5BXXA

Crystal structure of the ectoine synthase from the cold-adapted marine bacterium sphingopyxis alaskensis
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
121
structure length
121
Chain Sequence
b'MIVRNLGDIRKTDRNVRSDGWASARMLLKDDGMGFSFHVTTLFAGSELRMHYQNHLEAVLVLKGTGTIEDLATGEVHALRPGVMYALDDHDRHIVRPETDILTACVFNPPVTGREVHDESG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-ectoine synthase
publication title Biochemistry and Crystal Structure of Ectoine Synthase: A Metal-Containing Member of the Cupin Superfamily.
pubmed doi rcsb
source organism Sphingopyxis alaskensis rb2256
molecule tags Lyase
total genus 27
structure length 121
sequence length 121
chains with identical sequence B, C, D
ec nomenclature ec 4.2.1.108: Ectoine synthase.
pdb deposition date 2015-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06339 Ectoine_synth Ectoine synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5bxxA00
2ZKLA 4YYOA 3S7EA 5LRSA 5CU1A 4HSLA 1H1MA 3BU7A 2IXHA 2Q4SA 3M3IA 3ZDSA 2F4PA 3I54A 4I0AA 4IETA 4IESA 1CAWB 4AQ6A 1RC6A 5I0SA 5JCTA 5KHJA 4OFGA 1WLTA 4EWEA 2UY9A 5LEJA 3FZ3A 3LA7A 4PIZA 3NJZA 1GQHA 1EY2A 3R6SA 3QACA 4PJYA 3WW2A 4LA2A 4HVQA 3TNPB 1U12A 4AVBA 3LWCA 4J1WA 1O4TA 1Q3EA 3I59A 4XF1A 2PHLA 3OCPA 1QXJA 1FXZA 3NW4A 3LA2A 5I93A 1Y9QA 1O3TA 3G7DA 1TQ5A 3L2HA 2O1QA 3CO2A 4XF3A 1WGPA 4QX5A 4Z82A 1X82A 3BCWA 3H1WA 2PHDA 2QNKA 4P9GA 3H9AA 1SEFA 5FLHA 3SMHA 1QXRA 2D93A 4IEOA 4E2GA 3NSTA 5FQ0B 2EA7A 3CF6E 2QCSB 5KHGA 3ELNA 3H1MA 1XRUA 5FLIA 1I5ZA 3KGZA 4Q0QA 5KHKA 2B5HA 1PMIA 2D5HA 4K8FA 2Q30A 4FT8A 1ZRRA 3FJSA 4XFGA 4BIFA 4IEXA 4YRDA 3U10A 4HZFA 3USSA 4IEPA 3S7IA 3BALA 2XLAA 2C0ZA 5I91A 1ZX5A 1DZRA 3SHRA 2GZWA 1NZCA 3H3ZA 1O3RA 3ROUA 1RUOA 5JSOA 1DZTA 3RYPA 4X6QB 3DL3A 3MYXA 4QXKA 4NVPA 4XFAA 1LR5A 2BNOA 4E2QA 2HKXA 5AVPA 4I02A 1VJ2A 2OZJA 1J58A 1I6XA 1SFNA 2D40A 4QGNA 1ZZBA 5FPZA 2OA2A 5I0TA 2QVSB 3FX3A 2XLFA 3IDCB 1J3RA 1WA4A 4R52A 1OFNA 3SCHA 4MGYE 5D1IA 5J48A 4BH9A 1FI2A 1O5UA 5I8TA 1CAXB 2QDRA 2B9UA 2K0GA 2MNGA 3NVCA 2HJIA 3KGLA 1UPIA 1ZVFA 1ZRDA 4LLOA 3LZZA 4IEWA 4UBHA 2N7GA 3RYRA 4EWDA 2PFWA 2O8QA 4ZU5A 1J3PA 2FQPA 4ZU7A 2XKPA 3TNQA 5KHHA 5C8WA 1RGSA 2Y0OA 1O5LA 3H7JA 3KSCA 3E97A 2IXIA 2XGXA 4HN0A 4WZCA 4FAHA 2MPFA 1UW8A 2H6CA 3RZZA 4L11A 5CVRA 2P17A 5BY5A 3IWZA 1UCXA 2GC3A 1CAWA 4A2UA 2B8MA 4XFCA 2XL7A 4IEUA 4TLFA 4KU8A 1ZRCA 2IC1A 2K9ZA 2EAAA 5J7MA 3SXWA 2PAEA 5JR7B 4IEYA 4KWLA 4YNIA 2PYTA 3M70A 1ZZCA 1Y3TA 2XLGA 3OGJA 2VECA 2UY8A 5KBFA 1YFWA 5I0RA 2Q0AA 4R8HA 2I45A 1QY4A 1VR3A 3S0MA 2H0VA 2BEOA 1ZZ8A 4FAGA 3RNSA 2V09A 2CAVA 3NKTA 4FBFA 5T3NA 1CX4A 4O9GA 3ACLA 4N9IA 5HI0A 1LB2A 3KCCA 3BB6A 1V70A 1ZREA 3D82A 4EROA 2UYBA 1IPKA 1NXMA 1YHFA 5FQ0A 2EVXA 2PAKA 3GBFA 4QM9A 2GU9A 4Z07A 4XF9A 4D7SA 4KWJA 4JTOA 1XE7A 3WW1A 2WC2A 3E6DA 4QGMA 1OD5A 3ES4A 4D7TA 3JZVA 2GC0A 4ONUA 1HW5A 1O7FA 3EQEA 3GYDA 1FT9A 1H1IA 2KXLA 4WBBA 5E16A 3U0ZA 3UKTA 1X7NA 3WW3A 1UIJA 3FFQA 1CAVB 4OLLA 5KHIA 4I2OA 1UIKA 5FPXA 2IXLA 4RD7A 4HBNA 2DCTA 1Q5OA 4Q0SA 5BXXA 2FMYA 1YFUA 4XFHA 3HQXA 3VHRA 4XFFA 3E5UA 1CAUB 1EPZA 4Q29A 4QM8A 3IBMA 4WVZA 4AVAA 4HVOA 5BV6A 4AVCA 1J59A 3H3UA 4GULA 1GQGA 2XL9A 4CYDA 4Q0PA 1O3QA 2D5FA 2CAUA 2XHKA 2VPVA 1CAXA 4E2SA 5FLJA 1Q43A 3ETQA 4I3PA 2GC1A 2GAUA 5EFUA 1J3QA 3SCFA 3E5QA 3LOIA 3ST7A 4B29A 2OYZA 3NL1A 3HIFA 1OMIA 1G6NA 2CV6A 4QGLA 2OZ6A 5C6CA 5BUVA 4XFBA 4PIYA 1ZRFA 3CL1A 3KMHA 4MUVA 4YARA 5JSPA 4I0BA 4UBGA 5I8SA 3CJXA 3ES1A 4XF0A 3QOPA 4PIXA 4F8AA 4ORFA 4X6RB 1X8EA 4LUMA 3FHIB 1EYBA 5FCCA 4XF4A 1CGPA 4MV2A 2ATFA 2ZCWA 2MHFA 1NE4A 2OPKA 3EJKA 4AXOA 2H6BA 4MGKE 3IDBB 2IXCA 3SCGA 1DGRA 3FE5A 3LA3A 4KWKA 4L2NA 4XETA 5F1RA 2XKOA 4F7ZA 5I8YA 4BHPA 1JUHA 5EZWA 3UKVA 5CADA 5FDBA 3I59B 1YWKA 4KU7A 2E9QA 1X8MA 5J3UA 4IERA 4IEZA 1RUNA 2GC2A 1ZZ7A 4HLTA 3PVBB 1ZZ6A 2GH2A 1SQ4A 1RTVA 2IXKA 4XFIA 3H8UA 3LAGA 5JAXA 3PLQA 3DV8A 1O3SA 3C3VA 3H7YA 1NYWA 2ET1A 3O14A 1EP0A 4KL1A 2IXJA 2PAMA 2VQAA 5I0UA 3RPQA 1VP6A 3HT2A 4J1XA 1YFYA 5BPXA 5LEKA 4IEQA 3N4MA 1J1LA 3MPBA 2UYAA 2ET7A 3OTFA 3E5XA 3D0SA 1LKNA 3FWEA 3OD0A 1ZZ9A 3DN7A 4LTAA 4Q0VA 1LRHA 4Q0UA 2CGPA 2Z2SB 4N9HA 3E6CC 5LRRA 4I01A 4MZUA 1UD1A 3UKNA 3B02A 5E1RA 3EHKA 4LUKA 4UXAA 4DINB 1CAVA 2PTMA 3DKWA 3MDPA 1L3JA 3D0JA 3U11A 4IEVA 4O9EA 1QWRA 2BYVE 3I7DA 1IPJA 1PM7A 2QJVA 1OI6A 1XE8A 4AQ2A 2PQQA 3RDIA 4EWAA 2Z69A 4EV0A 2BNNA 2ETEA 1RL3A 5K8SA 2BGCA 3OF1A 3WW4A 2WFPA 1CAUA 3EBRA 3IIAA 4MGZE 4H7LA 4JV4A 1NE6A 4ZU4A 4QMAA 4YSFA 2PA7A 4LULA 3RYKA 5JSRA 2Q1ZB 4LEJA 1DGWA 3MZHA 4MGIE 1YFXA 3BPZA 3PNAA 4JTNA 4JVAA 1YLLA 3CLPA 1ZNPA 4META 4HSJA 1YUDA 4MX3A 3H50A 4HVRA 4XEZA 4BYYA 4MH0E 4HN1A 3CEWA 4I09A 2BNMA 3HT1A 3E6BA 4LA3A 3H1YA 3EO6A 4HMZA
chains in the Genus database with same CATH superfamily
