5BXXA

Crystal structure of the ectoine synthase from the cold-adapted marine bacterium sphingopyxis alaskensis
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
121
structure length
121
Chain Sequence
MIVRNLGDIRKTDRNVRSDGWASARMLLKDDGMGFSFHVTTLFAGSELRMHYQNHLEAVLVLKGTGTIEDLATGEVHALRPGVMYALDDHDRHIVRPETDILTACVFNPPVTGREVHDESG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-ectoine synthase
publication title Biochemistry and Crystal Structure of Ectoine Synthase: A Metal-Containing Member of the Cupin Superfamily.
pubmed doi rcsb
source organism Sphingopyxis alaskensis rb2256
molecule tags Lyase
total genus 27
structure length 121
sequence length 121
chains with identical sequence B, C, D
ec nomenclature ec 4.2.1.108: Ectoine synthase.
pdb deposition date 2015-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06339 Ectoine_synth Ectoine synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5bxxA00
1EYBA 1NZCA 4FT8A 4FAGA 5KHHA 1LRHA 2IXLA 3U0ZA 4MH0E 1FT9A 4Q0SA 1YLLA 5J7MA 4TLFA 2XL7A 3IBMA 1WA4A 3L2HA 5FPXA 4J1WA 2O1QA 4QGMA 1YFUA 3SMHA 4D7SA 1IPKA 3H1WA 3H50A 1ZZCA 4R52A 4F8AA 1ZVFA 2K0GA 3MPBA 2PHLA 2BGCA 3E6DA 5CVRA 4IEOA 1LKNA 5BV6A 4EWEA 2PTMA 4NVPA 5JSPA 3TNPB 5LEKA 3PVBB 3H3ZA 4J1XA 3ES4A 1G6NA 1DZTA 2V09A 4E2SA 4XF1A 3O14A 4KL1A 4YNIA 2PAEA 4Q0VA 1ZRFA 4I3PA 1O4TA 4AVAA 4LULA 5BPXA 2CV6A 1Y3TA 2CAVA 4MGKE 5I8TA 2PA7A 4BYYA 4N9HA 3PNAA 1OFNA 4Q29A 4IERA 5JCTA 2IXCA 3USSA 5LRRA 4L11A 1J3RA 1VR3A 4IEQA 4KWLA 4HVQA 4XF9A 3OTFA 3S7IA 4I0AA 3LOIA 5I93A 3I54A 1NXMA 2IXIA 2BNNA 4PIYA 1I6XA 2UY8A 3DN7A 2MHFA 3GBFA 5J48A 5BY5A 1OD5A 3VHRA 3LAGA 3B02A 3S7EA 1OI6A 1UIKA 1X82A 3I7DA 2XKOA 3ETQA 2UYAA 3H7YA 3LA2A 3FWEA 3H7JA 2OZJA 3R6SA 2QVSB 4QX5A 1RL3A 3HT1A 4PIXA 3D0JA 3ST7A 2EA7A 5C6CA 4HZFA 1QXRA 2GC3A 4QXKA 3SHRA 2XL9A 2BNMA 4ZU4A 4Q0PA 5AVPA 4O9EA 3U11A 1XRUA 5I0UA 4MX3A 2K9ZA 4O9GA 3HIFA 5J3UA 3UKVA 3SXWA 1FI2A 4LTAA 3HQXA 4ORFA 3E6BA 4R8HA 5CADA 1YHFA 3NVCA 2C0ZA 3CLPA 3LZZA 4QGNA 3D82A 2B8MA 3PLQA 2IXKA 3TNQA 2HJIA 5HI0A 1O5UA 5FQ0B 1H1MA 3SCFA 4I2OA 2IXHA 3ACLA 4KWJA 4YARA 2QNKA 5KBFA 3DKWA 3FZ3A 3U10A 3H1MA 4LA3A 3RDIA 2XGXA 4E2QA 1CX4A 1Y9QA 1O3TA 3QOPA 1QWRA 3LA7A 2Q30A 4ZU7A 4IEYA 1RGSA 2CAUA 4K8FA 3FJSA 3IWZA 4EWAA 1RUOA 4IEZA 2ETEA 2XLGA 3FFQA 3H3UA 4QM8A 5C8WA 3S0MA 1J3QA 2MPFA 1ZREA 5I91A 3H9AA 4YYOA 4D7TA 4IEUA 3KSCA 2OZ6A 3E97A 1LR5A 2IXJA 3RNSA 4XFFA 3EQEA 1SEFA 4HSLA 1NYWA 2DCTA 3MDPA 1NE6A 5I0TA 1V70A 4P9GA 3BALA 3SCHA 3FE5A 5F1RA 4UBGA 1Q5OA 1J59A 5FQ0A 4Z82A 3LWCA 1XE8A 1I5ZA 4WZCA 5FLHA 1YWKA 3KGZA 1ZNPA 1PM7A 4JVAA 2QDRA 5FDBA 5JSOA 1EP0A 4EROA 5E16A 1HW5A 3FHIB 4XF0A 4MGZE 5JAXA 1LB2A 3OGJA 1J58A 3N4MA 2VQAA 4RD7A 2KXLA 4HMZA 4ONUA 4JTNA 4HVOA 1O7FA 2WFPA 4UBHA 4BIFA 1ZZ6A 5BXXA 2ET7A 1NE4A 3CO2A 3FX3A 5I0SA 3RYRA 4FAHA 1CAWB 1DGRA 4HN1A 4IETA 3G7DA 4GULA 2O8QA 2IC1A 3NL1A 3CF6E 1EY2A 2XLAA 3RZZA 4OFGA 4YRDA 1O3RA 3I59B 3NW4A 2B9UA 2XHKA 2OYZA 1ZZ9A 2D93A 1GQHA 1ZRRA 2OA2A 5CU1A 2QJVA 3GYDA 3KMHA 4XFAA 4AVBA 2GC1A 4ZU5A 1YFWA 1TQ5A 1UD1A 5D1IA 3DL3A 2H6BA 4WVZA 1X7NA 1U12A 1XE7A 2FQPA 4LA2A 1UW8A 1UPIA 1YUDA 3MYXA 5JR7B 4Q0QA 4XEZA 3H1YA 2F4PA 2ZKLA 3OD0A 1OMIA 4F7ZA 4MZUA 1VJ2A 3M70A 4IESA 1QY4A 4JV4A 1CAWA 4XF4A 1ZRDA 2UY9A 4XETA 3IIAA 1SFNA 1UIJA 4XF3A 1ZRCA 3WW1A 2OPKA 3NJZA 2Y0OA 4Z07A 3RYPA 3C3VA 1DGWA 3I59A 4KU7A 2GC2A 4HBNA 1ZZBA 4HSJA 2GU9A 4XFHA 4AQ6A 2UYBA 2PAKA 3HT2A 4DINB 1CAXB 2BNOA 3BB6A 4BH9A 4EV0A 2PQQA 5LRSA 2I45A 3EBRA 2EVXA 3IDBB 1PMIA 4IEWA 5FLJA 5I0RA 1ZZ7A 2PFWA 3BU7A 2VPVA 2VECA 1RTVA 3E5QA 4MUVA 5FLIA 4PJYA 2XKPA 5T3NA 2CGPA 4X6QB 1UCXA 4XFIA 5LEJA 1DZRA 4LUKA 4UXAA 4HLTA 4XFGA 1ZX5A 4H7LA 4N9IA 4QM9A 3D0SA 1O3QA 2ATFA 2EAAA 4LEJA 5K8SA 1ZZ8A 3OF1A 1JUHA 4MGYE 2Q1ZB 3SCGA 2Q4SA 5I8SA 4OLLA 2Z2SB 2GH2A 5I8YA 3CJXA 2N7GA 4PIZA 4BHPA 3QACA 4IEVA 3WW4A 4HVRA 1EPZA 3UKNA 1J3PA 3KCCA 2BEOA 4KWKA 1CAUB 2XLFA 4I09A 4I0BA 1CAXA 5KHGA 3DV8A 1RC6A 1WGPA 1X8MA 2ET1A 3MZHA 4LUMA 4QGLA 5EZWA 1L3JA 4X6RB 5E1RA 1SQ4A 2Q0AA 2B5HA 4KU8A 1QXJA 3IDCB 2BYVE 3EHKA 4MV2A 5KHJA 1CAVB 5FPZA 3WW2A 3LA3A 3CEWA 2HKXA 1O5LA 3NSTA 1H1IA 5BUVA 1YFYA 5FCCA 3ZDSA 3RPQA 4B29A 2H6CA 2P17A 3EO6A 4JTOA 4CYDA 3ES1A 1VP6A 4FBFA 4AQ2A 1WLTA 2E9QA 1GQGA 3H8UA 4XFCA 4AVCA 4MGIE 2PHDA 3WW3A 1RUNA 1O3SA 2ZCWA 3BCWA 3ELNA 4YSFA 1CAUA 4I02A 3M3IA 1CGPA 2D40A 4IEXA 3ROUA 4L2NA 3OCPA 3NKTA 3BPZA 2D5HA 2MNGA 1J1LA 4A2UA 4E2GA 4WBBA 4META 4Q0UA 2GAUA 2WC2A 1IPJA 2Z69A 5EFUA 2GZWA 2GC0A 2PAMA 3UKTA 2QCSB 4XFBA 1CAVA 3JZVA 4I01A 2H0VA 3RYKA 2D5FA 3E5XA 3KGLA 4IEPA 2PYTA 1Q3EA 1Q43A 3CL1A 4EWDA 5JSRA 3E6CC 5KHIA 1FXZA 2FMYA 1YFXA 4HN0A 3E5UA 5KHKA 1X8EA 4QMAA 3EJKA 4AXOA 4LLOA
chains in the Genus database with same CATH superfamily
