1UD1A

Crystal structure of proglycinin mutant c88s
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
461
structure length
366
Chain Sequence
b'NECQIQKLNALKPDNRIESEGGLIETWNPNNKPFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQGKGIFGMIYPRHQKIYNFREGDLIAVPTGVAWWMYNNEDTPVVAVSIIDTNSLENQLDQMPRRFYLAGNQEQEFLKYQQGGSILSGFTLEFLEHAFSVDKQIAKNLQGEKGAIVTVKGGLSVIKPICTMRLRHNIGQTSSPDIYNPQAGSVTTATSLDFPALSWLRLSAEFGSLRKNAMFVPHYNLNANSIIYALNGRALIQVVNCNGERVFDGELQEGRVLIVPQNFVVAARSQSDNFEYVSFKTNDTPMIGTLAGANSLLNALPEEVIQHTFNLKSQQARQIKNNNPFKFLVPPQES'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycinin G1
publication title Crystal Structures and Structural Stabilities of the Disulfide Bond-Deficient Soybean Proglycinin Mutants C12G and C88S.
pubmed doi rcsb
source organism Glycine max
molecule tags Plant protein
total genus 92
structure length 366
sequence length 461
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2003-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00190 Cupin_1 Cupin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1ud1A02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1ud1A01
2GC0A 4XFBA 2H0VA 2XKPA 3LZZA 1QWRA 2IXIA 4D7SA 3N4MA 4ZU7A 2ZKLA 3MPBA 1RTVA 4MV2A 2Z69A 1OD5A 5CU1A 1NXMA 5JSRA 4LA2A 2Q1ZB 4Q0SA 3RYPA 4Q0UA 2PAKA 5I8SA 1RC6A 1CAUB 1ZRFA 4GULA 4K8FA 4OFGA 4Z82A 3USSA 2XLAA 1NZCA 2GU9A 1CAXA 4FT8A 4MGKE 4LA3A 4MUVA 4HN1A 2PTMA 5JSOA 3MYXA 2BGCA 4F8AA 4IEUA 2E9QA 5I0RA 5C8WA 1VR3A 3U0ZA 2VQAA 4E2SA 1NE4A 3GBFA 3WW4A 1ZRDA 4EWDA 4PJYA 3NSTA 4XF0A 1Q43A 4QGLA 4D7TA 3FE5A 2H6BA 1RGSA 3ROUA 4HN0A 2O1QA 1O3RA 2ZCWA 3QOPA 1QXRA 1YHFA 4QXKA 1UCXA 5FDBA 3ACLA 5J7MA 2PYTA 2GAUA 3BPZA 5JSPA 3KGLA 4QGNA 3LA3A 1L3JA 4X6QB 1NYWA 1H1IA 3SCFA 4AQ2A 4H7LA 4LLOA 4BHPA 3NW4A 1J59A 4YARA 1CAXB 3H3UA 1DGRA 2PA7A 2DCTA 2VPVA 4IEZA 3EHKA 1I6XA 5FQ0B 2PQQA 1OMIA 3RDIA 2UYAA 1RUOA 5E16A 1SFNA 3E5QA 1GQHA 5CADA 1WA4A 3RNSA 2MNGA 4LUKA 4QGMA 1YFXA 3LA2A 3RYKA 3FX3A 2OZ6A 1OI6A 4HZFA 3SCHA 1UIJA 4MGZE 1SQ4A 4X6RB 1EYBA 1DGWA 1Q5OA 4YSFA 2BNMA 5BPXA 2BEOA 1LR5A 2BNNA 3TNQA 2XLGA 1ZRCA 4Q0PA 1V70A 1EY2A 1U12A 3OD0A 3LWCA 4QM9A 4MGYE 4B29A 1WGPA 2CAUA 2K9ZA 3BCWA 3TNPB 4IEYA 2IXCA 5KHJA 5F1RA 3E5UA 4HLTA 4I2OA 5EFUA 3CEWA 2K0GA 4E2QA 3U11A 3DL3A 1CX4A 2Y0OA 3NJZA 4LEJA 2Z2SB 4AXOA 1JUHA 5I0UA 1LB2A 2MHFA 5I0TA 3KCCA 3JZVA 2OPKA 5LEJA 3HT2A 1ZZBA 2N7GA 4XFCA 4JV4A 2CV6A 1J58A 2D5FA 2IXKA 3R6SA 5I8TA 3B02A 4E2GA 2ATFA 4WBBA 1NE6A 1TQ5A 2BNOA 3FFQA 1YLLA 5KHKA 4P9GA 2QJVA 1X7NA 1ZZCA 2UY8A 3HT1A 1QY4A 4EWEA 2H6CA 2EAAA 3UKTA 3CLPA 4IEWA 5FQ0A 3ES4A 3E5XA 3MZHA 1J3QA 4QX5A 4IEOA 2BYVE 4WZCA 1CAVA 2B9UA 2XKOA 1QXJA 4IESA 4L2NA 2GZWA 4LUMA 2OYZA 3E6CC 2FQPA 4JTNA 1YUDA 4XF4A 2VECA 2XHKA 5JCTA 3KGZA 2IC1A 1YFYA 1FT9A 1G6NA 4FAGA 2FMYA 3QACA 1ZZ7A 1ZZ9A 4F7ZA 1FXZA 4HSJA 3IDBB 3LAGA 5LRSA 4LTAA 4HBNA 2XL9A 4HSLA 3EQEA 4JVAA 4MZUA 4UBHA 1YFWA 4XETA 3SHRA 4XF3A 3C3VA 3ELNA 3M3IA 4TLFA 3H8UA 4Q0QA 1ZZ8A 1O5LA 1XE7A 3FWEA 4UBGA 4XF1A 2Q30A 1OFNA 2ET7A 4BYYA 1O7FA 1J3PA 4IEXA 4IERA 4XFIA 1CAVB 3PNAA 4EV0A 3CL1A 1PMIA 4L11A 5K8SA 3DV8A 2EA7A 2ET1A 4J1WA 1UW8A 2F4PA 2ETEA 3ETQA 1IPKA 2PAEA 4I09A 1VJ2A 3BB6A 3FZ3A 1O5UA 3EBRA 3I59B 3FJSA 1I5ZA 2HJIA 4J1XA 4KWJA 4IETA 3S7IA 4RD7A 2D40A 2UY9A 3E97A 1ZREA 3RYRA 3RZZA 3VHRA 2CAVA 4IEQA 3GYDA 1J3RA 3EJKA 4PIZA 4O9EA 4XFFA 2QNKA 2IXLA 3DKWA 3H1MA 4I02A 4BIFA 2HKXA 4I01A 3WW2A 3H9AA 3OTFA 5AVPA 4N9HA 4O9GA 3OCPA 5FPZA 4HVRA 1DZTA 3KMHA 3SMHA 1GQGA 1H1MA 2OA2A 5JAXA 5EZWA 3MDPA 1XRUA 4FAHA 3IBMA 3UKVA 4KWLA 2IXJA 3WW3A 2B8MA 1UD1A 1IPJA 1ZNPA 3O14A 4EWAA 4AVAA 4IEVA 1LKNA 2OZJA 4IEPA 2QDRA 1CGPA 3U10A 2C0ZA 4BH9A 1EP0A 3HIFA 3IIAA 3CO2A 1O3QA 5LEKA 3IDCB 4YNIA 3I54A 3OGJA 4XF9A 1ZRRA 1UIKA 3CF6E 3H7YA 3LOIA 1PM7A 1ZX5A 4XFHA 1Q3EA 1XE8A 3ST7A 3FHIB 4KU7A 4WVZA 5D1IA 5I93A 3ES1A 5BUVA 5BXXA 5I91A 3UKNA 2PFWA 5CVRA 3H3ZA 3S0MA 3WW1A 4AVBA 5KHGA 4DINB 2O8QA 3DN7A 4XFGA 3BU7A 4ZU5A 5T3NA 3I59A 2UYBA 2XGXA 1YFUA 4HVQA 1DZRA 1YWKA 3NKTA 3RPQA 4HVOA 4KWKA 3E6DA 2Q0AA 3L2HA 2P17A 2Q4SA 2GH2A 1O3TA 4AVCA 3NVCA 3HQXA 3OF1A 5KBFA 3LA7A 3H50A 2I45A 4QMAA 2GC3A 1VP6A 2GC2A 4MX3A 5FLJA 1Y3TA 2XLFA 1X8EA 2V09A 2D5HA 1UPIA 1SEFA 1LRHA 2IXHA 1O4TA 4N9IA 5KHHA 4YRDA 4I0AA 3BALA 4I0BA 5HI0A 4QM8A 5J3UA 2B5HA 4XFAA 3D82A 3E6BA 4LULA 3IWZA 5I8YA 1CAWA 3PLQA 4ORFA 3H7JA 3I7DA 5BV6A 4HMZA 1HW5A 4ZU4A 5LRRA 4META 4CYDA 5I0SA 4ONUA 3G7DA 5FLHA 2MPFA 1X8MA 4R8HA 4I3PA 4EROA 1ZZ6A 4UXAA 4PIXA 4A2UA 1X82A 2QVSB 4Z07A 1J1LA 5C6CA 2GC1A 1RL3A 2PHDA 5JR7B 3KSCA 4R52A 4AQ6A 3PVBB 3NL1A 3D0JA 1WLTA 2KXLA 3D0SA 4FBFA 2CGPA 5J48A 4PIYA 1ZVFA 4KU8A 1CAUA 4KL1A 3H1WA 2EVXA 2WFPA 4YYOA 1RUNA 4OLLA 3CJXA 4XEZA 2WC2A 4MGIE 3SXWA 4NVPA 3M70A 4MH0E 1EPZA 3S7EA 3ZDSA 3SCGA 5E1RA 4JTOA 2QCSB 5FPXA 4Q29A 2XL7A 2D93A 4Q0VA 1CAWB 5KHIA 2PAMA 1FI2A 5FCCA 2PHLA 3H1YA 5BY5A 3EO6A 1O3SA 1Y9QA 5FLIA
chains in the Genus database with same CATH superfamily