2ZKLA 1NOVA 4LQRA 1VAMA 4LHNA 3WF3A 1AL21 1LHVA 4AI2A 2WJSA 3HNYM 1TG7A 3MHZA 3RS6A 4YZ1A 5A3PA 2YV8A 5LRSA 3B3QE 3AP7A 4B3NA 2UWAA 4SBVA 3LQCA 2WT2A 1H1MA 1N3QA 1PIV3 1UYZA 3ZYJB 2B46X 2FDKA 2XHNA 3I54A 4I0AA 2DUQA 4IETA 4W6YA 3ZDSA 4CP0A 4FQ4A 1CAWB 2VOVA 3AYEA 4Q4W2 3IDEA 4QB1A 4OHYA 3O1VA 3VZNA 5BNNC 3WNNA 4KBBA 4Y5Z0 1NCRA 5KHJA 1WLTA 1OBNA 2W0XA 3POYA 3VHPA 1DGLA 1GNYA 4DUXA 5LEJA 2VTXA 5J96B 3B9IA 2P3JA 2F6BA 1H4GA 3NJZA 4QHOA 2ZMNA 4LK7A 5FBZA 3QACA 5A6XA 3GBWA 1LOFA 4GWMA 4KGQA 4IQPA 4P9IA 2VZQA 3WW2A 5FO8B 4HVQA 1C8M3 2ZGQA 2C6SA 4NWVA 4AVBA 4A7ZA 4Y22B 4PLMA 1UY4A 3VUOA 3RZKA 2X5IA 3I59A 3I2KA 2FDGA 4H2AA 2XVGA 4LBLA 1CD3G 4FPGA 2PHLA 1QXJA 4W4ZA 3GF6A 4RQPA 4YGDA 1PO21 3AP4A 1V6OA 1SLTA 2ZS6B 4YG0A 3WP5A 3POSA 4A3ZA 1RUF1 2Y6HA 4AEMA 2VUJA 4BMEA 4CEYB 3VBRC 1EAH3 3CO2A 4XJAA 5DUUA 1OKOA 3KT7A 1IS6A 3VBFC 1X82A 1ZRIA 1YJKA 5F6KA 1W90A 2P4EA 2A3XA 1YIPA 2P34A 3OGSA 5FFOC 3V64A 2QQPA 3H9AA 1SEFA 3ZMOA 1QXRA 1W05A 4CCKA 3V0AB 4CSWA 4FPKA 5TSWA 2WBKA 2GNBA 1GOGA 2D93A 2OX0A 4FPYA 3OSDA 5GALA 4LKSA 2EA7A 3CF6E 5FBJA 2R041 5KHGA 1RIRA 2DDUA 3ELNA 2WNVA 3OPTA 1AR61 1RINA 1UOFA 3NNLA 3GZAA 1VBC2 1DDLA 3HPNA 2ZHMA 3MV11 5AC93 1GQPA 1ENSA 5DDJ2 3RZGA 4XE9A 4Q0QA 3Q8EA 3MW3A 1P8JA 2B5HA 1PMIA 4CDWA 1VBB3 3NV1A 1JUIA 5GJ6A 5L7OB 3Q9OA 1NX9A 2X10A 2VTFA 1HXS2 1LESA 1H30A 4X8NA 4YRDA 2W1UA 3POBA 1QOTA 4P9YA 4AHYA 2XJPA 3BALA 1D4M2 2XLAA 1VRH1 5I91A 1K5MA 1ZX5A 1DZRA 1FMD2 5A1FA 1WMXA 1DQ4A 2JIGA 4NO4A 1B35B 3ROUA 3RFRA 3RWKX 5FK8A 3VDBA 3VD9A 4B8EA 1QJU2 3DL3A 3ENRA 4M3CA 3NJYA 3A21A 1HRV3 5F7UA 1JXNA 2YC4A 3PDQA 4KGGA 4XDQA 3THPA 3UK9A 2B42B 2BVVA 1GWMA 2GP3A 2WRAA 3WT3A 3O1SA 2A70A 3WX5A 3KHCA 1FPN2 4P00B 1GICA 2JDMA 3VZKA 3UGFA 4YLZA 3K77A 1SFNA 4QGNA 3W20A 2EXKA 2OA2A 2VW2A 5KWRA 2QVSB 1BVVA 2XLFA 4JRAA 4CCOA 1ZBE2 1J3RA 5IVJA 5LK7B 3A23A 1EV12 2QE3A 4MGYE 5D1IA 5J48A 4NHXA 1AYM2 1HQNA 2I74A 4K40A 1CAXB 2VZOA 2QDRA 1LGCA 5FZKA 5DAQA 1UU6A 3QH6A 5E6HA 2HJIA 1A78A 2D98A 4AL9A 1K12A 1ZVFA 1US2A 2EIEA 3DXUA 4P5YA 2FZ2A 4YGCA 1H8VA 1OH4A 3PVEA 3KD4A 2CGNA 1H2NA 3HBZA 3I3QA 2WZPP 2BBVA 2Z4FA 3T09A 4YW1A 1W9SA 3JUUA 4MXWB 4Q4W1 5FZ8A 4ZU7A 4HK8A 3RQ0A 3TNQA 2JB4A 1OQEA 4XAEA 2ZX2A 1F31A 1HN0A 2C9AA 3NQHA 4GH4B 2A6ZA 1QJX2 2IXIA 1UAIA 2XGXA 5SV5A 1ULEA 1C5HA 2RDNA 3O1RA 1DU3D 4L11A 4Z1VA 2JG8C 2DU0A 3IWZA 1UCXA 1W6PA 4JGYC 4P5HA 4AYUA 2HH9A 1G9FA 4BB3A 4JCKA 2O14A 4MVTA 1GZWB 4XJ8A 4BM8A 1RMU3 2IVJA 5C8CA 1QNYA 2Y38A 2QTWB 2QDNA 2ZABA 2J22A 1SBFA 2RE9A 5F8PA 3KVAA 4ES8A 2ZX0A 2RJLA 2W47A 2R49A 2B45X 2W95A 3SXWA 4OI1A 1LOCA 5FZIA 1MEC2 2GP5A 5DUVA 2W3JA 2PAEA 5FZGA 5IUQA 5GM0A 4DUWA 4K8RB 2WZ8A 5C3OA 1WWYA 3TEZA 4KWLA 3M4FA 2PYTA 2YXSA 2QQIA 1MVQA 1SCSA 3ZXJA 1POV1 1VBE2 3OGJA 3D5OA 5IWFA 3TN92 2NLRA 3WOGA 4H7MA 3AK0A 5KBFA 4QT6A 4CA9A 4CUAA 3OBAA 3LFIA 1YFWA 4ASKA 2GMPA 4R8HA 2RDQA 3S0MA 5AVAA 4E27A 3LD8A 2GMMA 4QB6A 1OOPB 5JOYA 4FAGA 1H8TC 1PX3A 2RS53 1CX4A 1POV0 2ZHKA 1VBC1 3WNKA 4DRVA 5HI0A 1F4AA 4Q4X3 2VMDA 3ZN6B 1YIFA 4C8DA 4N43B 2Y34A 1CN1A 5DDJ1 4GALA 4XJWA 3VZLA 5F3GA 1RUJ2 5FY9A 1ULCA 4QX3A 1NXMA 2YFZA 3DPRB 3INAA 2QQWA 1VAKA 4IGQA 3ACIA 4AQSA 5FQ0A 3U37A 1HXS1 5L19A 2YUEA 3GBFA 3RMXA 4COZA 5KR7A 4QM9A 2ARCA 4BPZA 4YZ3A 1W8WA 2VL4A 4YW6A 4QD2A 4XF9A 1D4M1 2NM1A 1VALA 2WQZC 4GWIA 4QPGA 3AZVA 4DXTA 2WC2A 1Q8SA 1S0IA 3E6DA 1OD5A 3ES4A 5FKCA 1JYCA 2WLPA 4JRLA 5J09A 4D7TA 3ZN5A 3JZVA 5LA0A 2EIDA 1NQDA 1HW5A 2P5BA 3PUAA 5BNPB 5FY5A 4JGZA 5JZGA 2FCVA 3VBOC 3GCXA 1QJU1 2VQUA 1R64A 2VR4A 4LBJA 3MIGA 1V00A 2E7QA 4XQDA 3WW3A 4AGVA 1UIJA 1GP4A 2YMZA 1NT0A 2RS12 4MGQA 1DLLA 4P9JA 1FPN1 5IVEA 5KHIA 1ONAA 1AR72 1V9U2 5JI7A 3RJRA 5ISLA 5DABA 1WW6A 3TOJA 2CYFA 2WO1A 3VBUA 1AL23 1ZBE1 3AP6A 3AMQA 3BN6A 2WFF2 5BYNA 1EV11 2HEWF 3FC0A 3HQXA 2XR4A 5DAVA 3THTA 3IT8A 2XWJB 5FXWA 1AYM1 1AX0A 4HKOA 1KD7A 3J7LA 2LALA 4NPRA 2J1RA 5GLZA 3TB0A 2YGLA 3ZSLA 3LOBA 4QM8A 2ZEYA 3RGBA 3RI8A 2XQRA 3T0AA 5DZEA 4WVZA 5A3UA 5FPAA 5FYBA 5A7NA 4YWAA 3MLJA 4UFLA 5BV6A 1FNZA 2BTVC 4GULA 2P3KA 3VZJA 3JCIA 2C5DA 4CYDA 1OLMA 2J1SA 3GJAA 4LXLA 4QB2A 3VV1A 1FYUA 3OEBA 4RFT0 4OYUA 5FMBA 4AEJA 1H2KA 4JHTA 2D5FA 4Y24A 1CZTA 2CAUA 3N9MA 2X05A 4DO0A 5CA6A 4AOCA 4FOQA 3CZJA 2X09A 2VPVA 4UFJA 1XSRA 3I2IA 5JMCA 1Q43A 4M01A 2D7FA 3JU9A 4I3PA 3VDDB 1QJX1 3WLUA 1QGLA 2NQYA 1SLIA 3LFMA 4JKMA 3MF6A 5A7QA 3BU0A 2VVEA 3W5MA 2JD4A 3QH7A 3LDRA 4BU2A 1ZREA 3ST7A 4B29A 4NAMA 1G86A 5AC92 1GZCA 1RUF3 1O91A 4YFWA 4XJZA 3URFA 2PN5A 1YYNA 4LOTA 1MZFA 1NCQC 1LHWA 2OZ6A 1X33A 1YQ8A 1H2LA 2QQOA 4U2AA 4CCNA 5C9AA 5FYSA 4NRMA 5FPUA 3UL2A 3VZOA 4QU1A 1XNBA 4YARA 4I0BA 4AK3A 1LULA 4XF0A 2D43A 3WCRA 3POIA 1MEC1 4F8AA 3ME2A 3C7HA 3ACHA 1APNA 4FTEA 1HV0A 2P2KA 2VJXA 5IVBA 3WF2A 3CU7A 2QQKA 5FCCA 1VBE1 2UU8A 3TN91 2WT0A 1OPMA 1YRZA 2R043 2XOMA 4HXCA 4XF4A 3RG0A 3JXSA 4RS5A 4LMFA 2ZHNA 4LLFA 2WLQA 1KJRA 1O6UA 2WQ8A 1WKYA 1DQ5A 1RJ8A 3LEMA 3LEGA 3WV6A 4AXOA 1LEMA 5A6QA 1GOFA 3LPFA 4L9BA 3SCGA 1G8WA 2WO3A 5E8AA 4Y1UA 3N9OA 1MPXA 3AM2A 3MF9A 1RUG2 3QCWA 5H9QA 5L9RA 5CADA 1PGW2 2X5IB 3I59B 2E9QA 2K2SA 2ZGKA 1RUJ1 3N35A 3N9QA 4OUMA 4YFZA 4B4QA 3AKQA 3J7HA 4IERA 3W21A 1VRH3 2JDZA 4RQPB 1RYYA 2WNUC 2YDEA 3PIGA 4UW4A 2GC2A 1C28A 1ZZ7A 2HWD2 1RJ7A 2SLIA 2D6PA 1UU4A 3AXEA 2RDSA 3EYPA 5HXMA 3S5QA 4I0WB 1UF2C 3C2UA 3IIIA 3WSOA 4JQTA 1SQ4A 3KM5A 4ISQA 4MXVA 4YM0A 5HCFA 3VN4A 3SC7X 1JOPA 1I9RA 1QU0A 3PLQA 5K0UA 3AZXA 4AFBA 2BOIA 3ATGA 1UKRA 2GNTA 3I3DA 3LE0A 5IVYA 5EJ3A 2C1FA 1OKQA 2DVAA 3WNLA 5A32A 1D0GA 2WQ4A 