1D4M3 4MXWB 4YVSA 3SQOA 5L9BA 2R043 1NZCA 4KGQA 4QB1A 1W9FA 4LPLA 1HRV1 4OHVA 4FAGA 2ZMNA 3U37A 2DTYA 2XDVA 1W9YA 4YZ1A 1R1A1 1UY1A 4WM7A 5CYYA 1FT9A 1FMD2 3VBOA 2YFUA 3LEGA 5IJRA 1DU3D 2GMMA 5FPXA 1WA4A 1RYYA 2JIGA 2NZ9A 1NCQA 4CEYC 1YFUA 3QH6A 3OY8B 2ZBJA 1K5JA 1OOPA 1CZSA 3PVEA 4LOTA 3THDA 5IFTA 4IV1B 3O1OA 1VBD1 1QEXA 2BJSA 4R52A 3NAPB 2VNVA 4F8AA 4RS5C 4PCRA 2ZHLA 3H8OA 4LHKA 3I2FA 4Q4X1 2BGCA 3M1HA 3OUIA 1NUKA 5F2WA 4GH4C 5BV6A 5G05L 3T4HB 1ENSA 4EWEA 3L2YA 1POV0 2BU9A 2OQ6A 1GP5A 2VXRA 1UZWA 3LCPA 1WCQA 2DCZA 3U4XA 4L92A 2VMFA 1W0NA 4GB31 4JX0A 1OOPC 5LEKA 1ND2C 2HBUA 1H9WA 2WFF3 2AYHA 1I1EA 4CDWA 2VZOA 1ALYA 2ES3A 2ZAAA 3ZYGA 4LK7A 2C9AA 2WS91 2V09A 4FPHA 3WNOA 2XWJB 3GJAA 1PZ8A 2GSYA 3P3PA 5FYIA 1AR73 2WNUA 4ARXA 3B7MA 3CKHA 4MXWA 1HN0A 4N43C 2D6NA 4AFMA 4AG4A 1H0BA 1SLBA 1ZRFA 1RMU3 4HKLA 3MLJA 4K1ZA 4OMDA 3CIHA 3HR9A 2A3WA 1O4TA 2DF7A 3SH3A 4AVAA 2NMNA 4D7YA 3JCIA 2HEWF 4PQQA 2CHHA 1MPXA 4FPCA 4QQPA 2E32A 1NA1B 2Y6HA 4BYYA 4LO4B 3OY8A 1M06G 5GALA 1D2SA 1WBLA 3AB0A 2IXCA 4IV1A 2RG4A 4XPVA 5H9RA 5LRRA 2WWSA 1VR3A 1CVNA 3NAPA 2D6KA 3CNAA 4BMBA 4JAAA 3ACGA 1HJFA 3IMMA 5CEHA 2YBPA 1AL0G 4QKBA 1T2XA 4DRVA 3MHZA 4RR3C 1TE1B 2UURA 4OCTA 5EHDA 4NIAA 2I2SA 4AI3A 2PHUA 3RMYA 2DUQA 1D2QA 2F17A 4YW1A 1I6XA 1JMUB 3PUSA 2P37A 2WSVA 3BIWE 4K7JA 1GNYA 4P00B 2RDNA 4XUPA 3LB9A 1GOFA 5JIAA 1BEV3 5CKQA 4BA6A 3TYJA 2JD4A 1RUG1 4N90A 1TMF3 1LGNA 3B02A 3S7EA 4CDXB 1X82A 1W2OA 2VXJA 3JUUA 1MEC2 2XKOA 3PHMA 1XC6A 2IUWA 4Q27A 4TTGA 3LA2A 2RDRA 2BFUL 2J42A 1EV13 1WWYA 3FWEA 4QX5A 5DXDA 5AFEA 1YQ5A 1DZQA 3AK0A 1LHWA 3HT1A 3N7JA 3I3EA 3AJYA 5GZDA 5F7UA 4FOQA 1K3IA 1Y4WA 1ZBA2 3KQ4B 1MQTC 1H9PA 1NA1A 1WMEA 4BPZA 3WF2A 1R1A2 5BNOB 1B35C 3NJVA 1UY0A 1US3A 1APNA 1IQDC 4FFHA 3WR0A 3WT3A 1VBA3 1BZWA 2VOTA 1IG0A 2K9ZA 5EXOA 2G1MA 3HNBM 4QB6A 4AE2A 3SKVA 1J84A 3UKVA 3SXWA 3VDBA 1FI2A 4LTAA 3X29B 1HQWA 1VBE2 1ULOA 2RR13 3LEIA 1KS4A 5FZDA 4HETA 4L97A 3IPVB 2OXBA 5HCAA 1SLLA 3IAQA 1VIWB 2ZGNA 1PIV3 2B8MA 3J7LA 1KRIA 3TNQA 2HJIA 2RJ2A 4CDXA 2O8OA 4YW4A 2BDRA 4P9JA 4QB2A 4QQOA 5CKNA 3RFRA 5DDJ3 1COV2 1CIWA 2WNEA 4I2OA 3U75A 5H9SA 3RWNA 1LHUA 4P9LA 4BM8A 4MOAA 4PLMA 2JD9A 4IGQA 1VPHA 1W6OB 3VDCA 2E53A 3U10A 1SG3A 4QKFA 4Y5TA 1MS4A 1Y9QA 1UYYA 3QOPA 5FY0A 4UFJA 1N3PA 1DYOA 2JDMA 5DUXA 3THPA 4LNVA 2FBEA 4IEYA 1O8SA 4DS0A 1HB1A 2CAUA 3DPRB 4LXLA 1G7YA 1QJEA 4IEZA 3K46A 3LSEA 5BNOA 5JPMB 1W03A 5C8WA 3S0MA 4WVMB 5T52A 2K46A 4UFIA 4IEUA 1HB3A 4H7MA 2AR6A 3DXUA 3IT8A 3CHXA 1RUI3 2HWC3 1RUH1 3RNSA 4KBZA 1QQP3 3OBTA 1V6LA 3V56A 1SEFA 3IPVA 3DYOA 1W99A 2LW8A 3F95A 2WZR2 3S30A 2VOWA 3KM5A 4AHWA 4TXWA 4YVWB 2LALA 3U07A 4DPNA 3ON7A 2A5ZA 3ZXFA 5F37A 1OKQA 2R0FA 4QKNA 1UY3A 1TME1 4Z82A 3WG4A 3S5AA 1NY71 1XE8A 4AK3A 2G9FA 5FUNA 3ZYFA 1ZNPA 5C5TA 1W6OA 1RHI1 2DFBA 4D69A 3ZIXA 1JYXA 2QDRA 2R1DA 1MS9A 2V5DA 3MW3A 3KF5A 5A32B 5C5UA 1PMJX 1Y7BA 2QQKA 1HW5A 3FHIB 4QPWA 4OYUA 1RUJ1 5JXIA 5LY1A 5F3IA 1KFXL 3OGJA 4YPJA 3DPRA 1UKRA 1X36A 2KXLA 1MS0A 1VMFA 1SDDB 4ONUA 1PGL2 4JGYB 4WVMA 2WFPA 4S2FA 3LEKA 1S0GA 1F4AA 2JXAA 4BIFA 5IT6A 5GLZA 1QJX2 1HXS1 2SLIA 3DKQA 3CO2A 4XW3A 3PU8A 2IVIB 4UF0B 2QTWB 3VBHB 4AAPA 4FAHA 1CAWB 1C8M3 1PK6C 3M4FA 4HN1A 1IPSA 4JDNA 1N1SA 3JQXA 5LA2A 5IW0A 1AX1A 1QNYA 1ULEA 1UU6A 2IC1A 3MIEA 1E5RA 2JDZA 4YW7A 4EN7B 2ZZJA 3PIGA 4YVWA 2D6MA 3ZFEC 1VMHA 2R073 2CTVA 2TBVA 1R083 3WDUA 3VZOA 3NW4A 3IM0A 4LBQB 3ZKYA 1RUD2 2B9UA 2XHKA 1ZZ9A 2CWSA 1GQHA 1JS9A 3POWA 3N9QA 5HCFA 1PO12 3AMQA 3GYDA 3KMHA 4UFHA 3VD7A 1G9CA 3PUIA 2XBO2 3POGA 2FZ2A 1H8VA 2ZS6B 2E31A 3B01A 4COVA 5IK5A 5FYSA 3WY6A 4BWOA 3VD5A 5A32A 4Y1UA 1GZWB 1AF9A 1GFF2 4YVWC 1AYN1 2YBSA 3DXTA 4XDQA 3ZYHA 2V4AA 1N3OA 4Q1RA 1DYPA 1R091 4WVVA 1IS3A 1X7NA 2DUOA 4LA2A 4A41A 3B3QE 1UPIA 2BUKA 2IZWA 3FHAA 1D4VB 2BERA 5KC5A 1AL21 4JGYA 5KXBA 2JJ6A 4YW6A 3DF0A 1DQ4A 2ZX1A 4O7XA 5HCBA 4FTBA 2OUJA 1OMIA 4ISQA 2WZ8A 1Z0HA 1LULA 4LBOA 1VJ2A 2EF6A 2FD8A 2XOMA 5FMOS 2XJSA 3Q8BA 2Y6LA 2VW1A 3B94A 4A7YA 3UNPA 4B1MA 2FDKA 3OD4A 5B4NA 1S0DA 4LITA 3AL6A 4UF0A 3ASIA 3VBSC 3VBHA 4M01A 1CAWA 2I74A 2QZ2A 2VW0A 4NPLA 1GICA 2ORXA 2X8KA 3J26N 2EIEA 3IIAA 4NWVA 4XF3A 2QDNA 2VVEA 4UAPA 1ST8A 2PXJA 1LOAA 4JGYC 2OPKA 2JDYA 1RUH2 2VOVA 3B9CA 3R4UA 4PI2A 4Z07A 1OLQA 3C3VA 1VALA 2OUHA 2VOXA 1STMA 2BQPA 4LBQA 2DVDA 4KU7A 5A1FA 1ZZBA 2DWRA 2UWCA 2WL1A 3J8F2 3EB7A 1GLHA 4PDWB 2RMU2 4L9BA 3RI8A 2UYBA 1HRI2 1UU4A 1CAXB 3POJA 3MV01 3Q8FA 4OI2A 3A7QA 2I45A 2XJTA 3A22A 3MBWA 4XUTA 2P3KA 3RVHA 4BLIA 2NQYA 1TME2 1GZWA 3IDBB 1NCRB 1NY72 1QH7A 3TWIA 1FYUA 2WAOA 1RHI2 1AR62 4AVTA 2JE7A 3C8XA 1LU1A 5E88A 1XYOA 4MHRA 2VVFA 4CP0A 1VRBA 4CCEA 4XFIA 1F2NA 4QX3A 1RUJ2 4XFGA 4DXRA 2VUDA 4N9IA 5C9AB 2ATFA 4FPOB 4FVVA 2X53S 3BN6A 4XCBA 1Q8OA 1LJ7A 3HN1A 3MLLA 4IE0A 2W46A 4D0QA 2VBDA 2XR4A 2KM2A 1PVC2 5GM0A 3SCGA 3TBDA 5FZBA 3WVJA 1VBB3 1HXS2 2Z2SB 4H14A 3ZKUA 2GP5A 3JBG3 3K3NA 3CJXA 5FZEA 4AR2A 4K20A 2N7GA 5K0UB 2Y34A 1G9AA 1YQ8A 3K4DA 3IDEA 3T08A 3WNLA 5FO7B 2DBIA 1EPZA 2YPJA 3I2IA 4AGGA 2BTVC 3RSJA 4AVSA 1J3PA 1YIFA 4KWKA 1LAJA 4PDWA 4OUSA 3MF6A 5JMOA 1RIRA 1CAXA 5KHGA 3DV8A 3WCSA 1S2KA 1I5PA 1RUE1 1XXNA 1NAEA 5FY7A 2SBAA 3JD71 5LWBA 1DCSA 2D6PA 1NCRA 2ET1A 3HNMA 3PTRB 5AFBA 1HDKA 4K1YA 5E8AA 4BQWA 3W5NA 2MEV2 3GHNA 1CN1A 2P2KA 4SLIA 2VBBA 2WZEA 2C9KA 4YZ4A 3GHMA 4PBPA 5E1RA 4P9IA 4EN0A 3WDTA 4XUQA 1RUF3 3K51A 3AJZA 3IDCB 3VV1A 2VJXA 4OHXA 1V6KA 5A1AA 2W68A 1PVXA 2HYXA 2FCUA 1NG0A 1O8PA 5C9AA 1U5XA 3QCWA 4BQ2A 5FCCA 1CR7A 1AL22 3NV2A 4B29A 1J1TA 1RB8G 