1S2KA

Structure of scp-b a member of the eqolisin family of peptidases in a complex with a tripeptide ala-ile-his
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
206
structure length
199
Chain Sequence
TVESNWGGAILIGSDFDTVSATANVPSASGGSSAAGTAWVGIDGDTCQTAILQTGFDWYGDGTYDAWYEWEVSITISEGDSIQMSVTATSDTSGSATLENLTTGQKVSKSFSNESSGSLCRTNAEFIIEDFEECNSNGSDCEFVPFASFSPAVEFTDCSVTSDGESVSLDDAQITQVIINNQDVTDCSVSGTTVSCSYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Scytalidopepsin B
publication title The molecular structure and catalytic mechanism of a novel carboxyl peptidase from Scytalidium lignicolum
pubmed doi rcsb
source organism Scytalidium lignicola
total genus 44
structure length 199
sequence length 206
ec nomenclature ec 3.4.23.32: Scytalidopepsin B.
pdb deposition date 2004-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01828 Peptidase_A4 Peptidase A4 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.700 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1s2kA00
2IFRA 2IFWA 1S2BA 1Y43B 3TRSB 1S2KA
chains in the Genus database with same CATH superfamily
1LR5A 3R4DB 3WNMA 5A3MA 4D6QA 1OI6A 3ORJA 3SMHA 1AR61 4V2VA 2XXZA 4XFFA 5HV4A 2VNVA 4LPLA 1D4M1 1AJKA 3KQ4B 2OQ6A 1V70A 3POIA 4L9BA 4TLFA 2TUNA 5DPNA 4Z07A 3ZYRA 4JGYA 3CMGA 1U0AA 5GKAC 3JZVA 1PIV1 1JYXA 3H0OA 3HNMA 4ZKTB 2JE8A 4BE3A 5JR2A 1W8WA 1W0OA 2I2SA 2IZWA 4L92A 1EAH3 3LSDA 5FMOL 3M3CA 5LRRA 3WNKA 3Q8CA 2GZWA 4C0HA 2UWBA 4UF0B 2VBBA 4YGDA 2QQWA 2I45A 2ZABA 4LXLA 3AKQA 2WNVB 4JRLA 2BVVA 5FP8A 5DZGA 1D4M3 4YZ5A 2E32A 2FQPA 4DINB 2VJXA 3J26N 3K77A 3MLKA 3QACA 5I8SA 1HB2A 1IHMA 1PHMA 2WZR3 1ULEA 1XC6A 2ZEWA 3AYDA 4NWWA 4A2UA 1JW6A 4E4ZA 2VPVA 3JXSA 2XJPA 2ZZQA 4E8CA 5EFUA 1LTEA 1MVEA 3KWVA 4BIOA 2FBEA 1OVPA 1CAXB 3JB8A 3S5AA 1RINA 1KJRA 3SCHA 1VBE1 2WR9A 1RUE1 5LWBA 4Y1ZA 3TNQA 5EZWA 2DVBA 3I2OA 2D6KA 1XSRA 1W9WA 1ZA4A 4FSJA 1UN1A 3KGLA 3GHMA 4W6WA 3VDDA 2EXIA 5FYIA 1L7LA 4PQ9A 5F5QA 3OGRA 4XMIA 3WXPA 3USSA 2VCMA 3T0BA 1SG3A 2DBNA 5I0RA 3MV11 4WZCA 1V6LA 1UZWA 2ZGQA 4Q1RA 3AMHA 5J7MA 4PIYA 5I0SA 3AX4A 4RQPB 2YFZA 1ZVFA 4E2SA 1SBDA 2ZX1A 3Q8AA 2E53A 4YG6A 2PMWB 3KVAA 1HW5A 2B9UA 4IEOA 5HCBA 3W5NA 1JU4A 1QJY3 1QNWA 4UW4A 4HL0A 3N9QA 4NHXA 4KI5M 1RUD1 2HLEA 3H8UA 5FUIA 1ENSA 4K7JA 3DKWA 3TNPB 4AOCA 2VW0A 1XNBA 1NOVA 4BH9A 1QJX3 2DCYA 2IWGB 3LE0A 1AX2A 2HWE2 3CZJA 2ZA9A 1D7PM 3FFZA 1DG6A 1HRI2 5GLTA 5KC6A 5CB7A 3OOXA 1YC61 5CFDC 2XR4A 4CCLA 2O0OA 3KV4A 3SCFA 4BQXA 3MW4A 1IKPA 1HRV1 1W2OA 2A3YA 2VMHA 3FBYA 4UFLA 5IWFA 5FR3A 2ZEXA 5GLZA 4XFBA 4C0BA 4FAHA 1NCRA 4I02A 1T2XA 1VBC3 2ZGSA 4M01A 4B4QA 1SEFA 4YYOA 4CA9A 5LB6A 4MXWA 4CEWC 3ETQA 3NKGA 4YGCA 2W1UA 3AL5A 4GH4C 4K1YA 4YW3A 5E6HA 5ABJC 1IS6A 1JODA 4O61A 5FY7A 1G9FA 5FK7A 1GWKA 4QU2A 3WCSA 2R16A 3MDPA 4QM9A 1DGWX 1CQ9A 1N47A 2NLRA 4ISQA 4Q4Y2 1L7RA 4KU8A 5HXVA 1W8NA 4JHZA 1ZZ6A 4J6GA 1LKNA 1HRV3 2BYVE 1YFYA 5C5UA 5DMYA 4LO8A 1XOYA 5L19A 1PGSA 2CGNA 4PIZA 3SITA 3USUA 1W8HA 1Z7S1 4RS5C 1VBB2 3ZSMA 4Q27A 2E6VA 1NCQB 3PIGA 5DXDA 1UOJA 3CL1A 3H3ZA 2KXLA 3MUZ1 3BB6A 1K5MA 2J1EA 3ZYBA 4AEDA 2G4IA 2RS51 2XUEA 4HKOA 3WEZA 5JXHA 4HLTA 4LO6B 3KF3A 4K8FA 1OQDA 5A7WA 1J1LA 4D94A 5HBAA 4QPYA 4TXWA 2JDNA 4M3CA 2ETEA 4Q4V2 4IV3A 1GBGA 3KT1A 5DUUA 4MADA 5F3CA 4QQLA 5FP3A 2QQPA 4BQ4A 1W90A 5FBJA 2P2KA 2CWSA 4OUEA 1FMD3 3WZ1A 2VU9A 3ENRA 4Y24A 3RNSA 2VGDA 1N3QA 2XL9A 1QH6A 2VMEA 4JCKA 4AVAA 1N3PA 2JENA 4UYBA 1UKRA 3DF0A 1KRIA 5D8AA 4BHPA 2WNEA 1CAUA 4UFJA 4YW5A 4YSFA 4XBNA 2JB8A 1G7YA 1T6GC 1ULFA 1PGW2 1GOHA 1BYHA 4BISA 2WO7A 4COVA 4LR4A 5HCAA 2VOTA 4YVWC 3AFKA 4XXPA 3AP7A 1JHJA 2W3JA 3J7MA 4FOQA 4AFBA 4CDQC 3ALQA 3D8CA 4YW2A 1QEXA 5BXXA 3IAQA 5KXEA 1MQTB 2WA4A 1S2KA 2HYXA 1E5IA 5FY4A 1LGNA 3DUIA 1DQ6A 1K5JA 2FCUA 2P37A 3TWIA 4JDNA 4W65A 2BZDA 5DG1A 3VDCA 2VY0A 1DQ0A 2GDFA 2ZGPA 1W0PA 2ZMKA 3WW3A 5LK5A 2RJLA 5BNNB 3JD73 2W39A 3ZXKA 1FOD2 4QPGB 3VV1A 4H14A 4RR3A 2A5ZA 1W6MB 5FY8A 4OUMA 2BPA2 2GMPA 3M7AA 1C5IA 1AL23 1PNGA 2QQMA 3V0BA 5IK7A 3VHPA 2R0HA 2IVJA 1BEV1 2ZEZA 2DTYA 1FV3A 1O4TA 3BPZA 5FXWA 4FAGA 5A32A 5C9AA 1RVF3 4NIHA 2CHHA 1YQ8A 1CJDA 2WUHA 4PIXA 4QXKA 3WDVA 1Y7BA 1FAYA 2VZ1A 1Q8VA 4EJRA 4XJUA 1W9FA 4DUWA 2VNGA 1ULCA 1WCKA 1XYPA 2ADEA 2XH6A 4UI9L 4YNIA 4HBNA 4NIIA 2QZ2A 1XNAA 2FD8A 4XFHA 1W8OA 4RHV3 4LO4B 3ITQA 4PLNA 1UQXA 3RVHA 4AFAA 3POSA 3KF5A 2WINB 4UBHA 4NOTA 1A8DA 3UGHA 3WVJA 1SDDB 3BIWE 4IEXA 3ZVXA 1RUJ2 1X8MA 1MEC3 1VMJA 3ZM8A 5BNQA 4LBOA 4F83A 2GMEA 2JDAA 3WF2A 1E5SA 3NV4A 4MVTA 1RUI1 1SFYA 3K3NA 5CADA 4RGKA 4ZU7A 4P9YA 3I3DA 3FMGA 2G19A 3ACHA 2YBKA 4GMP1 3QOPA 2UYBA 4MGTA 2V5DA 1F4HA 3MUY1 3R0RA 1ZZ8A 4AAXA 1JZ8A 5IK4A 3AZXA 3C2UA 4COUA 4I01A 3ST7A 2EF6A 3PUAA 1VRH2 1O91A 4AI9A 4TN7A 3U75A 2LRPA 3U10A 4E4DX 4QB1A 3ES1A 3K75B 1YCIA 4Y4YA 1VPHA 4MGIE 3WG2A 2XDVA 2E51A 1LU2A 3PTRB 4KGGA 4MO3M 5BYNA 1DYKA 5HCHA 1NUKA 3G6JB 4JKKA 4JGZB 4P9IA 4M3CE 3VBOA 4QAWA 3UESA 3CU7A 2C1FA 3VD9A 2XQRA 3LD8A 1AR93 2OIIA 4FPEA 3VBRA 2VO5A 2WFF2 3ZXLA 1PO11 1ZBA3 3UK9A 1AYN1 5EYYA 2RDSA 5GZGA 1PO23 1SACA 2QQJA 4IGQA 4FFIA 2VM9A 1J83A 3POWA 4LO5B 5GLWA 4F3JA 2VQUA 3MBWA 1I5PA 4QKDA 1GOFA 4A44A 1UIJA 