1S2KA

Structure of scp-b a member of the eqolisin family of peptidases in a complex with a tripeptide ala-ile-his
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
206
structure length
199
Chain Sequence
TVESNWGGAILIGSDFDTVSATANVPSASGGSSAAGTAWVGIDGDTCQTAILQTGFDWYGDGTYDAWYEWEVSITISEGDSIQMSVTATSDTSGSATLENLTTGQKVSKSFSNESSGSLCRTNAEFIIEDFEECNSNGSDCEFVPFASFSPAVEFTDCSVTSDGESVSLDDAQITQVIINNQDVTDCSVSGTTVSCSYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Scytalidopepsin B
publication title The molecular structure and catalytic mechanism of a novel carboxyl peptidase from Scytalidium lignicolum
pubmed doi rcsb
source organism Scytalidium lignicola
molecule tags Hydrolase
total genus 44
structure length 199
sequence length 206
ec nomenclature ec 3.4.23.32: Scytalidopepsin B.
pdb deposition date 2004-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01828 Peptidase_A4 Peptidase A4 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.700 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1s2kA00
2IFWA 2IFRA 1Y43B 1S2BA 3TRSB 1S2KA
chains in the Genus database with same CATH superfamily
3SH4A 1NAEA 3GHMA 2WNUA 4YGEA 5DAQA 1GZCA 4M0HA 5ACA3 3J9SA 1HRV3 3FLRA 2OA2A 1C4RA 3GZTB 4RHV2 5JCTA 2VTXJ 4Y1YA 5CA6A 3BTXA 1C8M3 1QJU1 2BVBA 4QDSA 2VBBA 1RUG3 2GNBA 3AYEA 2YZ4A 4WM8C 2LALA 3GJAA 1EV13 4KMQA 3LD8A 3ILFA 1R1A3 3ZFEA 1WBFA 4ES9A 3NSTA 1DG6A 2V73A 1O3SA 1VB4A 2WNOA 4WZCA 5F39A 1MVEA 3MV11 4AAXA 5EXOA 4CP1A 1R082 2I45A 2EA7A 2O8OA 5F32A 2E7TA 4BQ2A 1KEXA 5FZ7A 3RS6A 5LCWL 4NIIA 2WA3A 2JX9A 4FPLA 3R4DB 3LQCA 4XJUA 5FZMA 3UV9A 4CCOA 4CCNA 1WCKA 4LBQB 2RS11 4C8DA 4COVA 4FFFA 5FJHA 3N7KA 4YM3A 1HQNA 4CVUA 3B7MA 2P6CA 4XJZA 3MBWA 1VPHA 4ZU4A 1S0DA 3VL9A 3GHNA 1GQHA 1UF2C 2EXIA 3N9MA 2XJRA 1M4WA 3ZMNA 1OC1A 2YPJA 3IDAA 3ORJA 2XJVA 4GH4A 4RR3A 2NN8A 5CIRA 4CDXC 3AYDA 2E9QA 1RVF3 4UBHA 1OXCA 1UY0A 5HCBA 2XL9A 4HLTA 1CJPA 4OYUA 4ASMB 2X29A 5IJRA 5JPNB 4FQZA 4IE6A 4GB33 4W8JA 4LA2A 1O59A 2WC2A 2OKXA 4QMAA 4E4HA 4LXLA 2C24A 3IDBB 2WS93 5I0UA 1W2AX 4RA0A 5HXMA 2I74A 3NJXA 4TXWA 3GCWA 4HVQA 2GMMA 1XC6A 3ZDVA 1YCIA 2J1RA 1GLHA 2RS12 3HBKA 1MACA 1IZ3A 2Q5TA 1AHSA 3GGLA 1RUI1 2A5ZA 1GNYA 2OX0A 2VZUA 3GM8A 3OUJA 5IAXA 5SV8A 1YQCA 2QQJA 4OULA 2YGMA 1HIXA 2VZPA 3B9IA 3U1XA 1RUH1 3SITA 2VZOA 1YFXA 5ISLA 3MYXA 2P3KA 4B3NA 3LE0A 4H2AA 3ZMOA 2Q30A 1ULPA 3FX3A 2ZMNA 3BOWA 4XXPA 2ZMLA 5T5PA 4OQ8A 2ZHLA 5KHHA 1CONA 3NAPA 3SC7X 5K9YA 4JDNA 2K2SA 5FUNA 2HLEA 1SPPA 4A3XA 2A7AA 4QB1A 4Y4YA 4HPKA 3IB3A 1Q5OA 2W92A 4LUKA 4QPYA 4D8MA 4BU2A 2LM3A 3PNAA 4LHSA 1OMIA 1V0AA 2ORZA 4AW7A 2YFUA 3MIGA 1FOD1 3FHQA 2K0GA 1SHWB 4GMP3 3KMHA 4ES8A 2ZGRA 4CCEA 2VMGA 1VMJA 5E89A 4LORA 3PVBB 2IXHA 3U78A 1AL0G 3C8XA 4AVTA 2HEYF 2W87A 4NHXA 1YIPA 3VBUA 5KXEA 5FCCA 4M4PA 2XVKA 2ZEYA 4LHNA 3OJBA 2PHTA 4P9IA 1CAVB 5E16A 4UFKA 1NKGA 3ZSMA 3GZEA 2XWJB 4CDQC 2NQYA 2V4VA 2QZ2A 3SMHA 2GP3A 3DUIA 4MXVA 2PLV1 4FXKB 3VKMA 3RZLA 3RZJA 4JRLA 1NCQC 1QEXA 2P1BA 2ID4A 5LK5A 4UW6A 4PIZA 3LOBA 2CDPA 1N3OA 2RJLA 3V0BB 4ATFA 2W1WA 5C5UA 4FXGB 5IAVA 3ZYPA 2VOKA 4OUSA 2RS32 3PJYA 3NRUA 3RMXA 1BMV2 1W3VA 1VRBA 4XQWA 1BQPA 1XU1A 1FOD2 2JKXA 3FHIB 5A7OA 1RUC1 1MZFA 3B93A 2MEV1 2RR12 2RS52 3J7MA 2WN3A 4BA6A 1YJKA 1ASJ2 1OOPB 4L9BA 3H8XA 5G05L 2VOVA 2DTYA 5KHKA 1CAWA 5BNNC 4XZUG 1UAIA 1VALA 1JOBA 1W8OA 2CL2A 3T1MA 3X29B 3MF9A 3OBAA 3OF1A 5C8WA 3KZ4C 4FBFA 1PK6B 1DQ1A 1C5IA 4A6OA 3I3DA 4N43B 3U75A 1Y9MA 2PLV2 1MS4A 3MV01 4JGZB 4YW2A 3N3HA 3OEBA 1QJX3 2J1UA 5FQ0B 3HAGA 1KD7A 4ZS3A 1PIV3 2VU9A 4XE9A 4YPJA 3RZKA 2WO2A 2H0BA 4K1ZA 5T54A 3WY6A 3ZXGA 3Q8BA 1FNYA 1RJ7A 5FMBA 2D93A 1CX1A 3B00A 5BYNA 1VBA3 5H9PA 4CXWA 2ZGLA 5C3RA 1PGL2 4I0AA 4ARXA 4K21A 5FY4A 3AVSA 2FMYA 1GQGA 2F6BA 2XMLA 4Y33A 4D6QA 1NUKA 3MFAA 4QX0A 5C4WC 1TMF3 4RFRB 3WG3A 1TME3 1CAUB 2YMZA 1V9U1 5FMCA 1AR93 1OF4A 2CSGA 1G9FA 1ENSA 3HWJA 1WW7A 4EN7B 3T2QA 2QQVA 2WZEA 3MF6A 4IEUA 2VW0A 4XIKA 4XZPA 3K51A 2HWC2 1HQWA 4Y20B 4OQ9A 5JOWA 1UX6A 1GWMA 3IMNA 3ZXDA 3LAGA 4M01A 3W58A 5AC91 5BXXA 1PM4A 2LRPA 1W8ZA 4FP2A 2JDZA 4FPEA 4WM8A 2FCUA 2R49A 4A2UA 5LBEA 1R091 2D97A 3AZXA 4LBLA 3UJOA 1W28A 2R16A 2EVXA 4QB6A 3JB4C 4YGDA 4AI3A 4DUXA 5M0TA 2R041 5FO7B 3I3BA 4Z2WA 2BWCA 3OGRA 4S2FA 1VIWB 1QQP1 3OPZA 2PHXA 4Z1VA 4Q4X1 1GSLA 1GUIA 4ONUA 4R52A 3HVDA 1JU3A 1I5ZA 1KS4A 5I0RA 5DQ0A 1AL22 4LO6B 2OW4A 2CYFA 2OQ7A 5J98B 3ZXLA 1JZ6A 1PVXA 1RUD3 3I54A 4JC1A 1TZOA 1SFPA 2CTVA 5F3CA 2R7EB 4ZY9A 1A78A 3BU7A 5FZ9A 3IMMA 1CESA 3A22A 1DQ0A 2Q1ZB 1DLCA 4DEQA 1UKRA 4CDXA 3B01A 5A32A 4KU8A 1SFYA 1LGBA 4GULA 2R042 1RUJ1 1LENA 2BOJA 5I0TA 4CDUC 3HD8B 3ASIA 5CZKA 4Z92B 2C1FA 5FP7A 2IVJA 2ZX1A 5A1AA 3MUY1 1XOYA 5CG9A 4XTMA 1R083 2VMFA 4HSLA 3DPRC 3NJVA 5FPBA 2R6QA 2EAKA 1V70A 3H1MA 1MVQA 2W5FA 1QDCA 2UWBA 4YW4A 4FAHA 5FJKA 4OI2A 3B69A 3KVBA 4L97A 1PX3A 5GALA 4YM1A 5A3PA 2PHLA 2XHNA 1IGOA 1UZ0A 4IEPA 3SHRA 3CU7A 3R4UA 2DDUA 3LIHA 3P1IA 5CVRA 4JKKA 2WO3A 4A41A 1COV2 3KGZA 3LDKA 4IE0A 3VB9A 3J26N 1QJU3 3NV2A 4FO9A 5FZOA 5F5IA 3BTAA 1I6XA 1YWKA 1QY4A 5DN2A 2FCVA 5FXWA 2BYVE 4XURA 1LKNA 1WW5A 3AL6A 4QX5A 3VL8A 4AE2A 4QHOA 3ZN4A 2DTWA 2ENRA 1LESA 1IHMA 