2A3YA 5FPBA 4B8EA 5C5UA 1IKQA 2NLRA 2FDGA 4LOSA 4NJ4A 2VOXA 3LB9A 2ZX1A 4CEYC 2R071 2JKBA 4MV2A 2Z69A 1W6NA 2VXJA 4W6YA 1AL0G 4CZSA 2JDNA 3ILNA 4ZXEA 4Y5TA 1LAJA 4Q0SA 5GZDA 1RC6A 1CAUB 3S5AA 2WSVA 4E4HA 4K8FA 4GH4A 3VD7A 3USSA 1KJLA 5JXHA 1NZCA 1CAXA 1XNAA 5DUXA 4LK6A 5FZ3A 5BNNC 3D6EA 4LORA 4U2AA 5K0UA 2B7YA 2V73A 1A6CA 3K4AA 1LHNA 4HN1A 2PTMA 5JOZA 1QJX2 3ZYGA 2W46A 2PHXA 2X5IA 1ULGA 2JE7A 2FDJA 4JZRA 3VBFA 1IPSA 4CDUB 2HWB3 2E9QA 5ABJC 2EXHA 5T55A 4WM8B 2DYCA 2ZHMA 3WP5A 2W5FA 1RUH2 1K42A 1ZRDA 1HRI1 1W9YA 2K46A 1U5IA 1UZYA 2VQTA 4GXLA 1W9WA 3DGTA 1QJY3 2DURA 3J8F2 5FIXA 4QGLA 2Q8DA 2B9VA 3UGHA 5A33A 3FE5A 4FP2A 5GALA 3NJVA 5JPNB 3ROUA 2BFUS 1EAH3 2VOVA 4CEWC 1E57A 3VD5A 4WVMB 1AJKA 5BNPA 2QQMA 1AR92 5DPNA 1JI6A 4RSUA 1SPPA 1YHFA 3AZZA 4QXKA 4QX3A 2P3JA 5KR7A 4HKWA 5CZKA 1BK1A 5HXMA 5FDBA 3MV01 1OBNA 3LEMA 5JXGA 5J7MA 3BPZA 2JG8A 1ULEA 4FFIA 1NCQB 3WCRA 3I2FA 2UWBA 1W0PA 3N7JA 3NWKA 3LA3A 5A3LA 1L3JA 3WHUA 2WFF1 4YM0A 4AQ2A 1R083 2A5ZA 3O5SA 4COVA 2DU0A 1VIWB 2XJQA 5FR3A 4YFZA 3KB5A 1J59A 2WWSA 2UURA 5FZ4A 5I0DA 4IEZA 4Q4W2 1LECA 5FJHA 2PLV1 1GP6A 2VU9A 4AHZA 3LOBA 5T5PA 2H0BA 4TN7A 4QKNA 3LEIA 2QUOA 3RDIA 3K3OA 1WCUA 1Z0HA 4N90A 1AXZA 1L7RA 4P9WA 5E16A 3M1HA 3J7LA 1WBFA 3FUQA 4EQVA 3AKTA 3UYJA 2JB8A 4KGQA 3RNSA 4DQAA 2MNGA 1UU6A 4KQ7A 4R9BA 5CFCC 1SBDA 4B3NA 2WZR3 5FYTA 4H3WA 1ZBE1 3LGRA 3CJIB 1PZ8A 4AWDA 1OI6A 4CU6A 2PMWB 2XUMA 3SCHA 4Y33A 4KBZA 1UIJA 1W6MA 5CA6A 3C7HA 1STMA 4X6RB 1EYBA 4YVWA 4YSFA 2XJSA 2KA3A 2DWRA 1JMUB 2YGLA 1HRV2 3A22A 1HDKA 4CP2A 1DQ4A 4AZZA 1AYM2 2P3YA 1LR5A 3WP3A 2VMDA 3AP5A 4HOOA 3TNQA 4XBNA 1PO12 3T30A 2RS53 4CXXA 5BYNA 1V70A 4M01A 4YW1A 1EY2A 5FXWA 1SLCA 2Y8KA 5FZHA 3E1F1 3AP4A 3MFCA 1TNFA 2L9LA 3VD4A 3POGA 4RHV1 2WR9A 3TNPB 2Y34A 3HN3A 4WM8C 1X9PA 3WNXA 2HYXA 1XNBA 3I2GA 1FMD2 3APBA 3PURA 4NPMA 2RS11 3E5UA 3F2ZA 3OBAA 3Q9OA 4YFWA 3HOBA 4AE2A 2K0GA 3U11A 4HK9A 4XHXA 2RDQA 4NR1A 2AGSA 1Q8PA 3O1SA 1AL21 1N1VA 1YNAA 2GP5A 2VMCA 3ZXAC 1QNWA 4PBOA 4A3ZA 4XHBA 4ASLA 2FZ1A 3UL2A 2ZA9A 2WQZC 2Y0IA 1B35B 1QMJA 3JZVA 3LSEA 5F3GA 1Y7BA 1JYTA 4YG0A 3OPWA 3WG2A 3MW3A 4BZ4A 2D5FA 2TBVA 3MFAA 4QX2A 5FYZA 2XXZA 1NCQC 5A3UA 5I8TA 4TTGA 4E2GA 3KV9A 1ZBA1 3B69A 5A6ZA 2CWSA 3WF3A 3DPRB 2HWC1 2GNBA 2WNUA 1POV1 3FBYA 1C8M1 2QQIA 3P6BA 4P9JA 1X7NA 1W8WA 3WINE 2X09A 4B7KA 1OA3A 2A6VA 4EWEA 4NN0A 1Y4WA 4A44A 4CTEA 4N53B 2DVFA 4IEWA 2XQRA 1WMFA 4R4XA 3MZHA 4IGOA 1S0IA 4CDWB 2P6CA 4ATFA 1RINA 3TOJA 1CAVA 1KXGA 2ZGLA 3WOGA 3WQBA 4W4ZA 4F3JA 1MEC3 2RMU1 2YZ4A 5K7PA 3B94A 4LUMA 4Y22A 4XC9A 1E5SA 1S2BA 4IQPA 2VZRA 1CZSA 3CNAA 3J7HA 1VBA3 1G9DA 4XF4A 3R0RA 4AAXA 1KS4A 1GZWB 3WR0A 3LEKA 3ZIWA 2X29A 1JODA 1KITA 4AFAA 4K9SA 1Q8SA 2IC1A 4Q8LA 3CJIC 5F7UA 1NUKA 3I2HA 5C33A 1JZ3A 3R05A 2CL2A 5JOXA 1VBB2 1UY0A 2A70A 3SQOA 1G6NA 1MS0A 4IGQA 1PHMA 1YC61 2FMYA 5FV3A 3QACA 4CPBA 5L19A 5H9SA 1VBC3 3ZLIA 4UF0A 4WVWA 1FXZA 1YJLA 2WUHA 3LAGA 5LRSA 5G04L 3BI3A 5FZMA 1SBEA 4LTAA 4HBNA 2XL9A 4IV3B 5L7OA 4MZUA 2IUWA 5D8AA 1DP0A 5AFBA 1N3OA 4UBHA 4LBNA 5T52A 3SHRA 3PTYA 1TME3 5A6QA 3C3VA 1MZEA 3CKHA 4LKFA 2OKXA 4QPGA 5CISA 5T5LA 3FWEA 2LW8A 2A1XA 5KXCA 3AZYA 2YFUA 1OF3A 3SKVA 1QOOA 4BYYA 3OEAA 1LU1A 4WM7A 5DXDA 3D3AA 1ND2B 2BP6A 4IEXA 3WHTA 4EV0A 3MIFA 3PUHA 1EPWA 2HWB1 4JQRA 4CUGA 2Y26A 3DV8A 2ET1A 4XBQA 3HQRA 2F4PA 1WWYA 2BOIA 4Y1XA 2WO2A 3PVOA 4ZS3A 3W5NA 5FYSA 3BGAA 4EYUA 1UMIA 2P3KA 2WQ4A 4KG8A 4QPIA 5GLZA 2R6QA 2AYHA 3ORJA 4I09A 1OUSA 1R64A 3FZ3A 4MG2A 3UJQA 4WVVA 5FREA 1QJY1 1UOBA 3S5QA 3I59B 3PVNA 4JDNA 3FJSA 2HJIA 3KT7A 4KWJA 1Z7S2 4GA9A 1G7YA 1EAH1 1EV13 3PUIA 3DKQA 4UFJA 2YPDA 1RUD2 2C4XA 2JDHA 4YGBA 3POFA 3AC0A 4XTPA 1QJFA 3EB7A 5IAVA 2PHWA 1D0GA 1C3HA 2FCUA 2ZZQA 4JX0A 3ZPOA 1WD3A 4N53C 4NIDA 4Y1YA 3H1MA 2ZGOA 3PU3A 2GN3A 4QDQA 1S0BA 4RL7A 5F9TA 1ONAA 2BFUL 1FOD3 2ZHLA 3N9OA 4N9HA 1R081 4BPZA 5FO7B 3OCPA 2WZPP 5C4WA 5A70A 1NAEA 4RS5A 2J1VA 2V72A 5FYIA 1MZ5A 2QKDA 2JG9B 4N7IA 4XUQA 2WYFA 5DAXA 4AF9A 3ITQA 1BK0A 2Q5TA 1HV1A 4LKEA 1ZNPA 3WDXA 3OGVA 3VBOB 3PHMA 4OHWA 1LKNA 4XQ4A 3JD72 1M06G 1U5YA 4O7XA 4CU8A 2XMLA 1D0HA 5JWPA 3I4IA 2C24A 4FCAA 3WX5A 4S2FA 3VKLA 1GLHA 2VNRA 2WZR1 5FZ0A 4FPKA 4IV3C 5LW9A 5FYYA 2VZOA 1LODA 2VULA 2HWF3 4N43C 4XUOA 4IE6A 1PZ9A 4OVEA 1FNZA 1E5IA 4QHZA 4OHYA 4DB5A 2JDAA 2GMPA 1O3QA 2LRPA 4JDMA 1GU3A 4IE5A 2JECA 4NE9A 4CXWA 1WD4A 4LO4B 1ZRRA 1LHWA 1AX1A 3CF6E 3LOIA 2FHRA 3SC7X 2RS51 4R9DA 1ZX5A 1DHKB 2J1TA 2VCBA 1UWWA 3ZSMA 2QQPA 4AEKA 2JD9A 2BVVA 5D1IA 1XNDA 5BNOB 5I93A 1U0AA 3ES1A 4OZOA 5LASA 5A7QA 3AVSA 3PL0A 4YW3A 2R0HA 3WW1A 2VBPA 4MXWA 3CQOA 1BCXA 1WLCA 2CGOA 1Q56A 4LIUA 1HQLA 1OLQA 3HPNA 4HETA 2UYBA 2XGXA 4IL7A 5CG8A 4K1ZA 5A32B 1Y9MA 1H2KA 2CYFA 1PGL1 4YW7A 3NKTA 3RVHA 3E6DA 2Q0AA 2P17A 2GH2A 2AEYA 1O3TA 1CX1A 4AVCA 1XB9A 3NVCA 3V65A 2W1UA 1V6LA 1N3PA 3ATGA 3WF0A 1KD7A 3AXDA 3ZR5A 1BEV2 1RXGA 3LA7A 1JOJA 1HKDA 3VKOA 4NPRA 5IYYA 4AEDB 2GC3A 1PO23 3LDKA 4QU1A 1XOYA 1DGWX 1VP6A 1OF4A 1DDLA 2WZEA 1RUE3 4E9KA 2VCMA 1JYWA 5FLJA 3FLTA 5HCHA 4AI9A 4CU7A 3A0NA 1RUI2 2D5HA 2EXIA 3GZAA 2ZJCA 4KH9A 1UPIA 4Q4V3 1W9FA 1BBT2 1W6NB 1SEFA 3MUY1 3ME2A 5FZAA 2JDPA 2F6BA 1AX2A 1OLME 2BPA2 4BQXA 1O4TA 3MIDA 2C26A 2JG9C 3TN92 1S0EA 1TNRA 4M4RA 2FDFA 5EWSA 2BBAA 2VGDA 4DY5A 5HI0A 1UPSA 2VG9A 4Y4RA 3WG1A 4QHBA 5J3UA 3M3CA 1MEC1 3VBOC 1U5XA 3HR9A 4XJ9A 1CJPA 4GH4B 4W6WA 