1UD1A

Crystal structure of proglycinin mutant c88s
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
461
structure length
366
Chain Sequence
NECQIQKLNALKPDNRIESEGGLIETWNPNNKPFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQGKGIFGMIYPRHQKIYNFREGDLIAVPTGVAWWMYNNEDTPVVAVSIIDTNSLENQLDQMPRRFYLAGNQEQEFLKYQQGGSILSGFTLEFLEHAFSVDKQIAKNLQGEKGAIVTVKGGLSVIKPICTMRLRHNIGQTSSPDIYNPQAGSVTTATSLDFPALSWLRLSAEFGSLRKNAMFVPHYNLNANSIIYALNGRALIQVVNCNGERVFDGELQEGRVLIVPQNFVVAARSQSDNFEYVSFKTNDTPMIGTLAGANSLLNALPEEVIQHTFNLKSQQARQIKNNNPFKFLVPPQES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Plant protein
molecule keywords Glycinin G1
publication title Crystal Structures and Structural Stabilities of the Disulfide Bond-Deficient Soybean Proglycinin Mutants C12G and C88S.
pubmed doi rcsb
source organism Glycine max
total genus 92
structure length 366
sequence length 461
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2003-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00190 Cupin_1 Cupin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1ud1A02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1ud1A01
3SMHA 2GC3A 5LEKA 2CV6A 4FAGA 3QOPA 4AVAA 4Q0SA 4Z07A 5JSPA 1RUOA 3NKTA 1QWRA 4MZUA 2ET1A 1CAWA 5BXXA 1X7NA 2Q30A 1YWKA 4Q0PA 4I01A 1O7FA 5JCTA 5LRRA 1NYWA 3I59B 4I0BA 1XE8A 5EFUA 1J1LA 2GH2A 4MGYE 4KU8A 5JR7B 2BYVE 5E16A 4YARA 3D0SA 4IETA 2IXKA 3H3UA 1FI2A 1EPZA 1DGRA 2E9QA 4KWJA 5FQ0A 1YUDA 2IC1A 3QACA 4UXAA 5JSRA 2EVXA 1ZRDA 4FT8A 3U10A 1EYBA 3EHKA 4MGIE 1G6NA 1RGSA 1PM7A 5JSOA 2VECA 2BGCA 4YYOA 3NJZA 1Y3TA 1OI6A 4KWKA 3H7YA 3E6CC 2H6CA 1RL3A 3DV8A 3RYKA 3OD0A 3H8UA 1ZZ9A 4QGMA 3RPQA 1ZRRA 4I3PA 2XHKA 3H3ZA 3NW4A 5FQ0B 3ZDSA 4AVCA 3MPBA 4EWAA 1LR5A 2WC2A 2XLFA 4P9GA 3SHRA 2OYZA 4HVRA 4HBNA 4MX3A 1YFUA 2BEOA 1WA4A 2PQQA 1ZRCA 4KWLA 4LUKA 1U12A 4XF0A 4K8FA 1PMIA 4E2SA 1LKNA 4IEWA 4R8HA 4E2QA 4IEPA 4J1WA 2Z69A 4QM8A 1UW8A 4JTOA 3PVBB 5I8SA 4MH0E 1ZX5A 2DCTA 3H1WA 2PHLA 2D5FA 4BHPA 2XKPA 1CAUA 5FLJA 3LA3A 4Q29A 3OGJA 3UKVA 4HN1A 1X82A 3M70A 1QXRA 4UBGA 5FLHA 1YFWA 4PIYA 4RD7A 5BPXA 5FPXA 1EY2A 4UBHA 2XKOA 5I0SA 4FBFA 2QNKA 1GQGA 2CGPA 1CAUB 3DKWA 4LLOA 4JVAA 4BYYA 3OCPA 5D1IA 3LWCA 2OZJA 2PAKA 1RTVA 5I0RA 5KHJA 1O3RA 4IESA 4O9EA 4I2OA 2PYTA 1YFYA 2B5HA 2QDRA 4CYDA 2IXHA 4TLFA 4B29A 2EA7A 4HVQA 1VR3A 3LAGA 2XL9A 3H7JA 4I09A 1RUNA 4Q0QA 3FFQA 1NE6A 4AVBA 5BUVA 1CX4A 2V09A 3PLQA 4ZU7A 5CADA 3NSTA 4HN0A 4MUVA 4HSJA 4JV4A 1O3QA 3BB6A 4BH9A 4F8AA 3RYRA 5I0UA 4X6RB 1O4TA 3HT2A 3O14A 4WVZA 2KXLA 3IDCB 2Y0OA 4Q0UA 3I54A 4ORFA 3UKNA 4HSLA 2FQPA 1CAWB 1Q43A 1RC6A 4IEOA 5J48A 2HKXA 2MPFA 5FDBA 3ETQA 3RNSA 3FX3A 1DZTA 3HQXA 1O5LA 2GZWA 1J3PA 3SCFA 5F1RA 1FT9A 3KGLA 1WGPA 2ATFA 5KHKA 3BALA 2H0VA 1VJ2A 4XFAA 3ROUA 4KU7A 4IEZA 3EBRA 3H1MA 4LA2A 3M3IA 4R52A 1Q3EA 4ONUA 3RDIA 4XFIA 2OPKA 2K0GA 5C6CA 4H7LA 3C3VA 4IERA 2D40A 4XETA 2QVSB 3H9AA 4HMZA 3D82A 3SXWA 3N4MA 4LTAA 4MGZE 3HT1A 4LEJA 4A2UA 2PHDA 2I45A 4EV0A 3ELNA 3ES1A 3D0JA 1XRUA 4QMAA 3WW1A 3ACLA 2GU9A 1ZNPA 4EWDA 4E2GA 3E5UA 4N9IA 4PIZA 1NZCA 2CAVA 4AXOA 1ZVFA 4EROA 2ZCWA 2CAUA 2UY8A 2VPVA 2UYAA 1HW5A 1V70A 1Y9QA 4XF4A 1ZZ6A 4IEYA 2ZKLA 3BU7A 3S7IA 4NVPA 5AVPA 1WLTA 2H6BA 1LB2A 2MNGA 3HIFA 3L2HA 4GULA 2GC2A 2IXCA 5J3UA 2Q0AA 2WFPA 2EAAA 5BV6A 3LA2A 4LULA 2HJIA 2XLGA 1FXZA 3ES4A 3OF1A 4XFGA 4F7ZA 1UD1A 2N7GA 5J7MA 5C8WA 2BNOA 1I5ZA 2IXLA 5KHHA 5KHIA 1GQHA 1VP6A 4XF9A 5KBFA 3SCHA 1QY4A 4HLTA 3SCGA 2XGXA 2ET7A 3EJKA 3CEWA 4ZU5A 1EP0A 5K8SA 4MGKE 3KMHA 3MZHA 1ZZCA 2O1QA 1NE4A 1I6XA 2UYBA 3IIAA 5I91A 1SEFA 3GYDA 4EWEA 5LEJA 3MDPA 4I02A 5JAXA 4IEVA 4DINB 4L2NA 3R6SA 4YSFA 4KL1A 2FMYA 4AQ2A 1QXJA 1XE7A 3MYXA 3S7EA 3DL3A 5CU1A 2F4PA 3E97A 5FCCA 4OLLA 1ZZ8A 3DN7A 2C0ZA 4XFBA 3BPZA 2B8MA 1IPKA 3IBMA 4Z82A 3ST7A 2QJVA 2XLAA 3IDBB 3U0ZA 3S0MA 4N9HA 4OFGA 5I0TA 3GBFA 3H1YA 1J3QA 2GC0A 3CLPA 5LRSA 3LA7A 5I8YA 4MV2A 4LUMA 1O3TA 3H50A 2D5HA 2IXIA 4IEXA 4YRDA 1UIJA 3CF6E 2Q4SA 4PJYA 2K9ZA 4ZU4A 4IEUA 1ZZ7A 4XFHA 1CGPA 5EZWA 3FE5A 2O8QA 1TQ5A 4QXKA 2VQAA 2Q1ZB 4PIXA 4YNIA 1ZRFA 3EQEA 5KHGA 4QGNA 1IPJA 2PFWA 4WBBA 4FAHA 5T3NA 3USSA 1J59A 2XL7A 3I7DA 4O9GA 4HZFA 5I93A 5I8TA 3NL1A 1DZRA 3B02A 2ETEA 3PNAA 2MHFA 1DGWA 1H1MA 3CL1A 4I0AA 2Z2SB 4QM9A 3RYPA 2IXJA 5FPZA 4J1XA 4D7SA 5FLIA 3WW3A 1NXMA 2D93A 2OA2A 1OMIA 1X8MA 1UCXA 2PA7A 3JZVA 1H1IA 1LRHA 1YHFA 4AQ6A 5BY5A 4XFCA 1ZZBA 1J58A 3OTFA 3E6DA 3FWEA 5CVRA 3FZ3A 4XF3A 2PTMA 3TNQA 3VHRA 1X8EA 3BCWA 3KSCA 4QX5A 4HVOA 4XEZA 3CJXA 3KGZA 5HI0A 2OZ6A 3WW2A 2GC1A 3E5XA 4LA3A 3U11A 2UY9A 3E5QA 1OFNA 4Q0VA 2QCSB 3G7DA 3KCCA 5E1RA 3E6BA 1L3JA 3LOIA 1SQ4A 1CAVA 1CAXA 1JUHA 1O3SA 4QGLA 2GAUA 3UKTA 1ZREA 3FJSA 1UPIA 4XFFA 2BNNA 1SFNA 3FHIB 4XF1A 1O5UA 3RZZA 1OD5A 1Q5OA 3IWZA 3TNPB 3WW4A 2P17A 3EO6A 3CO2A 3LZZA 1UIKA 2PAMA 4L11A 3I59A 1YLLA 4WZCA 4META 2PAEA 4BIFA 1YFXA 2B9UA 1J3RA 1CAVB 4IEQA 1CAXB 4JTNA 4D7TA 2BNMA 3NVCA 4X6QB
