4CPBA

Crystal structure of leca in complex with a divalent galactoside at 1. 57 angstrom in magnesium
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
121
structure length
119
Chain Sequence
AWKGEVLANNEAGQVTSIIYNPGDVITIVAAGASYGPTQKWGPQGDREHPDQGLIHDAFCGALVMKIGNSGTIPVNTGLFRWVAPNNVQGAITLIYNDVPGTYGNNSGSFSVNIGKDQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords PA-I GALACTOPHILIC LECTIN
publication title A Leca Ligand Identified from a Galactoside-Conjugate Array Inhibits Host Cell Invasion by Pseudomonas Aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 22
structure length 119
sequence length 121
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07828 PA-IL PA-IL-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 4cpbA00
1GWMA 2KR2A 4BQ4A 1L7LA 2Q1FA 3UT0A 4BQ2A 1HN0A 1W8WA 4LKDA 4CP9A 2LROA 4A6SA 3F95A 4YWAA 3ZYHA 4CPBA 1GWKA 4CP9B 2O14A 1OKOA 2JWPA 2K46A 2LRPA 4CPBD 4AL9A 4LK6A 4LKEA 3ZYBA 1W8TA 3ZYFA 2C24A 4YW7A 5D21A 4BQ3A 1W90A 1W9FA 4LJHA 1WMXA 1GWLA 1V0AA 2VXJA 4BQ5A 1WCUA 4LKFA 1W8UA 2WYFA 4YW6A 1OH3A 1WZXA 4LK7A 1W8ZA 1UOJA 3ORJA
chains in the Genus database with same CATH superfamily
3OUJA 3OPZA 1X33A 3ZYPA 4LLOA 2D5HA 5FMDA 4QM8A 1EUTA 4IEZA 2V5DA 5H9PA 4AK3A 1LEDA 4BXSV 3HQXA 3LPGA 1UCXA 2YPDA 1DBNA 2H6CA 2JD4A 2VBPA 2Y6HA 2ZX1A 3RNSA 1QIQA 3MIEA 2PQSA 3PTRB 3BU7A 4L99A 5DN2A 2WNUA 3GZUC 4Q4V3 2IXCA 4CRQA 5IVEA 3I2OA 4C1XA 3IN9A 3TB0A 2WFF2 1WWYA 3LA3A 3VZJA 1S0EA 5JI7A 2ARXA 4XF0A 3NNFA 1YIPA 2YMZA 3VD7A 1Q8VA 2ETEA 2QVSB 2L9LA 4XE9A 1MPXA 1VALA 4Y1ZA 3NO8A 1C5IA 1JOBA 2Z4FA 4N9HA 4PDWB 1LECA 2CV6A 2W46A 2ENRA 1W6PA 4PLMA 2ZGRA 2R0HA 3RZMA 3K51A 5FY8A 5J96B 4CPBA 3E6DA 1CAWA 4P5HA 2XL9A 1AR82 1LODA 2P3IA 3KV5A 2J42A 2F6BA 4JX0A 4PBPA 3RMYA 3HQUA 2QE3A 4Q26A 5FOJB 1PIV2 1R082 4XFCA 4E2GA 1UOGA 4QM9A 5HV4A 3FX3A 4UYBA 5DAWA 4BB3A 1HRI1 4NIHA 1S0DA 1ULOA 2B9UA 1I9RA 2X29A 5FO7B 2IZWA 3GZEA 3ST7A 1RUC3 1ND2A 5FUNA 2R043 1Q8SA 1XC6A 5C3QA 3V65A 4AHYA 4JQRA 1H1IA 4HZFA 2W91A 4ET7A 3BKZA 4GALA 3WDTA 2GN3A 2Z42A 1WCQA 1RUG3 5LBCA 3ZXGA 3WDYA 5F39A 1LGCA 5K0UA 1CONA 1RUF3 1XNKA 3IB3A 1OOPB 4IEXA 1VBA2 1AYM1 4AOCA 3PNAA 1WKYA 1POV0 3JQXA 3EYPA 1NCQA 2VOXA 1J83A 1PO23 3KT7A 1T2XA 4QQOA 5GZDA 3TN92 4DQAA 2CNAA 2H0VA 4GKYA 1AJOA 5JR2A 1ZYBA 3AMPA 3NL1A 5G04L 1AZDA 3LPFA 4RGKA 4YW6A 2JDPA 5A3OA 1ZZCA 4IV3B 5BNNA 2BWCA 2YPJA 2Z2SB 1MACA 3USUA 4S2HA 5LA2A 2BNOA 4IDZA 2WS91 1X9TA 2EIDA 5HCAA 3H50A 4TSVA 2XOMA 2VC9A 5FZ4A 2IFRA 1WW4A 2F17A 4E27A 2I74A 3LZZA 1HIXA 2WZR1 1UYXA 4DS0A 3VUOA 2VCAA 4YGCA 3U07A 1LHNA 1X36A 3WQ0A 1S4CA 2XG3A 3ATGA 1IS4A 3KB5A 3ZKYA 1RUE2 3IIAA 4FQ4A 2HYKA 2WNEA 3T0BA 1VLNA 3OGRA 3U14A 2ADDA 4BJ0A 4XZUG 4CEYA 1R091 3K3OA 1ZZ8A 1UOFA 4XIOA 5DG2A 2NP0A 3RSJA 2DF7A 3CEWA 4CCCA 1W2NA 5CADA 1WW6A 5JAXA 1XPWA 4JTOA 3PMSA 2PHUA 2QDRA 1CJPA 3AZZA 4LHKA 5CNAA 5LATA 4CSWA 5B4XA 2G4IA 3V56A 1RMU2 5DAVA 1FI2A 3RZJA 1PZ7A 1JYNA 1SCRA 3LQCA 1H2MA 3E5XA 4CEWB 2LS6A 2ZX0A 1H9WA 5FP4A 4JRLA 5EWSA 4AVBA 4FPEA 5C6CA 3IDCB 3QACA 3U10A 4IESA 3WR0A 1J84A 3ZN6A 4BMBA 2FD8A 2RS31 3SNMA 3VDBA 4TZDA 4XAEA 3THPA 1JUHA 2Q8CA 1HB4A 4NPRA 1W06A 3AVRA 2WZPP 4AHZA 4W65A 2WA3A 2EXJA 4XEZA 3S0MA 3KGLA 1Y3TA 3SC7X 2JG8B 4KI5M 3LCPA 4GB33 3DV8A 5HXMA 4Y1VA 3AXDA 1JBCA 1V9U1 2QQLA 4Z2WA 1VMJA 1LTEA 1BMV2 3RMXA 4KG0A 4NHXA 4XF9A 5C3SA 5JPNB 4DNYA 1HN0A 4CUAA 2OT7A 2F4PA 2JDYA 3SKJE 4DXZA 1U5XA 4IE6A 3PUIA 4OZOA 3VD5A 3D0SA 1AR93 3J26N 5DPNA 3ZIXA 2Q5TA 1L7RA 1NE6A 1R64A 4XILA 5FY9A 4WM7B 3O14A 3ACLA 3P3PA 1H1MA 4E8CA 4HL0A 2YZ4A 1W0OA 2VNRA 1NG0A 3NKGA 3WOGA 4CDXB 2JENA 4MGKE 1LOGA 5LEKA 2IXIA 1GNHA 1QXJA 3POJA 3RFRA 4IEWA 5JXJA 3DYMA 3LOIA 1GP4A 2HWC3 2HWB3 3AMNA 4M00A 5GALA 3CJIB 3VBOC 2JG8C 4NN0A 4FAHA 1PVXA 1QWRA 1VBD2 5CEHA 4QPGA 5LW9A 4GKXA 4MXWA 2E7TA 2WSUA 2C0ZA 4J6GA 4IE4A 1PVC1 2ZS6B 3E97A 5DUUA 4K7JA 5DZFA 5JIUA 3RZGA 2VZUA 3AP6A 3RPQA 1RUH3 3WSOA 1O4ZA 2RS51 5IK5A 2VAUA 3LIGA 1LENA 1WLCA 1OPMA 2R6QA 2V4VA 5HCHA 1YWKA 4FAGA 2OW4A 1YYNA 3VDDC 1AYN1 1SPPA 4FPKA 1IHMA 2WNVC 3RZZA 4BPZA 1SCSA 4AQ2A 4Q4Y3 1DLCA 4Q27A 3ZDVA 3AKQA 4EWAA 4FT8A 4CP2A 2CTVA 3EJKA 4RN5A 2R0FA 5IHRA 3EHKA 4K8FA 1HKDA 1APNA 2D40A 4G9SB 5F9TA 1W2TA 4UFKA 3BTAA 4K21A 4MADA 2WLPA 4YW7A 4AWDA 1H8TC 3K46A 1WW7A 2VO5A 2Y6KA 4AAXA 2BQPA 4QB6A 1GQGA 5F32A 4R9DA 5IVYA 1L7QA 1UW8A 4XF4A 4CCLA 4GWMA 3J9SA 4Q4W1 5JSPA 4IE7A 4IEVA 4QU2A 5FLIA 2XVKA 3SHRA 2HWF1 4RR3C 3AP4A 4O9GA 4NUBA 1JMUB 1UZ0A 3ZXAC 1W39A 1Y7BA 1O91A 4QB1A 3E6CC 1ULFA 2UWBA 1PX4A 2VOWA 3UYJA 3EQEA 1O59A 4FFHA 4XJAA 4BE3A 5G05L 3T30A 4XQ4A 1ZBE1 2YXSA 5ANNA 2SLIA 2VNOA 3POFA 5CVRA 2UYAA 3JB8A 4GA9A 2H0BA 1FATA 2WAOA 4MGYE 5FKBA 2Q8OA 3O0VA 3ZFFA 5L19A 4LBOA 4EN0A 5FY5A 4I02A 1ACCA 2DU0A 3BGAA 2AUYA 1F8VA 3DF0A 1O8SA 1G9AA 1HXS3 5DZGA 2RS12 3N7MA 3NNMA 4QB2A 1HRV2 1NXMA 1UY1A 2VVFA 5I8YA 5KWRA 3R6SA 1NQJA 3ZYGA 3FLPA 3A4UA 4S2FA 3AP7A 3KCCA 4FOYA 4C91A 5FK8A 5FZFA 3RJRA 3S7IA 1MEC1 3ZFEB 4MZUA 4K6BA 2IVIB 3BUCA 3FBMA 1OT5A 1O5LA 1RHI1 2OPKA 4KG8A 4LLFA 4D94A 3BALA 2AEYA 2ZTNA 4UFHA 1CGPA 5FZEA 3V0BB 4Q0VA 2E31A 3DKWA 3JD71 3OCPA 4DZGA 2E7QA 3OOXA 4PDWA 4QDRA 3OTFA 1Q5OA 2A1XA 2GNTA 3VBUB 1ZZBA 1ST8A 5BNPC 3JBG2 4AVVA 4CCKA 1UZYA 1O7FA 1PMHX 1AL21 5C3RA 5F37A 3OG2A 3ACGA 3C7HA 3U37A 4CUCA 5A7SA 2WO3A 3KT1A 4F8AA 3WP4A 2G9FA 1ZZ7A 2GH2A 4AI9A 3WQBA 1NCRB 1OSGA 1MR5A 2CY6A 2R063 4NHLA 1YO8A 1DF0A 1BKZA 2ILMA 3UL2A 1GP5A 1TEIA 2VQTA 4CXYA 3TNQA 5AVPA 3CZJA 2Y0IA 5J7MA 4ATEA 1SBDA 1VBC1 3B9IA 5FYVA 4QX1A 2BGCA 4CP1A 1CPMA 3VZOA 4YVWC 1Z7S2 1JTZX 1OOPA 1W99A 3CL1A 4JKKA 2XDVA 4BQWA 4BQ4A 3K4ZA 4P9YA 5GZGA 1V6OA 4YW5A 2ZGSA 4P9GA 5BNQA 5GZFA 3VBUC 5IAXA 5CFCB 1Y9QA 3AYCA 4RHV2 3IPVA 4X6RB 1S2BA 3VKMA 4L92A 5LEJA 1NE4A 2BEOA 5I93A 3OBAA 3KGZA 4NOTA 4IV3A 1GWLA 1XYNA 4JCKA 2AEZA 2YU1A 3ALQA 5FZ3A 3M3OA 5A7WB 5GM0A 1A34A 3JZVA 1XRUA 4Q4V1 1NCRC 2PLV3 4Y4RA 1YQ6A 5JLVA 3LA7A 2Z79A 4NJ4A 2IFWA 4Y24A 3AX4A 1UKRA 2VPVA 1E5SA 2IC1A 4XPVA 4JKLA 4FVVA 3WW2A 4L0PA 4URAA 3I3MA 1F2NA 5LCWL 1OMIA 1Z0HA 5AFEA 1C8M1 1OKOA 3QD6A 4OLLA 5C9AB 3FL7A 5JXHA 4YSFA 3WDXA 3ZYFA 2YFUA 1RUD2 3PHMA 1SBEA 3BPSA 5CU1A 3T1LA 5CFCC 4Q4X3 1ZRDA 1VRH2 4BQ5A 1XYOA 2VMFA 3H1YA 3H8UA 4WM8C 3NSTA 3ZDSA 1US3A 1CQ9A 4IUGA 1RUI3 4V2WA 3IWZA 4FPLA 3VV1A 5LBEA 1IG0A 1RUC1 3LEGA 2R041 1UXXX 2W94A 4IEUA 4CEWA 5C8CB 1UD1A 5EV7A 5FYSA 1GOGA 2VGDA 2XQRA 1LGBA 4U2AA 3W20A 4E9KA 1GBGA 3AL6A 1NZCA 1PMIA 3GBFA 1FPN2 1KJLA 2NPIA 1QJU1 3IAPA 2J1EA 1XSRA 2GNDA 2OUHA 3NRUA 5EXOA 5FQ0B 4YGDA 3WEZA 1DZRA 2W87A 2ZZJA 3N9OA 4AFBA 1S1AA 5FPZA 1WGPA 2WWSA 2E53A 4GQ7A 2B5HA 5C9AC 1OD3A 3EBRA 3H1WA 1WCDJ 3QH6A 2NZ9A 3CBNA 1E5IA 3O1RA 1UY4A 2VL4A 1YUDA 3WNNA 4B8EA 5DABA 1HV0A 1NLQA 3CJXA 1W9YA 3SCGA 3KD4A 3NVCA 5FZ8A 1POV3 2WNOA 5LBFA 3ZVXA 5FPAA 2JE7A 4PQ9A 4XDOA 4WM7A 3VZNA 4MGIE 5FZKA 1ZZ9A 5HXVA 4CCJA 5C8CC 2OKXA 4GD4A 5I0UA 3AZWA 2DU1A 4CDXA 2QZ2A 1UMIA 3KHBA 4R9CA 1WLWA 3J8F1 5A33B 4C90A 4ZONA 4XFBA 2VECA 3WVJA 1PM7A 4P9IA 4OQ9A 2R1DA 2A3XA 2DDUA 2JDKA 1PNFA 1HN1A 1CX4A 1HJGA 3AZVA 3C7EA 3ITQA 4J25A 4XFIA 2ZX4A 3CJIA 4BU2A 3GALA 4HK9A 2JE9A 4HN0A 4ES8A 2G9ZA 1MZ6A 1PGL1 4RQPB 3POWA 1W8WA 4J1XA 4WVVA 2VD7A 5FP3A 4B4PA 4CXWA 3JB4C 4IEOA 5F8PA 1JZ5A 2NMOA 3WW4A 4CDQB 3O12A 4XIKA 5HBAA 3IDAA 3HD8B 4CXXA 5A3NA 2JDMA 4HBNA 1MQTB 4D6SA 5K7PA 3H3ZA 2BVBA 3KQ4B 4X8NA 1AR73 2HH9A 4OUMA 4UW3A 4AQ6A 4Z07A 5J98B 2PHWA 4CE8A 2VZSA 1F15A 4Y1YA 3D82A 1KGYA 3TEZA 1OVSA 1L3JA 5LK5A 2Q30A 1ULCA 3TEWA 2ZMKA 1OF4A 2JDUA 2QZ3A 1KDMA 1OA3A 3OBTA 1UO9A 3AFGA 2XKOA 1DGRA 1CAVB 3B02A 1MZ5A 3NNLA 2V4AA 2NYYA 3P1IA 4YLZA 3O1TA 4A6SA 4GMP1 4AFDA 4YFZA 4HVQA 5I0RA 2XJRA 2DFCA 4RQPC 1YCIA 1EV13 1B35B 1JZ4A 3W9AA 4C8DA 5FKCA 1AR91 4P9LA 4XUTA 3E5QA 1J59A 2QNKA 2ZPXA 2RVAA 4AEKA 3MIFA 4Y1UA 2XBO3 1HV1A 3HT1A 4A7ZA 4CDQC 4AF9A 1HRI2 3M2MA 5F5IA 5DXDA 3EXUA 3K4AA 3AKSA 5C4WC 5KXCA 3UGGA 2VTXA 4KH9A 3LB9A 1UWWA 1VBE3 2ZGKA 1XNAA 3VGIA 4LHNA 2HJIA 2C9AA 1W28A 1LU2A 1GUIA 3ZXDA 3N9NA 1HB2A 2P2KA 4GIQA 4D7TA 4QHOA 2LUWA 2HWB1 5DUVA 5F1RA 4AEMA 4C1WA 2QQKA 4XDQA 2CGNA 4NR1A 1PZ8A 1AYM2 4QAWA 4NIDA 2KXLA 4MG2A 1VIWB 1CAXA 1SLAA 4KL1A 4NRPA 2XKPA 3DEMA 3RWKX 2VVEA 2I45A 1NAEA 3MDPA 2VW1A 1HW5A 1DLLA 2DUQA 5SV5A 2WO7A 4CCNA 4E8DA 4N43A 3CLPA 5FO8B 5FXWA 4QD2A 2AREA 5C70A 1RUJ1 2WS92 1QJZA 1VBB2 4DY3A 3GCWA 3UGFA 2WWUA 3VKLA 1J3QA 2FMYA 2XJUA 2XJSA 5FYMA 2I2SA 4E2QA 4QDQA 1UIKA 2VNGA 4LO7A 1NZIA 5DUWA 3GHMA 5I0TA 5KHIA 2WZR2 4M0NA 3ZFEA 1EPWA 5EQUA 4CU8A 4FP3A 5IAVA 2OIIA 3IMNA 2IXHA 1JYVA 1UNBA 1ZREA 1PIV3 