4QQPA 3CZJA 4K3UA 5EHDA 1AJOA 3E6BA 3HNMA 5C70A 3EMRA 3UV9A 5I8YA 1BMV1 1VBA1 3J7MA 5K0UB 2RR12 1DQ0A 3I7DA 1KEXA 3AM2A 4GD4A 5BV6A 1SLIA 4ES8A 5FZOB 4HMZA 4XOGA 1PIV2 1WLWA 2YC4A 3VBFB 4O65A 4QPYA 3BVCA 5FP7A 3WXPA 1IOAA 3POIA 1VBC1 2ZGRA 2HWE2 5JIAA 4R8HA 3W58A 3VL8A 4ES9A 4AQSA 3RZLA 1PX4A 2YBSA 4UXAA 4PIXA 3VV1A 1NOVA 4Q4Y3 4YZ1A 4Z07A 3H3LA 3T1LA 2DF7A 1RL3A 3AB0A 1NA1C 1PK6A 3MLKA 2IFRA 1AZDA 1LGBA 3A0KA 3KHBA 3VHOA 1TME1 1V00A 1GWLA 2KXLA 1HIXA 4AFBA 5BNOC 1W2TA 3IN9A 4GJYA 1ZVFA 4KL1A 1T6GC 2WT2A 4FTEA 3J26N 3Q8FA 5FYVA 1FYUA 3WP6A 2WO3A 5FO9B 4B7EA 4M4PA 5JUVA 4NVPA 4XABA 2GNTA 4IV1A 1TMF3 2JG8B 4SLIA 4YGCA 2Y6GA 3H0OA 2EALA 4PCRA 4JTOA 5DZEA 1RYYA 2QCSB 4Q29A 4MXVA 4ZPIA 1N1SA 2XL7A 1W8FA 2R043 2ZAAA 2B4KA 2EXJA 4UW5A 4XQWA 4PF1A 4DY3A 1RHI3 2VC9A 3KCXA 2ZAHA 2PAMA 5HPOA 4P02B 5FCCA 3I3MA 2PHLA 1BXHA 3DCQA 2VTFA 3BTYA 5T5OA 1T6BX 3AYCA 1JOBA 4M0NA 4AI2A 1Y9QA 5FZCA 2JIGA 4JC1A 4CP1A 1LOGA 3ZSEA 3ZYFA 2HYKA 5EPAA 4GWNA 1EV11 3I3QA 4BOWA 2QQNA 1QWRA 3UESA 4ZU7A 2ZKLA 4E4SA 4BM8A 4E8DA 3RZGA 4QU2A 1GZ9A 5FZ7A 1OD5A 5FZIA 3ZXDA 2VZSA 4Z92B 5FRAA 1W2AX 4LQRA 2A3XA 2C5DA 4FPOB 3DXUA 1H30A 1Q8QA 1NXMA 3N36A 5T54A 5FMCA 2A3WA 3NNJA 3ZFEA 1W6MB 1XC6A 1I9RA 2Q1ZB 3RYPA 1FOD1 2PAKA 1REDA 5I8SA 1SFYA 1GP5A 5F5IA 4XILA 2AC1A 4GULA 4UOJA 4JKLA 3MHZA 1IQAA 1FNYA 1WCDJ 4R9AA 4YPJA 5DZFA 2XLAA 4GH4C 1NCRA 5ACA2 4XMIA 4BA6A 2J1UA 1W2UA 4MGKE 3TWIA 1V6NA 2ZGKA 4A4AA 3LE0A 3O1PA 1IZ3A 1PGW1 4AK3A 3MYXA 2SLIA 4F8AA 3H8XA 3VBFC 1XNKA 5EIYB 3U0ZA 2FBEA 3U07A 1D4M2 4MGTA 5AFEA 1W05A 4JAAA 1NE4A 4ITCA 1CN1A 2D43A 4GWMA 3GBFA 1XQNA 1ULFA 3ETPA 3KLSA 2A6WA 1UN1A 4XJZA 1ENQA 4PJYA 5LA0A 3NSTA 5JR2A 1BVP1 2VZ1A 2HWF1 1AR72 4COYA 1NKGA 1DIWA 2E33A 3FFZA 1QXRA 3KF3A 5ANNA 5L9RA 5HV4A 4FOQA 1GKBA 3QCWA 2XBO3 4BK4A 1RUJ3 1QKQA 3VZMA 4INDA 3ACLA 3T2PA 1XU2A 2PYTA 5TSWA 4UYBA 2DCKA 1RUH3 3KVBA 2TNFA 4Z2AA 3KGLA 2JG8C 2ZABA 1NG0A 3VDCA 3WVJA 5FPUA 4MVTA 1H1IA 3POEA 1F9KA 2BJSA 3J4UH 1LOCA 3LFIA 1XE0A 2BZDA 2QQLA 3J8F3 2CDOA 4LLOA 5F2WA 2WNUB 1C4RA 5FZ8A 2PA7A 3H42B 1TZOA 2X05A 5CFDA 4EN6B 4NIHA 1W8NA 1SDDB 1LGNA 1UY1A 1AR93 1PVC2 4D7YA 5A3NA 4M3CE 4LT5A 2W91A 2GP3A 1FV3A 4AEJA 1IGOA 2ZZJA 1XYPA 2A6ZA 4P9XA 3T0AA 1SFNA 2DU1A 3AMQA 3AP9A 4DXRA 2VTXJ 5DABA 4QB2A 5GLUA 3AJZA 2ORZA 3N7MA 4QKBA 1BQPA 4AHWA 3JB4C 2A6XA 4DUWA 2QQUA 3MW4A 1LOAA 2ZGPA 5DDJ2 3TB0A 3RZHA 1JOPA 4NWWA 1FATA 2LM3A 1HB3A 3HEIA 1C1FA 4FPGA 4GMP3 3OPTA 1PO21 3I2KA 1S0JA 3N9QA 3ZYIB 4AG4A 4Y5Z0 1SQ4A 1RUE1 1DGWA 3LKJA 3N9LA 5FMOS 4CP9A 5A3OA 4EZHA 1TVGA 4UF0B 5IAXA 4AGGA 1YQ5A 4N7UA 5E88A 4Q4V1 2DUQA 2WN3A 1S0GA 5GJ6A 1JUIA 2XLGA 1IG3A 4Q0PA 5L7OB 4QXCA 5D8AB 1ND3A 1U12A 4AW7A 4MGYE 3BOPA 1WGPA 2CAUA 3BCWA 2OQ6A 2K2SA 3DUIA 1SLLA 4UFIA 3RQ0A 3ZX7A 4Y26A 2ARCA 3LPFA 3VL9A 1HRI2 1X50A 1GR3A 5KHJA 3ZSLA 2VY0A 2Y6KA 5FY4A 1JZ5A 4WM7B 4HFSA 5GZFA 3VKFC 5C3SA 3DL3A 5FJKA 3NJZA 2D3PA 4FO9A 3RFRA 5HV0A 4AXOA 1E5HA 1WMXA 2EIEA 4UW3A 5FUNA 4AHYA 3LDBA 3VZOA 1OPMA 1LB2A 2MHFA 4MGSA 5C8CC 3RZMA 4B1MA 5A6XA 3GZTB 1H8TC 2Z42A 2R16A 4LIVA 4QPIB 1RUC2 1MS3A 5LEJA 4LKSA 4FQ4A 5H9QA 2CV6A 2KM2A 4Q4Y1 1J58A 4PT6A 3SH4A 1CR7A 5IATA 4AGRA 1BHGA 1FMD3 2WFF2 5CNAA 3POSA 2ATFA 3DYMA 2GNMA 3AP6A 4AVVA 1NE6A 1TQ5A 2WBKA 3C7GA 3VBHB 4RR3A 2BNOA 1QOTA 1CWPA 1NX9A 1H2NA 1WW4A 4RA0A 3ZFGA 4M0HA 3T2OA 4Y24A 5A6YA 5KHKA 2WNUC 4LBJA 2Q1FA 1IKPA 1VBD2 1ZZCA 3WNNA 1JYCA 2WS93 5FZ1A 4BDVB 1QY4A 2ZGTA 4YZ3A 1VPHA 4I3GA 1TMF1 1W3VA 2GMMA 2TEPA 1GMMA 3CLPA 3K3NA 3WDYA 5FQ0A 3ES4A 4EN9B 4CCMA 3N7KA 4UFMA 5E8AA 2B9UA 1PX3A 1UMHA 2R041 1DYPA 2W52A 4YM3A 2XVLA 5C4WB 1FPN3 4UWDA 5FZLA 1RHI1 1W0NA 4NHMA 1AR63 5FYHA 4CUCA 1ZBE2 1H6XA 4I0WB 1YUDA 2D6LX 5IVYA 3VDAA 2XHKA 4JHZA 5JOYA 1UQXA 3GHMA 4QX8A 4OI4A 4JKKA 4IUGA 3MLLA 1YFYA 3N9PA 1FT9A 4BQ3A 4FAGA 3ZXFA 4YZ2A 2E51A 1ZZ7A 2C1FA 1H4HA 2DVDA 4TZDA 1HXS2 3K77A 3O1TA 3O1OA 2FDIA 3PTRB 4W8JA 3WY6A 4HL0A 4SBVA 1JW6A 3EQEA 3WQ7A 1K5JA 4RHV2 5L7OC 4QXBA 4LO7A 3VB9A 3TEYA 2EICA 3RZJA 3SH5A 5LBCA 3ELNA 3M3IA 1JTZX 3M3EA 3NAPA 4QWNA 3MO4A 1ZZ8A 4MHUA 4AI8A 1JN2P 1O5LA 2D3SA 2O0OA 2RS12 3QBQA 1N47A 3VN4A 1CJDA 1VBB3 5M0TA 4UBGA 1OFNA 1RIRA 3PU8A 1QH6A 4CVUA 4LE3A 2XOMA 1QJU2 3GXUA 1I5PA 2YY1A 1GOFA 2MEV3 1RXFA 5KXDA 1YXWA 3WG4A 3CL1A 5FY7A 2DCJA 3WG3A 5CYYA 5FZ6A 5K8SA 1F15A 3ZMNA 1R1ZA 2YROA 4DS0A 1UW8A 3OUIA 4LO8A 4FP3A 3RJRA 1RVF2 4JGYA 2XB6C 4L9BA 4MXWB 3WDVA 3MF9A 4ASMB 2PAEA 3AKQA 4M3CA 2YC0A 4P9LA 1ZBA2 4CDQA 1LHUA 3OJBA 1ENXA 4TXWA 2WQ8A 3VZNA 1I5ZA 3OBTA 2ZHKA 3VBHC 5JOWA 2D40A 2RM22 4IE7A 3PMEA 4XAAA 3V0BB 1VLNA 4Q1RA 4XXPA 2QQWA 1GOGA 1LEDA 2XBO1 5A7WA 1RUJ1 2VTXA 4NPLA 3GYDA 1PM4A 1AX0A 3AYDA 1O59A 1OSGA 4O9EA 2QNKA 3JB8A 1RUH1 2IXLA 1XYOA 1G86A 3ACIA 1W04A 4D6RA 4I02A 4CDUC 5DMYA 4QB1A 4XQDA 1NZIA 2HKXA 1JYXA 3H9AA 2V5YA 2UWAA 4Y1UA 5ANQA 3J8F1 3VBSA 5L9BA 3AFKA 1RUG2 3N9NA 3WZ1A 3M4FA 1Z7S3 2WO7A 1FV2A 3HBZA 4Q4X3 2X53S 2VMFA 3AMNA 3N7LA 1H1MA 4P5HA 1AUYA 4AQTA 2YPJA 1CIYA 2FCTA 2ARBA 5C3RA 1AR91 4FAHA 1RUD3 1ULDA 1YQ6A 3R4SA 3T2TA 5A1AA 1KFUL 3WW3A 3VBRA 2B8MA 3IDEA 1VMHA 2BRTA 1G9CA 1VMJA 1UD1A 1IPJA 3O14A 5J1XA 3ZYJB 1QXPA 2RE9A 2C6SA 1KDMA 2DBIA 5J36A 