1IOAA 3W59A 2QQKA 2ZHMA 4QPWA 4IE4A 4XQ4A 1V6KA 1DFQA 4JVAA 4CU7A 1T6BX 4I30A 2FDIA 5FK8A 1LHWA 1TME2 5LBBA 1YHFA 5HV0A 4N43B 1WZXA 3GJAA 3RWKX 4YVSC 5FYYA 4LKFA 3MW2A 4CUCA 1AYN3 1GZ9A 2DCZA 1AVBA 1VMFA 4C1XA 1CR7A 5JIAA 3ZYPA 4IEUA 3K48A 5F3GA 5F3EA 4XZUG 4IQPA 4EWDA 4MGZE 4YW6A 2AACA 1POV0 1RUF3 4KQ7A 1DGLA 2BRTA 2BU9A 1GR3A 4G3YC 3WP3A 4AI1A 5BY5A 5HI0A 4Y5TA 1W6QA 4Q0VA 1JZ7A 1OXCA 5J09A 2CWMA 2ZX4A 3WD5A 5C70A 5AFBA 5EHDA 5FFOC 4XDPA 2EIDA 1DGWA 4UFIA 1WLWA 5FQ0B 4XFIA 2TNFA 1UOFA 2W87A 5L9BA 3WX5A 5JZGC 1WLCA 4PDWC 2SBAA 3KM5A 1HB4A 4FPGA 2VUCA 4QKBA 3BI3A 5FZOB 2HWD2 1OF4A 2ZMNA 5FZ9A 1SLIA 1EV13 4LNVA 5FUNA 2RR13 2J1UA 3HNBM 2ENRA 2ZKLA 5FZAA 2Q1ZB 4QXCA 1LU1A 5CFDA 1H9WA 3N7LA 3D6EA 1XSQA 4BK4A 3ZMNA 4CDWB 4XUOA 4QX0A 2JB4A 1COV1 2L9LA 2RS12 3CIHA 2ARCA 3IPVA 2WRAA 2HBTA 3NV2A 1RUC3 1SBEA 3ZFGB 4AI3A 3MEPA 2RM23 2SLIA 2XBO1 3WF1A 4CEWA 5J48A 4Y1YA 1FOD1 5K0UB 3JQXA 3IZOA 3RZMA 1BHGA 1KFXL 5LASA 4GH4A 4XBQA 4CDUB 2VOVA 5T3NA 5ABJA 4XPVA 1C8M3 3GNEA 3H8OA 3AFGA 2F4LA 2XHNA 2VUJA 4QT6A 1GWLA 2QQLA 1UYYA 3VN4A 4GB32 2HWF1 3B02A 1IG3A 1COV3 2P4EA 1UW8A 3Q8FA 4EE2A 3OF1A 4FPCA 4RS5A 1R1A2 2G9GA 4D0QA 3M3IA 4XUTA 1K42A 1W2AX 1FPN2 4CCCA 4LE4A 3N9MA 1TG7A 1BK0A 4EQVA 3HD8B 1OQ1A 2P5BA 3H3LA 1X9PA 1CJPA 2R061 2VZVA 1U5XA 4LMFA 1VAVA 3U11A 3V56A 2ARAA 3RSJA 1OA4A 5ACA3 1GICA 3K4ZA 4JDOA 5FYBA 1Q43A 3OBZA 1POV3 5AFEA 3I2DA 4Y33A 1UU4A 1D4VB 1EUUA 1HV1A 5FY9A 4A41A 5FZDA 5FY0A 5A7OA 4P5YA 4QQPA 5K4LA 3RI8A 1ZA7A 2RDRA 1LGBA 3N9NA 1LB2A 1HDKA 5EJZB 2Y34A 3KHBA 5I0UA 2Y0IA 3QD6A 3H8RA 4ZU5A 4A45A 5A6YA 4PJYA 2YY1A 2OZ6A 2XLFA 2JIGA 1APNA 4WVMB 3PNAA 3M70A 4XE9A 4COWA 4YVWA 1ZZ7A 4PF5A 3M8LA 3J8F2 4XEZA 4CDQA 4A4AA 5JOZA 3X29B 2DUPA 1JH5A 4EZ4A 2ILMA 1V6OA 1S2BA 5FYMA 5LW9A 3AL6A 3OB8A 3UJOA 4NIGA 2O14A 2XOMA 1NLSA 1F15A 1Q56A 4C90A 2ARBA 2PLV2 4HETA 1YQ6A 3S30A 3U78A 3NV1A 5DAQA 1BK1A 3RZGA 1ULPA 1BXHA 4LUMA 5EXOA 4KG0A 4BCUA 3KLSA 3NNGA 5FBZA 3UL2A 2WKKA 4XBLA 3A0NA 4AGGA 1IPKA 2RMU1 1OD5A 3WW2A 2GP3A 1IKQA 3OSDA 3LEKA 4MGYE 2Y60A 3JBG2 1F8VA 5C8CB 4H7LA 1QJU3 2ZHKA 1BQPA 2BWCA 5CFCB 3AJYA 4CU6A 1H9PA 5FXZA 4AQSA 4OLLA 3VDDC 4AI0A 1XXNA 2GSYA 2TBVA 2W92A 2XVLA 3RJ2X 5I0DA 4XDOA 5F1RA 1CZVA 1ULGA 4AEJA 2A1XA 3PUHA 5T55A 1F2NA 1Z0HA 5LBEA 3B9IA 1U5IA 3ZOIA 3MIDA 3R05A 1R083 4ZS3A 1UMIA 4E2QA 4MXVA 1KDMA 3T4VA 1MZFA 4JQTA 4CCOA 1TQ5A 2XWJB 1JN2P 2EALA 4OULA 5TSWA 4NHKA 4S2DA 3NAPB 2PA7A 1F35A 3LIGA 1JTZX 1QMJA 1C8NA 4HK9A 4QU1A 3VBUA 2HKXA 2C5DA 2PFWA 3PMSA 3CJIC 2V4VA 1W8UA 1U5ZA 1XB9A 4XF9A 4LBLA 4AGVA 2YBSA 2VNOA 3F2ZA 3KV9A 2V73A 4F8AA 1VRBA 3WNNA 4AQ6A 5C3RA 1NA1B 4FPYA 3I3MA 2BTVC 3K4DA 1AR62 2LW8A 4FCAA 4DEVA 2FZ1A 1WW6A 5F6LB 4IE0A 2JDUA 1D4M2 3DPRB 4CP9B 4YARA 2C0ZA 3H1MA 1ZZBA 1BBT3 4CCMA 1VP6A 1PIV2 4XURA 2IXCA 2R30A 2WS91 3A7QA 3SQOA 1JMUB 3QLQA 4XJ9A 1OC1A 1AYM3 3FHQA 2NN8A 4ZXEA 2R041 1YIFA 2Q8EA 2DYCA 3J4UH 3DYPA 1O3TA 1M4WA 4QDRA 1NE4A 4H7MA 4AVVA 2W52A 2D7FA 2B39A 3BCWA 3KT7A 4IE6A 3ZFFC 5JOXA 1DCSA 1W3XA 4WM7B 3M2MA 4IEYA 4MV2A 4BB3A 4NRPA 3TN93 2VVEA 3DEMA 5DG2A 2I74A 5T52A 2AEYA 2AYHA 2Y6FA 1POQA 3LEGA 3OUHA 4MSVA 2IUWA 4DNYA 5JDBA 1HQLA 3HN3A 1K5MC 3MIFA 1WLDA 2AENA 2E63A 3F95A 4K3UA 4CRQA 2RE9A 3OTFA 1WBFA 2GU9A 1MS0A 3ACFA 1H2MA 1V6JA 2XHKA 4HK8A 3T1MA 1OSGA 1GMMA 2YU1A 3GBFA 3A4UA 4LKEA 3K2OA 2XJSA 1VBE2 3EYPA 1RUE2 3FJSA 1LECA 3I2JA 1H8VA 4QB2A 2F6BA 3PVOA 1XU2A 5F8PA 4YVSA 2QQIA 3MHZA 2Z79A 2E7QA 2Y64A 4OHZA 2YYOA 2VTXJ 2J1SA 3CKHA 3PHMA 5KHJA 5DUWA 2KD7A 5EQUA 1LHNA 4UWDA 1QQP1 1J59A 5D21A 3RZJA 1AR83 3R6SA 3AP9A 5A6QA 4UFHA 5IW0A 5D8AC 4IL7A 2UWCA 2X5IB 4P9JA 4XJWA 4CEWB 5DDJ1 1FXZA 2A6YA 3O7OA 3W9AA 4Q4W1 5IFPA 3PURA 1TMF3 1UWWA 2RVAA 5BNPC 2Y0OA 2GN3A 4RFRB 1W8TA 1AXYA 1D2QA 1KFUL 2VC9A 4YRDA 4AYUA 1HN1A 1NAEA 3HJRA 4RYDA 4XILA 3ZKUA 4EN8B 5JZGA 4FT8A 1RUD2 4PDWA 3EHKA 3GBGA 2J1TA 3MLJA 2XUMA 2WZ8A 2J22A 2ZX3A 4FTBA 3IM0A 1RHI1 4L99A 1ALYA 4OHVA 3VKNA 2ZKNA 1RUG1 1LOFC 1Y9QA 4LT5A 1R091 2MNGA 1C5HA 1CONA 2ZGNA 1RMU3 3O0VA 1PX4A 4Q4W3 3VHOA 3OPZA 2JKBA 1HRV2 2DFCA 3IMMA 3INAA 1PK6C 4XF0A 5JUVA 1SLBA 3QCWA 4O9EA 3GJBA 5A7NA 3H1YA 1V9U1 5A3OA 3J9SA 2IFWA 1HIXA 1US3A 1YO8A 3LZZA 2VVFA 2JG8C 1LAJA 1JZ4A 3OUIA 1RHI3 4XF4A 3JUUA 3I97A 5IJRA 3WNOA 4FI9A 1SPPB 4YM1A 1UYXA 4W6XA 5FYSA 4DRRA 2A6WA 4GA9A 3AYEA 5FPZA 2HWB1 4XHXA 5C9AC 2ZX0A 1S0EA 4FP3A 2Q8CA 5H9PA 3WNXA 1JYVA 1NKGA 3AM2A 4Y22A 3FLRA 3OD0A 1UYPA 5C4WB 1V9U3 1WKYA 3AB0A 3AZVA 1Z7S2 4HSJA 5CAZA 5GLUA 3WW4A 3BTAA 2DBIA 3WQ7A 2IC1A 3W58A 5EYXA 2R073 3T2OA 4QPIC 2RS52 4FQZA 3BIEA 1IPJA 4YVWB 2JKXA 2GNTA 1YFWA 3B9CA 3ACLA 3K51A 2HWB3 2HWC3 1W28A 4CP1A 1GQGA 3B69A 1CPNA 1X82A 4LHNA 3WSOA 3LB9A 1UAIA 2CGOA 2W1WA 2YC0A 1EAH1 4JV4A 5L7OC 4LEJA 1LCLA 4CUGA 4R9DA 3H8XA 2FDJA 4D6SA 1QY4A 3HAGA 1OFNA 5FZHA 1UY1A 3U07A 2ZGLA 4FFGA 1XNTA 5FYZA 5IVFA 4Q0QA 1CAWB 2GC0A 4IEWA 4HXCA 4XABA 3RJRA 1YYNA 2WNUB 1RUH1 5CG9A 2Y38A 2WO3A 2WZR1 4QXHA 2QKDA 2FHRA 3VBHC 1GKBA 4W50A 2VZSA 2VVDA 1LENA 4GZ9A 4AQ2A 1CX4A 4CDXC 4D7SA 2AREA 4FO9A 5H9QA 1S1AA 3HNYM 1ODMA 3P3PA 3LA7A 4B3NA 2ZHNA 3S0MA 3VBOC 2D40A 1EPWA 4OZOA 3WY6A 4OQ8A 3TOJA 1WCUA 