5BXXA

Crystal structure of the ectoine synthase from the cold-adapted marine bacterium sphingopyxis alaskensis
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
121
structure length
121
Chain Sequence
MIVRNLGDIRKTDRNVRSDGWASARMLLKDDGMGFSFHVTTLFAGSELRMHYQNHLEAVLVLKGTGTIEDLATGEVHALRPGVMYALDDHDRHIVRPETDILTACVFNPPVTGREVHDESG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-ectoine synthase
publication title Biochemistry and Crystal Structure of Ectoine Synthase: A Metal-Containing Member of the Cupin Superfamily.
pubmed doi rcsb
source organism Sphingopyxis alaskensis rb2256
molecule tags Lyase
total genus 27
structure length 121
sequence length 121
chains with identical sequence B, C, D
ec nomenclature ec 4.2.1.108: Ectoine synthase.
pdb deposition date 2015-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06339 Ectoine_synth Ectoine synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5bxxA00
3I59B 3H3ZA 5C6CA 4HBNA 4ONUA 3UKTA 3MYXA 3R6SA 1QY4A 2BNOA 2CAUA 3KGZA 4LLOA 3B02A 3DV8A 5J48A 1VP6A 3CLPA 2B9UA 3KCCA 1CAVA 1YFUA 1CAXA 3S7IA 1O3RA 5JSOA 4YARA 2D93A 3LA7A 3H9AA 3KSCA 1YLLA 2PAMA 3DL3A 4MGIE 1J1LA 5CADA 3L2HA 3USSA 3CF6E 4JTNA 4XFIA 3E97A 4O9EA 1WLTA 1OMIA 3I54A 3NKTA 3H7JA 3OCPA 1SEFA 4I02A 3UKVA 3WW2A 3PVBB 3SMHA 2OYZA 3E6CC 4XF4A 2QJVA 3M3IA 1FXZA 1Q43A 2PQQA 2QCSB 3ES4A 3OTFA 4FT8A 4IEWA 4QGMA 5I0UA 4AVCA 1ZZ9A 5JSRA 2GC2A 3I59A 4X6RB 4X6QB 2PA7A 2IC1A 2PFWA 4Q0SA 2MHFA 4XFCA 2WFPA 3RDIA 2CGPA 5BXXA 3CO2A 1I6XA 4Q0QA 1OD5A 4JV4A 4HSLA 3D0SA 4YYOA 4QM9A 5I0SA 2UYAA 1QXJA 1O3QA 1GQGA 4ZU4A 3BB6A 4EWAA 2IXLA 2GU9A 3S7EA 4HSJA 2MNGA 3MDPA 5FLHA 4IEQA 3WW1A 4META 5KHIA 1Q3EA 2UYBA 5J3UA 3OGJA 3FZ3A 4Q0UA 3U11A 3FFQA 4FAHA 3HT2A 3RNSA 3KGLA 3BPZA 5FCCA 2IXJA 1CAWB 4YNIA 2GC1A 2F4PA 1RL3A 2V09A 3VHRA 2OZJA 4YRDA 2VQAA 4AXOA 4JVAA 3SXWA 1X8EA 5CVRA 5HI0A 1DZRA 5FLIA 3E5QA 3ELNA 1EYBA 2ETEA 1IPJA 2ZKLA 5I8YA 4OFGA 3E6BA 3M70A 1JUHA 3FWEA 4PJYA 4XFAA 1O3SA 3IDBB 4FAGA 4E2GA 4EWEA 3RYPA 3LZZA 1Q5OA 1VJ2A 4I0AA 3IIAA 3QOPA 1ZZ6A 1DZTA 1FI2A 2XHKA 3ACLA 3E6DA 4BH9A 3PNAA 5JSPA 2PAEA 3ZDSA 1Y3TA 4KWJA 1UD1A 1YWKA 4NVPA 3SCHA 4E2QA 4LA2A 3LA2A 2MPFA 2XLGA 3MPBA 2N7GA 2PHDA 2C0ZA 1CAWA 4QM8A 4MGYE 4I2OA 5LRSA 4LTAA 1ZVFA 2GZWA 2XGXA 2E9QA 3KMHA 4IEPA 3LA3A 4PIZA 1CGPA 1GQHA 3ST7A 1YFXA 1SFNA 2QVSB 3H7YA 2GAUA 4O9GA 4JTOA 4L2NA 3E5UA 5FQ0B 2ZCWA 4GULA 5BPXA 2H6BA 1XE8A 3RYRA 3H1WA 4B29A 1ZZCA 1O4TA 2B8MA 1HW5A 5I8TA 2ATFA 4IEYA 2FMYA 2QDRA 4D7TA 2QNKA 1SQ4A 4XF9A 4F8AA 2KXLA 4PIXA 4A2UA 3WW3A 3JZVA 1X7NA 1LKNA 3IWZA 3RYKA 1FT9A 5LEKA 4TLFA 3O14A 5JAXA 2IXKA 1DGRA 4PIYA 1CAUB 4KWKA 1J3QA 3LAGA 5KHKA 1UW8A 3LWCA 4HLTA 4J1XA 4EWDA 4WVZA 1ZZBA 1J3RA 5CU1A 2Y0OA 3H8UA 2PYTA 1UPIA 5EZWA 4Q0VA 1OI6A 3DKWA 2DCTA 2K9ZA 3EBRA 3G7DA 5FQ0A 3CL1A 1ZZ8A 4IEVA 2HJIA 3OF1A 3RZZA 2D40A 5JR7B 2XKOA 2GC0A 4HVQA 4DINB 3BALA 5KBFA 1ZRFA 4MX3A 1WGPA 5E1RA 2PAKA 4XF3A 2FQPA 2BNMA 4F7ZA 3FHIB 3N4MA 5K8SA 3TNPB 5E16A 4XFBA 3NSTA 1DGWA 2OA2A 1ZNPA 3CEWA 1LB2A 4XF0A 4AVAA 1WA4A 1UCXA 2EAAA 1CAUA 4R8HA 1O5LA 3S0MA 3HQXA 2OPKA 4MGZE 1YFYA 1EP0A 1ZRDA 1RGSA 2B5HA 4KU8A 2Q30A 2WC2A 3D82A 3H1YA 4IEOA 2BEOA 4HZFA 2GC3A 4WZCA 5EFUA 4MGKE 3H3UA 2VPVA 3ROUA 4QGNA 2EVXA 1PM7A 3EQEA 4HVOA 4XEZA 1PMIA 4MH0E 1NYWA 2O1QA 3OD0A 5FLJA 1NE4A 4OLLA 3HIFA 4Z82A 2IXCA 2Z2SB 3FJSA 5KHHA 3EHKA 4IETA 3U0ZA 3C3VA 5I8SA 4Q29A 2XL9A 1J3PA 3GBFA 1NE6A 4AQ6A 2O8QA 3QACA 3MZHA 4BYYA 1YFWA 3ETQA 1ZX5A 2Q1ZB 2PTMA 5AVPA 3PLQA 3GYDA 1EY2A 1I5ZA 3EO6A 3ES1A 4IEUA 5T3NA 2HKXA 1QXRA 4L11A 5D1IA 3E5XA 4LA3A 2K0GA 4I01A 2EA7A 3SCFA 4CYDA 4HN1A 1CX4A 4KU7A 2I45A 4J1WA 5FDBA 4LULA 5J7MA 3H1MA 4XFGA 2IXHA 3FX3A 5BUVA 4QGLA 3D0JA 4UBHA 3EJKA 4AQ2A 3H50A 1RTVA 2D5HA 4ORFA 1OFNA 4QX5A 1UIJA 1LRHA 1J58A 2OZ6A 1IPKA 4E2SA 2XLAA 2ET1A 1O5UA 3LOIA 5BV6A 4I09A 4N9HA 2IXIA 5LRRA 4XETA 3SCGA 4IEXA 2PHLA 1YHFA 5FPXA 1ZRCA 3SHRA 4XF1A 2Q0AA 4P9GA 4XFHA 3BU7A 4YSFA 1ZZ7A 1O7FA 1X8MA 4EV0A 4IEZA 5F1RA 2UY8A 2D5FA 1YUDA 1XE7A 1V70A 4QMAA 2BNNA 4EROA 3HT1A 3NW4A 4IESA 4AVBA 1O3TA 4BIFA 3WW4A 3UKNA 2P17A 1NZCA 4H7LA 4HN0A 3U10A 1UIKA 4K8FA 1RUOA 3IDCB 5FPZA 3TNQA 4KL1A 1VR3A 2CAVA 4LUMA 1RUNA 4HVRA 3BCWA 3RPQA 1H1MA 4R52A 4Z07A 3NL1A 2CV6A 2ET7A 2UY9A 2XL7A 4KWLA 4BHPA 4XFFA 3I7DA 2BGCA 1L3JA 4I3PA 3NVCA 1QWRA 1CAVB 4LUKA 2XLFA 5JCTA 1G6NA 1XRUA 1CAXB 1TQ5A 3FE5A 3CJXA 4MUVA 2Z69A 4MZUA 1NXMA 4IERA 2GH2A 4I0BA 1EPZA 2H0VA 1ZREA 4MV2A 4Q0PA 4D7SA 2BYVE 1U12A 5I93A 1RC6A 4LEJA 4RD7A 5I0RA 1LR5A 2XKPA 4ZU5A 3IBMA 5C8WA 1Y9QA 5I0TA 3NJZA 5I91A 2VECA 4HMZA 4N9IA 3DN7A 5KHJA 2H6CA 1X82A 4FBFA 4UBGA 1H1IA 1ZRRA 4QXKA 4WBBA 4ZU7A 4UXAA 5BY5A 5KHGA 1J59A 2Q4SA 5LEJA
chains in the Genus database with same CATH superfamily