chains in the Genus database with same CATH superfamily
1D0GA 3ZR5A 2WO2A 3AL5A 4Y1YA 1YEWA 1GOFA 3AP9A 1WMXA 1UMZA 4NJ4A 2NP0A 2WZR2 4Q0SA 1O4ZA 3I2HA 3MV01 3ZFGB 2XONA 1QWRA 2Z42A 1V6IA 5BXXA 5AC92 2NMOA 4FXKB 4JZRA 1YWKA 2YGMA 3HEIA 4L9BA 4AAXA 5JCTA 5LRRA 1QH7A 4HG6B 3O5SA 3J4UH 3OBRA 3NV1A 5F3IA 4D3WA 1XU1A 4QT6A 1NXD1 1HIXA 2GH2A 3M3EA 4MGYE 1PO13 2ZKNA 4HL0A 4RR3A 3AXEA 5FZGA 5C4WA 3BIEA 3RFRA 3AP6A 4YARA 3PVOA 4IETA 2IXKA 5FOBB 2G4IA 4XJUA 3ZM8A 1F8VA 1OXCA 2YGLA 1CR7A 5FQ0A 1W90A 1YUDA 2WO7A 3VBHB 3QACA 2EAKA 4UXAA 3SKVA 4BMBA 2VO5A 5IT6A 3NAPC 4BWOA 2LM3A 2WT1A 1EYBA 1MZ5A 2BU9A 3HBKA 1KFXL 5LA9A 2EIDA 4ITCA 4L0PA 5JSOA 2VECA 5FYTA 1QJY3 4XQWA 4EN0A 2J1SA 3GZAA 2XJSA 3NJZA 1JZ6A 1POQA 4AHZA 4TWTA 1ZBE3 3WSOA 1Y3TA 2VC9A 4KWKA 4YM0A 5E8AA 4ATFA 1AR81 2MEV1 3WNMA 1RUE2 3E6CC 2H6CA 1NQDA 3RYKA 3MIHA 3H8UA 4QGMA 5LY2A 4I3PA 2XHKA 3H3ZA 2NQYA 4SLIA 1WMDA 5DABA 1UXXX 2CGNA 2BOJA 5FZLA 4XE9A 4EWAA 2FCTA 2UWBA 2WC2A 3H3LA 3LPFA 3MEPA 5IK8A 5FP4A 4DMIA 5JOZA 1GKBA 3CQOA 2OYZA 5LBFA 3NV3A 4CPBD 4RGAA 1PK6A 5DMYA 5A6QA 4LUKA 1LHVA 1QF3A 1F2NA 1AYN1 4CU8A 4QDRA 3UJQA 4C91A 2YB7A 4LKEA 1GYKA 3CKHA 4EZHA 2FD8A 2YC2A 4HKWA 2JG8A 1VRH1 4MO3M 1UW8A 2ARCA 2GN7A 1XQNA 5FV3A 5IAVA 2OXBA 2PLV2 3CJIB 4XPVA 5F2SA 2ZX2A 3T2TA 1R091 2WNVC 2JKXA 4OUEA 1HXS3 3B69A 2RE9A 3AKPA 4IV3C 4JTOA 1NX9A 3O1OA 2AZ5A 1Q56A 5IUQA 5A3OA 3VBUA 4B7KA 2D97A 3H1WA 3VL9A 4YZ3A 1CAUA 3LA3A 3P1IA 1SBDA 1JN2P 1O8SA 2VGDA 4DNYA 5FRAA 3VBFC 5KXEA 4HN1A 2XVKA 5FZ7A 5GLVA 3ZYFA 5FPAA 4TN7A 3PMSA 4RA0A 4AF9A 2BVBA 3Q8FA 1V6JA 4LE3A 3T0BA 1WW5A 4EJRA 1TMF2 4TZDA 4NR1A 5F3GA 5A7PA 1GU3A 3ZFFC 3ZFEB 1QXRA 3IM0A 5F2WA 4UBGA 5L7OB 4CDWC 1KGYA 1BEV1 1D2SA 1OF3A 4S2FA 5F5AA 1DQ5A 5FMDA 3MW2A 1RIRA 1XNKA 1WD4A 4PIYA 1LESA 1FOD3 3M3OA 4LBMA 1D4M1 1DYPA 2RR11 4UBHA 2XKOA 3NJYA 1ZBA3 2JICA 4FOWA 4JHZA 4X8PA 4AEDB 4GB33 5I0SA 3PTRB 4ISRA 4CDUB 5JIAA 5BNOC 5CBLA 2ZGMA 4FOYA 4JKMA 2DU1A 4N8MA 3S57A 3ZYJB 5M0TA 1TE1B 5DUUA 4FI9A 3VBSC 3M3QA 3VKNA 5DAVA 1DF0A 4N43C 4NPRA 3C7HA 5JZGB 1HQLA 1G9AA 1O3RA 5FUNA 1LOBA 2Z79A 4IESA 4IE0A 4X8NA 4D94A 2RHPA 2HWE2 1YFYA 1HX6A 1GZWB 3APBA 4CYDA 1GICA 3I4IA 5ERLA 4COYA 3LAGA 3UESA 4HVQA 1T6BX 3OY8B 3LSDA 4ASMB 3T0DA 3B00A 1N3PA 1WZXA 4XW3A 1OH4A 4M01A 3WUDA 1XNAA 1JXNA 3MBWA 1W8HA 2HYKA 1JYXA 1W8WA 1CX4A 2P34A 3PLQA 3VZMA 1LTEA 2O14A 3ORJA 4OI1A 1W39A 4MUVA 1GOGA 2IFRA 2R0HA 2X5IC 3LD8A 3TAYA 1AR93 3ZSEA 4BE3A 3BB6A 4BH9A 1VALA 1UY4A 3A4UA 3JB8A 5I0UA 2YPJA 4FQ4A 1F35A 1IG3A 3HT2A 4UW5A 2GMPA 3O14A 5AVAA 1JYTA 2VOTA 3OBTA 3IDCB 4Q4Y1 3POSA 4LKFA 4FFIA 5FZHA 4E8CA 5FPUA 5L19A 1VBD3 2RDNA 2JDAA 3PUQA 4RL7A 4LJHA 4OZXA 3UKNA 1VMJA 2B9VA 1OURA 1QDOA 3PUHA 3PUAA 3TN91 4BQ1A 4GWIA 5J96B 3UV9A 4XJWA 1S0FA 3U78A 4Y5SA 3AZZA 1T2XA 5KR7A 1AR62 4LHSA 2ZGKA 1VAVA 1CAWB 1PGSA 1Q8VA 4LO8A 1Q43A 1RC6A 5HCHA 4XDOA 5T5PA 4GZ9A 4P00B 2HKXA 3VKOA 4F3JA 1RUI1 2W95A 5HBAA 3AKRA 2VBDA 3RZJA 1UNBA 1DZTA 2LTNA 1C28A 3AMHA 2HWC3 1O5LA 3HQXA 1PIV3 4FPJA 2Y26A 3UGGA 4CP0A 3N7MA 4M4PA 4NPMA 4DQAA 1UZZA 3CMGA 1EAH2 3MLJA 2EIEA 1QJU2 2R043 4AFMA 1VBE2 5FZOB 1VJ2A 2JD4A 1ODMA 4DUWA 2XJRA 3ROUA 4UW3A 1LNSA 3GCXA 2EXHA 2HWF1 5ACA1 2ZX1A 2A3XA 3H1MA 4R9DA 3ZSLA 1OUSA 2JX9A 4NN0A 5E6HA 3WG1A 1M06G 4XFIA 1RUC3 1AVBA 2PQSA 1AR73 5C6CA 1D7PM 2FZ2A 4OHVA 3C3VA 1CZSA 2QFEA 2D40A 3DUIA 1PVXA 3IMNA 4CUBA 4XETA 1COV3 1C4RA 5LA1A 2EXIA 2D6PA 4J6GA 4C8DA 2D6KA 4E4HA 4Y1XA 2QZ3A 1GUIA 1Z7S3 2RDSA 2DFBA 2DVFA 3ES1A 4CVUA 3JCIA 1WUVA 4R4ZA 1S1AA 2DCKA 3QLQA 5F6LB 5CFCC 3D0JA 1DLCA 1XRUA 3POEA 4NRQA 1MS9A 5GM0A 4DS0A 1AF9A 1V9U1 3ACLA 1A34A 1O8PA 1ZNPA 1KQRA 4E2GA 3E5UA 4N9IA 1W8FA 2LRPA 2ZX0A 4DXTA 4P9WA 5FKBA 2EALA 2FHRA 1SDDB 1X9PA 2WNUB 2ZCWA 3ZOIA 1PMHX 2UY8A 4CCDA 2YC0A 1EV11 3BYWA 4XUPA 3WP6A 3FBYA 1C8M3 4ZONA 1UPSA 1REFA 1V70A 2AACA 1LOEA 1Y9QA 2W2IA 1UU6A 