5FP4A 4NAMA 5FP8A 3HWJA 4CTEA 1CPNA 3ZXGA 2JE8A 4QPGB 4JDOA 3RJ2X 1UMZA 4FBFA 2D7FA 1WLTA 2E9QA 2EXHA 2CU5A 3VBRB 1TEIA 2ARXA 2RS12 5K0UA 4Q4W1 4N8MA 2RM22 5FJKA 1DYKA 3G6JB 3QH7A 3WOGA 4AVCA 1DFQA 1RINA 1IKQA 3TEZA 3UT0A 3ZSKA 5LW9A 2WQZC 3CJIC 1DLLA 2OW4A 2XQXA 4YSFA 1OQDA 2VMDA 4QX0A 2W2IA 3I3MA 4V2VA 2BBAA 3ROUA 3TN93 4NRMA 3ZYJB 3OCPA 5FY1A 1W8NA 1SDWA 3ECQA 4QD2A 3NKTA 2K2SA 1GOHA 1POV3 2Q8DA 1J1LA 3KCXA 3MF9A 3T0BA 2XB6C 2XJQA 3VKOA 4BDVB 1OQEA 4BJ0A 4ZXEA 4HONA 4PI0A 4WBBA 4D3WA 2WYFA 4META 2ZMKA 1SLIA 2A75A 2GAUA 3GJBA 2HWE3 5GLVA 3WUDA 4B7EA 3BOPA 2PAMA 5T5PA 1GSLA 4XAEA 4MVTA 4XFBA 2IFWA 2ZGUA 2HH9A 4BLJA 1W0PA 3H42B 3RYKA 4R9BA 3MUY1 4N53C 2AZ5A 3R4SA 2G9ZA 3VHPA 1FXZA 2NM1A 1VB4A 2E7AA 2FMYA 3DYMA 4CCJA 4HN0A 1VBC3 3K75B 5LY2A 4G3YC 4HPKB 2QQNA 4AXOA 3EJKA 4QPGA 4EN8B 5DPNA 3DCQA 4M3CE 5FZKA 4BIOA 5L7OB 2UWAA 1JH5A 4LLOA 3VBRA 1IZ3A 3ZMNA 2DUPA 2RS31 4FPYA 2C6SA 4FT8A 3ZN5A 3BVCA 3HQRA 4A3ZA 1LRHA 2IXLA 1UY2A 1HX6A 1T6BX 2P34A 5JUVA 2VZQA 4BZ4A 5A6QA 3WV6A 2Y6FA 1YLLA 4TLFA 3L2HA 2QKDA 1UZZA 1WZXA 4MGSA 2QBXA 2OVUA 3KS7A 5LK5A 1Q8VA 5FUPA 2CGOA 3TB0A 3CZUA 5JMCA 4M3CF 3O1TA 3H1WA 2PLV2 5FYBA 2WNVB 3O12A 2A6WA 1ZVFA 4GKYA 3MPBA 4YLZA 3OPZA 1ND3B 4CDQC 2ARAA 3E6DA 5FMCA 4IEOA 3OGGA 1LKNA 1WW7A 2PTMA 2QQVA 5IVBA 3N9MA 1N1VA 5M0TA 4LE3A 3BU0A 1WBFA 2BP6A 3J7NA 4Y4RA 4BQYA 3KD4A 5FZFA 4DY3A 4J1XA 1PO23 3EMRA 3KT4A 4HANA 5T5JA 1L7QA 3AXDA 3HAGA 2WWJA 3AKTA 3NNFA 4HPKA 1G6NA 5JI9A 1F5FA 3LF7A 3T2OA 4XF1A 5L7OA 4CXWA 3O14A 3A0KA 4WVWA 4YNIA 4QPIB 5E89A 4QXBA 3VKLA 1KS5A 4ZS2A 2PAEA 1ZA7A 2YROA 3H8RA 2AC1A 1EUUA 4GWJA 1O4ZA 3U1XA 1UOFA 5BPXA 2CV6A 3BIEA 1JI6A 3OB8A 4Q4W2 2HWF1 1BBT3 2CAVA 4CUCA 5L7OC 2WYSA 4AQSA 2PA7A 4ASKA 5CIRA 3HPNA 1D4M1 2G9GA 1U5ZA 3I3DA 5JCTA 2R041 4L11A 2WNVA 2AUYA 2ZEWA 4C1WA 3N9LA 5C8CC 2VQUA 2HWB3 3BOWA 3NQHA 4KBBA 4AGVA 5C70A 2E6VA 5B2GB 5F39A 1F35A 4EYUA 4KWLA 3PUQA 4NPRA 1FATA 4CEWC 4OI1A 1FOD3 1ND3A 3OTFA 3S7IA 3KB5A 3WZ1A 2YU1A 2XVKA 1NXMA 3IAPA 2IXIA 5DZEA 4CEYB 2OX0A 2ZAHA 1F15A 1QJY3 1D0GA 1OT5A 4QU2A 5FAXA 3AC0A 2UY8A 4AZZA 1Z78A 3AP4A 2AEYA 3GBFA 3P3NA 4NRQA 4XHXA 3OBAA 4HFSA 4DZGA 2A6VA 5T5LA 2W08A 4QXCA 5J48A 2Q8OA 5JLVA 4CPBA 3AP5A 4RS5B 3C7OA 3LQCA 4XJ9A 4XUOA 1FPN3 5C3QA 4QPIA 2A1XA 5B4XA 5D8AC 3ETQA 3H7YA 4GH4B 4NHYA 3EYPA 1V9U3 3N9OA 4LBMA 4RFT0 1H6YA 4BK5A 3N7KA 1H1AA 3C7GA 2XG3A 3ZO0B 2EICA 2P5BA 5IVFA 2WFF1 3O1MA 1RL3A 1SCRA 4Q4Y1 1ND2B 3VKNA 1JZ5A 3WINE 2RS32 3POYA 1AR93 1D7PM 5A3UA 1Q8QA 2PHFA 2FDHA 2YC0A 2ZEXA 2E33A 3BYWA 4QQHA 1ENQA 5FMBA 4P9WA 1Q8PA 1GMMA 3OPWA 3SHRA 1W8WA 2B42B 4A3XA 1JOPA 1AR71 1KGYA 1XU1A 4N43B 2BNMA 4IV3C 4JKKA 4BK4A 5BNNB 1RMU1 3AKPA 1XRUA 4MX3A 2C1FA 2QE3A 1W6QB 4COZA 1AVBA 1BVVA 1DIWA 1BKZA 2HLEA 3HIFA 4D94A 2Q1MA 1GP4A 5IVCA 3P1IA 3TRSB 5DMYA 3HQXA 3O1UA 3K2OA 3E6BA 3NNLA 4V2WA 4CEYA 1LTEA 3UL2A 2JICA 1YHFA 4FPLA 1WLDA 2C0ZA 3NVCA 3ZN4A 1AXKA 5EJZB 4K6BA 2E63A 2IXKA 1ZBE1 4MLOA 4GD4A 4RS5A 1XNBA 3WF1A 1OF4A 1BJQA 2E7QA 2XXZA 1BYHA 1AR82 4GH4A 5L73A 3ACLA 1K5MC 4P02B 3LIGA 4MHUA 2E26A 4RR3B 1UZVA 5KBFA 3FZ3A 2P1BA 3ZR6A 1IS4A 5FZ1A 3SEPA 3WDYA 3H1MA 1VAKA 3VD9A 1ND2A 1XSRA 2FHRA 3AM2A 1S2BA 4MSVA 1O3TA 2BGPA 3ILNA 3MIDA 5LZ6A 1BEV1 1KEXA 5FRAA 3LA7A 4BB3A 1TMF1 3LD8A 5IVYA 1RGSA 2BZDA 1YJLA 4EWAA 2PHXA 3P6BA 2RV9A 4QAWA 4N43A 5BNNA 3H3UA 2GMEA 2A71A 4KI5M 5CKMA 4P9XA 1J3QA 2HWF2 4NPMA 4XQWA 1VRH2 5CFCC 1W6QA 2ZX3A 4Y33A 4YYOA 1OPMA 3KSCA 3BI3A 5FOJB 2VAUA 1LHNA 1H30A 1QOTA 4LKFA 4YM2A 1FX5A 5CG9A 2JEMA 2IXJA 4L0PA 1W28A 2EXIA 3L9JT 3EQEA 3LIHA 1OKOA 4DY5A 4ATEA 1MQTB 1X9TA 1TZOA 4IQPA 3ACIA 4HSLA 1NYWA 4Y5Z0 5GZCA 3ILRA 2DCTA 2XJUA 5BNNC 5IK8A 4KMQA 1B35B 1RUC1 1XJAA 3BALA 4AEKA 1VBA1 2WR9A 2DCKA 4OZXA 4JHZA 4FPKA 4YZ2A 3LDKA 3VHOA 1J59A 3WP3A 1O59A 3M3QA 5FFOC 1OA2A 5FBJA 1I5ZA 4K3UA 2WABA 1W2AX 4RR3A 4UFKA 2RR11 1HJGA 1JOJA 2DU1A 2VE1A 3F2ZA 4JVAA 4LK6A 1S0JA 3BTXA 2ARBA 1V0AA 2TNFA 5A7OA 1FV3A 5FY4A 5JSOA 4EROA 1PIV1 3ZR5A 3VD4A 5ABJC 2WIIB 4CCDA 1BMV1 4MGZE 4XHBA 1YO8A 5HPOA 2X29A 1J58A 1TG7A 1VMJA 2WFF2 2VQAA 3NV4A 4Q4Y2 5DDJ1 3N4MA 1W2TA 3M7AA 1MEC3 1N47A 1O7FA 1ASJ1 4UBHA 2RDQA 4SBVA 5FOBB 2YY1A 4NIGA 3FN9A 1AR72 4NHLA 2HBTA 1S0BA 2V72A 2YB7A 1NKGA 1OLRA 1DLCA 2ET7A 5I0SA 4N7UA 1ZBA3 2A70A 1MQTA 2B39A 1K12A 4PHZA 5FKBA 4GULA 5CFDB 4AEJA 1B35A 3ZXDA 3O1VA 1R1A3 3NKGA 2R062 3ALQA 4IUGA 1JYCA 2P6HA 3CF6E 4UWDA 4EN6B 4KG8A 3BTAA 1YRZA 4GMP0 3I59B 4Y1YA 3SNMA 1RUI1 2D43A 3CMGA 3KWVA 2HWC1 2JDHA 4K9SA 2OYZA 4S2DA 2D93A 3DYPA 2PQSA 1FAYA 2OA2A 5CU1A 5IVVA 1QQP1 1HRV2 4UW5A 1ZBE2 2VBPA 2VZRA 4JQTA 3ZN6B 4W65A 3FBYA 1VBE3 4DNYA 1FV2A 1RVF1 1QXPA 3LDRA 4Z2WA 3BUCA 4YFZA 4XUNA 1YFWA 4Q2FA 5DUWA 1UD1A 2WA3A 3M8LA 1UXXX 4PLOA 4XCAA 5FXZA 2DVFA 1YJKA 4S2GA 4NHKA 5J1XA 2RHPA 2HEYF 2G19A 4NO4A 2DURA 1XE7A 1EAH1 1VBD2 2CWMA 5FZCA 5A3NA 1COV3 2ZKLA 1A8MA 5FZAA 5EIYB 1PM4A 1CQ9A 4CU9A 2YC4A 3LSDA 4Q4X2 3IB3A 3PVNA 4Y5SA 3M70A 5A6XA 5FYYA 1I9RA 1W04A 1QY4A 1QNWA 4BCUA 4AOCA 2Y6KA 1ZRDA 3HOBA 5JZGC 4GB32 2RJKA 3A4UA 5CFDA 3VBFC 3UGHA 3W9AA 3WW1A 2XUEA 4C90A 1QOSA 1XPWA 1REDA 1XQNA 4CU6A 2YUEA 3PURA 3SC7X 2WS92 4C8DA 