3T2QA 3NNLA 1RUH3 3ZFEB 5DUXA 2WDBA 3VBRC 4AL9A 1ND3A 4ET7A 2XMLA 4A6OA 1SCSA 2OQ7A 1PNFA 1XRUA 1JYIA 3ZYJB 2OT7A 3DCQA 3OJBA 3KHCA 2RS31 3TRSB 2RJ2A 3WOGA 4AVTA 4XACA 3GGLA 1TEIA 3O14A 4WM8B 2C9KA 4RGAA 3S7EA 1K12A 4OI1A 2UY9A 3RMXA 4RSUA 4PBOA 2R6QA 2R7EB 4M00A 4I3GA 3OPTA 4Y5SA 4BOWA 1IZ3A 1EUTA 1W9YA 1QOOA 1GP5A 1HX6A 1QJY1 2MEV3 2XKPA 1NLQA 1O4YA 2IFRA 2Q8OA 5C33A 3LSEA 5JOWA 1BEV2 4UXAA 4D69A 1WMFA 1OD3A 2RS33 3OBTA 2VNRA 5T5JA 2O8OA 3NV3A 5T54A 4Z8BA 4XUPA 1W9SA 4CCKA 4OVEA 1QJX1 1MEC2 1ZBE3 2WAAA 3MIEA 2DCJA 3O1VA 3RZHA 3FFQA 4BJ0A 1CWPA 1R64A 5FWJA 1IQDC 1WA4A 3SEPA 1ONAA 2ZEYA 1GWMA 3SHRA 4NAOA 2A71A 1CVNA 3PL0A 2JG9C 3VBSB 2CU5A 1PVC1 1VBC1 1G9CA 3KV6A 2JDZA 1OLMA 2YZ4A 3PMEA 5IAXA 1HN0A 1C4RA 5L36A 2ZXQA 3AMMA 1W04A 3AP6A 3V0AA 3CJIA 2QDRA 2QUOA 5CZKA 1NY71 1RUI2 5FPAA 2QQVA 2ZPXA 1W06A 4HOOA 1JUHA 2ZMLA 4LIUA 3N7MA 4MLOA 1Z78A 4QHZA 4RA0A 3NL1A 3UKVA 1EYBA 3WW1A 4EN6B 3O1UA 5CISA 2QCSB 5JOYA 1PVC3 4J1XA 3AZZA 5J96B 2X29A 5A6ZA 1UXXX 3KB5A 4CXWA 3AJZA 1SZBA 2VOWA 3WDUA 1UMHA 5GJ6A 1TZOA 1DGRN 1TNRA 1H2KA 4XHBA 4ORFA 1OOPC 1ASJ3 5T5LA 4YZ1A 3IAPA 2EIBA 4MUVA 2VD7A 2WT1A 3EB7A 1XYNA 3OY8B 4X8NA 3T08A 2ATFA 1SFNA 3ZFFA 4G9SB 1ZRIA 5KR7A 1PO12 4Y3OA 5B4XA 1FNYA 2W5FA 4CEYB 1NZCA 1AYN2 1PVXA 1FMD1 4QXBA 2BFUS 5IVJA 4TZDA 3RZKA 1QXRA 4IXLA 5G04L 3ZPYA 5LY2A 1UD1A 1B09A 3LF7A 3ZR5A 3M4FA 4DY5A 4HN1A 1UZVA 4GWJA 4AI2A 3JU9A 1JOPA 5C71A 1SCRA 1W0NA 1O3RA 4BMEA 1VR3A 1PMIA 1JOBA 1CX1A 3ACIA 3GCWA 1JYCA 5DQ0A 3ZYHA 2WWSA 3CDZB 3KGZA 1OPOA 2Y6HA 3FBMA 3L9JT 2XKOA 2ID4A 3NJVA 5IUQA 5KWRA 2OPKA 3BOPA 3DYMA 3ZX7A 1N1VA 4FPHA 1AXZA 4IEZA 4DEQA 1R1ZA 4QDSA 1OUXA 1YJLA 3AYCA 2D3PA 5F7UA 5A33A 2DCTA 1W2TA 2JECA 3ZN6B 1G9DA 3M3QA 2HEVF 1ND2A 3O1MA 1W6OB 1D0GA 2VZRA 3FX3A 4WBBA 5BNPA 1LHUA 1W6NA 3AXEA 1LEMA 1QWRA 2QE3A 1WA6X 4I0AA 2CAVA 2VE1A 3B7MA 2BNNA 5FO8B 3WLUA 2PXJA 3JD71 2H6BA 3AZYA 1C1LA 3ZYIB 1CAVA 2QNKA 3DKQA 1AL21 1LOFA 1E5RA 1QXPA 4K21A 4A7KA 3T2PA 2IVIB 5FZGA 2J7MA 1W6PA 4BWOA 2AGSA 4AHXA 1UO9A 4N8MA 1RVF1 3ACGA 4IV1C 3QH7A 1H0BA 1PK6A 5BNOC 1FNZA 3URFA 1JOJA 1UKGA 1COV2 3BU7A 4ARYA 1O3QA 1GZWB 4CP0A 2WFPA 5FY1A 5T50A 3PVNA 2XBO2 3R4UA 4Z2WA 4YZ4A 2JE7A 2JG8A 3E6BA 5LATA 2DVGA 2BERA 4P14A 4X6QB 4QD2A 2EXJA 3CQOA 5F3IA 4RHV1 3L2YA 2RJKA 4BMBA 4A7ZA 4XQWA 5GZEA 3GXUA 3K4AA 4COZA 4Z1VA 1OLME 2P17A 5FZIA 3E6DA 2OW4A 3OYWA 2HWF2 4GWMA 4OI2A 3FUOA 3A23A 4GALA 2A7AA 5C3OA 1MEC1 1VAMA 3ZKYA 1MR5A 1I6XA 1QF3A 3H3UA 2JD9A 4JGYB 2BOJA 4QQHA 3H42B 3E1F1 1V0AA 4QPIA 3TYJA 1E5HA 3VZMA 4HT1T 2C26A 3AZWA 4AEKA 4Y20A 4EWAA 3VDAA 2NZ9A 3WT3A 1F9KA 4ASKA 2R062 1A34A 5FZBA 2EIGA 3PJQA 1XBFA 3VBUC 2E9QA 4XW3A 4NE9A 1UL9A 4QQ2A 3VKOA 1JS9A 2WNVC 4AVSA 3THCA 2A3XA 2ZCWA 5L7OA 2Z69A 4KWUA 3ZR6A 2A75A 2UURA 5DUVA 4BQ2A 2Y6JA 3KQRA 3T30A 5A70A 2JX9A 1NZIA 5FZLA 4RGGA 3ATGA 4MZUA 4SLIA 5JXGA 1AR91 5EJ1B 3MIGA 3NO8A 1F5JA 4CU9A 3EJKA 3KCCA 1ZBA1 5E16A 3PU3A 3HR9A 3WQBA 1PO21 3VBHA 3BTYA 4I0WB 4RFT0 4CDXA 1JZ3A 3W21A 1QU0A 5FOJB 5FRAA 2NM1A 3IWZA 4QX2A 3H1WA 3MIHA 4U36A 4YGEA 2YMZA 2DUQA 4Y4RA 4YG0A 3LEMA 3T3YA 3ZSLA 4Z2AA 3VDDB 1ZYBA 4DOUA 1S0BA 2QVSB 3VHNA 4NAMA 2ET7A 4HKWA 3IDCB 4LBQD 4KMQA 1S0IA 2WYFA 2W08A 4GKXA 2OUJA 2Q30A 1HB3A 2OS2A 4NWVA 3ZXFA 1AXKA 1QJZA 1VB2A 4BQWA 1REFA 2LUWA 4TSVA 1UZ0A 1O59A 1VJ2A 2D6OX 1XE0A 4GXLA 2RMU2 3KS7A 2NMNA 3SISA 1AZDA 4XQDA 4HVQA 1W8FA 2CTVA 1GZCA 1RUF1 2WO1A 4K8RB 5BPXA 4MH0E 4GJZA 1GYKA 3LDKA 3SXWA 1GLHA 3MIBA 2GAUA 1H8TA 2P34A 2AZ5A 3HVDA 3GCXA 2WABA 3CBNA 5GZCA 3VZJA 3I59A 4MYEA 3ME2A 4NHMA 4XC9A 2ZHLA 2ZTNA 4YLZA 2B4KA 3AVSA 3SLIA 1Q8OA 4AFCA 1UY3A 4D3WA 2BEOA 4J25A 1QGLA 2JDYA 3IDBB 4O65A 3LAGA 1RIRA 3C3VA 1EV11 2RR11 1NCRB 4LBJA 5EJ3A 1L3JA 4XFGA 1CIWA 4K20A 4MXWB 3WINE 5A7PA 1ZNPA 2PHTA 1YXWA 4V1PA 3MGUA 4DB5A 2VULA 5A1FA 5FPUA 2JG9A 3G7DA 2G1MA 1MS8A 3NJYA 2E33A 4CXXA 1SMVA 3T2TA 1ZRCA 4FFFA 4BM8A 2ERFA 1RUC1 2RM21 3LQCA 1OKOA 2VZOA 5FYCA 5C5TA 3MI8A 2D6NA 3N35A 4P08A 4CPBD 3VBFA 1C8M1 1YFUA 4ASMB 1ZREA 4RD7A 1CESA 3USUB 1HJFA 4NN0A 5F5IA 4CP2A 1NCQC 5FP4A 1XE8A 4ZS2A 1NQDA 4BU2A 3U37A 3IBMA 2VR4A 1K5MB 3UGGA 4AEDB 4BIFA 2YUEA 3H50A 5FZ6A 4AI8A 4QX7A 1KJLA 4DRVA 2BGCA 4LE3A 5B4NA 4PF1A 2D6LX 2PHFA 4JHTA 1DGRA 2A6VA 2WS92 1LOAA 1WD4A 2H6CA 4XMAA 5A7WB 3SH4A 5C6CA 1YI7A 1JYTA 4M3CB 2J1VA 2HJIA 3OGVA 4IV3B 5HCFA 1OOPA 2EXKA 2R042 3D3AA 2Y6LA 2GMMA 3J7HA 4JAAA 4QHBA 4ZU4A 4AXOA 1OUSA 4UOJA 3B3QE 1A6CA 2VAUA 1O3SA 3S57A 1W05A 2D5FA 5ACA1 3P1IA 1SQ4A 2K0GA 2K46A 1Q5OA 1POV1 1WW4A 2XJRA 1UPSA 3KCYA 1Y4WA 2MPFA 1DF0A 4N7IA 3T09A 4CU8A 4FOWA 3W20A 2ET1A 5D8AB 1CAUB 2Z4FA 3AKRA 4HPKA 5C8WA 1S0FA 4QX8A 2OA2A 2VXJA 5LA2A 5J3UA 4NJ4A 1PGL1 1Q8SA 4GJYA 1UX6A 1JBCA 2JJ6A 3SH3A 2JXAA 2CSGA 2DV9A 2XJQA 3P6BA 3NNMA 2VZ3A 2WLQA 3WG3A 4IESA 2FZ2A 2P3IA 4WVZA 3GZTB 3FL7A 2HBUA 2PQQA 2WWJA 2VOKA 1GNYA 4NIDA 3VUOA 5FPLA 1QHDA 3THTA 5KXDA 1X8EA 2B46X 3WP6A 1Q3EA 5EIYB 1IGOA 2BWAA 3PUIA 2YFUA 5JPMB 3NQHA 1B35A 3E5UA 1QQP2 2R0FA 3FE5A 3SKJE 5C7GA 1X50A 3UT0A 3Q8BA 1A8MA 3C7GA 1PK6B 1VBA1 4QHOA 1VBD1 3O12A 5AC91 4KNCA 3H9AA 3WF3A 1LRHA 2B7YA 4YW7A 4HZFA 4URAA 2H0BA 2X10A 1GNZA 5DDJ2 4RR3B 4XXAA 