1S2KA

Structure of scp-b a member of the eqolisin family of peptidases in a complex with a tripeptide ala-ile-his
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
206
structure length
199
Chain Sequence
TVESNWGGAILIGSDFDTVSATANVPSASGGSSAAGTAWVGIDGDTCQTAILQTGFDWYGDGTYDAWYEWEVSITISEGDSIQMSVTATSDTSGSATLENLTTGQKVSKSFSNESSGSLCRTNAEFIIEDFEECNSNGSDCEFVPFASFSPAVEFTDCSVTSDGESVSLDDAQITQVIINNQDVTDCSVSGTTVSCSYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The molecular structure and catalytic mechanism of a novel carboxyl peptidase from Scytalidium lignicolum
pubmed doi rcsb
source organism Scytalidium lignicola
molecule tags Hydrolase
molecule keywords Scytalidopepsin B
total genus 44
structure length 199
sequence length 206
ec nomenclature ec 3.4.23.32: Scytalidopepsin B.
pdb deposition date 2004-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01828 Peptidase_A4 Peptidase A4 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.700 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1s2kA00
1Y43B 3TRSB 2IFWA 1S2KA 1S2BA 2IFRA
chains in the Genus database with same CATH superfamily
4YARA 1IGOA 2I2SA 3D4KA 2RR11 1EPZA 1W3VA 4IV3B 1FOD2 4QX3A 3FL7A 1XU2A 3NJXA 1GMMA 1HX6A 1KEXA 2ZHLA 3GM8A 3J7NA 4F8AA 4X8NA 2HWD2 1DZQA 1LHOA 5FZ6A 1V6OA 4AI8A 4LKSA 4EYUA 2ZABA 4PDWA 5BNNA 2D6KA 2YFZA 3LA3A 4ISRA 2X8KA 1LRHA 1GNYA 4ONUA 4KGGA 5JIUA 1QJY2 3RDIA 4RS5C 1J83A 3K51A 2BWCA 4O9EA 3NJZA 3WUDA 5CKNA 3BPZA 3IDEA 1G9AA 4FPYA 1FPN2 5DQ0A 3ENRA 3WD5A 2JDNA 4TN7A 2VNRA 4O61A 3WQ0A 4KWLA 4YZ5A 3HNBM 5A3TA 3SCGA 4FPFA 3QACA 1YHFA 1G7YA 1CWPA 1U5XA 1RXGA 2ETEA 1J84A 4Z82A 4C0HA 1A78A 3SMHA 3VHOA 3TOJA 2JKBA 2YC0A 3NMBA 3NSTA 4MGZE 3WZ1A 2W08A 3ZKUA 1J59A 3VKMA 2QQOA 3PTYA 1W6MB 3Q8EA 2ATFA 1W8NA 3BTXA 3U75A 3MW4A 4ZS3A 3X29B 1JZ4A 2ORZA 3GHMA 4TLGA 2ZX3A 3O1OA 3AVRA 5JOWA 4JGZC 1MVQA 4FQZA 4CDUC 4EV0A 4CSWA 4E2QA 2VUAA 4EWEA 1NA1C 1X7NA 2VNOA 3ES1A 4AI2A 1KRIA 1UYYA 2HLEA 1BVVA 2OZJA 3BCWA 3JB4C 2B46X 3NAPA 3WG1A 2HWD1 4KG0A 2UYAA 3ALQA 1UU4A 4N90A 5FY0A 4DUVA 3VBUA 4GWJA 4FPLA 1RHI2 1UMHA 5FZOB 4ASMB 4CA9A 2Q8EA 1YIFA 3KQ4B 4OZXA 3KCYA 1A6CA 1BKZA 1SCRA 2PN5A 2ZACA 3DF0A 3RZMA 1OLMA 1XNTA 3AFKA 5L19A 1LR5A 2WZ8A 4AR2A 4CYDA 2WQZC 2EIEA 1YCIA 2PHXA 2P4EA 1O8PA 1IPKA 1EV12 1US2A 2J1AA 2WFF3 4FXKB 4P08A 1RVF1 2ZGLA 4IGOA 4XF4A 4LK7A 1Q56A 2JX9A 2ZKNA 3R4SA 5J09A 1EUUA 3PUQA 5L9BA 3S30A 5HCHA 2HYXA 2OT7A 3HN3A 5E1RA 1FV2A 2ID4A 2W1WA 5F32A 3LA2A 4MOAA 5FUNA 3M8LA 2GAUA 2Y6LA 4UT5A 4Q8LA 4M3CF 5A3UA 2IUWA 3ZXFA 2PFWA 4CDQA 1JYIA 1BK1A 3H42B 1DYOA 4ZPIA 2WNUC 3ZIXA 4ZS2A 1BVP1 2RR13 4X6RB 1KD7A 2R7EB 2XUEA 4IEYA 4P9JA 4DXRA 4FOYA 3H1YA 1UZ0A 2E7QA 1ALYA 1UY1A 2ZZQA 5FK8A 3U4XA 4PI0A 1MVEA 4HZFA 1ULOA 3MLJA 5JMOA 5ERLA 1LTEA 4IEOA 5A7WB 4FOVA 3J26N 2JD4A 1XU1A 3LIHA 4UI9L 5I8TA 4BIFA 2AC1A 4LHNA 3TEYA 1IQAA 1BBT2 4BH9A 1R1A3 2VH9A 2GALA 4HSJA 5FZOA 4XUQA 2O8QA 5LA9A 1STMA 5FPVA 5A33B 3HVDA 3JZVA 4FCAA 1F35A 3MF9A 4KGQA 4QXCA 3ZYIB 4AL9A 4A2UA 2HWE1 4V2VA 1HQWA 2QTWB 4YGBA 1FNZA 4CDQC 4DY3A 2ZGQA 1W8TA 5A1LA 1QJU3 4MGKE 5CZKA 3CIHA 1XYPA 1BEV3 2ZBJA 1PGSA 2B7YA 5FZMA 3POWA 1W05A 5SV8A 3VBOC 2FCUA 1RUF3 2RVAA 4CU9A 3ILFA 3O1UA 1LENA 2FCVA 2D93A 2D7FA 5FMBA 1BEV2 1W06A 5FZ9A 1LGCA 2PLV2 4LKEA 1BMV1 1AYM2 3ACHA 4CXXA 4UOJA 5A7QA 1SLAA 5KHJA 2ZX4A 2F6BA 5FXWA 2D5FA 4UF0A 1UY3A 2XJVA 3MEPA 4HKLA 5A6YA 2W5FA 3VBOB 2IXCA 3DECA 1WKYA 4U2AA 1WLTA 5F5AA 1GQGA 2EVXA 4DEQA 2NMOA 4CCNA 1AR71 1D4M1 1D4VB 2MEV1 2W92A 2PYTA 3PVOA 1VE0A 5ABJC 2HWD3 1DHKB 3DXUA 1Y3TA 5K8SA 3FHQA 4IEQA 2YC4A 1O4ZA 4UFJA 4Y5Z0 4RA0A 2HEYF 5ACA2 2DVFA 2TNFA 3ASIA 1JH5A 2C9AA 1QNWA 5FPAA 4JZRA 1MQTB 1RMU2 2OVUA 3S5AA 1FNYA 2ZGMA 2P3KA 5LBCA 2W94A 2XMLA 1RUD2 1SFPA 3O1PA 4WVVA 5HXMA 1X8MA 3GCXA 2LTNA 2WSVA 4FPCA 1QJX1 1JYCA 4DPNA 4XBQA 1G8WA 4CDXB 1IS4A 1QQP1 1PIV1 3AMHA 3SH5A 3U1XA 5E89A 4AQ6A 2ZXQA 1AR83 3POGA 4ARXA 5LRRA 1JUIA 1UWWA 4J25A 3NRUA 3ZVXA 2BU9A 3SNMA 4B8EA 1RUH1 1VBA1 2WZR1 3IPVB 4K1ZA 1W6NB 2GH8A 2AACA 4NRQA 4G4FA 2YROA 2NZ9A 2PQQA 3GBFA 2P3JA 4QWNA 4YLZA 4DXTA 4I0AA 1ZZCA 2R32A 2WS92 3OCPA 4HETA 3VL8A 3H8XA 1ZM1A 3AZWA 2DU0A 3S7IA 2JDYA 1CJPA 2WA3A 2GMEA 3KF5A 4PF1A 2R043 5FBZA 5LZ6A 1TVGA 1H8VA 4B7KA 5FP7A 1W8FA 3ACFA 4HONA 4I3GA 3RWNA 4GWNA 3WF2A 2DCTA 2OUHA 1AHSA 4WM8B 5FZLA 2GMMA 4XFCA 5DUXA 3BPSA 3KGZA 3KT4A 2IVIB 5FQ0A 4UFKA 1H9WA 1ULGA 3ZKYA 4XURA 4GB31 4DY5A 3C7HA 4NAOA 4AI3A 2W95A 1BBT3 3MPBA 1O3RA 1IKPA 1OVPA 1QIQA 1FXZA 4AGGA 2R061 1GWMA 1PO23 2JEMA 1SCSA 4GJYA 4XQ4A 5DPNA 4XETA 5LBFA 3OEBA 3FX3A 4OQ9A 3VBHC 4JRLA 4CE8A 4YVWA 2AR6A 1LECA 3M70A 4CDXA 5C6CA 2GP3A 2WFF2 4N7UA 5FJHA 4MXWA 4QKFA 3VB9A 1YYNA 2H0VA 3ZFGA 4ET7A 5KWRA 1NCQA 4CEWB 4IE7A 1RUF2 1LOFA 4FPHA 2DUPA 1APNA 2WFF1 3UJOA 2YGLA 4RGAA 4NHXA 4UFLA 3T2OA 4AEKA 3DEMA 2XWJB 4BQ2A 3OUIA 1Z7S3 3UT0A 4RR3C 1WMEA 4XJUA 2PHLA 5FZKA 4NIGA 2VUJA 3AJZA 1TG7A 2AREA 2HWC3 3AP9A 4IGQA 2WYFA 2WZEA 3SCHA 4PIZA 1CGPA 1GOHA 4KU7A 1DQ0A 2RS52 4NE9A 3L9JT 4UFIA 3GHNA 2PA7A 1O91A 5EZWA 2WINB 4FBFA 1FMD3 2PHTA 2X53S 3KHBA 3KT1A 2FDGA 1YJLA 2KR2A 4XFGA 5EHDA 4ATFA 4QDQA 5D2AA 3MLKA 4L0PA 