2AH2A 3ON7A 5DN2A 1VP6A 5FP8A 1UX6A 1YFYA 2OKXA 1PZ9A 3NAPB 3WP4A 2YGMA 4IEQA 1XOYA 3ZFEC 2RS11 2HYXA 4ISRA 1J1TA 1AR71 1S55A 1V9U1 2WA4A 2WNVB 3MPBA 4ZS3A 5LB6A 2EIBA 3DECA 2ADDA 2RM22 3AYDA 4QX7A 3KT1A 4AW7A 5J36A 3ZFGB 3FWEA 2VOXA 4LTAA 1DHKB 4E4DX 2WFF1 1LRHA 1STMA 4Q0UA 3E6CC 4CDWB 3FFZA 5LRRA 2R072 4UFIA 2HLEA 3VBHC 3T0DA 2ZGLA 4UOJA 1CZVA 2MEV2 3WHTA 4NIHA 1S0JA 2VU9A 5FYCA 2HWC1 1GR3A 1MQTC 4Q4W3 1J83A 1NG0A 2FDFA 4CDUC 4YVSC 4DNYA 4NPMA 4Y1YA 4Q8KA 1AUYA 3HNMA 2VNVA 1RITA 1K5MB 4YW2A 5F6LB 1IPJA 1PM7A 3W9AA 1C4RA 3VHOA 5EHDA 2PQQA 2PLV1 3OBTA 1AXKA 2G9ZA 5HV0A 5FY0A 1SHWB 2BRTA 3P1IA 2BGCA 4Y5TA 4W6XA 5A6YA 5K8SA 1BQPA 3WW4A 4M3CB 4K6BA 1JI6A 3N7JA 2YBKA 3EBRA 4NR1A 3GGLA 4GKYA 3DKQA 2Q8EA 3F2ZA 1NQJA 4ZU4A 1JBCA 5EXOA 4QQPA 1HJGA 2Q1FA 1A8DA 3RYKA 2KM2A 4PDWA 3L9JT 4LR4A 5GZEA 5AC91 1AHSA 5JSRA 4PI2A 3IKWA 2DCKA 5JOWA 2WWJA 1QH6A 2PHRA 1OA2A 4NWWA 1PK6A 5ACA2 4CU9A 4XILA 1ULPA 1YFXA 2ARAA 3MO4A 2BERA 2OUHA 3V0BA 1W6OA 3N7KA 4JVAA 4PI0A 1G9DA 1PZ7A 1RUC2 1BLZA 3J7MA 2AGSA 1POV3 3WUCA 1Y9MA 3SH4A 4DRRA 1ZNPA 2EAKA 1KFXL 5T5OA 4XJ9A 3RVHA 1W6MA 1HLCA 2XPJA 4MX3A 5KC6A 2CWMA 3IAQA 1QJFA 4MH0E 5C6CA 1BXHA 4G3YC 3C7EA 5FV3A 4JKLA 5FYVA 4TYSA 3MI8A 4LA3A 3H1YA 4FPCA 2BBAA 3DYMA 3B94A 4XHXA 3PURA 4BK4A 4WM8A 1C8NA 1VBC3 4IV3C 3KF3A 5FKBA 1QKQA 1AJKA 3EMRA 2A5ZA 5DDJ3 2JDHA 1W03A 1N3PA 5F5CA 2ORZA 1PHMA 2ZACA 2JENA 2IXHA 1C1FA 2Q4SA 1TMF2 2F4PA 1RUG1 1W6PB 1HXS3 5DUWA 5A7SA 1PGW1 4QDQA 3D8CA 4HOOA 2XJUA 3ITQA 5HCBA 5BNNA 2J7MA 1EUUA 1KQRA 4HPKA 1D4M3 2DUOA 4QPYA 2UY9A 1CIWA 3VLBB 1VMHA 5FZ0A 3LA7A 4CVUA 2HWD1 4G9SB 1JS9A 4XXAA 4D6SA 3MFCA 4FOYA 4PJYA 4LA2A 4S2DA 1QJU3 3R4SA 3TNPB 4Y5SA 3LWCA 4J1WA 1O4TA 3HD8B 3NJXA 2A3WA 3PL0A 3OCPA 4FPLA 5JXIA 2BGPA 1FPN3 2WWUA 1CJPA 3KT4A 4QWNA 3NW4A 2WT1A 2VD7A 4EJRA 4QQHA 2W91A 2DCZA 2DVFA 3KCYA 1SLBA 3TEXA 4O65A 1N47A 1ZBE3 1CIYA 3BKZA 2O1QA 4XF3A 1EV13 5JLVA 3VBRA 3VD4A 2VGDA 4HK9A 1AYM3 1XNAA 2BWCA 3OYWA 2NN8A 3VBFA 2PHUA 3ZPYA 3H1WA 4D6RA 3I3EA 2W08A 1O4ZA 2DURA 2RM21 1QHDA 1XBFA 2YBPA 4XUQA 3ECQA 3WD5A 3NNMA 4FPEA 2R071 3RZHA 4KG8A 1LOEA 2YG0A 4IEOA 5CEHA 4E2GA 1GOHA 4R9AA 1JMUB 2MEV1 5ANQA 5FQ0B 1WCUA 3T4VA 2QCSB 2ZGTA 4COWA 2Y64A 4P14A 2AENA 2JD9A 2JWPA 5FPVA 3WG3A 2VBBA 3WUDA 1O8PA 4FFFA 1XRUA 3LEIA 4QPGB 5GLVA 2RG4A 3PTRB 1MS9A 2IUWA 1SBEA 2DWRA 4CTEA 5GZCA 1QJX3 5T52A 4AI3A 5J37A 3OG2A 3BOPA 1ULDA 3I2FA 1WD3A 4KBZA 4BJ0A 4JGZB 1XB9A 1XNTA 1FATA 2W9XA 2VNRA 2Y8KA 4UWDA 1HJFA 1VLNA 1ZRRA 3BVCA 2WYFA 3FJSA 5FYIA 5FUIA 1FAYA 4M0NA 4Q4V2 1PVC2 2W39A 1LGNA 4A41A 1IS3A 4HZFA 5A3WA 3USSA 3ZXEA 1DQ2A 4NMIA 3S7IA 1RVF1 1HB2A 4K7JA 1NZCA 3H3ZA 3WY6A 1RUOA 2A73B 3VBUB 3NNJA 2BZDA 2E51A 1CR7A 3ACFA 4AI9A 4LO6B 4RYDA 3RYPA 3T2TA 5FWJA 1B35C 3TBDA 4AEKA 4QXKA 5ACA1 1MEC3 3MW4A 3M2MA 3MUZ1 1W6NB 4KWUA 4DOUA 2HKXA 3F95A 5AVPA 1RUC1 2YZ4A 1VBE3 4NIGA 3TN93 1SPPA 1V6NA 5ANNA 5FPZA 2VULA 1H9PA 3N36A 4TZDA 4H14A 4NOTA 5A33A 3FX3A 1YQ5A 3IDCB 4YW5A 2R1BA 1SDWA 2QZ2A 1BBT2 1OFNA 2AACA 3P3NA 5EYYA 3N9PA 4C1XA 4M4RA 1BMV2 3W59A 1XSQA 2HWF2 1O5UA 2CU5A 4EZ4A 5I8TA 5DAWA 2Y0IA 3JB8A 4XBNA 3PUSA 2K0GA 4CDQA 1CX1A 2JKBA 4QX0A 2D97A 4D7YA 1ULFA 3DEMA 2LM3A 3ZKYA 1UPIA 4NHLA 1RUJ3 3A7QA 1W8ZA 1ZRDA 3CIHA 4CCEA 2BQPA 4LLOA 1TMF1 3KB5A 1JOBA 3JB4C 4UBHA 3RYRA 2PFWA 2VMEA 4O7XA 5FAXA 2ZEWA 4NHMA 2O8QA 1ZYBA 2RS32 4Z92B 1F5FA 1NZIA 5KHHA 1L7QA 3J4UH 5C8WA 1OUXA 1O5LA 1KEXA 5LA1A 1A6CA 3QBQA 4FO9A 5D8AA 3FLRA 3H7JA 3I3BA 5C9AB 1R1A2 2VOWA 3KSCA 1Z7S2 5FZAA 1ENQA 4UT5A 4WZCA 4EZHA 3SKVA 4GH4C 5FZFA 2HWB2 1MACA 2DTWA 3OPZA 3WINE 5BY5A 1WLDA 4J6GA 2Z5WA 2JG8A 2VMCA 3O7OA 2HEYF 4JGYA 4Q5OA 4N7IA 4JZRA 1NAEA 4Y4RA 2RS13 2NP0A 1VBA2 1XNCA 1WW5A 1AR73 1V9U3 1QEXA 4KU8A 4LBOA 1BHGA 1PVXA 5EJ1B 2IC1A 2JG9C 2K9ZA 2VUDA 5T5JA 3H8RA 3SEPA 1SBDA 2QQVA 5DAXA 2RHPA 4LO4B 5E88A 1BK0A 4S2HA 2WFF3 3NJVA 4YM1A 5JR7B 1RUD2 4IEYA 3JQWA 3OEAA 4YNIA 1KS4A 3M70A 3O1TA 1W06A 3PJYA 3B5LB 3WP3A 5C4WA 1W8UA 4CZSA 2HWC3 1XU1A 2VECA 3GM8A 2UURA 1GBGA 3A0NA 3WF1A 2TUNA 2YROA 5I0RA 4NIAA 2I45A 5F3IA 1SLAA 1T6GC 2JDAA 2YU1A 1VR3A 1LHNA 2R0FA 5J98B 2Q5TA 2PLV3 4CCDA 2R16A 1AR92 2J1TA 2ERFA 2OQ6A 2P1BA 4D94A 3CJIC 4EN0A 3CBNA 1H8TA 4LIVA 1S0DA 4O9GA 4FOWA 2Q8OA 1C5IA 3BB6A 1QJZA 4LNVA 5K0UB 1AR82 1V70A 1SACA 3DF0A 5F5IA 1V6JA 2UYBA 3MPPG 4TSVA 3FUQA 1YHFA 2G19A 2R32A 4NUBA 5A32B 2FMDA 3ZYPA 5AFBA 1WW7A 4JAAA 4XUOA 4Q4V1 1PVC1 2DYCA 3K46A 3JBG2 3P3PA 4ZS2A 2Q8DA 3SISA 5J1XA 2WZEA 3Q8AA 2WWSA 5LA9A 3UT0A 4QDRA 4KWJA 4JTOA 1JH5A 2LTNA 4BQWA 3AZZA 4QGMA 4V2WA 4B7KA 2BGOA 2WA3A 5JPNB 3ZSKA 2R062 4FFGA 4WBBA 2CY6A 1H1IA 1H6YA 2P6CA 1S0EA 1U5IA 3BIWE 4IGPA 1C3HA 4N8MA 4RGGA 1IQDC 5E16A 4JKKA 5T5PA 3VBOA 3B93A 2I07B 2RMU2 1COV2 3AP9A 3FFQA 1VE0A 2LUWA 2OIIA 5LASA 4ZZ8A 5DMYA 1Q8VA 4Y1VA 1V6LA 4OLLA 4QKDA 2TEPA 4V1PA 5B4NA 3P5BA 1VBD2 4OVEA 3O5SA 2QQNA 2JXAA 4AHWA 2IXLA 3ILNA 4AGGA 5C70A 1TME2 2Y60A 4UW6A 3T08A 1HDKA 1DZQA 1UY3A 2FMYA 2H0BA 2VCCA 4PQ9A 4XFHA 1BBT1 2ARXA 4FXKB 4IUGA 4YG3A 3UGGA 3VBSC 4PT6A 3VHRA 3WQBA 1BMV1 2WKKA 2HWF1 4XUTA 1K5JA 1SLCA 5GLWA 4CDXC 1ZA4A 4XFFA 4QXBA 3BTZA 1IOAA 1X9PA 1RUG3 4QPIC 