4BQ1A 4QGMA 4Q4X1 4Q4W2 2KR2A 3NRUA 1AX0A 5J1XA 4N53C 1GP6A 3ZSKA 4E2GA 4JKLA 3V0BB 2DTWA 1OPMA 5IVEA 4ATFA 2YC2A 4IW3A 5A32B 5C9AB 5A80A 5FP9A 1QJU1 1EP0A 2BGOA 2ES3A 2QFEA 1VBA3 1RHI2 2R32A 4FXKB 2D5HA 1VBD3 5AC93 1MS1A 1RUG2 3OCPA 3RFRA 1ND3C 4YM3A 3JCIA 1R092 2GNBA 5LK7B 1OFSA 1AF9A 2VMDA 3B94A 5HXMA 5LY1A 4IV1A 2JWPA 3AK0A 4Q4X3 4XCAA 5BNOA 5JXJA 3J7LA 3RZLA 3GZAA 3UGFA 5FXXA 1CIYA 4NPRA 4Q0UA 3N9PA 1F5FA 4DXRA 1V9U2 3WUDA 1R081 2GP5A 1W2NA 5ANQA 1U12A 1XNKA 2WA3A 4S2FA 1NG0A 2D6MA 1JYWA 5E1RA 3U4XA 1Q8QA 1JI6A 4ATEA 1DLCA 2A73B 2F17A 1GQPA 1LOCA 1MZ5A 2FMDA 2BW8A 3IDAA 4OCTA 3WHUA 3K46A 1VRH3 4OHYA 2HWB2 1MZ6A 3O0WA 3IIAA 3MZHA 1N3OA 2YDEA 5A7QA 1WLTA 3C8XA 1REEA 4MGQA 1Y43B 3OGSA 1PMJX 2LM3A 2WYSA 5FMOS 1RUOA 1OLQA 3GZEA 4H55A 5F5AA 2WQZC 2BNMA 1DZQA 1WGPA 5FJHA 4XJAA 1H30A 5FREA 5FKCA 3WNLA 1RITA 4Q8KA 3BKZA 5JXIA 4UF0A 5A7SA 1BBT1 2EA7A 3PU8A 5KXBA 4TTGA 1YRZA 3NVCA 4JGZC 1V6NA 2WNVA 2Q8DA 1DYOA 3ZN5A 5M0TA 4QX5A 2VBPA 1GQHA 1W39A 2AR6A 2KA3A 3M1HA 5FMCA 1I3HA 3VBOB 5FPBA 1AYM1 2GALA 3O1RA 1EAH2 2EXHA 1PMHX 3FHIB 3D0JA 3N36A 4IERA 4R52A 5GLVA 3VBRB 5KHIA 4MX3A 5JI9A 1H4HA 5I0TA 1HLCA 3RDIA 2Q5TA 1VIWB 4BXSV 3WG4A 1TME3 1P8JA 4LA3A 4XDQA 1CAXA 1RUH2 1JYNA 1YQCA 3I49A 4YZ2A 5FOBB 1CPMA 2WZR2 3QH6A 5DAWA 5H9SA 3TN91 3B00A 3VD5A 1ENQA 2XPJA 1J3QA 4W6YA 2YXSA 1SLTA 3I2IA 3NJXA 2Q4SA 4E4SA 3V0AB 5CKQA 2LTNA 4N43C 2GH8A 3MFAA 4JQRA 3VB9A 3GALA 1QXJA 3VKLA 1J84A 4KU7A 3WDXA 2DU1A 4XFAA 1IS5A 4UBGA 1XNCA 3POGA 1LOBA 4LKDA 5I93A 4ES8A 3C7EA 2Q1FA 4YPJA 2VBDA 2WLPA 4BDVB 5JAXA 2VL4A 3HEIA 2F4PA 4KBZA 5FZ1A 4DXTA 2HEYF 5EP9A 5A3TA 5A1LA 1YLLA 4LK6A 5LA9A 3OUJA 4OZXA 4ZY9A 1RXGA 1WMEA 2D97A 2RS32 2HWD3 2YU2A 1W6QB 5FLHA 1AR81 3MPPG 1UIKA 2DWRA 3L2HA 4AFMA 1KXGA 2VUAA 4XETA 3O1PA 1NXD1 1NXMA 1FATA 1DHKB 3LPGA 3CLPA 4FPOB 1VB4A 1H2NA 2UWAA 3LWCA 3D0SA 3I4IA 3MLLA 2RS13 1TMF1 1V6IA 4QM8A 4BQ5A 2H0VA 3PJYA 3VD3A 3ILFA 1I5ZA 2VMCA 4Z82A 1QJY2 4FOVA 1G8WA 1ZX5A 4P9XA 5K9YA 1BKZA 3RQ0A 1A3KA 5CFDB 2JDHA 4CDWC 4ZZ8A 2VG9A 4NHLA 4QKFA 1QJX2 3GYDA 3IPVB 3ZFGC 4TWTA 4HN0A 2ZAAA 2R49A 4CYDA 5K0UC 1URXA 4GB33 1H1AA 1RMU1 4CDUC 1ND2C 4C8DA 1PM7A 2LS6A 4GH4B 5DZEA 4HVRA 5ABJB 3HQUA 5KXCA 1HKDA 1R1A3 5F2WA 1U5YA 3WDYA 1PVC2 3WUCA 3ZMOA 1VBC2 5GM0A 5IVCA 1YNAA 2BOIA 2CDPA 3LFIA 3ZXDA 2NYYA 5JSOA 3WDTA 3EBRA 4P9LA 2XVKA 2PHUA 3O0XA 1UZYA 3HWJA 4I09A 4LHLA 2CL2A 3R4SA 3VKMA 4HONA 4DUXA 1BVVA 2XQXA 4LULA 1MS3A 1AR71 2BJSA 3WP4A 4DXSA 4RS5B 1XPWA 3NW4A 1NCQA 1NY72 4LLFA 1UYZA 2YHJA 4M4PA 2X53S 4P02B 4ITCA 3CHXA 1LGCA 3PVEA 5JLVA 2YGMA 2A6ZA 4GWNA 4ZONA 4K9SA 4U2AA 4XUNA 2ZZJA 2QZ3A 4A3ZA 4EV0A 1RC6A 2JDKA 1GFF2 2FDHA 3N9OA 1PM4A 2R071 3THPA 2CNAA 5FZEA 1AR73 4N9IA 4Q2FA 2I07B 3SCGA 4D7YA 2YB7A 1W3VA 3N7JA 1AL0G 3VZNA 4XFCA 2HWC1 4EN0A 4MG2A 4FPLA 4FPJA 3GBWA 4N7UA 2WBKA 3J8F3 3UYJA 4GULA 3HOBA 3PIJA 2P3KA 3DECA 3POJA 2X09A 3AVRA 1UMZA 2RDNA 4OI0A 1Y9GA 5FYVA 5SV8A 1FMD2 4MOAA 3TB0A 5J98B 3THDA 2WO2A 3OG2A 2YBPA 2PLV3 4DXZA 4IGOA 1C1FA 4LHSA 5F37A 4Z92B 1W03A 4CDQB 1G9BA 3ABZA 3LGRA 4TLGA 1MQTA 4QWNA 1AJOA 1OQEA 3LIHA 1SHWB 3CF6E 4IUGA 3I2FA 3OEAA 2PAMA 1H4GA 2JE9A 4Q8LA 1O5LA 5A3WA 2OYZA 2Y26A 2XWBB 3AKTA 3ZXEA 1ENRA 3JBG3 4OMDA 4XTPA 4WZFA 4DUVA 3BYWA 5L9VA 3KVBA 1EPZA 4LA2A 2JICA 2OX0A 1RJ8A 3RZZA 1Y3TA 3AMQA 4CVUA 5BNNA 1GP4A 4L97A 3SNMA 4MGKE 4QPGA 3I3EA 4LOSA 5C8CC 5LA1A 1W6MA 2QQNA 1UU6A 1RUNA 3APBA 5CU1A 4N53A 5FYHA 5CFCC 3IB3A 3VHRA 3FWEA 2MHFA 3SKVA 4CTEA 4AQTA 3ETPA 1E57A 2XVGA 1RYYA 5CA6A 3JD72 4LORA 3I3QA 4IE7A 1QDOA 1MZEA 2ZBJA 3NMBA 4XZPA 1BCXA 3S7IA 3V65A 1WCDJ 4LBMA 1NYWA 4UW6A 1AL22 3IKWA 3IN9A 4RN5A 4Y5Z0 4R9BA 2MEV1 2GN7A 1GUIA 1MS4A 3CZUA 3KMHA 1RVF2 1HXS1 2CDOA 5DAPA 3BOWA 4UFMA 3ZPOA 4HANA 4IEQA 3RRDA 2FDFA 1X7NA 1ZBE1 2YPDA 4QGLA 3NAPC 2P3YA 3WCRA 3ZSJA 5I8YA 3DV8A 1QNYA 3ILRA 3VBUB 1AR63 4QB6A 3MFCA 5FZ3A 3NKTA 2JDPA 1RB8G 5B2GB 3POFA 4B29A 1H8TC 3LEIA 2IXLA 4RHV2 2FMYA 4XAAA 4BA6A 1MACA 2BV4A 1REDA 2WIIB 4NPMA 5IAVA 1PIV3 4CCEA 4B4RA 4FTSA 3AXDA 5CG8A 1EY2A 5JR7B 3C7FA 1NA1C 1FI2A 2IXHA 5DAXA 3BPSA 5JSRA 1HXS3 3IDEA 3P3NA 5FZMA 2W9XA 3DPRC 4PQQA 4X8PA 4BYYA 4NVPA 4DIQA 4JTNA 3B93A 3FZ3A 2E31A 2DUOA 4AHYA 2CAUA 4NPLA 2BBAA 4MHUA 2JDMA 3ASIA 3P5BA 2ZGMA 1X9TA 2LROA 4AAPA 2OVUA 1V00A 3BGAA 3GF6A 4D7TA 4SBVA 3OGJA 1ZZCA 3D5OA 4JGZA 4XF3A 3NWKA 4XIKA 3GDBA 2QQOA 3NNJA 2WL1A 1ULOA 1N1SA 3OBAA 5GALA 1JU3A 5AVPA 3VBFC 5F6KA 4EYUA 3ES4A 1J58A 4WM7C 5JCTA 5KHKA 2A70A 1ASJ1 5J36A 3KD4A 2FCVA 2FCTA 2ZJCA 4FQ4A 3TEYA 3RYPA 1VBE3 3U14A 3M3OA 2ZGUA 4JTOA 1RUE3 1WWYA 3AP4A 4XAEA 2CGPA 1PZ7A 1BMV1 4LITA 4I3PA 2XONA 5K7PA 1AR92 1NQJA 3H7YA 1ZBA2 2V09A 2ZAHA 5FMDA 5A3PA 1O4ZA 3AYAA 2IXKA 1PO22 1H2LA 2VMGA 4GIQA 3TEZA 1O5UA 5E89A 5LRSA 3VZOA 4N43A 5A3LA 4XCBA 3UETA 4IEVA 3DL3A 2UU8A 4E8DA 4PHZA 4YVSB 3TEXA 3KZ4C 5IYYA 4JRAA 3PUQA 4AW7A 1QH7A 2R1DA 3BN6A 1DQ4A 1W9TA 2Z2SB 2O8QA 5FMBA 2W1SA 2JD4A 3LKJA 3LOIA 1I9RA 5T5PA 4BLJA 4HSLA 1BLZA 5E8AA 5CKNA 3JB4C 5FJKA 1Q8PA 1STMA 4LUKA 2B9VA 2X5IC 2D6PA 1RUD3 1SFPA 4L8QA 3SC7X 5FYUA 4M0NA 4HMZA 1BJQA 3T0AA 4CCJA 1QIQA 4KH9A 5GZFA 5J37A 1PZ8A 3QBQA 1NE6A 2RV9A 3KCXA 