1PVC1 1W03A 3ZM8A 3CF6E 4F7ZA 1HXS1 4OUMA 4QKDA 4H14A 5F2SA 5FYYA 2D6NA 1J58A 1BK0A 4FPCA 4RQPB 3ZPYA 5A33B 3OCPA 2XJPA 3THCA 4CUBA 5GZCA 4YZ5A 5KWRA 4P5YA 3SH3A 2RS13 1S0BA 3N7MA 3E5QA 3UGHA 4HL0A 4S2HA 1MEC2 3H7YA 5A7WB 1E5SA 3IAPA 1RJ8A 1AZDA 4QM9A 3TEXA 1PNGA 3PUQA 4QPGC 4Y24A 1XNTA 4MGIE 4BJ0A 3ZOIA 3K75B 1NA1B 2PMWB 3AC0A 1A6CA 4IERA 3KT4A 2Z4FA 3I97A 2QVSB 4OHVA 3K2OA 4FOVA 4AZZA 4CDQA 3EHKA 4Q27A 4AHZA 2HWF1 2VMCA 3LB9A 2ARXA 5J48A 3V0AA 1YQ6A 3ZXKA 5IWFA 1FMD2 1NCQA 2FZ2A 5CFDB 1IPSA 5BNPB 5HBAA 3E6DA 2CNAA 4IEZA 3I2DA 3LOIA 1JYTA 1X33A 1HXS2 4JKMA 1NYWA 2R30A 3QH7A 4PIXA 3VHOA 4R4ZA 1ND3B 1O4ZA 1W39A 2RMU2 1LHUA 1LOFC 2VJXA 4XFFA 4YVSB 3VBRC 3ZFFB 2DURA 3EB7A 3W20A 4LPLA 1OUSA 3LFIA 1V6KA 1H1AA 1W90A 1WCDJ 2AZ5A 4QU1A 5C9AC 3TWIA 1RUI3 5FKCA 1LHVA 1ZRFA 1ND2C 1VRH1 5FRAA 3T0DA 3RDIA 5EHDA 3KD4A 2VQAA 3ZX7A 5GZFA 1RUH3 2WZR2 1W2NA 5BNNA 4ZXKA 1H4GA 5KXCA 1BEV2 1SCSA 2WAAA 2X53S 3WUCA 3POSA 2VE1A 4XCBA 2Q8DA 4NOTA 4N53B 2RJKA 3CMGA 3TEYA 5FR3A 4BISA 1VBE1 3M3QA 1REEA 1HB4A 2JD9A 2P17A 3T0AA 5KXBA 1OD3A 4FOWA 3N9QA 4E2GA 1RUE2 5ABJC 3UNPA 1W9SA 2VR4A 4GWJA 1YIFA 2DVBA 4K7JA 5GLTA 1GMMA 1GNHA 4XOGA 5L36A 1CPNA 3GF6A 1DYPA 3WQ0A 1NZIA 4AR2A 1FOD3 2XHKA 2X5IC 3HNBM 5C4WA 2R061 4DEVA 4XAAA 4GB31 1SBFA 4UF0B 1X7NA 5FZEA 1UWWA 4JX0A 5JIUA 4HXCA 5I0SA 2FDKA 1K3IA 5I93A 4NWVA 2VTFA 3LDBA 5FLHA 5LY2A 2XLAA 1QHDA 3FE5A 2W47A 3HT1A 5HPOA 5FPVA 3EBRA 2J1VA 5LA0A 3RG0A 1GP5A 2WA4A 3MI8A 5LZ6A 4ORFA 1OPMA 3ZYFA 4L8QA 5EP9A 1C1FA 3M3OA 2NM1A 3K4AA 1RMU1 3ZR6A 1D7PM 3AMNA 3WNXA 3VKLA 1W0PA 4AG4A 1W9TA 3GZUC 1LCLA 1MQTC 5A80A 2FDFA 2PLV3 5A3NA 4Q4Y1 4EYUA 3N9PA 1FI2A 4H3WA 2C26A 5C3PA 2ZPXA 4FT8A 4KWJA 1QOTA 1R1ZA 1XYNA 3KCCA 3RNSA 3FFZA 3SCHA 1D4M2 5I8SA 4XFIA 1NLRA 4I01A 3VDDB 2VZRA 3R05A 4PLNA 4FPJA 1DGRA 2VULA 1PGW2 1RUC3 3ETPA 4FTBA 3VHPA 2P6HA 3MHZA 4P9XA 1MS0A 2MEV3 2KXLA 1EAH1 1UPSA 3AFKA 1VAVA 1ULCA 1Y4WA 3HN3A 3OG2A 4P02B 3JBG2 2CAUA 1JW6A 1Z7S1 5FFOC 2Z2SB 3BODA 3K4ZA 1ZX5A 4WM7B 1LULA 2D44A 3IIIA 4DRVA 1RUNA 3WHTA 2A6ZA 4PF1A 4BQ3A 1W6QA 5C7GA 4QPIC 3K46A 3ZFGB 1ST8A 2DU0A 2HWE1 4M3CB 5FYMA 4MUVA 4AI9A 1Q8QA 2A3XA 4GALA 4HOOA 2HEVF 3JCIA 1X9TA 3WW2A 4IQPA 3VBOB 1H2KA 2HYXA 4XDPA 3O1UA 3HQXA 3F95A 2QBXA 3M3IA 4NMIA 1ENXA 1OKQA 4P08A 2JENA 3H8RA 4CDUA 1Z78A 1S0EA 1JODA 1AR81 2F4PA 3CKHA 2LTNA 5IHRA 3RZGA 4CDWC 4NWWA 3DPRA 2ZX4A 2NMOA 3L2HA 1KDKA 2WFPA 5FO8B 4AEDB 5GZGA 1V9U3 5JVVA 1Z7S2 5SV5A 3MIBA 5A7NA 2XVLA 1PZ9A 3FWEA 3ENRA 5HV0A 2P34A 1QNYA 4LBJA 2LUWA 3HR9A 1XNDA 4J1XA 4KWKA 2A75A 2BGPA 2Y6GA 3JQXA 2HWE2 2ZZJA 5EFUA 5DMYA 4QX7A 1B09A 2WLPA 1HRI1 2JDNA 3EYPA 5AC93 2GP5A 1H2LA 5FZDA 3JU9A 2XJQA 4DXZA 1DYKA 3AKSA 4BIFA 5FZHA 4M3CF 2ZABA 3CNAA 3KT1A 4B29A 3AZWA 1R093 1FATA 3KV5A 2QQOA 3I59B 4LITA 2VZVA 3EXUA 4KGGA 4UAPA 5J36A 2R043 4XFCA 3SKJE 3OEAA 3R6SA 5B4XA 1X8MA 2OUJA 4JQTA 4CDXB 1QQP3 3KB5A 3VD4A 4ZS2A 3IBMA 4LQRA 4LO4B 4AAPA 2D43A 2YFZA 2H6BA 3BOPA 3OYWB 3RI8A 4CXYA 1F35A 4LOSA 4XF3A 4CUGA 4Q4X3 2PHWA 2R32A 5APAA 3RSJA 5IK5A 4NHLA 5HV4A 4MHUA 1VBD2 2B42B 3PUAA 2SLIA 4MG2A 1H8TC 2GU9A 4EN0A 3VKNA 5FYHA 4I2OA 2V5YA 3O12A 2EIGA 3O14A 5J37A 1O4YA 4AHWA 2WINB 5FOBB 3ZXEA 3BIWE 4OI1A 4Q0QA 4DQAA 3PUIA 1CX4A 4L2NA 5FY7A 3POIA 1EY2A 3K48A 4PBOA 4QPGA 4M0NA 3A21A 2HJIA 2Y26A 3ES1A 5C71A 1PNFA 5FY5A 5T3NA 4HONA 3WP5A 4BPZA 3AKQA 2D6MA 4G9SB 5GLUA 4E4DX 4Q4V2 4X6RB 2OUHA 5JLVA 2YPDA 3VN4A 3CJIC 5D8AC 3R4SA 3WQ7A 2ZJCA 4L99A 2BERA 4CU6A 5C8CB 1RUJ3 2ZZQA 4MGQA 3JD71 2FDJA 4PJYA 1NQDA 4H7LA 4Q8LA 2X09A 1PZ8A 1VBB2 2IXCA 2W9XA 5H9QA 1YQ8A 5F1RA 1F5JA 2A1XA 5FZ1A 4A44A 2YBPA 3M3EA 2QQUA 3VBRA 1LOFA 2WR9A 3I2GA 3O1OA 1L7QA 2JKBA 2WWUA 5C3QA 3CZJA 4PQQA 5FUIA 3U11A 3RI9A 5FXXA 5CAZA 1UIKA 5C9AA 3MFCA 5E1RA 3LGRA 5FY9A 4KWUA 4PI0A 1ND2A 2QCSB 2Y6HA 1W05A 4IV1B 2VMHA 2ARBA 1LEDA 5BV6A 1WA4A 2E33A 1L7LA 1YO8A 1XSRA 2B9UA 5JWPA 5FMDA 4FSJA 1CAXA 1W2TA 2QQMA 1APNA 3WDYA 3DKQA 4K3UA 2H0VA 2Y8KA 5HCHA 5I0DA 2HWD2 1N1VA 1W8FA 3WCSA 2JB4A 4RHV1 3LZZA 4OZXA 1WCSA 2VCAA 3J7HA 2ZKNA 4YFWA 4BYYA 5ABJA 5IYYA 5A6ZA 4D69A 1BCXA 1PVC3 3WP4A 3AB0A 1HXS3 5FP4A 1G9AA 5FXZA 1AF9A 1XSQA 3W9AA 4Q8KA 5K0UC 4F83A 1WW4A 1NY72 1QOSA 4LMFA 4EWAA 4AVVA 5JSOA 5LRSA 3KVAA 2X5IA 1AXYA 4LJHA 1SMVA 5BY5A 2VZSA 4AXOA 2D3PA 2P37A 4KG8A 3S5QA 4QX1A 4QXKA 1ODNA 4GKXA 3A0NA 2BOIA 4IGOA 4LE3A 4BK4A 4BXFA 2RDQA 3DXUA 2I07B 1AJKA 1RYYA 2ZGSA 3J7NA 4ZKTB 4DFSA 1GU3A 2WZR3 4IE5A 5H9SA 4BWOA 2PA7A 1XE8A 2A71A 5D21A 4JGYB 4WVMA 2Y34A 3VBSB 5LA1A 5LEKA 3O0WA 4KBBA 1JU4A 5FWEA 2BFUS 2P3JA 1GWKA 1IG3A 3SNMA 5LWBA 3UESA 4Z8BA 4XXAA 1MQTA 2HWF3 2VQTA 3DCQA 3C7GA 1LAJA 3GJBA 5FK7A 5CFCC 3N9LA 2JIGA 4BIOA 3IM0A 3VDBA 2XJSA 2XBO2 2P2KA 3KSCA 3POWA 1AYM2 1S55A 3NNGA 1IS4A 2W0XA 2QQIA 1FV2A 5DDJ2 2YY1A 4DY3A 1B35C 2DFBA 4GJZA 4TYSA 4LE4A 4BQ5A 4DS0A 1SLCA 1ULDA 3CZUA 3D6EA 4KGQA 2JG9C 4E8CA 2ZAAA 2E32A 4XJWA 4IXLA 2WL1A 4LIVA 3MPPG 3VLBB 2EXJA 1FX5A 5C6CA 2RE9A 1VRH3 1CPMA 1BXHA 4QKBA 2W52A 3VBHC 4AFCA 4PCRA 4M3CE 3PJQA 1FPN2 4CCJA 2Y60A 1ZRDA 4QQLA 3SQOA 5A3TA 4KI5M 4OHWA 5J09A 4QPIA 4IV3B 5FUPA 1OLQA 4UYBA 2FDHA 1VBC2 3JZVA 2VPVA 3M4FA 1O5UA 4YW1A 