1OA4A 3MW4A 3I59A 3JQWA 3OPTA 4LORA 2GU9A 3AFGA 1RUC2 4F83A 1WMFA 1Z7S1 1VBA2 3ZN6A 2PAKA 2R49A 1PK6B 1WW5A 3WQ0A 4EV0A 4TZDA 3U4SA 5CFDC 3I49A 5EWSA 4Q1PA 1V00A 1HV1A 5FZ0A 2Q8EA 5H9QA 3PUHA 2WZR3 2R071 3ZFEB 2RR12 1SMVA 3BU7A 2DU0A 1D0HA 2VPVA 2ZZQA 2VECA 5IK4A 4MUVA 2J1RA 3WP6A 3WD5A 1GZTA 3FFZA 4G4FA 4PJYA 2XKPA 2CGPA 1PIV2 1UCXA 5F5IA 1UOJA 5IVJA 3IIIA 4LUKA 2ZA9A 2XJPA 2C4XA 4NHXA 1W39A 2NYYA 1KJRA 1H6XA 2X05A 4IDZA 4QM9A 3D0SA 4W6WA 5LBEA 4D8MA 5FZ7A 4BMEA 5DZFA 5K8SA 2BVVA 1ENXA 1ZZ8A 2R6QA 4E8CA 3KHCA 1YCIA 4XTMA 3ZXEA 3RZMA 1ASJ2 1W2NA 4YGBA 1SBEA 4V1PA 4Q8KA 2KA3A 2WQ4A 4OLLA 1LHOA 3LFIA 1W8HA 2VCMA 4BQ3A 5J37A 4J25A 5I8YA 3V0AB 1E5HA 1WCSA 1XU2A 2EXKA 5LBBA 2J1UA 4PIZA 3R05A 3QACA 4IEVA 4XABA 1RUG2 3WNPA 2FZ1A 1IHMA 2VW2A 4ES9A 2Z4FA 3UKNA 1OH4A 3KCCA 1QJX3 1NOVA 1R1ZA 5KR7A 1XBFA 4A6SA 5FP9A 2RVAA 1KXGA 3R4DB 5DN2A 3VBSB 4I09A 3ZPOA 4RYDA 5L19A 2B4KA 1PK6A 2ZHNA 4I0BA 2VL4A 5FR3A 4TN7A 3GBGA 5FJHA 1WMDA 3VB9A 3RZHA 4E27A 1RUI2 1WGPA 2DVBA 2PHWA 4P14A 4AEDC 3GZUC 4LKEA 4QGLA 4A45A 1AZDA 4IE4A 3ZFEA 1AX2A 5FTTC 2WLPA 2QZ3A 1SQ4A 3TAYA 2Q0AA 1RVF2 3CZJA 3LE0A 4JHTA 4ZS3A 4OHZA 4KU8A 2EIBA 4DRRA 2WKKA 3RZLA 2YU2A 3KCYA 1RUD3 3EHKA 3WCRA 3LA3A 2JDPA 1O5LA 1DP0A 4BXSV 3NSTA 5CAZA 1PO13 2WDBA 1C1FA 3D5OA 3UYJA 3ZYPA 3ZVXA 1EAH2 1G86A 2XBO3 3ZDSA 1I3HA 1JZ2A 2P17A 3ACHA 2Y33A 4OUEA 4CCLA 3GZAA 3Q9OA 1GUIA 3VBUC 5FREA 1JYVA 3V0AA 2ENRA 4AI8A 2ZHMA 2ZPXA 4QT6A 5A3PA 1GQGA 4XDOA 1PGW1 1UY4A 3H8UA 4AFAA 4RGGA 2ZGMA 1NZIA 5J09A 3C2UA 4WV8A 2HEVF 1OC1A 4MGIE 4G9SB 4DFSA 2ORZA 1YNAA 3WW3A 1RUNA 3MEPA 1H4HA 1JZ7A 5FWEA 2GN3A 4I02A 4TWTA 5APAA 3VBSA 2ZGRA 4FTEA 2DCYA 1VBB1 4NIIA 3VZLA 1KQRA 3JBG1 2D5HA 2VZVA 4YG6A 3AMPA 4LLFA 1W9WA 2WBKA 4RN5A 4A2UA 4E4DX 1Z7S2 4AEMA 1E5SA 3LOBA 1RUH3 1V6JA 2W1QA 2C26A 2Z5WA 1IPJA 1NLRA 1S0EA 1DF0A 2VUCA 1QDOA 2GC0A 1T6GC 3K4ZA 4FFFA 4QX8A 1XNAA 4EE2A 3J8F3 2RMU3 3MFCA 1LEDA 1HRI3 5KXCA 2G4IA 2D5FA 1NT0A 3KGLA 5SV8A 3E6CC 1Q3EA 3MGUA 1J83A 3VZMA 4ZKTB 1BK1A 5FYZA 5KHIA 2TUNA 4RQPC 1S4CA 4GAZA 3PJQA 1UOGA 3MO4A 1GZCA 3E5UA 3B9IA 1PNGA 3OUJA 4QMAA 5A3WA 2RE9A 2YGMA 2ZGTA 4QHBA 1YI9A 1RHI3 1AR63 2A7AA 2PHRA 2WNUB 1MS5A 4MXVA 1EYBA 3JB8A 3WQBA 1PX3A 4KH9A 3QLQA 1QDCA 2YPDA 1QJFA 1OF3A 3ZLIA 3J7MA 1ENRA 1W9SA 2GH8A 1GWMA 1RUJ3 1RXGA 4M3CB 5KHHA 3SH4A 4Y1VA 4MH0E 3D8CA 4Q0SA 4OZOA 1F4HA 5F5QA 5FZMA 4O61A 1YEWA 4XZUG 2B46X 4JDMA 1PVC3 4K8RB 3ZDVA 4D6QA 1MZ5A 1UU5A 1WCDJ 2JG9B 1HXS3 3N7MA 3WF4A 3ENRA 5C3PA 1LGCA 1IPKA 4LO8A 3H50A 4YGCA 1ZZCA 4CP9B 1L7RA 1UO9A 2W9XA 2V5YA 1MR5A 4QDQA 2K0GA 1C28A 3KT7A 2VMEA 3ZXJA 3T30A 2WO7A 3PL0A 3CJIB 5CVRA 3O5SA 3M3EA 4URTA 3TN91 4CCKA 1DDLA 3N3HA 2JKXA 4NVPA 1CIYA 1GKBA 2ZJCA 1W8FA 5F6LB 1LOFC 3H3ZA 3T3YA 4A44A 5DUVA 3ITQA 2J1VA 4ZZ8A 3ME2A 5IK7A 4EZHA 1UF2C 1DHKB 3ES4A 2P4EA 4E2SA 5DZGA 4OUMA 2MEV3 3MW2A 3VL8A 3UK9A 2ILMA 1YXWA 4KL1A 4W4ZA 2R32A 1OURA 4FSJA 1QH6A 3MI8A 4PQ9A 4M3CA 2VD7A 4JC1A 4FP3A 4Z2AA 3GGLA 4MGTA 2HWD1 4N53B 1REEA 2ADDA 4FQZA 4LO5B 5FPBA 5FMOL 3VUOA 1PGW2 4ITCA 2XJRA 1Y3TA 1OLME 1AL23 1U0AA 3KV5A 3M2MA 5I8TA 4RGAA 2JG9A 1G9BA 3Q8EA 1N1YA 2Y64A 3PNAA 1OFNA 2NMOA 3OOXA 1AYN2 1BXHA 3USSA 4CP9A 4B1LA 3RWKX 2RS13 1J3RA 1R092 2GNBA 2D98A 1UOBA 4IEQA 2RM23 3POFA 4AHXA 5A6YA 4QX7A 4QWNA 3J9SA 4XF9A 1REFA 3AP6A 1HKDA 2ID4A 3CJIA 4A6OA 3HJRA 1MS3A 3PUAA 5FK7A 4XOGA 4BQXA 5I93A 3UESA 3NRUA 2YYOA 1KDKA 4BU2A 4COUA 3AYAA 3ZYRA 2JG9C 2WT0A 3AVRA 3ZSEA 2R30A 4GMP1 3MZHA 1BQPA 4QKDA 1GYKA 3DN7A 1WLWA 2MHFA 3UGGA 4DUXA 4CXYA 5BY5A 1RITA 4MADA 4NWWA 1FNZA 1OH3A 4CA9A 1JTZX 1OI6A 1UIKA 2QQMA 4W8JA 2Y6GA 4CDQB 3GM8A 3SITA 4NROA 4AQTA 2ZXQA 5FO9B 2X5IB 3H7JA 4INDA 1UNBA 3R6SA 4QHZA 1SPPB 5FP7A 2A6ZA 2NPIA 1SFPA 4HL0A 1NXD1 1PO21 2CNAA 4N53A 1A3KA 5AC91 2QQPA 3D0JA 4XDPA 1IOAA 2EA7A 1JODA 5FYHA 1QXRA 1JXNA 4XILA 4QXKA 1V6NA 2BV4A 3POSA 1IGOA 1W8TA 2RS53 3FLRA 3PMEA 4ZU4A 4Q0PA 2W47A 4O9EA 4LO6B 4UT5A 3IKWA 4IW3A 5I0UA 5K4LA 3ZYIB 4GIQA 3A23A 4ZZ5A 4JRLA 3MPPG 5J3UA 2WNOA 3WHUA 4Q4V1 1OA3A 1BBT1 1WCUA 1CWPA 2ADEA 4ORFA 1BCXA 1M4WA 4PLNA 4H2AA 4R8HA 5CADA 2W92A 4E4SA 5A7NA 2EIGA 2FCVA 3RI9A 4FPEA 2HWB1 4QGNA 2YV8A 5C8CB 3VDDB 2PLV3 4Y3OA 3AL5A 5FYCA 2ZGLA 2Q8CA 3TEWA 1PMHX 4CEWB 3B93A 2W52A 5HI0A 4QDRA 2WO3A 1H1MA 3VL9A 3WHTA 4CDQA 1A34A 3THTA 4LT5A 1C57A 4NAOA 3VDAA 3AZZA 3OBZA 2X5IA 4XVHA 3SH5A 2ZKNA 5FWJA 5A7QA 4P5YA 3DKWA 1SPPA 4CCMA 1OUSA 1QJY1 2YDEA 5JOYA 3BKZA 2DDUA 3KV4A 4E2QA 3AMMA 4Y26A 1W2UA 2W95A 1YI7A 2OIIA 1ODMA 1CESA 1QJU1 1RJ8A 2Q30A 2ZEZA 1E57A 1RUE2 4LKSA 4DXZA 5KC6A 1FPN1 1UXZA 3FJSA 3JD72 3NWKA 4ISRA 2HWD2 2ARCA 5T54A 5D8AB 2XLGA 4QM8A 2X5IC 1JZ3A 1UPSA 2BWAA 4K21A 2GNMA 5DABA 3WNMA 1UL9A 3H9AA 5ACA1 4FQ4A 5CA6A 1QHDA 4CDUC 3K48A 1Y9MA 4XJZA 2OZ6A 3ZIWA 1AR91 1LR5A 3B5LB 4DUVA 4Q26A 4HXCA 4XJAA 5SV5A 2BW8A 3RZJA 4KWUA 1UMHA 4Q4W3 3RZGA 3T1MA 1TVGA 4DIQA 3RMXA 1UYPA 4L8QA 5GZEA 2VR4A 3FUQA 5FZ9A 1WCKA 4NIDA 3N36A 1NE6A 5I0TA 1OQ1A 5IUQA 4IV3B 4JZRA 1LENA 4CSWA 5C8CA 3SCHA 3VDDA 5F1RA 1QF3A 3LPGA 3VN4A 5DAVA 1Q5OA 5DG1A 4GWMA 1JYWA 1KDMA 2CY6A 4CEWA 4CXXA 2VGDA 2KD7A 4RHV3 4QQ2A 1AYM1 5F5AA 2XUMA 1GP6A 