1UZYA 2DCYA 2R062 4NIAA 4XACA 3LF7A 4FOVA 4M00A 4CCJA 1HV1A 2H6BA 1OOPC 3B94A 2BGOA 1LB2A 1NKGA 2MNGA 4YG0A 3WZ1A 2ZS6B 3HIFA 4QU1A 3WDVA 3L2HA 5IVFA 1VIWB 5CKNA 2ZGNA 3MIGA 4Q27A 2CY6A 3B3QE 2YBKA 1JODA 1OPOA 1KFUL 4XQDA 3P3PA 4FPOB 3WDTA 2Y60A 4Q8LA 3AKQA 3ES4A 3OF1A 4AZZA 4F7ZA 5A80A 3LKJA 1NCQC 1S2KA 2VNOA 5J7MA 1B35B 3VBOC 1R081 1V00A 2B39A 3R4SA 2D6NA 1GQHA 3KVBA 1VP6A 3USUA 1FMD2 1JOPA 1LEDA 2VZQA 5KBFA 2VW0A 5FY9A 3SCHA 4YW1A 1QJFA 3VL8A 3WF2A 2YYOA 4MHUA 1C1LA 4YPJA 5C70A 2GMEA 2VZSA 2W1WA 4RHV1 3N35A 1DBNA 1AXYA 1LJ7A 1O6UA 1PO23 4HONA 4OMCA 4XCBA 3NNMA 1NE4A 4CUGA 1G9BA 1I6XA 3V0BA 1A8MA 4RSUA 2WZR1 3T4HB 3RZLA 3V0AB 3GYDA 1F15A 1NG0A 1PVC2 1W0PA 2R30A 2W46A 3AP5A 3N36A 4FFGA 1AL22 4GWMA 1H8TA 4RN5A 4BJ0A 4I02A 3U14A 4IEVA 3KWVA 1DGWX 4LBQB 5AC91 3RQ0A 5JDBA 2VW1A 1ONAA 1FPN2 2VR4A 1HRV2 4UFJA 4QKDA 2DURA 4YG3A 3UGHA 2XR4A 3S7EA 3SNMA 1EPWA 1N3QA 4QX3A 1WCDJ 3PDQA 4XAEA 5G05L 1TNRA 5FO8B 4PDWA 1HB2A 2R073 4PF5A 3DN7A 2D7FA 4XC9A 1UOFA 2HEWF 2AEZA 1ZYBA 5GLUA 5FJHA 2Y34A 2WWSA 4BQ2A 1MQTA 4R9BA 4IUGA 1V0AA 2XLAA 3U1XA 5FTTC 2XVLA 1OA2A 4P9LA 3N7JA 1AYM2 5ABJB 1C8NA 3GBFA 1J3QA 4Y20A 4XZUG 5IK4A 5JPMB 2ZHMA 3LA7A 4LR4A 1RMU2 1MR5A 4B1LA 4N7UA 4DZGA 3A7QA 5I8YA 1R1ZA 2ZGSA 1V6MA 4INDA 3FFZA 3TEZA 4UFKA 3H50A 1WMFA 2C5DA 1RUE1 4RQPB 4IEXA 5C33A 3N9OA 4WV8A 2Q4SA 1Y9GA 2XJUA 5FP7A 3J7MA 2W5FA 4ZU4A 3LEGA 4HK8A 4A45A 3AZWA 3A0KA 4P5YA 4XFHA 1OBNA 5LK5A 3VBRC 1K42A 3AYCA 3IIIA 3VBHC 1JTZX 3NNLA 3VZNA 3GHNA 4AW7A 2VQAA 4K1YA 2Q1ZB 4PIXA 4K1ZA 2QKDA 3MO4A 1NA1A 2D6LX 3EQEA 4YZ4A 2VVFA 4AOCA 2QUOA 2EF6A 2WZPP 2HEYF 4WBBA 4BQ5A 3OSDA 4FAHA 4QB1A 3S30A 4P9JA 5H9PA 1LCLA 4NROA 1CD3G 2YU2A 2P4EA 3CJIA 2PLV1 3LB9A 2Q8CA 4DOUA 2EICA 2MHFA 3PNAA 3R4DB 3VZKA 4IV3B 2R32A 3HBZA 4XMIA 3ZMNA 2FDFA 4I0AA 3I3MA 2VNVA 1E5SA 1GQPA 1RUH3 1XNCA 4OMDA 5CFDA 3RS6A 4GAZA 3IDEA 4J1XA 4WVWA 4D7SA 3WG4A 3W9AA 4Y4YA 1W9YA 4QKFA 2ZXQA 3WW3A 5C3PA 5LY1A 2OA2A 4QQ2A 2YBPA 5BNPB 3VV1A 4CZSA 4CEYB 4LOTA 1UCXA 2PA7A 4YVWA 1VRH2 1TMF1 3JZVA 5JR2A 1IGOA 4HKOA 4AQ6A 5D8AB 4LITA 3T2QA 1ZZBA 2WIIB 1J58A 2WAAA 3OTFA 1R092 3E6DA 3O1VA 5J1XA 1W8TA 2OVUA 2YPDA 4RGGA 3DPRB 4QX5A 1PGW2 4HVOA 4OUSA 3VZJA 4JC1A 4TLGA 2ZZJA 3WW2A 1WBFA 2XWBB 3E5XA 2R16A 4ATEA 4LA3A 3U11A 1AXZA 3T4VA 4B1MA 4C0BA 3LCPA 1OFNA 1QU0A 3K2OA 4QB6A 2LS6A 1FV3A 1MZEA 1L3JA 3FMGA 4CP1A 3RZKA 1CAVA 2HWE1 1E57A 2RS12 5GLWA 2P6CA 3CZJA 2PMWB 2WSUA 2P1BA 4BOWA 2AH2A 3ACIA 3BGAA 4GWNA 4LXLA 4XFFA 3ZFEC 2BNNA 1BEV2 5L7OC 4A41A 1ULCA 4M3CA 2G9ZA 3TNPB 1RYYA 3H8OA 3EB7A 4AEDC 1YCIA 2RS32 4AQTA 2HBUA 1CVNA 2DVBA 3HNYM 2ZACA 4CDUC 1F5FA 1UIKA 1WA6X 2PAMA 3WY6A 1ENSA 1HQNA 2W52A 1ULFA 2JG9A 4ARXA 5LK7B 3SH5A 2D98A 5JZGC 4UWDA 2X53S 4IEQA 1CAXB 1AX2A 1ZM1A 3OGSA 1GZTA 1QQP2 2BNMA 4JTNA 5FYIA 4D7TA 4QPIB 1UN1A 5EJ1B 3VD9A 2GC3A 5LEKA 2EXKA 2J1VA 3QOPA 4GXLA 3SISA 2XJQA 3K75B 2D6MA 4Z07A 2R1DA 4MZUA 1CAWA 2J7MA 5FO7B 1NLRA 2QQIA 3K4DA 2K46A 3AX4A 3GM8A 1A3KA 1G8WA 1SZBA 3I59B 4Q4X2 1KD7A 3HAGA 3RSJA 4QPGB 4JQTA 2PHRA 3CDZB 2GNBA 2D43A 4KH9A 1RVF3 2VZPA 3LE0A 3LGRA 4QX1A 3SH4A 5IFPA 2W3JA 5T5JA 4WM8B 1EAH1 3D0SA 3AMPA 3ZN6A 5FY4A 1FI2A 1VBE1 3C7EA 4YW6A 1GWLA 3AXDA 4KBZA 1SLAA 3DGTA 3MIDA 4LO6B 4COWA 4BQ3A 5FZ3A 4PI2A 3T30A 5JSRA 3BUCA 2Y38A 4DY5A 5DPNA 5FJKA 3KCYA 3H8RA 1RGSA 1APNA 1MPXA 1F31A 1LOAA 2WYSA 3AVRA 5JXHA 1RHI2 1ZRIA 3HWJA 4E9KA 4M4RA 5A3TA 4JRAA 1OI6A 1GP6A 1OVPA 1N1TA 2VTXA 4QAWA 1BLZA 3SEPA 1AL0G 3DV8A 5EYYA 1OLMA 3MLLA 1VBB2 1MS8A 1HB4A 2E6VA 1CN1A 1W6QB 1Y9MA 4FP2A 1IKPA 1VBA2 5DAQA 2QZ2A 3ZDSA 1REDA 4AVCA 2ZAAA 3WNOA 1W6PA 2WQ8A 3B7MA 2HWF2 5FYCA 5K0UB 5ACA2 4A7KA 2P5BA 2XWJB 2CWMA 2Y33A 4HVRA 4BM8A 2ES3A 4MX3A 4BB3A 2WZEA 4B3NA 5DDJ2 1WA4A 2XH6A 4KWLA 1L7QA 4A6SA 1PZ9A 3J9SA 1X36A 2QQMA 4ARYA 4YM3A 4IEWA 4L97A 4R8HA 3OBAA 1VAKA 4J1WA 1ENRA 1W9SA 2R061 3NKGA 4COUA 2Z69A 1GNYA 4YVSB 1BZWA 5C8CB 2RS51 5FP9A 1UAIA 4LO4B 1JZ8A 1UWWA 3IDAA 4QQHA 5LASA 1ZX5A 1AR63 3OYWB 5KXDA 1HRI2 5JWPA 5EPAA 3WG2A 2D5FA 1XNBA 2XKPA 5F3CA 2VAUA 1OF4A 2WNUC 4JX0A 4BQXA 3VBOB 3O7OA 3HPNA 1H2NA 4DPNA 1ND3A 4NRPA 1XSRA 3JQXA 1ASJ3 1FMD1 1QJU3 3ZXGA 1X82A 1VRBA 4CEWB 1RUG2 4QHBA 3THPA 3U07A 4CXWA 1LGCA 5FLHA 1UZ0A 2YFUA 4UF0A 5IVEA 4NWWA 3TEYA 1D2QA 3PL0A 1EY2A 4O65A 5FYYA 1YJKA 2JDUA 1ULDA 4W50A 1M4WA 2BOIA 1DFQA 1GQGA 2CGPA 2FMDA 1AL21 3VKMA 4D6QA 3MUY1 3ILNA 4LBQA 4FPHA 1OSGA 