1S2KA

Structure of scp-b a member of the eqolisin family of peptidases in a complex with a tripeptide ala-ile-his
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
206
structure length
199
Chain Sequence
b'TVESNWGGAILIGSDFDTVSATANVPSASGGSSAAGTAWVGIDGDTCQTAILQTGFDWYGDGTYDAWYEWEVSITISEGDSIQMSVTATSDTSGSATLENLTTGQKVSKSFSNESSGSLCRTNAEFIIEDFEECNSNGSDCEFVPFASFSPAVEFTDCSVTSDGESVSLDDAQITQVIINNQDVTDCSVSGTTVSCSYV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Scytalidopepsin B
publication title The molecular structure and catalytic mechanism of a novel carboxyl peptidase from Scytalidium lignicolum
pubmed doi rcsb
source organism Scytalidium lignicola
molecule tags Hydrolase
total genus 44
structure length 199
sequence length 206
ec nomenclature ec 3.4.23.32: Scytalidopepsin B.
pdb deposition date 2004-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01828 Peptidase_A4 Peptidase A4 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.700 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1s2kA00
2IFWA 1S2KA 2IFRA 1S2BA 3TRSB 1Y43B
chains in the Genus database with same CATH superfamily
4CP9A 3WP5A 1RL3A 4Y22A 3J8F3 1S0EA 1W8FA 2ZZQA 2D97A 2A73B 3B93A 2CY6A 3VD3A 1UIJA 2FDKA 1XOYA 2IFWA 2VH9A 3EJKA 3WHUA 3VZNA 1LHVA 2ZX4A 3RZLA 4HN0A 3LKJA 5A33A 3MF6A 4A3ZA 1FAYA 1ZA7A 1KFXL 1N1SA 4B7EA 2GAUA 4CCJA 5C9AC 4BXSV 1QQP3 2BGPA 3B01A 1B35B 3THPA 1IG0A 4CCEA 4OCTA 3GZTB 1KDKA 2VNRA 3AYEA 4YGDA 2TUNA 2R072 2VZ3A 1OA4A 3LDBA 1GP6A 1XYNA 1PGL1 1OQDA 4LQRA 5FYUA 2V73A 4YVWA 3HNMA 5FP7A 1XU2A 4ARYA 2C24A 3ZFFC 4CYDA 1NUKA 5HV4A 3HNBM 2QQWA 1MS0A 1JZ7A 3PLQA 3ALQA 4G3YC 4BWOA 1PNGA 4LE4A 4FFHA 1FPN1 1WMFA 5BNPA 4QX2A 4C1WA 2HWD1 2FMDA 3VDDA 3BB6A 3WD5A 5I8SA 5A7OA 2ZX3A 4B4QA 5JMOA 1AR83 1W6PA 3ZSEA 2PHWA 4E8CA 3V0BB 1BVP1 1OURA 1MQTB 4K3UA 5IK5A 1ULCA 1VBD1 5APAA 2PTMA 4GH4A 2WNVB 4DY3A 2SLIA 2AEZA 1XQNA 4J1XA 2ET7A 2WNOA 1ZVFA 2H6BA 1B09A 2EXIA 4OI2A 4XTPA 5FKCA 3VD5A 2I2SA 4C91A 3VZJA 4AOCA 2RDSA 3VKLA 3BU0A 2C9KA 2WINB 3WUDA 5CZKA 4R9AA 5DG1A 1XNTA 1JI6A 2HWF3 5T5OA 1VMJA 4XBQA 4B3NA 3BUCA 5ACA3 2DUOA 4GMP0 1LEDA 2RMU1 3FFZA 4CDWC 3WR0A 4BQ4A 1AYM3 1SLBA 4LBNA 2XUMA 1PK6A 1I5PA 3ATGA 5DAQA 3T2TA 3TEYA 3OPZA 4Y1XA 1H6XA 2KR2A 2JG8C 2XB6C 4IQPA 2D5FA 1UOBA 5F3CA 1QJZA 2EA7A 4P9LA 2NLRA 1FPN2 4ATEA 4YFZA 3UYJA 4FAGA 2HWD2 5FYZA 1J1LA 1SMVA 4Y1ZA 1JYCA 1UN1A 2B46X 3J26N 3VDAA 1W3VA 4JCKA 4AI2A 3U0ZA 1VBD2 1W0NA 1JXNA 2EIDA 1GWKA 4TLFA 1DLLA 5CA6A 1SDDB 5CFDB 5FOJB 5IVJA 4UBHA 1AX2A 1N1TA 2J1TA 1XNCA 5EXOA 1SCRA 4DUVA 3N9QA 1ZRCA 2WSVA 3ACLA 3FX3A 4YRDA 2Q4SA 4IERA 1QXRA 4HK9A 3RDIA 4BOWA 4TSVA 1QH6A 4XBLA 2Y64A 1C57A 2D93A 5A7SA 5FY9A 2RMU2 1KJRA 1SLLA 1H0BA 5FZKA 5LZ6A 3ECQA 3WF1A 1ZREA 2JG9B 1EUTA 1UMHA 3FBYA 2HWE3 2E26A 3GCXA 3OEBA 3WT3A 4IEQA 3CZUA 5A7WA 4IW3A 2EXKA 2NMNA 4CCLA 4CDQA 3DUIA 1IKQA 1ND2B 3AYAA 3O0WA 2DVGA 2XGXA 4QQOA 1JYWA 5F3IA 5IATA 2BP6A 3ZYIB 1SBDA 5FBZA 5LY1A 5CAZA 1KITA 3MZHA 1FNYA 2TEPA 2R061 3PTRB 4AWDA 4AI8A 4UFMA 4OI1A 1DP0A 5C71A 2R043 2JICA 4BQYA 3PHMA 3ZFEA 5IAVA 4XZUG 2QTWB 4LORA 1RGSA 3K3NA 4I02A 1KS4A 3OJBA 4WM7A 1LOFC 2YDEA 1KRIA 1QJEA 4XABA 2QQIA 3UGHA 3H9AA 4FQ4A 3QCWA 1HXS3 3WP4A 1R093 3RPQA 1ND3B 4XW3A 4EWEA 2LTNA 1CIWA 2BGCA 2VOKA 4LUKA 2ZEXA 1H2MA 4LUMA 4FOVA 4N43B 3MIBA 2HWB1 4COYA 3P1IA 2XQRA 4EN8B 4Z1VA 1ZBE3 4E2GA 5A3TA 4ZHNA 1KJLA 3I3EA 2RG4A 2WQZC 3MI8A 4YM2A 4YG3A 4CU7A 1R64A 2R062 3DPRC 4A4AA 5JSRA 2DVDA 1SPPB 4QMAA 3T2QA 3W20A 4AI1A 3JD73 5DDJ3 2HYXA 3LZZA 5GLZA 4XFBA 1DGWX 4PJYA 1NE6A 2A70A 2XJRA 2C4XA 2J1AA 4E4HA 3USUA 1R1A1 1SLAA 1OA3A 3K48A 2GN7A 1Y43B 2PFWA 2VL4A 4UW5A 3FHQA 4Y20A 1QIQA 2Q1FA 4XDOA 1G9AA 1EP0A 1W8WA 4Q0VA 4JKMA 4XE9A 5FPXA 3O1RA 1U5YA 4BQ3A 3AZVA 2Y60A 4IV1B 2WNUB 3I2FA 2E63A 1QOOA 1UY1A 3J7HA 4KNCA 5DUUA 5JIAA 3VZMA 2OX0A 1W99A 5F32A 1N47A 3IPVA 5FMCA 5JSOA 4XUTA 1UYXA 5FP9A 1WBFA 4FTEA 2BOIA 5K0UB 1D4M1 2HWB2 1Q8QA 3FZ3A 2WQ8A 4F8AA 1Q56A 1Q8PA 3FLPA 2EIBA 5LA1A 1Y4WA 5GLWA 5L7OB 2AH2A 4YVWC 1UOGA 5FYBA 4AEJA 2VTFA 1YFWA 3LSDA 4NE9A 4XHXA 1J83A 4IV3A 2RDRA 3WF3A 3WNLA 4IEOA 1HRI1 3W21A 3DCQA 5F3EA 5JI7A 4XMIA 4XIKA 3VKFC 1FOD1 3PUQA 2BNNA 2W1UA 1DDLA 4A44A 3UGGA 5FXVA 1JU4A 1R1A2 3PU8A 4COZA 1VE0A 3E5XA 1GQHA 5FV3A 5FPBA 3LF7A 5BNPC 1LJ7A 4P9XA 5KHHA 1O3RA 2Q5TA 2WRAA 1RUD3 3AKTA 4HL0A 5HCBA 3T1LA 2ZHMA 3M2MA 1ASJ3 1GYKA 1B35A 3AFKA 4ZXKA 3KCYA 5AC91 2WWSA 5F5IA 3SCGA 5FMOS 1CAXB 2VBBA 1XSRA 4FBFA 5FR3A 2CYFA 1OSGA 1BK1A 2VULA 4KWUA 4RQPC 3SITA 4CU6A 3T09A 4P9IA 2VW2A 1D4M2 2C5DA 2XG3A 4FQZA 1XE8A 3N9LA 4I3GA 3B94A 3HQRA 5FP3A 3ZN6B 3DKWA 4D94A 4YZ1A 3NJXA 4NIHA 3ZSMA 4KWLA 1RUH1 1JHJA 4UYBA 1MS3A 1RITA 5FCCA 3LFIA 1VB4A 4RHV1 4R9CA 3SKJE 1NCRB 5EJ1B 2KD7A 4Q4X3 3ITQA 1HRI2 1PVC3 3CL1A 5FPZA 4CCNA 1C4RA 4H2AA 1UU5A 1ZZ6A 2ADDA 1RJ8A 5L9RA 1NA1B 1UMIA 4UF0B 3NV3A 1PM7A 1FMD3 1LHNA 2KA3A 1GWMA 2RJ2A 4XOGA 4DFSA 1WLTA 4KU7A 1VRH1 2XBO1 4FTBA 4XJ8A 2WAOA 5JUVA 1VPHA 3I59B 5C4WB 3KS7A 4IGOA 4ORFA 3KVBA 3RJRA 1EPWA 2WNVA 3ZX7A 4OYUA 3ZYFA 5AC92 1UAIA 4CTEA 3LA7A 2V5DA 1H4HA 1QWRA 4IE4A 4OULA 1XE7A 3WF4A 1IS5A 1SHWB 1V9U3 2Y6FA 3VL8A 