4WVMA 5DUUA 5HCBA 1B35C 5KHHA 3VBUB 3VD7A 3DPRC 3ZSKA 4COWA 3N4MA 1CD3G 2CL2A 2VXRA 5EJ1B 4UXAA 1IS5A 2D6PA 3Q8BA 4YM1A 1T6BX 2VCMA 4B4RA 5C33A 4P5HA 3V65A 2WWUA 5IT6A 3ZYRA 5ACA3 1MZ5A 1PK6C 3NV4A 1VIWB 1S1AA 2G1MA 4XTMA 3VZJA 2VTXJ 1JYTA 1W39A 2Q1FA 2WS93 1S55A 4IE4A 1ND3A 3ETPA 1V6KA 2OQ7A 1IG0A 5DDJ3 5F3EA 1AL0G 2EXIA 4BLJA 4IV1B 3PUSA 2IZWA 4F83A 5CB7A 1W3XA 2ERFA 3I3QA 3QLQA 5FYZA 5LA0A 2EALA 2VMHA 3M2MA 3WP4A 4Y5SA 1BK0A 3VDDB 1PIV2 4TTGA 1BLZA 1DGWA 5DDJ2 4YZ3A 2Y0OA 4BYYA 5A3PA 1DF0A 5GLVA 5GZEA 5EQUA 4DOUA 1SEFA 1ULCA 5I0RA 2YYOA 2VZVA 3JUUA 4S2GA 4IEZA 2WC2A 4Q29A 3J8F2 5FY4A 4QX0A 4XAAA 2E51A 1FOD3 1D2SA 1RMU3 4TZDA 2XJPA 3LEMA 3URFA 3VLBB 1NZIA 3ACLA 4YVSA 4OULA 1F5FA 3SKVA 3VZNA 3PJYA 2WT2A 3E5UA 5FZBA 3BUCA 3POJA 3O14A 1YQ8A 4IEVA 4QQLA 1JHNA 3MIBA 5ANNA 1OOPB 3GBWA 2V4VA 1OH3A 4YG6A 4TWTA 3IDBB 4GH4B 2H6BA 2WO2A 4P9GA 5EJZB 5A6XA 1H2LA 1ND2A 2QE3A 2Y0IA 5FY8A 5DABA 3ZPYA 2QQLA 2PAKA 2R16A 3FJSA 3P3PA 2OZ6A 4YW1A 3KZ4C 1HRV3 2BYVE 5CFCB 2FDKA 3C3VA 1O3SA 3SXWA 1BEV1 5LATA 3OD0A 2EA7A 3GZEA 3V64A 1C8M2 1VMJA 4R4XA 3GJBA 2DV9A 3BOWA 3KVBA 1H4HA 4LLOA 1QJX3 5JXIA 2P6CA 2XG3A 4GH4C 4MXVA 2GP5A 1QOSA 5FYSA 2VL4A 4DRRA 1U5IA 1CX1A 1DZRA 5GZDA 3Q9OA 2RJLA 4DZGA 3PNAA 2TUNA 3CZUA 2JDKA 2A5ZA 1RUE3 2X5IA 1W8HA 3T08A 5BNPA 5GJ6A 4QDSA 1W9TA 2DCJA 2AENA 5FZ7A 5FXXA 4AXOA 1VPHA 3VKNA 2GU9A 3SISA 3HBKA 4XVHA 4E8DA 4CEYB 1FI2A 1GZCA 2DU1A 2WL1A 2WR9A 3M3IA 4CUAA 2Y60A 4JGYB 1LEDA 3POFA 4JDOA 2PHWA 1SBDA 2W3JA 3MBWA 4PDWC 2BP6A 1POV0 4UBGA 2RV9A 1JZ6A 1VB4A 3ATGA 2CDPA 4RHV3 1OVSA 4BQ4A 4FT8A 1V0AA 2D98A 1OQEA 4HMZA 2DCKA 3KM5A 2GC3A 5EJ3A 2VOTA 2OQ6A 1I5ZA 1HQNA 1IS3A 1AR73 1D4M3 3ZFEA 3AYCA 1UX6A 2HBTA 2XGXA 1ODNA 2VZPA 1Q8SA 5A7NA 2XJRA 4GH4A 4P5YA 3ABZA 5FP8A 4Q4W1 2JIGA 1WMDA 3M7AA 2WWSA 1NOVA 3MIDA 1CONA 4XF3A 4DQAA 3E97A 3INAA 3WNXA 3HQUA 3I54A 3LDRA 1S0JA 1K3IA 4XUPA 2RM22 4BJ0A 4S2HA 3FBMA 4E4HA 5DG1A 4HG6B 3VBRC 3OPTA 1RUH3 2WZR3 4YW4A 4ZY9A 3WQBA 1RUF1 5F5IA 4XXAA 3POBA 4XJ8A 1UY0A 1DFQA 1OURA 1QDCA 2CWSA 5FLIA 3VZMA 4ZZ8A 1ZBE3 2XL9A 5FY5A 3BYWA 4N8MA 1XRUA 3AC0A 5DAWA 5BNPB 2CNAA 4B29A 1PO11 2O0OA 3IPVA 4DEVA 1Q8OA 2AGSA 1W6NA 4Q4V3 1F9KA 5IVYA 4ES8A 4FAHA 5DAVA 2ZAAA 1H1MA 2C6SA 4IETA 4QKNA 4AHZA 5C9AA 5KC6A 1RUI3 2WQ4A 3MICA 1MS4A 5AC92 2JG9A 2WSUA 3RZKA 4OUSA 4J6GA 1LAJA 1GOFA 4JQTA 2CTVA 2HWC1 2W1UA 4LBMA 3GCWA 4ARYA 5A3WA 4JDMA 3FHAA 2N7GA 4PJYA 3WNMA 1ULFA 4JHZA 3TBDA 3WW3A 3RZHA 4LO4B 5H9PA 5BNOC 2E7AA 2D3SA 1YQ6A 1W2TA 2C26A 4I09A 3RGBA 5K7PA 3FHIB 3H7YA 4FTBA 3HQXA 1FT9A 1SZBA 2ZMLA 4K21A 2XVLA 3B00A 5FQ0B 3AP7A 1PHMA 1N1YA 5FZHA 5A1FA 3WXPA 3ZIWA 1I5PA 1ZBA1 5FIXA 4Q4W3 4W50A 2VMFA 4NHLA 1RIRA 1R1A1 2P37A 4LIUA 4IEXA 2ZGNA 5KR7A 1DQ5A 1NCQB 4QHBA 4Y5TA 3CJIA 1RUH2 2IWGB 2WZR2 3T1LA 5A3NA 2BBAA 4P9XA 4MHUA 4Y24A 5B4NA 4CU8A 3K4AA 4OYUA 4A4AA 4V1PA 4BK4A 2VOWA 4Q4X3 2MPFA 3PL0A 1QQP2 1YRZA 3CLPA 3OUJA 3CL1A 3F2ZA 3H1MA 1QJX2 2VBBA 1KDKA 1SQ4A 3USUB 3QH7A 1QJY1 1RJ8A 4H3WA 3MZHA 3KCCA 2RS31 4YW5A 3R0RA 5FY1A 5C3OA 5C7GA 1AR62 3RG0A 3GYDA 1LULA 1UXZA 1H2KA 5FK7A 2VBPA 5L73A 2QVSB 4BLIA 1D2QA 1DQ1A 2BOJA 4GMP0 1AR93 3ILRA 2OW4A 5GZGA 5F2WA 1HV0A 2YPDA 5C70A 5JXJA 2FDJA 2LALA 5D8AB 2C24A 4KU8A 5C4WB 3K75B 2DYCA 4R9BA 3RZLA 1FATA 1GV9A 1X9TA 1JYXA 2DBIA 1ENRA 1FOD1 2Y34A 5F3GA 3S7EA 3WW2A 3B02A 4META 3ZR6A 2FDHA 5CIRA 1WMFA 3MV11 1W9SA 1PO21 5IWFA 1DQ2A 2IXIA 1XNBA 2CWMA 3ZYGA 4WVMB 1W9WA 3RFRA 1Q43A 1J58A 3B94A 1ZZ6A 4QPGA 1W8UA 3PIGA 1AX0A 5F8PA 5GZFA 1JUHA 3V0BA 1EAH3 2BGOA 1W8ZA 5BNNC 5KHIA 1NT0A 4G3YC 2Q5TA 3MIGA 5FPLA 4AYUA 5EWSA 4Q4Y2 4YZ2A 5IFPA 4FPJA 3I3EA 3GXUA 1NY71 4FFGA 5AVPA 4DUWA 1AR61 1NE6A 2VD7A 4Q2FA 3I2HA 1W6PB 2A6WA 2G4IA 2XBO2 1A34A 2BEOA 3WHUA 4N9IA 5M0TA 3VL9A 3MIEA 1ACCA 4QX1A 3FMGA 1QH7A 3P6BA 5IAXA 1OA3A 5I93A 2Y8KA 4COVA 4CU7A 1GBGA 2HJIA 3AYEA 5LCWL 4XFAA 5BNPC 5LEJA 4FVVA 2HBUA 1K5MC 2ZAHA 3KV5A 2WABA 5CFDA 3B69A 1SBFA 3APBA 4BQ5A 4AQSA 3RNSA 1POV1 3KT7A 1ZRIA 1Q3EA 3A7QA 4LBJA 2QZ2A 1SPPB 1S2BA 3OGSA 3VBFC 4WM7A 1AXKA 1RC6A 1RUC2 1SFYA 4TLFA 5FWJA 3ES4A 1S0FA 3WDXA 4GWIA 1H30A 1QNYA 2YMZA 4MGIE 2OYZA 3I2FA 5FOJB 2DVBA 2WUHA 3BU7A 3OY8A 3T30A 4A3ZA 1VAVA 1QHDA 3CU7A 4BWOA 3NAPB 2XHNA 4CDUA 2BNMA 4D0QA 3OEAA 3JCIA 4D8MA 4BDVB 4CDQB 5JSRA 5FPUA 1UL9A 3NAPC 1W6OB 2F4LA 3D6EA 4NO4A 2ES3A 1UF2C 3UNPA 4KG8A 1PK6B 2XBO3 4NPMA 3J7HA 3C2UA 4LULA 1Y7BA 5FZ0A 4CUCA 3BI3A 2ZZJA 2AEYA 4GQ7A 2LROA 2NM1A 4WV8A 3S6PA 3AKTA 1LGBA 5FMOL 3S5QA 1WLWA 2XKOA 5K0UC 1OA2A 4UW3A 3VBUC 1EV11 3VBRA 4FPOB 3ZXKA 4AHYA 4CCOA 1YNAA 1OKOA 2VCCA 2XLGA 4RN5A 1JODA 3WNOA 4LE3A 4YW7A 5LRSA 3VBFA 2XXZA 4WM8C 4XFIA 4JGYA 4AGVA 4AI0A 3A23A 3KV4A 4FFIA 1J3QA 1UMZA 4Y3OA 3AP6A 1QKQA 3ZOIA 4COZA 2E32A 3WX5A 4HKOA 1A8DA 1WW7A 4ZXEA 2O1QA 3A0KA 1JYWA 2E63A 3O1RA 2WNVB 3N7LA 4NMIA 1N47A 4GWMA 2VY0A 5LBEA 4AEJA 1U0AA 4XOGA 4AWDA 3D8CA 1DQ6A 2DTYA 4AEMA 1OKQA 1JYVA 3IIAA 2RDRA 1DU3D 4I01A 2BVBA 5CKQA 1ZZ7A 2JIJA 1HJFA 1WWYA 1YXWA 2DVAA 1SLIA 3OY8B 5JPNB 1D0HA 2DWRA 3B7MA 3ZFGC 4CP1A 1S2EA 4QU2A 3VKOA 2RMU1 3HIFA 4LHSA 3QH6A 5FAXA 1CAUB 4NIDA 2VUCA 4CDXC 1WUVA 3WNLA 1W6OA 2J1EA 3WLUA 4ZHNA 