1S2KA

Structure of scp-b a member of the eqolisin family of peptidases in a complex with a tripeptide ala-ile-his
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
206
structure length
199
Chain Sequence
TVESNWGGAILIGSDFDTVSATANVPSASGGSSAAGTAWVGIDGDTCQTAILQTGFDWYGDGTYDAWYEWEVSITISEGDSIQMSVTATSDTSGSATLENLTTGQKVSKSFSNESSGSLCRTNAEFIIEDFEECNSNGSDCEFVPFASFSPAVEFTDCSVTSDGESVSLDDAQITQVIINNQDVTDCSVSGTTVSCSYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The molecular structure and catalytic mechanism of a novel carboxyl peptidase from Scytalidium lignicolum
pubmed doi rcsb
source organism Scytalidium lignicola
molecule tags Hydrolase
molecule keywords Scytalidopepsin B
total genus 44
structure length 199
sequence length 206
ec nomenclature ec 3.4.23.32: Scytalidopepsin B.
pdb deposition date 2004-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01828 Peptidase_A4 Peptidase A4 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.700 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1s2kA00
1Y43B 3TRSB 1S2BA 1S2KA 2IFRA 2IFWA
chains in the Genus database with same CATH superfamily
2VOKA 2ID4A 2VVDA 2WZ8A 1SBEA 1GZTA 3GCXA 3USUA 3NNGA 4YZ1A 1B35B 3SEEA 1V6KA 1LRHA 1D4VB 2YC4A 1JXNA 5DDJ3 5JOYA 4I2OA 3K3NA 1QOOA 2C5DA 4DRRA 5B4NA 3S7EA 4BDVB 1JH5A 1KD7A 2DU0A 3ZOIA 4XACA 2FMDA 1RINA 2ZGUA 4ONUA 4B29A 3S5AA 3J7HA 1UX6A 4I30A 1AR61 5CVRA 1HB2A 1H2NA 4IEWA 2ZABA 3ZXGA 4DY5A 1SBDA 2DCTA 4AI3A 2BJSA 4Q0PA 3TEYA 2ZGNA 1CD3G 3SCGA 3U4XA 1AL23 3AXEA 1DCSA 5IHRA 1LOCA 4Z82A 3E5XA 2HEYF 1AXZA 2WFF2 5DAQA 3POIA 1QJY2 1QJX3 4N7UA 1NCRA 2SLIA 3MI8A 5ABJA 3RYPA 4GWNA 2X10A 2GMMA 2Q8CA 3NWKA 4R9BA 2VW0A 4CCNA 4DNYA 5GKAC 1CPMA 5JSRA 1AR83 4K7JA 4AEJA 2HWF2 2LTNA 3ETQA 2ZEZA 3N35A 4HFSA 4RHV2 5A3PA 4CXYA 1W28A 2W95A 2YHJA 2C9KA 5A32B 2FMYA 2PHWA 2IC1A 5L9VA 3UNPA 3UGFA 4YRDA 3WF1A 2FHRA 2NM1A 1VRH3 3KV5A 5B2GB 1WBLA 1OA3A 1ND3C 4UFIA 5FCCA 3I2KA 3P3PA 4LIVA 2J1SA 3FHAA 5C4WB 3OGVA 1YJLA 1C4RA 4K3UA 1JHJA 4PBOA 3N7JA 3VDAA 3NVCA 3OEBA 3IDEA 4PDWC 4AQ6A 4BXFA 2ZX2A 4YARA 1LEDA 2RG4A 3UKTA 1JZ5A 1RUJ2 1Z7S3 4OYUA 1W05A 1OMIA 3D5OA 4HSJA 3RS6A 4WZCA 1MEC3 2HWD3 1JOBA 3GXUA 4GH4C 4LR4A 1FAYA 4Q0SA 3PHMA 3WNPA 3ILFA 3IPVB 4K9SA 2BBVA 2IVIB 3OYWA 1ASJ3 2UY9A 4AVVA 1TMF2 4UXAA 5L9BA 1F4AA 2ZXQA 4YVWC 4KQ7A 3FHIB 4KNCA 4D69A 4X6QB 2Y60A 1QH7A 1VBC1 5DABA 4AFAA 2D3RA 2O14A 3AJYA 5HI0A 1RHI3 2NZ9A 2ADDA 2JDNA 5FREA 4DS0A 2VZVA 4PT6A 2GZWA 3EJKA 4LBNA 5FMOL 4C1WA 4DIQA 3DF0A 2VW1A 1OF3A 1SLBA 5BNPB 4LO5B 3BTYA 2WL1A 2BNOA 1RGSA 1RUC2 4YW3A 4EWAA 1X50A 1FMD1 3CZUA 2GC2A 3QH7A 1DGLA 1W6MB 3B69A 4KG8A 4LHKA 1QOSA 1H1AA 4XUTA 1J3QA 5E1RA 2QQNA 4QX8A 4NO4A 1NCQC 1REEA 4HZFA 1OF4A 4FPCA 4LO6B 3Q8FA 4XVHA 5LEJA 1WLWA 3WW1A 4K6BA 2WO2A 3JCIA 1O91A 5FZ4A 1CX1A 4OI2A 2Q8OA 3VD9A 3I59B 4W6YA 2R49A 5IATA 4RHV3 4E8DA 1BBT1 3WQ1A 1GZWA 1PNFA 3WHUA 2YUEA 2Z2SB 1HRV3 1UZWA 2AR6A 2BYVE 4CEYC 1VAKA 2O0OA 2XQRA 4Y4RA 2Y6LA 2X5IC 4S2DA 1O7FA 1QMJA 2YYOA 3U10A 1GP6A 3BCWA 4FAHA 5F39A 2XMLA 3GCWA 1DZQA 2VXJA 5DDJ2 4COWA 5FUPA 1ENXA 1QDOA 1LHVA 3Q9OA 5EJ1B 5FZ6A 4XZPA 1YRZA 1RB8G 2FDFA 3WCSA 3PUSA 2UWBA 4AI8A 3AYAA 3HWJA 4NUBA 1QXRA 1C8M3 3WD5A 1JZ2A 1FI2A 1H9WA 3ZPYA 5BNPA 3N9NA 1JTZX 5FZHA 1VPHA 2XL7A 1X8EA 4LUMA 2ZGLA 2FCTA 3F95A 5CYYA 5EHDA 5C3OA 3H0OA 4JRAA 5IVJA 2EXKA 1GICA 4ET7A 3R4DB 5IVBA 2ZZJA 2WA4A 3P3NA 3KCXA 4L8QA 2CY6A 4IW3A 2ZGMA 3ZVXA 1JU3A 4F83A 5AFEA 2VOWA 2GSYA 3EQEA 4QT6A 2VO5A 1WCQA 3T30A 2JE8A 3T09A 3VD7A 1JYIA 4FAGA 1BYHA 3KHCA 1B35C 1SACA 1SPPA 1UY3A 2D5FA 2JKXA 3ZYFA 2RVAA 2WZR1 4WM8B 3SCFA 3FZ3A 1X9TA 1FX5A 2MEV3 3MYXA 4LMFA 5IT6A 4LHLA 4FPEA 2ZGRA 4NRQA 2WQZC 5JAXA 2GNMA 3WF0A 4RQPA 1J58A 4IEZA 1PO11 1QWRA 4XBNA 1X7NA 4UF0A 3RJRA 2ZS6B 4W65A 4DEVA 1PVXA 1WLCA 3ZSMA 5BNOB 3DN7A 3ZKYA 3EBRA 3KD4A 4MYEA 2Q30A 2WUHA 1QY4A 3AC0A 1GR3A 1S1AA 4BQ5A 4EN9B 2GN3A 3CL1A 1TNRA 3E6CC 3KT1A 3AZWA 3FHQA 1AX0A 1CZTA 1MVQA 1RJ8A 5CKQA 1CZSA 3TRSB 1W8FA 4GMP3 3WUCA 5BUVA 1V00A 1QJEA 1HB1A 1O4YA 5HV4A 3CIHA 2P1BA 3KT4A 3Q8BA 3C7FA 1ZA7A 4ES8A 4P9WA 1ND2A 2JDHA 3ZDSA 5FZFA 1J84A 1UMIA 1AYM2 2VY0A 1O6UA 2Y33A 1PM7A 3ZXKA 4AI0A 4B3NA 3O1UA 1R092 3FBYA 1OH3A 5L36A 1W9YA 3ROUA 3H1YA 4W6WA 2F4LA 4I3GA 5LASA 4AEDB 2WNUA 4TWTA 1F9KA 4MGQA 2LM3A 4CEYA 1UCXA 2JDUA 2EXIA 5FK7A 3FFZA 3HT1A 4QGLA 4ZY9A 5LY1A 4QU2A 3VZMA 3ENRA 3LQCA 3LPGA 1IG0A 2Y6JA 4OI4A 1NLRA 1VAMA 3LDBA 4HMZA 4ISRA 4CYDA 1S4CA 1YQCA 5FZLA 3DYMA 4KWUA 1ZBA2 1REFA 1MR5A 1PIV3 1XQNA 3NRUA 4QXHA 1NT0A 4QWNA 1QIQA 3LF7A 3WCRA 3B3QE 5ANQA 4D6QA 2ZGOA 1NA1C 3I2DA 4ASKA 5I0RA 2ZHMA 2OA2A 3RMYA 5JPMB 1ASJ1 3KWVA 5BNOA 1W0PA 3GJAA 3IMNA 1ZA4A 2B42B 2JWPA 2VU9A 4LBOA 1F8VA 1H8TA 5C70A 1Q8VA 3FUOA 3WQ7A 2PLV2 2VW2A 4A7YA 4BQ2A 5H9RA 1SHWB 5EWSA 4SBVA 1GOFA 3BGAA 4LT5A 2P5BA 3FN9A 3VBHB 3ACFA 1NG0A 4RGGA 5J48A 1DP0A 4XBQA 4RGAA 2C0ZA 3LFIA 2BOIA 2VQUA 4BE3A 3KVAA 3KS7A 3TN93 4YG6A 3AK0A 1HB4A 4K8RB 2ZKNA 2WNVC 1K5MA 4O61A 4CZSA 4XF4A 1KFUL 2JDYA 1I9RA 4XIKA 5JXHA 5HCFA 5IWFA 4DO0A 4LHSA 4E2QA 1QHDA 4U2AA 5HPOA 1LULA 4CP9A 5GZDA 5H9QA 1ENRA 2WLQA 1REDA 5EP9A 2X8KA 1GFF2 1OVSA 1ULEA 1DLCA 