3DKWA 4JVAA 2J1RA 1GFF2 1FPN1 3OCPA 3LWCA 4Y1UA 1HRV1 1B35C 4UFHA 1Y4WA 4CCKA 2PYTA 5JMCA 4I2OA 1W6OB 1RUD2 4TLFA 1JZ2A 1GZ9A 4B29A 1OA3A 2EA7A 1VR3A 3NNFA 3RI8A 1I1EA 3WDUA 2VNGA 2YU1A 1BHGA 4MGSA 3NAPA 3RGBA 4H14A 4I09A 3LEIA 3Q8BA 3PUSA 5BUVA 1VBC2 3OEAA 4XIKA 3GHMA 1AYM1 4GJYA 1W2AX 4XUNA 1R1A2 2A6VA 2GMMA 4HN0A 1W3XA 4HSJA 2E63A 2HWD2 1QH6A 1RJ8A 4ZZ5A 1RMU1 2VBBA 2WKKA 2D3PA 2ZHNA 3AKSA 5A33A 4F8AA 1JZ4A 2J1UA 2OIIA 3DECA 1W8UA 1NUKA 5DUVA 2JDHA 3PHMA 4D6SA 1W3VA 2SLIA 2PELA 1ZA7A 2V4VA 4W65A 5FYBA 3WG3A 2E7AA 1F5JA 2WL1A 3T09A 2W94A 5FZDA 4YGCA 1EUTA 4WVZA 2KXLA 2WDBA 4QHOA 3HN3A 5T50A 1XYNA 4Q0UA 2DV9A 1XU2A 4B4QA 1UMHA 1TME3 3VBRB 3ZDVA 1K5MB 1RUF2 4HPKA 1S0GA 2W1UA 3BTAA 1NCRB 5F3EA 1AXKA 2WWUA 4YLZA 2D3SA 3W5NA 3O0WA 5HXVA 4AI3A 5J36A 1H6XA 5ABJC 5CAZA 4LBOA 4CTEA 5FDBA 2R7EB 3FX3A 4XTMA 1VMHA 2ZEZA 4LIVA 4GKYA 1J3PA 1V6KA 1ALYA 4P08A 3SCFA 5F1RA 4DEVA 5A7QA 2BWCA 2ARXA 5DG1A 2HLEA 5FZ6A 4CP9B 1ST8A 5KC6A 4W6YA 1UX7A 2VMCA 3KGLA 3P3NA 1WGPA 1YIPA 1W03A 2HBTA 3I2DA 3T2OA 5A32A 5KHKA 4RQPC 2WNVA 4YGDA 2AREA 1HJFA 2C4XA 4FVVA 5H9QA 1AX1A 1LHUA 4XFAA 4AI0A 4IV3A 5A70A 3M7AA 5B4NA 1MEC2 4LBNA 1PVC3 1CONA 3JD72 3ZYBA 1KITA 2JIGA 1PM4A 4LA2A 5FY7A 4R52A 2BZDA 4LQRA 3O0VA 1LECA 2VUAA 4Y22B 4NO4A 2K0GA 3AMMA 5EV7A 4R9CA 4OI0A 3VBFA 4H7LA 3OOXA 2RV9A 2DFCA 4IERA 1UKRA 2JIJA 3WNNA 3O1TA 4ET7A 1NT0A 3A22A 3RMXA 3ZFFA 2QVSB 4Q1PA 4CDWA 3SXWA 4Q4W2 2VOVA 1OH3A 2CTVA 1POV0 1IQDC 3HT1A 4LEJA 2PHDA 4JGYB 4MGZE 5FPBA 5EQUA 5LB6A 4BQWA 5EIYB 4DRRA 1YXWA 4GWJA 4QMAA 4Y26A 2VJXA 4JGZC 2ZX4A 5BNOA 5IATA 4AXOA 3VZLA 4PI0A 1PGW1 1TZOA 1POV1 3I2IA 4CCCA 3M2MA 2VPVA 5FMCA 1GR3A 5CYYA 5DAPA 1W6MB 4UFMA 2P37A 5B4XA 3AK0A 3J8F2 3VBSA 1QOTA 3ZKUA 4AFDA 4N43A 4DB5A 2QBXA 4AFCA 3GXUA 3I2KA 3KV5A 5BNPC 2HWB2 3S7IA 4KWUA 4CEYC 4NVPA 4UW4A 2YHJA 1FNZA 1STMA 4JKLA 2RS11 5K4LA 1VLNA 5H9SA 2BVVA 4QXBA 5D8AC 1OA4A 4YGEA 4B8EA 2GC2A 1KS4A 2Q0AA 4XAAA 3ZIXA 4XILA 2WNEA 2VTXJ 3JXSA 5F7UA 2YROA 3ZXJA 3FC0A 2HJIA 3DPRC 1FXZA 2JDYA 2RS31 2WA3A 4XFGA 4YW7A 2X5IA 3TEWA 1W8OA 4PHZA 3C7FA 5JOYA 1UD1A 2RM22 1DYOA 4AHYA 5C8WA 1W04A 3VHNA 1AR83 2DCZA 2MEV3 1FNYA 4RS5B 2BUKA 1G7YA 4DXSA 3I49A 5CIRA 2CGOA 2F6BA 1CJPA 4XF9A 1JOBA 2IWGB 3B5LB 3HMYA 4N90A 5IVCA 1QY4A 1MS4A 2BQPA 5FZIA 3WHUA 4DFSA 1QQP1 4B4RA 3GCWA 5GLZA 2CDPA 1OKOA 4MVTA 5FYHA 5FXVA 1CZVA 1Q8QA 3WQ1A 4JKKA 4C1XA 1WCUA 2O1QA 3AZVA 5CA6A 2WA4A 3HNBM 4BMEA 1PZ7A 1TNFA 2OUHA 5I91A 5EJZB 4Q5OA 2WINB 1G9FA 4AGGA 2VU9A 3N9LA 2VOWA 4DINB 1AYN3 1XE0A 4L2NA 3ZYIB 1GV9A 2WRAA 5DUXA 4A6OA 4MHRA 4TXWA 3DYMA 4KL1A 4Q4X1 4CDQB 1U5ZA 5FZFA 1VRH3 1W9FA 1O4YA 3MYXA 2DVAA 3LIHA 3T3YA 4Z1VA 4C90A 2F4PA 2A6WA 4HANA 4QWNA 5E88A 4C0HA 5HV4A 1QOSA 5FCCA 4OLLA 1R093 3AFKA 4CSWA 1ZZ8A 4QPIC 4XFBA 2FDGA 3Q8AA 3ZSMA 1IPKA 4AHXA 5ANNA 4CXXA 3VD4A 3IBMA 2QJVA 4QXHA 3WQBA 1NLSA 2DUPA 4MXWB 5I0TA 4GH4B 3RJ2X 4QX8A 3H1YA 3VDBA 4EQVA 4XDPA 1CPNA 3VDDB 5LBCA 2VY0A 5LZ6A 2VZ1A 2RMU2 1UY1A 1SACA 4GIQA 5E89A 3U75A 3K3NA 1NQJA 1RHI1 5C9AB 4LUMA 2X29A 3UJOA 1WLWA 1EUUA 4QPGC 2A71A 3OBZA 5EYXA 2IXIA 4BU2A 1BEV3 3CF6E 2KM2A 1W6QA 1VBB1 5CFCA 4WM8C 4PJYA 1W9WA 4COVA 2VQUA 2NLRA 3THTA 1VBA1 1D4M3 2RR13 2RJKA 3T08A 4ZY9A 3RWKX 5EZWA 2O8QA 1L7RA 1TQ5A 4AHWA 4HETA 2ZA9A 1DLLA 4YNIA 4BQ4A 3DCQA 4AVSA 5CB7A 5JI9A 1W28A 1BK0A 2GN3A 4GMP0 5DDJ1 4EYUA 1IPJA 1N1SA 2Y8KA 1GZCA 4FPGA 4OUMA 3RRDA 5AFEA 1ULPA 3AJZA 1QJX2 4TSVA 3VGIA 1J59A 4XZPA 1H9PA 2JE9A 2QQLA 2XOMA 4ZPIA 3W59A 5GZGA 4FTEA 1OOPA 1XC6A 2QQWA 3C7OA 3IN9A 3KVAA 4KGQA 4O9GA 1ULEA 4KMQA 5GZCA 2IVIB 1WMEA 5I8TA 1IS5A 2O8OA 3NL1A 1BBT2 4GMP1 2JENA 3B02A 4OYUA 1K3IA 2R49A 1H1MA 3CL1A 2Z5WA 3WCRA 2DBNA 2EXJA 4JDNA 2Z2SB 4QM9A 1ND2C 2VZVA 5K0UC 1HRI1 2BFUS 3DEMA 5FWEA 2GNDA 1CIYA 4LK7A 1NCQA 4LHKA 4CU6A 3D5OA 4UFIA 2VXRA 3JQWA 5FLIA 3VBOA 2EIBA 1K12A 1NAEA 1NXMA 2AUYA 1IZ3A 2WJSA 1SPPA 3OD4A 5IFTA 4DUVA 1HQWA 1T6GC 3ZX7A 1WD3A 1S2EA 2W08A 2WFF2 1DP0A 5FXWA 4PLNA 3WF3A 1US2A 2Y64A 4NHYA 2VQTA 1YHFA 4Q4Y3 3UNPA 2B4KA 1RUG1 4XFCA 2E33A 3WF4A 4YVSC 2RS52 4AI9A 1WWYA 3TN93 5C8CC 1BQPA 1UYYA 4XJ9A 5CVRA 5DAWA 2DUOA 1HN1A 2VCAA 1IQAA 3SQOA 3BCWA 5FZCA 4C1WA 4QPYA 2QQUA 3CJXA 4OHXA 2NZ9A 2OZ6A 2QQOA 5HI0A 2GC1A 1RUI3 2TUNA 3TEXA 4YFZA 3NJXA 4AGVA 1SCRA 2VZ3A 1W2UA 3ZSJA 5HCAA 3L9JT 1BJQA 1C1FA 1CX1A 5A3MA 4AQSA 3O1SA 4XCAA 1OC1A 3OPTA 1PO12 5IVJA 1C57A 4AFAA 4CEWC 1HJGA 