1V6MA 3WNKA 4CVUA 3LGRA 3J9SA 4OHZA 5K0UB 1GKBA 1ZNPA 1UPSA 2YV8A 4I30A 1DCSA 4LO8A 1KJLA 1ZYBA 3LA7A 1HQLA 2A3WA 2ZGTA 1LOFC 1XB9A 4A41A 1GZ9A 1VBC3 2XBO1 1RUE1 3ZXJA 2BFUS 3MLLA 1QGLA 2VECA 4PI2A 4D6SA 1S0GA 4I0BA 1RINA 4MGYE 4QQOA 5A32A 3AMNA 4WZCA 4Q4Y1 5JAXA 1VBE2 3G7DA 3IDAA 4IGPA 5JXHA 4XE9A 3VBSB 4AFMA 2W87A 4E4ZA 4M01A 3ZM8A 2W2IA 3AVSA 1NE4A 3POEA 4NOTA 2JDZA 1ENSA 1QH6A 1MR5A 1TME2 4A7ZA 4EZHA 3VKFC 3B3QE 3VBOA 1RHI3 1OHFA 5FO9B 2WZPP 1IQDC 5FZIA 5T52A 2ZGOA 2W47A 3HJRA 3SEEA 3V0AB 1UYPA 5F5CA 5GM0A 5LWBA 1REFA 1NZCA 2E7TA 2V09A 2LRPA 4LIVA 2OIIA 3P1IA 1HRV2 4A6SA 4K1YA 4IL7A 4EN8B 3OBRA 2UY8A 4RYDA 4RSUA 2J1UA 4L11A 1WZXA 1L7RA 1ZBA3 2G9FA 4HN0A 4LBOA 4P9LA 2R071 2YHJA 4Y1XA 2XJUA 4DS0A 4ISQA 1DGWX 3O1MA 1N1SA 3IDCB 4URAA 2X09A 1OSGA 5KHKA 5C3RA 1B35B 5FXVA 2OXBA 3AZYA 3ORJA 4Y1VA 4EN0A 5JUVA 1MACA 1ZREA 4XDQA 4EROA 1A8MA 4QD2A 3POYA 1VBE1 5EXOA 2D40A 1QEXA 2HWF3 4KNCA 1YFWA 3KQRA 4RGGA 5B2GB 4FPGA 5TSWA 4CCMA 2C5DA 4NR1A 4P02B 3H0OA 5EP9A 4CDWB 1QQP3 4LXLA 1H0BA 2ZKLA 1RUE2 2PXJA 1BXHA 2QDNA 3CJIB 3MW3A 1RUI2 3R05A 1LHWA 3N9MA 1FAYA 2P2KA 2PHRA 3U07A 3WNNA 2C0ZA 3UGGA 5FYVA 1CAVB 1X9PA 2IXHA 4Q5OA 5C71A 3B9IA 2ZEXA 4YVSC 2VU9A 5FTTC 4IV3C 5FYMA 3VN4A 1HRI3 4Z2AA 2D6MA 2VZ3A 1H8TA 5FLJA 5LY1A 3NKGA 1JN2P 4H2AA 2UWAA 5KXBA 1MS3A 5FXZA 5D8AA 2RMU2 5DAQA 5T5LA 5ABJA 3ME2A 3NV2A 5FWEA 4LBQB 2PMWB 2VOKA 5FP4A 1R1A2 4MG2A 5AFBA 3LF7A 2VTFA 3AZZA 2VM9A 3DKQA 2WWJA 5EFUA 5FZ1A 4Z92B 1K5MA 4C91A 5FMOS 2K2SA 1ZBA2 1U5ZA 5C8WA 2BRTA 1HB3A 1OT5A 3IAQA 1H1AA 1XYOA 4S2DA 1NCRC 4JVAA 3OB8A 3A4UA 4CTEA 3LPFA 1XNDA 1PX3A 2GC0A 3U78A 5FZ4A 1ULEA 4DUXA 1EPWA 1JZ3A 4HK8A 1GSLA 2W68A 2VCAA 4FAGA 1G9CA 1QJEA 2VNVA 4AI9A 3J7LA 3QBQA 3N9OA 5T5OA 1UCXA 1CX4A 4PT6A 3B5LB 5FYTA 4IV3A 3SEPA 4YVWB 4BK5A 5F9TA 2AUYA 3VZOA 5DAPA 3VBHA 2A73B 3OYWB 1YO8A 3U14A 4E4DX 2VZUA 2BV4A 3ZFGB 1G9BA 3IKWA 3OGRA 2UU8A 1PMHX 3I7DA 1XBFA 1JI6A 3V0BB 1YQCA 4PDWB 4W4ZA 2YGMA 4UW6A 5HI0A 3ZSLA 4NIHA 1NUKA 2BNOA 2D6NA 2ET7A 1VALA 3DYPA 4QDRA 5CBLA 5FZ8A 2BW8A 4UW5A 5T5JA 3RPQA 1UKGA 4BISA 2RM21 4XUNA 3O0XA 3RWKX 2K0GA 1UX7A 3WF0A 4AVVA 2YC2A 3EMRA 4UW4A 3ZN6B 2CHHA 2RDQA 2W39A 1H9PA 3DUIA 3KCXA 5A3MA 1W90A 1PO13 4NIIA 3O1VA 4AFBA 1QXJA 3DXTA 5BNOB 4ZU4A 1MEC2 3GF6A 2V5YA 3OGVA 4AI1A 3THTA 1MPXA 2D43A 2JE8A 3TNQA 1RUOA 1PZ9A 2IFWA 1IPSA 2VAUA 2R062 3R6SA 1SMVA 4XIKA 3S0MA 4Q4W2 4Q0UA 4KWJA 4QGMA 3TRSB 4RL7A 2E6VA 4YW6A 3UESA 1W28A 1AXYA 1GFF2 4AF9A 1XOYA 4E4SA 3W21A 1W9FA 3MIFA 1JOPA 4CZSA 4C1WA 4SBVA 2I74A 2EAAA 3J4UH 4B3NA 2B5HA 3QD6A 2PELA 2Q1ZB 3ZXGA 3C8XA 1Y4WA 1ASJ3 1OA4A 1PVC1 1CAXA 1V6LA 2EXHA 2XL7A 3E6BA 3T09A 4GULA 4LA2A 1WA6X 1PK6A 4LUMA 3VBRB 1DLCA 2AYHA 2MNGA 5FYBA 1MS1A 3GJAA 1W2AX 1VLNA 3AK0A 5FKCA 2VVFA 2JENA 1NY72 1YJKA 2BZDA 3KV9A 5HPOA 4XF0A 1C8M1 5FZ3A 3MI8A 3N7MA 4YGCA 1S0DA 5IUQA 3OF1A 4QQPA 3WV6A 5A7OA 1O3TA 3H3UA 4AHXA 2ILMA 3ITQA 4OHXA 2ZOEB 1SG3A 4LORA 4A42A 5FP3A 2R6QA 4CCDA 2CAUA 1OBNA 3JBG2 1JXNA 3E5XA 3EB7A 4OMCA 2XVKA 1UYXA 4XZUG 3CEWA 1QMJA 1PO22 3P3NA 3ZYJB 4XJ9A 1VMFA 1G9DA 4M4RA 1MS5A 2QKDA 4LO6B 4ZKTB 5KBFA 1SFNA 1VR3A 1PNFA 2JE9A 4YVSB 2D5HA 4AW7A 1C8NA 2BFUL 4XJZA 3KS7A 1CN1A 2E31A 4BQYA 3T4HB 1IOAA 1T6GC 1RUD3 2AEZA 3NJVA 2W1SA 5FV3A 3VUOA 3THDA 3UK9A 3WNPA 3UL2A 4CDWC 5D1IA 5ACA1 1Y43B 2FCTA 3RYRA 1HXS2 4Y20B 2Z4FA 5FZAA 1BCXA 1O5UA 3PU3A 4HVOA 4LBQD 3MHZA 1O5LA 2WT0A 4I2OA 5B4XA 2RS32 1RYYA 3D5OA 1W04A 1KITA 1OI6A 1XNAA 2JE7A 1HW5A 2FZ2A 1UQXA 3AJYA 4BOWA 1X50A 3I4IA 3RZGA 5DDJ1 1CZTA 3EJKA 1LODA 1YFYA 1YQ5A 1EAH1 1JHJA 2P3YA 4TXWA 3RMYA 3AL5A 1RUNA 2QQVA 1VBE3 2G19A 5JOZA 3TWIA 4QQHA 1BJQA 4AGRA 3T2TA 1WCUA 2D3PA 3JXSA 1QWRA 4BQ1A 5DG2A 1AR63 2JDPA 2DCZA 5EPAA 1KGYA 4Y26A 3CJXA 1TMF2 1RUG3 2YB7A 5BXXA 2B39A 4XIOA 4RFRB 3AZXA 4HVRA 5FREA 1WCKA 2P1BA 4X8PA 5F39A 4OQ8A 3I3MA 4Q8KA 2NP0A 1NX9A 1CIWA 2ZHKA 1VRH3 4LBKA 3SHRA 4AQTA 4QKDA 2X10A 5GLTA 4IERA 5D8AC 4XUOA 2DURA 3WINE 4PIYA 2VMIA 2YG0A 4XJWA 1C28A 1Q5OA 2JB4A 4Q0SA 1WBLA 4NWVA 4XHXA 1W2NA 1MEC3 1BBT1 2ARXA 3AMPA 3M4FA 3RJRA 3WDYA 4DO0A 1COV2 4XFFA 1WLDA 1KQRA 3ZDVA 1D7PM 3I8TA 4ATEA 4JQRA 5A6ZA 5I0DA 2D6LX 5AC91 1DQ4A 3WF1A 1LHUA 3MYXA 3PIJA 4EN9B 4LE4A 2EICA 1OFSA 2FMYA 1ULPA 2W1QA 3R4DB 1OLRA 3ZSMA 1XSRA 5IAVA 4OHWA 4XDOA 3THCA 3VDDC 5C9AB 3EYPA 1HB1A 4PLNA 3LZZA 2XPJA 1XYNA 2R073 5L36A 1NA1B 1UN1A 4ASLA 4CP0A 5CG8A 4NIAA 3K77A 1QF3A 2AZ5A 5IVFA 5GALA 2ADEA 4M3CB 4BMEA 2P3IA 2E53A 2JJ6A 2J1VA 2JDUA 5EYYA 2OKXA 2FZ1A 3KV6A 3UGHA 1PGL2 4I3PA 3OTFA 1F4HA 1HN1A 4LTAA 4QGNA 1NLRA 1TME3 4Z07A 4LBLA 4YM3A 4EJRA 4OI1A 2BTVC 1TQ5A 1P8JA 4JGZB 4BQWA 4YW3A 2F17A 3ZMNA 1RITA 1DGRN 2ZGSA 2A3YA 1WW4A 2NQYA 3I2KA 3PUIA 4QPWA 3QCWA 4NHYA 5FMDA 1RTVA 3ZYHA 5IVBA 1M4WA 5GKAC 5CVRA 4KQ7A 2Y26A 3FLTA 3M3EA 4D6QA 5BV6A 3LKJA 1K5MB 2VZSA 4MYEA 1F15A 5I0UA 2QQKA 3I3DA 4XFHA 1LU1A 4BE3A 5A1AA 2O14A 2QQNA 1JZ8A 3LB9A 4DNYA 1US3A 1LCLA 2VUDA 5IK7A 1OFNA 2QQWA 5A3LA 2JDHA 1VBD2 2JG9C 2CDOA 2VZQA 4BIOA 2YZ4A 4L92A 1JZ5A 3W20A 3Q8FA 2BGCA 1IG3A 3PVNA 1V70A 2ZMNA 2R063 1RXFA 2XQRA 2LUWA 3DGTA 5DUVA 2QQJA 3AZVA 4CU6A 3RZJA 3NV3A 3BN6A 1TE1B 2NPIA 2PLV3 5BUVA 4EE2A 