1QOTA

Lectin uea-ii complexed with fucosyllactose and fucosylgalactose
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
236
structure length
234
Chain Sequence
SDDLSFNFDKFVPNQKNIIFQGDASVSTTGVLQVTKVSTTTSIGRALYAAPIQIWDSITGKVASFATSFSFVVKADKSDGVDGLAFFLAPANSQIPSGSSAGMFGLFSSSDSKSSNQIIAVEFDTYFGKAYNPWDPDFKHIGIDVNSIKSIKTVKWDWRNGEVADVVITYRAPTKSLTVCLSYPSDGTSNIITASVDLKAILPEWVSVGFSGGVGNAAEFETHDVLSWYFTSNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHITIN BINDING LECTIN, UEA-II
publication title Structural Basis of Carbohydrate Recognition by Lectin II from Ulex Europaeus, a Protein with a Promiscuous Carbohydrate Binding Site
pubmed doi rcsb
molecule tags Lectin
total genus 51
structure length 234
sequence length 236
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1999-11-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1qotA00
5DZEA 2GN7A 3GALA 2ZACA 3UL2A 3JU9A 4FOYA 2P2KA 4YG6A 4BLIA 4FPLA 1WW5A 4GA9A 1LECA 1DBNA 4XBLA 1U0AA 4ATEA 1FAYA 4YFZA 1G7YA 1CQ9A 2UU8A 1AX1A 2A6VA 4L8QA 4NO4A 3KQRA 4GWMA 3POYA 3UJOA 5LK5A 1WCSA 4U36A 1DIWA 4WZFA 1G9CA 1QMJA 2E7QA 5DXDA 5GZFA 4BLJA 2EXJA 3ZXKA 1CPNA 2ZKNA 3R4SA 4XMAA 1LGNA 1RINA 5CBLA 1DYKA 2UWAA 4YG3A 2A70A 2ZBJA 3V0BA 1AXZA 3ILFA 2ENRA 2NZ9A 3M3CA 1W6OB 1D0HA 1W0OA 3ZYRA 1FX5A 1C1LA 1RIRA 1W0PA 4XMIA 4DRRA 4BMBA 1G9DA 4XTPA 5IT6A 2CY6A 4I30A 1SLIA 1DQ1A 4FPHA 4XILA 2HYKA 2D6OX 3B3QE 1Q8VA 2ZGQA 3IN9A 3BOPA 1MS8A 3B69A 1A78A 2JECA 3ATGA 3SLIA 3HR9A 5FREA 3ZPYA 4XXPA 4LBKA 3M3EA 4DS0A 1LHNA 4NOTA 2OUHA 1V6KA 1A8DA 3WHTA 5DZGA 4YZ3A 2PHUA 4WVWA 4Y24A 1UL9A 5IK4A 4XHBA 1ULEA 2R0HA 4YFWA 1C1FA 1Y7BA 2XB6C 5DZFA 4D69A 2EXHA 1LOFC 1S0DA 1FV3A 1IOAA 5KXBA 2FHRA 3N3HA 2DTWA 3O5SA 4Y20A 2AH2A 3FUOA 2R49A 3N35A 3RMYA 1MS4A 1AZDA 2GMEA 2E7TA 2KM2A 4XOGA 1IKPA 2W08A 1BYHA 1LEDA 3QCWA 2D6LX 1S0IA 4JCKA 2ERFA 3N7MA 1LOCA 2A6XA 3WDUA 1WW6A 2CL2A 3OY8B 2ZHMA 3ZSKA 2EXKA 2ZABA 5JOXA 2RHPA 2E53A 4GWNA 3WDWA 1DQ6A 5EYXA 2VW0A 1IS5A 4ZXKA 4UW3A 1WD4A 2Q5TA 4XBNA 5H9RA 1GYKA 4LBQD 1VIWB 2GNBA 5H9QA 1PZ7A 1AJOA 1SFYA 4FOWA 3WDXA 5DG2A 4FPYA 2EIGA 4XYXA 4FOVA 4ITCA 4M3CA 1QGLA 4FP2A 5GM0A 1HQLA 2GMPA 1N1SA 3PVOA 4HL0A 4XBQA 2TEPA 3MEPA 5GZDA 2NMNA 3RG0A 4BQ1A 1DYPA 3APBA 4R9CA 4AGVA 5JVVA 2R1BA 3T1LA 4FPCA 4YLZA 3ILNA 1GBGA 4RL7A 1LENA 1BQPA 2ZGUA 3ENRA 4XJ9A 1V6LA 2PHWA 1LESA 1ENSA 1SLAA 2DVDA 2JE7A 3IPVB 2XG3A 1N47A 5T54A 2AENA 5BYNA 4AYUA 1B09A 1LHUA 1X50A 4PF5A 2YZ4A 4Q8LA 1W6MA 3ZYPA 5IUQA 4K1ZA 1UPSA 1FV2A 1NXD1 2G4IA 3W58A 3O0WA 4YW1A 2WLQA 1G86A 3AP6A 2WJSA 3AJYA 1S0CA 5T5PA 2A3XA 3TAYA 4DRVA 5F5QA 1MZ6A 3AZWA 3HMYA 1OKQA 2ES3A 3OBRA 4YZ4A 3V0AB 1MS5A 1N3QA 1PZ9A 3NV3A 1ZM1A 1Q8OA 1CIWA 1GZ9A 2D43A 4PBOA 1UX6A 1H9WA 1MR5A 1V6JA 1KQRA 1A3KA 3PVNA 1I1EA 1JYCA 1SLLA 1UMZA 4XJAA 4LBOA 2WT0A 2D6NA 1Q56A 1UAIA 1DHKB 1W6MB 3CNAA 3BTAA 1BXHA 1ULGA 1WLWA 3V64A 2DU1A 2W39A 4Y26A 1ENRA 2CYFA 4RA0A 2AUYA 5F9TA 3AZZA 5FRAA 5EWSA 3FLTA 1DQ5A 1W6OA 2LTNA 2YY1A 1SBEA 2EALA 2VW1A 3WZ1A 4WV8A 3A0NA 3M3OA 1SBDA 4AVTA 2VH9A 3WG3A 3VKFC 1FNYA 3B01A 1O4ZA 1NLSA 5GJ6A 1DGLA 3MW4A 3WCRA 5GZGA 2A6WA 4AVVA 1IS4A 1IS6A 2GDFA 5EYYA 3AP4A 3AYDA 1QOSA 5JLVA 4M3CE 1F5FA 4CZSA 3PJQA 4XE9A 2EXIA 2ZHNA 1W6PB 2DUQA 5L73A 1AXYA 4XDQA 2ZMKA 3MW3A 3WV6A 3L2YA 1MS9A 4AGRA 3RS6A 2ZMLA 1KRIA 4FPFA 2A6ZA 2AREA 4OZXA 4YW3A 3WDYA 5DG1A 1DFQA 1UZYA 2D6PA 1JXNA 3FUQA 3NV4A 1LGCA 4IQPA 1TEIA 2LALA 4GKYA 2VUAA 2WT1A 3BODA 2GN3A 1GZWB 3WNXA 1LGBA 1UKGA 1Z78A 4ASMB 3ZSJA 3WUCA 1GKBA 1JOJA 1LOFA 3AP5A 4Q1PA 4Z8BA 2DYCA 1VLNA 3AYCA 1LU2A 1FATA 1JBCA 1H9PA 1MACA 2ZGRA 3IMNA 4YGCA 4DFSA 4LBLA 1LODA 3AP9A 3OY8A 4P9WA 3KM5A 5CB7A 3SH3A 1I3HA 1KDMA 2A5ZA 4YGDA 2I2SA 5JMCA 1SCRA 4M3CF 1LEMA 1AX0A 3V65A 1KDKA 2PHTA 2A75A 3FBYA 2ZAAA 4Y22B 3OYWB 4YZ2A 2DVBA 1V6OA 5GLWA 4Q8KA 1LOGA 1LOBA 1WLDA 1C4RA 2Z42A 4R9DA 1N1TA 2ZGMA 3I4IA 1V6NA 1V6IA 1JYIA 2ZA9A 1PZ8A 1C57A 4JC1A 1BKZA 1Z0HA 4GALA 4WVVA 5T52A 1OFSA 2JD4A 4AGGA 3OGGA 4YW4A 4YZ5A 2NN8A 3WG1A 4YGBA 1WBFA 2ARXA 1YI7A 1LOAA 4FOQA 3VKMA 1MVQA 1S0EA 4LBQB 1Q8SA 1G8WA 1HDKA 2NMOA 1CVNA 3AP7A 2DVGA 2ZGKA 4HANA 1SCSA 2ZGPA 3IPVA 3AZYA 1QNYA 4YW2A 5SV8A 4R9BA 4CRQA 3AFKA 4SLIA 1DQ2A 3DGTA 5T5JA 4FPOB 1MZ5A 5DUWA 2A7AA 3R05A 5JOZA 1HLCA 1LJ7A 2DTYA 1CPMA 1AF9A 1JUIA 4XXAA 1R1ZA 3ILRA 3POWA 3A0KA 2GNTA 2ZGSA 3B00A 3NV1A 3SNMA 2SBAA 5HCFA 4XZPA 3SISA 1KJRA 3V0AA 4TYSA 1HKDA 3HN1A 3AXEA 4K21A 1W6QB 2GALA 1LTEA 4Q2FA 3PVEA 1S0GA 2UWBA 3LCPA 3AZXA 1N1VA 4FVVA 2NP0A 2P37A 2VY0A 4C1XA 4Y1XA 1VAVA 3SH4A 1QU0A 2VW2A 3INAA 2WKKA 1WD3A 1ZA4A 4FPKA 5AVAA 3USUB 2ARBA 1S0FA 4U2AA 2JJ6A 2YXSA 2ZGOA 3BIWE 5DUXA 5GLVA 2D44A 3AJZA 4FPGA 3OJBA 4CTEA 3MPPG 4XJUA 4ISRA 2PHXA 3VKNA 3VKOA 1WBLA 3WLUA 2GNDA 2CWSA 4YW5A 4DQAA 4KBBA 2P34A 5E88A 4YG0A 3O0VA 5T5LA 2P3KA 1APNA 5CA6A 3D4KA 5E8AA 3UJQA 1W6PA 5GLZA 4F83A 4LBMA 2YV8A 3OPZA 3AXDA 1BZWA 3SH5A 1URXA 1GV9A 1JHNA 3ZXEA 1WW4A 2BQPA 2P3JA 2UWCA 1FNZA 1F31A 2YMZA 3D5OA 5CAZA 5H9SA 3D6EA 4W65A 4XIKA 2E51A 1GNHA 2ZGTA 3OBTA 3FFZA 4DPNA 1ONAA 2A6YA 3MW2A 4XJZA 1MS1A 4YGEA 3H0OA 3VUOA 3UK9A 4YM2A 2OVUA 1GZWA 3M1HA 1LU1A 1EPWA 1O4YA 