3Q9OA 5APAA 3VKFC 2BDRA 2VCBA 2WAOA 4B7EA 1RUF2 5FQ0A 1ODNA 4DZGA 1UY2A 5JZGB 1BZWA 2HH9A 2JIJA 4KG8A 4PDWB 5FZOA 3H7JA 1FX5A 3NJZA 2B42B 5A3UA 4FVVA 1ZRRA 3BVCA 4A6SA 1OMIA 2VMIA 1WBLA 4Q0PA 5LZ6A 5H9RA 4LO7A 1XE7A 1UOGA 5JSPA 4DMIA 4EN7B 4LIVA 1B35C 4CDWA 5IK5A 2FDKA 4NROA 3A21A 5KC5A 3RWNA 5IVBA 3ZFGA 4B1MA 5G05L 1EV12 4P9GA 5FV3A 1JHNA 2RR12 5K0UA 5FZ7A 3EO6A 2QDNA 2NP0A 3UKNA 1TVGA 5KBFA 4PI0A 4CDUA 1GNHA 3LPFA 1WMXA 3K3OA 4HVOA 4LJHA 3RMYA 4ES9A 5LBCA 1Z7S3 1H6XA 4DFSA 1RUC2 4HKLA 2RM22 5FTTC 2P6HA 4OUSA 1YQ2A 3FC0A 1DQ1A 4J1WA 4LBQA 3N7KA 4O7XA 3T0DA 2P1BA 2RS53 4NRMA 3AKSA 2XLAA 2ZS6B 1C8M2 5SV5A 1NX9A 2DVAA 2IXJA 4Y22B 2DFBA 2YV8A 4YG3A 1MPXA 5BV6A 5C4WC 1D2SA 3LA3A 1OA3A 2ZGOA 2QQUA 2FDGA 1JXNA 1G9AA 3V64A 2CV6A 3NSTA 2VMFA 4FPFA 1H6YA 5JIUA 3VDBA 3ZN4A 5L9RA 1FYUA 3LFMA 3SEEA 4N90A 4UT5A 4OFGA 3RPQA 2D3SA 3DXUA 1DYPA 1QKQA 1XJAA 2ZGTA 3PUSA 4R9AA 4YZ3A 1RTVA 5FYTA 3ROUA 2DDUA 3GHNA 3PVBB 2HEWF 1UU5A 4FOYA 5A3NA 5ACA2 2QTWB 5EPAA 4W4ZA 1UOBA 4CUAA 4GMP0 1OA2A 3AKPA 2WNUC 5C3SA 1ZM1A 1S0JA 5FO7B 2K2SA 2PHWA 3RI9A 2XJTA 4WVMA 1M06G 3DN7A 2XG3A 4OHXA 1S0GA 2WJSA 2W2IA 1PGL2 2ZOEB 2P3JA 5FDBA 1S55A 1YEWA 2AC1A 4P00B 5FZ4A 5IHRA 4N53B 3JQWA 5FIXA 4CPBA 4R4XA 3ZYFA 2OZJA 1MVQA 1IPSA 4DY3A 4ARXA 3LA2A 3UV9A 1VALA 5KHGA 3ZFEC 1GANA 1FV2A 2JEMA 2VXRA 2D3RA 1ND3B 2R1BA 3OD4A 4EN9B 4L11A 1S0CA 4N9HA 2QJVA 3KV5A 1FT9A 4K40A 2ZX2A 4FPKA 4OI4A 5JI7A 1VBA2 1VBD2 5AC92 4WM8C 5ISLA 1BEV3 1XNDA 5C8CA 4QQOA 2TEPA 4QGNA 5CFCA 4Q4X2 1LOEA 4PI2A 3N3HA 3MPBA 4L0PA 5F2SA 4YGBA 2HWE1 3POYA 4AG4A 4YW4A 4LBNA 2VH9A 1IQAA 1HRI1 2W0XA 1DZTA 3AP5A 4DS0A 4FTEA 5C3PA 1OKQA 2PHXA 4UFKA 1F4AA 2Z42A 1QJU2 2ZGRA 3HN1A 1KDKA 1G6NA 2WWUA 2PELA 2D44A 1UY0A 1O8PA 4XJZA 5CEHA 5JPNB 4UAPA 2WSVA 5FUPA 1V6MA 2LALA 4RQPC 4PLOA 5CKMA 4COYA 3WQ0A 4LK7A 2WN3A 5FWEA 2NQYA 4AFDA 1QJFA 1X33A 1S0DA 2HWE3 1KS4A 3I3BA 3VBSC 3VZLA 4AZZA 2GC2A 1HRI3 1F31A 2VTFA 3NAPA 3RGBA 1RUI3 3FLTA 1R082 2XJVA 4Q4Y1 1J3PA 1VAKA 1WMDA 1TE1B 1SLLA 4GMP3 4NHYA 1DBNA 3FUQA 2J1RA 2PHDA 3I2KA 3CJIB 1ENXA 4GD4A 4G4FA 1KGYA 3OGGA 3TAYA 2XJUA 4BPZA 1VBB1 1LHVA 2ARXA 2P6CA 1NA1A 3WR0A 4B4PA 2GH2A 1DU3D 2PAKA 4W8JA 1MS5A 1OT5A 3TEWA 2W47A 3DPRA 4Q1PA 5FKBA 4CP9A 4CE8A 2DCKA 3VLBB 2YPJA 4AEMA 3DXTA 3CJXA 4UW3A 1BVP1 3OBRA 4Q4Y3 4R9CA 1ZRFA 5HPOA 3E6CC 4LKSA 2WSUA 1X36A 2W95A 4F7ZA 4Q4V1 2VW1A 2XB6C 3O5SA 5L73A 1S2EA 4R8HA 1PO13 1S4CA 1VBB3 1BBT2 3O1SA 4CSWA 5EWSA 3LDBA 4Q29A 5CIRA 4DPNA 2Q0AA 2VZQA 5CBLA 1AYM2 3BTXA 4WM7A 3ZFFB 2ZGKA 2VZUA 1WW7A 5FPVA 4CEYC 1YFXA 4OMCA 3SH5A 1CN1A 1QJEA 1JZ6A 3WV6A 4Q4V3 4K6BA 2E7AA 3HQRA 1PGW1 3MF6A 1KS5A 3PTYA 2W1QA 2BFUL 5FAXA 3BODA 3DYOA 5LEJA 3GZUC 4I0BA 2PTMA 2XLGA 2WQ8A 2B45X 1MS9A 4LLOA 4Y1XA 1C28A 1NLRA 5FPXA 1JZ2A 4NMIA 4CXYA 3D4KA 3TN92 1OHFA 2W91A 3RG0A 1OVSA 3FHAA 5C3QA 5CNAA 2PAEA 4FP2A 4EZHA 1OBNA 2V72A 2YGLA 4P5HA 3ECQA 1UNBA 2A3WA 2WT2A 1Y9MA 1JZ5A 2XGXA 1VLNA 3MYXA 2AEZA 1UY4A 1C3HA 2YROA 3EXUA 3LCPA 4BZ4A 2DVFA 4DQAA 2PHRA 4ZHNA 3EMRA 5AVAA 2AUYA 3I2GA 2Q1MA 4A42A 3PLQA 4B8EA 2BQPA 4OHWA 1TNFA 5D1IA 3BU0A 3I2HA 3T4HB 2X5IA 5A33B 3U4SA 1HB1A 2PYTA 3WF0A 4ASLA 1GSLA 2OPWA 1K3IA 4WV8A 1ND2B 5EV7A 2WZEA 5BNPB 3HT1A 1DP0A 1AR82 1J1TA 1W6NB 2GNMA 1UCXA 4AHWA 3ZXAC 2V4AA 2DVDA 4IEPA 2RG4A 1MQTC 2IXIA 5CVRA 4LBQB 1ULDA 4LOTA 5IVYA 5FO9B 3E97A 3ON7A 2PN5A 1TMF2 3AMPA 3RYRA 4XIOA 2J42A 4PLMA 1CAVB 2EIEA 4LBKA 5ANNA 2XBO3 1OF3A 3UKTA 3WNPA 1FOD3 2OXBA 1H1MA 4QX3A 1W6PB 2VW2A 4E9KA 3GM8A 5LA0A 2D98A 2OUHA 4IGPA 2DU0A 3A22A 1DZRA 3EQEA 1W8ZA 1RL3A 1DIWA 4GQ7A 4D8MA 5BNNC 1IS3A 1WCSA 4XUQA 2EAAA 4QPGC 3B01A 5FZCA 2JG8B 2HWF3 1RMU2 4META 4PT6A 3C7HA 1AX1A 1RUJ1 1O6UA 2WC2A 2VZTA 3A0KA 1SPPA 3AC0A 2BGPA 2X8KA 4XYXA 4NIAA 4B1LA 4LHKA 3FN9A 4JC1A 1KITA 4M3CF 1DLLA 1IG0A 4FFHA 4EWEA 4DO0A 3OYWB 5F5CA 3MV01 3D82A 4BK5A 2C6SA 2RDQA 1UPIA 3ZLIA 5FY5A 5C4WA 1A78A 4TYSA 2G9FA 1H1IA 1AR72 2R063 3UNPA 2K9ZA 4JGYC 3U0ZA 3FLPA 3HIFA 1VRH1 4WVVA 4LQRA 4XJ8A 1ST8A 2ORXA 1CD3G 3VZKA 4AK3A 5JMCA 1CGPA 1RUJ3 3OPWA 4QPIB 1WW5A 2WN2A 4AR2A 3W5MA 1UF2C 1WUVA 4Y20B 1G86A 1SLCA 4YFWA 4E4HA 2CY6A 2V5YA 5IK8A 5DN2A 1L7QA 1LHOA 3IMNA 2EAKA 2R072 5DAVA 3KT4A 3MW3A 4Q5OA 4Q0SA 4KWLA 2WFF1 3I7DA 4P9WA 5L7OB 2YG0A 3WHTA 1KQRA 4IDZA 2GC3A 2HWC2 3MF9A 3ZXJA 1CAWA 1US2A 4WVWA 4GAZA 3OEBA 1UZZA 2WNUA 2EICA 1SDWA 4XVHA 5KHHA 4QKNA 2PHLA 3WDWA 4AHZA 4CCNA 5K8SA 2J1AA 1LEDA 1W2UA 3HT2A 3VL8A 1D0HA 3VBHB 5A1AA 5GZDA 3NNFA 1TME1 1UXZA 2AH2A 4AF9A 1GV9A 2UY8A 1RXFA 4CDXB 1YIPA 2WFF3 3VGIA 2NMOA 3ZIWA 5IVVA 4IETA 4C91A 3KSCA 4ISRA 4AVBA 5ERLA 4M4RA 1HV0A 3ZDVA 2D43A 2E7TA 2PQSA 3E5XA 1ACCA 4JZRA 3ZFEA 2RMU3 1NT0A 3T1LA 2D93A 4XF1A 4XTMA 3RS6A 5FCCA 3WF4A 1YUDA 4IE5A 3ZO0B 1CZSA 2XL7A 4AGRA 4BXFA 3C7OA 4KL1A 5F32A 1QOSA 4ZXKA 1WD3A 1LESA 2A6XA 4CCDA 1YWKA 4B7KA 1OURA 4NO4A 5I91A 1GU3A 1SLAA 2W46A 4WM8A 4ZZ5A 1VE0A 1LJ7A 1ZZ9A 3MICA 2WZPP 3O1TA 1GOGA 4E27A 2HWD1 4R4ZA 1CZTA 1GZTA 1H8TB 1XYOA 4QDQA 2B8MA 2Y6GA 4ZPIA 1DDLA 3HQXA 3I59B 4M0HA 1KD7A 2OKXA 4PCRA 3BUCA 1LNSA 1IS4A 2BVBA 4O9GA 3I8TA 1LOGA 2RS11 4K1ZA 5D2AA 4YW1A 3POEA 5IATA 3CNAA 3LDRA 4RQPA 3ZIXA 1NCRC 2MEV2 