2ZCWA 1NLQA 5FYHA 4BQXA 3HOBA 3PUAA 2VE1A 5CYYA 2QUOA 3B93A 3VDCA 3KSCA 3EQEA 4WM8A 5A80A 1V00A 1EP0A 1CESA 3LE0A 2OA2A 4N7IA 4Y33A 4LEJA 3C7GA 4OFGA 4LJHA 5IK5A 3CHXA 3NKTA 2EIBA 1ASJ2 3PVBB 3O0WA 5DN2A 1RB8G 1X36A 1HIXA 3VBHB 5JXGA 3VZKA 3SLIA 1YLLA 4MX3A 4CCCA 2XJSA 4N43B 4AEDB 1Z78A 2BDRA 3ZDSA 1TZOA 4JGZA 2ZGKA 5CEHA 5C3SA 2XJQA 3LDKA 5FYYA 1JOBA 1OPOA 1SLCA 5JSPA 3MUZ1 4W6WA 1E57A 5DZGA 1LGNA 1GU3A 1UU6A 4M0NA 2UWBA 3IWZA 3GDBA 1BQPA 1UPIA 4IXLA 1MS8A 5C8CC 3WF4A 5KXDA 4CUGA 1KDMA 4LITA 3HEIA 4COYA 1AL21 3AKQA 4WVZA 2WYSA 1XXNA 1AX2A 1XC6A 4HLTA 2GZWA 4R9CA 2HH9A 2R072 5IVCA 4MLOA 1DZTA 5JZGA 3MFCA 4ZU5A 3WQ1A 3MUY1 2VNGA 5FRAA 5GLWA 5JVVA 2DFBA 4CCLA 5L7OB 5FZEA 2XR4A 4P00B 4QPIC 5IK4A 1BZWA 1Y9MA 4UBHA 4QPGB 4FOWA 1HJGA 5CFDB 4BXFA 4QX8A 3N9NA 4LQRA 4FO9A 4AK3A 2PLV1 4PLOA 2Y33A 4YGEA 1UIJA 4D7TA 2X05A 1AYM3 3JU9A 1TME1 4QHZA 4AVTA 4B1MA 4FQ4A 3AP4A 2Y6HA 3UV9A 1V9U3 4MHRA 1R64A 1W6PA 2IXLA 4LNVA 3LIGA 4YRDA 1AYN3 1KFUL 1O8SA 1JBCA 3KD4A 5E88A 3AX4A 2WLPA 1V9U2 1WA4A 2F4PA 5C3PA 3WEZA 3AB0A 3DL3A 2VCBA 2QQIA 1OF4A 3ZO0B 4OZOA 1RUJ2 4W65A 5FYIA 3H8UA 1DGLA 2E9QA 1KS4A 5A33A 1MS9A 4EWAA 1LU2A 4F3JA 4YSFA 5E8AA 2MHFA 2JKXA 1Z7S1 2VULA 3MO4A 4MV2A 5G05L 1GOGA 1K12A 1DBNA 2BNNA 3RRDA 4XILA 3AP5A 1UYZA 3VD5A 1UOBA 1SBEA 3NWKA 2GNMA 3NL1A 4DXZA 2YXSA 1W99A 1SHWB 5IVVA 3NW4A 3UETA 4E9KA 1RL3A 1VRH1 3E6DA 1H4GA 1IHMA 3LFMA 4ZONA 4A44A 2JXAA 2V73A 5FYUA 4Y20A 5FJKA 5CFDC 1L7QA 5LW9A 2YBPA 4QXKA 2EF6A 2Z5WA 1YUDA 4PBOA 5CU1A 1HB4A 3WOGA 1QOOA 2H6CA 4N43C 3UJQA 4AEDC 3BTZA 1F2NA 4UF0B 5KC5A 2YBSA 4XZPA 1LHNA 5FDBA 2LW8A 4XTPA 4OCTA 2R042 1PGW1 1AXZA 3LPGA 3U4SA 5FY9A 3W59A 1H8TC 2CGNA 1REEA 4ZZ5A 2KD7A 5DMYA 4QMAA 3OSDA 2HEVF 2VW2A 3DPRB 4QX2A 3NQHA 4CCEA 4IDZA 1NYWA 2K9ZA 4CP2A 2QNKA 2GSYA 2ET1A 1UZZA 3LCPA 5A70A 2OPWA 1YEWA 2WN3A 1TNFA 2BWAA 4OLLA 2CAVA 5JR7B 4LBNA 1YC61 3VBFB 3ZXEA 4CCKA 4RD7A 1AR82 4IEPA 5J96B 1CAUA 1ZBE1 3MW2A 4J1XA 1RVF2 1XSQA 3PMSA 2OX0A 5A3OA 4K7JA 1OLME 1WW5A 3KB5A 4FI9A 2R0FA 4JGYC 4W8JA 2GN7A 3FC0A 4INDA 4Q0PA 5K0UA 4H7MA 3T0DA 3IB3A 3TN91 4BQ3A 4GJZA 3RVHA 1O6UA 1AF9A 1FPN3 1NCRA 1OC1A 3ZFEC 1DDLA 4QPYA 1UNBA 2QZ3A 2ORXA 1AR91 4LUKA 1E5HA 4QGLA 3ZYFA 2VGDA 2XKPA 2Q1MA 1YIPA 1C3HA 4QX5A 3M3CA 2Y64A 3GZTB 5J7MA 1VBD3 3HWJA 4YWAA 4P9IA 1OH4A 3AM2A 3WSOA 2XLAA 2Y38A 2GMPA 1ZZ9A 1NA1A 2ZPXA 2VOVA 3HT2A 3EO6A 3M3QA 2XHKA 1RUC1 4B7EA 2WFPA 3D0JA 2HWE3 4L99A 2GN3A 5K4LA 2VOXA 3OBZA 3U0ZA 3PUHA 2WIIB 1FX5A 3LFIA 5LEKA 1LHVA 1XNCA 4MO3M 4XEZA 2WS91 4M3CA 3B9CA 4CEWC 3BU0A 5T55A 5C5UA 1H1IA 1PMIA 4QB2A 4XBNA 4HFSA 4XJAA 3ZFFA 5KHGA 5LK5A 1ZA7A 3ETQA 3OBAA 1G6NA 3ZFEB 3OPWA 4Q4X1 4XMAA 5FZDA 2B8MA 2J1RA 2W52A 1CAWB 3AYAA 2YPJA 4IEWA 1SPPA 3C7EA 5T3NA 4JKLA 4Q4V1 2ARCA 2D97A 4XAEA 5C9AC 3O5SA 3QOPA 5JIAA 4ORFA 4R4ZA 1TEIA 5IATA 1RUI1 2DFCA 5C4WC 3D0SA 1NLSA 1UD1A 2B45X 2Q30A 4MGSA 3CKHA 5JPMB 2J22A 3PVEA 1JU4A 5FMCA 1C8M3 4D7YA 3O1TA 2BUKA 3PU8A 1ND3C 2VZOA 1RMU1 5E6HA 3W58A 1Z0HA 3BOPA 4FTSA 4NRMA 5F2SA 1D0GA 2QBXA 2KXLA 4QU1A 4CEYC 3FFZA 2WNUA 4JV4A 2JICA 1R081 2YBKA 3WP3A 1QJZA 3TN93 3ZYBA 3LEIA 4D69A 5FPZA 4XABA 4CEWA 2QQUA 5JWPA 4P9YA 2WO3A 3IM0A 1W9YA 5HCFA 3ZPOA 4ZXKA 3T0BA 1AZDA 1VJ2A 2RE9A 4LHLA 2WNEA 4HVQA 1AX1A 2A1XA 4LK6A 1J3RA 1VMHA 2VG9A 1R092 4O7XA 2BQPA 3VD4A 5AVAA 1HRV1 1NCQC 2A71A 4URTA 1RGSA 1SACA 3SITA 3OUHA 1CVNA 2A6YA 2RR12 3AFGA 3CJIC 1AR81 3FLPA 3J8F3 1F5JA 2RS11 4LBQA 4CP9B 1VBC1 3UGFA 5JCTA 1BMV2 1GYKA 4ASKA 4BA6A 1OQDA 3O0VA 4LO7A 2RS53 2J42A 3EBRA 2B4KA 5I0SA 3MGUA 1MQTC 4LOSA 4NPLA 3WDVA 2UYBA 3RS6A 4EQVA 2VQUA 3HD8B 1GR3A 1KS5A 2DVDA 2HWF1 1OOPC 4PF5A 1O4YA 1O59A 3BODA 3AMQA 4RS5B 1HLCA 3Q8AA 3ZLIA 2YY1A 4XQWA 5DUWA 1CJDA 3SC7X 3UKVA 1LOGA 1EV13 1PGW2 4LR4A 5DZFA 1ND2B 1AYN2 3ZYPA 3E6CC 2ZGUA 5LK7B 3S57A 2Z69A 5HXVA 2Z79A 1COV3 1UOFA 3WG2A 5FUIA 4NAMA 3LD8A 4ZU7A 1GZTA 3RZZA 4FSJA 4BHPA 1PVXA 1ST8A 2CGOA 5FLHA 4F7ZA 3LEGA 4YG3A 1R093 5JZGB 1POV3 3GBGA 4H14A 1J1LA 4IV1A 5CISA 5L7OA 3USUA 3VDAA 1CQ9A 2D6OX 3BALA 4QPGC 2X5IB 1BYHA 1HDKA 3PURA 2J1TA 2JG8C 1REDA 4KH9A 2JECA 4L8QA 2GNBA 5T50A 3ZN6A 5FFOC 1O3QA 4P9WA 1ZZBA 2Z2SB 2Q8DA 1XPWA 1YI7A 4E27A 2HWC2 3BKZA 3ACGA 1K45A 4OVEA 3A22A 4EWDA 1CPNA 2DBNA 3CMGA 1V9U1 2HKXA 5F3IA 3D82A 1UZYA 4N53B 3WHTA 2KM2A 2WQ8A 5H9SA 2XH6A 2R49A 1KFXL 3EHKA 3OYWA 5FO7B 1WGPA 5KXEA 3WVJA 4E2SA 4HOOA 2YFUA 1S0BA 4IEUA 4L9BA 4JDNA 4E8CA 1PO12 1OLQA 3BIWE 3KF3A 3N9LA 4OI2A 1DYKA 3T0AA 5F7UA 3MF6A 1RUG2 2RJKA 1OD3A 4XC9A 2XQXA 4Y22A 5J37A 1XE0A 3ELNA 1QJU2 4C0BA 4XF9A 2IFRA 3HAGA 3LQCA 1NAEA 1UXXX 3HN1A 1W6QA 4QT6A 5DXDA 3RSJA 2OUJA 5T54A 3KMHA 3CF6E 4M4PA 1PX4A 3ON7A 3G6JB 4B4PA 3USSA 1BHGA 1CAXB 3PDQA 3N9QA 4RR3B 1FMD1 4XCAA 5FOBB 1ND2C 3WT3A 4I0WB 1S4CA 1WCQA 1N3PA 4XMIA 3NV1A 2XOMA 2A6ZA 3RI9A 1GNZA 3IMNA 3WY6A 3ZR5A 4XFBA 2ZX1A 1CR7A 1R082 1YQ2A 4KMQA 2GC1A 4IUGA 5A32B 1LOBA 3JD73 3CO2A 4Z2WA 2VZTA 2E33A 4A6OA 4L97A 3OD4A 2EXKA 1M06G 2E26A 2EIDA 1KXGA 2CU5A 5JI9A 2ADDA 4Y4RA 1GZWB 2QQMA 2FMDA 3SH4A 4CXWA 3FE5A 3RI8A 2JG9B 1NXMA 3MDPA 4IE0A 2R1DA 1UY2A 4Q4V2 1CZVA 1NXD1 2HEWF 5A7WA 1VBB2 3WF3A 4YVWC 4JHTA 2VW0A 3ZFFC 2RJ2A 