5BXXA

Crystal structure of the ectoine synthase from the cold-adapted marine bacterium sphingopyxis alaskensis
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
121
structure length
121
Chain Sequence
MIVRNLGDIRKTDRNVRSDGWASARMLLKDDGMGFSFHVTTLFAGSELRMHYQNHLEAVLVLKGTGTIEDLATGEVHALRPGVMYALDDHDRHIVRPETDILTACVFNPPVTGREVHDESG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords L-ectoine synthase
publication title Biochemistry and Crystal Structure of Ectoine Synthase: A Metal-Containing Member of the Cupin Superfamily.
pubmed doi rcsb
source organism Sphingopyxis alaskensis rb2256
total genus 27
structure length 121
sequence length 121
chains with identical sequence B, C, D
ec nomenclature ec 4.2.1.108: Ectoine synthase.
pdb deposition date 2015-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06339 Ectoine_synth Ectoine synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5bxxA00
4JV4A 2ETEA 2GAUA 5I0SA 2GU9A 4NVPA 3ST7A 3FWEA 4Q0QA 5KBFA 3BCWA 4QGMA 5C8WA 5I8YA 3TNPB 1H1IA 2GC3A 1IPJA 2H6BA 1O3RA 5FQ0A 3BB6A 4OLLA 3EO6A 4A2UA 2BGCA 2OYZA 2Q1ZB 3OTFA 1CAWB 1WLTA 2EVXA 3OCPA 3PLQA 3D82A 1WA4A 1Q3EA 2Z2SB 3FX3A 4IEXA 1UD1A 2OZ6A 5EZWA 4BH9A 4QM8A 1ZRFA 4XF0A 4Q0SA 5FDBA 1ZZ9A 3CF6E 4Z07A 1ZX5A 2PHDA 2VQAA 3NJZA 3LZZA 2ZKLA 1PMIA 1YHFA 4IEPA 4HBNA 4MX3A 1YFYA 3H8UA 5JSOA 2O1QA 3LAGA 3ROUA 1QXRA 1ZZBA 4AVAA 4HVRA 1SQ4A 2F4PA 3NL1A 1DZRA 4XFAA 4ONUA 3ACLA 4LLOA 4HZFA 1XE8A 4D7TA 5FQ0B 4YARA 1UW8A 1OFNA 4QMAA 3RYKA 1O5LA 2VECA 1L3JA 5EFUA 4BHPA 4E2QA 3U0ZA 5I8TA 2EA7A 3RDIA 1JUHA 2PHLA 3BU7A 1X82A 2MHFA 3I59B 3EJKA 2XGXA 3SXWA 1OD5A 1ZZ6A 4KWLA 2PA7A 2Q30A 2V09A 4I2OA 1VR3A 2GH2A 3SCGA 5AVPA 5FLJA 1CAXA 4I0BA 3PVBB 3MPBA 1ZZ7A 4O9EA 4EROA 2B5HA 1QY4A 1DZTA 1ZZCA 2UYBA 2HKXA 1J3PA 4LEJA 3MYXA 4N9IA 1SEFA 5KHJA 4F8AA 5CVRA 2PTMA 3LOIA 3HT1A 2ET7A 4IEQA 5JAXA 2BNNA 3WW1A 4FBFA 3H3ZA 2IXKA 3CO2A 4OFGA 4IEUA 1FT9A 4J1WA 1ZVFA 1O3TA 4YYOA 5HI0A 2O8QA 2IXIA 1EY2A 2K0GA 2OA2A 3KSCA 4XFIA 5JSRA 4X6RB 4J1XA 1CAUA 2XKOA 4CYDA 2QVSB 3H1MA 3ETQA 2PQQA 3DN7A 4HSLA 2P17A 4P9GA 2QCSB 2FMYA 3NW4A 4KU8A 1OMIA 4XF4A 3O14A 3CJXA 4XF9A 1I6XA 4KWKA 3UKTA 5CU1A 5J7MA 3RNSA 2OZJA 2OPKA 4HMZA 4UBHA 4UXAA 1PM7A 3E97A 3HIFA 3KCCA 3G7DA 1EP0A 4KU7A 2BNOA 1DGWA 3S7EA 4R52A 3USSA 1O3QA 1ZNPA 2UYAA 3GBFA 4KL1A 4BYYA 4UBGA 4IERA 1O4TA 3NKTA 5FPZA 2UY8A 2B8MA 1UPIA 5KHIA 5I0RA 2CAVA 2Q4SA 1QXJA 3E6DA 4I01A 1X7NA 3M70A 1V70A 2ET1A 1CAVA 3VHRA 3HQXA 2IXJA 1RUNA 4QGNA 5KHKA 5BXXA 4H7LA 4YNIA 1J59A 3M3IA 3FE5A 1YFWA 1RGSA 1J1LA 3HT2A 4Q0UA 2XLAA 3TNQA 3B02A 4EV0A 4I3PA 3WW3A 3H3UA 5BPXA 5LRRA 4LA3A 4IEVA 3S7IA 4MGKE 4F7ZA 1I5ZA 4L2NA 4PIZA 3H7YA 4K8FA 5BY5A 1VJ2A 1IPKA 3DL3A 4R8HA 2H0VA 4DINB 1RUOA 1UIKA 2KXLA 4I09A 4HLTA 4QGLA 4LTAA 3WW2A 2GZWA 3LA7A 3OD0A 2D5HA 2BYVE 3CLPA 5FLIA 1TQ5A 3LWCA 3D0JA 2D5FA 4Q29A 4Q0VA 1RL3A 5FPXA 4PIYA 3H50A 4IESA 5I0TA 2IXCA 2GC1A 2Y0OA 3RYPA 2N7GA 4XF3A 2HJIA 4MZUA 4B29A 5KHHA 3EBRA 4MV2A 4YRDA 4MGYE 1OI6A 1YLLA 5D1IA 2XKPA 4HN1A 4XF1A 4IEYA 3MDPA 5LRSA 3D0SA 5K8SA 1ZRRA 5E1RA 1YWKA 2B9UA 4KWJA 2XL9A 2XLGA 3E6CC 4FT8A 2PAEA 4FAGA 2BEOA 2DCTA 3KGZA 4WBBA 3E5UA 3RYRA 3EQEA 2CAUA 3DV8A 5FLHA 1CAXB 2IXLA 1EPZA 4HN0A 5I0UA 4XFBA 1FXZA 1CAWA 3ES1A 1RTVA 2IXHA 4TLFA 1QWRA 3GYDA 5T3NA 3U10A 3ZDSA 3LA2A 3UKNA 2C0ZA 5KHGA 4EWAA 3UKVA 3E5QA 4PJYA 2E9QA 4AVCA 4I0AA 5I91A 4META 4E2SA 3SCFA 4LA2A 5E16A 4LUKA 4O9GA 4AQ2A 2UY9A 1GQGA 2D93A 4N9HA 1UIJA 4L11A 4ORFA 5CADA 5LEJA 1LB2A 1H1MA 3BALA 3IBMA 4YSFA 2EAAA 4ZU7A 4QX5A 3FZ3A 4ZU4A 3L2HA 3FJSA 5C6CA 1WGPA 1Q5OA 5JCTA 1CAUB 5BUVA 4MUVA 4RD7A 2GC2A 4IEWA 3FHIB 1RC6A 1Y3TA 1ZZ8A 2I45A 5JR7B 3DKWA 4WZCA 1NE4A 3U11A 2XHKA 1NXMA 1LR5A 3JZVA 4LUMA 4I02A 1YFUA 3IDCB 1X8MA 2H6CA 3I59A 3WW4A 3R6SA 3KGLA 1UCXA 3OGJA 4JVAA 4PIXA 2WC2A 4XFGA 4MH0E 3N4MA 3PNAA 1CX4A 1G6NA 3SMHA 2CV6A 4EWDA 1DGRA 3BPZA 2MNGA 5JSPA 3ELNA 3SCHA 2XLFA 3H7JA 4HSJA 1YFXA 2PYTA 5I8SA 5F1RA 2PAKA 3E6BA 3QACA 3ES4A 5J48A 2ZCWA 3QOPA 1NZCA 2GC0A 2QNKA 3SHRA 3H1WA 3H9AA 2QDRA 4QXKA 3IIAA 2Q0AA 4XETA 2K9ZA 4LULA 1J58A 1X8EA 2D40A 1CAVB 1YUDA 4IETA 1U12A 4JTOA 3RPQA 4XFCA 5FCCA 3NVCA 1O5UA 4XEZA 1Q43A 3E5XA 1NE6A 4X6QB 1ZRDA 2WFPA 1XRUA 3I7DA 1NYWA 1Y9QA 1ZREA 4ZU5A 3EHKA 3H1YA 1SFNA 2CGPA 3CEWA 1LKNA 3KMHA 4BIFA 5J3UA 1O7FA 2MPFA 2PAMA 4MGIE 1VP6A 4Q0PA 2VPVA 4E2GA 4HVOA 1O3SA 1J3RA 2BNMA 3OF1A 4FAHA 4Z82A 1EYBA 2Z69A 2ATFA 1LRHA 1J3QA 4XFHA 1HW5A 4AQ6A 4MGZE 4IEZA 2QJVA 3C3VA 3IDBB 4QM9A 4HVQA 3MZHA 3LA3A 4EWEA 4WVZA 5I93A 2XL7A 4D7SA 2FQPA 1FI2A 4XFFA 4IEOA 5LEKA 4AVBA 1GQHA 3FFQA 3NSTA 3RZZA 2PFWA 2IC1A 3S0MA 3CL1A 4GULA 5BV6A 3IWZA 4AXOA 1ZRCA 1XE7A 1CGPA 3I54A 4JTNA
chains in the Genus database with same CATH superfamily