5JOWA 3FC0A 4D6RA 4WZCA 5FLHA 3RRDA 1YWKA 2WLQA 2PELA 4YM0A 4XYXA 1PM7A 3WNXA 4NRPA 3B00A 4E4ZA 5LBCA 1GNZA 1QOOA 1GBGA 3C7HA 5FDBA 5LA0A 1EP0A 5E16A 3VDDC 2W1WA 1PX4A 1LCLA 1VLNA 2QQWA 4IL7A 3E1F1 4QX1A 5FZGA 2D3PA 5JAXA 2BOIA 1AJKA 2J1TA 5JVVA 2E51A 4XXAA 4ET7A 1QU0A 3ORJA 5IATA 1UZ0A 3ZFFC 1PO22 3APBA 5AC92 5D8AA 1W8ZA 1GWKA 4KNCA 3FBMA 3SKJE 3ZFGC 4R4ZA 1X9PA 1MS8A 2JB4A 3AKRA 1CZTA 1K5MB 1UX6A 4HVOA 4JTNA 1ONAA 4Y1ZA 4UW3A 4NN0A 3I2GA 4DEVA 1OUXA 3HN3A 2D6OX 2LROA 1G9DA 4ZY9A 3AMNA 1BLZA 3O0WA 5IFPA 1ZZ6A 5BXXA 1NE4A 4GZ9A 4RFRB 1LU2A 2RS33 3FX3A 4NUBA 3UJQA 1PNFA 4EQVA 2D6LX 4FOVA 4IETA 3G7DA 4QXHA 4C1XA 3OG2A 2VQ0A 3AX4A 2VNRA 2O8QA 2DVGA 5JXHA 1WMXA 2XMLA 4IV3A 3ZOIA 2BRTA 2OT7A 2XJVA 1JUIA 1F5JA 4Q4V2 4DQAA 4P08A 5CFCB 2Q5TA 1EY2A 2XLAA 3WDXA 3RZZA 2A3YA 4YRDA 1O3RA 4AYUA 2A6XA 3BTZA 2PN5A 4MO3M 4LBNA 3O1PA 4ZHNA 5FV3A 4JKLA 3MV11 3PTYA 1PHMA 1V6MA 3DEMA 3MFAA 4WM8B 3WUCA 2Y38A 4BE3A 2YBKA 2RJLA 1W8UA 4AVBA 4CE8A 3W5MA 4ZU5A 4LR4A 1TQ5A 3T2QA 5FYMA 5FPLA 1H2KA 2ZTNA 2XHNA 3GZEA 1N1TA 1LESA 1EPWA 1U12A 1GQPA 1DG6A 2JB8A 2WRAA 1KFUL 3OSDA 1UW8A 2WT2A 1W0OA 3MYXA 3NJXA 4Q8LA 5FZHA 5C4WC 5E6HA 3T0DA 4Q0QA 1FMD3 3POEA 1K5MA 1AR83 2DVAA 1JHJA 1QJU2 2B7YA 3WDWA 3VLBB 5A3OA 4JGZB 1NQDA 4IESA 3ZSMA 2WO2A 3I4IA 5FO8B 4JV4A 1LOCA 3I97A 5ABJB 1S1AA 2LTNA 4JQRA 1XYPA 5ACA2 5HCHA 2UY9A 1OHFA 2HYKA 4YM3A 1OVPA 4DO0A 1SFNA 1UIJA 4YWAA 1ZRCA 4GJYA 4ES8A 4LJHA 3KVAA 2W0XA 3P5BA 1MEC1 3OBRA 5DAWA 3NJZA 4X8PA 4R4XA 4COWA 5CFCA 4GXLA 1KITA 1QJZA 1DGWA 1VRH3 5CZKA 1LOBA 4YZ5A 3I2OA 2GN7A 3D6EA 2Q1FA 2VH9A 1GR3A 4M4RA 1OXCA 4XFHA 5FY9A 1ZBA1 3HT2A 4WM8A 4Q5OA 3ZXKA 2W5FA 3WX5A 2JG8C 3EBRA 2EVXA 4GJZA 4NJ4A 3GBWA 1AYM2 3IZOA 4OHYA 2X09A 3D4KA 4IGPA 4IEWA 5FK8A 4QX2A 1EV11 1ZM1A 5FYUA 5FLJA 5KWRA 2PFWA 4FFGA 4UW4A 3O1SA 1RTVA 1D4M2 1WKYA 2DCJA 2VOKA 3V64A 3M3OA 4RSUA 3AZWA 5GZFA 2R042 3INAA 4JCKA 4YVSC 5F32A 2BFUS 4RGKA 5LEJA 1DZRA 4UXAA 3S6PA 1VB2A 4WM8C 4HLTA 1W3VA 1X50A 3ZPYA 1VBE1 1YYNA 4YG3A 2FDIA 3HNYM 5C3RA 4JGZA 1JW6A 1CX1A 4WM7C 3VBOC 3OF1A 4XBQA 2F4LA 4GWNA 2VMCA 4Y22B 4HOOA 5ABJA 2OKXA 1YQCA 2A6YA 4MGYE 2VMGA 1W05A 3O0XA 3PIJA 4ZPIA 4A4AA 5I8SA 1NCQC 5JWPA 2JX9A 2OQ7A 3WEZA 2GH2A 3PDQA 2ZOEB 5LASA 1H2LA 2WQ8A 4DOUA 3SISA 1SLTA 1COV1 1KD7A 1U5YA 4LBJA 4Q4Y3 2X10A 4HKWA 4BHPA 1V6IA 3KT1A 3NO8A 4M00A 3WW4A 2VUJA 4Y20B 4HVRA 4PBOA 5A80A 4RA0A 2VZTA 3OGSA 4JGZC 4KQ7A 2BEOA 1YQ6A 3T2PA 1CAUB 2XLFA 5ANQA 1SBDA 1ZA4A 4AI9A 4HKOA 4Y24A 4WZFA 1W06A 4C0HA 1UAIA 5JZGB 2FDFA 3VBFB 1X8MA 4CDWC 5A7SA 1XNKA 2WUHA 3AYEA 5EZWA 1OPOA 1L3JA 2ZX0A 4X6RB 5F5CA 2R7EB 3HBKA 3WF0A 5IHRA 4CCOA 2R063 2VNGA 2WNUC 5LATA 3HQUA 4LMFA 1QXJA 3MIHA 2BYVE 1RMU2 5K9YA 5KHJA 5J36A 1AUYA 1CAVB 5FPZA 3WW2A 2HKXA 3I3BA 1VAVA 1QGLA 1HRV3 3WSOA 4URAA 1ZBE3 5JI7A 5J96B 4P5HA 1MZEA 1XE0A 5LB6A 2Z79A 2VTFA 3RPQA 1O91A 2WZR1 1ULCA 3CQOA 4Y22A 4BXFA 3EO6A 2YMZA 4JTOA 4CYDA 1JZ6A 4XIKA 1C4RA 3NV1A 3FLTA 4B4PA 2VULA 4XTPA 1MS1A 1VP6A 2PMWB 4AI0A 4IV1C 2DTWA 2DFCA 2WN2A 4E8DA 2D97A 1VBD3 3NNMA 4Y20A 3NAPC 2XONA 4XURA 1JU4A 2QUOA 4EJRA 5IAXA 2LRPA 3J4UH 4FOWA 4LOSA 1OD3A 1URXA 4DUWA 3BCWA 1O3SA 2VUAA 2YC2A 4Q4X3 1R64A 4YW3A 1CAUA 1GV9A 1JU3A 3WNKA 3AZYA 1W6PB 4YGDA 1QKQA 5FYTA 3VHNA 5KXDA 1SFYA 5JZGA 2EIDA 3WQ1A 5EYYA 4ZXKA 1G8WA 2WA4A 4UFMA 5FBZA 3BPZA 4GB33 4YGEA 3VBFA 1YC61 4CRQA 1BEV2 4MYEA 1CONA 1LEMA 2BOJA 1TMF2 1PGL1 3FHQA 2AREA 1WW6A 2UU8A 3EXUA 2WS93 3BTYA 2P3YA 2WC2A 2VVDA 3T2TA 1QJX1 2NLRA 2Z69A 4TLGA 4ASMB 3VD3A 4A7KA 5ISLA 5TSWA 2J7MA 3UKTA 2QCSB 1NQJA 1EV12 1CAVA 2B9VA 3NMBA 3JZVA 4AAXA 5GZGA 1RUC3 5L9RA 4CCNA 1C3HA 4XQ4A 2JDAA 1XNCA 2ZGQA 4I01A 2VZSA 2H0VA 3E5XA 4IEPA 3RJRA 1A8DA 2PYTA 2ZGOA 4GKXA 5IWFA 5J98B 4AEDB 4EWDA 2IVJA 5JSRA 2VU9A 5HV4A 4AHZA 2QQJA 4NE9A 4O65A 3GCXA 3SEEA 1X8EA 1NA1C 2YGLA 3OJBA 4FO9A 4X8NA 3RGBA 5FXVA 5D2AA 1MVEA 2KR2A 2O0OA 1HV0A 3J7HA 1RUD1 3AP7A 4U2AA 5JXJA 1JYNA 5ERLA 1C8M1 3WP4A 5EYXA 1PO11 1F9KA 2WWUA 3U0ZA 4LE4A 4D6SA 2XBO1 4ARYA 1AJOA 3N35A 4YG0A 1BHGA 3N9PA 5EPAA 2Y8KA 5EQUA 1W6PA 5J7MA 3WXPA 1R081 4FOYA 2XL7A 3IBMA 1BVP1 5I0DA 1TNFA 2CDPA 1ASJ3 2O1QA 2Y26A 2VZUA 3OGVA 1JN2P 4J1WA 4QGMA 5T50A 2GMPA 3VBUB 3VZNA 4CZSA 1C1LA 3H3LA 2JECA 2VZ1A 3SMHA 4D7SA 1BMV2 3AFKA 2Z42A 4NMIA 4E4HA 4L99A 1AX0A 1GOGA 2XVLA 2W91A 3I8TA 3HD8B 3Q8AA 4UFLA 1UYXA 2QQLA 2XWBB 5FZOB 1RUG3 3W59A 5DDJ2 4CDXC 5IVEA 4GWIA 2PHLA 1W6MB 4XMIA 5FZ3A 5HXVA 5HBAA 1PZ7A 5FIXA 2JE9A 1JBCA 3ACFA 3B69A 5FMDA 2ZGPA 4FXKB 3IN9A 1G9FA 1IKPA 4Z1VA 3TNPB 5JSPA 3PVBB 4AEDA 2R1BA 2GDFA 3CBNA 5BNPB 1F8VA 4QQLA 1AHSA 3IMNA 2OS2A 3WLUA 3AZVA 5T55A 2C24A 1U5IA 2J1SA 4MG2A 1A78A 1AXYA 1DZTA 2C5DA 5CISA 1S0FA 3H8XA 1SBFA 1VE0A 2CL2A 3KVBA 4QPYA 3TEYA 3MIBA 4HK8A 4NHMA 5BNOC 1RVF3 2AGSA 1CJPA 5C33A 4Q0VA 3J8F1 2JDNA 1EUTA 3MUZ1 2VCBA 1AXZA 2RMU1 4HK9A 1F31A 1YIPA 4I3PA 4IE5A 1HRI1 4OI0A 3AYDA 1XSQA 3DUIA 3RQ0A 1S2EA 2HWC2 1LECA 3QBQA 4LULA 3KV6A 2GALA 4FCAA 4LBKA 1EAH3 4RQPB 1QQP2 3FUOA 3M3CA 4I0WB 5JOXA 4MGKE 4XQDA 3VBUA 1AR61 2ZEYA 4N9HA 4C0BA 1O4YA 3BPSA 5CNAA 4Q29A 4IERA 3PJYA 3PVOA 3AKQA 4M0NA 3UETA 5FZOA 4B7KA 5IYYA 4YFWA 2YFZA 1W6MA 