1R083 2IVJA 1SBFA 1W8TA 3BN6A 4LKEA 5I0DA 2W0XA 3ROUA 2TBVA 3WG1A 4PJYA 2D3RA 4HXCA 1LHVA 4B7EA 4JRAA 4AFAA 4XJUA 2B7YA 3FUOA 2P4EA 4LOSA 4YM0A 2YBKA 4YW4A 5BXXA 3DKQA 1WA6X 3NNGA 2JG9B 3PURA 1PK6A 1DP0A 2XLGA 1BYHA 3MFAA 3HNYM 3JU9A 4QDSA 4BM8A 3CIHA 5GLZA 1VBA3 1W05A 1NCRA 2BNNA 2FDIA 4CDUB 2XUEA 4FTSA 2RS32 5BY5A 3CZUA 2ZKLA 4Y5Z0 1U5ZA 3TN93 3WF0A 3R4UA 3PVNA 1T6GC 3FWEA 2VNVA 2AENA 1NA1B 3RRDA 1REEA 1F4HA 1ULGA 4XFHA 5FYYA 4YZ1A 2WINB 1WCUA 3MW3A 1SHWB 2VMCA 3MLJA 4MGSA 4OHXA 3J4UH 2EAKA 4LBMA 4MHRA 2W3JA 1V9U2 1LOEA 5FZ1A 4A6OA 4LUMA 3U0ZA 3N9LA 1VRBA 2LTNA 4ZU4A 2PHXA 5LRRA 1BZWA 4YM3A 3O0XA 1TE1B 3N4MA 5CB7A 1JZ6A 1FMD2 3ECQA 2XWBB 1EYBA 1UQXA 1K5MC 1LOBA 2JG9C 2BW8A 2XJQA 2W08A 2VH9A 2FDJA 2QQJA 3ZLIA 4H2AA 1RUE3 4A3ZA 2YB7A 1KDKA 1H6YA 5KHGA 1F31A 3H3UA 4AFMA 3K3NA 4XCAA 4CDUC 3AZYA 3FLRA 1DGRN 4O7XA 1DYPA 4LUKA 4N90A 4LE3A 1FOD2 3ZKUA 5C3OA 2E6VA 1UY0A 1O5UA 2PYTA 4XJWA 1NA1C 5DMYA 1VPHA 1IGOA 4YG3A 4Q8LA 4ASKA 1C57A 2PA7A 3OPTA 1RMU3 1FT9A 3C3VA 1I1EA 2VTFA 2JJ6A 3HJRA 4FPGA 3N7LA 4K1YA 1W03A 5C9AA 2PTMA 4JGZC 2RR12 3HNBM 5T54A 1LNSA 2QQUA 4OHWA 4RGGA 1OFNA 3ZYHA 1KITA 1HQWA 1PVC2 3IBMA 3SISA 1WLTA 1U5IA 5F5AA 1QF3A 1JZ3A 4FSJA 5FZ9A 2VE1A 2WIIB 1FV3A 2WR9A 3H9AA 1ZRFA 4IEPA 1W90A 2RS52 1UF2C 5F5QA 3I49A 1V0AA 2D6MA 2R061 2WWJA 4YPJA 4BDVB 4K1ZA 4ZXKA 2QQIA 5IVFA 1AYN2 5FYBA 1ULPA 1KEXA 5C8CA 2BUKA 1SLBA 2KD7A 4QXBA 5FLJA 5AC92 4ZZ8A 2EF6A 2EXKA 1QNYA 2WQZC 2B42B 2GMEA 3DPRB 4Y26A 2B46X 3TBDA 4PBOA 4LBLA 3T09A 4YW2A 5FQ0A 3GJBA 2RDNA 1ULEA 1Y43B 4MX3A 1X8MA 1X7NA 4HOOA 2ZHMA 4UFJA 1YHFA 5GJ6A 2Z69A 3BIEA 1C4RA 3BTZA 1ZNPA 4ASMB 1BEV1 3R0RA 4P08A 3VZKA 4YZ2A 2VXJA 1C8NA 2EIBA 5I8SA 2ZGNA 2J1RA 4KWUA 2W5FA 5FUIA 1SLIA 1RXGA 1SZBA 2OX0A 3POIA 2X8KA 5DZEA 1CAUB 4Q4W2 5CAZA 3VBHC 3ZSEA 3RQ0A 2VW0A 4UW4A 1D4M2 5FY7A 1XB9A 1OLMA 2ZGUA 1QU0A 3C2UA 3GBWA 5SV8A 1VBD3 2GAUA 3ZXEA 5F6KA 4QX0A 1VAMA 1UX6A 3MLKA 3PL0A 4EROA 1CD3G 2YHJA 3NJXA 5I91A 2JKXA 1UAIA 3S5QA 2IWGB 3DPRC 5T55A 3WF4A 2DYCA 3ZYBA 4I0AA 4Y20B 2Y34A 2PHRA 3N36A 5HI0A 3H7YA 3NV2A 3MV01 1I6XA 3LDKA 1TVGA 1YJKA 4FPOB 5EHDA 1JN2P 2JD9A 2WC2A 4OZXA 1FX5A 4UI9L 2YYOA 2RJKA 4RQPA 1NOVA 5KC6A 4FFIA 1QQP1 1KJRA 1XU1A 4WVWA 1RUI1 2J1VA 1I3HA 3NQHA 4JGYC 2JDNA 1LESA 2WQ4A 2XMLA 3GHNA 1QDOA 3OUHA 4LEJA 4QPIC 4XXPA 5A7OA 3WHUA 4CDQA 4XUQA 2WN3A 3OEBA 1MQTA 1FV2A 1TQ5A 1XSQA 2OQ7A 3EB7A 4ORFA 3IM0A 4MVTA 5FWJA 5FZ7A 2ZXQA 4UWDA 1AX0A 4AFCA 1LKNA 1TME1 1GQHA 1RHI2 3N7KA 4ZY9A 2PAMA 1W6QA 2ATFA 3I2FA 1HB1A 4M0HA 2SBAA 1PX3A 2XJPA 2ZEXA 1R1A1 4KBBA 5IWFA 4BH9A 3FHIB 1G9DA 2VZ3A 4RD7A 3NMBA 4WVMB 4XUNA 1CAVA 1UMZA 4UF0B 4CVUA 3ZO0B 1SFNA 5APAA 1AL22 1LJ7A 3OYWB 4PHZA 4O65A 2PHLA 2JECA 4DPNA 2JE8A 4CP9A 2HWE3 2DVFA 1B35A 2QQMA 4UW6A 5LRSA 4UXAA 5LY2A 5F3IA 4GULA 5FPBA 1POV1 4MUVA 1GANA 4XVHA 2B9VA 3L9JT 1LOAA 3RGBA 1F35A 1X50A 4N7UA 1LOCA 4XF3A 3M3EA 5FMBA 3F2ZA 3N3HA 1F4AA 1W3VA 1YQCA 3WINE 1QXRA 2MHFA 3CO2A 3GGLA 2O1QA 3HR9A 5FMCA 3VHOA 2G19A 1MS4A 3WZ1A 4UFLA 4JQTA 5J3UA 1VBC2 1IPJA 2VZQA 5DAQA 5C33A 5JWPA 4ONUA 2D3PA 1BK0A 2IXKA 2BU9A 2TNFA 3VBOB 3VBRB 2W1QA 3FHQA 4MYEA 3MIDA 2JKBA 4MLOA 1E5RA 1HRV3 3G6JB 2ZGQA 1W8HA 1LAJA 5FYZA 4XJ9A 1XYPA 2IXJA 1N47A 3D5OA 3IAQA 5LA0A 3CNAA 4AE2A 3JQWA 5IK8A 5FFOC 2DURA 4P02B 1OD5A 2QQWA 2C4XA 4W6XA 3RZHA 3THTA 2B8MA 1ND3C 3KZ4C 4G4FA 1G6NA 1NX9A 2HEYF 2YROA 3C7GA 3MGUA 3M3CA 4P14A 4E4DX 4DINB 4QX7A 4A2UA 4BZ4A 1ZX5A 2R071 1S0IA 4HT1T 1GZWA 2A75A 1EP0A 3I2IA 3AP5A 4QKDA 4EN6B 2E51A 4K9SA 3AMHA 4CU6A 2OS2A 5LK7B 1QJX1 1PGW2 1J58A 3DECA 3VDDB 4NIAA 4H55A 1F9KA 4NPLA 4UW5A 1LR5A 2WNVB 4TXWA 3Q8FA 1W2AX 4JDNA 4DXSA 3W5NA 1XQNA 2K0GA 3IMMA 5KXDA 2DVAA 4OMDA 1YEWA 3CDZB 4IETA 3VBRC 3VL8A 3B7MA 1EY2A 1CJDA 1FAYA 1SACA 4FPCA 3VBSA 3WNMA 1BBT2 4AGVA 2J22A 1C8M2 2Y6LA 1V6IA 3RYRA 1H8TB 4CDWB 2C9KA 3ZSMA 1LEMA 4XJZA 2A3WA 3AXEA 3WLUA 3AP9A 3RG0A 3WG4A 3A0KA 3POGA 4QXCA 1U0AA 4HKOA 3USSA 5ABJB 3Q8AA 4FFFA 3ACIA 1EAH1 2PQQA 5EJ1B 5IK4A 3UJQA 2W2IA 1W8UA 5FPUA 4CTEA 3H8XA 1SLTA 2B39A 3LE0A 4FCAA 4XTPA 1FXZA 1OH3A 4GJZA 4ISRA 4LKSA 3U4XA 1CESA 2BGOA 4RR3B 1Z7S3 1RUC2 3GNEA 4Q0SA 1VBE1 4IE5A 4ZU5A 3SH4A 2QQOA 1PO12 4DMIA 4LQRA 4CDUA 3KCYA 5JDBA 3O5SA 4RHV3 3URFA 4FTBA 2Q1MA 2ZEWA 3GZTB 4LXLA 1QJU2 2CSGA 4ZS2A 1DQ2A 1JODA 1WA4A 3APBA 4D69A 2J1UA 2VM9A 3ZYRA 2QKDA 1F5JA 1CPNA 1V6MA 2WZ8A 1CVNA 2WSVA 4R4ZA 4I01A 4BIOA 4CDWC 5H9QA 1OC1A 2RM22 2MPFA 4YARA 1IS3A 5LA9A 4LO6B 4QX5A 5GKAC 5FZDA 5ABJC 5FZ0A 2WJSA 4RFRB 1JHNA 2NM1A 4QXHA 1CZTA 2YU2A 1ENXA 3T4VA 2VUCA 4C0BA 4QX8A 4QPWA 4HKWA 2W1UA 1SEFA 3V0AB 2W39A 4XBQA 1GLHA 5FP7A 2DCTA 1H2KA 1JOJA 1H30A 3K75B 2P6HA 1A8DA 3J8F2 4BQXA 1YI7A 5IFPA 1VRH3 1V70A 5JMCA 2BBVA 3MBWA 3I3DA 2BV4A 2BNMA 2R7EB 3RYKA 2FDFA 1O8PA 3MFCA 2WO1A 2VULA 1JZ8A 5BNPB 5JZGB 4A42A 4QQ2A 5KC5A 3OEAA 4WZFA 2D93A 1AVBA 3I2HA 4QQPA 4KGGA 1PGL2 1TG7A 5K9YA 1QJY1 3GJAA 2DUOA 2VCMA 4W6YA 1COV1 5A3PA 2ZEYA 3I59B 4XDPA 3LOBA 2CAVA 4OCTA 2JDAA 3AC0A 3CKHA 3ES1A 5FYIA 3WNXA 4DY5A 2R30A 1FPN3 2ZGMA 1EUUA 4AR2A 5D8AC 2A73B 2WDBA 3RI8A 1GU3A 2VMGA 3CU7A 2VTXJ 3HPNA 3PVBB 4XBNA 5DUXA 4CP0A 5FZBA 4S2DA 5HCBA 5CFDA 4IV1C 4BLIA 5JSOA 3JXSA 5DDJ1 2ZJCA 3W5MA 2CAUA 2P3KA 4AI1A 4YVWB 4IGQA 1OFSA 2VZRA 4DUVA 1ENSA 4UOJA 3AJYA 3DPRA 1JYCA 1UZVA 1TMF1 2HWD1 5JZGC 3AB0A 4D7SA 2P3YA 4W4ZA 5A3UA 3ZR5A 3S6PA 1GKBA 3ZIWA 2D6OX 4BCUA 2CHHA 3M3QA 3WP3A 1RUNA 3N9PA 4M3CB 2QFEA 3RS6A 4WV8A 1RUE1 1AXZA 1OI6A 4QKFA 4QQLA 2W47A 3WDWA 4A4AA 2UWCA 4F3JA 1OLRA 4E2SA 1S0FA 4K20A 2D6LX 2ZABA 2ADEA 1CAUA 2NLRA 4A7KA 1OVPA 4LBNA 3LFIA 2GNBA 2YG0A 2Y26A 2EICA 1SFYA 3H8RA 2EIGA 5EFUA 3ZFGB 2XHKA 3UGHA 3MPBA 4Q1PA 4GWJA 1W8NA 5FY4A 3VHNA 1AR62 1JH5A 1UZWA 3FBYA 4Q0QA 1JZ2A 3B94A 3VBFC 1DYOA 1WD4A 2YGMA 2W1SA 3K4DA 5FZMA 3S30A 4ZS3A 5C5TA 5F3CA 1FNYA 1LHOA 1ZZ6A 2WQ8A 4K40A 4Y20A 4CCEA 3RJ2X 3NJVA 1BVVA 3HOBA 4WM8B 1MS0A 3BYWA 2DTWA 2ZEZA 1ZRIA 1JXNA 1NLRA 1XNTA 3H0OA 3NV4A 3PMEA 3Q8CA 3LD8A 3SCFA 1HQLA 2QBXA 2WN2A 3H42B 3RVHA 2WRAA 5GZEA 1W6MB 3MF9A 1PNGA 4DUXA 4P00B 4KQ7A 5J37A 2X09A 1RUJ2 4ISQA 4NAMA 2ORZA 1RGSA 2RMU2 2PMWB 1HB3A 2GMMA 4JV4A 1RITA 4L97A 3H8OA 1N3PA 2BOJA 1YIFA 3FE5A 1QDCA 1VB2A 5AVAA 4DXTA 2AYHA 3NWKA 3SLIA 1ZBA2 3OUIA 2DCYA 1M4WA 3PJYA 5FLHA 3ZFGC 2MEV2 2WO2A 2VMEA 3BPZA 3ZSKA 3LDRA 1VE0A 1WUVA 4TN7A 5FY0A 5ACA2 2ZHLA 1HRI3 3VKFC 2ZX2A 2FHRA 5F2SA 3SEPA 1WD3A 5E6HA 3VZLA 3O1MA 4MGTA 2ZGLA 2JEMA 2EAAA 2BFUS 4WVMA 3BU0A 5FP9A 4UF0A 2O0OA 5DQ0A 4CU9A 3BTYA 4NRMA 3P5BA 2EXIA 3OYWA 5A7QA 3FC0A 4XFGA 1G7YA 1BVP1 4IEYA 1OURA 5T5LA 1J1TA 2VXRA 3UKNA 4FI9A 3KT4A 1AYM3 4JDMA 1RXFA 1VBD1 3ZMOA 4IXLA 5E89A 1KXGA 1WCKA 1RUG1 1RC6A 1J3RA 4R8HA 2WABA 5LZ6A 1RUF1 4D6RA 1T6BX 3LEMA 1G86A 2JX9A 1JU4A 2WUHA 4IL7A 1PO21 2JG8A 5GLTA 3TWIA 3VBOA 3VBRA 4NROA 3LEIA 1IOAA 2WS93 2VCCA 1VBB3 3C7OA 4I09A 4YVSB 3ZXLA 2QQNA 4DOUA 3LF7A 5A70A 4E4SA 4GH4B 4D7YA 5JXGA 4Y5SA 4Q2FA 5C71A 3N9MA 5B4NA 1Y9GA 3GXUA 3I3EA 1PZ9A 2WZR3 4A41A 1SMVA 3LA2A 1J3PA 3W59A 2E63A 2WLQA 1N1YA 2AH2A 5EJ3A 1KFUL 3B69A 3HBZA 1CIYA 1IQAA 4ZKTB 2XB6C 1QMJA 5JXIA 4A3XA 2I07B 5FRAA 1RVF3 3VDDA 1IPSA 5FWEA 4XABA 2WNVA 3MF6A 5LBBA 5FMOS 1ASJ3 2BOIA 3I2DA 1VB4A 3HT2A 4KNCA 4N9IA 4AVTA 1IS6A 1RJ7A 1U12A 4AGRA 1GOFA 1OQDA 3N7JA 4NPMA 2FDGA 2W9XA 2WNUC 4YVSC 1D0GA 4DRVA 1GMMA 2Q0AA 3WG3A 4GH4C 3PLQA 1H8TA 4AHWA 4CDWA 1IQDC 1SLCA 2LROA 2Y6GA 3OGSA 3T3YA 2RS33 2HWE1 4EN8B 5FR3A 4GMP0 2BZDA 4E4HA 1RB8G 5ABJA 1M06G 4B4RA 5C4WB 4JVAA 2E32A 1NCQB 2ZGPA 5JPMB 4QGNA 2EIEA 3AMMA 4BHPA 1DFQA 4RR3A 5IATA 5J36A 1V9U3 4O9EA 2BDRA 3I3QA 4AGGA 4GAZA 1U5YA 1FYUA 4JAAA 1W9SA 2WBKA 3OGJA 4M4RA 4UFMA 3IDEA 5F5CA 4GB31 4KU7A 3SQOA 3UT0A 4YG6A 5KHKA 3DL3A 1F5FA 1FMD3 3KCXA 4QT6A 4BQ2A 4QHBA 3H1MA 3O1SA 4NIGA 4HVOA 4K8RB 1BJQA 1JU3A 3IDBB 4NVPA 3TNPB 3F95A 3LIHA 4M4PA 4Y3OA 4XCBA 4DXRA 5CKMA 1VAKA 1ZRCA 3B00A 3BCWA 5A6XA 4YG0A 1GZTA 4IE0A 4WVZA 1BEV2 3PIJA 4LO5B 5TSWA 2A3YA 2GU9A 2Q1ZB 5FY1A 5K0UC 1FOD3 5LASA 2GC3A 3AYEA 1S55A 3U11A 3POYA 3VN4A 2XVLA 4KWLA 4EJRA 5FYUA 1NCQC 3HVDA 2VOTA 4XBLA 3HMYA 4OHYA 3ZXJA 4O61A 1QH7A 3V0AA 3KV9A 1O4YA 4QX3A 4COYA 2X53S 2RV9A 3NAPB 2RR13 2IXLA 2HWC1 3HN1A 4HANA 5IFTA 2D3SA 1PVC3 1UKGA 1IKPA 1QY4A 2ARAA 4JDOA 3AYDA 4CU7A 4LA3A 4H3WA 4UBHA 2P37A 5J48A 5J1XA 4XQWA 2RS53 3T0AA 4BIFA 5EIYB 4LMFA 5BNPA 5JZGA 1NKGA 2R1BA 5FZIA 3SXWA 2WFF3 4NHYA 1RUH1 2WYFA 4IW3A 4LA2A 4B4QA 3UETA 1W8OA 1XE7A 1Q56A 1QQP2 2X5IB 1GZCA 4PLOA 5AC93 3JCIA 1RUI2 3I59A 4I3PA 1AJKA 4V1PA 3AJZA 3S7EA 4EQVA 5FO9B 2CGOA 2D97A 2PXJA 2IUWA 3MLLA 3POEA 4BWOA 