3IBMA 5JZGB 2V4AA 2VTXJ 4DPNA 4CU6A 1JZ2A 4PHZA 3FL7A 1LENA 4BQ1A 1H2MA 4K1ZA 4AVCA 1AF9A 3QD6A 3H3UA 1W8TA 2XL9A 1ENRA 3AVRA 2VQTA 1V6KA 4CUBA 2HWD3 2RS31 1GU3A 2IWGB 1PK6B 5FZ7A 3N9NA 4BISA 3O0WA 1REDA 5CG8A 2WO2A 4RL7A 1H6XA 2F17A 1BVP1 4LHSA 3V0BB 1R1A1 1W6OB 1NLQA 1Z7S1 2GC1A 2XG3A 3RZMA 2YC0A 3MW2A 2RJ2A 1Z78A 3VDDC 2HWB1 3WG1A 2ZX3A 4DY5A 3LOIA 4ZXEA 1W0NA 4V2VA 4B1LA 3WP6A 2VNGA 2P3IA 2PELA 3HQUA 5LA2A 1G6NA 1PGSA 3CKHA 1S0BA 4RSUA 3VD3A 1WCSA 1NCQA 1VBA1 2ZGMA 3PMSA 4BQ4A 4DXSA 5T55A 5BUVA 4CXWA 1BCXA 5CFCB 5EIYB 5JDBA 3V65A 3UYJA 3MIEA 4P9WA 3TEWA 1ZRFA 1UQXA 4WM8B 4MUVA 2D3PA 2GNDA 1S0GA 2RM23 1BEV2 1PMHX 2D3RA 2QBXA 3CJXA 4WM7A 5I8SA 1YQ2A 5L9VA 2VZPA 3APBA 1F9KA 4HKWA 4QKBA 1RUD1 2WAOA 3H42B 2R073 3ILFA 1RUE2 3AC0A 3LEKA 4X6RB 2CGOA 3CDZB 4LUMA 3PVOA 3ZXLA 4F83A 1EYBA 1YCIA 2MEV3 4W50A 3KV5A 3PTYA 4IV1B 1JZ8A 4P9XA 1OVSA 5BNNB 5JPMB 4HPKB 2AREA 1JYIA 3PU3A 4XCAA 4A7KA 2ID4A 4BLJA 3IDBB 3C7FA 3K75B 1DGRA 2DU1A 2ZX4A 1AR91 3KLSA 3U07A 4P08A 4AAXA 3NO8A 1UZYA 5I8YA 4F7ZA 3WVJA 2XUMA 5CKQA 1LOFC 3AB0A 1T6BX 2E63A 3K4AA 4KU7A 1AR81 1X8MA 1VRBA 4LE4A 4DFSA 4TN7A 1RVF3 1OC1A 2ZGRA 1LU2A 4BCUA 3I49A 4AHZA 4LKDA 3OJBA 3GCWA 1S2EA 2C26A 1ND2C 3U78A 3THCA 4PLNA 3LDBA 4IE0A 4LO7A 1JU4A 4RQPC 2VNOA 3T1LA 3JBG1 1XU2A 3AFGA 1ZZ6A 1ND3A 3ZXGA 2GH2A 3SNMA 4A42A 4XAAA 3VBRB 5ACA3 5HBAA 3H8UA 3OYWB 5JAXA 1OVPA 1NLRA 3MGUA 4KH9A 4XDPA 2B9VA 3NNFA 1RUC3 4CU7A 3ZR5A 4MO3M 2R061 5I0UA 2VQAA 4FPJA 4XUNA 4GB32 2WS92 3LIGA 3ZXDA 4BQ3A 1FV3A 3MIFA 2RMU1 4PBPA 1COV1 5FREA 4BE3A 1IHMA 4OMDA 5ERLA 1A3KA 1J1LA 1W2UA 3NAPC 4OULA 1IKQA 1UZWA 1UYYA 1VBD1 1OXCA 5FMOS 4CCMA 5CAZA 4EQVA 1TME1 4LKEA 1QDOA 3E5XA 2ZXQA 3D0SA 4WVMB 3OD0A 1ZZ9A 3DN7A 4RN5A 2JECA 2VVDA 3PUHA 4N9HA 4DB5A 1CPNA 4MZUA 4UFKA 3ZFGC 1OQDA 1D0HA 2DUPA 3OB8A 1TMF3 5FP3A 4LUKA 3VBHA 2VVFA 3D3AA 1CAVA 1R082 5CISA 2W1QA 5L9BA 3KVBA 4FPHA 3ZYHA 1ZA7A 1W9TA 1YI7A 4CDUA 4YVSA 1DQ6A 2Z79A 3PIJA 4M4PA 2ZZJA 2BFUS 2RJKA 3ACGA 5T50A 1OFSA 2YPJA 5FR3A 4XBQA 3RDIA 3HN3A 2HWC2 3GBGA 3HQRA 3K4ZA 1HRI2 1ULOA 2ETEA 1CJDA 2O0OA 1WZXA 2FDJA 1OF3A 4CP2A 3ZKUA 2JDKA 4XIKA 1CAUA 4OQ9A 3S6PA 4AI0A 4A6OA 2A75A 4AEDA 1UY0A 3IIAA 3KQ4B 4BLIA 1WMFA 3IZOA 2ZGPA 4JV4A 1GWLA 2PLV2 2VUAA 2YC2A 1TNFA 3ABZA 3AYCA 1SPPB 4D8MA 5CFDC 3H8OA 1IS4A 5JR2A 5A33B 3IM0A 4HANA 2Q1ZB 3AZYA 4UF0A 1C57A 1IG3A 5BNOA 3Q8BA 2ZMLA 5CNAA 3BPZA 3WHUA 3PNAA 4GMP3 2VE1A 2XMLA 4JTNA 1OQ1A 1UKGA 2ZPXA 2BDRA 1LOAA 4CDQB 1YLLA 5A7OA 5JOZA 2WAAA 1E5SA 1UZ0A 1XYNA 5FY1A 1N1SA 1BEV1 2Y6GA 4KG0A 3OBRA 2ZGNA 1YUDA 1LODA 1S0FA 3H50A 1RUE1 4HVRA 4XEZA 1LOBA 1KITA 5C5UA 5B2GB 3W58A 2VZVA 2BNMA 2DTYA 1DYKA 3E6BA 3L2YA 3EO6A 3C8XA 3T3YA 4HMZA 5D8AB 4COVA 4IGOA 1XJAA 3IAPA 4YYOA 2PHWA 1OURA 1GP5A 2VC9A 4R9DA 5CU1A 1UXXX 2W2IA 3FMGA 1QJEA 1U0AA 4HSLA 2A6XA 3BU7A 3ZYIB 1N1TA 3TRSB 1IS5A 3FUOA 1UZVA 2VG9A 4XCBA 4A6SA 2ZMKA 1NCRB 2JG8B 3BODA 4GA9A 4IESA 3K51A 3TYJA 3AVSA 4XOGA 4Q4V3 2W92A 2DVBA 1PVC3 4JGYB 4AQ6A 1SFPA 5FP7A 5JCTA 4BWOA 4LITA 1YQ6A 5JXHA 1DLCA 3C7OA 4EWEA 4OZOA 3ZYFA 2VO5A 3BYWA 3TWIA 1PNFA 3RJ2X 5AFEA 1NLSA 1W6QA 4PIZA 3R4DB 1GQHA 3R6SA 3ZN4A 4K9SA 4CP1A 4IW3A 4NPLA 2FBEA 2ZZQA 3M8LA 5A3OA 5CG9A 2R6QA 2W5FA 5ABJC 3T4HB 4GJYA 1Q3EA 2BOJA 5FUPA 3VKNA 4OHWA 2B39A 5C4WB 4BXSV 3LGRA 2VXJA 1LGBA 2VBDA 3KWVA 4MHUA 4XABA 4Q4Y2 3O0XA 5FY8A 4GB31 2WS91 4UW5A 4FTBA 4Y26A 1W99A 1Y9QA 3A0KA 4S2FA 1O3TA 5IAVA 3LCPA 3VB9A 3G7DA 1TQ5A 2Y6KA 3L2HA 4C0HA 5DQ0A 1BBT3 5FZ6A 2JDUA 1WGPA 1WMDA 1QQP2 2AR6A 1H4HA 2HWF3 5JI9A 2G9FA 1H8TB 1HX6A 1BK1A 2AZ5A 4XQWA 2HBUA 2BP6A 5FLHA 1ZBA2 1WMEA 5A80A 2DFCA 3MIBA 5IVVA 2YFUA 4YW4A 4YW3A 5FMOL 3WEZA 3NSTA 5LBCA 4FPFA 1DCSA 1I1EA 1WW4A 4N53A 3VHNA 4MG2A 1R081 3WR0A 1E57A 1LHUA 2RS33 3SQOA 3X29B 3KCXA 3WNOA 4CUCA 2VOKA 1S2BA 4AVSA 5FLIA 1LNSA 4LPLA 2AYHA 1B09A 1OLRA 3ALQA 4XMAA 1R1A3 4Z8BA 1Z7S3 2FZ1A 3OUIA 2D5HA 1SZBA 3ZYGA 1HRI1 2HWB3 3VBOB 4JDOA 3KV9A 4RR3C 4IEXA 1YC61 2JX9A 3LSEA 4BMBA 1NA1A 2BFUL 2BPA2 2GN7A 1SDDB 1N1VA 5FMDA 2BU9A 5FY7A 4DEQA 4JDMA 3SHRA 3OD4A 1VBA3 5JWPA 4YPJA 3WDYA 5LY1A 2WSVA 1O3RA 4L99A 1RHI2 4XACA 4JC1A 1DZTA 5FZBA 4B7EA 4CEWA 3J26N 4RHV2 1CESA 5KXBA 3PJQA 3VBUC 1RVF2 4PF1A 2NZ9A 2VW1A 1B35A 2RVAA 3HAGA 4NVPA 5FYZA 5C5TA 5C71A 1RUD3 5JUVA 3H8XA 3VDCA 4LIUA 4I02A 4IXLA 5FXXA 1VJ2A 2AUYA 1J58A 5FK7A 5FYMA 1ZZBA 1H0BA 2WSUA 3NRUA 1WCKA 4JX0A 5GZFA 5FJKA 1LU1A 1DF0A 4KMQA 4YW7A 5IHRA 1BJQA 1WA4A 4JQRA 1UOBA 1T2XA 3I2OA 2VBPA 3R0RA 1AR93 1FI2A 4BH9A 4KI5M 5JXGA 1GLHA 3KV4A 2B9UA 4XC9A 5F2SA 3WNPA 4Q26A 4BOWA 1U5YA 3NVCA 1YEWA 1OT5A 3G6JB 1VIWB 2VCMA 3KGLA 3M3OA 3ZFFC 1AR83 3LZZA 2EALA 1AYN2 2A6WA 5IJRA 2OQ7A 4YVWA 3ZSMA 4EWDA 1PGL2 4CRQA 4FVVA 5FYHA 1JOJA 4C90A 3ZXKA 1MVEA 2FQPA 2XB6C 1EUTA 2XKPA 3I8TA 3JBG3 2QQJA 4ZPIA 1GP6A 1RGSA 2Y0OA 3AZWA 4DUVA 1NCQB 4QQLA 3ZDVA 2VOTA 3VKMA 3ZR6A 5FMCA 2XH6A 4EN7B 4HN0A 2YYOA 3KV6A 1RXGA 2JKXA 2MPFA 1XQNA 1UW8A 2VMGA 4NHKA 5C9AC 3K3OA 1MZEA 4MSVA 5I0DA 2W52A 2H6CA 2R063 4GH4A 4WM7B 3O1UA 5CVRA 2P17A 5FXZA 5C8CB 3I2DA 3NWKA 4A2UA 2VH9A 2A6VA 4BK5A 3S5AA 4BQXA 2VAUA 2RMU3 2XL7A 3MV01 1COV3 1W8HA 4XFCA 1QOSA 