1QOTA

Lectin uea-ii complexed with fucosyllactose and fucosylgalactose
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
236
structure length
234
Chain Sequence
SDDLSFNFDKFVPNQKNIIFQGDASVSTTGVLQVTKVSTTTSIGRALYAAPIQIWDSITGKVASFATSFSFVVKADKSDGVDGLAFFLAPANSQIPSGSSAGMFGLFSSSDSKSSNQIIAVEFDTYFGKAYNPWDPDFKHIGIDVNSIKSIKTVKWDWRNGEVADVVITYRAPTKSLTVCLSYPSDGTSNIITASVDLKAILPEWVSVGFSGGVGNAAEFETHDVLSWYFTSNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lectin
molecule keywords CHITIN BINDING LECTIN, UEA-II
publication title Structural Basis of Carbohydrate Recognition by Lectin II from Ulex Europaeus, a Protein with a Promiscuous Carbohydrate Binding Site
pubmed doi rcsb
total genus 51
structure length 234
sequence length 236
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1999-11-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1qotA00
1YIFA 1DFQA 2P37A 1WW5A 1N3OA 3FUQA 5GZCA 4M3CA 1W6OB 2Q5TA 4HANA 1G9DA 4YGBA 3SLIA 2NP0A 1DQ5A 1BXHA 1ULCA 3LCPA 4I30A 4ATEA 1H9PA 1JYCA 3JUUA 1S0IA 3OBTA 3NV1A 3O0XA 1HDKA 2R49A 2WNEA 2WSVA 3B01A 4YGEA 4XBNA 5DXDA 2D6NA 5AVAA 4BPZA 3POWA 3TB0A 3OY8A 1G9FA 2ZGLA 4ITCA 1VLNA 1MS3A 1TEIA 1N3PA 1WD3A 2OVUA 4LBQA 1N1SA 1W6QB 1O4YA 2AGSA 3MPPG 1MS5A 1G9CA 2D3RA 1QNYA 2UURA 2DUQA 3NWKA 1QF3A 1QDOA 3KM5A 1VIWB 1SLLA 2ENRA 3AP7A 4YM1A 5GZGA 4CZSA 3IKWA 2TEPA 2ZGSA 4ZKTB 1U0AA 2ZGTA 4FPEA 1KITA 4HL0A 1C1FA 1Q8OA 2JKBA 1IS3A 4R9CA 4ASMB 3PVEA 3FLRA 1LOBA 3ILFA 1ULGA 3OGGA 4FPCA 2WT0A 3AJYA 1MS9A 3RMXA 2DUOA 3V0AA 1IOAA 1ULDA 4XJAA 2VXRA 4Y20B 1CJPA 1UKGA 1GSLA 1Q8SA 3M2MA 3HN1A 1LGCA 2EXIA 1GZCA 2ZGRA 4YM3A 3AZZA 1V6IA 3O12A 3WDXA 1Q56A 5GZDA 1DQ0A 1WLWA 5IK8A 4YM2A 3ZXKA 3BODA 3ILNA 3OYWB 3IMNA 4FPGA 3UL2A 2JE9A 4NO4A 1QU0A 3B3QE 2ZGNA 1D2SA 4YZ4A 1WLDA 2CY6A 3M3OA 3AFKA 2I2SA 2ZMNA 1AX0A 1BKZA 1S1AA 3IM0A 4CRQA 1S0DA 2UWBA 1ENSA 2WQZC 5GLUA 1YRZA 3WDWA 2ZGQA 2R1BA 2WJSA 4GXLA 5H9RA 3GNEA 1W6NA 2W39A 3M1HA 1YYNA 1G7YA 3PVOA 2CNAA 1DZQA 3AXEA 1DQ1A 1DQ4A 3AXDA 1DGLA 5DUXA 1GICA 3WVJA 3WHTA 1RIRA 3ZXEA 1CESA 5F9TA 4Y24A 1ULEA 4P9WA 2DVFA 2ZHNA 3R05A 5H9QA 4Y1VA 2AH2A 4YG3A 1HQWA 2SLIA 3O5SA 3O0WA 4U2AA 3DUIA 1UZZA 2WT2A 3ILRA 4Y1UA 1AX1A 5SV8A 2ZGUA 4AVSA 3AYAA 3JU9A 1CQ9A 1JUIA 1MZ5A 3WNXA 3WUCA 2E53A 1V6LA 2A7AA 2AREA 1S0EA 2UU8A 3SNMA 5IK4A 1N1YA 1CIWA 4BQ1A 1ONAA 4TYSA 2A6WA 1FAYA 3T2TA 4RL7A 4XE9A 2CL2A 1GZ9A 4C1XA 1LECA 4UW6A 1S0CA 2GDFA 2PHXA 3WG2A 1MR5A 1S0FA 4WVWA 4OZXA 5GALA 2AYHA 3WUDA 1LTEA 1JYIA 5GLTA 3VUOA 1S0GA 3B9CA 1HKDA 3ZXJA 3VKMA 4BLIA 3N7LA 1FYUA 1GZWA 3RMYA 1V6OA 1QOSA 1SACA 3M3QA 3PVNA 4ISQA 4Q8KA 1RINA 1RITA 1LENA 4D69A 1AXKA 2EXJA 3I8TA 1FATA 4AGRA 4XDQA 4WV8A 1KQRA 1Q8VA 5KXBA 2WLQA 4M3CB 5IUQA 2YROA 5DZEA 1QMJA 2XG3A 1MVEA 2A6VA 2EF6A 3AZVA 3OPZA 4K20A 1SLBA 3B00A 2ZHMA 5EYYA 3AZXA 4FP2A 4LBLA 5JLVA 4Y1YA 1JBCA 1SBEA 3MEPA 1ENRA 2A3WA 4P9XA 2E7QA 2H0BA 2VW1A 2A3YA 3GALA 1QNWA 4M01A 1KRIA 2CWMA 3OY8B 1BYHA 1LU2A 3HMYA 5GLWA 3WCSA 5DG1A 5E88A 4LBQB 1QDCA 1FNZA 1YXWA 1N1VA 3MW3A 5BYNA 3V0BA 2ZACA 1IKPA 1LOCA 1AVBA 3IPVA 2ZGMA 1BQPA 1SCSA 2W08A 2D7FA 4K1ZA 1UPSA 1LODA 3UJOA 4XJZA 1SFYA 2D6PA 1S0BA 4YGCA 2FHRA 1W6MA 2RHPA 2DU1A 2ZA9A 4XMAA 1ENQA 1QOTA 2R0FA 1LOFC 2A70A 2ARBA 4LBJA 3USUA 4C1WA 5CA6A 3A4UA 4GKXA 1F5FA 4ATFA 2VW2A 5L73A 2ARXA 3V0AB 5T55A 4SLIA 1JHNA 1GNZA 2GMEA 4Y22A 1C57A 4FOWA 3HR9A 3ZPYA 4YG0A 2PELA 2B7YA 1LEDA 3WDTA 2D6OX 2JD4A 2GNMA 4AGVA 2DWRA 3D6EA 3POSA 2BQPA 3ZXFA 1IS6A 1AF9A 3V65A 2JE7A 2CWSA 5DUUA 5HCBA 1CVNA 1PZ9A 3ATGA 3RQ0A 1G9BA 3SISA 5JDBA 3RRDA 1FNYA 1LGBA 1Q8PA 2GNBA 1DBNA 2P3JA 1AX2A 3OBRA 4P14A 2CTVA 2ERFA 4ZXKA 1MZ6A 1LEMA 4KBBA 5FREA 1V6NA 4YLZA 2PHTA 4YZ1A 2GMMA 1W6PA 4GWMA 4Q8LA 1CPNA 1JN2P 3A0NA 2WT1A 1ULFA 1W6NB 5EWSA 2GNDA 4XJWA 5FRAA 1CR7A 4XHXA 1MACA 1GANA 2ZKNA 3L2YA 3R4SA 2YV8A 4YZ5A 5JOWA 1LGNA 1AZDA 4GWNA 4UW5A 2YZ4A 4YZ2A 1MS0A 3AX4A 5F5QA 1EPWA 1S0JA 1PZ8A 4TZDA 2ZHKA 2OUJA 4PCRA 4XOGA 1UX6A 3VKLA 5JOXA 4Y26A 3I4IA 4BOWA 1LULA 1G86A 3BTAA 4FPKA 2AUYA 3N36A 2AR6A 4XTPA 4XYXA 1N3QA 1Z78A 4AWDA 2GN3A 2EAKA 5HCFA 3ZYRA 3RG0A 1W0OA 3ZSKA 3ZSLA 4BMEA 2D6LX 3WHUA 1WBFA 2Z42A 2GN7A 1F9KA 4XJUA 2ZGKA 2UWAA 5JVVA 4XJ9A 3ZSMA 4YFZA 4NOTA 1UMZA 3MW4A 3INAA 3FFZA 5T54A 2P3IA 1APNA 1SCRA 5KXDA 3WOGA 1DHKB 1KJRA 1IS4A 5KXEA 4FPOB 1DYKA 2P3KA 3SH3A 2DTYA 2VH9A 3M3CA 1MS4A 3APBA 4R9BA 2GNTA 4XZPA 1HLCA 4F83A 1GZWB 5CNAA 4YZ3A 1Z0HA 4XHBA 2WSUA 1A3KA 4AGGA 2A6YA 3FBYA 5DUVA 1LOAA 4XBLA 1UZYA 3VV1A 2DTWA 4AVVA 2YXSA 3V64A 3LSDA 2NN8A 2ZAAA 3RS6A 1V6KA 5DG2A 5LK5A 1URXA 4DRRA 4LBOA 5DZFA 1J1TA 4FVVA 4LBNA 4GA9A 1D0HA 1QOOA 3N7MA 2ZBJA 2JJ6A 2FMDA 3OJBA 2WKKA 1LHVA 3SH4A 3R4UA 1LU1A 2PHWA 1DIWA 3Q9OA 5CB7A 4PQ9A 1GV9A 1BZWA 2ZHLA 3DGTA 3SH5A 4U36A 5T5PA 2D3PA 3V0BB 2YMZA 4GALA 4JC1A 3IPVB 1LHOA 3BOPA 3PJQA 5H9SA 2C9AA 5GM0A 1H30A 1Y7BA 2D6MA 4Y1ZA 5E89A 1G8WA 2E6VA 1UAIA 2R0HA 3AZYA 1AXZA 1F31A 4Q2FA 3AK0A 1W6MB 5T52A 3UK9A 3WV6A 1JW6A 4RA0A 1Q8QA 2G4IA 3USUB 1AXYA 4Q1PA 1A78A 2D3SA 3AP5A 5CAZA 4P9YA 1LHUA 1SLTA 1MS8A 2LALA 1AJOA 1KJLA 1VAMA 1V00A 2DU0A 3O0VA 3QLQA 4XXAA 3AP4A 4Y22B 2E51A 4YW5A 5KXCA 