1SBFA 1V6MA 2D3PA 1W6NB 2GMMA 1CR7A 2DV9A 1OQ1A 2A3WA 1LOEA 1CONA 2ZMNA 3IM0A 3ZSMA 1S1AA 5IK5A 1D2SA 2ZHKA 3FLPA 4PQ9A 3WG2A 1WW7A 1SLCA 2D3SA 3IKWA 1GZCA 3VV1A 3N36A 1QOTA 3RQ0A 1QNWA 3C2UA 1JN2P 2SLIA 3AK0A 2W68A 4Y22A 4FQ4A 3OYWA 4UW6A 4XJ8A 3ZSLA 2DUPA 2V5YA 4Q27A 4XTMA 1VALA 1YO8A 5T5OA 1AX2A 5IK7A 3GNEA 1AJKA 1ULCA 1DQ0A 2P3IA 1J1TA 3WCSA 3WUDA 4MYEA 5DUUA 1GANA 4YM0A 2DWRA 1ULFA 2D3RA 3WHUA 4GKXA 5E89A 2ZGNA 4AVSA 1YYNA 4P9YA 4UW5A 3WOGA 3RRDA 4LBQA 1AXKA 3AX4A 2CTVA 1DQ4A 1QKQA 3WDTA 2JE9A 2PELA 1GICA 2PHFA 3N7LA 4FPJA 4XIOA 4JRAA 1IKQA 2A71A 3O12A 1ENQA 2A3YA 1QOOA 4YM3A 4AWDA 4YM1A 5GZCA 4Q26A 3PMEA 3V0BB 1BJQA 1N3PA 3ZXLA 3DUIA 1DLLA 2R0FA 3ASIA 4PCRA 3WG4A 4BPZA 5H9PA 5JOWA 1H30A 5GLTA 5KXCA 2B7YA 1LULA 2R1DA 5T55A 1WLCA 1W6QA 4K1YA 3WVJA 3ZXFA 5KXEA 2DU0A 4R9AA 2DVFA 2D7FA 2DUOA 4Y1ZA 3NV2A 5GALA 1MS0A 3B9CA 2NM1A 4BM8A 3AYEA 4ISQA 2WSVA 1MS3A 1LHOA 2ZZJA 3VKLA 5CNAA 2WT2A 3LSDA 3USUA 5KXDA 1UN1A 2EF6A 2JDZA 1S0BA 3POSA 3JUUA 3RSJA 1HQWA 2W52A 1KITA 2AYHA 2AGSA 3T2TA 3W59A 4BMEA 4Q1RA 1GLHA 2EAKA 3QLQA 4Y20B 1LHWA 1FYUA 3R4UA 1G9FA 3M3QA 3ZXJA 1DZQA 4ZKTB 4H55A 3Q9OA 4P14A 3I8TA 4ATFA 1AVBA 2YROA 2ZHLA 5DUVA 2DURA 1UZZA 3FLRA 3N7KA 4XHXA 5GLUA 5IK8A 1XQNA 2WSUA 3LSEA 3N7JA 3WDVA 1KJLA 5HCBA 4YZ1A 1MVEA 4LBNA 3RMXA 1RITA 1LCLA 1VAMA 2FMDA 2OUJA 3A4UA 1YXWA 5JOYA 1V00A 3U4XA 2C9AA 4Y1UA 1N3OA 1GSLA 1QDOA 1YRZA 1Q8QA 1SACA 2JKBA 1G9AA 2D6MA 3O0XA 1G9BA 2VU9A 2WNEA 1GNZA 5T50A 2WQZC 4M3CB 4Y1YA 5JDBA 1IS3A 5GZEA 1ULDA 2V73A 1SLTA 1W6NA 2PHRA 1QF3A 3NWKA 4XJWA 5EXOA 4UW4A 1QDCA 1CJPA 3ZVXA 2VXRA 4Y1VA 4FQZA 2C5DA 1LHVA 3T1MA 5HCAA 4C1WA 4M00A 1YIFA 2GNMA 1SLBA 3TB0A 1JW6A 2CNAA 4GXLA 3AZVA 2H0BA 2OW4A 4M01A 2E6VA 2DVAA 1F9KA 2NYYA 2ZGLA 1N1YA 4K20A 2CWMA 1CN1A 1Q8PA 2D6KA 4FPEA 2R16A 1CESA 4PBPA 3AYAA 4TZDA 1S0JA 3M2MA 2UURA 4FP3A 4P9XA 1WUVA 4BOWA 3SITA 2AR6A 4LBJA
chains in the Genus database with same CATH superfamily
5DZEA 3GALA 2ZACA 1NXMA 1UYZA 5KHJA 3ETPA 2WR9A 3B5LB 3SEPA 3HT2A 4GA9A 4CEYC 1DBNA 1B35B 3CQOA 2Y6GA 1RUH2 5BNNA 2UU8A 1NYWA 2FDJA 1XNDA 3OUIA 4O61A 3VBHB 1UWWA 4OMCA 2LM3A 3I3BA 4QM9A 1WCSA 2J22A 1JU3A 4AQSA 1M4WA 2E7QA 5GZFA 5A7QA 4JZRA 2OT7A 5FQ0A 3WQ1A 4CP2A 3R4SA 1PMIA 4UF0B 2BWAA 3O1VA 1AXZA 2R30A 2X29A 3HBZA 1W0NA 1W6OB 3I2GA 3MIDA 2VZPA 3CL1A 3RI9A 1K42A 5LRRA 1OKOA 3PURA 1AR72 1RIRA 1W0PA 4GD4A 5I0TA 3S30A 2CY6A 4MX3A 2GC0A 4IV1B 3E6DA 1S4CA 4I30A 4N7IA 4RD7A 2VOXA 2W46A 1DQ1A 4XILA 2HYKA 4Q4X1 2D6OX 1QJU2 4PQQA 1H2KA 1MS8A 2MEV1 2GZWA 4LOTA 3I97A 1GMMA 1IPJA 5JPMB 5JSOA 2TUNA 3POIA 4NOTA 4NIGA 2ZEXA 5DZGA 2FMYA 5DDJ1 5IK4A 1J3RA 2PAKA 4GWJA 4X8PA 4A45A 2PXJA 2R0HA 1C1FA 2XB6C 4MGIE 4AEJA 3HJRA 1NQJA 4MH0E 4XF9A 2AH2A 1AL21 4K9SA 3RZMA 2KM2A 4XOGA 3T0DA 1IKPA 1E5IA 1QQP3 3UETA 2QUOA 1RUG1 4MO3M 2QQPA 1X82A 1CAXA 1H6XA 1S0IA 1XYOA 4UFJA 1WCKA 4ZU4A 4OMDA 2YYOA 4LKSA 3U10A 3WDUA 3SEEA 3VHNA 3CEWA 4GMP1 2BDRA 4YVSB 2CL2A 2VL4A 2ORZA 5JZGC 2QDRA 2E53A 2RHPA 3I49A 1SZBA 2C6SA 2VW0A 1IS5A 4BIFA 1AYN1 2O0OA 2B5HA 1WD4A 2Q5TA 4RQPB 5FY7A 5FZFA 5H9RA 1K3IA 1VIWB 2I74A 4ORFA 3I59B 1AJOA 1LB2A 2IVIB 3S7IA 3WDXA 5DG2A 2Y6HA 3NNGA 4PLNA 4CXWA 3KS7A 4ITCA 4QQLA 2VCMA 2W92A 4FP2A 3PVOA 2WZEA 3LQCA 2VCCA 1BCXA 2BW8A 2NMNA 5JAXA 4BQ1A 1DYPA 3GHMA 3APBA 4LMFA 4LJHA 4A7KA 3GBWA 2LRPA 4FPCA 3POGA 4QB6A 4UFMA 4OCTA 3DYPA 5FZHA 5FXWA 4AFBA 3ACHA 4RL7A 2ZGUA 5ANQA 3ENRA 5FYBA 4ARYA 1LESA 3LDRA 4HOOA 5LZ6A 2FDKA 5K0UB 1PGL2 3LFMA 3IPVB 3W5MA 1CZSA 5T54A 2BGCA 4PLOA 4D8MA 2BWCA 1SDWA 3KT4A 3OCPA 4YSFA 4LT5A 5FMCA 4JDMA 3RPQA 4PF5A 1F5JA 1W6MA 3AL5A 5FMOL 3MO4A 5FP4A 4BQ3A 1XNTA 1G86A 3U0ZA 4CCKA 2IXLA 2A3XA 1UOGA 1DU3D 1H8TB 2RS52 4OYUA 4XFHA 5F5QA 1MZ6A 4B1LA 2VTFA 4COUA 1UXXX 2ES3A 4WVZA 5ACA3 3VD4A 1C28A 1MS5A 1PZ9A 3NV3A 3KLSA 3WF2A 1YQCA 1B35A 3DPRB 1CIWA 5FAXA 3HN3A 4AEKA 1H9WA 1V6JA 4OLLA 3T2QA 2K46A 2HWB2 2IC1A 5A3OA 2O8QA 1JYCA 5KHHA 2HKXA 3VBHA 1BMV2 4Y3OA 2VE1A 1ZA7A 3VB9A 2GP3A 5A1LA 3V64A 3BTAA 4CP0A 2J42A 4Y26A 4QKFA 1B35C 2ZX2A 5I8SA 4UF0A 1WCQA 1VB2A 3FLTA 1DQ5A 1W6OA 2MEV3 2VGDA 3CHXA 2E7AA 3J26N 3OEBA 4PF1A 4UOJA 2HEYF 4WV8A 3VBHC 3UT0A 3A0NA 2XLAA 3WZ1A 1FNYA 1DGLA 4JKLA 1PNFA 4DY5A 1UKRA 4IV1A 5FKBA 4F8AA 1IS6A 1H6YA 1O5UA 3UKVA 5IFTA 1SHWB 3AP4A 1YQ6A 4ZHNA 1CAUB 1Q5OA 3PJQA 3ZR5A 2ZHNA 1CAWB 4XQ4A 1UO9A 4XDQA 4DOUA 3NQHA 4AGRA 5HV0A 4IV1C 1RUJ1 1V70A 4EWDA 2YU2A 1CZVA 5LBFA 4QPGB 1RUG3 4AI1A 3O14A 5A6YA 2OX0A 2MPFA 1FT9A 1NY71 1JXNA 3ACGA 3USSA 4D7TA 3L9JT 1TEIA 2LALA 4LKFA 2YB7A 2RR12 1C3HA 1XNBA 2RDQA 3MHZA 3RWNA 5L7OA 1PM7A 4NHKA 4O9EA 3WF4A 4CPBD 4FBFA 5C6CA 4RHV3 1J84A 4A42A 1I5PA 3WUCA 1GOGA 1W3VA 4LQRA 1GKBA 3AVRA 4BU2A 3HNBM 4Q1PA 5IVJA 1FMD2 3J7HA 1LU2A 1PIV2 1JBCA 4GB31 3AKTA 1UCXA 5L7OC 4OQ9A 5I0SA 1VBD3 4ZU7A 2H0VA 4YVSA 4AAPA 4LIUA 2Q8DA 3I2KA 1CX1A 4AVAA 5FPVA 5HI0A 2A5ZA 3A22A 2I2SA 2G9FA 1GR3A 1LEMA 1RHI2 1AX0A 1D2QA 4RQPA 3V65A 3EQEA 1W9TA 2ZEZA 1Y43B 2W9XA 1FXZA 2JG8B 3VBFB 2ZAAA 3I59A 4YZ2A 1K5MB 1QH6A 2K0GA 1V6OA 1UY4A 4YVSC 3I3EA 4A6OA 3VZJA 5FYZA 3VZKA 3VBUB 3ZYIB 5HXMA 1WA4A 3ROUA 1Z7S3 4RQPC 1R093 5FYVA 3ABZA 1JYIA 5FXXA 