3HR9A 3ILRA 2JECA 1NY71 3BTAA 4NVPA 3FWEA 1HN0A 2Y6FA 5KBFA 5JDBA 1V9U3 3BCWA 5IK8A 2BQPA 3TNPB 1UXZA 1DLLA 3EYPA 5A7PA 4JHZA 1HRV3 2RHPA 4XC9A 3AXDA 4YVWA 4AFDA 4CUBA 1GP4A 5BNPA 3EO6A 1EV11 3ZFEB 2BGCA 5FZGA 3ZIWA 2Q1ZB 3ZFEC 3OTFA 3NWKA 3JCIA 1UU6A 1MQTA 1GZCA 2D6KA 3PLQA 5G04L 1DQ5A 1UKGA 1Q3EA 2Z2SB 4ISQA 4JAAA 2QQKA 2BW8A 2OKXA 1EUUA 3N35A 4JDMA 4BH9A 3RZKA 2QQUA 4QM8A 4HK8A 1PIV1 1VBB1 2VBDA 2BZDA 2XH6A 4MGQA 4DIQA 3UNPA 4AAXA 4COUA 5HXVA 1PMHX 3DUIA 1OVPA 3OYWB 4N90A 5JOZA 5B4XA 3NJZA 2X8KA 4QPWA 1EAH3 2HEWF 2XHNA 4IEPA 4NMIA 4IXLA 4LBJA 1YFYA 2QZ2A 3ETPA 5L9VA 2O1QA 4UOJA 2V4AA 1AYM1 1YNAA 1H2KA 2GN7A 2LUWA 2PQSA 2CHHA 3ZM8A 3V65A 2WKKA 4ASKA 3OBAA 3ACLA 1DQ4A 4LLOA 2C5DA 1ULCA 4FOVA 3VHOA 2DVFA 4D7TA 3J9SA 3U75A 5F3IA 4Q4W3 1OFNA 1PM4A 4QMAA 3OGVA 1LAJA 1IQAA 4BA6A 3RYKA 3BYWA 3MLJA 2VZRA 4S2GA 1W9SA 2VL4A 3MW3A 1VAVA 3KZ4C 1CPMA 2A3WA 5F6KA 2EA7A 3RDIA 2W5FA 3DPRA 5KR7A 1JUHA 3RMXA 3W5NA 4R9DA 3BU7A 1RVF3 1X82A 2MHFA 3VD5A 2RM21 5CBLA 2KD7A 4Q4V2 2D6PA 5CIRA 2WN2A 3PVEA 3B00A 4LO4B 1OD5A 1IG3A 2HWF3 1KRIA 3QCWA 2W1UA 4JC1A 4KWLA 2CDPA 4NHLA 1RUE2 3B94A 2V09A 4I2OA 2XDVA 2Y6JA 1VR3A 5IWFA 1IKPA 4XTMA 3SCGA 4YW4A 1WWYA 3PVBB 3HQRA 2ZBJA 4OZOA 4LO8A 4QU1A 2YMZA 4NR1A 3ALQA 1ZZCA 2UYBA 1SLTA 1O4ZA 3IMMA 3RWNA 3VBFA 2W95A 5A7SA 3D8CA 4DQAA 4HPKB 4N9IA 1ASJ1 2D7FA 3LF7A 4OYUA 4F8AA 5FMDA 2QQLA 4Y26A 3LOIA 4NPMA 2E32A 2MEV3 4HOOA 2QDNA 3H8RA 2PHRA 2J22A 1IS4A 1NCRA 1GU3A 4NROA 3HNBM 4DUWA 2C9KA 1RITA 3WW1A 4FBFA 4XUOA 4AFMA 2VOXA 3AKPA 4OFGA 5FZ0A 3S30A 1FT9A 1XYOA 5BNNB 3CZJA 3VL8A 5DUUA 5BNNC 1JODA 3QH6A 3AZWA 1OOPB 2JXAA 2IXIA 1OOPC 4OQ9A 4ARXA 4NUBA 3GALA 1TEIA 5IVFA 2VZTA 3VV1A 4Q8LA 2DFCA 2P1BA 4OHYA 2AUYA 3PUHA 3PVOA 4IE6A 2YY1A 3RI9A 1S0FA 3KSCA 5JOYA 4D69A 1PO12 1AUYA 3UETA 1CZSA 1CAUA 1S0JA 1VB4A 2D6LX 2R043 2XMLA 3OEAA 4QX1A 3HBKA 2JE7A 3H1MA 2HYKA 4IL7A 2DUPA 2WDBA 1BYHA 3DN7A 4LKFA 1GQPA 2A73B 4S2FA 3VBUB 1SPPB 2QCSB 2VVDA 3NW4A 4KQ7A 3VBUC 3HAGA 3O14A 4PI0A 2A5ZA 4KWKA 1NA1A 1QKQA 3LKJA 5LBEA 3W9AA 2ID4A 3BU0A 5A32A 4CA9A 2E51A 2R072 5CKQA 4E27A 1L7QA 3NNLA 2BGOA 1VB2A 2DFBA 2TEPA 3ZMOA 5FIXA 1R093 4QXCA 1NAEA 4UBHA 3E97A 5FP3A 3OEBA 3RQ0A 3VKOA 1OVSA 3ZKYA 2PHUA 5A7WA 1U5IA 1OA4A 2ZMNA 2TBVA 4DNYA 1BEV1 3GZEA 2YC2A 3WCRA 4BISA 5C3PA 1AX1A 4XDQA 2E7QA 4KU7A 1C8M3 2VXRA 3B7MA 4BIOA 4YW7A 1KJLA 4CCEA 2ZGTA 4COZA 1YO8A 2DUOA 3MFCA 3MW2A 4QXHA 4R52A 4RS5B 2FD8A 1Y9GA 4P9IA 2NN8A 4GKYA 1AX0A 2Y33A 4RS5C 4UT5A 5EQUA 2VNRA 5SV5A 2FDHA 1CQ9A 4PLOA 1ND2A 3AJZA 5DUWA 3ZN5A 4UBGA 4BYYA 4YZ2A 2BBVA 1FAYA 1JZ2A 1J84A 5FPZA 3WG3A 4ZXEA 1COV1 2NLRA 2LS6A 3KWVA 5DG1A 1CESA 2B8MA 4Z8BA 3U37A 4KWUA 5I0RA 5KHIA 2YBSA 3I2KA 1OKOA 4YZ3A 2NQYA 1REFA 1X7NA 3H0OA 5FREA 1QOSA 1X9PA 1F4HA 2HWE1 4GALA 3ZYGA 2IXJA 2RS31 2Q8DA 1ONAA 1NX9A 3JD73 3N9PA 3NV2A 2RMU3 2XJTA 4MO3M 4QKFA 2XR4A 2P3KA 1FNYA 1UY4A 3OSDA 4N43B 3BODA 1HJGA 2I07B 3HT2A 4N43C 3SH4A 2JDKA 3TN92 2D97A 3WP3A 2ZEZA 5FOJB 2F4LA 1FOD1 1MVEA 1Q8SA 3ZYJB 1W6NA 2ARCA 2Q1MA 3VGIA 1ST8A 1W05A 1ND3B 4YM1A 1GSLA 5BPXA 1WMFA 1ND3C 3OB8A 1QU0A 3O1RA 4YFWA 4OI2A 1AR72 4L2NA 2Z79A 3C8XA 3J4UH 4CZSA 2VOWA 4PIZA 5LBCA 3WDYA 3LIHA 4K8FA 4NRMA 5BY5A 2EIBA 4QHZA 1R64A 4R8HA 3ZFGB 1VALA 3P6BA 2KXLA 4RQPB 1ULOA 3ZFGC 2HWB3 4QQOA 4RQPC 1NY72 1RXFA 3PTYA 3N9QA 1O91A 1OA3A 4XVHA 5J1XA 3LA7A 3WG2A 2BYVE 5FBZA 4QXBA 2WLPA 3I8TA 1PHMA 3MIHA 4QX3A 4AEMA 4QPIB 3MHZA 4YGEA 4B1LA 1VBD1 1TQ5A 4QPIC 2X09A 3UYJA 3VZKA 2WZR3 4OHZA 3U4SA 2JE8A 4Q29A 1CWPA 3KS7A 4Q0VA 5FPXA 2YU2A 2AYHA 2W3JA 1EV12 4EQVA 3O0VA 2FDIA 1W2UA 4IESA 4AR2A 1XOYA 5A3OA 2YROA 2HWC1 3PJYA 3FFZA 1F5JA 2N7GA 1DDLA 3V0AA 2HJIA 2R062 1QJU1 4Y1UA 1DU3D 2VGDA 3WVJA 1H4HA 2ZEXA 1GR3A 1PGSA 3EBRA 3E1F1 3KCYA 3BOPA 4MV2A 4Q4X3 3WLUA 4AQ6A 5F8PA 1MS8A 1HDKA 5HPOA 5D1IA 1OH4A 3AK0A 3VZNA 1PIV2 1WCKA 2F17A 2ADEA 3KHBA 1N1SA 3T30A 1VMFA 3GCWA 4AL9A 4D3WA 1PNGA 5K8SA 4FO9A 4LE4A 1WA6X 4FTSA 5E1RA 1YWKA 2B9UA 4KWJA 1HV1A 1FPN3 2XLGA 4URAA 1PZ7A 5F9TA 5IAXA 5FYYA 1KD7A 3CDZB 5EWSA 4FT8A 5FK8A 4BLJA 4YFZA 1R1A3 2BEOA 2DCTA 4FAGA 5DAQA 3W58A 3B9CA 3J26N 5IVEA 4H2AA 4UW3A 1AYM2 3E5UA 2CNAA 3RYRA 3EQEA 3WP4A 4YVSB 2CAUA 1YQ8A 1XNAA 1XNTA 4W50A 5FLHA 5IT6A 3EXUA 4LK7A 4YVSC 1XSRA 2J1SA 2JG8B 3VHPA 2JG8C 3USUA 4AZZA 3I4IA 1WBFA 1VMJA 2RE9A 5KHGA 3T4HB 1DYKA 4NHKA 3DYMA 4EWAA 1BK0A 4XILA 4DXTA 4GQ7A 2R32A 3PDQA 3M2MA 3ACIA 3GCXA 1CJDA 2DF7A 2E26A 3OGRA 4CUGA 5F3EA 1GZWB 3O1TA 1UPSA 4HFSA 4FPHA 2RM22 2EIEA 5E16A 4H14A 3J8F3 3G6JB 5DQ0A 3ZFFB 1CR7A 4ORFA 1KDKA 1OSGA 1UMIA 2X29A 3AMMA 3PVNA 4L11A 4QX8A 3ZFFC 1ZRIA 1XNBA 1IS6A 1U5YA 3HD8B 1AR93 3NV4A 1F15A 1H2LA 3ZOIA 1VBC1 1ENSA 3LEKA 4ZY9A 3NV3A 1AR63 1S0CA 1RHI1 4BQWA 4AWDA 4ZU7A 1ZBE3 5CG9A 3UGHA 2YGMA 1W6OB 5GZGA 4DOUA 3P3NA 4BCUA 2WZ8A 4N7IA 3LCPA 1WGPA 5FY0A 3BN6A 5IAVA 1XNKA 3T0AA 4C0HA 3W5MA 3VD3A 2YBKA 2XWBB 3KF5A 1GKBA 2PLV1 1RC6A 1ASJ2 5EJZB 5FMCA 4YGCA 5JR7B 1NKGA 3S5QA 4XUPA 3LGRA 4I3GA 5FFOC 3INAA 4AVVA 1JZ6A 2DURA 3WNXA 3U4XA 3DGTA 4AEDB 2EF6A 1W6QB 3C7FA 1NXMA 2XB6C 1DQ1A 4AEDC 3VZMA 2LTNA 5L36A 3IDCB 1L7LA 3T3YA 2H6CA 3DXTA 1PO23 3PIJA 3WW4A 1UCXA 1GZTA 5ISLA 2D44A 4C90A 2LM3A 4JVAA 4XFGA 4JRLA 1RYYA 4LO6B 5EPAA 5I0DA 1C28A 1XB9A 3SMHA 4EWDA 3VKFC 3BPZA 1OPMA 3SQOA 3ELNA 2WWJA 3LEIA 4HSJA 1BBT3 1RUJ1 2RDNA 4DRRA 2ZGRA 3OGGA 1O59A 3QACA 4Q1RA 5J48A 1ULGA 3WINE 4FSJA 2WT0A 4JKMA 3SHRA 3VHNA 2QQOA 2ZAAA 1MS1A 3H1WA 1PVC1 3IAQA 4D0QA 5IK7A 4SLIA 4GJYA 1UOBA 1WZXA 2Q0AA 4H3WA 1LULA 4XETA 3WQBA 5KWRA 