4CEYC 1L7LA 1CN1A 4PQQA 1S2EA 5FXXA 3DXUA 2HLEA 4FPYA 2HYXA 4C0HA 1NQDA 4HSLA 1GZ9A 5FJHA 4Q4Y1 4RHV1 3WG2A 1AR83 1SQ4A 2VZVA 4CZSA 3NAPC 1TME2 4P9XA 3WNKA 3D4KA 4HPKB 1ODNA 4YVWA 4LJHA 4OMCA 1R092 5GZCA 4RSUA 3V0BA 3ACFA 1R1A2 1AHSA 1UPIA 1J1LA 4META 2YC4A 1W0PA 4Q4W3 3VBUA 4CCDA 5ANQA 5FV3A 1D4M3 5F7UA 5H9SA 3RI9A 1K5MB 5FIXA 1NYWA 3M70A 3OPWA 4XACA 2A5ZA 1MS8A 5F6LB 2AZ5A 2GC0A 2X5IC 4LORA 4Y22B 4XXAA 4ZPIA 3UKVA 4M3CA 3ZN4A 4AZZA 2OXBA 2OZ6A 3WCSA 2CYFA 1N1SA 4URTA 5FK7A 3L2HA 3VZMA 4EN7B 3A0NA 2ZACA 1AF9A 2YDEA 1V6LA 1S0GA 5DAPA 4CPBD 4AVCA 4MXWB 1OXCA 4CCMA 3PUHA 1Q43A 1DZQA 1UN1A 3WP6A 3U75A 1VRH1 5A3LA 1K45A 3MUY1 1UPSA 1ZM1A 2B45X 2WZEA 2ID4A 4YZ4A 5L9VA 1URXA 4XTMA 1JZ7A 3FUQA 3LSDA 4LBQB 2VMDA 4LO8A 2VMIA 1NXD1 4ES9A 1DCSA 2VW2A 1TNFA 2RDRA 4JGZB 5T5OA 1MZFA 5M0TA 3NKTA 1SFPA 4Z1VA 3T2OA 3GZAA 1US2A 5FAXA 4AG4A 4I0WB 3WNPA 5CFCA 3KVAA 3IIIA 1HXS1 4WM8A 5FUPA 5F2WA 3BOWA 2YUEA 1B09A 2C5DA 5KXBA 1ZVFA 2ARBA 5CISA 5KHJA 1OQEA 4Y33A 1RHI3 5ERLA 2A6ZA 1W6MA 2R072 4XF1A 5A7WA 2ZMLA 1DHKB 4Q29A 3WUCA 1QJX2 4BLJA 1WCSA 2YBSA 1WMDA 4IGPA 1ONAA 1Q8QA 1HJFA 1DZTA 1UY3A 2BRTA 4AI8A 1TNRA 3D3AA 2FQPA 1AL23 1MS5A 1UU6A 5FPVA 5FXVA 1UU5A 4YGEA 1BHGA 1KS4A 4PIYA 4UFIA 3WF1A 2XGXA 3W58A 3O0WA 3ILNA 4MGQA 5CFDB 1OPOA 1GQPA 2ARCA 4CUBA 4DIQA 4ZU7A 1DQ5A 4AEDB 4COVA 4EYUA 3SH5A 5A1LA 2JXAA 4SLIA 2OYZA 1YQ2A 2FCTA 1D4VB 3PUQA 1EAH2 2C26A 3WF2A 3HQRA 3S5AA 4NO4A 4M01A 1D0HA 2OQ6A 3H7JA 1VBC3 2RG4A 3VBHB 3QLQA 1TZOA 3KSCA 5FCCA 4AI0A 1JYWA 3S57A 1AUYA 4HN1A 1RIRA 1W8ZA 3T2PA 1VBE2 1LHWA 2ZA9A 2RJ2A 4XURA 1KRIA 3R4DB 4QKBA 1W0NA 1GFF2 1G8WA 4NAOA 2HEVF 3PJQA 2UURA 5A3TA 4RGAA 1S0CA 2ZMNA 5KXEA 3I54A 4XHXA 3FFZA 2TUNA 4OVEA 2A6XA 4NIIA 3WCRA 3M4FA 5JOZA 5EYXA 1JUIA 1SDDB 5LA1A 3LKJA 4AL9A 5CFDC 4R9BA 2ZZQA 4GZ9A 4XETA 1GYKA 4I0BA 1UX7A 3ABZA 3PTYA 3QBQA 1ZA7A 2Y60A 4XFAA 4YVSA 4AEDC 3RYPA 2P5BA 3AVSA 5JOWA 5LWBA 2OZJA 4GH4A 4L9BA 1ENQA 1GOHA 2D6NA 3VB9A 4GXLA 4E4ZA 4EZ4A 4JGYB 4COWA 1WLDA 3PVOA 1KD7A 1YI9A 2PHDA 4QPIB 2PLV1 3ON7A 1KS5A 3OD0A 2PAKA 3Q8EA 4Z2AA 3POBA 4IERA 5BUVA 3NW4A 2HWF2 3UESA 4BXFA 1V6JA 1BBT3 3I7DA 1D7PM 1OLME 1Y4WA 1C8M3 1BK1A 3ZFFC 2BP6A 1XU2A 2PHTA 4S2GA 2JIJA 4TLFA 5A33A 1MVEA 1W2UA 1HLCA 2DCJA 2Y0OA 1ZBE2 1H6XA 1OF3A 2E26A 1DIWA 4LBJA 2VUAA 5JI9A 2WYSA 2DCZA 4L8QA 4FPFA 4Q1RA 3VL9A 2VCBA 3D6EA 3O1UA 1H4HA 1DQ6A 2VZ1A 4Q4X1 1Y9MA 5HPOA 5L7OB 4TLGA 3HBKA 5EYYA 2XUMA 1WMEA 5D1IA 4HONA 1QJY2 1PO13 3WHTA 1COV2 3FFQA 1XNDA 4DFSA 3KM5A 1QGLA 3U78A 4LOTA 3E5UA 5IVVA 4YFWA 3VDCA 3LDBA 4XC9A 1BLZA 5IJRA 3WP5A 5E16A 5CA6A 1QJU3 5FREA 4XMIA 4PDWC 4Z82A 4MSVA 5A7PA 5C4WA 2Y6JA 4X6QB 1MEC2 4D3WA 2C1FA 2XJVA 4QQHA 1YFWA 5FZHA 5A3MA 3D8CA 5DDJ2 3IPVB 1E57A 2GZWA 3RWNA 2RE9A 2VQ0A 4QHZA 2RM23 1QXPA 3VKOA 4W6WA 3WQ1A 1G9BA 4OI2A 3JD72 4AXOA 2MNGA 3WUDA 4LBQD 1LOFC 1VBB1 3ASIA 1TMF2 1W9WA 2HWD2 2GN7A 5E1RA 3DN7A 4OHZA 4I30A 3T4HB 2VMHA 5FYCA 3AYAA 1UZZA 3H3LA 3W21A 4YGBA 1LCLA 5L7OC 3KWVA 4LE4A 1ND3B 4YM2A 2J1TA 2G1MA 3MIBA 5AFBA 5IVJA 1H0BA 4AW7A 1R1ZA 3RDIA 1ZA4A 2O14A 3FHAA 3C7FA 3J8F3 3ZM8A 1H2NA 5C5UA 2ZGOA 3MHZA 4JTNA 1OOPC 3WDVA 1MZEA 1GICA 4QPYA 4XW3A 1RVF1 2FCUA 1DGWX 3QH7A 3TAYA 3U1XA 3O1OA 2VZPA 1XNCA 2VG9A 1ASJ1 1LRHA 2FZ1A 4NHMA 5A6ZA 3K2OA 1NUKA 1UOJA 2JB4A 2ZOEB 3NAPA 3BVCA 4IQPA 4IV3C 1YJLA 2RS13 3N9QA 3PDQA 1NT0A 3OF1A 4B29A 1UU4A 3N35A 2B4KA 2PFWA 4MH0E 1Q3EA 2DTYA 3TEXA 1Q8PA 1SDWA 5JR7B 5BNOB 1QKQA 4FXKB 3KF5A 2ZGTA 1GSLA 5KHHA 1DDLA 4ATFA 1LB2A 1C1FA 4FP2A 5CYYA 3SH3A 3IT8A 5A80A 3HN3A 3KV6A 4KGQA 2FDKA 3ZR6A 3BOPA 1AL0G 1KFXL 4HG6B 2X5IA 3A23A 5I8TA 2WA4A 2PHFA 2ZAAA 1IG3A 4Q4V2 3T2TA 1JOPA 1NY71 4H7LA 1AR71 1QEXA 4QMAA 4R9AA 2D98A 4KWKA 2Q8EA 3LWCA 1K42A 3SITA 3JBG3 5F3EA 3C8XA 5JVVA 3A22A 3DUIA 2WT2A 4GMP3 2Q1FA 2UWAA 3PVEA 5BV6A 2DVDA 1FMD1 3CHXA 5K8SA 3PU3A 5FP8A 1K3IA 3AM2A 3VD9A 4HPKA 4XAAA 1OKQA 2VZOA 1JHJA 4GJYA 1MVQA 3WNOA 2P3JA 4CEWC 1PMJX 5FZ6A 3AFKA 1EV11 3KVBA 4XQDA 5BNOC 5J09A 2BJSA 2CDOA 4MOAA 1REFA 2RDQA 2XBO1 2GC1A 4JHZA 2PAEA 2Q4SA 1FOD1 2GSYA 1K5MA 1OH4A 2JG9A 2QJVA 3A7QA 3VLBB 3V64A 1AR63 2GDFA 2ZCWA 2LALA 4Y22A 5T5JA 4LK6A 1OUSA 2R042 4P9WA 1GR3A 2W95A 4QKNA 2KA3A 3MYXA 5JSRA 3MV11 2XJTA 4LKDA 4XFFA 5L73A 2JDZA 4PIZA 1RUG2 3G7DA 2RR11 1BXHA 4F7ZA 5KR7A 1VAVA 3ZXKA 1GNZA 1RUF2 1X82A 4HSJA 4LO4B 4J1WA 4NE9A 2YBPA 3ZPOA 1NA1A 2ZHKA 3MUZ1 1PGSA 4AVAA 2UU8A 3WY6A 1YQ8A 5FPXA 1P8JA 2XWJB 4ZXEA 1PO22 2XXZA 3DXTA 2BERA 1RUJ3 2OPWA 4LBQA 4WM7C 5D2AA 5EZWA 3O1VA 1QJFA 2RMU3 1A8MA 1Q8OA 1DG6A 1O3RA 2WFF1 2AACA 4JGZA 5T3NA 5T50A 4H7MA 3ZOIA 4CDXC 5KBFA 3EO6A 4NRQA 1QJEA 1QOTA 1JW6A 4JKMA 5AC91 4NHKA 2QUOA 3J7NA 2YC2A 5FZOB 3BODA 1ZBA3 3JUUA 3NV1A 4XZPA 1Z78A 5D8AB 2FDHA 5GLWA 2JB8A 4R4XA 2FCVA 2MEV3 1BCXA 3WX5A 2ZBJA 1LGNA 4IV1B 3CJIC 4OYUA 3HIFA 3ZX7A 5I0SA 2FMDA 2Y38A 3MIGA 4OFGA 1YXWA 2R16A 5ACA3 2RDSA 1RUD3 1AR81 1K5JA 5D21A 1KQRA 3VHRA 2HEWF 1HDKA 1PIV1 1R081 2WFPA 3KMHA 3UKTA 5IUQA 3I2KA 4AEJA 3O1PA 3AKRA 4FFGA 1H9PA 4QWNA 1CZSA 1C5HA 1D4M1 1XE8A 3GYDA 3J7LA 3ORJA 3OGVA 4HETA 4PI0A 5FJKA 2BPA2 4YNIA 4EWDA 2R49A 3HWJA 4AEDA 1G9CA 3GDBA 4L2NA 2HWE2 4PCRA 4KMQA 5L9RA 1XBFA 2BVVA 4BQ1A 1QOSA 2V72A 1PHMA 2UY9A 4WZCA 1VBA1 1W6NB 4Q0UA 4PF5A 5FBZA 1CZVA 4Y5TA 1RL3A 3M1HA 3POSA 3VBHA 1C1LA 3LSEA 1WW5A 1CAXB 1AX2A 1OA4A 1K12A 4LHSA 4TYSA 3TN91 3ZSLA 4UBGA 3OBRA 5FBJA 2AC1A 1HX6A 1WZXA 4N43B 3P3NA 5IT6A 2ZX3A 4FTEA 2NQYA 4GB32 3VBFB 3VDAA 4AYUA 2Y6FA 1YFYA 4W50A 4DRRA 1RTVA 1GWMA 2CL2A 4AHXA 4UT5A 2V73A 4RS5B 5A7NA 5FZLA 2XPJA 1VJ2A 2VUJA 2CWSA 3DGTA 3ZYJB 4MXVA 3WW1A 3LGRA 3PUAA 1IS5A 2G9GA 4HLTA 3LAGA 3WF3A 3B9CA 1N1VA 1AR92 5CG9A 3MICA 4XUPA 4OI4A 2YC0A 2XH6A 1S0BA 3J7MA 1UIJA 4QGMA 1HQNA 5FZCA 2VUDA 1QNWA 4JGYA 4QPIA 4OUSA 2W68A 2V09A 2XONA 3ME2A 4NMIA 2ES3A 1UXZA 3HNMA 5JIAA 4JZRA 2ZKNA 3KV4A 1CX1A 2BTVC 4A45A 4FXGB 4N53B 3RZKA 3FMGA 1G9FA 4WBBA 5GLVA 2KR2A 2GC2A 1PK6B 2HWB2 2HWC2 2VR4A 4N43C 4YYOA 4D0QA 3OY8B 4KU8A 1LHUA 2VBDA 1RMU1 3R05A 1POQA 2HBTA 1H2LA 2YFZA 3ZMNA 2HKXA 1CIWA 5A3WA 4B3NA 2O8QA 4RS5C 2WT1A 4COZA 1LOFA 2XQXA 3GBGA 3T2QA 3M7AA 3BI3A 2FZ2A 3ENRA 4HVRA 3E1F1 3ZFEC 3KQRA 2JDHA 3D0JA 1UMHA 5L7OA 1RUH2 1XJAA 5DG1A 5BPXA 3ILFA 3CQOA 4OI0A 4I2OA 2XR4A 4TTGA 4CYDA 3TEYA 1WMFA 3B01A 4MV2A 1IKQA 4N7IA 5FXZA 1ZRRA 2OUJA 5A6QA 3ETPA 5C7GA 4XMAA 4EWEA 4EN9B 3RZLA 3FZ3A 1BMV1 2YV8A 4A44A 3PIGA 1OBNA 3MPPG 4RA0A 3BB6A 2YY1A 3WXPA 1XXNA 2YGLA 4Q4Y2 4LHLA 4N53C 1NLSA 5FDBA 1V00A 1PK6C 4BA6A 1BEV3 2LRPA 3OJBA 1W3XA 1UL9A 4PF1A 2E33A 1XE0A 2TEPA 1QH6A 1H8VA 3WV6A 1N3OA 2ZAHA 4U36A 3WW3A 5T5PA 1UYYA 1LULA 3FN9A 1OHFA 1PGW1 2DCKA 2J7MA 2JICA 2V5YA 3UNPA 4FOWA 3ES4A 1W6OB 3ZXFA 4DB5A 1YRZA 4HFSA 2D43A 4YW3A 4AVSA 1C28A 3BIWE 5L9BA 1ND3A 3THDA 5A32B 2EA7A 2VY0A 2ZHNA 4AQSA 4Z8BA 4LULA 2F4LA 4BOWA 3I8TA 3INAA 2ET1A 2DV9A 3KS7A 3MO4A 5E8AA 3WT3A 5FYTA 2LW8A 3FJSA 5HV0A 5FOBB 1BBT1 3A21A 3HEIA 4YWAA 5JOYA 3M8LA 4Y4YA 2PN5A 2J1AA 2QTWB 4H14A 5LY1A 4PI2A 3BTXA 4LIUA 1A78A 5FZAA 4GWIA 4OHVA 4LTAA 1RUOA 2A70A 4Q8KA 4GWNA 1QQP3 4IEQA 4NWVA 2WNUB 3WDUA 3I4IA 3FLTA 3K48A 4W8JA 4BISA 4QXKA 5K4LA 1MS9A 2EXHA 3THCA 3SCHA 4F83A 1PO11 5JOXA 2QCSB 5BNOA 4TWTA 4QGLA 1HXS2 3OSDA 2X10A 2FBEA 1TME3 3I3BA 1W8FA 2A6WA 3AMQA 2UY8A 3EMRA 2N7GA 4P9JA 4CCOA 1W6PB 2XHNA 2D5FA 2W92A 2Q8DA 2CGPA 3AK0A 1ENRA 3WNLA 1R093 2CWMA 3MW2A 1CAWB 4FOVA 3MI8A 1R1A3 1WBFA 2DBIA 4HKLA 2NMNA 1VMHA 1VMFA 1W2OA 2GH8A 4LR4A 4NWWA 4QU1A 2BBAA 1I5ZA 5IYYA 2RM21 3GCXA 1MS3A 5A6YA 4YW1A 1DQ1A 1ULDA 2EALA 2DWRA 3AZXA 3NNJA 3I97A 5EPAA 1AXYA 3GM8A 3VD3A 5B2GB 2W52A 1YNAA 1ND2B 1V6KA 5DAXA 5LB6A 3T1MA 4HMZA 1C3HA 1OA2A 1DGLA 5CBLA 2VBBA 2GP3A 3B3QE 3KHCA 3ZPYA 4LBKA 4YZ5A 3IKWA 5K0UB 4L11A 2QQPA 3Q8BA 3AKTA 2GMPA 1N1TA 4FPJA 3MW4A 4MHUA 2A6VA 3I2GA 2R062 1I5PA 4LKFA 1RJ8A 1OUXA 4XJ8A 4A7YA 1YFXA 2RHPA 4LK7A 4B1MA 4AI3A 2Z5WA 1OQ1A 4Q0PA 1N3QA 2VQUA 3E6BA 5BNNB 3TOJA 1MS1A 4XHBA 3USUB 3LFMA 4EZHA 3VKNA 2A6YA 1UOBA 1BQPA 2RS11 2VQAA 4KWJA 1HRV1 5GLUA 4CUGA 3VD4A 4XYXA 3QCWA 3ZN5A 2VU9A 3ACHA 1GP6A 3KF3A 4EV0A 4EE2A 1JYIA 1ND2C 1O6UA 2K46A 2R073 3ILRA 3UV9A 3TRSB 2D6KA 4CA9A 1W04A 1QJX3 4Z92B 4FPHA 4FOQA 1W9FA 4OI1A 3SKVA 3O7OA 1A3KA 1W6QB 4ITCA 2QDNA 4CEYB 1O4TA 1VR3A 2GALA 5FZOA 2PLV2 4M3CF 4X8PA 1UY2A 1UYPA 2QQVA 5D8AA 5CG8A 2VOVA 2OVUA 4ARYA 2Y8KA 5FTTC 3OGGA 3JBG1 2WAAA 1YFUA 4IV1A 1GNYA 2J1SA 2VVDA 2GP5A 3LEKA 5BNNC 5A1FA 4PLNA 4SBVA 4ARXA 2DVBA 3QOPA 4RYDA 4CP9B 2AGSA 2XL7A 1DQ4A 2JWPA 4RL7A 4PT6A 1QOOA 1EAH3 1ODMA 3DYPA 4LITA 5EP9A 1PM4A 4BQ3A 5C3PA 2Y64A 1H4GA 