5AC91 5K4LA 1C57A 1BKZA 1Z0HA 4GALA 1EAH3 4WVVA 4CCLA 3PIGA 4CCJA 4B29A 3IDAA 4P9GA 1L7RA 1R1A3 3OEAA 1WBFA 2YBPA 3KT7A 4FOQA 3ZN6B 4AQ2A 2EA7A 1MVQA 2ORXA 3H42B 1JMUB 4Y33A 4Z82A 3LA2A 3AP7A 1HDKA 5K0UA 1CVNA 2NPIA 4Q4Y1 1UY1A 4HZFA 3J8F2 1SCSA 2HEVF 3IPVA 5SV8A 4XETA 4R9BA 1TMF2 4CRQA 3CIHA 3LZZA 4JTNA 2QQIA 4FPOB 3R4DB 2QQLA 5DUWA 2A7AA 1S2BA 4XF0A 5FV3A 1LJ7A 2DTYA 5K0UC 1REDA 1AF9A 2JWPA 2L9LA 4XXAA 1R1ZA 5LA1A 3A0KA 4CP1A 5F39A 1H8TA 5HCFA 2BP6A 4XZPA 3U11A 1KJRA 2RVAA 5CIRA 4TYSA 3C3VA 1YQ8A 2FCTA 4GH4A 1U5XA 3DPRA 3PVEA 3AKRA 3Q8AA 5CBLA 4LOSA 4WM8B 4ASLA 1S0GA 2X53S 3DCQA 3LCPA 1OMIA 4C1XA 3BPSA 3HD8B 1H8TC 2IXIA 5HPOA 1F15A 2W1WA 1W03A 4HK8A 5B4XA 3INAA 4L92A 3CMGA 2VNVA 4GH4C 3DPRC 1S0FA 4PI0A 4U2AA 5FUPA 4EV0A 1WZXA 3E97A 2RS33 3B02A 4GWIA 2P17A 5FYMA 1C8M1 2CAUA 5DQ0A 2VQUA 1OPOA 3BTXA 5KC6A 1W04A 2PHXA 3H3LA 5IAVA 1RUJ3 3VKNA 4BDVB 3WLUA 5JR2A 2Y38A 3DKWA 2FD8A 1Q3EA 3J9SA 4DQAA 5FO7B 4YG0A 1CAUA 3ZMOA 3UJQA 1RUI1 3E5QA 4B3NA 1CAWA 4FAHA 4P9LA 2H6CA 3KHCA 3OPZA 4MGZE 1OPMA 3KWVA 1BZWA 2CGPA 4IV3A 1GV9A 1ULPA 1WW4A 2UWCA 3D5OA 3AMPA 1F31A 4QPGA 1H8VA 5FPBA 3D6EA 1UZVA 4GQ7A 4YRDA 3CZUA 1PO12 1S2KA 2WNUB 1OLME 1MS1A 1UYYA 3UK9A 2DCYA 4D6QA 4IV3C 1V6MA 1H2NA 3CBNA 4BQ4A 3FX3A 1ZBE3 5FMOS 4JDNA 1LOEA 3P3PA 2ZMNA 3IM0A 1NLRA 2G9ZA 2XJTA 2ZX4A 2ID4A 2Y6FA 4IERA 1VAKA 4UFLA 1WW7A 1QY4A 1QOTA 1XE8A 1KGYA 2WWSA 4F3JA 3C2UA 3AK0A 4PIXA 2VVEA 3UKTA 2JG8A 3VBFA 4OULA 1QXJA 5FY9A 4XURA 4RR3B 2DUPA 1XU2A 3HOBA 4Q27A 4D6RA 1QJZA 5FO8B 3VBUA 1AJKA 3IB3A 4Y5Z0 4Q4W2 4UXAA 2QQUA 2XWJB 1GANA 2XH6A 5A3MA 2JG8C 1ULFA 3VBFC 3WHUA 4CDXB 3H3UA 2XVKA 2DCKA 1GP5A 4EQVA 4J6GA 4UW5A 3WOGA 3ZN6A 3GJBA 2VJXA 1D4M1 3VDAA 5K7PA 3AX4A 3H8OA 2W95A 2HWC2 4QKNA 1TME1 2PELA 5DMYA 1GICA 1WMEA 2E9QA 5GKAC 1JYTA 2E32A 3JZVA 2R063 2ETEA 4COWA 2A71A 1UYPA 2H6BA 4QX8A 2A3YA 1R64A 2HWD2 4NAMA 5GZCA 4Q26A 1N3PA 1O4TA 1WCDJ 1IQAA 3JQWA 5T3NA 5H9PA 5JOWA 3HBKA 3OD0A 4GZ9A 2B7YA 1LULA 2WFF3 4L2NA 5F2SA 4K1YA 3URFA 4YPJA 2D40A 3FE5A 2CV6A 3U1XA 2W47A 1NLQA 2D7FA 1AYM1 1C8M3 4Y5SA 2Q8OA 3NO8A 1MS0A 2QQVA 5CG8A 3U78A 2OQ7A 2QVSB 3AYEA 4HVOA 1LRHA 2WSVA 5CKMA 1VMHA 3HVDA 5ANNA 4NIDA 1VBB3 1YI9A 4S2FA 2RDRA 1NQDA 2Q8EA 4AFAA 5JPNB 1QJY1 2GC3A 2RMU1 2W52A 1KITA 2J1TA 3A23A 2AYHA 1RUI3 1RUE1 3NL1A 4DUXA 5M0TA 5C8WA 4DINB 5CKNA 1GLHA 3WSOA 3QLQA 3G7DA 1FYUA 3R4UA 3PTRB 3ZYHA 1HRI3 2QTWB 1RUF2 4P14A 5B2GB 3I8TA 2PQSA 3LA3A 1AVBA 4D7SA 2W0XA 2YROA 4I02A 1AR82 2F17A 4IEXA 1UZZA 1Y9QA 4EN8B 2R042 2PFWA 4PJYA 4XHXA 5GLUA 4META 5HV4A 2ILMA 3O1UA 3N7JA 1UOFA 2ZCWA 1KJLA 2EICA 4YZ1A 4CP9B 1RITA 1LCLA 1VAMA 1VBE1 2BV4A 2ET1A 1AR62 1COV1 4DO0A 5C3SA 3U4XA 3LEMA 1VR3A 1LNSA 3WD5A 1G9AA 2WNUA 4LEJA 4IEYA 3LEIA 1H0BA 4COZA 2VU9A 1JYVA 1HXS1 4ASKA 4K6BA 4M3CB 4FFHA 4Y1YA 5FZ4A 2R072 1LR5A 1VBA3 1D0GA 1SLTA 1ZRRA 3NWKA 1QF3A 3PTYA 3QD6A 4XJWA 4BISA 4UW4A 4SBVA 1UOJA 4LO8A 2WNUC 3VD3A 4JGYB 1R081 2W5FA 3JBG2 3WW4A 4UAPA 3EBRA 1JW6A 1H1IA 1NZIA 4M0HA 2J1AA 1W8FA 3ZN4A 3AZVA 2H0BA 1QJX1 4M01A 4RN5A 2P6CA 2ZGLA 1NE6A 4K20A 4P5HA 4RR3A 1CN1A 1J1LA 3RZKA 2BGPA 4YYOA 4TZDA 2VZVA 1ULOA 3KF5A 4IW3A 4QPWA 4FXGB 4EN0A 4BOWA 1TME3 2WT1A 2HBUA 2GN7A 3KHBA 3JD73 2KD7A 2CGOA 3VD7A 4CDXA 3WNLA 2BJSA 1QJEA 4NRPA 5IHRA 2BGOA 2G19A 3NNJA 1LECA 4M4PA 5FZGA 4XBLA 1WA6X 2WUHA 3ZO0B 1U0AA 4Q4X2 3T4HB 1FAYA 4ATEA 5J7MA 1G7YA 1CQ9A 3WEZA 2XOMA 2BNOA 1AX1A 2WABA 4QHBA 4QX1A 2Y0OA 2A6VA 4FFGA 5LBCA 4GWMA 5FBZA 2E31A 3VBRB 1W8NA 3UJOA 2VZRA 4HG6B 4LO5B 4P5YA 3E6BA 4U36A 4XEZA 1DIWA 4WZFA 2JIJA 4YNIA 5L9RA 5LK5A 1A6CA 4XMAA 1BHGA 1MZEA 1DYKA 1AYM3 2VZ3A 2A70A 5LWBA 3ILFA 2IZWA 2WFPA 3D8CA 3IMMA 1IGOA 2YUEA 4XF1A 5JWPA 4G9SB 1VBC1 1OF3A 2RM21 4QQPA 2IXJA 4JX0A 4BMBA 1AL22 1JYNA 5IT6A 1PHMA 2I07B 1G9DA 5JSPA 4XCAA 1V9U2 2OIIA 2RMU3 5FZCA 4AHZA 3RJRA 1RUE3 2DBIA 4N9IA 1YJKA 2OXBA 3OTFA 5K9YA 2Z4FA 1H2LA 4QT6A 3ZPYA 1CAVB 4LBKA 1LHNA 3PUSA 4AZZA 2HBTA 2PHUA 4WVWA 3UKNA 4CCOA 1ULEA 2QQWA 1Y7BA 4MG2A 5CFDB 5BNPB 4RYDA 3X29B 1ST8A 5APAA 3BKZA 1FV3A 4E8CA 3FFQA 4CVUA 4XFIA 4IE5A 3N3HA 1W8OA 2DTWA 2W2IA 4V2WA 2VBBA 2HJIA 1AZDA 2GMEA 2VOVA 4NR1A 3TEZA 3KB5A 4QDQA 4JV4A 3QCWA 4D7YA 2D97A 1RVF3 3OGJA 2XLFA 4NE9A 4YW7A 1O3QA 4OUMA 4AEDC 2WAOA 4AI8A 1LOCA 2OYZA 1EV11 3WINE 3KZ4C 5A3PA 1WW6A 2AACA 5LA2A 1HRV1 1KD7A 1TG7A 2ZHMA 3OY8B 4CP9A 3WF1A 5JOXA 4GWNA 4B8EA 3DV8A 2Y8KA 5EYXA 1BBT1 1JYWA 5A3UA 3MPBA 1W06A 2ARAA 4WVMB 4LBQD 5C5UA 5FUNA 2XBO3 1PZ7A 5CEHA 5JZGB 4FPYA 1JYXA 3V56A 5HBAA 4XYXA 2CU5A 4FOVA 4M3CA 1QGLA 4DB5A 3HEIA 4I3GA 1DGWX 1NE4A 4HL0A 3U4SA 2JDAA 4XBQA 4AK3A 4E27A 1UU4A 2VMCA 3RG0A 5A70A 3GDBA 5FYCA 2XKOA 1W05A 4JGYA 4H2AA 1YQ2A 2VOWA 2BU9A 1NT0A 2C0ZA 2DCJA 3H50A 2IXCA 5FJKA 1QQP1 1V6LA 3EMRA 3LD8A 4KWKA 4AW7A 2WA4A 2ET7A 2Y6LA 2WO7A 1PVC3 5J98B 4HKLA 1LAJA 4CYDA 4OHXA 1GU3A 4BK4A 2AENA 1W8ZA 3ACFA 4JGYC 1X8MA 5G05L 2PAMA 4AYUA 5A7WB 2IXKA 2MHFA 5FZMA 1X50A 2YZ4A 3MBWA 4K1ZA 1UPSA 4QQ2A 2G4IA 3W58A 4YW1A 3RNSA 1RUC3 3AP6A 2XR4A 3H8UA 4L97A 2WJSA 3AJYA 3ECQA 3NJVA 1O8PA 5A7PA 5KHGA 2WAAA 5DAQA 1OKQA 4BYYA 4G4FA 1YNAA 5FBJA 2BFUL 4PIYA 4Z07A 5LY2A 4UFIA 1ZM1A 