2Y38A 1N3QA 1ULOA 1WCUA 2BPA2 2IFWA 3I54A 4QB2A 1CGPA 4XW3A 3U07A 4AAPA 2ZX4A 3WW4A 2KM2A 4AOCA 2RJKA 5I0TA 5IFTA 5LBFA 5A3NA 4LKEA 3HNBM 1AR62 3QCWA 2ENRA 3PVEA 1VAVA 4LHNA 1VBE2 3HAGA 3SMHA 2JECA 3ACGA 2RDNA 2ZAHA 4KBBA 4AGVA 3ZXAC 5A70A 3VBFA 4XMIA 5F3GA 3V0BB 1R081 1HV0A 3GJBA 1YQ2A 3N9QA 4H2AA 4MVTA 5FYSA 5G04L 4UW5A 4FPKA 5CKMA 5DN2A 2MEV2 2XWJB 3C3VA 5C4WA 4XQDA 3KM5A 4KG0A 5FY1A 4AQTA 2J1AA 4IV3C 2XH6A 1QKQA 4MSVA 4BH9A 1AR81 5ACA1 3SLIA 1FV3A 4W50A 3HMYA 4XUPA 3WG4A 5JLVA 2HEWF 1J59A 4JKMA 4UBHA 1ENSA 2XDVA 3J7LA 1JZ8A 2RS31 3J4UH 1NY71 1BKZA 1WA4A 2ORXA 1XNBA 2WWUA 4IE7A 2A7AA 1AR72 1QJX2 3LCPA 1OOPA 3K2OA 4GZ9A 4Q4X1 4PLOA 2J22A 4DUVA 3B9IA 1XSQA 1ZRCA 1W2TA 1RUF3 4XF3A 1C5IA 1OKOA 3M3IA 4WM8C 3CF6E 1RUD2 3A0NA 5L7OB 1SLCA 1VRH1 3WUDA 4PF1A 2A3YA 3NNJA 4XAAA 5C6CA 5FPAA 5IUQA 5KHJA 4IUGA 4YFZA 2E31A 2ZMKA 5FOJB 1AYM3 2OQ7A 3ZFFB 3WNKA 4JX0A 5FTTC 3LA3A 4Q4W3 4HSLA 3ES4A 4FXGB 1ND3A 3M3EA 4QGMA 4W4ZA 4K1YA 2RS11 4XUNA 5F2SA 3M3QA 2VZ1A 1N1TA 5C9AA 4DXZA 2X29A 3AFGA 3AZVA 4WM7B 3V56A 1GQGA 3D8CA 1G9BA 2A6VA 4J6GA 3EB7A 2FQPA 3K51A 4Q4W1 4N53A 5A7NA 2XHKA 1V0AA 1VALA 3O1RA 1Z7S2 1H2LA 1H6XA 2CV6A 1OLMA 1OOPB 3A22A 1OA2A 3I2OA 3NNMA 1WWYA 3HOBA 4IEOA 2QQWA 5K7PA 1E5HA 5FP8A 1QQP3 4JGYB 5JPNB 3CKHA 2VZRA 3W20A 1S0IA 1IKPA 2D3SA 2PTMA 1ASJ2 2UU8A 1OFSA 4JGYC 4M3CF 2VUDA 4XF9A 4NIIA 4QPIC 1KFXL 1XNTA 3T3YA 4OQ8A 3VHPA 3PIJA 3NNLA 4COZA 3JD71 3H7YA 2FBEA 2WO1A 2YC0A 1UZ0A 1OC1A 1GOHA 3AP9A 3KZ4C 4EWEA 1UPIA 3C7EA 3DXUA 5GZCA 5IK7A 4QPYA 5E88A 5FY7A 2OVUA 2SBAA 4Y4YA 5C8CA 5CKNA 2K2SA 1SZBA 1C8M2 4K20A 1LECA 5EYYA 4CTEA 4MZUA 4FT8A 4IE5A 2QQIA 3K75B 1H8TB 3VBFC 4E2SA 4NHLA 1IZ3A 4IGPA 3J7NA 4KGQA 4Z07A 3IB3A 2DF7A 4TTGA 4GAZA 4A42A 4NROA 4DFSA 1FOD3 1WZXA 1Q5OA 1OSGA 3CO2A 4OUEA 1EAH3 3OB8A 3N3HA 2WWJA 4HPKA 4JKLA 4CCCA 1GZ9A 2BW8A 2Y0IA 5G05L 1O8PA 1QJU3 5FP4A 2R1DA 3RSJA 4G9SB 5IK8A 1W6PB 4D7YA 4YM2A 1MS9A 5JWPA 2ZCWA 1GBGA 1C1FA 4AI1A 1YQ5A 2DUPA 3VBHC 1DGRA 2EIGA 4FOWA 1H0BA 4P08A 5HCHA 4OI0A 2WIIB 1W9TA 2B39A 1EPZA 3H3UA 2OZJA 2FDHA 4RFRB 4QX3A 4MADA 4S2FA 4NOTA 1NKGA 3AMMA 3IN9A 1K5MB 1R1A2 4IQPA 1PK6A 4XPVA 1HIXA 1ZZ7A 4ATFA 2WNVB 2OQ6A 2E26A 2FZ2A 2ORZA 3M3OA 4DQAA 2AEZA 4R8HA 1D0HA 3KGZA 1ULDA 3RYKA 1BHGA 5DAPA 1VBA2 2VNOA 1UKRA 3J26N 4UT5A 4UFJA 3WLUA 1QJY1 2J1UA 4MXWA 3H9AA 2RS52 3NMBA 3AMNA 3KB5A 3ZXEA 4ZU7A 5C8WA 2VNGA 4D8MA 1CZVA 5I8YA 1CJPA 4Q0QA 5FXVA 1YFYA 2RE9A 5ACA2 3BALA 5FMOS 4BQ4A 4KU7A 3VBUB 4YVWA 4BU2A 3E6DA 4YGEA 2FDIA 3WY6A 1GZWB 4HVOA 3VHRA 1HB3A 1CQ9A 2DCYA 4AW7A 1HW5A 4GALA 4IEUA 2HWF3 2WS91 1GKBA 1OI6A 1O4TA 4IV1A 1S0EA 3BPSA 3L9JT 4CP1A 3ZN5A 4JAAA 3AKQA 3CQOA 2VZOA 2XJRA 1JU4A 2RM23 2XKOA 1VE0A 1POV0 1CVNA 4A7KA 2O8QA 4C90A 2OZ6A 2ZGSA 5FZ9A 3RI8A 1NCQA 4A41A 1ZNPA 2IXKA 3CDZB 1BBT2 3WF3A 1GOGA 5A7WB 4DXRA 3FWEA 3HVDA 5BNNB 3NW4A 5C8CC 2A71A 1MZ5A 4MV2A 4UFMA 3OUJA 2WNUC 3ILNA 3S30A 3ZN6A 4GULA 3AKSA 1WW7A 2QQKA 3WF4A 3VBOA 3VB9A 3SNMA 3OCPA 1WW5A 4QXBA 2J1RA 1BJQA 1S0CA 1PZ7A 2G4IA 1ZRIA 2R0FA 2B4KA 4LULA 3IM0A 4XURA 4UW4A 3CHXA 2XOMA 5FP9A 3USUB 3I8TA 4RS5A 1K42A 1QGLA 1W90A 4BISA 2AACA 4MHUA 2VULA 2PAEA 3R4UA 4LE4A 4XFHA 4Q5OA 1U5IA 5FPZA 4OFGA 4LOSA 3IDBB 4F3JA 4A3ZA 2ZA9A 3U14A 3EO6A 3RVHA 2ZKLA 2BGCA 3AX4A 2DVGA 5FZBA 1T6GC 4DUXA 1OPOA 4AGGA 4QX1A 3WINE 4AEDA 2ES3A 2Q0AA 1QQP2 2J42A 3G7DA 3MO4A 3ORJA 4KWLA 1LB2A 4QX2A 3UESA 3VHNA 3ZYGA 2C24A 3LSEA 2HBTA 3ZR6A 1VBB1 4B7EA 1NCQB 2YDEA 4OHWA 3WOGA 3T2QA 4I01A 4FTBA 5GM0A 4B7KA 1AYN3 2E6VA 2A70A 2HJIA 3BOWA 2LUWA 3FLTA 4JQTA 4XJWA 3ZIWA 1N3OA 3RYRA 5T5PA 2B5HA 4L92A 2GH8A 4Q29A 3LPFA 2RR12 4WM7C 1PMHX 4EROA 4Q4Y3 2XQXA 3FX3A 5A6ZA 3GF6A 1BMV1 1NCRB 3MLJA 3O1VA 4N53C 3VBSC 4IEQA 4XJ8A 4M3CA 3RJ2X 5CFCB 5EXOA 1RUG1 1RUF1 5FBJA 3VKFC 2BFUL 4ATEA 2LALA 5C3RA 5IYYA 3TEXA 1FT9A 1UY0A 2R043 1CAXB 2AUYA 2UWAA 3WDUA 3JBG3 1RUH3 3VBSA 3ALQA 3DUIA 3IKWA 4FPLA 4XDQA 3ZYRA 3NL1A 4OHVA 2AZ5A 1OUXA 3SH4A 3NAPC 5C7GA 4AFMA 1WLTA 5JOWA 1AVBA 1W2NA 3THPA 3NAPB 1A6CA 1RUE2 1UY4A 4AXOA 1X33A 3WDXA 2VMCA 2XG3A 4OHZA 4W6XA 2B45X 2O8OA 1W6NA 2W87A 2WT2A 2WSVA 5FZCA 4LLFA 4L97A 1JHNA 5JIAA 2EA7A 3UKVA 3VL8A 4LK6A 2WBKA 3LGRA 4O9EA 4BCUA 4EYUA 4RS5B 2RS13 2WFF1 4XMAA 5KC6A 3GZTB 1AR92 3UV9A 4Z92B 2HKXA 1POQA 4CRQA 4N9IA 1B35A 3FE5A 3K4AA 4QKBA 1DZRA 5JZGB 3D0SA 4A6OA 2VUAA 4CDUC 3PUAA 1LOFC 3ZXJA 1JZ6A 1UZYA 4W8JA 3F2ZA 1XC6A 5LW9A 4FTSA 2ZACA 2QDRA 5FZ7A 1QF3A 4XEZA 3ZFFC 4FFHA 4D0QA 4AR2A 5F32A 1T6BX 3AL5A 2ZX0A 2XGXA 3I2HA 3L2YA 5I93A 3RQ0A 3VZLA 1GUIA 3POYA 2RS32 1RHI2 3N7MA 4XC9A 5F6KA 3O1OA 2QQMA 3KHBA 1K5MC 5FYTA 2WAOA 2D6PA 2EVXA 3IIAA 5FXXA 3WV6A 2F17A 3WP4A 1S55A 4NPLA 1V6OA 2VAUA 4COVA 4C0BA 3BTZA 4V1PA 3Q8EA 2R7EB 1H4HA 2XHNA 3HN3A 4LJHA 5DPNA 3RMXA 3BUCA 1PZ9A 3KQ4B 1AYN2 4MGIE 2Y6HA 1AZDA 5FBZA 5IVFA 5F3EA 2PFWA 4E4HA 3ZR5A 3O5SA 4N43B 2DCJA 2WT1A 2K9ZA 2WT0A 3OD4A 4N43C 2OX0A 3O7OA 4URTA 3B7MA 4PIZA 1A3KA 2UYAA 5FY8A 4BOWA 1Q8OA 1RYYA 4YM3A 1S0GA 4H55A 5F5QA 3USSA 5CZKA 1HRI2 4MO3M 4GB33 3PIGA 1O59A 5LBEA 1BZWA 2ZEWA 1CAWB 2I2SA 1W6MA 3DKQA 2XVKA 1K5JA 2WC2A 3OGSA 4MLOA 1R1ZA 4FCAA 2DVDA 5JR7B 1PK6B 2WABA 4GKYA 