4YW5A 4Q27A 1LCLA 3C7OA 2ZX3A 1S2KA 4PLNA 3OGSA 4GQ7A 2A75A 2WAOA 1GV9A 3RGBA 3X29B 5LBBA 4C0HA 3M7AA 2BGOA 1RUF2 5FTTC 1OURA 1GOHA 1XJAA 3PVEA 4OMCA 4GMP1 2W1QA 3ILRA 4Q2FA 4LPLA 2B42B 3M3OA 3IIAA 4FFFA 2XDVA 1UKGA 1UXXX 1AHSA 3JXSA 5IUQA 1DF0A 4XJUA 4GWIA 4A7YA 4BLJA 2XJVA 5LEKA 4GAZA 1R093 3POJA 4X8PA 3ZOIA 5DG2A 4F83A 3I97A 5A7NA 4CEYA 1VMFA 1SLTA 1F5FA 1PM7A 3NJXA 4DUVA 3JD73 1G9BA 5F39A 2JDMA 4PQ9A 3GZUC 1C57A 3G6JB 2VJXA 3ST7A 1VRH2 5FMOL 2FCVA 4KU7A 3BTAA 4WVZA 2LROA 2AZ5A 2WABA 4OHXA 5BUVA 5I91A 2E53A 4FXGB 5FY5A 3KV6A 5FUPA 4D94A 5CVRA 3S0MA 1XNTA 5A3PA 5KHGA 3J7NA 1JYNA 3LFMA 4DINB 4OHVA 4PDWB 3DN7A 3H8RA 2HWD3 1ZYBA 4IV1B 1JU3A 2B45X 4LO6B 5HXVA 1GYKA 2JB4A 4BISA 3K75B 1EAH2 1LU2A 2WA4A 1BZWA 2JE9A 1PO11 1K5MA 4DUXA 4OUMA 3S6PA 2XJTA 1R1A2 5A7PA 4HVOA 4KWKA 3RPQA 5CEHA 3L2HA 4LHSA 4XYXA 2WNEA 3T09A 3WNMA 4K40A 2VVDA 1UX7A 4MGQA 1SCSA 2C9KA 5A7OA 4QMAA 1FMD1 2RS32 5FZDA 1R082 2GC2A 1NY72 5C7GA 1XPWA 3WNKA 1WUVA 2VW1A 5IK8A 2P37A 4H55A 4XURA 3ZDVA 3MPPG 5CG9A 5FPVA 1Y3TA 3B9IA 4CEWA 5KWRA 1ST8A 3LF7A 2Y64A 2W3JA 4S2DA 4FPJA 5EYYA 5FXXA 3QH7A 1QQP2 2WS91 1LRHA 5C3PA 2G9ZA 2J7MA 5KHHA 4CCDA 1W3XA 2ARAA 3ZXKA 4I0AA 3ZN5A 3ZFEB 2VNVA 1H9PA 1WCKA 3W21A 2VM9A 1BEV3 3BALA 1UYXA 1ZM1A 4ZY9A 2J22A 2RV9A 2Q8OA 4A41A 5B4NA 5KC6A 3OUHA 3U78A 3VD9A 3ASIA 2B5HA 1UZ0A 4XFAA 1UZZA 5DUVA 1B35C 1FPN1 1H6YA 1NCRB 4YZ4A 2AENA 3RWKX 4D6QA 1AR61 3A4UA 5JLVA 3JQXA 5E89A 4DEVA 1CAWA 5JXIA 2OPWA 4ORFA 1MQTA 2YYOA 2ID4A 3H7JA 1XU1A 2WL1A 2XONA 3CZUA 5GKAC 3T3YA 1TG7A 3HBKA 2E31A 3OYWA 1JZ2A 2WSUA 4XPVA 2DV9A 5FXVA 4DXTA 5LA1A 2ZMLA 4ZU4A 1V9U3 3DPRC 5I0SA 3TN93 1YRZA 2SBAA 2W0XA 5B2GB 5FLHA 3VKNA 4AFCA 1GWKA 4OI0A 1X8MA 4QQOA 2R49A 3JU9A 3ZFFA 3IKWA 4QD2A 2JD4A 4I3PA 4X8NA 3RS6A 3FN9A 5CFCA 1W90A 4A2UA 2R0FA 1J1LA 5IK7A 4AQ6A 4CDWC 5DUWA 2R063 2RR13 2VZVA 4AI1A 3OUJA 3VDDA 4ZZ5A 4FBFA 2VXRA 3I2OA 1N1TA 1ULCA 2CGPA 5J48A 2WNVA 1O6UA 4FOVA 2DTWA 1CAUA 4KU8A 4MHRA 3I8TA 4XACA 2EVXA 2WFPA 1VBB1 4YYOA 3KT4A 4C91A 4OUSA 1G8WA 1BLZA 5APAA 3SXWA 1OXCA 4Y20B 4PDWC 3HAGA 1SACA 4DMIA 2WYSA 2MEV1 1PGL2 1DYOA 3IZOA 3RG0A 2QZ2A 2CDPA 3SCGA 4ZXKA 4I30A 3BIEA 5ERLA 1LOFA 3LSDA 2CU5A 1WZXA 4NIIA 4WM8A 3I2JA 2JX9A 2XVGA 5J09A 1A8DA 2V5DA 1GNYA 2PXJA 4FPLA 1FI2A 1LEMA 1VE0A 1H8VA 5BY5A 5CFDB 4LBQD 3T0BA 4Y5SA 1VAMA 3VHPA 4BU2A 1SZBA 3ZSJA 5FLIA 2OUHA 3GJAA 4FPHA 2CTVA 2VUJA 2ZKNA 2H0VA 2XKPA 3LZZA 4AGVA 1ASJ2 5A1LA 4WVMA 2IXIA 4D7SA 3N4MA 3AJYA 1U5ZA 3MPBA 4QX1A 4GKXA 3V56A 4GB33 4OHZA 2VMIA 1H1AA 1HQWA 1KFXL 1QGLA 4AOCA 1ND2C 5IJRA 3TBDA 5JXJA 1SMVA 2XUEA 2VQUA 4LA2A 3ZFEC 1YO8A 4LITA 4CP9B 2WKKA 2G1MA 4S2GA 1ZRFA 2WDBA 3ECQA 2R30A 3VHNA 3O1VA 1Z7S1 4Q4X1 1NCRC 2GU9A 4E27A 5JZGB 3ENRA 1KJRA 2YFZA 2CSGA 3A23A 1H4GA 3B7MA 4LA3A 2ORXA 4MUVA 4CCCA 3W20A 4L99A 1ND3B 1IQDC 1RUD1 2CY6A 2BGCA 2JDZA 2WLQA 3AFGA 2ZS6B 4YW6A 3ZKYA 3EYPA 2W95A 4RQPA 5I0RA 5C8WA 2VQAA 2GNDA 1B09A 4Z2WA 2QBXA 1HB4A 3KM5A 1LESA 4QQHA 1V6JA 5FPLA 4A42A 4D69A 3VBUB 3AK0A 1OKOA 5DN2A 3WW4A 2XG3A 2Z4FA 1QEXA 1XSRA 2ENRA 2JXAA 1ULOA 4EWDA 5ACA3 1DFQA 1DGRN 2JDKA 1Q43A 5CKNA 3RMYA 1GNZA 1OVSA 1JYIA 1YJKA 2O14A 5KXEA 3N9MA 2DUPA 4DRRA 3KS7A 3ZO0B 2D98A 1O4ZA 1R091 1DBNA 4BCUA 4NHXA 1CONA 3GNEA 1D4M3 1JZ6A 2OVUA 3ZPYA 5IVJA 3JD71 5FP3A 2GAUA 1W8ZA 2AEZA 4QGNA 3GM8A 1DU3D 3ACFA 3SKJE 3VKMA 1NYWA 3JBG2 4P5YA 4ARXA 5A3MA 4H7LA 2B46X 3MIGA 4FPFA 2BBVA 3ZFGB 1CAXB 1DGRA 3A7QA 1RJ7A 1HB1A 4PQQA 1AR73 2BWCA 4XAEA 5CFDC 5EXOA 4ET7A 4CXYA 3EHKA 2HWD1 4XUNA 2KD7A 1I6XA 4OQ9A 2X5IB 1S0CA 5FQ0B 4V2VA 1VB2A 1OMIA 2BV4A 2PQQA 4LBLA 5EP9A 5FKCA 4P9YA 4URAA 2W39A 5GM0A 1BYHA 2RJLA 3F95A 3LQCA 4ATEA 4YW4A 1RUOA 1QDCA 2P5BA 1W6QA 1W8UA 4P08A 1AYN2 2A6YA 3E5QA 3IPVA 2J42A 1WA4A 4XBLA 4QX7A 1YFXA 3LA2A 1MVQA 3GALA 3I3EA 3RYKA 5F6KA 3VZJA 3BTXA 2VD7A 3FX3A 3N3HA 4AYUA 1FOD2 2OZ6A 3B00A 5FZGA 5A33B 2YC2A 1NT0A 4XZUG 2LALA 4MGZE 4FPEA 4CCKA 1Q5OA 2X8KA 4FTSA 1PVC3 4YM2A 5BNPB 2BNMA 2EAKA 4NRPA 5BPXA 1W8HA 1GBGA 1AR82 1SPPB 3S30A 1T2XA 4AHXA 3SEEA 5LA9A 2BNNA 3PUSA 1ZRCA 2QFEA 3MUZ1 3NMBA 5JZGA 4MLOA 2OXBA 3U75A 1ND3C 3OD0A 4N53A 3KQRA 5DDJ3 4QM9A 4OQ8A 1BEV1 3NAPB 1CESA 3RI9A 4HT1T 1COV3 1CZVA 1LGCA 3AVRA 1UY3A 4YGDA 4YW2A 4CCJA 2IXCA 4QKFA 5E6HA 3VBUC 5F1RA 4FQZA 5EJZB 4QQLA 2W2IA 5K4LA 4RYDA 1RMU2 1GP4A 2ADDA 3O12A 5EFUA 3WLUA 4CE8A 1MACA 4AEDC 4B4PA 1CX4A 1SHWB 2Y0OA 2ES3A 5FFOC 2BWAA 3KWVA 3O0WA 2Z2SB 1JUHA 1W0OA 1YQ2A 1V9U1 2ZACA 3TN91 2JICA 4DNYA 4PBPA 4DRVA 1VBE3 4QDRA 3UT0A 4JGYB 3U4SA 2D6PA 1S1AA 3K46A 5FAXA 1OQEA 5A1FA 5CBLA 2OPKA 3MIBA 4M3CB 3HT2A 4XFCA 2N7GA 2HEVF 4YM1A 4JV4A 4ZHNA 1CPMA 1US3A 5J98B 4CDQB 2IXKA 2DTYA 2J1EA 1BKZA 4R9CA 4A7KA 1PNGA 2ARXA 2ZEXA 3LD8A 4N43A 3B02A 4YVWB 2VUCA 2R061 5CKQA 5FXZA 2RR11 1V6KA 4WBBA 5C71A 1S55A 3FFQA 4K8RB 4L0PA 2VVEA 4Y1VA 4XIOA 5L73A 5IK4A 3SLIA 3ACHA 3ZFGC 2C9AA 1CIWA 2VMHA 1LOBA 2Y33A 4P9GA 5A7WB 4HK8A 5K0UC 2UY8A 2BW8A 3TRSB 3HT1A 2E7QA 3LIHA 2EAAA 4PI0A 4UFHA 5FZEA 3AYAA 3POWA 1RUC3 1LENA 2X5IC 4RGKA 1J3QA 1Q8OA 4QX5A 3THTA 4BQWA 3O1MA 3BTZA 4WZCA 2IZWA 1JBCA 4V2WA 1QXJA 4LHLA 5FBJA 3A21A 4L2NA 3VBSB 2GZWA 3M8LA 4XCBA 4XIKA 1IS5A 2YB7A 