1J58A 1X8EA 2D40A 3RZGA 1CGPA 2XUEA 4YW1A 4NIAA 1H2MA 1DQ0A 3JBG2 5FZKA 4WZFA 2QZ3A 4IETA 3V56A 3VBRA 1U12A 4Q1PA 1W8TA 4S2DA 1HXS3 2WS91 3Q8BA 3RPQA 5FCCA 4HL0A 1O5UA 2YU1A 3THPA 1BEV2 3VBSB 2DVGA 2WL1A 3E5XA 5LW9A 1F35A 2BU9A 1OOPA 2D3PA 2WQ4A 3VBSC 3VDCA 2VNOA 4NIIA 1AYN3 2WAOA 4GA9A 1RUC1 4QB6A 5KXBA 2EIDA 2VQTA 5ANQA 3I7DA 3VKLA 1NCQA 5FYUA 2HWF1 1W2AX 4NRPA 5FYZA 4QPYA 1UYPA 4DPNA 1F5FA 2CSGA 2CGPA 4UFJA 1VBA3 3CEWA 3UL2A 2PAMA 5DZFA 4MGIE 3ZXFA 5IK4A 2TUNA 2VXJA 1D2QA 4XCBA 2WNOA 1H9WA 5JVVA 4Q0PA 4U36A 4HK9A 3ZN6A 3AP9A 1O3SA 4A4AA 4JX0A 5BNOB 5J09A 2HWE2 1D0HA 2FDJA 2P3IA 3QD6A 5BNOC 2RS32 2DWRA 2E7TA 1MS9A 1EYBA 2Z69A 1I3HA 2A6VA 2ATFA 2WNVB 4CP0A 2WNVC 1IS5A 2NZ9A 2JDAA 5GZDA 2ZGSA 5CFCB 4QQLA 3PIGA 4CU8A 2QJVA 3J7HA 5FYCA 5CFCC 5JXHA 2LALA 1PX4A 2B9VA 1D2SA 3OOXA 4IGQA 1P8JA 4QM9A 4XJUA 3O0WA 4HVQA 5CG8A 5FK7A 2BBAA 1RINA 2WR9A 1WKYA 2XL7A 4MXVA 4OUMA 3I2DA 4BMEA 5LY2A 1JYVA 5LEKA 4FFIA 4NHMA 1HB2A 2PHWA 4Y33A 1W6MB 2OW4A 4AVBA 1GQHA 1S2BA 1JUIA 4CP9B 1H0BA 3H8XA 3RZZA 4LO5B 1OKQA 3OY8B 1AL21 1YJLA 5FPVA 2J1AA 3KT4A 3CL1A 2D6MA 4XJZA 1FV2A 4FXGB 1XE0A 3A0KA 1TMF2 2XQXA 3HNMA 3IWZA 5BV6A 2V4VA 1JZ4A 1MEC2 3SH3A 4AI0A 1VBE2 3KV4A 4BQ1A 4MXWB 5D2AA 1E5IA 4QDRA 4CDXB 2GU9A 5H9QA 5LA9A 3SNMA 4CDXC 3WDUA 4GH4A 3POBA 1VBD2 3JQXA 4GZ9A 2ZX1A 3K51A 4M3CE 4QGMA 4ASLA 5C8WA 5K7PA 2XJSA 3AXEA 2Z42A 3KF3A 1IPJA 2GN3A 3ZYPA 2WIIB 3M8LA 1UXXX 3IM0A 2EICA 3GZTB 3LSEA 1HQNA 5FQ0A 2HWC2 4RHV1 5L9BA 4A2UA 2AEYA 2A6XA 2VZQA 1GNZA 2ZHMA 1QJU2 4K8RB 3HWJA 4Q27A 2EVXA 4B3NA 1YXWA 4NIHA 4AHYA 4LJHA 1C8M1 4W6XA 3VBOA 2GDFA 2Y26A 2R49A 1HV0A 2OVUA 5GLTA 1IOAA 2OZ6A 5EZWA 3ZPOA 2WWSA 2TNFA 4M4PA 2WFF1 4AGRA 4RQPA 3MV11 2GMPA 1RUH1 4QKBA 4GWIA 1C5HA 1QJY3 2JDNA 5FBJA 1D0GA 2PHDA 2RS12 4LKEA 5IW0A 1VAKA 4HETA 2RS51 4MOAA 5FZBA 1QOTA 4Y1ZA 4AK3A 4A7YA 4EZHA 4L9BA 4A6SA 1OUXA 2V5YA 4ISRA 5CFDB 4N53A 1A34A 2VOTA 1WCUA 1UWWA 5CFDC 5FZEA 3ROUA 1QXRA 1ZZBA 1CJPA 2GP5A 4XCAA 3UESA 2XXZA 4HVRA 4PQ9A 1PO11 1DZRA 1DZQA 1KEXA 5JMCA 2VAUA 1YC61 4OQ8A 4XACA 4Y22B 1SFYA 5EHDA 3IB3A 3N9LA 3N9MA 4P5YA 3AZXA 3AMNA 4NJ4A 4IV1B 4PLNA 1UZVA 2VECA 3A21A 4GWJA 3S57A 3CU7A 5EFUA 4IV1C 2DU1A 1DGLA 1W8FA 3SEEA 5FY1A 2R071 4CPBD 1VIWB 2BUKA 1OUSA 3A0NA 1W8HA 5HBAA 3EJKA 3I59B 2FMDA 1Z7S3 4LT5A 1GYKA 4ATFA 2CGOA 2XGXA 2IVIB 2WBKA 1FV3A 4HKOA 4M00A 4TXWA 4B4QA 2ZX2A 3SXWA 1RHI2 2DYCA 3AMHA 3WZ1A 3HN1A 1IGOA 3RZHA 1ZM1A 1X33A 5C3RA 3UV9A 4ZKTB 1V9U2 4YVSA 4LOSA 2OXBA 5AVPA 4Z2AA 2BPA2 1VRBA 5A7QA 3O1OA 2UURA 1YQ5A 1ZZ7A 2C26A 1W2NA 1LU2A 4P14A 5FKCA 2G9GA 4LITA 3ZYHA 2CTVA 2VW2A 1O4YA 3DECA 3MEPA 1DZTA 4IUGA 1J3PA 4MHRA 3PUAA 4FTEA 3OD4A 1GOHA 1JYWA 4FVVA 4MADA 3AC0A 5CVRA 2AEZA 4EE2A 4E9KA 4XQDA 1K45A 2ET7A 1STMA 1SLAA 2P34A 5EYYA 4CXYA 1JOBA 4LBOA 2BNNA 2D43A 1UMHA 3ZFFA 5F5QA 4BDVB 1LNSA 5F7UA 2ZOEB 5JXJA 1OLMA 3POIA 3PURA 4KBZA 1QDOA 4IGPA 3U78A 1APNA 3F2ZA 3AP4A 3IIIA 1HRI3 1W3VA 2K0GA 1GNYA 2VW1A 1EAH2 4NAOA 1W6OA 1N3OA 4XJWA 1TME3 5DG2A 5CKNA 4DXRA 1RUJ2 1XYPA 1R1A1 3AMQA 3RGBA 5JSRA 1D7PM 1QJX3 2RR11 3VKMA 3RJRA 4A7ZA 5A3PA 4BXSV 2XKOA 4QAWA 3BTXA 4ASMB 4C1WA 5L7OA 3GM8A 3I2GA 5AC93 1JYNA 4Q26A 1PVC2 2PQQA 2R30A 3LDBA 3FLPA 1EUTA 5K9YA 3B93A 1N1VA 5FZHA 4Q4W2 2VBPA 2W52A 4YGBA 4B4PA 1IG0A 4XF4A 4CP2A 4AEDA 4DRVA 4XF9A 1I6XA 1LEMA 3UKTA 3AM2A 5IK5A 4M3CA 3WDVA 2AENA 1IKQA 2WS92 2OZJA 3R0RA 2OPKA 4HMZA 4UXAA 3ZSKA 1RVF2 3KCCA 3SLIA 4B7KA 1V0AA 3OBZA 5FTTC 1XYNA 2QE3A 1RUI3 5KXCA 3T1LA 4FFGA 1RUC2 1VRH3 4E4DX 3WNNA 2K2SA 2P3YA 4XIKA 2OQ7A 1J1TA 3K2OA 3UGFA 2HWF2 3WT3A 4D6SA 2BNOA 3VD9A 2R061 3RS6A 3USSA 2DVDA 4B7EA 1O3QA 1ZNPA 2Y38A 4DMIA 2Y8KA 3QLQA 3GBFA 5C3QA 4FOWA 4FPKA 2ZTNA 1G8WA 5LASA 4AG4A 5A7OA 1GUIA 1LEDA 4EN0A 1ULDA 5CISA 2Q8CA 4LBMA 4CEWB 2Q4SA 4Y1YA 1POV1 4CEWC 4UFHA 3MLLA 5GLVA 1AXKA 1UZZA 3TEZA 1T2XA 3HQXA 4BMBA 1SCSA 5KHKA 5BXXA 5FPLA 1O8PA 4H7LA 2ZJCA 1J59A 4CUCA 1KXGA 4BE3A 1O6UA 3M3IA 2BOJA 2D98A 4A3XA 1RUF3 3VBSA 4OVEA 2YFUA 3WNPA 1FMD3 3M3CA 5GZCA 5HXMA 4LMFA 1J1LA 4M0HA 2IVJA 1W8NA 3RJ2X 5FZMA 3VBHB 1UX6A 4XAEA 3WUCA 4O65A 4D6RA 3VBHC 3Q8CA 3K77A 5FUPA 1RXGA 4P9YA 3VN4A 4FFHA 3ZR5A 4EV0A 1NQDA 5IVJA 3BKZA 1HIXA 4LA3A 4F3JA 1XU1A 4FQZA 1SBEA 1AL22 3APBA 3AVRA 4QB1A 4WM7A 4F7ZA 2X5IA 2O14A 2Y6HA 4KG8A 3Q9OA 2BV4A 5F5IA 2Y6GA 1DFQA 2C9AA 1VJ2A 4P08A 4CVUA 4B8EA 3DL3A 4R9AA 4FTBA 3O1VA 4I09A 1TVGA 4HLTA 1NXD1 4QGLA 2W47A 3F95A 1LHUA 2GZWA 1OFSA 1LHOA 1UKRA 2ADDA 2W2IA 1RUG1 2WNVA 5A33B 3VKNA 2PHTA 4JDOA 3WF4A 2VQUA 5CZKA 1KFXL 3D0JA 4UI9L 5E8AA 2DTYA 3J7MA 5ABJB 2LRPA 1C1FA 1RL3A 2VD7A 1WD3A 4RHV2 2D6NA 5ABJC 1HXS1 1Z0HA 1R1ZA 5FUNA 3H50A 5I0TA 5AFBA 1JZ5A 5C9AA 4ES8A 2GC1A 3HQUA 2Y0OA 2LROA 4XF3A 3LB9A 3U1XA 4XDOA 4CP9A 2YBPA 4CCJA 3J7NA 5JIAA 1QGLA 1C8M2 4QPGB 4QQ2A 4TWTA 1CPNA 4COVA 3OY8A 4QPGC 2DVBA 2V72A 4MGYE 4W6WA 4UFLA 5FMOS 5J36A 3FLTA 2J7MA 3ZVXA 4GB31 3WHTA 2WFF2 1CIYA 3POEA 4HN1A 4XF1A 2FZ2A 5LY1A 1SBDA 3A7QA 5A80A 2Q8EA 1UY2A 2DCYA 3D6EA 1RUH2 3MDPA 3D0SA 4K21A 4MGSA 4V1PA 5LRSA 3LEGA 5FPAA 2C4XA 4MXWA 1QQP1 2CYFA 2XL9A 2RS52 2VMGA 2ZEYA 4OMDA 2C6SA 1AL0G 2A3YA 4QDSA 4CDXA 4PT6A 1HQLA 