3ZN6B 2AR6A 3ETQA 1O3TA 5A1AA 3AL5A 5H9RA 4Q4X2 1UYZA 1MQTC 2H6BA 4LT5A 4MGZE 3P6BA 4R52A 1AYN3 1RINA 4LPLA 2X05A 2D7FA 3ELNA 1AR61 2VZTA 3CF6E 1Z7S1 1OLQA 3SMHA 4YRDA 4AQTA 3PU8A 4Y1XA 3OD4A 1W6NA 5HCFA 4B7KA 4FBFA 4DO0A 2R32A 1S2KA 1DYKA 3B5LB 2BYVE 1D2SA 4UAPA 2XLAA 1O3QA 1SG3A 5EJZB 2C24A 4HK8A 4XUOA 1B35C 4AI2A 1AX1A 4G3YC 3NJZA 4LNVA 3ZSJA 2BWAA 2DBNA 1GZWB 3MIHA 3VBFA 1QHDA 2E7AA 2P1BA 2DVGA 2RMU1 2WKKA 4RS5A 5BYNA 2KM2A 3DYOA 1LU1A 4FQZA 4JHTA 5T52A 4ZHNA 2HWF3 2HBUA 2DFBA 3GF6A 1YC61 1EPZA 4BMEA 1JYTA 3SEEA 1S0JA 1ZBA1 2P34A 2PELA 3MEPA 1D2QA 1DGWA 4YZ3A 2D44A 1GWKA 2MEV1 4M3CE 3VBSB 1ZBE3 5IVBA 5IK7A 1REDA 2E9QA 2BFUL 5L36A 5ISLA 1X8EA 4QPGB 2EVXA 5IVCA 2OA2A 1RVF2 2A71A 3K77A 3PUSA 4RFT0 5E88A 5ACA1 1CR7A 1RUD1 1STMA 3U4SA 1ASJ2 1YLLA 4JC1A 4BYYA 1JS9A 1QJY3 2K2SA 2XLFA 4N53A 5IW0A 3TYJA 3ZFGA 1COV3 4P5YA 2NN8A 5FYHA 3OY8A 1A6CA 4QX2A 4BQYA 5JMOA 1GV9A 3X29B 2RJLA 1RYYA 4DEQA 3T08A 5C8WA 4V2VA 1SPPB 3B93A 4BK4A 3MZHA 5JCTA 1ALYA 1MEC3 1XNBA 5FPLA 3HAGA 2A7AA 5CIRA 5DDJ3 2ET7A 4D8MA 2CU5A 1FPN1 4YM1A 1H1AA 5FZGA 1O3SA 3WD5A 5CKNA 1CWPA 2ORXA 1IZ3A 2JIGA 3NV3A 3OB8A 3VBSC 3J7HA 1DU3D 1E5HA 2UYBA 2CDPA 3AKPA 1NY72 1XOYA 3JD73 1AR72 3I2JA 3M3IA 4QPGC 4ZZ5A 4I3GA 2LM3A 1TMF3 2HWD3 2C6SA 4OQ8A 1SLLA 1FNZA 4PIXA 3R4SA 4B1LA 3IZOA 3UK9A 3L2YA 1JYXA 2WT0A 3NJYA 2XVGA 2P6CA 3CMGA 4AAPA 4INDA 2DUPA 3OBZA 2WL1A 2ERFA 4K3UA 4OULA 4D6QA 1YQ5A 5CZKA 3T0DA 1V6NA 2K9ZA 2W1WA 5FMOL 3WQ7A 2O8OA 4BK5A 3ZYIB 1JI6A 4DUWA 5CKQA 1EV12 2GNMA 1IPKA 4Q5OA 4XOGA 3UJOA 4ASLA 4COUA 4OUEA 4MO3M 5F3GA 2Y33A 4FO9A 2D6PA 4KBZA 1WMXA 3VHPA 1W6OA 2XBO2 5JUVA 1X9PA 2VOKA 1W9TA 1VP6A 4LIVA 4N8MA 2BGPA 1WBLA 4DEVA 1DQ0A 5A32A 3DCQA 1AXKA 4IGOA 3KLSA 3ZFFB 3Q9OA 2P17A 2VJXA
chains in the Genus database with same CATH topology
1GWMA 2KR2A 4BQ4A 1L7LA 2Q1FA 3UT0A 4BQ2A 1HN0A 1W8WA 4LKDA 4CP9A 2LROA 4A6SA 3F95A 4YWAA 3ZYHA 4CPBA 1GWKA 4CP9B 2O14A 1OKOA 2JWPA 2K46A 2LRPA 4CPBD 4AL9A 4LK6A 4LKEA 3ZYBA 1W8TA 3ZYFA 2C24A 4YW7A 5D21A 4BQ3A 1W90A 1W9FA 4LJHA 1WMXA 1GWLA 1V0AA 2VXJA 4BQ5A 1WCUA 4LKFA 1W8UA 2WYFA 4YW6A 1OH3A 1WZXA 4LK7A 1W8ZA 1UOJA 3ORJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GWM A;  2KR2 A;  4BQ4 A;  1L7L A;  2Q1F A;  3UT0 A;  4BQ2 A;  1HN0 A;  1W8W A;  4LKD A;  4CP9 A;  2LRO A;  4A6S A;  3F95 A;  4YWA A;  3ZYH A;  4CPB A;  1GWK A;  4CP9 B;  2O14 A;  1OKO A;  2JWP A;  2K46 A;  2LRP A;  4CPB D;  4AL9 A;  4LK6 A;  4LKE A;  3ZYB A;  1W8T A;  3ZYF A;  2C24 A;  4YW7 A;  5D21 A;  4BQ3 A;  1W90 A;  1W9F A;  4LJH A;  1WMX A;  1GWL A;  1V0A A;  2VXJ A;  4BQ5 A;  1WCU A;  4LKF A;  1W8U A;  2WYF A;  4YW6 A;  1OH3 A;  1WZX A;  4LK7 A;  1W8Z A;  1UOJ A;  3ORJ A; 
#chains in the Genus database with same CATH topology
 3OUJ A;  3OPZ A;  1X33 A;  3ZYP A;  4LLO A;  2D5H A;  5FMD A;  4QM8 A;  1EUT A;  4IEZ A;  2V5D A;  5H9P A;  4AK3 A;  1LED A;  4BXS V;  3HQX A;  3LPG A;  1UCX A;  2YPD A;  1DBN A;  2H6C A;  2JD4 A;  2VBP A;  2Y6H A;  2ZX1 A;  3RNS A;  1QIQ A;  3MIE A;  2PQS A;  3PTR B;  3BU7 A;  4L99 A;  5DN2 A;  2WNU A;  3GZU C;  4Q4V 3;  2IXC A;  4CRQ A;  5IVE A;  3I2O A;  4C1X A;  3IN9 A;  3TB0 A;  2WFF 2;  1WWY A;  3LA3 A;  3VZJ A;  1S0E A;  5JI7 A;  2ARX A;  4XF0 A;  3NNF A;  1YIP A;  2YMZ A;  3VD7 A;  1Q8V A;  2ETE A;  2QVS B;  2L9L A;  4XE9 A;  1MPX A;  1VAL A;  4Y1Z A;  3NO8 A;  1C5I A;  1JOB A;  2Z4F A;  4N9H A;  4PDW B;  1LEC A;  2CV6 A;  2W46 A;  2ENR A;  1W6P A;  4PLM A;  2ZGR A;  2R0H A;  3RZM A;  3K51 A;  5FY8 A;  5J96 B;  4CPB A;  3E6D A;  1CAW A;  4P5H A;  2XL9 A;  1AR8 2;  1LOD A;  2P3I A;  3KV5 A;  2J42 A;  2F6B A;  4JX0 A;  4PBP A;  3RMY A;  3HQU A;  2QE3 A;  4Q26 A;  5FOJ B;  1PIV 2;  1R08 2;  4XFC A;  4E2G A;  1UOG A;  4QM9 A;  5HV4 A;  3FX3 A;  4UYB A;  5DAW A;  4BB3 A;  1HRI 1;  4NIH A;  1S0D A;  1ULO A;  2B9U A;  1I9R A;  2X29 A;  5FO7 B;  2IZW A;  3GZE A;  3ST7 A;  1RUC 3;  1ND2 A;  5FUN A;  2R04 3;  1Q8S A;  1XC6 A;  5C3Q A;  3V65 A;  4AHY A;  4JQR A;  1H1I A;  4HZF A;  2W91 A;  4ET7 A;  3BKZ A;  4GAL A;  3WDT A;  2GN3 A;  2Z42 A;  1WCQ A;  1RUG 3;  5LBC A;  3ZXG A;  3WDY A;  5F39 A;  1LGC A;  5K0U A;  1CON A;  1RUF 3;  1XNK A;  3IB3 A;  1OOP B;  4IEX A;  1VBA 2;  1AYM 1;  4AOC A;  3PNA A;  1WKY A;  1POV 0;  3JQX A;  3EYP A;  1NCQ A;  2VOX A;  1J83 A;  1PO2 3;  3KT7 A;  1T2X A;  4QQO A;  5GZD A;  3TN9 2;  4DQA A;  2CNA A;  2H0V A;  4GKY A;  1AJO A;  5JR2 A;  1ZYB A;  3AMP A;  3NL1 A;  5G04 L;  1AZD A;  3LPF A;  4RGK A;  4YW6 A;  2JDP A;  5A3O A;  1ZZC A;  4IV3 B;  5BNN A;  2BWC A;  2YPJ A;  2Z2S B;  1MAC A;  3USU A;  4S2H A;  5LA2 A;  2BNO A;  4IDZ A;  2WS9 1;  1X9T A;  2EID A;  5HCA A;  3H50 A;  4TSV A;  2XOM A;  2VC9 A;  5FZ4 A;  2IFR A;  1WW4 A;  2F17 A;  4E27 A;  2I74 A;  3LZZ A;  1HIX A;  2WZR 1;  1UYX A;  4DS0 A;  3VUO A;  2VCA A;  4YGC A;  3U07 A;  1LHN A;  1X36 A;  3WQ0 A;  1S4C A;  2XG3 A;  3ATG A;  1IS4 A;  3KB5 A;  3ZKY A;  1RUE 2;  3IIA A;  4FQ4 A;  2HYK A;  2WNE A;  3T0B A;  1VLN A;  3OGR A;  3U14 A;  2ADD A;  4BJ0 A;  4XZU G;  4CEY A;  1R09 1;  3K3O A;  1ZZ8 A;  1UOF A;  4XIO A;  5DG2 A;  2NP0 A;  3RSJ A;  2DF7 A;  3CEW A;  4CCC A;  1W2N A;  5CAD A;  1WW6 A;  5JAX A;  1XPW A;  4JTO A;  3PMS A;  2PHU A;  2QDR A;  1CJP A;  3AZZ A;  4LHK A;  5CNA A;  5LAT A;  4CSW A;  5B4X A;  2G4I A;  3V56 A;  1RMU 2;  5DAV A;  1FI2 A;  3RZJ A;  1PZ7 A;  1JYN A;  1SCR A;  3LQC A;  1H2M A;  3E5X A;  4CEW B;  2LS6 A;  2ZX0 A;  1H9W A;  5FP4 A;  4JRL A;  5EWS A;  4AVB A;  4FPE A;  5C6C A;  3IDC B;  3QAC A;  3U10 A;  4IES A;  3WR0 A;  1J84 A;  3ZN6 A;  4BMB A;  2FD8 A;  2RS3 1;  3SNM A;  3VDB A;  4TZD A;  4XAE A;  3THP A;  1JUH A;  2Q8C A;  1HB4 A;  4NPR A;  1W06 A;  3AVR A;  2WZP P;  4AHZ A;  4W65 A;  2WA3 A;  2EXJ A;  4XEZ A;  3S0M A;  3KGL A;  1Y3T A;  3SC7 X;  2JG8 B;  4KI5 M;  3LCP A;  4GB3 3;  3DV8 A;  5HXM A;  4Y1V A;  3AXD A;  1JBC A;  1V9U 1;  2QQL A;  4Z2W A;  1VMJ A;  1LTE A;  1BMV 2;  3RMX A;  4KG0 A;  4NHX A;  4XF9 A;  5C3S A;  5JPN B;  4DNY A;  1HN0 A;  4CUA A;  2OT7 A;  2F4P A;  2JDY A;  3SKJ E;  4DXZ A;  1U5X A;  4IE6 A;  3PUI A;  4OZO A;  3VD5 A;  3D0S A;  1AR9 3;  3J26 N;  5DPN A;  3ZIX A;  2Q5T A;  1L7R A;  1NE6 A;  1R64 A;  4XIL A;  5FY9 A;  4WM7 B;  3O14 A;  3ACL A;  3P3P A;  1H1M A;  4E8C A;  4HL0 A;  2YZ4 A;  1W0O A;  2VNR A;  1NG0 A;  3NKG A;  3WOG A;  4CDX B;  2JEN A;  4MGK E;  1LOG A;  5LEK A;  2IXI A;  1GNH A;  1QXJ A;  3POJ A;  3RFR A;  4IEW A;  5JXJ A;  3DYM A;  3LOI A;  1GP4 A;  2HWC 3;  2HWB 3;  3AMN A;  4M00 A;  5GAL A;  3CJI B;  3VBO C;  2JG8 C;  4NN0 A;  4FAH A;  1PVX A;  1QWR A;  1VBD 2;  5CEH A;  4QPG A;  5LW9 A;  4GKX A;  4MXW A;  2E7T A;  2WSU A;  2C0Z A;  4J6G A;  4IE4 A;  1PVC 1;  2ZS6 B;  3E97 A;  5DUU A;  4K7J A;  5DZF A;  5JIU A;  3RZG A;  2VZU A;  3AP6 A;  3RPQ A;  1RUH 3;  3WSO A;  1O4Z A;  2RS5 1;  5IK5 A;  2VAU A;  3LIG A;  1LEN A;  1WLC A;  1OPM A;  2R6Q A;  2V4V A;  5HCH A;  1YWK A;  4FAG A;  2OW4 A;  1YYN A;  3VDD C;  1AYN 1;  1SPP A;  4FPK A;  1IHM A;  2WNV C;  3RZZ A;  4BPZ A;  1SCS A;  4AQ2 A;  4Q4Y 3;  1DLC A;  4Q27 A;  3ZDV A;  3AKQ A;  4EWA A;  4FT8 A;  4CP2 A;  2CTV A;  3EJK A;  4RN5 A;  2R0F A;  5IHR A;  3EHK A;  4K8F A;  1HKD A;  1APN A;  2D40 A;  4G9S B;  5F9T A;  1W2T A;  4UFK A;  3BTA A;  4K21 A;  4MAD A;  2WLP A;  4YW7 A;  4AWD A;  1H8T C;  3K46 A;  1WW7 A;  2VO5 A;  2Y6K A;  4AAX A;  2BQP A;  4QB6 A;  1GQG A;  5F32 A;  4R9D A;  5IVY A;  1L7Q A;  1UW8 A;  4XF4 A;  4CCL A;  4GWM A;  3J9S A;  4Q4W 1;  5JSP A;  4IE7 A;  4IEV A;  4QU2 A;  5FLI A;  2XVK A;  3SHR A;  2HWF 1;  4RR3 C;  3AP4 A;  4O9G A;  4NUB A;  1JMU B;  1UZ0 A;  3ZXA C;  1W39 A;  1Y7B A;  1O91 A;  4QB1 A;  3E6C C;  1ULF A;  2UWB A;  1PX4 A;  2VOW A;  3UYJ A;  3EQE A;  1O59 A;  4FFH A;  4XJA A;  4BE3 A;  5G05 L;  3T30 A;  4XQ4 A;  1ZBE 1;  2YXS A;  5ANN A;  2SLI A;  2VNO A;  3POF A;  5CVR A;  2UYA A;  3JB8 A;  4GA9 A;  2H0B A;  1FAT A;  2WAO A;  4MGY E;  5FKB A;  2Q8O A;  3O0V A;  3ZFF A;  5L19 A;  4LBO A;  4EN0 A;  5FY5 A;  4I02 A;  1ACC A;  2DU0 A;  3BGA A;  2AUY A;  1F8V A;  3DF0 A;  1O8S A;  1G9A A;  1HXS 3;  5DZG A;  2RS1 2;  3N7M A;  3NNM A;  4QB2 A;  1HRV 2;  1NXM A;  1UY1 A;  2VVF A;  5I8Y A;  5KWR A;  3R6S A;  1NQJ A;  3ZYG A;  3FLP A;  3A4U A;  4S2F A;  3AP7 A;  3KCC A;  4FOY A;  4C91 A;  5FK8 A;  5FZF A;  3RJR A;  3S7I A;  1MEC 1;  3ZFE B;  4MZU A;  4K6B A;  2IVI B;  3BUC A;  3FBM A;  1OT5 A;  1O5L A;  1RHI 1;  2OPK