1CONA 5C9AA 3P3PA 5LWBA 1REEA 2Q1FA 2VW2A 3WXPA 4AGRA 1NCQA 4HBNA 4ONUA 2WSUA 1S0EA 2VNOA 3WHTA 3S57A 1R093 1S2EA 1OA4A 1UZYA 2CAUA 3LEMA 5F3EA 2WAOA 5GZEA 3VDDA 4CPBA 4Y1XA 1V6IA 1TMF2 2QQOA 1AR71 2XUEA 5J48A 2ADEA 1ULDA 3HD8B 4IQPA 2JE9A 2LM3A 4YVSA 5LA0A 3AZXA 1L7LA 2OW4A 3NMBA 4WVVA 1YFUA 1HQLA 3BODA 3V0AB 1BKZA 3H3LA 1CVNA 4FFHA 3ZR5A 4MSVA 5JSOA 1RB8G 2NN8A 4JQRA 1QDCA 4AEKA 5CKQA 4YM2A 1Q8SA 2RE9A 5CKNA 4XQ4A 1DQ2A 4A6OA 4MGIE 2YXSA 5F32A 1J1LA 2YC4A 3MUY1 1OT5A 5A80A 2QZ2A 5GKAC 3VZMA 5DAWA 3ZXKA 4GZ9A 5HBAA 3USSA 1UQXA 4JTNA 1HLCA 1QOOA 2VZ1A 3MIFA 2YC0A 4CUBA 1OMIA 2OIIA 3AJYA 3H7JA 4XBNA 3OEBA 1MZEA 1RUF3 3T30A 1XNAA 2RS11 4I02A 3WW2A 5T50A 1ASJ3 3MBWA 3M8LA 5FK8A 1IHMA 5JOWA 1GOGA 2QJVA 3E6CC 1UZVA 3M3IA 1LHOA 1RHI2 2GH8A 1PZ9A 3S5AA 5JOZA 3ES4A 2QCSB 2R1DA 3A22A 4QGMA 5I0UA 3RJRA 3ILRA 1RHI1 2P2KA 2W1WA 3PMEA 1L7QA 2CWSA 4CP9B 3H8RA 2IC1A 4NROA 4Q0SA 5A3PA 1PO22 4BQ5A 5BXXA 2BERA 3NNMA 4UW6A 5F6LB 3WNXA 4Q0QA 3VKFC 2C9KA 1KS5A 4BQYA 3QH7A 3T4HB 1ENRA 2ZGNA 2ZEWA 5GLUA 4ZY9A 4PBOA 5IJRA 5K0UB 4Y22B 1O3QA 2BZDA 1VBA2 4EWAA 2ZMLA 2Y8KA 3J26N 5EV7A 1HIXA 1WMEA 4YW5A 2X29A 3A4UA 4IEQA 5FYMA 2RS31 3WW1A 4EQVA 4EE2A 4GMP3 4OMDA 4META 3GZEA 1BVP1 1IOAA 3P1IA 3T2OA 1MR5A 5J3UA 5KR7A 1G9BA 1NX9A 4FAHA 3RNSA 3J7NA 1UOBA 2NZ9A 1NCQB 3BPZA 3POEA 1N1TA 3ZYBA 3VBRA 5FY0A 2DURA 3FHAA 1DGLA 1R082 2V09A 3BVCA 2R32A 1B35C 2OZJA 1PGW2 1TME3 1IQAA 3LDRA 1UN1A 4GMP0 1EAH3 4MVTA 1W8NA 3TEXA 4I3GA 1WZXA 5L19A 1GOFA 1XYNA 4NPRA 4YVSB 2WO2A 1SMVA 2WUHA 3VBOC 1IPJA 1RUG2 1CIYA 1QQP2 1X50A 3E6BA 1CJDA 3I2FA 4GKYA 2VCMA 4XUTA 2VZRA 5DAPA 2VCBA 1XBFA 3AKSA 4XJAA 5A3WA 5JPMB 5EQUA 2DUPA 1RVF2 5FZMA 5IVFA 4PJYA 2YFZA 5H9RA 4CDUB 5LASA 2P3IA 1REDA 1QJU2 2PHWA 3M1HA 1LHNA 1BYHA 3ZDVA 4FAGA 2BPA2 4E2GA 3IM0A 5LATA 4V1PA 1QJU1 2GP3A 5C4WA 2Q8EA 2RR12 3NWKA 4Y4YA 1H9PA 1UAIA 3LZZA 3AVSA 3QOPA 2G1MA 3ALQA 3UYJA 2RR11 3O1PA 3ACLA 3T0BA 1STMA 1QOTA 1LULA 2KD7A 3J7HA 4ET7A 3K3OA 3WINE 4E9KA 2CWMA 3PNAA 2PAEA 4RFT0 3UGHA 2A70A 4K6BA 2ZGPA 2C4XA 1BBT1 1Y3TA 4URTA 5A7NA 5FZOA 3NJYA 1JU3A 1QXPA 1F31A 3SCHA 1VBD1 2PLV1 4LA2A 3WF1A 3VDAA 3RZGA 3W9AA 2JB4A 2VOTA 3NNLA 4NMIA 3JBG1 2PHDA 4NUBA 1CAWA 4L92A 2D3RA 4QM8A 3ZFGB 4C1XA 1QH6A 3O12A 4J6GA 1LOAA 4LTAA 4A42A 2XGXA 3BGAA 4LXLA 4IEPA 1GFF2 3EYPA 5EJZB 4LPLA 1RUC1 5TSWA 2J1TA 1V00A 1GANA 1BK1A 1SFNA 2D6OX 4R9AA 3RI9A 3NV4A 1XSRA 3ACFA 4FPJA 3VDBA 2ZX0A 4JTOA 1DU3D 2YBKA 4GULA 3SC7X 3U78A 4RS5C 5APAA 5BPXA 4LHKA 1N3OA 3AYCA 1TMF3 1XU1A 4WM8B 5CB7A 5KXCA 2XMLA 3H1WA 5FREA 5T52A 4DXSA 4PDWA 4B3NA 2B8MA 3B93A 5IVCA 1REFA 1GZWA 5I8TA 5GLTA 4N43A 1AJOA 1N47A 1OKOA 3LQCA 4LKSA 2E7TA 5T5OA 4AI8A 1JBCA 2FMYA 5FZ6A 5A1LA 5FY8A 3ORJA 5IVBA 3SKVA 5FP4A 1YJLA 3VKOA 3WQ1A 3CHXA 3SISA 3M7AA 3VB9A 4ISQA 4DY5A 4A2UA 4C90A 5I0DA 5IVVA 3ZFEC 3JZVA 4J25A 2VTXA 3IWZA 5F5AA 1QF3A 2V4VA 3B00A 3IN9A 1V6MA 4AGVA 4GWMA 3BIEA 4TLFA 3O14A 5EYYA 2WAAA 1O8PA 2D98A 4PIYA 1POQA 5JXGA 3UJOA 3PJYA 3H0OA 4R9DA 2WRAA 4QPGB 1DGWX 1J3QA 3PUSA 3AZYA 3TEWA 3I2IA 5L9RA 3HBKA 5JUVA 1OQEA 4HLTA 4J1XA 1NOVA 1RHI3 5FZHA 4WVZA 1ZZBA 4LIVA 5CU1A 3PURA 5DPNA 3BYWA 2E33A 5FPUA 3KQRA 1LU1A 1UPIA 3N9MA 2JXAA 2A5ZA 1PO23 2DCTA 3EBRA 4AEMA 3QCWA 1JW6A 3G7DA 3GZUC 1E5SA 2R49A 1CQ9A 3CL1A 1ZM1A 4MYEA 2C9AA 4LNVA 1TZOA 1Q8OA 3NAPB 3VKNA 2KA3A 3GALA 4JQTA 3UESA 3ACGA 2LTNA 1C5HA 1U0AA 5KBFA 1ZRFA 2I2SA 4V2VA 3VD3A 1K12A 5DMYA 1DFQA 2YZ4A 3JUUA 4BXSV 2YGLA 3FHIB 4YG0A 4QAWA 4QKBA 2X53S 5K8SA 2YBPA 4YVWA 3TNPB 4XFBA 2OA2A 3AP6A 2J1SA 1ZNPA 5A6YA 4FPFA 3P6BA 1YIPA 3U37A 2FZ2A 1GNZA 4Q4V2 3I2HA 1WA4A 4NRPA 1CD3G 2HBUA 2IVIB 1ACCA 2EAAA 4XPVA 2FHRA 1CAUA 2QQWA 3GF6A 2GNDA 3ZMOA 1R083 3S0MA 1UYZA 2P34A 4Q4V1 4YLZA 2XB6C 5CA6A 3RZMA 4MGZE 2W95A 4ES9A 1KFXL 2EIGA 2Q30A 5LBEA 3HWJA 4NO4A 5H9QA 4EN7B 5KXEA 2D97A 5EJ3A 4Y1UA 3R4SA 1RUG3 3ZLIA 1QQP3 2JG9B 2P6HA 1W6OA 4OCTA 2JDHA 5EFUA 3UJQA 3VBSB 4MGKE 3VBRC 1VE0A 5FYZA 3WUCA 4OHWA 4UW3A 3V0BB 1C4RA 1W8TA 3POGA 1C8NA 5T54A 2GN7A 4QX3A 1G9CA 1QJU3 3ZYRA 5F39A 4CDXC 1QHDA 5L7OA 1PMIA 2ZX4A 1R1A1 1EUTA 1QJFA 2WQ8A 2NLRA 5FJHA 5FJKA 2RR13 2O1QA 5BNNB 3KS7A 5IFTA 5IYYA 5FLJA 3AZZA 3PTRB 1MS3A 4ASKA 3FBMA 3FMGA 4TTGA 1FV3A 1OOPA 1QJY2 3HIFA 1YIFA 4C91A 1ENQA 2HYKA 2ZGOA 1AXKA 4FQ4A 1V6JA 4Z82A 1W0PA 1S2KA 1E57A 1ND2A 3KVAA 1QJY1 2Z2SB 3OGGA 3VBUB 4DXRA 4IETA 3JBG3 1LOFA 1UKGA 3A23A 3LCPA 1OUXA 2ZJCA 1XYPA 4ZPIA 1DG6A 3OBAA 3GBFA 3BIWE 3MICA 4YWAA 3WOGA 1RUD2 4QB1A 4HK8A 1YQCA 4XCAA 3CNAA 1MVEA 5C3QA 3WF0A 4BYYA 1YFWA 4IV3C 3NV2A 4HONA 1WCQA 1N1SA 1UKRA 2DFCA 2DTWA 5K7PA 3LB9A 5CBLA 2PTMA 3S30A 3WLUA 1XNCA 1GR3A 4PQ9A 1EY2A 3EO6A 3ZFFC 5JIAA 2DFBA 1U5XA 3RZKA 1HRV1 4LA3A 3OY8B 3WV6A 2K0GA 5SV8A 1XQNA 4BQXA 2ILMA 3K4DA 3SCFA 1YQ2A 3DPRC 5IT6A 1UY4A 1PO12 5FDBA 2FCVA 5FMBA 5J7MA 4LJHA 1GP6A 1XE0A 2WYSA 4DEQA 5CNAA 3FL7A 1F15A 4COZA 1ND3A 4QGLA 4QHZA 3I49A 2EAKA 2QDNA 1WUVA 3AKRA 1RTVA 3I2GA 3VLBB 4OUSA 4WVMB 2ADDA 3H8XA 2D5HA 4K21A 4ORFA 3KF5A 4A7KA 1UOJA 1OFNA 4GWIA 1W6QA 3MHZA 4CU8A 4N43C 5FMCA 2XWJB 4JGZB 3K75B 2WZR2 1J58A 4YGBA 2HWD2 2RM21 1X36A 2W0XA 2VZTA 1H2MA 1O5UA 4YGCA 5IK5A 1SZBA 2AGSA 3CQOA 1L7RA 1W0OA 4QHOA 5DDJ1 2HWD1 1W8UA 2ARCA 4FCAA 2IXIA 4N9HA 3WNMA 1FMD2 2A6ZA 4DRVA 4IV1A 4IEXA 4KI5M 2W08A 3F2ZA 4XMIA 5BNOC 5CFDB 5FPXA 3SLIA 3N7KA 2IZWA 1JZ4A 3O1TA 1FMD1 2Y26A 2P3YA 2ZABA 1Y4WA 2Q0AA 2AREA 4Y26A 1C3HA 3W59A 2EXIA 2JWPA 4XFHA 1IG0A 4YSFA 2B46X 2ZTNA 3Q8AA 5FBZA 1ZA4A 4NHLA 5FKCA 4CPBD 3O7OA 4YW4A 1H8TA 4UFMA 