1UPIA 2GH8A 1RUD1 2G9FA 2HWF3 5ACA3 2NM1A 4OHWA 4XF1A 5IVVA 3D8CA 3RZZA 1CZTA 1CESA 1Q5OA 2YY1A 2ZEWA 3IWZA 5FP3A 2X09A 4BPZA 2VM9A 3UK9A 3ZFGA 4Y4RA 4CDXB 2Y6JA 1VBC1 4IV1B 1LODA 3WNKA 2VUJA 1W9TA 1R1A1 2TNFA 4L92A 5LATA 3CZUA 4L11A 1QJY2 2HWD1 2XDVA 1YLLA 3PURA 4XYXA 4META 1D0HA 4GQ7A 4NHXA 2W68A 4ISQA 3RI9A 1ZBE2 2JB8A 3AZYA 2WN3A 3HJRA 5JOWA 2JXAA 1Y7BA 4X6QB 1WW4A 1V9U3 1UU4A 1SLTA 2QQKA 4LKSA 4ZHNA 3D4KA 2XXZA 3VBRA 2CV6A 1US3A 2WAOA 1MZ6A 3WP3A 4FAGA 3ZR6A 3VBHA 1LULA 3PIGA 1RUF1 3IT8A 1BMV2 1OHFA 2C9KA 2BP6A 1W6NB 1OPMA 3KD4A 1EV13 1WLDA 2VCBA 4K21A 1X7NA 1LOFC 4P02B 3WR0A 2HEVF 4Q0PA 2XJVA 4WM7B 1O7FA 4J25A 1SBFA 4OCTA 4OQ9A 4I0BA 1XE8A 2VH9A 3D3AA 5FFOC 3KHCA 3WDXA 5HCFA 2XB6C 4JRLA 1J1LA 1MS1A 1OKQA 4PLMA 4Y5Z0 4KU8A 5JR7B 1TG7A 2BYVE 5E16A 4CCLA 1L7LA 4XTPA 4RFRB 1FV2A 3AKTA 3H3UA 4LO7A 1JOJA 3URFA 3ZXDA 2W39A 1DU3D 4KWJA 4COZA 1CJDA 5B2GB 2WWJA 1GWKA 4YFWA 1JYWA 1MEC1 3JD71 3JB4C 3WF0A 1HXS2 2XQRA 4PLOA 5J37A 1K5MC 2EVXA 2OQ7A 2VE1A 4BDVB 2W47A 5FKCA 1ZRDA 4ZS3A 1NCRC 1OLRA 5T52A 3KQRA 4PQQA 4YZ5A 4FP3A 1PM7A 1R083 2XG3A 4YYOA 3O1PA 5JXGA 2V72A 4NHKA 3VDAA 4NRMA 5DZGA 3WX5A 1DYKA 4QX0A 3H7YA 4RR3B 1W99A 5T54A 5C4WB 1UX6A 4RHV3 2WABA 4Q4W1 1ZZ9A 1BK1A 3RPQA 4Q4V1 3AZXA 2Q8OA 1G9DA 2Y6LA 3NW4A 5FQ0B 2WZR3 2VG9A 1YRZA 3NWKA 3MPBA 4FPCA 3AVSA 4JGZB 5A1FA 5JIUA 4P9GA 3BKZA 1YYNA 5FBZA 3OJBA 2ZOEB 1FOD2 2Y6KA 3B9CA 2GSYA 1ENXA 3SHRA 3WXPA 5AC93 1ZBA2 3D6EA 3O0XA 4GB32 4Y1VA 1YFUA 2BEOA 4AEMA 1SHWB 4K3UA 1U12A 4IGOA 3ZO0B 1V6OA 1FX5A 3J8F1 4P14A 2AC1A 2X05A 4F83A 3S5AA 1W2TA 1GLHA 1LKNA 4E8DA 2XJTA 2C1FA 1A6CA 2GNMA 2HWB1 2QE3A 5SV8A 3P6BA 3ZXLA 3ZFEA 1WW7A 4I3GA 4KGGA 3UETA 4FPKA 5L7OA 3P5BA 1AJKA 2G1MA 4JGYC 3OEBA 3ZXKA 4FOQA 3MFAA 1I9RA 3NQHA 2WBKA 3JBG1 1VPHA 4MH0E 2VOKA 1W2OA 4DO0A 3IMMA 1WLCA 4M0HA 4AEDA 5CNAA 5F39A 1JS9A 2PHLA 5GALA 4CDUA 4NMIA 5L9RA 1XSQA 1H30A 1PK6B 5FLJA 5BNQA 3JU9A 3WEZA 3OGJA 2LW8A 4WVVA 2RM21 3VKLA 1UL9A 3POWA 3UKVA 1AR92 3KM5A 1RUE3 5JZGA 5BNNC 2JG8B 5FY1A 2BERA 1Q8OA 1J1TA 4FQZA 2JDMA 3M70A 4L8QA 5FYSA 5HPOA 1GZWA 2F4LA 4FPFA 5FYVA 1YFWA 3WHTA 1O59A 2VTFA 3HR9A 4XXAA 4MGQA 1JZ5A 4IGPA 3I2JA 2VBPA 3SEEA 4AI2A 2JDNA 1VBD2 3OY8A 1QHDA 5BPXA 5C7GA 5FPXA 3E1F1 3VZOA 3B01A 2XVGA 3N9QA 4JQRA 2JE7A 1U5YA 2K2SA 2QNKA 1BVP1 3NV4A 1KJRA 4UI9L 3ZYGA 1CAUB 3CIHA 2AEYA 3POBA 4EN6B 2TEPA 4A7ZA 4LLOA 5FR3A 4A44A 4BYYA 5D1IA 2OZJA 1SMVA 1RTVA 5I0RA 2R6QA 1WCKA 4FO9A 4RS5C 2HWC2 4O9EA 1PIV2 4CP2A 4KQ7A 5F6KA 2PLV3 3N9NA 2A3WA 2B5HA 2QDRA 2Q5TA 4XMAA 3ACGA 2XBO1 2YDEA 2ZGLA 2R042 3HQRA 3VDCA 5D2AA 1D4VB 4Q1RA 4QX7A 1RUJ1 1WBLA 3C8XA 1V6LA 1RUNA 2PHTA 4Q0QA 5LBBA 1NE6A 1PMJX 3J7LA 2ZGUA 3K3OA 3QBQA 1PHMA 5CADA 3W20A 3NSTA 2NYYA 4XJ8A 5FZMA 1RUC2 1O3QA 1PNFA 4KNCA 4LBKA 5K7PA 1AR72 3H42B 2RMU1 2VULA 4BISA 1S55A 2WSVA 2A70A 5IWFA 4N53C 1TMF3 5FK7A 4CDQC 1COV2 4E4SA 2JEMA 3ZN5A 4XDQA 4AI1A 3SITA 1VB2A 2P3YA 2DVGA 1H1AA 2CSGA 2ZGQA 1Z7S2 5IYYA 1V6NA 3KT4A 4L99A 5FZOA 5IJRA 2Y0OA 1KRIA 4B4PA 3RWNA 3AM2A 1XXNA 2PHXA 4HT1T 3C7GA 1ZA4A 2VZTA 4IE6A 3PVNA 4GD4A 1QOOA 1W06A 4GH4C 4IEOA 5F32A 4OZOA 5G04L 2MPFA 1OD3A 2JD9A 2P3KA 3T0AA 3VDDC 4YZ1A 1XNDA 3RZGA 1QJX1 1JU4A 1LEMA 2HWE3 4M3CE 3DXUA 2VZOA 2Z4FA 3KHBA 5C9AC 1FT9A 3KF3A 3SLIA 2WS91 2ATFA 1MVEA 3FUQA 1ENQA 3BALA 1MZFA 2XJPA 3GF6A 4K20A 3WINE 3LDRA 5JUVA 4HXCA 1BBT1 2BJSA 2C26A 2CDOA 2ZGTA 1RJ7A 2IUWA 2WT0A 4NAOA 3EBRA 2C6SA 5IVBA 1ND2B 5FPVA 4ONUA 1H2KA 1QDCA 4XJAA 4A4AA 2C24A 2WO1A 3V64A 2WNUA 3ZPOA 1FYUA 3RVHA 5J98B 4LK6A 2Y6HA 4YZ2A 4NIIA 3KS7A 2WYFA 5C71A 4AAPA 1KDKA 2WFF1 3WVJA 5FMOS 3UT0A 2A6ZA 3OGGA 4ZXKA 3MFCA 4HMZA 4DXRA 3N4MA 1NY72 3MICA 1P8JA 1BKZA 3CNAA 2I45A 4Y24A 1QJZA 5FZAA 2VZUA 2W87A 3WW1A 4MSVA 1OT5A 2GU9A 1UKGA 1Q8SA 1PO22 2VD7A 3I2OA 4CCNA 4S2HA 1A8DA 2ADEA 4E4DX 1ZVFA 2V4AA 3AP7A 3ASIA 5FY0A 3WD5A 4EROA 4KI5M 1MS5A 4ES8A 1DQ4A 3POFA 4AEJA 1HN0A 2HYXA 1QJEA 1B35A 3POIA 4DEQA 5DZFA 1H0BA 4XF4A 3U4XA 3B9IA 1UQXA 2W91A 3VUOA 1EAH3 1HLCA 2FBEA 1AX0A 2PXJA 2VMGA 3BU7A 3N3HA 4BK4A 1CWPA 4Z2WA 1VBE3 1PO11 2I2SA 5FWJA 1UZVA 1Z78A 2AGSA 2DU0A 2XHNA 3N7KA 2R072 5GZFA 2ZGPA 5DAXA 1IG0A 2E7TA 3DF0A 4GULA 2IXCA 3AC0A 3GGLA 4UW6A 2OT7A 5J3UA 4HOOA 3MIFA 4G9SB 5TSWA 2ZAHA 3FL7A 3V0AA 2Q1FA 2WFPA 5JXIA 2EAAA 3HD8B 4LNVA 5A7WA 3ZPYA 5GKAC 5IW0A 4CCEA 4OVEA 1YQ8A 2B45X 2Q8DA 5HXMA 1GP5A 4D69A 1OLME 2NMNA 2UU8A 5CKQA 5A7SA 