3FBMA 4FXGB 1KFUL 4RA0A 2P37A 2PHFA 4E4HA 4EYUA 1MS0A 3HWJA 4Q4Y1 1VBD3 3U4XA 3VKOA 2EAAA 1S4CA 2JG9A 1TME3 1YNAA 1GV9A 3GZUC 5EYXA 1O59A 4E8CA 5DAPA 1RB8G 1NUKA 3A22A 3U14A 1QQP1 3POFA 1XNKA 1QMJA 1ZZCA 1Y3TA 1ASJ2 2AC1A 1FV2A 1C1LA 5CYYA 1QF3A 3T2OA 2R30A 2ZGSA 2UY8A 3O12A 1ZBA1 2VZSA 1SG3A 1K42A 2LW8A 3WDUA 3SH5A 4CEYC 1PNGA 1JU3A 1QY4A 1ODNA 4LKFA 3UETA 5GZGA 1DG6A 1IKPA 1H1AA 1YJLA 2BEOA 2VMIA 4XXPA 3M1HA 1ND3B 1ZZ8A 3RNSA 2V09A 2CAVA 3ZYRA 4BIOA 4HG6B 4FBFA 2RR11 5T3NA 3CJIA 5GLTA 2WYSA 4N9IA 4Y4YA 3KCCA 1U5XA 2QQMA 3VGIA 2HEVF 2ZTNA 3D82A 3DYPA 5GKAC 4EROA 4PBOA 5KC5A 2Y6JA 5F39A 5IW0A 3VD5A 2X8KA 3ZN6A 5BNQA 3WG4A 1MR5A 4QXHA 3USUA 4A44A 1Q8PA 2TBVA 5KXCA 3HJRA 1UU5A 2PAKA 3ZLIA 2ZKNA 4JDNA 3UJOA 3N9LA 3I2JA 2GN3A 2ZBJA 4ZZ5A 1CONA 3WW1A 3I97A 4PCRA 1PO12 5F37A 1Y4WA 3FN9A 5D2AA 1RHI1 4F3JA 1VB4A 4L0PA 5L7OC 2WABA 1LEDA 1FT9A 3EQEA 1BEV3 3GYDA 3PUQA 4RHV1 4AWDA 4GWNA 3U0ZA 3MFAA 2YB7A 1QOOA 3UKTA 4OHVA 2RDRA 1X7NA 5FZDA 2PHXA 2Z42A 1MZ5A 1RUE3 1MS8A 2TNFA 3HVDA 1A34A 1CAVB 1US3A 4NN0A 4I2OA 4Y3OA 4IL7A 3WQ1A 4ARYA 1V6MA 2LRPA 3K4DA 4CDUB 2FHRA 4YVSB 3T2QA 3I2HA 2EXJA 4HBNA 2DCTA 1OH3A 1Q5OA 4QHZA 4QKFA 5LBEA 4Q0SA 2D6MA 5IK7A 3VZMA 3WDWA 1ENXA 2CSGA 4I30A 5EPAA 1BZWA 4S2GA 5KXDA 1W2AX 4RGAA 4CDXA 1PZ8A 1CAUB 4AEDB 2R7EB 2VZUA 1OHFA 1I5PA 3KQRA 4QPIA 1URXA 2JJ6A 4R9CA 4AVAA 1Q56A 4HVOA 3UV9A 2Y6LA 1GQGA 5FPBA 4DIQA 1LAJA 1AYN1 2J1AA 3AKRA 1PGL1 3IN9A 4UF0B 3JD72 1R092 1WLWA 3MBWA 4MADA 3ZXFA 1DGWX 3ZYBA 5BNOB 4GWJA 4BZ4A 3SH3A 4CXYA 1MS1A 3KHBA 2E26A 4G4FA 4FQZA 2GAUA 2A7AA 1W04A 3RZLA 2DVGA 5FTTC 1LOGA 4N90A 4XBLA 4KQ7A 1JZ4A 1OSGA 2GALA 4INDA 4GB33 2WS93 3NL1A 2NYYA 1R1ZA 2EF6A 1Q8QA 1OMIA 1W28A 2CV6A 4E8DA 5JXJA 1U5ZA 1WCDJ 4DQAA 3T2PA 5C7GA 4AFMA 4LO8A 4ASMB 1VB2A 1UL9A 2YPDA 3CL1A 1N1YA 5CKNA 2JICA 1DBNA 1OLQA 5CFCC 3AXDA 5HCHA 2AEYA 4UBGA 3PVNA 2XXZA 3ES1A 3VBSA 1W2NA 1REEA 1DFQA 4WM8C 2ZX1A 3QOPA 1D7PM 2P3YA 4M00A 4Y20A 4IDZA 1XE0A 5LY2A 1X8EA 2X29A 5A3TA 4RS5B 5EQUA 5JMOA 4Y1ZA 1ASJ1 3A4UA 1AZDA 2ES3A 3ZSJA 3DCQA 4DXZA 1R083 1CGPA 2VMFA 3SITA 1TNRA 4FTSA 4IV1C 5HXVA 2OPKA 3EJKA 1GNHA 4GMP1 4GIQA 4QU2A 1F2NA 3CHXA 2C24A 3ZOIA 1W6QB 2V5YA 3T0BA 5K9YA 2XQXA 2WN2A 3FE5A 5CZKA 5LZ6A 1HRI3 1HIXA 3BIEA 1JHNA 5L36A 1Y9GA 4L2NA 4XETA 2XKOA 1PM4A 1AX1A 3BGAA 4BHPA 1OLME 2QKDA 3E1F1 1K3IA 5A7WA 5EZWA 5FDBA 1E5RA 1GUIA 2VZRA 1YWKA 4XTMA 4OHZA 3WCSA 1O4YA 1GZ9A 2W87A 5J3UA 4XDOA 5F2WA 2JDYA 4GMP0 4ARXA 1RUNA 5C3RA 3OGGA 1WLCA 1TE1B 2XJQA 1OOPC 3AJZA 3DXTA 3O1PA 2WN3A 3U75A 5A3NA 1ND2A 2E7AA 3PVBB 4NIIA 5EV7A 4NIDA 3T1MA 3N7MA 3VL8A 3VKLA 1DGRN 4R9BA 3RMYA 4N43C 2IXKA 4AVTA 3LAGA 1GSLA 1PO11 2VUCA 3GXUA 2Y6FA 3H7YA 4NHYA 1NYWA 4E9KA 1O3SA 2XJVA 1JYWA 2ET1A 2D44A 3O14A 1EP0A 3DPRC 4HL0A 2IXJA 2PAMA 5FZ1A 3PHMA 2IVIB 4CPBA 4QKNA 3ZM8A 2CL2A 3HT2A 4J1XA 4MHRA 5BPXA 5IK4A 4L8QA 5LEKA 4IE4A 4QHBA 4GJZA 1RUH2 2G1MA 4N53B 2E53A 1DP0A 1W9YA 2DF7A 2WZR2 4HETA 2ZAAA 5LBBA 2XVKA 2ZEZA 3NAPA 1UX7A 2WUHA 4DS0A 2PQSA 2UYAA 2ET7A 5HCAA 5BNPC 4XURA 1WUVA 1XYOA 4W8JA 1O8SA 1LKNA 4Q27A 3AKSA 5LWBA 2Z2SB 4FP3A 4XZPA 2KA3A 4I01A 5LW9A 1LECA 1UD1A 3UKNA 4XW3A 3ZFGA 4FP2A 1UPSA 4DINB 1XNDA 2IFWA 3DKWA 3MDPA 1NA1B 1L3JA 1AVBA 4ES9A 3D0JA 1QNWA 4O9EA 2JB8A 1NXD1 4EN8B 3I7DA 2ARBA 3WDTA 4AG4A 2HWE2 5JVVA 3FLTA 3POEA 2Z69A 3J7NA 4EV0A 1KS5A 1TEIA 1RL3A 1UXZA 3JD71 5FY4A 2WL1A 1R091 4CEWB 1L7RA 2R1DA 4A3XA 3OF1A 4YZ2A 2WFPA 1POQA 1W0PA 4UFHA 5CKMA 4EE2A 4C0BA 3ZO0B 1UMHA 4ZY9A 2A3YA 2E33A 2VQ0A 4AQTA 5SV8A 4LBMA 3KF5A 4MGZE 3RRDA 1W3XA 3D4KA 4PDWB 2GMEA 2FCUA 1ZM1A 4CP9A 4Q1RA 4AR2A 4QMAA 1F15A 3LSDA 4XJUA 5CFDA 2ZEXA 3BPSA 1Y7BA 4K1YA 4EN9B 4Q4Y3 3ZX7A 4FPOB 3ETPA 1FOD2 2W94A 5L73A 1DGWA 4LOSA 2VCBA 3LB9A 4GAZA 5F3EA 2WNEA 2DCYA 2OVUA 1W8FA 3MZHA 2EIGA 1E5HA 3N3HA 2NPIA 2UWBA 2IFRA 3OUJA 5A1LA 1QQP3 4P02B 1W6MB 4YGEA 3CLPA 5FRAA 3MICA 5H9SA 1HN1A 2VXRA 4CDQC 1ZBA3 3AKTA 3VL9A 2FDHA 4AHXA 1HV1A 2OT7A 2ZAHA 5FP4A 5A7PA 4MLOA 3CEWA 4YVWB 4R4XA 2D6NA 1OUSA 1CQ9A 4I09A 1GNZA 2D6OX 5F5AA 3NMBA 2F4LA 3FLPA 2G9GA 3HT1A 3R4UA 5FYTA 3MIDA 4DEVA 2RR13 5FOBB 1QJY2 3IDAA 4SLIA 3OY8A 3UNPA 3S7EA 1CVNA 1F35A 1NY72 5D8AC 2ORXA 5FUNA 1WA6X 1UZZA 5LK5A 1UYPA 3KS7A 3M3IA 1JTZX 1XYPA 2WR9A 1WD4A 2B7YA 2ADEA 5FWEA 1NCRC 1GFF2 1RC6A 1VMFA 2ENRA 4XMIA 5A70A 5I0SA 4OFGA 3AMPA 1GYKA 1AX2A 5APAA 4CE8A 3FZ3A 1SFYA 5KXEA 2OXBA 2JG9B 1JYVA 1EY2A 1RHI3 3QLQA 1L7LA 3OOXA 4RHV3 1QXPA 1V6IA 4PF5A 1U12A 4WZFA 3WDVA 1TZOA 2X5IC 3POJA 5ABJA 3ZIXA 1IQAA 5H9RA 1FNYA 2ZHLA 3VKFC 4BA6A 4XF1A 3CZUA 2WNUA 1FXZA 2DBNA 5C4WC 5DG2A 1RUI2 3HBKA 3LA2A 4NRQA 4M0HA 5LATA 3WQ0A 5F5QA 1GANA 5I93A 1DQ1A 2OUJA 5FZOA 1QDCA 4AFDA 4Q1PA 2W68A 1D2SA 3VBFB 1RUH1 2FD8A 3BOWA 4N7UA 5C3QA 1X36A 2WZR1 4XPVA 4BDVB 4QX5A 4QPWA 4HKLA 4LBNA 2QQUA 4Z82A 3BCWA 2CHHA 3EXUA 3CJIB 1YQCA 2PHDA 3JQXA 2QNKA 4P9GA 4A45A 3SMHA 3J8F2 1IPSA 5K4LA 3I4IA 4LO5B 5F32A 1UMZA 3SLIA 3ZFEA 2VW0A 4AI1A 3USUB 1AYN3 2A71A 4YZ5A 3BTYA 2VY0A 2WNVC 4C1WA 1S2KA 3AKPA 1MS4A 3H1MA 3IMNA 2NMOA 4UFMA 1I5ZA 3B01A 1W2TA 4IE5A 3KGZA 2XDVA 2HWE1 4HFSA 2WDBA 3ZIWA 4CDWC 5KHKA 4LBQA 4K8FA 5IFTA 1JYXA 2ZOEB 