1UZWA 4DS0A 4LHNA 4PIZA 4WM8A 2VMCA 4LA3A 5E1RA 5T5PA 1V6NA 1H9PA 1MR5A 3D8CA 1PX3A 1REFA 4YW6A 5FZAA 5LATA 1TMF3 1RUH2 3I54A 5KHKA 3R0RA 3EB7A 2NQYA 4CSWA 4OZOA 4BQ5A 4RHV2 4FFGA 4RFT0 3AZXA 4BQ1A 3O1PA 3POJA 3HMYA 3A22A 2YHJA 5DG2A 1LNSA 5FYIA 5KXEA 1HRV1 4LBJA 4S2GA 5CG8A 2E33A 1G9CA 3I7DA 5A80A 2W5FA 4FVVA 5DPNA 1VRH2 2XBO2 1LECA 3THCA 5IVBA 3HT2A 1VBB1 4Z92B 1ZZBA 1BHGA 5CEHA 3OGRA 1OHFA 1XNDA 2LRPA 2WUHA 1GFF2 3D5OA 1QU0A 1NLRA 3LFMA 4FCAA 3VBUB 4MGTA 2FMYA 3C7GA 1HB3A 4QM9A 1WWYA 3JB8A 1S1AA 1UNBA 1JYTA 1OPOA 3NJYA 5IYYA 3VBRB 4FOQA 1S0IA 1DU3D 3KMHA 2VW1A 3ZFGB 5BUVA 1BBT1 1SG3A 3ZFEC 5FZ6A 3ZMOA 1VR3A 4G4FA 5T50A 3VD9A 1XNAA 4P5YA 4DXZA 3AL5A 4UWDA 4MX3A 1BCXA 4HG6B 4WM7C 5FZCA 3T08A 4QPIB 4AVSA 2B8MA 3OGSA 1QJX3 1RINA 2DCKA 4QXKA 1HRV2 1QJU1 3M3CA 2Y0IA 3PVNA 1OOPA 2JDUA 4BIOA 4KGGA 2VZSA 3U78A 2E7QA 1XBFA 4UW4A 3ZDSA 3JBG1 5FK7A 5DUWA 1WLDA 1CJPA 1T2XA 3SISA 1VBB2 3POGA 3UKNA 4LO5B 2XVGA 2ZHLA 5I0SA 4JTOA 4NR1A 3ZYRA 5A6XA 5FRAA 3ZYBA 1WCQA 2JDHA 4YZ4A 2RR11 4CA9A 1UY3A 5HXMA 2P3KA 1W9YA 3LOBA 4LPLA 2CNAA 2CSGA 3ZVXA 3Q8FA 1AR71 1GU3A 3I49A 1BBT2 4AXOA 3C7OA 4QU2A 2VOWA 4A7KA 1Z0HA 4XUNA 2QNKA 4Q1RA 1S0DA 4JDNA 4FPEA 4YG6A 3V0AB 4BZ4A 5GZFA 4I0WB 2GZWA 4GWMA 5GALA 4RS5B 3R6SA 1ND3A 3AZYA 3H8OA 4EWDA 3BOWA 1LKNA 4FTSA 2YU2A 3N7LA 1MEC1 1OVPA 3ELNA 4I0BA 4XJZA 1QJU2 3EQEA 2ZEZA 4QHOA 1UY0A 5LY2A 1WGPA 1U0AA 1UWWA 1WMXA 2ZGQA 5J37A 3ZYGA 5K7PA 1TME1 3JBG2 1PGSA 1RYYA 4YYOA 3KQRA 1NOVA 1AYN3 2WZR2 1CZTA 1MZ5A 2K9ZA 5FZHA 2D7FA 5A6ZA 2ORXA 4Y5SA 1HW5A 3PVOA 3MO4A 4XAEA 4XFGA 3ZPYA 3UV9A 2LROA 3ZOIA 1DQ4A 3U14A 1DZTA 1V6LA 4YVSB 2R32A 4IV3C 2RR12 2ZBJA 2FDFA 5FWEA 2BDRA 4CEWA 4QHBA 5CKQA 1AR72 1NY71 3ZLIA 3POIA 2QQKA 4NIIA 3M70A 3QD6A 4XQ4A 1IGOA 3T0BA 5FWJA 2CU5A 2CGOA 3NNMA 4LE3A 2JDKA 1R1ZA 1UX6A 2HJIA 4J6GA 4QPYA 4AFMA 1V6OA 4CCMA 2O14A 4W65A 4PBPA 3MF9A 4IV1A 4DRVA 2W52A 2WNUA 3MPBA 4YW5A 1B35C 2N7GA 4BU2A 5EJ3A 4XUOA 1LGBA 3TWIA 4GB31 1MEC2 5K0UA 4Y22B 1OBNA 2A5ZA 2OA2A 1MS9A 3VBHA 1TME2 4CDUA 1ZRFA 3MFCA 4OI0A 4JKKA 1L3JA 1DQ2A 1A3KA 2OIIA 2XXZA 3WDWA 3NRUA 1M06G 4GKXA 1JS9A 2EICA 2BERA 1EAH3 1O59A 1WW4A 1RVF1 2GMMA 1WBLA 1JOPA 1S0GA 3GYDA 1AR63 2GC1A 2VPVA 3A4UA 2X09A 2Q8DA 3VBOB 4EYUA 1GLHA 3KV9A 5FMOL 5A7QA 1TEIA 2W46A 3H7JA 4UFHA 1W6NB 1NY72 4ASLA 2IXIA 2QFEA 4Z2AA 1DZRA 5B4NA 2AGSA 2W08A 4IE0A 1MQTC 3WDUA 4JDMA 3E1F1 1RUF1 2D44A 1I1EA 2BBVA 4WZCA 2WNVC 3HR9A 1CAXA 2BNOA 4IEPA 4OUMA 5I93A 3CKHA 4LO6B 1FPN3 1N3QA 4PIXA 1NZIA 4CE8A 5BYNA 3POEA 1GUIA 3C8XA 4GB32 4XBNA 2DCZA 3DKQA 3T2PA 2K0GA 3WP3A 1LCLA 1TE1B 5GZCA 1Y9GA 2OXBA 5E8AA 1VBD3 1SLIA 3VDDB 4NIAA 4HSJA 4HZFA 1W6PB 1TNFA 4QQLA 4HOOA 2J1UA 4MUVA 5FZ0A 4GH4B 1RVF2 3FHIB 1C1FA 1NA1A 4UF0A 5C70A 1W9WA 4XILA 4AVTA 1OF3A 5E16A 3J7NA 4FP2A 4L8QA 5I0UA 3UK9A 3RZMA 5A70A 4AGGA 1VAMA 2LS6A 2XWJB 4AI0A 1CQ9A 1V6IA 2ERFA 3I59A 5C4WA 1AZDA 3ETQA 3QBQA 2W87A 4JRAA 1ZRDA 2CDPA 1ZX5A 2K46A 1BK0A 3SC7X 4DNYA 1RUF2 4N53A 1HB4A 5CFDC 3OUJA 3MBWA 3PVBB 1PK6B 3Q8BA 1VAVA 1W8HA 2VZUA 3LB9A 4QX5A 4YARA 5J09A 2HWC3 1LRHA 1UKRA 2D3SA 4D6RA 4M3CF 1F35A 4FXKB 1OPMA 4LO8A 1S2EA 4LBQB 4QXCA 2DF7A 3LGRA 5B4XA 1D2SA 2VMFA 1VJ2A 5IK4A 1DGWA 2IXLA 2JG9C 2QJVA 4QX7A 5JPMB 2B39A 3B7MA 4RR3B 2MEV1 2WFF1 2ZOEB 1ND2C 4NIGA 1F5JA 2ZEWA 3AYDA 3M4FA 2QQPA 3VGIA 3ILFA 1F15A 1W03A 3NQHA 2ZX2A 3NNJA 4QQHA 3AJYA 4CDXB 5EIYB 2DCTA 3VBUA 5JOXA 4H55A 1Z78A 4UFJA 5FK8A 2BZDA 2HH9A 3O14A 1W6OB 3VV1A 1RUJ1 1W3XA 2RJLA 2RJKA 1O8PA 4AEDA 4M4PA 4FSJA 1YQ5A 2PLV1 2J22A 2Y6KA 1U5IA 1YJLA 2Y38A 3ZFGA 1VAKA 4JHZA 5A7WB 1HB2A 1OFSA 3RSJA 4CDQB 3GBWA 5D2AA 4LT5A 2VZRA 4Q29A 3K77A 2DURA 4BH9A 5C8WA 1OUXA 5LASA 2LW8A 2R063 3WW1A 1X7NA 2VZTA 5BNQA 3B3QE 2WIIB 4V2VA 3PDQA 4FP3A 4AGRA 3ZR5A 1W90A 1FYUA 2A3YA 3AMPA 3QH7A 3T2OA 1NLSA 2JIGA 1ND3C 2TNFA 3U4SA 3MIHA 1DG6A 2MEV2 1K12A 1ZYBA 2P4EA 2WFF2 4H3WA 1GZ9A 4LBMA 4N43C 1O4TA 5LA2A 5HPOA 3IMNA 5E88A 4ZZ5A 1DLCA 1DQ5A 3O1OA 1JBCA 3FBMA 2CDOA 3PUIA 5AVAA 2QCSB 3HBZA 1RMU1 5A6QA 5FDBA 3NAPA 4HKLA 1RUJ2 2ENRA 3PUHA 4IDZA 4RD7A 4NIDA 1W0OA 5EJZB 5K8SA 5FY8A 2YYOA 3VZKA 3GBFA 2YFUA 2JE8A 4RL7A 4E27A 5JI9A 1CZSA 2D6PA 2MHFA 5FLHA 2AENA 3J9SA 5FIXA 4KU8A 4L11A 3AMHA 3VLBB 3VKMA 4M00A 5A1FA 5AFEA 4DOUA 3ACGA 4LHLA 2A75A 4IV1C 4LBKA 1UW8A 2WNUC 4NHMA 3HQXA 4JRLA 4NROA 4NWWA 1WLCA 5FYVA 3SQOA 4O7XA 2JDNA 3HPNA 5K0UC 1C3HA 1LULA 2W91A 5DQ0A 2JE7A 4DPNA 3DXTA 5BPXA 5C8CB 4F83A 5C3PA 5L7OC 1RUI1 3RFRA 5FYCA 2BFUL 5ACA1 1RMU2 1ZBA1 2VXRA 4UFIA 2RV9A 4YVSA 1W28A 3F2ZA 1XJAA 4DUWA 1R083 2A3XA 4WVWA 1PMJX 2NZ9A 3O5SA 3RYPA 2WDBA 2IXCA 5AVPA 4MO3M 2WN2A 1MS8A 3IPVB 3POFA 5LBFA 2WAAA 3INAA 1LR5A 4DINB 4LBOA 2TBVA 4Q2FA 1OC1A 3M8LA 4P02B 2Q1MA 5A3LA 1EV13 3FL7A 1G9DA 3H7YA 1LB2A 4LBQD 1BQPA 5FPAA 4AI9A 4XVHA 3WDXA 4EN7B 1H9WA 5T5LA 1NLQA 4D0QA 2GMPA 3H8RA 3PMSA 1FOD3 3OEAA 3SH5A 3WZ1A 1FATA 1XSQA 4A41A 4CVUA 5FXXA 1AXYA 2YXSA 3ZM8A 1G9BA 2VOXA 4NJ4A 3SNMA 2WYSA 3DGTA 1QY4A 2FDHA 5DN2A 5F6LB 4JVAA 4DEVA 4LKSA 1RUI2 2QQNA 4HK8A 5ACA2 1ZBA2 4E2SA 5LA0A 4NAOA 3RMYA 1NCRC 1E57A 3S7EA 1FXZA 3VBOA 2WA4A 1W6NA 3HN1A 1NA1C 4NO4A 4YW2A 4L99A 4Q4W1 3WQ7A 1RUH3 2ARCA 