1DYPA 1KDKA 1G9FA 1RUI1 4GMP0 3R0RA 3N4MA 3VL9A 2H6CA 1VBE1 4HG6B 5A6YA 2D6OX 1FPN2 3ES1A 4K8FA 5K4LA 4CDWB 5A3WA 1JS9A 4I3PA 3POWA 1CIYA 4XAEA 4FQZA 4XUOA 1VMJA 2CU5A 4YWAA 1EV11 4E4SA 1S0BA 2D98A 1MZEA 3HNMA 1NA1B 3ZDVA 3ITQA 3A4UA 3MUZ1 3OYWB 1WMFA 5A7PA 3ZSEA 5I0UA 4DOUA 3N36A 1Q8SA 1TME3 4Q4V1 4AHWA 4Y1VA 5F3CA 1RUC1 5GLZA 2EF6A 4FFFA 2IXCA 5FV3A 1NOVA 1S0JA 3AMPA 4PJYA 1TZOA 1SG3A 3RZLA 3V0AB 2ZGQA 2GALA 4ORFA 1Y9GA 3J9SA 5FYIA 3HBKA 2YGMA 1A8DA 1ZBE3 3MIDA 4JKKA 2DUQA 1O3RA 3VV1A 2G9ZA 1KEXA 1UY2A 1W0NA 2D44A 1W9WA 4MGKE 2W5FA 4XBLA 3IWZA 3P1IA 3B02A 1XYOA 4IGQA 4IV1C 5CISA 4YZ3A 1JYVA 1W39A 1PGW2 1QDCA 3I7DA 4B1LA 1ENQA 1FXZA 4XCAA 3H3LA 3HQUA 1XE0A 4ZXEA 1HQWA 1NQDA 1APNA 1UKGA 3MIFA 3PMEA 4TSVA 1PX3A 5GZGA 3WT3A 3VBUA 5DAVA 3OBZA 1CAVA 4G3YC 5AC92 4CDQA 1RUJ1 3DPRA 1MS1A 1MS4A 3ZPOA 3GALA 2DTYA 4Z2WA 5FK8A 1H30A 1HN0A 5CFDB 3N9PA 5L7OC 1XNDA 3PNAA 2PHDA 4LO8A 3OUHA 3O0XA 1KJRA 2PHLA 1YIPA 3C8XA 4NJ4A 3AL6A 4KI5M 4YNIA 1ND2C 2D40A 4K21A 2A6ZA 2C26A 1UO9A 2PHXA 4IXLA 2EALA 1HRI3 1ND2B 4X8NA 2RS12 3OD0A 2VMHA 3NKTA 1D2SA 1I5PA 5L9RA 2R0HA 1G8WA 3N9MA 2JG9B 4MGSA 4JHZA 4UFKA 4AVBA 3NV3A 2GNTA 4RYDA 2XJUA 1CAUA 1W6NB 2OXBA 4YZ4A 5L73A 3ACIA 1EYBA 1VBB2 3DPRB 1ZBA1 4EN8B 5FPUA 3MZHA 5BNNC 5FY4A 5C8CB 1DQ5A 3O12A 3OJBA 1VIWB 2PHFA 3KF5A 3DXTA 3KLSA 4PIXA 2TEPA 3VD5A 2OIIA 3ZYPA 2W08A 2Q5TA 4URAA 3THCA 2ARAA 4QDRA 2NYYA 4QDSA 1C57A 1ULPA 3ZFGC 4Q2FA 3WX5A 4CPBD 2HH9A 2XJTA 3W21A 1D2QA 5T52A 4RQPC 2Z69A 5JI7A 3NNFA 3T1MA 2TBVA 1DYKA 5D8AC 4ZU5A 3T08A 3V0AA 1LESA 2R072 4LBQD 2P3JA 2B9VA 4Q0VA 3HBZA 4EJRA 3HT2A 1OUSA 1SMVA 1VB4A 1ZVFA 1J3PA 2R063 4WM8A 1IQDC 1SPPB 3TEZA 3O1SA 5A6QA 2PHUA 1JZ3A 5FIXA 3BKZA 2AEYA 5C9AB 1AF9A 5JXGA 4FP2A 5AC91 2R1BA 5A7QA 1N1YA 2BVBA 1W8WA 4HVQA 1RIRA 2P37A 1JN2P 1TMF3 4LBKA 3ZLIA 2CNAA 4AVCA 2VM9A 3SEPA 1PIV1 1MVEA 1V6LA 1LAJA 2F4PA 2QQJA 3J7MA 1NUKA 4N9HA 2X53S 4NWVA 4ZU4A 1GU3A 2P6CA 2BUKA 2ZHLA 3ECQA 3ZFEA 5LA0A 1ZZBA 4DEQA 2ILMA 4IERA 2VNRA 4JGZA 5FP7A 5L19A 4CU8A 1UIJA 4IV3A 1W8NA 5FZDA 1GLHA 3FUQA 2WKKA 3K4DA 5IAVA 5BY5A 3W5MA 2VOTA 4N90A 2VQ0A 5D2AA 3OF1A 2NP0A 2RR13 4LOTA 1GMMA 1MS0A 2PA7A 4XTMA 2IWGB 4Q4Y2 4Y1ZA 2HWB2 1YO8A 3VDDC 5D8AA 3IDAA 4FOVA 4FBFA 4FOQA 5A1AA 4B4RA 3IDCB 5LZ6A 1KRIA 3AYEA 3KF3A 3FBMA 3HQXA 2XPJA 5IK4A 2JXAA 4QPIB 2WZR2 4EZ4A 2R042 4YW1A 3VZKA 4BHPA 3ME2A 1DQ1A 2C1FA 5LA9A 1QXJA 2VECA 4LEJA 1ZBA3 3DGTA 5DQ0A 3O0WA 4IETA 3ZN6B 3BB6A 1AR73 1F5FA 1W03A 2JIJA 1C3HA 1S0FA 3PVOA 3GNEA 4FXKB 5FZOA 5GLVA 1V6JA 3VBUC 4AVTA 3PL0A 2JG8B 1TVGA 2JD9A 3KT7A 5LB6A 1VBE3 2XWBB 4OI1A 3VBFB 3ZSLA 2DCZA 2VCBA 4OUSA 4NPMA 3LDRA 5EJ3A 2XBO2 1W3VA 4FPJA 4XDOA 3ASIA 1S2KA 4EN6B 1OKQA 2A73B 3N9LA 2RJ2A 1YQ6A 5DZGA 2H0BA 3N7LA 4CDXB 4Z8BA 3HEIA 2GP3A 4I0BA 2K46A 3UYJA 3VBOC 3WW2A 3C2UA 5KHHA 1RUI3 3E6BA 3VLBB 5FR3A 1VBC3 4Y5TA 3BI3A 1PNGA 2XLGA 4X6RB 4AI9A 2D6LX 3MW2A 3ELNA 4QX7A 5FFOC 3BN6A 4R9AA 5K0UC 1XU1A 5GLUA 5JOXA 2W2IA 2E7TA 3POJA 5FZMA 2JDZA 2EXHA 3ILRA 4NAOA 5M0TA 2JDPA 3OY8B 2E32A 3PJQA 4HXCA 1MZ6A 1PGSA 2RS53 3VKOA 1TMF1 4ITCA 4RN5A 1CAWA 4QAWA 1VP6A 3WR0A 3ZM8A 4XZUG 2GAUA 3ZFEB 5JMCA 2JE7A 4GXLA 4Y1XA 4BWOA 5C5UA 4AHXA 4WBBA 2O1QA 2W92A 3SQOA 2Z4FA 1OFNA 2ARBA 4S2GA 4CU7A 2VJXA 2HBUA 1BEV3 3ZSKA 3VZJA 1RC6A 5DUVA 4XJUA 3FFQA 3R4SA 5CBLA 2Y64A 2W9XA 1NXMA 5LEKA 3U75A 4XTPA 1IPKA 1SQ4A 4OCTA 2HWE1 2OT7A 4QHBA 5FRAA 1UPSA 5B4XA 1Z0HA 2YXSA 3TB0A 1DF0A 3EMRA 4H7LA 2WS92 2YC2A 4P00B 3DKWA 4TZDA 5FMCA 1UU6A 3NJXA 2VMFA 1OQ1A 1PK6C 2KA3A 3LKJA 4Y26A 3I49A 2RMU3 3H7JA 1FNZA 1GV9A 2WFF3 3B9CA 4D7SA 2YY1A 1W3XA 2ARXA 5FQ0A 2KD7A 1PGL1 4AVAA 2B7YA 5LRSA 1Z78A 4JC1A 3MLKA 2RM22 5FYYA 5FZOB 4ASMB 3LFMA 1FYUA 2VVFA 2D43A 3AZZA 3AMQA 1AL0G 2Q4SA 1NCRC 2D6KA 3TAYA 2V5DA 1GZCA 3LEMA 2WNUB 4JTNA 1RUG2 4QMAA 4BK4A 1FPN3 3WG2A 2DWRA 2CAVA 2X5IB 1ZZ8A 4MHRA 4BQ3A 4XUQA 1GP4A 4GD4A 1U5YA 4LORA 5CEHA 3MDPA 1RMU1 1S0DA 4J1WA 5H9PA 5GJ6A 4C1XA 1DZTA 4EV0A 4PI0A 1JOPA 3INAA 1TG7A 2ZMNA 1AJKA 1UQXA 4PBPA 4XQWA 2ZMLA 4YW5A 1VLNA 2QQOA 5D8AB 5KXDA 3TN92 1AL21 1L7RA 1VBC2 2P2KA 5E8AA 2I74A 3OPTA 3VKLA 2ETEA 5HCAA 4HPKB 4B1MA 5FO7B 5FXWA 1B09A 1NE6A 2D5HA 3BYWA 1VBA3 3PJYA 4FPGA 5EZWA 2ZGPA 4ASLA 4BB3A 5E89A 2WQ8A 4FSJA 4ISQA 2ZPXA 4DB5A 4MOAA 1J1LA 1YHFA 1G9CA 1UY1A 5FP3A 1U5ZA 2DDUA 4AK3A 1NQJA 2HLEA 4OMDA 1UNBA 3KV9A 2FZ1A 3I97A 4ES9A 3M1HA 2YGLA 4HT1T 5KHKA 1V6IA 1O5UA 1UYZA 2PQSA 4GKXA 4OZOA 1Z7S1 5JZGC 3ZFFA 1BVP1 1D0GA 5KXEA 2YFUA 1SDDB 2BVVA 2L9LA 4YZ2A 2W1WA 1LHUA 1PO22 2GNDA 3WP5A 1RUNA 3Q8CA 3UL2A 4AFCA 2ATFA 3PLQA 3JBG2 3NJVA 2VG9A 1RUC3 2XBO3 4Z1VA 4Q8KA 2AGSA 2W47A 1CIWA 4QXKA 3FLPA 4AYUA 4YVWB 3QACA 3O1TA 1IS5A 1W6OB 4AGRA 1JZ7A 1HV1A 3IZOA 3C7OA 5T5JA 3MIHA 3I3MA 2JJ6A 1UAIA 5C3SA 1WCSA 5DG2A 2VZ3A 1VB2A 4MGYE 4NVPA 1H2MA 1JW6A 3H1MA 3RPQA 3TNQA 4NHMA 2E9QA 2RJLA 3EYPA 4K1ZA 4P14A 4QPGC 5AVPA 4DUWA 5FYMA 1PM4A 4Y22A 1QEXA 4K40A 4MH0E 4YVSA 1OURA 5AVAA 2VQAA 1PVC2 3JUUA 1AL22 2J1TA 2BFUS 4QKDA 1RVF3 2H0VA 1W8OA 1XSRA 5FZ8A 2JG8C 5T55A 3CJIB 3AVRA 1RUE3 1HRV2 1GP5A 3CJIC 3MICA 2VMIA 4HK9A 1SFNA 4L2NA 4XXPA 2NMNA 3AP5A 2CDPA 1X82A 1U12A 3OG2A 1KS4A 2QCSB 4A44A 