1PIV2 4XIOA 4CU8A 2I2SA 1FMD1 2Q30A 4PQQA 4FT8A 1MQTA 4WV8A 1DQ0A 4XFGA 4MOAA 4BIFA 3HMYA 5FZ9A 4OCTA 2YHJA 4UW3A 3GALA 4YGBA 4RR3A 4W65A 3U10A 2ZGUA 4IEPA 2D3SA 4PLOA 1K5MC 4XZUG 4AVVA 2DVDA 1MS5A 1W9WA 1PX4A 2C0ZA 4L92A 3WF4A 2J1EA 2GZWA 4IE7A 4FSJA 2XBO3 5E89A 2EXIA 4IE6A 4NRPA 1N3OA 1UN1A 1ULGA 1FOD1 4OZXA 5JSOA 4AFAA 1KRIA 2DV9A 3AX4A 4ZHNA 1Y43B 5IFPA 4X6QB 3WZ1A 4X8PA 3MYXA 1C8M2 1ODMA 4XFAA 1LR5A 1W0OA 2BNOA 3BUCA 3BI3A 4E2QA 4CDXB 3AMNA 2VZ1A 2XJTA 2GSYA 4LJHA 1ASJ3 3PU8A 4DXRA 2OZJA 1YO8A 4QPIB 1I6XA 1W8OA 5FZHA 2D40A 1W6NA 3Q8FA 5JIAA 5I0TA 5F3CA 2UWCA 3UESA 4ITCA 4GKXA 4LHKA 3ZPOA 3MIHA 4A4AA 4CUGA 1E5IA 1EAH2 5K7PA 1BKZA 2E32A 4R52A 5G05L 2OW4A 3SCHA 2V72A 3J9SA 1HQWA 1M4WA 1D4VB 5EP9A 1UO9A 4H55A 5JZGC 5FOJB 4TLGA 1QJY1 2MNGA 3CMGA 4D69A 3B00A 2PMWB 2Q1MA 3GZEA 3O1OA 1NY71 2ILMA 1HB4A 3T30A 4H3WA 3ZFFA 4DMIA 5IAXA 4IEWA 2N7GA 5B4XA 2L9LA 4A7YA 2WO7A 4ZU5A 1J3PA 4WVWA 4L97A 2EXHA 4QQOA 3AYAA 1S0CA 1UOGA 1CWPA 4IV3A 5FZMA 4B4RA 1PO23 2P6HA 1W39A 3IPVA 1JN2P 4CPBD 5IK5A 3LIHA 3E97A 1UOJA 3O1MA 1PO13 2CDPA 1VBB2 4FAHA 4B4PA 4HONA 2BWAA 2GNMA 1M06G 4XHBA 1WBFA 3C7GA 3HR9A 4Q8LA 3VBSB 3RZZA 3CNAA 4COYA 4Y20B 2GC3A 4WM7C 1CAWA 5LBFA 2B8MA 3PUIA 1VPHA 1JYTA 2JEMA 4M3CF 3WDXA 4GXLA 3M3EA 5C8CC 1V0AA 1G9CA 4IEUA 4TLFA 4URTA 5FYUA 2HYKA 2J1UA 3NKGA 3PMEA 1ZRCA 1RUI1 2G4IA 3KZ4C 2XVLA 4HT1T 5FZEA 1KDKA 1UYXA 5J7MA 4FI9A 2C4XA 4NE9A 1AR63 1JODA 1ALYA 3K2OA 1HRV2 2VM9A 5GLUA 5GZDA 1UY1A 4C91A 4TWTA 4Y22A 2XONA 2XLGA 2BUKA 5C33A 1AXYA 1G9AA 4MYEA 2A6YA 5FP9A 5A7WB 4GQ7A 2JE8A 3J8F1 4Q2FA 1K45A 3AP5A 3MUY1 4LK6A 2SBAA 2Q0AA 4I3GA 1X9TA 3OGVA 4CEYA 5EJZB 2H0VA 3ASIA 3ILRA 1UMIA 4EN6B 1ND2B 4QQ2A 1GMMA 3JD73 3UGHA 1R093 1LHOA 3NKTA 1DIWA 1VMJA 3MLKA 3RWNA 3O0VA 4BQ2A 5FZ3A 3ACLA 1XPWA 2O8OA 3POGA 1ND3C 1Q8OA 4BXFA 1LB2A 1W2OA 3WF0A 1J84A 5T54A 4W6WA 2J1VA 3FHAA 4CCJA 2QQLA 5FIXA 5FYYA 2W1WA 4UAPA 5CB7A 1IPKA 3AL5A 3V0AA 1PIV1 4XQ4A 4LT5A 3SKJE 5EWSA 3WNXA 5DXDA 4GD4A 4XVHA 3ZMNA 2RR12 1G7YA 4QXCA 2EVXA 3GNEA 1SMVA 4K3UA 4JHZA 2GU9A 2WNOA 1WCQA 2QUOA 2XWBB 4QPGC 2B4KA 1W8NA 4OHXA 1D2QA 4Z07A 4K21A 3VDAA 4D7SA 1S1AA 1XE7A 3M7AA 4AGRA 3NV4A 4QX2A 2GC0A 4JGZC 1NKGA 4ONUA 2A1XA 1O7FA 2DFBA 3HN1A 3P6BA 4QAWA 2BW8A 4Y33A 3U4SA 2KXLA 4J25A 4CXXA 5L7OA 3GJBA 3TEYA 1C8M1 1F4HA 2NMNA 1IG0A 1YI9A 2BV4A 1F5JA 1RMU2 5DZFA 3B69A 1UIKA 5FPXA 3S30A 2VCAA 1JHJA 4FFIA 1IZ3A 4ATFA 4RD7A 4XYXA 4FFHA 5BXXA 1JYNA 1EAH1 1YFUA 1KGYA 1TVGA 5IYYA 4XUPA 1HKDA 5DZGA 4LHLA 3E5UA 3I3MA 1EPZA 4Q29A 4E4SA 2X53S 2HBTA 2JDNA 4ASLA 3POWA 3I2GA 3GZTB 4AEDC 4CP9B 1DYOA 3NV2A 1W9FA 1OA4A 1J59A 5CFDB 5A3LA 2PHTA 4Q0PA 2E6VA 5FZCA 4Z2WA 2LS6A 2Y26A 1O3QA 4MGSA 2RS52 2XHKA 5IVCA 4OI0A 4ZXKA 1CAXA 1KJLA 3B7MA 1LJ7A 4Q4X2 1LTEA 5FLJA 4E2SA 2WINB 4OQ8A 5CIRA 3ETQA 1RXFA 4YG6A 5BNOC 4UYBA 3U1XA 2GH8A 1UY2A 5EFUA 5M0TA 1VBB1 3K48A 3LF7A 1J3QA 5JOXA 3AMHA 3GHMA 3SCFA 4AI8A 3RSJA 2JIJA 5IATA 3E5QA 2C9KA 1GKBA 2VZTA 5T5LA 2OYZA 2V4VA 3WQ7A 2YU2A 2V5DA 4MXWA 4YM2A 2VZ3A 3HIFA 5FO7B 4K20A 2K46A 4Y1XA 4AZZA 4URAA 4QGLA 5A1AA 1RUH3 5FZLA 4YZ4A 4XFBA 2WZR3 5FZ4A 4PIYA 1SCRA 1UWWA 2GDFA 3KMHA 4MGTA 1VAVA 3OY8B 5JSPA 2OS2A 5CFCA 3RI9A 3WXPA 1HRV1 4PIXA 4U36A 3S57A 1PMJX 4NJ4A 4ORFA 5D21A 4M3CE 5FPLA 2XBO2 3FHIB 2WIIB 4ZONA 1AL0G 1GZWA 4RS5C 4Z2AA 3AJYA 2CWSA 3H0OA 4LBQD 4MV2A 2ATFA 2ZCWA 2MHFA 4O61A 5F9TA 1NE4A 3R05A 1AL22 4IV1A 3V56A 1AXZA 1CZSA 2DBIA 2ZA9A 1HB3A 1Z0HA 2H6BA 1JZ7A 2HWE3 3D6EA 3IMMA 4MGKE 4ZKTB 2IXCA 1HB1A 2LROA 4OUEA 3FHQA 1JZ5A 3LA3A 4TXWA 4KWKA 1FMD3 3IB3A 4DY3A 5F1RA 2R0HA 1JZ6A 3NV3A 4FOVA 1WBLA 5FJHA 2IZWA 3H3LA 1JUHA 5DG1A 5H9PA 4D0QA 4D3WA 5FO9B 4RFRB 2V73A 4NAOA 3UKVA 5ABJB 3MLLA 2KD7A 2ZGOA 2WNUB 4AAPA 2PXJA 4B1MA 2AEZA 3ZVXA 4IEZA 3ZXAC 2W1SA 3RZJA 1SLLA 3TAYA 1XXNA 3ORJA 1GZTA 4HLTA 3VD7A 4BQYA 5FZOB 1FOD3 1OOPA 4DZGA 1OPOA 5IT6A 5G04L 1AJOA 1RTVA 4XFIA 5K0UC 3DUIA 4N43A 3DV8A 4QDSA 1QH7A 3C3VA 3BTAA 1DYPA 3Q8CA 4KL1A 1JW6A 4NROA 4WVVA 4KNCA 3DPRA 2XJRA 4QX8A 1PO22 3NNGA 4GZ9A 5DUXA 3RPQA 4YM3A 2D6KA 1RUF2 5JIUA 3ZFEB 1JZ3A 3CQOA 5A6ZA 1MZ6A 2YBSA 1RMU1 3N4MA 1GWKA 4AFCA 1OA3A 1W3VA 3K3NA 4UI9L 4N53C 1ST8A 3ZSEA 3OUHA 3OTFA 3DYOA 4AF9A 4TTGA 1QJY3 5BNPA 4Q0VA 3VBHB 5IK8A 4LBQB 2CGPA 2E7TA 2W46A 4CCLA 2BJSA 4QX1A 4AE2A 3B02A 1XC6A 2ZJCA 1MQTB 5E1RA 1YXWA 2QFEA 4WVMA 3EHKA 3THDA 4UXAA 3W5NA 2XUEA 2R042 2PTMA 4RR3B 2E31A 3HOBA 1REFA 3GHNA 4ATEA 1AR62 3U11A 4IEVA 1X50A 2EICA 2DCJA 1QWRA 1NA1C 2BYVE 3HEIA 2QJVA 3HNBM 1OI6A 3BTXA 1XE8A 1OF4A 4AQ2A 3OGRA 3MEPA 5LCWL 3LKJA 4RGKA 4EWAA 4D6QA 2BNNA 3M3CA 1QIQA 2RS51 4R4ZA 3SEEA 1A8MA 4OUSA 1KXGA 3GDBA 3EB7A 2FCTA 4Q4X1 4CEWC 4XTPA 4P9LA 2XJSA 2BVBA 2JE7A 4H7LA 4OI4A 1I3HA 2CDOA 1BYHA 5HPOA 4COUA 1NE6A 2YY1A 1VRH2 1CPMA 1UNBA 4YSFA 1OD3A 4E4ZA 4PDWC 3AMMA 2JE9A 2J42A 1IGOA 2PA7A 4LULA 1ACCA 4ET7A 1RUI3 5DPNA 2JDPA 5C3PA 2VMHA 3N7LA 4LEJA 1PK6C 3OPWA 4OI2A 3WNMA 4BQ5A 5C3SA 1KDMA 5HV4A 2CNAA 1LCLA 4MGIE 2D6LX 5A3MA 2Q8CA 1G9BA 2QZ3A 2KR2A 3VDDA 1FX5A 5CBLA 1HQLA 3LPGA 3LDKA 3AL6A 3M3QA 2OPWA 3B9CA 4HSJA 4LORA 4META 1MS3A 3WG2A 3J8F3 3ZFFB 4OMCA 3UJQA 3AFKA 4BYYA 5IVFA 2XBO1 4HN1A 1EPWA 1F8VA 2Y33A 2FDIA 4CCCA 1H9WA 3DGTA 4YVWC 3OBZA 2RV9A 4IV3B 2CTVA 4LE3A 3FBYA 4FCAA 5FXVA 4LBKA 3IPVB