1N1YA 2AC1A 4GWJA 3VL9A 2XKPA 5IFPA 3RZHA 1Z7S3 3RI8A 4XUPA 4IEXA 1MVEA 5H9SA 4KG0A 3USSA 1LGNA 1GV9A 1OF4A 2ET1A 3MICA 3NO8A 1SCSA 5LRSA 4A6OA 1AUYA 3UESA 2GN3A 1QF3A 1GZWB 4PLOA 2G9GA 3AP9A 4OI4A 5F5QA 5FYSA 1VRH3 2FCVA 3NNFA 1WMDA 4MGSA 3WDVA 4IEWA 2Q1ZB 1VBE2 3AXEA 1GBGA 4ZS2A 4Z2WA 5CNAA 1V6MA 1VBC3 3V64A 4COUA 2GC2A 1KGYA 3POSA 4GQ7A 3N4MA 1H30A 2XJPA 3BODA 3E6BA 3FLTA 4MGKE 1BLZA 3L2YA 3WINE 1BEV3 1Q8VA 4JGYB 2Y6GA 4PT6A 3CU7A 1POQA 1YRZA 3A0NA 1A34A 2BWAA 2XOMA 1RUG2 5FZ1A 4MXVA 2QE3A 3KSCA 1X36A 5FZGA 1VBA3 2A6XA 4I01A 4Q4W2 1J59A 3VZOA 4B8EA 4WM8B 5GZGA 3NL1A 3ZXKA 1WZXA 2BTVC 2P2KA 2IXKA 4FPHA 5FP8A 1GWLA 4ASMB 5C3OA 3VBUC 1CVNA 2EXJA 4LEJA 4Q0SA 5FZMA 3HIFA 1UZVA 2WKKA 2ZMNA 3VBRC 1SACA 2G19A 2VMDA 3AXDA 4S2HA 3LIHA 4PCRA 2ZAHA 3M1HA 1VBB3 3ZFGC 4E4SA 2JD4A 2W9XA 4Z82A 4LBQA 1AXZA 3KCXA 2E6VA 3LAGA 4IEUA 1GNZA 1LOBA 1F9KA 2XJQA 2VNVA 4B29A 3LCPA 1D0HA 4XFFA 2OYZA 1HB1A 5LCWL 5DMYA 3E97A 4QPIC 4NHYA 3TBDA 1G8WA 3VN4A 4HONA 2RS31 4FOYA 1UYZA 5FZ4A 5GLUA 4RR3A 3WW2A 2X29A 3I2JA 4QGLA 2R1DA 1DGLA 2D3PA 3CLPA 3ZIWA 4WVVA 2VZ1A 3D6EA 2D3RA 3I8TA 1OLME 2G9FA 4I30A 2B5HA 3OOXA 1RUC2 3Q8AA 4CDXA 1DBNA 1G86A 2JX9A 3I2GA 3KT4A 2FHRA 4L9BA 2B9UA 5J98B 1VIWB 3WV6A 2DUQA 2JDAA 5H9RA 1W6OA 5EPAA 1ZZCA 4P9JA 4K40A 4XDQA 1LEMA 3ZXJA 4XMAA 5FO8B 2BVBA 1YO8A 2ZGRA 2P6CA 4NUBA 4AZZA 5J48A 5JZGB 2ZTNA 1NCQB 1IPKA 1ULPA 3JBG3 1JUHA 4BIFA 4M0HA 5IVCA 3RZJA 1OOPB 3P6BA 1PIV2 1NE4A 3G7DA 3S57A 1GQGA 1UYPA 1ACCA 2FBEA 4A45A 3VBSB 5KXDA 1AHSA 4PLMA 3IDCB 1VP6A 4FPKA 3SMHA 1RHI3 2RS32 2XKOA 3IN9A 3OBTA 4RS5C 4XIOA 4D3WA 1DFQA 3SH3A 1AR73 1J3RA 1GANA 2X8KA 2DYCA 2AEYA 4V2WA 2EAAA 2UYBA 4XETA 4LBLA 1VMHA 2MPFA 3FUOA 3KB5A 4XJAA 4LO7A 3H1YA 1UZZA 4HETA 1IQAA 4MGYE 2ID4A 1OFNA 5IT6A 3WY6A 1W9TA 4X6QB 4ZS3A 4BJ0A 4D7TA 1JW6A 2QZ3A 1MEC3 3K2OA 4IUGA 5FZ7A 4YVSC 3WNXA 4XF3A 4BPZA 5ABJB 2RDQA 1W6QB 2A3WA 2WS91 2WLQA 1YLLA 2XVLA 5EWSA 4FAHA 1I3HA 4CU8A 2JXAA 4PIYA 3M3EA 3UGFA 1C8M3 2Z42A 4ITCA 4QB6A 2Q8EA 1C5IA 2BW8A 1WA6X 2WO1A 3K4DA 2VZOA 3OY8B 5LK7B 3WNPA 4D6SA 4Y26A 3DEMA 4GIQA 1S2BA 1EUUA 5BNOB 1DYKA 3MUY1 1GZTA 3ZN4A 4E4ZA 1HJGA 4Q4V3 3U11A 4A7YA 1D0GA 2LM3A 5IUQA 4DRRA 1QEXA 1F31A 3HWJA 4CEWB 1J3QA 2W92A 1S55A 1IKPA 2UWAA 1A78A 4X6RB 5C8CA 2ZGPA 5DZGA 3VUOA 4IETA 5CFCB 1CX4A 4OHXA 3PNAA 4RGAA 2CAUA 2CTVA 3KQ4B 4GB33 1G7YA 1V6JA 1AL0G 2WS92 3VBOC 2VR4A 2NMOA 2Y26A 1OD5A 1QKQA 4XQDA 5F37A 2DFCA 1MZEA 5LEKA 4O61A 1PMIA 2AR6A 3UJOA 4A42A 4ZXEA 3VBHB 3N7KA 3BVCA 4Q26A 4CDUB 1GP4A 4PF5A 3WVJA 1W2UA 2BV4A 4C8DA 4AFAA 4CXXA 1PO12 4E4DX 2WA3A 1X8EA 4GXLA 1Y9MA 2Q0AA 2Q30A 2YPDA 3H8UA 4QX8A 3SLIA 4ATFA 5CKMA 3E6DA 5EV7A 1OMIA 2YC4A 2AREA 2B7YA 3ABZA 3N3HA 5C7GA 4D6QA 5FZFA 3PIJA 1M4WA 3N9PA 3VD7A 3VDDC 4K21A 3ZXAC 3MIEA 2DBNA 5F5AA 1QOTA 2ETEA 2OPKA 4K9SA 4K8FA 1ODNA 4P08A 4RGKA 5IAXA 4GH4C 4Q4Y1 2I74A 1W9SA 3B9CA 4BDVB 5IFTA 3AZWA 3HBKA 4Q8LA 2SBAA 1O4ZA 2DVBA 4TWTA 4NHXA 4INDA 1S0JA 3S5AA 5EFUA 5C33A 5CYYA 4OMCA 3PJYA 2QDRA 5ERLA 5FY5A 3SKVA 2FZ2A 4R52A 3J8F1 3OBZA 1BKZA 2WFPA 2WBKA 2XVKA 3ZXFA 4CEYA 4JQRA 3AX4A 4Y3OA 1PK6C 2NPIA 3F95A 2NYYA 1GZWA 3AP5A 4QM8A 4XACA 4E9KA 2P3YA 2XQXA 2Y33A 5C3RA 3T3YA 4XF0A 1CX1A 1GICA 1PMHX 1QQP1 2ZGMA 4OUSA 4QDSA 5F7UA 3LPFA 4XC9A 1RXFA 1UF2C 4QPGB 3NKTA 3IDAA 4HN1A 1ODMA 2VM9A 4JGYA 3UT0A 1WMEA 2VAUA 2OQ6A 4N53B 1FI2A 4Q4Y2 1CPNA 4RR3C 3I2IA 5C3QA 2H0BA 3OBRA 1I6XA 4JC1A 5FZ9A 4D69A 4QPWA 1CWPA 2ILMA 2ZABA 1WCUA 3N7JA 3KT1A 1XRUA 3AP7A 3O1UA 3U1XA 2ZKLA 4IL7A 4IGPA 5HCFA 3TEZA 2PHXA 4CDXC 2WLPA 4Y4RA 2E53A 5JR2A 3LEMA 2BOJA 2JENA 3PU3A 1HN1A 3J8F2 4WVMB 3L9JT 2XHKA 2IUWA 2OUHA 2D6MA 2FDJA 2VECA 3LPGA 1OXCA 4R9DA 4W6YA 4IEZA 3AYCA 1COV1 3ZXLA 1DQ0A 1HJFA 4LHSA 4CDQC 5C3SA 2PHUA 1QQP2 3HN3A 5KHIA 2GC3A 2YZ4A 3GBGA 4YW4A 4D8MA 4CP1A 2JECA 3I2HA 3ZXGA 1QJY1 1SFYA 1AJKA 3BYWA 5F8PA 5JMCA 1YIFA 2PLV3 2HWF1 4QXBA 1JYVA 5B2GB 1NAEA 5GJ6A 2ATFA 2VCBA 3VBFB 4AEDB 4FPYA 1QNYA 1AYM1 5J3UA 4MYEA 1AX0A 3WCSA 3WG1A 1DYPA 5J96B 3ZSKA 1DGRN 4KGQA 2VUAA 3OD4A 4BISA 4XDPA 1YFXA 3C7EA 3ROUA 5BNNB 3NV2A 1GNYA 2VOVA 3JB4C 2FCUA 3POYA 2W39A 1IHMA 5JZGA 1AR82 1NCQA 1OLRA 5JR7B 4X8NA 5FREA 3M3QA 5DAVA 1J84A 1COV2 1OA2A 2JG8B 4UI9L 2IVIB 3GCWA 5EHDA 2QBXA 1AXKA 2WZR1 1RMU3 3CEWA 3CHXA 3CZJA 3FHAA 3MW3A 3B02A 3OCPA 3M7AA 4MLOA 1QJY2 1NG0A 2PHTA 1SEFA 3H3LA 4H14A 4CCCA 2BPA2 5KC6A 1Q3EA 3RZKA 2CWSA 4QGNA 5FTTC 3SH4A 1YUDA 3NAPB 2HWF2 1POV1 1MZFA 5F9TA 1XB9A 4QDRA 4FPFA 4AFCA 1AYM2 3MLJA 1LOGA 4N7UA 1PO21 4BQXA 4P9GA 2C26A 1H1IA 2XLFA 4QU1A 2VMIA 5FZEA 1OH3A 2Z2SB 5C8CC 4JZRA 1DYOA 2VMEA 3K3OA 4LITA 2YGLA 2R0HA 5ABJA 2BGOA 3WW3A 4GAZA 4QX0A 1W6QA 5EYXA 5F5CA 2WL1A 1GMMA 3S7IA 2XJSA 1XXNA 5T55A 1C1LA 1S0CA 3BTZA 2ZGLA 3P5BA 5E89A 3RZGA 1HKDA 4H7MA 1XU1A 2E7AA 2WSUA 4D7YA 1REEA 4RSUA 5JOYA 3MYXA 3NKGA 2PMWB 3OY8A 2GALA 1ZA4A 5LK5A 4JX0A 2R041 1JODA 2BNMA 5GZEA 4BXFA 4P00B 1RUNA 2ORZA 1LU1A 2OUJA 1QGLA 2VY0A 3WLUA 5BNOA 3BCWA 2I45A 4N90A 2JDZA 4QT6A 2R073 3BU7A 2X05A 3MGUA 2P1BA 3HQUA 5AFBA 1JYXA 1D2QA 1C8NA 2VVEA 4MH0E 3WP6A 1PO22 3POWA 1YIPA 1IG3A 3ETPA 3IKWA 4AVBA 2BFUS 1R091 5CFCA 5HCHA 4Q8KA 5F2SA 5I0TA 4ES8A 