2WQ4A 1I1EA 4INDA 3WG1A 4BQYA 1ZRDA 1YJKA 5LBFA 2UYAA 3WQ1A 4ONUA 1HXS2 3VBSA 2VTXA 2W94A 2JG9B 4HG6B 1O7FA 5F39A 3ZDSA 4D6RA 1ZBE2 4A7YA 4YFZA 4BLIA 4UW5A 4GB31 4NRQA 5DZFA 3N4MA 5FZFA 3BALA 4OQ9A 3VBFB 4KWKA 3CO2A 4MGSA 5LEKA 1R1A1 3WP5A 2ADDA 1AHSA 2WS93 1OLRA 1FPN1 1LULA 1DQ2A 4PBPA 4QMAA 5JWPA 3N9LA 2KM2A 2EVXA 2R043 4AEDC 1QDCA 4FXGB 4H2AA 4JKMA 2DURA 4S2GA 4FBFA 2BUKA 1HJGA 2G9ZA 5T5OA 2Y8KA 4AWDA 4IV3C 1HQWA 4AE2A 1WCQA 4V2WA 5DABA 2YC4A 2Y33A 3TBDA 1OOPB 5FLIA 3RYKA 1FPN3 3OY8A 1XQNA 2VECA 2W68A 4C1WA 2QBXA 3B5LB 2CYFA 1YQ5A 1VMHA 2GC1A 2N7GA 2C4XA 4CEYA 2C24A 3MO4A 1ASJ2 4KWJA 2ORZA 4I2OA 4Y1VA 2GNDA 2VCAA 4RL7A 2X05A 3POBA 3Q8EA 2C9AA 4H3WA 4HPKB 4Q26A 1K45A 4BQ3A 4MHRA 5E88A 3VL9A 1BMV2 3ZYGA 4YWAA 1HQNA 3IT8A 3J8F1 4X6RB 3ELNA 3CEWA 3LOBA 1YI9A 1QQP3 5IT6A 2BBVA 1PX3A 2VQAA 3VD4A 2VQ0A 2PLV1 2B5HA 1LODA 4L2NA 3S5QA 1N1TA 5IFTA 2NPIA 1DQ5A 1SBFA 4EROA 5DDJ3 5BUVA 4QX1A 1B35B 2ZACA 3BTZA 4GKYA 2BNOA 5FLJA 1J3RA 3HBKA 1W99A 3ZN6A 2VQTA 1JUIA 2E26A 1OH4A 3JBG1 4URTA 2DF7A 3UJQA 2VZPA 1W6OA 4NR1A 4RR3C 4CUBA 4JDMA 3HMYA 1RJ7A 4Y1UA 5FP7A 2VUDA 3I54A 5JMOA 1RUG3 2WT0A 1OH3A 3U1XA 2WNOA 3DGTA 5A6XA 1R093 1KEXA 3E5QA 4YM2A 5LCWL 4XOGA 5FZ8A 5FZ0A 3IIIA 3ZXGA 1QOTA 4JX0A 4YM0A 1PZ9A 4NUBA 4S2HA 3AMNA 3S6PA 5CYYA 4OYUA 4LTAA 5JVVA 1AUYA 3VD7A 2VOXA 2HYKA 4IV1B 5BNOB 3O1OA 1UX7A 1GZWA 4KGQA 1RGSA 1O8SA 4Y26A 5F9TA 2Y6KA 5I8TA 4HFSA 2BP6A 2Z5WA 3HPNA 4CZSA 3J7NA 4A3XA 2RHPA 1XU1A 3ILNA 4GWIA 5FZKA 2O1QA 3ZSEA 1C57A 3PDQA 4AVCA 1N1YA 2VCCA 4KBBA 3HBZA 3M3EA 5FXVA
chains in the Genus database with same CATH topology
1LR5A 3R4DB 5A3MA 1OI6A 3SMHA 1AR61 4XFFA 4TLFA 1D4M1 1AJKA 4L9BA 4Z07A 1V70A 3WG1A 2TUNA 3ZYRA 4JGYA 1U0AA 5GKAC 3JZVA 1PIV1 3H0OA 4ZKTB 4BE3A 1W0OA 2I2SA 2IZWA 4L92A 1EAH3 3LSDA 5FMOL 3M3CA 5LRRA 2GZWA 4C0HA 2UWBA 4YGDA 2I45A 2ZABA 3AKQA 2WNVB 4JRLA 2BVVA 5DZGA 1D4M3 4YZ5A 2FQPA 4DINB 3J26N 3MLKA 3QACA 5I8SA 1PHMA 1IHMA 2WZR3 3AYDA 1ULEA 4A2UA 4NWWA 1JW6A 4E4ZA 2VPVA 2XJPA 2ZZQA 5EFUA 1LTEA 1MVEA 4BIOA 2FBEA 1CAXB 3JB8A 1RINA 1KJRA 3SCHA 1VBE1 1RUE1 4Y1ZA 3TNQA 5EZWA 2DVBA 2D6KA 1ZA4A 4FSJA 1UN1A 3KGLA 3GHMA 4W6WA 3VDDA 2EXIA 4PQ9A 5F5QA 4XMIA 3WXPA 3USSA 5I0RA 4WZCA 1V6LA 2ZGQA 4Q1RA 3AMHA 5J7MA 4PIYA 5I0SA 3AX4A 4RQPB 1ZVFA 4E2SA 1SBDA 2ZX1A 4YG6A 2E53A 1HW5A 2B9UA 4IEOA 5HCBA 1QJY3 1QNWA 4UW4A 4HL0A 1RUD1 3H8UA 1ENSA 4K7JA 3DKWA 3TNPB 2VW0A 1XNBA 1NOVA 4BH9A 1QJX3 2DCYA 2IWGB 1AX2A 2HWE2 2ZA9A 3FFZA 1DG6A 1HRI2 5GLTA 5KC6A 5CB7A 5CFDC 2O0OA 3SCFA 3MW4A 1IKPA 1HRV1 2A3YA 2VMHA 3FBYA 4FAHA 5GLZA 4XFBA 4C0BA 1NCRA 4I02A 4M01A 1VBC3 2ZGSA 4B4QA 1SEFA 4YYOA 4MXWA 4CEWC 3ETQA 3NKGA 4YGCA 4GH4C 4K1YA 4YW3A 5ABJC 1IS6A 1G9FA 4QU2A 3WCSA 2R16A 3MDPA 4QM9A 1DGWX 1CQ9A 1N47A 2NLRA 4ISQA 4Q4Y2 4KU8A 5HXVA 1ZZ6A 4J6GA 1LKNA 1HRV3 1YFYA 2BYVE 4LO8A 5L19A 1PGSA 2CGNA 4PIZA 3SITA 3USUA 1Z7S1 4RS5C 1VBB2 3ZSMA 4Q27A 2E6VA 1NCQB 5DXDA 3CL1A 3H3ZA 2KXLA 3BB6A 1K5MA 4AEDA 2G4IA 2RS51 4HKOA 4HLTA 4LO6B 4K8FA 1OQDA 1J1LA 4D94A 5HBAA 4QPYA 4M3CA 2ETEA 4Q4V2 4IV3A 1GBGA 3KT1A 5DUUA 4QQLA 2QQPA 2P2KA 2CWSA 1FMD3 2VU9A 3ENRA 4Y24A 3RNSA 2VGDA 1N3QA 2XL9A 1QH6A 4JCKA 4AVAA 1N3PA 2JENA 1UKRA 3DF0A 1KRIA 5D8AA 4BHPA 2WNEA 1CAUA 4YW5A 4YSFA 4XBNA 1G7YA 1T6GC 1ULFA 1PGW2 4COVA 1BYHA 4LR4A 5HCAA 4YVWC 3AFKA 4XXPA 3AP7A 4FOQA 4AFBA 4CDQC 3ALQA 3D8CA 4YW2A 5BXXA 5KXEA 1MQTB 2WA4A 1S2KA 1LGNA 3DUIA 1DQ6A 2P37A 3TWIA 4JDNA 4W65A 5DG1A 2VY0A 1DQ0A 2GDFA 2ZGPA 1W0PA 2ZMKA 3WW3A 5LK5A 2RJLA 5BNNB 3JD73 2W39A 3ZXKA 1FOD2 4QPGB 3VV1A 4H14A 4RR3A 2A5ZA 1W6MB 4OUMA 2BPA2 2GMPA 3M7AA 1C5IA 1AL23 1PNGA 3V0BA 5IK7A 3VHPA 2R0HA 1BEV1 2DTYA 1FV3A 1O4TA 3BPZA 4FAGA 5A32A 5C9AA 1RVF3 1CJDA 4PIXA 4QXKA 3WDVA 1Y7BA 1FAYA 1Q8VA 4EJRA 4XJUA 2VNGA 1ULCA 1WCKA 1XYPA 2XH6A 4YNIA 4HBNA 2QZ2A 4XFHA 4RHV3 4LO4B 4PLNA 4AFAA 3POSA 2WINB 4UBHA 4NOTA 1A8DA 3WVJA 3BIWE 4IEXA 3ZVXA 1RUJ2 1X8MA 1MEC3 5BNQA 4LBOA 4F83A 2GMEA 3NV4A 4MVTA 1RUI1 1SFYA 5CADA 4ZU7A 4P9YA 3FMGA 4GMP1 3QOPA 2UYBA 3R0RA 1ZZ8A 5IK4A 3AZXA 3C2UA 4COUA 4I01A 3ST7A 2EF6A 1VRH2 1O91A 3U10A 4E4DX 3ES1A 1YCIA 4Y4YA 4MGIE 3WG2A 4KGGA 2E51A 1LU2A 5BYNA 1DYKA 3G6JB 4JGZB 4P9IA 4M3CE 3VBOA 3CU7A 2C1FA 1AR93 2OIIA 4FPEA 3VBRA 2WFF2 3ZXLA 1PO11 1ZBA3 3UK9A 1AYN1 5EYYA 5GZGA 1PO23 1SACA 3POWA 4LO5B 5GLWA 4F3JA 1UIJA 1IOAA 3W59A 2ZHMA 4XQ4A 1V6KA 1DFQA 4JVAA 4I30A 1LHWA 1TME2 1YHFA 4N43B 4YVSC 3MW2A 1AYN3 1GZ9A 2DCZA 1AVBA 4C1XA 1CR7A 5JIAA 3ZYPA 4IEUA 3K48A 4IQPA 4EWDA 4MGZE 1POV0 1RUF3 4KQ7A 1DGLA 4AI1A 3WP3A 1GR3A 4G3YC 5BY5A 5HI0A 1W6QA 4Q0VA 5J09A 2CWMA 2ZX4A 3WD5A 5AFBA 5FFOC 1DGWA 5FQ0B 1WLWA 4XFIA 2TNFA 5JZGC 3WX5A 1WLCA 4PDWC 2SBAA 3KM5A 4FPGA 2HWD2 2ZMNA 1SLIA 1EV13 4LNVA 2RR13 2ENRA 2ZKLA 2Q1ZB 1LU1A 5CFDA 1H9WA 3N7LA 3D6EA 3ZMNA 4CDWB 1COV1 2RS12 3IPVA 4YZ2A 3NV2A 3ZFGB 1RUC3 1SBEA 4AI3A 3MEPA 2RM23 2SLIA 2XBO1 5J48A 4CEWA 4Y1YA 1FOD1 5K0UB 3JQXA 1KFXL 4GH4A 4XBQA 4CDUB 2VOVA 5T3NA 5ABJA 4XPVA 1C8M3 3GNEA 3AFGA 2VUJA 4QT6A 3VN4A 4GB32 2HWF1 3B02A 1COV3 1UW8A 3OF1A 4FPCA 4RS5A 1R1A2 2G9GA 3M3IA 1FPN2 4LE4A 3HD8B 1OQ1A 2R061 1CJPA 3U11A 1U5XA 1VAVA 3V56A 3RSJA 1OA4A 