4NUBA 2NMNA 3L2HA 3VDBA 1QDOA 4GAZA 4GD4A 4K8RB 4A3XA 2WO7A 2K46A 3K4ZA 1X33A 3N36A 2ZS6B 3ZN5A 3LEKA 4UFMA 2SBAA 3K46A 3ZXAC 2IC1A 3T2PA 4Q4Y3 4RQPC 4UWDA 4HN1A 4H7LA 1WBFA 3I97A 1GP6A 4BU2A 3KWVA 3H8RA 1NCRB 3R4UA 4AFAA 5BY5A 1OF3A 3IT8A 2XWBB 3ZXLA 3BTYA 3LDBA 4RR3A 4NJ4A 1T2XA 4QX7A 1L7LA 3ST7A 2AH2A 2PHDA 2VR4A 3K3NA 4D3WA 1O7FA 1V6IA 1VBD1 3AKRA 4WVWA 3JB8A 2HWB3 4HSLA 4GA9A 1Q8VA 4IW3A 3TN92 1E5RA 4DINB 2P34A 2PAMA 2BPA2 3T4VA 1SLBA 4XW3A 3B01A 4AVCA 1HN0A 3MFAA 2VPVA 1OXCA 2HWB2 5GLZA 2YDEA 4AZZA 1ODMA 4BXSV 4V2WA 1ZBE2 3I59A 4HBNA 4FOQA 5IVJA 4QAWA 3ZN4A 1RUC3 3WG4A 2DDUA 4YG0A 3I2DA 5JMCA 3MIHA 1CAWA 4LPLA 5FZCA 4C90A 3J8F1 1UAIA 4OHYA 4XYXA 3VKLA 3WP6A 1C57A 1NG0A 3F95A 2BGPA 4CUBA 2EXJA 4YYOA 3HT1A 2A6VA 2WT1A 2C4XA 5DAXA 2P5BA 3O1SA 1MQTA 1J3PA 5GLUA 3W5NA 2VO5A 3MV01 4J1WA 5K9YA 4QXBA 4NWWA 3UKNA 1VP6A 2VQAA 2R041 2WKKA 1OOPA 2CYFA 4HPKB 1UZVA 3UYJA 5CNAA 2DTWA 4YGDA 1TNRA 4PLMA 3HPNA 4R9DA 4A45A 3AYDA 5FUPA 1HRI1 2WNUB 1R083 1S2KA 4XXPA 4PQQA 2W0XA 5F6LB 5ANQA 2PHUA 5HV4A 4KL1A 4AVSA 5IVEA 5LA1A 1ZRFA 1COV1 2RDSA 4GMP1 3TAYA 1WD3A 1PNGA 3VHNA 4OI4A 5HV0A 3LAGA 2IVJA 2TBVA 3J7MA 3JQXA 3VBSA 4DB5A 1SLLA 3AKSA 4FPKA 2CGPA 1W2UA 2QDRA 2EIGA 1ENXA 2J1SA 4Q27A 1OUSA 3T3YA 1Z7S2 4GXLA 3T2QA 3JD72 5CAZA 2B9VA 3W9AA 5JSOA 5J1XA 3I49A 3NNGA 5LASA 1JW6A 4BPZA 1W2OA 4OUEA 4WM7C 5AC93 1JS9A 2XB6C 3VD3A 4HXCA 2DUOA 2X29A 2FHRA 1UO9A 1V6NA 1X8EA 4LLFA 3OJBA 2ZEZA 4XF1A 3A0NA 2VQTA 2ARAA 2QFEA 4CP9A 4MUVA 4RS5A 1UZWA 4NROA 4QQ2A 3IZOA 3VZLA 2C1FA 2ENRA 2P6HA 4XBLA 5F37A 3V56A 2H0BA 3DKWA 2Q4SA 4Z1VA 1VBB3 1ZVFA 3AXDA 4HK9A 4DMIA 3BTAA 4HT1T 3VBSC 3OGGA 3TEXA 4UYBA 3LSEA 2VTXA 4YW2A 1GWKA 3LSDA 1N1TA 4MXWB 1HXS1 1PM4A 1Y9QA 2VZ1A 1POQA 4PBPA 4RQPB 2R30A 3GZAA 4HL0A 2FDFA 1OUXA 3RMXA 1PM7A 4KI5M 2QCSB 4CRQA 2UURA 2HWB1 2IXJA 2XJTA 4QM9A 3CZJA 2GDFA 4KBZA 2R1BA 1JMUB 1GUIA 1X82A 2V72A 3P5BA 1AL22 4OUMA 4NHMA 3WG3A 4A7YA 2A70A 5JLVA 3RYKA 5AFEA 5F3CA 4N43A 4AEDA 1RJ7A 3HQRA 1UMIA 2G9GA 4GIQA 1J1TA 2ZHMA 3VGIA 2WRAA 4RHV2 1DG6A 2RS13 2BERA 3I2GA 3JBG1 1SDWA 1AVBA 4BB3A 4DFSA 2DCYA 3WW1A 4EN7B 1VB2A 3CQOA 1H2MA 1PIV3 2YUEA 4YM0A 1K5JA 2D44A 2XLFA 3POIA 4AHWA 4K40A 3IN9A 1WCDJ 4XQDA 5IW0A 5A7SA 2FD8A 1JZ7A 1ZRDA 1XNKA 2WNVA 4D94A 1F4AA 3THPA 3HBZA 2PQSA 2C9KA 4R9AA 2BJSA 3KLSA 3RYPA 4COUA 3FBYA 3IMMA 3H1WA 2IXKA 1ASJ1 1PVC3 5SV5A 2ZJCA 3VD9A 4N53A 1NQDA 3AMMA 3VHPA 4JTOA 1KJRA 3BVCA 3ZMOA 4LA3A 4JTNA 1SDDB 3WCRA 1G9FA 3VHRA 1ULDA 2LS6A 2RS33 4CDUB 1PVC2 3TNPB 3CNAA 1W0OA 1IS6A 4CXYA 1C5HA 2WBKA 4O65A 3FN9A 4GKYA 2ZX0A 4QKBA 2DVGA 4CCJA 1WLCA 3N35A 1EY2A 4Y1UA 4EN6B 4YZ4A 4B1LA 1ZRCA 3N7JA 1XJAA 2W46A 1FV3A 1ND3B 5A7PA 5JR2A 4RQPA 4K6BA 2Q0AA 4QXHA 1DGRA 1H2NA 5L9VA 2XUMA 3FZ3A 2A6XA 1RUD1 3TEWA 3RQ0A 4YFWA 4DRVA 1XQNA 5FPXA 5J48A 4S2FA 3H50A 1K42A 1GP5A 4Q0QA 3GZUC 2EAKA 4BZ4A 2VW1A 5J3UA 3NNFA 3N3HA 4JKMA 3BGAA 1MEC1 1IKQA 5CA6A 5BNOA 1LJ7A 1Y9GA 2G9ZA 2JG8B 4N53C 4AE2A 2BBVA 2HYKA 4KWUA 2J7MA 3RJ2X 4YM2A 5E16A 1AR72 1D4M2 3LOIA 2Z42A 4FFHA 5FZFA 1UU5A 3HMYA 1I1EA 1FMD2 4XPVA 1RVF3 4QPIA 5C5TA 3T1MA 4HKWA 5JZGC 2UY9A 1H6YA 1GZWA 4H55A 5IYYA 2WLQA 2Y6GA 3M3OA 4K3UA 1NQJA 1C4RA 1EUTA 5C4WA 5EIYB 1AYM1 1PGL1 1QXPA 5CG9A 1ENQA 1UOGA 1NKGA 1L3JA 2RG4A 1V6JA 4UAPA 4Y1YA 3WR0A 3ZXDA 2QQPA 1MZ6A 1YWKA 1GLHA 1A3KA 1URXA 1DIWA 2VBDA 5FYCA 2L9LA 4AQ2A 3HR9A 2BOIA 3WDUA 4D7SA 4R52A 5BYNA 1N3QA 4Q26A 1UKRA 3FFQA 2RM23 1B35A 2ARBA 4MADA 1GQHA 1CPMA 1AL23 2VMEA 4FPEA 4SLIA 2GH2A 4M3CE 5T5PA 2JB8A 1UY4A 3MPPG 3OG2A 4CPBA 3DPRA 2WAAA 3NNJA 4CDWA 4M00A 4NVPA 1LEMA 1XE8A 1LNSA 1GP4A 3OOXA 3JD71 2Y6KA 2GNTA 5BNNB 2MEV3 5JOXA 3K4DA 5KXCA 5CKMA 1CAVA 1YFUA 4WZFA 5J98B 4EZ4A 3DCQA 1C1LA 2VXJA 2XONA 1JYNA 1UW8A 2W91A 1W03A 1W0NA 1W0PA 3VV1A 1VAKA 5LY2A 3TEZA 1H8TB 4QB6A 1JZ2A 4C8DA 4L2NA 4LOTA 1G86A 1TMF1 2RS51 1B09A 5F5QA 4XUTA 4PIXA 4GZ9A 2OS2A 4JCKA 4QPIB 1RUJ3 3CBNA 3I59B 5IK8A 3I2JA 1HRI2 1CIYA 1I6XA 3JQWA 3DV8A 4Z8BA 5LBBA 5J36A 1GNHA 4PHZA 4FTEA 1U12A 4IE6A 3HNMA 5JDBA 2VQ0A 1EAH2 4WM7B 4KWKA 1ZA4A 3WW4A 5EV7A 1QJFA 3NO8A 4D6RA 4IE5A 3WUCA 5F1RA 4R8HA 1W8OA 1OQ1A 1I9RA 2QJVA 2HWF2 4GKXA 1AUYA 2RDNA 2JDMA 3O12A 2VZRA 2A3XA 4Y4YA 5H9RA 4HPKA 1LOEA 1Q8QA 2W9XA 5LA2A 4E2GA 4LT5A 3KVAA 1H6XA 2VMDA 1PZ7A 2WAOA 1S0EA 5ISLA 4FXGB 3ZFFB 3K48A 1LESA 3I3BA 1VBC2 4K20A 1W6MA 2FBEA 2RS12 3NNLA 3N7KA 5FR3A 5I8SA 1MS0A 1LKNA 1RHI1 1F31A 1VAMA 4BMBA 4UFHA 3SCFA 4FP3A 4RFT0 1C1FA 2RMU3 3ZSEA 2ZX2A 4GB32 1AJKA 3VDDA 4G9SB 1AJOA 3ECQA 4NHKA 3A21A 4LMFA 5HCAA 5FCCA 4ES9A 3PTRB 1SLTA 3AXEA 1VRBA 4AVBA 2NN8A 4GB33 2Q8CA 4BM8A 1WW6A 2YU1A 3GGLA 1UIKA 4M0HA 1W8WA 5D21A 5IHRA 3HNYM 2O8OA 3TYJA 2NLRA 1CZSA 2VC9A 3U11A 3E1F1 3PHMA 5LB6A 3EXUA 1LB2A 4MGTA 1TMF3 1HB2A 2ZGPA 4OI0A 1ONAA 1I3HA 4N9HA 3PJQA 3OGJA 2DUQA 2WA4A 3FLRA 4QHOA 2FDIA 2WNVC 3IAPA 4BCUA 2WN2A 2ZHNA 1VBB1 2DF7A 3LOBA 4DIQA 1C5IA 1QJY3 2I45A 2KA3A 3PLQA 1N3OA 2JDAA 4W6XA 5I91A 1WMXA 2GC2A 3WCSA 3SH3A 1VBA2 1Q8PA 5FBJA 4AFDA 3H3ZA 4MGQA 3NNMA 3DYOA 3FWEA 4Q4X2 1LOAA 2CY6A 1FPN1 2ZEYA 1DP0A 4QM8A 3ROUA 3ILNA 4RHV1 4AFCA 4XDPA 5JOYA 1N1VA 3D3AA 3U10A 4YFZA 5CFCA 2R0HA 3H8OA 3C7OA 