4AEKA 1JZ8A 4MOAA 3TYJA 1UPSA 3LEGA 4TZDA 2Y34A 4AHZA 2VD7A 3RYKA 1ZBE1 4B1LA 2NP0A 5E6HA 3I97A 3ZSJA 4FXGB 1E5HA 1X9PA 4UBGA 3AP6A 2VMHA 4AHYA 1DHKB 3RJ2X 5KXCA 5DDJ1 3WQ1A 3GM8A 2R042 1OKQA 4IGQA 1AL21 3RS6A 3U37A 3APBA 2CL2A 4P14A 2XPJA 1UMZA 4GWNA 4PDWB 1H6YA 5KR7A 4ONUA 2RS51 4GJZA 2OKXA 1WLWA 2O8QA 4Q4W3 5DAXA 3OSDA 3T0AA 5HI0A 1O3QA 1MS1A 2DU0A 2PAMA 2R30A 3BOPA 4FPJA 4MGZE 1RB8G 1ZRRA 1OD3A 4BLJA 1GSLA 2VMGA 2P3IA 4YM3A 4NVPA 3VBSA 4MGIE 5I8YA 1R092 2BQPA 1J58A 3KZ4C 1JZ4A 4GD4A 4JV4A 5L9BA 5FFOC 1WW7A 4JGYC 1ZBE2 2F6BA 2H0VA 2QKDA 1K5JA 1XNBA 1PNFA 2QDNA 2HWD3 4GKYA 4PQ9A 4UW6A 4AHWA 2A1XA 3Q8EA 4BK4A 3VKNA 2LALA 3IT8A 3GXUA 4QAWA 4COVA 2ZGKA 3NW4A 4DUXA 4NPRA 2MNGA 4AF9A 3LA2A 4LTAA 2ZX0A 4WM8C 3H50A 4J25A 2FDGA 3JD72 4WV8A 5DDJ2 3CBNA 5FO9B 5CBLA 1AL22 4QKBA 5FLJA 4YGBA 3AK0A 4NWVA 4MVTA 2P17A 4FPGA 5GKAC 1C28A 2X5IB 1U5ZA 1LHOA 1GNHA 2QQVA 4I0AA 2RS52 4OHWA 4XUQA 3WX5A 2BJSA 4AQSA 4ET7A 5J7MA 1O3TA 3BTAA 5FPVA 1ULFA 4EN6B 3RNSA 1ASJ1 4NPMA 4Y5Z0 3ILRA 2EIGA 3GJAA 2RMU3 2IVJA 1I5ZA 2Y8KA 4QPGA 2ZA9A 3K46A 5BY5A 4EN9B 4LKFA 3RZZA 5JAXA 4MG2A 4XJWA 4O9GA 3ZN5A 3JUUA 3TEXA 4H7LA 5C9AA 2YGMA 4EE2A 2J7MA 3PTYA 4JKLA 3FE5A 2DFBA 5CVRA 3THDA 4YWAA 1MS5A 4RYDA 1OUSA 2CAVA 5GM0A 4Q4X1 4OQ8A 1PVC1 2G1MA 5KHJA 4WVMA 1ULOA 3HVDA 2W1SA 1SFNA 3TNQA 4AR2A 2C0ZA 2BYVE 4AFDA 5F2WA 4BE3A 3URFA 1SDWA 3ZFFA 2I07B 3TN91 2A6WA 1UOJA 3KCCA 1UOFA 4JGZB 4FPLA 4QKNA 5JZGC 5A3WA 4NRMA 4XZPA 2OT7A 4AQTA 3A21A 3PVEA 5FXZA 1ASJ2 1OOPC 5FZIA 1L7LA 3ZDVA 1BYHA 3MDPA 2VQUA 1TZOA 3H8XA 4YFWA 1V9U1 5EYYA 4W6XA 3VBSC 1CIYA 1SLCA 2PQSA 5I91A 2ZGSA 3E5UA 3WW4A 4NPLA 1SZBA 3VBFA 1W2NA 4QX1A 5LB6A 1UYYA 1F2NA 5IHRA 4UXAA 1GOHA 2ZXQA 2XH6A 2W3JA 3H1WA 1QHDA 3NV1A 4Q4X2 5F3GA 1PVC2 2HEVF 3D0JA 2ZX1A 3OPTA 3K75B 4IE6A 5BNNA 3BPSA 4MGQA 2NN8A 1FMD2 4CZSA 4CDWA 5ABJC 2YBSA 3TN92 2DCJA 1YI7A 4R9BA 4BMBA 1MZ6A 4LIVA 3WG4A 2RVAA 2UY8A 2JG8A 3ZR6A 4LA2A 2VQ0A 3H0OA 1CJDA 3AMMA 3RI9A 4PHZA 1ZM1A 1KXGA 3IBMA 3WQ0A 3KGLA 3B5LB 3D82A 4GZ9A 1ENXA 2BRTA 4A7ZA 4URAA 2YROA 2H6CA 1V9U2 3EHKA 5FZLA 1CD3G 2YFZA 1E5SA 3TEWA 4Z8BA 1L7QA 1Y7BA 2WO3A 5BNOC 1A8MA 2VCMA 3OG2A 2ARBA 3WDTA 1UXXX 2ZHNA 2A6YA 2Y6HA 1KFUL 4DXRA 2ZGNA 1CGPA 3OBAA 1IS4A 2HWB3 3O12A 1YQ2A 3JU9A 2HLEA 1AR91 4CEWC 1LU2A 1MS4A 2VBPA 1NX9A 5C5TA 1QJX1 4J1WA 4QQPA 4CUCA 5LBEA 5DAPA 4Y1YA 3VB9A 3ZKUA 1IQDC 3C2UA 2Q8OA 3H42B 1O5UA 3MFAA 3NSTA 4BQ2A 4MHUA 5T3NA 3LE0A 1R1A3 5EZWA 4ES9A 2IZWA 4CUGA 4DQAA 4K1YA 3WF2A 4XF1A 2PHRA 1WUVA 3KD4A 4QWNA 4YW7A 5GLVA 3KV4A 5JOZA 4EWAA 3O1MA 4EZHA 4KWJA 3VBHC 4AW7A 1W2OA 5CB7A 4CDUC 1ULGA 4JDOA 4Q27A 4L2NA 1UY4A 5A3NA 3AMQA 2D6OX 1YWKA 4XF4A 3WSOA 3WG3A 2QVSB 4HVQA 5FP4A 4ZZ8A 4I3PA 3I2OA 3DYOA 3LEKA 1D4M3 4M0NA 3P3NA 5BXXA 1NXMA 2GH8A 5IK8A 1X33A 2WJSA 3JCIA 4JTNA 1AR92 3IIIA 5FQ0A 4LJHA 3T1MA 1YFUA 2C1FA 3SCHA 3W9AA 1QJX2 1A6CA 3ZPOA 2IXJA 1UIKA 5L9VA 2VE1A 1JZ2A 1NYWA 2VNGA 3H3ZA 2R16A 1UKGA 3TRSB 2DUPA 4UFLA 1HRI3 4F3JA 4XFCA 2FD8A 5A32B 3E6CC 3DV8A 5FZ3A 3KHBA 2BWCA 2AZ5A 4KL1A 1AYN1 1W8OA 3JXSA 4HVOA 3O0XA 4AE2A 4HMZA 1QDCA 2YBKA 3OTFA 3HOBA 2DBIA 2ARAA 1VBE1 2HEWF 3N9MA 4GMP1 4KH9A 3O1TA 4NRQA 2AUYA 4LOSA 3RWKX 1H1MA 3I3MA 5AC93 1JOJA 2VVFA 1KDMA 4PDWA 4XAAA 3O1SA 4Q4Y3 1O4YA 4MZUA 3OB8A 4YM1A 5LWBA 1GOGA 1BXHA 2BU9A 3Q9OA 4N9HA 2Q8CA 3A23A 3BGAA 3CJXA 3DPRA 5EQUA 1S4CA 2KM2A 1RUG1 1NT0A 3S0MA 1CESA 2VQTA 3KGZA 5D8AB 1UZ0A 2XHNA 3NVCA 2FDIA 4NRPA 3LQCA 3ES4A 3L2HA 2YBPA 2ZHKA 2W95A 4K20A 1W0PA 5FYHA 5C4WC 4R8HA 4E8DA 4QPGC 4RHV3 3WF0A 2IWGB 1LHUA 3B00A 2ZACA 1LODA 1EYBA 2PAEA 3C7FA 4AHXA 2J1VA 2XWBB 3V65A 1JZ5A 1WKYA 3RRDA 4EJRA 3U07A 4KG8A 2G9ZA 2EXHA 4N53C 3ZO0B 4EZ4A 3ZYJB 4XJ9A 5HV0A 3SEEA 2OQ7A 3SCFA 4CEYB 5IVFA 1AYN2 2CGNA 4IE7A 4NHKA 4NHLA 4BA6A 1UZYA 2XBO3 1QOSA 4YZ2A 1EAH1 1X8MA 2VUCA 4CRQA 5C6CA 1UPIA 3VDBA 4DEQA 2PHLA 1AR61 1NQJA 4L92A 5A1LA 3I2DA 1V00A 2X5IA 3ZXEA 2JJ6A 3JQXA 1UO9A 1AF9A 2VQAA 3CDZB 4DY5A 2G4IA 2DDUA 4AI3A 4FOWA 1RUC1 1K42A 3GHMA 4XQWA 3NV4A 3M3OA 4L0PA 1O7FA 1AVBA 1T6GC 1UU6A 1GOFA 5FPLA 3BI3A 4QQ2A 1FNZA 1JH5A 1HRV3 4IESA 2AYHA 3PURA 5FY1A 4CCDA 5A6YA 3C3VA 1COV3 3VBFC 5FAXA 3S6PA 4AEDC 3E5QA 4Y5TA 2YB7A 2JDYA 3GZEA 2Z5WA 3J7MA 3VHRA 1IS6A 1EAH2 2GSYA 1CAWB 1PIV1 1QJY3 2UWBA 4LK6A 4RQPA 4CXWA 4HPKA 4Y24A 3SHRA 3A7QA 3GZAA 3MEPA 1AR62 2E31A 3WNKA 4XXAA 3VHPA 1PGL2 4LOTA 2D98A 5BNNC 2GNMA 1IPJA 4TYSA 2HBUA 4UAPA 3B9IA 1VLNA 3I3DA 2CHHA 3HAGA 5A3OA 4JGZA 1H2LA 4B7KA 3R05A 1JHNA 2UU8A 2J1EA 4GALA 1UU4A 4YGCA 1BBT3 3KLSA 4S2DA 4CCOA 2UWCA 2IFRA 2XL9A 4P5HA 4LULA 4ARXA 2RHPA 2V72A 5HXVA 1APNA 1YQCA 2VTXA 4KQ7A 1BMV1 2RM21 2E7TA 4HKOA 2W0XA 2ADEA 5J1XA 2W68A 3EMRA 2HWC1 2RS11 5KWRA 1N1VA 1EPZA 2YY1A 3NAPC 1QJU3 2BBAA 5FY0A 5KHGA 2QQOA 2NM1A 4L97A 5CU1A 5I0RA 2DCYA 1OLQA 1NQDA 3FLRA 5KBFA 5LW9A 4OZXA 4FPOB 2L9LA 2WZR3 4R4XA 3WCRA 2BUKA 4K8RB 2WO7A 4TXWA 4BHPA 1BZWA 3W59A 1CAUB 2YG0A 4FO9A 5FUPA 4DMIA 1TQ5A 3P3PA 4FFFA 4LKEA 2EVXA 2CV6A 2RR13 1POV3 2DU1A 2PXJA 3MV11 4W8JA 1O91A 4N7IA 4LMFA 3WG2A 4AQ2A 3G6JB 5FLIA 2W2IA 4HSLA 2XMLA 4XEZA 1LOEA 1T6BX 2C9AA 3S30A 4B4RA 1PO23 1UQXA 5JVVA 3CNAA 3FC0A 1VB2A 5FMDA 1PZ9A 