4XIOA 2PHRA 1GBGA 1W6OA 1SBDA 1CONA 2ZGPA 1LOEA 4BMBA 2ZABA 4K1YA 1V6JA 2NM1A 1UN1A 1WW7A 2SBAA 3AYCA 2KM2A 3FLTA 4LBMA 2NMNA 5T5OA 5E8AA 3CNAA 2ZMLA 1BJQA 4YW3A 1IKQA 4L8QA 4ISRA 4FQZA 3NV4A 4WVVA 1MS1A 1H9WA 2PHUA 1W6QA 5DUWA 2DYCA 3ASIA 2A71A 5GLZA 1GYKA 4M00A 3LSEA 4Q27A 1IS5A 3AYDA 3W58A 4AYUA 1C1LA 2UWCA 3N7KA 3NV3A 4XIKA 3T1MA 1W6PB 3FLPA 1N47A 1LJ7A 4BM8A 4UW3A 4Z8BA 5IT6A 1WW4A 3WCRA 1KDMA 1HQLA 1VAVA 1X50A 2VUAA 4FQ4A 3D5OA 4YGDA 5GLVA 1CPMA 2NZ9A 3VKOA 3U4XA 1SLAA 1A8DA 1AJKA 4M3CF 2EALA 3C2UA 4Q1RA 2A3XA 1FV2A 2NMOA 3WDUA 3ZSJA 2E7TA 3D4KA 1I1EA 4XTMA 5CBLA 3QCWA 4W65A 4YFWA 2ZZJA 3AYEA 4Y20A 1V6MA 3BIWE 3H0OA 1SLIA 2LTNA 5JOZA 2DUPA 4XILA 1MVQA 3ZVXA 1LCLA 4YM0A 3AJZA 4M3CE 4WZFA 5DZGA 3M3EA 4H55A 2W68A 1JOJA 4PBOA 1NLSA 1PZ7A 1WUVA 2DVBA 4FP3A 3WG1A 1N1TA 1NXD1 4FPYA 1GNHA 1LOFA 3OYWA 4XJ8A 2ZMKA 5EYXA 4Q26A 4FOQA 4FPLA 4R9AA 3PMEA 1DQ2A 3POYA 3WLUA 1G9AA 2CYFA 4FPHA 2AENA 2PHFA 1B09A 4FOVA 4K21A 4LBQD 4AVTA 1CN1A 2VW0A 3WZ1A 4BLJA 5T5LA 2YY1A 4XBQA 5GJ6A 5HCAA 1LESA 4FPJA 3AP9A 1FX5A 1JXNA 1WD4A 1R1ZA 3B69A 4DFSA 2JDZA 2C5DA 3N3HA 2DVGA 4MYEA 1OQ1A 2A5ZA 1XQNA 3WDYA 2V73A 1ZA4A 5IK7A 3W59A 1WLCA 2GALA 4FPFA 5EXOA 5T5JA 3N35A 2DURA 2DVAA 2D44A 3RSJA 2OW4A 1WW6A 4LBKA 4UW4A 4YG6A 1LOGA 3NV2A 1DYPA 4Y1XA 1VALA 2DVDA 4JCKA 4CTEA 2JECA 4PBPA 2R16A 1DQ6A 1FV3A 2A75A 4R9DA 3VKFC 3WDVA 1QGLA 1SBFA 2OUHA 1OKQA 2V5YA 1LHNA 4DQAA 2A6ZA 2XB6C 1YI7A 5IK5A 1W0PA 4DPNA 1QKQA 3AZWA 3A0KA 4IQPA 2R1DA 4YW1A 1GKBA 3KQRA 3T1LA 3WG4A 5T50A 2D6KA 1WCSA 2ES3A 2EIGA 5GZFA 2A6XA 2VY0A 4JRAA 4XMIA 1DLLA 3SITA 4DS0A 4YW2A 1SLCA 1GLHA 1O4ZA 4FOYA 4YW4A 1WBLA 3WG3A 1KDKA 5H9PA 5JOYA 2ZGOA 2DV9A 3MW2A 3IN9A 1I3HA 1C4RA 3AP6A 3VKNA 1YO8A 3UJQA 3ZXLA 1UL9A 1OFSA 4XXPA 5JMCA 2GMPA 2NYYA 3TAYA 2P34A 4PF5A 2VU9A 4DRVA 1LHWA 2D43A 2W52A 3ENRA 1ZM1A 4GKYA 5GZEA 2P2KA 3N7JA 3FUOA 3ZYPA 2EXKA 2HYKA 2EXHA
chains in the Genus database with same CATH superfamily
1YIFA 1GNYA 1BBT2 4QXCA 4QU2A 5CEHA 4N90A 1TME2 4BK5A 4IV1A 1D2QA 3CIHA 4TWTA 4ZZ8A 4EN8B 2VECA 5C71A 3SLIA 3LDKA 3FWEA 1BXHA 1ULCA 3LCPA 4I30A 3THPA 3PUQA 1COV1 4P00B 4QAWA 3VLBB 4CA9A 3O0XA 1HDKA 3U10A 1K5JA 3VDBA 4COUA 5L9RA 4BPZA 4LIUA 4JGYA 2RJ2A 3TB0A 3NNJA 3MV11 4ITCA 1WD3A 1N3PA 1H8VA 4WZCA 4CUAA 4LBQA 1HB1A 4TSVA 2VZSA 2W87A 1HQNA 4XUTA 3ZDVA 4NHYA 4LOTA 3HNBM 1VBD1 3RZMA 4LNVA 1OQDA 2R063 1ZBE2 5JZGC 3P5BA 1JYXA 3KD4A 3KM5A 2IXKA 2WN3A 3GZAA 4IE7A 1NCRB 4IGPA 5ACA3 5DAVA 1SLLA 4CP9A 3IKWA 3ZFFC 1K5MB 1UIJA 1YHFA 2O14A 1OSGA 1U0AA 2JG9C 3KCXA 1C1FA 4ET7A 4R9CA 4ASMB 4BU2A 3FLRA 4OI4A 3OGGA 3WF2A 3GHMA 1WGPA 4B7EA 4QXKA 4BQ5A 1MS9A 2DUOA 4NPRA 2CDPA 3HBZA 2ZX1A 4P9GA 5DDJ2 4CP2A 1CJPA 1OXCA 1Q8SA 4KMQA 3HN1A 3SCGA 4NIGA 4LT5A 3USSA 3T08A 2VUCA 5AFEA 1AL22 5FTTC 2Y60A 1EPZA 1V6IA 1W3XA 4CDXC 1PIV2 1Q56A 3MIFA 1DQ0A 2JKXA 4YM2A 4ES8A 4NIIA 1ALYA 3RI9A 3ZLIA 1W0NA 3ILNA 1QJEA 4H2AA 3VBRB 4BQXA 2JE9A 3VHNA 2R043 1KXGA 5FMOS 5LBCA 1UYXA 2P6CA 2ZGNA 5FJKA 3I2OA 2XQXA 1JUHA 2EIDA 2ZZQA 5AVPA 2VO5A 1AX0A 1S1AA 5ERLA 3W20A 4CRQA 3VN4A 1S0DA 1X82A 1ND2A 2ARCA 5M0TA 4E9KA 2LRPA 1XJAA 4JZRA 5FMOL 5C4WC 4GXLA 4QKDA 4Q4W2 3FHIB 1SFNA 3ZMOA 2HJIA 4IE0A 1DZQA 1MEC3 3AXEA 1VBA2 4JRLA 1BK1A 3WVJA 2BV4A 1CESA 2WFF1 2YBKA 1OUXA 5I8TA 1ULEA 4NIDA 5A3NA 1B35C 3SQOA 3R05A 1BBT3 1TME3 2AH2A 4YG3A 1HQWA 3O5SA 3DUIA 1LNSA 5FY4A 5D21A 4AVSA 5IAVA 2MEV1 2BPA2 2E53A 4CXYA 2C1FA 1OHFA 1RXFA 2NQYA 4I0AA 1S0EA 1Z7S2 1O5UA 2BOJA 2UU8A 1IG3A 5IK4A 1CIWA 1PMJX 1DG6A 1ONAA 1FAYA 1E5SA 2V4AA 5F3GA 4XE9A 4IV1C 1GZ9A 4PHZA 4AQTA 1XE0A 2Y6KA 3VZKA 3KV6A 2BNOA 1H6XA 3OSDA 1ZBE3 3A7QA 4FO9A 4PT6A 4NUBA 3CF6E 1UU5A 4MSVA 3URFA 4L9BA 4PDWB 5FZ6A 1R092 5GALA 1JYIA 2EICA 4EV0A 3B9CA 3ZXJA 3VKMA 5JXJA 2K0GA 1NA1B 3EYPA 4NHLA 4LTAA 4BLIA 1BEV2 5D1IA 5C8WA 1GZWA 2VOXA 5LASA 4Q8KA 3PVNA 3M8LA 3DL3A 2WN2A 4D69A 5DAWA 4OQ9A 1WCQA 2WO1A 3N9QA 4D6SA 4JVAA 4XDQA 4PIXA 4WV8A 5DDJ3 4B4PA 4XETA 5KXBA 1CAVA 4P02B 1QMJA 3PU3A 3ZN6A 3OGSA 2DF7A 2JB4A 4YVWC 5FZBA 4F7ZA 2ZEZA 1AL23 4CCKA 1JBCA 3AKSA 3I2IA 3NJZA 3ZXGA 5BNOB 1VMFA 1DGWA 1PIV3 3MEPA 5HBAA 3RZJA 3VHPA 5IHRA 1OURA 3C7HA 1QNWA 1VBE2 3U0ZA 3Q8CA 1J84A 2W95A 4LA3A 4KI5M 4RHV2 3HMYA 4A3ZA 2ORXA 1N1VA 4XZUG 4QX1A 3MW3A 1JOPA 1NUKA 1LOCA 4FFIA 1AVBA 4O7XA 3WF0A 4A41A 1BQPA 3ZFGB 3H1WA 1SCSA 4YVSA 4MXWA 4B8EA 5FUNA 4XJZA 4FTBA 4Q4W3 4D6RA 2Q0AA 1W6MA 1VBA3 1ENQA 1GQGA 2DBIA 2R0FA 3USUA 5FZ8A 5J96B 2QQWA 2JDNA 5I8SA 2VZPA 2QQPA 2X5IB 2VW2A 4B3NA 4BQ3A 3H8XA 5EZWA 3MZHA 4CCJA 3V0AB 5T55A 1JHNA 1ND2C 2GMEA 2HWC2 2WDBA 1C57A 4B4QA 4FOWA 4K8RB 5J1XA 2ARAA 4QMAA 3UV9A 1VBB1 3AKPA 3ZIXA 2R32A 5KHJA 1ZREA 2PELA 4XCBA 5FZEA 4JX0A 5JWPA 4XF9A 2JX9A 2AZ5A 2DWRA 2Z79A 3SC7X 1Z7S3 3LE0A 4PLMA 4LK7A 2CWSA 5DUUA 5CG8A 3ATGA 2WZR1 4AAXA 1YLLA 4GWJA 3KZ4C 4NAMA 4P14A 2E31A 3G6JB 1UCXA 4CDQC 2CTVA 1HV0A 1DU3D 1KS4A 2VTXJ 4WM7B 1J58A 2ERFA 3K4AA 4AW7A 1V6NA 3OBZA 4XCAA 4R8HA 5TSWA 3UKVA 5A6QA 5JR2A 1W6PA 2DCKA 1R093 2D40A 2YU2A 4GWMA 3BKZA 1ULFA 1W6NB 3MIEA 4XJWA 1CX4A 4HLTA 4GULA 3WP6A 5BY5A 3W9AA 4JAAA 1BEV3 3R4SA 1D7PM 4YZ5A 1W03A 3LWCA 3DPRA 3P3NA 3RGBA 1R081 