1LTEA 4XVHA 4AVBA 1VBE3 4RSUA 4Y5SA 2GAUA 4YNIA 4NIHA 1LOAA 2YROA 3FJSA 1UD1A 4XBLA 4XFHA 5CKQA 5FIXA 1VAMA 4CEWC 1BVP1 2JE8A 2W08A 1WWYA 1WGPA 2GALA 1MPXA 4YZ3A 5GZDA 4BQ4A 2ZX3A 2E51A 5FYZA 5AVPA 3P3NA 1DF0A 4ET7A 4CDWA 2WBKA 3BCWA 4FPYA 3LEGA 4Y22A 5EJZB 3W59A 1UNBA 5FMOL 1SBDA 2R063 1C8NA 3PVEA 4RL7A 1TG7A 4CP9A 4L0PA 2BRTA 2W94A 1YHFA 2KA3A 1QXRA 2V5DA 3J8F2 4H55A 1S2BA 3N7JA 1SDDB 2C4XA 2W2IA 1NE6A 5DZGA 4E2QA 2QQPA 2XXZA 1WLTA 1WLCA 1VP6A 2IXKA 3ILNA 3HJRA 2AYHA 1GYKA 2PHDA 4A45A 3BIEA 5BNQA 4E4ZA 2GNMA 3W5MA 1JS9A 4MZUA 4PDWB 4FP3A 1LODA 1WMXA 3WNMA 2YDEA 1RMU3 2P3YA 4ZU7A 1FV3A 1S2KA 2YU1A 1CIYA 1RHI2 3FHAA 3ALQA 4QX3A 4TWTA 5ANQA 3VBFB 1W8HA 3HNMA 4HETA 4IEXA 4Q4Y3 1G7YA 3H1YA 3ZKYA 3RVHA 2VZ3A 3WD5A 1YI7A 4RGKA 3OGGA 2JJ6A 4QHBA 1POV0 5FZ3A 2V72A 4A3ZA 4AHYA 1FYUA 3KV6A 2R071 5IK8A 3ACIA 4HSJA 3ZDSA 2RVAA 3DN7A 4YVWB 3U4SA 1OH3A 4P14A 5A6YA 2JDAA 4KNCA 1PGSA 1EAH3 2X8KA 1YI9A 1NCRB 3FUQA 1H8TA 1Z7S3 2G9FA 3G7DA 1UU6A 2RS31 5LBCA 4AHXA 1BMV1 1OLRA 3WQBA 1FXZA 3R0RA 4E4SA 1UU5A 4IGPA 1XU2A 2UURA 2RR11 1FNZA 1O7FA 2RS51 2VNGA 3OB8A 1VLNA 2F17A 3WP3A 4D6SA 4JHTA 5BNOC 1ASJ1 2HWE3 1G9CA 4LKSA 4ISQA 1A8DA 2TNFA 2KM2A 4Z07A 5F5CA 5FP8A 3H3LA 1JYCA 2AEYA 2WFF2 2RV9A 2P4EA 2YG0A 5J96B 5A1FA 1ZBA1 1UQXA 3CJIA 2XB6C 5D8AA 2DUOA 3CLPA 3T4VA 1SDWA 4GKYA 4BK5A 2D6PA 2BNNA 5LY1A 4EE2A 1S2EA 3RYRA 3AKTA 3U37A 1BJQA 1AR83 1GP6A 3J7LA 1ZBE2 3E5UA 3MPBA 2R072 1IG0A 3QH6A 2BV4A 4RS5B 4I30A 4C90A 4UWDA 1WCQA 4MXWA 1J84A 2ADDA 1TEIA 2CGOA 3KS7A 5JSPA 3KV9A 5A6QA 4NIDA 1SLTA 3AM2A 4ITCA 1OQEA 4BOWA 3G6JB 4NUBA 1PGL1 3IAQA 4AGGA 5JZGB 1HN0A 3AKPA 4N7UA 5IVJA 3S0MA 2GSYA 1BK1A 2ZGMA 1YC61 4XJAA 4LEJA 3IIAA 3CBNA 1HRI3 1X36A 2HH9A 4AL9A 5CADA 5KXDA 3LCPA 2QQWA 3K3OA 1RUF2 2GZWA 3OPWA 5A7QA 1NOVA 3BALA 3UKTA 4N9HA 3ZVXA 1ZBA2 5JAXA 4QB2A 2HWC1 1LGCA 1Q8PA 1AR62 2VUJA 1OQ1A 5FP9A 4BCUA 3HQRA 5EYXA 2DF7A 2NYYA 1KQRA 1NE4A 1YFUA 2JG8B 4MO3M 4O65A 3I7DA 3ZIWA 4EROA 3WSOA 4D0QA 3WNOA 4PQ9A 4OI0A 3PLQA 3E6BA 5K0UA 1GQPA 2ZA9A 4HBNA 4IEOA 3VDCA 3ZN6A 1D2SA 5LEJA 3M1HA 5HI0A 4JTOA 1D4VB 1DQ4A 3AJZA 1V6LA 3ACLA 2DV9A 3BPSA 4R9DA 2QZ3A 5EYYA 1W6MB 1CD3G 4EN6B 1ZVFA 3ATGA 4AQSA 3HN1A 1TVGA 1V6OA 2WSVA 2YXSA 3C7OA 1DYOA 1NX9A 4Q26A 5F2WA 5IVCA 5C3OA 4YZ1A 5L7OB 5KHJA 1YUDA 4QX2A 4BM8A 2RDSA 5FZCA 4GAZA 3ZIXA 1AL21 2Q1FA 1MS3A 3IPVB 3NV3A 3ZYBA 3WW4A 4N7IA 4BZ4A 3KM5A 3USUA 1KITA 1W6NB 1HB2A 2XH6A 5FYCA 5CFCA 3JD73 2NZ9A 1LECA 1A8MA 5CNAA 4P9LA 4V1PA 3FL7A 2GC2A 1C28A 3K77A 3MIFA 1W6PA 2XQXA 3I2KA 3ZSKA 2X05A 1LHNA 1B35A 2WNVB 5IVEA 1AYN2 4KWLA 3NKTA 2Y38A 5JPMB 5JR2A 5DAVA 5C70A 2JG9A 1L7RA 2CWSA 2IFWA 1RUOA 1PMHX 2ZCWA 5FBZA 2ZGOA 2PAKA 3PURA 5A6XA 4C1XA 1QJZA 4O9EA 1CZSA 3QD6A 4QPWA 2QQNA 3ACHA 4KH9A 5FPLA 2BWAA 4ZZ5A 2FMDA 3VBHA 4R9CA 4LTAA 1J3QA 1PMIA 1X82A 3I2IA 4NROA 2RDNA 3A4UA 1J3PA 1W8NA 2ZXQA 5DUVA 3WF3A 1US3A 3NWKA 1GZWA 1XYOA 2PQQA 2GH8A 3GNEA 4QD2A 3ACFA 1JZ5A 4XW3A 1CVNA 1HDKA 2IFRA 3FBYA 4RHV3 3JQWA 1COV1 4WVMB 1KFUL 4CEWA 2R0HA 2Q8CA 2WNUB 3GYDA 1XNAA 2G9GA 1QXJA 3T2OA 1RTVA 2Y6JA 4XDQA 4DB5A 1D0HA 3I2FA 1ZREA 5F9TA 1MS5A 2IWGB 4W6XA 1UY1A 1DDLA 3AZVA 3KHBA 1IQDC 3LA7A 3WDXA 3WUDA 5I91A 3ZFEB 1KFXL 3NKGA 4BHPA 1ULOA 4W6WA 3H50A 4CEYC 4INDA 2UWAA 5IT6A 5FWJA 3RWKX 2GN3A 3MW4A 4AI2A 1C5HA 2XLFA 2RM22 3B9CA 4OHYA 4LT5A 2LS6A 4YLZA 1ZZ8A 2SBAA 1L3JA 5JSRA 5FZIA 4IEWA 3H7JA 4AFMA 1MEC1 1N3PA 2JDHA 3LDRA 4R4XA 2JWPA 2VECA 5B2GB 3H3UA 1JH5A 3WZ1A 5F5AA 5F8PA 3TNPB 1SEFA 4K20A 1HKDA 2JIJA 3KQ4B 5T50A 5KBFA 3ITQA 2B9VA 1TE1B 4G3YC 4CUCA 4QQHA 2R0FA 5DUWA 1S0GA 4C91A 3TN92 2HWB2 3EMRA 1ZRRA 1JTZX 1HJGA 2PXJA 2XJUA 2P3IA 1FMD1 4RR3B 1CIWA 4GH4B 4ISRA 3RYKA 5G04L 4KBZA 2PELA 1QF3A 1OSGA 2Z79A 4QT6A 3INAA 5E8AA 3S6PA 1POV1 2GN7A 3T30A 4LOTA 2AUYA 2RMU1 1AX2A 2ZHNA 4JAAA 1CJDA 1ULGA 1NG0A 1Q8OA 1QIQA 2BBAA 4HKLA 1QJY2 1SQ4A 2WYFA 1J1LA 5GLVA 1GICA 1LOBA 1KGYA 1H30A 5BNOA 2YC2A 3MIHA 3AP7A 3SXWA 2YBKA 1F31A 4AI8A 2WO1A 4BQWA 1UCXA 2WZR1 2ZGTA 4ASLA 3AX4A 3CHXA 5ERLA 5FP3A 1BEV1 4HK9A 3KCXA 4B1MA 1G9DA 2R1BA 1LJ7A 5JI7A 1I1EA 5TSWA 4JCKA 3OGSA 4MVTA 1PO11 3WNLA 2ZEZA 1US2A 2AGSA 3OY8A 3LEIA 1T6GC 2D7FA 4LR4A 2AEZA 1OQDA 3POEA 4Y1UA 3D8CA 1JYVA 1N1TA 1LHWA 1RUE1 2D98A 3UKVA 2DCYA 2EXHA 1DZTA 1JYXA 1SCRA 5L19A 2YGLA 3NAPB 5JOYA 1O8SA 2XUMA 5L9VA 2XPJA 2W1SA 1UMZA 4V2WA 1BBT2 4QX8A 1SPPB 4UBGA 1E5RA 3BKZA 3TRSB 2C6SA 4HPKB 4N90A 4XJ8A 2WT0A 2HKXA 1PK6C 2Y64A 4N43C 2CWMA 1KDMA 1U5ZA 1OLME 2IUWA 3JUUA 4JGZC 1D2QA 3H1WA 3Q8CA 4XHXA 1O8PA 1N1YA 1H9PA 1QGLA 2ARCA 2Z69A 4QM8A 3VDAA 2Y6KA 1JYIA 4AQ6A 2HYKA 1EPWA 5DAPA 1XBFA 5DZEA 1AR72 5EIYB 3POGA 2YV8A 1GKBA 4OFGA 1QXPA 1HQLA 1AX0A 3S7IA 1W6OA 1PO12 3NMBA 5K4LA 4YG0A 1BYHA 2YYOA 2DVDA 3I2HA 4S2GA 4UT5A 3VBUB 4B4QA 4URAA 1QWRA 3ZXJA 1P8JA 2PFWA 4JDMA 2R073 3CJIB 4NE9A 5D8AB 1Y9QA 2WNEA 4MGKE 1ZA7A 2Z5WA 1AJOA 1WLDA 2DUQA 1YNAA 2IVIB 5DAXA 1XPWA 2B7YA 4GWIA 1OBNA 1ODMA 3JB8A 3NJZA 2FBEA 2BUKA 4MLOA 4XBQA 3VHRA 4AFAA 1D4M1 2RS33 5HXVA 3I8TA 4X8NA 1LGNA 4TN7A 2DCTA 1PGW1 1JHNA 1FAYA 2RJ2A 5BPXA 4EWDA 4XF9A 2DVGA 2RR13 2RS53 1OF3A 4NVPA 1HRV2 3C7EA 3WF2A 4CE8A 5ACA2 1ASJ3 2EIDA 2ZAHA 