chains in the Genus database with same CATH topology
2ZKLA 1NOVA 1VAMA 4LHNA 1AL21 1LHVA 4AI2A 2WJSA 3RS6A 4YZ1A 5LRSA 2YV8A 3B3QE 3AP7A 4B3NA 2UWAA 4SBVA 2WT2A 1H1MA 1N3QA 1PIV3 3ZYJB 2B46X 3ZDSA 3I54A 4I0AA 2DUQA 4IETA 4W6YA 4CP0A 4OHYA 4FQ4A 1CAWB 2VOVA 3AYEA 4Q4W2 3IDEA 3VZNA 5BNNC 4KBBA 4Y5Z0 1NCRA 5KHJA 1WLTA 2W0XA 3POYA 3VHPA 1DGLA 5LEJA 5J96B 3B9IA 2P3JA 2F6BA 1H4GA 3NJZA 2ZMNA 5FBZA 3QACA 3GBWA 1LOFA 4GWMA 4KGQA 4IQPA 4P9IA 3WW2A 5FO8B 4HVQA 1C8M3 2ZGQA 4NWVA 4AVBA 4A7ZA 4Y22B 4PLMA 3VUOA 2X5IA 3I59A 2XVGA 4LBLA 1CD3G 4FPGA 2PHLA 1QXJA 3GF6A 4RQPA 4YGDA 1PO21 3AP4A 1V6OA 1SLTA 2ZS6B 4YG0A 3WP5A 3POSA 1RUF1 4AEMA 2VUJA 4BMEA 4CEYB 3VBRC 1EAH3 3CO2A 4XJAA 5DUUA 3KT7A 1IS6A 3VBFC 1X82A 1YJKA 5F6KA 5FFOC 2A3XA 1YIPA 2P34A 3V64A 2QQPA 3H9AA 1SEFA 3ZMOA 1QXRA 3V0AB 4FPKA 5TSWA 2GNBA 2D93A 4FPYA 5GALA 2EA7A 3CF6E 2R041 5KHGA 1RIRA 3ELNA 2WNVA 1AR61 1RINA 3GZAA 1VBC2 1DDLA 2ZHMA 5AC93 1ENSA 5DDJ2 4XE9A 4Q0QA 3MW3A 2B5HA 1PMIA 4CDWA 1VBB3 3NV1A 1JUIA 5GJ6A 5L7OB 3Q9OA 1HXS2 1LESA 1H30A 4X8NA 4YRDA 1QOTA 4P9YA 4AHYA 2XJPA 3BALA 1D4M2 2XLAA 1VRH1 5I91A 1K5MA 1ZX5A 1DZRA 1FMD2 1DQ4A 4NO4A 1B35B 3ROUA 4B8EA 1QJU2 3DL3A 3ENRA 4M3CA 1HRV3 1JXNA 3UK9A 4KGGA 4XDQA 3THPA 2B42B 2BVVA 3WT3A 2A70A 3WX5A 1FPN2 1GICA 3VZKA 4YLZA 1SFNA 4QGNA 2EXKA 2OA2A 2VW2A 5KWRA 2QVSB 1BVVA 2XLFA 4JRAA 1ZBE2 1J3RA 5LK7B 1EV12 2QE3A 4MGYE 5D1IA 5J48A 1AYM2 1HQNA 2I74A 4K40A 1CAXB 2QDRA 1LGCA 1UU6A 3QH6A 2HJIA 1A78A 2D98A 1ZVFA 2FZ2A 4YGCA 1H8VA 3PVEA 3KD4A 2CGNA 1H2NA 3HBZA 2WZPP 2BBVA 4YW1A 3JUUA 4MXWB 4Q4W1 4ZU7A 4HK8A 3RQ0A 3TNQA 1OQEA 2ZX2A 1F31A 2C9AA 4GH4B 2A6ZA 1QJX2 2IXIA 1UAIA 2XGXA 5SV5A 1ULEA 1C5HA 1DU3D 4L11A 4Z1VA 2JG8C 2DU0A 3IWZA 1UCXA 1W6PA 4JGYC 4P5HA 4AYUA 1G9FA 4JCKA 4MVTA 1GZWB 4XJ8A 4BM8A 1RMU3 5C8CA 1QNYA 2Y38A 2ZABA 2QDNA 1SBFA 2RE9A 4ES8A 2ZX0A 2RJLA 2R49A 2B45X 3SXWA 4OI1A 1LOCA 1MEC2 5DUVA 2PAEA 5IUQA 5GM0A 4KWLA 3M4FA 2PYTA 2YXSA 1MVQA 1SCSA 3ZXJA 1POV1 1VBE2 3OGJA 3D5OA 3TN92 2NLRA 3WOGA 4H7MA 3AK0A 5KBFA 4QT6A 1YFWA 2GMPA 4R8HA 3S0MA 5AVAA 4E27A 2GMMA 5JOYA 1OOPB 4FAGA 1H8TC 2RS53 1CX4A 1POV0 2ZHKA 1VBC1 4DRVA 5HI0A 4Q4X3 3ZN6B 1YIFA 4N43B 5DDJ1 1CN1A 3VZLA 4GALA 4XJWA 1RUJ2 1ULCA 1NXMA 3DPRB 3INAA 1VAKA 4AQSA 5FQ0A 1HXS1 5L19A 2YUEA 3GBFA 3RMXA 4COZA 4QM9A 4BPZA 4YZ3A 4QD2A 4XF9A 1D4M1 2NM1A 1VALA 2WQZC 4QPGA 3AZVA 2WC2A 1Q8SA 1S0IA 3E6DA 1OD5A 3ES4A 1JYCA 2WLPA 4JRLA 5J09A 4D7TA 3ZN5A 3JZVA 5BNPB 1NQDA 1HW5A 4JGZA 5JZGA 3VBOC 1QJU1 4LBJA 3MIGA 1V00A 2E7QA 4XQDA 3WW3A 4AGVA 1UIJA 2YMZA 2RS12 1DLLA 4P9JA 1FPN1 5KHIA 1ONAA 1AR72 1V9U2 5JI7A 3RJRA 1WW6A 3TOJA 2CYFA 3VBUA 1AL23 1ZBE1 3AP6A 3AMQA 5BYNA 2WFF2 1EV11 2HEWF 3FC0A 3HQXA 3THTA 3IT8A 2XWJB 1AYM1 1AX0A 4HKOA 1KD7A 2LALA 4NPRA 5GLZA 3TB0A 3ZSLA 2YGLA 3LOBA 4QM8A 3RI8A 5DZEA 4WVZA 3MLJA 5BV6A 1FNZA 2BTVC 4GULA 2P3KA 3VZJA 3JCIA 2C5DA 4CYDA 3VV1A 1FYUA 4RFT0 4AEJA 1H2KA 4Y24A 2D5FA 5CA6A 2CAUA 4FOQA 2VPVA 5JMCA 1Q43A 4M01A 2D7FA 3JU9A 4I3PA 3VDDB 1QJX1 3WLUA 1QGLA 2NQYA 1SLIA 3MF6A 2VVEA 2JD4A 3QH7A 3ST7A 4B29A 1G86A 5AC92 1GZCA 1RUF3 1O91A 4YFWA 4XJZA 3URFA 2PN5A 1YYNA 1MZFA 1NCQC 1LHWA 2OZ6A 1X33A 1H2LA 4U2AA 5C9AA 3UL2A 3VZOA 4YARA 1XNBA 4I0BA 4AK3A 1LULA 4XF0A 2D43A 3WCRA 1MEC1 4F8AA 3ME2A 1APNA 4FTEA 1HV0A 2P2KA 3CU7A 5FCCA 1VBE1 2UU8A 3TN91 2WT0A 1OPMA 1YRZA 2R043 4XF4A 3RG0A 4RS5A 2ZHNA 4LLFA 2WLQA 1KJRA 3WV6A 1DQ5A 1RJ8A 4AXOA 1LEMA 4L9BA 3SCGA 1G8WA 5E8AA 4Y1UA 3AM2A 3MF9A 1RUG2 3QCWA 5H9QA 5CADA 1PGW2 2X5IB 3I59B 2E9QA 2K2SA 2ZGKA 1RUJ1 3N35A 4OUMA 4YFZA 4B4QA 3AKQA 4IERA 1VRH3 2JDZA 4RQPB 2WNUC 2YDEA 4UW4A 2GC2A 1C28A 1ZZ7A 2HWD2 1RJ7A 2SLIA 2D6PA 1UU4A 3AXEA 4I0WB 1UF2C 3C2UA 1SQ4A 3KM5A 4ISQA 4MXVA 4YM0A 5HCFA 3VN4A 3PLQA 1I9RA 1QU0A 5K0UA 3AZXA 4AFBA 3ATGA 1UKRA 2GNTA 5EJ3A 2C1FA 1OKQA 2DVAA 5A32A 1D0GA 2WQ4A 2AH2A 1VP6A 1UX6A 1YFYA 1PZ9A 3NAPB 3WP4A 2YGMA 4IEQA 3ZFEC 2RS11 4ISRA 1J1TA 1AR71 1S55A 1V9U1 2WA4A 2WNVB 3MPBA 2RM22 3AYDA 3KT1A 4AW7A 5J36A 3ZFGB 3FWEA 2VOXA 4LTAA 1DHKB 4E4DX 2WFF1 1LRHA 4Q0UA 3E6CC 4CDWB 3FFZA 5LRRA 2R072 3VBHC 2ZGLA 2MEV2 3WHTA 1S0JA 2VU9A 2HWC1 1GR3A 1MQTC 4Q4W3 1NG0A 4CDUC 4YVSC 4DNYA 4Y1YA 4Q8KA 1AUYA 1RITA 1K5MB 4YW2A 5F6LB 1IPJA 1PM7A 3W9AA 1C4RA 3VHOA 2PQQA 2PLV1 3OBTA 1AXKA 5K8SA 2BGCA 4W6XA 1BQPA 3WW4A 4M3CB 4K6BA 3N7JA 3EBRA 4NR1A 4GKYA 1NQJA 4ZU4A 1JBCA 5EXOA 4QQPA 1A8DA 3RYKA 2KM2A 4PDWA 3L9JT 4LR4A 5GZEA 5AC91 1AHSA 5JSRA 3IKWA 2DCKA 5JOWA 1QH6A 2PHRA 1OA2A 4NWWA 1PK6A 5ACA2 4XILA 1YFXA 2OUHA 3V0BA 1W6OA 3N7KA 4JVAA 1G9DA 1PZ7A 1RUC2 3WUCA 2AGSA 1POV3 4DRRA 3SH4A 1ZNPA 2EAKA 1KFXL 5T5OA 4XJ9A 1W6MA 1HLCA 2XPJA 4MX3A 5KC6A 2CWMA 4MH0E 1BXHA 4G3YC 4TYSA 3MI8A 4LA3A 3H1YA 4FPCA 3B94A 4XHXA 4WM8A 1C8NA 1VBC3 4IV3C 1QKQA 1AJKA 5DDJ3 2A5ZA 1N3PA 1PHMA 2ZACA 2JENA 2IXHA 1C1FA 2Q4SA 1TMF2 2F4PA 1RUG1 1W6PB 1HXS3 5DUWA 1PGW1 3D8CA 2XJUA 5HCBA 5BNNA 1KQRA 4HPKA 1D4M3 2DUOA 4QPYA 2UY9A 1CIWA 3VLBB 3LA7A 2HWD1 4G9SB 4XXAA 3MFCA 4FOYA 4PJYA 4LA2A 4S2DA 1QJU3 3R4SA 3TNPB 