The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
27
|
sequence length |
121
|
structure length |
121
|
Chain Sequence |
MIVRNLGDIRKTDRNVRSDGWASARMLLKDDGMGFSFHVTTLFAGSELRMHYQNHLEAVLVLKGTGTIEDLATGEVHALRPGVMYALDDHDRHIVRPETDILTACVFNPPVTGREVHDESG
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| molecule keywords |
L-ectoine synthase
|
| publication title |
Biochemistry and Crystal Structure of Ectoine Synthase: A Metal-Containing Member of the Cupin Superfamily.
pubmed doi rcsb |
| source organism |
Sphingopyxis alaskensis rb2256
|
| molecule tags |
Lyase
|
| total genus |
27
|
| structure length |
121
|
| sequence length |
121
|
| chains with identical sequence |
B, C, D
|
| ec nomenclature |
ec
4.2.1.108: Ectoine synthase. |
| pdb deposition date | 2015-06-09 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF06339 | Ectoine_synth | Ectoine synthase |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Sandwich | Jelly Rolls | Jelly Rolls |