2D6NA 2VTXJ 2JD9A 2VZQA 3CJIB 1BMV2 4TN7A 1SLTA 2DVAA 2RM22 2Y6JA 3DXUA 3HD8B 4LNVA 2YC2A 4ZU5A 5FYTA 2HWC2 2RS12 3ACFA 3QH6A 3IAQA 1YNAA 4BMEA 1H8TB 5IW0A 3PUAA 5LRRA 4ZU7A 3AKRA 4AEMA 5KXBA 3DN7A 1TME3 5JWPA 2WT0A 1JZ6A 1CONA 1O3SA 4CPBD 3BIEA 2V4VA 5IVEA 4XCAA 5ANNA 3ON7A 4CP0A 4DXSA 5FY7A 4MSVA 1W2TA 2WNEA 1GKBA 1UXZA 2GC0A 3PMEA 4Y4YA 1PO11 1RUOA 1W05A 1RUE1 3EXUA 2VVDA 3QLQA 2WWUA 1W8ZA 1KS5A 2Z79A 5FBJA 3ILNA 4OLLA 1EY2A 1W04A 3CO2A 3D0SA 4DXTA 5JSPA 4K6BA 2V09A 5HCAA 2XR4A 5L36A 4QHZA 1F8VA 4R4ZA 2WWJA 1KQRA 5JIUA 3LWCA 1CPMA 1VALA 3H1MA 4ZY9A 1REDA 3VHOA 1GP5A 3HJRA 4PDWC 2LUWA 4W50A 1V0AA 3VZLA 1KEXA 5DABA 5T52A 2W1WA 1ZZ9A 2ZJCA 2JDMA 3FN9A 1G6NA 2BVVA 2J1RA 3WDYA 4QB1A 2VZPA 4B1MA 3NWKA 3IAPA 3UL2A 2V5YA 1AL23 3AKPA 3MV01 4N8MA 4XFAA 4ZONA 4XCBA 4HXCA 4XF9A 5A32A 1W6MA 2RS53 2PN5A 3W5NA 1RVF3 4LIUA 2WO2A 4EROA 1P8JA 1PM4A 1RUE2 4KWKA 4I09A 4U36A 2OZJA 4QKDA 3K51A 2PELA 1ENQA 2GNTA 5HBAA 4BYYA 1LAJA 4PLNA 3BIWE 5FYMA 5FKBA 3BKZA 4YW1A 2YU1A 4GWIA 1K3IA 1R081 2WYFA 1RUF3 1AX1A 4LK7A 4UT5A 4BM8A 4DO0A 2R6QA 1X82A 2ZGUA 3FWEA 1E5IA 1W39A 2A6VA 2WQ4A 1VMFA 3AKSA 1U12A 4IEYA 1NZCA 4AFBA 1PZ8A 4M3CB 5JXIA 2X5IC 2GNBA 2HKXA 2D6LX 2F4LA 5D8AA 2QQUA 5D1IA 1X9TA 1EV11 1H4GA 4LR4A 1MPXA 3TB0A 1DZQA 3ES1A 1US3A 3K4AA 1J1TA 1AJOA 3TOJA 1XYOA 5CG9A 5A3PA 3NJVA 5T5JA 1V70A 3KV6A 3N35A 4K1ZA 1OI6A 3KT7A 1YFYA 3AVRA 5G04L 4TLGA 4CPBA 5A1AA 1K5MB 4LLOA 4URTA 1W2AX 4V1PA 4YLZA 3DYPA 3N9NA 3D4KA 4MADA 1R082 1YCIA 5A7NA 1FV3A 3SEPA 3IWZA 4AVCA 1TVGA 3ZYPA 3AFGA 4OQ9A 2ZMLA 3FMGA 2ZMKA 3GALA 5EP9A 1FT9A 1Y3TA 5JDBA 1YXWA 1RC6A 3IB3A 1LTEA 4JGZC 4XYXA 1QXPA 1Z7S1 2JWPA 5C9AB 4YZ5A 1EV12 2GU9A 3ZMNA 3TNPB 1F4HA 1YEWA 3I3BA 4IE5A 5J36A 1FOD2 4JQTA 2FQPA 4A2UA 3DL3A 2VOTA 3R4DB 3TN93 2D6KA 4LKDA 5SV5A 3V0BA 3MPPG 1MQTA 4O65A 5K9YA 2DV9A 2JE9A 2MEV3 2ZS6B 2IXHA 1URXA 2WFF3 1AR81 1W8NA 4N9IA 3ZFFB 1VBC1 4CU9A 2EALA 3CIHA 3OYWB 3KF3A 1ULDA 4GA9A 1QXJA 4WVZA 1CN1A 1QJFA 1CAWA 1SFPA 3O7OA 4PI2A 4ZPIA 5FZ8A 4C0BA 1BEV1 2PYTA 4XURA 1HQLA 2CWMA 2PHFA 4P9YA 1IOAA 1S2KA 5F1RA 1SBEA 2DWRA 4KBBA 5TSWA 1RUJ3 2WZPP 3OD0A 1BVVA 2WR9A 1VBA1 3KV5A 2WABA 4W4ZA 3JZVA 2DTYA 4BB3A 1Y9QA 1FV2A 5A3MA 1YJKA 1Z7S2 2B42B 2W47A 5FO7B 3U4XA 1VRBA 4QD2A 5DUXA 1JTZX 4D7SA 3EYPA 3MIFA 4WBBA 3AZZA 4W6WA 4BCUA 5L73A 3WEZA 3N7MA 1NXD1 3AM2A 3HNYM 2V4AA 3POBA 1RTVA 2GP3A 3ZXDA 3QOPA 3WOGA 3I2KA 4CDWB 5CFDA 2ZPXA 1VBC2 2XUEA 3BTXA 2Z69A 1OVSA 2P6HA 2QQMA 1JN2P 1F5FA 2XJTA 5IJRA 1CAUA 5CADA 3FFQA 3ZSLA 1PX4A 2B9VA 3OUHA 1BEV2 2ZGOA 3THTA 3Q8CA 1LGCA 4AVVA 2P37A 3H3UA 3DF0A 4QX3A 4DZGA 1VBA2 4ASKA 3T0DA 2A7AA 4QKFA 4OHVA 4XHBA 2PAKA 3I3QA 3VHNA 1AR93 2JG9A 3N36A 2FCTA 5JPNB 3D3AA 3OPWA 4PF1A 3GDBA 3CJIA 4HBNA 2QQLA 1JOBA 1ND2A 1S0FA 1YQ8A 1CAVB 2HWE1 1ZZ7A 2AACA 4RGGA 3MLKA 5DXDA 5H9QA 2E9QA 2YPJA 1WW5A 1YYNA 2GP5A 3FJSA 2P5BA 4HANA 3M3IA 3U75A 5FXWA 1H8TA 2WT1A 2VGDA 2K2SA 2WT2A 5FZOB 5FPUA 4UFKA 2VNOA 2RDNA 2VJXA 3IMMA 3LIGA 1WW6A 5I0DA 1QH7A 1O6UA 1U5XA 1HLCA 1SQ4A 3WQBA 5CIRA 4FT8A 1RHI1 1RUI3 5K4LA 1HV0A 1ST8A 1UD1A 1ZBA3 2YUEA 4WZFA 1N3OA 4NMIA 2VU9A 2Y0OA 4QDQA 4XJUA 3WUCA 3IM0A 2ES3A 3B69A 5FZDA 4NOTA 3AC0A 1C5HA 1CZVA 2WZEA 4XTMA 4ISRA 1ONAA 1V6KA 1D7PM 3MIGA 3RQ0A 3RWNA 5JOWA 2EAKA 2PHDA 3LDRA 3RMXA 1LHWA 1HXS1 1Q8OA 4N43A 2HWE2 5FQ0B 5FUNA 2CGPA 1SBFA 5G05L 5ISLA 4G9SB 2GMEA 4DB5A 4EN0A 1H2KA 3GGLA 3OUIA 2XL7A 4OUEA 4C1XA 4DIQA 1C8M1 1GR3A 3IDEA 3LOIA 1N3PA 4Y1VA 3HT1A 1SPPA 3WNOA 3ZIXA 4AVAA 3IIAA 4GMP3 1VBE3 3KM5A 5D8AC 4RA0A 4YPJA 4MXWB 5LBCA 3OGVA 1JU3A 1RHI2 4YNIA 1DF0A 2OVUA 3JD71 4E2QA 2QUOA 4B4PA 2EIEA 4MHRA 1LENA 2P34A 4EQVA 3BTYA 4KBZA 1IZ3A 4Q4V1 4QB2A 2QQJA 2XONA 4FI9A 5M0TA 3UJQA 5KC5A 1RUG3 3ASIA 1FX5A 3OF1A 2QZ2A 3IDBB 4CEYC 5I8TA 5IVYA 4A6SA 4KMQA 2C6SA 3AB0A 3R4SA 4O9EA 3KHCA 3DPRB 3PIGA 3ZYHA 3MW4A 3LA3A 1RIRA 2HEYF 2OZ6A 1ZZ8A 3GJBA 4QGMA 1XPWA 1HXS2 3KF5A 4CP9B 1Q5OA 4ZKTB 3UNPA 1POV0 3AVSA 4C0HA 4LHKA 4M3CA 5H9PA 3BN6A 2VW0A 4Z07A 5L7OA 2UYAA 1DIWA 2A71A 3ACIA 4YM0A 1C8M2 4K7JA 5LEJA 4C90A 3O0VA 5A33B 3R4UA 5IK7A 2WN3A 2VC9A 1WA4A 4AAXA 1E5RA 3BALA 2R49A 2D43A 2VUDA 2HYKA 3EBRA 5FMBA 1GZCA 4EV0A 4Q0PA 3LDKA 3MUZ1 4HVRA 3UETA 4HT1T 4XFIA 4YZ3A 4BQWA 3ST7A 4BK5A 3DYMA 3PJQA 4Q4V2 5BV6A 1CR7A 1UX7A 4LO4B 1OKOA 1F4AA 2VZVA 5F39A 2PA7A 2WC2A 1W8UA 4XPVA 4XXPA 4OHZA 3GNEA 2IC1A 1K5MA 1YHFA 2Z4FA 3BPZA 4YVWB 4A3XA 1RUD1 4Q5OA 3MIDA 1RUC3 2J42A 1WD3A 1JYNA 1H2NA 4AAPA 4HLTA 2VG9A 1Q43A 2P3JA 4IEVA 5F6KA 1HN0A 3WNMA 2XLAA 2PQQA 4ZU4A 4AYUA 3ZN6A 1K45A 1YC61 3ENRA 5BNPB 4S2FA 2A6ZA 2VCAA 4SBVA 1HDKA 5T54A 5CISA 2DVFA 3AP4A 2JKBA 5FOBB 3HEIA 1QMJA 1NCRA 3K4ZA 4CUBA 2D40A 1JYIA 2VUJA 3IZOA 1PIV3 4U2AA 4RN5A 5A7PA 3VDCA 2ZCWA 2X53S 1ULEA 3GF6A 1DQ6A 4AL9A 3UKTA 3A0KA 2W1QA 4HKWA 4UOJA 1HQNA 1WD4A 2JKXA 2YC0A 3CF6E 2E51A 4RQPB 3X29B 2JB4A 4AG4A 3GZUC 4HPKB 3QACA 2RS33 4CP2A 1I9RA 2R1BA 1FMD1 2J1SA 3S5QA 2F4PA 4GULA 2JEMA 1A8DA 1QNWA 3OYWA 2YV8A 3TAYA 1J3PA 1RUD2 1HIXA 2UURA 1NCQC 2DTWA 2OW4A 5GZDA 4COWA 4CXYA 2BEOA 2RM23 3I4IA 3ZKYA 3VD4A 1DCSA 3NMBA 5LBBA 2R7EB 2ZAAA 4KI5M 4ISQA 4PBOA 2RS13 1LESA 4M01A 2ZEYA 1H8VA 4Q1PA 4GJYA 