3LWCA 4J1WA 1O4TA 3HD8B 2A3WA 4FPLA 3OCPA 1FPN3 1CJPA 3KT4A 3NW4A 2WT1A 4EJRA 4QQHA 2DCZA 2DVFA 3KCYA 1SLBA 1N47A 1ZBE3 2O1QA 4XF3A 1EV13 5JLVA 3VBRA 2VGDA 4HK9A 1AYM3 3OYWA 2BWCA 2NN8A 3VBFA 2PHUA 3ZPYA 3H1WA 2W08A 1O4ZA 2DURA 2RM21 1QHDA 3ECQA 3WD5A 4FPEA 2R071 4KG8A 1LOEA 4IEOA 4E2GA 4R9AA 2MEV1 5FQ0B 2QCSB 2ZGTA 4COWA 4P14A 2AENA 3WG3A 3WUDA 1XRUA 5GLVA 4QPGB 1MS9A 1SBEA 2DWRA 4CTEA 5GZCA 1QJX3 5T52A 4AI3A 5J37A 3BOPA 1ULDA 1WD3A 4JGZB 5JZGB 1FATA 2VNRA 1VLNA 1ZRRA 3FJSA 1FAYA 4M0NA 4Q4V2 1PVC2 2W39A 1LGNA 1IS3A 4HZFA 3USSA 3ZXEA 1DQ2A 3S7IA 1RVF1 4K7JA 1NZCA 3H3ZA 3WY6A 1RUOA 2A73B 3VBUB 2E51A 1CR7A 4LO6B 3RYPA 3T2TA 1B35C 3TBDA 4AEKA 4QXKA 5ACA1 1MEC3 3MW4A 3M2MA 1W6NB 4DOUA 2HKXA 5AVPA 1RUC1 2YZ4A 1VBE3 3TN93 1V6NA 5FPZA 2VULA 1H9PA 3N36A 4TZDA 4H14A 4NOTA 5A33A 3FX3A 3IDCB 4YW5A 2R1BA 1SDWA 2QZ2A 1BBT2 1OFNA 3P3NA 5EYYA 1BMV2 4C1XA 3W59A 2HWF2 1O5UA 5I8TA 2Y0IA 3JB8A 4XBNA 2K0GA 4CDQA 2JKBA 2D97A 4D7YA 1ULFA 2LM3A 1UPIA 4NHLA 1RUJ3 1ZRDA 2BQPA 4LLOA 1TMF1 3KB5A 3JB4C 4UBHA 3RYRA 2PFWA 5FAXA 4NHMA 2O8QA 1ZYBA 2RS32 4Z92B 1F5FA 5KHHA 3J4UH 5C8WA 1O5LA 1A6CA 3QBQA 4FO9A 5D8AA 3FLRA 3H7JA 5C9AB 1R1A2 2VOWA 3KSCA 1Z7S2 1ENQA 4WZCA 4GH4C 2HWB2 1MACA 2DTWA 3OPZA 3WINE 5BY5A 1WLDA 4J6GA 2Z5WA 2JG8A 3O7OA 2HEYF 4JGYA 4N7IA 2RS13 2NP0A 1VBA2 1XNCA 1WW5A 1AR73 1V9U3 4KU8A 4LBOA 1PVXA 2IC1A 2JG9C 2K9ZA 5T5JA 1SBDA 2RHPA 4LO4B 5E88A 4S2HA 2WFF3 4YM1A 5JR7B 1RUD2 4IEYA 3JQWA 4YNIA 1KS4A 3M70A 3PJYA 3B5LB 3WP3A 5C4WA 4CZSA 2HWC3 1XU1A 2VECA 2UURA 1GBGA 3A0NA 2TUNA 2YROA 5I0RA 2I45A 1SLAA 1T6GC 1VR3A 1LHNA 2R0FA 5J98B 2Q5TA 2PLV3 2R16A 1AR92 2ERFA 4D94A 3CJIC 4EN0A 1H8TA 1S0DA 4O9GA 4FOWA 2Q8OA 1C5IA 3BB6A 1QJZA 4LNVA 5K0UB 1AR82 1V70A 1SACA 3DF0A 1V6JA 2UYBA 3MPPG 4TSVA 3FUQA 1YHFA 2R32A 5A32B 2FMDA 3ZYPA 5AFBA 1WW7A 4JAAA 4Q4V1 1PVC1 2DYCA 3P3PA 3JBG2 3SISA 2WWSA 4KWJA 4JTOA 1JH5A 2LTNA 3AZZA 4QGMA 4B7KA 2WA3A 5JPNB 3ZSKA 2R062 4WBBA 2CY6A 1H1IA 3BIWE 1S0EA 1U5IA 4RGGA 5E16A 1C3HA 5T5PA 3VBOA 3B93A 2I07B 2RMU2 1COV2 3AP9A 3FFQA 2LUWA 2OIIA 1Q8VA 4Y1VA 1V6LA 4OLLA 2TEPA 4V1PA 1VBD2 4OVEA 3O5SA 2JXAA 4AHWA 2IXLA 3ILNA 4AGGA 1TME2 4UW6A 1HDKA 1DZQA 2FMYA 2H0BA 4PQ9A 4XFHA 1BBT1 2ARXA 4FXKB 4YG3A 3VHRA 1BMV1 2WKKA 2HWF1 5GLWA 1SLCA 4CDXC 1ZA4A 4XFFA 1IOAA 1RUG3 4QPIC 3IBMA 4DPNA 1LENA 4BQ1A 1H2MA 4K1ZA 4AVCA 1AF9A 3QD6A 3H3UA 2XL9A 1ENRA 1V6KA 2HWD3 2RS31 2IWGB 1PK6B 3O0WA 1REDA 5CG8A 4RL7A 1BVP1 3V0BB 1R1A1 1W6OB 1Z7S1 2GC1A 2XG3A 2YC0A 3MW2A 3VDDC 1Z78A 4DY5A 2HWB1 3WG1A 2ZX3A 3LOIA 3WP6A 2VNGA 2P3IA 2PELA 1G6NA 1PGSA 1S0BA 4RSUA 5C6CA 1WCSA 1NCQA 1VBA1 2ZGMA 3PMSA 5BUVA 5CFCB 5T55A 5JDBA 1BCXA 1ZRFA 3V65A 3MIEA 4P9WA 4WM8B 4MUVA 2D3PA 2GNDA 1S0GA 2RM23 1BEV2 2D3RA 3CJXA 4WM7A 5I8SA 3VBSC 3APBA 1F9KA 4HKWA 1RUD1 4X6RB 2R073 3ILFA 1RUE2 2CGOA 4LUMA 3PVOA 3ZXLA 4F83A 1EYBA 1YCIA 2MEV3 3PTYA 4IV1B 4P9XA 5BNNB 5JPMB 4HPKB 2AREA 1JYIA 4A7KA 4BLJA 3IDBB 1DGRA 2DU1A 2ZX4A 1AR91 3KLSA 3U07A 3NO8A 1UZYA 5I8YA 4F7ZA 3WVJA 2XUMA 1LOFC 3AB0A 2E63A 4KU7A 1AR81 1X8MA 4LE4A 4DFSA 1RVF3 2ZGRA 1LU2A 4BCUA 4AHZA 3OJBA 1ND2C 4PLNA 4LO7A 3T1LA 4RQPC 2VNOA 3JBG1 1XU2A 3AFGA 1ZZ6A 1ND3A 3ZXGA 2GH2A 3SNMA 3VBRB 5ACA3 5HBAA 3H8UA 3OYWB 5JAXA 1NLRA 3MGUA 4KH9A 1RUC3 2R061 5I0UA 2VQAA 4FPJA 4GB32 2WS92 3ZXDA 1FV3A 3MIFA 2RMU1 4PBPA 1COV1 5FREA 4BE3A 1IHMA 1A3KA 1J1LA 1W2UA 3NAPC 4OULA 1IKQA 1VBD1 5FMOS 5CAZA 1TME1 1QDOA 3E5XA 3D0SA 4WVMB 3OD0A 1ZZ9A 3DN7A 2JECA 2VVDA 4N9HA 4DB5A 1CPNA 4MZUA 3ZFGC 1OQDA 1D0HA 2DUPA 1TMF3 3VBHA 4LUKA 2VVFA 1CAVA 1R082 4FPHA 1YI7A 4CDUA 4YVSA 1DQ6A 2Z79A 2ZZJA 2BFUS 2RJKA 5T50A 1OFSA 2YPJA 4XBQA 3RDIA 2HWC2 3GBGA 1HRI2 1CJDA 2ETEA 2O0OA 4CP2A 4XIKA 1CAUA 3S6PA 4AI0A 4AEDA 2A75A 4BLIA 3IIAA 1WMFA 2ZGPA 4JV4A 2VUAA 2PLV2 3AYCA 1TNFA 5CFDC 1IS4A 5A33B 3IM0A 4HANA 2Q1ZB 3AZYA 1C57A 5BNOA 2ZMLA 5CNAA 3BPZA 3WHUA 3PNAA 4GMP3 4JTNA 1OQ1A 1UKGA 2ZPXA 5JOZA 1LOAA 4CDQB 1YLLA 1XYNA 1N1SA 1BEV1 4KG0A 3OBRA 2ZGNA 1YUDA 1LODA 1S0FA 3H50A 1RUE1 4HVRA 4XEZA 1LOBA 1KITA 5B2GB 3W58A 2BNMA 2DTYA 1DYKA 3E6BA 3L2YA 3EO6A 4HMZA 5D8AB 4COVA 4YYOA 2PHWA 4R9DA 5CU1A 3FMGA 1U0AA 4HSLA 2A6XA 3BU7A 3ZYIB 1N1TA 3TRSB 1IS5A 3FUOA 2VG9A 2ZMKA 1NCRB 2JG8B 3BODA 4GA9A 4IESA 3K51A 3TYJA 4XOGA 4Q4V3 4JGYB 2DVBA 1PVC3 4AQ6A 5JCTA 4BWOA 4EWEA 3TWIA 1PNFA 3RJ2X 5AFEA 1NLSA 1W6QA 4PIZA 3R4DB 1GQHA 3R6SA 3ZN4A 4K9SA 4CP1A 2FBEA 2ZZQA 3M8LA 5CG9A 2R6QA 5ABJC 1Q3EA 3VKNA 4OHWA 2B39A 5C4WB 3LGRA 1LGBA 4Q4Y2 3O0XA 4GB31 2WS91 4UW5A 4FTBA 4Y26A 1Y9QA 3A0KA 4S2FA 1O3TA 3LCPA 3G7DA 1TQ5A 3L2HA 4C0HA 1BBT3 1WGPA 1WMDA 1QQP2 2AR6A 1H4HA 2HWF3 5JI9A 2G9FA 1H8TB 1HX6A 1BK1A 2AZ5A 4XQWA 5FLHA 1ZBA2 1WMEA 2DFCA 3MIBA 4YW4A 4YW3A 5FMOL 3NSTA 4FPFA 1I1EA 1WW4A 4N53A 3VHNA 1R081 3WR0A 1E57A 1LHUA 2RS33 3X29B 3KCXA 2VOKA 1S2BA 4AVSA 5FLIA 2AYHA 1B09A 1OLRA 3ALQA 4XMAA 1R1A3 4Z8BA 1Z7S3 2FZ1A 2D5HA 3ZYGA 1HRI1 2HWB3 3VBOB 4JDOA 4RR3C 4IEXA 2JX9A 3LSEA 4BMBA 1NA1A 2BFUL 2BPA2 2GN7A 1N1VA 4JDMA 3SHRA 3OD4A 1VBA3 5JWPA 3WDYA 2WSVA 1O3RA 4L99A 1RHI2 4JC1A 1DZTA 4B7EA 4CEWA 3J26N 4RHV2 1CESA 5KXBA 3PJQA 3VBUC 1RVF2 2NZ9A 2VW1A 1B35A 3HAGA 4NVPA