5ACA3 1GICA 4JDOA 5AFEA 1Q43A 1POV3 3I2DA 1UU4A 1D4VB 1HV1A 4QQPA 3RI8A 1LGBA 1LB2A 1HDKA 5I0UA 2Y0IA 3QD6A 4ZU5A 4PJYA 2YY1A 2OZ6A 2XLFA 1APNA 4WVMB 3PNAA 3M70A 4XE9A 4COWA 4YVWA 1ZZ7A 4PF5A 3M8LA 3J8F2 4XEZA 4CDQA 5JOZA 3X29B 2DUPA 1JH5A 2ILMA 1V6OA 1S2BA 3UJOA 1NLSA 1Q56A 4C90A 2ARBA 2PLV2 4HETA 3S30A 3NV1A 1BK1A 1BXHA 4LUMA 5EXOA 4KG0A 4BCUA 3KLSA 5FBZA 3UL2A 2WKKA 4XBLA 3A0NA 4AGGA 1IPKA 2RMU1 1OD5A 3WW2A 1IKQA 4MGYE 3JBG2 1F8VA 5C8CB 4H7LA 1QJU3 2ZHKA 1BQPA 2BWCA 5CFCB 3AJYA 1H9PA 4AQSA 4OLLA 3VDDC 4AI0A 1XXNA 2GSYA 2TBVA 2XVLA 3RJ2X 5F1RA 1ULGA 4AEJA 5T55A 1F2NA 1Z0HA 3B9IA 1U5IA 3MIDA 3R05A 1R083 4E2QA 4MXVA 1KDMA 1MZFA 1TQ5A 2XWJB 1JN2P 2EALA 4OULA 5TSWA 4NHKA 4S2DA 3NAPB 2PA7A 4HK9A 1JTZX 1QMJA 1C8NA 3VBUA 2HKXA 2C5DA 2PFWA 3PMSA 3CJIC 1U5ZA 4XF9A 4LBLA 4AGVA 2VNOA 4F8AA 2V73A 4AQ6A 1NA1B 4FPYA 2BTVC 1AR62 4FCAA 2FZ1A 1WW6A 5F6LB 1D4M2 3DPRB 4YARA 2C0ZA 3H1MA 1ZZBA 1BBT3 1VP6A 1PIV2 2IXCA 2R30A 2WS91 3QLQA 4XJ9A 1AYM3 2NN8A 2R041 1YIFA 2DYCA 3J4UH 1O3TA 1M4WA 1NE4A 4H7MA 4AVVA 2W52A 2D7FA 2B39A 3BCWA 3KT7A 3ZFFC 5JOXA 4WM7B 3M2MA 4IEYA 4MV2A 3TN93 2VVEA 5DG2A 2I74A 5T52A 2AYHA 5JDBA 4DNYA 4MSVA 1HQLA 1K5MC 3MIFA 1WLDA 2AENA 2E63A 4K3UA 4CRQA 2RE9A 3OTFA 1WBFA 2GU9A 1MS0A 3T1MA 1H2MA 1V6JA 2XHKA 4HK8A 1OSGA 3GBFA 3A4UA 2XJSA 1VBE2 1RUE2 3FJSA 1LECA 1H8VA 2F6BA 3PVOA 1XU2A 4YVSA 2Z79A 2E7QA 4OHZA 2YYOA 3PHMA 5KHJA 5DUWA 1LHNA 1QQP1 1J59A 1AR83 3R6SA 3AP9A 5D8AC 4IL7A 2UWCA 2X5IB 4P9JA 4XJWA 4CEWB 5DDJ1 1FXZA 2A6YA 3O7OA 3W9AA 4Q4W1 1TMF3 5BNPC 2Y0OA 2GN3A 1AXYA 1D2QA 1KFUL 4AYUA 4YRDA 4EN8B 4XILA 5JZGA 4FT8A 1RUD2 4PDWA 3EHKA 3GBGA 3MLJA 2XUMA 2ZX3A 4FTBA 3IM0A 1RHI1 4L99A 1ALYA 4OHVA 3VKNA 2ZKNA 1RUG1 1LOFC 1Y9QA 4LT5A 1R091 2MNGA 1C5HA 1CONA 2ZGNA 1RMU3 3O0VA 4Q4W3 3VHOA 3OPZA 2JKBA 1HRV2 2DFCA 3INAA 4XF0A 1PK6C 1SLBA 3QCWA 4O9EA 3H1YA 1V9U1 3J9SA 2IFWA 1HIXA 3LZZA 1YO8A 2VVFA 2JG8C 1RHI3 4XF4A 3JUUA 4YM1A 4W6XA 4DRRA 2A6WA 4GA9A 3AYEA 5FPZA 2HWB1 4XHXA 5C9AC 2ZX0A 1S0EA 4FP3A 5H9PA 3WNXA 3AM2A 4Y22A 3FLRA 3OD0A 5C4WB 5CAZA 1V9U3 3AB0A 3AZVA 1Z7S2 4HSJA 5GLUA 3WW4A 3BTAA 3WQ7A 2IC1A 3W58A 5EYXA 2R073 4QPIC 2RS52 4FQZA 1IPJA 4YVWB 2GNTA 1YFWA 3B9CA 3ACLA 3K51A 2HWB3 2HWC3 4CP1A 1GQGA 3B69A 1CPNA 1X82A 4LHNA 3LB9A 1UAIA 2CGOA 2YC0A 1EAH1 4JV4A 5L7OC 4LEJA 1LCLA 4R9DA 1QY4A 3HAGA 1OFNA 3U07A 2ZGLA 4Q0QA 1CAWB 2GC0A 4IEWA 3RJRA 1YYNA 2WNUB 1RUH1 5CG9A 2Y38A 2WZR1 2QKDA 2FHRA 3VBHC 1GKBA 2VVDA 1LENA 4AQ2A 1CX4A 4CDXC 4D7SA 2AREA 4FO9A 5H9QA 1S1AA 3P3PA 3LA7A 4B3NA 2ZHNA 3S0MA 3VBOC 2D40A 1EPWA 3WY6A 3TOJA 1RUH3 3ZFEB 5DUXA 3VBRC 1ND3A 1SCSA 1PNFA 1XRUA 1JYIA 3ZYJB 3OJBA 2RS31 3TRSB 3WOGA 4AVTA 1TEIA 3O14A 4WM8B 4RGAA 3S7EA 4OI1A 2UY9A 3RMXA 4RSUA 4PBOA 2R6QA 4M00A 4I3GA 4BOWA 1IZ3A 1QOOA 1HX6A 1QJY1 2MEV3 2XKPA 1O4YA 2IFRA 2Q8OA 5C33A 5JOWA 3LSEA 1BEV2 4UXAA 4D69A 1WMFA 2RS33 3OBTA 2VNRA 5T5JA 2O8OA 3NV3A 5T54A 4Z8BA 4OVEA 1QJX1 1MEC2 1ZBE3 3MIEA 2DCJA 3FFQA 1WA4A 1ONAA 3SHRA 2A71A 1CVNA 3VBSB 2JG9C 1PVC1 1VBC1 1G9CA 2JDZA 2YZ4A 3PMEA 1C4RA 5L36A 3AMMA 3AP6A 3V0AA 3CJIA 2QDRA 2QUOA 1NY71 1RUI2 2ZPXA 1JUHA 2ZMLA 4MLOA 3N7MA 4RA0A 1Z78A 3UKVA 3WW1A 3NL1A 1EYBA 4EN6B 2QCSB 5JOYA 1PVC3 4J1XA 3AZZA 5J96B 2X29A 3KB5A 3AJZA 2VOWA 3WDUA 5GJ6A 1DGRN 1TNRA 1H2KA 4XHBA 4ORFA 1OOPC 1ASJ3 5T5LA 4YZ1A 4MUVA 2WT1A 1XYNA 3OY8B 4X8NA 2ATFA 1SFNA 3ZFFA 4G9SB 1PO12 1FNYA 4CEYB 1NZCA 1AYN2 1PVXA 1FMD1 2BFUS 4TZDA 1QXRA 4IXLA 3ZPYA 1UD1A 1B09A 3M4FA 4DY5A 4HN1A 4AI2A 3JU9A 1SCRA 1O3RA 4BMEA 1VR3A 1PMIA 1JYCA 2WWSA 3KGZA 1OPOA 3L9JT 3FBMA 5KWRA 2XKOA 5IUQA 2OPKA 3BOPA 3ZX7A 1N1VA 4FPHA 1AXZA 4IEZA 1R1ZA 1YJLA 3AYCA 2D3PA 5A33A 2DCTA 2JECA 3ZN6B 1G9DA 3M3QA 2HEVF 1ND2A 1W6OB 1D0GA 3FX3A 4WBBA 5BNPA 1LHUA 1W6NA 3AXEA 1LEMA 1QWRA 2QE3A 4I0AA 2CAVA 3B7MA 2BNNA 5FO8B 3WLUA 3JD71 2H6BA 3AZYA 1C1LA 3ZYIB 1CAVA 2QNKA 1AL21 1LOFA 1QXPA 4K21A 4A7KA 1W6PA 4BWOA 2AGSA 4AHXA 1RVF1 4IV1C 3QH7A 1H0BA 1PK6A 5BNOC 1FNZA 3URFA 1JOJA 1UKGA 1COV2 3BU7A 1O3QA 1GZWB 4CP0A 2WFPA 5T50A 3PVNA 2XBO2 3R4UA 4Z2WA 4YZ4A 2JE7A 2JG8A 3E6BA 2DVGA 4P14A 4X6QB 4QD2A 2EXJA 4RHV1 3L2YA 2RJKA 4BMBA 4A7ZA 4XQWA 5GZEA 4COZA 4Z1VA 2P17A 3E6DA 2OW4A 3OYWA 2HWF2 4GWMA 4OI2A 3FUOA 4GALA 2A7AA 1MEC1 1VAMA 1MR5A 1I6XA 1QF3A 3H3UA 4JGYB 4QQHA 4QPIA 3TYJA 3VZMA 4HT1T 3AZWA 4AEKA 4EWAA 4Y20A 2NZ9A 3WT3A 1F9KA 2R062 2EIGA 3PJQA 3WZ1A 3VBUC 2E9QA 4XW3A 1UL9A 4QQ2A 3VKOA 2WNVC 4AVSA 2A3XA 2ZCWA 5L7OA 2Z69A 2A75A 2UURA 5DUVA 3KQRA 2JX9A 4RGGA 3ATGA 4MZUA 4SLIA 1AR91 3MIGA 3NO8A 1F5JA 3EJKA 3KCCA 1ZBA1 5E16A 3HR9A 1PO21 3VBHA 4I0WB 4RFT0 4CDXA 5FOJB 1QU0A 5FRAA 2NM1A 3IWZA 3H1WA 3MIHA 4U36A 4YGEA 2YMZA 2DUQA 4YG0A 3ZSLA 3VDDB 1ZYBA 4DOUA 1S0BA 2QVSB 3VHNA 2ET7A 4HKWA 3IDCB 4LBQD 1S0IA 2W08A 4GKXA 2OUJA 2Q30A 3ZXFA 4NWVA 1AXKA 1QJZA 1VB2A 1REFA 2LUWA 4TSVA 1VJ2A 2D6OX 4GXLA 2RMU2 3KS7A 2NMNA 3SISA 1AZDA 4XQDA 4HVQA 2CTVA 1GZCA 1RUF1 5BPXA 4MH0E 1GYKA 3SXWA 1GLHA 3MIBA 2GAUA 1H8TA 2P34A 2AZ5A 5GZCA 3VZJA 3I59A 4MYEA 3ME2A 4NHMA 2ZHLA 2ZTNA 4YLZA 3SLIA 1Q8OA 4AFCA 4D3WA 2BEOA 1QGLA 3IDBB 3LAGA 1RIRA 3C3VA 1EV11 2RR11 1NCRB 4LBJA 5EJ3A 1L3JA 4XFGA 1CIWA 4K20A 