1W8OA 4M0HA 5FZLA 4HVQA 3T0AA 2FCTA 3KHBA 5G04L 4U36A 4YW2A 1H2MA 1LGBA 3LOIA 3I54A 1H4GA 4I0AA 4PT6A 4BISA 3ZXAC 5JDBA 3U14A 5H9PA 1PVC1 2W39A 4PF5A 4XJUA 2BNNA 4OHWA 4AI2A 4PIYA 5FYVA 5BNPA 2Y60A 4B4RA 1JZ4A 4Z8BA 1HN1A 2W1UA 2QFEA 5JOZA 2OPWA 1Z7S3 4I30A 1OD5A 4ATFA 5DAPA 3DPRC 3LAGA 3VHRA 4XXPA 3RZKA 3I7DA 5CG8A 2UYAA 1NLQA 4XJWA 1K42A 1JZ8A 3AP9A 1CZVA 2OZJA 4GA9A 2QVSB 4AL9A 5JPNB 3W20A 3S57A 1DQ0A 5BNPC 1SLCA 3D3AA 1W90A 4R9CA 1HLCA 4OVEA 4PIXA 3HEIA 2JIJA 4RQPA 3ST7A 1C8M2 4HZFA 5C6CA 4H55A 2GC3A 4XZPA 2MEV1 2FDJA 2XL9A 3ETPA 4F3JA 2VCCA 3ATGA 4FXGB 1OLMA 4CUBA 2F6BA 2R072 5AVPA 4W6XA 1MVQA 1R082 4COYA 3U11A 4DMIA 1MACA 5FPAA 1HB4A 5GJ6A 1OFSA 3I3QA 3LKJA 2AH2A 4O9GA 2NN8A 2ERFA 2CYFA 1NX9A 1TME3 5DUUA 2VC9A 2ZX4A 5GLUA 2A73B 2WZPP 4PF1A 2DYCA 2D3RA 4BQ4A 1RUF1 3VZJA 4GQ7A 5FXXA 4XE9A 4A42A 4CP1A 3CLPA 1LOEA 3LZZA 2RS11 3D82A 2VTXJ 3PLQA 2RM21 1UWWA 3N7LA 4HT1T 2YG0A 1O5UA 4E9KA 1XNDA 1W6NB 5FQ0B 3SCFA 3T1LA 2AEZA 3PU3A 3BODA 3KQRA 4LBLA 2IXHA 5EV7A 2WJSA 4KWJA 3JXSA 4YARA 2CDOA 2QNKA 5EJ1B 3RS6A 1KJLA 5K7PA 2QQIA 3AKSA 2AENA 1ZYBA 4LA3A 3RDIA 1LOFA 3GF6A 1Y43B 2XGXA 5F3GA 1CX4A 1US2A 5FZ6A 1OBNA 2P3JA 3VBHC 1XB9A 1QWRA 2O14A 3POBA 3KV9A 3VZKA 4IGOA 1JYIA 4ZU7A 3DGTA 2H0BA 2JDUA 3AXEA 4K8FA 5LCWL 4FTSA 3IWZA 3V0BB 1RUOA 1CD3G 5JXGA 2ETEA 3FFQA 1BK0A 4FFIA 1Q56A 2MPFA 3UV9A 1ZREA 5I91A 4D7TA 3N9NA 2V4VA 1POV1 4R9AA 3ZYBA 3E97A 3VGIA 5A6ZA 4CU8A 1GU3A 4LBQD 4EN9B 5EJ3A 1SLAA 5FUIA 2J1EA 4XFFA 2HWE1 1UN1A 2VG9A 2NP0A 1HB2A 2RS51 3NJYA 3ZXLA 3MDPA 1V6OA 2ZACA 3GDBA 1V70A 3MICA 4P9GA 2EAKA 1AYN3 3FE5A 5GLTA 4UBGA 1R093 2Y0IA 3V65A 2VTXA 2FMDA 2GP3A 2ZX2A 1W6NA 1OVSA 5FPVA 5FQ0A 3OUHA 3UJOA 3LWCA 5A3TA 2D3SA 1VBC1 2I07B 3I2HA 2VQTA 1IQAA 3GNEA 4R9DA 4KG0A 3KGZA 4AFCA 2WN3A 4NR1A 5FY8A 1VAMA 1UQXA 2V73A 3TEXA 1L7LA 4NOTA 2BWCA 2AACA 2PLV1 1RJ7A 1PGSA 2YZ4A 3JB4C 4N7IA 1VBB2 4XF0A 2R16A 1LB2A 3JBG2 5F9TA 4XIOA 4M4PA 3V0BA 4RD7A 4CCCA 1DBNA 1GZ9A 3I2JA 4GALA 2J1AA 4HMZA 5FZ8A 3USUB 1K45A 1RXFA 1SZBA 2JENA 4MGQA 3T09A 3FLPA 3R0RA 3T4VA 5IAVA 3LDBA 4LHNA 1H8TB 2J22A 2VY0A 4PDWC 1ULDA 1MZ6A 1S0IA 1H2NA 2P3IA 2XVGA 5FY5A 1DGRA 3RYRA 4AVVA 4A7ZA 2ZABA 3VKFC 4RL7A 3ZSLA 3KLSA 1XOYA 1NCRC 2CGNA 1UX7A 3NL1A 2VO5A 4W6YA 5C7GA 1W9TA 1CJDA 3QD6A 1RUF2 4OFGA 4KGGA 1O6UA 2ZGSA 3AYCA 4OMCA 4CDUB 2QQUA 1WA6X 1ZRRA 5F3EA 1UKGA 5FPUA 2QJVA 4OQ8A 3GXUA 5C3OA 4XFAA 5C9AC 2WO1A 4DB5A 2GC1A 3ZMOA 1WW4A 1ULGA 1LOGA 3ILFA 3POIA 5D1IA 3TOJA 3NNGA 2RDSA 3DL3A 4S2HA 2H6BA 4WVZA 2W3JA 4FPGA 1LNSA 3FMGA 4I3GA 3WG2A 2FQPA 3AZXA 4RHV1 3OYWB 1YUDA 4XACA 1HIXA 5FKCA 5JR7B 5LA1A 2BBVA 5C71A 5K0UC 5L36A 1DQ2A 4XEZA 3USUA 3H1YA 2F4PA 1POQA 4B8EA 2W94A 3O0VA 3OD0A 2P6CA 4F7ZA 4AI1A 4MZUA 3OEBA 1ODNA 1UMIA 3CU7A 3LFMA 4LQRA 5FZIA 5CBLA 1H8TA 2GNDA 4BOWA 1DQ6A 1OSGA 3TN92 1CPMA 1YQ2A 3LEMA 4XF4A 4AFBA 1S0CA 1FOD1 1GANA 4XETA 3WDVA 1RUE3 1C5IA 3DECA 3BGAA 3ZFFB 1LHVA 3JD73 2WSUA 3HVDA 2HWD3 2ZGKA 1ACCA 3ZFGB 2Y0OA 4AGRA 5GKAC 2VM9A 4XMAA 3RYPA 5F3CA 2HWE2 3A21A 4CDUA 2IFRA 3WG1A 1IS6A 1H8TC 2RS52 2GC2A 4HBNA 2JKBA 4HSJA 5A7PA 3SLIA 1X33A 3O7OA 1SCSA 4CU7A 1C5HA 4AQ6A 4QHOA 4BQ1A 3Q8CA 4FI9A 4DINB 4BH9A 2BNOA 3BB6A 4XAAA 2PQQA 5LRSA 2D44A 3UGFA 3AMHA 1SHWB 5A7WB 1PMIA 1V9U1 5A3MA 1VBC2 3WQ7A 4HG6B 4OI4A 4CUAA 4CVUA 2YXSA 1GNHA 2WAAA 4W50A 4XC9A 3OEAA 2XQRA 5I0RA 1ZZ7A 3W58A 2R0HA 4LKDA 5F2SA 4QPGC 4OULA 3ZM8A 1JYTA 5BNQA 3E5QA 2YHJA 5CB7A 2GNTA 3OYWA 1NLSA 5FLIA 2BVBA 1XYNA 3VBRC 1W3XA 4ASLA 5T3NA 4GMP3 4X6QB 3LPFA 1E5IA 2EALA 5ANNA 2W87A 5AVAA 4XBLA 5C3SA 1ZX5A 4H7LA 2XPJA 3GALA 2QQOA 3MLKA 2IWGB 1O3QA 2EAAA 4LEJA 4UOJA 2VMIA 4JKMA 3ZX7A 1IG3A 5LK7B 4Y4YA 3I2KA 3ZSJA 1JUHA 2Q1ZB 3PMSA 2Q4SA 2LM3A 2WT1A 2PHTA 4H3WA 2VCAA 4FP2A 2A3XA 5FZ4A 3ZFFA 5C4WB 2LUWA 2DBNA 3IDAA 1FMD1 3WP5A 1AR81 3C7EA 3ZFGA 5AC93 1WD4A 1Y9GA 3WF3A 4AF9A 4FPJA 4C91A 5LBFA 1QIQA 4CUGA 1QMJA 3GCWA 5BYNA 2JWPA 4NIHA 1IS5A 5KXEA 2EXJA 1TNRA 1ULFA 3I2DA 1JOBA 3THCA 3JU9A 3KZ4C 2DV9A 1A6CA 4QU1A 4Y1XA 4DEQA 5A33B 5A70A 4UI9L 3H0OA 4AW7A 1RC6A 5FP3A 5A7WA 2BPA2 2JDKA 4B4QA 4LUMA 1P8JA 3K4AA 4J6GA 3GZTB 3W21A 1B09A 4Q4V3 2ZHKA 1VRH1 3K3OA 2B5HA 4K40A 1WLCA 3U78A 2VMHA 2XH6A 3KF3A 2ZMLA 4TSVA 1MZFA 4P9YA 5GLWA 5HV0A 4B3NA 3MIGA 4MV2A 4AWDA 3HBZA 1UZYA 3CEWA 1H1IA 3VKMA 5BUVA 1DGWX 1YFYA 2JG8B 4RHV2 4IE7A 4UW6A 5DG2A 2B45X 5LA9A 4DXTA 2TEPA 1BBT2 2H6CA 4LHSA 4AFDA 4YW5A 5A1LA 1ULPA 4LO7A 4QDSA 1DQ5A 1C8NA 4YM1A 3ES1A 2W1SA 4AQ2A 5C4WA 4EZ4A 1WD3A 1XNTA 5JR2A 5D21A 2HWB2 3ABZA 3CDZB 1UYZA 2WNVC 4YZ3A 2VZ3A 4XJ8A 4YVSB 4XFCA 4CP2A 1N3QA 5F6KA 2BGOA 1FOD2 4LIUA 1GWLA 1QJU3 2PHDA 3OGRA 1ND3C 2ZCWA 3ELNA 4WM7B 1S55A 3VBOB 5L9VA 3C7FA 4IXLA 5A33A 3M3IA 3RG0A 1CGPA 4IE6A 4LHLA 2D40A 4IEXA 4L2NA 4AHYA 1QJY2 1NCQB 4JRAA 3WNNA 5ACA3 2CSGA 1DGLA 2L9LA 3MIFA 2MNGA 1DQ1A 1OOPB 2Y6JA 3A0NA 3LGRA 5DAQA 5DQ0A 3S5QA 4E2GA 5A3LA 5T5OA 4FPFA 4LIVA 2VNOA 3AVSA 3WG3A 1FPN2 1LODA 2UWBA 4DXSA 3FL7A 5HXMA 4Z92B 4Q0UA 5F8PA 4TYSA 3HMYA 1ZRIA 2VZPA 4QPIC 4UYBA 5EFUA 3K77A 2FDGA 2GZWA 4CPBD 1V9U2 1HQLA 4ZONA 5EP9A 3NNJA 1Q8SA 4BQ5A 5FXWA 2JG8A 1HQNA 1AR92 1Q43A 3CL1A 1SACA 4CDWB 4XBNA 1AYM3 1PZ9A 1DGRN 1YFXA 3URFA 5DAXA 5KHKA 1JHNA 2R061 4OQ9A 2HWF3 3NV3A 2WINB 1FNYA 5JIUA 2LS6A 3O1RA 1WUVA 2E7TA