4E2GA 3ZO0B 4LE4A 5FY5A 4YZ2A 5F5QA 4RQPB 4IW3A 2IZWA 2Y64A 2HWE1 4PCRA 3MO4A 4Y26A 4BOWA 1KD7A 1OLMA 3KQ4B 4LO5B 5IWFA 4N43A 5A3TA 1RUC1 2QE3A 2GC2A 4UYBA 4AWDA 2EAKA 1VBE3 3KT1A 3UKTA 2TUNA 3ZSKA 1HV1A 5F3IA 2WNUB 3T2OA 3ZYRA 4RHV3 2D6LX 3POJA 4Y3OA 2WIIB 3WHUA 2XDVA 5AC91 2WL1A 4RGAA 2H6CA 3O1MA 2JEMA 5FMCA 3UKNA 3E5QA 4I02A 3ZSMA 4ONUA 1OMIA 1H2MA 1E5IA 3IIAA 3FFZA 1WMDA 3INAA 5FZHA 3FE5A 1APNA 2J22A 5LBFA 1QXJA 2ZXQA 2CSGA 1KJRA 2QQLA 3KV4A 2VNVA 2XL9A 5KXEA 1DYKA 1AUYA 2XR4A 3E6BA 3ECQA 3GZTB 2VH9A 5JSOA 4MVTA 1W8WA 2RS51 4HZFA 5FLHA 2X05A 1YEWA 1Z0HA 2WSUA 4P9JA 5F5CA 4TTGA 1HRV1 1HB3A 5DUVA 2ZPXA 4CEYC 1TNRA 5A6XA 1CZVA 1PK6B 2HWC3 1J3QA 3VBUA 3KB5A 4FFGA 4NRMA 2VCAA 1V6KA 5DG2A 1SPPA 1QJU2 1URXA 2Q30A 3ACHA 4DRRA 4EN0A 2CGOA 2D93A 2J7MA 1TG7A 2Y38A 5EJ3A 4GA9A 3HEIA 1QOOA 2VBDA 5C8CC 2JG8B 3N7MA 2IC1A 2ZBJA 1QJFA 5JXIA 3F2ZA 1OLME 2BZDA 3R4UA 4IE6A 2PHWA 4DY5A 1L3JA 2WNVC 4FAHA 1PHMA 3Q9OA 5GKAC 5FPBA 2ZEYA 3I54A 3PMSA 5C5TA 2JB8A 5JSRA 5FMBA 4JC1A 5HV0A 3IT8A 1L7RA 3BOPA 3PJQA 5FPXA 3ELNA 2D97A 1H30A 1IPKA 1VR3A 5FQ0B 1G8WA 1IQDC 3DXUA 3AZYA 3CLPA 4KH9A 4Q0VA 4UAPA 4CUBA 3GBWA 2Y6FA 3J7MA 5IJRA 4Z07A 1VMJA 2D3SA 4XFBA 5I0TA 3GGLA 3MLLA 1SLTA 1MS8A 3CJIB 3THDA 1AJOA 2DU0A 1KJLA 1VAMA 1Q5OA 1TMF2 3BPZA 3O0VA 3QLQA 4XXAA 1H1IA 4YW5A 5EJ1B 1CIYA 2R061 2Y26A 4HSJA 5A1FA 5KXCA 1CAWA 2BERA 1K3IA 3U78A 3SXWA 4OLLA 3WNLA 3S7IA 5ACA1 3MIGA 1YUDA 4BMBA 1HN1A 2RS31 5A33A 3POFA 1OD3A 4JDMA 3IIIA 4QQLA 4SBVA 2P6HA 1UN1A 3ETPA 5FYVA 2KM2A 2WO3A 5F37A 3POEA 3LOBA 3CNAA 3NJXA 4A2UA 2VOWA 4ZU7A 2EIEA 3A22A 1MS1A 2VNOA 4QB6A 1OOPA 2DYCA 3ASIA 5FUPA 3ZFGA 4RR3B 1GYKA 1YJKA 2MNGA 1NOVA 3FHAA 4N43C 1UWWA 2WC2A 3SEEA 2WS92 4LMFA 3S5QA 1C1LA 1K45A 3I3BA 4COYA 4ZZ5A 3T1MA 3I3EA 3ZN5A 2IVJA 4MV2A 1DCSA 2LUWA 1YFUA 4A42A 4AL9A 1O4TA 1MQTA 3ES4A 4UW3A 1WW4A 2BNMA 1QH6A 4QPGA 4GJYA 2JDPA 2R041 2NZ9A 4AI8A 4C90A 2ZX2A 3GBGA 1A8DA 4M3CF 5IVYA 1IPSA 4QWNA 3OPTA 4I09A 4XTMA 5B4NA 4Y4RA 5FY8A 2Y34A 3QCWA 1XYPA 3NL1A 5FDBA 2XJUA 1L7LA 3B9IA 5JZGB 3BIWE 4HPKA 1SLIA 1UNBA 5L7OC 4XILA 1MVQA 1W9YA 4KL1A 1UXZA 1QJU3 4YM0A 4ASLA 4WVMB 1XU1A 3THCA 3FMGA 5DZGA 2GAUA 4OHVA 1YQ8A 2DVBA 3WG1A 4FP3A 4AEDC 4A7YA 3PUHA 2Y0IA 3WQ0A 4IEWA 4KWKA 2JDYA 2ZMKA 1H8TA 2W1SA 4Q26A 4R9AA 1W2OA 4XDOA 3DYOA 1QQP2 4GJZA 1DQ2A 1GWKA 5CG9A 5FZ7A 2EIBA 1BBT1 2Y6LA 1B09A 2E7AA 4LHNA 1WLTA 4BLJA 3WZ1A 3RZKA 3VBOA 4MGIE 2BFUS 3I2FA 2I45A 3IZOA 1OA3A 4XQ4A 4XURA 1NYWA 2WZEA 5LY1A 3UGHA 3H1YA 3N9LA 4AFDA 1RUD2 1FX5A 4A4AA 1RHI2 5FPVA 5BPXA 2JDZA 4MYEA 3DN7A 3H9AA 1A8MA 5IK7A 4K9SA 3W59A 3AC0A 4HKLA 3SCFA 4BQ2A 5LA9A 2DURA 3CKHA 2DVAA 2R30A 1QXPA 3T0BA 1LOGA 3NV2A 1TMF3 4JQTA 2WNOA 1HXS2 1UU4A 2QUOA 3HJRA 3AMMA 2QQKA 3I2DA 4D7SA 4R9DA 4AQ2A 5C4WB 2RDSA 2OUHA 4DUVA 2GC1A 2V5YA 4UFMA 4MXVA 4XPVA 5FZGA 2PFWA 1J3PA 2WINB 4DPNA 4IQPA 1GOGA 2OPWA 1NCQC 5HXMA 2AC1A 2Y8KA 3T1LA 3AKTA 5T50A 1PVXA 2BNNA 2EIGA 1B35B 5K0UC 1NT0A 1GFF2 4P5HA 4JRAA 4NIAA 1RUJ2 1SLCA 1GLHA 5DDJ1 4FOYA 3MUY1 4YW4A 2X8KA 2WS93 2O1QA 2RJKA 2VAUA 3UT0A 1AL21 1R082 2JXAA 4LQRA 3R6SA 4FT8A 1C4RA 4KNCA 4AFMA 4CEWC 1AR71 2B42B 1YO8A 2C26A 1NQJA 3DF0A 1UL9A 3VDDB 3T0DA 3PTRB 1VPHA 2K46A 4ZS3A 5JMCA 2GMPA 4NJ4A 3TAYA 2P34A 5K7PA 5FOJB 4RS5A 1JI6A 3FFQA 3VD3A 4BJ0A 5FK8A 5A1AA 3V56A 3MHZA 1RUC2 3DYPA 5GZEA 3N7JA 1T6BX 3BOWA 5CFCA 4J1WA 1DFQA 4PI2A 1W9FA 5FYUA 4C0BA 4UXAA 4HT1T 4M3CA 5FY1A 1W6OB 3O14A 4HANA 4OVEA 1G9DA 2VL4A 4QPGC 1DQ5A 4LR4A 1JHJA 4P08A 4XQDA 1POV3 2OPKA 3VD4A 2FQPA 1S0IA 2IXLA 3NV1A 2R49A 4JQRA 1XRUA 2WNEA 1AYN2 4XBNA 2D6NA 3POWA 2VMEA 4DEVA 3OY8A 1I5PA 1CAUA 1QQP3 3ZDSA 3MDPA 1RUH2 1MS3A 2OVUA 4AZZA 5JXGA 3RYKA 1W6QB 2W9XA 1O4YA 2AGSA 4IEXA 5C3PA 4COWA 1OPMA 4CVUA 2RS52 3MIDA 3NAPA 4CDWA 1G9CA 4YVWB 2DUQA 4EN9B 4Z2AA 2B9UA 1HIXA 4IEPA 2BVVA 3TWIA 4LKEA 1RUD3 4K40A 1RHI3 1IG0A 1MPXA 2W92A 4CZSA 5A80A 5BNNC 1Z7S1 3RFRA 2QFEA 4XUOA 3KT4A 4HL0A 1KITA 2QKDA 5C70A 4CPBD 3VBOC 3VBSA 1LOBA 4Y5Z0 5LY2A 2RDQA 1YFXA 4GH4A 2Z5WA 2AEZA 1W39A 3WNKA 1TVGA 1ULDA 1HXS3 4Y20B 1HRI1 2VCCA 3M2MA 1GSLA 4AK3A 1LGCA 1R091 2ZGRA 4XW3A 4QQHA 5JI9A 1F4AA 2B5HA 3CHXA 3T3YA 3KWVA 1F5JA 4QX8A 3BODA 3OYWB 3ZFEC 1BEV1 4TLGA 4I0WB 4QB2A 3IMNA 2ZJCA 3K75B 3OGRA 2VC9A 3THTA 1O3QA 4ZPIA 4IV3C 5FZIA 5JUVA 2VZ3A 1D2SA 1RUJ3 1WLDA 4MADA 3RZHA 2ADEA 2I2SA 1M4WA 2DCZA 1BKZA 1ULPA 5FPAA 1R083 4AI9A 4YYOA 2G9GA 5A7WA 3WY6A 1NXMA 1YRZA 1UO9A 2ZGQA 3OUIA 4A44A 3K51A 4EN6B 2Q1ZB 1VBE1 3PVOA 2CNAA 4LHKA 3ZYJB 1DQ1A 2BWAA 1ENXA 4RHV1 5JXHA 2XMLA 2PLV1 4HFSA 5CKNA 1RUC3 2RS32 3WHTA 4CDQB 4P9WA 2ZHNA 5KR7A 4OMDA 5FAXA 5H9QA 4EZ4A 3RYPA 2GU9A 1QH7A 1W99A 4GWIA 1FXZA 2VXJA 4MHRA 4O9GA 5FV3A 1UZZA 2P17A 2WT2A 4WVZA 4CDUA 1AX1A 1OC1A 5FZKA 2ZGUA 3A21A 3AYAA 4BWOA 4RS5C 1JUIA 3WNXA 3RDIA 1D4VB 1V6LA 4UF0A 1AYN3 3SCHA 2E63A 4DUXA 1N1YA 3FJSA 3U07A 3DCQA 3EO6A 1RUH3 2QBXA 4L97A 1RGSA 4TYSA 3T2TA 4AVBA 2W91A 4YARA 4C1XA 1LECA 1BVVA 4UW6A 2HWC1 2VJXA 2BGPA 2GDFA 2RS53 2UY9A 3WG2A 1MR5A 4E8CA 4I2OA 1H2LA 4IESA 4OZXA 4Q0UA 4MUVA 4JDOA 1LTEA 4RSUA 2FDGA 5GLTA 1S0GA 1HKDA 1OVSA 2VMIA 4QPIC 4LIVA 4KG0A 3HT2A 3LFMA 2HWF2 