A;  4KG8 A;  4LLF A;  4D94 A;  3BAL A;  2AEY A;  2ZTN A;  4UFH A;  1CGP A;  5FZE A;  3V0B B;  4Q0V A;  2E31 A;  3DKW A;  3JD7 1;  3OCP A;  4DZG A;  2E7Q A;  3OOX A;  4PDW A;  4QDR A;  3OTF A;  1Q5O A;  2A1X A;  2GNT A;  3VBU B;  1ZZB A;  1ST8 A;  5BNP C;  3JBG 2;  4AVV A;  4CCK A;  1UZY A;  1O7F A;  1PMH X;  1AL2 1;  5C3R A;  5F37 A;  3OG2 A;  3ACG A;  3C7H A;  3U37 A;  4CUC A;  5A7S A;  2WO3 A;  3KT1 A;  4F8A A;  3WP4 A;  2G9F A;  1ZZ7 A;  2GH2 A;  4AI9 A;  3WQB A;  1NCR B;  1OSG A;  1MR5 A;  2CY6 A;  2R06 3;  4NHL A;  1YO8 A;  1DF0 A;  1BKZ A;  2ILM A;  3UL2 A;  1GP5 A;  1TEI A;  2VQT A;  4CXY A;  3TNQ A;  5AVP A;  3CZJ A;  2Y0I A;  5J7M A;  4ATE A;  1SBD A;  1VBC 1;  3B9I A;  5FYV A;  4QX1 A;  2BGC A;  4CP1 A;  1CPM A;  3VZO A;  4YVW C;  1Z7S 2;  1JTZ X;  1OOP A;  1W99 A;  3CL1 A;  4JKK A;  2XDV A;  4BQW A;  4BQ4 A;  3K4Z A;  4P9Y A;  5GZG A;  1V6O A;  4YW5 A;  2ZGS A;  4P9G A;  5BNQ A;  5GZF A;  3VBU C;  5IAX A;  5CFC B;  1Y9Q A;  3AYC A;  4RHV 2;  3IPV A;  4X6R B;  1S2B A;  3VKM A;  4L92 A;  5LEJ A;  1NE4 A;  2BEO A;  5I93 A;  3OBA A;  3KGZ A;  4NOT A;  4IV3 A;  1GWL A;  1XYN A;  4JCK A;  2AEZ A;  2YU1 A;  3ALQ A;  5FZ3 A;  3M3O A;  5A7W B;  5GM0 A;  1A34 A;  3JZV A;  1XRU A;  4Q4V 1;  1NCR C;  2PLV 3;  4Y4R A;  1YQ6 A;  5JLV A;  3LA7 A;  2Z79 A;  4NJ4 A;  2IFW A;  4Y24 A;  3AX4 A;  1UKR A;  2VPV A;  1E5S A;  2IC1 A;  4XPV A;  4JKL A;  4FVV A;  3WW2 A;  4L0P A;  4URA A;  3I3M A;  1F2N A;  5LCW L;  1OMI A;  1Z0H A;  5AFE A;  1C8M 1;  1OKO A;  3QD6 A;  4OLL A;  5C9A B;  3FL7 A;  5JXH A;  4YSF A;  3WDX A;  3ZYF A;  2YFU A;  1RUD 2;  3PHM A;  1SBE A;  3BPS A;  5CU1 A;  3T1L A;  5CFC C;  4Q4X 3;  1ZRD A;  1VRH 2;  4BQ5 A;  1XYO A;  2VMF A;  3H1Y A;  3H8U A;  4WM8 C;  3NST A;  3ZDS A;  1US3 A;  1CQ9 A;  4IUG A;  1RUI 3;  4V2W A;  3IWZ A;  4FPL A;  3VV1 A;  5LBE A;  1IG0 A;  1RUC 1;  3LEG A;  2R04 1;  1UXX X;  2W94 A;  4IEU A;  4CEW A;  5C8C B;  1UD1 A;  5EV7 A;  5FYS A;  1GOG A;  2VGD A;  2XQR A;  1LGB A;  4U2A A;  3W20 A;  4E9K A;  1GBG A;  3AL6 A;  1NZC A;  1PMI A;  3GBF A;  1FPN 2;  1KJL A;  2NPI A;  1QJU 1;  3IAP A;  2J1E A;  1XSR A;  2GND A;  2OUH A;  3NRU A;  5EXO A;  5FQ0 B;  4YGD A;  3WEZ A;  1DZR A;  2W87 A;  2ZZJ A;  3N9O A;  4AFB A;  1S1A A;  5FPZ A;  1WGP A;  2WWS A;  2E53 A;  4GQ7 A;  2B5H A;  5C9A C;  1OD3 A;  3EBR A;  3H1W A;  1WCD J;  3QH6 A;  2NZ9 A;  3CBN A;  1E5I A;  3O1R A;  1UY4 A;  2VL4 A;  1YUD A;  3WNN A;  4B8E A;  5DAB A;  1HV0 A;  1NLQ A;  3CJX A;  1W9Y A;  3SCG A;  3KD4 A;  3NVC A;  5FZ8 A;  1POV 3;  2WNO A;  5LBF A;  3ZVX A;  5FPA A;  2JE7 A;  4PQ9 A;  4XDO A;  4WM7 A;  3VZN A;  4MGI E;  5FZK A;  1ZZ9 A;  5HXV A;  4CCJ A;  5C8C C;  2OKX A;  4GD4 A;  5I0U A;  3AZW A;  2DU1 A;  4CDX A;  2QZ2 A;  1UMI A;  3KHB A;  4R9C A;  1WLW A;  3J8F 1;  5A33 B;  4C90 A;  4ZON A;  4XFB A;  2VEC A;  3WVJ A;  1PM7 A;  4P9I A;  4OQ9 A;  2R1D A;  2A3X A;  2DDU A;  2JDK A;  1PNF A;  1HN1 A;  1CX4 A;  1HJG A;  3AZV A;  3C7E A;  3ITQ A;  4J25 A;  4XFI A;  2ZX4 A;  3CJI A;  4BU2 A;  3GAL A;  4HK9 A;  2JE9 A;  4HN0 A;  4ES8 A;  2G9Z A;  1MZ6 A;  1PGL 1;  4RQP B;  3POW A;  1W8W A;  4J1X A;  4WVV A;  2VD7 A;  5FP3 A;  4B4P A;  4CXW A;  3JB4 C;  4IEO A;  5F8P A;  1JZ5 A;  2NMO A;  3WW4 A;  4CDQ B;  3O12 A;  4XIK A;  5HBA A;  3IDA A;  3HD8 B;  4CXX A;  5A3N A;  2JDM A;  4HBN A;  1MQT B;  4D6S A;  5K7P A;  3H3Z A;  2BVB A;  3KQ4 B;  4X8N A;  1AR7 3;  2HH9 A;  4OUM A;  4UW3 A;  4AQ6 A;  4Z07 A;  5J98 B;  2PHW A;  4CE8 A;  2VZS A;  1F15 A;  4Y1Y A;  3D82 A;  1KGY A;  3TEZ A;  1OVS A;  1L3J A;  5LK5 A;  2Q30 A;  1ULC A;  3TEW A;  2ZMK A;  1OF4 A;  2JDU A;  2QZ3 A;  1KDM A;  1OA3 A;  3OBT A;  1UO9 A;  3AFG A;  2XKO A;  1DGR A;  1CAV B;  3B02 A;  1MZ5 A;  3NNL A;  2V4A A;  2NYY A;  3P1I A;  4YLZ A;  3O1T A;  4A6S A;  4GMP 1;  4AFD A;  4YFZ A;  4HVQ A;  5I0R A;  2XJR A;  2DFC A;  4RQP C;  1YCI A;  1EV1 3;  1B35 B;  1JZ4 A;  3W9A A;  4C8D A;  5FKC A;  1AR9 1;  4P9L A;  4XUT A;  3E5Q A;  1J59 A;  2QNK A;  2ZPX A;  2RVA A;  4AEK A;  3MIF A;  4Y1U A;  2XBO 3;  1HV1 A;  3HT1 A;  4A7Z A;  4CDQ C;  4AF9 A;  1HRI 2;  3M2M A;  5F5I A;  5DXD A;  3EXU A;  3K4A A;  3AKS A;  5C4W C;  5KXC A;  3UGG A;  2VTX A;  4KH9 A;  3LB9 A;  1UWW A;  1VBE 3;  2ZGK A;  1XNA A;  3VGI A;  4LHN A;  2HJI A;  2C9A A;  1W28 A;  1LU2 A;  1GUI A;  3ZXD A;  3N9N A;  1HB2 A;  2P2K A;  4GIQ A;  4D7T A;  4QHO A;  2LUW A;  2HWB 1;  5DUV A;  5F1R A;  4AEM A;  4C1W A;  2QQK A;  4XDQ A;  2CGN A;  4NR1 A;  1PZ8 A;  1AYM 2;  4QAW A;  4NID A;  2KXL A;  4MG2 A;  1VIW B;  1CAX A;  1SLA A;  4KL1 A;  4NRP A;  2XKP A;  3DEM A;  3RWK X;  2VVE A;  2I45 A;  1NAE A;  3MDP A;  2VW1 A;  1HW5 A;  1DLL A;  2DUQ A;  5SV5 A;  2WO7 A;  4CCN A;  4E8D A;  4N43 A;  3CLP A;  5FO8 B;  5FXW A;  4QD2 A;  2ARE A;  5C70 A;  1RUJ 1;  2WS9 2;  1QJZ A;  1VBB 2;  4DY3 A;  3GCW A;  3UGF A;  2WWU A;  3VKL A;  1J3Q A;  2FMY A;  2XJU A;  2XJS A;  5FYM A;  2I2S A;  4E2Q A;  4QDQ A;  1UIK A;  2VNG A;  4LO7 A;  1NZI A;  5DUW A;  3GHM A;  5I0T A;  5KHI A;  2WZR 2;  4M0N A;  3ZFE A;  1EPW A;  5EQU A;  4CU8 A;  4FP3 A;  5IAV A;  2OII A;  3IMN A;  2IXH A;  1JYV A;  1UNB A;  1ZRE A;  1PIV 3;  1R08 3;  2IVJ A;  1SBF A;  1W8T A;  3BN6 A;  4LKE A;  5I0D A;  2W0X A;  3ROU A;  2TBV A;  3WG1 A;  4PJY A;  2D3R A;  4HXC A;  1LHV A;  4B7E A;  4JRA A;  4AFA A;  4XJU A;  2B7Y A;  3FUO A;  2P4E A;  4LOS A;  4YM0 A;  2YBK A;  4YW4 A;  5BXX A;  3DKQ A;  1WA6 X;  3NNG A;  2JG9 B;  3PUR A;  1PK6 A;  1DP0 A;  2XLG A;  1BYH A;  3MFA A;  3HNY M;  3JU9 A;  4QDS A;  4BM8 A;  3CIH A;  5GLZ A;  1VBA 3;  1W05 A;  1NCR A;  2BNN A;  2FDI A;  4CDU B;  2XUE A;  4FTS A;  2RS3 2;  5BY5 A;  3CZU A;  2ZKL A;  4Y5Z 0;  1U5Z A;  3TN9 3;  3WF0 A;  3R4U A;  3PVN A;  1T6G C;  3FWE A;  2VNV A;  2AEN A;  1NA1 B;  3RRD A;  1REE A;  1F4H A;  1ULG A;  4XFH A;  5FYY A;  4YZ1 A;  2WIN B;  1WCU A;  3MW3 A;  1SHW B;  2VMC A;  3MLJ A;  4MGS A;  4OHX A;  3J4U H;  2EAK A;  4LBM A;  4MHR A;  2W3J A;  1V9U 2;  1LOE A;  5FZ1 A;  4A6O A;  4LUM A;  3U0Z A;  3N9L A;  1VRB A;  2LTN A;  4ZU4 A;  2PHX A;  5LRR A;  1BZW A;  4YM3 A;  3O0X A;  1TE1 B;  3N4M A;  5CB7 A;  1JZ6 A;  1FMD 2;  3ECQ A;  2XWB B;  1EYB A;  1UQX A;  1K5M C;  1LOB A;  2JG9 C;  2BW8 A;  2XJQ A;  2W08 A;  2VH9 A;  2FDJ A;  2QQJ A;  3ZLI A;  4H2A A;  1RUE 3;  4A3Z A;  2YB7 A;  1KDK A;  1H6Y A;  5KHG A;  1F31 A;  3H3U A;  4AFM A;  3K3N A;  4XCA A;  4CDU C;  3AZY A;  3FLR A;  1DGR N;  4O7X A;  1DYP A;  4LUK A;  4N90 A;  4LE3 A;  1FOD 2;  3ZKU A;  5C3O A;  2E6V A;  1UY0 A;  1O5U A;  2PYT A;  4XJW A;  1NA1 C;  5DMY A;  1VPH A;  1IGO A;  4YG3 A;  4Q8L A;  4ASK A;  1C57 A;  2PA7 A;  3OPT A;  1RMU 3;  1FT9 A;  3C3V A;  1I1E A;  2VTF A;  2JJ6 A;  3HJR A;  4FPG A;  3N7L A;  4K1Y A;  1W03 A;  5C9A A;  2PTM A;  4JGZ C;  2RR1 2;  3HNB M;  5T54 A;  1LNS A;  2QQU A;  4OHW A;  4RGG A;  1OFN A;  3ZYH A;  1KIT A;  1HQW A;  1PVC 2;  3IBM A;  3SIS A;  1WLT A;  1U5I A;  5F5A A;  1QF3 A;  1JZ3 A;  4FSJ A;  5FZ9 A;  2VE1 A;  2WII B;  1FV3 A;  2WR9 A;  3H9A A;  1ZRF A;  4IEP A;  1W90 A;  2RS5 2;  1UF2 C;  5F5Q A;  3I49 A;  1V0A A;  2D6M A;  2R06 1;  2WWJ A;  4YPJ A;  4BDV B;  4K1Z A;  4ZXK A;  2QQI A;  5IVF A;  1AYN 2;  5FYB A;  1ULP A;  1KEX A;  5C8C A;  2BUK A;  1SLB A;  2KD7 A;  4QXB A;  5FLJ A;  5AC9 2;  4ZZ8 A;  2EF6 A;  2EXK A;  1QNY A;  2WQZ C;  2B42 B;  2GME A;  3DPR B;  4Y26 A;  2B46 X;  3TBD A;  4PBO A;  4LBL A;  3T09 A;  4YW2 A;  5FQ0 A;  3GJB A;  2RDN A;  1ULE A;  1Y43 B;  4MX3 A;  1X8M A;  1X7N A;  4HOO A;  2ZHM A;  4UFJ A;  1YHF A;  5GJ6 A;  2Z69 A;  3BIE A;  1C4R A;  3BTZ A;  1ZNP A;  4ASM B;  1BEV 1;  3R0R A;  4P08 A;  3VZK A;  4YZ2 A;  2VXJ A;  1C8N A;  2EIB A;  5I8S A;  2ZGN A;  2J1R A;  4KWU A;  2W5F A;  5FUI A;  1SLI A;  1RXG A;  1SZB A;  2OX0 A;  3POI A;  2X8K A;  5DZE A;  1CAU B;  4Q4W 2;  5CAZ A;  3VBH C;  3ZSE A;  3RQ0 A;  2VW0 A;  4UW4 A;  1D4M 2;  5FY7 A;  1XB9 A;  1OLM A;  2ZGU A;  1QU0 A;  3C2U A;  3GBW A;  5SV8 A;  1VBD 3;  2GAU A;  3ZXE A;  5F6K A;  4QX0 A;  1VAM A;  1UX6 A;  3MLK A;  3PL0 A;  4ERO A;  1CD3 G;  2YHJ A;  3NJX A;  5I91 A;  2JKX A;  1UAI A;  3S5Q A;  2IWG B;  3DPR C;  5T55 A;  3WF4 A;  2DYC A;  3ZYB A;  4I0A A;  4Y20 B;  2Y34 A;  2PHR A;  3N36 A;  5HI0 A;  3H7Y A;  3NV2 A;  3MV0 1;  1I6X A;  3LDK A;  1TVG A;  1YJK A;  4FPO B;  5EHD A;  1JN2 P;  2JD9 A;  2WC2 A;  4OZX A;  1FX5 A;  4UI9 L;  2YYO A;  