3ETPA 4JCKA 5C3OA 1OOPB 2EIDA 4OHVA 2VULA 1DYKA 2UY8A 2YUEA 3CJIA 4CEWA 1VALA 5FY1A 1H9WA 3CIHA 3NNJA 3VL9A 1H6YA 1LAJA 4HG6B 2W5FA 4W8JA 2BTVC 2Z5WA 4H55A 5CISA 1H4GA 2P17A 5EYXA 2FCUA 1CJPA 2B45X 1JUIA 1OLMA 2WNEA 3GHNA 4MGSA 2V5YA 5IAVA 2LS6A 4JZRA 1RUOA 3PHMA 2KM2A 3VBFA 1ULCA 2CAVA 3IDAA 3UT0A 1FX5A 2VAUA 4BZ4A 1H1MA 2F6BA 4Q4V3 4XHXA 1AR61 2P3JA 4R52A 3ECQA 2GDFA 3KT7A 4GB32 3WP4A 2VCAA 1MPXA 4FPYA 5FO7B 5A7WA 4XACA 2VZ3A 3I4IA 4CXYA 5BNPB 3VZJA 1PIV1 2YU2A 4Q4Y1 4KGQA 1OLRA 1VIWB 1V9U2 5FY4A 3OGSA 1BMV2 1NQJA 1LTEA 4MXWA 4NHYA 1TQ5A 2WNVA 1SLTA 3AMQA 1VMJA 1W06A 2W87A 2MEV2 3KB5A 3MUZ1 4FTBA 3LPGA 3QLQA 2WN2A 2RVAA 4XQWA 5F37A 4IERA 3T0DA 4XILA 2DCYA 4Q4X1 4YGDA 5C8CA 4MV2A 4Q0PA 4XAAA 3P5BA 4CXWA 1W8FA 4XYXA 5IFPA 1WW7A 5I93A 5ISLA 3U14A 2HBTA 3A7QA 5T55A 5CEHA 1QJX2 3I3DA 4ZU5A 5B4NA 2HH9A 1W2NA 2QKDA 1AJKA 5I0TA 1CZVA 1K3IA 2VY0A 5A3MA 4JDOA 1A34A 5FO8B 5L36A 3VD5A 1QJY3 2ZKNA 3EMRA 1JZ6A 1ZBA1 1W3VA 2H6CA 2D43A 4A3ZA 4AVTA 1WCKA 2ZGKA 1MQTA 5T5PA 4LR4A 1VMHA 1NAEA 4CCDA 5L7OC 3ZYHA 2W2IA 3GCXA 3LOBA 3H3ZA 2XBO1 2YV8A 4AE2A 1RMU1 5C6CA 1TNFA 1Z7S2 5FP3A 2WSVA 3VZKA 3WDTA 1W39A 2JDAA 4OQ9A 4A3XA 1RUD3 2WNUC 5EPAA 1FAYA 2BNOA 2YHJA 3WF4A 3ZXDA 4L99A 3VKLA 1AR91 4CCCA 1LOBA 2VBDA 5LZ6A 4LLOA 4W65A 1ND2C 3ENRA 4S2DA 3D6EA 2ID4A 2Q5TA 2QQLA 5FPLA 3WP5A 2CDOA 4NPMA 5JPNB 1UXZA 2VD7A 4EJRA 4EZ4A 1BCXA 1CAVA 1Q8QA 1JI6A 2UWBA 1GUIA 1HRV3 1QKQA 3S7IA 1CAXA 5LA9A 4JRLA 5HCBA 5F7UA 2GSYA 4KQ7A 2DTYA 1GSLA 3KSCA 4H14A 1R1ZA 4LKFA 1YLLA 2VQTA 1SACA 3FUQA 1ENXA 1H6XA 4WM7B 1RUF2 4F83A 1PO13 1XNBA 3HOBA 5CADA 2KR2A 4IE4A 3L2HA 4XFIA 3E97A 1J83A 1EV12 1UZZA 4QXCA 1UY3A 2F4LA 1RUI1 1KD7A 2BBAA 1KITA 2RMU1 2PMWB 3NKTA 1QEXA 2NPIA 4G9SB 2C1FA 1QMJA 1SEFA 4E27A 1Z78A 1AR81 2DF7A 2Y60A 1RINA 5LBFA 2OYZA 2JIGA 1MS9A 4QKFA 4XF4A 4HXCA 4YM1A 2CSGA 3ZN6A 4IEWA 1GP5A 1PX4A 2WFF1 1DBNA 1K5MA 2WZR3 1YI7A 1D0GA 2X5IC 2HWD3 3HMYA 3ZN4A 4AVCA 1DYPA 2WNVB 2BFUL 1Q8PA 1HDKA 3ATGA 2J1AA 3AXEA 2BP6A 3I8TA 3TRSB 2PXJA 2MHFA 4XFCA 2WFPA 1FMD3 5FUIA 5FR3A 4JGYB 5FXWA 1Q8VA 1QGLA 2CGOA 2OVUA 2CGPA 2BBVA 3VGIA 4P5YA 2FZ1A 4CDQB 2R042 1VRBA 3KT1A 4HSLA 4M00A 3J7MA 1SBDA 2AEZA 2UYAA 1QXJA 4LT5A 1GQGA 3V0AA 5GLWA 4CP0A 1AYM2 2A75A 2GU9A 2VQUA 2YC2A 4HSJA 1LOCA 4AEDB 4CVUA 5FLHA 3MW4A 1YJKA 1RUH2 1RUJ2 1W6MB 1Q3EA 1SCSA 1LENA 4Z1VA 1NY72 3OGJA 3FZ3A 2YFUA 4FP3A 3SITA 1YO8A 1H8VA 3HT2A 3N9OA 5AVAA 3KGLA 2DBNA 4BQWA 5FCCA 4QPIA 3ZVXA 2BU9A 2JE8A 1DCSA 1H8TC 2I07B 4GJZA 4YNIA 4FFIA 2GC1A 2VVFA 5DQ0A 5F3IA 3ZKYA 4E8CA 3VHRA 5JI9A 1S0JA 5J98B 3M3OA 3MEPA 4AXOA 1GBGA 4NIDA 4CDWC 1SFPA 1JOJA 3E5QA 3ELNA 3HQUA 1ZA7A 1EYBA 2LW8A 2VNGA 4GB33 4N8MA 4QB6A 4FTEA 2ETEA 1E5RA 2BGOA 3AL5A 2VBPA 3AP9A 3MLLA 4CP9A 5CKMA 2R7EB 1TG7A 5EXOA 3FWEA 2WA3A 1V9U3 3HBZA 4XFAA 3MF6A 1UMHA 1VBB1 1UNBA 3VBHB 4C8DA 3KHCA 5KC6A 3OPZA 2J7MA 3MIBA 5C7GA 2NYYA 4GWNA 1S0DA 4EWEA 5FZDA 4Q4X3 3UV9A 5K0UA 4Y22A 4LBQB 4I0AA 2XJUA 3IIAA 2GNMA 2X09A 1SFYA 1JXNA 4K40A 4Q4W2 1GNHA 2G4IA 4AR2A 5J1XA 4BH9A 2VJXA 1UY0A 4FPOB 2Y6FA 3POJA 1NLRA 1PK6A 1VB2A 3UL2A 1LU2A 3RVHA 4OYUA 4OI1A 1QJX3 4KWJA 2WS91 5IVYA 1YWKA 3LA2A 4M3CF 2VZSA 1HRI1 4O65A 4EN6B 2PHRA 1OXCA 1US3A 2ARBA 5FMOS 4D69A 2C0ZA 4N53C 1BLZA 4Q5OA 4I2OA 1CX1A 1AR72 3BOWA 4WV8A 2RS51 5GM0A 4XUPA 2GZWA 2WZ8A 1OA3A 3TWIA 1GQHA 3ST7A 3WP6A 2BDRA 1Z7S3 4G4FA 5FAXA 1VBE1 2VVDA 5IK7A 3L2YA 5FQ0B 2GMMA 2ZCWA 1DGRN 5A3TA 1DIWA 2R16A 3TBDA 3JD71 5GZCA 1JZ5A 2H6BA 4JAAA 4PHZA 1WD4A 1DQ1A 4XXPA 1XE8A 5FYVA 3RYRA 2JENA 4H7MA 4NPLA 4YW1A 1S0GA 1RJ7A 2WBKA 3O0VA 4CDUA 3I2OA 3L9JT 3VZOA 1OHFA 4CA9A 2OS2A 3ZYFA 3WDXA 4PQQA 5JOXA 2QDRA 4MHUA 2QNKA 4XF9A 1B35B 1NA1C 4F8AA 4QPIB 3JB8A 1VRH1 1AXZA 4FP2A 3ZO0B 2RS12 5CG9A 3RMYA 4Y20B 5T5LA 4EN8B 4YZ5A 5FZIA 5FZ0A 5FXXA 3RYKA 2H0BA 1F4HA 5F8PA 1M4WA 1BK0A 4OMCA 1ENSA 1RUI3 5K9YA 2Z79A 2RMU3 5LEKA 4K1YA 3SEEA 2VU9A 1V0AA 1EV13 2VO5A 3ZPOA 5JAXA 1JYXA 3PVEA 4LE3A 2QQMA 3RS6A 4UFIA 3ZXLA 5F3GA 5FZAA 2OUJA 5FZLA 5KHKA 2O14A 2VZPA 2W94A 2WFF3 1UW8A 1N1VA 3ZFGA 2WQZC 1WKYA 3Q8BA 3AL6A 4EWDA 1D7PM 2R6QA 3NO8A 4AHWA 4CEYC 2AZ5A 4DRRA 3U1XA 4Y1ZA 4DMIA 5FPAA 1AVBA 2ZAHA 4Q0VA 1GNYA 2TBVA 5C33A 4M3CE 1OI6A 1MACA 1MEC2 2PHTA 2QQVA 3ACHA 3B5LB 3MIEA 4JKLA 4E4ZA 5F9TA 2RS32 3VL8A 1NCRC 1ZZ8A 1MEC1 3KCYA 1PMHX 3OF1A 2R043 3RGBA 4B7EA 3O0WA 4WM8A 2D40A 2XKOA 1PZ7A 2GC0A 1PK6B 3BPSA 1LOGA 1K5MC 3K4ZA 4XHBA 4CTEA 4RQPB 3BALA 5FOBB 4XUNA 1H2NA 4HPKB 4MX3A 2WINB 4Z2WA 3POYA 1AYM3 2PAKA 2FQPA 3PUHA 1XNDA 2BNMA 1LECA 1O91A 1RUH3 2QUOA 3DXTA 1RUJ3 3PMSA 4KWUA 4QX0A 4FPGA 3OBZA 2Y64A 4BQ2A 3LEGA 5E16A 3WQ7A 3X29B 4GA9A 1AZDA 4FOWA 1XXNA 4DPNA 1YEWA 4OHXA 3CEWA 4K3UA 1LB2A 1EUUA 5CFCC 3WVJA 4RS5B 2W52A 2WDBA 3R0RA 5GJ6A 1O5LA 3T0AA 1JYTA 5HV0A 3RZLA 1CZSA 3HQXA 3LFIA 1OSGA 2OPKA 4XCBA 3IAPA 4QPGA 5FBJA 1IZ3A 2FDGA 1YFYA 3AKPA 1HN0A 1BJQA 3BN6A 2VG9A 1W90A 2DU1A 2WC2A 4IEOA 4ZS2A 4HETA 2GC3A 4HZFA 4WZCA 2HWE1 4DB5A 1OH4A 1KDKA 2EIEA 4CU9A 4DY3A 2W39A 4HL0A 1FPN1 1X9PA 2XUMA 3H3UA 3ZFEB 4A41A 1GKBA 2GMPA 3BTZA 2W1UA 2O8OA 3OD4A 5AC91 1PM7A 3EQEA 1BEV1 4HVOA 5JOYA 1PGSA 4D6QA 3A0NA 1BBT2 4XEZA 2J1VA 