4OUSA 3N7LA 1XC6A 1ZNPA 3RMYA 3DYMA 3WF3A 1SACA 1RINA 2P3YA 5J3UA 2EXJA 5FJHA 1FATA 4AGRA 1I6XA 3H42B 1GP5A 2WLQA 5IUQA 3OPZA 1VAKA 5EYYA 3B00A 4M4RA 2DCJA 4YW6A 3AZXA 4LBLA 2ILMA 1PMHX 3CJXA 1SBEA 2OQ7A 5LRRA 5EPAA 2A3WA 1QJY2 2FMYA 2E7QA 2H0BA 3NW4A 4P9XA 5A7PA 2A3YA 4G9SB 2WR9A 2CWMA 4AHWA 2KD7A 4GH4C 1LU2A 4IEYA 3WCSA 2UY8A 4CEYB 1O3RA 1UKRA 2LS6A 1P8JA 3UYJA 2Y6GA 1VBC1 1RMU2 4BIOA 3KS7A 3V0BA 2ZACA 3T0AA 4W6WA 3IPVA 2VUDA 2PXJA 1KEXA 2CV6A 4QDSA 5BNPA 1K12A 1LODA 1OLQA 1RYYA 3VD5A 3ACLA 5LBBA 4ASKA 4MX3A 1X9TA 4YRDA 5C8CB 1WMFA 2D6PA 3ALQA 4B7KA 3OCPA 4A45A 2ORZA 2FHRA 2W1UA 2DU1A 1GP6A 4KU8A 4XMAA 1YFWA 3QACA 4EWDA 3GM8A 2ARBA 5LB6A 2WNVB 4NAOA 2RS33 3PURA 3VBHA 4ATFA 3I97A 1HW5A 2BTVC 4Z1VA 2W94A 1PO22 2FZ1A 5FKBA 1S2KA 2J1TA 2X53S 3HR9A 1E57A 4EROA 2XOMA 1RUI1 5DAXA 4YG0A 4F3JA 3E1F1 1PO12 3VGIA 2VVFA 4LHLA 1LEDA 3JQXA 2D6OX 2WWSA 2JD4A 3WP5A 5IVJA 3ZXAC 4M0HA 3H8RA 3VZLA 3D6EA 3OD4A 1YQCA 4N53C 4X6QB 4C8DA 5HCBA 1AR72 1PZ9A 1G9BA 1OT5A 3NSTA 1FNYA 4HOOA 4OCTA 2GNBA 1I5ZA 5BV6A 1UYZA 2VVEA 3TYJA 1PGL2 2V72A 1RUF2 1LEMA 1O3TA 1QJU1 3AM2A 2G19A 4KGGA 1JN2P 4H7LA 2R071 2WT1A 2YC0A 5EWSA 1CR7A 4CXWA 1CZTA 1ST8A 2HWF3 4Y33A 5FXZA 5CYYA 1XE8A 3OUHA 3L2YA 1WCDJ 2YV8A 5I93A 1LGNA 1AZDA 4GWNA 3JXSA 4UW5A 3T2PA 3VBFB 2YZ4A 4ZXEA 3T4HB 4Y4YA 3I49A 3POIA 4N7IA 1EPWA 1PZ8A 2YPJA 1ZYBA 2OUJA 1ND3C 4JTNA 4RD7A 3VKLA 3I4IA 3B7MA 2XJTA 3L2HA 3EB7A 3BTAA 5APAA 4FPKA 2AUYA 3N36A 3WF1A 4IEUA 1QJY3 4G4FA 4XTPA 4K3UA 4AFCA 2IXJA 1ASJ2 1UIKA 3TEXA 1WBFA 2Z42A 1OFNA 1PX4A 2GN7A 1F35A 3EQEA 2O8QA 4M0NA 4XJUA 3ZXDA 2ZGKA 1JZ7A 1TMF1 4GZ9A 3GHNA 2FDFA 1SG3A 1RMU3 4YFZA 5L7OB 1UMZA 2WQ8A 3MW4A 5A32A 1Y43B 2BWCA 2P3IA 1UOGA 2BDRA 1SCRA 5FZDA 5ABJA 5KXDA 3PDQA 4AI2A 5FP8A 1DHKB 4AEDB 3HOBA 1IS4A 5LCWL 3HQXA 1HRI2 2FCTA 2WABA 5L36A 3NNGA 2VD7A 1MS4A 4R9BA 2Y0OA 1GWLA 3MF6A 1HLCA 1UPIA 4JGYC 5B4XA 5CNAA 3BTYA 1H1AA 1PMIA 1S4CA 2BVBA 3GYDA 4KG8A 5CFDA 1UYPA 3UNPA 1AR82 4N9HA 3J26N 1PNFA 1PO23 2VMFA 2WS91 1W90A 2HWB2 3TOJA 4NIHA 4KGQA 2ZX4A 1F8VA 3GF6A 4JGZA 2GC3A 4LLFA 3BU0A 5C33A 2W5FA 1PO13 2RMU2 3FN9A 3HAGA 5DZFA 5IAXA 4FVVA 4CU6A 4XC9A 1YWKA 5D8AB 3GJBA 4QPWA 1BHGA 3VBHC 4OHWA 5C9AA 3T2QA 4MO3M 2BBVA 3OJBA 3SH4A 1AR73 4OZOA 3BGAA 3CO2A 3H3LA 3N9MA 5F7UA 5G05L 2XJQA 1GV9A 1BZWA 2ZHLA 3DGTA 3SH5A 4QGNA 2PLV2 3O1TA 2YMZA 4K7JA 1RUF3 1LHOA 5DQ0A 5F3EA 1R64A 5H9SA 4XF1A 2V5DA 4LKDA 3H3UA 1POV1 3I2KA 5E89A 3U1XA 1OLRA 5JIUA 2R0HA 3K4ZA 4HETA 1PVC1 4OI1A 4Q2FA 3K77A 5T52A 4AXOA 3EJKA 1NCQB 1TE1B 1JW6A 5JIAA 5A3UA 1QQP1 4Q1PA 2VMGA 5K0UB 2PHDA 2O8OA 1OPOA 4P9YA 4FTEA 2LALA 4DY3A 2TBVA 1V00A 2LROA 2UYBA 4QX0A 5FMDA 4Y22B 2E51A 4LO7A 2YC4A 2IXCA 1HB2A 3LEGA 1UOFA 1UQXA 1GBGA 2PHRA 3ORJA 2CGPA 4YNIA 1SBDA 4CEWB 1RUD1 4KWJA 1R1A2 1RHI1 4BQWA 5IVFA 4P9LA 2ZABA 3WW1A 4K1YA 1VRBA 3AYCA 1ACCA 1XU2A 2ZS6B 3WW2A 1ASJ3 2ZMLA 2RJLA 3KMHA 4L8QA 1H4HA 5DPNA 5E16A 3UESA 1YJLA 2PHUA 3PUAA 4JKKA 5DUWA 3T30A 4QT6A 1HXS1 4D8MA 5C3QA 5FZ1A 2CU5A 1BLZA 1FMD2 2WFPA 4NHXA 1JOBA 3W58A 2JENA 4XIKA 3C7EA 4LO6B 2YPDA 4IEVA 1NCRA 4W50A 1YI9A 5IT6A 2VZVA 1JYVA 2B45X 3WCRA 1KDMA 1HRI3 1JU4A 3LA3A 4FQ4A 1K5MA 4QM8A 5FP4A 4DO0A 4UT5A 3VKOA 4CCDA 1U5IA 1SLAA 1RJ8A 3MFCA 2BGOA 2NMOA 1I1EA 1RUJ1 2WUHA 4LITA 1AR83 4BIFA 1WA4A 3HNYM 4HKOA 4YFWA 4OQ8A 2HWB3 2ZZJA 4YSFA 3OB8A 4YPJA 3CDZB 2LTNA 1JODA 2XGXA 4AFAA 4FSJA 5ANNA 1FOD2 1OKOA 2WZ8A 4FXGB 1VB4A 4WZFA 2RMU3 5SV5A 1VBC2 4PI0A 4WM8B 5BNNB 2YBPA 2FDIA 1NLSA 1PZ7A 4L0PA 5A7NA 3J4UH 1QWRA 3K4DA 1N1TA 3HT1A 4QXHA 4UBGA 1LOFA 2DCYA 3VBRA 4FOQA 4DXRA 4FPLA 3AFGA 4HVRA 1MZEA 5J09A 2VUJA 4AVCA 4CUCA 3CMGA 1JZ8A 2PYTA 2ZAHA 4K21A 5A70A 3WW4A 1T6GC 2WWUA 5T5LA 2PLV3 4MHUA 4COVA 2YY1A 5LATA 4NN0A 4XBQA 3CZUA 4CCEA 5FCCA 3OGJA 3TN92 2VQAA 4QDQA 2GH8A 3AP9A 4LXLA 2OKXA 2ATFA 2Q8DA 3DKQA 3ZFEB 1AYN1 5D2AA 1XQNA 2C0ZA 2V73A 1SEFA 3WDYA 4GMP3 2XJRA 1RUI2 1KFXL 1XXNA 1RUH1 4IV3B 5T5JA 3PUIA 5FZ4A 1UZVA 1RXGA 2OIIA 1ZRCA 3J7LA 4LBKA 4KQ7A 1W8UA 1V70A 3E5XA 1DYPA 5LZ6A 3OUJA 2JECA 3ZYGA 5CISA 1V9U2 2R16A 4Q4Y2 1FV3A 2A75A 4S2FA 5JAXA 1HB4A 3VKFC 3RZGA 3H8UA 1QGLA 1R1A3 1SBFA 3FHQA 1OKQA 4YVSC 1LHNA 3VL8A 3EMRA 4FAGA 1YI7A 4BB3A 3AVRA 4IETA 3M7AA 5DABA 1W0PA 4HK8A 4E4HA 4FBFA 1QKQA 4HVOA 4DXSA 3ACFA 4YW1A 2D6KA 2R072 3ZYBA 3MFAA 5GZFA 4EQVA 2A6XA 3RWNA 3ZR5A 4XMIA 3SITA 1DLLA 2VG9A 4DINB 2CHHA 5KHHA 2XJPA 2F17A 4XACA 3WG3A 1FMD3 1KDKA 5H9PA 2G1MA 4KU7A 3S7EA 4QQPA 3Q8BA 5DMYA 3ACIA 3MW2A 5IVCA 2ETEA 1HN0A 1XPWA 4PDWA 3IMMA 1DZRA 2AACA 2VMHA 1BMV1 4CU7A 1DYOA 2VU9A 1NA1A 4DRVA 3S5AA 2WA4A 4K6BA 1ZM1A 3EBRA 4XF4A 3WT3A 2OA2A 4UFIA 3ZYPA 1X8EA 5FZOB 3BIEA 2HYKA 2EXHA 1W2TA 3RJ2X 3HD8B 4XFHA 1CAXB 5F32A 1VRH2 3FUQA 5GZCA 3KT7A 4W4ZA 2VBBA 3I3MA 1FOD3 2RVAA 1H9PA 1JYCA 1VBC3 3H7YA 1H4GA 3NMBA 3JUUA 2CGNA 2F4PA 3J9SA 4Q0SA 4QPIB 3S6PA 4HK9A 1JH5A 3VHRA 2FCUA 2QDNA 2WSVA 1QIQA 5KC6A 1QY4A 2ZGLA 1ULOA 3IWZA 4MLOA 4YWAA 5FKCA 3HWJA 2JICA 1UY1A 1A6CA 1RUOA 2VOKA 3DPRC 4OULA 4DXTA 3C7GA 1MS5A 3MPPG 1NAEA 2VZTA 1RB8G 4QHBA 3NO8A 1NE6A 4DMIA 3E97A 1QF3A 1QDOA 3TEWA 3TN93 1XYOA 1XNBA 1VIWB 2VCMA 4QQ2A 2ENRA 3Q8EA 3AL5A 4I0BA 