2OYZA 2RDRA 4NHYA 1UZVA 1WA6X 4JTNA 4BIOA 3MIHA 5FZBA 2I74A 3FMGA 5H9RA 1BVVA 2VW0A 2NMNA 5IFTA 3KGZA 2G19A 1PMHX 1VBD3 4KG0A 1GANA 1OPOA 5D2AA 3VBRB 4Q8KA 1P8JA 1S0FA 2PHRA 2Y6FA 5JVVA 1QJX3 5J37A 1ZRIA 4LBQA 2ILMA 3GGLA 4RGGA 5BNPC 3CMGA 4DPNA 1ZZ9A 3LDRA 4F7ZA 4HSJA 3PUQA 2O8OA 2VZUA 1OVPA 3T2QA 4MSVA 2Q8EA 5IFPA 3VUOA 4HSLA 4GB31 4JVAA 3W9AA 4LNVA 1V6IA 4D6SA 1YFWA 3QD6A 4XETA 4XF3A 5HCBA 2VZPA 2P6HA 2VOWA 1UF2C 3H8UA 3NAPC 4Q0QA 3THPA 2Y6LA 3ZXGA 5AC92 5IVBA 2WO1A 4LXLA 4JQTA 2E26A 4XDPA 3C7EA 3DXTA 4XF1A 5J96B 4CEYB 4C90A 1F5JA 1XXNA 4MADA 2ET7A 1DQ2A 1O7FA 1HXS3 3N35A 4ISQA 5F3EA 3O1UA 2JG9A 1HLCA 4UFLA 5IVVA 4XFIA 1BJQA 4K6BA 1CAVB 4BLIA 3MEPA 2OT7A 2R072 1RB8G 1VAVA 1L7LA 4Y22B 2YGMA 4J1WA 2ETEA 3ETQA 5LK7B 5FOJB 4PF5A 3HN1A 2X10A 4AFMA 5A3WA 3KV5A 5ACA1 3BB6A 1MPXA 4KNCA 4Q4W3 4JGZA 3I2IA 3ZN4A 2D6MA 1OQ1A 2XR4A 4YVWC 1K5MB 1DQ5A 4IETA 1QJU3 3WV6A 5FYMA 3FHAA 1PVXA 3ALQA 4RD7A 3KVAA 2Y6JA 4JRLA 3S7IA 3GBGA 4B4RA 3AZWA 3IB3A 3Q8AA 1WMEA 2DBNA 4OCTA 1ZREA 4Q5OA 1MVEA 2CAVA 5LBFA 5ISLA 3O1RA 4PLOA 3ZM8A 2Y60A 3EJKA 1D4M1 3MF6A 1H2LA 4JDOA 1APNA 4XFFA 5JI7A 4CDXA 1RVF3 1W28A 3HD8B 4FOWA 2YMZA 3DF0A 3DKWA 4XUPA 4E8CA 2DFCA 1NA1A 1JZ8A 2DVGA 5FY9A 2LS6A 1JYVA 1GZCA 4AVTA 2RVAA 3OTFA 4QPGB 1CVNA 5AVPA 4B4QA 5F8PA 3ZYBA 5BNOA 2QZ3A 2DVBA 3GBWA 1O4YA 5FP8A 3USUA 4CEWB 4HVRA 4BXFA 3TEZA 1HRV3 1DZTA 3GHNA 3KMHA 4GALA 3SMHA 1AR71 1XYNA 2RM23 4XZPA 5C3OA 2W08A 5FY8A 5LB6A 1AYM3 1Y9GA 3MDPA 3TEWA 2FZ2A 2F17A 1OH3A 1XRUA 4ISRA 3UKVA 4KWLA 1Z78A 1PO13 1GWMA 3AL6A 5HCFA 3VBRC 5FPAA 4KI5M 1K45A 3PJQA 4QKDA 4IXLA 2XWJB 1O8SA 5LATA 1V0AA 2W1SA 1W2OA 1IHMA 3I49A 2OIIA 2Q1MA 4HKOA 5LA2A 3V0AA 1MR5A 1MQTB 3KQ4B 4IEPA 4FSJA 1WMDA 1RUG3 1OD3A 3QLQA 3U10A 2C0ZA 1C5HA 3AX4A 4BH9A 1J84A 3OYWB 3Q8EA 4Y1ZA 1EP0A 1C28A 4LOTA 5GZEA 5JMOA 1OOPA 1OQDA 1WKYA 1PVC1 3CO2A 2PLV2 1UY4A 5DG1A 4JHTA 3IDCB 3O7OA 1OFSA 3Q8BA 3ZFFB 3LPGA 4CUBA 5FP9A 5CFCB 4KGGA 1GNHA 1W8TA 3J9SA 3K2OA 5F5CA 1F4HA 4JCKA 4XFHA 1Q3EA 1POQA 1I3HA 2JKXA 4XJAA 2E32A 5KC5A 3BU0A 5DDJ1 2AREA 3JQWA 3FHIB 1OHFA 3VDDB 4NIGA 1RUF3 5FK7A 1COV1 4EE2A 3ABZA 2WNVB 5BXXA 4MOAA 4EJRA 4RS5B 3MV11 3K4ZA 1SG3A 2PFWA 4LR4A 4NHKA 5LY1A 2WIIB 2KR2A 3INAA 2O8QA 4CSWA 1LJ7A 1G9AA 4OI1A 3OOXA 4XFGA 2PHUA 1QF3A 5T3NA 4AL9A 3OY8A 2XJUA 2GN7A 4LBOA 1W39A 5FZOA 4ZONA 4COZA 1QNYA 1YFUA 3R4UA 4OUEA 4NRMA 4XE9A 2RHPA 1K5MC 4HVQA 1GZTA 1YWKA 2XBO2 2YU2A 3D8CA 1RUJ2 2JDYA 1VBE1 1VRH3 3HNYM 3CIHA 4H7MA 4UT5A 2QQOA 3U4XA 2NPIA 3OF1A 2CGNA 1OH4A 3W59A 5KBFA 2WAAA 2WINB 3H50A 2I45A 5D8AC 2WA3A 3CBNA 1C1LA 2JWPA 4YWAA 4AR2A 1GFF2 3VZKA 4LJHA 1IG0A 4MX3A 1SLBA 2QQVA 2D7FA 2YDEA 4QPGC 3VLBB 4LKDA 2E6VA 5FWJA 4TSVA 1GQPA 3JCIA 1DQ6A 3VGIA 1A78A 3D4KA 3HMYA 1R1A3 4WM7C 1AL22 2IWGB 2ZMKA 1E5RA 2BUKA 2IXHA 3NV2A 2EIBA 4N9IA 2YBKA 4R4ZA 4ARYA 4YRDA 3KD4A 1RUC1 5DAWA 4C1WA 2W94A 3O0XA 5LK5A 4YG6A 2V4AA 4M00A 2PHFA 2VBDA 3IAQA 4TLGA 4IE4A 1X36A 2RS33 2QTWB 1CPNA 1MS4A 3D82A 4LHNA 4LULA 4QPIC 3OGRA 1DGLA 5T5JA 3PLQA 3FBMA 2ZTNA 1MQTC 1W6PA 4XCAA 2BOJA 2PHTA 2VAUA 3SH3A 1CQ9A 1QJZA 5SV8A 3IIIA 1VBD1 2HWC2 1WLDA 2IVIB 2JENA 1QQP3 2VOKA 1C8M2 1W8OA 2V4VA 2VCAA 3WF1A 5EQUA 4RQPB 1QJX1 5LRRA 2HLEA 3IMNA 3PUAA 4META 3OG2A 1F2NA 5F5AA 4CYDA 5LCWL 1KRIA 3SEPA 1W06A 4COWA 2MPFA 3AYEA 4LK7A 3RWNA 1N3QA 3ZFFC 1JU4A 1X9TA 1ZA4A 1KGYA 1OT5A 4HXCA 1ZZ6A 3UJOA 1X82A 2QVSB 5C6CA 2RMU2 1JHJA 2Z5WA 5JI9A 4R52A 3RSJA 1GICA 3MW2A 3B01A 2D3RA 3NL1A 4W65A 1W9SA 2VMEA 3VDDC 1UNBA 4YVSA 5F37A 1AXYA 5C4WC 1VALA 2WNVC 3PIJA 4E4DX 2VQ0A 3C2UA 4RS5C 3CU7A 3NNGA 4FI9A 2OW4A 4MGIE 4C8DA 5BNQA 3M70A 3AMHA 2VW2A 4MH0E 1HXS1 5DZGA 1EPZA 1XNCA 3LEGA 3ZDSA 3T4VA 4WZFA 1UU5A 2F4LA 5G05L 1V6MA 1LOFC 2D93A 1OC1A 1LNSA 4HPKA 4Z1VA 2XVKA 3C7FA 5IHRA 4QB6A 5KHIA 5GLTA 1DQ1A 4ASKA 2GMEA 3H1YA 4B1LA 1TE1B 3NRUA 4BQ4A 3K48A 1O3SA 4Q4W1 5IVCA 2D44A 5C9AA 1HN0A 2I07B 1K12A 3ZXEA 1QJU1 2GC0A 4XUTA 1YIFA 4XFBA 4XXAA 4NRQA 2BQPA 3T1MA 1W6QB 4UW4A 3IPVB 3FC0A 1O8PA 2WS92 1UY2A 5C8CA 1LULA 1H9WA 3AP7A 1H8TA 1RTVA 4FPYA 5FZFA 2OS2A 1WCQA 2NMOA 5CB7A 3I2DA 4Y3OA 3ILFA 5CU1A 3PJYA 2HWB2 4CCLA 3MBWA 1PK6B 2ADEA 2WLPA 1RVF1 3P3NA 5FBZA 4DXSA 1UYPA 5IT6A 1REFA 4PI2A 5JSRA 2J1RA 1FPN2 2HBUA 4Q0UA 2UWCA 4UW6A 1AR62 1JXNA 3AXEA 3PIGA 4OFGA 4Z82A 1W6OA 1W9TA 1UKRA 1D2SA 1A3KA 1QJY2 1HRV1 5BNNA 4FT8A 1W03A 4W6XA 4A6SA 2RM21 1OUXA 3MICA 3TAYA 1AYM1 1ASJ3 2LTNA 3K4DA 3BYWA 3NNMA 5FWEA 4DOUA 5IVFA 2J1SA 3U14A 5JSOA 1UMZA 3WP4A 4IEUA 5ABJA 2Y38A 3BPSA 1G9FA 4JRAA 1VR3A 3FLRA 4RQPC 2RG4A 4E2SA 2FD8A 5F3CA 2ZX4A 2W87A 4IDZA 4BJ0A 4K7JA 2ERFA 3ZKUA 2OQ7A 2P3IA 1RUG1 1W99A 1I1EA 1RITA 4XF0A 2JJ6A 3ACGA 4P14A 5FYCA 4RFT0 2BU9A 1DCSA 4D7TA 2VZ3A 1SDWA 1RGSA 2H6BA 4HKLA 1MS8A 1OA4A 2O1QA 4HN0A 2ZCWA 2QQKA 3QOPA 4QQ2A 4J6GA 3AKRA 4AI0A 4XMAA 3THCA 1WBLA 1ZA7A 1UOJA 3BIWE 3ZSKA 2E63A 1GUIA 2CHHA 2CWMA 1OA2A 1SCRA 3EXUA 3ZN6A 1UCXA 2MEV2 3M2MA 1S4CA 4UFKA 1GSLA 4EN7B 1JS9A 5JSPA 1VB4A 4N43B 2YHJA 4X6QB 1RUF1 1AF9A 3SCFA 1PMJX 1ULPA 4BHPA 1PZ7A 3NW4A 3IT8A 4YARA 3H3UA 2WZR2 4BXSV 4QXHA 4HONA 2DCTA 2VPVA 3RRDA 3ZXJA 2IVJA 1RUI3 5B4XA 3ZR6A 3HVDA 2XH6A 2BVBA 2HEWF 3ZIXA 4NOTA 