1DQ6A 4QGLA 3JBG1 2VBDA 4XMIA 2QTWB 2FCTA 5C3SA 4O7XA 3FBMA 1RUG2 1CGPA 1F9KA 4QGNA 3S7EA 3MO4A 1EV12 4NJ4A 4NHYA 4QU2A 1R1A2 1W06A 1ZBA3 4QDQA 4BMBA 4UW3A 1RGSA 3LPFA 1DLLA 3NNLA 1W0NA 3BYWA 3PUHA 3PDQA 3AYCA 1CAWB 3USSA 1BVVA 4BMEA 3RZMA 3FLPA 4LBQA 1MZ6A 1QJFA 1JBCA 3GBFA 4QKNA 3QACA 3AMMA 4GZ9A 3T2TA 4XF0A 4EZHA 4JDOA 3AP6A 4HG6B 1WMDA 2P5BA 3PMSA 2OPKA 4PLMA 2BZDA 1UO9A 5CKMA 4FPFA 4M4RA 2AENA 5J3UA 1JZ2A 1S0FA 3C3VA 5T52A 3HT2A 4RD7A 2BU9A 3PU8A 4DO0A 5DZFA 4YGBA 4E9KA 4J6GA 2QKDA 4NAOA 4NR1A 2BEOA 5C5TA 3KV4A 1QMJA 4XHBA 1XE0A 2WKKA 4GJYA 2VAUA 2AR6A 3D0JA 2AC1A 5LBBA 4AGRA 1YEWA 2HWC3 3CL1A 1RVF2 4LKDA 3GCXA 3BVCA 5FYVA 4AFBA 1XNKA 2QNKA 4QHZA 2ZOEB 2BGCA 3HOBA 1G6NA 2B39A 3PU3A 4LK6A 3LKJA 4QAWA 4KL1A 1SACA 1BKZA 1OFNA 2NPIA 2OZJA 2WS92 2IXLA 4OMDA 4YYOA 1JZ3A 4WM8B 2VOTA 3NV4A 3UL2A 5FXVA 4IUGA 3THDA 3ZSJA 3LSDA 1MZEA 2O8QA 4QXBA 4U36A 1S4CA 5LATA 4CEYA 1LOEA 4YZ4A 1U0AA 3T1LA 2A73B 4P9GA 4AVSA 4K1YA 1VBD1 1J83A 2C5DA 1H6YA 2G1MA 3AP4A 3TOJA 3BUCA 4XUQA 1LR5A 3UETA 1AL23 1W9YA 1F4AA 4OCTA 3DKWA 4K9SA 2VVFA 4AFDA 5JMCA 5IFPA 2N7GA 2J1EA 3IKWA 3CQOA 4MHRA 1OA4A 2HBUA 5T5LA 2E6VA 1LRHA 2BQPA 5A7SA 1GZWB 1LB2A 3ILRA 2D40A 4RQPC 4XILA 4F8AA 1ZZ7A 2ZGPA 4Q4V1 3LEKA 1IKPA 2ZS6B 4C0HA 5F37A 3SLIA 1O6UA 3KF5A 1SG3A 1XQNA 4Y5Z0 4YW5A 1CWPA 2W46A 3VD3A 3TBDA 1AXZA 4CU7A 5A32B 1UX7A 2QFEA 2ZX2A 4JKLA 1SLAA 2ORXA 2VMEA 2PYTA 1VBB1 4LA3A 5F5QA 3E1F1 4XAEA 5IK7A 4YARA 2QDRA 3WT3A 1V6IA 3VD7A 3O7OA 1CAVA 4Q4W1 3V56A 3MIDA 3TAYA 3F2ZA 5FKBA 5HCAA 1BZWA 4YW3A 5AFBA 4ZONA 1UYXA 2ZTNA 5CFDC 1H6XA 3VZLA 4PLOA 4WVVA 5BNPC 4AYUA 3KHCA 4HFSA 5DUUA 5T55A 3RJRA 3V0BA 3HIFA 1E5IA 2FDGA 1COV3 1ND3C 3ZN5A 1UW8A 4Y1XA 4YVSC 3O1SA 3ZFFC 2FDIA 1GOGA 4Q0SA 1U5IA 3VD5A 3V65A 5CYYA 1DFQA 3AP9A 4YW7A 2XLGA 3UYJA 3DGTA 4EWEA 4W6YA 4NAMA 2HWD1 4AK3A 5FZOB 5A3WA 4CPBA 2VCCA 4META 3NO8A 4ZPIA 2WJSA 1GOFA 1AUYA 4GWNA 2L9LA 2XR4A 2W1QA 2YU2A 4FPOB 3AK0A 5I8TA 4NPRA 5FYTA 1OLMA 5EPAA 1UOFA 2VVDA 4FPKA 1NY71 4Q4W2 1Q43A 1A34A 5KHIA 3K3NA 2VC9A 3LPGA 1UOJA 4WBBA 1OVPA 4A7ZA 1PK6A 2XOMA 5JIAA 2A6WA 5DXDA 2W39A 4N43A 4JGZA 4XPVA 1WD3A 2D6KA 5LA9A 1MEC3 1U5XA 1JZ8A 5FQ0A 1MS9A 1CN1A 1YRZA 4MOAA 5FZ4A 1ZZCA 3LF7A 2Q8EA 1QJX2 4N9IA 4FTSA 4YWAA 2A6XA 4FFGA 3L2YA 3T09A 2ZMKA 3Q8EA 1PIV2 2JICA 3ACGA 1K5JA 4IESA 2G4IA 4LHLA 2VQ0A 4KG0A 3FC0A 1VBA2 4ZU5A 5GLWA 3SEPA 1CAUA 1REFA 3VZNA 5KHGA 2PHUA 4ZZ8A 1FMD3 5JR7B 3BTZA 2XQRA 3CEWA 1TMF2 4CDQB 1TME2 2JD4A 3NNMA 1POV3 4I02A 2XBO1 2Y0OA 3WG2A 3V0AB 1AR92 1AYM1 2J7MA 3VV1A 2RMU3 4EJRA 3FZ3A 1NCQB 4K8FA 4Y20A 5DDJ1 4GIQA 4JQRA 4MV2A 2AACA 3QBQA 5IW0A 1VR3A 1UU4A 4A7YA 3MZHA 1YYNA 3AP5A 2WRAA 3AVRA 4D6RA 2BW8A 1V6JA 1J3RA 3NV1A 1STMA 1IS6A 2BTVC 1ZNPA 4A6SA 2VG9A 1UIJA 2XDVA 1FPN1 3VD9A 5T5OA 4CCLA 1LU2A 2OQ6A 1K5MC 2JEMA 5GKAC 5JXHA 1K42A 1W04A 3IT8A 1BEV3 2EF6A 3PTYA 1DGRN 3VDDC 2H6CA 1VBC1 1XB9A 1UY3A 1PO13 5BNNB 1REDA 5CU1A 2W95A 1GANA 1ENQA 4XF1A 4UFHA 4YG6A 1S0JA 4I09A 4XABA 1CZTA 2D3SA 1SBEA 3AYAA 1RUE3 1F15A 3S30A 4UOJA 3HMYA 4WM7C 2IXIA 1JZ4A 3TEZA 2BGOA 4KQ7A 3I2OA 5CKNA 2ET7A 4WV8A 3ZFGC 4X6QB 3I4IA 4AQ2A 1NXMA 4J1WA 1EYBA 2UYAA 4LULA 2R1DA 2ETEA 1RUD2 1RXFA 5BUVA 3VUOA 4YGCA 4XQ4A 1JZ7A 3VBOC 4DPNA 5FPUA 1M06G 2VOWA 4BH9A 3J8F1 2Q4SA 3UJQA 5C4WB 4RYDA 3E6CC 3I3EA 3WG4A 4UFJA 4B7KA 2CGNA 1H8VA 2FZ1A 4QDRA 4LBQD 4MYEA 4NPMA 2B4KA 4B7EA 2VTXA 2XKPA 4OMCA 2LROA 3KCYA 5FY0A 1ZRIA 3ZXFA 3POBA 2WZPP 4DMIA 3RWNA 2E63A 1ZZ6A 1PZ7A 2E7QA 2PHRA 1GBGA 4AEDC 1RHI1 1W0OA 1ZA4A 2VUAA 3OGJA 4ATEA 2XGXA 3OSDA 1E5HA 2JECA 5FPZA 2NLRA 4BQYA 1W2OA 3ABZA 4JZRA 1QJEA 4HKWA 3SCFA 3WG1A 1D4M3 2KD7A 4IDZA 2WWSA 2C9KA 2OYZA 4Q0UA 3J4UH 3NVCA 3FMGA 3GBGA 1O3TA 2A6VA 2VW2A 3ZPOA 1N1SA 2VVEA 3KGLA 1I5PA 2V4AA 2JB8A 1UYPA 1XE7A 4IEYA 4FFHA 3OTFA 1SLIA 3CIHA 1WKYA 4LBNA 3JBG3 4XACA 4E27A 1GZ9A 1QJU2 1GNZA 2W68A 2WT1A 1CZVA 4UFIA 5JOXA 3ZLIA 5IVVA 4Q5OA 1JUIA 1V6MA 3N35A 4NRQA 3ZYIB 5A1LA 2QQKA 5LA2A 3OOXA 3HPNA 3URFA 2BBVA 4OI4A 1WUVA 2E7AA 3B3QE 3APBA 3HQUA 1W6QB 3KWVA 3MEPA 4RQPA 3T08A 3UGFA 2WFF1 4B4RA 2WZ8A 3DYMA 5AFEA 1WBLA 1OUXA 4L92A 4CXXA 3WLUA 4CP0A 1WA6X 4O9GA 1XNCA 2Q0AA 1LEMA 2AH2A 4HN0A 5A7WA 4LKEA 3NL1A 3OD0A 4LIUA 4Q2FA 3PVNA 1ZBE1 1OA3A 3I3MA 1S0CA 2BNOA 3QOPA 2QUOA 4CDUB 4E2SA 3NQHA 4F3JA 1OKOA 1POQA 2VMDA 1NA1A 1QOOA 2ZGKA 2UY9A 2RG4A 3ZYRA 2DCZA 2GMEA 5FYUA 1UPIA 3LSEA 3DPRB 3DYPA 4CEYB 1KJLA 3H8UA 4OHZA 2B46X 2PAMA 1XNBA 1URXA 4AI0A 5C8CC 2VCMA 2CAVA 1DHKB 2B5HA 2OS2A 2V09A 5ANNA 5CFDA 1H4HA 1W8TA 3ZSEA 4A42A 5BNPA 2E53A 4B8EA 3KLSA 5EZWA 2A3YA 3SISA 5JMOA 4ARYA 3WF1A 1ND3A 3S57A 1PMJX 2WN2A 4YVSA 3ZFFA 3RMYA 2VCBA 1RUF1 3M8LA 1NXD1 1HX6A 3BN6A 4Q0PA 2ZEXA 3VHNA 4IL7A 2O0OA 5CBLA 1QH6A 3AL5A 4EV0A 1LNSA 2MHFA 4Y4RA 1UZYA 1WMFA 1AR61 2W3JA 1GWLA 3H42B 5DABA 1QNWA 2WUHA 4XJ9A 4AI1A 4IV1C 1NT0A 3ELNA 1F2NA 1O3QA 4RGAA 1RUI2 4QQOA 2TUNA 3BGAA 1LHOA 1O5LA 3WHUA 3MLKA 5J7MA 3POJA 4MSVA 1C3HA 5EJ3A 3TNQA 4Z2AA 1RUH2 1OA2A 1SFNA 2DVFA 2VUDA 1VBD3 1X8EA 4N53A 3BTYA 4AOCA 3MICA 3N4MA 3RQ0A 2VM9A 1DGLA 4P9YA 4YRDA 5D1IA 4COWA 3PIJA 4NHMA 1IOAA 5J1XA 1YQ2A 5L73A 4LK7A 3ROUA 4CPBD 3CJXA 4WVWA 1OHFA 4B1LA 