2OZ6A 3ROUA 3VBRC 4RYDA 5GZGA 2DBNA 1OA2A 4CP0A 3IAQA 5FLJA 2VE1A 3JD71 4AVAA 4URAA 2ZGTA 3ZM8A 1RUI3 5FY9A 4EZHA 1Q8OA 1AYM2 4NRQA 2JKBA 3KSCA 1U5XA 1GR3A 1RVF2 1PGW1 1ULGA 1DF0A 2X5IA 2FBEA 2VGDA 3RMXA 3V0AA 3HPNA 1IOAA 5LK7B 1RUG1 4Z82A 1V9U3 4Q4Y3 2V4VA 2EXIA 4LLOA 3DECA 3C3VA 3AZZA 3NVCA 5K8SA 3O12A 1ZRRA 2PTMA 4D0QA 3ZXKA 2HWF1 2Q8OA 5J37A 3UL2A 1UY2A 4L2NA 4XFAA 3KVBA 3ZFFB 2R073 2HBTA 4E2SA 4HN0A 2JG9B 3KGLA 1PVC2 1O59A 5KHGA 3ST7A 1IQAA 3M3OA 3TEZA 3WSOA 4WM7A 3AFKA 2QCSB 2W46A 3VBUC 4XVHA 4LEJA 3IM0A 4KWLA 2UWBA 4B1MA 1ENSA 2WQZC 1QJZA 3LA7A 4QX5A 4XEZA 3W21A 1QJY1 2WJSA 4MGSA 5H9RA 1W6NA 3M1HA 2XLGA 1F2NA 1C5HA 1JU3A 4N53B 1DQ4A 4CDXB 5I0SA 2WLPA 1UF2C 1DGLA 1GICA 1RIRA 3ZXEA 1UX7A 4L11A 4Y24A 4IGQA 1RMU1 4QHOA 2BFUL 3OEAA 4RQPA 3I59B 1VRH3 2SLIA 1LKNA 3O0WA 4U2AA 1EP0A 1OH4A 3RZLA 3ILRA 4Y1UA 5SV8A 3IDEA 2QZ3A 1W8NA 3SHRA 2W0XA 4LJHA 2QQNA 3E6DA 1IZ3A 3VZMA 3JU9A 4CYDA 2VQUA 2A7AA 3UGFA 2AREA 3GZEA 2WNUA 4QD2A 3A23A 1DGWX 4FCAA 5IATA 4BQ1A 1UXXX 2A6WA 1U5YA 3K46A 4H14A 4RL7A 2CL2A 2VZ1A 4FTSA 5LBEA 1PO21 4OHXA 3CL1A 1S0CA 1ND3B 3TBDA 2PHXA 3AB0A 4CU9A 5JPMB 4NE9A 2PQQA 4J25A 1S0FA 3POGA 5F6KA 5FOBB 4WVWA 3T09A 1PO11 2B46X 1X33A 4A7KA 3WUDA 4LKSA 4GB32 4ZONA 2D5HA 4XFCA 3NJVA 5F5AA 5FYHA 3LA2A 5FIXA 3AMNA 4QGLA 4CPBA 1AYM3 4NHMA 2E32A 1RVF3 3M3QA 5F2SA 3HQRA 2CDOA 2HKXA 4MGKE 1OOPC 1PGL1 3QBQA 1NX9A 3ZFGC 3ES1A 1PK6A 1KQRA 1RUF1 5I0UA 2IXHA 4MGQA 1RUE2 2YROA 4IV1B 3ZSEA 1MVEA 1XYNA 2A6VA 3GXUA 3NQHA 1W2NA 1E5HA 1SLBA 4OHZA 1DDLA 2TNFA 4FP2A 1WWYA 4JHZA 2N7GA 4Y1YA 1X8MA 4H7MA 1ZRIA 1C3HA 1ENRA 4INDA 2E26A 1MQTC 2VW1A 3WXPA 2XONA 2JG8A 1KRIA 3LPFA 4JGYB 1BK0A 2XLAA 5GLWA 2VR4A 2B8MA 4HONA 5DG1A 5E88A 4LBQB 5IVBA 1UY4A 1FNZA 1PVC3 5K9YA 1YXWA 2G9FA 3AKRA 4K8FA 5A7OA 2XJVA 4IUGA 5IVVA 1DZTA 1IKPA 4EWAA 1JTZX 2ZGMA 1JZ4A 2PMWB 3O1PA 4K1ZA 4PF1A 3UJOA 5FQ0A 4CP9B 5T3NA 1SFYA 5I8YA 1D4M2 3HQUA 1S0BA 3QOPA 4Q0QA 5A6ZA 5FR3A 1ASJ1 2RHPA 1DLCA 3LEMA 4LBJA 4C1WA 1H8TC 3A4UA 1W05A 4X8PA 4A6OA 1YCIA 2J1EA 4AR2A 4NR1A 3CJIA 5FBJA 1BCXA 1LRHA 1XOYA 4SLIA 4HN1A 3OG2A 5L9BA 2A73B 2GP5A 3ZPYA 5DN2A 3OF1A 4V1PA 2ZKLA 3NKGA 3C8XA 2B7YA 2VMDA 2FDHA 1DP0A 5FXVA 4AGVA 2HWD1 3ME2A 3OBAA 2BQPA 3ZXFA 3V65A 1J1LA 4BZ4A 2D5FA 1SHWB 1CVNA 3WNNA 1AR81 4HSLA 4S2DA 2PAKA 1Q8PA 2P3JA 3I7DA 1AR61 1AX2A 2HLEA 3PTYA 4NPMA 2KR2A 2HWB1 4RR3A 3ZKYA 4HVQA 5KHKA 1BMV2 4ZXKA 4KBBA 5A3WA 5FREA 4YLZA 1ND2B 2PHTA 4TXWA 2VPVA 2RMU1 3AL6A 3S57A 1CPNA 4XUNA 3A0NA 3VZJA 4GB33 3VZNA 1ODMA 5L9VA 1XBFA 1POV0 4IGOA 1VB2A 3QH6A 4XHXA 5FPZA 5ANQA 1MACA 2MHFA 1GANA 3MICA 2IUWA 2ZKNA 5FWEA 4IL7A 3D82A 5FK7A 5E1RA 3TRSB 5JOWA 2ET1A 2GP3A 5F3CA 1WMXA 4MZUA 1W9TA 4MGTA 1MS0A 4XABA 1S0JA 5EP9A 1RUE3 5JZGA 5JOXA 1UX6A 2YU1A 1W9WA 4ZHNA 4LE3A 1LULA 3LIGA 3TEYA 1ZVFA 4WVMA 2DFCA 2A1XA 1JYWA 2AR6A 2VZRA 1OH3A 1U12A 3D3AA 1N3QA 1Z78A 4GMP1 5CKQA 2GN3A 5FZAA 5HCFA 3U37A 4LO4B 2C9KA 1W0OA 3RG0A 3ZSLA 4AOCA 2VOTA 2Q8CA 4ARYA 4CCNA 1J59A 4OHYA 1F9KA 2P5BA 1H1MA 4AHYA 1QHDA 5A6YA 2UWAA 5CFCC 4XJ9A 3JD72 1H2NA 5FWJA 3H3ZA 2QQVA 1SDDB 5A3OA 3ZYIB 2IFRA 4CXXA 2RM22 1PGW2 1R1A1 1CGPA 4AEMA 2XL7A 4JV4A 4J1XA 4IEOA 4R4XA 1POQA 1RUG2 1D4M3 2P3KA 1PGSA 2LM3A 3J8F2 3M3CA 4Q4X2 4XZPA 3AMPA 4D7TA 3H8OA 4IEQA 1GZWB 5C3RA 4YZ3A 4XHBA 1Y3TA 3CZJA 4AGGA 1C28A 2A6YA 3JZVA 4BDVB 4V2VA 1LOAA 2ID4A 1FMD1 3EHKA 1XNCA 1UZYA 3M3IA 2DTWA 4AVVA 1CAVB 2HEYF 3ZN6B 3V64A 2XXZA 3LDRA 4CDWC 3NAPC 2ZAAA 3RS6A 3J7NA 2CAUA 1C5IA 1OD5A 3R4DB 5LK5A 5C4WA 4LBOA 4P5YA 4P9IA 3LZZA 5JSPA 1J1TA 4H3WA 2FZ2A 5G04L 2WWJA 1C8M1 1D0HA 2BRTA 3RI8A 5FP3A 2YC2A 3I2JA 5IFPA 4GIQA 2EVXA 2WKKA 2JWPA 4RFRB 2XVGA 4AQSA 1A34A 1LU1A 1B35A 3D0JA 4N9IA 3VBSC 1IGOA 5J36A 4PQ9A 4U36A 2PHLA 2RDNA 2D3PA 3RJRA 4GALA 3LGRA 2B9VA 4Y5TA 1MZFA 1RC6A 1FOD1 1M06G 5BXXA 4EWEA 2PN5A 4LO8A 4RGGA 4Q4V1 4YVSB 5GM0A 2D6MA 4MXWB 2BBAA 2VZOA 4Y1ZA 2JE8A 2E6VA 1UAIA 5BNOA 3E5UA 2W3JA 2QQUA 5EFUA 5CKMA 2VULA 1W6MB 3VDDA 3R0RA 4DB5A 3BUCA 1Q8QA 3USUB 3W5MA 5JMOA 2YFUA 5FY7A 1A78A 4ZU5A 4RR3C 4AI0A 3RWKX 5C7GA 1ZBA2 5CAZA 4XUPA 5HXVA 2HYXA 1LHUA 4D7YA 5A3MA 3I2HA 5KWRA 2R6QA 3M4FA 2JIJA 5A1LA 2ADDA 3N9PA 4NROA 2VOVA 1UU6A 1W8HA 4AAPA 1JYTA 1D0GA 1W6OA 3TN91 2ZEXA 1CONA 1EAH2 2HH9A 3PIGA 1LOEA 3NNLA 2QQIA 1QEXA 2RR12 1V6JA 2ET7A 5FLIA 3WQBA 1XNTA 4QHZA 4R52A 3FLTA 2DDUA 4LBMA 3WNOA 4A3XA 4E8DA 5E8AA 5FO7B 4YW3A 1IKQA 3JCIA 2X10A 2QNKA 3NV4A 4WVVA 1H9WA 5FY0A 1W6QA 2RS12 1UD1A 3BYWA 1T2XA 1W8OA 2YFZA 2Z4FA 3JBG2 3JD73 2QDRA 3LSEA 4XFIA 1IS5A 1V9U1 3AYDA 2BOIA 4Q4Y1 1UMHA 3B5LB 4YVWA 2RM23 2UWCA 5IYYA 1NQDA 3GCWA 4LUMA 1W6PB 2BP6A 3FLPA 4CDUC 5LW9A 3NKTA 4Z8BA 3QH7A 4BXFA 1RUG3 1OA4A 5CADA 5J7MA 1VAVA 1X50A 1ZZBA 2VUAA 4YGDA 5B2GB 1WA6X 3J8F3 5CZKA 3VD9A 1UY3A 4Q4X3 3J7HA 4META 1OF3A 1ODNA 3HIFA 4E4DX 3U4XA 3D8CA 5FFOC 1AJKA 3ZN4A 2EALA 4CP1A 4E2QA 3DPRB 4HMZA 5I91A 3ZSJA 3D4KA 3BI3A 4A6SA 4DXZA 4OI0A 2RDRA 3H50A 2J1UA 4GAZA 4W65A 5FYIA 1DGRA 3LDBA 3AYEA 4Y20A 1V6MA 3H0OA 4AEKA 2YGLA 5IFTA 5JOZA 2DUPA 2FDKA 1LCLA 1DGRN 4N43B 3QD6A 4O61A 1SZBA 4CCOA 3M3EA 4H55A 1O8SA 4PBOA 1WUVA 1EV12 2OX0A 2Y6JA 3BCWA 4FPYA 1GNHA 