3TB0A 3OUJA 2VZSA 3GYDA 1KQRA 3MF9A 3AC0A 1A3KA 1H2MA 3WNNA 1SLLA 5LCWL 3VBRA 1OA4A 3O1PA 1DHKB 1W6MB 1BXHA 3M8LA 3T09A 2CYFA 4A3XA 2WYFA 2ZX1A 1RGSA 3OSDA 4NAOA 5F9TA 3KV9A 5FRAA 1NY72 5EWSA 1JOPA 1QJFA 2LTNA 2YC4A 2YY1A 3I7DA 1SBEA 1I5ZA 3KT1A 3OPWA 1HB4A 3VBRC 3M3OA 1GNYA 4GIQA 2VPVA 3B01A 1VPHA 1O4ZA 2BEOA 2B8MA 2VULA 1VB4A 5GZGA 3OGSA 4AVVA 2EIBA 3BALA 1YCIA 5EYYA 5A6ZA 4BHPA 4XFGA 3AYDA 1QOSA 1JH5A 2VMEA 3H3ZA 3PL0A 4M3CE 4GB32 4XE9A 4Y4YA 3VZNA 4CSWA 2DUQA 1C8NA 1RUNA 1AXYA 1UU6A 1GFF2 3CDZB 4XUOA 1US2A 1BK1A 5ACA1 1CAVA 1DF0A 3BU0A 4JRLA 5FZ6A 2BTVC 4OZXA 4YW3A 4X6RB 3WDYA 2JIGA 5E1RA 1RMU2 1NZCA 1DFQA 1UX7A 5DAPA 4PIZA 2XDVA 3HNMA 3OBAA 3FUQA 1LGCA 4BIOA 1GUIA 1TVGA 5CFDA 5BNPA 2HWF3 1ZRCA 3B93A 4LKEA 1EV13 3BODA 1HRV3 1BVVA 3MF6A 3UNPA 5FYHA 3SC7X 2WN2A 1LGBA 1W90A 4ASMB 3PUQA 3MUY1 1BBT3 1UYXA 4QHZA 5FK7A 2W91A 5AC92 4OHVA 4MGTA 2YFUA 1W28A 5CFDC 5BNPC 3WQ0A 5KHKA 2XLGA 2BVBA 3GCWA 3NKGA 2PHDA 3IMNA 4YGCA 1W8TA 4TSVA 5FZIA 1LODA 3AP9A 3OY8A 4H14A 3TN93 2JB4A 1I3HA 1KDMA 4Q4Y2 3W5NA 4M3CF 2RJLA 4WVMA 4IETA 2PHTA 5L7OB 2JDYA 4CE8A 1HN1A 1FPN1 3M3IA 4CDQB 2V09A 4Y22B 3OYWB 1PO22 1OOPC 5JZGA 2DBNA 2PA7A 3CJXA 1J83A 3POEA 1IPSA 1LOBA 3F95A 5DAVA 3ZSEA 1C4RA 2Z42A 4BZ4A 1UMHA 2VMGA 1N1TA 1O59A 1HV1A 2Y26A 1F35A 5AVPA 1PZ8A 4KWUA 2VXJA 1CD3G 4CXXA 5LATA 4BCUA 1GOHA 2VQTA 4RHV1 4YZ5A 2NN8A 2C4XA 2AC1A 3LOIA 2P4EA 1YI7A 2BBAA 5FZ3A 1S0EA 1WKYA 3ELNA 1HQNA 4I01A 4LBQB 4N90A 1OF4A 1G8WA 1Q8SA 3AMMA 2FZ2A 4P02B 4XF4A 2ZGPA 1QNYA 1VBD1 1ASJ3 5EJ3A 5A7WA 1DQ2A 3SCGA 4A41A 4CCNA 3MV11 4QX0A 1YHFA 2ZKLA 4DY3A 4Q0PA 5JCTA 2VTXA 1JUIA 2GNTA 2ZGSA 4QWNA 2AEZA 1RUF3 3SISA 4C90A 2YG0A 1AR93 1AHSA 2GALA 3NSTA 1LTEA 3CZJA 1MPXA 4D3WA 1Z7S1 1R091 3KCCA 3ZYBA 1MEC2 3ST7A 4OI2A 4C8DA 5A3TA 5E6HA 1EAH1 3VHPA 1VAVA 3SH4A 3FC0A 5ERLA 1GP6A 1R1A1 3GM8A 5FZ1A 2ZS6B 4FPKA 1XYNA 2ARBA 5I0UA 4C91A 2BNMA 2JJ6A 4HT1T 2YXSA 2ZGOA 3BIWE 4LR4A 2W1SA 4L0PA 5GLVA 4AL9A 1C5IA 2JD9A 3RYRA 3AJZA 1BEV3 2PLV2 3S6PA 3BTZA 1UQXA 5CADA 3MPPG 4XJUA 2XKPA 4GH4B 4ISRA 4XAEA 2Z69A 4NN0A 3UGFA 4DXTA 1K12A 3MUZ1 2WINB 4YW5A 3M7AA 3MIBA 4IESA 2XQRA 1EY2A 5CA6A 1OI6A 1APNA 2QQJA 3JBG3 4NWWA 3HIFA 5GLZA 4BQXA 4F83A 5FYYA 1DCSA 3LDKA 4JQRA 3AXDA 3KSCA 5FZDA 3SH5A 1URXA 3FL7A 3K48A 3K46A 4FSJA 2YMZA 4GAZA 2RDSA 5D2AA 4W65A 4XIKA 4QKBA 2D5HA 1GNHA 3OBTA 2QJVA 4QU1A 4OFGA 4KWLA 5C3OA 2WS93 2A6YA 3K75B 5EHDA 4OI1A 4ZZ8A 2VZQA 3H0OA 5JI7A 3VUOA 5C71A 4YM2A 2OVUA 1Y9MA 4TXWA 1LU1A 4A44A 3ES4A 2K9ZA 2RS31 1E57A 2D3PA 2A73B 2XWBB 4Q29A 4HBNA 2WO3A 1JZ6A 1FPN3 3VL9A 5FDBA 1K45A 2DV9A 1CIYA 4CXYA 3MICA 4IV3B 2ZJCA 3S5QA 5HXVA 5FMBA 5A6QA 3N9QA 1D2SA 4UWDA 1D4M2 1UIKA 3FLPA 1OH4A 4HVQA 3WG2A 2D3SA 1ZVFA 2Q1MA 1WMDA 3SKVA 3KF3A 4OHWA 2BFUS 1JN2P 2FBEA 1KS4A 4CDQA 3K51A 4LIVA 2W68A 3WQ7A 1SPPA 1VMJA 4Y22A 3OYWA 3Q8FA 3S57A 4RS5C 4XTMA 1VALA 5LA9A 5T5OA 4NROA 1AX2A 5IK7A 1ULCA 1OSGA 1W3XA 3WCSA 3WUDA 4MYEA 5DUUA 4CDQC 4AOCA 1V9U3 4AVSA 2F6BA 1RUD2 3RZGA 4QGMA 1YYNA 4P9YA 1FOD3 2ADDA 1EUTA 5FZKA 4LBQA 4KU7A 5EP9A 2CTVA 1OD3A 1ZBE1 1DQ4A 1QKQA 3PIJA 3WNOA 3P5BA 3N7LA 1RUH1 4XIOA 3K4DA 4ZU5A 3UGHA 1IKQA 1GZTA 3HT1A 1QJY2 2CAVA 3OD4A 2EIEA 2JE8A 3DUIA 1DLLA 1DZRA 2PQQA 3ASIA 1PX4A 2WIIB 4ZONA 3Q8BA 3MLJA 3RZZA 3LOBA 2YBSA 5GLTA 2R1DA 5FZ0A 4QX7A 1ACCA 5JIAA 4B7KA 1JZ3A 1GOFA 5KXEA 4QX2A 2J1UA 4MZUA 1SDDB 3FHQA 4Y1ZA 4MXWB 5GALA 3I3DA 3CO2A 1ZBA3 2NM1A 4BM8A 4ISQA 1SEFA 5AFEA 1U5YA 1MS3A 4OQ8A 2TNFA 2X05A 2W1QA 3LB9A 5FLIA 2OS2A 5FP3A 1VBE2 3ACLA 4CUAA 5BV6A 5IFPA 2HWE2 3POSA 3JUUA 3ZMNA 2YFZA 1E5SA 2AGSA 1X9PA 4A7YA 2R061 3MIGA 4I0BA 3W59A 4CCDA 4COYA 3IIAA 4E2GA 2EAKA 3DECA 3VGIA 3IDBB 1G9FA 3M3QA 3WNPA 1DLCA 4LHSA 3NVCA 5FPLA 3Q9OA 4ATFA 2Z5WA 1P8JA 2PMWB 2ZHLA 3H1MA 3MIEA 3JXSA 3FLRA 3N7KA 1O3RA 2WFF1 2Z79A 2IUWA 4Q0VA 4UBHA 4WBBA 4MGYE 2RS13 2FMDA 5J48A 5FPXA 1VRH3 2VZTA 3A4UA 5FPZA 2QE3A 5FY0A 4Q4V3 1QJX2 5JOYA 4Y5TA 3T08A 1J58A 1GSLA 1Q8QA 4I0WB 2GP5A 3S5AA 1UMIA 1PK6C 3O0XA 4JQTA 1VBB1 4I0AA 1NCRB 1EPZA 4E4ZA 1ZYBA 2G9GA 4KG0A 2FDHA 3NNFA 2W1UA 3I2FA 1W9FA 3LEKA 5EJZB 5GZEA 2WZR3 5EXOA 3P1IA 1YJLA 5D8AB 4QM8A 5A33B 3WQBA 4H3WA 1WCUA 4FQZA 3T1MA 5L9BA 1W2NA 2VR4A 1M06G 1HRI1 1ZRIA 4XABA 1I6XA 1RYYA 3G6JB 1JI6A 4FCAA 4E4DX 5C4WB 1W8UA 2N7GA 4MSVA 1IPKA 1O7FA 2VVDA 4XFFA 1S2EA 2E26A 3BYWA 3B7MA 2D93A 2JDPA 3I2IA 2K2SA 2QFEA 2OW4A 2XJUA 2E6VA 1DDLA 1NA1B 2NYYA 4MV2A 1N1YA 5HCHA 2R16A 1CESA 4PBPA 3AYAA 2DCTA 5A7SA 3RWKX 5A80A 3U75A 2VZOA 4AI2A 5C33A 2UURA 2CGNA 1UY2A 2RM22 4QDRA 4ZY9A 2Y34A 1ND2C 3AFGA 1RUH3 3WX5A 3UL2A 3ZM8A 3JU9A 4FOYA 2WA3A 4QX5A 5CU1A 1UU5A 4B4RA 4YG6A 4FPLA 1WW5A 4XUQA 3K2OA 3OF1A 4LLOA 2BZDA 3WP5A 1VBA1 1PMJX 3AKPA 1YFXA 3PHMA 4KWJA 4KQ7A 4L8QA 3OG2A 3KQRA 3TRSB 3BVCA 1OLRA 1ZZ7A 3NW4A 3I3QA 5LW9A 1HIXA 1YQ5A 1G9CA 4UI9L 4BLJA 5FY8A 2EXJA 1PX3A 3FBMA 4IE0A 1AR73 2ZKNA 2VZ1A 3ME2A 2VZUA 1RINA 2QBXA 4FFFA 2UWAA 3IDCB 2GAUA 3RDIA 4Z1VA 4MGKE 2ZBJA 2OZJA 2J7MA 1UW8A 1XPWA 2NZ9A 1W0OA 2A1XA 2IVJA 2VQ0A 3A21A 3H9AA 4XCBA 3H1YA 1FX5A 1C1LA 2ZPXA 3Q8EA 3J4UH 1QJU3 4XMIA 4EYUA 5J3UA 3LIHA 2B9UA 3DKQA 3VD5A 4XDPA 3TNPB 4C0BA 