3OGJA 2ZZJA 1PVXA 2HBTA 4P9WA 2KXLA 3LD8A 3ORJA 1TMF1 3C7HA 2Y6LA 4YW3A 5JXJA 2OPWA 3ME2A 3NNGA 1OT5A 2O0OA 1TNRA 5FYYA 3RYRA 4UW3A 3CJIC 1JZ3A 2B45X 1OQEA 1PZ7A 2GH2A 2RE9A 3PUSA 1WCSA 4YG0A 3O1VA 5A3UA 4RFRB 1STMA 5FZBA 5JCTA 2GNDA 5FUIA 2XJVA 3JQWA 4TTGA 1H8TC 4I2OA 4XFHA 1HV1A 4AQ6A 3T4VA 4CCKA 1UY2A 3VBRA 3W58A 2VXJA 2F17A 5JXGA 3UKVA 4OHYA 2X10A 1XYPA 4PQQA 1WCKA 2E32A 2JIJA 4JAAA 5DAWA 3AJZA 1PGW1 1WCDJ 4QXHA 3AL6A 1ENSA 2ARXA 4HFSA 4PI0A 1KD7A 2XJUA 1XNKA 2WS93 3J4UH 1NKGA 4QPIA 5DZEA 5D21A 1BJQA 1MVQA 1HQWA 1IS3A 1TMF2 3MHZA 4FPCA 4FFIA 1OH4A 4YSFA 2JB8A 3MW2A 1CAVA 1HX6A 3CQOA 2O1QA 2VCCA 2ZGTA 4X8PA 1ZNPA 2ZKNA 4LXLA 4OVEA 1PO13 5CFCC 1RUE3 2VBDA 3T30A 2D5HA 5FY4A 4CUAA 3DECA 3RVHA 3ZFEB 3OGGA 5FZOA 4META 3EO6A 3NJZA 1PHMA 2B4KA 4M4RA 4OMDA 3RGBA 4BLIA 1GQPA 1ALYA 1H1AA 1XC6A 3SXWA 4WM7B 5FJKA 4AK3A 1W9FA 3LSEA 2XDVA 4Q0UA 1TG7A 2EF6A 2YMZA 1O5LA 4Q0QA 5GLTA 2FZ1A 3T4HB 2PLV2 4M3CE 3KWVA 3WXPA 1L7RA 1PGW2 2W94A 1IPSA 1YQ6A 2GDFA 1RXGA 5L19A 3AMNA 1OLMA 1DGRA 4AGVA 3V0AA 1W06A 5DUVA 1YI9A 2R0FA 1X50A 4SLIA 3N9OA 5IWFA 4RS5A 4YGEA 1ZRIA 1Q8SA 2JDPA 1D4VB 3J7LA 3MLLA 3AKQA 5ANQA 1W8TA 3U10A 4F7ZA 1MACA 1UCXA 5FJHA 3NNLA 4IXLA 5C5UA 1JUIA 3LEIA 4JHTA 1UL9A 3USUB 4OFGA 4NAMA 3FUQA 4LLFA 4MV2A 5DZFA 1W6MB 1JMUB 1LOFA 4Y33A 1G9FA 3CMGA 5SV8A 5IVVA 3GHNA 4Y20B 4MXWA 2VO5A 3ACHA 1US2A 1LOAA 4Y1UA 5JXHA 3PL0A 2OS2A 5CKNA 3W5MA 2R071 2XLGA 1ENRA 3KVAA 2O8OA 4NN0A 2UY9A 5LA9A 1DQ1A 1O8SA 1S0BA 3VKOA 1QDOA 1OQ1A 1RJ7A 1LOCA 1K5MC 1XE0A 3WNNA 5JLVA 3V56A 3WHTA 3RG0A 4IV3B 2WZ8A
chains in the Genus database with same CATH topology
3WP5A 1RL3A 4Y22A 3J8F3 1S0EA 2ZZQA 2D97A 2A73B 3B93A 2CY6A 1UIJA 2IFWA 2VH9A 3EJKA 3WHUA 3VZNA 1LHVA 2ZX4A 4HN0A 3LKJA 5A33A 3MF6A 1FAYA 1KFXL 1N1SA 4B7EA 2GAUA 5C9AC 1QQP3 3B01A 1B35B 3THPA 3GZTB 1KDKA 2VNRA 3AYEA 4YGDA 2TUNA 2R072 1OA4A 1XYNA 1PGL1 1OQDA 2V73A 4YVWA 1XU2A 3ZFFC 4CYDA 1MS0A 3PLQA 3ALQA 4G3YC 4BWOA 1PNGA 4LE4A 1FPN1 1WMFA 5BNPA 4C1WA 2HWD1 2FMDA 3VDDA 3BB6A 3WD5A 5I8SA 2ZX3A 4B4QA 1AR83 1W6PA 3ZSEA 2PHWA 3V0BB 1BVP1 4K3UA 1MQTB 5IK5A 1ULCA 1VBD1 2PTMA 4GH4A 2WNVB 4DY3A 2SLIA 1XQNA 4J1XA 2ET7A 1ZVFA 2H6BA 1B09A 2EXIA 4OI2A 4XTPA 2I2SA 4C91A 3VZJA 3VKLA 2WINB 3WUDA 5DG1A 4R9AA 2HWF3 5T5OA 4XBQA 4B3NA 2DUOA 4GMP0 1LEDA 2RMU1 3FFZA 4CDWC 3WR0A 1AYM3 1SLBA 4LBNA 2XUMA 1PK6A 3ATGA 3T2TA 3OPZA 4Y1XA 2JG8C 2XB6C 4IQPA 2D5FA 1QJZA 2EA7A 4P9LA 2NLRA 1FPN2 4ATEA 4YFZA 4FAGA 2HWD2 1J1LA 1SMVA 4Y1ZA 1JYCA 1UN1A 2B46X 3J26N 4JCKA 4AI2A 3U0ZA 1VBD2 1JXNA 4TLFA 1DLLA 5CA6A 5CFDB 5FOJB 4UBHA 1AX2A 1N1TA 1XNCA 5EXOA 1SCRA 1ZRCA 2WSVA 3ACLA 3FX3A 4YRDA 2Q4SA 4IERA 1QXRA 4HK9A 3RDIA 4BOWA 4TSVA 1QH6A 4XBLA 1C57A 2D93A 2RMU2 1KJRA 1SLLA 1H0BA 3ECQA 1ZREA 2JG9B 3FBYA 2HWE3 4IEQA 2EXKA 2NMNA 4CDQA 3DUIA 1IKQA 1ND2B 3AYAA 3O0WA 2DVGA 2XGXA 4QQOA 3ZYIB 1SBDA 5FBZA 5CAZA 1KITA 3MZHA 1FNYA 2TEPA 2R061 4AWDA 4AI8A 4OI1A 2R043 2JICA 3PHMA 3ZFEA 1RGSA 4I02A 1KS4A 3OJBA 4WM7A 1LOFC 2YDEA 1KRIA 3H9AA 4FQ4A 3QCWA 1HXS3 3WP4A 1R093 3RPQA 1ND3B 4XW3A 4EWEA 2LTNA 1CIWA 2BGCA 2VOKA 4LUKA 1H2MA 4LUMA 4FOVA 4N43B 3MIBA 2HWB1 4COYA 4Z1VA 4EN8B 1ZBE3 4E2GA 1KJLA 2WQZC 3MI8A 4YM2A 4YG3A 2R062 3DPRC 5JSRA 2DVDA 4QMAA 4AI1A 3JD73 5DDJ3 3LZZA 5GLZA 4XFBA 1DGWX 4PJYA 1NE6A 2A70A 2XJRA 3USUA 1R1A1 1SLAA 1OA3A 3K48A 2GN7A 1Y43B 2PFWA 4UW5A 4Y20A 1G9AA 1EP0A 4Q0VA 4XE9A 5FPXA 1U5YA 3AZVA 4IV1B 2WNUB 2E63A 1QOOA 5DUUA 4KNCA 3VZMA 5JSOA 1N47A 3IPVA 4FTEA 1WBFA 5K0UB 1D4M1 2HWB2 1Q8QA 3FZ3A 4F8AA 1Q56A 1Q8PA 3FLPA 5GLWA 5L7OB 2AH2A 4YVWC 4AEJA 1YFWA 3LSDA 4XHXA 4IV3A 4IEOA 1HRI1 5JI7A 4XMIA 4XIKA 3VKFC 1FOD1 2BNNA 1DDLA 4COZA 1J59A 1R1A2 5BNPC 3E5XA 1GQHA 1LJ7A 4P9XA 5KHHA 1O3RA 2Q5TA 1RUD3 3AKTA 4HL0A 5HCBA 3T1LA 2ZHMA 3M2MA 1ASJ3 1GYKA 1B35A 3AFKA 4ZXKA 3KCYA 5AC91 2WWSA 3SCGA 5FMOS 1CAXB 4FBFA 2CYFA 1OSGA 1BK1A 2VULA 4RQPC 3SITA 4P9IA 2VW2A 1D4M2 2C5DA 2XG3A 4FQZA 1XE8A 4I3GA 5JIAA 3B94A 3ZN6B 4D94A 3DKWA 4YZ1A 3ZSMA 4KWLA 1RUH1 1MS3A 1RITA 5FCCA 1VB4A 4RHV1 4R9CA 1NCRB 4Q4X3 1HRI2 1PVC3 3CL1A 5FPZA 1C4RA 1UU5A 1ZZ6A 1RJ8A 1NA1B 3NV3A 1PM7A 1FMD3 1LHNA 2KA3A 4DFSA 4XOGA 1WLTA 4KU7A 1VRH1 2XBO1 4FTBA 4XJ8A 5C4WB 3I59B 3KS7A 4ORFA 3RJRA 3ZX7A 1EPWA 2WNVA 5AC92 1UAIA 4CTEA 3LA7A 1H4HA 1QWRA 4OULA 1XE7A 1IS5A 1V9U3 3VL8A 4DS0A 4LHNA 4PIZA 4WM8A 4LA3A 5E1RA 5T5PA 1V6NA 1H9PA 1MR5A 3D8CA 1REFA 1TMF3 1RUH2 3I54A 5KHKA 3R0RA 2NQYA 4RHV2 4RFT0 3AZXA 4BQ1A 3HMYA 2YHJA 5DG2A 5CG8A 5KXEA 1HRV1 4LBJA 4S2GA 1G9CA 3I7DA 4FVVA 1VRH2 2XBO2 1LECA 4Z92B 3HT2A 1VBB1 1ZZBA 1OHFA 1XNDA 1GFF2 3D5OA 1QU0A 1NLRA 4FCAA 3VBUB 2FMYA 4QM9A 3JB8A 1S1AA 1OPOA 3VBRB 4FOQA 1S0IA 1DU3D 3KMHA 2VW1A 3ZFGB 5BUVA 1BBT1 3ZFEC 3ZMOA 1VR3A 4G4FA 5T50A 4DXZA 4MX3A 1BCXA 4WM7C 4QPIB 4AVSA 2B8MA 1QJX3 1RINA 2DCKA 4QXKA 1HRV2 1QJU1 3M3CA 2Y0IA 3PVNA 1OOPA 4BIOA 4KGGA 2E7QA 4UW4A 3ZDSA 3JBG1 5DUWA 1WLDA 1CJPA 3SISA 1VBB2 3UKNA 4LO5B 2XVGA 2ZHLA 5I0SA 4JTOA 4NR1A 3ZYRA 5FRAA 4YZ4A 2RR11 2P3KA 3LOBA 3ZVXA 2CNAA 1AR71 1BBT2 4AXOA 4QU2A 2VOWA 4A7KA 1Z0HA 2QNKA 4Q1RA 1S0DA 4JDNA 4FPEA 4YG6A 3V0AB 4BZ4A 5GZFA 4I0WB 2GZWA 4GWMA 5GALA 4RS5B 3R6SA 1ND3A 