chains in the Genus database with same CATH topology
1D4M3 4MXWB 4YVSA 2R043 1NZCA 4KGQA 1HRV1 4OHVA 4FAGA 2ZMNA 2DTYA 4YZ1A 1R1A1 4WM7A 3VBOA 1FT9A 1FMD2 1DU3D 2GMMA 5FPXA 1WA4A 2NZ9A 1NCQA 4CEYC 1YFUA 3QH6A 3OY8B 2ZBJA 1OOPA 3PVEA 4IV1B 1VBD1 4R52A 3NAPB 4F8AA 4RS5C 4PCRA 2ZHLA 4LHKA 4Q4X1 2BGCA 3M1HA 4GH4C 5BV6A 1ENSA 4EWEA 3L2YA 1POV0 2VXRA 5H9RA 3LCPA 2DCZA 3U4XA 4L92A 5LEKA 4GB31 1OOPC 1ND2C 2WFF3 1H9WA 2AYHA 1I1EA 4CDWA 1ALYA 2ES3A 2ZAAA 3ZYGA 2C9AA 2WS91 2V09A 4FPHA 2XWJB 1PZ8A 2GSYA 3P3PA 1AR73 2WNUA 3B7MA 4N43C 4MXWA 2D6NA 4AFMA 4AG4A 1H0BA 1SLBA 1ZRFA 1RMU3 4HKLA 3MLJA 4K1ZA 3HR9A 2A3WA 1O4TA 2DF7A 3SH3A 4AVAA 2NMNA 4D7YA 3JCIA 2HEWF 4FPCA 4QQPA 1NA1B 4BYYA 4LO4B 3OY8A 1M06G 5GALA 1D2SA 1WBLA 3AB0A 2IXCA 4IV1A 4XPVA 5LRRA 2WWSA 1VR3A 1CVNA 3NAPA 2D6KA 3CNAA 4BMBA 4JAAA 1AL0G 4DRVA 4RR3C 1TE1B 2UURA 4AI3A 2I2SA 2PHUA 3RMYA 2DUQA 1D2QA 4YW1A 1I6XA 2P37A 2WSVA 3BIWE 4K7JA 3LB9A 5JIAA 1BEV3 4BA6A 3TYJA 2JD4A 1RUG1 4N90A 1TMF3 1LGNA 3B02A 3S7EA 4CDXB 1X82A 3JUUA 1MEC2 2XKOA 3PHMA 4Q27A 3LA2A 3FWEA 2BFUL 1EV13 4QX5A 5DXDA 5AFEA 1DZQA 3AK0A 1LHWA 3HT1A 3N7JA 5GZDA 3AJYA 4FOQA 1ZBA2 1MQTC 1H9PA 1NA1A 1WMEA 4BPZA 1R1A2 5BNOB 1B35C 1APNA 3WR0A 3WT3A 1VBA3 1BZWA 2K9ZA 5EXOA 4AE2A 3UKVA 3SXWA 1FI2A 4LTAA 3X29B 1HQWA 1VBE2 2RR13 1KS4A 4HETA 4L97A 3IPVB 5HCAA 1SLLA 1VIWB 2ZGNA 1PIV3 2B8MA 1KRIA 3TNQA 2HJIA 4CDXA 2O8OA 4YW4A 4P9JA 4QQOA 5DDJ3 1COV2 1CIWA 2WNEA 4I2OA 5H9SA 3RWNA 1LHUA 4P9LA 4BM8A 4PLMA 1W6OB 2E53A 3U10A 1MS4A 1Y9QA 3QOPA 1N3PA 5DUXA 3THPA 4LNVA 2FBEA 4IEYA 4DS0A 2CAUA 3DPRB 1G7YA 4IEZA 5BNOA 3LSEA 5JPMB 5C8WA 3S0MA 4WVMB 5T52A 4IEUA 4H7MA 2AR6A 3IT8A 1RUI3 2HWC3 1RUH1 3RNSA 1QQP3 3OBTA 1V6LA 3V56A 1SEFA 3IPVA 2WZR2 3S30A 2VOWA 3KM5A 4AHWA 4YVWB 2LALA 3U07A 4DPNA 2A5ZA 3ZXFA 1OKQA 2R0FA 1TME1 4Z82A 3WG4A 1NY71 1XE8A 4AK3A 2G9FA 1ZNPA 1W6OA 1RHI1 2DFBA 4D69A 3ZIXA 2QDRA 2R1DA 1MS9A 3MW3A 5A32B 1Y7BA 1HW5A 3FHIB 1RUJ1 1KFXL 3OGJA 3DPRA 1UKRA 1X36A 2KXLA 1MS0A 4ONUA 1PGL2 4JGYB 4WVMA 2WFPA 4S2FA 1S0GA 2JXAA 4BIFA 5IT6A 5GLZA 1QJX2 1HXS1 2SLIA 3CO2A 4XW3A 3VBHB 4FAHA 1CAWB 1C8M3 1PK6C 3M4FA 4HN1A 4JDNA 1N1SA 3JQXA 1AX1A 1QNYA 1ULEA 1UU6A 2IC1A 3MIEA 4EN7B 2JDZA 2ZZJA 4YVWA 2D6MA 3ZFEC 2R073 2CTVA 2TBVA 1R083 3WDUA 3VZOA 3NW4A 3IM0A 4LBQB 1RUD2 2B9UA 2XHKA 1ZZ9A 2CWSA 1GQHA 3POWA 5HCFA 1PO12 3AMQA 3GYDA 3KMHA 1G9CA 2XBO2 2FZ2A 1H8VA 2ZS6B 3B01A 4COVA 5IK5A 3WY6A 4BWOA 5A32A 4Y1UA 1GZWB 1AF9A 1GFF2 4YVWC 1AYN1 4XDQA 1N3OA 4Q1RA 1DYPA 1R091 4WVVA 1IS3A 1X7NA 2DUOA 4LA2A 3B3QE 1UPIA 2BUKA 2IZWA 1D4VB 5KC5A 1AL21 4JGYA 2JJ6A 3DF0A 1DQ4A 2ZX1A 5HCBA 4FTBA 2OUJA 1OMIA 4ISQA 1Z0HA 1LULA 4LBOA 1VJ2A 2EF6A 5FMOS 2XJSA 2VW1A 3B94A 4A7YA 3OD4A 1S0DA 3ASIA 3VBSC 3VBHA 4M01A 1CAWA 2I74A 2QZ2A 2VW0A 1GICA 3J26N 2X8KA 4NWVA 3IIAA 4XF3A 2QDNA 2VVEA 1LOAA 4JGYC 2OPKA 1RUH2 2VOVA 3B9CA 3R4UA 4Z07A 1OLQA 3C3VA 1VALA 2OUHA 2VOXA 2BQPA 4LBQA 2DVDA 4KU7A 1ZZBA 2DWRA 2WL1A 2UWCA 3J8F2 1GLHA 4PDWB 2RMU2 4L9BA 3RI8A 2UYBA 1HRI2 1UU4A 1CAXB 4OI2A 2I45A 2XJTA 2P3KA 4BLIA 2NQYA 1TME2 1GZWA 3IDBB 1NCRB 1NY72 1QH7A 3TWIA 1FYUA 1RHI2 1AR62 4AVTA 2JE7A 1LU1A 5E88A 1XYOA 2VVFA 4CP0A 4XFIA 1F2NA 1RUJ2 4XFGA 4N9IA 5C9AB 2ATFA 4FPOB 4FVVA 2X53S 1Q8OA 1LJ7A 3HN1A 3MLLA 2KM2A 1PVC2 5GM0A 3SCGA 3TBDA 3WVJA 1VBB3 1HXS2 2Z2SB 4H14A 3JBG3 3CJXA 4K20A 2N7GA 5K0UB 1G9AA 3IDEA 5FO7B 1EPZA 2YPJA 4AGGA 2BTVC 3RSJA 4AVSA 1J3PA 1YIFA 4KWKA 4PDWA 4OUSA 3MF6A 1RIRA 1CAXA 5KHGA 3DV8A 3WCSA 1S2KA 1XXNA 1RUE1 2SBAA 3JD71 2D6PA 1NCRA 2ET1A 5AFBA 1HDKA 4K1YA 5E8AA 2MEV2 3GHNA 1CN1A 2P2KA 4SLIA 4YZ4A 5E1RA 3GHMA 4PBPA 4P9IA 4EN0A 3WDTA 1RUF3 3K51A 3AJZA 3IDCB 3VV1A 4OHXA 1V6KA 2W68A 1PVXA 1NG0A 5C9AA 1U5XA 3QCWA 5FCCA 1CR7A 1AL22 3NV2A 4B29A 1J1TA 1RB8G 3HWJA 4CTEA 1CPNA 3ZXGA 4QPGB 4JDOA 3RJ2X 1UMZA 4FBFA 2D7FA 1WLTA 2E9QA 2EXHA 3VBRB 1TEIA 2ARXA 2RS12 5K0UA 4Q4W1 2RM22 1DYKA 3G6JB 3QH7A 3WOGA 4AVCA 1DFQA 1RINA 1IKQA 3ZSKA 2WQZC 3CJIC 1DLLA 2OW4A 4YSFA 1OQDA 3ROUA 3TN93 3ZYJB 3OCPA 1SDWA 3ECQA 4QD2A 3NKTA 2K2SA 1POV3 1J1LA 3KCXA 3MF9A 2XB6C 2XJQA 3VKOA 1OQEA 4WBBA 4D3WA 4META 2ZMKA 1SLIA 2A75A 2GAUA 5GLVA 2HWE3 3WUDA 4B7EA 3BOPA 2PAMA 5T5PA 1GSLA 4XFBA 4MVTA 2IFWA 2ZGUA 4BLJA 1W0PA 3RYKA 4R9BA 4N53C 2AZ5A 3R4SA 3VHPA 1FXZA 2NM1A 1VB4A 2E7AA 2FMYA 4HN0A 1VBC3 4G3YC 4HPKB 4EN8B 4AXOA 3EJKA 4QPGA 4M3CE 4BIOA 5L7OB 2UWAA 1JH5A 4LLOA 3VBRA 1IZ3A 3ZMNA 2DUPA 2RS31 4FPYA 4FT8A 3ZN5A 1LRHA 2IXLA 1HX6A 2P34A 4BZ4A 3WV6A 1YLLA 4TLFA 3L2HA 2QKDA 1UZZA 2OVUA 3KS7A 5LK5A 1Q8VA 2CGOA 3TB0A 5JMCA 4M3CF 3H1WA 2PLV2 2WNVB 3O12A 2A6WA 1ZVFA 4GKYA 3MPBA 4YLZA 3OPZA 1ND3B 4CDQC 3E6DA 4IEOA 3OGGA 1LKNA 1WW7A 2PTMA 1N1VA 4LE3A 1WBFA 3KD4A 4DY3A 4J1XA 1PO23 3KT4A 4HANA 5T5JA 3AXDA 3HAGA 3AKTA 4HPKA 1G6NA 5JI9A 1F5FA 4XF1A 5L7OA 3O14A 3A0KA 4WVWA 4YNIA 4QPIB 5E89A 3VKLA 1KS5A 2PAEA 2YROA 1O4ZA 5BPXA 2CV6A 4Q4W2 2HWF1 1BBT3 2CAVA 5L7OC 4AQSA 2PA7A 5CIRA 1D4M1 2G9GA 1U5ZA 5JCTA 2R041 4L11A 2WNVA 2AUYA 4C1WA 5C8CC 3BOWA 2HWB3 4KBBA 4AGVA 