2UY9A 3D82A 5FZ7A 2F4LA 3B3QE 5DAXA 4MXWA 4BXFA 3JD71 1Q8VA 2ZGQA 2BUKA 3BOPA 1A78A 3ATGA 3SLIA 2ZOEB 3VD9A 4DS0A 5F37A 3M70A 2VUCA 5F6LB 2OUHA 3U07A 3ACIA 4ZS2A 4BQ2A 2YGMA 3OPTA 4YZ3A 5F3IA 4Y24A 3VHOA 5IW0A 1UL9A 2ZZQA 3DYMA 3PUHA 1PO23 4YFWA 3IIIA 5C8CB 4D69A 2W94A 2FDIA 2EXHA 1LOFC 2FQPA 2VC9A 5KXBA 5FY4A 3RMYA 5FPUA 3N9NA 1MS4A 4DUVA 4EWAA 2RR11 1XU1A 2D98A 4B7EA 1RC6A 2W08A 4DIQA 4FTSA 1BYHA 1LEDA 1JUHA 2D6LX 3NJYA 4JTOA 4QDSA 2KA3A 4AAXA 1XB9A 2JDNA 1H1MA 4CDWB 5FK8A 1QQP2 5J36A 1WMFA 2ZABA 4HN0A 3WDWA 1DQ6A 3PLQA 3GF6A 4AEDB 3GZEA 1FI2A 1WWYA 4XBNA 3B94A 3GJAA 5I8TA 3POFA 5JXGA 5H9QA 3C7OA 1SFYA 3GZUC 3IT8A 4FOWA 3NNLA 3BIEA 1NCRA 4ZS3A 3RZHA 2EIGA 4LHLA 1ZX5A 4DUWA 1KS5A 2KXLA 3UV9A 1N1SA 4AFMA 1TQ5A 3WXPA 3MIHA 2XL9A 3MEPA 1OC1A 4N53B 4FFIA 5D8AA 2BVVA 5A33A 4AVCA 3TEWA 3ZN5A 3POJA 3MFCA 4IGQA 3ZR6A 5J1XA 1ZREA 3DF0A 4ONUA 3T1LA 4AGVA 1NCRC 1DZTA 4XC9A 4YLZA 3ILNA 1Y3TA 3VDDC 5C4WA 4XJ9A 1UY0A 3NKTA 1YEWA 1RVF1 2WWJA 2X10A 4PHZA 5D8AC 4NHXA 3SXWA 2XL7A 1N47A 1NA1A 5BYNA 3PU3A 2WZ8A 4W4ZA 5A7OA 1B09A 3WNKA 5CYYA 3FN9A 1LHUA 2RS53 3HAGA 3J8F1 4W6YA 5C4WC 5IVBA 3ZYPA 1X7NA 1RTVA 5IUQA 2BOIA 1FV2A 1NXD1 3O0WA 4NIAA 5LEJA 1IQDC 1OXCA 2Q1ZB 2WN3A 2XQXA 4IDZA 5DABA 3VDCA 5EV7A 5JMOA 2XBO1 1S0CA 2GSYA 4HETA 4NMIA 5DAWA 3TAYA 1NA1C 2EIDA 2B39A 3NJXA 3WY6A 1OA2A 2HWB3 4DRVA 3AZWA 3HMYA 1X36A 1Q8OA 1GZ9A 3ZDSA 4EWEA 1MR5A 5F5CA 4NPMA 5JXHA 3NJZA 3PVNA 4KGGA 1I1EA 4XJAA 1UMZA 4HXCA 3RZLA 1QXRA 1OT5A 1Q56A 3CNAA 1CWPA 1VMFA 1ULGA 1GWKA 1POV0 2DU1A 2YPJA 4S2GA 4S2HA 4TWTA 4V1PA 3ZXDA 3N4MA 3PJYA 2AUYA 3AZZA 1PVC1 3IDEA 3KV6A 4AG4A 4HSJA 2BERA 1RXGA 2EALA 4IE6A 4CDUB 4MGQA 1SBDA 4UFKA 2VH9A 4LLFA 3NRUA 3VN4A 1K5JA 3KCYA 3ZIWA 2A6WA 1CZTA 1L7LA 2MEV2 3AMHA 4AE2A 2GDFA 3FZ3A 3N9PA 1ODMA 4ZZ5A 1RUC1 4K3UA 1TNRA 3J7LA 5JLVA 1OQDA 2EXIA 1O5LA 3H8XA 2GH8A 5L73A 4KH9A 2Q0AA 5DDJ2 4M4RA 3WV6A 2HYXA 2ZMLA 3ON7A 1J59A 4OI0A 2A6ZA 2RR13 1XNKA 1H4HA 5FXZA 5DG1A 4BQYA 1UZYA 4L99A 2D6PA 1UY3A 5FY1A 4IQPA 3NV4A 3E5XA 5C8CA 3I54A 5EZWA 2VUAA 1FMD3 3EXUA 1RUG2 1PIV3 4BWOA 1GZWB 2WO2A 4QXKA 1NOVA 3WNXA 1Z78A 2PYTA 4N43B 4KU8A 5J37A 4HPKB 2YC0A 3Q8CA 4AVBA 5DN2A 4Z8BA 2DYCA 3EJKA 5C8CC 1VLNA 3AYCA 2XMLA 3GZTB 4C0HA 1FATA 3VZMA 4RHV2 3S0MA 1RHI3 1AYN2 3KGZA 4CDWA 4YW6A 4P9WA 5I0RA 3KM5A 4YGDA 2JDHA 3N9OA 4K40A 1SCRA 2P6HA 1HB3A 1KDKA 4AEDA 1VBD2 1O3TA 1QHDA 3MYXA 4QD2A 3FBYA 1MZFA 2DVBA 5ABJC 3HPNA 3DN7A 2YGLA 1T2XA 2CHHA 5GLWA 4CDWC 1LOGA 1POV3 1WLDA 4R9DA 3MDPA 3BPZA 3I4IA 4N7UA 2QCSB 2RG4A 1V6NA 4N53A 1V6IA 2HWF1 1OOPB 2ZA9A 3U14A 2XPJA 2Y6JA 4JC1A 5T52A 4Q4W1 4Z2WA 2JKXA 3J7MA 3J8F3 2ZEYA 3WG1A 1Z7S2 4YGBA 2ARXA 3SHRA 5F5AA 3VKMA 1TMF3 3BUCA 2XUMA 4MADA 1EUUA 5FZOB 1EAH2 1OLQA 1XRUA 4N53C 3K4ZA 2DVGA 5CVRA 1REFA 4HMZA 4QXHA 4JVAA 3THTA 1R1A2 4AFCA 4DEVA 2XVGA 1YLLA 3MIFA 1ZNPA 3T3YA 1XJAA 4RGGA 1L3JA 3TN91 1F4AA 3AFKA 3DGTA 4SLIA 5T5JA 1MZ5A 3H1WA 3R05A 5JOZA 4HLTA 3PDQA 4QXCA 5A1FA 3DXTA 2FZ1A 2XJSA 2LS6A 3B00A 3LEGA 3NV1A 1PNGA 3RGBA 2SBAA 1O91A 5FZ8A 3VDBA 3KV4A 3QH6A 3AXEA 4IEOA 4K21A 1W6QB 3EO6A 4NVPA 4Y4RA 1WMXA 3AZXA 1N1VA 1ZZ9A 3J7NA 4EN6B 2P37A 4Y1XA 2AEYA 1D7PM 4O9GA 2BNNA 2WNOA 3HWJA 3T30A 1WD3A 1ZA4A 1US3A 5IVCA 3B9IA 1PVXA 4Q5OA 4H7LA 3VLBB 3I2OA 5DUXA 1HB2A 4W6WA 2FDGA 2D44A 2WQ8A 1A8MA 3OJBA 1ASJ1 4CDUA 3MI8A 5ISLA 4LE3A 3THCA 4CTEA 2YDEA 4I09A 4UBGA 5FIXA 3FMGA 3ZIXA 3VKOA 3PMSA 1X9TA 3LE0A 2RS32 1KEXA 2CWSA 3MZHA 2ZX0A 3JCIA 4JHTA 4KBBA 2VMFA 1W9SA 5E88A 3WF3A 3O0VA 5T5LA 2P3KA 1RUJ2 3D4KA 4A2UA 1RUF1 4IEZA 4CDUC 1RUOA 1AR91 3RJ2X 5FZAA 2YV8A 4IE7A 1JOBA 4NWVA 4JGZB 4RFRB 5EQUA 1PO13 5D1IA 2XJQA 1JHNA 3EHKA 1G6NA 5FYUA 2BQPA 1HJFA 5CAZA 5TSWA 2B9VA 4LUKA 4LITA 5IAXA 2ZGTA 3FFZA 1T6BX 1LKNA 1ONAA 4IEWA 2QDNA 2XUEA 4XJZA 5BNOB 4YGEA 5KC5A 1GZWA 2P5BA 3M1HA 2WQ4A 3AM2A 1EPWA 1O4YA 1QH7A 3PVBB 4N43A 4D0QA 4QX3A 5F7UA 2VD7A 5C3PA 4HPKA 1JZ7A 1BEV1 1CR7A 4NUBA 3T2PA 1QWRA 4CEWB 1OQ1A 2A3WA 1S1AA 1W2TA 2CDPA 2ZHKA 5FPAA 1NAEA 2JEMA 3BB6A 4N43C 4V2VA 1SLCA 1ZBE2 1PGW1 1GZCA 5BY5A 1NCQB 3ZXAC 2F4PA 1XBFA 4NHMA 3JBG1 2SLIA 3MLLA 4BQWA 1EP0A 2R6QA 4Q4W3 1XE0A 3ZSLA 3O1RA 5C5TA 2V5YA 4B4QA 2DFBA 3EB7A 5K8SA 2PN5A 2O14A 3MV01 4KL1A 3SCHA 4OHZA 1UIJA 1CX4A 1DQ0A 1S55A 1J1TA 4IEPA 2WS91 1OOPA 4YM0A 4LK6A 1JTZX 4RS5B 2HWC3 2D3RA 2I45A 4GKXA 5E89A 3U37A 4RSUA 1XNAA 1GWLA 2VNOA 1GQPA 5CFCA 2BPA2 4KBZA 5FZOA 3JQXA 3BTYA 1SPPB 3WDTA 2HWD3 2JE9A 1PM4A 4XFBA 3LWCA 4NRQA 4FPJA 2HH9A 1QEXA 3FJSA 2XGXA 4K8FA 4LUMA 2JDMA 2C26A 4HONA 4YM3A 1QOOA 3RFRA 1OH3A 1SMVA 3I2HA 5CFCC 3ZYGA 4CU7A 5E16A 5A3WA 1JZ5A 3V0BB 1YFWA 4AI3A 1POQA 3JB8A 2R0FA 2R062 3O1TA 2OPWA 2B46X 4CCEA 1PGSA 1W99A 3C7HA 3ZDVA 4IE4A 5KXCA 1GQHA 1OUXA 3GHNA 4D6SA 3LF7A 1JODA 2WYSA 1WLCA 1W6QA 1RJ7A 2WDBA 3HQRA 4RGKA 2DFCA 2DVFA 5LASA 2GC1A 2DUOA 5IVFA 2J1RA 2WFF2 1V9U1 3RYPA 4TTGA 3THPA 4CCCA 5FJHA 1FOD1 1YUDA 5CG9A 2QZ2A 1C8M2 2UYBA 2X8KA 2WT2A 3IBMA 3LKJA 5CNAA 3PUIA 1BLZA 3RSJA 4OUSA 1MQTB 1HQWA 2ATFA 3C7GA 4URTA 4W50A 1JZ4A 4OUEA 3VBOB 1VBB2 4E4HA 3KV5A 3P6BA 3UYJA 1AR83 4K7JA 4Q1RA 4QB1A 2X09A 2ZX3A 4JHZA 4BMEA 4Y20B 1LHWA 2R043 4ZKTB 