4QXCA 4UFLA 5JI9A 3OD4A 1JOPA 4JTNA 5FPAA 1YQ5A 4SBVA 4IEQA 2CU5A 4Q4V3 4QPGB 3ECQA 3AFGA 4UF0A 5A70A 2F4LA 2HEWF 2VO5A 1G9BA 5C33A 5L9RA 2PN5A 3P6BA 3O0XA 4LO7A 4Y5TA 3UK9A 1AX1A 1UZZA 4K6BA 3D3AA 1W3XA 1VBB3 1WCUA 3P5BA 4TTGA 4JVAA 1RITA 2WAOA 1OI6A 4FI9A 2JDYA 3N7LA 1TQ5A 4GD4A 4FOQA 1ALYA 1RL3A 1AYN1 4J25A 4JGYC 3VBSC 5FYSA 4Q4W3 1MR5A 4CSWA 2AREA 3LEMA 4I3PA 3KF3A 3RJ2X 1XYPA 2JDPA 4CRQA 3VBRB 1OFSA 4DXSA 5IATA 2GH2A 1UOBA 2I2SA 3WP6A 3WNKA 4LLFA 5CISA 4Y1ZA 1FT9A 1X50A 5F6LB 3B94A 4UFMA 5C9AB 3D4KA 1OT5A 1K5MA 3WEZA 5B4NA 1UOGA 1UL9A 1F4HA 1ND2B 2ZHKA 1V00A 3C7FA 2Q8OA 3WINE 4COUA 4RN5A 4Y1VA 5KR7A 4JV4A 3VDDA 3RGBA 3ST7A 3U4XA 5DG1A 1W9FA 3H3ZA 5A3UA 4XMAA 5FZGA 1D0GA 1CAXB 3QCWA 4LBOA 4K8RB 2HWD3 1DIWA 1CR7A 1H2NA 2XG3A 2YC0A 3EQEA 1RUC2 4NIAA 4A7KA 4AVAA 2MEV2 4GWMA 4WM7A 5FZBA 1OVSA 2GDFA 2ET1A 5GM0A 4AVCA 1ZZBA 2K9ZA 1UKGA 2XVGA 2ZGUA 5FZFA 5K8SA 3S5AA 3ZFGA 4IV3C 4W4ZA 5F7UA 3U0ZA 5ABJB 2XJTA 2QQLA 4M3CA 1ONAA 4Q1RA 5DG2A 3VBOA 2A70A 3AXEA 3E5XA 4N8MA 4BE3A 4LNVA 4OLLA 3RZZA 3O0VA 2X5IB 2RM21 5JUVA 3WDWA 4CTEA 3AZZA 5IK4A 3VKFC 3AMHA 2WSUA 4XYXA 3Q8AA 2JDMA 2JDKA 4L11A 2ES3A 4OUEA 3EJKA 5FLJA 4MGZE 2DVAA 2ZACA 3GZAA 4XFBA 3THPA 4AEDA 1RB8G 1JYWA 3EO6A 3OGVA 2BPA2 2CV6A 2ADEA 2FD8A 1VAKA 4D3WA 3TYJA 2QDNA 3IZOA 1EUUA 1GOHA 5IVFA 1MQTB 1PO21 1V9U2 2XBO3 1AYM3 5FREA 3RPQA 4LBMA 1DQ2A 4K40A 4GMP0 1NLSA 4XUNA 5DDJ3 2HWB1 5F3EA 5LASA 3TN91 4PDWC 4DOUA 2Z42A 3IDCB 4AF9A 5FOJB 5A3MA 1ACCA 4BXSV 5FO9B 3VBFC 1H9WA 5AC92 2Y0IA 5T5JA 4B4PA 1MS1A 1O3RA 3I59A 1HJFA 2BP6A 3PUSA 2K46A 1FPN3 1HB3A 1QJY1 2VOXA 1UMHA 2VUCA 2WO7A 1VMFA 4QGMA 2PTMA 1K45A 1SZBA 2Q1MA 3NW4A 4XQDA 2XONA 1R092 3SKVA 1YLLA 3WX5A 3M3CA 5JXIA 2CGPA 1Y9GA 2GC3A 1LOGA 3OYWA 1VBC3 4A4AA 1OH4A 3POYA 2PHFA 2X10A 4YVWC 3TB0A 4YM2A 4QPIB 1QQP2 5LB6A 4D7TA 1ZYBA 1K12A 1NCRC 1DU3D 4W50A 4H7MA 5FZ6A 4CCCA 4MGTA 3WR0A 4Q4X2 1PO22 1WD4A 2XKOA 4IE7A 1PM7A 4M00A 1ENRA 3I49A 1GP4A 2UU8A 5FV3A 3BB6A 4YFZA 4PBPA 1OD5A 3B5LB 2DBIA 1Q3EA 4R8HA 1C1LA 3AMQA 4LO8A 5FY8A 5IVYA 3WDTA 2YUEA 3HEIA 4C0BA 5A33A 3DECA 4CDWB 5A7PA 3WXPA 4MGYE 2XUEA 2D5FA 2VH9A 3J8F3 4O61A 4Y22B 1KRIA 1BBT1 4WZFA 1DQ5A 4CP9B 2NMNA 5C8CA 3ME2A 1SLBA 2C0ZA 2ZBJA 3AXDA 5E88A 3FLTA 4BQ1A 1RIRA 4IGQA 1VB2A 4RS5C 4D7SA 4DNYA 5FZKA 1RUJ2 2YBSA 1TNFA 1G86A 3H8OA 2YC4A 1H0BA 2WT2A 4NRMA 2CDOA 3WNNA 4W65A 1LU1A 1HLCA 1RHI3 1T6BX 4CUAA 1AR71 2JE9A 3NJYA 4AEMA 5CB7A 3WW1A 4NHKA 5JZGC 4YG3A 1KJRA 3SH5A 2PAEA 1ZZ9A 3T0BA 1JOJA 4HK8A 1HN1A 3B02A 4FVVA 1NQJA 2IZWA 4IV1A 5L9BA 3GBWA 2EAAA 1OOPC 2BFUL 1MZ5A 4G4FA 3E97A 2ATFA 3DYOA 3I2JA 3MIEA 5EV7A 2Y6LA 4BB3A 3DV8A 1W8UA 2VNVA 4HKOA 4Y26A 4DXTA 2VD7A 5FTTC 1JUHA 3VZJA 4COZA 3BPZA 2OXBA 2OT7A 2OZ6A 2YHJA 4LHKA 3MLLA 1YXWA 2E31A 2QE3A 1QKQA 4CP2A 3VZMA 3AJYA 1RINA 3PMEA 1U5YA 4P9WA 4XEZA 1H8TB 2G19A 2A3WA 2JG8C 5FAXA 1HRV1 1ULEA 4X8PA 3RRDA 5ACA1 4XTPA 5H9RA 4XIOA 3LA2A 2WIIB 5FMOS 5JXJA 2XL7A 2EIEA 1VJ2A 4EN8B 3WQ1A 2VXJA 1C8M1 5FZ0A 3VGIA 1EPZA 1RUG1 2WFF3 4XFGA 1PVC2 2WYSA 1EV11 3MW3A 1R1A1 4PI2A 4XETA 3SEEA 3AZYA 4ZXEA 5GLZA 3IN9A 3WOGA 4RFT0 4NO4A 4U2AA 4WVZA 3PL0A 1EP0A 3ZYJB 2TBVA 2J42A 2VMIA 4PT6A 1ZBE3 5L7OC 3OBRA 4JHZA 3A7QA 1XJAA 1S0IA 2G9ZA 4R9BA 1I3HA 2GC1A 1JXNA 2MPFA 4GA9A 4JGYA 2VZTA 1Y3TA 3VBSA 2EXKA 2IXJA 3N9NA 4TLGA 4FTEA 1DP0A 1TNRA 3D82A 4CZSA 4MX3A 3DXTA 3Q8FA 4DUWA 1Q8SA 1WZXA 4MXWB 1C57A 4P9JA 4XUOA 2KR2A 1CQ9A 4JRAA 3NNJA 2VL4A 2FQPA 3POFA 2DCKA 4ASKA 2HWF2 2B8MA 4OZOA 3OUHA 1DZQA 4EZ4A 5EJ1B 1C8M2 2ILMA 1A3KA 2EIBA 2WWJA 4QKFA 2WNVC 2ZGQA 1RUF3 2XWBB 2VNRA 1W2UA 4URTA 2DCJA 4EN9B 1HV1A 3ON7A 4CYDA 4LBKA 1RVF1 3ZSLA 3A23A 3CDZB 1AR63 2LW8A 4FPHA 3GALA 4XDOA 5FYIA 2BVVA 1UMIA 2EALA 5E6HA 4LO5B 3M7AA 3ZYHA 1OPOA 5FBJA 4QWNA 3W5NA 4FCAA 2QJVA 2VZQA 3WW3A 5FPXA 4CU9A 1JMUB 3U07A 2E26A 2WS91 3C2UA 1VRH2 4IV3A 2VZ1A 2WQ8A 3OBZA 4XFAA 4XCAA 1QH7A 5CEHA 4CCMA 5K0UB 2J1TA 3T2PA 5FZLA 3ZN6B 1EUTA 1W99A 1DGWA 4BLIA 1RXGA 1UN1A 4XBNA 2VNOA 1YFWA 1SLLA 3D5OA 3DEMA 2WNUC 1VBE2 4GQ7A 2VXRA 2O1QA 3O5SA 5D2AA 5DUXA 3V64A 1BHGA 2A6YA 3LWCA 1WLWA 4MADA 3VZOA 3O1TA 1UXXX 5FZ8A 3MW2A 4BLJA 4AWDA 4EQVA 3VKOA 2DUPA 3WVJA 1K5MB 3ZFEC 5JXGA 4MGSA 1Y43B 1GZTA 4Q1PA 1Y7BA 5EQUA 1LOCA 3AMPA 2JXAA 3AKRA 1QU0A 2GNTA 4NIGA 1YJLA 3H9AA 2C9AA 2R062 1IS5A 4FAGA 4GB32 2FHRA 1IQAA 1AXKA 2WQZC 4FFIA 4LLOA 4MH0E 4QXHA 3PHMA 3USUB 2DFCA 5F6KA 2DU1A 5CFCB 4BQXA 3WF4A 5DAWA 4Z82A 1JHJA 2J1AA 1AYN3 4PDWA 5GZEA 4IETA 2W1UA 2BDRA 3A0KA 1W6PB 3U10A 4OHXA 1B35B 4GMP1 4LKFA 3VBFA 1AVBA 2EICA 4FQ4A 4S2DA 4XUTA 1YFYA 1JYNA 2JG9B 4UW4A 1RMU2 4Q29A 2IC1A 3MDPA 1HV0A 3THTA 3BI3A 4Y3OA 1UY4A 3OPTA 3NNFA 4NRPA 4Q4Y2 5LK7B 4PHZA 3TEWA 1BLZA 5FDBA 3VBHB 4Q0VA 4YVWA 3N9OA 3H0OA 5IFTA 2D6OX 2VW1A 4GH4C 1Z0HA 2JDUA 4NPLA 4RR3C 3RYPA 5EWSA 1WMEA 4COYA 4IW3A 1WW6A 1DBNA 3C7HA 4UW5A 3WF0A 4FPGA 1NCRA 4GXLA 4DXRA 3ZXAC 5CG8A 4UI9L 3QLQA 4FOYA 1HB1A 2ZHMA 1PHMA 5JDBA 3PVOA 1EAH2 1ZRCA 2VBPA 5HCFA 3WCRA 1MS8A 2CHHA 3ZR5A 4CEWB 1HW5A 2UWCA 4ZHNA 5FLIA 5A3OA 2RHPA 5AVAA 3O1MA 1N47A 2DWRA 2TEPA 5FYBA 3LA3A 4XUPA 1H1IA 2ZX0A 5LRRA 1IPKA 4E8DA 3O1VA 1ZM1A 1GV9A 2GNDA 2WQ4A 3L9JT 3MLJA 