3E6CC 1YJKA 5LA2A 4P02B 5KC6A 5FP7A 4JZRA 4BM8A 5F32A 4TLGA 1VAMA 3SEPA 1QEXA 2CU5A 2W1SA 5GLZA 4MGTA 4XPVA 2R16A 1LOCA 3I49A 1CAXB 2PHFA 2IXLA 2RMU2 2HBTA 4XBLA 5FZFA 1I9RA 2A6ZA 2WYFA 2AZ5A 1RTVA 4TLFA 1IS3A 5T5PA 3U10A 2ORXA 3ZDSA 4TYSA 2NYYA 5FZ6A 1JS9A 3GNEA 2BVBA 2KM2A 1JYIA 5FY8A 3CMGA 4MHUA 1IZ3A 2OS2A 2WQ8A 3THDA 4PJYA 3JBG1 1AX2A 1RB8G 5C8CA 3DCQA 1LESA 4E2SA 3U14A 2OT7A 4LUKA 3B3QE 4O9GA 2G1MA 1W06A 4YG6A 4AQ2A 1UIJA 5LEJA 1BHGA 1D4M1 1W90A 2VQ0A 3CJIB 4ZS3A 4Q4V3 1LB2A 3TRSB 4FP3A 3BALA 1FATA 3CJIC 2VBBA 3IAPA 4XBNA 3RVHA 4YSFA 5C3OA 5LK5A 5CFDA 4LBKA 5D21A 1JHNA 3ZYRA 1RUE3 3FZ3A 3W20A 1OH3A 3L2HA 4BK5A 4BXFA 1OF4A 1WW4A 2VMCA 3FJSA 1RMU1 3NMBA 4FI9A 4R4ZA 1SMVA 2VMFA 4CDWB 1POV0 2WZR2 5JCTA 5A6XA 1WCSA 4UW6A 4CDWC 2ZXQA 4NN0A 5BUVA 2XVLA 1PZ8A 4TZDA 2GC2A 1DP0A 3BUCA 5C4WB 3N7JA 4CU9A 5LK7B 2I45A 1QMJA 1ZBA3 3DKWA 4NOTA 5FZ8A 1F9KA 3TYJA 1E57A 5C4WC 3TBDA 3UGGA 1NE4A 1YI9A 2IWGB 1MZ6A 2B7YA 2CWMA 4PHZA 4Q4X2 2XHKA 3ZXDA 4AW7A 1LHWA 2PN5A 1REDA 1KS5A 4I02A 1X8MA 3I59A 4RR3B 3KGLA 1JOJA 3OGJA 2HH9A 4RR3C 2FDKA 3GXUA 2WC2A 1N3PA 4MH0E 4YW6A 3QH7A 5JOXA 2HWD3 3JXSA 4X8PA 4LKDA 4K20A 1ODMA 2CV6A 3WDTA 3VDDA 3PUSA 3IPVA 5JSPA 1R1A2 2K46A 4YGDA 1GICA 2RR12 4CCCA 4CRQA 1YFXA 5FXWA 1URXA 4GMP1 2PAKA 5D8AB 3ES4A 1MS3A 5D8AC 4XXAA 3WP6A 1NZCA 1T6BX 2DDUA 1TMF1 2GC0A 3P1IA 5DPNA 5LATA 5E6HA 1JU4A 3B9IA 1MEC1 1ALYA 1VBE1 4QT6A 2E53A 4XYXA 2IFWA 3M4FA 1LOBA 1W9TA 3IKWA 4V2VA 4O61A 4CCLA 4BQ3A 3O1PA 1CAVB 5KC5A 4IQPA 5FXXA 4TTGA 3WQ7A 4JGYA 3O1UA 3KHCA 4AI2A 2VCBA 3PJQA 5CEHA 4JTOA 4XFCA 1Q8OA 5F2WA 3ORJA 3DEMA 1Q43A 2AREA 1S0IA 2ZGMA 4PQQA 5C7GA 3W21A 1DLCA 5EXOA 1LOAA 1X36A 3ZO0B 3T2OA 1ZYBA 3LE0A 4GJZA 3BTZA 1W8ZA 3MIEA 1Y9QA 5LA0A 2RDRA 1CZVA 1M4WA 4ZU5A 1AJOA 2VG9A 3H1YA 1LKNA 5J3UA 3WV6A 3MGUA 2UWCA 1QXPA 4WVWA 1SLBA 4RL7A 2R0HA 5G05L 1H8TB 3WF2A 1OLRA 3O1MA 4XJ8A 1H8TC 3C7EA 1C8NA 3GF6A 1K5MB 4HVOA 1BK1A 3HEIA 3LEMA 5L19A 2BFUL 1K5MC 3AP6A 1QNWA 2RS11 5FMBA 3GZAA 4FAHA 2VY0A 2D6OX 4AEKA 4XBQA 4OUSA 5GLUA 2VTFA 4LIUA 3POWA 3T1MA 4XABA 2EXHA 2XUMA 3NNMA 2VVFA 1AZDA 2VZVA 5ACA1 3ZIXA 5J37A 1BJQA 3T2QA 3IDBB 4NIDA 5DAVA 5C33A 3ZFEA 1X9TA 3MZHA 4HKLA 3OBRA 4LKSA 4PF1A 4EWEA 4WVZA 5I93A 2FQPA 3JB8A 1W99A 1UYXA 5FYMA 1QH6A 4BOWA 4IEOA 1W2OA 1AF9A 1CX1A 2J1UA 3ACHA 3K3NA 3FC0A 5FZLA 2HLEA 1JI6A 2WQZC 2B45X 3GHMA 2GMMA 4FPGA 3NSTA 2R0FA 1RUD3 3OUJA 1LODA 5ERLA 4CDQB 4COWA 4Y1XA 1AR73 3TWIA 2YZ4A 2RDSA 3FUQA 4CDQC 1DHKB 2YHJA 4CEYB 4GULA 4JHTA 1VE0A 3PHMA 1F4AA 2QQJA 3NRUA 4FOYA 4CEYC 3OYWA 4CEWA 1YIPA 1PGW2 1MZ5A 3FBYA 5AC91 2XJRA 5EJ3A 2GAUA 4OHWA 4H55A 5LB6A 1X50A 2ZHKA 5FYHA 1DBNA 1RUG2 3KVBA 4UW5A 3WQ1A 2DBIA 3ZR6A 5LBFA 4L0PA 1SLIA 4GWNA 5IUQA 4IV3B 5HCBA 4AEJA 1V9U1 3NNFA 1Q56A 4X8NA 4IV3C 3WQ0A 1H1IA 2WNEA 2H6BA 1O3RA 1VMHA 4Y20B 1HXS2 1ENXA 4UAPA 2A71A 1HRV1 5FYTA 3BB6A 4Y5SA 2OYZA 2AGSA 1UL9A 4ES9A 1JOPA 2Y6KA 3CBNA 1WLTA 2UU8A 1OD3A 4FPJA 3OCPA 4NWVA 1PNFA 2W9XA 1WA4A 2AH2A 3D82A 4PLMA 5CYYA 2E33A 4GB32 5T52A 2VZSA 5GM0A 1H8VA 2VZOA 1PIV3 1VBA2 1VBB3 1ULFA 2W91A 1ZRFA 4L97A 4U2AA 1JHJA 1QQP2 2ZAHA 5GKAC 1ZZ9A 4LHLA 4AGVA 1I1EA 5L9RA 4Z07A 1ZX5A 2VQAA 2ZKLA 4LBLA 5A33A 4BPZA 5FZ4A 3A23A 1EAH1 3U07A 3H8UA 1DF0A 1I5PA 4JGZB 2XJQA 3NJVA 5JSOA 3LAGA 4JGZC 1AYM3 3WNMA 4AVAA 5ABJA 3AKQA 1SQ4A 1HB3A 2E6VA 4BLIA 4DFSA 2JEMA 3B69A 2BRTA 4XFAA 2VULA 1UAIA 4HKWA 4ONUA 4AI8A 3LIGA 4YWAA 4HPKA 4M4RA 1A6CA 2Q5TA 3ZXJA 1XE8A 1AXYA 1D4VB 1QHDA 1G9FA 1UW8A 4YARA 5BNPB 4M01A 5BNPC 1UZWA 1O5LA 4Q4W1 2A1XA 2BGPA 3U0ZA 1MQTB 4PBOA 2HBUA 3IDAA 1MQTC 1QNYA 3A4UA 5B2GB 5BNNA 4GAZA 2DCZA 2GSYA 2RM23 3RG0A 1D4M2 2QQWA 1GWKA 1RVF1 2YV8A 2BFUS 3R4SA 3X29B 5A3WA 2ORZA 2QBXA 4YW5A 2R1BA 5GJ6A 1REEA 1W0PA 1QH7A 2PA7A 4NPLA 5C5TA 2UWAA 1V6JA 5FUIA 2VW0A 3WXPA 4BJ0A 1RMU2 1G9DA 3AKTA 4XJ9A 1U0AA 1CAXA 2QQVA 3J7LA 2WYSA 4I0BA 5FLJA 2YC0A 2FCUA 3MPBA 1SDWA 3OPWA 4MYEA 4O9EA 3LD8A 3OJBA 3DYOA 3PU3A 4FQ4A 4KGQA 4EZ4A 1N1TA 2B5HA 4EROA 2WA4A 1GFF2 2PMWB 1SPPA 1QY4A 5FY7A 3VBUA 3QBQA 4D94A 2HKXA 4W6YA 4YG0A 3VB9A 1LENA 4BB3A 3LQCA 5FY4A 5KHJA 4UWDA 4OHXA 4QQHA 3ACGA 5C5UA 2PTMA 2JIJA 2VM9A 3HT1A 2VZ3A 1KJRA 5JXIA 2MEV1 4IE5A 1JTZX 3N3HA 5JAXA 1MVQA 3H3ZA 2J1RA 3CO2A 4QHOA 4IEUA 3DPRB 3NKGA 1OLME 1ZA7A 3DPRC 1ZVFA 5A3NA 1QJY2 4YYOA 5HI0A 3BI3A 4AQSA 4RS5A 1EY2A 4AI3A 1UO9A 2ZKNA 4B4RA 3I3BA 3PTRB 2VO5A 4QQPA 2J1VA 2OA2A 2QQNA 3MUY1 5FP8A 4CDWA 1JYTA 4X6RB 4L92A 2BP6A 4J1XA 2ZZQA 2BWCA 5IFPA 3B01A 1ODNA 1AR83 1ULPA 2R041 3TB0A 4EN8B 4CPBA 2CGNA 2Q1FA 4HSLA 3LPGA 3UJQA 4P9GA 1Y4WA 4XUQA 5H9PA 2DV9A 1ENQA 2FMYA 3VBFB 1TZOA 3AYEA 3VBFC 4XHBA 2WO2A 3CJXA 2ZX0A 3ZLIA 5IVCA 5CU1A 4BQ2A 3GHNA 5FPUA 2CDOA 3I2OA 3IDEA 5E88A 5A3TA 5J7MA 1JN2P 1SLCA 4N43A 2X53S 3KQRA 1NCRB 5FOBB 1XPWA 1H9PA 4YG3A 1NCRC 4P5HA 1R091 1BEV3 2C1FA 5HV4A 3GBGA 2WRAA 4KMQA 1ND3A 2WT2A 3ABZA 5LA1A 1LTEA 5JI7A 1DGWA 1W8OA 2JKXA 2W68A 3R4DB 4C1XA 4IDZA 2WJSA 3WNKA 5JMOA 1JZ8A 4K1YA 1K12A 5D8AA 3VDBA 1K42A 3ZMNA 2R6QA 4KL1A 3ZFGA 3PMSA 1COV3 4IERA 3NKTA 1WW5A 1K3IA 3HOBA 3AP5A 1W0OA 2UY8A 5FAXA 1WCQA 2CAVA 3PL0A 4AYUA 2GNBA 4I01A 4A7KA 2HWE3 3M70A 4AOCA 