4L0PA 4MH0E 1HQWA 3NAPA 3PJQA 3WDWA 4BQ4A 5IATA 4HOOA 1VBD2 2PLV2 3OD0A 2OQ6A 3GJAA 4TWTA 3O1RA 1NE4A 3JBG2 4XJ8A 4E8DA 4ZZ5A 2P37A 1OQDA 2AH2A 5L73A 4Q4W3 4L8QA 4QXHA 4FPCA 1I1EA 4COUA 2JD9A 3RWKX 2WN3A 4Z92B 1AX0A 1T6BX 3FJSA 1S0IA 1RUC2 1W05A 3EHKA 1C1LA 3Q9OA 3C3VA 1JZ7A 2QQPA 3AKQA 5FZ3A 3KQ4B 1PNFA 2K2SA 1W9TA 1LEMA 2VW0A 2JD4A 2FDKA 1AR73 2RDNA 1OLQA 2Y34A 1UY2A 4QD2A 1XYOA 1KEXA 3ETQA 1ZX5A 4P9JA 2Z42A 1LJ7A 3NJVA 5DXDA 3WY6A 5JXIA 1W9FA 2HLEA 4TSVA 5AVPA 3PLQA 2J1RA 4IEUA 1I5ZA 5C9AC 3ES1A 2WA4A 3AXDA 3QD6A 5AFBA 2JG9A 2RV9A 3KZ4C 1NCQC 3VBSA 1W28A 1H2KA 2D7FA 4I01A 3JCIA 3JU9A 2VMDA 3V0BA 1DP0A 2RG4A 5GZGA 3VDDC 3AKTA 4HN1A 1ZBE2 2I45A 3N7JA 4BOWA 3AZVA 4J1WA 5FXZA 1P8JA 2WIIB 4YW6A 2IVJA 3LIGA 1ZBE1 1VLNA 3BTAA 4YVSC 3W5NA 3ILFA 2WYFA 1UL9A 5BNNA 2R1BA 3VN4A 4LO4B 3KV5A 4A7ZA 3ZSJA 1IS6A 2RS13 1KS4A 1UWWA 1DQ0A 3H50A 3J8F1 4LO8A 4LBLA 2CL2A 2ZS6B 3EXUA 2VXRA 3WQ0A 5JZGB 4U2AA 4CDUC 5IUQA 2VQ0A 3APBA 5JLVA 1QNWA 1UIJA 3VBUA 3WNOA 3KV9A 2DVBA 4BXFA 5A70A 2OZ6A 4QWNA 3U4XA 4QPYA 3WCRA 3HR9A 4IGQA 5JI7A 2D6MA 4AOCA 4YZ3A 4NN0A 2AENA 1G9AA 1APNA 2W9XA 5LRRA 2WKKA 2XJQA 1GOHA 3B9CA 4Y5SA 2WABA 2WLPA 2XJTA 3I2JA 2IUWA 1FYUA 4XBLA 2DCJA 2CHHA 3FLPA 5JIUA 3GZTB 2J1UA 2DU0A 3PU3A 1BZWA 3SH4A 4CZSA 4IE6A 3KF3A 1ZZ7A 4R4ZA 2XH6A 4QKDA 1X8MA 5KC5A 1MEC3 2L9LA 4EV0A 1IKQA 4OULA 3WD5A 4KNCA 2AR6A 4QX7A 2RS33 1YRZA 3NV1A 4OI0A 1W2TA 3KWVA 5FTTC 2A3WA 2PHXA 3OY8A 3RMXA 2YY1A 3M3EA 1IKPA 2ZX3A 4XABA 2AC1A 1URXA 1YUDA 4NAOA 4QQPA 1V70A 4AFBA 3B01A 4QMAA 4SBVA 1C8M1 1GWLA 3AP7A 3HT1A 5H9SA 4EROA 4AVBA 3KHBA 3WSOA 4LK6A 4BIFA 1FNZA 3WP3A 1W2OA 2BWAA 2XR4A 3I2KA 4H7LA 4IV3B 4SLIA 1CZTA 3U10A 5AFEA 4CU6A 3JQXA 1JZ2A 3HEIA 3IDCB 4RL7A 4WVMA 5E8AA 1D0HA 1UZ0A 3LIHA 1RUNA 4COYA 3BCWA 4OVEA 3ILNA 1HN1A 3ZFFB 2R0FA 1UMIA 5IW0A 1JYVA 2VNVA 3IPVB 4JGZA 3CKHA 4XZUG 2DVGA 1TE1B 1WMDA 2IFWA 4Z07A 4KWLA 1JS9A 1D2SA 3DPRB 5KWRA 4XFFA 4MGTA 1R64A 4R9BA 2BGCA 2Q8CA 5D8AB 1GP4A 1NLQA 5CFDA 3NVCA 5ERLA 1R1A2 2Q8OA 2UWAA 4LUKA 5JCTA 5FO9B 4MOAA 3C7OA 3ZKUA 3PVOA 1YI9A 3D3AA 5J09A 4GD4A 1V6NA 4PF1A 5FYHA 3O0XA 3FLTA 4URAA 1EPZA 4QX2A 4XIKA 1PGL1 3DYOA 2W1SA 3LFMA 5LCWL 2ZGSA 3K2OA 4D7SA 2D44A 4BJ0A 1BBT3 1LHWA 2B7YA 4UYBA 4ES8A 1VBD3 2PLV3 4LEJA 1JYWA 3GXUA 4RD7A 4FOYA 5I0RA 4QQOA 2ARXA 5DAVA 4CXXA 1N1YA 2O0OA 3VDCA 5C8WA 1F5FA 1F4AA 1Y9QA 5I91A 2VECA 4OI4A 4QDRA 2RDRA 5C4WC 2JG8A 5BNOB 4N9IA 4LKDA 4DIQA 2A6VA 4YM3A 3VUOA 1X82A 2BW8A 4GH4A 4NRMA 3LD8A 4UBGA 3BKZA 5KHGA 4QXKA 4WBBA 2GALA 4UXAA 4XJWA 4PLOA 4XMAA 1RUC3 4XIOA 3NAPC 4BDVB 4CCKA 4D8MA 2RDSA 1SPPB 1PVC1 3I59B 4AWDA 3BU0A 3GJBA 5LBCA 3TOJA 2WO1A 3MYXA 1UX6A 1G9DA 4Y1YA 1HRV2 1QY4A 4P14A 4RFRB 2ZMKA 3IIIA 5FXVA 1JH5A 3KGZA 5BNPA 2AEYA 5A7QA 2VCCA 3RSJA 3DV8A 4AVSA 1VP6A 5M0TA 5LA1A 2AACA 5EJ1B 3D8CA 4YFZA 2B9UA 4ASMB 3R4UA 3WCSA 5C71A 4MGQA 2VMHA 3KVBA 1QDOA 2B42B 3LEKA 3I97A 2PAMA 2V4AA 1ULFA 2VMEA 2WWSA 1ZBE3 3FHQA 5FYCA 3KM5A 5A3OA 1JN2P 1OF4A 1SLLA 4PDWC 4LMFA 3MI8A 1SLIA 1UF2C 3WF3A 4P9YA 2VMFA 5DAQA 3WZ1A 1WLTA 2RM22 2BVVA 3OUHA 4BK4A 3J8F3 1VPHA 2AUYA 4QT6A 4HT1T 2VZUA 2ENRA 2JG9C 3C8XA 3VBSC 5FYIA 4NR1A 5DDJ2 1SLCA 2JKXA 4LIUA 3THTA 3OCPA 1POV1 3UKVA 2C6SA 3PVBB 4HANA 5K4LA 3SMHA 2HEVF 2YG0A 1PNGA 3VV1A 2JICA 1WMXA 1AUYA 4BE3A 2NMNA 1FXZA 1Q43A 2PQQA 3OTFA 4FT8A 3TB0A 3USUB 2BRTA 3N36A 1ZZ9A 5JSRA 2GC2A 5BNNC 1VAKA 3OPTA 2PA7A 4X6QB 4K1ZA 3AYDA 1WLCA 2PFWA 4R4XA 4B4PA 3MFAA 4PLNA 3CO2A 2WT0A 5DUWA 1AHSA 1OD5A 4FXGB 1A6CA 1AL21 4JV4A 2BOJA 5FKBA 3D0SA 3VBUC 4GJYA 3MV11 2UURA 3IMMA 4RHV1 2DUQA 4QM9A 1A3KA 5HCHA 2EF6A 5A3NA 2F17A 4ZU4A 3SKJE 2VM9A 3KT4A 1NQDA 3IAQA 2IXLA 3B3QE 2JG8B 3S7EA 3MDPA 1W9SA 2E32A 2W3JA 4GH4B 2WNOA 4I30A 3TN92 4PF5A 3CDZB 4WVWA 5L9BA 2UYBA 5IHRA 3NV3A 2D6KA 4WM7A 3VZNA 3OUIA 3TN91 3UETA 1PHMA 1V6LA 2ZGRA 3U11A 1GZ9A 2JIJA 1AR62 1DYOA 2VC9A 3WNKA 3ZR6A 5H9PA 2ZMNA 4B4QA 2A6WA 4RGGA 3POIA 1DQ4A 4YW3A 5LBBA 5FYTA 3VHPA 2HWF1 1PIV2 5FZCA 5C3RA 1UZWA 1S1AA 4Q4Y2 5LA2A 2XJSA 3IB3A 2F4PA 1RL3A 4JDNA 3K3NA 4XC9A 4ATEA 1HXS1 1VMFA 2VQAA 3OBRA 4HKWA 4OHYA 2XONA 1I3HA 3T2PA 4JVAA 2WWJA 2JDKA 1O4YA 2WWUA 4YVWC 5ABJA 2WR9A 1DZRA 5FLIA 1Y7BA 1LOEA 4BK5A 4IGOA 2UWCA 2C26A 2ZKLA 5B4XA 4D3WA 3OYWA 4DUWA 1UOFA 1A8MA 1MZ5A 2EXJA 1HX6A 3AB0A 1M06G 1NLSA 4LHSA 4JRAA 4Q4X2 4JGYA 1DDLA 3IT8A 1R1A3 3DCQA 2R071 5HXMA 4CDQA 2V5DA 2ZAAA 1GZCA 5LY2A 4YW7A 2XQXA 4JGZC 1XPWA 2RJKA 4S2GA 3O1UA 3RYPA 1N3QA 4Y3OA 1Q5OA 1VJ2A 1ZBA2 2VUDA 3J7LA 1ZZ6A 3NJXA 1DZTA 2CYFA 4AEDA 3JQWA 2WT1A 2IFRA 5FWJA 2X5IB 3NNGA 4M4RA 5CFDC 4LORA 1W6MA 3ZDSA 4NOTA 1W3XA 2XBO2 1RMU2 4NVPA 5FY9A 5F2WA 2XLGA 2ZGMA 1X33A 2HWB1 2N7GA 4AFCA 1AR92 5GLZA 2VZOA 1JMUB 1HB3A 4FPKA 4MGYE 1OOPC 3HNBM 4FOQA 4Q26A 5FPBA 1Y9GA 1ZVFA 2ZGQA 2E9QA 3F95A 3KMHA 3WQBA 3O1VA 4D0QA 4IW3A 1LESA 2JX9A 2QVSB 3ZN5A 4ATFA 3N9LA 1LOFC 5A3LA 3H7YA 4Q1RA 2GAUA 2YROA 4O9GA 1HB1A 4L2NA 3E5UA 2YU1A 1SLAA 1AYN1 3AFKA 1HKDA 3LE0A 4UFJA 1N3PA 3QBQA 4ZS3A 3PL0A 4X8NA 4B29A 2J42A 4RR3B 1O4TA 3BI3A 1V6OA 4UF0B 4Y5TA 1KJLA 5A33A 3WNLA 2R061 1HW5A 2Y6JA 5HPOA 3VBHA 3DGTA 4IXLA 3O1SA 1DQ5A 1JODA 3RZJA 1RUI2 5FZKA 