3OYWA 4XJ8A 3ZYFA 2BGCA 3WD5A 4QGMA 4OUEA 4TN7A 3PMEA 3POYA 3WLUA 3MIHA 1G9AA 4FPHA 4PLNA 5EV7A 2AENA 4LBQD 4FOVA 3VHOA 1VRH1 3JB4C 4C0HA 1NY72 4QX3A 3MGUA 4COZA 5FO9B 4E4ZA 2Q1MA 1LESA 2Z2SB 4FPJA 1R1ZA 4OUMA 4DFSA 2C5DA 3N3HA 1OQ1A 2A5ZA 4QB1A 1LR5A 4S2HA 5FYBA 4FPFA 3KV9A 2XJSA 3AVSA 4TLFA 4BHPA 1ZBA3 4DOUA 4CDQA 2YBSA 4NWWA 4BE3A 1JYNA 1NLQA 4YG6A 2HWD2 3OEBA 1W2UA 3MPBA 1VALA 2DVDA 3VBUB 3NRUA 2IXIA 2VNRA 3OD0A 1PNGA 2XBO2 1SPPB 3MLKA 4AFBA 1E5RA 1EAH3 3VDDC 2JD9A 3JB8A 5BNPC 1AR62 2VZUA 2A6ZA 4JHTA 2RR13 5IK5A 4LOSA 4XFFA 3AZWA 1W8FA 5F39A 1UW8A 5LEKA 2W47A 2WAOA 1AYM1 1AHSA 1F4HA 3IDBB 1W06A 1RVF1 3WG4A 3MIBA 1WCSA 2ES3A 2Q8EA 3LQCA 2VY0A 1H0BA 4DS0A 1RJ7A 2RS13 2W1QA 3JBG3 4QDRA 3X29B 3GBFA 1WBLA 5JOYA 3MUZ1 2ZGOA 4UBHA 2HEVF 1CJDA 3I3DA 1I3HA 1NZCA 4XQWA 4AHZA 5F8PA 3AP6A 3SKJE 2VTFA 4B29A 4XFGA 4LA2A 1H6YA 3I3QA 3LAGA 3UJQA 5J48A 1OFSA 2KA3A 4XXPA 2PAEA 3G7DA 4AHXA 2NYYA 4JKLA 5EHDA 2D43A 2JDKA 3ENRA 2XVLA 4UWDA 4AF9A 2P2KA 1WMEA 3FUOA 4PJYA 5IVEA 1YNAA 5F1RA 2VBPA 2L9LA 2P37A 1WW5A 1N3OA 3M70A 1UZWA 1WCKA 3PUSA 3VL9A 1FPN2 1J83A 1SDWA 1CAWB 2Q5TA 1PM7A 2Z69A 3MYXA 4LPLA 4YGBA 4O65A 4ATEA 2NP0A 3O7OA 5A33B 1LB2A 4D6QA 1H2KA 3N9NA 3OBTA 3ZX7A 1EV13 4MGZE 1UZ0A 3B01A 4YGEA 5DXDA 3WW3A 2QZ2A 2QQOA 3KV5A 4UFHA 5AVAA 1G9FA 1GQPA 1UMIA 2IWGB 4OI2A 1VLNA 3K48A 1TEIA 4CEYA 2BEOA 3ON7A 1N1SA 1OOPB 4X8NA 4BH9A 2DFBA 3MI8A 3NNFA 2BW8A 4E27A 5FYMA 2Q1FA 2D3RA 1HJFA 1QNYA 2UURA 3KHCA 2D98A 3NWKA 1JZ6A 4YW7A 4ORFA 3K3OA 3PHMA 1MQTB 2VQ0A 2LW8A 3AP7A 4QPGB 3LFIA 4YM1A 5C8CA 5KBFA 1HX6A 1STMA 2TEPA 3LPGA 3PVBB 5IW0A 4CE8A 2ZGSA 3S0MA 2WO7A 4ZKTB 2PAMA 4FPEA 5FPLA 4I01A 1IS3A 3AKQA 2BUKA 2WNVA 5I0RA 3PVEA 5F2WA 4QPYA 3ILFA 2P4EA 2ZTNA 4FPCA 2WT0A 1C8M2 2HWD3 3AJYA 5JCTA 2QVSB 2ZCWA 4LHSA 4XJAA 2VXRA 4HPKB 1UKGA 3N9OA 2XBO3 4FXKB 4IDZA 3CQOA 5HI0A 1GZCA 1YFYA 4YM3A 1ZZ6A 1AR63 1TNFA 2XKPA 2ZX3A 3CU7A 4GB31 5FXWA 3WQ7A 3WDXA 5ABJC 5GZDA 2XWBB 1WLWA 2RV9A 5IK8A 3FBMA 5JI7A 2NPIA 4AE2A 3D0SA 1EUTA 4Q4V2 1H8TB 4FPGA 4S2GA 3Q8AA 5C3SA 1JZ5A 4NO4A 1QU0A 1AR92 5DAQA 5EJZB 1QJX2 3B3QE 4X6RB 4CCCA 4BCUA 1IPJA 4YZ4A 1GU3A 2CY6A 3RVHA 5CFDC 3KF5A 1RUE1 2HEWF 3VBOB 3WR0A 3IBMA 1OBNA 2ZMNA 5DAPA 5KC5A 1Y9GA 1XNKA 2JDAA 1ZRFA 3KF3A 1X36A 4IE5A 4JGZC 5FYTA 3LEKA 5FYCA 5GLUA 3WDWA 4B4RA 3E6CC 2R1BA 3GNEA 1COV2 2W39A 2QQJA 1YYNA 1G7YA 2YHJA 4N8MA 3ZMNA 1W3VA 2C6SA 4ZS2A 2XPJA 2DCTA 3ZOIA 2NLRA 5LA0A 3ZYHA 5FPUA 2IVIB 3AXDA 4W8JA 5C9AC 1JMUB 2CAVA 5DUXA 3P6BA 1Y9QA 3GZUC 5F9TA 2VMCA 1RUNA 2XWJB 1REDA 2DVFA 5FUIA 3VBFA 1KFUL 5CU1A 1VE0A 4XF0A 2QQMA 4Y1VA 5CVRA 5LWBA 1FPN3 3TNQA 1VBD2 4DEQA 1FT9A 1W8ZA 3AMQA 3FC0A 5C5UA 5F5IA 1YIPA 1D4M1 1CQ9A 1MZ5A 3WUCA 3HBKA 1BVP1 2WAAA 1Q3EA 2BJSA 5FZLA 3SNMA 3PU8A 4JDNA 3IDCB 3K2OA 3N4MA 2B4KA 2GC0A 2XUMA 1SMVA 2ZX0A 5FP7A 3WP3A 2JDMA 5L7OA 3LEIA 1W28A 3TNPB 1J3RA 4NRPA 1Y9MA 2G9ZA 4JTOA 5A7SA 4Z2WA 4LUKA 2KXLA 2AYHA 1W8TA 4AEDA 3POBA 4FFHA 3VUOA 4O9EA 4RS5B 1YQ2A 1FYUA 4MH0E 3WEZA 1GWMA 1QOSA 1V6OA 4ISQA 3SEPA 5CFCB 1RITA 1LENA 1C8M3 1AXKA 3SKVA 4AG4A 3I8TA 4FFFA 1O5LA 1OF4A 1Q8VA 1GZTA 1ZZCA 3WNPA 4M3CB 5JPNB 5DZEA 2XG3A 4D94A 2EF6A 3AZVA 4K20A 2ZHMA 3HNMA 1XB9A 4HKWA 3WX5A 5JLVA 3RNSA 4QXBA 2XH6A 3LD8A 1NCRC 2VVDA 4LKFA 3PIJA 5D8AA 4UFKA 3GALA 4M01A 2OT7A 1K5MC 4Q4V3 3ZIWA 3OY8B 1BYHA 1CAUB 3LKJA 4GMP0 4LULA 3O1VA 1AR93 2GH2A 4PQQA 1QJX3 4M4PA 1QDCA 2E9QA 1YQ5A 2WFF2 2YGMA 3C7OA 3UGGA 1GP4A 1O7FA 4CDWB 3NAPB 1UYYA 5BYNA 1ZZ7A 2WQ4A 3H7JA 4BA6A 4IXLA 1NZIA 5A3PA 2W08A 1FI2A 2D7FA 1UPSA 3HN3A 1ZZ9A 3IAPA 2E33A 4ZU4A 4NHKA 1COV3 2XHKA 3GDBA 3KHBA 1VMHA 2MEV2 2W2IA 4YGCA 2XKOA 1NCQA 2ZA9A 3BTZA 1QOTA 1LOFC 2A70A 5E6HA 5CA6A 5K0UA 1GMMA 2BYVE 4GKXA 3VBSB 2EA7A 1F5FA 3AMHA 1WCUA 5L73A 2ARXA 4GH4B 5K4LA 5HPOA 4QM9A 3BPSA 2H6BA 2I74A 4AEJA 5FBZA 1GNZA 2VM9A 3B93A 4Y22A 4W6XA 5FP9A 3FX3A 2RM21 2B39A 1VBD3 4MG2A 3MF9A 4JKMA 4V2WA 5FZ3A 5C3OA 4CEWA 2VNGA 2F4LA 2Y6HA 4UOJA 2GSYA 3ACGA 4CU8A 2O0OA 2PQSA 4E4SA 1REEA 3KCCA 3WDTA 1O8PA 5A7QA 2GNMA 3J8F1 4R4ZA 1G6NA 2W1WA 2JDHA 4Q4X1 5LA2A 3POSA 3DXTA 1WKYA 1IS6A 1AF9A 3GCXA 3ITQA 2JE7A 3T4VA 3VBFC 4MGYE 3RQ0A 2WO2A 3BU7A 3SISA 3RRDA 5JDBA 1LGBA 4C91A 2RE9A 3OBRA 2WBKA 1DBNA 3DEMA 4KBZA 3GJAA 2H0VA 5LRSA 1CZSA 3SMHA 2J42A 4Z92B 2JIGA 2YDEA 1MZ6A 3PLQA 2XUEA 1KGYA 4BK4A 3WINE 4YZ1A 1TZOA 2GMMA 5A7WB 3U11A 4Q8LA 2R7EB 3I2GA 4HBNA 2GNDA 5FRAA 3P3PA 4ZY9A 3BTXA 1JS9A 2OS2A 2OZJA 3K3NA 5BNQA 3P1IA 1XNDA 3AX4A 2XQRA 4PLOA 4TZDA 2ZHKA 4XOGA 1WZXA 2WYFA 3CEWA 1MEC1 4RGKA 1W2AX 4CDUB 1G86A 4RFT0 3BALA 4QU1A 1CX1A 5I0DA 2FD8A 1EY2A 4PDWC 2FCVA 1QXRA 4WM8A 5BNNA 4XYXA 4UF0B 1OQEA 3RYRA 4BMEA 1TME1 1OUSA 1ZBA1 1JZ3A 1NA1C 2ZEWA 3U75A 3PNAA 4AQ6A 4F8AA 2J1SA 2GZWA 2RG4A 2WFF3 5JVVA 1NKGA 1NE4A 3FL7A 4UFLA 4NOTA 4OMCA 4QX7A 1EAH1 5T54A 3L9JT 2XVKA 5CIRA 5D8AC 3WOGA 1L7QA 1VBB2 2PA7A 2RR11 4XAAA 4FPOB 5BNOC 2MEV3 3SH3A 4UFJA 2DTYA 3ZFEA 3APBA 2GNTA 5ISLA 4XUQA 4F83A 4IV3A 3IB3A 1ZBE1 1A3KA 3WF4A 1OVPA 4Q0PA 2RS11 1VP6A 2WZR2 4FI9A 3FBYA 3JBG1 4QKBA 1I9RA 2WRAA 4L99A 2YG0A 2OYZA 3ZR6A 4BQ4A 4GD4A 4XBLA 3VV1A 1UOBA 2YXSA 4IE4A 3LSDA 5FYZA 2NN8A 