2RJK A;  4RQP A;  1NOV A;  5KC6 A;  4FFI A;  1QQP 1;  1KJR A;  1XU1 A;  4WVW A;  1RUI 1;  2J1V A;  1I3H A;  3NQH A;  4JGY C;  2JDN A;  1LES A;  2WQ4 A;  2XML A;  3GHN A;  1QDO A;  3OUH A;  4LEJ A;  4QPI C;  4XXP A;  5A7O A;  3WHU A;  4CDQ A;  4XUQ A;  2WN3 A;  3OEB A;  1MQT A;  1FV2 A;  1TQ5 A;  1XSQ A;  2OQ7 A;  3EB7 A;  4ORF A;  3IM0 A;  4MVT A;  5FWJ A;  5FZ7 A;  2ZXQ A;  4UWD A;  1AX0 A;  4AFC A;  1LKN A;  1TME 1;  1GQH A;  1RHI 2;  3N7K A;  4ZY9 A;  2PAM A;  1W6Q A;  2ATF A;  3I2F A;  1HB1 A;  4M0H A;  2SBA A;  1PX3 A;  2XJP A;  2ZEX A;  1R1A 1;  4KBB A;  5IWF A;  4BH9 A;  3FHI B;  1G9D A;  2VZ3 A;  4RD7 A;  3NMB A;  4WVM B;  4XUN A;  1CAV A;  1UMZ A;  4UF0 B;  4CVU A;  3ZO0 B;  1SFN A;  5APA A;  1AL2 2;  1LJ7 A;  3OYW B;  4PHZ A;  4O65 A;  2PHL A;  2JEC A;  4DPN A;  2JE8 A;  4CP9 A;  2HWE 3;  2DVF A;  1B35 A;  2QQM A;  4UW6 A;  5LRS A;  4UXA A;  5LY2 A;  5F3I A;  4GUL A;  5FPB A;  1POV 1;  4MUV A;  1GAN A;  4XVH A;  2B9V A;  3L9J T;  1LOA A;  3RGB A;  1F35 A;  1X50 A;  4N7U A;  1LOC A;  4XF3 A;  3M3E A;  5FMB A;  3F2Z A;  3N3H A;  1F4A A;  1W3V A;  1YQC A;  3WIN E;  1QXR A;  2MHF A;  3CO2 A;  3GGL A;  2O1Q A;  3HR9 A;  5FMC A;  3VHO A;  2G19 A;  1MS4 A;  3WZ1 A;  4UFL A;  4JQT A;  5J3U A;  1VBC 2;  1IPJ A;  2VZQ A;  5DAQ A;  5C33 A;  5JWP A;  4ONU A;  2D3P A;  1BK0 A;  2IXK A;  2BU9 A;  2TNF A;  3VBO B;  3VBR B;  2W1Q A;  3FHQ A;  4MYE A;  3MID A;  2JKB A;  4MLO A;  1E5R A;  1HRV 3;  3G6J B;  2ZGQ A;  1W8H A;  1LAJ A;  5FYZ A;  4XJ9 A;  1XYP A;  2IXJ A;  1N47 A;  3D5O A;  3IAQ A;  5LA0 A;  3CNA A;  4AE2 A;  3JQW A;  5IK8 A;  5FFO C;  2DUR A;  4P02 B;  1OD5 A;  2QQW A;  2C4X A;  4W6X A;  3RZH A;  3THT A;  2B8M A;  1ND3 C;  3KZ4 C;  4G4F A;  1G6N A;  1NX9 A;  2HEY F;  2YRO A;  3C7G A;  3MGU A;  3M3C A;  4P14 A;  4E4D X;  4DIN B;  4QX7 A;  4A2U A;  4BZ4 A;  1ZX5 A;  2R07 1;  1S0I A;  4HT1 T;  1GZW A;  2A75 A;  1EP0 A;  3I2I A;  3AP5 A;  4QKD A;  4EN6 B;  2E51 A;  4K9S A;  3AMH A;  4CU6 A;  2OS2 A;  5LK7 B;  1QJX 1;  1PGW 2;  1J58 A;  3DEC A;  3VDD B;  4NIA A;  4H55 A;  1F9K A;  4NPL A;  4UW5 A;  1LR5 A;  2WNV B;  4TXW A;  3Q8F A;  1W2A X;  4JDN A;  4DXS A;  3W5N A;  1XQN A;  2K0G A;  3IMM A;  5KXD A;  2DVA A;  4OMD A;  1YEW A;  3CDZ B;  4IET A;  3VBR C;  3VL8 A;  3B7M A;  1EY2 A;  1CJD A;  1FAY A;  1SAC A;  4FPC A;  3VBS A;  3WNM A;  1BBT 2;  4AGV A;  2J22 A;  1C8M 2;  2Y6L A;  1V6I A;  3RYR A;  1H8T B;  4CDW B;  2C9K A;  3ZSM A;  1LEM A;  4XJZ A;  2A3W A;  3AXE A;  3WLU A;  3AP9 A;  3RG0 A;  3WG4 A;  3A0K A;  3POG A;  4QXC A;  1U0A A;  4HKO A;  3USS A;  5ABJ B;  3Q8A A;  4FFF A;  3ACI A;  1EAH 1;  2PQQ A;  5EJ1 B;  5IK4 A;  3UJQ A;  2W2I A;  1W8U A;  5FPU A;  4CTE A;  3H8X A;  1SLT A;  2B39 A;  3LE0 A;  4FCA A;  4XTP A;  1FXZ A;  1OH3 A;  4GJZ A;  4ISR A;  4LKS A;  3U4X A;  1CES A;  2BGO A;  4RR3 B;  1Z7S 3;  1RUC 2;  3GNE A;  4Q0S A;  1VBE 1;  4IE5 A;  4ZU5 A;  3SH4 A;  2QQO A;  1PO1 2;  4DMI A;  4LQR A;  4CDU A;  3KCY A;  5JDB A;  3O5S A;  4RHV 3;  3URF A;  4FTB A;  2Q1M A;  2ZEW A;  3GZT B;  4LXL A;  1QJU 2;  2CSG A;  4ZS2 A;  1DQ2 A;  1JOD A;  1WA4 A;  3APB A;  4D69 A;  2J1U A;  2VM9 A;  3ZYR A;  2QKD A;  1F5J A;  1CPN A;  1V6M A;  2WZ8 A;  1CVN A;  2WSV A;  4R4Z A;  4I01 A;  4BIO A;  4CDW C;  5H9Q A;  1OC1 A;  2RM2 2;  2MPF A;  4YAR A;  1IS3 A;  5LA9 A;  4LO6 B;  4QX5 A;  5GKA C;  5FZD A;  5ABJ C;  5FZ0 A;  2WJS A;  4RFR B;  1JHN A;  2NM1 A;  4QXH A;  1CZT A;  2YU2 A;  1ENX A;  3T4V A;  2VUC A;  4C0B A;  4QX8 A;  4QPW A;  4HKW A;  2W1U A;  1SEF A;  3V0A B;  2W39 A;  4XBQ A;  1GLH A;  5FP7 A;  2DCT A;  1H2K A;  1JOJ A;  1H30 A;  3K75 B;  2P6H A;  1A8D A;  3J8F 2;  4BQX A;  1YI7 A;  5IFP A;  1VRH 3;  1V70 A;  5JMC A;  2BBV A;  3MBW A;  3I3D A;  2BV4 A;  2BNM A;  2R7E B;  3RYK A;  2FDF A;  1O8P A;  3MFC A;  2WO1 A;  2VUL A;  1JZ8 A;  5BNP B;  5JZG B;  4A42 A;  4QQ2 A;  5KC5 A;  3OEA A;  4WZF A;  2D93 A;  1AVB A;  3I2H A;  4QQP A;  4KGG A;  1PGL 2;  1TG7 A;  5K9Y A;  1QJY 1;  3GJA A;  2DUO A;  2VCM A;  4W6Y A;  1COV 1;  5A3P A;  2ZEY A;  3I59 B;  4XDP A;  3LOB A;  2CAV A;  4OCT A;  2JDA A;  3AC0 A;  3CKH A;  3ES1 A;  5FYI A;  3WNX A;  4DY5 A;  2R30 A;  1FPN 3;  2ZGM A;  1EUU A;  4AR2 A;  5D8A C;  2A73 B;  2WDB A;  3RI8 A;  1GU3 A;  2VMG A;  3CU7 A;  2VTX J;  3HPN A;  3PVB B;  4XBN A;  5DUX A;  4CP0 A;  5FZB A;  4S2D A;  5HCB A;  5CFD A;  4IV1 C;  4BLI A;  5JSO A;  3JXS A;  5DDJ 1;  2ZJC A;  3W5M A;  2CAU A;  2P3K A;  4AI1 A;  4YVW B;  4IGQ A;  1OFS A;  2VZR A;  4DUV A;  1ENS A;  4UOJ A;  3AJY A;  3DPR A;  1JYC A;  1UZV A;  1TMF 1;  2HWD 1;  5JZG C;  3AB0 A;  4D7S A;  2P3Y A;  4W4Z A;  5A3U A;  3ZR5 A;  3S6P A;  1GKB A;  3ZIW A;  2D6O X;  4BCU A;  2CHH A;  3M3Q A;  3WP3 A;  1RUN A;  3N9P A;  4M3C B;  2QFE A;  3RS6 A;  4WV8 A;  1RUE 1;  1AXZ A;  1OI6 A;  4QKF A;  4QQL A;  2W47 A;  3WDW A;  4A4A A;  2UWC A;  4F3J A;  1OLR A;  4E2S A;  1S0F A;  4K20 A;  2D6L X;  2ZAB A;  2ADE A;  1CAU A;  2NLR A;  4A7K A;  1OVP A;  4LBN A;  3LFI A;  2GNB A;  2YG0 A;  2Y26 A;  2EIC A;  1SFY A;  3H8R A;  2EIG A;  5EFU A;  3ZFG B;  2XHK A;  3UGH A;  3MPB A;  4Q1P A;  4GWJ A;  1W8N A;  5FY4 A;  3VHN A;  1AR6 2;  1JH5 A;  1UZW A;  3FBY A;  4Q0Q A;  1JZ2 A;  3B94 A;  3VBF C;  1DYO A;  1WD4 A;  2YGM A;  2W1S A;  3K4D A;  5FZM A;  3S30 A;  4ZS3 A;  5C5T A;  5F3C A;  1FNY A;  1LHO A;  1ZZ6 A;  2WQ8 A;  4K40 A;  4Y20 A;  4CCE A;  3RJ2 X;  3NJV A;  1BVV A;  3HOB A;  4WM8 B;  1MS0 A;  3BYW A;  2DTW A;  2ZEZ A;  1ZRI A;  1JXN A;  1NLR A;  1XNT A;  3H0O A;  3NV4 A;  3PME A;  3Q8C A;  3LD8 A;  3SCF A;  1HQL A;  2QBX A;  2WN2 A;  3H42 B;  3RVH A;  2WRA A;  5GZE A;  1W6M B;  3MF9 A;  1PNG A;  4DUX A;  4P00 B;  4KQ7 A;  5J37 A;  2X09 A;  1RUJ 2;  4ISQ A;  4NAM A;  2ORZ A;  1RGS A;  2RMU 2;  2PMW B;  1HB3 A;  2GMM A;  4JV4 A;  1RIT A;  4L97 A;  3H8O A;  1N3P A;  2BOJ A;  1YIF A;  3FE5 A;  1QDC A;  1VB2 A;  5AVA A;  4DXT A;  2AYH A;  3NWK A;  3SLI A;  1ZBA 2;  3OUI A;  2DCY A;  1M4W A;  3PJY A;  5FLH A;  3ZFG C;  2MEV 2;  2WO2 A;  2VME A;  3BPZ A;  3ZSK A;  3LDR A;  1VE0 A;  1WUV A;  4TN7 A;  5FY0 A;  5ACA 2;  2ZHL A;  1HRI 3;  3VKF C;  2ZX2 A;  2FHR A;  5F2S A;  3SEP A;  1WD3 A;  5E6H A;  3VZL A;  3O1M A;  4MGT A;  2ZGL A;  2JEM A;  2EAA A;  2BFU S;  4WVM A;  3BU0 A;  5FP9 A;  4UF0 A;  2O0O A;  5DQ0 A;  4CU9 A;  3BTY A;  4NRM A;  3P5B A;  2EXI A;  3OYW A;  5A7Q A;  3FC0 A;  4XFG A;  1G7Y A;  1BVP 1;  4IEY A;  1OUR A;  5T5L A;  1J1T A;  2VXR A;  3UKN A;  4FI9 A;  3KT4 A;  1AYM 3;  4JDM A;  1RXF A;  1VBD 1;  3ZMO A;  4IXL A;  5E89 A;  1KXG A;  1WCK A;  1RUG 1;  1RC6 A;  1J3R A;  4R8H A;  2WAB A;  5LZ6 A;  1RUF 1;  4D6R A;  1T6B X;  3LEM A;  1G86 A;  2JX9 A;  1JU4 A;  2WUH A;  4IL7 A;  1PO2 1;  2JG8 A;  5GLT A;  3TWI A;  3VBO A;  3VBR A;  4NRO A;  3LEI A;  1IOA A;  2WS9 3;  2VCC A;  1VBB 3;  3C7O A;  4I09 A;  4YVS B;  3ZXL A;  2QQN A;  4DOU A;  3LF7 A;  5A70 A;  4E4S A;  4GH4 B;  4D7Y A;  5JXG A;  4Y5S A;  4Q2F A;  5C71 A;  3N9M A;  5B4N A;  1Y9G A;  3GXU A;  3I3E A;  1PZ9 A;  2WZR 3;  4A41 A;  1SMV A;  3LA2 A;  1J3P A;  3W59 A;  2E63 A;  2WLQ A;  1N1Y A;  2AH2 A;  5EJ3 A;  1KFU L;  3B69 A;  3HBZ A;  1CIY A;  1IQA A;  4ZKT B;  2XB6 C;  1QMJ A;  5JXI A;  4A3X A;  2I07 B;  5FRA A;  1RVF 3;  3VDD A;  1IPS A;  5FWE A;  4XAB A;  2WNV A;  3MF6 A;  5LBB A;  5FMO S;  1ASJ 3;  2BOI A;  3I2D A;  1VB4 A;  3HT2 A;  4KNC A;  4N9I A;  4AVT A;  1IS6 A;  1RJ7 A;  1U12 A;  4AGR A;  1GOF A;  1OQD A;  3N7J A;  4NPM A;  2FDG A;  2W9X A;  2WNU C;  4YVS C;  1D0G A;  4DRV A;  1GMM A;  2Q0A A;  3WG3 A;  4GH4 C;  3PLQ A;  1H8T A;  4AHW A;  4CDW A;  1IQD C;  1SLC A;  2LRO A;  2Y6G A;  3OGS A;  3T3Y A;  2RS3 3;  2HWE 1;  4EN8 B;  5FR3 A;  4GMP 0;  2BZD A;  4E4H A;  1RB8 G;  5ABJ A;  1M06 G;  4B4R A;  5C4W B;  4JVA A;  2E32 A;  1NCQ B;  2ZGP A;  5JPM B;  4QGN A;  2EIE A;  3AMM A;  4BHP A;  1DFQ A;  4RR3 A;  5IAT A;  5J36 A;  1V9U 3;  4O9E A;  2BDR A;  3I3Q A;  4AGG A;  4GAZ A;  1U5Y A;  1FYU A;  4JAA A;  1W9S A;  2WBK A;  3OGJ A;  4M4R A;  4UFM A;  3IDE A;  5F5C A;  4GB3 1;  4KU7 A;  3SQO A;  3UT0 A;  4YG6 A;  5KHK A;  3DL3 A;  1F5F A;  1FMD 3;  3KCX A;  4QT6 A;  4BQ2 A;  4QHB A;  3H1M A;  3O1S A;  4NIG A;  4HVO A;  4K8R B;  1BJQ A;  1JU3 A;  3IDB B;  4NVP A;  3TNP B;  3F95 A;  3LIH A;  4M4P A;  4Y3O A;  4XCB A;  4DXR A;  5CKM A;  1VAK A;  1ZRC A;  3B00 A;  3BCW A;  5A6X A;  4YG0 A;  1GZT A;  4IE0 A;  