1BBT3 2YG0A 3NNFA 4A3XA 2ZEZA 3MIEA 3ZYRA 2AR6A 3P1IA 3NV4A 3TYJA 4COUA 5EV7A 2UYAA 4NWVA 1YQ8A 3NJYA 2QQJA 2GSYA 1VRH1 2RS52 2R32A 1GQHA 5CADA 5HBAA 5FMDA 3JBG3 4LUKA 4QGMA 2R1DA 5EYXA 4XTMA 1S0DA 2B39A 2Z79A 3MGUA 2NZ9A 3WCSA 1PK6C 2Q8CA 1DLCA 1LTEA 5FUIA 4XJWA 1EUUA 4HZFA 2A7AA 1L7QA 4MYEA 2A73B 2HBTA 1HQNA 1PIV3 3R4DB 4LBQB 4Q4X2 1UU4A 4QT6A 1VAKA 3U37A 3VBHA 3UNPA 2BEOA 1Y43B 2ZGUA 3VDBA 1OLRA 4YG3A 2I2SA 2HWE3 4ZKTB 1R1A1 3KCYA 1AYN3 3OPZA 1RJ8A 4IV1C 1UAIA 5JZGC 4QPWA 4DIQA 3P5BA 4S2HA 2FMDA 3I3BA 4XDQA 3LWCA 4L97A 4CDUA 4B29A 3H8OA 2K9ZA 3RJ2X 3DYPA 4IEYA 3QH6A 1QDOA 1QU0A 2AH2A 2RS31 1A34A 1NY71 4BK5A 2YUEA 4AVSA 2RJ2A 1QJEA 4HLTA 2ZGQA 1AR83 4I2OA 4HG6B 3CEWA 4E2QA 3BKZA 3IAPA 3P3PA 2ZEWA 2YBPA 1DYKA 4KWUA 1QOSA 4TYSA 4LEJA 1QQP1 2EIDA 1AVBA 1ENSA 1R092 5I0UA 4A6OA 2W68A 1YYNA 3GZEA 4GKYA 4DO0A 5I0TA 1NQJA 3OBRA 5DAVA 4ZZ8A 2BTVC 2TUNA 1YI7A 3BOWA 2ZPXA 3KCCA 3O0VA 1M4WA 2DDUA 4QAWA 1ZZBA 2EIGA 2VH9A 3C8XA 3VZLA 4JGZB 2VOTA 3GDBA 1MEC2 4NAOA 1JH5A 1NCQA 3DYOA 3R6SA 4Q26A 2HEYF 1UYZA 2GH8A 3FLPA 1IS3A 3HQUA 1O3RA 5C3QA 4AI3A 1EUTA 1RMU3 1CD3G 5GLWA 3FL7A 3TEXA 1VBA2 1BMV2 3WQ1A 4LE4A 3L9JT 1YLLA 3JUUA 4V1PA 5FYUA 2HWD2 2QJVA 2D6NA 2P34A 2UU8A 4KBBA 4AAPA 2E7TA 3RI8A 2H6CA 2Y6HA 4CDXB 4GWJA 3UKTA 2W9XA 2FDKA 4NMIA 1NA1B 1VBC2 3E5XA 4IEOA 3AKSA 2BYVE 2QE3A 3UGFA 1N1YA 1MS9A 1MZ6A 3NV3A 5EJ3A 3WUDA 4BE3A 2XKOA 4GZ9A 4CA9A 5FY1A 1DZQA 1NXD1 4IESA 3USUB 4K20A 3HJRA 4BQ2A 3E6CC 2WWUA 5JMCA 2FQPA 4TWTA 3SISA 4FTBA 3W5MA 4LMFA 1TME2 2VECA 5EJ1B 3VD3A 3ZMOA 4BB3A 5JCTA 4EZ4A 4YZ5A 1PNFA 2XHNA 4DEQA 4XDOA 3CJIA 5FZ9A 4L92A 3BODA 4OZXA 1SBFA 3SNMA 3GCXA 5FY0A 4Q1PA 5SV5A 4DXZA 2VCCA 3IDBB 3V0BA 3NQHA 5FO8B 2QDNA 2VNOA 2XJPA 2VL4A 3NNLA 2DVAA 3V0AB 3ON7A 1KQRA 4BQ1A 5AVAA 2CNAA 3BN6A 3WDUA 5LWBA 5CKMA 2P4EA 1ALYA 1IS6A 2NYYA 4D0QA 1UZWA 3AKPA 1UOGA 3B93A 1DG6A 1QIQA 4RR3B 4PHZA 5F3IA 1OOPB 1HN1A 4TLFA 1XSQA 3THDA 3ZYPA 4CCOA 1XE7A 1YIPA 5A7SA 2VUAA 2ZHNA 2Q30A 3HWJA 3D5OA 2D97A 3HNBM 2OX0A 4XW3A 2ZEYA 2LUWA 1D4VB 1J3PA 5LBEA 1ASJ1 3AMPA 5LY2A 5H9PA 2VBBA 1EV12 5L36A 1V9U2 4IERA 4GJZA 3OEBA 3PNAA 5FZKA 4EN8B 4MO3M 4AEMA 1PMIA 2VVFA 4L11A 4XVHA 2WJSA 1TEIA 4IE0A 2EA7A 1H2MA 2D6KA 1WW6A 3L2YA 3KV4A 1B35A 1A8MA 1IPKA 3B5LB 5AC93 5JIUA 2DUOA 2ZGNA 3PDQA 4DFSA 1VJ2A 2JEMA 2R062 3NV1A 4CP0A 1O5UA 2A71A 3EBRA 1H0BA 1HJGA 2E7AA 3OY8B 4JGZC 4ZS2A 3UK9A 1ODMA 4J1XA 1QHDA 2BDRA 3WF4A 4CRQA 5IK5A 4JKMA 2XJRA 3FUOA 4BQYA 2UY9A 3DPRA 1X33A 3E97A 3LCPA 2ZX0A 1W2NA 5IVEA 2P2KA 1D2QA 3RYRA 1CZTA 3RZZA 1PGW2 5DAQA 2R073 4WV8A 3VHRA 2WN2A 2ZBJA 4IEQA 1J3RA 1ENRA 4PIZA 5KXBA 2EF6A 4G4FA 4RGAA 4CDXC 1HX6A 2WT1A 2DFBA 5DUUA 3WUCA 4KMQA 4BIFA 4CDWA 1REEA 4I01A 3WW2A 2R1BA 3T4HB 4O9GA 5F6LB 3ZXLA 2BGPA 1D7PM 5FPZA 2RDNA 3WD5A 2G4IA 4BMBA 4FOYA 1GQGA 2HWF2 3OB8A 1Q8VA 3GF6A 3KT1A 1RUI1 2OA2A 5JAXA 1GZWA 1UXZA 2ZX2A 5EZWA 2JDUA 4W50A 4PDWA 4URTA 1BBT1 1WW7A 1SFPA 3IBMA 5FKBA 2IXJA 1MS5A 2NN8A 3CHXA 2P1BA 2RJKA 1FAYA 2HH9A 4EWAA 2GDFA 1JZ4A 1ACCA 4AVAA 5CAZA 4IEVA 1AXKA 2W47A 3AZVA 2J1AA 2OZJA 4GB32 1DLLA 4N8MA 3JBG1 2ZGMA 1HRI3 4CCEA 2AUYA 1KDKA 2QDRA 1JZ7A 1W6PB 4PLMA 4IV3A 3KF5A 1CGPA 5FMBA 5HCAA 3S57A 3WDWA 3WQ0A 3RZKA 2WRAA 3HIFA 1ODNA 4A7ZA 3OSDA 4RR3C 1PIV1 1K3IA 1OOPC 1LHVA 2JE8A 5GZCA 5DAPA 4BQ5A 2G9FA 4QDSA 4G9SB 3OBZA 4CUAA 3IM0A 4AFDA 4YNIA 4H2AA 3WNLA 1F4AA 1C5IA 3I54A 3OGJA 4OI2A 3H7YA 1UIKA 2YV8A 4XF9A 2HWE1 3ZYHA 5K9YA 1AYN1 2W1WA 4FFHA 2VZTA 1MZFA 4OULA 3WSOA 1ND2A 2VR4A 4E4ZA 3I3DA 1XE8A 3T08A 2DCZA 2WFF3 2FDHA 4U36A 4YVSB 3T0DA 4EN0A 5JDBA 1NLSA 4NAMA 3UKNA 3RMXA 3U1XA 5FP4A 2ZXQA 1PO22 3H3ZA 3Q8CA 3URFA 1UL9A 2PLV3 4NUBA 4AVBA 5FOBB 1AR81 1RUE2 4LBMA 1US2A 3MLJA 4YLZA 1J83A 3V64A 1WCSA 2ZGSA 3BU7A 4FFGA 4ZU5A 2GALA 3I59A 4DZGA 4UAPA 5GZGA 1XBFA 1KS5A 2WNOA 2R7EB 3UETA 2G9GA 5JPMB 4Q4V2 4L8QA 1HV0A 1DZRA 2NM1A 4HPKB 3ZVXA 3KHCA 2Q4SA 4C0BA 3FHQA 3HQXA 2PN5A 4P00B 3WT3A 1F35A 2PQSA 1ZBE3 4LLFA 4XJ8A 5C9AB 2YU1A 4NHLA 1UX6A 2EXKA 4A45A 1F8VA 1RMU1 3NO8A 2JIJA 3IDAA 4RFRB 3BUCA 2XLFA 1X8EA 2V09A 1VRBA 4K1YA 5C8CB 1H8TB 1FX5A 4OMDA 1HB2A 4Z8BA 1YCIA 2W92A 4FXKB 4NO4A 5F5QA 4Y20A 2PELA 3PMSA 2VO5A 1IS4A 1J1TA 5A3TA 3UGGA 3POYA 3K51A 4O61A 1WW5A 3DEMA 3WF2A 2AACA 1YI9A 1F31A 4I0BA 2NQYA 4LBKA 4FVVA 4QM8A 4RHV3 5CIRA 3SITA 4CU9A 3VBOA 3WNPA 2WT0A 4H14A 4LO5B 2WWJA 5D21A 3NKGA 4BWOA 1W6OB 4JGYC 4Q4Y2 4QHOA 1QH7A 3IWZA 5BNNB 1OLMA 1UO9A 2RS13 2ZMNA 4G3YC 3M3QA 4P9IA 1SLAA 4CDQC 2XQXA 3WNOA 4IW3A 1UYYA 4YGEA 1HW5A 5FK8A 1AL23 1O91A 2RDSA 3MI8A 4NIAA 4OYUA 3WEZA 5ABJB 1LHOA 3CDZB 3B9CA 4ONUA 3G7DA 1NLQA 3LIGA 1OKQA 4Y4YA 3WDTA 3GJBA 4BMEA 5DQ0A 1TMF2 2VE1A 5FYBA 1NLRA 4EROA 3POBA 2R042 3OD4A 2GC1A 3GCWA 2PHDA 4J25A 1COV2 1UOFA 5IW0A 2XWBB 3KSCA 5JR7B 3PVBB 5A80A 1HJFA 1ZBA3 1RHI2 3KZ4C 2ZOEB 1S2EA 3D0JA 1WLTA 3D0SA 4QX0A 4C1XA 4GIQA 3VBSC 4UI9L 3AL5A 4PIYA 1LOEA 2HWC3 4HANA 4YVSC 3OGGA 1POV3 3AMMA 1C8M3 3H1WA 2D6OX 4NROA 1RUNA 1PGSA 4LHKA 1JHNA 3CJXA 4OLLA 4XEZA 2WC2A 1URXA 3ZN6B 5LZ6A 4GMP0 5F32A 3S7EA 3DECA 1MS1A 2NP0A 5E1RA 1POV0 3AZXA 4FPCA 1VBE2 4RN5A 5A32A 5FPXA 5GLVA 2YXSA 2RMU3 1NQDA 2OUJA 4M3CF 2VUDA 3IMMA 2VNGA 4Q0VA 1YQCA 5F2SA 5T50A 4D3WA 5L9VA 2WZ8A 4IGPA 2DCYA 1CAWB 5AC91 3VBUA 4CPBD 3EO6A 2BERA 2IFWA 4D8MA 5C5TA 2XPJA 1C8NA 1YEWA 2VZQA 5IWFA 1V6OA 3B3QE 4AEDA 4K21A 4CCNA 5C9AC 2VMGA