1RTVA 3Q8FA 4I3PA 4DZGA 1Q43A 5FYYA 1EUUA 4RN5A 4NPLA 4DUWA 1X7NA 2K9ZA 4LBNA 5J98B 3KGZA 4NVPA 1OI6A 4URTA 4EE2A 5AFBA 2JJ6A 2FMDA 1JZ2A 5FXXA 4MOAA 3VB9A 1O6UA 1LHVA 3O1UA 4N7UA 1Y4WA 1DIWA 2J1RA 3CBNA 5CB7A 5EIYB 2X5IC 1S2BA 4QKFA 3ABZA 1PIV1 3KCYA 5T5PA 3V0BB 1O3SA 3IPVB 2HWE2 4IERA 1S2EA 2I07B 2QJVA 3UETA 1GOFA 2C9AA 5FZMA 5BNPB 1Y7BA 3BB6A 5HCHA 1NG0A 4LORA 1EV11 1AXZA 4EN7B 3RZZA 1F31A 3UK9A 3AK0A 3LOIA 4Q5OA 5F6LB 5FZ0A 3WQ1A 1HJGA 4RA0A 2G4IA 2F6BA 3WV6A 1W04A 1AXYA 1YQ6A 3OOXA 3VDAA 3AP5A 3VBHB 3WP4A 5AC92 4J6GA 4CSWA 5FZOA 1UOJA 3B94A 3O1RA 3KVAA 1NY71 1CAXA 1NLRA 4OYUA 3AP4A 4Q4W1 4PIZA 4WM7C 4XIOA 4BYYA 1VBA1 5LEJA 1IHMA 1V0AA 2ZGPA 4BQYA 2X29A 1S55A 3VDCA 2WYSA 3H1MA 2NM1A 3B02A 4QPIA 2SBAA 1WW7A 1GQHA 2NMNA 1U5ZA 5T5OA 1XSQA 1C8NA 1BJQA 3ZKUA 4ISRA 3NNMA 4FQZA 1KS5A 2YB7A 3IDAA 1X9PA 1HRV2 2A71A 3HVDA 4Y5SA 5GLZA 4M00A 5FZ9A 4Q27A 3PJYA 1YC61 4RQPC 5JR7B 1PX3A 2XBO1 4AYUA 3N7KA 2YUEA 2XLFA 3NV3A 4WM8C 4BISA 1SQ4A 4GQ7A 4I3GA 2VQTA 1N47A 3O1OA 1LJ7A 4BM8A 1VBB3 3MV01 2K2SA 2WA3A 5EQUA 4HG6B 2MPFA 1HQLA 2P1BA 4XF3A 2BU9A 3D5OA 5GLVA 3MBWA 1CPMA 4W6YA 3WNMA 5FO8B 2JDUA 4Q1RA 2WNUC 3C2UA 2A3XA 1FV2A 3U4SA 3DV8A 3WDUA 3ZPOA 2E7TA 2WZR3 3OGVA 3OTFA 2QTWB 2Y33A 5CBLA 4AI3A 5LA1A 3NJYA 3ZVXA 3RPQA 3AJZA 5HV4A 4M3CE 4QKNA 4BXSV 2W68A 4B1LA 1JOJA 3MLJA 4XAEA 1NXD1 2EAAA 4Q29A 3S30A 1XSRA 3JQWA 5EYXA 4ES9A 3ZFFA 2OQ6A 2YYOA 2CYFA 3DKWA 2IFWA 2JG9A 2VZQA 2PHFA 3EXUA 4AVTA 4UI9L 1CN1A 2VW0A 1FPN1 1CWPA 1PK6C 5A32B 2R062 4CUGA 2HWE3 1UY0A 1US2A 1XE7A 1GOHA 4PIYA 5ABJB 5FZFA 1GUIA 5GJ6A 5C6CA 4DNYA 5HCAA 1JXNA 1WD4A 5ACA2 2WZPP 2X09A 3B69A 1O91A 4EJRA 4IEZA 5KHIA 2VCBA 2DVGA 3KLSA 1XNAA 1ZA4A 1CD3G 1WLCA 2C4XA 4N53A 2JG8C 4CDXA 2GALA 5EXOA 1ZZ8A 2Q4SA 3N35A 4HXCA 3FZ3A 5A3LA 5AC93 3BN6A 2D44A 3C7FA 3RSJA 2OW4A 3LF7A 1WW6A 4D3WA 5CFDB 4UW4A 4Y1XA 1REFA 4JCKA 4CCMA 4CTEA 1TQ5A 3I59A 4EYUA 3LIHA 3F95A 4XDPA 4PBPA 1DQ6A 4JGZB 1EYBA 4OFGA 3WDVA 1ZA7A 5FYSA 3W5NA 4DQAA 2XB6C 1F15A 4WBBA 2FDJA 2OXBA 3A0KA 2AEYA 3O1SA 5C9AB 2V09A 1VJ2A 4DIQA 2J1VA 2R1DA 1GKBA 1SFPA 3KQRA 5BUVA 3VD7A 1K42A 2R042 5L19A 3VZOA 2C24A 2UYAA 3BVCA 3ETQA 4NWVA 4KWUA 1HRV3 4YW2A 3CJIC 1O4ZA 2J1AA 1ND3A 1US3A 4QX2A 1ZRDA 1ZX5A 2DV9A 3LB9A 1PM4A 4LK6A 3OPWA 5FZCA 2VTXA 3IN9A 3PL0A 2HBUA 3VKNA 4NMIA 4ARXA 3ZXLA 4AI1A 3U14A 1MEC2 4G3YC 4PF5A 4L92A 1LHWA 1AR91 2W52A 4A7ZA 1QJX1 1AL0G 4GKYA 4CCLA 1LAJA 4QQOA 2ZOEB 2EXKA 2XHNA 1RL3A 1W9SA
chains in the Genus database with same CATH topology
1YIFA 1BBT2 4QU2A 4N90A 1TME2 4IV1A 1D2QA 4TWTA 4EN8B 2VECA 3SLIA 3THPA 3FWEA 1BXHA 1ULCA 3LCPA 4I30A 1COV1 3VLBB 3O0XA 1HDKA 3U10A 4COUA 4BPZA 4JGYA 3TB0A 4ITCA 1WD3A 1N3PA 1H8VA 4WZCA 4LBQA 4TSVA 1HQNA 1VBD1 4LNVA 1OQDA 2R063 1ZBE2 5JZGC 3KD4A 3KM5A 2IXKA 3GZAA 1NCRB 5ACA3 1SLLA 3IKWA 3ZFFC 1K5MB 1UIJA 1YHFA 1OSGA 1U0AA 2JG9C 3KCXA 1C1FA 4R9CA 4ASMB 3FLRA 4OI4A 3OGGA 3GHMA 1WGPA 4B7EA 4QXKA 1MS9A 2DUOA 4NPRA 3HBZA 2ZX1A 4P9GA 5DDJ2 4CP2A 1CJPA 3SCGA 1Q8SA 3HN1A 4LT5A 3USSA 5AFEA 1AL22 5FTTC 1EPZA 1V6IA 4CDXC 1PIV2 1Q56A 3MIFA 1DQ0A 4YM2A 4ES8A 1ALYA 3RI9A 3ILNA 3VBRB 2JE9A 3VHNA 2R043 1KXGA 5FMOS 2ZGNA 1JUHA 2ZZQA 5AVPA 1AX0A 1S1AA 4CRQA 3VN4A 1S0DA 1X82A 1ND2A 4E9KA 5FMOL 5C4WC 4GXLA 4Q4W2 3FHIB 1SFNA 3ZMOA 2HJIA 1DZQA 1MEC3 3AXEA 1VBA2 4JRLA 1BK1A 3WVJA 1CESA 2WFF1 5I8TA 1ULEA 1B35C 3R05A 1BBT3 1TME3 2AH2A 4YG3A 1HQWA 3O5SA 3DUIA 4AVSA 2MEV1 2BPA2 2E53A 2C1FA 2NQYA 1OHFA 4I0AA 1S0EA 1Z7S2 1O5UA 2UU8A 5IK4A 1CIWA 1DG6A 1ONAA 1FAYA 4XE9A 4IV1C 1GZ9A 4AQTA 3VZKA 2BNOA 1ZBE3 4FO9A 3CF6E 1UU5A 4MSVA 3URFA 4L9BA 4PDWB 5GALA 1R092 1JYIA 4EV0A 3B9CA 3ZXJA 3VKMA 2K0GA 1NA1B 4NHLA 4BLIA 4LTAA 5C8WA 1BEV2 5D1IA 1GZWA 2VOXA 4Q8KA 3PVNA 3M8LA 3DL3A 4D69A 4JVAA 4XDQA 4PIXA 4WV8A 5DDJ3 4B4PA 4XETA 5KXBA 1CAVA 3ZN6A 1QMJA 2DF7A 4YVWC 4F7ZA 1AL23 1JBCA 3AKSA 3NJZA 3ZXGA 5BNOB 1DGWA 1PIV3 3MEPA 5HBAA 3VHPA 1QNWA 1VBE2 3U0ZA 4LA3A 4RHV2 3HMYA 1N1VA 3MW3A 1LOCA 1AVBA 1BQPA 3ZFGB 3H1WA 1SCSA 4YVSA 4MXWA 4B8EA 4XJZA 4FTBA 4Q4W3 2Q0AA 1W6MA 1VBA3 1ENQA 1GQGA 2R0FA 3USUA 5J96B 5I8SA 2QQPA 2X5IB 2VW2A 4B3NA 3MZHA 5EZWA 3V0AB 5T55A 1JHNA 1ND2C 2GMEA 2HWC2 1C57A 4B4QA 4FOWA 4QMAA 3UV9A 1VBB1 3AKPA 3ZIXA 2R32A 5KHJA 1ZREA 2PELA 5JWPA 4XF9A 2JX9A 2AZ5A 2DWRA 2Z79A 1Z7S3 4PLMA 2CWSA 5DUUA 5CG8A 3ATGA 2WZR1 1YLLA 3KZ4C 4CDQC 4P14A 3G6JB 1UCXA 2CTVA 1HV0A 1DU3D 1KS4A 4WM7B 1J58A 2ERFA 4AW7A 1V6NA 5TSWA 4R8HA 3UKVA 1W6PA 2DCKA 1R093 2D40A 4GWMA 1ULFA 1W6NB 3MIEA 4XJWA 1CX4A 4HLTA 4GULA 3WP6A 5BY5A 3W9AA 4JAAA 1BEV3 3R4SA 4YZ5A 3LWCA 3DPRA 3P3NA 4E2GA 1R081 3ZO0B 4LE4A 4YZ2A 5F5QA 4RQPB 2IZWA 2HWE1 4PCRA 4Y26A 4BOWA 1KD7A 4LO5B 4N43A 1RUC1 2QE3A 2GC2A 4AWDA 2EAKA 1VBE3 3KT1A 3UKTA 2TUNA 3ZSKA 1HV1A 3ZYRA 2WNUB 4RHV3 2D6LX 3WHUA 5AC91 2WIIB 2WL1A 4RGAA 2H6CA 2JEMA 3UKNA 3E5QA 4I02A 3ZSMA 4ONUA 1OMIA 1H2MA 3IIAA 3INAA 3FFZA 1WMDA 3FE5A 1APNA 1QXJA 1KJRA 2XL9A 5KXEA 1DYKA 1AUYA 3E6BA 3ECQA 3GZTB 2VH9A 5JSOA 4MVTA 2RS51 4HZFA 5FLHA 1Z0HA 2WSUA 4P9JA 1HRV1 5DUVA 2ZPXA 4CEYC 1TNRA 1PK6B 1J3QA 2HWC3 3VBUA 3KB5A 1V6KA 5DG2A 1QJU2 1URXA 2Q30A 4DRRA 4EN0A 2CGOA 2D93A 2Y38A 