1I5ZA 2IXLA 1QJY1 4YWAA 5KHIA 3ZSKA 3K48A 4K9SA 4YM1A 4V2WA 3MW4A 5SV5A 1AJOA 1ZBE1 2ZZQA 3CBNA 3FN9A 4H55A 1UXZA 1JHNA 2A73B 2WNOA 4HLTA 3SCGA 2PN5A 2ZMNA 2WQ4A 3ON7A 4ZU5A 3N9PA 3U4SA 5K8SA 2QQVA 3EMRA 3INAA 4EN9B 3T2PA 2J22A 4A7YA 1ZZCA 3AYAA 4YW4A 2UYBA 2KA3A 3FBMA 3L2YA 1BMV1 1SEFA 5JMOA 5F5QA 1LENA 2JE8A 4EWEA 3POJA 2VQ0A 2D44A 3MDPA 5ABJA 5C5TA 3HNMA 3MW3A 4CDXC 4IV1C 5A6XA 3R6SA 1LOGA 4LPLA 4UAPA 4NPLA 3THCA 2R063 2FMYA 3KV4A 4AQ2A 3USUB 4BQYA 1QXJA 2GP5A 4DRVA 3SC7X 1DQ1A 5HCBA 5CU1A 2RS53 1KS5A 3E97A 4URAA 1OQDA 3WT3A 4RQPA 1TEIA 5LA0A 3DYOA 4XBNA 2KD7A 2RDQA 5A3PA 2C0ZA 4XIOA 4XVHA 4B7EA 2B8MA 2YZ4A 3V0BB 1F4AA 3MIBA 4Z82A 5IAXA 3ST7A 1X50A 1A78A 1HXS1 3IDBB 3U0ZA 1DQ2A 5ANQA 2VMEA 3IPVB 1YQ2A 3S0MA 1FAYA 1H8TB 1PNGA 2CL2A 4N9HA 5DUWA 5L73A 3ME2A 4XABA 1RUH2 2VCCA 4BCUA 5A3UA 1J83A 1GSLA 1GMMA 3W5MA 1RITA 2ZEXA 5FUPA 2E51A 1FMD3 4WM7C 3WUCA 1PX3A 1O3TA 2ZPXA 2D6OX 2ZHKA 2A7AA 4FXGB 3O1MA 3WNXA 1C5IA 3GBWA 4Q8KA 4PDWB 4YRDA 1UIJA 2QQJA 3I97A 2ILMA 5JI7A 2JECA 2K9ZA 5CG8A 1UY3A 4IEUA 1MQTB 4JGZA 4LHNA 1S4CA 3IKWA 2VMDA 1CGPA 1KXGA 2XUEA 1AL23 2JB4A 5FXZA 5C5UA 1FOD1 4OHZA 3S5QA 3J7HA 3OUIA 4Y20B 3KT1A 1ZBA1 3MUZ1 1ZRFA 2Y6FA 4GB31 1FPN3 1YIFA 3A21A 4AVTA 1HRV3 4WVMB 5F5CA 4DIQA 5CISA 4QGNA 5KHGA 2IFWA 2PFWA 1C3HA 3ITQA 4QX2A 4UT5A 4AVVA 5GZDA 3USSA 5BNPA 1OQEA 2EIGA 3A23A 2H0BA 5LA2A 4CEYA 3I7DA 1XJAA 4NWVA 3I8TA 4M3CF 4RR3C 2ZTNA 3ATGA 2XMLA 5C4WC 4MLOA 4LORA 4CRQA 2VVEA 2VMHA 5D8AA 2VL4A 4LBJA 1ODNA 4Q4V2 4TYSA 2ZGOA 1GBGA 2E32A 2V5YA 1DGWA 1JI6A 3GDBA 3FHAA 4IDZA 1RXGA 3KV6A 1S0JA 1S0BA 2W0XA 4XUQA 1AYM3 1DHKB 1UOBA 3DPRA 3RYPA 4BK5A 2B42B 5FPZA 3PIJA 1NA1B 5A1AA 4OHYA 2WLPA 3J7NA 4XOGA 1RMU3 1IOAA 1XB9A 3ABZA 5IK7A 4CCMA 1AR91 5BNNB 2WZ8A 2BDRA 4NHMA 4LOSA 1QIQA 4YM2A 3LEMA 3I3BA 2G19A 1H1IA 1HB1A 1LRHA 4NIHA 4LHLA 2VMFA 2R0FA 3ACFA 3FLRA 2X10A 1W2NA 5A3NA 3FWEA 4D0QA 4FPLA 4XF3A 3WDYA 1JYIA 3JBG2 4Y3OA 2PTMA 1OQ1A 1VBD1 3TNQA 4BLIA 5FZ0A 2DVDA 3KSCA 4XXPA 5DQ0A 1JYNA 3ZLIA 3OB8A 5CFDB 3KGZA 1JYVA 1QXPA 5FK8A 2UY9A 5CEHA 3BTZA 1PK6C 3VD5A 1OUXA 1SLCA 4LIUA 2QCSB 2O0OA 3GBGA 3G7DA 1I3HA 3KCCA 2AR6A 2HWC1 4YVWB 1PIV1 3TBDA 1CAXA 1JUHA 4BA6A 1RVF2 4LBQD 2JG8C 4QGLA 3FUOA 4QPIA 1ULOA 5KXBA 5J09A 4DY3A 1SFNA 4AG4A 4ES9A 3FHIB 4PT6A 2R041 3OG2A 3Q8CA 1O5UA 1OD5A 3V65A 4LLFA 3OPWA 3WW4A 3MV11 3OPZA 1LHWA 3VBUC 3EO6A 3U37A 3BPSA 3J26N 4K40A 3LZZA 5IHRA 1RUC1 2A6XA 1AR71 3K51A 3I59A 4WZCA 4N53B 1SLIA 2PAEA 4QPGA 2NPIA 4A3XA 2DWRA 4K7JA 4NAMA 4E27A 1UOGA 2ID4A 3WP4A 1CAVB 1COV1 2FCVA 4D6RA 4DXZA 2L9LA 3HQUA 3R4UA 4WM8A 1YC61 3NVCA 4PQ9A 4Q2FA 2XBO2 2FZ1A 5A7WB 3SMHA 3X29B 1Z7S1 4AR2A 4D7YA 3FHQA 4URTA 4M3CB 5T55A 1SFPA 3QCWA 3LEKA 4AVAA 1RUJ2 5JSPA 4RFT0 1POV3 3NKTA 3I3EA 3R05A 1RUOA 5L9BA 4IE7A 1PX4A 1SCSA 2ET1A 2ZGRA 2Q30A 2WN2A 4LKDA 2XPJA 2GALA 3H8XA 2ARAA 1H2LA 1CQ9A 4K6BA 3LDKA 4I01A 5L36A 4Z2AA 4KG0A 4ZXEA 1N3OA 4D8MA 1NYWA 4LBLA 5L9VA 2A75A 1C8M1 1LU1A 2JG9B 5EFUA 1RB8G 2VW2A 2RS13 3EYPA 4PBOA 1N1YA 4P5HA 2DBIA 3NNGA 5FYMA 5KWRA 3W21A 1QKQA 3IAPA 1KEXA 5IVYA 1JZ3A 1GNHA 4HK9A 1EPZA 1DGRA 2E9QA 2YBSA 3ENRA 3WCSA 5KXCA 5A6ZA 4XURA 1K45A 2IC1A 5APAA 5H9RA 1ND2A 1SDWA 5K0UA 3VKFC 4FT8A 1N47A 2RS33 4QDSA 3S6PA 3U10A 3EHKA 1W0NA 4MGIE 1G6NA 1NOVA 4R4XA 2Q8EA 5CG9A 4RGKA 3M1HA 2DDUA 1IPSA 1HB3A 2HH9A 2BGCA 4KG8A 3MI8A 3O1UA 5FOJB 5LW9A 3AJYA 3EXUA 5CKMA 1DCSA 5FUIA 1UMIA 1KJLA 3Q8EA 1QQP3 1ASJ2 1YQ5A 1RL3A 2UWCA 1ACCA 2BBAA 3OD0A 4NE9A 2WS92 3M4FA 1NY71 4M0NA 4YVSA 5C3SA 1LU2A 4OI2A 4MADA 5EJ3A 1ZRRA 3W58A 3ZN6B 5C8CA 4OQ8A 4PF1A 1BYHA 1JBCA 2DTWA 3OUJA 1UF2C 2P3IA 2CHHA 1LR5A 3JUUA 2XLFA 1LHOA 1PO21 3GZTB 1DGLA 3OYWA 4HBNA 2R1BA 3QH6A 4AI8A 3GNEA 2VZRA 5IK5A 2PQQA 1ZRCA 2NN8A 1IHMA 4Q4X3 3AYEA 5FZ1A 4XF0A 4FTBA 1UYXA 1WCSA 3AYDA 3KCXA 4K8FA 1PMIA 5FAXA 4E2SA 2A1XA 4IE5A 4DUXA 1PGL2 3KV9A 1CPMA 1VMFA 4E2QA 4IEPA 2W92A 2ORXA 3WNLA 1K5JA 4Z8BA 4QM8A 5CZKA 4CEWA 2E53A 2FDKA 2JJ6A 2ARBA 1Q8PA 1W05A 1H9WA 2R071 2XUMA 4FFHA 4IXLA 5F37A 3GALA 1W6PB 3PVBB 5I8SA 1SLBA 4UOJA 2DCTA 4NOTA 4U2AA 3GZEA 1YNAA 3TWIA 4BHPA 4QB2A 1REEA 5KC5A 1C5HA 3WV6A 2FDIA 1UZWA 4UFLA 1HKDA 2JDPA 4Q29A 4OULA 1RHI3 3VN4A 3H0OA 2RJ2A 2DCJA 4JDMA 2OUJA 4YGBA 2Y0IA 5EHDA 2W1SA 3I2FA 4O7XA 3PU3A 2LALA 2I07B 3DKQA 2BV4A 2KR2A 1VBB3 2X8KA 2D3RA 2YXSA 3O1RA 1VBA3 2CYFA 1QEXA 3NMBA 1W6OA 1Y43B 1YQ6A 5DN2A 2RVAA 3ZXFA 3OGRA 