1V70A 1O8SA 2ET1A 2RS33 2ZMKA 1G9BA 1ZBA1 1CAVA 4QPIA 4XHXA 1WBLA 2PELA 5A70A 4QGNA 4ZPIA 3AJYA 1WLCA 3GZUC 4CP1A 1NA1B 3Q8AA 5ACA2 4CXWA 1SDDB 1UY1A 3JD71 4JDNA 5A32B 1NA1C 4XJAA 4LORA 2A70A 2FCTA 5C71A 4M0NA 2W46A 2RMU1 1YFWA 2XJVA 3RFRA 3S6PA 4E8CA 1FOD3 1R083 5A7WB 3TEYA 4N8MA 5L73A 5IVYA 1W3XA 3B02A 1V6NA 3H3UA 5LRRA 4IEVA 1BVVA 4K1ZA 4A3ZA 3ZYIB 3H7YA 5FWJA 4HANA 1H8TA 3KT1A 1ND2B 3POYA 1UIKA 4N7UA 5AC92 1ND2C 4RGKA 5C70A 1WW7A 1SACA 2G9FA 3I3EA 2HWB1 4OULA 1LOFC 2QQMA 3WW2A 1OC1A 5FO8B 5JUVA 4OI0A 3OD0A 2NMNA 2D5HA 5FLIA 5SV8A 3NNJA 3ZPYA 5T54A 4Q4Y3 5IATA 2KR2A 1VBD3 1DGWX 3MICA 4AVTA 2XBO3 2VUCA 2IZWA 2V73A 2RJKA 3LFMA 3LWCA 5IFTA 3V0BA 2D5FA 1S0GA 2WZR1 1UZYA 1HRV2 1MACA 2JG8A 4FOQA 1GLHA 1NLQA 4NAMA 4PIYA 5DZEA 2HWC3 5FZAA 3JQWA 5HCFA 3PMEA 1RUI2 4XIOA 1QJZA 1QJU3 3RYPA 1MZFA 1VRH2 5A1AA 3FLRA 4FCAA 4R9CA 5IHRA 1E5RA 5GALA 1F2NA 1WMEA 4YRDA 3ZDVA 3TEWA 4YPJA 2ZGPA 4Q4X1 1W03A 5JLVA 1GZWA 2RJ2A 4LO7A 4PI2A 4BU2A 2WUHA 4Y4YA 3P3PA 4MLOA 2ZHNA 1IHMA 4XE9A 5DDJ3 2GNDA 3D5OA 3AKRA 3ENRA 3ZX7A 3T0DA 2Y64A 4ZONA 1BCXA 1LGNA 1NLRA 1ACCA 2Y60A 3M7AA 3O1SA 2OUHA 1OPOA 2AR6A 2YDEA 4OUEA 2VVEA 1C1LA 2QQIA 5FZ3A 2A7AA 4JKKA 1FPN1 3MLKA 1OQEA 1GP6A 2PAEA 2F6BA 3ZYFA 3KGZA 4WBBA 5T5OA 1F8VA 1V6LA 4RFT0 4DB5A 5FMOL 4P00B 3ZSEA 3KV6A 4Q5OA 1VLNA 3MUZ1 3ILNA 3O12A 4PDWB 1EPZA 3WG1A 2WNUB 2LW8A 2WLQA 4PDWC 3ES1A 2WNUC 1FX5A 5APAA 1QWRA 5KXDA 3GYDA 3L9JT 3Q8FA 5T3NA 5FO9B 5LCWL 1PGL1 1KDMA 4CXXA 1W8UA 3SC7X 1W6QA 2JG9B 3JB4C 2EIGA 2JG9C 2P6HA 3UKVA 4OCTA 5FZ9A 1VPHA 2NP0A 4J6GA 4META 2Z4FA 3SCFA 1HB1A 4LA2A 1NQJA 1GOFA 3RZLA 3T09A 2UY9A 1GQGA 4ZS2A 5A7NA 5CADA 2YG0A 3J8F1 5FZ1A 1G9AA 5JWPA 1VBC3 2P5BA 1HLCA 1H1MA 3IBMA 3KB5A 2VUDA 1RHI3 4E4SA 4MG2A 1T6GC 1AR91 3BOWA 4OHVA 1JYCA 5F3GA 3PU8A 1GV9A 4JGZA 1MZEA 4PBPA 5FZOB 1AR61 1NLSA 3MO4A 4UFMA 4ZU4A 3K4AA 1ZBE1 3EB7A 4OI4A 1DQ6A 2HEVF 2VCAA 3HN3A 5JOWA 1CZTA 3ZYBA 3KQ4B 4KI5M 4YZ1A 4K3UA 4LOTA 2WSVA 4CE8A 4RSUA 3CIHA 4ZXKA 3GGLA 3ZXKA 2VMHA 2PLV3 2D3RA 4MUVA 4Z1VA 1W2TA 4RD7A 4CCDA 4IEWA 2ARBA 2W94A 4CU7A 1ZZ8A 4LPLA 1HX6A 2WAAA 4WZCA 2DTWA 3FHQA 3OUIA 3SKVA 1J83A 2IUWA 2WWUA 2ZA9A 2BERA 3U11A 5EV7A 4DEVA 2MEV2 2WABA 2VCMA 1OXCA 1OQDA 1LR5A 3MIDA 4IE0A 2O0OA 3N36A 3JZVA 3CHXA 1G7YA 2WZEA 4WVMB 2DU0A 5FR3A 1SBFA 3R6SA 4EN7B 1GOGA 1PO21 1MPXA 2ZACA 1GNHA 3NJYA 4PIXA 4ATEA 1TNFA 5IYYA 3N4MA 4AHZA 3T2TA 4UFIA 3USUB 5A1FA 5A1LA 1CX4A 2GH8A 4L99A 1KGYA 4EN6B 1WUVA 5DXDA 4UW4A 1ENRA 4RFRB 4BZ4A 1DGRA 1UOJA 2MNGA 4LBQD 3SCHA 1RUJ3 1S0DA 5K0UB 3VZJA 3RSJA 5K0UC 2PYTA 5F1RA 1JYXA 1Z78A 1XBFA 1BBT1 3E6BA 3JU9A 4BQXA 5FV3A 2R042 2ZCWA 2BVVA 3QOPA 4H7MA 4DXSA 1PVC3 5BNOA 3UK9A 1YRZA 1W8WA 2WT1A 1JZ7A 2H0BA 3VD4A 1F31A 3BPSA 4Z92B 1PGW1 2V5DA 3AX4A 5F37A 4P9JA 4SBVA 3KVAA 1A8DA 2VUJA 4ZZ5A 3HVDA 1BLZA 2FZ1A 3AP7A 4TN7A 2K9ZA 4LULA 5CFCA 2BDRA 4XMAA 4YZ4A 5FRAA 2WS93 1UMZA 1CVNA 2RV9A 3LFIA 3H8OA 1R092 3I2JA 1PK6B 4Q8KA 3LDRA 3NVCA 3HPNA 1PK6C 2J42A 5HCHA 2NPIA 5GZEA 1W6MA 1RUC3 5C3SA 4LXLA 3WF1A 3RI8A 4D6QA 5LZ6A 4QX0A 1ZRDA 1XRUA 1JZ3A 1AYN1 5FYVA 1L7RA 3AFGA 3AYAA 3THCA 1NYWA 3WHUA 3FUOA 1ZREA 3WCSA 4YM3A 2HYXA 2ENRA 4L8QA 4NRQA 3KLSA 3ECQA 3VD7A 3KMHA 4LE3A 2MPFA 1RJ7A 1VBA1 2ZABA 1IQDC 5FY5A 1YEWA 3I3QA 4Y3OA 5DAXA 3MI8A 4E2GA 1WMDA 1A78A 2QUOA 1US2A 1ZBA2 2BNMA 3KM5A 4R9BA 2JD9A 4NHXA 4Z82A 1OHFA 1TNRA 1NUKA 1YYNA 4ARYA 3I3MA 2ES3A 1LRHA 1PZ9A 3JD72 1UY3A 4WVVA 4JQRA 5T5JA 1KFUL 1HW5A 5ANNA 4W8JA 2AC1A 4KGGA 3VBRB 1S4CA 3N9NA 5DUVA 4XAAA 3LA3A 3VBRC 4LHKA 1SHWB 5H9RA 3WEZA 1XQNA 4D7SA 3S5AA 1H6XA 5FYSA 4NWWA 4XFFA 1A8MA 4I30A 2HWD2 2JICA 2W1QA 3M3EA 3ZXLA 3FFQA 3K48A 3URFA 1AL23 1DCSA 2IC1A 1NCQB 1LJ7A 3S0MA 3LOBA 1UU5A 1Y7BA 1NCQC 4K40A 3LDKA 4OI1A 1N3QA 4FFFA 3ZKUA 1UYZA 1KQRA 2CY6A 2YXSA 2ZGUA 5FJHA 3SKJE 4LBNA 4D7YA 4AXOA 1SCRA 1GMMA 2JKBA 3GJAA 3IT8A 2HWB2 2JJ6A 2WN3A 4JTNA 1AR81 1JXNA 1ZA4A 4JV4A 4CDUB 3ZXGA 2ETEA 3ZN6B 4CDUC 1MS4A 4Z2WA 4AHWA 5I0SA 1GP5A 4IW3A 2W1WA 3ST7A 2JDYA 4Q0QA 5FZIA 2XPJA 3WY6A 5DAWA 2ARXA 2W0XA 3FMGA 3M1HA 1DIWA 4AF9A 5I8YA 2WSUA 3TEXA 1SG3A 1XJAA 2GC3A 2XQRA 3UT0A 4P9XA 4Y22A 1OURA 2DVAA 2FBEA 4RHV3 3WOGA 2OQ6A 3AYCA 4WV8A 4OLLA 2ZMLA 5F5CA 2VJXA 3AMPA 2P37A 4IV1A 1CAWB 3T2PA 1G9CA 4C91A 1UX7A 5GZFA 3SH5A 1H4GA 3I2FA 4QB2A 3VDAA 1B35B 3FX3A 1TE1B 3OGSA 1B35C 5FXZA 1WLDA 4Y24A 4IEXA 1UD1A 2WFF3 3K4DA 2ZX4A 1QF3A 3NNGA 4LIVA 3WDWA 1TG7A 2JDMA 2VE1A 4GKXA 1BXHA 4XF0A 4Q0SA 1RUH3 4DS0A 3CKHA 4JKLA 1BQPA 4AGGA 4DUVA 1LOFA 2HEYF 4KH9A 5FDBA 3P5BA 5M0TA 4D8MA 2BOIA 1LHVA 3CF6E 1WLWA 5FZDA 2RS53 4AI1A 1FPN2 1QJY1 3LZZA 1PMIA 2DCKA 3AL5A 1ULEA 4QDQA 1WCDJ 1YHFA 2G9ZA 4FPFA 4HBNA 4MX3A 5A3LA 1BMV2 4CUAA 5AFEA 2XJUA 4GH4B 1LGBA 1XNCA 3MW4A 1PO13 2B4KA 2QQPA 3IN9A 4GH4C 2F4PA 3NL1A 1OT5A 3ZN4A 4AE2A 3HMYA 4J25A 5A6YA 2VC9A 1BKZA 4AFCA 2FDGA 3WX5A 2RJLA 1S1AA 2OPWA 3THTA 4HZFA 1C5IA 3CNAA 2AACA 1PGL2 2QKDA 3M3OA 5FQ0B 4DXZA 4ZZ8A 1R081 4YM0A 4BQ5A 5AVAA 1L3JA 4BHPA 2R7EB 2R073 1RUD2 2J1TA 4E2QA 1OBNA 2W92A 3WUDA 5I8TA 2WO3A 5DN2A 2PHLA 3VBOB 2ZZJA 2WZPP 3VBOC 4A6OA 1OA2A 2Y0IA 3J8F2 3K46A 3CQOA 3SITA 1Z7S1 3LPFA 1NG0A 4XURA 