTA 3AZWA 1PO21 1RUE1 1RVF1 4RS5A 3IT8A 4Z82A 1VBB2 3KSCA 5CFDA 4AVSA 5E1RA 1JHNA 3BPZA 2ZAHA 2Z2SB 3VZMA 2R071 3AKPA 4LO5B 3E97A 1DQ6A 4M3CF 1W6OA 4I01A 3UKTA 5A3MA 1ENQA 5HCFA 1ZVFA 1VB4A 3AP9A 1ONAA 4A2UA 2B46X 2P3IA 3LOIA 3KM5A 2BNOA 1LHNA 1PO23 1QJY3 1U0AA 1V6JA 4QQPA 1RVF3 3SH4A 4E27A 1NE6A 2RS32 4YGBA 2VNRA 5C9AC 1KFUL 1SEFA 2WNVA 2BQPA 1OOPC 3FLTA 3I59A 1GZWB 2R073 4AI2A 2A6WA 3WW2A 1R1ZA 4BH9A 2KXLA 1QJZA 3WV6A 4IETA 4XYXA 4S2GA 5T5LA 1CAWA 4FOYA 3KCYA 4OHYA 1QHDA 4RHV3 1QY4A 2GC0A 2WT1A 1CR7A 2R1BA 3MIEA 3GYDA 1ND2B 4ONUA 4EWAA 5CAZA 1ZZ6A 4E2SA 2GAUA 3LCPA 4LHKA 4PLNA 4F83A 4GA9A 1VAVA 3FUOA 3WT3A 1UMZA 1NLSA 1VP6A 1IS4A 1LKNA 2R6QA 5EJ3A 4D7SA 4LNVA 1XNCA 3ZX7A 4AEJA 1HRI3 5EWSA 1D0HA 4D3WA 3B3QE 3TAYA 4FXGB 2ZGUA 2HEYF 2VW0A 4Y24A 4Q8KA 4QQHA 1OA3A 1JN2P 4LO4B 1W6MB 5DG2A 1TNRA 4GH4A 2RJKA 3HAGA 5FO8B 5C4WB 1N1TA 3GHMA 4HPKA 2ZTNA 3H0OA 1CAXA 1PIV1 1VAMA 4CEYA 1QDOA 3H8UA 4ES9A 4M3CE 3TYJA 4BYYA 5F6LB 2DUPA 4RR3B 4HBNA 4Q4V1 2G4IA 1NOVA 1A8DA 2OUJA 2EVXA 1J3PA 1WLDA 5L7OC 2IFRA 2WZR2 4J1XA 2P3KA 3DKWA 4XFHA 3FFQA 2WQ4A 4EN6B 3PTYA 4OHZA 2E63A 1F5FA 4AI3A 1RUI1 1PIV3 4Y5Z0 4Q4X1 4FQ4A 2W0XA 4XQDA 4E2GA 3E5QA 2A6ZA 4QPGA 5HBAA 1VBD1 5JMCA 4K8FA 4QU2A 4PJYA 1ZYBA 1SLIA 1WW5A 1GQHA 3MZHA 4JGZA 4R4ZA 4Q4V3 3ZN6A 1EAH2 4CEWB 1Y43B 3RYKA 1C5HA 3V64A 1LTEA 1GV9A 3ILFA 1YFWA 1YJLA 1RUI3 3IDCB 5GKAC 4QMAA 4RGAA 1RMU1 4Q4X3 1UD1A 1BXHA 2ZACA 4AFBA 1VBD3 4Z8BA 3HN1A 1O3TA 2PYTA 5GZEA 1RJ7A 4LBKA 4CDUA 4YGDA 5DZEA 2CWMA 2P17A 4LA2A 2ZOEB 3KQRA 1NCRC 1I6XA 1ZM1A 1RUD3 2YUEA 4WBBA 5DDJ2 5FPZA 5IUQA 4BQ1A 1CAVB 4TZDA 2R0FA 3MFCA 3PVEA 4AGVA 2OW4A 3D0SA 4UW6A 5IK4A 2EAAA 1LOFC 4BIOA 5GLUA 4MXWB 1FOD2 2PHLA 4XIOA 5FQ0A 2DCZA 3J4UH 1LESA 3AKSA 3N36A 1XXNA 2DFBA 4BWOA 2AYHA 4KNCA 2R061 4WZFA 1QH6A 2CYFA 2ZKNA 3JBG1 4N90A 2ZGMA 2UY8A 1COV2 4LHLA 3USUA 4L97A 4OI1A 4AHYA 2HWE2 2ZZJA 4OLLA 2WC2A 2WIIB 3RWNA 2W39A 5DUXA 2DUQA 2H0BA 5L73A 2R063 4TWTA 1BVP1 1NE4A 1ND2C 1IKQA 2VMHA 3JBG3 2DURA 3QH6A 1ZRFA 4XDQA 4KBBA 1Z7S2 5JIAA 3KT7A 3POYA 4XF3A 4HK8A 5SV8A 2YXSA 4GB33 2DWRA 4WVZA 4G9SB 3SCHA 1LOGA 1BYHA 1OPMA 4URTA 3JB8A 4RFT0 3VBOC 5GZCA 2XG3A 1V6KA 3N7JA 5ACA1 1QJU3 3FE5A 4IEPA 1O3QA 4XFBA 1GNZA 5B2GB 4FPFA 1AR71 3WXPA 1IS5A 1DIWA 2O8QA 5AC91 1QOSA 1D4M2 3ZO0B 4L99A 3WW4A 1JXNA 1DZQA 5D8AB 1LGNA 2Y26A 1ND3C 4LTAA 4KWKA 3FWEA 4QGMA 3MF9A 3P3PA 3KS7A 4LE4A 2JJ6A 2ZMNA 4FCAA 3OBTA 3UL2A 2NLRA 3EJKA 2PLV2 4NVPA 3MW3A 3IPVA 5ACA3 2D5FA