2VUAA 2RMU2 4M01A 4U36A 4P5HA 2KXLA 3GGLA 2D3PA 4IGPA 4LBQA 4PIXA 5HXVA 1TEIA 1AR82 1W2UA 2ORZA 3KV4A 3W5MA 1OLME 4Y24A 5A32B 3V65A 1FT9A 2WFF2 3CZUA 2GN3A 2YDEA 3PUIA 3I3MA 4DEVA 2RM23 5ABJB 1WD3A 1POV3 4DO0A 1DGRA 4HKOA 3DEMA 5DDJ3 1LGNA 3URFA 1GLHA 4LLFA 5JDBA 2VUCA 3OYWB 1JYIA 1ND3C 3LAGA 1UU6A 4BWOA 5A6ZA 1LGCA 3LWCA 4AQTA 2E31A 3N9NA 1ULGA 2LRPA 2QQJA 1ASJ1 1PM4A 1W9YA 1J3RA 2Z4FA 2JECA 3HNYM 3POFA 1RITA 1ODNA 3RWNA 3H8UA 3KD4A 2K46A 2VE1A 3LEIA 4LO5B 2PYTA 1OFSA 4BM8A 5IK4A 5EZWA 3MIDA 1POV0 4G3YC 2YGMA 3G6JB 3DKWA 2K9ZA 2VL4A 4M4PA 4AQSA 4QXBA 1AL23 4Q8LA 5FIXA 1SDWA 1J84A 4W6WA 5FQ0A 1J1TA 1QIQA 4OI2A 2D6PA 4FFFA 3W20A 4LHNA 2P4EA 4IV1C 5DZFA 4COVA 5EWSA 1QJZA 3MO4A 4CCOA 3OOXA 3GHMA 5E6HA 1NUKA 5KXBA 4N53B 1OC1A 3KLSA 1H2LA 3N9PA 3T1LA 1LNSA 4Q27A 4XF3A 5E1RA 3V56A 4W6YA 3S5QA 1B35A 2JDMA 1YCIA 2Y6KA 2WZEA 3TN93 3DYPA 4F7ZA 2WZPP 2PQSA 4LO6B 3ZPYA 4Y20A 3DKQA 3N4MA 3Q8FA 3OUJA 5IWFA 3NSTA 3AMNA 4GMP1 3CJIC 1T2XA 4Z2AA 4CEWC 1AR63 1COV2 2FCTA 1AX1A 4AVAA 4NJ4A 1COV1 1HXS3 1OD3A 1XOYA 1PIV3 2QQIA 3KV6A 4R8HA 4Q4Y3 4YG6A 3THDA 4C0BA 1VBB2 4V2WA 1VBC1 2A71A 1EP0A 1Y9MA 1ALYA 2DVAA 4KU8A 1UYYA 1W8OA 2GNTA 4WM7C 4I0WB 1JHJA 3VBFC 1NA1B 3D82A 3H1YA 4RGAA 1OF3A 1WCDJ 3WX5A 4CSWA 1TNRA 2VZQA 3HN3A 3OJBA 1UO9A 3RJ2X 2BUKA 2C24A 3PIGA 1W6NB 2VVEA 1CPNA 4ZZ8A 2JDYA 1PVXA 2VPVA 4EN0A 1KFUL 3T2TA 4CE8A 2VOVA 1RXGA 3ROUA 1JZ3A 5FZ7A 2DWRA 1C1FA 3ABZA 1PX3A 4QGNA 2DCZA 4M3CA 1O8SA 5IK8A 4KBZA 4KBBA 4RGKA 2WS92 5ACA2 3WDUA 1NYWA 3IKWA 5FPVA 3HNMA 3I3QA 4GIQA 1HRI2 1OPOA 3AZWA 4RQPA 2WNVC 3OGRA 5ACA1 1ZBA3 4HPKA 5FP8A 4X8PA 4NHXA 2RS52 3DECA 2QQNA 4AFAA 3O1MA 2JE7A 2VMIA 1B09A 2VOWA 2IXCA 2WO3A 3N7LA 1GYKA 4XW3A 2HEYF 5KHHA 5C8CC 2XBO3 4DXTA 5I8SA 5C3PA 1MZFA 1RMU3 5KXDA 1C5IA 3MV01 4AK3A 4D7YA 5FWEA 3LKJA 1VBE2 1QU0A 1JU4A 2XL9A 5LB6A 1NCRB 4BCUA 2B9VA 4RS5A 1AR93 2YB7A 3JD72 4RN5A 1LHUA 5FZFA 2FDJA 3QACA 2E63A 1LEDA 2GMEA 3M4FA 1MQTC 2JDNA 1UMZA 1AYN3 3J9SA 4TZDA 3ITQA 1YC61 5T3NA 2VH9A 2WL1A 4FI9A 2DVFA 1KRIA 2Y0IA 1MS0A 1VRH2 4L11A 2ZZJA 5D1IA 4Y4RA 1G7YA 4JC1A 2I74A 4LBJA 3ZFEA 2R063 2BFUS 2A7AA 2A3XA 2WQ4A 2EA7A 2CGNA 3HQRA 4CYDA 1TMF1 1CX4A 4CP2A 4KU7A 5CFCB 3B7MA 3OEAA 3MLJA 4LULA 4JHZA 2EXKA 3H1MA 1Z0HA 3VBOB 4AFDA 2E53A 2IXHA 3FX3A 1OH3A 4HK9A 4R9CA 1C28A 5BUVA 3D0JA 3S6PA 3EB7A 4OZOA 1ULPA 4UBHA 3EJKA 3HJRA 5FY7A 4EYUA 1AR83 4AQ2A 4ISRA 5A6XA 1YXWA 5G04L 2OT7A 3WG3A 1C57A 1SBFA 2ZX1A 5GLVA 4KG0A 1OVPA 3VBHC 5CG8A 1LRHA 4AF9A 2XVLA 3RRDA 3THPA 4A4AA 4E2SA 1W0NA 2RHPA 2W47A 2XLAA 4O7XA 2DBIA 2WJSA 2IWGB 5JMOA 5BV6A 4I09A 5DG2A 1DZQA 3PTYA 4QKNA 4XETA 1D2QA 3BOPA 3SCGA 2PHLA 1ZRCA 3R4DB 1XNKA 4LO7A 1XSQA 4YW2A 3H8OA 4M3CB 1BVVA 1NT0A 1LODA 2G19A 4XUOA 3VD4A 3AM2A 4CRQA 2G9ZA 1X9TA 1FV2A 3MFCA 3AJZA 4OZXA 4XDOA 1YQ6A 1SG3A 3VD9A 1G86A 1PO21 1JTZX 5A3UA 4P02B 5F1RA 2NP0A 2VXJA 1W6PB 3RQ0A 3RZHA 5B2GB 1XE7A 4UOJA 4YZ4A 4IESA 3SNMA 1ODMA 4AI1A 4GKXA 1O3TA 1UU4A 2ZOEB 4FPEA 3A0KA 3UKNA 1NZCA 2UU8A 3NQHA 1VBA1 4IDZA 3WF2A 5LY1A 3AYEA 1F5JA 3BUCA 5FPZA 3TNQA 4QDSA 1VR3A 4PI0A 4LUMA 5JZGA 2VOXA 2ZHNA 4BMBA 5C9AB 1COV3 4HVRA 4LK7A 3I3EA 1UYXA 3RPQA 1D4M2 2JEMA 2HWE2 4GAZA 4K7JA 4KMQA 2Y38A 1FPN2 1VBC3 3NL1A 2CV6A 1D4M1 2ET7A 2TUNA 2UY9A 3PU8A 5FUPA 4Y1VA 3VDDB 4QPIC 5FK7A 4BHPA 5J37A 1VBB3 3HPNA 1R081 3I7DA 3I3BA 4XJ9A 5AC92 4CDXA 2XG3A 1BEV2 1PGW1 1A8DA 1I5PA 1L3JA 3AMPA 4I3PA 4LKEA 4P9IA 4AAPA 1QWRA 2YMZA 1XRUA 1NZIA 1BXHA 2DV9A 5C5UA 3CJXA 4MUVA 4YGEA 1T6GC 2NM1A 1GWMA 2VW1A 4CCLA 1RUG1 4P08A 1QQP1 2FD8A 3JB4C 4HKLA 2CTVA 2E7AA 4MZUA 5FV3A 1U5YA 1NXMA 3WNPA 4Y5Z0 1UYPA 1WLDA 2OX0A 4QPWA 4QU2A 1HQNA 4XTMA 1RVF1 2H0VA 1ZREA 2A6YA 3GBWA 3Q8EA 5DUXA 1JYNA 1IGOA 2WS93 5ACA3 3VD7A 1ZRIA 1H1AA 4D6RA 2Y6HA 4Z8BA 1HRI3 3FBYA 4XQDA 3LPFA 3NJZA 4AL9A 1DLLA 1G9FA 4DXZA 5K0UC 5KHJA 1CN1A 2RS53 4IV3A 1AX2A 4UFLA 1ZRRA 2W91A 4ZU7A 2XJRA 3N3HA 4CUGA 4EN9B 5BY5A 5GALA 5LEJA 1S2BA 4MHRA 2GNBA 4A6SA 1PK6C 1ST8A 3NKGA 1VBE3 3UGFA 3ZFFA 4RQPC 1US2A 1OA2A 3UKTA 3R6SA 3IPVA 4UFHA 3JD73 2D6NA 2A6XA 1JOPA 2SBAA 2XOMA 3DPRA 2OQ7A 4QU1A 2X05A 3B02A 4NHKA 4K8RB 5EIYB 1TVGA 1DF0A 4XVHA 4KH9A 2P3KA 4ITCA 1BHGA 5D8AA 3CLPA 1Q56A 3KCCA 3VHNA 1SHWB 3K51A 4FVVA 2D6LX 3WDYA 4BA6A 5C70A 1O3RA 1VRH3 1CIWA 4YARA 2D93A 3LA7A 4QX8A 2X10A 3H9AA 4GQ7A 5FYYA 3J8F2 5C5TA 4D94A 1GZTA 2Q8DA 3DL3A 3GNEA 3LSEA 2ZHMA 5F5CA 5IVJA 3THCA 4AEJA 1HJGA 2ZHKA 1U5ZA 2XVKA 3CF6E 2OKXA 4O9EA 4BLIA 3B94A 3ZSMA 2G9GA 5FYBA 2XPJA 2EIBA 3VBRB 2ERFA 4B8EA 3I54A 4LBMA 2ARAA 4YPJA 3K77A 4XTPA 4AGGA 3OGVA 5EHDA 5BNOA 2PHFA 1FOD2 5A1AA 4CDXB 1D4VB 3N35A 3NNFA 4JKMA 1KJRA 5D2AA 1FOD1 1IS4A 5LK7B 4MO3M 3ZYGA 1SPPA 3I59A 4X6RB 4NAMA 4BIOA 5FYUA 2TNFA 4A44A 2CDPA 2ZZQA 3RDIA 2BGPA 1UY1A 4XJZA 5IVEA 2J1EA 3LSDA 1MZ6A 1I6XA 3C7GA 4JKKA 4XAEA 4XBQA 1WBFA 3VKMA 1YQ8A 3ZFGC 4BISA 4AW7A 1W8WA 1C8M2 4IE5A 4YYOA 4NIIA 3WG4A 5C4WB 3UGGA 5I0SA 5BYNA 1NXD1 3FFZA 3VZLA 4AI9A 4DZGA 3AX4A 3FLRA 4ZXEA 4LBKA 4E4HA 1PZ8A 3BB6A 4S2FA 5FZEA 2MNGA 4LOTA 2E51A 4XJUA 1RUE2 5KHIA 4AFMA 1W8ZA 1WW5A 3ZOIA 5FZOB 1IS3A 4Q0UA 1RUE1 1VBA3 3FFQA 4WM8C 4AHZA 4E4DX 5FZ1A 1SBEA 4LBQD 2CU5A 