1DZQA 1RUI2 4H55A 4O7XA 5D21A 5FLJA 3QH7A 5KR7A 5JI9A 5DUVA 4HVRA 3D3AA 4MGSA 2QQNA 1HRI2 4CU9A 1AR63 2VOKA 1SFNA 4P08A 4JGZA 4NIIA 3WDVA 5F1RA 4NJ4A 1MVEA 3RMXA 1F2NA 5FLHA 2VUDA 2OUJA 3BU7A 4S2DA 5FY5A 1YXWA 2Y64A 1V00A 1ZBA1 1Y4WA 1JU4A 1N3OA 4H7MA 5G04L 1SACA 1YRZA 2R073 2YU1A 1JZ2A 3ZKYA 4JGZC 5BNOA 2WNEA 5JIUA 1GNZA 4RGAA 4GMP0 3ZFFB 2VNRA 5FZLA 3BI3A 1ULDA 5F3CA 1KXGA 1PK6B 3T0BA 1QDCA 2VXRA 4CEWA 1U5ZA 2DCZA 4CU6A 4C1WA 4M00A 5BNOC 1YIFA 1VBA2 5FWEA 5EIYB 1YFUA 2E33A 3HNYM 1NCQA 3KGLA 4DNYA 4EN7B 4CEWC 4P00B 3SCFA 2Y33A 4NHLA 3C7EA 4GJZA 1J3QA 2RS11 2CWMA 1Q8PA 4LNVA 2RE9A 4LPLA 2HLEA 2IWGB 4QHOA 1VRH1 2C9KA 3QOPA 4K8RB 4IEUA 2UY8A 4Q4V1 4DXSA 1NCQC 3MLKA 4FP3A 3D0JA 4P9XA 3A7QA 3FWEA 3GCXA 3H7JA 4LBJA 4Q4X3 3SITA 2LUWA 1H4GA 2P2KA 2ZTNA 4RS5A 1VRBA 4BLIA 1NKGA 5C70A 4B1MA 1KFUL 1TME2 1RL3A 1U5IA 4YFZA 2WZR1 4KGQA 3JD72 4HKWA 4QB2A 1ND2B 1OD5A 5DDJ3 3AMNA 2YPDA 5LBBA 3NNMA 4NO4A 2IFRA 3POYA 4MUVA 1HJGA 1QMJA 3WF0A 5DXDA 5A6XA 3ZXKA 3K4AA 3TNQA 1CPNA 4AI0A 4XFCA 2EVXA 1DGWA 1LGNA 4NPRA 5JR7B 4YG3A 1AL23 5LBEA 1REEA 4KG8A 4COVA 3BCWA 4DMIA 3V0BA 2ENRA 3VL8A 1D0HA 4FT8A 3ZYRA 1ALYA 2Z2SB 3IZOA 2B42B 3HQXA 4Z2AA 4DRRA 1OQEA 5FYTA 4OVEA 1AYM2 1OA3A 4XTPA 3WP6A 5BNNB 4J1XA 4TLGA 1SLIA 4GMP3 3D0SA 4FPHA 2XHNA 2V4VA 2C24A 4DEQA 1CGPA 3IN9A 1AYN3 3B69A 2JECA 2JB8A 3K77A 2B45X 1DP0A 3M3CA 4MVTA 3HR9A 5FREA 4XXPA 3M3EA 2RMU2 5HCAA 1V6KA 1A8DA 3WHTA 1RUE2 1UD1A 3HQUA 4PT6A 2VBDA 4Q0QA 4XZUG 3RI8A 3TWIA 4XHBA 1MQTA 2VTXJ 2VECA 5I8YA 5DZFA 1YWKA 3I2DA 4A4AA 2WC2A 3VBOA 4EE2A 1QIQA 1S0DA 3W21A 2GH2A 1RMU1 4QU2A 1IOAA 5FZ9A 2PHLA 2FHRA 2X5IB 1AR71 3O5SA 4Y20A 3RYKA 3FUOA 5A3NA 2R49A 3N35A 4B4PA 3THDA 4TLFA 2E7TA 1W9WA 4QGLA 4ES8A 1MQTC 2ZAHA 3DYOA 4JCKA 3VBOC 3ZYJB 1QJU1 2ERFA 4AQ6A 5LA0A 4J25A 3N7MA 2A6XA 1COV2 3WR0A 2OA2A 1OHFA 3NMBA 3ZSKA 2EXKA 1RVF2 4BA6A 1SG3A 3LDBA 3ORJA 1UPIA 3ZFGB 2O1QA 4KI5M 5FWJA 4ZXKA 4UW3A 1HXS2 3TEXA 4BE3A 3R0RA 4R52A 1GYKA 1ZZCA 2TBVA 2GNBA 1OLMA 2QKDA 3I3MA 2VO5A 3CF6E 1XC6A 2LW8A 4W6XA 3OB8A 1O8SA 3ZFFA 2QQMA 1W8WA 3KMHA 5A32B 3CLPA 1PO21 1R082 1HQLA 2GMPA 5GM0A 2XBO2 3UGGA 2IFWA 4QKDA 1VE0A 2TEPA 5GZDA 4AEMA 1PK6A 2G1MA 2JG9B 1SFPA 4I3PA 4R9CA 5JVVA 2R1BA 2JDUA 2MNGA 5LK7B 1GBGA 3ZFFC 4EJRA 1LENA 1BQPA 2V5DA 1TNFA 3O1OA 2PHWA 5LEKA 1ENSA 1SLAA 2P1BA 4QQHA 2DVDA 4QMAA 4EROA 5F8PA 3RZJA 3DEMA 3KQ4B 5BPXA 4LO7A 3AKQA 2JE7A 3ALQA 2XG3A 3MFAA 4WM7B 4XF3A 3VDDB 4AHYA 4QXBA 1ZRFA 1PVC2 4Q8LA 2O8OA 4QGNA 5JUVA 4ZXEA 4AHXA 3WW3A 2WLQA 5FYSA 3MGUA 2LROA 3ZOIA 5T5PA 3LA7A 1VP6A 2DF7A 4N8MA 2ZEWA 5EJ1B 5C9AB 3OBRA 3V0AB 4YZ4A 3FHAA 2Y0IA 1N3QA 1W2AX 3KD4A 3ES1A 1RUC2 5F2WA 2D43A 4MLOA 4DPNA 4PBOA 1UX6A 1ND2A 3CU7A 1TE1B 4GULA 4WZCA 1X8EA 3OOXA 1CJDA 3AB0A 3QBQA 3LGRA 4LBOA 2WT0A 5IYYA 1PGL1 5FKCA 1XXNA 2D6NA 1MEC1 1UAIA 5FMDA 1GWMA 1IZ3A 1WLWA 2AZ5A 4G3YC 2W39A 4MHRA 2GC2A 1D4VB 1ENRA 4OI4A 4RA0A 4D94A 4E8DA 1VBC2 4LKDA 4BJ0A 4FTEA 2Q1FA 4ARXA 3ITQA 1Y9GA 2Y60A 2VW1A 4LK7A 1ODNA 2OQ6A 4UT5A 4AVTA 3WG3A 3VKFC 4GB33 2RS51 1NLSA 4XAAA 1ND3B 5GJ6A 3MW4A 3WCRA 4E9KA 2PLV1 2C1FA 1IS4A 3T0AA 2QQOA 2WNVB 4QPGC 1F5FA 4R4ZA 4CZSA 3ZXGA 5J09A 2JENA 3DXUA 2HWB1 1RMU3 1W6PB 2ARCA 2VG9A 2VMDA 3F2ZA 1QXPA 3POBA 1XOYA 2ZMKA 3MW3A 3L2YA 5BNNC 1MS9A 1BMV1 3RS6A 1W39A 3OUHA 5IWFA 1PMHX 5IVYA 4FPFA 1KRIA 2AREA 1UNBA 3RVHA 2J1VA 4P9JA 4O65A 4NPLA 4HK9A 1IHMA 2VMIA 4LULA 3KVBA 5F3EA 3LIGA 3LPGA 4GKYA 4PLMA 5AC93 2XJRA 5I93A 5FP8A 1OVSA 5IVVA 5L9VA 2GN3A 2X5IA 4XUPA 5C3QA 5EFUA 1K5MA 1UKGA 4BXSV 3ZSJA 4FAGA 2HWF2 3C8XA 3ZX7A 1JOJA 1EV12 1LOFA 3AP5A 4FO9A 2WBKA 3CKHA 4R8HA 4BH9A 1HRV2 1OVPA 4Q4Y3 2IXHA 2VUJA 5A1AA 1H9PA 3WW1A 5BNQA 1MACA 2VCAA 2ZGRA 1BBT2 2X5IC 1UZWA 4DFSA 2XJVA 1K5MC 1L7QA 4LBLA 4OZOA 5CB7A 3SH3A 1XNCA 5F6KA 1SQ4A 2HEWF 3ZFGA 5JMCA 4XUNA 1DGRA 4BB3A 3VBUC 4URAA 1HV0A 3R6SA 2J1EA 3PUAA 2A75A 3I2JA 1HW5A 5AFBA 5C7GA 5I0DA 5LRSA 3TN92 3ZPOA 4A6SA 2JXAA 2BOJA 3OGRA 4CUCA 5FO9B 5JXJA 4Q8KA 2W87A 5A32A 3TEYA 1JHJA 4QPYA 3ZFGC 2ZGMA 1RXFA 1C5HA 1XSQA 4CUGA 2JG9A 5DPNA 5ABJB 1FMD1 4ET7A 1OFSA 2JD4A 4AGGA 1PIV1 3OGGA 4YW4A 5FYIA 1I9RA 3AMQA 2J1SA 3CJIB 1LOAA 4LXLA 5IATA 1RUD1 2FCUA 1JZ8A 1IG3A 2NMOA 2XVLA 3SQOA 3VBSB 2JG9C 4WM8A 2ZGKA 1RHI1 2EAAA 4HANA 5FZEA 4HFSA 4WM7A 4EZ4A 3AZYA 4YW2A 3VDDA 4AHWA 4GJYA 1NUKA 1O6UA 2VNGA 3H8RA 5FP7A 4PDWB 1F4HA 4JKMA 1J3PA 5F3GA 5KWRA 3WT3A 4XPVA 1HLCA 5L19A 1ASJ2 1CPMA 5KHIA 4IUGA 3POWA 1W2UA 3ILRA 4WM8C 4IXLA 1UOBA 4WM7C 3SNMA 1MEC3 4EN9B 3K3NA 2VQAA 4KMQA 3NAPB 4L9BA 5C9AA 1EYBA 3V0AA 1POV1 1HKDA 3HN1A 4A7ZA 5I91A 3VZOA 2UYAA 4Q2FA 1KFXL 2BRTA 4X8NA 2Q8CA 1W8HA 4E4SA 2UWBA 4FVVA 1AR92 2NP0A 2VY0A 3IAPA 4AF9A 4XACA 4LA2A 4HSLA 3VZLA 5C9AC 5L36A 1QU0A 2PLV3 2VW2A 1DG6A 2WKKA 3USUB 1TMF1 5AVAA 2WL1A 2VCBA 5J96B 2QQKA 2VVFA 5EPAA 4PI2A 3TBDA 4FPGA 4XFAA 1STMA 2HWE1 1GP4A 1ND3A 1WBLA 3WP4A 4L11A 4M0NA 2GNDA 5LB6A 5CZKA 1HX6A 1BEV2 5FTTC 4X6QB 1T6GC 5ACA2 1O3SA 1ZRDA 2P34A 2WNVA 3QACA 1U12A 1W2OA 5E8AA 1W6PA 4YVWB 4LBMA 3DL3A 1BVP1 3ZFEB 5F32A 1ND3C 4DXZA 1PGW2 1VJ2A 3PNAA 3O7OA 2NLRA 3AKSA 2W3JA 3OBZA 2P3JA 3ZXEA 1FNZA 5H9SA 4LHNA 3E1F1 2WNVC 