3AZYA 4EWDA 3BOWA 1LKNA 4FTSA 3N7LA 1MEC1 3ELNA 4I0BA 4XJZA 1QJU2 3EQEA 1WGPA 1U0AA 5J37A 2ZGQA 3ZYGA 5K7PA 1TME1 3JBG2 1PGSA 4YYOA 3KQRA 1NOVA 1AYN3 2WZR2 1MZ5A 2K9ZA 2D7FA 1HW5A 3PVOA 4XFGA 3ZPYA 3UV9A 1DQ4A 1DZTA 1V6LA 4YVSB 2R32A 4IV3C 2RR12 2ZBJA 4CEWA 4QHBA 1AR72 1NY71 3M70A 3QD6A 4XQ4A 1IGOA 2CGOA 4LE3A 4J6GA 1R1ZA 1UX6A 2HJIA 4QPYA 4AFMA 1V6OA 4DRVA 4W65A 4PBPA 3MF9A 4IV1A 2W52A 2WNUA 3MPBA 1B35C 2N7GA 5EJ3A 1LGBA 3TWIA 4GB31 1MEC2 5K0UA 4Y22B 2OA2A 2A5ZA 1MS9A 3VBHA 1TME2 4CDUA 1ZRFA 3MFCA 4OI0A 1L3JA 1DQ2A 1A3KA 2OIIA 3WDWA 1M06G 4GKXA 1EAH3 1WW4A 1RVF1 1WBLA 2GMMA 1S0GA 3GYDA 1AR63 2GC1A 2VPVA 3A4UA 3VBOB 1GLHA 5FMOL 1TEIA 3H7JA 1W6NB 1NY72 4ASLA 2IXIA 2QFEA 1DZRA 2AGSA 2W08A 3WDUA 1MQTC 4JDMA 1I1EA 1RUF1 2D44A 2BBVA 4WZCA 2WNVC 3HR9A 1CAXA 2BNOA 4IEPA 4OUMA 5I93A 4LO6B 1FPN3 1N3QA 4PIXA 5BYNA 4GB32 4XBNA 2DCZA 2K0GA 3WP3A 1LCLA 1TE1B 5GZCA 5E8AA 1VBD3 1SLIA 3VDDB 4HSJA 4HZFA 1W6PB 1TNFA 4QQLA 4MUVA 4GH4B 1RVF2 3FHIB 1C1FA 1NA1A 4XILA 4AVTA 5E16A 4FP2A 4L8QA 5I0UA 3UK9A 4AGGA 1VAMA 2XWJB 4AI0A 1CQ9A 1V6IA 2ERFA 3I59A 5C4WA 1AZDA 3ETQA 3QBQA 4JRAA 1ZRDA 1ZX5A 4DNYA 1RUF2 4N53A 5CFDC 3PVBB 1PK6B 1VAVA 3LB9A 4QX5A 4YARA 5J09A 2HWC3 1LRHA 1UKRA 2D3SA 4M3CF 4FXKB 1OPMA 4LO8A 4LBQB 2DF7A 3LGRA 1D2SA 5IK4A 1VJ2A 1DGWA 2IXLA 2JG9C 2QJVA 5JPMB 2B39A 3B7MA 4RR3B 2MEV1 2WFF1 2ZOEB 1ND2C 1F5JA 3AYDA 3M4FA 2QQPA 3VGIA 3ILFA 2ZX2A 4QQHA 3AJYA 4CDXB 2DCTA 3VBUA 5JOXA 4H55A 1Z78A 3O14A 1W6OB 3VV1A 1RUJ1 2RJLA 2RJKA 4AEDA 4FSJA 2PLV1 1U5IA 1YJLA 2Y38A 3ZFGA 1VAKA 1OFSA 3RSJA 4CDQB 3GBWA 4LT5A 4Q29A 2DURA 4BH9A 5C8WA 2R063 3WW1A 1X7NA 5BNQA 3B3QE 2WIIB 4FP3A 1FYUA 2A3YA 3AMPA 3QH7A 1NLSA 1ND3C 2TNFA 3MIHA 1DG6A 2MEV2 1ZYBA 2WFF2 4H3WA 1GZ9A 4LBMA 4N43C 1O4TA 3IMNA 5E88A 1DQ5A 1JBCA 3FBMA 5AVAA 2QCSB 3HBZA 1RMU1 5FDBA 3NAPA 4HKLA 1RUJ2 2ENRA 4RD7A 1W0OA 5K8SA 2YYOA 3VZKA 3GBFA 5JI9A 4RL7A 4E27A 2D6PA 2MHFA 5FLHA 2AENA 3J9SA 4KU8A 4L11A 3AMHA 3VLBB 3VKMA 4M00A 5AFEA 4DOUA 4LHLA 2A75A 4IV1C 4LBKA 1UW8A 2WNUC 4NHMA 3HQXA 4JRLA 4NWWA 1WLCA 5K0UC 1C3HA 1LULA 4DPNA 2JE7A 5BPXA 5C8CB 4F83A 5L7OC 1RUI1 2BFUL 5ACA1 1RMU2 1ZBA1 2VXRA 4YVSA 1R083 2A3XA 4WVWA 2NZ9A 3O5SA 3RYPA 2IXCA 5AVPA 1MS8A 3IPVB 3INAA 1LR5A 4DINB 4LBOA 2TBVA 4Q2FA 3M8LA 2Q1MA 5A3LA 1EV13 1G9DA 3H7YA 1LB2A 4LBQD 1BQPA 4EN7B 3WDXA 1H9WA 5T5LA 2GMPA 3PMSA 1FOD3 3SH5A 3WZ1A 1FATA 1AXYA 2YXSA 1G9BA 2VOXA 3SNMA 3DGTA 1QY4A 5F6LB 4JVAA 1RUI2 4HK8A 5ACA2 1ZBA2 4E2SA 3RMYA 1NCRC 1E57A 3S7EA 1FXZA 3VBOA 2WA4A 1W6NA 3HN1A 1NA1C 4NO4A 4YW2A 4L99A 4Q4W1 3WQ7A 1RUH3 1N1YA 3VL9A 2XKPA 1Z7S3 3RI8A 4IEXA 1MVEA 5H9SA 4KG0A 3USSA 1LGNA 1GV9A 2ET1A 3MICA 3NO8A 1SCSA 5LRSA 1AUYA 2GN3A 1QF3A 1GZWB 4PLOA 2G9GA 3AP9A 4OI4A 5F5QA 1VRH3 3WDVA 1WMDA 4IEWA 2Q1ZB 1VBE2 3AXEA 1GBGA 4Z2WA 5CNAA 1V6MA 1VBC3 3V64A 4COUA 2GC2A 3POSA 4GQ7A 3N4MA 1H30A 2XJPA 3BODA 3E6BA 3FLTA 4MGKE 3L2YA 3WINE 1BEV3 1Q8VA 4JGYB 3CU7A 1YRZA 3A0NA 2BWAA 1RUG2 4MXVA 2QE3A 3KSCA 1X36A 1VBA3 2A6XA 4I01A 4Q4W2 3VZOA 4B8EA 4WM8B 5GZGA 3NL1A 3ZXKA 2BTVC 2P2KA 2IXKA 4FPHA 4ASMB 3VBUC 1CVNA 2EXJA 4LEJA 4Q0SA 3HIFA 2WKKA 2ZMNA 3VBRC 1SACA 3AXDA 4S2HA 4PCRA 2ZAHA 3M1HA 1VBB3 3ZFGC 4E4SA 2JD4A 4Z82A 4LBQA 1AXZA 3KCXA 2E6VA 3LAGA 4IEUA 1LOBA 1GNZA 1F9KA 2XJQA 4B29A 3LCPA 1D0HA 4XFFA 2OYZA 3E97A 4QPIC 3TBDA 1G8WA 3VN4A 2RS31 4FOYA 3WW2A 5GLUA 4RR3A 2X29A 4QGLA 2R1DA 1DGLA 2D3PA 3CLPA 3ZIWA 4WVVA 3D6EA 2D3RA 3I8TA 2G9FA 4I30A 2B5HA 1RUC2 4CDXA 1DBNA 1G86A 2JX9A 3KT4A 4L9BA 2FHRA 2B9UA 5J98B 1VIWB 3WV6A 2DUQA 5H9RA 1W6OA 1ZZCA 4P9JA 4K40A 4XDQA 1LEMA 3ZXJA 4XMAA 5FO8B 2BVBA 1YO8A 2ZGRA 5J48A 5JZGB 2ZTNA 1NCQB 1IPKA 3JBG3 4BIFA 1JUHA 4M0HA 1OOPB 1PIV2 1NE4A 3G7DA 1GQGA 2FBEA 3VBSB 5KXDA 1AHSA 4PLMA 3IDCB 1VP6A 4FPKA 3SMHA 1RHI3 2RS32 2XKOA 3IN9A 3OBTA 4RS5C 4XIOA 4D3WA 1DFQA 3SH3A 1AR73 1J3RA 1GANA 2X8KA 2DYCA 2EAAA 2UYBA 4XETA 4LBLA 2MPFA 3FUOA 3KB5A 4XJAA 4LO7A 3H1YA 1UZZA 4HETA 1IQAA 4MGYE 1OFNA 5IT6A 3WY6A 4X6QB 4D7TA 1JW6A 2QZ3A 1MEC3 4BPZA 3WNXA 4YVSC 5ABJB 4XF3A 1W6QB 2A3WA 2WS91 2WLQA 1YLLA 2XVLA 5EWSA 4FAHA 1I3HA 2JXAA 4PIYA 3M3EA 1C8M3 2Z42A 4ITCA 1C5IA 2BW8A 3OY8B 5LK7B 4Y26A 4GIQA 1S2BA 5BNOB 1DYKA 4E4ZA 3ZN4A 4A7YA 4Q4V3 3U11A 1D0GA 2LM3A 5IUQA 4DRRA 3HWJA 1F31A 4CEWB 1J3QA 1S55A 1IKPA 2UWAA 1A78A 4X6RB 5C8CA 2ZGPA 5DZGA 3VUOA 4IETA 5CFCB 1CX4A 4OHXA 3PNAA 4RGAA 2CAUA 2CTVA 4GB33 1G7YA 1V6JA 1AL0G 2WS92 3VBOC 2NMOA 2Y26A 1OD5A 1QKQA 4XQDA 2DFCA 1MZEA 5LEKA 3UJOA 1PMIA 2AR6A 3VBHB 3N7KA 4Q26A 4CDUB 4PF5A 3WVJA 1W2UA 4AFAA 1PO12 4E4DX 2WA3A 1X8EA 4GXLA 2Q0AA 4ATFA 2Q30A 3H8UA 3SLIA 3E6DA 5EV7A 1OMIA 2AREA 2B7YA 3N3HA 1M4WA 3VDDC 4K21A 3ZXAC 3MIEA 1QOTA 2ETEA 2OPKA 4K9SA 4K8FA 4GH4C 4Q4Y1 2I74A 3B9CA 3AZWA 4Q8LA 2SBAA 1O4ZA 2DVBA 4TWTA 4INDA 1S0JA 5EFUA 5C33A 3PJYA 2QDRA 2FZ2A 4R52A 3J8F1 1BKZA 2WFPA 2XVKA 3ZXFA 4CEYA 4JQRA 3AX4A 1PK6C 2NPIA 2NYYA 1GZWA 3AP5A 4QM8A 4E9KA 4XF0A 1GICA 1QQP1 2ZGMA 4OUSA 4QPGB 1UF2C 3NKTA 4HN1A 4JGYA 1WMEA 4N53B 1FI2A 4Q4Y2 1CPNA 4RR3C 2H0BA 3OBRA 1I6XA 4JC1A 4D69A 2ILMA 2ZABA 3N7JA 3KT1A 1XRUA 3AP7A 2ZKLA 4IL7A 5HCFA 2PHXA 4CDXC 2WLPA 2E53A 2JENA 3J8F2 4WVMB 3L9JT 2XHKA 