4WVZ A;  1BEV 2;  3PIJ A;  4LO5 B;  5TSW A;  2A3Y A;  2GU9 A;  2Q1Z B;  5FY1 A;  5K0U C;  1FOD 3;  5LAS A;  2GC3 A;  3AYE A;  1S55 A;  3U11 A;  3POY A;  3VN4 A;  2XVL A;  4KWL A;  4EJR A;  5FYU A;  1NCQ C;  3HVD A;  2VOT A;  4XBL A;  3HMY A;  4OHY A;  3ZXJ A;  4O61 A;  1QH7 A;  3V0A A;  3KV9 A;  1O4Y A;  4QX3 A;  4COY A;  2X53 S;  2RV9 A;  3NAP B;  2RR1 3;  2IXL A;  2HWC 1;  3HN1 A;  4HAN A;  5IFT A;  2D3S A;  1PVC 3;  1UKG A;  1IKP A;  1QY4 A;  2ARA A;  4JDO A;  3AYD A;  4CU7 A;  4LA3 A;  4H3W A;  4UBH A;  2P37 A;  5J48 A;  5J1X A;  4XQW A;  2RS5 3;  3T0A A;  4BIF A;  5EIY B;  4LMF A;  5BNP A;  5JZG A;  1NKG A;  2R1B A;  5FZI A;  3SXW A;  2WFF 3;  4NHY A;  1RUH 1;  2WYF A;  4IW3 A;  4LA2 A;  4B4Q A;  3UET A;  1W8O A;  1XE7 A;  1Q56 A;  1QQP 2;  2X5I B;  1GZC A;  4PLO A;  5AC9 3;  3JCI A;  1RUI 2;  3I59 A;  4I3P A;  1AJK A;  4V1P A;  3AJZ A;  3S7E A;  4EQV A;  5FO9 B;  2CGO A;  2D97 A;  2PXJ A;  2IUW A;  3MLL A;  3POE A;  4BWO A;  4CEY C;  1L7L A;  1CN1 A;  4PQQ A;  1S2E A;  5FXX A;  3DXU A;  2HLE A;  4FPY A;  2HYX A;  4C0H A;  1NQD A;  4HSL A;  1GZ9 A;  5FJH A;  4Q4Y 1;  4RHV 1;  3WG2 A;  1AR8 3;  1SQ4 A;  2VZV A;  4CZS A;  3NAP C;  1TME 2;  4P9X A;  3WNK A;  3D4K A;  4HPK B;  1ODN A;  4YVW A;  4LJH A;  4OMC A;  1R09 2;  5GZC A;  4RSU A;  3V0B A;  3ACF A;  1R1A 2;  1AHS A;  1UPI A;  1J1L A;  4MET A;  2YC4 A;  1W0P A;  4Q4W 3;  3VBU A;  4CCD A;  5ANQ A;  5FV3 A;  1D4M 3;  5F7U A;  5H9S A;  3RI9 A;  1K5M B;  5FIX A;  1NYW A;  3M70 A;  3OPW A;  4XAC A;  2A5Z A;  1MS8 A;  5F6L B;  2AZ5 A;  2GC0 A;  2X5I C;  4LOR A;  4Y22 B;  4XXA A;  4ZPI A;  3UKV A;  4M3C A;  3ZN4 A;  4AZZ A;  2OXB A;  2OZ6 A;  3WCS A;  2CYF A;  1N1S A;  4URT A;  5FK7 A;  3L2H A;  3VZM A;  4EN7 B;  3A0N A;  2ZAC A;  1AF9 A;  2YDE A;  1V6L A;  1S0G A;  5DAP A;  4CPB D;  4AVC A;  4MXW B;  1OXC A;  4CCM A;  3PUH A;  1Q43 A;  1DZQ A;  1UN1 A;  3WP6 A;  3U75 A;  1VRH 1;  5A3L A;  1K45 A;  3MUY 1;  1UPS A;  1ZM1 A;  2B45 X;  2WZE A;  2ID4 A;  4YZ4 A;  5L9V A;  1URX A;  4XTM A;  1JZ7 A;  3FUQ A;  3LSD A;  4LBQ B;  2VMD A;  4LO8 A;  2VMI A;  1NXD 1;  4ES9 A;  1DCS A;  2VW2 A;  1TNF A;  2RDR A;  4JGZ B;  5T5O A;  1MZF A;  5M0T A;  3NKT A;  1SFP A;  4Z1V A;  3T2O A;  3GZA A;  1US2 A;  5FAX A;  4AG4 A;  4I0W B;  3WNP A;  5CFC A;  3KVA A;  3III A;  1HXS 1;  4WM8 A;  5FUP A;  5F2W A;  3BOW A;  2YUE A;  1B09 A;  2C5D A;  5KXB A;  1ZVF A;  2ARB A;  5CIS A;  5KHJ A;  1OQE A;  4Y33 A;  1RHI 3;  5ERL A;  2A6Z A;  1W6M A;  2R07 2;  4XF1 A;  5A7W A;  2ZML A;  1DHK B;  4Q29 A;  3WUC A;  1QJX 2;  4BLJ A;  1WCS A;  2YBS A;  1WMD A;  4IGP A;  1ONA A;  1Q8Q A;  1HJF A;  1DZT A;  1UY3 A;  2BRT A;  4AI8 A;  1TNR A;  3D3A A;  2FQP A;  1AL2 3;  1MS5 A;  1UU6 A;  5FPV A;  5FXV A;  1UU5 A;  4YGE A;  1BHG A;  1KS4 A;  4PIY A;  4UFI A;  3WF1 A;  2XGX A;  3W58 A;  3O0W A;  3ILN A;  4MGQ A;  5CFD B;  1OPO A;  1GQP A;  2ARC A;  4CUB A;  4DIQ A;  4ZU7 A;  1DQ5 A;  4AED B;  4COV A;  4EYU A;  3SH5 A;  5A1L A;  2JXA A;  4SLI A;  2OYZ A;  1YQ2 A;  2FCT A;  1D4V B;  3PUQ A;  1EAH 2;  2C26 A;  3WF2 A;  3HQR A;  3S5A A;  4NO4 A;  4M01 A;  1D0H A;  2OQ6 A;  3H7J A;  1VBC 3;  2RG4 A;  3VBH B;  3QLQ A;  1TZO A;  3KSC A;  5FCC A;  4AI0 A;  1JYW A;  3S57 A;  1AUY A;  4HN1 A;  1RIR A;  1W8Z A;  3T2P A;  1VBE 2;  1LHW A;  2ZA9 A;  2RJ2 A;  4XUR A;  1KRI A;  3R4D B;  4QKB A;  1W0N A;  1GFF 2;  1G8W A;  4NAO A;  2HEV F;  3PJQ A;  2UUR A;  5A3T A;  4RGA A;  1S0C A;  2ZMN A;  5KXE A;  3I54 A;  4XHX A;  3FFZ A;  2TUN A;  4OVE A;  2A6X A;  4NII A;  3WCR A;  3M4F A;  5JOZ A;  5EYX A;  1JUI A;  1SDD B;  5LA1 A;  3LKJ A;  4AL9 A;  5CFD C;  4R9B A;  2ZZQ A;  4GZ9 A;  4XET A;  1GYK A;  4I0B A;  1UX7 A;  3ABZ A;  3PTY A;  3QBQ A;  1ZA7 A;  2Y60 A;  4XFA A;  4YVS A;  4AED C;  3RYP A;  2P5B A;  3AVS A;  5JOW A;  5LWB A;  2OZJ A;  4GH4 A;  4L9B A;  1ENQ A;  1GOH A;  2D6N A;  3VB9 A;  4GXL A;  4E4Z A;  4EZ4 A;  4JGY B;  4COW A;  1WLD A;  3PVO A;  1KD7 A;  1YI9 A;  2PHD A;  4QPI B;  2PLV 1;  3ON7 A;  1KS5 A;  3OD0 A;  2PAK A;  3Q8E A;  4Z2A A;  3POB A;  4IER A;  5BUV A;  3NW4 A;  2HWF 2;  3UES A;  4BXF A;  1V6J A;  1BBT 3;  3I7D A;  1D7P M;  1OLM E;  1Y4W A;  1C8M 3;  1BK1 A;  3ZFF C;  2BP6 A;  1XU2 A;  2PHT A;  4S2G A;  2JIJ A;  4TLF A;  5A33 A;  1MVE A;  1W2U A;  1HLC A;  2DCJ A;  2Y0O A;  1ZBE 2;  1H6X A;  1OF3 A;  2E26 A;  1DIW A;  4LBJ A;  2VUA A;  5JI9 A;  2WYS A;  2DCZ A;  4L8Q A;  4FPF A;  4Q1R A;  3VL9 A;  2VCB A;  3D6E A;  3O1U A;  1H4H A;  1DQ6 A;  2VZ1 A;  4Q4X 1;  1Y9M A;  5HPO A;  5L7O B;  4TLG A;  3HBK A;  5EYY A;  2XUM A;  1WME A;  5D1I A;  4HON A;  1QJY 2;  1PO1 3;  3WHT A;  1COV 2;  3FFQ A;  1XND A;  4DFS A;  3KM5 A;  1QGL A;  3U78 A;  4LOT A;  3E5U A;  5IVV A;  4YFW A;  3VDC A;  3LDB A;  4XC9 A;  1BLZ A;  5IJR A;  3WP5 A;  5E16 A;  5CA6 A;  1QJU 3;  5FRE A;  4XMI A;  4PDW C;  4Z82 A;  4MSV A;  5A7P A;  5C4W A;  2Y6J A;  4X6Q B;  1MEC 2;  4D3W A;  2C1F A;  2XJV A;  4QQH A;  1YFW A;  5FZH A;  5A3M A;  3D8C A;  5DDJ 2;  3IPV B;  1E57 A;  2GZW A;  3RWN A;  2RE9 A;  2VQ0 A;  4QHZ A;  2RM2 3;  1QXP A;  3VKO A;  4W6W A;  3WQ1 A;  1G9B A;  4OI2 A;  3JD7 2;  4AXO A;  2MNG A;  3WUD A;  4LBQ D;  1LOF C;  1VBB 1;  3ASI A;  1TMF 2;  1W9W A;  2HWD 2;  2GN7 A;  5E1R A;  3DN7 A;  4OHZ A;  4I30 A;  3T4H B;  2VMH A;  5FYC A;  3AYA A;  1UZZ A;  3H3L A;  3W21 A;  4YGB A;  1LCL A;  5L7O C;  3KWV A;  4LE4 A;  1ND3 B;  4YM2 A;  2J1T A;  2G1M A;  3MIB A;  5AFB A;  5IVJ A;  1H0B A;  4AW7 A;  1R1Z A;  3RDI A;  1ZA4 A;  2O14 A;  3FHA A;  3C7F A;  3J8F 3;  3ZM8 A;  1H2N A;  5C5U A;  2ZGO A;  3MHZ A;  4JTN A;  1OOP C;  3WDV A;  1MZE A;  1GIC A;  4QPY A;  4XW3 A;  1RVF 1;  2FCU A;  1DGW X;  3QH7 A;  3TAY A;  3U1X A;  3O1O A;  2VZP A;  1XNC A;  2VG9 A;  1ASJ 1;  1LRH A;  2FZ1 A;  4NHM A;  5A6Z A;  3K2O A;  1NUK A;  1UOJ A;  2JB4 A;  2ZOE B;  3NAP A;  3BVC A;  4IQP A;  4IV3 C;  1YJL A;  2RS1 3;  3N9Q A;  3PDQ A;  1NT0 A;  3OF1 A;  4B29 A;  1UU4 A;  3N35 A;  2B4K A;  2PFW A;  4MH0 E;  1Q3E A;  2DTY A;  3TEX A;  1Q8P A;  1SDW A;  5JR7 B;  5BNO B;  1QKQ A;  4FXK B;  3KF5 A;  2ZGT A;  1GSL A;  5KHH A;  1DDL A;  4ATF A;  1LB2 A;  1C1F A;  4FP2 A;  5CYY A;  3SH3 A;  3IT8 A;  5A80 A;  3HN3 A;  3KV6 A;  4KGQ A;  2FDK A;  3ZR6 A;  3BOP A;  1AL0 G;  1KFX L;  4HG6 B;  2X5I A;  3A23 A;  5I8T A;  2WA4 A;  2PHF A;  2ZAA A;  1IG3 A;  4Q4V 2;  3T2T A;  1JOP A;  1NY7 1;  4H7L A;  1AR7 1;  1QEX A;  4QMA A;  4R9A A;  2D98 A;  4KWK A;  2Q8E A;  3LWC A;  1K42 A;  3SIT A;  3JBG 3;  5F3E A;  3C8X A;  5JVV A;  3A22 A;  3DUI A;  2WT2 A;  4GMP 3;  2Q1F A;  2UWA A;  3PVE A;  5BV6 A;  2DVD A;  1FMD 1;  3CHX A;  5K8S A;  3PU3 A;  5FP8 A;  1K3I A;  3AM2 A;  3VD9 A;  4HPK A;  4XAA A;  1OKQ A;  2VZO A;  1JHJ A;  4GJY A;  1MVQ A;  3WNO A;  2P3J A;  4CEW C;  1PMJ X;  5FZ6 A;  3AFK A;  1EV1 1;  3KVB A;  4XQD A;  5BNO C;  5J09 A;  2BJS A;  2CDO A;  4MOA A;  1REF A;  2RDQ A;  2XBO 1;  2GC1 A;  4JHZ A;  2PAE A;  2Q4S A;  1FOD 1;  2GSY A;  1K5M A;  1OH4 A;  2JG9 A;  2QJV A;  3A7Q A;  3VLB B;  3V64 A;  1AR6 3;  2GDF A;  2ZCW A;  2LAL A;  4Y22 A;  5T5J A;  4LK6 A;  1OUS A;  2R04 2;  4P9W A;  1GR3 A;  2W95 A;  4QKN A;  2KA3 A;  3MYX A;  5JSR A;  3MV1 1;  2XJT A;  4LKD A;  4XFF A;  5L73 A;  2JDZ A;  4PIZ A;  1RUG 2;  3G7D A;  2RR1 1;  1BXH A;  4F7Z A;  5KR7 A;  1VAV A;  3ZXK A;  1GNZ A;  1RUF 2;  1X82 A;  4HSJ A;  4LO4 B;  4J1W A;  4NE9 A;  2YBP A;  3ZPO A;  1NA1 A;  2ZHK A;  3MUZ 1;  1PGS A;  4AVA A;  2UU8 A;  3WY6 A;  1YQ8 A;  5FPX A;  1P8J A;  2XWJ B;  4ZXE A;  1PO2 2;  2XXZ A;  3DXT A;  2BER A;  1RUJ 3;  2OPW A;  4LBQ A;  4WM7 C;  5D2A A;  5EZW A;  3O1V A;  1QJF A;  2RMU 3;  1A8M A;  1Q8O A;  1DG6 A;  1O3R A;  2WFF 1;  2AAC A;  4JGZ A;  5T3N A;  5T50 A;  4H7M A;  3ZOI A;  4CDX C;  5KBF A;  3EO6 A;  4NRQ A;  1QJE A;  1QOT A;  1JW6 A;  4JKM A;  5AC9 1;  4NHK A;  2QUO A;  3J7N A;  2YC2 A;  5FZO B;  3BOD A;  1ZBA 3;  3JUU A;  3NV1 A;  4XZP A;  1Z78 A;  5D8A B;  2FDH A;  5GLW A;  2JB8 A;  4R4X A;  2FCV A;  2MEV 3;  1BCX A;  3WX5 A;  2ZBJ A;  1LGN A;  4IV1 B;  3CJI C;  4OYU A;  3HIF A;  3ZX7 A;  5I0S A;  2FMD A;  2Y38 A;  3MIG A;  4OFG A;  1YXW A;  2R16 A;  5ACA 3;  2RDS A;  1RUD 3;  1AR8 1;  1K5J A;  5D21 A;  1KQR A;  3VHR A;  2HEW F;  1HDK A;  1PIV 1;  1R08 1;  2WFP A;  3KMH A;  3UKT A;  5IUQ A;  3I2K A;  4AEJ A;  3O1P A;  3AKR A;  4FFG A;  1H9P A;  4QWN A;  1CZS A;  1C5H A;  1D4M 1;  1XE8 A;  