1A3KA 3T0BA 1AR92 4WM8B 4DEQA 2CWSA 4WM8C 1ZZ6A 2GALA 2XJPA 1AR62 3R05A 1WW6A 5EJ1B 1ZBE2 2Q30A 4XQWA 2GP3A 2GH2A 4K6BA 4G9SB 3OUHA 1KS4A 4N53B 4Q4Y1 4HT1T 3N7LA 3WG4A 4AI9A 2E63A 4N53C 4PDWA 2XBO1 3AZYA 5DABA 2WNUA 1YIFA 1W9YA 2JENA 2B39A 2ZPXA 3MF9A 1QDCA 3NAPB 2WO7A 2BJSA 3MFAA 3NAPC 4RGAA 4LEJA 1XSQA 2JG9A 3MYXA 1SEFA 5JZGB 4RA0A 4CU6A 5JZGC 2VUAA 4RYDA 2JDHA 4OMCA 1OQ1A 4YZ5A 1W6PB 4IEQA 3PUIA 2Q8OA 4UF0B 3ZSMA 2JE9A 3FHAA 3WNOA 2IXKA 1Y9MA 1PO22 1VBB2 1DYPA 2QFEA 2RDQA 4YW2A 4P9WA 2CL2A 2NMOA 2ZGQA 3MV01 3TN93 4J1WA 5DDJ1 1O3TA 5HV0A 2NM1A 1V00A 2C24A 2O8QA 2PHXA 3ASIA 4LQRA 3AVSA 5FZOA 3UJOA 1HRI1 1DQ2A 1UOFA 1TME1 3POGA 2RVAA 2RR13 1BBT2 1XNDA 3ME2A 4YLZA 5JPMB 4XFIA 1EPWA 1PMJX 3I2HA 4YW3A 4E8DA 4AAPA 4Y5Z0 5JIUA 2JD4A 1QJFA 1QJX1 1N47A 2VMDA 4XXPA 1OLQA 4CYDA 1MS5A 2QVSB 3DXUA 4INDA 3ETQA 2W08A 3MPPG 4XMIA 4E4HA 1LGCA 4XOGA 1UQXA 1YI7A 3MIGA 2P17A 4DUXA 3BIWE 1E5SA 1AVBA 5JR2A 3TOJA 1HKDA 4KU8A 1DGRN 1OMIA 1V6MA 4AVSA 3I97A 4B1MA 4Y4RA 4E4ZA 3AYDA 1NZIA 1CIWA 2JB4A 5F2SA 3POFA 5DAPA 2WA3A 4WVMA 2YFZA 2I2SA 5BYNA 3RNSA 4KBBA 2YC4A 5FWEA 3R4UA 5JI9A 4QKNA 5EYXA 1PM7A 3N7MA 1B09A 1EV13 1Q8QA 3HIFA 3VBHA 5CB7A 5A3MA 4LBQB 4LLFA 1S0EA 5FP9A 3G7DA 4CTEA 1AXZA 1AYN2 1RUI1 2R063 1EP0A 1VRH1 2JDUA 1H1AA 2KA3A 2SLIA 1CD3G 2QTWB 3KT7A 1YQCA 3GDBA 3DKQA 5K0UA 5FPBA 3AZVA 3S7EA 4XUTA 2IFRA 1NT0A 2UYAA 4QWNA 4BQ4A 3GJBA 5BNQA 1WD4A 3AFKA 4K7JA 2A75A 3L2YA 3DYPA 1O4TA 1V6OA 4DY3A 3Q8EA 1FNZA 1POV3 1UPIA 1XXNA 2RG4A 3MIBA 4LHSA 5CKMA 5L7OB 1QXJA 1GWLA 3E6DA 5L7OC 4GMP0 1QOOA 1W9FA 1W39A 1Q8PA 1W9WA 3ILFA 3LSDA 4XW3A 5FO7B 3VHRA 1RUNA 2G4IA 4F83A 3AB0A 2XOMA 2JDPA 1M06G 4YNIA 2EXIA 1K5JA 2JDZA 4DO0A 3D4KA 1PK6A 1QIQA 1UF2C 3FE5A 1U5XA 4M3CB 1GZ9A 3ACFA 2A6WA 5T50A 1RUF1 1RGSA 2XVGA 4YVWB 4Q0UA 2XLAA 1FMD1 3RZJA 4YVWC 4QPGA 3TNQA 4S2HA 3OPZA 4XTPA 4LHNA 2ERFA 1LOGA 4I3PA 4JQTA 5FYBA 3WW3A 3WD5A 3N7KA 3S7IA 4MGKE 2R1DA 1I5ZA 2EALA 2OUJA 4Y1VA 1UZ0A 1AHSA 1DYOA 2W87A 1W0NA 1IPKA 3B5LB 4DINB 2H0VA 2L9LA 1RUOA 1AR82 4FPLA 1HJFA 1Y43B 4CCNA 5FP4A 4LTAA 2VOKA 3WDXA 4Q2FA 1RUG3 2D3SA 3RWKX 3CLPA 1G86A 2VMEA 3VUOA 1H6YA 4COYA 4AHXA 4CSWA 2VR4A 1JMUB 3RMYA 2XWJB 3VL9A 1GBGA 4URTA 3A22A 1POQA 4FPEA 4NHYA 1GANA 2VU9A 3FL7A 5CA6A 5GLWA 1ASJ3 2IXCA 3AL6A 1S2KA 1Q8VA 1LHNA 3KV5A 1XU2A 4MZUA 4B29A 5KHHA 4OZXA 2VCCA 4Y5TA 4EJRA 3FBMA 1OI6A 1UU4A 1GWMA 3K3OA 4GB33 5A3UA 1YLLA 2ARAA 2WO1A 2XKPA 3MBWA 4RN5A 4WM7B 3AZZA 1H2NA 2X5IB 4WM7C 3POSA 4A45A 4BQYA 3CJIA 4IEYA 4EN9B 3ATGA 2X5IC 3H42B 1COV2 1UYYA 4AQTA 2GNMA 4GIQA 1QQP3 1UN1A 4CDUA 1ZRRA 4EYUA 3RRDA 3I3DA 3NQHA 3K75B 4FXKB 2JIGA 3WSOA 4HONA 4R4XA 4HXCA 4DZGA 3WF0A 1WMXA 5K4LA 2DUQA 4O7XA 4XQ4A 5DMYA 5EIYB 5FKBA 2ZGKA 1RJ8A 1MR5A 4G4FA 5LBBA 3DV8A 4M3CF 2ZS6B 3VZLA 2VNVA 4NIGA 2YUEA 1UY0A 5C4WA 4KNCA 4FPOB 5JXGA 4HN0A 5I0UA 4XFBA 1FXZA 3ZXEA 3CZUA 1CAWA 5EP9A 5F5AA 1FOD2 2IXHA 2XG3A 1R082 2YPDA 3WR0A 5KXEA 5C9AB 5J96B 1S2EA 3LA2A 3UKNA 2C0ZA 2VNGA 3O0XA 5C9AC 3HBZA 1B35A 3MF6A 3HJRA 2X05A 3E5QA 3JBG3 2JB8A 4RGGA 2VZUA 1V6KA 5FZCA 2EAKA 4I0WB 3SISA 4RR3A 1S0BA 1UOGA 2E9QA 3POJA 4AVCA 4I0AA 5I91A 1D4M3 4GXLA 1PX3A 2D93A 1Z7S2 2GMEA 4N9HA 3O5SA 1MS0A 3V64A 4LNVA 3NJXA 4Q4V1 2E31A 4FPYA 1RIRA 4AFAA 2EAAA 2P2KA 3D3AA 3I2IA 5LWBA 1H30A 1LCLA 2PXJA 3DF0A 3KCXA 4QX5A 4TSVA 1UNBA 2XONA 4Q4Y2 1RMU3 1RUE1 2YPJA 5B4NA 4XUNA 5IVBA 5DUXA 1YQ2A 2XBO2 2E7AA 2ZGOA 4A44A 5C6CA 1CN1A 1Q5OA 2EXJA 4KG0A 4QX7A 5FXVA 4A42A 3ZXAC 3V0BB 1CAUB 1C57A 2UWBA 5IVVA 1BVP1 2DBNA 3BGAA 2VOVA 2OX0A 3FHIB 4W65A 1Y3TA 4NE9A 1HB4A 2VMIA 4FP2A 1PVXA 1JU3A 2W39A 4GWMA 4BK4A 3I54A 3ZSJA 2P4EA 2YB7A 5HCAA 3FN9A 4LK6A 4LUMA 1LECA 1YFUA 4K9SA 1N1YA 4W4ZA 1HN1A 5C8CB 5DDJ2 5C8CC 4YM2A 2FHRA 5CNAA 4WM8A 4CCOA 1FYUA 3PNAA 5H9SA 4LR4A 5IJRA 3VLBB 3KV9A 2ZGLA 1HRI2 1G6NA 4UFKA 2HWD1 2Y34A 5FY9A 1TME2 3C7OA 2B46X 2XLFA 4XDPA 5E89A 3H7JA 3IZOA 2VTXJ 2YYOA 4GMP3 4UYBA 2VZ1A 5I8SA 1QJX2 4P9LA 2BTVC 5A6ZA 1TMF3 4QD2A 1W28A 3NAPA 3OPTA 1K5MA 3MIFA 4AFBA 1SZBA 5F3CA 3RZMA 1LU1A 2QNKA 1MEC3 3C7HA 4DY5A 1VBE3 2GNTA 3H9AA 4C8DA 5JZGA 2QDRA 3BIEA 4QXKA 3C7GA 1JH5A 1XC6A 3IIAA 2OIIA 1W04A 2J1EA 1W6PA 1OF3A 1US3A 4UF0A 1YUDA 3WP5A 2JX9A 4CCKA 4NO4A 3H3LA 3W59A 2YGLA 2JWPA 1SLLA 1NOVA 2ZGNA 4ET7A 3PUQA 2FDFA 2SBAA 2WINB 2ZX3A 4XEZA 4A41A 2EXKA 1DG6A 2DCJA 2P6CA 1LOEA 2X10A 1JBCA 4JRAA 3IMNA 1HQWA 1NE6A 1VBC2 1YCIA 4PCRA 4X6QB 1C3HA 3VZOA 5A6QA 2WFPA 3HNYM 2BWAA 5T5LA 4CDQA 1W6NB 5JPNB 4G3YC 4BWOA 1IPSA 4GD4A 1QJEA 3EHKA 5DZGA 5FYIA 3VDDB 4CEYA 4ITCA 3IPVB 4CCMA 1SFNA 3VDDC 2A6YA 4BIFA 3N9OA 1O7FA 5CAZA 4XZUG 3NV1A 4JCKA 4ZHNA 1SFPA 1VP6A 3TAYA 3WF3A 2PLV2 2P3JA 3JUUA 3KD4A 2VPVA 4HG6B 4V2WA 3NO8A 2RS13 5FJKA 1J3RA 2VTXA 3GBWA 4QU2A 4IE7A 2ZHLA 2B42B 3OF1A 3WNLA 2FCVA 3EMRA 4IV3A 1E5HA 1YQ6A 1BMV1 1V6IA 3ZSLA 3ITQA 5ACA3 4QX2A 1J3QA 4Y20A 3OG2A 4IE4A 4XFHA 3BTYA 4QKDA 3C2UA 4IEZA 1S55A 3ON7A 2VZPA 3C3VA 1RUF2 4LBQA 4MGZE 4PF5A 5F39A 4JGYB 3T08A 1KITA 1U5ZA 5FZ7A 1FMD2 4JGYC 5T55A 2G19A 2XVKA 2A3XA 1CONA 1AJKA 3AKSA 3TN91 1FI2A 1JW6A 5F6LB 2I74A 3BVCA 3M3QA 1C4RA 1BZWA 4QHBA 4FPCA 2VH9A 3V0AB 2PFWA 5J98B 2ZEWA 3OBTA 4MSVA 1RUD1 3K4ZA 1AR71 4IGOA 2ILMA 3O7OA 4NPRA 5TSWA 2Y6LA 4MVTA 4XZPA 4C0BA 3T4VA 1ZRCA 1XE7A 2Z5WA 2O8OA