chains in the Genus database with same CATH topology
2A3YA 4B8EA 1IKQA 2NLRA 2VOXA 3LB9A 2ZX1A 4CEYC 2R071 2JKBA 4MV2A 2Z69A 1W6NA 4W6YA 1AL0G 4CZSA 3ILNA 4Q0SA 5GZDA 1RC6A 1CAUB 2WSVA 4K8FA 4GH4A 3USSA 1KJLA 1NZCA 1CAXA 5DUXA 5BNNC 3D6EA 5K0UA 4U2AA 2B7YA 2V73A 1A6CA 1LHNA 4HN1A 2PTMA 5JOZA 1QJX2 3ZYGA 2PHXA 2X5IA 1ULGA 2JE7A 3VBFA 4CDUB 2HWB3 2E9QA 5ABJC 2EXHA 5T55A 4WM8B 2DYCA 2ZHMA 3WP5A 1RUH2 1ZRDA 1HRI1 1U5IA 1UZYA 4GXLA 3DGTA 1QJY3 2DURA 3J8F2 4QGLA 5A33A 3FE5A 4FP2A 5GALA 5JPNB 3ROUA 2BFUS 1EAH3 2VOVA 4CEWC 1E57A 5BNPA 4WVMB 1AJKA 1AR92 4RSUA 3AZZA 1YHFA 4QXKA 2P3JA 4HKWA 1BK1A 5FDBA 5J7MA 3BPZA 2JG8A 1ULEA 3WCRA 1NCQB 2UWBA 1W0PA 3N7JA 3NWKA 3LA3A 5A3LA 1L3JA 3WHUA 2WFF1 4YM0A 4AQ2A 1R083 2A5ZA 3O5SA 4COVA 2DU0A 1VIWB 2XJQA 1J59A 4YFZA 3KB5A 2WWSA 2UURA 4IEZA 4Q4W2 1LECA 2PLV1 2VU9A 4AHZA 3LOBA 5T5PA 2H0BA 2QUOA 3RDIA 1Z0HA 4N90A 1AXZA 4P9WA 5E16A 3M1HA 1WBFA 3FUQA 3AKTA 4KGQA 3RNSA 4DQAA 2MNGA 1UU6A 4KQ7A 4R9BA 5CFCC 1SBDA 4B3NA 2WZR3 4H3WA 1ZBE1 3LGRA 3CJIB 1PZ8A 4AWDA 1OI6A 2XUMA 3SCHA 1UIJA 1W6MA 5CA6A 4X6RB 4YVWA 1EYBA 4YSFA 2XJSA 2KA3A 2DWRA 2YGLA 1HRV2 1HDKA 4CP2A 1DQ4A 1AYM2 1LR5A 3WP3A 3AP5A 3TNQA 4XBNA 1PO12 5BYNA 2RS53 1V70A 4M01A 4YW1A 1EY2A 1SLCA 3AP4A 3MFCA 1TNFA 4RHV1 3TNPB 4WM8C 3WNXA 1XNBA 1FMD2 3APBA 2RS11 3E5UA 4YFWA 3Q9OA 4AE2A 2K0GA 3U11A 4HK9A 4XHXA 4NR1A 2AGSA 1Q8PA 1AL21 1N1VA 1YNAA 3ZXAC 1QNWA 4PBOA 4XHBA 4ASLA 2FZ1A 3UL2A 2ZA9A 2WQZC 2Y0IA 1B35B 1QMJA 3JZVA 3LSEA 1Y7BA 4YG0A 3WG2A 3MW3A 4BZ4A 2D5FA 2TBVA 3MFAA 1NCQC 5I8TA 4E2GA 1ZBA1 3B69A 2CWSA 3DPRB 2HWC1 2GNBA 2WNUA 1POV1 3FBYA 1C8M1 4P9JA 1X7NA 3WINE 4B7KA 1OA3A 2A6VA 4EWEA 4NN0A 4CTEA 4N53B 2DVFA 4IEWA 1WMFA 4R4XA 3MZHA 1S0IA 4CDWB 4ATFA 1RINA 3TOJA 1CAVA 1KXGA 2ZGLA 3WOGA 4F3JA 1MEC3 2RMU1 2YZ4A 5K7PA 3B94A 4LUMA 4Y22A 1S2BA 4IQPA 3CNAA 1VBA3 1G9DA 4XF4A 3R0RA 1KS4A 1GZWB 3WR0A 3ZIWA 2X29A 4AFAA 1KITA 4K9SA 1Q8SA 2IC1A 4Q8LA 3CJIC 5C33A 3R05A 2CL2A 5JOXA 1VBB2 2A70A 1G6NA 1MS0A 1PHMA 5L19A 2FMYA 3QACA 5H9SA 1VBC3 4WVWA 1FXZA 1YJLA 3LAGA 5LRSA 1SBEA 4LTAA 4HBNA 2XL9A 4IV3B 5L7OA 4MZUA 5D8AA 5AFBA 1N3OA 4UBHA 4LBNA 5T52A 3SHRA 3PTYA 1TME3 3C3VA 1MZEA 4QPGA 5T5LA 3FWEA 5KXCA 3AZYA 1QOOA 4BYYA 1LU1A 4WM7A 5DXDA 1ND2B 4IEXA 3WHTA 4EV0A 3MIFA 1EPWA 2HWB1 4JQRA 2Y26A 3DV8A 2ET1A 4XBQA 2F4PA 4Y1XA 3PVOA 4QPIA 2P3KA 2WQ4A 4KG8A 5GLZA 2R6QA 2AYHA 4I09A 3FZ3A 3UJQA 4WVVA 5FREA 1QJY1 3I59B 3PVNA 4JDNA 3FJSA 2HJIA 3KT7A 4KWJA 1Z7S2 4GA9A 1G7YA 1EAH1 1EV13 1RUD2 4YGBA 4XTPA 2PHWA 1D0GA 1C3HA 2ZZQA 1WD3A 4N53C 4Y1YA 3H1MA 2ZGOA 4RL7A 2GN3A 5F9TA 1S0BA 1ONAA 2BFUL 1FOD3 2ZHLA 4N9HA 1R081 4BPZA 5FO7B 3OCPA 2WZPP 5C4WA 4RS5A 1MZ5A 2QKDA 2JG9B 4N7IA 4AF9A 2Q5TA 1HV1A 1ZNPA 3WDXA 3VBOB 3PHMA 4OHWA 1LKNA 4XQ4A 3JD72 1M06G 1U5YA 1D0HA 5JWPA 3I4IA 4FCAA 3WX5A 4S2FA 3VKLA 1GLHA 2VNRA 2WZR1 4FPKA 4IV3C 1LODA 2VULA 2HWF3 4N43C 1PZ9A 4OVEA 1FNZA 4OHYA 4DB5A 2GMPA 1O3QA 4JDMA 2JECA 1WD4A 4LO4B 1ZRRA 1LHWA 1AX1A 3CF6E 3LOIA 2FHRA 2RS51 4R9DA 1ZX5A 1DHKB 3ZSMA 2QQPA 4AEKA 2BVVA 5D1IA 1XNDA 5BNOB 5I93A 1U0AA 3ES1A 4YW3A 2R0HA 3WW1A 4MXWA 1BCXA 1WLCA 2CGOA 1Q56A 1HQLA 1OLQA 4HETA 2UYBA 2XGXA 4IL7A 5CG8A 4K1ZA 5A32B 1H2KA 2CYFA 1PGL1 3NKTA 3E6DA 2Q0AA 2P17A 2GH2A 1O3TA 4AVCA 3NVCA 3V65A 3ATGA 1V6LA 1N3PA 1KD7A 3AXDA 1BEV2 3LA7A 1JOJA 1HKDA 3VKOA 4NPRA 4AEDB 2GC3A 1PO23 1DDLA 1DGWX 1VP6A 1RUE3 4E9KA 5FLJA 3FLTA 3A0NA 1RUI2 2D5HA 2EXIA 3GZAA 2ZJCA 4KH9A 1UPIA 4Q4V3 1BBT2 1W6NB 1SEFA 3ME2A 2F6BA 1AX2A 2BPA2 1O4TA 3MIDA 2JG9C 3TN92 1S0EA 1TNRA 5EWSA 4DY5A 2VGDA 5HI0A 1UPSA 2VG9A 3WG1A 4QHBA 5J3UA 3M3CA 1MEC1 3VBOC 1U5XA 3HR9A 4XJ9A 1CJPA 4GH4B 4W6WA 4QQPA 4K3UA 1AJOA 3E6BA 5I8YA 3UV9A 1BMV1 1VBA1 5K0UB 2RR12 1DQ0A 3I7DA 3AM2A 5BV6A 1SLIA 4ES8A 4HMZA 4XOGA 1PIV2 1WLWA 3VBFB 4QPYA 3WXPA 1IOAA 1VBC1 2ZGRA 2HWE2 5JIAA 4R8HA 3W58A 3VL8A 4ES9A 4AQSA 4UXAA 4PIXA 3VV1A 1NOVA 4Q4Y3 4YZ1A 4Z07A 3T1LA 2DF7A 1RL3A 3AB0A 1NA1C 1PK6A 3MLKA 2IFRA 1AZDA 1LGBA 3A0KA 3VHOA 1TME1 1V00A 2KXLA 1HIXA 4AFBA 5BNOC 3IN9A 1ZVFA 4KL1A 1T6GC 2WT2A 4FTEA 3J26N 1FYUA 3WP6A 5FO9B 4B7EA 4NVPA 2GNTA 4IV1A 1TMF3 2JG8B 4SLIA 4YGCA 3H0OA 2EALA 4PCRA 4JTOA 5DZEA 2QCSB 4Q29A 4MXVA 1N1SA 2XL7A 2R043 2ZAAA 2EXJA 4UW5A 4XQWA 4DY3A 1RHI3 3KCXA 2ZAHA 2PAMA 5FCCA 2PHLA 1BXHA 5T5OA 3AYCA 4M0NA 4AI2A 1Y9QA 4JC1A 4CP1A 1LOGA 3ZSEA 2HYKA 4GWNA 1EV11 4BOWA 1QWRA 4ZU7A 2ZKLA 4E4SA 4BM8A 4QU2A 1GZ9A 3ZXDA 1OD5A 4Z92B 5FRAA 2A3XA 2C5DA 4FPOB 3N36A 1H30A 1Q8QA 1NXMA 5T54A 2A3WA 3ZFEA 1W6MB 1I9RA 2Q1ZB 3RYPA 1FOD1 2PAKA 1REDA 5I8SA 1SFYA 4XILA 4GULA 1IQAA 1FNYA 1WCDJ 4R9AA 5ACA2 5DZFA 2XLAA 4GH4C 1NCRA 4XMIA 4BA6A 1W2UA 4MGKE 3TWIA 1V6NA 2ZGKA 1IZ3A 1PGW1 4AK3A 3MYXA 2SLIA 4F8AA 3VBFC 1XNKA 3U0ZA 2FBEA 3U07A 1D4M2 5AFEA 4JAAA 1NE4A 4ITCA 1CN1A 2D43A 4GWMA 3GBFA 1XQNA 1ULFA 3KLSA 2A6WA 1UN1A 4XJZA 1ENQA 4PJYA 3NSTA 1BVP1 2HWF1 1AR72 4COYA 1DIWA 3FFZA 1QXRA 4FOQA 1GKBA 3QCWA 2XBO3 1RUJ3 1QKQA 3VZMA 4INDA 3ACLA 1XU2A 2PYTA 5TSWA 