4KU7A 1KS5A 4CU8A 1J1TA 2Y33A 4QQ2A 1NA1C 4XC9A 4DZGA 2RM23 3W21A 4CCKA 5KC5A 1UYZA 1N3QA 4IEVA 4PIYA 4HVOA 5F3GA 2MNGA 1IKQA 5I8YA 1X9PA 3FN9A 4RS5A 2VGDA 2WDBA 1Q56A 2GC0A 1AR82 3RZHA 2VY0A 4TSVA 4TLFA 3NAPC 3GXUA 4CCDA 1T2XA 1QJX1 3N36A 3MUZ1 5JZGA 1PIV1 4NN0A 1RC6A 1PO23 2OIIA 4P00B 4AGVA 2Y6FA 4IE4A 4AEKA 3UGGA 1VBA1 4LUMA 1OOPA 3TN93 2HWB3 4PF5A 3U14A 3WV6A 4YZ2A 3CO2A 5FY1A 3T4HB 1JN2P 2UYBA 1NLQA 2D6LX 3M2MA 4D7YA 1TMF1 2W91A 1TME1 1ULFA 3OBTA 3FUOA 2OPWA 2PQSA 4HN1A 3SCGA 1HRI2 3ZYGA 1AR91 2J1SA 1F8VA 1G8WA 1J59A 1UXZA 3DL3A 4HT1T 4DY5A 4DINB 5LW9A 1H2MA 1QJY3 4N53C 3KQRA 4DUVA 3VBUC 1KXGA 2JG8A 1DCSA 2JE7A 4SLIA 4V2VA 4XF4A 4DRRA 2B45X 3UT0A 3IWZA 5F3IA 1E57A 3DF0A 4RGGA 1XRUA 2J22A 4P5HA 2ZEWA 1NZCA 4YW6A 2O14A 4AQTA 5BNOB 1W6MA 1IS3A 3M70A 2CY6A 4I3GA 4I0WB 4HANA 5DPNA 3O1PA 3FFQA 1I9RA 1Q8VA 3WDVA 5FK8A 3JXSA 2HBTA 1GFF2 5IVBA 5L7OA 3IDEA 4TZDA 3MGUA 4UXAA 1DGWX 2BJSA 2D3RA 1GR3A 1W8WA 1DZRA 2ZGNA 3D0SA 1S1AA 4CA9A 1O91A 1UZVA 3WNPA 3OY8B 2NP0A 3GDBA 1JI6A 2WABA 3IPVA 2VQUA 4D94A 2UY8A 5GJ6A 1W9WA 3LFMA 4HMZA 5FZAA 2OVUA 5A3LA 5IUQA 3ZKUA 1W6NA 1BBT3 4DIQA 2ERFA 3Q9OA 2ARAA 1VE0A 2DBNA 3BU0A 1RUD1 3K4DA 1U12A 1UYYA 2DYCA 2RDRA 4R9AA 1O4TA 3JD72 4I0BA 2WNVA 3ZO0B 4QQPA 3HNYM 1PX4A 1R64A 4HVRA 5KC6A 1AR73 2ZKLA 2D5HA 3PIGA 5K7PA 3KT7A 1QDOA 2YB7A 3RFRA 5JOZA 2WLQA 4OVEA 1IPJA 1VMHA 3UKNA 3PTRB 2GMPA 4C1WA 2BNMA 1H1MA 3ES4A 1UZWA 3HBZA 1R081 1W6OB 3OUIA 4AEJA 3LIGA 1V6NA 3WDUA 4HZFA 3VZKA 1F5FA 4BDVB 3ETQA 1OURA 3I3QA 1UY2A 3P3PA 5LBFA 3T3YA 4YSFA 4YM0A 1XXNA 3O1RA
chains in the Genus database with same CATH topology
3SH4A 3GHMA 2WNUA 4YGEA 1GZCA 4M0HA 5ACA3 3J9SA 1HRV3 3FLRA 2OA2A 1C4RA 3GZTB 4RHV2 5JCTA 4Y1YA 5CA6A 1C8M3 1QJU1 2BVBA 4WM8C 1RUG3 2GNBA 3AYEA 2YZ4A 2LALA 1EV13 3ILFA 1R1A3 3ZFEA 1WBFA 4ES9A 3NSTA 1DG6A 2V73A 1O3SA 1VB4A 4WZCA 1MVEA 5EXOA 4CP1A 1R082 2EA7A 2I45A 2O8OA 2E7TA 3RS6A 2WA3A 2JX9A 4FPLA 3R4DB 4XJUA 3UV9A 1WCKA 4LBQB 2RS11 4COVA 3N7KA 4YM3A 1HQNA 3B7MA 4XJZA 4ZU4A 1S0DA 3VL9A 3GHNA 1GQHA 1UF2C 2EXIA 2XJRA 1M4WA 3ZMNA 2YPJA 4RR3A 4GH4A 2XJVA 5CIRA 4CDXC 2NN8A 3AYDA 2E9QA 1RVF3 4UBHA 5HCBA 2XL9A 4HLTA 1CJPA 4ASMB 2X29A 5JPNB 4FQZA 4GB33 4LA2A 2WC2A 4QMAA 5I0UA 3IDBB 2WS93 4RA0A 2I74A 4HVQA 2GMMA 1YCIA 2RS12 1GLHA 1MACA 1IZ3A 2Q5TA 1AHSA 1RUI1 2A5ZA 5SV8A 4OULA 2YGMA 1HIXA 3B9IA 1RUH1 3SITA 1YFXA 3MYXA 2P3KA 4B3NA 3ZMOA 2Q30A 4XXPA 3FX3A 2ZMNA 3BOWA 2ZMLA 5T5PA 2ZHLA 5KHHA 1CONA 3NAPA 5K9YA 4JDNA 2K2SA 4A3XA 2A7AA 4Y4YA 4HPKA 1Q5OA 4LUKA 4QPYA 2LM3A 3PNAA 1OMIA 4AW7A 3MIGA 1FOD1 2K0GA 4GMP3 3KMHA 4ES8A 2ZGRA 2VMGA 5E89A 3PVBB 2IXHA 1AL0G 4AVTA 2HEYF 1YIPA 3VBUA 5KXEA 5FCCA 2XVKA 4LHNA 3OJBA 2PHTA 4P9IA 1CAVB 5E16A 3ZSMA 2XWJB 4CDQC 2NQYA 3SMHA 2QZ2A 3DUIA 4MXVA 2PLV1 4FXKB 3VKMA 4JRLA 1NCQC 5LK5A 4UW6A 4PIZA 3LOBA 1N3OA 2RJLA 3V0BB 4ATFA 4FXGB 3ZYPA 2VOKA 4OUSA 2RS32 3PJYA 3RMXA 1BMV2 4XQWA 1BQPA 1XU1A 1FOD2 3FHIB 1RUC1 1MZFA 3B93A 2MEV1 2RR12 2RS52 4BA6A 1YJKA 1ASJ2 1OOPB 4L9BA 2VOVA 2DTYA 5KHKA 1CAWA 5BNNC 1UAIA 1VALA 2CL2A 3T1MA 3X29B 3MF9A 3OF1A 5C8WA 3KZ4C 4FBFA 1PK6B 1DQ1A 1C5IA 4N43B 2PLV2 1MS4A 4JGZB 4YW2A 3N3HA 1QJX3 5FQ0B 3HAGA 1KD7A 1PIV3 2VU9A 4XE9A 3ZXGA 2H0BA 4K1ZA 5T54A 3WY6A 1FNYA 1RJ7A 2D93A 3B00A 5BYNA 1VBA3 5H9PA 1PGL2 2ZGLA 4I0AA 4K21A 2FMYA 1GQGA 2F6BA 5C4WC 3MFAA 1TMF3 3WG3A 1TME3 1CAUB 2YMZA 1V9U1 1AR93 1G9FA 1ENSA 3HWJA 1WW7A 4EN7B 3MF6A 4IEUA 4XIKA 2VW0A 4XZPA 3K51A 2HWC2 1HQWA 4Y20B 5JOWA 1UX6A 3IMNA 3ZXDA 3LAGA 4M01A 3W58A 5AC91 5BXXA 4FP2A 2JDZA 4FPEA 4WM8A 2R49A 4A2UA 1R091 2D97A 3AZXA 4LBLA 3UJOA 2R16A 2EVXA 4AI3A 3JB4C 4YGDA 2R041 5FO7B 4Z2WA 2BWCA 4S2FA 1VIWB 1QQP1 3OPZA 2PHXA 4Z1VA 4Q4X1 1GSLA 4R52A 4ONUA 1I5ZA 1KS4A 5I0RA 1AL22 4LO6B 2OW4A 2CYFA 5J98B 3ZXLA 1PVXA 1RUD3 3I54A 4JC1A 2CTVA 1A78A 3BU7A 1CESA 1DQ0A 2Q1ZB 1UKRA 4CDXA 3B01A 5A32A 4KU8A 1SFYA 1LGBA 4GULA 2R042 1RUJ1 1LENA 5I0TA 4CDUC 3HD8B 3ASIA 4Z92B 2C1FA 2ZX1A 5CG9A 4XTMA 1R083 4HSLA 3DPRC 2R6QA 2EAKA 1V70A 3H1MA 1MVQA 1QDCA 2UWBA 4YW4A 4FAHA 4OI2A 3B69A 4L97A 5GALA 4YM1A 2PHLA 4IEPA 1IGOA 3SHRA 3CU7A 3R4UA 5CVRA 1COV2 3KGZA 3J26N 1QJU3 3NV2A 4FO9A 3BTAA 1I6XA 1YWKA 1QY4A 4AE2A 2BYVE 3VL8A 1LKNA 1WW5A 4QX5A 3ZN4A 2DTWA 2ENRA 1LESA 1IHMA 1PVC1 3CF6E 4F7ZA 1HXS1 4OUMA 4H14A 2D6NA 1J58A 4FPCA 4RQPB 3ZPYA 5GZCA 3OCPA 2XJPA 5KWRA 4YZ5A 3SH3A 2RS13 1S0BA 3N7MA 3E5QA 4HL0A 4S2HA 1MEC2 3H7YA 1RJ8A 1AZDA 4QM9A 1PNGA 4QPGC 4Y24A 4MGIE 1NA1B 1A6CA 4IERA 3KT4A 2QVSB 4OHVA 4FOVA 4CDQA 3EHKA 4Q27A 4AHZA 2HWF1 3V0AA 3LB9A 2ARXA 5J48A 3ZXKA 2FZ2A 1FMD2 1NCQA 5CFDB 5BNPB 5HBAA 3E6DA 2CNAA 4IEZA 3I2DA 3LOIA 1X33A 1HXS2 1NYWA 2R30A 3QH7A 4PIXA 3VHOA 4R4ZA 1ND3B 1O4ZA 1W39A 2RMU2 1LHUA 1LOFC 4XFFA 4YVSB 3VBRC 3ZFFB 2DURA 1V6KA 1H1AA 1WCDJ 2AZ5A 5C9AC 3TWIA 1RUI3 1LHVA 1ZRFA 1ND2C 1VRH1 5FRAA 3RDIA 3KD4A 2VQAA 3ZX7A 5GZFA 1RUH3 2WZR2 5BNNA 4ZXKA 1H4GA 5KXCA 1BEV2 1SCSA 2X53S 3WUCA 3POSA 4NOTA 4N53B 2RJKA 1VBE1 3M3QA 1REEA 2P17A 5KXBA 4FOWA 4E2GA 1RUE2 5ABJC 1YIFA 2DVBA 4K7JA 5GLTA 1GNHA 4XOGA 5L36A 1CPNA 3GF6A 1DYPA 3WQ0A 1FOD3 2XHKA 2X5IC 5C4WA 2R061 4GB31 1SBFA 1X7NA 5JIUA 5I0SA 5I93A 