2E51A 2B4KA 3MW2A 4FTBA 2VBPA 2WZPP 3C7FA 4QQOA 3T4VA 4F7ZA 5BUVA 2V72A 1WGPA 1X33A 2ADEA 2OZ6A 2RDNA 3ETQA 4E2QA 1SBFA 4KNCA 4BQ5A 1ZZ6A 4XVHA 1W6NB 2WS92 1D4M3 2GMMA 4XUTA 4ZPIA 4LO6B 4JKKA 3LAGA 2BYVE 3WNMA 1CONA 4QPIB 5FCCA 3ZSMA 1JS9A 5CISA 5IK5A 3ZYFA 1XSRA 3M4FA 4PQ9A 4XQDA 1FPN2 1NG0A 4RR3C 3IKWA 2P3YA 3VV1A 3N36A 2YHJA 4YARA 4AR2A 1YFYA 3T2OA 1XYPA 3RQ0A 1YC61 1QNWA 4DZGA 4J1WA 1IG0A 3O1SA 3AL6A 4NIHA 3AVSA 5FFOC 2GU9A 4FQ4A 4UW6A 4XJ8A 1PO11 3O1MA 4XW3A 4IGPA 4CEYB 4CDXC 3OGVA 1YO8A 5FOBB 1YIPA 1RUD3 3LFIA 3GNEA 4MXVA 4LE4A 4CCMA 2P3IA 1UF2C 4JDOA 2BBVA 2ZXQA 3PU8A 5ABJA 1UXZA 3GZAA 2DWRA 3H7YA 4BK5A 4HKOA 3E6CC 2ZGNA 2V4AA 2XHKA 3TYJA 3CJIA 1ZZ8A 3RRDA 5KBFA 1AXKA 5SV5A 2CDOA 2JICA 4LTAA 1QJY3 4R4XA 5LY1A 5JSRA 3VBSA 2PHFA 1FOD2 3IWZA 1TZOA 1F8VA 5FOJB 4JRAA 4Z92B 3O12A 1AL0G 1ENQA 3CJIC 4PDWA 5FQ0B 2NQYA 4QAWA 4AWDA 3N9LA 5JXIA 2R32A 4YM1A 4DXRA 3K3OA 3PMEA 2Q4SA 1BJQA 4Q0UA 3ZXLA 4E2SA 4PCRA 3WG4A 4BPZA 4AI9A 3VBSC 1DGRN 1H30A 2QZ3A 2VOTA 2WLPA 1R092 5FXVA 3NAPA 5B4NA 2PAEA 1OFNA 3GBGA 5T55A 5CFCB 5FR3A 2E63A 4PDWC 1RB8G 2RV9A 3WVJA 1NX9A 3FHIB 3ZXFA 2DU0A 3P3NA 4R9AA 5FUIA 3ZLIA 4ES9A 1VBE3 3NV2A 5IVEA 3B9CA 1RJ8A 1COV3 4AXOA 2XONA 2HWC1 4LHKA 1DYOA 3L2HA 2HWE3 4IL7A 3VHRA 1OBNA 3NAPC 1LHOA 2CSGA 2JDKA 3BN6A 2ZZJA 3VKLA 4TN7A 4AQTA 4CUBA 4I2OA 2PTMA 2VMHA 1HXS3 3LSDA 3USUA 2OPKA 5KXDA 1ZBA2 5FP9A 2OKXA 5A3LA 1UN1A 2EF6A 2JDZA 1S0BA 3ZKUA 2HWD1 4OHYA 4P9IA 2R7EB 2YBKA 4LO4B 2DDUA 1E5HA 3T2TA 2KR2A 1R083 4FI9A 3WW2A 3ZXJA 1E5RA 2FCVA 1OURA 4LORA 4CA9A 4HN1A 2DURA 4A3ZA 1CAXB 2Q30A 5IJRA 5IK8A 1XQNA 1QJX3 2WO1A 2WSUA 4YVWA 3ZFEA 3GXUA 4MOAA 3LSEA 4IEQA 4MHUA 1HN0A 4Q0SA 3SMHA 5HCBA 2XJPA 4XQWA 4LBNA 4NHYA 1WLTA 4UYBA 5F5IA 3KVAA 1AUYA 1XE7A 2C9AA 4Y1UA 2JKBA 1QDOA 5CKQA 5FZBA 1OUSA 2RS12 2RJ2A 4RFT0 1H1AA 4YVWC 2D6MA 4AFDA 3ZFEC 1G9BA 1VRH2 1BK0A 2JX9A 3N9MA 2WWUA 1UZ0A 3IAQA 4Q4V2 3W9AA 5BXXA 3EYPA 5T50A 2WQZC 5JDBA 2XXZA 1IS3A 4XDOA 4LA3A 3S7EA 2V73A 1W6NA 2PHRA 2RJKA 4CPBA 1A34A 1W9YA 4YWAA 4N9HA 3UESA 1AR81 1CJPA 3WP3A 4Y1VA 3ZVXA 1Q43A 1LHVA 2C5DA 2VAUA 3TOJA 2R041 2QNKA 3BOWA 3BGAA 4QPIA 2GNMA 2WZR2 4FXKB 3SKJE 1GQGA 1V0AA 1SLBA 4W8JA 3JB4C 1ENXA 4NRMA 1ZZBA 3LPFA 2YC2A 2CNAA 2FDFA 4INDA 3W20A 4GXLA 1AR61 1HB1A 3GBFA 4EZHA 2DVAA 1F9KA 1VBC3 2RM23 2Y6KA 4QPIC 4JAAA 3KCXA 4UFHA 5A7NA 4FPEA 2D6KA 2D5FA 4IEVA 3GGLA 4CEYA 5C3RA 2WRAA 4IGOA 1S0JA 3M2MA 4CU8A 1WUVA 3E5UA 2VM9A 2AR6A 2R071
chains in the Genus database with same CATH topology
5DZEA 3GALA 2ZACA 1NXMA 5KHJA 3B5LB 3HT2A 4GA9A 4CEYC 1DBNA 1B35B 1RUH2 2UU8A 1NYWA 1XNDA 3VBHB 2LM3A 4QM9A 1WCSA 4AQSA 1M4WA 2E7QA 5GZFA 5FQ0A 3WQ1A 4CP2A 3R4SA 1PMIA 2BWAA 1AXZA 2R30A 2X29A 3HBZA 1W6OB 3MIDA 3RI9A 3CL1A 5LRRA 1AR72 1RIRA 1W0PA 5I0TA 3S30A 2CY6A 4MX3A 2GC0A 4IV1B 3E6DA 4I30A 4N7IA 4RD7A 2VOXA 1DQ1A 4XILA 2HYKA 4Q4X1 2D6OX 1QJU2 1H2KA 1MS8A 2MEV1 2GZWA 1IPJA 5JPMB 5JSOA 2TUNA 4NOTA 5DZGA 2FMYA 5DDJ1 5IK4A 1J3RA 2PAKA 4X8PA 2R0HA 1C1FA 2XB6C 4MGIE 4AEJA 1NQJA 4MH0E 4XF9A 2AH2A 1AL21 4K9SA 2KM2A 4XOGA 1IKPA 1QQP3 2QUOA 1RUG1 2QQPA 1X82A 1CAXA 1S0IA 1XYOA 1WCKA 4ZU4A 2YYOA 3U10A 3WDUA 3VHNA 3CEWA 4GMP1 4YVSB 2CL2A 5JZGC 2QDRA 2E53A 2RHPA 2VW0A 1IS5A 4BIFA 1AYN1 2O0OA 2B5HA 1WD4A 2Q5TA 4RQPB 5H9RA 1VIWB 2I74A 4ORFA 3I59B 1AJOA 1LB2A 3S7IA 3WDXA 5DG2A 4PLNA 3KS7A 4ITCA 4QQLA 4FP2A 3PVOA 1BCXA 2BW8A 2NMNA 5JAXA 4BQ1A 1DYPA 3GHMA 3APBA 4A7KA 3GBWA 4FPCA 4AFBA 4RL7A 2ZGUA 3ENRA 1LESA 5K0UB 1PGL2 3IPVB 5T54A 2BGCA 4PLOA 2BWCA 1SDWA 3KT4A 3OCPA 4YSFA 4LT5A 4JDMA 3RPQA 4PF5A 1F5JA 1W6MA 5FMOL 1G86A 3U0ZA 2IXLA 2A3XA 2RS52 1DU3D 1H8TB 4XFHA 4COUA 5F5QA 1MZ6A 2ES3A 4WVZA 5ACA3 1C28A 1MS5A 1PZ9A 3NV3A 3KLSA 1B35A 3DPRB 1CIWA 5FAXA 4AEKA 1H9WA 1V6JA 4OLLA 2HWB2 2IC1A 2O8QA 1JYCA 5KHHA 2HKXA 3VBHA 1BMV2 3V64A 3BTAA 4CP0A 4Y26A 1B35C 2ZX2A 5I8SA 1VB2A 3FLTA 1DQ5A 1W6OA 2MEV3 2VGDA 3J26N 2E7AA 3WZ1A 3VBHC 2HEYF 4WV8A 3A0NA 2XLAA 1FNYA 1DGLA 4DY5A 1PNFA 1UKRA 4IV1A 4F8AA 1IS6A 1O5UA 3UKVA 3AP4A 1CAUB 1Q5OA 3PJQA 2ZHNA 1CAWB 4XQ4A 4XDQA 4DOUA 4AGRA 4IV1C 1RUJ1 1V70A 4EWDA 4QPGB 1RUG3 4AI1A 3O14A 2MPFA 1FT9A 1NY71 1JXNA 3USSA 4D7TA 3L9JT 1TEIA 2LALA 2RR12 1C3HA 1XNBA 3RWNA 5L7OA 1PM7A 4NHKA 4O9EA 4FBFA 5C6CA 4RHV3 3WUCA 1GKBA 4Q1PA 1FMD2 1LU2A 1PIV2 1JBCA 4GB31 3AKTA 1UCXA 5L7OC 5I0SA 1VBD3 4ZU7A 2H0VA 4YVSA 4AVAA 5HI0A 2A5ZA 2I2SA 2G9FA 1GR3A 1LEMA 1RHI2 1AX0A 1D2QA 4RQPA 3V65A 3EQEA 1Y43B 1FXZA 2JG8B 3VBFB 2ZAAA 3I59A 4YZ2A 1K5MB 1QH6A 2K0GA 1V6OA 4YVSC 3VZJA 3VZKA 3VBUB 3ZYIB 1WA4A 3ROUA 1Z7S3 4RQPC 1R093 1JYIA 5AC91 1C57A 1BKZA 1Z0HA 4GALA 1EAH3 4WVVA 4B29A 4P9GA 1R1A3 1WBFA 3KT7A 4FOQA 3ZN6B 4AQ2A 2EA7A 1MVQA 4Z82A 3LA2A 3AP7A 1HDKA 5K0UA 1CVNA 2NPIA 4Q4Y1 4HZFA 3J8F2 1SCSA 2HEVF 3IPVA 5SV8A 4XETA 4R9BA 1TMF2 4CRQA 3LZZA 4JTNA 4FPOB 3R4DB 5DUWA 2A7AA 1S2BA 4XF0A 1LJ7A 2DTYA 5K0UC 1REDA 1AF9A 4XXAA 1R1ZA 3A0KA 4CP1A 1H8TA 5HCFA 4XZPA 3U11A 1KJRA 5CIRA 4TYSA 3C3VA 4GH4A 1U5XA 3DPRA 3PVEA 3AKRA 4WM8B 4ASLA 1S0GA 2X53S 3LCPA 1OMIA 4C1XA 3HD8B 1H8TC 2IXIA 4HK8A 3INAA 4L92A 4GH4C 3DPRC 1S0FA 4U2AA 4EV0A 3E97A 2RS33 3B02A 2P17A 1C8M1 2CAUA 