4MZUA 4JKKA 3ZX7A 3U37A 4ITCA 3NVCA 1QXRA 3H9AA 3E5QA 2I07B 3I2IA 4HANA 1IZ3A 2V5DA 2PTMA 1OD5A 4YPJA 1EYBA 1GANA 1HV1A 3OBTA 4XHBA 5FO8B 4JAAA 3WQ7A 4O9GA 4Q1PA 2ZA9A 5JI7A 1GICA 3POSA 5GZCA 4CEYA 3C7FA 2VVEA 1AR92 3FUQA 5FKBA 3W5MA 1QY4A 2MEV2 5DZEA 2BVVA 3JBG3 1QJU1 1MZFA 2JWPA 4RGKA 2ZEWA 2A75A 5I8YA 2PHFA 1E5IA 4OMDA 4WBBA 5C3QA 2GNDA 5H9QA 3NJYA 3K3OA 3DYMA 4KBBA 4MVTA 3BIEA 4Q0VA 1U5YA 4IQPA 5I0TA 3L2YA 5HBAA 3WP5A 3H3LA 5CFCC 4LKFA 3PMEA 3V0AA 4JC1A 1WCSA 1FYUA 4FFFA 5FY7A 5FPBA 2Y6JA 3TB0A 1ZZ8A 1RUG1 4NN0A 4QB1A 4U36A 1PMJX 4X6QB 4GALA 5IJRA 2WDBA 2UWCA 2VVDA 4IESA 1HXS3 2SLIA 2B9UA 1JTZX 2YU2A 2XVGA 3N9PA 2A7AA 3IBMA 4W6YA 5APAA 5C8CA 4AAXA 1QU0A 4B4QA 4Q1RA 1ZX5A 4MH0E 1IPJA 1LOCA 4LO5B 1PZ8A 5ABJB 2HWE2 1YFXA 2Y6FA 4P14A 4JX0A 4LKDA 1HKDA 1DYPA 3M1HA 3ZSJA 3SQOA 2LM3A 3UKTA 2TEPA 5A6QA 3K2OA 1GQPA 1F8VA 1QOTA 4Y1ZA 4CPBD 2VMGA 3AKPA 3KHCA 5CADA 4YNIA 5EYXA 4I02A 1S0CA 5FP9A 4LHKA 4K8FA 3OPZA 5FZGA 2CSGA 5L7OC 1VRH2 3LWCA 1W6QB 5IFTA 4XCBA 4A7KA 1WD4A 4TYSA 4AAPA 1OPMA 2VJXA 1JU3A 2PAEA 2JG8A 1MZEA 2FQPA 4XACA 4IV1C 4AOCA 1S0IA 3O7OA 3FUOA 3KGLA 2XDVA 4AG4A 2D3RA 4TSVA 2ZMKA 2OPKA 5BPXA 3BB6A 3AL6A 1R1ZA 1GWLA 1YI9A 1VBA3 2NYYA 1ZRRA 2WNOA 3Q8CA 3SKJE 3IIIA 2P17A 4JRAA 4AVAA 1AYN1 1UOJA 2WJSA 1RUJ1 2JD9A 4NPRA 2ZGRA 3I2OA 4OHVA 4NRPA 4PCRA 2ZTNA 2WO1A 5F6KA 4DXSA 2RHPA 3H7JA 1JOJA 2Q8OA 3ACIA 4K9SA 4Y22B 1E5SA 3CDZB 3GNEA 4PQ9A 5L9RA 4MSVA 4YZ1A 2VMCA 2X5IC 3DN7A 5C8CB 1DLLA 1XE7A 4FP2A 1OMIA 2CV6A 4GMP3 4C1XA 3WDWA 5G04L 1R091 5BNQA 3GALA 3WDTA 2B42B 1O4TA 2V4AA
chains in the Genus database with same CATH topology
4YARA 1IGOA 2I2SA 3D4KA 2RR11 1EPZA 4IV3B 1FOD2 1XU2A 1HX6A 2ZHLA 4F8AA 4X8NA 2HWD2 1DZQA 1LHOA 1V6OA 4AI8A 2ZABA 4PDWA 5BNNA 2D6KA 3LA3A 4ISRA 2X8KA 1LRHA 4ONUA 4KGGA 5JIUA 1QJY2 3RDIA 4RS5C 3K51A 2BWCA 4O9EA 3NJZA 3WUDA 3BPZA 3IDEA 1G9AA 4FPYA 1FPN2 4YZ5A 3ENRA 3WD5A 3WQ0A 2VNRA 4KWLA 3SCGA 4FPFA 3QACA 1YHFA 1G7YA 1U5XA 2ETEA 4Z82A 4C0HA 1A78A 3SMHA 3VHOA 3TOJA 2JKBA 2YC0A 3NSTA 4MGZE 3WZ1A 2W08A 1J59A 3VKMA 3PTYA 1W6MB 2ATFA 3MW4A 3X29B 3GHMA 2ZX3A 5JOWA 4JGZC 1MVQA 4FQZA 4CDUC 4EV0A 4E2QA 2VUAA 4EWEA 1NA1C 1X7NA 2VNOA 3ES1A 4AI2A 1KRIA 1BVVA 2OZJA 3BCWA 3JB4C 2B46X 3NAPA 3WG1A 2HWD1 4KG0A 2UYAA 3ALQA 1UU4A 4N90A 3VBUA 4FPLA 1RHI2 4ASMB 1YIFA 4OZXA 3KCYA 1A6CA 1BKZA 1SCRA 2PN5A 2ZACA 3DF0A 3AFKA 5L19A 1LR5A 4CYDA 2WQZC 1YCIA 2PHXA 4FXKB 1IPKA 1EV12 2WFF3 1RVF1 2ZGLA 4XF4A 1Q56A 2JX9A 2ZKNA 3R4SA 5J09A 3S30A 5E1RA 1FV2A 3LA2A 3M8LA 2GAUA 4Q8LA 4M3CF 1JYIA 3ZXFA 2PFWA 4CDQA 1BK1A 2WNUC 3ZIXA 1BVP1 2RR13 4X6RB 1KD7A 4IEYA 4P9JA 4FOYA 3H1YA 2E7QA 1ALYA 2ZZQA 3U4XA 1MVEA 4HZFA 3MLJA 1LTEA 4IEOA 4FOVA 3J26N 2JD4A 1XU1A 5I8TA 4BIFA 4LHNA 1IQAA 1BBT2 4BH9A 1R1A3 2VH9A 2GALA 4HSJA 2O8QA 5A33B 3JZVA 4FCAA 4KGQA 3MF9A 3ZYIB 4A2UA 2HWE1 1HQWA 4YGBA 4CDQC 1FNZA 4DY3A 2ZGQA 1QJU3 4MGKE 1XYPA 1BEV3 2ZBJA 1PGSA 2B7YA 3VBOC 3POWA 5SV8A 1RUF3 3ILFA 1LENA 2D93A 2D7FA 1BEV2 1LGCA 2PLV2 1BMV1 1AYM2 1SLAA 5KHJA 2ZX4A 2F6BA 2D5FA 2XJVA 3MEPA 4HKLA 3VBOB 2IXCA 4U2AA 1WLTA 1GQGA 2EVXA 2NMOA 1AR71 1D4M1 1D4VB 2MEV1 2PYTA 3PVOA 5ABJC 2HWD3 1DHKB 1Y3TA 5K8SA 4IEQA 1O4ZA 4Y5Z0 5ACA2 4RA0A 2HEYF 2DVFA 2TNFA 3ASIA 1JH5A 2C9AA 1QNWA 1MQTB 1RMU2 2OVUA 1FNYA 2ZGMA 2P3KA 1RUD2 4WVVA 1X8MA 2LTNA 2WSVA 4FPCA 1QJX1 1JYCA 4DPNA 4XBQA 1G8WA 4CDXB 1IS4A 1QQP1 1PIV1 3AMHA 3SH5A 5E89A 4AQ6A 1AR83 5LRRA 1JUIA 3ZVXA 3SNMA 4B8EA 1RUH1 1VBA1 2WZR1 3IPVB 4K1ZA 1W6NB 2GH8A 4G4FA 2YROA 2NZ9A 2PQQA 3GBFA 2P3JA 4YLZA 4I0AA 1ZZCA 2R32A 2WS92 3OCPA 4HETA 3VL8A 1ZM1A 3AZWA 2DU0A 3S7IA 1CJPA 2WA3A 2GMEA 2R043 5FBZA 1H8VA 4B7KA 4I3GA 3RWNA 4GWNA 2DCTA 2OUHA 1AHSA 4WM8B 2GMMA 4XFCA 5DUXA 3KGZA 3KT4A 5FQ0A 1H9WA 1ULGA 4GB31 4DY5A 4AI3A 1BBT3 3MPBA 1O3RA 1IKPA 1FXZA 4AGGA 2R061 1PO23 2JEMA 4XQ4A 1SCSA 4XETA 3FX3A 3VBHC 4JRLA 4YVWA 2AR6A 1LECA 3M70A 4CDXA 5C6CA 2WFF2 4N7UA 4MXWA 1YYNA 2H0VA 3ZFGA 5KWRA 1NCQA 4CEWB 1RUF2 1LOFA 4FPHA 2DUPA 1APNA 2WFF1 3UJOA 2YGLA 4RGAA 4AEKA 2XWJB 1Z7S3 4RR3C 1WMEA 4XJUA 2PHLA 2VUJA 3AJZA 3AP9A 2AREA 2HWC3 3SCHA 4PIZA 1CGPA 4KU7A 1DQ0A 2RS52 3L9JT 3GHNA 2PA7A 1O91A 5EZWA 2WINB 4FBFA 1FMD3 2PHTA 2X53S 3KT1A 1YJLA 4XFGA 4ATFA 3MLKA 4WVMA 5DUUA 5HCBA 3VBUB 1B35C 5KHHA 3DPRC 3ZSKA 4COWA 3N4MA 1CD3G 2CL2A 2VXRA 3V0BB 4UXAA 1IS5A 2D6PA 4YM1A 4B4RA 5IT6A 5C33A 4P5HA 3V65A 3ZYRA 5ACA3 1MZ5A 1PK6C 3NV4A 1VIWB 1S1AA 4XTMA 3VZJA 1W39A 2WS93 1S55A 1ND3A 1V6KA 5DDJ3 1AL0G 2EXIA 4BLJA 4IV1B 2IZWA 4F83A 5CB7A 2ERFA 3QLQA 2VMHA 2EALA 3M2MA 3VDDB 1PIV2 4BYYA 1DGWA 5DDJ2 4YZ3A 2Y0OA 1DF0A 5GLVA 5GZEA 4DOUA 1SEFA 1ULCA 5I0RA 2YYOA 3JUUA 4S2GA 4IEZA 2WC2A 4Q29A 3J8F2 2E51A 1FOD3 1D2SA 1RMU3 4TZDA 2XJPA 3URFA 3VLBB 4YVSA 3ACLA 3VZNA 4OULA 1F5FA 5JOZA 3PJYA 2WT2A 3E5UA 3O14A 4IEVA 4QQLA 1JHNA 3MIBA 1OOPB 3GBWA 4YG6A 4TWTA 3IDBB 4GH4B 2H6BA 4P9GA 1H2LA 1ND2A 2QE3A 2Y0IA 3ZPYA 2R16A 2PAKA 3FJSA 3P3PA 2OZ6A 4YW1A 3KZ4C 1HRV3 2BYVE 5CFCB 3C3VA 1O3SA 3SXWA 1BEV1 3OD0A 2EA7A 3V64A 1C8M2 4R4XA 2DV9A 3BOWA 1H4HA 4LLOA 1QJX3 2XG3A 4GH4C 4MXVA 1QOSA 4DRRA 1U5IA 1DZRA 5GZDA 3Q9OA 2RJLA 4DZGA 3PNAA 2TUNA 2A5ZA 1RUE3 2X5IA 5BNPA 