2E6VA 5B2GB 4KWLA 4NPRA 1FATA 4CEWC 4OI1A 1FOD3 1ND3A 3OTFA 3S7IA 3KB5A 3WZ1A 2XVKA 1NXMA 2IXIA 5DZEA 4CEYB 2ZAHA 1QJY3 1D0GA 4QU2A 5FAXA 2UY8A 1Z78A 3AP4A 3GBFA 4XHXA 3P3NA 4HFSA 4DZGA 2A6VA 5T5LA 2W08A 5J48A 5JLVA 2Q8OA 3AP5A 4RS5B 4XJ9A 1FPN3 4QPIA 5D8AC 3ETQA 3H7YA 4GH4B 1V9U3 4LBMA 4RFT0 3N7KA 1H1AA 2XG3A 3ZO0B 2WFF1 1RL3A 1SCRA 4Q4Y1 1ND2B 3VKNA 3WINE 2RS32 3POYA 1AR93 1Q8QA 2PHFA 2YC0A 4QQHA 1ENQA 4P9WA 1Q8PA 3SHRA 4A3XA 2B42B 1AR71 1XU1A 4N43B 2BNMA 4IV3C 5BNNB 1RMU1 3AKPA 1XRUA 4MX3A 2C1FA 2QE3A 1W6QB 4COZA 1AVBA 1BVVA 1DIWA 1BKZA 4D94A 3HIFA 2Q1MA 3TRSB 3HQXA 3E6BA 4CEYA 1LTEA 3UL2A 2JICA 1YHFA 4FPLA 1WLDA 2C0ZA 3NVCA 3ZN4A 1AXKA 4K6BA 2E63A 2IXKA 1ZBE1 4MLOA 4RS5A 1XNBA 2E7QA 1BJQA 1BYHA 1AR82 4GH4A 5L73A 3ACLA 1K5MC 4RR3B 5KBFA 3FZ3A 1IS4A 3WDYA 3H1MA 1VAKA 1ND2A 2FHRA 3AM2A 1S2BA 4MSVA 1O3TA 3MIDA 3ILNA 1BEV1 5FRAA 3LA7A 1TMF1 1RGSA 1YJLA 4EWAA 2PHXA 4N43A 5BNNA 3H3UA 2GMEA 2A71A 4P9XA 1J3QA 2HWF2 4XQWA 5CFCC 1VRH2 1W6QA 2ZX3A 4YYOA 1OPMA 3KSCA 5FOJB 1LHNA 1H30A 1QOTA 4YM2A 1FX5A 5CG9A 2JEMA 2IXJA 2EXIA 3L9JT 3EQEA 4DY5A 4ATEA 1MQTB 5GZCA 4IQPA 4Y5Z0 4HSLA 1NYWA 3ILRA 2DCTA 2XJUA 5BNNC 5IK8A 1B35B 1RUC1 3BALA 4AEKA 1VBA1 4OZXA 2DCKA 4FPKA 4YZ2A 3VHOA 1J59A 3WP3A 3M3QA 5FFOC 1OA2A 1I5ZA 4K3UA 4RR3A 2RR11 1JOJA 2DU1A 4JVAA 1S0JA 2ARBA 2TNFA 1FV3A 5JSOA 4EROA 1PIV1 1BMV1 5ABJC 2WIIB 4MGZE 4XHBA 1YO8A 2X29A 1J58A 3N4MA 2WFF2 5DDJ1 2VQAA 3NV4A 4Q4Y2 3M7AA 1MEC3 1N47A 1O7FA 1ASJ1 4UBHA 4SBVA 5FOBB 2YY1A 1AR72 4NHLA 1S0BA 1OLRA 2ET7A 5I0SA 4N7UA 1ZBA3 2A70A 1MQTA 2B39A 4GULA 5CFDB 4AEJA 1B35A 3ZXDA 1R1A3 3NKGA 2R062 3ALQA 1JYCA 3CF6E 4EN6B 4KG8A 3BTAA 1YRZA 4GMP0 3I59B 4Y1YA 3SNMA 1RUI1 2D43A 2HWC1 4K9SA 2OYZA 4S2DA 2D93A 1FAYA 2OA2A 5CU1A 1QQP1 1HRV2 4UW5A 1ZBE2 3ZN6B 4W65A 3FBYA 1VBE3 4DNYA 1FV2A 1RVF1 1QXPA 4Z2WA 4YFZA 1YFWA 4Q2FA 5DUWA 1UD1A 2WA3A 3M8LA 4PLOA 2DVFA 1YJKA 4S2GA 4NHKA 2RHPA 2HEYF 4NO4A 2DURA 1XE7A 1EAH1 1VBD2 2CWMA 1COV3 2ZKLA 1A8MA 1CQ9A 3LSDA 4Q4X2 3PVNA 3M70A 1I9RA 1QY4A 1QNWA 4BCUA 1ZRDA 5JZGC 4GB32 2RJKA 3A4UA 5CFDA 3VBFC 3W9AA 3WW1A 4C90A 1QOSA 1REDA 1XQNA 2YUEA 2WS92 1OA4A 3MW4A 3I59A 3JQWA 2GU9A 3AFGA 1RUC2 4F83A 1WMFA 1Z7S1 1VBA2 3ZN6A 2PAKA 2R49A 1PK6B 1WW5A 3WQ0A 4EV0A 4TZDA 5CFDC 5EWSA 4Q1PA 1V00A 1HV1A 5H9QA 2WZR3 2R071 3ZFEB 2RR12 1SMVA 3BU7A 2DU0A 1D0HA 2VPVA 2ZZQA 2VECA 5IK4A 4MUVA 3WP6A 3WD5A 3FFZA 4G4FA 4PJYA 2XKPA 2CGPA 1PIV2 1UCXA 4LUKA 2ZA9A 2XJPA 1W39A 2NYYA 1KJRA 4QM9A 3D0SA 4W6WA 4BMEA 5DZFA 5K8SA 2BVVA 1ENXA 1ZZ8A 2R6QA 1YCIA 4XTMA 3ZXEA 1ASJ2 4YGBA 1SBEA 4V1PA 4Q8KA 2KA3A 2WQ4A 4OLLA 1LHOA 5J37A 5I8YA 3V0AB 1WCSA 1XU2A 2EXKA 4PIZA 3R05A 3QACA 4IEVA 1RUG2 2FZ1A 1IHMA 2VW2A 4ES9A 3UKNA 3KCCA 1QJX3 1NOVA 1R1ZA 1KXGA 3R4DB 3VBSB 4I09A 5L19A 2ZHNA 1PK6A 4I0BA 3GBGA 1WMDA 4E27A 1RUI2 1WGPA 2DVBA 2PHWA 4P14A 4AEDC 3GZUC 4QGLA 1AZDA 3ZFEA 1AX2A 5FTTC 2WLPA 2QZ3A 1SQ4A 3TAYA 2Q0AA 1RVF2 4OHZA 4KU8A 4DRRA 2WKKA 3KCYA 1RUD3 3EHKA 3WCRA 3LA3A 1O5LA 3NSTA 5CAZA 1PO13 3ZYPA 1C1FA 3D5OA 3ZVXA 1EAH2 1G86A 2XBO3 3ZDSA 1I3HA 2P17A 3GZAA 3Q9OA 3VBUC 5FREA 3V0AA 2ENRA 4AI8A 2ZHMA 2ZPXA 4QT6A 1GQGA 1PGW1 3H8UA 4AFAA 4RGGA 2ZGMA 5J09A 3C2UA 4WV8A 2HEVF 4MGIE 4G9SB 4DFSA 1YNAA 3WW3A 1RUNA 3MEPA 1H4HA 2GN3A 4I02A 4TWTA 3VBSA 2ZGRA 4FTEA 2DCYA 1VBB1 3VZLA 1KQRA 3JBG1 2D5HA 4YG6A 3AMPA 4LLFA 4A2UA 4E4DX 1Z7S2 4AEMA 3LOBA 1RUH3 1V6JA 2Z5WA 1IPJA 1NLRA 1S0EA 1DF0A 1QDOA 2GC0A 1T6GC 3J8F3 2RMU3 3MFCA 1LEDA 1HRI3 5KXCA 2G4IA 2D5FA 3KGLA 5SV8A 3E6CC 1Q3EA 3MGUA 3VZMA 4ZKTB 1BK1A 5KHIA 2TUNA 4RQPC 3PJQA 1GZCA 3E5UA 3B9IA 1PNGA 4QMAA 2RE9A 2YGMA 2ZGTA 4QHBA 1YI9A 2WNUB 1RHI3 2PHRA 1AR63 2A7AA 1MS5A 4MXVA 1EYBA 3JB8A 4KH9A 3QLQA 1QDCA 1ENRA 2GH8A 4M3CB 1RUJ3 5KHHA 3SH4A 4Y1VA 4MH0E 3D8CA 4Q0SA 5F5QA 2B46X 4JDMA 1PVC3 1MZ5A 1UU5A 1WCDJ 2JG9B 1HXS3 3N7MA 3ENRA 1LGCA 1IPKA 4LO8A 3H50A 4YGCA 1ZZCA 2V5YA 1MR5A 2K0GA 1C28A 3KT7A 3ZXJA 3CJIB 5CVRA 3O5SA 3M3EA 4URTA 3TN91 1DDLA 3N3HA 4NVPA 1GKBA 2ZJCA 5F6LB 1LOFC 3H3ZA 5DUVA 5IK7A 3ME2A 1UF2C 1DHKB 3ES4A 4E2SA 5DZGA 4OUMA 2MEV3 3MW2A 3VL8A 3UK9A 2ILMA 1YXWA 4KL1A 2R32A 4FSJA 1QH6A 3MI8A 4PQ9A 4M3CA 4JC1A 4FP3A 2HWD1 4N53B 1REEA 4FQZA 4LO5B 5FMOL 3VUOA 1PGW2 4ITCA 2XJRA 1Y3TA 1AL23 1U0AA 3M2MA 5I8TA 4RGAA 2JG9A 1G9BA 1N1YA 3PNAA 1OFNA 2NMOA 1AYN2 1BXHA 3USSA 2RS13 1J3RA 1R092 2GNBA 2D98A 4IEQA 2RM23 4AHXA 3J9SA 4XF9A 1REFA 3AP6A 1HKDA 3CJIA 1MS3A 4XOGA 5I93A 2YYOA 1KDKA 4COUA 3AYAA 3ZYRA 2JG9C 2WT0A 3ZSEA 2R30A 4GMP1 1BQPA 1GYKA 3DN7A 1WLWA 2MHFA 5BY5A 1RITA 4NWWA 1FNZA 1JTZX 1OI6A 1UIKA 4CDQB 3SITA 4AQTA 5FO9B 2X5IB 3H7JA 4INDA 3R6SA 2A6ZA 2NPIA 4HL0A 4N53A 1NXD1 1PO21 2CNAA 5AC91 1A3KA 2QQPA 3D0JA 1IOAA 2EA7A 1QXRA 1JXNA 4XILA 4QXKA 1V6NA 3POSA 1IGOA 2RS53 3FLRA 3PMEA 4ZU4A 4Q0PA 4O9EA 4LO6B 5I0UA 3IKWA 3ZYIB 4GIQA 4JRLA 3MPPG 5J3UA 3WHUA 4Q4V1 1OA3A 1BBT1 4ORFA 1BCXA 1M4WA 4PLNA 4R8HA 5CADA 4E4SA 2EIGA 3RI9A 4FPEA 2HWB1 4QGNA 2YV8A 5C8CB 3VDDB 2PLV3 2ZGLA 4CEWB 5HI0A 3B93A 2W52A 1H1MA 3VL9A 3WHTA 4CDQA 3THTA 4LT5A 1C57A 3AZZA 2X5IA 3SH5A 2ZKNA 3DKWA 1QJY1 2YDEA 5JOYA 4E2QA 3AMMA 4Y26A 1W2UA 1YI7A 2OIIA 1CESA 1QJU1 1RJ8A