5EJ3A 4GA9A 1QOOA 5C8CC 2JG8B 3N7MA 2IC1A 2ZBJA 3R4UA 4DY5A 2PHWA 1L3JA 2WNVC 4FAHA 1PHMA 3Q9OA 5GKAC 5JSRA 3I54A 3PMSA 4JC1A 3IT8A 3BOPA 3PJQA 5FPXA 3ELNA 2D97A 1H30A 1IPKA 1VR3A 5FQ0B 1G8WA 3AZYA 3CLPA 4KH9A 4Q0VA 3GBWA 4Z07A 2D3SA 4XFBA 5I0TA 3MLLA 1SLTA 1MS8A 3CJIB 1AJOA 1KJLA 1VAMA 1Q5OA 1TMF2 2DU0A 3BPZA 3O0VA 3QLQA 4XXAA 1H1IA 4YW5A 2R061 2Y26A 4HSJA 5KXCA 1CAWA 3SXWA 4OLLA 3S7IA 5ACA1 3MIGA 1YUDA 4BMBA 5A33A 2RS31 4JDMA 4QQLA 4SBVA 1UN1A 2KM2A 3LOBA 3CNAA 4A2UA 2VOWA 4ZU7A 1MS1A 2VNOA 1OOPA 2DYCA 3ASIA 3ZFGA 4RR3B 1GYKA 1YJKA 2MNGA 1NOVA 4N43C 2WC2A 2WS92 1C1LA 4COYA 3T1MA 3ZN5A 4MV2A 2LUWA 1YFUA 1O4TA 1MQTA 3ES4A 4UW3A 1WW4A 2BNMA 1QH6A 4QPGA 2R041 2NZ9A 4AI8A 4C90A 2ZX2A 3GBGA 1A8DA 4M3CF 4I09A 4XTMA 3QCWA 1XYPA 3NL1A 5FDBA 2XJUA 5JZGB 3B9IA 3BIWE 4HPKA 1SLIA 5L7OC 4XILA 1MVQA 4KL1A 4YM0A 4ASLA 1QJU3 4WVMB 1XU1A 3FMGA 5DZGA 2GAUA 4OHVA 2DVBA 3WG1A 4AEDC 4FP3A 4A7YA 2Y0IA 3WQ0A 4IEWA 4KWKA 2ZMKA 1H8TA 4Q26A 4R9AA 1QQP2 1DQ2A 5CG9A 1BBT1 1B09A 2E7AA 4LHNA 1WLTA 4BLJA 3WZ1A 3VBOA 4MGIE 2BFUS 2I45A 1OA3A 4XQ4A 1NYWA 3H1YA 4AFDA 1RUD2 1FX5A 1RHI2 5BPXA 2JDZA 4MYEA 3DN7A 3H9AA 1A8MA 5IK7A 4K9SA 3W59A 4HKLA 3SCFA 2DURA 2DVAA 2R30A 1QXPA 1LOGA 3NV2A 1TMF3 1HXS2 1UU4A 2QUOA 3AMMA 3I2DA 4D7SA 4R9DA 4AQ2A 5C4WB 2OUHA 2GC1A 2V5YA 4MXVA 4XPVA 2PFWA 1J3PA 2WINB 4DPNA 4IQPA 1NCQC 3T1LA 3AKTA 5T50A 1PVXA 2BNNA 2EIGA 1B35B 5K0UC 4P5HA 1GFF2 4JRAA 1RUJ2 1SLCA 1GLHA 5DDJ1 4FOYA 4YW4A 2X8KA 2WS93 2O1QA 2RJKA 1AL21 1R082 2JXAA 3R6SA 4FT8A 1C4RA 4KNCA 4AFMA 4CEWC 1AR71 2B42B 1YO8A 1NQJA 3DF0A 1UL9A 3VDDB 5JMCA 2GMPA 5K7PA 3TAYA 2P34A 5FOJB 4RS5A 3FFQA 3V56A 1RUC2 5GZEA 3N7JA 3BOWA 5CFCA 4J1WA 1DFQA 4C0BA 4UXAA 4HT1T 4M3CA 1W6OB 3O14A 4HANA 4OVEA 1G9DA 4QPGC 1DQ5A 4LR4A 4XQDA 1POV3 2OPKA 2FQPA 1S0IA 2IXLA 3NV1A 2R49A 4JQRA 1XRUA 2WNEA 1AYN2 4XBNA 2D6NA 3POWA 3OY8A 1CAUA 1QQP3 3ZDSA 3MDPA 1RUH2 1MS3A 2OVUA 3RYKA 1W6QB 1O4YA 2AGSA 4IEXA 4COWA 1OPMA 1G9CA 2RS52 3MIDA 3NAPA 4CDWA 4YVWB 2DUQA 4EN9B 2B9UA 1HIXA 4IEPA 2BVVA 3TWIA 1RUD3 4K40A 1RHI3 4CZSA 5BNNC 1Z7S1 2QFEA 3KT4A 4HL0A 1KITA 2QKDA 3VBOC 3VBSA 1LOBA 4Y5Z0 1YFXA 4GH4A 2Z5WA 1W39A 1ULDA 1HXS3 4Y20B 1HRI1 3M2MA 1GSLA 4AK3A 1LGCA 1R091 2ZGRA 4XW3A 4QQHA 5JI9A 2B5HA 1F5JA 3BODA 3OYWB 3ZFEC 1BEV1 3THTA 4I0WB 1BMV2 3IMNA 2ZJCA 1O3QA 4IV3C 1D2SA 1RUJ3 1WLDA 2I2SA 1M4WA 2DCZA 1BKZA 1R083 4YYOA 2G9GA 3WY6A 1NXMA 1YRZA 2ZGQA 3K51A 4EN6B 2Q1ZB 1VBE1 3PVOA 2CNAA 4LHKA 3ZYJB 1DQ1A 2BWAA 1ENXA 4RHV1 2PLV1 4HFSA 1RUC3 2RS32 3WHTA 4CDQB 4P9WA 2ZHNA 5FAXA 5H9QA 3RYPA 2GU9A 1QH7A 1FXZA 4O9GA 1UZZA 2P17A 2WT2A 4WVZA 4CDUA 1AX1A 2ZGUA 3AYAA 4BWOA 4RS5C 1JUIA 3WNXA 3RDIA 1D4VB 1V6LA 1AYN3 3SCHA 2E63A 1N1YA 3FJSA 3U07A 3EO6A 1RUH3 4L97A 4TYSA 1RGSA 3T2TA 4AVBA 4YARA 4C1XA 1LECA 1BVVA 4UW6A 2HWC1 2GDFA 2RS53 2UY9A 3WG2A 1MR5A 4I2OA 1H2LA 4IESA 4OZXA 4Q0UA 4MUVA 4JDOA 1LTEA 4RSUA 5GLTA 1S0GA 1HKDA 2VMIA 4QPIC 4KG0A 3HT2A 2HWF2 4OUSA 3N7LA 1ZNPA 3RMYA 1SACA 1RINA 5J3UA 2EXJA 1FATA 4AGRA 1I6XA 2WLQA 5IUQA 3OPZA 1VAKA 5EYYA 3B00A 2DCJA 3AZXA 4LBLA 2ILMA 3CJXA 1SBEA 5LRRA 2A3WA 1QJY2 2FMYA 2E7QA 2H0BA 3NW4A 4P9XA 2A3YA 4G9SB 2CWMA 4AHWA 4GH4C 1LU2A 4IEYA 3WCSA 2UY8A 4CEYB 1UKRA 1VBC1 1RMU2 4BIOA 3KS7A 3V0BA 2ZACA 4W6WA 3IPVA 2CV6A 5BNPA 1LODA 1OLQA 3ACLA 4MX3A 4YRDA 5C8CB 1WMFA 2D6PA 3ALQA 4B7KA 3OCPA 2FHRA 2DU1A 4KU8A 4XMAA 1YFWA 3QACA 4EWDA 2ARBA 2WNVB 2RS33 3VBHA 4ATFA 1HW5A 2BTVC 4Z1VA 1PO22 2FZ1A 1S2KA 2X53S 3HR9A 1E57A 4EROA 1RUI1 4YG0A 4F3JA 1PO12 3VGIA 2VVFA 4LHLA 1LEDA 3JQXA 2D6OX 2WWSA 2JD4A 3WP5A 3ZXAC 4M0HA 3VZLA 3D6EA 3OD4A 4N53C 4X6QB 5HCBA 1AR72 1PZ9A 1G9BA 3NSTA 1FNYA 2GNBA 1I5ZA 5BV6A 2VVEA 3TYJA 1PGL2 1RUF2 1LEMA 1O3TA 1QJU1 3AM2A 4KGGA 1JN2P 4H7LA 2R071 2WT1A 2YC0A 5EWSA 1CR7A 2HWF3 1XE8A 3L2YA 1WCDJ 2YV8A 5I93A 1LGNA 1AZDA 4GWNA 4UW5A 3VBFB 2YZ4A 4Y4YA 4N7IA 1EPWA 1PZ8A 2YPJA 1ZYBA 2OUJA 1ND3C 4JTNA 4RD7A 3VKLA 3I4IA 3B7MA 2XJTA 3L2HA 3BTAA 4FPKA 2AUYA 3N36A 4IEUA 1QJY3 4G4FA 4XTPA 4K3UA 4AFCA 2IXJA 1ASJ2 1UIKA 1WBFA 2Z42A 1OFNA 2GN7A 3EQEA 4M0NA 3ZXDA 2O8QA 4XJUA 2ZGKA 1TMF1 3GHNA 1RMU3 4YFZA 5L7OB 1UMZA 3MW4A 5A32A 1Y43B 2BWCA 2P3IA 1SCRA 5ABJA 5KXDA 4AI2A 1DHKB 4AEDB 1IS4A 3HQXA 1HRI2 5L36A 1MS4A 4R9BA 2Y0OA 3MF6A 1HLCA 1UPIA 4JGYC 5CNAA 1H1AA 1PMIA 2BVBA 3GYDA 4KG8A 5CFDA 1AR82 4N9HA 3J26N 1PNFA 1PO23 2WS91 3TOJA 2HWB2 4KGQA 2ZX4A 1F8VA 3GF6A 4JGZA 2GC3A 4LLFA 5C33A 5DZFA 1PO13 2RMU2 3HAGA 4FVVA 1YWKA 5D8AB 3VBHC 4OHWA 5C9AA 2BBVA 3OJBA 3SH4A 1AR73 3CO2A 2XJQA 1GV9A 1BZWA 2ZHLA 3DGTA 3SH5A 4QGNA 2PLV2 2YMZA 4K7JA 1RUF3 1LHOA 5H9SA 4XF1A 3H3UA 1POV1 5E89A 5JIUA 1OLRA 2R0HA 4HETA 1PVC1 4OI1A 4Q2FA 5T52A 4AXOA 3EJKA 1NCQB 1TE1B 1JW6A 5JIAA 1QQP1 4Q1PA 2VMGA 5K0UB 2PHDA 2O8OA 1OPOA 4P9YA 4FTEA 2LALA 4DY3A 2TBVA 1V00A 2UYBA 4Y22B 2E51A 4LO7A 2IXCA 2PHRA 1GBGA 2CGPA 4YNIA 1SBDA 4CEWB 1RUD1 4KWJA 1R1A2 1RHI1 4P9LA 2ZABA 3WW1A 4K1YA 3AYCA 1XU2A 2ZS6B 3WW2A 1ASJ3 2ZMLA 2RJLA 3KMHA 4L8QA 1H4HA 5E16A 1YJLA 2PHUA 5DUWA 4QT6A 1HXS1 2WFPA 1FMD2 3W58A 2JENA 4XIKA 4LO6B 4IEVA 1NCRA 1YI9A 5IT6A 2B45X 3WCRA 1KDMA 1HRI3 3LA3A 4FQ4A 1K5MA 4QM8A 3VKOA 1U5IA