3T09A 5BNQA 2IXJA 2W46A 1WWYA 1WW4A 1CAWB 3C7EA 3OPWA 1OUSA 2XDVA 2GP5A 1JHNA 2NQYA 2XQRA 4YRDA 1E5IA 5C3SA 3TYJA 1MS1A 3OBTA 1WW6A 4BQ1A 3SXWA 1X8EA 5HCFA 5CVRA 3TEYA 1QH7A 1D4M3 1XNTA 3DXUA 5HI0A 2HWE3 3O1OA 1JOBA 3AK0A 4PLMA 3USUA 2YPDA 1FPN3 1XB9A 2D3SA 5I8YA 4OFGA 5FRAA 3WT3A 2P1BA 4UT5A 3M70A 5F3CA 5AC93 2W92A 1JUHA 3AP4A 3Q8CA 1PGL2 5LK5A 5JWPA 4PDWB 1BEV3 2P6CA 2FDIA 1KGYA 2OXBA 4QPGC 1GZWB 4N43B 4XDPA 2YBSA 4NIAA 3ZSEA 5JZGC 3IDBB 1O3SA 3POWA 4PT6A 3PUQA 1K5JA 4AI2A 5HV4A 4QHBA 5LW9A 1W2AX 2XWBB 2QFEA 1RVF3 4NIGA 5JXJA 2XHKA 1FI2A 4LHLA 1W9WA 3E6DA 2DDUA 3WHUA 4AVVA 3ZXGA 5F6KA 1HV1A 4W4ZA 4AZZA 1UPSA 4ARYA 5JSPA 1S4CA 1NKGA 5FFOC 2A3YA 1Y43B 4CUCA 5F2SA 1PVC2 2ZA9A 1F9KA 1KDMA 1UD1A 4NRQA 3UK9A 4C1WA 3WG2A 4E2QA 2MPFA 2WNUA 3ZXAC 2JDUA 3MPBA 2VUJA 4YM0A 3M3QA 4LQRA 1XJAA 2XVGA 4YFWA 1OVSA 5GZFA 4F3JA 2W68A 2YYOA 5A7SA 4EZHA 1WLWA 3K4AA 5LRSA 3OB8A 3CMGA 1AXYA 1GU3A 3U75A 2A1XA 1YYNA 2BJSA 3LA3A 2BOIA 2ORXA 4PIZA 5DABA 5SV5A 5IAXA 1CGPA 1RXFA 5F5QA 1YFXA 4YZ2A 1ULOA 2X8KA 2FBEA 3M3CA 2ZEYA 1XU2A 2TEPA 2Q4SA 4XOGA 4E4SA 5A1FA 1O59A 4RYDA 1SDDB 3B69A 1ULEA 1RUD1 2NMOA 2VNRA 4OHZA 2W1QA 2B39A 3ME2A 4FOVA 1ZZCA 4FO9A 4JHTA 2DCKA 2ATFA 3PUAA 5DUUA 2ZHLA 2FDFA 4BPZA 3MIHA 4IEYA 2G9FA 3FC0A 1O6UA 1LCLA 2EXHA 4D7TA 1SQ4A 5FMDA 3BTXA 2PN5A 3ZXFA 3W21A 1NG0A 1HB2A 1RIRA 4NE9A 4BLJA 2Y6LA 4MXVA 1V6KA 5E88A 4BU2A 4P9LA 4CCMA 3HN1A 4KGGA 4YVWB 3WW3A 3RFRA 1X7NA 4Q8KA 1LKNA 4O61A 4XE9A 4NIHA 5E89A 1H4HA 3CBNA 4H3WA 2X5IA 5D8AC 4QDQA 1F8VA 4AYUA 4B4RA 1PO11 3T08A 5FP9A 2B4KA 2IXKA 3I2DA 1CAUB 4W6XA 5FY5A 4KWKA 4RSUA 4XUQA 4TLGA 1FOD3 2E6VA 2JJ6A 3U4SA 1AL22 1LGBA 2BVBA 4N7UA 4FXKB 4FQZA 1VAMA 2Y0OA 4RHV2 2C5DA 4P9WA 2PELA 4XDQA 1W6OB 5CAZA 3WG1A 3WUDA 2WZR1 2VMGA 2J22A 4RA0A 2QE3A 4FFGA 4CUAA 2XHNA 3ACIA 2HEWF 3LF7A 4UFKA 3ZMNA 4ZXKA 2QTWB 5FZ4A 1I9RA 5DUVA 4IEVA 2HJIA 4PCRA 3RZZA 4FPLA 5L7OB 1LHVA 5ANQA 1C8M3 5JR7B 4RR3A 4OUMA 4UF0A 4HVQA 4KG8A 3GZAA 4DINB 2EICA 4DFSA 1F2NA 1GQPA 1GMMA 1WGPA 2WNUB 3T2QA 2A73B 3CZJA 2HWF2 4GWJA 2EALA 4LE4A 4UWDA 4AHYA 3MW3A 5CIRA 2ZACA 5J96B 2HYXA 1HXS2 1IQDC 1ND2B 1RUE3 4FTSA 4CDWA 5DN2A 1PMJX 5F5IA 1DGWA 4BQ3A 2ZPXA 2V72A 5A32A 4XF0A 4CCJA 3K46A 4LOSA 3V64A 1UCXA 4XURA 3N9QA 4TYSA 1BQPA 3DUIA 2WO7A 2DYCA 4UW4A 5EP9A 5FYSA 5GZDA 1A78A 3AMHA 1OPMA 3ZX7A 3FUOA 3AP5A 4GALA 3D5OA 3HAGA 3NRUA 1ZRDA 1AF9A 4AG4A 2R072 1RGSA 2B5HA 5A7PA 5JR2A 2BWCA 2BEOA 3A21A 1O4ZA 2ZEZA 2XJPA 3DYMA 1JYCA 4GB31 1AL0G 5CZKA 3FN9A 4UW5A 3K48A 2RJLA 5A33B 2RJ2A 3POSA 2LUWA 3PIJA 1K45A 2EVXA 1V9U1 3TAYA 1HV0A 2FMDA 1WCSA 3U07A 4BMEA 1BMV1 1W03A 1H30A 4FSJA 1ND3B 1WMFA 2ZXQA 2HWB2 2OPWA 4N53A 2MEV1 3MGUA 4OLLA 1EPWA 2HWC2 3QH6A 2Y33A 4IE7A 4QQ2A 3JXSA 3LGRA 1GICA 3IZOA 1H0BA 1W6QB 2HWC1 4DS0A 3ZSLA 5JMCA 3ZIXA 1PVC3 3U0ZA 3TEZA 1G8WA 4K9SA 4NWVA 2QQKA 3INAA 3C2UA 4S2HA 4WZFA 3W58A 1W8HA 1QJX1 3M2MA 5FOJB 2BV4A 4Q29A 2Y6GA 4NHMA 4AI0A 4INDA 4B1LA 1J3PA 5D21A 4DUVA 3UNPA 1AYN2 1UX7A 1NE6A 2ES3A 3MIGA 2V73A 4IL7A 4IV1B 4LBNA 1R092 2JG8C 4AQ6A 1DHKB 2O8QA 4DUXA 3MZHA 2R0HA 4GH4C 4PI2A 3GDBA 1U5IA 1R091 2R062 4YG3A 3SEPA 4XZPA 2QZ3A 2Q1ZB 2CNAA 3ASIA 4LITA 3N7MA 1NA1A 1SLBA 1E5HA 3GYDA 4L9BA 3ZXEA 4A45A 1MS4A 2ZGUA 2HKXA 1Z7S1 3IMNA 5DG1A 1H8TB 1QXRA 1W6NA 1ONAA 3C7FA 4A7YA 3E5XA 4AAXA 2VGDA 3O5SA 3CJIB 3D4KA 3ZM8A 4CEWB 1S55A 1QOSA 1CPMA 4D6SA 4CDWB 3LDBA 5BNPC 5JVVA 4AI3A 1WA6X 4MLOA 4UI9L 2VMCA 5L9VA 1F35A 1QNYA 2JB8A 1S0BA 3IDEA 3J4UH 4XFGA 5FMOL 3T3YA 1IPSA 3ZYJB 1CR7A 1GWKA 2DVDA 2VOKA 3ZYPA 5CYYA 5A7OA 4TN7A 2VTXJ 3ZSKA 5FZ8A 3E1F1 4N7IA 2Q1MA 4CEYA 3VBFB 1ASJ2 2QQUA 4TXWA 3H42B 2FDHA 1RUF1 3AVRA 1WBLA 1K42A 4QX5A 4FPHA 3WR0A 1MS5A 3GBGA 3C7HA 1RYYA 4H2AA 1IPKA 5A7WB 3MF9A 5FZGA 5FZ9A 1FATA 1EV11 1GV9A 2ET1A 2R30A 1S0FA 3LOIA 5FZBA 3WNNA 4CU7A 1CESA 2YPJA 5JXHA 4MG2A 1NCRA 3VHOA 3B9IA 3OSDA 1ZYBA 4QQLA 1OQ1A 4YZ1A 1YHFA 3AC0A 2WLQA 2ZX2A 2E7QA 3P3NA 3SHRA 4Q2FA 3AYAA 4M0HA 4RHV3 1QJEA 4MXWB 4XF1A 4HFSA 2SLIA 4P9XA 1OKQA 4P9GA 3BU7A 4DOUA 1O7FA 2CY6A 4XXAA 1HJFA 1KXGA 4IEZA 4ASLA 3MPPG 2VTFA 5C8CB 5T5JA 4OUEA 1FNYA 4ARXA 2D5FA 3R05A 4NWWA 1UU5A 1OBNA 1JZ8A 2R041 4JDMA 4B1MA 3BTYA 2VZVA 1YQ5A 2BNNA 5CFCA 1IS5A 2BQPA 2AYHA 2RDQA 3NW4A 5J36A 3WDVA 2WT2A 4Q1PA 2QBXA 3WW4A 5A6QA 2HWF3 3VBOA 2XXZA 3GM8A 4HN0A 4DNYA 4ZHNA 5HCAA 3AMMA 1AYM1 4COWA 1DLCA 1MQTB 1UIKA 1VBC2 4PBPA 4K8FA 4C0HA 1W99A 2E26A 1RUH1 1TME2 2PHUA 1RUJ1 4KL1A 4RR3C 4GXLA 4CP1A 1EAH2 1NY71 3SH5A 3CU7A 3ZYIB 2VBBA 1TME1 1EAH1 2VR4A 3PVNA 3T4VA 1RJ8A 3AFGA 2LALA 2XL7A 3T1MA 1DQ6A 3SH3A 2LROA 1VB4A 2OUHA 1HB4A 1W04A 1MVQA 1WCUA 2JKBA 4MADA 2R073 4P00B 4JX0A 4UAPA 4B7KA 4OQ8A 3ZIWA 1S0CA 3DF0A 1CAVB 3OG2A 2XLFA 1G6NA 3HVDA 4LBOA 1CAXB 1MS8A 2ZGLA 4CCNA 3ZXJA 2JDPA 4K20A 5DZGA 4CCEA 3FE5A 5ABJC 2ZBJA 3PDQA 4QB2A 2XJVA 2Z69A 3KCXA 4L97A 3RG0A 3MLKA 3SQOA 1XC6A 1CWPA 2P5BA 4Y33A 5DZEA 1OURA 5DAXA 2ZEXA 2GH2A 4I0BA 4QQHA 4IUGA 5G05L 4AHXA 4W50A 3MW2A 4CEYB 2BYVE 1VAVA 4DQAA 1W6PA 1U12A 3POBA 1UXXX 1IG3A 4JGYC 4N90A 1RC6A 2MEV3 3LDKA 3RI8A 1LR5A 2XKPA 4CDQC 4ZKTB 3IBMA 2HWB3 1SCRA 5ANNA 1YNAA 4ZONA 2JDZA 4HMZA 1UOGA 2HWC3 3DN7A 4QX1A 3ON7A 2ZGTA 4M0NA 4Q4W1 3WEZA 4FBFA 1H1IA 4BB3A 1KQRA 3ZN6B 5FP7A 2DUOA 5FUNA 1J59A 4AEDC 4IE0A 1K5MB 3GCWA