5GJ6A 2DCJA 2AENA 4AXOA 3VKNA 2GU9A 3SISA 4CEYB 1FI2A 1GZCA 2DU1A 2WL1A 3M3IA 4JGYB 1LEDA 4JDOA 2PHWA 1SBDA 4PDWC 4UBGA 1POV0 1VB4A 3ATGA 4RHV3 4FT8A 4HMZA 2D98A 1OQEA 5EJ3A 2DCKA 3KM5A 2GC3A 1I5ZA 1HQNA 1IS3A 1AR73 1D4M3 3ZFEA 3AYCA 1UX6A 2XGXA 1Q8SA 2XJRA 4GH4A 4Q4W1 1WMDA 3M7AA 2WWSA 1NOVA 3MIDA 1CONA 4XF3A 4DQAA 3E97A 3INAA 3WNXA 3I54A 1S0JA 2RM22 4S2HA 3FBMA 5DG1A 3VBRC 1RUH3 2WZR3 4YW4A 1RUF1 4XXAA 4XJ8A 1DFQA 1QDCA 2CWSA 5FLIA 3VZMA 1ZBE3 2XL9A 1XRUA 5BNPB 2CNAA 4B29A 1PO11 2O0OA 3IPVA 1Q8OA 2AGSA 1W6NA 4Q4V3 1F9KA 4ES8A 4FAHA 2ZAAA 1H1MA 4IETA 4AHZA 5C9AA 5KC6A 1RUI3 2WQ4A 3MICA 1MS4A 5AC92 2JG9A 2WSUA 4OUSA 4J6GA 2CTVA 2HWC1 4LBMA 4JDMA 4PJYA 2N7GA 1ULFA 3TBDA 3WW3A 4LO4B 5H9PA 5BNOC 2E7AA 2D3SA 4I09A 5K7PA 3FHIB 3H7YA 4FTBA 3HQXA 1FT9A 2ZMLA 4K21A 2XVLA 3B00A 5FQ0B 3AP7A 1PHMA 1N1YA 3WXPA 3ZIWA 1ZBA1 4Q4W3 4NHLA 1RIRA 1R1A1 2P37A 4IEXA 2ZGNA 1DQ5A 1NCQB 4QHBA 3CJIA 1RUH2 2IWGB 2WZR2 3T1LA 4P9XA 4Y24A 4V1PA 2VOWA 4Q4X3 2MPFA 1QQP2 1YRZA 3CLPA 3CL1A 3H1MA 1QJX2 1KDKA 1SQ4A 3USUB 3QH7A 1QJY1 1RJ8A 4H3WA 3MZHA 3KCCA 2RS31 4YW5A 3R0RA 1AR62 3RG0A 3GYDA 1LULA 1H2KA 5L73A 2QVSB 4BLIA 1D2QA 1DQ1A 4GMP0 1AR93 3ILRA 2OW4A 5GZGA 1HV0A 2LALA 5D8AB 4KU8A 5C4WB 2DYCA 4R9BA 1FATA 1GV9A 1ENRA 1FOD1 3S7EA 3WW2A 3B02A 4META 5CIRA 1WMFA 1PO21 1DQ2A 2IXIA 1XNBA 2CWMA 3ZYGA 4WVMB 1Q43A 1J58A 3B94A 1ZZ6A 4QPGA 1AX0A 5GZFA 1JUHA 3V0BA 1EAH3 5BNNC 5KHIA 4G3YC 2Q5TA 3MIGA 4AYUA 5EWSA 4Q4Y2 4YZ2A 4FPJA 1NY71 5AVPA 1AR61 1NE6A 4Q2FA 1W6PB 2A6WA 2G4IA 2XBO2 2BEOA 3WHUA 4N9IA 3VL9A 3MIEA 3FMGA 1QH7A 1OA3A 5I93A 4COVA 1GBGA 2HJIA 3AYEA 4XFAA 5BNPC 5LEJA 4FVVA 2ZAHA 1K5MC 5CFDA 3B69A 1SBFA 3APBA 4AQSA 3RNSA 1POV1 3KT7A 1Q3EA 4LBJA 2QZ2A 1S2BA 3VBFC 4WM7A 1AXKA 1RC6A 1RUC2 1SFYA 4TLFA 3ES4A 1S0FA 3WDXA 1H30A 1QNYA 2YMZA 4MGIE 2OYZA 5FOJB 2DVBA 3BU7A 3OY8A 1VAVA 1QHDA 3CU7A 4BWOA 3NAPB 4CDUA 2BNMA 3JCIA 5JSRA 4CDQB 1UL9A 3NAPC 1W6OB 3D6EA 4NO4A 2ES3A 1UF2C 4KG8A 1PK6B 2XBO3 3C2UA 4LULA 1Y7BA 2ZZJA 4GQ7A 2NM1A 4WV8A 3S6PA 3AKTA 1LGBA 5FMOL 1WLWA 2XKOA 5K0UC 1OA2A 4UW3A 3VBUC 1EV11 3VBRA 4FPOB 3ZXKA 4AHYA 1YNAA 2XLGA 4LE3A 5LRSA 3VBFA 4WM8C 4XFIA 4JGYA 4AGVA 4AI0A 1J3QA 1UMZA 3AP6A 1QKQA 4COZA 3WX5A 4HKOA 1A8DA 1WW7A 2O1QA 3A0KA 2E63A 2WNVB 3N7LA 1N47A 4GWMA 2VY0A 4AEJA 1U0AA 4XOGA 4AWDA 3D8CA 1DQ6A 2DTYA 4AEMA 1OKQA 3IIAA 1DU3D 4I01A 2BVBA 1ZZ7A 2DVAA 3OY8B 1YXWA 1SLIA 5JPNB 1D0HA 2DWRA 3B7MA 3ZFGC 4CP1A 4QU2A 3VKOA 2RMU1 3HIFA 3QH6A 5FAXA 1CAUB 4CDXC 1WUVA 1W6OA 3WLUA 1V6MA 3LGRA 3J9SA 4OHZA 5K0UB 1GKBA 1ZNPA 1UPSA 2YV8A 4I30A 4LO8A 1KJLA 1ZYBA 3LA7A 1HQLA 2A3WA 2ZGTA 1LOFC 1GZ9A 1VBC3 2XBO1 1RUE1 3ZXJA 2BFUS 3MLLA 1QGLA 2VECA 1S0GA 4I0BA 1RINA 4MGYE 4QQOA 5A32A 3AMNA 4WZCA 4Q4Y1 5JAXA 1VBE2 3G7DA 4XE9A 3VBSB 4AFMA 4E4ZA 4M01A 1NE4A 4NOTA 2JDZA 1ENSA 1QH6A 1MR5A 1TME2 4A7ZA 3VKFC 3B3QE 3VBOA 1RHI3 1OHFA 5FO9B 2WZPP 5T52A 2ZGOA 3V0AB 5GM0A 1REFA 1NZCA 2E7TA 2V09A 2OIIA 1HRV2 4K1YA 4IL7A 4EN8B 3OBRA 2UY8A 4RSUA 4L11A 1ZBA3 4LBOA 2G9FA 4HN0A 4P9LA 4Y1XA 2R071 2YHJA 3WP4A 2XJUA 4DS0A 4ISQA 1DGWX 1N1SA 3IDCB 1OSGA 5KHKA 1B35B 3AZYA 4EN0A 4Y1VA 1ZREA 1MACA 4XDQA 4EROA 1A8MA 4QD2A 3POYA 1VBE1 5EXOA 2D40A 2HWF3 4KNCA 1YFWA 3KQRA 4RGGA 5B2GB 4FPGA 5TSWA 2C5DA 4NR1A 3H0OA 4CDWB 1QQP3 1H0BA 2ZKLA 1RUE2 1BXHA 2QDNA 3CJIB 3MW3A 1RUI2 3R05A 1LHWA 3U07A 1FAYA 2P2KA 2PHRA 2C0ZA 1CAVB 2IXHA 3B9IA 4YVSC 2VU9A 5FTTC 4IV3C 3VN4A 1HRI3 2D6MA 1H8TA 5FLJA 3NKGA 1JN2P 2UWAA 5KXBA 1MS3A 5D8AA 2RMU2 5T5LA 5ABJA 3ME2A 3NV2A 4LBQB 2VOKA 1R1A2 5AFBA 3AZZA 5EFUA 4Z92B 1K5MA 4C91A 5FMOS 2K2SA 1ZBA2 1U5ZA 5C8WA 1H1AA 1XYOA 4S2DA 1NCRC 4JVAA 3A4UA 4CTEA 1XNDA 2GC0A 1ULEA 1EPWA 4HK8A 1GSLA 2W68A 4FAGA 1G9CA 3QBQA 5T5OA 1UCXA 1CX4A 3B5LB 4IV3A 4YVWB 5F9TA 2AUYA 3VZOA 3VBHA 2A73B 3OYWB 1YO8A 4E4DX 3ZFGB 1G9BA 3IKWA 2UU8A 3I7DA 4PDWB 2YGMA 4UW6A 5HI0A 3ZSLA 2D6NA 2BNOA 2ET7A 5CBLA 1VALA 2BW8A 4UW5A 5T5JA 3RPQA 1UKGA 2RM21 3O0XA 2K0GA 4AVVA 4UW4A 3ZN6B 2W39A 3DUIA 3KCXA 1H9PA 5A3MA 1PO13 4AFBA 1QXJA 5BNOB 4ZU4A 1MEC2 3GF6A 2V5YA 4AI1A 3THTA 2D43A 3TNQA 1RUOA 1PZ9A 2IFWA 2R062 3R6SA 1SMVA 4XIKA 3S0MA 4Q4W2 4Q0UA 4KWJA 4QGMA 3TRSB 4RL7A 2E6VA 1AXYA 1GFF2 4AF9A 4E4SA 3MIFA 4CZSA 4C1WA 4SBVA 2I74A 2EAAA 3J4UH 4B3NA 2B5HA 3QD6A 2PELA 2Q1ZB 3ZXGA 1ASJ3 1OA4A 1PVC1 1V6LA 1CAXA 2EXHA 2XL7A 3E6BA 4GULA 4LA2A 1PK6A 4LUMA 3VBRB 2AYHA 2MNGA 1MS1A 1VLNA 3AK0A 2VVFA 2JENA 1NY72 1YJKA 4XF0A 1C8M1 3MI8A 3N7MA 4YGCA 1S0DA 5IUQA 3OF1A 4QQPA 3WV6A 1O3TA 3H3UA 4AHXA 2ILMA 4OHXA 2ZOEB 2R6QA 2CAUA 3JBG2 1JXNA 3E5XA 2XVKA 3CEWA 1QMJA 1PO22 3P3NA 3ZYJB 4XJ9A 1G9DA 1MS5A 2QKDA 4LO6B 4ZKTB 5KBFA 1SFNA 1VR3A 1PNFA 2JE9A 4YVSB 2D5HA 4AW7A 1C8NA 2BFUL 4XJZA 3KS7A 1CN1A 1IOAA 1T6GC 1RUD3 3VUOA 3UK9A 3UL2A 4CDWC 5D1IA 5ACA1 1Y43B 3RYRA 1HXS2 4Y20B 1BCXA 1O5UA 4HVOA 4LBQD 1O5LA 2WT0A 4I2OA 2RS32 3D5OA 1KITA 1OI6A 2JE7A 1HW5A 2FZ2A 3AJYA 4BOWA 1X50A 3I4IA 5DDJ1 3EJKA 1LODA 1YFYA 1EAH1 3RMYA 1RUNA 1VBE3 3TWIA 4QQHA 1BJQA 4AGRA 3T2TA 2D3PA 4BQ1A 1QWRA 5DG2A 1AR63 2DCZA 4Y26A 3CJXA 1TMF2 1RUG3 5BXXA 2B39A 4XIOA 3AZXA 4HVRA 5FREA 1WCKA 4X8PA 4Q8KA 2NP0A 1CIWA 2ZHKA 1VRH3 4LBKA 3SHRA 4AQTA 