4FPYA 2OQ6A 4RD7A 3B93A 1TME2 1AUYA 3O12A 4FBFA 1AHSA 1N1VA 2VUDA 5DDJ3 1GWMA 1LOFA 3I3DA 3RJRA 5F9TA 1U5IA 3MF6A 1G9CA 2SBAA 1TVGA 1JUIA 3I2GA 2WLQA 5GZEA 1ND3B 1IS6A 2PAKA 5FY5A 1LGNA 5KHJA 3BI3A 5FMOL 2QQPA 2A3YA 3WQ7A 1XOYA 5T5LA 1NZIA 1X9TA 3K77A 4GMP3 2LROA 4K8RB 2J1TA 5A7NA 4QQPA 1H6YA 2XQXA 2IXHA 2ZABA 5FPLA 4UF0B 4FCAA 3AFGA 1WW6A 2BBVA 3BOWA 1H4GA 1K5MA 1LOCA 1HRI3 2XL9A 3H7JA 1NCRA 4V2VA 3IPVA 3BN6A 1UU5A 3FFQA 4AVBA 1HDKA 5D21A 1DQ6A 3VLBB 2JDZA 2V09A 2ZX3A 3OUHA 4ZU7A 1ULGA 1W0OA 1YO8A 2QTWB 5GLTA 1RUH1 2WUHA 4JV4A 2WT2A 5F5IA 3KZ4C 1JHJA 5DXDA 4W8JA 3CHXA 1MVQA 3RYRA 4XJZA 3NO8A 3WOGA 2WR9A 4X6RB 1RUG3 3T1LA 1O4TA 4CP9A 1YQCA 1SFYA 5I0DA 2QQNA 4GJZA 5JVVA 3VD3A 3I54A 1QGLA 3N7LA 4ORFA 2E7QA 2GP3A 4FSJA 4HSLA 3DXTA 3NAPB 3ETPA 1MS3A 2FQPA 4AGRA 4HFSA 3ZFGC 4OI4A 2ZMLA 1H8VA 4Y22A 1H8TC 3A0NA 3Q9OA 4WVMA 4PCRA 3MHZA 4MGTA 5J48A 3ETQA 1NLQA 3RNSA 5A1LA 2BTVC 1G86A 2A6YA 1LHNA 5A33B 2YMZA 5DZEA 3GZUC 2GZWA 5FO9B 1H2MA 1DGRN 4P9IA 3SH3A 2DYCA 1RUD3 3ILRA 3MPPG 4QQLA 4I30A 5LBEA 2BGPA 2GNTA 1O91A 4JGYA 4PDWC 2H0VA 2JWPA 2W1QA 3LFMA 1GP4A 2E31A 4KU7A 5DG2A 3BTYA 1VB4A 4HPKB 4CA9A 4IEZA 1MQTC 1MS0A 3UYJA 2J1AA 1GOHA 1VBC3 1SG3A 3M3IA 4LE4A 1IS3A 1Q3EA 1WCQA 2Q1MA 4MOAA 4QD2A 4QDQA 3RDIA 1R1A3 3LQCA 4ASKA 3MF9A 2OPKA 4GALA 2HWD3 4ZS2A 5C3QA 1W6MA 3AL6A 1SLLA 1JU3A 1R64A 2IVJA 4S2DA 4PBPA 5BNNA 4A3ZA 2WO3A 1AR82 3OGVA 2MEV2 1YI9A 4IGQA 4KBBA 3ZYRA 4CU9A 1RXFA 2VVDA 2VXJA 4JHTA 1W8NA 3H9AA 3D82A 4LTAA 4O61A 3BODA 5A32B 4A2UA 2WNVB 4EV0A 3ELNA 2JDKA 4E4ZA 3PJYA 1RUF3 3G6JB 4EWDA 4W6XA 4PIZA 5JXJA 1NZCA 3TYJA 3LOBA 3IAQA 2CAVA 2P6HA 5FYZA 3NJVA 5FP8A 2YFZA 1JH5A 3PTYA 3WP5A 4IE4A 3ZVXA 1DIWA 1B09A 2CAUA 4BXFA 2DTYA 1U5XA 2UYAA 1NA1C 5EXOA 3VBFB 3POYA 2W9XA 1AYN2 1HW5A 1UOJA 2OPWA 4SBVA 4RS5A 1ZZ6A 4IEYA 4S2GA 2ZKLA 3BIWE 3GJAA 3ZFFB 4XBQA 1F9KA 3ACHA 2OW4A 4NHLA 5EP9A 3LFIA 4BLJA 1HV0A 5AVPA 1WLTA 4CDWB 4H7MA 4EN7B 1RVF1 3IZOA 4U36A 2ZBJA 1QNYA 4QQOA 4JCKA 3PMEA 3ZYPA 1JMUB 1MEC3 3CJIC 3JD73 4EN8B 5HV0A 3BOPA 4AL9A 3MLKA 4NIGA 3CU7A 5BNOB 3WF1A 2F17A 4YG6A 3DYPA 3NRUA 5FXXA 3VBUB 5BV6A 3LA2A 4LULA 4QXCA 2XLGA 4CU7A 1DDLA 3TOJA 5CFDC 4YW5A 2J42A 3VBSB 1YJLA 2N7GA 3IB3A 1DG6A 4N43B 2BNOA 4YW3A 4N53A 3R0RA 3LDBA 3N9MA 4XQ4A 1XPWA 5KHHA 1MACA 3ILFA 3M3CA 3WLUA 5T5OA 4CDQA 2ORZA 2PHUA 2BPA2 3HN1A 4CE8A 4Q4W3 3ZN4A 1E5RA 3SKJE 5A6YA 4Q4V3 3VB9A 2XGXA 4RHV2 2ET7A 3EJKA 3CEWA 2P3JA 1EP0A 4YVWC 1GANA 2B7YA 1GNZA 2VUCA 2ZEYA 4MGKE 5A3WA 1S2BA 3KMHA 3MZHA 4JDOA 3QH7A 3KB5A 1AZDA 1D4M2 4G3YC 1S0DA 1JW6A 2RR12 3IIAA 1UYZA 4QHZA 4XHXA 3AMQA 5AFBA 3BU0A 2BRTA 4BIOA 4MXWA 5LEJA 5K9YA 4GH4A 4FFFA 5JAXA 2X5IB 3HOBA 3J8F3 4WZFA 1PZ8A 3VDDA 1XNTA 4V1PA 3PU8A 4YSFA 1Z0HA 2HWB3 5C9AA 3ECQA 3K4AA 1XE7A 3K4ZA 4QU2A 5A3LA 3DL3A 4GKXA 1FATA 2ENRA 1CIWA 2C9AA 5FBJA 3JBG3 1IS4A 1F4HA 3BPZA 3F2ZA 3ZXEA 4AK3A 3UL2A 2I74A 1VE0A 3AP4A 4AEKA 2UURA 3WDWA 3ZIWA 1XYOA 4QPWA 4Q26A 5FZ4A 5JLVA 2P2KA 3ZKYA 5C3OA 4OFGA 2PHWA 1W8ZA 1AR61 1J84A 4MYEA 2GC0A 3CLPA 2TBVA 2WQZC 2RM23 2VMIA 5LRSA 5JOXA 1BCXA 3LSEA 4XBLA 4W6WA 4CUCA 2ERFA 2QDNA 2RG4A 2CWSA 4MV2A 5FY8A 3NV2A 4AFBA 1C8M2 3VHOA 4UYBA 5FMBA 2D5HA 2JG9C 1S0EA 4MXVA 3GJBA 1ASJ1 4W4ZA 4EZ4A 1QJU1 4ZKTB 4XHBA 4Q4Y2 5BYNA 1OLQA 4EE2A 4ZZ8A 1KDMA 1ZZ7A 3THDA 3TN92 4P9XA 4Y5TA 1E5IA 2CU5A 2CNAA 3FE5A 4NIDA 2YV8A 5FZBA 4FTSA 4P9YA 4QXKA 1LGBA 2AENA 5FZ9A 2VCMA 3RZHA 1XYPA 2V5DA 2ZHLA 5FZ8A 1RUI2 3KLSA 3ZMOA 1QMJA 5T3NA 1DZQA 3HVDA 4GA9A 1PGL1 3T1MA 3F95A 3KF5A 2XL7A 5JPNB 1RINA 2XBO3 4ASLA 4IL7A 4BZ4A 2ZJCA 5LCWL 4HZFA 3FLPA 5I93A 5CFCB 4CPBA 1DZRA 1RUJ3 2ETEA 3KQ4B 4YW2A 3WQ0A 4TTGA 1UO9A 4Y1ZA 3ZXAC 2J1EA 2PHFA 3K46A 2FDHA 3WNPA 2BW8A 2IXJA 5FZEA 4CCOA 1BXHA 3QD6A 2RMU3 1BVVA 3TRSB 4Z92B 2D93A 1OMIA 1X8MA 4JAAA 4XUOA 3C2UA 4IQPA 4IW3A 2RDRA 1OOPB 2BWAA 3I3QA 2AYHA 2JKBA 2OX0A 1DQ0A 3ZYHA 5BY5A 2UWAA 3RZMA 2V73A 4RYDA 5FIXA 1U0AA 3PJQA 1S0CA 1IKQA 2LUWA 1UY2A 2A5ZA 2G9GA 3NNJA 1V9U2 1QNWA 3KT7A 5A7OA 3FLTA 3FZ3A 1I5PA 1JZ7A 2E26A 1E5HA 2GDFA 3POGA 1YI7A 3VHRA 3BTXA 5LWBA 1TME1 1WKYA 1X8EA 2OS2A 1UY0A 3PVEA 4FPEA 3AB0A 4HKLA 4XEZA 4MG2A 4CDXA 1URXA 1NCQB 4IV1A 4QKNA 1EV12 2B46X 5FREA 1OVSA 2FDJA 2RJLA 3E5QA 1VAMA 1QJX3 1H4HA 3MIEA 1SPPB 4Q0VA 3MGUA 4CUAA 2WS93 5E1RA 3BVCA 1XBFA 1SQ4A 3ALQA 3E6BA 3LOIA 5EWSA 4NUBA 4LT5A 1O3SA 1BBT3 2GAUA 2ADDA 2ZMKA 4AE2A 3AMNA 3TB0A 3FJSA 1S0IA 3UKTA 1ZREA 4AWDA 2YG0A 3PUIA 4LO5B 3VD7A 4I0WB 1SBEA 3VHPA 4BXSV 4R9AA 4XUTA 2YUEA 1PVC1 1OFSA 4H2AA 2P17A 1W6NA 1UYPA 2BFUL 3M8LA 4A42A 2FCUA 3UGFA 1X33A 4AYUA 3CO2A 4CXYA 4QKBA 3V56A 2VOXA 4WM7A 5F8PA 1R082 4LMFA 4N7IA 3RG0A 1LAJA 3LIGA 3LPGA 2WFF3 4Y33A 5FZKA 2YC4A 4BIFA 2OKXA 1YFXA 2B9UA 3RMYA 1ND3C 2Y6GA 2IZWA 1J3RA 5FYUA 5GJ6A 4G4FA 5ISLA 4H3WA 5C3RA 2VNRA 2DF7A 1JYCA 2DUQA