chains in the Genus database with same CATH topology
1CONA 5C9AA 3P3PA 1REEA 4AGRA 2VW2A 3WXPA 1NCQA 4HBNA 4ONUA 2WSUA 1S0EA 2VNOA 3WHTA 1R093 1UZYA 1OA4A 2CAUA 5GZEA 3VDDA 4Y1XA 1V6IA 1TMF2 1AR71 5J48A 1ULDA 3HD8B 4IQPA 2JE9A 2LM3A 4YVSA 3AZXA 2OW4A 4WVVA 1YFUA 1HQLA 3BODA 3V0AB 1BKZA 1CVNA 4MSVA 5JSOA 1RB8G 2NN8A 4JQRA 1QDCA 4AEKA 4YM2A 1Q8SA 2RE9A 4XQ4A 1DQ2A 4MGIE 2YXSA 1J1LA 2QZ2A 5GKAC 3VZMA 3ZXKA 5HBAA 3USSA 4JTNA 1HLCA 1QOOA 3MIFA 2YC0A 1OMIA 2OIIA 3AJYA 3H7JA 4XBNA 1MZEA 1RUF3 4I02A 2RS11 3WW2A 5T50A 1ASJ3 3M8LA 1IHMA 5JOWA 3E6CC 2QJVA 3M3IA 1LHOA 1RHI2 2GH8A 1PZ9A 5JOZA 3ES4A 2QCSB 2R1DA 4QGMA 5I0UA 3RJRA 3ILRA 1RHI1 2P2KA 3PMEA 2CWSA 2IC1A 4Q0SA 1PO22 5BXXA 4UW6A 5F6LB 3WNXA 4Q0QA 3VKFC 1KS5A 3QH7A 1ENRA 2ZGNA 5GLUA 4PBOA 5K0UB 4Y22B 1O3QA 1VBA2 4EWAA 2ZMLA 3J26N 5EV7A 1HIXA 1WMEA 4YW5A 2X29A 3A4UA 4IEQA 3WW1A 2RS31 4GMP3 4META 1BVP1 1IOAA 1MR5A 5J3UA 1G9BA 4FAHA 3RNSA 2NZ9A 1NCQB 3BPZA 1N1TA 3VBRA 2DURA 1DGLA 1R082 2V09A 2R32A 1B35C 2OZJA 1PGW2 1TME3 1IQAA 1UN1A 4GMP0 1EAH3 4MVTA 4I3GA 5L19A 1XYNA 4NPRA 4YVSB 1SMVA 3VBOC 1IPJA 1RUG2 1QQP2 1X50A 3E6BA 1CJDA 4GKYA 3AKSA 4XJAA 5JPMB 2DUPA 1RVF2 4PJYA 5H9RA 4CDUB 2P3IA 1REDA 1QJU2 2PHWA 3M1HA 1LHNA 1BYHA 4FAGA 2BPA2 4E2GA 3IM0A 4V1PA 1QJU1 5C4WA 2RR12 3NWKA 4Y4YA 1H9PA 1UAIA 3LZZA 3QOPA 3ALQA 2RR11 3ACLA 1QOTA 1LULA 3WINE 4E9KA 2CWMA 3PNAA 2PAEA 4RFT0 2A70A 4K6BA 2ZGPA 1BBT1 1Y3TA 4URTA 1QXPA 1F31A 3SCHA 1VBD1 2PLV1 4LA2A 3W9AA 3JBG1 2PHDA 1CAWA 4L92A 2D3RA 4QM8A 3ZFGB 4C1XA 1QH6A 3O12A 4J6GA 1LOAA 4LTAA 2XGXA 4IEPA 1GFF2 1RUC1 5TSWA 1V00A 1GANA 1BK1A 1SFNA 2D6OX 4R9AA 3RI9A 3NV4A 4FPJA 2ZX0A 4JTOA 1DU3D 4GULA 4RS5C 5BPXA 4LHKA 1N3OA 3AYCA 1TMF3 1XU1A 4WM8B 5CB7A 5KXCA 3H1WA 5FREA 5T52A 4PDWA 4B3NA 2B8MA 3B93A 1REFA 1GZWA 5I8TA 5GLTA 4N43A 1AJOA 1N47A 2E7TA 5T5OA 4AI8A 1JBCA 2FMYA 1YJLA 3VKOA 3WQ1A 3SISA 3M7AA 4ISQA 4DY5A 4A2UA 4C90A 3ZFEC 3JZVA 3IWZA 1QF3A 3B00A 3IN9A 1V6MA 4AGVA 4GWMA 4TLFA 3O14A 5EYYA 2D98A 4PIYA 3UJOA 3PJYA 3H0OA 4R9DA 4QPGB 1DGWX 1J3QA 3AZYA 1OQEA 4HLTA 4J1XA 1NOVA 1RHI3 4WVZA 1ZZBA 5CU1A 3KQRA 1LU1A 1UPIA 2JXAA 2A5ZA 1PO23 2DCTA 3EBRA 4AEMA 3QCWA 1JW6A 3G7DA 3GZUC 2R49A 1CQ9A 3CL1A 1ZM1A 4MYEA 2C9AA 4LNVA 3NAPB 1Q8OA 3VKNA 2KA3A 3GALA 2LTNA 1C5HA 1U0AA 5KBFA 1ZRFA 2I2SA 1DFQA 2YZ4A 3JUUA 2YGLA 3FHIB 4YG0A 2X53S 5K8SA 4YVWA 3TNPB 4XFBA 2OA2A 3AP6A 1ZNPA 4FPFA 1YIPA 2FZ2A 1GNZA 4Q4V2 1WA4A 1CD3G 4XPVA 2EAAA 2FHRA 1CAUA 3GF6A 2GNDA 3ZMOA 1R083 3S0MA 2P34A 4Q4V1 4YLZA 2XB6C 5CA6A 4MGZE 4ES9A 1KFXL 2EIGA 2Q30A 3HWJA 4NO4A 5H9QA 4EN7B 5KXEA 2D97A 5EJ3A 4Y1UA 3R4SA 1RUG3 1QQP3 2JG9B 3UJQA 1W6OA 5EFUA 3VBSB 4MGKE 3VBRC 3WUCA 4OHWA 4UW3A 3V0BB 1C4RA 5T54A 1C8NA 2GN7A 1G9CA 1QJU3 3ZYRA 4CDXC 1QHDA 5L7OA 1PMIA 2ZX4A 1R1A1 2NLRA 2RR13 2O1QA 5BNNB 3KS7A 5FLJA 3AZZA 1MS3A 3FBMA 3FMGA 1FV3A 1OOPA 1QJY2 3HIFA 1YIFA 4C91A 1ENQA 2HYKA 2ZGOA 1AXKA 4FQ4A 1V6JA 4Z82A 1W0PA 1S2KA 1E57A 1ND2A 1QJY1 2Z2SB 3OGGA 3VBUB 4IETA 3JBG3 1LOFA 1UKGA 3LCPA 2ZJCA 1XYPA 1DG6A 3GBFA 3BIWE 3MICA 3WOGA 1RUD2 4HK8A 3CNAA 1MVEA 4BYYA 1YFWA 4IV3C 3NV2A 1N1SA 1UKRA 2DFCA 2DTWA 5K7PA 3LB9A 5CBLA 2PTMA 3S30A 3WLUA 1XNCA 1GR3A 4PQ9A 1EY2A 3EO6A 3ZFFC 5JIAA 2DFBA 1U5XA 1HRV1 4LA3A 3OY8B 3WV6A 2K0GA 5SV8A 1XQNA 2ILMA 3SCFA 3DPRC 5IT6A 1PO12 5FDBA 5J7MA 5CNAA 4COZA 1ND3A 4QGLA 2EAKA 2QDNA 1WUVA 3AKRA 1RTVA 3VLBB 4OUSA 4WVMB 2D5HA 4K21A 4ORFA 4A7KA 1OFNA 1W6QA 4N43C 2XWJB 4JGZB 2WZR2 1J58A 4YGBA 2HWD2 2RM21 1X36A 2W0XA 4YGCA 1H2MA 1O5UA 5IK5A 2AGSA 1W0OA 5DDJ1 2HWD1 4FCAA 4N9HA 2IXIA 1FMD2 2A6ZA 4DRVA 4IV1A 4IEXA 5CFDB 2W08A 5FPXA 4XMIA 5BNOC 3SLIA 3N7KA 2IZWA 1FMD1 2Y26A 2ZABA 2Q0AA 2AREA 4Y26A 1C3HA 3W59A 2EXIA 4XFHA 4YSFA 2B46X 2ZTNA 5FBZA 1ZA4A 4NHLA 3O7OA 4YW4A 1H8TA 4JCKA 1OOPB 4OHVA 2VULA 1DYKA 2UY8A 2YUEA 3CJIA 4CEWA 1VALA 1H9WA 3VL9A 2BTVC 2Z5WA 4H55A 1H4GA 2P17A 5EYXA 1CJPA 2B45X 1JUIA 2WNEA 3GHNA 2V5YA 1RUOA 3PHMA 2KM2A 3VBFA 1ULCA 2CAVA 1FX5A 4BZ4A 1H1MA 2F6BA 4Q4V3 4XHXA 1AR61 2P3JA 4R52A 3ECQA 2GDFA 3KT7A 4GB32 3WP4A 4FPYA 5FO7B 3I4IA 5BNPB 3VZJA 1PIV1 4Q4Y1 4KGQA 1OLRA 1VIWB 1V9U2 1BMV2 1NQJA 1LTEA 4MXWA 1TQ5A 2WNVA 1SLTA 3AMQA 2MEV2 3KB5A 4FTBA 3QLQA 4XQWA 4IERA 4XILA 2DCYA 4Q4X1 4YGDA 5C8CA 4MV2A 4Q0PA 4XYXA 1WW7A 5I93A 5T55A 1QJX2 4ZU5A 2QKDA 1AJKA 5I0TA 5A3MA 2VY0A 4JDOA 5FO8B 5L36A 1QJY3 2ZKNA 1ZBA1 2H6CA 2D43A 4AVTA 1WCKA 2ZGKA 1MQTA 5T5PA 4LR4A 5L7OC 3LOBA 3H3ZA 2XBO1 2YV8A 4AE2A 1RMU1 5C6CA 1TNFA 1Z7S2 3WDTA 2WSVA 3VZKA 1W39A 4A3XA 1RUD3 2WNUC 1FAYA 2BNOA 2YHJA 3ZXDA 4L99A 3VKLA 1AR91 1LOBA 4LLOA 4W65A 1ND2C 3ENRA 4S2DA 3D6EA 2Q5TA 3WP5A 5JPNB 4EJRA 1BCXA 1CAVA 1Q8QA 2UWBA 1QKQA 1HRV3 3S7IA 1CAXA 4JRLA 5HCBA 2GSYA 4KQ7A 2DTYA 1GSLA 3KSCA 4H14A 1R1ZA 1YLLA 3FUQA 1SACA 1ENXA 4WM7B 1RUF2 4F83A 1PO13 1XNBA 5CADA 3L2HA 4XFIA 3E97A 1EV12 1UZZA 1RUI1 1KD7A 1KITA 2RMU1 3NKTA 2NPIA 4G9SB 2C1FA 1QMJA 1SEFA 4E27A 1Z78A 1AR81 2DF7A 1RINA 2OYZA 4XF4A 1MS9A 4YM1A 3ZN6A 4IEWA 2WFF1 1DBNA 1K5MA 2WZR3 1YI7A 1D0GA 2X5IC 2HWD3 