4NWVA 5FLHA 2XLAA 1QHDA 3FE5A 3HT1A 3EBRA 3RG0A 2WA4A 3MI8A 4ORFA 1OPMA 4L8QA 1C1FA 3M3OA 2NM1A 1RMU1 3WNXA 3AMNA 3VKLA 1W0PA 4AG4A 3GZUC 1LCLA 1MQTC 2PLV3 4Q4Y1 1FI2A 4H3WA 2ZPXA 4FT8A 4KWJA 1QOTA 1R1ZA 1XYNA 3KCCA 3RNSA 3FFZA 3SCHA 1D4M2 5I8SA 4XFIA 1NLRA 4I01A 3VDDB 4PLNA 3R05A 4FPJA 1DGRA 2VULA 1PGW2 1RUC3 4FTBA 3VHPA 4P9XA 1MS0A 2MEV3 2KXLA 1EAH1 1UPSA 3AFKA 1VAVA 1ULCA 3JBG2 2CAUA 1JW6A 1Z7S1 5FFOC 2Z2SB 3BODA 4DRVA 1ZX5A 4WM7B 1LULA 2D44A 1RUNA 3WHTA 2A6ZA 1W6QA 4QPIC 3ZFGB 2DU0A 2HWE1 4M3CB 4MUVA 1Q8QA 2A3XA 4GALA 2HEVF 3JCIA 3WW2A 4IQPA 3VBOB 1H2KA 3HQXA 3M3IA 1ENXA 1OKQA 2JENA 4CDUA 1Z78A 1S0EA 1AR81 2F4PA 2LTNA 4CDWC 4NWWA 3DPRA 2ZX4A 2NMOA 3L2HA 1KDKA 2WFPA 5FO8B 4AEDB 5GZGA 1V9U3 5JVVA 1Z7S2 5SV5A 3MIBA 2XVLA 1PZ9A 3FWEA 3ENRA 2P34A 1QNYA 4LBJA 2LUWA 3HR9A 1XNDA 4J1XA 4KWKA 2A75A 3JQXA 2HWE2 2ZZJA 5EFUA 1B09A 2WLPA 1HRI1 5AC93 1H2LA 3JU9A 2XJQA 4DXZA 1DYKA 3AKSA 4BIFA 4M3CF 2ZABA 3CNAA 3KT1A 4B29A 3AZWA 1R093 1FATA 3I59B 3EXUA 4KGGA 5J36A 2R043 4XFCA 3R6SA 1X8MA 2OUJA 4CDXB 1QQP3 3KB5A 3IBMA 4LO4B 2D43A 3OYWB 2H6BA 3BOPA 3RI8A 4XF3A 4Q4X3 2PHWA 2R32A 3RSJA 5IK5A 4NHLA 1VBD2 2B42B 2SLIA 1H8TC 2GU9A 4EN0A 3VKNA 4I2OA 2V5YA 3O12A 2EIGA 3O14A 5J37A 1O4YA 4AHWA 2WINB 5FOBB 3ZXEA 3BIWE 4OI1A 4Q0QA 4DQAA 1CX4A 4L2NA 4PBOA 1EY2A 3K48A 4QPGA 4M0NA 3ES1A 2HJIA 2Y26A 1PNFA 5T3NA 3WP5A 4BPZA 3AKQA 2D6MA 4G9SB 5GLUA 4E4DX 4Q4V2 4X6RB 2OUHA 5JLVA 3VN4A 3CJIC 5D8AC 3R4SA 3WQ7A 2ZJCA 4L99A 5C8CB 1RUJ3 2ZZQA 3JD71 4PJYA 1NQDA 4H7LA 4Q8LA 1PZ8A 1VBB2 2IXCA 5H9QA 5F1RA 1F5JA 3M3EA 3VBRA 1LOFA 2JKBA 3U11A 3RI9A 5CAZA 1UIKA 5C9AA 3MFCA 5E1RA 3LGRA 1ND2A 2QCSB 4IV1B 2VMHA 2ARBA 1LEDA 5BV6A 1WA4A 1YO8A 2B9UA 5JWPA 4FSJA 1CAXA 1APNA 3WDYA 4K3UA 2H0VA 2HWD2 1N1VA 3WCSA 4RHV1 3LZZA 4OZXA 1WCSA 2ZKNA 4YFWA 4BYYA 5ABJA 4D69A 1BCXA 1PVC3 3WP4A 3AB0A 1HXS3 1G9AA 3W9AA 1AF9A 5K0UC 4Q8KA 4F83A 1WW4A 1NY72 1QOSA 4EWAA 4AVVA 5JSOA 5LRSA 2X5IA 1AXYA 1SMVA 5BY5A 4AXOA 2D3PA 2P37A 4KG8A 4QXKA 4GKXA 3A0NA 4LE3A 2I07B 1AJKA 2ZGSA 4ZKTB 4DFSA 2WZR3 5H9SA 4BWOA 2PA7A 1XE8A 2A71A 4JGYB 4WVMA 5LEKA 3VBSB 3O0WA 4KBBA 2BFUS 2P3JA 3SNMA 4Z8BA 4XXAA 1MQTA 2HWF3 5CFCC 4BIOA 3IM0A 2XJSA 2XBO2 2P2KA 3KSCA 3POWA 1AYM2 1S55A 1IS4A 2W0XA 4DY3A 1FV2A 5DDJ2 2YY1A 1B35C 2DFBA 4TYSA 4LE4A 4DS0A 1SLCA 1ULDA 3D6EA 4KGQA 2JG9C 2ZAAA 4XJWA 4IXLA 2WL1A 3MPPG 3VLBB 2EXJA 1FX5A 5C6CA 2RE9A 1VRH3 1CPMA 1BXHA 2W52A 3VBHC 4AFCA 4PCRA 4M3CE 3PJQA 1FPN2 1ZRDA 4QQLA 5J09A 4OHWA 4QPIA 4IV3B 1OLQA 1VBC2 3JZVA 2VPVA 3M4FA 1O5UA 4YW1A 1LTEA 4AVBA 1VBE3 4RSUA 4YNIA 2GAUA 1LOAA 2YROA 3FJSA 1UD1A 4XBLA 4XFHA 1VAMA 4CEWC 1BVP1 2W08A 1WGPA 2GALA 4YZ3A 5GZDA 2ZX3A 2E51A 5AVPA 3P3NA 1DF0A 4CDWA 3BCWA 4FPYA 4Y22A 3W59A 5FMOL 1SBDA 2R063 1C8NA 3PVEA 4RL7A 1YHFA 2KA3A 1QXRA 3J8F2 4H55A 1S2BA 3N7JA 5DZGA 4E2QA 1NE6A 2QQPA 1WLTA 1WLCA 1VP6A 2IXKA 3ILNA 2AYHA 1GYKA 2PHDA 5BNQA 4E4ZA 2GNMA 4MZUA 4PDWB 4FP3A 1LODA 2YDEA 1RMU3 4ZU7A 1FV3A 1S2KA 1RHI2 3ALQA 4TWTA 3VBFB 4HETA 4Q4Y3 4IEXA 1G7YA 3H1YA 3WD5A 1YI7A 3OGGA 2JJ6A 4QHBA 1POV0 4AHYA 1FYUA 2R071 5IK8A 4HSJA 3ZDSA 3DN7A 4YVWB 4P14A 4KNCA 1PGSA 1EAH3 2X8KA 1YI9A 1NCRB 3FUQA 1H8TA 1Z7S3 2G9FA 3G7DA 1UU6A 2RS31 4AHXA 1BMV1 1OLRA 1FXZA 3R0RA 4E4SA 1UU5A 1XU2A 2UURA 2RR11 1FNZA 1O7FA 2VNGA 2RS51 3WP3A 1VLNA 4C90A 5BNOC 1G9CA 1ASJ1 2HWE3 4ISQA 1A8DA 2TNFA 2KM2A 4Z07A 1JYCA 2WFF2 5J96B 1ZBA1 3CJIA 2XB6C 5D8AA 2DUOA 3CLPA 1SDWA 4GKYA 2D6PA 2BNNA 3RYRA 3AKTA 1BJQA 1AR83 3QH6A 1ZBE2 3E5UA 3MPBA 2R072 4RS5B 4I30A 4MXWA 2CGOA 1TEIA 3KS7A 5JSPA 1SLTA 3AM2A 4ITCA 1OQEA 4BOWA 3G6JB 1PGL1 4AGGA 5JZGB 3AKPA 4N7UA 3S0MA 2GSYA 1BK1A 2ZGMA 4XJAA 4LEJA 3IIAA 1HRI3 1X36A 5CADA 5KXDA 3LCPA 1RUF2 2GZWA 1NOVA 3BALA 3UKTA 4N9HA 3ZVXA 1ZBA2 5JAXA 2HWC1 1LGCA 1Q8PA 1AR62 2VUJA 1OQ1A 4BCUA 5EYXA 2DF7A 2NYYA 1KQRA 1NE4A 1YFUA 2JG8B 3ZIWA 4OI0A 3I7DA 4EROA 4PQ9A 3PLQA 3E6BA 5K0UA 2ZA9A 4HBNA 4IEOA 3ZN6A 5LEJA 1D2SA 3M1HA 5HI0A 4JTOA 1D4VB 1DQ4A 3AJZA 1V6LA 3ACLA 2DV9A 5EYYA 4R9DA 2QZ3A 4EN6B 1W6MB 1CD3G 1ZVFA 3ATGA 4AQSA 3HN1A 1V6OA 2WSVA 2YXSA 4Q26A 5L7OB 4YZ1A 5KHJA 1YUDA 4BM8A 3ZIXA 1AL21 1MS3A 3IPVB 3NV3A 3WW4A 4N7IA 4BZ4A 3KM5A 3USUA 1KITA 1W6NB 2XH6A 5CFCA 3JD73 2NZ9A 1LECA 1A8MA 5CNAA 4P9LA 4V1PA 2GC2A 1C28A 3MIFA 1W6PA 3ZSKA 1LHNA 1B35A 2WNVB 1AYN2 4KWLA 3NKTA 2Y38A 5JPMB 2JG9A 2CWSA 2IFWA 1RUOA 2ZCWA 5FBZA 2ZGOA 2PAKA 4C1XA 1QJZA 4O9EA 3QD6A 4KH9A 2BWAA 2FMDA 3VBHA 4R9CA 4LTAA 1J3QA 1PMIA 1X82A 3A4UA 1J3PA 5DUVA 3NWKA 1GZWA 1XYOA 2PQQA 2GH8A 3GNEA 4QD2A 4XW3A 1CVNA 1HDKA 2IFRA 3FBYA 4RHV3 3JQWA 1COV1 4WVMB 1KFUL 4CEWA 2R0HA 2WNUB 3GYDA 2G9GA 4DB5A 1QXJA 1RTVA 4XDQA 1D0HA 1ZREA 5F9TA 1MS5A 2IWGB 4W6XA 1DDLA 3AZVA 3WUDA 3LA7A 3WDXA 5I91A 3ZFEB 1KFXL 3NKGA 4BHPA 4W6WA 3H50A 4CEYC 4INDA 2UWAA 5IT6A 2GN3A 3MW4A 4AI2A 1C5HA 2XLFA 2RM22 3B9CA 4OHYA 4LT5A 4YLZA 1ZZ8A 2SBAA 1L3JA 5JSRA 4IEWA 3H7JA 4AFMA 1MEC1 1N3PA 4R4XA 2VECA 5B2GB 3H3UA 1JH5A 3WZ1A 3TNPB 1SEFA 4K20A 1HKDA 5T50A 5KBFA 1TE1B 4G3YC 4QQHA 2R0FA 5DUWA 1S0GA 4C91A 3TN92 2HWB2 1ZRRA 1JTZX 2XJUA 2P3IA 1FMD1 4RR3B 1CIWA 4GH4B 4ISRA 3RYKA 2PELA 1QF3A 1OSGA 2Z79A 4QT6A 3INAA 5E8AA 3S6PA 