3GYD A;  3J7L A;  3ORJ A;  3OGV A;  4HET A;  4PI0 A;  5FJK A;  2BPA 2;  4YNI A;  4EWD A;  2R49 A;  3HWJ A;  4AED A;  1G9C A;  3GDB A;  4L2N A;  2HWE 2;  4PCR A;  4KMQ A;  5L9R A;  1XBF A;  2BVV A;  4BQ1 A;  1QOS A;  2V72 A;  1PHM A;  2UY9 A;  4WZC A;  1VBA 1;  1W6N B;  4Q0U A;  4PF5 A;  5FBZ A;  1CZV A;  4Y5T A;  1RL3 A;  3M1H A;  3POS A;  3VBH A;  1C1L A;  3LSE A;  1WW5 A;  1CAX B;  1AX2 A;  1OA4 A;  1K12 A;  4LHS A;  4TYS A;  3TN9 1;  3ZSL A;  4UBG A;  3OBR A;  5FBJ A;  2AC1 A;  1HX6 A;  1WZX A;  4N43 B;  3P3N A;  5IT6 A;  2ZX3 A;  4FTE A;  2NQY A;  4GB3 2;  3VBF B;  3VDA A;  4AYU A;  2Y6F A;  1YFY A;  4W50 A;  4DRR A;  1RTV A;  1GWM A;  2CL2 A;  4AHX A;  4UT5 A;  2V73 A;  4RS5 B;  5A7N A;  5FZL A;  2XPJ A;  1VJ2 A;  2VUJ A;  2CWS A;  3DGT A;  3ZYJ B;  4MXV A;  3WW1 A;  3LGR A;  3PUA A;  1IS5 A;  2G9G A;  4HLT A;  3LAG A;  3WF3 A;  3B9C A;  1N1V A;  1AR9 2;  5CG9 A;  3MIC A;  4XUP A;  4OI4 A;  2YC0 A;  2XH6 A;  1S0B A;  3J7M A;  1UIJ A;  4QGM A;  1HQN A;  5FZC A;  2VUD A;  1QNW A;  4JGY A;  4QPI A;  4OUS A;  2W68 A;  2V09 A;  2XON A;  3ME2 A;  4NMI A;  2ES3 A;  1UXZ A;  3HNM A;  5JIA A;  4JZR A;  2ZKN A;  3KV4 A;  1CX1 A;  2BTV C;  4A45 A;  4FXG B;  4N53 B;  3RZK A;  3FMG A;  1G9F A;  4WBB A;  5GLV A;  2KR2 A;  2GC2 A;  1PK6 B;  2HWB 2;  2HWC 2;  2VR4 A;  4N43 C;  4YYO A;  4D0Q A;  3OY8 B;  4KU8 A;  1LHU A;  2VBD A;  1RMU 1;  3R05 A;  1POQ A;  2HBT A;  1H2L A;  2YFZ A;  3ZMN A;  2HKX A;  1CIW A;  5A3W A;  4B3N A;  2O8Q A;  4RS5 C;  2WT1 A;  4COZ A;  1LOF A;  2XQX A;  3GBG A;  3T2Q A;  3M7A A;  3BI3 A;  2FZ2 A;  3ENR A;  4HVR A;  3E1F 1;  3ZFE C;  3KQR A;  2JDH A;  3D0J A;  1UMH A;  5L7O A;  1RUH 2;  1XJA A;  5DG1 A;  5BPX A;  3ILF A;  3CQO A;  4OI0 A;  4I2O A;  2XR4 A;  4TTG A;  4CYD A;  3TEY A;  1WMF A;  3B01 A;  4MV2 A;  1IKQ A;  4N7I A;  5FXZ A;  1ZRR A;  2OUJ A;  5A6Q A;  3ETP A;  5C7G A;  4XMA A;  4EWE A;  4EN9 B;  3RZL A;  3FZ3 A;  1BMV 1;  2YV8 A;  4A44 A;  3PIG A;  1OBN A;  3MPP G;  4RA0 A;  3BB6 A;  2YY1 A;  3WXP A;  1XXN A;  2YGL A;  4Q4Y 2;  4LHL A;  4N53 C;  1NLS A;  5FDB A;  1V00 A;  1PK6 C;  4BA6 A;  1BEV 3;  2LRP A;  3OJB A;  1W3X A;  1UL9 A;  4PF1 A;  2E33 A;  1XE0 A;  2TEP A;  1QH6 A;  1H8V A;  3WV6 A;  1N3O A;  2ZAH A;  4U36 A;  3WW3 A;  5T5P A;  1UYY A;  1LUL A;  3FN9 A;  1OHF A;  1PGW 1;  2DCK A;  2J7M A;  2JIC A;  2V5Y A;  3UNP A;  4FOW A;  3ES4 A;  1W6O B;  3ZXF A;  4DB5 A;  1YRZ A;  4HFS A;  2D43 A;  4YW3 A;  4AVS A;  1C28 A;  3BIW E;  5L9B A;  1ND3 A;  3THD A;  5A32 B;  2EA7 A;  2VY0 A;  2ZHN A;  4AQS A;  4Z8B A;  4LUL A;  2F4L A;  4BOW A;  3I8T A;  3INA A;  2ET1 A;  2DV9 A;  3KS7 A;  3MO4 A;  5E8A A;  3WT3 A;  5FYT A;  2LW8 A;  3FJS A;  5HV0 A;  5FOB B;  1BBT 1;  3A21 A;  3HEI A;  4YWA A;  5JOY A;  3M8L A;  4Y4Y A;  2PN5 A;  2J1A A;  2QTW B;  4H14 A;  5LY1 A;  4PI2 A;  3BTX A;  4LIU A;  1A78 A;  5FZA A;  4GWI A;  4OHV A;  4LTA A;  1RUO A;  2A70 A;  4Q8K A;  4GWN A;  1QQP 3;  4IEQ A;  4NWV A;  2WNU B;  3WDU A;  3I4I A;  3FLT A;  3K48 A;  4W8J A;  4BIS A;  4QXK A;  5K4L A;  1MS9 A;  2EXH A;  3THC A;  3SCH A;  4F83 A;  1PO1 1;  5JOX A;  2QCS B;  5BNO A;  4TWT A;  4QGL A;  1HXS 2;  3OSD A;  2X10 A;  2FBE A;  1TME 3;  3I3B A;  1W8F A;  2A6W A;  3AMQ A;  2UY8 A;  3EMR A;  2N7G A;  4P9J A;  4CCO A;  1W6P B;  2XHN A;  2D5F A;  2W92 A;  2Q8D A;  2CGP A;  3AK0 A;  1ENR A;  3WNL A;  1R09 3;  2CWM A;  3MW2 A;  1CAW B;  4FOV A;  3MI8 A;  1R1A 3;  1WBF A;  2DBI A;  4HKL A;  2NMN A;  1VMH A;  1VMF A;  1W2O A;  2GH8 A;  4LR4 A;  4NWW A;  4QU1 A;  2BBA A;  1I5Z A;  5IYY A;  2RM2 1;  3GCX A;  1MS3 A;  5A6Y A;  4YW1 A;  1DQ1 A;  1ULD A;  2EAL A;  2DWR A;  3AZX A;  3NNJ A;  3I97 A;  5EPA A;  1AXY A;  3GM8 A;  3VD3 A;  5B2G B;  2W52 A;  1YNA A;  1ND2 B;  1V6K A;  5DAX A;  5LB6 A;  3T1M A;  4HMZ A;  1C3H A;  1OA2 A;  1DGL A;  5CBL A;  2VBB A;  2GP3 A;  3B3Q E;  3KHC A;  3ZPY A;  4LBK A;  4YZ5 A;  3IKW A;  5K0U B;  4L11 A;  2QQP A;  3Q8B A;  3AKT A;  2GMP A;  1N1T A;  4FPJ A;  3MW4 A;  4MHU A;  2A6V A;  3I2G A;  2R06 2;  1I5P A;  4LKF A;  1RJ8 A;  1OUX A;  4XJ8 A;  4A7Y A;  1YFX A;  2RHP A;  4LK7 A;  4B1M A;  4AI3 A;  2Z5W A;  1OQ1 A;  4Q0P A;  1N3Q A;  2VQU A;  3E6B A;  5BNN B;  3TOJ A;  1MS1 A;  4XHB A;  3USU B;  3LFM A;  4EZH A;  3VKN A;  2A6Y A;  1UOB A;  1BQP A;  2RS1 1;  2VQA A;  4KWJ A;  1HRV 1;  5GLU A;  4CUG A;  3VD4 A;  4XYX A;  3QCW A;  3ZN5 A;  2VU9 A;  3ACH A;  1GP6 A;  3KF3 A;  4EV0 A;  4EE2 A;  1JYI A;  1ND2 C;  1O6U A;  2K46 A;  2R07 3;  3ILR A;  3UV9 A;  3TRS B;  2D6K A;  4CA9 A;  1W04 A;  1QJX 3;  4Z92 B;  4FPH A;  4FOQ A;  1W9F A;  4OI1 A;  3SKV A;  3O7O A;  1A3K A;  1W6Q B;  4ITC A;  2QDN A;  4CEY B;  1O4T A;  1VR3 A;  2GAL A;  5FZO A;  2PLV 2;  4M3C F;  4X8P A;  1UY2 A;  1UYP A;  2QQV A;  5D8A A;  5CG8 A;  2VOV A;  2OVU A;  4ARY A;  2Y8K A;  5FTT C;  3OGG A;  3JBG 1;  2WAA A;  1YFU A;  4IV1 A;  1GNY A;  2J1S A;  2VVD A;  2GP5 A;  3LEK A;  5BNN C;  5A1F A;  4PLN A;  4SBV A;  4ARX A;  2DVB A;  3QOP A;  4RYD A;  4CP9 B;  2AGS A;  2XL7 A;  1DQ4 A;  2JWP A;  4RL7 A;  4PT6 A;  1QOO A;  1EAH 3;  1ODM A;  3DYP A;  4LIT A;  5EP9 A;  1PM4 A;  4BQ3 A;  5C3P A;  2Y64 A;  1H4G A;  3ZN6 B;  2AR6 A;  3ETQ A;  1O3T A;  5A1A A;  3AL5 A;  5H9R A;  4Q4X 2;  1UYZ A;  1MQT C;  2H6B A;  4LT5 A;  4MGZ E;  3P6B A;  4R52 A;  1AYN 3;  1RIN A;  4LPL A;  2X05 A;  2D7F A;  3ELN A;  1AR6 1;  2VZT A;  3CF6 E;  1Z7S 1;  1OLQ A;  3SMH A;  4YRD A;  4AQT A;  3PU8 A;  4Y1X A;  3OD4 A;  1W6N A;  5HCF A;  4B7K A;  4FBF A;  4DO0 A;  2R32 A;  1S2K A;  1DYK A;  3B5L B;  2BYV E;  1D2S A;  4UAP A;  2XLA A;  1O3Q A;  1SG3 A;  5EJZ B;  2C24 A;  4HK8 A;  4XUO A;  1B35 C;  4AI2 A;  1AX1 A;  4G3Y C;  3NJZ A;  4LNV A;  3ZSJ A;  2BWA A;  2DBN A;  1GZW B;  3MIH A;  3VBF A;  1QHD A;  2E7A A;  2P1B A;  2DVG A;  2RMU 1;  2WKK A;  4RS5 A;  5BYN A;  2KM2 A;  3DYO A;  1LU1 A;  4FQZ A;  4JHT A;  5T52 A;  4ZHN A;  2HWF 3;  2HBU A;  2DFB A;  3GF6 A;  1YC6 1;  1EPZ A;  4BME A;  1JYT A;  3SEE A;  1S0J A;  1ZBA 1;  2P34 A;  2PEL A;  3MEP A;  1D2Q A;  1DGW A;  4YZ3 A;  2D44 A;  1GWK A;  2MEV 1;  4M3C E;  3VBS B;  1ZBE 3;  5IVB A;  5IK7 A;  1RED A;  2E9Q A;  2BFU L;  5L36 A;  5ISL A;  1X8E A;  4QPG B;  2EVX A;  5IVC A;  2OA2 A;  1RVF 2;  2A71 A;  3K77 A;  3PUS A;  4RFT 0;  5E88 A;  5ACA 1;  1CR7 A;  1RUD 1;  1STM A;  3U4S A;  1ASJ 2;  1YLL A;  4JC1 A;  4BYY A;  1JS9 A;  1QJY 3;  2K2S A;  2XLF A;  4N53 A;  5IW0 A;  3TYJ A;  3ZFG A;  1COV 3;  4P5Y A;  2NN8 A;  5FYH A;  3OY8 A;  1A6C A;  4QX2 A;  4BQY A;  5JMO A;  1GV9 A;  3X29 B;  2RJL A;  1RYY A;  4DEQ A;  3T08 A;  5C8W A;  4V2V A;  1SPP B;  3B93 A;  4BK4 A;  3MZH A;  5JCT A;  1ALY A;  1MEC 3;  1XNB A;  5FPL A;  3HAG A;  2A7A A;  5CIR A;  5DDJ 3;  2ET7 A;  4D8M A;  2CU5 A;  1FPN 1;  4YM1 A;  1H1A A;  5FZG A;  1O3S A;  3WD5 A;  5CKN A;  1CWP A;  2ORX A;  1IZ3 A;  2JIG A;  3NV3 A;  3OB8 A;  3VBS C;  3J7H A;  1DU3 D;  1E5H A;  2UYB A;  2CDP A;  3AKP A;  1NY7 2;  1XOY A;  3JD7 3;  1AR7 2;  3I2J A;  3M3I A;  4QPG C;  4ZZ5 A;  4I3G A;  2LM3 A;  1TMF 3;  2HWD 3;  2C6S A;  4OQ8 A;  1SLL A;  1FNZ A;  4PIX A;  3R4S A;  4B1L A;  3IZO A;  3UK9 A;  3L2Y A;  1JYX A;  2WT0 A;  3NJY A;  2XVG A;  2P6C A;  3CMG A;  4AAP A;  4IND A;  2DUP A;  3OBZ A;  2WL1 A;  2ERF A;  4K3U A;  4OUL A;  4D6Q A;  1YQ5 A;  5CZK A;  3T0D A;  1V6N A;  2K9Z A;  2W1W A;  5FMO L;  3WQ7 A;  2O8O A;  4BK5 A;  3ZYI B;  1JI6 A;  4DUW A;  5CKQ A;  1EV1 2;  2GNM A;  1IPK A;  4Q5O A;  4XOG A;  3UJO A;  4ASL A;  4COU A;  4OUE A;  4MO3 M;  5F3G A;  2Y33 A;  4FO9 A;  2D6P A;  4KBZ A;  1WMX A;  3VHP A;  1W6O A;  2XBO 2;  5JUV A;  1X9P A;  2VOK A;  1W9T A;  1VP6 A;  4LIV A;  4N8M A;  2BGP A;  1WBL A;  4DEV A;  1DQ0 A;  5A32 A;  3DCQ A;  1AXK A;  4IGO A;  3KLS A;  3ZFF B;  3Q9O A;  2P17 A;  2VJX A; 
#chains in the Genus database with same CATH homology
 1GWM A;  2KR2 A;  4BQ4 A;  1L7L A;  2Q1F A;  3UT0 A;  4BQ2 A;  1HN0 A;  1W8W A;  4LKD A;  4CP9 A;  2LRO A;  4A6S A;  3F95 A;  4YWA A;  3ZYH A;  4CPB A;  1GWK A;  4CP9 B;  2O14 A;  1OKO A;  2JWP A;  2K46 A;  2LRP A;  4CPB D;  4AL9 A;  4LK6 A;  4LKE A;  3ZYB A;  1W8T A;  3ZYF A;  2C24 A;  4YW7 A;  5D21 A;  4BQ3 A;  1W90 A;  1W9F A;  4LJH A;  1WMX A;  1GWL A;  1V0A A;  2VXJ A;  4BQ5 A;  1WCU A;  4LKF A;  1W8U A;  2WYF A;  4YW6 A;  1OH3 A;  1WZX A;  4LK7 A;  1W8Z A;  1UOJ A;  3ORJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...