2DCKA 1RUH3 2TNFA 3KGLA 2JG8C 2ZABA 1NG0A 3WVJA 4MVTA 1H1IA 1F9KA 3J4UH 1LOCA 3J8F3 4LLOA 2WNUB 1C4RA 2PA7A 5CFDA 4EN6B 1LGNA 1AR93 1PVC2 4D7YA 4M3CE 4LT5A 4AEJA 1FV3A 1IGOA 2ZZJA 1XYPA 2A6ZA 4P9XA 1SFNA 2DU1A 3AMQA 3AP9A 5GLUA 3AJZA 3N7MA 1BQPA 4AHWA 3JB4C 2A6XA 3MW4A 1LOAA 2ZGPA 5DDJ2 3TB0A 4NWWA 1FATA 2LM3A 4FPGA 1C1FA 4GMP3 1PO21 3ZYIB 1S0JA 4AG4A 4Y5Z0 1SQ4A 1RUE1 1DGWA 3LKJA 5FMOS 4AGGA 4N7UA 5E88A 4Q4V1 2DUQA 5GJ6A 1S0GA 1JUIA 2XLGA 4Q0PA 5L7OB 5D8AB 1ND3A 1U12A 4AW7A 4MGYE 3BOPA 1WGPA 2CAUA 3BCWA 2K2SA 3DUIA 1SLLA 3ZX7A 3RQ0A 4Y26A 3VL9A 1HRI2 1X50A 1GR3A 5KHJA 3ZSLA 2VY0A 4WM7B 4HFSA 5GZFA 3VKFC 3DL3A 3NJZA 2D3PA 4FO9A 4AXOA 4UW3A 4AHYA 3VZOA 1OPMA 1LB2A 2MHFA 5C8CC 3GZTB 1H8TC 2Z42A 2R16A 4QPIB 1RUC2 1MS3A 5LEJA 4FQ4A 5H9QA 2CV6A 2KM2A 4Q4Y1 1J58A 3SH4A 1CR7A 4AGRA 1FMD3 2WFF2 5CNAA 3POSA 2ATFA 2GNMA 3AP6A 4AVVA 1NE6A 1TQ5A 3VBHB 4RR3A 2BNOA 1QOTA 1H2NA 1WW4A 4RA0A 3ZFGA 4M0HA 4Y24A 5KHKA 2WNUC 4LBJA 1IKPA 1VBD2 1ZZCA 1JYCA 2WS93 1QY4A 2ZGTA 4YZ3A 4I3GA 1TMF1 3WDYA 2GMMA 2TEPA 3CLPA 5FQ0A 3ES4A 4EN9B 3N7KA 5E8AA 2B9UA 2R041 1DYPA 2W52A 4YM3A 2XVLA 5C4WB 1FPN3 1RHI1 4NHMA 1AR63 1ZBE2 4I0WB 1YUDA 2D6LX 2XHKA 5JOYA 3GHMA 4OI4A 3MLLA 1YFYA 1FT9A 4FAGA 3ZXFA 4YZ2A 2E51A 1ZZ7A 2C1FA 1H4HA 2DVDA 4TZDA 1HXS2 3WY6A 4HL0A 4SBVA 1JW6A 3EQEA 3WQ7A 4RHV2 5L7OC 4LO7A 3SH5A 3ELNA 3M3IA 1JTZX 3M3EA 3NAPA 1ZZ8A 4AI8A 1JN2P 1O5LA 2D3SA 2O0OA 2RS12 3QBQA 1N47A 3VN4A 1CJDA 1VBB3 4UBGA 1OFNA 1RIRA 1QH6A 4LE3A 1QJU2 2YY1A 2MEV3 5KXDA 1YXWA 3WG4A 3CL1A 2DCJA 3WG3A 5K8SA 3ZMNA 1R1ZA 2YROA 4DS0A 1UW8A 4LO8A 4FP3A 3RJRA 1RVF2 4JGYA 2XB6C 4L9BA 4MXWB 3WDVA 3MF9A 4ASMB 2PAEA 3AKQA 4M3CA 2YC0A 4P9LA 1ZBA2 4CDQA 1LHUA 3OJBA 1ENXA 1I5ZA 3OBTA 2ZHKA 3VBHC 5JOWA 2D40A 2RM22 3PMEA 3V0BB 1VLNA 4Q1RA 4XXPA 2XBO1 1LEDA 1RUJ1 3GYDA 1AX0A 3AYDA 1OSGA 4O9EA 2QNKA 3JB8A 1RUH1 2IXLA 1XYOA 1G86A 4I02A 4CDUC 4XQDA 2HKXA 3H9AA 2V5YA 2UWAA 4Y1UA 3J8F1 3VBSA 3AFKA 1RUG2 3WZ1A 3M4FA 1Z7S3 1FV2A 3HBZA 4Q4X3 2X53S 3AMNA 3N7LA 1H1MA 4P5HA 1AUYA 4AQTA 2YPJA 2ARBA 1AR91 4FAHA 1RUD3 1ULDA 3R4SA 3T2TA 1KFUL 3WW3A 3VBRA 2B8MA 3IDEA 1G9CA 1UD1A 1IPJA 3O14A 3ZYJB 1QXPA 2RE9A 1KDMA 5J36A 4YW5A 4Q27A 1LCLA 2ZX3A 1S2KA 4PLNA 4C0HA 4GQ7A 2A75A 1GV9A 3X29B 3M7AA 1RUF2 5FTTC 3PVEA 4GMP1 3ILRA 4Q2FA 2B42B 3M3OA 3IIAA 1UKGA 1AHSA 5IUQA 4A7YA 1DF0A 4XJUA 4BLJA 2XJVA 5LEKA 1R093 4X8PA 5DG2A 4F83A 4CEYA 1SLTA 1F5FA 1PM7A 3JD73 1G9BA 4PQ9A 3GZUC 1C57A 3G6JB 3ST7A 1VRH2 5FMOL 4KU7A 3BTAA 4WVZA 2AZ5A 4OHXA 5BUVA 5I91A 2E53A 4FXGB 4D94A 5CVRA 3S0MA 5KHGA 4DINB 4OHVA 4PDWB 3DN7A 2HWD3 1ZYBA 4IV1B 2B45X 4LO6B 5HXVA 1GYKA 1EAH2 1LU2A 2WA4A 1BZWA 2JE9A 1PO11 1K5MA 4OUMA 3S6PA 2XJTA 1R1A2 3RPQA 4HVOA 4KWKA 3L2HA 4XYXA 2WNEA 4K40A 2VVDA 1SCSA 4QMAA 1FMD1 2RS32 1R082 2GC2A 1NY72 1WUVA 2VW1A 5IK8A 2P37A 4H55A 3MPPG 5CG9A 1Y3TA 3B9IA 4CEWA 5KWRA 4S2DA 4FPJA 5EYYA 3QH7A 1QQP2 2WS91 1LRHA 5KHHA 3ZXKA 4I0AA 3ZN5A 3ZFEB 1H9PA 1WCKA 3BALA 1BEV3 5KC6A 1ZM1A 2Q8OA 3ASIA 2B5HA 4XFAA 1UZZA 5DUVA 1B35C 1FPN1 1NCRB 4YZ4A 2AENA 1AR61 3A4UA 5JLVA 3JQXA 5E89A 1CAWA 4ORFA 1MQTA 2YYOA 3H7JA 1XU1A 2WL1A 5GKAC 3OYWA 2WSUA 4XPVA 2DV9A 2ZMLA 4ZU4A 1V9U3 3DPRC 5I0SA 3TN93 1YRZA 2SBAA 2W0XA 5B2GB 5FLHA 3VKNA 4AFCA 4OI0A 1X8MA 4QQOA 2R49A 3JU9A 3ZFFA 3IKWA 4QD2A 2JD4A 4I3PA 4X8NA 3RS6A 5CFCA 4A2UA 2R0FA 1J1LA 5IK7A 4AQ6A 4CDWC 5DUWA 2R063 2RR13 4AI1A 3VDDA 4FBFA 2VXRA 1N1TA 1ULCA 2CGPA 5J48A 2WNVA 4FOVA 2DTWA 1CAUA 4KU8A 3I8TA 2EVXA 2WFPA 1VBB1 4YYOA 3KT4A 4C91A 4OUSA 1G8WA 3SXWA 4Y20B 4PDWC 3HAGA 1SACA 4DMIA 2MEV1 1PGL2 3RG0A 2QZ2A 3SCGA 4ZXKA 4I30A 1LOFA 3LSDA 4WM8A 2JX9A 2XVGA 5J09A 1A8DA 4FPLA 1FI2A 1LEMA 1H8VA 5BY5A 5CFDB 4LBQD 1VAMA 3VHPA 3ZSJA 5FLIA 2OUHA 4FPHA 2CTVA 2VUJA 2ZKNA 2H0VA 2XKPA 3LZZA 4AGVA 1ASJ2 4WVMA 2IXIA 4D7SA 3N4MA 3AJYA 1U5ZA 3MPBA 4GKXA 3V56A 4GB33 4OHZA 2VMIA 1H1AA 1HQWA 1KFXL 1QGLA 1ND2C 3TBDA 1SMVA 4LA2A 3ZFEC 1YO8A 2WKKA 4S2GA 1ZRFA 3ECQA 2R30A 3VHNA 1Z7S1 4Q4X1 1NCRC 2GU9A 4E27A 3ENRA 1KJRA 1H4GA 3B7MA 4LA3A 4MUVA 4L99A 1ND3B 1RUD1 2CY6A 2JDZA 2BGCA 2WLQA 3AFGA 2ZS6B 4RQPA 5I0RA 5C8WA 2VQAA 2GNDA 1B09A 4Z2WA 3KM5A 1LESA 4QQHA 1V6JA 4D69A 3VBUB 3AK0A 3WW4A 2XG3A 2ENRA 2JXAA 4EWDA 5ACA3 1DFQA 1DGRN 1Q43A 3RMYA 1GNZA 1JYIA 1YJKA 5KXEA 2DUPA 4DRRA 3KS7A 3ZO0B 2D98A 1O4ZA 1R091 1DBNA 4BCUA 1CONA 3GNEA 1D4M3 2OVUA 3ZPYA 3JD71 2GAUA 4QGNA 1DU3D 3VKMA 1NYWA 3JBG2 5A3MA 4H7LA 2B46X 3MIGA 4FPFA 2BBVA 3ZFGB 1CAXB 1DGRA 1RJ7A 1AR73 2BWCA 5CFDC 5EXOA 3EHKA 2HWD1 1I6XA 2X5IB 1S0CA 5FQ0B 1VB2A 1OMIA 2PQQA 4LBLA 4P9YA 2W39A 5GM0A 1BYHA 2RJLA 4ATEA 4YW4A 1RUOA 1QDCA 1W6QA 1AYN2 2A6YA 3E5QA 3IPVA 1WA4A 4XBLA 1YFXA 3LA2A 1MVQA 3GALA 3RYKA 5F6KA 3VZJA 4AYUA 3FX3A 3N3HA 1FOD2 2OZ6A 3B00A 5A33B 2LALA 4MGZE 4FPEA 1Q5OA 2X8KA 4FTSA 1PVC3 4YM2A 5BNPB 2BNMA 2EAKA 5BPXA 1GBGA 1AR82 3S30A 4AHXA 2BNNA 1ZRCA 2QFEA 5JZGA 4MLOA 1ND3C 3OD0A 4N53A 3KQRA 5DDJ3 4QM9A 1BEV1 3NAPB 1CESA 3RI9A 4HT1T 1COV3 1LGCA 4YGDA 4YW2A 2IXCA 3VBUC 5F1RA 4FQZA 4QQLA 5EFUA 1RMU2 3WLUA 3O12A 1MACA 4AEDC 4B4PA 1CX4A 2Y0OA 2ES3A 5FFOC 2BWAA 3O0WA 2Z2SB 1JUHA 1W0OA 1V9U1 2ZACA 3TN91 2JICA 4DNYA 4PBPA 4DRVA 1VBE3 4JGYB 2D6PA