4BZ4A 2D93A 2DU1A 2EAKA 3GBFA 3WDTA 2MNGA 4Q4Y1 1CESA 5KC5A 2DFBA 2R30A 1H8VA 4L99A 3DYOA 2BZDA 3LSDA 4ZZ5A 2CWMA 3I59A 4XFGA 2IXJA 4AEMA 3O14A 4CDWC 2DV9A 3WG1A 1R1A1 1Q8QA 5FY0A 1E5SA 1LODA 1QOTA 3AKTA 3MLLA 4LBJA 3VBHA 3S5QA 2AC1A 1VBA1 3VZOA 4FFGA 1LHWA 4O7XA 2NQYA 3URFA 5CU1A 4CUGA 2WN2A 3HR9A 1OLME 2VE1A 3U1XA 4IDZA 4AFDA 3J8F3 5HV0A 2VMEA 1GSLA 3PU8A 5FWEA 4M01A 3SISA 1C5HA 1PO21 1AXYA 1UL9A 2D3PA 2ZHNA 4GH4A 4AFBA 2OW4A 2LRPA 1DGWA 3T2PA 4HKOA 1UYXA 4LITA 5KWRA 3RDIA 1JZ4A 1POV1 4P9XA 5FYCA 5FZ3A 2V72A 4GA9A 1XBFA 2IXHA 2Q1ZB 1T2XA 2QZ3A 3AB0A 4QU1A 5FPBA 1GQHA 2JEMA 1PO23 2ZEXA 1J3RA 5K0UA 3I3QA 1AYN1 4GWJA 5FOBB 4QKNA 4RL7A 5KXBA 2ZAAA 4IV1B 4KU8A 3CLPA 4XHBA 2OKXA 1SLLA 1IHMA 1KQRA 4I02A 3H8UA 3ACHA 2VOVA 2WO3A 2ZEYA 4IE0A 4E2GA 2G9GA 1A78A 1O3TA 4PCRA 1RMU2 4O65A 1PX4A 4O9GA 4M0HA 1ZRRA 2CYFA 4NHYA 3B94A 5FZAA 3UK9A 4QHZA 1AYM1 2ARCA 4CDWA 1MQTC 1J1TA 5A7SA 1TME1 4Q4V3 4CCEA 4UI9L 1G7YA 1TME2 2E33A 2P3YA 3MPBA 4PQ9A 2XR4A 4BK5A 1R091 1D7PM 1HJFA 3CBNA 3D0JA 4CCDA 4IEXA 5FZ1A 3P5BA 2VCCA 1EV13 2HWC1 1GANA 4RR3C 5FZ0A 5CFCC 3W9AA 2W94A 1UF2C 4RR3B 2IUWA 3RI9A 2GNBA 1FMD2 4A4AA 3CU7A 3N7KA 4Q4X3 3DL3A 1WLDA 5T50A 2P4EA 1YNAA 1XPWA 3EHKA 1F5JA 4QX0A 1R093 1OVPA 2VZQA 2RS33 4PLMA 3AMHA 1PZ8A 1H6YA 3BIWE 3OUIA 1K3IA 1QQP1 4HOOA 5TSWA 1JYCA 3A0KA 4M4RA 1JODA 3SKJE 4CDXA 4PIYA 3WHTA 3A7QA 1AXKA 1BQPA 4CUCA 2VXRA 1GNYA 2FDJA 3OPZA 3LEIA 4OZXA 2GMPA 4FPHA 1RUOA 1N1SA 1YIFA 2WINB 1COV2 3JD72 4CCJA 3BVCA 2AENA 2R073 5KXCA 2PELA 2CAUA 2CWSA 3NV2A 3VKMA 2Q1FA 4P9GA 4C8DA 3C7GA 4JQRA 4L11A 4DXSA 4CA9A 3PUHA 1LOGA 2E63A 5CNAA 3PMSA 4L9BA 1STMA 3ZFGA 4E8CA 4AVSA 3WP3A 1ZREA 2WA3A 2VR4A 3WQ0A 1S2EA 4Q1RA 5IVVA 1QJU1 3MW4A 3DYPA 1XOYA 3ZXLA 2WQ4A 3KV6A 3T1LA 2VCAA 2HWE3 3WNOA 1MPXA 4META 5JDBA 4D3WA 4YM1A 1C28A 3GM8A 1D4M2 3QD6A 2ZZQA 4CDUA 1A34A 1UOBA 1Y7BA 1HRV1 2A6WA 3SITA 3B5LB 1UOGA 2WYSA 3GZAA 5CAZA 4FOYA 5JXIA 2WRAA 5JMOA 1MS8A 2I45A 5FYHA 1TEIA 3WG3A 1XU2A 4AZZA 4NRPA 3CMGA 1ULCA 1OH4A 4GJYA 4QM9A 5D1IA 4LKDA 3KSCA 4EN7B 1RUH1 1HKDA 2RMU1 3DPRC 5FZEA 5FXZA 1YXWA 3TBDA 4CP9B 4QX5A 4WM7A 1O8SA 4NIHA 3T0BA 4XHXA 4FPOB 1W04A 2RDRA 2LS6A 5ACA3 1W2OA 5LK5A 1EUTA 3OPWA 1YQ8A 1AX1A 2V73A 5C33A 4Q4V2 2NPIA 2DFCA 4X8PA 1VBD1 2ZGKA 3ZFGB 5DZEA 1SFYA 3POSA 3SHRA 1CJDA 3CEWA 3IT8A 2DCKA 1XNCA 5A7WA 1BEV1 1SLTA 3SXWA 1QNWA 4AQSA 2W91A 4BQ1A 2GP5A 3LWCA 2Y6GA 3AYCA 2JX9A 1EY2A 1KITA 4AEDC 4YGCA 1RTVA 4NHXA 5HCBA 5LCWL 4CCKA 1RHI1 4TXWA 3KVBA 1I5ZA 3JXSA 3M4FA 2FD8A 2BERA 3JBG1 4NMIA 4XFAA 2EIDA 5A3UA 1DQ6A 1LCLA 4HLTA 1ZZ6A 3OTFA 4IE4A 5FLJA 4ZS2A 2G1MA 3JD73 5K8SA 1H1MA 4KMQA 4QKFA 1ACCA 1OBNA 3ZKUA 4CPBA 2EAAA 2UURA 1W2AX 5F5AA 5I8SA 3PUIA 4XIOA 3ZIXA 3MV11 4LBMA 1RMU3 2ZJCA 5E6HA 4OQ9A 3MUY1 1CR7A 1JYNA 2CL2A 1YJKA 4G4FA 4F8AA 3RGBA 2YBKA 3MW3A 2IZWA 1ULGA 5GZFA 2W1SA 1RUE1 4MUVA 3WSOA 3LE0A 3TN91 2Z5WA 2YMZA 4IV3B 1AX2A 3UETA 4YVSC 1V70A 3NSTA 1URXA 1RUH2 1MEC2 2HWD2 4GMP1 2WZR3 1W9FA 3CNAA 3NV4A 2WLPA 4P5YA 1F15A 4XILA 3VDCA 4DMIA 2YBSA 4N43A 4XJAA 3EXUA 5K9YA 3JU9A 1DDLA 1L3JA 4UW3A 1XJAA 1NXD1 1CWPA 1NLQA 2WO7A 3CZJA 1HXS1 2C6SA 2JD4A 4Q4W2 2P34A 4AQ2A 2H6BA 4QQ2A 5BNQA 3U4SA 1WMXA 3GHNA 1LU2A 4M4PA 4UAPA 5LY2A 3T4HB 2JICA 5CFDC 4I0AA 4RFT0 2VL4A 4BXSV 4CXWA 1YFXA 5J3UA 1JI6A 1N3PA 2GMEA 2OUHA 3MFCA 5ANNA 4A6SA 5A3TA 4JTOA 3X29B 3LIGA 1V6MA 2QNKA 3E97A 1KXGA 2XJPA 1ZZ9A 1PHMA 4Y5Z0 2RR11 5LBCA 1VMHA 4LA2A 2EICA 2YV8A 3ST7A 3WNMA 4LBQB 4D94A 5JR2A 5CB7A 1LOBA 4YZ5A 2W3JA 1OT5A 1E5RA 5BNOC 3K46A 5FMDA 5F5CA 4AEKA 4CCMA 5T3NA 1NAEA 5JZGA 1UZZA 1H4GA 1LR5A 1FATA 1RUD3 2I07B 3MPPG 2JIGA 2A75A 2VTXJ 3ZXDA 1DQ4A 1YYNA 1PGW1 3AYDA 4OMCA 4QQPA 3H8RA 3T2TA 4C91A 4BPZA 3PDQA 2D97A 2BTVC 4JCKA 1ZBE1 2IXLA 3GZUC 3M7AA 2BRTA 1NA1A 3JB4C 2TUNA 5T54A 4DXTA 2JKBA 2FDGA 4RGKA 4YM0A 2VZSA 3UGHA 4PQQA 3AKRA 1ZRFA 3Q8AA 2XONA 4WVVA 1CN1A 5JUVA 4ZHNA 1OHFA 3ZX7A 3TEWA 1TQ5A 1GWKA 2IVJA 2W68A 2NMOA 2OPWA 3RZHA 1POV3 2R062 5APAA 1ODMA 1QJY3 4WVZA 4Q27A 5IW0A 1Y3TA 1XE7A 5BNNA 2WAAA 2QKDA 2EIBA 4CEWA 1G86A 2QZ2A 5LA1A 3RNSA 1AHSA 1SLIA 3GZEA 3FMGA 2VPVA 4UBGA 3I3DA 5FPXA 1CAVB 1W6PA 4JGZB 4Q8LA 4ZPIA 5FQ0B 3ZMOA 3VKNA 2W1QA 4LO7A 4M3CB 5CFCA 1LOEA 2VMDA 5T5OA 5FPVA 2MEV1 1HX6A 2D6NA 2YPJA 3BODA 4YGBA 2R16A 1LOFA 2MPFA 5IJRA 5J37A 1F2NA 1R082 5HXMA 3W5NA 3O1MA 2PHTA 2IXIA 4B8EA 3ZMNA 5A32A 3GYDA 1LTEA 5IK5A 1Y9QA 2Y34A 1R1A3 2WZPP 3VHOA 5C71A 2ET1A 2XUEA 5A1FA 1PO12 4Y33A 3GBGA 5EV7A 5IVYA 3VGIA 1DYOA 1OLQA 5LWBA 1I3HA 2V09A 2VZTA 3U37A 4RD7A 4JRLA 4DPNA 2X05A 2A5ZA 1W6QB 2K0GA 2VTXA 2KR2A 4N53B 1J83A 4XJZA 4Z2AA 1ZRDA 1V9U3 3H42B 1KJLA 5FY9A 3OBRA 1NLSA 2DYCA 4FI9A 1FOD2 3KMHA 4HETA 4DINB 5CG8A 4LQRA 1ST8A 2JDAA 3OGGA 3VBRC 4GB32 1UX7A 3BPZA 3PTYA 1WMDA 5KBFA 1Y4WA 4PI2A 2WNOA 3GBWA 3I2IA 4QQOA 1CAUB 4Y1YA 1QJU2 1KS5A 1PVC1 4XDPA 3V0BA 4XXAA 1L7LA 4QPGB 4YW6A 1AJOA 4ARXA 3S7IA 5I0SA 1HDKA 2PLV3 2Z42A 4Y24A 2UYBA 4QXCA 2R061 3S6PA 1BBT3 4JHTA 4LPLA 1BLZA 1XXNA 3H3ZA 3WNNA 3OOXA 5EJZB 4KWJA 1O3QA 5EIYB 5A3LA 4Y20A 1O4ZA 4AAXA 1MQTA 2Q8EA 1ODNA 3QOPA 1SCRA 1DIWA 2ZX1A 4FO9A 4FPFA 3FL7A 1ND3B 3PURA 1FPN1 1LGBA 1YLLA 4UOJA 5C4WC 