3HMYA 3ZN4A 4AVCA 1DYPA 2WNVB 2BFUL 1Q8PA 1HDKA 3ATGA 3AXEA 3I8TA 3TRSB 2MHFA 4XFCA 2WFPA 1FMD3 4JGYB 2CGPA 1Q8VA 1QGLA 2CGOA 2OVUA 3VGIA 2FZ1A 4CDQB 2R042 3KT1A 4HSLA 4M00A 1SBDA 2UYAA 1QXJA 4LT5A 1GQGA 3V0AA 5GLWA 4CP0A 1AYM2 2A75A 2GU9A 4HSJA 1LOCA 4AEDB 5FLHA 3MW4A 1YJKA 1RUH2 1RUJ2 1W6MB 1Q3EA 1SCSA 1LENA 4Z1VA 1NY72 3OGJA 3FZ3A 4FP3A 3SITA 1YO8A 1H8VA 3HT2A 5AVAA 3KGLA 5FCCA 4QPIA 3ZVXA 4YNIA 1H8TC 2I07B 2GC1A 2VVFA 3VHRA 5JI9A 1S0JA 5J98B 3M3OA 3MEPA 4AXOA 1GBGA 4CDWC 1JOJA 3E5QA 3ELNA 1EYBA 2VNGA 4GB33 4FTEA 2ETEA 3AP9A 3MLLA 5EXOA 3FWEA 2WA3A 1V9U3 3HBZA 4XFAA 3MF6A 1VBB1 3VBHB 5KC6A 3OPZA 3MIBA 2NYYA 4GWNA 1S0DA 4EWEA 4Q4X3 3UV9A 5K0UA 4Y22A 4LBQB 4I0AA 2XJUA 3IIAA 2GNMA 1SFYA 1JXNA 4K40A 4Q4W2 1GNHA 2G4IA 4BH9A 4FPOB 1NLRA 1PK6A 1VB2A 3UL2A 1LU2A 4OI1A 1QJX3 4KWJA 2WS91 1YWKA 3LA2A 4M3CF 1HRI1 4EN6B 2PHRA 5FMOS 2ARBA 4D69A 2C0ZA 4N53C 4I2OA 1AR72 3BOWA 4WV8A 2RS51 5GM0A 2GZWA 1OA3A 3TWIA 1GQHA 3ST7A 3WP6A 1Z7S3 4G4FA 5FAXA 1VBE1 2VVDA 5IK7A 3L2YA 5FQ0B 2GMMA 2ZCWA 1DGRN 1DIWA 2R16A 3TBDA 3JD71 5GZCA 2H6BA 4JAAA 4XXPA 1WD4A 1DQ1A 1XE8A 3RYRA 2JENA 4H7MA 4YW1A 1S0GA 1RJ7A 3O0VA 4CDUA 3L9JT 3VZOA 1OHFA 3WDXA 5JOXA 2QDRA 2QNKA 4XF9A 1B35B 1NA1C 4F8AA 4QPIB 3JB8A 1VRH1 1AXZA 4FP2A 3ZO0B 2RS12 5CG9A 3RMYA 4Y20B 5T5LA 4EN8B 4YZ5A 3RYKA 2H0BA 1M4WA 5K9YA 5LEKA 1ENSA 1RUI3 2Z79A 2RMU3 4K1YA 2VU9A 1EV13 5JAXA 3PVEA 4LE3A 3RS6A 3ZXLA 2OUJA 5KHKA 2WFF3 1UW8A 1N1VA 3ZFGA 2WQZC 4EWDA 2R6QA 4CEYC 3NO8A 4AHWA 2AZ5A 4DRRA 4Y1ZA 4DMIA 1AVBA 2ZAHA 4Q0VA 2TBVA 5C33A 4M3CE 1OI6A 1MACA 1MEC2 2PHTA 3B5LB 3MIEA 4E4ZA 5F9TA 2RS32 3VL8A 1NCRC 1ZZ8A 1MEC1 3KCYA 3OF1A 2R043 4B7EA 3O0WA 4WM8A 2D40A 2XKOA 1PZ7A 2GC0A 1PK6B 1LOGA 1K5MC 4XHBA 4CTEA 4RQPB 3BALA 5FOBB 1H2NA 4HPKB 4MX3A 2WINB 4Z2WA 3POYA 1AYM3 2PAKA 2FQPA 1XNDA 2BNMA 1LECA 1O91A 1RUH3 2QUOA 3PMSA 1RUJ3 4FPGA 3WQ7A 5E16A 3X29B 4GA9A 1AZDA 4FOWA 1XXNA 4DPNA 4OHXA 3CEWA 4K3UA 1LB2A 5CFCC 3WVJA 4RS5B 2W52A 3R0RA 5GJ6A 1O5LA 3HQXA 1OSGA 2OPKA 4QPGA 1IZ3A 1YFYA 3AKPA 1BJQA 2VG9A 2DU1A 2WC2A 4IEOA 4HETA 2GC3A 4HZFA 4WZCA 2HWE1 4DB5A 1KDKA 4DY3A 2W39A 4HL0A 1FPN1 3H3UA 2XUMA 3ZFEB 1GKBA 2GMPA 2O8OA 3OD4A 5AC91 1PM7A 3EQEA 1BEV1 4HVOA 5JOYA 1PGSA 3A0NA 1BBT2 4XEZA 4MH0E 1HQWA 3NAPA 3PJQA 3WDWA 1VBD2 2PLV2 3OD0A 4TWTA 1NE4A 3JBG2 4XJ8A 2P37A 1OQDA 2AH2A 5L73A 4Q4W3 4L8QA 1I1EA 4FPCA 4COUA 4Z92B 1AX0A 3FJSA 1S0IA 1RUC2 3Q9OA 3EHKA 1C1LA 3C3VA 2QQPA 3AKQA 1PNFA 2K2SA 1LEMA 2VW0A 2JD4A 1AR73 1OLQA 4QD2A 1XYOA 3ETQA 4P9JA 1ZX5A 3WY6A 2Z42A 1LJ7A 5DXDA 4TSVA 5AVPA 3PLQA 4IEUA 1I5ZA 5C9AC 3ES1A 2WA4A 3AXDA 3QD6A 5AFBA 2JG9A 3VBSA 3KZ4C 1NCQC 1H2KA 2D7FA 4I01A 3JCIA 3JU9A 3V0BA 5GZGA 3VDDC 3AKTA 4HN1A 1ZBE2 2I45A 3N7JA 4BOWA 3AZVA 4J1WA 2WIIB 4YVSC 1ZBE1 1VLNA 3BTAA 3ILFA 1UL9A 5BNNA 2R1BA 3VN4A 4LO4B 4A7ZA 3ZSJA 1IS6A 2RS13 1KS4A 1DQ0A 3H50A 3J8F1 4LO8A 4LBLA 2CL2A 2ZS6B 3EXUA 2VXRA 3WQ0A 5JZGB 4U2AA 4CDUC 5IUQA 2VQ0A 3APBA 5JLVA 1QNWA 1UIJA 3VBUA 2DVBA 2OZ6A 3U4XA 4QPYA 3WCRA 3HR9A 5JI7A 2D6MA 4YZ3A 4NN0A 2AENA 1G9AA 1APNA 5LRRA 2WKKA 2XJQA 3B9CA 2WLPA 2XJTA 1FYUA 4XBLA 2DCJA 3FLPA 5JIUA 3GZTB 2DU0A 1BZWA 3SH4A 4CZSA 1ZZ7A 4R4ZA 2XH6A 1X8MA 5KC5A 1MEC3 4EV0A 1IKQA 4OULA 3WD5A 4KNCA 2AR6A 2RS33 1YRZA 3NV1A 4OI0A 5FTTC 2A3WA 2PHXA 3OY8A 3RMXA 2YY1A 3M3EA 1IKPA 2ZX3A 1URXA 1YUDA 4QQPA 4AFBA 1V70A 3B01A 4QMAA 4SBVA 1C8M1 3AP7A 5H9SA 3HT1A 4EROA 4AVBA 4BIFA 1FNZA 3WP3A 2BWAA 4H7LA 4IV3B 4SLIA 3U10A 5AFEA 3JQXA 3IDCB 4RL7A 4WVMA 5E8AA 1D0HA 1RUNA 4COYA 3BCWA 4OVEA 3ILNA 3ZFFB 2R0FA 3IPVB 4JGZA 4Z07A 2DVGA 1TE1B 1WMDA 2IFWA 4KWLA 1D2SA 3DPRB 5KWRA 4XFFA 4R9BA 2BGCA 5D8AB 5CFDA 3NVCA 1R1A2 2Q8OA 2UWAA 4LUKA 5JCTA 5FO9B 3PVOA 1YI9A 5J09A 1V6NA 3O0XA 3FLTA 1EPZA 4XIKA 1PGL1 2ZGSA 4D7SA 2D44A 1BBT3 1LHWA 2B7YA 4ES8A 1VBD3 2PLV3 4LEJA 2BBVA 4RD7A 5I0RA 4FOYA 4QQOA 2ARXA 1N1YA 2O0OA 5C8WA 1F5FA 1Y9QA 5I91A 2VECA 4OI4A 5C4WC 2JG8A 5BNOB 4N9IA 2A6VA 4YM3A 3VUOA 1X82A 2BW8A 4GH4A 4UBGA 5KHGA 4QXKA 4WBBA 2GALA 4UXAA 4XJWA 4PLOA 4XMAA 1RUC3 4XIOA 3NAPC 4AWDA 1PVC1 3I59B 3TOJA 3MYXA 1UX6A 1G9DA 4Y1YA 1HRV2 1QY4A 4P14A 2ZMKA 1JH5A 3KGZA 5BNPA 3RSJA 3DV8A 4AVSA 1VP6A 3D8CA 4YFZA 2B9UA 4ASMB 3R4UA 3WCSA 2VMHA 1QDOA 2B42B 2PAMA 1ULFA 2WWSA 1ZBE3 3KM5A 1JN2P 1SLLA 4PDWC 3WZ1A 3MI8A 1SLIA 1UF2C 4P9YA 1WLTA 2RM22 2BVVA 3J8F3 2AUYA 4QT6A 4HT1T 2ENRA 2JG9C 3VBSC 4NR1A 5DDJ2 1SLCA 3THTA 3OCPA 1POV1 3UKVA 3PVBB 4HANA 3SMHA 2HEVF 1PNGA 3VV1A 2JICA 1AUYA 4BE3A 2NMNA 1FXZA 1Q43A 2PQQA 3OTFA 4FT8A 3TB0A 3USUB 3N36A 1ZZ9A 5JSRA 2GC2A 5BNNC 1VAKA 4X6QB 2PA7A 4K1ZA 3AYDA 1WLCA 2PFWA 4R4XA 4B4PA 3MFAA 4PLNA 3CO2A 2WT0A 5DUWA 1AHSA 1OD5A 4FXGB 1A6CA 1AL21 4JV4A 3D0SA 3VBUC 4RHV1 2UURA 2DUQA 4QM9A 1A3KA 2EF6A 4ZU4A 3KT4A 1NQDA 2IXLA 3B3QE 2JG8B 3S7EA 3MDPA 4I30A 4GH4B 3TN92 4PF5A 4WVWA 2UYBA 3NV3A 2D6KA 4WM7A 3VZNA 3TN91 1PHMA 1V6LA 2ZGRA 3U11A 1GZ9A 1AR62 5H9PA 2ZMNA 4B4QA 2A6WA 4RGGA 1DQ4A 4YW3A 3VHPA 2HWF1 1PIV2 1S1AA 4Q4Y2 2XJSA 4JDNA 2F4PA 1RL3A 4ATEA 1HXS1 2VQAA 3OBRA 4HKWA 4OHYA 1I3HA 4JVAA 1O4YA 4YVWC 5ABJA 1DZRA 5FLIA 1Y7BA 1LOEA 2UWCA 2ZKLA 4D3WA 3OYWA 3AB0A 1A8MA 1MZ5A 2EXJA 1HX6A