4MXWB 3WINE 1ZNPA 2PHTA 1YXWA 4V1PA 3MGUA 4DB5A 2VULA 1ZRDA 2JG9A 3G7DA 1MS8A 1SMVA 3T2TA 1ZRCA 4BM8A 2ERFA 1RUC1 2RM21 3MI8A 2D6NA 3N35A 3VBFA 1C8M1 1YFUA 4ASMB 1ZREA 4RD7A 1CESA 3USUB 4NN0A 4CP2A 1NCQC 1XE8A 1NQDA 3IBMA 1K5MB 4AEDB 4BIFA 2YUEA 3H50A 4AI8A 4DRVA 1KJLA 2BGCA 4LE3A 2D6LX 2PHFA 1DGRA 2A6VA 2WS92 1LOAA 1WD4A 2H6CA 4XMAA 3SH4A 5C6CA 1YI7A 4M3CB 5HCFA 2HJIA 4IV3B 1OOPA 2EXKA 2R042 4JAAA 4QHBA 2GMMA 4ZU4A 4AXOA 3B3QE 1A6CA 1O3SA 2D5FA 5ACA1 1SQ4A 2K0GA 1Q5OA 1POV1 1WW4A 2XJRA 1UPSA 3KCYA 2MPFA 1DF0A 4N7IA 4FOWA 2ET1A 5D8AB 1CAUB 3AKRA 4HPKA 5C8WA 1S0FA 2OA2A 5J3UA 1PGL1 1Q8SA 1UX6A 1JBCA 2JJ6A 3SH3A 2JXAA 2DV9A 2XJQA 3WG3A 2WLQA 4IESA 2FZ2A 2P3IA 4WVZA 3GZTB 2PQQA 2VOKA 3VUOA 1QHDA 3THTA 5KXDA 1X8EA 2B46X 3WP6A 1Q3EA 1IGOA 2BWAA 5JPMB 1B35A 3E5UA 1QQP2 2R0FA 3FE5A 1X50A 1A8MA 1PK6B 1VBA1 1VBD1 3O12A 5AC91 4KNCA 3H9AA 1LRHA 2B7YA 4HZFA 2H0BA 1GNZA 5DDJ2 4RR3B 4XXAA 4BQ1A 4QGMA 4Q4X1 4Q4W2 1AX0A 4N53C 3ZSKA 4E2GA 3V0BB 2DTWA 1OPMA 4ATFA 5A32B 5C9AB 1QJU1 1EP0A 2ES3A 2R32A 2QFEA 1VBA3 1RHI2 4FXKB 2D5HA 1VBD3 5AC93 1MS1A 1RUG2 3OCPA 1ND3C 4YM3A 3JCIA 1R092 2GNBA 5LK7B 1OFSA 1AF9A 3B94A 4IV1A 3AK0A 4Q4X3 5BNOA 3GZAA 4NPRA 4Q0UA 1F5FA 1V9U2 3WUDA 1R081 1U12A 1XNKA 2WA3A 4S2FA 1NG0A 2D6MA 5E1RA 3U4XA 1Q8QA 4ATEA 2A73B 1LOCA 1MZ5A 2FMDA 2BW8A 3WHUA 1VRH3 4OHYA 2HWB2 1MZ6A 3O0WA 3IIAA 3MZHA 1N3OA 2YDEA 1WLTA 1REEA 1Y43B 2LM3A 5FMOS 1RUOA 1OLQA 4H55A 2WQZC 2BNMA 1DZQA 1WGPA 5FREA 4XJAA 1H30A 1RITA 4Q8KA 1BBT1 2EA7A 5KXBA 1YRZA 3NVCA 4JGZC 1V6NA 2WNVA 3ZN5A 4QX5A 1GQHA 1W39A 2AR6A 2KA3A 3M1HA 3VBOB 1I3HA 1AYM1 2GALA 1EAH2 2EXHA 3FHIB 3N36A 3D0JA 4IERA 4R52A 5GLVA 3VBRB 5KHIA 4MX3A 5JI9A 1H4HA 5I0TA 1HLCA 3RDIA 2Q5TA 1VIWB 3WG4A 1TME3 4LA3A 4XDQA 1CAXA 1RUH2 5FOBB 1CPMA 2WZR2 3QH6A 3TN91 5H9SA 3B00A 1ENQA 2XPJA 1J3QA 4W6YA 2YXSA 1SLTA 2Q4SA 4E4SA 2LTNA 4N43C 2GH8A 3MFAA 4JQRA 3GALA 1QXJA 3VKLA 4KU7A 3WDXA 2DU1A 4XFAA 1IS5A 4UBGA 1XNCA 1LOBA 5I93A 4ES8A 5JAXA 2WLPA 2F4PA 2HEYF 1YLLA 4OZXA 1WMEA 2D97A 2RS32 2HWD3 1W6QB 5FLHA 1AR81 3MPPG 1UIKA 2DWRA 3L2HA 4AFMA 1KXGA 2VUAA 4XETA 1NXD1 1NXMA 1FATA 1DHKB 3CLPA 4FPOB 1VB4A 1H2NA 2UWAA 3LWCA 3D0SA 3I4IA 3MLLA 2RS13 1TMF1 1V6IA 4QM8A 2H0VA 3PJYA 3ILFA 1I5ZA 4Z82A 1QJY2 4FOVA 1G8WA 1ZX5A 4P9XA 5K9YA 1BKZA 3RQ0A 1A3KA 5CFDB 4CDWC 2VG9A 4NHLA 1QJX2 3GYDA 3IPVB 3ZFGC 4TWTA 4HN0A 2ZAAA 2R49A 4CYDA 5K0UC 1URXA 4GB33 1H1AA 1RMU1 4CDUC 1ND2C 1PM7A 4GH4B 5DZEA 4HVRA 5ABJB 5KXCA 1HKDA 1R1A3 1U5YA 3WDYA 1PVC2 3WUCA 3ZMOA 1VBC2 5GM0A 1YNAA 3ZXDA 2NYYA 5JSOA 3WDTA 3EBRA 4P9LA 2XVKA 2PHUA 3O0XA 1UZYA 3HWJA 4I09A 4LHLA 2CL2A 3R4SA 3VKMA 1BVVA 4LULA 1MS3A 1AR71 3WP4A 4RS5B 3NW4A 1NCQA 1NY72 4LLFA 2YHJA 2X53S 4ITCA 1LGCA 3PVEA 5JLVA 2YGMA 2A6ZA 4GWNA 4K9SA 4U2AA 2ZZJA 2QZ3A 4EV0A 1RC6A 1GFF2 2R071 3THPA 2CNAA 1AR73 4N9IA 4Q2FA 2I07B 3SCGA 4D7YA 3N7JA 1AL0G 3VZNA 4XFCA 2HWC1 4EN0A 4FPLA 4FPJA 3GBWA 4N7UA 3J8F3 4GULA 2P3KA 1UMZA 4OI0A 5SV8A 1FMD2 3TB0A 5J98B 4DXZA 2PLV3 1C1FA 4Z92B 4CDQB 1G9BA 3LGRA 1MQTA 1AJOA 1OQEA 3CF6E 2PAMA 1H4GA 2JE9A 4Q8LA 1O5LA 2OYZA 2Y26A 2XWBB 3AKTA 3ZXEA 1ENRA 3JBG3 4XTPA 4WZFA 1EPZA 4LA2A 2JICA 1RJ8A 3RZZA 1Y3TA 3AMQA 5BNNA 4L97A 3SNMA 4MGKE 4QPGA 5C8CC 1W6MA 1UU6A 1RUNA 3APBA 5CU1A 4N53A 5CFCC 3VHRA 3FWEA 2MHFA 4CTEA 4AQTA 1E57A 2XVGA 5CA6A 3JD72 1QDOA 1MZEA 2ZBJA 3S7IA 4XZPA 1BCXA 3V65A 1WCDJ 4LBMA 1NYWA 4UW6A 1AL22 3IKWA 3IN9A 4Y5Z0 4R9BA 2MEV1 2GN7A 1MS4A 3KMHA 1RVF2 1HXS1 3BOWA 4HANA 4IEQA 3RRDA 1X7NA 1ZBE1 4QGLA 3WCRA 3NAPC 3ZSJA 5I8YA 3DV8A 1QNYA 3ILRA 3VBUB 1AR63 3MFCA 3NKTA 1RB8G 5B2GB 4B29A 1H8TC 2IXLA 4RHV2 2FMYA 4BA6A 1MACA 1REDA 2WIIB 4FTSA 1PIV3 4B4RA 3AXDA 5CG8A 1EY2A 5JR7B 1NA1C 1FI2A 2IXHA 5JSRA 1HXS3 3IDEA 3P3NA 3DPRC 4X8PA 4BYYA 4NVPA 4JTNA 3B93A 3FZ3A 4AHYA 2DUOA 2CAUA 3ASIA 2ZGMA 2OVUA 1V00A 3GF6A 4D7TA 4SBVA 3OGJA 1ZZCA 3D5OA 4JGZA 4XF3A 3NWKA 4XIKA 2WL1A 1N1SA 5GALA 5AVPA 3VBFC 5F6KA 3ES4A 1J58A 4WM7C 5JCTA 5KHKA 2A70A 1ASJ1 5J36A 3KD4A 2ZJCA 4FQ4A 3RYPA 1VBE3 3M3OA 2ZGUA 4JTOA 1RUE3 2CGPA 3AP4A 1PZ7A 1BMV1 5K7PA 4I3PA 1AR92 1NQJA 3H7YA 1ZBA2 2V09A 2ZAHA 1O4ZA 3AYAA 2IXKA 1PO22 1H2LA 2VMGA 4GIQA 1O5UA 5E89A 5LRSA 3VZOA 4N43A 5A3LA 4IEVA 3DL3A 2UU8A 4YVSB 3KZ4C 4JRAA 4AW7A 1QH7A 2R1DA 1DQ4A 2Z2SB 2O8QA 5T5PA 3LKJA 2JD4A 3LOIA 1I9RA 4BLJA 4HSLA 5E8AA 3JB4C 1Q8PA 4LUKA 2X5IC 2D6PA 1RUD3 4L8QA 4M0NA 4HMZA 1BJQA 4KH9A 5GZFA 5J37A 1PZ8A 3QBQA 1NE6A 3KCXA 3Q9OA 3VKFC 4B7EA 1RUF2 5FQ0A 4DZGA 5JZGB 1BZWA 4KG8A 4PDWB 3H7JA 1FX5A 3NJZA 2B42B 4FVVA 1ZRRA 1OMIA 2VMIA 1WBLA 4Q0PA 5H9RA 4LO7A 1XE7A 5JSPA 4DMIA 4EN7B 4CDWA 1B35C 5IK5A 5KC5A 3RWNA 3ZFGA 1EV12 4P9GA 5K0UA 1JHNA 2RR12 3EO6A 2QDNA 2NP0A 3UKNA 5KBFA 4CDUA 1GNHA 4HVOA 3RMYA 4ES9A 1Z7S3 4DFSA 1RUC2 4HKLA 2RM22 5FTTC 4OUSA 4J1WA 3FC0A 1DQ1A 4LBQA 3N7KA 2RS53 3AKSA 2XLAA 2ZS6B 1C8M2 5SV5A 2IXJA 2DVAA 5C4WC 4Y22B 2DFBA 2YV8A 4YG3A 5BV6A 1D2SA 3LA3A 1OA3A 2ZGOA 1JXNA 1G9AA 3V64A 2CV6A 3NSTA 4FPFA 5JIUA 3ZN4A 1FYUA 4N90A 4OFGA 3RPQA 2D3SA 1DYPA 1QKQA 2ZGTA 4R9AA 4YZ3A 1RTVA 3ROUA 3GHNA 3PVBB 2HEWF 1UU5A 4FOYA 5ACA2 4GMP0 1OA2A 3AKPA 2WNUC 1ZM1A 1S0JA 5FO7B 2K2SA 2PHWA 3RI9A 2XJTA