3MIBA 1WMEA 1I6XA 5FPLA 3WXPA 4CP2A 5F7UA 4CDQB 5I0DA 4BA6A 5FO9B 1Q3EA 4CDQC 4CDUB 3AP6A 2E7AA 3JB8A 4HN0A 2D7FA 5DUUA 1W8TA 1V9U1 2IFRA 2V4AA 4ZONA 2VC9A 3LIHA 1JYXA 2NN8A 3UJOA 5JCTA 5F37A 1DHKB 2RS51 1YC61 3H50A 5A1LA 1ULFA 2DBNA 1PMJX 2XJSA 4GH4B 4CU9A 2G9FA 5KR7A 4FTEA 2HWE2 1WGPA 2BOJA 1WA6X 3ON7A 2XXZA 4OUMA 2PLV1 5IAXA 2QUOA 1COV1 2Y6FA 1Q56A 4RHV1 5J7MA 4EN0A 2PMWB 1K12A 3POEA 1HQLA 1WCDJ 4JDMA 4XE9A 4BMBA 2VD7A 2GU9A 3PUQA 1YFUA 1VMFA 2BV4A 2XKPA 5C3PA 4J25A 2W39A 1W0OA 3UJQA 5AC93 1PO13 4BLJA 1UW8A 1VR3A 2Y26A 4QQLA 4E4ZA 1WCKA 1C8M1 4LA3A 4KL1A 4XF1A 2R6QA 3NJYA 1Y9MA 4NPRA 2VNVA 3ACLA 4P9IA 3AZYA 3E1F1 4HL0A 5AFBA 2P3IA 2YPDA 5D21A 1ZYBA 2CGNA 1XNKA 5LATA 1IGOA 2YBPA 4Q1PA 1MS5A 2W46A 3ZSJA 2VQTA 4OVEA 1G9DA 4BIOA 3I4IA 5FUIA 1JUIA 4CXXA 1XRUA 4M0NA 5FUNA 4BIFA 2ZTNA 1IOAA 3A23A 3P6BA 3HQRA 1UU4A 1RVF2 3VD3A 1TE1B 3K4ZA 3POFA 3G6JB 3B00A 4HVRA 3TYJA 4NR1A 3OGJA 4EWDA 2QFEA 2HWC2 3JQWA 5DXDA 3RRDA 1JOJA 3H8OA 3NKGA 3M2MA 1BXHA 4BQYA 3BTXA 2ERFA 3JQXA 1W9SA 3GDBA 4H14A 2GC1A 1JMUB 1O5LA 1RXGA 1WKYA 2OS2A 2VMGA 4R9DA 3AP4A 5LA2A 3DEMA 3AVSA 3VBSB 2VOXA 3DCQA 4EQVA 2GDFA 4L0PA 4Q0UA 1EPWA 3I2FA 4OULA 3THDA 4B4PA 2GH2A 4M00A 1AUYA 4P5HA 2WN3A 4WV8A 3POBA 4I09A 4N8MA 3WDVA 5FKBA 4LXLA 4AI2A 4XYXA 1AR82 1BEV2 1LU1A 2BGOA 2RDQA 4HBNA 3U0ZA 4CVUA 1O3SA 3DECA 4LKFA 3NO8A 2BNNA 4P9JA 3A21A 2Y0OA 5A33B 4ZXKA 1DLLA 1OD5A 3I2JA 2C4XA 5JVVA 1E57A 1YEWA 1G6NA 1LOAA 2W0XA 1BVVA 1QXPA 1LHNA 1Q8PA 2B46X 3D3AA 3L2HA 4JGZC 4QB6A 1DG6A 2BGPA 1H8TC 1RUD1 3ETPA 2GN7A 2DVFA 4V2VA 1HXS3 5FO8B 2HEVF 3MIGA 2E51A 4GB31 3SKVA 1X36A 3AJZA 4QPIA 1DGRN 2CTVA 3ZN4A 4YG0A 3I3BA 4MX3A 1DGWX 4FFIA 5GLWA 1HRI1 5F3IA 3AXDA 1VBB3 4PF5A 2XLFA 3OSDA 4QDQA 4OHXA 1XNAA 1YFWA 3OY8A 1SFPA 1VRH2 4IGOA 4WVMB 4Y3OA 1UZVA 4H3WA 4GWMA 4QM8A 3UKNA 2CDOA 3WW3A 3WNLA 2Z79A 1MQTB 5CFDA 4AL9A 1D4M1 3JZVA 4CSWA 5F8PA 2DVBA 2HYXA 5ABJB 1K45A 2C9AA 1HN1A 5BXXA 5J09A 2DUOA 2QQVA 2VBBA 4XCBA 5F9TA 3I2GA 2W1UA 2WZEA 1N47A 5FYZA 1RUJ3 4CCOA 4QD2A 3IAPA 5L7OA 1DBNA 3LA7A 4OLLA 4V2WA 4E4DX 1C8NA 3LAGA 3BTAA 4NN0A 3R6SA 3SCHA 4LBQA 2ET7A 3SH5A 1UIKA 2VBPA 1AR93 2BWCA 3FLRA 3O1PA 2VZPA 2ZOEB 4LO4B 1PVC3 2VBDA 5A33A 4CP0A 3V64A 3B93A 5DAXA 3NAPA 2LW8A 2YROA 4S2HA 2JB8A 2QBXA 5FZGA 4YG3A 5LBBA 3QH6A 5FWJA 5JSOA 1OA4A 2CSGA 2YU2A 3T0DA 3AFKA 3HN1A 2R041 2QJVA 1IG3A 4OHYA 4QGNA 4Y1UA 1YI7A 1M06G 2P3KA 2A1XA 5A80A 1QJZA 1UMZA 4HKLA 2DTWA 4NE9A 4LIUA 2D6MA 4RS5C 3ZO0B 4YYOA 5C3QA 1OQDA 4TN7A 1NZIA 3VZNA 4UF0B 2PN5A 5JIUA 2RV9A 2OYZA 1P8JA 1KGYA 1WW4A 3I3EA 4DZGA 2J7MA 2WYFA 3ZYBA 5J1XA 4NWWA 4AHZA 4XQ4A 1EUUA 2JE9A 4XFCA 3T0AA 2B8MA 4FP3A 2PXJA 3O0VA 1WBFA 2P6HA 1Y43B 2WR9A 4AF9A 4BM8A 5E16A 1U5XA 1ZBE2 1DQ2A 4CEYB 1QH6A 3BU0A 5SV8A 1PIV2 2ZX3A 3D6EA 3K3OA 1F35A 4COUA 1MS3A 3MV01 4LUKA 2VGDA 5IVEA 4MGZE 3FC0A 4E27A 3QLQA 3HIFA 2JDKA 3M70A 2XL9A 1DU3D 4ZS3A 2VVEA 2QQPA 1UXZA 1YWKA 3OBTA 1LGCA 4ARYA 3QBQA 1MEC1 2HWD1 1EP0A 1VBD3 4D6RA 1IPSA 1UMHA 4YVSB 3D82A 4TLFA 2J1VA 4FPYA 2DBIA 4NIDA 2HYKA 1UWWA 1W99A 4UWDA 5BNPC 1H2KA 5GZEA 3IPVA 3RWKX 2G19A 3VD4A 1V9U2 1NX9A 1GNZA 3VUOA 2E53A 3POGA 2VTFA 2V5YA 4R4ZA 5FDBA 4R4XA 4JVAA 4YW4A 5SV5A 1L7QA 4YW7A 1GWMA 1UOFA 2A6XA 4LK7A 4P9YA 5FMBA 1KDMA 2R32A 3OBAA 2WFPA 4YW2A 4DRVA 5BYNA 2CGPA 1BCXA 2OPKA 2X5IA 4KGGA 5KHGA 5BPXA 3RZJA 3MGUA 4XF0A 1BK0A 2BQPA 4PHZA 1Q43A 3MF6A 3APBA 4UFLA 4H7MA 2XJQA 3HD8B 4FQ4A 1RITA 1M4WA 2J1EA 3WNXA 1US3A 2GC0A 5FLHA 2RM21 1BMV2 2FCVA 5EFUA 1LKNA 2XBO1 1LHOA 1RXFA 4XJ9A 1JBCA 1MZFA 2JG8A 3ZYIB 4EZHA 5FZIA 1FMD3 2MHFA 3RZMA 4AE2A 1QJX1 4Q4X2 2XVGA 1LENA 4A7ZA 1W2UA 3HJRA 3BIEA 1NY72 1D4M3 4CU6A 4LNVA 4PDWA 4Y20B 2ADEA 4UW6A 4R9CA 2ZHKA 3M3CA 3PVNA 2EIEA 2XVLA 5DUXA 1EAH1 2RHPA 1ZX5A 3RWNA 1X8MA 3NV1A 2VUCA 2WNVA 4MGTA 5JOZA 4GQ7A 1CX4A 2UY8A 1WUVA 4SLIA 4B4QA 3WEZA 2VH9A 1NE4A 4A45A 4NRMA 5FY5A 4M3CE 3KCYA 3W58A 1COV3 4MXWB 1C1LA 1HLCA 5DDJ1 1TNFA 2AH2A 2YU1A 5DZFA 4P02B 4WVMA 4P9LA 1SDWA 2BWAA 1GWLA 1HJGA 4A3XA 1V6NA 3IMMA 5FYVA 3GHMA 5FLIA 2Q1MA 5FYBA 4TLGA 1QNYA 1FNYA 5DUWA 2RMU2 5ERLA 3FJSA 4QB1A 3S57A 5H9SA 5DAWA 3DV8A 1JUHA 2PHRA 3M8LA 1GNHA 3H8XA 1CONA 1W6QA 1E5IA 1FV2A 3BOPA 2HWB1 3LEKA 2QE3A 4NAMA 3WVJA 3AM2A 1LJ7A 4A2UA 1RL3A 4HK8A 1W6OA 1YUDA 4DY3A 3TWIA 2GC3A 4PDWB 1IS3A 1VBD2 3C7HA 1EV12 4AG4A 5EPAA 2QQUA 1S2BA 4YLZA 5J98B 5LRRA 1OXCA 5ABJC 4F7ZA 1PMIA 1F4HA 1UD1A 2YG0A 3HPNA 1OLRA 1ONAA 1IKQA 2X09A 4WZFA 5CIRA 4MG2A 2PQQA 2HWB3 3LOBA 3LA2A 1DFQA 1WW6A 3MEPA 3VBRA 5J36A 2BU9A 1UXXX 1VRBA 1JYWA 1OPMA 3LZZA 1W8HA 4QPWA 4AWDA 3D4KA 1XB9A 5I8TA 1NYWA 3TNPB 2JDMA 2ZGTA 3LEGA 4LTAA 1SBFA 4GJZA 5FJHA 4JZRA 5DG1A 1VJ2A 3IBMA 3LB9A 1HQNA 4HONA 3J8F2 3U11A 4ZZ8A 3WP6A 3KV4A 2PAMA 1OOPC 2Y6KA 3KCCA 4LBLA 4COYA 3VDDB 1U0AA 1OQEA 2F6BA 3OEAA 4CUAA 3NQHA 4JDOA 4Y5SA 2ZBJA 4QQHA 4RR3A 4JDNA 1NZCA 3VBRB 1N1VA 2A3WA 2FCUA 3WZ1A 4QHOA 4TYSA 1XE8A 4YSFA 4RA0A 2VZUA 4IEVA 5F1RA 5HBAA 5F5IA 4N7IA 4XABA 5T5LA 1RVF1 4BYYA 4LKSA 4NIGA 4CEWB 4D6SA 3E5QA 4IL7A 5ISLA 4CEWC 1LNSA 1ALYA 1SLAA 1W8ZA 1WD4A 2QTWB 2YFZA 5F2WA 1RUI2 3IAQA 4BQWA 1AR91 3LDKA 4BLIA 5I91A 4BQXA 3T4VA 2WDBA 3VN4A 5IFPA 4Q26A 