1OPOA 5KC6A 2PHXA 3VKNA 1RUJ3 3WLUA 2Y38A 3DKWA 1Q3EA 3J9SA 4DQAA 5FO7B 4YG0A 1CAUA 3ZMOA 3UJQA 1RUI1 3E5QA 4B3NA 1CAWA 4FAHA 4P9LA 2H6CA 3OPZA 4MGZE 1OPMA 1BZWA 2CGPA 4IV3A 1GV9A 1WW4A 2UWCA 3D5OA 3AMPA 1F31A 4QPGA 1H8VA 3D6EA 4GQ7A 4YRDA 1PO12 1S2KA 2WNUB 1MS1A 3UK9A 2DCYA 4IV3C 1V6MA 1H2NA 3FX3A 1ZBE3 5FMOS 4JDNA 1LOEA 3P3PA 2ZMNA 3IM0A 1NLRA 2XJTA 2ZX4A 4IERA 1VAKA 1WW7A 1QY4A 1QOTA 1XE8A 2WWSA 4F3JA 3C2UA 3AK0A 4PIXA 2VVEA 3UKTA 2JG8A 3VBFA 4OULA 1QXJA 4RR3B 2DUPA 1XU2A 4Q27A 1QJZA 5FO8B 3VBUA 1AJKA 4Y5Z0 4Q4W2 4UXAA 2XWJB 1GANA 2XH6A 5A3MA 2JG8C 1ULFA 3VBFC 3WHUA 4CDXB 3H3UA 2XVKA 2DCKA 4J6GA 4UW5A 3WOGA 3ZN6A 1D4M1 5K7PA 3AX4A 2HWC2 1TME1 2PELA 1GICA 1WMEA 2E9QA 5GKAC 3JZVA 2R063 2ETEA 4COWA 2A71A 2H6BA 2A3YA 2HWD2 5GZCA 4Q26A 1N3PA 1O4TA 1WCDJ 1IQAA 3JQWA 5T3NA 5H9PA 5JOWA 3OD0A 4L2NA 2B7YA 1LULA 2WFF3 4K1YA 3URFA 2D40A 3FE5A 2CV6A 2Q8OA 2D7FA 1AYM1 1C8M3 3NO8A 1MS0A 5CG8A 2QVSB 3AYEA 4HVOA 1LRHA 2WSVA 1VBB3 1YI9A 4S2FA 1NQDA 4AFAA 5JPNB 1QJY1 2GC3A 2RMU1 2W52A 1KITA 2AYHA 1RUI3 1RUE1 3NL1A 5C8WA 4DINB 1GLHA 3QLQA 3G7DA 1FYUA 3R4UA 1HRI3 1RUF2 4P14A 5B2GB 3I8TA 3LA3A 1AVBA 4D7SA 2W0XA 2YROA 4I02A 1AR82 4IEXA 1UZZA 1Y9QA 4EN8B 2R042 2PFWA 4PJYA 4XHXA 5GLUA 4META 2ILMA 3N7JA 2ZCWA 1KJLA 4YZ1A 1RITA 1LCLA 1VAMA 1VBE1 2ET1A 1AR62 1COV1 3U4XA 1VR3A 3WD5A 1G9AA 2WNUA 4LEJA 4IEYA 1H0BA 4COZA 2VU9A 1HXS1 4K6BA 4M3CB 4Y1YA 2R072 1LR5A 1VBA3 1D0GA 1SLTA 1ZRRA 3NWKA 1QF3A 3PTYA 3QD6A 4XJWA 4UW4A 4SBVA 4LO8A 2WNUC 4JGYB 1R081 3JBG2 3WW4A 3EBRA 1JW6A 1H1IA 4M0HA 3ZN4A 3AZVA 2H0BA 1QJX1 4M01A 2ZGLA 1NE6A 4K20A 4P5HA 4RR3A 1CN1A 1J1LA 4YYOA 4TZDA 4EN0A 4FXGB 4BOWA 1TME3 2WT1A 2GN7A 3JD73 2CGOA 4CDXA 1LECA 4Z2WA 4XBLA 3ZO0B 1U0AA 4Q4X2 4ATEA 1FAYA 5J7MA 1G7YA 1CQ9A 2BNOA 1AX1A 4QHBA 2Y0OA 2A6VA 4GWMA 5FBZA 3VBRB 3UJOA 4LO5B 4XEZA 3RJRA 5LK5A 3E6BA 4U36A 4YNIA 1DIWA 4WZFA 1A6CA 4XMAA 1MZEA 1DYKA 1AYM3 2A70A 3ILFA 2IZWA 2WFPA 3D8CA 1IGOA 2YUEA 4XF1A 5JWPA 4G9SB 1VBC1 2RM21 4QQPA 2IXJA 4BMBA 1AL22 1G9DA 5IT6A 1PHMA 2I07B 5JSPA 1V9U2 2OIIA 2RMU3 4AHZA 1RUE3 4N9IA 1YJKA 3OTFA 5K9YA 1H2LA 4QT6A 3ZPYA 1CAVB 4LBKA 1LHNA 2PHUA 4WVWA 3UKNA 1ULEA 1Y7BA 5CFDB 5BNPB 3X29B 1FV3A 3FFQA 4XFIA 3N3HA 2DTWA 2HJIA 1AZDA 2GMEA 2VOVA 4NR1A 3KB5A 4JV4A 3QCWA 4D7YA 2D97A 1RVF3 3OGJA 2XLFA 1O3QA 4OUMA 4AEDC 4AI8A 1LOCA 2OYZA 1EV11 3WINE 3KZ4C 1WW6A 1HRV1 1KD7A 3OY8B 2ZHMA 5JOXA 4GWNA 4B8EA 3DV8A 5EYXA 1BBT1 3MPBA 4WVMB 4LBQD 2XBO3 1PZ7A 5JZGB 4FPYA 3V56A 5HBAA 4XYXA 4FOVA 4M3CA 1QGLA 4DB5A 4I3GA 1DGWX 1NE4A 4HL0A 4AK3A 4XBQA 4E27A 1UU4A 3RG0A 2XKOA 4JGYA 2VOWA 2C0ZA 2DCJA 3H50A 2IXCA 1QQP1 1V6LA 4AW7A 4KWKA 2WA4A 2ET7A 1PVC3 5J98B 4HKLA 4CYDA 4OHXA 2AENA 4JGYC 1X8MA 2PAMA 4AYUA 2IXKA 2MHFA 1X50A 2YZ4A 4K1ZA 1UPSA 4QQ2A 2G4IA 3W58A 4YW1A 3RNSA 1RUC3 3AP6A 4L97A 3H8UA 2WJSA 3AJYA 3ECQA 5KHGA 1OKQA 4BYYA 4G4FA 1YNAA 2BFUL 4PIYA 4Z07A 1ZM1A 3TB0A 3GYDA 1KQRA 3MF9A 1A3KA 1H2MA 1SLLA 3VBRA 1OA4A 1DHKB 1W6MB 1BXHA 3M8LA 2CYFA 4A3XA 2ZX1A 1RGSA 5F9TA 5FRAA 1NY72 5EWSA 2LTNA 3I7DA 2YY1A 1SBEA 1I5ZA 3KT1A 3VBRC 3M3OA 4GIQA 2VPVA 3B01A 1O4ZA 2BEOA 2B8MA 2VULA 1VB4A 5GZGA 4AVVA 3BALA 1YCIA 5EYYA 4BHPA 4XFGA 3AYDA 1QOSA 1JH5A 3H3ZA 4M3CE 4GB32 4XE9A 4Y4YA 3VZNA 2DUQA 1C8NA 1RUNA 1AXYA 1UU6A 1GFF2 5ACA1 1BK1A 1CAVA 1DF0A 4JRLA 2BTVC 4OZXA 4YW3A 4X6RB 3WDYA 5E1RA 1RMU2 1NZCA 1DFQA 4PIZA 3FUQA 1LGCA 4BIOA 5CFDA 5BNPA 1ZRCA 2HWF3 3B93A 1EV13 3BODA 1HRV3 1BVVA 3MF6A 1LGBA 4ASMB 1BBT3 5AC92 4OHVA 5CFDC 5BNPC 3WQ0A 5KHKA 2XLGA 2BVBA 3NKGA 2PHDA 3IMNA 4YGCA 4TSVA 1LODA 3AP9A 3OY8A 4H14A 3TN93 1I3HA 1KDMA 4Q4Y2 4M3CF 2RJLA 4WVMA 4IETA 2PHTA 5L7OB 3M3IA 1FPN1 4CDQB 2V09A 4Y22B 3OYWB 1PO22 1OOPC 5JZGA 2PA7A 3CJXA 1LOBA 4BZ4A 3ZSEA 1C4RA 2Z42A 2VMGA 1N1TA 1HV1A 2Y26A 5AVPA 1PZ8A 1CD3G 4BCUA 4YZ5A 4RHV1 2NN8A 3LOIA 1YI7A 1S0EA 4I01A 3ELNA 1HQNA 4LBQB 4N90A 1Q8SA 1G8WA 3AMMA 2FZ2A 4XF4A 2ZGPA 1QNYA 1VBD1 1ASJ3 5EJ3A 1DQ2A 3SCGA 1YHFA 2ZKLA 4DY3A 4Q0PA 5JCTA 1JUIA 2GNTA 2ZGSA 1RUF3 3SISA 4C90A 1AR93 1AHSA 2GALA 3NSTA 1LTEA 4D3WA 1Z7S1 1R091 3KCCA 1MEC2 3ST7A 4OI2A 1EAH1 3VHPA 1VAVA 3SH4A 3FC0A 1R1A1 2ZS6B 4FPKA 1XYNA 2ARBA 5I0UA 4C91A 2BNMA 2JJ6A 4HT1T 2YXSA 2ZGOA 3BIWE 4LR4A 5GLVA 1C5IA 3RYRA 3AJZA 1BEV3 2PLV2 3S6PA 5CADA 3MPPG 4XJUA 2XKPA 4GH4B 4ISRA 2Z69A 4NN0A 2WINB 4YW5A 3M7AA 3MIBA 4IESA 1EY2A 5CA6A 1OI6A 1APNA 3JBG3 4NWWA 3HIFA 5GLZA 4F83A 4JQRA 3AXDA 3KSCA 3SH5A 1URXA 3K48A 4FSJA 2YMZA 4W65A 4XIKA 2D5HA 1GNHA 3OBTA 2QJVA 4OFGA 4KWLA 2WS93 2A6YA 4OI1A 3H0OA 5JI7A 3VUOA 4YM2A 2OVUA 1LU1A 3ES4A 2K9ZA 2RS31 1E57A 2D3PA 2A73B 2XWBB 4Q29A 4HBNA 1FPN3 3VL9A 5FDBA 2DV9A 3MICA 4IV3B 2ZJCA 5HXVA 1D2SA 1D4M2 1UIKA 3FLPA 4HVQA 3WG2A 2D3SA 1ZVFA 2Q1MA 1WMDA 4OHWA 2BFUS 1JN2P 2FBEA 1KS4A 4CDQA 3K51A 2W68A 3WQ7A 4Y22A 3OYWA 4RS5C 4XTMA 1VALA 5T5OA 1AX2A 5IK7A 1ULCA 1OSGA 3WCSA 3WUDA 4MYEA 5DUUA 4CDQC 1V9U3 4AVSA 2F6BA 1RUD2 4QGMA 1YYNA 4P9YA 1FOD3 4LBQA 4KU7A 2CTVA 1ZBE1 1DQ4A 1QKQA 3N7LA 1RUH1 4XIOA 4ZU5A 1IKQA 3HT1A 1QJY2 2CAVA 3OD4A 3DUIA 1DLLA 1DZRA 2PQQA 3ASIA 2WIIB 3MLJA 3RZZA 3LOBA 5GLTA 2R1DA 5JIAA 4B7KA 5KXEA 4MZUA 4Y1ZA 4MXWB 5GALA