chains in the Genus database with same CATH topology
3HR9A 3ILRA 2JECA 1NY71 3BTAA 4NVPA 3FWEA 5KBFA 5JDBA 1V9U3 3BCWA 5IK8A 2BQPA 3TNPB 1DLLA 1HRV3 2RHPA 3AXDA 4YVWA 4AFDA 5BNPA 3EO6A 1EV11 3ZFEB 2BGCA 3ZIWA 2Q1ZB 3ZFEC 3OTFA 3NWKA 3JCIA 1UU6A 1MQTA 1GZCA 2D6KA 3PLQA 1DQ5A 1UKGA 1Q3EA 2Z2SB 4ISQA 4JAAA 2BW8A 3N35A 4JDMA 4BH9A 4QM8A 4HK8A 1PIV1 1VBB1 2XH6A 4COUA 5HXVA 3DUIA 3OYWB 4N90A 5JOZA 3NJZA 2X8KA 1EAH3 2HEWF 4IEPA 4IXLA 4LBJA 1YFYA 2QZ2A 2O1QA 1AYM1 1YNAA 1H2KA 2GN7A 2LUWA 3V65A 2WKKA 3ACLA 1DQ4A 4LLOA 2C5DA 1ULCA 4FOVA 3VHOA 2DVFA 4D7TA 3J9SA 4Q4W3 1OFNA 4QMAA 1IQAA 4BA6A 3RYKA 3MLJA 4S2GA 3MW3A 1VAVA 3KZ4C 1CPMA 2A3WA 5F6KA 2EA7A 3RDIA 3DPRA 1JUHA 3RMXA 4R9DA 3BU7A 1RVF3 1X82A 2MHFA 2RM21 5CBLA 4Q4V2 2D6PA 5CIRA 3PVEA 3B00A 4LO4B 1OD5A 2HWF3 1KRIA 3QCWA 4JC1A 4KWLA 4NHLA 1RUE2 3B94A 2V09A 4I2OA 1VR3A 1IKPA 4XTMA 3SCGA 4YW4A 3PVBB 2ZBJA 4LO8A 2YMZA 4NR1A 3ALQA 1ZZCA 2UYBA 1SLTA 1O4ZA 3RWNA 3VBFA 3D8CA 4DQAA 4HPKB 4N9IA 1ASJ1 2D7FA 4F8AA 4Y26A 3LOIA 2MEV3 2QDNA 2PHRA 1IS4A 1NCRA 1RITA 3WW1A 4FBFA 4AFMA 2VOXA 3AKPA 4OFGA 3S30A 1FT9A 1XYOA 5BNNB 3VL8A 5DUUA 5BNNC 3QH6A 3AZWA 1OOPB 2JXAA 2IXIA 1OOPC 3GALA 1TEIA 3VV1A 4Q8LA 2DFCA 4OHYA 2AUYA 3PVOA 2YY1A 3RI9A 1S0FA 3KSCA 5JOYA 4D69A 1PO12 1AUYA 3V0BA 1CAUA 1S0JA 1VB4A 2D6LX 2R043 2JE7A 3H1MA 2HYKA 4IL7A 2DUPA 1BYHA 3DN7A 2A73B 4S2FA 3VBUB 2QCSB 2VVDA 3NW4A 4KQ7A 3VBUC 3HAGA 3O14A 2A5ZA 4KWKA 1NA1A 1QKQA 3LKJA 3W9AA 5A32A 2E51A 2R072 4E27A 1VB2A 2DFBA 2TEPA 3ZMOA 1R093 4UBHA 3E97A 3RQ0A 3VKOA 2PHUA 1U5IA 1OA4A 2ZMNA 2TBVA 4DNYA 1BEV1 3WCRA 1AX1A 4XDQA 2E7QA 4KU7A 1C8M3 2VXRA 3B7MA 4BIOA 4COZA 1KJLA 2ZGTA 1YO8A 2DUOA 3MFCA 3MW2A 4RS5B 4R52A 4P9IA 2NN8A 4GKYA 1AX0A 4RS5C 2VNRA 5SV5A 1CQ9A 4PLOA 1ND2A 3AJZA 5DUWA 3ZN5A 4UBGA 4BYYA 4YZ2A 2BBVA 1FAYA 5FPZA 3WG3A 1COV1 2NLRA 4Z8BA 5DG1A 1CESA 2B8MA 5KHIA 5I0RA 4YZ3A 2NQYA 1REFA 1X7NA 3H0OA 5FREA 1QOSA 2HWE1 4GALA 3ZYGA 2IXJA 2RS31 1ONAA 3JD73 3NV2A 2RMU3 2XJTA 2P3KA 1FNYA 4N43B 3BODA 2I07B 3HT2A 4N43C 3SH4A 3TN92 2D97A 3WP3A 5FOJB 1FOD1 1MVEA 1Q8SA 3ZYJB 1W6NA 3VGIA 2Q1MA 1ND3B 4YM1A 1GSLA 5BPXA 1WMFA 1ND3C 1QU0A 4YFWA 4OI2A 1AR72 4L2NA 2Z79A 4CZSA 3J4UH 2VOWA 4PIZA 3WDYA 4K8FA 5BY5A 4R8HA 3ZFGB 1VALA 2KXLA 4RQPB 3ZFGC 2HWB3 4QQOA 4RQPC 1NY72 3PTYA 1O91A 1OA3A 3LA7A 3WG2A 2BYVE 5FBZA 2WLPA 3I8TA 1PHMA 3MIHA 4AEMA 4QPIB 4YGEA 1VBD1 1TQ5A 4QPIC 3VZKA 2WZR3 4OHZA 4Q29A 3KS7A 4Q0VA 5FPXA 2AYHA 1EV12 3O0VA 1W2UA 4IESA 2YROA 2HWC1 3PJYA 3FFZA 1F5JA 2N7GA 1DDLA 3V0AA 2HJIA 2R062 1QJU1 4Y1UA 1DU3D 2VGDA 3WVJA 1H4HA 3KCYA 1GR3A 1PGSA 3EBRA 4MV2A 4Q4X3 3BOPA 3WLUA 1MS8A 1HDKA 5D1IA 3AK0A 3VZNA 1PIV2 1WCKA 1N1SA 4D3WA 1PNGA 5K8SA 4FO9A 4LE4A 4FTSA 5E1RA 1YWKA 2B9UA 4KWJA 1HV1A 1FPN3 2XLGA 1PZ7A 5F9TA 1KD7A 5EWSA 4FT8A 4BLJA 4YFZA 1R1A3 2BEOA 2DCTA 4FAGA 3W58A 3B9CA 3J26N 4UW3A 1AYM2 3E5UA 2CNAA 3RYRA 3EQEA 3WP4A 4YVSB 2CAUA 5IT6A 5FLHA 3EXUA 4YVSC 2JG8B 3VHPA 2JG8C 3USUA 3I4IA 1WBFA 2RE9A 5KHGA 1DYKA 4NHKA 4EWAA 4XILA 4GQ7A 2R32A 3M2MA 1CJDA 2DF7A 1GZWB 1UPSA 4HFSA 4FPHA 2RM22 5E16A 4H14A 3J8F3 3G6JB 3ZFFB 1CR7A 4ORFA 1KDKA 1OSGA 2X29A 3AMMA 3PVNA 4L11A 3ZFFC 1XNBA 1IS6A 1U5YA 3HD8B 1AR93 3NV4A 1H2LA 1VBC1 1ENSA 3NV3A 1AR63 1S0CA 1RHI1 4ZU7A 4AWDA 1ZBE3 5CG9A 2YGMA 1W6OB 5GZGA 4DOUA 3P3NA 4BCUA 4N7IA 3LCPA 1WGPA 1XNKA 4C0HA 2XWBB 1GKBA 2PLV1 1RC6A 1ASJ2 4YGCA 5JR7B 3LGRA 4I3GA 5FFOC 3INAA 4AVVA 2DURA 3WNXA 3U4XA 3DGTA 4AEDB 2EF6A 1W6QB 1NXMA 2XB6C 1DQ1A 4AEDC 3VZMA 2LTNA 5L36A 3IDCB 2H6CA 3WW4A 1PO23 1UCXA 2D44A 4C90A 2LM3A 4JVAA 4XFGA 4JRLA 4LO6B 1C28A 3SMHA 4EWDA 3VKFC 3BPZA 1OPMA 3ELNA 4HSJA 1BBT3 1RUJ1 4DRRA 2ZGRA 3OGGA 3QACA 4Q1RA 5J48A 1ULGA 3WINE 4FSJA 2WT0A 3SHRA 3VHNA 3H1WA 2ZAAA 1MS1A 1PVC1 5IK7A 4SLIA 2Q0AA 4H3WA 1LULA 4XETA 5KWRA 1J58A 1X8EA 2D40A 4YW1A 1H2MA 1DQ0A 3JBG2 4WZFA 2QZ3A 4IETA 3V56A 3VBRA 1U12A 4Q1PA 4S2DA 1HXS3 2WS91 3RPQA 5FCCA 4HL0A 1O5UA 3THPA 3VBSB 1BEV2 2WL1A 2DVGA 3E5XA 2WQ4A 1OOPA 2D3PA 3VBSC 2VNOA 1AYN3 4GA9A 1RUC1 5KXBA 3VKLA 3I7DA 1NCQA 2HWF1 4QPYA 4DPNA 1F5FA 2CGPA 1VBA3 3CEWA 3UL2A 2PAMA 5DZFA 4MGIE 3ZXFA 5IK4A 2TUNA 1D2QA 1H9WA 5JVVA 4Q0PA 4U36A 4HK9A 3ZN6A 3AP9A 1O3SA 5BNOB 5J09A 2HWE2 1D0HA 2P3IA 3QD6A 5BNOC 2RS32 2DWRA 2E7TA 1MS9A 1EYBA 2Z69A 1I3HA 2A6VA 2ATFA 2WNVB 4CP0A 2WNVC 1IS5A 2NZ9A 5GZDA 2ZGSA 5CFCB 4QQLA 2QJVA 5CFCC 2LALA 4QM9A 1D2SA 4XJUA 4HVQA 5CG8A 3O0WA 1RINA 2XL7A 4MXVA 4OUMA 3I2DA 4BMEA 5LEKA 4NHMA 2PHWA 1W6MB 2OW4A 4AVBA 1GQHA 1S2BA 1JUIA 1H0BA 3RZZA 4LO5B 1OKQA 3OY8B 1AL21 1YJLA 3KT4A 3CL1A 2D6MA 4XJZA 1FV2A 4FXGB 3A0KA 1TMF2 5BV6A 3IWZA 1MEC2 3SH3A 4AI0A 1VBE2 4BQ1A 4MXWB 4CDXB 2GU9A 5H9QA 3SNMA 4CDXC 3WDUA 4GH4A 1VBD2 3JQXA 2ZX1A 3K51A 4M3CE 4QGMA 4ASLA 5C8WA 5K7PA 2XJSA 3AXEA 2Z42A 1IPJA 2GN3A 3ZYPA 2WIIB 3M8LA 3IM0A 3GZTB 3LSEA 1HQNA 5FQ0A 2HWC2 4RHV1 4A2UA 2A6XA 1GNZA 2ZHMA 1QJU2 3HWJA 4Q27A 2EVXA 4B3NA 1YXWA 4AHYA 1C8M1 4W6XA 3VBOA 2GDFA 2Y26A 2R49A 1HV0A 2OVUA 5GLTA 1IOAA 2OZ6A 5EZWA 2WWSA 2TNFA 4AGRA 2WFF1 4RQPA 2GMPA 