5GLTA 4IERA 5D8AC 2DURA 3WINE 4PIYA 2VMIA 4XJWA 1C28A 1Q5OA 4Q0SA 4XHXA 1WBLA 4NWVA 1MEC3 1BBT1 2ARXA 3AMPA 3M4FA 3RJRA 3WDYA 1COV2 4XFFA 1WLDA 1KQRA 3I8TA 4ATEA 4JQRA 2D6LX 5AC91 1DQ4A 1LHUA 3MYXA 4EN9B 4LE4A 1OFSA 2FMYA 3R4DB 1OLRA 3ZSMA 5C9AB 4OHWA 3VDDC 4PLNA 3LZZA 2XPJA 1XYNA 2R073 5L36A 1NA1B 1UN1A 4ASLA 4CP0A 5CG8A 1QF3A 2AZ5A 5GALA 4M3CB 4BMEA 2P3IA 2E53A 2JJ6A 5EYYA 1PGL2 2FZ1A 4I3PA 3OTFA 4LTAA 4QGNA 1NLRA 1TME3 4Z07A 4LBLA 4YM3A 4EJRA 4OI1A 2BTVC 1TQ5A 4JGZB 4YW3A 3ZMNA 1RITA 1DGRN 2ZGSA 2A3YA 1WW4A 2NQYA 3QCWA 1RTVA 1M4WA 5GKAC 5CVRA 4KQ7A 2Y26A 3FLTA 3M3EA 5BV6A 3LKJA 1K5MB 4MYEA 5I0UA 4XFHA 4BE3A 1LU1A 3LB9A 4DNYA 1LCLA 5IK7A 1OFNA 5A3LA 1VBD2 2JG9C 4BIOA 2YZ4A 4L92A 2BGCA 3PVNA 1V70A 2ZMNA 2R063 2LUWA 3DGTA 5DUVA 3AZVA 3NV3A 5BUVA 1TE1B 2NPIA 2PLV3 2ZCWA 2QUOA 3B93A 3KSCA 3EQEA 4WM8A 1V00A 1EP0A 1CESA 2OA2A 4N7IA 4LEJA 4OFGA 5IK5A 3NKTA 1ASJ2 3PVBB 3O0WA 1RB8G 1X36A 1HIXA 3VBHB 3VZKA 3SLIA 1YLLA 4MX3A 2XJSA 4N43B 4AEDB 1Z78A 3ZDSA 4JGZA 2ZGKA 2XJQA 1OPOA 1SLCA 5JSPA 4W6WA 1E57A 5DZGA 1LGNA 1UU6A 4M0NA 2UWBA 3IWZA 1BQPA 1UPIA 4IXLA 1MS8A 5C8CC 5KXDA 1KDMA 4COYA 1AL21 3AKQA 4WVZA 1XXNA 1AX2A 4HLTA 2GZWA 4R9CA 2R072 4MLOA 1DZTA 5JZGA 3MFCA 4ZU5A 3WQ1A 5FRAA 2VNGA 5GLWA 5JVVA 2DFBA 5L7OB 4QPIC 5IK4A 1BZWA 4UBHA 4QPGB 4FOWA 5CFDB 4FO9A 4AK3A 2PLV1 4PLOA 4YGEA 1UIJA 4D7TA 1AYM3 3JU9A 1TME1 4AVTA 4FQ4A 3AP4A 3UV9A 1V9U3 1W6PA 2IXLA 4LNVA 4YRDA 1AYN3 1KFUL 3KD4A 1JBCA 5E88A 3AX4A 2WLPA 1V9U2 1WA4A 2F4PA 3AB0A 3DL3A 3ZO0B 1RUJ2 4W65A 3H8UA 1DGLA 2E9QA 1KS4A 5A33A 1MS9A 4EWAA 1LU2A 4F3JA 4YSFA 5E8AA 2MHFA 1Z7S1 2VULA 4MV2A 1DBNA 2BNNA 3RRDA 4XILA 3AP5A 3NWKA 1SBEA 2GNMA 3NL1A 4DXZA 2YXSA 3NW4A 4E9KA 1RL3A 1VRH1 3E6DA 1H4GA 1IHMA 2JXAA 2V73A 4Y20A 5CFDC 4QXKA 2EF6A 2Z5WA 1YUDA 4PBOA 5CU1A 3WOGA 1QOOA 2H6CA 4N43C 3UJQA 4AEDC 1F2NA 5KC5A 4XZPA 1LHNA 5FDBA 4XTPA 2R042 1PGW1 1AXZA 3W59A 1H8TC 2CGNA 1REEA 4QMAA 2HEVF 2VW2A 3DPRB 1NYWA 2K9ZA 4CP2A 2QNKA 2GSYA 2ET1A 1UZZA 3LCPA 1TNFA 2BWAA 4OLLA 2CAVA 5JR7B 4LBNA 3VBFB 3ZXEA 4RD7A 1AR82 4IEPA 5J96B 1CAUA 1ZBE1 3MW2A 4J1XA 1RVF2 3PMSA 4K7JA 1WW5A 3KB5A 4JGYC 2R0FA 5K0UA 2GN7A 3FC0A 4INDA 4Q0PA 4H7MA 3TN91 1AF9A 1FPN3 1NCRA 3ZFEC 1DDLA 4QPYA 2QZ3A 1AR91 4LUKA 4QGLA 2VGDA 2XKPA 2Q1MA 1YIPA 1C3HA 4QX5A 3M3CA 3GZTB 5J7MA 1VBD3 3HWJA 4P9IA 3AM2A 2Y38A 2XLAA 2GMPA 2ZPXA 1NA1A 1ZZ9A 2VOVA 3HT2A 3EO6A 3M3QA 2XHKA 1RUC1 4B7EA 2WFPA 3D0JA 2HWE3 4L99A 2GN3A 2VOXA 3U0ZA 2WIIB 1FX5A 5LEKA 1LHVA 1XNCA 4XEZA 2WS91 4M3CA 3B9CA 4CEWC 5T55A 1H1IA 1PMIA 4XBNA 4XJAA 4HFSA 3ZFFA 5KHGA 5LK5A 3ETQA 1G6NA 3ZFEB 4Q4X1 4XMAA 2B8MA 2W52A 1CAWB 3AYAA 2YPJA 4IEWA 5T3NA 4Q4V1 2D97A 5C9AC 3O5SA 3QOPA 5JIAA 4ORFA 4R4ZA 1TEIA 1RUI1 2DFCA 5C4WC 3D0SA 1NLSA 1UD1A 2B45X 2Q30A 5JPMB 3PVEA 1C8M3 4D7YA 2BUKA 1ND3C 1RMU1 3W58A 1Z0HA 3BOPA 4FTSA 1D0GA 2KXLA 4CEYC 3FFZA 2WNUA 4JV4A 2JICA 1R081 3WP3A 1QJZA 3TN93 4D69A 5FPZA 4CEWA 5JWPA 4P9YA 3IM0A 5HCFA 4ZXKA 1AZDA 1VJ2A 2RE9A 4LHLA 2WNEA 4HVQA 1AX1A 1J3RA 2VG9A 1R092 2BQPA 5AVAA 1HRV1 1NCQC 2A71A 4URTA 1RGSA 1SACA 3SITA 1CVNA 2A6YA 2RR12 3AFGA 3CJIC 1AR81 3FLPA 3J8F3 1F5JA 2RS11 4LBQA 5JCTA 1VBC1 1BMV2 1GYKA 4BA6A 1OQDA 3O0VA 4LO7A 2RS53 3EBRA 5I0SA 3MGUA 1MQTC 3WDVA 2UYBA 3RS6A 3HD8B 1GR3A 1KS5A 2DVDA 2HWF1 1OOPC 4PF5A 1O4YA 4RS5B 3BODA 3AMQA 1HLCA 2YY1A 4XQWA 5DUWA 1CJDA 3UKVA 1LOGA 1EV13 1PGW2 4LR4A 5DZFA 1ND2B 1AYN2 3ZYPA 3E6CC 2ZGUA 5LK7B 2Z69A 5HXVA 2Z79A 1COV3 3WG2A 4ZU7A 4FSJA 4BHPA 1PVXA 2CGOA 5FLHA 4F7ZA 4YG3A 1R093 5JZGB 1POV3 3GBGA 4H14A 1J1LA 4IV1A 5L7OA 3USUA 1CQ9A 2D6OX 3BALA 4QPGC 2X5IB 1BYHA 1HDKA 4KH9A 2JG8C 1REDA 4L8QA 2JECA 2GNBA 5T50A 3ZN6A 5FFOC 1O3QA 4P9WA 1ZZBA 2Z2SB 1YI7A 4E27A 2HWC2 4OVEA 4EWDA 1CPNA 1V9U1 2HKXA 3D82A 1UZYA 4N53B 3WHTA 2KM2A 5H9SA 2XH6A 2R49A 1KFXL 3EHKA 3OYWA 5FO7B 1WGPA 5KXEA 3WVJA 4E2SA 1S0BA 4IEUA 4L9BA 4JDNA 1PO12 1OLQA 3BIWE 4OI2A 1DYKA 3MF6A 1RUG2 2RJKA 4Y22A 5J37A 3ELNA 1QJU2 4C0BA 4XF9A 2IFRA 3HAGA 5DXDA 3RSJA 3HN1A 1W6QA 4QT6A 2OUJA 5T54A 3KMHA 3CF6E 3G6JB 4B4PA 3USSA 1CAXB 5FOBB 4RR3B 1FMD1 1ND2C 3WT3A 4I0WB 1N3PA 4XMIA 3NV1A 2A6ZA 3RI9A 1GNZA 3IMNA 3WY6A 4XFBA 2ZX1A 1CR7A 1R082 2GC1A 5A32B 1LOBA 3JD73 3CO2A 4Z2WA 4L97A 3OD4A 2EXKA 1M06G 1KXGA 5JI9A 1GZWB 2FMDA 3SH4A 3FE5A 3RI8A 2JG9B 1NXMA 3MDPA 2R1DA 4Q4V2 1NXD1 2HEWF 1VBB2 4YVWC 2VW0A 3ZFFC 2NMNA 3L2HA 1QDOA 4A3XA 3N36A 1X33A 2ZS6B 3ZN5A 2SBAA 3ZXAC 2IC1A 4Q4Y3 4RQPC 4HN1A 4H7LA 1WBFA 1NCRB 3R4UA 4AFAA 5BY5A 3IT8A 2XWBB 3ZXLA 4RR3A 3ST7A 2AH2A 2PHDA 4D3WA 1O7FA 1V6IA 1VBD1 3AKRA 4WVWA 3JB8A 2HWB3 4HSLA 4GA9A 1Q8VA 3TN92 4DINB 2P34A 2PAMA 2BPA2 1SLBA 4XW3A 3B01A 4AVCA 3MFAA 2VPVA 2HWB2 5GLZA 2YDEA 1ZBE2 3I59A 4HBNA 4FOQA 3ZN4A 1RUC3 3WG4A 4YG0A 3I2DA 5JMCA 3MIHA 1CAWA 4C90A 3J8F1 1UAIA 4OHYA 4XYXA 3VKLA 3WP6A 1C57A 1NG0A 2EXJA 4YYOA 3HT1A 2A6VA 2WT1A 1MQTA 1J3PA 5GLUA 4J1WA 5K9YA 4NWWA 3UKNA 1VP6A 2VQAA 2R041 2WKKA 1OOPA 2CYFA 4HPKB 5CNAA 2DTWA 4YGDA 1TNRA 4PLMA 4R9DA 3AYDA 1HRI1 2WNUB 1R083 1S2KA 4XXPA 2W0XA 5F6LB 2PHUA 4KL1A 4AVSA 1ZRFA 1COV1 4GMP1 3TAYA 1WD3A 1PNGA 3VHNA 4OI4A 3LAGA 3JQXA 2TBVA 3VBSA 4DB5A 2CGPA 1SLLA 3AKSA 4FPKA