1POV1 2GN7A 2AUYA 2RMU1 1AX2A 2ZHNA 4JAAA 1CJDA 1ULGA 1NG0A 1Q8OA 4HKLA 1QJY2 1SQ4A 1J1LA 5GLVA 1GICA 1LOBA 1H30A 5BNOA 3MIHA 3AP7A 3SXWA 1F31A 4AI8A 1UCXA 2WZR1 2ZGTA 4ASLA 3AX4A 1BEV1 4HK9A 3KCXA 1G9DA 2R1BA 1LJ7A 5JI7A 1I1EA 5TSWA 4JCKA 4MVTA 1PO11 2AGSA 3OY8A 1T6GC 2D7FA 4LR4A 1OQDA 4Y1UA 3D8CA 1N1TA 1LHWA 1RUE1 2D98A 3UKVA 2DCYA 2EXHA 1DZTA 1SCRA 5L19A 2YGLA 3NAPB 5JOYA 2XUMA 2XPJA 1UMZA 1BBT2 4UBGA 3TRSB 4HPKB 4N90A 4XJ8A 2WT0A 2HKXA 1PK6C 4N43C 2CWMA 1KDMA 1U5ZA 4JGZC 3JUUA 1D2QA 3H1WA 4XHXA 1N1YA 1H9PA 1QGLA 2Z69A 4QM8A 4AQ6A 2HYKA 1EPWA 5DZEA 1AR72 2YV8A 1GKBA 4OFGA 1QXPA 1HQLA 1AX0A 3S7IA 1W6OA 1PO12 4YG0A 1BYHA 2YYOA 2DVDA 4S2GA 3VBUB 4B4QA 1QWRA 3ZXJA 2PFWA 4JDMA 2R073 3CJIB 5D8AB 1Y9QA 2WNEA 4MGKE 2Z5WA 1AJOA 1WLDA 2DUQA 1YNAA 2B7YA 3JB8A 3NJZA 2FBEA 2BUKA 4MLOA 4XBQA 3VHRA 4AFAA 1D4M1 2RS33 5HXVA 3I8TA 4X8NA 1LGNA 2DCTA 1PGW1 1JHNA 1FAYA 5BPXA 4EWDA 4XF9A 2DVGA 2RR13 2RS53 4NVPA 5ACA2 1HRV2 1ASJ3 2ZAHA 1DQ6A 4QGLA 3JBG1 4XMIA 3FBMA 1RUG2 1CGPA 1F9KA 4QGNA 3S7EA 1EV12 4QU2A 4BMBA 1R1A2 1ZBA3 4UW3A 1RGSA 1DLLA 3AYCA 1CAWB 3USSA 1BVVA 4BMEA 3FLPA 4LBQA 1MZ6A 1JBCA 3GBFA 3QACA 3AMMA 3T2TA 4XF0A 4JDOA 3AP6A 1WMDA 3PMSA 2OPKA 4PLMA 4FPFA 2AENA 5J3UA 1S0FA 3C3VA 5T52A 3HT2A 4RD7A 4E9KA 5DZFA 4YGBA 4J6GA 2QKDA 4NR1A 2BEOA 1QMJA 4XHBA 2WKKA 3D0JA 2AR6A 4AGRA 2HWC3 3CL1A 1RVF2 4AFBA 1XNKA 2QNKA 2ZOEB 2BGCA 1G6NA 2B39A 3LKJA 4KL1A 1SACA 1BKZA 1OFNA 2NPIA 2OZJA 2WS92 2IXLA 4YYOA 4WM8B 3NV4A 3UL2A 3ZSJA 3LSDA 1MZEA 2O8QA 4U36A 4CEYA 1LOEA 4YZ4A 1U0AA 3T1LA 2A73B 4P9GA 4AVSA 4K1YA 1VBD1 2C5DA 3TOJA 3AP4A 1LR5A 1AL23 3DKWA 4K9SA 2VVFA 4AFDA 5JMCA 2N7GA 3IKWA 1OA4A 5T5LA 2E6VA 1LRHA 2BQPA 1LB2A 1GZWB 3ILRA 2D40A 4RQPC 4XILA 4F8AA 1ZZ7A 2ZGPA 4Q4V1 1IKPA 2ZS6B 4C0HA 3SLIA 1XQNA 4Y5Z0 4YW5A 3TBDA 1AXZA 5A32B 2QFEA 5F5QA 2ZX2A 1SLAA 2PYTA 1VBB1 4LA3A 5IK7A 4YARA 2QDRA 3WT3A 1V6IA 3O7OA 1CAVA 4Q4W1 3V56A 3MIDA 3TAYA 5HCAA 1BZWA 4YW3A 5AFBA 2ZTNA 5CFDC 5BNPC 3VZLA 4PLOA 4WVVA 4AYUA 4HFSA 5DUUA 5T55A 3RJRA 3V0BA 3HIFA 1COV3 1ND3C 3ZN5A 1UW8A 4Y1XA 4YVSC 3ZFFC 4Q0SA 1U5IA 3V65A 1DFQA 3AP9A 2XLGA 3DGTA 4EWEA 4W6YA 2HWD1 4AK3A 4META 3NO8A 2WJSA 1AUYA 4GWNA 4FPOB 3AK0A 5I8TA 4NPRA 2VVDA 4FPKA 1NY71 4Q4W2 1Q43A 5KHIA 4WBBA 4A7ZA 1PK6A 5JIAA 2A6WA 5DXDA 2W39A 4N43A 4JGZA 4XPVA 1WD3A 2D6KA 1MEC3 1U5XA 5FQ0A 1MS9A 1CN1A 1YRZA 1ZZCA 1QJX2 4N9IA 4FTSA 2A6XA 3L2YA 2ZMKA 1PIV2 2JICA 4IESA 2G4IA 4LHLA 2VQ0A 4KG0A 3FC0A 1VBA2 4ZU5A 5GLWA 1CAUA 1REFA 3VZNA 5KHGA 2PHUA 1FMD3 5JR7B 3CEWA 1TMF2 4CDQB 1TME2 2JD4A 3WG2A 1POV3 4I02A 2XBO1 2Y0OA 3V0AB 1AR92 1AYM1 3VV1A 4EJRA 2RMU3 3FZ3A 1NCQB 4K8FA 4Y20A 5DDJ1 4GIQA 4JQRA 4MV2A 3QBQA 1VR3A 1UU4A 4A7YA 3MZHA 1YYNA 3AP5A 2BW8A 1V6JA 1J3RA 3NV1A 1IS6A 2BTVC 1ZNPA 2VG9A 1UIJA 1FPN1 5T5OA 1LU2A 1K5MC 2JEMA 5GKAC 3IT8A 1BEV3 2EF6A 3PTYA 1DGRN 3VDDC 2H6CA 1VBC1 1PO13 5BNNB 1REDA 5CU1A 1GANA 1ENQA 4XF1A 4YG6A 1S0JA 4I09A 2D3SA 1SBEA 3AYAA 1RUE3 3S30A 3HMYA 4WM7C 2IXIA 4KQ7A 2ET7A 4WV8A 3ZFGC 4X6QB 3I4IA 4AQ2A 1NXMA 4J1WA 1EYBA 2UYAA 4LULA 2R1DA 2ETEA 1RUD2 5BUVA 3VUOA 4YGCA 4XQ4A 3VBOC 4DPNA 1M06G 2VOWA 4BH9A 3J8F1 2Q4SA 3UJQA 5C4WB 3E6CC 3WG4A 4B7KA 2CGNA 1H8VA 2FZ1A 4LBQD 4MYEA 4B7EA 2XKPA 3KCYA 3ZXFA 2WZPP 4DMIA 3RWNA 2E63A 1ZZ6A 1PZ7A 2E7QA 2PHRA 1GBGA 4AEDC 1RHI1 1W0OA 1ZA4A 2VUAA 3OGJA 4ATEA 2XGXA 2JECA 5FPZA 2NLRA 4HKWA 3SCFA 3WG1A 1D4M3 2OYZA 2WWSA 4Q0UA 3J4UH 3NVCA 3FMGA 3GBGA 1O3TA 2A6VA 2VW2A 1N1SA 2VVEA 3KGLA 1XE7A 4IEYA 3OTFA 1SLIA 4LBNA 3JBG3 4E27A 1GZ9A 1QJU2 1GNZA 2W68A 2WT1A 5JOXA 1JUIA 1V6MA 3N35A 3ZYIB 3URFA 2BBVA 4OI4A 1WUVA 2E7AA 3B3QE 3APBA 4B4RA 1W6QB 3MEPA 4RQPA 2WFF1 5AFEA 1WBLA 4L92A 3WLUA 4CP0A 4O9GA 1XNCA 2Q0AA 1LEMA 2AH2A 4HN0A 3NL1A 3OD0A 4Q2FA 3PVNA 1ZBE1 1OA3A 1S0CA 2BNOA 3QOPA 2QUOA 4CDUB 4E2SA 4F3JA 2ZGKA 1NA1A 1QOOA 2UY9A 3ZYRA 2DCZA 2GMEA 1UPIA 3LSEA 3DPRB 4CEYB 1KJLA 3H8UA 4OHZA 2B46X 2PAMA 1XNBA 1URXA 4AI0A 5C8CC 2CAVA 1DHKB 2B5HA 2V09A 5CFDA 5BNPA 1H4HA 3ZSEA 2E53A 4B8EA 3KLSA 5EZWA 2A3YA 3SISA 1ND3A 4YVSA 3ZFFA 3RMYA 1RUF1 3M8LA 1NXD1 1HX6A 5CBLA 4Q0PA 3VHNA 4IL7A 2O0OA 1QH6A 4EV0A 2MHFA 1UZYA 1WMFA 1AR61 1QNWA 4XJ9A 4AI1A 4IV1C 3ELNA 1F2NA 1O3QA 4RGAA 1RUI2 4QQOA 2TUNA 1LHOA 1O5LA 3WHUA 3MLKA 5J7MA 4MSVA 1C3HA 5EJ3A 3TNQA 1RUH2 1OA2A 1SFNA 2DVFA 4N53A 1VBD3 1X8EA 3MICA 3N4MA 3RQ0A 1DGLA 4P9YA 4YRDA 5D1IA 4COWA 4NHMA 1IOAA 5L73A 3ROUA 3CJXA 4WVWA 1OHFA 5JI9A 3OD4A 4JTNA 4SBVA 4IEQA 4Q4V3 4QPGB 3ECQA 3AFGA 2HEWF 1G9BA 5C33A 2PN5A 3O0XA 4LO7A 3UK9A 1AX1A 1UZZA 4K6BA 1VBB3 4JVAA 1RITA 1OI6A 3N7LA 1TQ5A 4FOQA 1ALYA 1RL3A 1AYN1 4JGYC 3VBSC 1JYIA 4Q4W3 1MR5A 2AREA 4I3PA 3RJ2X 1XYPA 4CRQA 3VBRB 1OFSA 2GH2A 2I2SA 3WP6A 4LLFA 4Y1ZA 1FT9A 1X50A 5F6LB 3B94A 5C9AB 3D4KA 1K5MA 1UL9A 2Q8OA 1ND2B 2ZHKA 1V00A 3WINE 4COUA 4Y1VA 3U4XA 4JV4A 3VDDA 3ST7A 5DG1A 3H3ZA 4XMAA 1D0GA 1CAXB 3QCWA 4LBOA 2HWD3 1DIWA 1CR7A 1H2NA 2XG3A 2YC0A 3EQEA 1RUC2 4A7KA 4AVAA 2MEV2 4GWMA 4WM7A 5GM0A 2GDFA 2ET1A 4AVCA 1ZZBA 2K9ZA 1UKGA 2XVGA 2ZGUA 5K8SA 3ZFGA 4IV3C 3U0ZA 5ABJB 2XJTA 4M3CA 1ONAA 4Q1RA 5DG2A 3VBOA 2A70A 3AXEA 3E5XA 4BE3A 4LNVA 4OLLA 3RZZA 3O0VA 2X5IB 2RM21 3WDWA 4CTEA