1HXS2 1ZZCA 2CGOA 2XUMA 1CAXA 4U36A 5EQUA 3ZXFA 5BV6A 4RSUA 1AR63 1A8MA 4CDXC 4KH9A 1QU0A 1F31A 1R083 3VDBA 5FAXA 1YCIA 4J1XA 5DMYA 3E5UA 4ZKTB 1PGL2 5JXJA 5FZKA 3B01A 4KBZA 3IIIA 3U78A 4FVVA 4IEYA 5C5TA 3S0MA 2BDRA 1UN1A 4MXVA 3RZZA 4I0WB 1ZM1A 2Y8KA 2R071 4INDA 3V65A 2NLRA 2VCMA 1W8UA 2XJVA 3NJZA 4WVWA 1SCSA 2TNFA 4IESA 4JV4A 2W52A 1US2A 2YZ4A 4XFIA 5LK7B 4PLNA 5HXVA 1RUF2 3AKPA 5FJKA 4C0HA 3PTRB 4D7TA 5A6XA 2WJSA 3ATGA 3LD8A 2AREA 4GIQA 2WSUA 2RDSA 1G9AA 1SEFA 1LGNA 2FDKA 2CHHA 5FKCA 3CJIA 4XOGA 1H1IA 1JYTA 1XYPA 4XETA 4LE3A 2XB6C 2LROA 3UGGA 3KQRA 3T2OA 5A3OA 4UFHA 2PYTA 4Y22B 4NIAA 2Q8DA 3N9OA 2E7QA 3MHZA 2VUJA 3THTA 4QPGA 1QJFA 2JG9A 4IE6A 1RUG3 2HWC3 2QQLA 4R52A 3SH3A 2BEOA 1WD3A 1R64A 1IQAA 2BBAA 2DVAA 4CCLA 4NHKA 1RJ7A 5JI9A 2YB7A 4KWKA 2QVSB 2A3XA 2BNMA 2A6YA 3H1WA 3ABZA 1UU5A 4E9KA 1IS6A 2V4VA 2WWSA 2JG9C 3R05A 4YGDA 4CE8A 3BU7A 1IS4A 3HNYM 3VBOB 5IVCA 5CG9A 1DQ0A 2UWCA 3LOIA 1W06A 2OUJA 1BK1A 1H9PA 3RZKA 5JSPA 3K77A 2DURA 1I1EA 1UYPA 5K0UB 1OD3A 1XYNA 3MF9A 2PAKA 1GYKA 5CA6A 2KXLA 1MACA 3VDDA 2HWF1 2WS93 4IEPA 3MBWA 5GALA 2BP6A 3RG0A 3PU3A 2B9UA 4YPJA 1GQPA 3RZGA 1CPNA 2WNEA 4CUBA 5A7OA 4JGYA 5J96B 5F6LB 3AZXA 3GGLA 2JB4A 2XLAA 2P17A 3MIEA 4HKWA 4RQPB 4HANA 5EYXA 3ZFEC 3AP7A 3ZYJB 3OGRA 4BMEA 4LLOA 4BJ0A 3TOJA 3MFAA 3SC7X 2JENA 3K48A 3CJXA 4UYBA 1LEMA 3UT0A 5A3MA 5KHIA 3RFRA 1UOJA 1X9PA 1FOD1 1AR71 2EXJA 1IPJA 2AYHA 4HN1A 4XFBA 5GLTA 3WDWA 2N7GA 3PVBB 4GWIA 3J8F1 3WF2A 5CADA 1YI9A 2QDNA 4XFFA 5FYUA 3WDYA 5C9AC 4YFWA 1EAH2 3ZYHA 4AHYA 3W59A 1UYYA 3WQBA 3KGLA 4EE2A
chains in the Genus database with same CATH topology
2VOKA 2VVDA 1SBEA 3USUA 4YZ1A 1B35B 1V6KA 1LRHA 1D4VB 5JOYA 1JXNA 5DDJ3 4I2OA 1QOOA 2C5DA 4DRRA 3S7EA 1JH5A 1KD7A 2DU0A 2FMDA 1RINA 2ZGUA 4ONUA 4B29A 1UX6A 4I30A 1AR61 5CVRA 4DY5A 1H2NA 4IEWA 2ZABA 3ZXGA 1SBDA 2DCTA 4AI3A 4Q0PA 2ZGNA 1CD3G 3SCGA 3U4XA 1AL23 3AXEA 1LOCA 4Z82A 3E5XA 2HEYF 1AXZA 2WFF2 1QJY2 1QJX3 4N7UA 1NCRA 2SLIA 3MI8A 5ABJA 3RYPA 4GWNA 2GMMA 3NWKA 4R9BA 2VW0A 4DNYA 5GKAC 1CPMA 5JSRA 1AR83 4K7JA 4AEJA 2HWF2 2LTNA 3ETQA 4RHV2 3N35A 4HFSA 2YHJA 5A32B 2FMYA 2PHWA 2IC1A 4YRDA 2FHRA 2NM1A 1VRH3 5B2GB 1WBLA 1OA3A 1ND3C 5FCCA 3P3PA 5C4WB 1YJLA 1C4RA 4K3UA 4PBOA 3N7JA 3NVCA 3IDEA 4PDWC 4AQ6A 2ZX2A 4YARA 1LEDA 3UKTA 1RUJ2 1Z7S3 3D5OA 1OMIA 4HSJA 3RS6A 4WZCA 1MEC3 2HWD3 4GH4C 4LR4A 1FAYA 4Q0SA 3PHMA 3ILFA 3IPVB 4K9SA 2BBVA 3OYWA 1ASJ3 2UY9A 4AVVA 1TMF2 4UXAA 4YVWC 4KQ7A 3FHIB 4KNCA 4D69A 4X6QB 1QH7A 1VBC1 4AFAA 5HI0A 3AJYA 2D3RA 1RHI3 2NZ9A 5FREA 4DS0A 2GZWA 3EJKA 4LBNA 5FMOL 4C1WA 3DF0A 2VW1A 1SLBA 5BNPB 4LO5B 2WL1A 2BNOA 1RGSA 1RUC2 4YW3A 4EWAA 1X50A 1FMD1 2GC2A 3QH7A 1DGLA 1W6MB 3B69A 4KG8A 4LHKA 1QOSA 1H1AA 1J3QA 5E1RA 4NO4A 1NCQC 1REEA 4HZFA 4FPCA 4LO6B 5LEJA 1WLWA 3WW1A 4K6BA 3JCIA 1O91A 4OI2A 2Q8OA 3I59B 4W6YA 2R49A 4RHV3 1BBT1 3WQ1A 1GZWA 1PNFA 3WHUA 2YUEA 2Z2SB 1HRV3 2AR6A 2BYVE 4CEYC 1VAKA 2O0OA 2X5IC 4S2DA 1O7FA 1QMJA 2YYOA 3U10A 4FAHA 3BCWA 1DZQA 5DDJ2 4COWA 1ENXA 1QDOA 1LHVA 3Q9OA 4XZPA 1YRZA 1RB8G 3WCSA 2UWBA 4AI8A 3AYAA 3HWJA 3WD5A 1QXRA 1C8M3 1FI2A 1H9WA 3ZPYA 5BNPA 1JTZX 2XL7A 1X8EA 4LUMA 2ZGLA 3H0OA 4JRAA 2EXKA 1GICA 3R4DB 2ZZJA 2WA4A 3P3NA 3KCXA 4L8QA 2CY6A 3ZVXA 2ZGMA 4F83A 5AFEA 2VOWA 2GSYA 3EQEA 4QT6A 1JYIA 4FAGA 1BYHA 1B35C 1SACA 2D5FA 2WZR1 4WM8B 3SCFA 3FZ3A 2MEV3 1FX5A 3MYXA 5IT6A 4LHLA 4FPEA 2ZGRA 2WQZC 5JAXA 2GNMA 4RQPA 1J58A 4IEZA 1PO11 1QWRA 4XBNA 1X7NA 3RJRA 2ZS6B 4W65A 1PVXA 1WLCA 3ZSMA 5BNOB 3DN7A 3EBRA 3KD4A 4MYEA 2Q30A 1QY4A 1GR3A 1S1AA 4EN9B 2GN3A 3CL1A 1TNRA 3E6CC 3KT1A 3AZWA 1AX0A 1MVQA 1RJ8A 3TRSB 4GMP3 3WUCA 5BUVA 1V00A 1O4YA 3KT4A 4ES8A 4P9WA 1ND2A 3ZDSA 2VY0A 1AYM2 3ZXKA 1PM7A 4AI0A 4B3NA 1R092 3FBYA 5L36A 3ROUA 3H1YA 4W6WA 4I3GA 4AEDB 2WNUA 4TWTA 1F9KA 2LM3A 4CEYA 1UCXA 2EXIA 3FFZA 3HT1A 4QGLA 4QU2A 3VZMA 3ENRA 4OI4A 1NLRA 1VAMA 4HMZA 4ISRA 4CYDA 1ZBA2 1REFA 1MR5A 1PIV3 1XQNA 3WCRA 3B3QE 2ZGOA 1NA1C 3I2DA 5I0RA 2ZHMA 2OA2A 3RMYA 5JPMB 1ASJ1 5BNOA 1W0PA 3IMNA 1ZA4A 2B42B 2VU9A 4LBOA 1F8VA 1H8TA 1Q8VA 3FUOA 3WQ7A 2PLV2 2VW2A 4A7YA 5H9RA 5EWSA 4SBVA 4LT5A 3VBHB 1NG0A 4RGGA 5J48A 4XBQA 4RGAA 2C0ZA 4BE3A 3KS7A 3TN93 4YG6A 3AK0A 2ZKNA 2WNVC 1K5MA 4CZSA 4XF4A 1KFUL 4XIKA 1I9RA 5HCFA 4E2QA 1QHDA 4U2AA 1LULA 5GZDA 5H9QA 1ENRA 2WLQA 1REDA 2X8KA 1GFF2 1ULEA 2Y38A 2BPA2 1N3QA 2IFWA 3I54A 1CGPA 4XW3A 3U07A 2ZX4A 3WW4A 2KM2A 2RJKA 5I0TA 1AR62 3QCWA 2ENRA 3PVEA 1VAVA 4LHNA 1VBE2 3HAGA 3SMHA 2JECA 2ZAHA 4KBBA 4AGVA 3ZXAC 3VBFA 4XMIA 3V0BB 1R081 1HV0A 4MVTA 4UW5A 4FPKA 2MEV2 2XWJB 3C3VA 5C4WA 4XQDA 3KM5A 4KG0A 4AQTA 4IV3C 2XH6A 1QKQA 4MSVA 4BH9A 1AR81 5ACA1 3SLIA 1FV3A 3HMYA 3WG4A 5JLVA 2HEWF 1J59A 4UBHA 1ENSA 2RS31 3J4UH 1NY71 1BKZA 1WA4A 1XNBA 2A7AA 1AR72 1QJX2 3LCPA 1OOPA 4Q4X1 4PLOA 3B9IA 1ZRCA 1RUF3 4XF3A 1C5IA 3M3IA 4WM8C 3CF6E 1RUD2 3A0NA 5L7OB 1SLCA 1VRH1 3WUDA 2A3YA 5C6CA 5IUQA 5KHJA 4YFZA 5FOJB 2ZMKA 1AYM3 3ZFFB 5FTTC 3LA3A 4Q4W3 4HSLA 3ES4A 4FXGB 1ND3A 3M3EA 4QGMA 4K1YA 2RS11 3M3QA 1N1TA 5C9AA 4DXZA 2X29A 3AFGA 3AZVA 4WM7B 3V56A 1GQGA 3D8CA 1G9BA 2A6VA 4J6GA 2FQPA 3K51A 4Q4W1 4N53A 2XHKA 1VALA 1Z7S2 1H2LA 2CV6A 1OOPB 1OA2A 4IEOA 