2OUHA 2D6MA 2VECA 4R9DA 4W6YA 4IEZA 3AYCA 1COV1 3ZXLA 1DQ0A 4CDQC 2PHUA 1QQP2 5KHIA 2GC3A 2YZ4A 3GBGA 4YW4A 4CP1A 2JECA 3ZXGA 1QJY1 1SFYA 1AJKA 5JMCA 1YIFA 2PLV3 2HWF1 5B2GB 5GJ6A 2ATFA 3VBFB 4AEDB 4FPYA 1QNYA 1AYM1 5J3UA 4MYEA 1AX0A 3WCSA 3WG1A 1DYPA 5J96B 3ZSKA 1DGRN 4KGQA 2VUAA 3OD4A 1YFXA 3ROUA 5BNNB 3NV2A 3JB4C 2VOVA 3POYA 2W39A 1IHMA 5JZGA 1AR82 1NCQA 1OLRA 5JR7B 4X8NA 5FREA 3M3QA 1COV2 1OA2A 2JG8B 1AXKA 2WZR1 1RMU3 3CEWA 3MW3A 3OGGA 4YW5A 3VBSA 3B02A 3OCPA 3M7AA 4MLOA 1QJY2 1NG0A 2PHTA 1SEFA 4H14A 2BPA2 5KC6A 1Q3EA 2CWSA 4QGNA 5FTTC 3SH4A 1YUDA 3NAPB 2HWF2 1POV1 1MZFA 5F9TA 4FPFA 4AFCA 1AYM2 3MLJA 1LOGA 4N7UA 1PO21 4P9GA 1H1IA 2XLFA 2VMIA 2Z2SB 5C8CC 2YGLA 2R0HA 5ABJA 3WW3A 1W6QA 5EYXA 3S7IA 2WL1A 2XJSA 1XXNA 5T55A 1C1LA 1S0CA 2ZGLA 5E89A 1HKDA 4H7MA 1XU1A 2E7AA 2WSUA 4D7YA 1REEA 4RSUA 5JOYA 3MYXA 3NKGA 3OY8A 2GALA 1ZA4A 5LK5A 2R041 2BNMA 5GZEA 1RUNA 3WLUA 1LU1A 2OUJA 1QGLA 2VY0A 5BNOA 3BCWA 2I45A 4N90A 2JDZA 4QT6A 2R073 3BU7A 3MGUA 5AFBA 1D2QA 1C8NA 2VVEA 4MH0E 3WP6A 1PO22 3POWA 1YIPA 3IKWA 4AVBA 2BFUS 1R091 5CFCA 4Q8KA 5I0TA 4ES8A 4AEKA 3TYJA 1UPSA 4TZDA 4AHZA 3RYKA 1ZBE1 2NP0A 3ZSJA 4FXGB 4UBGA 3AP6A 2VMHA 4AHYA 1DHKB 3RJ2X 5KXCA 5DDJ1 3WQ1A 2R042 1OKQA 1AL21 3RS6A 3APBA 2CL2A 4P14A 2XPJA 1UMZA 4GWNA 4PDWB 4ONUA 2RS51 1WLWA 2O8QA 4Q4W3 5HI0A 1O3QA 1MS1A 2DU0A 2PAMA 2R30A 3BOPA 4FPJA 4MGZE 1RB8G 1ZRRA 4BLJA 1GSLA 2VMGA 2P3IA 4YM3A 4NVPA 4MGIE 5I8YA 1R092 2BQPA 1J58A 3KZ4C 4JV4A 5FFOC 1WW7A 4JGYC 1ZBE2 2F6BA 2H0VA 2QKDA 4PQ9A 1XNBA 1PNFA 2QDNA 2HWD3 4GKYA 4UW6A 4AHWA 3VKNA 2LALA 3IT8A 4COVA 2ZGKA 3NW4A 4NPRA 2MNGA 4AF9A 3LA2A 4LTAA 2ZX0A 4WM8C 3H50A 3JD72 4WV8A 5DDJ2 5FO9B 5CBLA 1AL22 5FLJA 4YGBA 3AK0A 4NWVA 4MVTA 2P17A 4FPGA 5GKAC 1C28A 2X5IB 1U5ZA 1LHOA 1GNHA 4I0AA 4OHWA 2RS52 3WX5A 4AQSA 5J7MA 1O3TA 3BTAA 1ULFA 4EN6B 3RNSA 1ASJ1 4Y5Z0 3ILRA 2EIGA 2RMU3 1I5ZA 4QPGA 2ZA9A 5BY5A 4EN9B 3RZZA 5JAXA 4XJWA 4O9GA 3ZN5A 3JUUA 4H7LA 5C9AA 2YGMA 3PTYA 3FE5A 2DFBA 5CVRA 1MS5A 2CAVA 5GM0A 4Q4X1 1PVC1 5KHJA 4WVMA 1SFNA 3TNQA 2C0ZA 2BYVE 4AFDA 4BE3A 3URFA 1SDWA 3ZFFA 2I07B 3TN91 2A6WA 3KCCA 4JGZB 4FPLA 5JZGC 4XZPA 4AQTA 3PVEA 1ASJ2 1OOPC 1BYHA 3MDPA 4YFWA 1V9U1 5EYYA 4W6XA 3VBSC 1SLCA 5I91A 2ZGSA 3E5UA 3WW4A 3VBFA 1F2NA 4UXAA 3H1WA 3NV1A 2XH6A 1QHDA 4Q4X2 1PVC2 2HEVF 3D0JA 2ZX1A 5BNNA 2NN8A 1FMD2 4CZSA 4CDWA 5ABJC 3TN92 2DCJA 1YI7A 4R9BA 4BMBA 1MZ6A 3WG4A 2UY8A 2JG8A 4LA2A 2VQ0A 3H0OA 1CJDA 3AMMA 3RI9A 1ZM1A 1KXGA 3IBMA 3WQ0A 3KGLA 3B5LB 3D82A 1ENXA 4A7ZA 2YROA 2H6CA 1V9U2 3EHKA 1CD3G 4Z8BA 1Y7BA 5BNOC 1A8MA 2ARBA 3WDTA 2ZHNA 2A6YA 1KFUL 2ZGNA 1CGPA 1IS4A 2HWB3 3O12A 3JU9A 1AR91 4CEWC 1LU2A 1MS4A 1QJX1 4J1WA 4QQPA 4Y1YA 3C2UA 2Q8OA 1O5UA 3MFAA 3NSTA 5T3NA 1R1A3 5EZWA 4ES9A 2IZWA 4DQAA 4K1YA 4XF1A 2PHRA 1WUVA 3KD4A 5GLVA 5JOZA 4EWAA 4KWJA 3VBHC 4AW7A 5CB7A 4CDUC 1ULGA 4JDOA 4Q27A 4L2NA 3AMQA 2D6OX 1YWKA 4XF4A 3WG3A 2QVSB 4HVQA 4I3PA 1D4M3 4M0NA 3P3NA 5BXXA 1NXMA 2GH8A 5IK8A 1X33A 2WJSA 3JCIA 4JTNA 1AR92 5FQ0A 3T1MA 1YFUA 2C1FA 3SCHA 3W9AA 1QJX2 1A6CA 2IXJA 1UIKA 1NYWA 2VNGA 3H3ZA 2R16A 1UKGA 3TRSB 2DUPA 1HRI3 4F3JA 4XFCA 5A32B 3E6CC 3DV8A 2BWCA 2AZ5A 4KL1A 1AYN1 4HVOA 3O0XA 4AE2A 4HMZA 1QDCA 3OTFA 2HEWF 4GMP1 1VBE1 4KH9A 2AUYA 1H1MA 5AC93 1JOJA 2VVFA 1KDMA 4PDWA 4Q4Y3 1O4YA 4MZUA 4YM1A 1BXHA 3Q9OA 4N9HA 3CJXA 3DPRA 2KM2A 1RUG1 3S0MA 1CESA 5D8AB 3KGZA 3NVCA 3ES4A 3L2HA 2ZHKA 4K20A 1W0PA 5C4WC 4R8HA 4QPGC 4RHV3 2IWGB 1LHUA 3B00A 2ZACA 1LODA 1EYBA 2PAEA 4AHXA 2XWBB 3V65A 3RRDA 4EJRA 3U07A 4KG8A 2EXHA 4N53C 3ZO0B 3ZYJB 4XJ9A 3SCFA 4CEYB 1AYN2 2CGNA 4NHKA 4NHLA 4BA6A 1UZYA 2XBO3 1QOSA 4YZ2A 1EAH1 1X8MA 4CRQA 5C6CA 1UPIA 2PHLA 1AR61 1NQJA 4L92A 3I2DA 1V00A 2X5IA 3ZXEA 2JJ6A 3JQXA 1AF9A 2VQAA 4DY5A 2G4IA 4AI3A 4FOWA 1RUC1 3GHMA 4XQWA 3NV4A 3M3OA 1O7FA 1AVBA 1T6GC 1UU6A 4QQ2A 1FNZA 1JH5A 1HRV3 4IESA 2AYHA 3C3VA 1COV3 3VBFC 5FAXA 3S6PA 4AEDC 3E5QA 3VHRA 2Z5WA 1IS6A 1EAH2 2GSYA 2UWBA 1CAWB 1PIV1 1QJY3 4RQPA 4HPKA 4Y24A 3SHRA 3MEPA 3GZAA 1AR62 4XXAA 3VHPA 1PGL2 2D98A 5BNNC 2GNMA 1IPJA 4TYSA 3B9IA 1VLNA 3HAGA 4JGZA 1H2LA 4B7KA 3R05A 1JHNA 2UU8A 4GALA 1UU4A 4YGCA 1BBT3 3KLSA 4S2DA 2UWCA 2IFRA 2XL9A 4P5HA 4LULA 2RHPA 5HXVA 1APNA 4KQ7A 1BMV1 2RM21 2E7TA 4HKOA 2W0XA 2W68A 2HWC1 2RS11 5KWRA 1N1VA 1EPZA 2YY1A 3NAPC 1QJU3 5KHGA 2NM1A 4L97A 5CU1A 5I0RA 2DCYA 1OLQA 1NQDA 3FLRA 5KBFA 4OZXA 4FPOB 4R4XA 2WZR3 3WCRA 2BUKA 4BHPA 1BZWA 3W59A 1CAUB 4FO9A 4DMIA 1TQ5A 3P3PA 2EVXA 2CV6A 2RR13 1POV3 2DU1A 4AQ2A 1O91A 4N7IA 3WG2A 3G6JB 5FLIA 4HSLA 4XEZA 1LOEA 3S30A 2C9AA 4B4RA 1PO23 5JVVA 3CNAA 3FC0A 1VB2A 1PZ9A 2D6NA 3CJIB 1BMV2 1SLTA 2DVAA 2RM22 3HD8B 4LNVA 4ZU5A 2HWC2 2RS12 3QH6A 1YNAA 4BMEA 1H8TB 5LRRA 4ZU7A 3AKRA 4AEMA 5KXBA 3DN7A 1TME3 5JWPA 2WT0A 1CONA 1O3SA 4CP0A 4MSVA 2WNEA 1GKBA 2GC0A 3PMEA 4Y4YA 1RUOA 1PO11 1RUE1 3EXUA 2VVDA 3QLQA 1KS5A 2Z79A 3ILNA 4OLLA 1EY2A 3CO2A 3D0SA 5JSPA 4K6BA 2V09A 5HCAA 5L36A 1F8VA 4R4ZA 1KQRA 5JIUA 3LWCA 1CPMA 1VALA 3H1MA 1REDA 3VHOA 4PDWC 2LUWA 3VZLA 5T52A 1ZZ9A 2ZJCA 1G6NA 2BVVA 3WDYA 3NWKA 3UL2A 2V5YA 1AL23 3AKPA 4XFAA 4XF9A 5A32A 1W6MA 2RS53 2PN5A 1RVF3 4EROA 1RUE2 4KWKA 4I09A 4U36A 2OZJA