1RUH1 1C5HA 1QJY3 1D0GA 2PHDA 2RS12 1VAKA 4HETA 2RS51 4AK3A 4A7YA 1QOTA 4Y1ZA 4L9BA 2V5YA 4ISRA 5CFDB 4N53A 5CFDC 3ROUA 1QXRA 1ZZBA 1CJPA 4HVRA 4PQ9A 1PO11 1DZRA 1DZQA 5JMCA 4Y22B 1SFYA 3AZXA 3AMNA 4IV1B 4PLNA 2VECA 3CU7A 5EFUA 4IV1C 2DU1A 1DGLA 2R071 1VIWB 2BUKA 3A0NA 5HBAA 3EJKA 3I59B 2FMDA 1Z7S3 4LT5A 1GYKA 4ATFA 2CGOA 2XGXA 4HKOA 4M00A 1FV3A 4B4QA 2ZX2A 3SXWA 1RHI2 2DYCA 3AMHA 3WZ1A 3HN1A 1IGOA 1ZM1A 1X33A 3UV9A 4ZKTB 1V9U2 4YVSA 2BPA2 5AVPA 2UURA 1ZZ7A 1LU2A 4P14A 2G9GA 2CTVA 2VW2A 1O4YA 3MEPA 1DZTA 1J3PA 4FTEA 3OD4A 4FVVA 5CVRA 4E9KA 4XQDA 2ET7A 2P34A 1SLAA 5EYYA 4LBOA 2BNNA 2D43A 3ZFFA 5F5QA 2ZOEB 1QDOA 1APNA 3AP4A 1HRI3 2K0GA 2VW1A 1EAH2 4XJWA 1W6OA 1N3OA 5DG2A 1TME3 1RUJ2 1XYPA 1R1A1 3AMQA 5JSRA 1QJX3 3VKMA 2RR11 3RJRA 4A7ZA 2XKOA 4ASMB 4C1WA 5L7OA 5AC93 4Q26A 1PVC2 2PQQA 2R30A 3FLPA 5K9YA 3B93A 1N1VA 4Q4W2 2W52A 4YGBA 4B4PA 4XF4A 4CP2A 4AEDA 4DRVA 4XF9A 1I6XA 1LEMA 3UKTA 3AM2A 5IK5A 4M3CA 3WDVA 2AENA 1IKQA 2WS92 2OZJA 3R0RA 2OPKA 4HMZA 4UXAA 3ZSKA 1RVF2 3KCCA 3SLIA 4B7KA 5FTTC 1XYNA 2QE3A 1RUI3 5KXCA 3T1LA 1RUC2 1VRH3 4E4DX 2K2SA 4XIKA 1J1TA 2HWF2 3WT3A 2BNOA 2R061 3RS6A 3USSA 2DVDA 4B7EA 1O3QA 1ZNPA 2Y38A 4DMIA 3QLQA 3GBFA 4FOWA 4FPKA 2ZTNA 1G8WA 4AG4A 1LEDA 4EN0A 1ULDA 4LBMA 4CEWB 2Q4SA 4Y1YA 1POV1 4CEWC 3MLLA 5GLVA 1AXKA 1UZZA 3HQXA 1SCSA 5KHKA 5BXXA 4H7LA 2ZJCA 1J59A 1KXGA 4BE3A 3M3IA 4A3XA 2D98A 1RUF3 3VBSA 4OVEA 1FMD3 3M3CA 5GZCA 4M0HA 1J1LA 4BMBA 3RJ2X 3WUCA 3VBHB 1UX6A 3VBHC 3VN4A 4P9YA 4EV0A 1NQDA 1HIXA 4LA3A 4F3JA 1XU1A 4FQZA 1SBEA 1AL22 3APBA 4WM7A 4F7ZA 2X5IA 4KG8A 3Q9OA 1DFQA 2C9AA 1VJ2A 4B8EA 3DL3A 4R9AA 4FTBA 4I09A 4HLTA 1NXD1 4QGLA 1LHUA 2GZWA 1OFSA 1LHOA 1UKRA 2WNVA 5A33B 1RUG1 3VKNA 2PHTA 4JDOA 1KFXL 3D0JA 5E8AA 2DTYA 5ABJB 1C1FA 1RL3A 1WD3A 4RHV2 2D6NA 5ABJC 1HXS1 1Z0HA 1R1ZA 5AFBA 3H50A 5I0TA 5C9AA 4ES8A 2GC1A 2Y0OA 4XF3A 3LB9A 5JIAA 1QGLA 1C8M2 4QPGB 4QQ2A 4TWTA 1CPNA 4COVA 3OY8A 4QPGC 2DVBA 4MGYE 4W6WA 5FMOS 5J36A 3FLTA 3ZVXA 4GB31 3WHTA 2WFF2 4HN1A 4XF1A 2FZ2A 1SBDA 3D6EA 2DCYA 3MDPA 1RUH2 5LRSA 3D0SA 4K21A 4V1PA 4MXWA 1QQP1 2CYFA 2XL9A 2RS52 2VMGA 1AL0G 2A3YA 4CDXA 1HQLA 3E6CC 1YJKA 5KC6A 4BM8A 1VAMA 5GLZA 4XPVA 2R16A 1LOCA 1CAXB 2PHFA 2IXLA 2RMU2 4XBLA 1I9RA 2A6ZA 2AZ5A 1RTVA 4TLFA 1IS3A 5T5PA 3U10A 3ZDSA 4TYSA 2NYYA 3GNEA 2BVBA 2KM2A 1JYIA 1IZ3A 4PJYA 3JBG1 1AX2A 1RB8G 5C8CA 1LESA 4E2SA 4LUKA 3B3QE 4O9GA 4AQ2A 4YG6A 1UIJA 5LEJA 1D4M1 2VQ0A 3CJIB 1LB2A 4Q4V3 3TRSB 4FP3A 3BALA 1FATA 3CJIC 4XBNA 4YSFA 5LK5A 5CFDA 4LBKA 1JHNA 3ZYRA 1RUE3 3FZ3A 3L2HA 1WW4A 3FJSA 1RMU1 4R4ZA 1SMVA 4CDWB 1POV0 2WZR2 5JCTA 1WCSA 4UW6A 4CDWC 4NN0A 5BUVA 2XVLA 1PZ8A 4TZDA 2GC2A 5C4WB 3N7JA 5LK7B 2I45A 1QMJA 1ZBA3 3DKWA 4NOTA 3TYJA 1F9KA 5C4WC 1E57A 3TBDA 1NE4A 1YI9A 2IWGB 1MZ6A 2B7YA 2CWMA 4Q4X2 2XHKA 3ZXDA 4AW7A 1LHWA 2PN5A 1REDA 1KS5A 4I02A 1X8MA 3I59A 4RR3B 3KGLA 1JOJA 3OGJA 4RR3C 2WC2A 1N3PA 4MH0E 3QH7A 5JOXA 2HWD3 4X8PA 4K20A 3WDTA 2CV6A 3VDDA 3IPVA 5JSPA 1R1A2 4YGDA 1GICA 2RR12 4CRQA 1YFXA 1URXA 4GMP1 2PAKA 5D8AB 3ES4A 1MS3A 5D8AC 4XXAA 3WP6A 1NZCA 1TMF1 2GC0A 3B9IA 1MEC1 1ALYA 1VBE1 4QT6A 2E53A 4XYXA 2IFWA 3M4FA 1LOBA 3IKWA 1CAVB 5KC5A 4IQPA 3WQ7A 4JGYA 4AI2A 3PJQA 4JTOA 4XFCA 1Q8OA 1Q43A 2AREA 1S0IA 2ZGMA 5EXOA 1LOAA 1X36A 3ZO0B 1ZYBA 3MIEA 1Y9QA 1M4WA 4ZU5A 1AJOA 2VG9A 3H1YA 1LKNA 5J3UA 3WV6A 3MGUA 2UWCA 1QXPA 4WVWA 1SLBA 4RL7A 2R0HA 1H8TB 1OLRA 4XJ8A 1H8TC 1C8NA 3GF6A 1K5MB 4HVOA 1BK1A 5L19A 2BFUL 1K5MC 3AP6A 1QNWA 2RS11 3GZAA 4FAHA 2VY0A 2D6OX 4AEKA 4XBQA 4OUSA 5GLUA 3POWA 3T1MA 2EXHA 2XUMA 2VVFA 1AZDA 5ACA1 3ZIXA 5J37A 1BJQA 3IDBB 5C33A 3ZFEA 3MZHA 4HKLA 3OBRA 4EWEA 4WVZA 5I93A 2FQPA 3JB8A 1QH6A 4BOWA 4IEOA 1AF9A 3FC0A 4YM0A 2WQZC 2B45X 3GHMA 2GMMA 4FPGA 3NSTA 2R0FA 1RUD3 1LODA 4CDQB 4COWA 4Y1XA 1AR73 3TWIA 2YZ4A 4CDQC 3FUQA 1DHKB 2YHJA 4CEYB 4GULA 4CEYC 3PHMA 4FOYA 3OYWA 4CEWA 1YIPA 1PGW2 1MZ5A 3FBYA 5AC91 2XJRA 5EJ3A 2GAUA 4OHWA 4H55A 1X50A 2ZHKA 1DBNA 1RUG2 4UW5A 3WQ1A 1SLIA 4GWNA 5IUQA 4IV3B 5HCBA 4AEJA 1V9U1 4X8NA 1Q56A 4IV3C 3WQ0A 1H1IA 2WNEA 2H6BA 1O3RA 4Y20B 1HXS2 1ENXA 2A71A 1HRV1 3BB6A 2OYZA 2AGSA 1UL9A 4ES9A 1WLTA 2UU8A 4FPJA 3OCPA 4NWVA 1PNFA 3D82A 1WA4A 2AH2A 4PLMA 4GB32 5T52A 5GM0A 1H8VA 1PIV3 1VBA2 1VBB3 1ULFA 1ZRFA 4L97A 4U2AA 1QQP2 2ZAHA 5GKAC 1ZZ9A 4LHLA 4AGVA 1I1EA 4Z07A 1ZX5A 2VQAA 2ZKLA 4LBLA 5A33A 4BPZA 1EAH1 3U07A 3H8UA 1DF0A 4JGZB 2XJQA 5JSOA 3LAGA 4JGZC 1AYM3 4AVAA 5ABJA 3AKQA 1SQ4A 2E6VA 4BLIA 4DFSA 2JEMA 3B69A 4XFAA 2VULA 1UAIA 4HKWA 4ONUA 4AI8A 4HPKA 1A6CA 2Q5TA 3ZXJA 1XE8A 1AXYA 1D4VB 1QHDA 1G9FA 1UW8A 4YARA 5BNPB 4M01A 5BNPC 4Q4W1 1O5LA 3U0ZA 1MQTB 4PBOA 1MQTC 1QNYA 3A4UA 5B2GB 5BNNA 3RG0A 2DCZA 2GSYA 2RM23 1D4M2 1RVF1 2YV8A 2BFUS 3R4SA 3X29B 4YW5A 2R1BA 5GJ6A 1REEA 1W0PA 1QH7A 2PA7A 2UWAA 1V6JA 2VW0A 3WXPA 1RMU2 1G9DA 3AKTA 4XJ9A 1U0AA 1CAXA 4I0BA 5FLJA 2YC0A 3MPBA 1SDWA 4MYEA 4O9EA 3OJBA 4FQ4A 4KGQA 1N1TA 2B5HA 4EROA 2WA4A 1GFF2 3VBUA 5JIUA 1QY4A 3QBQA 4D94A 2HKXA 4W6YA 4YG0A 1LENA 5KHJA 4OHXA 4QQHA 2PTMA 3HT1A 1KJRA 2MEV1 1JTZX 3N3HA 5JAXA 1MVQA 3H3ZA 3CO2A 4IEUA 3DPRB 3NKGA 3DPRC 1ZVFA 1QJY2 4YYOA 5HI0A 4AQSA 4RS5A 1EY2A