5K7PA 1QQP3 4JGYB 5JPNB 1S0IA 1IKPA 2D3SA 2PTMA 1ASJ2 2UU8A 1OFSA 4JGYC 4M3CF 4XF9A 4QPIC 1KFXL 3VHPA 4COZA 3JD71 3H7YA 2FBEA 2YC0A 3AP9A 3KZ4C 4EWEA 1UPIA 5GZCA 5IK7A 4QPYA 5E88A 2SBAA 2OVUA 4Y4YA 5C8CA 2K2SA 1C8M2 4K20A 1LECA 5EYYA 4CTEA 4MZUA 4FT8A 3VBFC 1H8TB 4E2SA 4NHLA 1IZ3A 4Z07A 4KGQA 2DF7A 4DFSA 1FOD3 1Q5OA 1OSGA 3CO2A 1EAH3 3N3HA 4HPKA 1GZ9A 2BW8A 2Y0IA 1QJU3 3RSJA 2R1DA 5IK8A 4G9SB 1W6PB 4D7YA 4YM2A 1MS9A 5JWPA 2ZCWA 1GBGA 1C1FA 4AI1A 2DUPA 3VBHC 1DGRA 2EIGA 4FOWA 1H0BA 4OI0A 2WIIB 2B39A 1EPZA 3H3UA 2OZJA 4S2FA 4NOTA 3AMMA 3IN9A 1K5MB 1R1A2 4IQPA 1PK6A 4XPVA 1HIXA 1ZZ7A 4ATFA 2WNVB 2FZ2A 3M3OA 4DQAA 4R8HA 1D0HA 3KGZA 1ULDA 3RYKA 1VBA2 2VNOA 1UKRA 3J26N 3WLUA 1QJY1 4MXWA 3H9AA 2RS52 3AMNA 3KB5A 3ZXEA 4ZU7A 5C8WA 2VNGA 5I8YA 1CJPA 4Q0QA 1YFYA 2RE9A 5ACA2 3BALA 5FMOS 4KU7A 3VBUB 4YVWA 3E6DA 4YGEA 3WY6A 1GZWB 4HVOA 3VHRA 2DCYA 1CQ9A 4AW7A 1HW5A 4GALA 4IEUA 2HWF3 2WS91 1GKBA 1OI6A 1O4TA 4IV1A 1S0EA 3L9JT 4CP1A 3ZN5A 4JAAA 3AKQA 2XJRA 2RM23 2XKOA 1POV0 1CVNA 4A7KA 2O8QA 4C90A 2OZ6A 2ZGSA 3RI8A 1NCQA 1ZNPA 2IXKA 1BBT2 3FWEA 5BNNB 3NW4A 5C8CC 2A71A 1MZ5A 4MV2A 3S30A 3ZN6A 2WNUC 3ILNA 4GULA 3AKSA 1WW7A 3VBOA 3SNMA 3OCPA 1WW5A 1BJQA 1S0CA 1PZ7A 2G4IA 2R0FA 4LULA 3IM0A 4UW4A 3USUB 3I8TA 4RS5A 1QGLA 2VULA 2PAEA 3R4UA 4LE4A 4XFHA 1U5IA 5FPZA 4OFGA 3IDBB 4F3JA 2ZA9A 3EO6A 2ZKLA 2BGCA 3AX4A 2DVGA 1T6GC 1OPOA 4AGGA 4AEDA 3WINE 2ES3A 2Q0AA 1QQP2 3G7DA 1LB2A 4KWLA 3ZYGA 3VHNA 3LSEA 4B7EA 1VBB1 1NCQB 2YDEA 4OHWA 3WOGA 4I01A 4FTBA 5GM0A 4B7KA 1AYN3 2E6VA 2A70A 2HJIA 3BOWA 2LUWA 3FLTA 4XJWA 3ZIWA 1N3OA 3RYRA 5T5PA 2B5HA 4L92A 2GH8A 4Q29A 2RR12 4WM7C 4EROA 4Q4Y3 3FX3A 3GF6A 1BMV1 1NCRB 3MLJA 4N53C 3VBSC 4IEQA 4XJ8A 4M3CA 3RJ2X 5CFCB 5EXOA 1RUG1 1RUF1 3VKFC 2BFUL 4ATEA 2LALA 1FT9A 2R043 1CAXB 2AUYA 2UWAA 3WDUA 3JBG3 1RUH3 3VBSA 3ALQA 3DUIA 3IKWA 4FPLA 4XDQA 3ZYRA 3NL1A 4OHVA 2AZ5A 3SH4A 3NAPC 4AFMA 1WLTA 5JOWA 1AVBA 3THPA 3NAPB 1A6CA 1RUE2 4AXOA 1X33A 3WDXA 2XG3A 4OHZA 4W6XA 2B45X 2O8OA 1W6NA 2WT2A 2WSVA 4LLFA 4L97A 1JHNA 5JIAA 2EA7A 3UKVA 3VL8A 4BCUA 3LGRA 4O9EA 4RS5B 2RS13 2WFF1 4XMAA 5KC6A 3GZTB 1AR92 3UV9A 4Z92B 2HKXA 4CRQA 4N9IA 1B35A 3FE5A 1DZRA 5JZGB 3D0SA 2VUAA 4CDUC 1LOFC 3ZXJA 1UZYA 4FTSA 2ZACA 2QDRA 1QF3A 4XEZA 3ZFFC 2ZX0A 2XGXA 3L2YA 5I93A 3RQ0A 3VZLA 3POYA 2RS32 1RHI2 3N7MA 5F6KA 1K5MC 3WV6A 2D6PA 2EVXA 3IIAA 3WP4A 1S55A 1V6OA 4COVA 4C0BA 4V1PA 1H4HA 3RMXA 1PZ9A 1AYN2 4MGIE 1AZDA 5FBZA 2PFWA 3O5SA 4N43B 2DCJA 2WT1A 2K9ZA 2WT0A 3OD4A 4N43C 3O7OA 4URTA 3B7MA 4PIZA 1A3KA 2UYAA 4BOWA 1Q8OA 1S0GA 4H55A 5F5QA 3USSA 1HRI2 4GB33 1BZWA 1CAWB 2I2SA 1W6MA 2XVKA 2WC2A 4MLOA 1R1ZA 4FCAA 2DVDA 5JR7B 1PK6B 4GKYA 1DYPA 1KDKA 1G9FA 1RUI1 4GMP0 3R0RA 3N4MA 3VL9A 2H6CA 1VBE1 2D6OX 1FPN2 3ES1A 4K8FA 4CDWB 4I3PA 3POWA 4FQZA 1EV11 4E4SA 1S0BA 2D98A 1MZEA 1NA1B 3A4UA 3OYWB 1WMFA 3ZSEA 5I0UA 4DOUA 3N36A 1Q8SA 1TME3 4Q4V1 4AHWA 4Y1VA 1RUC1 5GLZA 2EF6A 2IXCA 1NOVA 1S0JA 3AMPA 4PJYA 3V0AB 2ZGQA 2GALA 4ORFA 3J9SA 2YGMA 1A8DA 1ZBE3 3MIDA 2DUQA 1O3RA 3VV1A 2D44A 4MGKE 4XBLA 3IWZA 3B02A 1XYOA 4IV1C 4YZ3A 1W39A 1PGW2 1QDCA 3I7DA 1ENQA 1FXZA 1HQWA 1NQDA 1APNA 1UKGA 3MIFA 3PMEA 4TSVA 5GZGA 3WT3A 3VBUA 4G3YC 1CAVA 5AC92 4CDQA 1RUJ1 3DPRA 1MS1A 1MS4A 3GALA 2DTYA 4Z2WA 1H30A 5CFDB 5L7OC 1XNDA 3PNAA 2PHDA 4LO8A 3O0XA 1KJRA 2PHLA 1YIPA 4YNIA 1ND2C 2D40A 4K21A 2A6ZA 2PHXA 4X8NA 4IXLA 2EALA 1HRI3 1ND2B 2RS12 3OD0A 2VMHA 3NKTA 1D2SA 2R0HA 1G8WA 2JG9B 4AVBA 3NV3A 2GNTA 2XJUA 1CAUA 1W6NB 4YZ4A 5L73A 1EYBA 1VBB2 3DPRB 1ZBA1 4EN8B 3MZHA 5BNNC 5C8CB 1DQ5A 3O12A 3OJBA 1VIWB 2PHFA 3KLSA 4PIXA 2TEPA 2OIIA 3ZYPA 2W08A 2Q5TA 2NYYA 1C57A 3ZFGC 4Q2FA 3WX5A 2XJTA 1D2QA 5T52A 4RQPC 2Z69A 5JI7A 3T1MA 2TBVA 1DYKA 5D8AC 4ZU5A 3V0AA 1LESA 2R072 4LBQD 2P3JA 4Q0VA 3HBZA 4EJRA 3HT2A 1SMVA 1VB4A 1ZVFA 1J3PA 2R063 4WM8A 2PHUA 5C9AB 1AF9A 4FP2A 5AC91 2R1BA 1N1YA 2BVBA 4HVQA 1RIRA 2P37A 1JN2P 1TMF3 4LBKA 2CNAA 4AVCA 1PIV1 1MVEA 1V6LA 2F4PA 4N9HA 2X53S 4NWVA 4ZU4A 2ZHLA 2BUKA 3ECQA 3ZFEA 1ZZBA 2ILMA 4IERA 2VNRA 4JGZA 5L19A 1UIJA 4IV3A 5BY5A 1GLHA 3FUQA 2WKKA 4N90A 2VQ0A 3OF1A 2NP0A 2RR13 1MS0A 2PA7A 4XTMA 2IWGB 4Q4Y2 4Y1ZA 2HWB2 1YO8A 3VDDC 5D8AA 4FOVA 4FBFA 4FOQA 4B4RA 3IDCB 1KRIA 3AYEA 3FBMA 3HQXA 2XPJA 5IK4A 2JXAA 4QPIB 2WZR2 2R042 4YW1A 3VZKA 4BHPA 3ME2A 1DQ1A 2C1FA 1QXJA 2VECA 4LEJA 1ZBA3 3DGTA 3O0WA 4IETA 3ZN6B 3BB6A 1AR73 1F5FA 4FXKB 1C3HA 1S0FA 3PVOA 3GNEA 5GLVA 3VBUC 4AVTA 1V6JA 4YM3A 2JG8B 3KT7A 1VBE3 2XWBB 4OI1A 3VBFB 3ZSLA 2DCZA 4OUSA 5EJ3A 2XBO2 4FPJA 3ASIA 1S2KA 4EN6B 1OKQA 2A73B 5DZGA 2H0BA 3N7LA 4CDXB 4Z8BA 4I0BA 3VBOC 3WW2A 3C2UA 5KHHA 1RUI3 3E6BA 3VLBB 1VBC3 1PNGA 2XLGA 4X6RB 2D6LX 3MW2A 3ELNA 5FFOC 4R9AA 5K0UC 1XU1A 5GLUA 5JOXA 2E7TA 2JDZA 2EXHA 3ILRA 3OY8B 3PJQA 1MZ6A 1PGSA 2RS53 3VKOA 1TMF1 4ITCA 1CAWA 1VP6A 3WR0A 2GAUA 3ZFEB 5JMCA 2JE7A 4GXLA 4Y1XA 4BWOA 4AHXA 4WBBA 2O1QA 1OFNA 2ARBA 4S2GA 1BEV3 3ZSKA 3VZJA 1RC6A 5DUVA 4XJUA 3FFQA 3R4SA 5CBLA 5LEKA 1NXMA 4XTPA 1IPKA 1SQ4A 4QHBA 2HWE1 5FRAA 1UPSA 1Z0HA 2YXSA 3TB0A 1DF0A 4H7LA 2WS92 3DKWA 4TZDA 1UU6A 1OQ1A 1PK6C 2KA3A 3LKJA 4Y26A 2RMU3 3H7JA 1FNZA 1GV9A 3B9CA 2WFF3 4D7SA 2YY1A 2ARXA 5FQ0A 1PGL1 4AVAA 2B7YA 5LRSA 1Z78A 4JC1A 3MLKA 2RM22 4ASMB 2VVFA 1FYUA 2D43A 3AZZA 3AMQA 1AL0G 2Q4SA 1NCRC 2D6KA 3TAYA 1GZCA 4JTNA 2WNUB 4QMAA 1RUG2 1FPN3 3WG2A 2DWRA 2CAVA 2X5IB 1ZZ8A 1U5YA 3MDPA 1RMU1 1S0DA 4J1WA 5H9PA 5GJ6A 4C1XA 1DZTA 4EV0A 3INAA 2ZMNA 1AJKA 4PBPA 4XQWA 2ZMLA 4YW5A 1VLNA 5D8AB 5KXDA 3TN92 1AL21 1VBC2 2P2KA 5E8AA 2I74A 3VKLA 2ETEA 5HCAA 4HPKB 5FO7B 1B09A 1NE6A 2D5HA 4FPGA 1VBA3 3PJYA 5EZWA 2ZGPA 4ASLA 5E89A 4FSJA 4ISQA 2ZPXA 4DB5A 1J1LA 1YHFA 1G9CA 1U5ZA 4AK3A 1NQJA 2FZ1A 4ES9A 3M1HA 2YGLA 4HT1T 5KHKA 1V6IA 1O5UA 4GKXA 1Z7S1 5JZGC 3ZFFA 1BVP1 1D0GA 5KXEA 2BVVA 4YZ2A 1LHUA 1PO22 2GNDA 3WP5A 1RUNA 3UL2A 4AFCA 2ATFA 3PLQA 3JBG2 2VG9A 1RUC3 2XBO3 4Z1VA 4Q8KA 2AGSA 1CIWA 4QXKA 3FLPA 4AYUA 4YVWB 3QACA 1IS5A 1W6OB 4AGRA 1HV1A 5T5JA 3MIHA 2JJ6A 1UAIA 1WCSA 5DG2A 1VB2A 4MGYE 4NVPA 1H2MA 1JW6A 3H1MA 3RPQA 3TNQA 4NHMA 2E9QA 2RJLA 4K1ZA 4QPGC 4P14A 5AVPA 4Y22A 4YVSA 4K40A 4MH0E 5AVAA 2VQAA 1PVC2 3JUUA 1AL22 2BFUS 1RVF3 2H0VA 2JG8C 5T55A 3CJIB 3CJIC 1RUE3 1HRV2 3MICA 2VMIA 4HK9A 1SFNA 4L2NA 4XXPA 2NMNA 3AP5A 1X82A 1U12A 1KS4A 2QCSB 4BZ4A 2D93A 2DU1A 2EAKA 3GBFA 3WDTA 2MNGA 4Q4Y1 1CESA 5KC5A 2DFBA 2R30A 1H8VA 4L99A 3LSDA 2CWMA 3I59A 4XFGA 2IXJA 4AEMA 3O14A 4CDWC 2DV9A 3WG1A 1R1A1 1Q8QA 1LODA 1QOTA 3AKTA 3MLLA 4LBJA 3VBHA 3VZOA 1VBA1 1LHWA 2NQYA 3URFA 5CU1A 3HR9A 4AFDA 3J8F3 1GSLA 3SISA 4M01A 1C5HA 1PO21 1AXYA 1UL9A 2D3PA 2ZHNA 4GH4A 4AFBA 2OW4A 1DGWA 4HKOA 5KWRA 3RDIA 1POV1 4P9XA 4GA9A 2IXHA 2Q1ZB 2QZ3A 3AB0A 1GQHA 2JEMA 1PO23 1J3RA 5K0UA 1AYN1 5FOBB 4RL7A 5KXBA 2ZAAA 4IV1B 4KU8A 3CLPA 4XHBA 1SLLA 1IHMA 1KQRA 4I02A 3H8UA 2VOVA 4E2GA 2G9GA 1A78A 1O3TA 4PCRA 1RMU2 4O9GA 4M0HA 1ZRRA 2CYFA 3B94A 3UK9A 1AYM1 4CDWA 1MQTC 1J1TA 1TME1 4Q4V3 1G7YA 1TME2 3MPBA 4PQ9A 1R091 3D0JA 4IEXA 1EV13 2HWC1 1GANA 4RR3C 5CFCC 3W9AA 4RR3B 1UF2C 3RI9A 2GNBA 1FMD2 3CU7A 3N7KA 4Q4X3 3DL3A 1WLDA 5T50A 1YNAA 3EHKA 1F5JA 1R093 2RS33 4PLMA 3AMHA 1PZ8A 3BIWE 5TSWA 1QQP1 1JYCA 3A0KA 4CDXA 4PIYA 3WHTA 1AXKA 1BQPA 2VXRA 3OPZA 4OZXA 2GMPA 4FPHA 1RUOA 1N1SA 1YIFA 2WINB 1COV2 3JD72 5KXCA 2AENA 2R073 2PELA 2CAUA 2CWSA 3NV2A 3VKMA 4P9GA 4JQRA 4L11A 1LOGA 2E63A 5CNAA 3PMSA 4L9BA 3ZFGA 4AVSA 3WP3A 1ZREA 2WA3A 3WQ0A 4Q1RA 1QJU1 3MW4A 3ZXLA 2WQ4A 3T1LA 2HWE3 5JDBA 4META 4D3WA 4YM1A 1C28A 1D4M2 3QD6A 2ZZQA 4CDUA 1Y7BA 1HRV1 2A6WA 3SITA 3B5LB 3GZAA 5CAZA 4FOYA 1MS8A 2I45A 3WG3A 1TEIA 1XU2A 1ULCA 4QM9A 5D1IA 3KSCA 4EN7B 1RUH1 1HKDA 2RMU1 3DPRC 3TBDA 1YXWA 4QX5A 4WM7A 4XHXA 4FPOB 5ACA3 5LK5A 1AX1A 2V73A 5C33A 4Q4V2 2NPIA 2DFCA 4X8PA 2ZGKA 1VBD1 3ZFGB 5DZEA 1SFYA 3POSA 3SHRA 1CJDA 3CEWA 3IT8A 2DCKA 1XNCA 1BEV1 1SLTA 3SXWA 1QNWA 4AQSA 4BQ1A 3LWCA 3AYCA 2JX9A 1EY2A 1KITA 4AEDC 4YGCA 1RTVA 5HCBA 1RHI1 1I5ZA 3M4FA 3JBG1 4XFAA 1DQ6A 1LCLA 4HLTA 1ZZ6A 3OTFA 5FLJA 3JD73 5K8SA 1H1MA 2EAAA 2UURA 5I8SA 4XIOA 3ZIXA 4LBMA 1RMU3 2ZJCA 1CR7A 2CL2A 1YJKA 4G4FA 4F8AA 3MW3A 2IZWA 1ULGA 5GZFA 1RUE1 4MUVA 3TN91 2Z5WA 2YMZA 4IV3B 1AX2A 4YVSC 1V70A 3NSTA 1URXA 1RUH2 1MEC2 2HWD2 4GMP1 2WZR3 3CNAA 3NV4A 2WLPA 4XILA 4DMIA 4N43A 4XJAA 3EXUA 5K9YA 3JU9A 1DDLA 1L3JA 4UW3A 1NXD1 1HXS1 2JD4A 4Q4W2 2P34A 4AQ2A 2H6BA 4QQ2A 5BNQA 3GHNA 1LU2A 5CFDC 2JICA 4I0AA 4RFT0 1YFXA 5J3UA 2GMEA 1N3PA 2OUHA 3MFCA 4JTOA 3X29B 1V6MA 2QNKA 3E97A 1KXGA 2XJPA 1ZZ9A 1PHMA 4Y5Z0 2RR11 4LA2A 2YV8A 3ST7A 4LBQB 4D94A 5CB7A 1LOBA 4YZ5A 5BNOC 4AEKA 5JZGA 5T3NA 1UZZA 1H4GA 1LR5A 1FATA 1RUD3 2I07B 3MPPG 2A75A 3ZXDA 1DQ4A 1YYNA 3AYDA 1PGW1 4QQPA 3T2TA 4C91A 4BPZA 2D97A 2BTVC 4JCKA 1ZBE1 2IXLA 3GZUC 3M7AA 1NA1A 3JB4C 2TUNA 5T54A 2JKBA 4YM0A 1ZRFA 3AKRA 4WVVA 1CN1A 1OHFA 3ZX7A 1TQ5A 2W68A 2NMOA 1POV3 2R062 1QJY3 4WVZA 4Q27A 1Y3TA 1XE7A 5BNNA 2QKDA 4CEWA 1G86A 2QZ2A 3RNSA 1AHSA 1SLIA 3FMGA 2VPVA 4UBGA 5FPXA 1CAVB 1W6PA 4JGZB 4Q8LA 5FQ0B 3ZMOA 3VKNA 4LO7A 4M3CB 5CFCA 1LOEA 5T5OA 2MEV1 1HX6A 2D6NA 2YPJA 3BODA 4YGBA 2R16A 1LOFA 2MPFA 5J37A 1F2NA 1R082 2PHTA 2IXIA 4B8EA 3ZMNA 5A32A 3GYDA 1LTEA 5IK5A 1Y9QA 1R1A3 2WZPP 3VHOA 2ET1A 1PO12 3VGIA 3GBGA 5EV7A 1OLQA 1I3HA 2V09A 4DPNA 4RD7A 4JRLA 2A5ZA 1W6QB 2K0GA 4N53B 4XJZA 1ZRDA 1V9U3 1KJLA 3OBRA 1NLSA 2DYCA 1FOD2 3KMHA 4HETA 4DINB 5CG8A 3OGGA 3VBRC 4GB32 3BPZA 3PTYA 1WMDA 5KBFA 4Y1YA 4QQOA 3GBWA 1CAUB 1QJU2 1KS5A 1PVC1 3V0BA 4XXAA 4QPGB 5I0SA 1AJOA 3S7IA 1HDKA 2PLV3 2Z42A 4Y24A 2UYBA 2R061 3S6PA 1BBT3 3H3ZA 1XXNA 4KWJA 1O3QA 5A3LA 4Y20A 1O4ZA 1MQTA 3QOPA 1SCRA 1DIWA 2ZX1A 4FO9A 4FPFA 1ND3B 1FPN1 1LGBA 1YLLA 5C4WC 3MIBA 1WMEA 1I6XA 4CP2A 3WXPA 4CDQB 4BA6A 5FO9B 1Q3EA 4CDQC 4CDUB 3AP6A 2E7AA 3JB8A 4HN0A 2D7FA 5DUUA 2IFRA 1V9U1 2NN8A 3UJOA 5JCTA 1DHKB 2RS51 3H50A 1ULFA 4GH4B 2XJSA 2G9FA 4FTEA 2HWE2 1WGPA 4OUMA 2PLV1 2QUOA 1COV1 1Q56A 4RHV1 5J7MA 4EN0A 1HQLA 1WCDJ 4JDMA 4XE9A 4BMBA 2GU9A 1YFUA 2XKPA 2W39A 1W0OA 3UJQA 5AC93 1PO13 4BLJA 1UW8A 1VR3A 2Y26A 4QQLA 4E4ZA 1WCKA 1C8M1 4LA3A 4KL1A 4XF1A 2R6QA 4NPRA 3ACLA 4P9IA 3AZYA 4HL0A 5AFBA 2P3IA 1ZYBA 2CGNA 1XNKA 1IGOA 4Q1PA 1MS5A 3ZSJA 4OVEA 1G9DA 4BIOA 3I4IA 1JUIA 1XRUA 4M0NA 4BIFA 2ZTNA 1IOAA 1UU4A 1RVF2 1TE1B 3G6JB 3B00A 4HVRA 3TYJA 4NR1A 3OGJA 4EWDA 2QFEA 2HWC2 3JQWA 5DXDA 3RRDA 1JOJA 3NKGA 3M2MA 1BXHA 2ERFA 3JQXA