chains in the Genus database with same CATH topology
1D0GA 4Y1YA 3AP9A 1UMZA 2NP0A 2WZR2 4Q0SA 1O4ZA 3ZFGB 1QWRA 2Z42A 1V6IA 5BXXA 5AC92 2NMOA 4FXKB 1YWKA 2YGMA 4L9BA 5JCTA 5LRRA 1QH7A 3O5SA 3J4UH 3OBRA 3NV1A 4D3WA 1XU1A 4QT6A 1NXD1 1HIXA 2GH2A 3M3EA 4MGYE 1PO13 2ZKNA 4HL0A 4RR3A 3AXEA 5C4WA 3AP6A 4YARA 3PVOA 4IETA 2IXKA 5FOBB 2G4IA 4XJUA 1F8VA 2YGLA 1CR7A 5FQ0A 1YUDA 3VBHB 3QACA 2EAKA 4UXAA 4BMBA 5IT6A 3NAPC 4BWOA 2LM3A 2WT1A 1EYBA 1MZ5A 1KFXL 4ITCA 5JSOA 2VECA 1QJY3 4XQWA 4EN0A 3GZAA 2XJSA 3NJZA 4AHZA 4TWTA 1ZBE3 4ATFA 1Y3TA 4KWKA 5E8AA 4YM0A 1AR81 2MEV1 3E6CC 1RUE2 2H6CA 1NQDA 3RYKA 3MIHA 3H8UA 4QGMA 4I3PA 2XHKA 3H3ZA 2NQYA 4SLIA 1WMDA 2CGNA 4XE9A 4EWAA 2WC2A 2UWBA 3MEPA 5IK8A 4DMIA 5JOZA 1GKBA 2OYZA 3NV3A 4RGAA 1PK6A 4LUKA 1LHVA 1QF3A 1F2NA 1AYN1 3UJQA 4C91A 1GYKA 4HKWA 2JG8A 1VRH1 1UW8A 2GN7A 1XQNA 2PLV2 4XPVA 3CJIB 2ZX2A 3T2TA 1R091 2WNVC 1HXS3 3B69A 2RE9A 3AKPA 4IV3C 4JTOA 2AZ5A 1Q56A 5IUQA 3VBUA 4B7KA 2D97A 3H1WA 3VL9A 4YZ3A 1CAUA 3LA3A 1SBDA 1JN2P 2VGDA 4DNYA 5FRAA 3VBFC 5KXEA 4HN1A 2XVKA 5GLVA 4AF9A 3PMSA 4RA0A 2BVBA 4LE3A 1V6JA 4EJRA 1WW5A 1TMF2 4TZDA 4NR1A 3ZFFC 3ZFEB 1QXRA 3IM0A 4UBGA 5L7OB 4CDWC 1BEV1 1D2SA 4S2FA 1DQ5A 3MW2A 1RIRA 1XNKA 1WD4A 4PIYA 1LESA 1FOD3 3M3OA 4LBMA 1D4M1 1DYPA 2RR11 4UBHA 2XKOA 4FOWA 1ZBA3 2JICA 4AEDB 5I0SA 4X8PA 4GB33 4ISRA 4CDUB 5JIAA 5BNOC 5CBLA 2ZGMA 4FOYA 2DU1A 3ZYJB 1TE1B 5DUUA 3VBSC 3M3QA 3VKNA 1DF0A 4N43C 4NPRA 5JZGB 1HQLA 1G9AA 1O3RA 1LOBA 2Z79A 4IESA 4X8NA 4D94A 2RHPA 2HWE2 1YFYA 1HX6A 1GZWB 3APBA 4CYDA 1GICA 3I4IA 4COYA 3LAGA 4HVQA 3OY8B 3LSDA 4ASMB 3B00A 1N3PA 4XW3A 4M01A 3WUDA 1JXNA 2HYKA 1CX4A 2P34A 3PLQA 3VZMA 1LTEA 4OI1A 1W39A 4MUVA 2IFRA 2R0HA 2X5IC 3TAYA 1AR93 3ZSEA 4BE3A 3BB6A 4BH9A 1VALA 3A4UA 3JB8A 5I0UA 2YPJA 4FQ4A 3HT2A 4UW5A 2GMPA 3O14A 5AVAA 3OBTA 3IDCB 4Q4Y1 3POSA 1VBD3 3UKNA 4RL7A 4OZXA 3TN91 1QDOA 4BQ1A 5J96B 3UV9A 4XJWA 1S0FA 3AZZA 1AR62 2ZGKA 1VAVA 1CAWB 1PGSA 1Q8VA 4LO8A 1Q43A 1RC6A 5T5PA 2HKXA 3VKOA 4F3JA 1RUI1 5HBAA 3AKRA 1DZTA 2LTNA 1C28A 3AMHA 1O5LA 2HWC3 3HQXA 1PIV3 4FPJA 2Y26A 4CP0A 3N7MA 4DQAA 1UZZA 1EAH2 3MLJA 1QJU2 2R043 4AFMA 1VBE2 1VJ2A 2JD4A 2XJRA 3ROUA 4UW3A 2EXHA 2HWF1 5ACA1 2ZX1A 2A3XA 3H1MA 4R9DA 3ZSLA 2JX9A 4NN0A 3WG1A 1M06G 4XFIA 1RUC3 1AVBA 1AR73 5C6CA 2FZ2A 4OHVA 3C3VA 2QFEA 2D40A 3DUIA 1PVXA 3IMNA 4XETA 1COV3 1C4RA 2EXIA 2D6PA 4J6GA 2D6KA 4Y1XA 2QZ3A 1Z7S3 2DFBA 2DVFA 3ES1A 3JCIA 1WUVA 4R4ZA 1S1AA 2DCKA 3QLQA 5F6LB 5CFCC 3D0JA 1XRUA 4DS0A 5GM0A 1MS9A 1AF9A 1V9U1 3ACLA 1ZNPA 1KQRA 4E2GA 3E5UA 4N9IA 2ZX0A 4P9WA 2EALA 2FHRA 2WNUB 2ZCWA 2UY8A 2YC0A 1EV11 3WP6A 3FBYA 1C8M3 1UPSA 1REFA 1V70A 1LOEA 1Y9QA 1UU6A 1UZYA 2DCYA 2R062 4FOVA 4M00A 1HV1A 2H6BA 1OOPC 3B94A 1LB2A 2MNGA 4YG0A 3WZ1A 2ZS6B 3HIFA 3WDVA 3L2HA 1VIWB 2ZGNA 3MIGA 4Q27A 2CY6A 3B3QE 1OPOA 4XQDA 1KFUL 3P3PA 4FPOB 3WDTA 4Q8LA 3AKQA 3ES4A 3OF1A 4F7ZA 3LKJA 1NCQC 1S2KA 2VNOA 5J7MA 1B35B 3VBOC 1R081 1V00A 2B39A 3R4SA 2D6NA 1GQHA 1VP6A 3USUA 1FMD2 1LEDA 5KBFA 2VW0A 3SCHA 4YW1A 3VL8A 2YYOA 1C1LA 2GMEA 4RHV1 3N35A 1DBNA 1AXYA 1LJ7A 1G9BA 1PO23 1NE4A 3V0BA 1I6XA 1A8MA 4RSUA 2WZR1 3V0AB 3GYDA 1NG0A 1PVC2 1W0PA 2R30A 3AP5A 3N36A 4GWMA 1AL22 1H8TA 4I02A 4IEVA 5JDBA 1DGWX 4LBQB 5AC91 3RQ0A 2VW1A 1ONAA 1FPN2 1HRV2 2DURA 4YG3A 3S7EA 3SNMA 1EPWA 1N3QA 1WCDJ 5FO8B 1TNRA 4PDWA 2R073 4PF5A 3DN7A 2D7FA 2HEWF 1ZYBA 5GLUA 2WWSA 1MQTA 4R9BA 2XLAA 5FTTC 2XVLA 1OA2A 4P9LA 3N7JA 1AYM2 5ABJB 1C8NA 3GBFA 1J3QA 4Y20A 5IK4A 5JPMB 2ZHMA 3LA7A 4LR4A 1RMU2 1MR5A 4N7UA 4DZGA 5I8YA 1R1ZA 2ZGSA 1V6MA 4INDA 3FFZA 3H50A 1WMFA 2C5DA 1RUE1 4RQPB 4IEXA 5C33A 4WV8A 2Q4SA 2XJUA 4ZU4A 4HK8A 3AZWA 3A0KA 4XFHA 5LK5A 3VBRC 3AYCA 3VBHC 1JTZX 3VZNA 3GHNA 4AW7A 2VQAA 4K1YA 2Q1ZB 4PIXA 4K1ZA 2QKDA 1NA1A 2D6LX 3EQEA 4YZ4A 2VVFA 2QUOA 2EF6A 2WZPP 2HEYF 4WBBA 4FAHA 3S30A 4P9JA 5H9PA 1LCLA 1CD3G 3CJIA 2PLV1 3LB9A 4DOUA 3PNAA 2MHFA 3R4DB 3VZKA 4IV3B 2R32A 3HBZA 4XMIA 3ZMNA 4I0AA 1XNCA 1RUH3 5CFDA 3RS6A 3IDEA 4J1XA 4WVWA 4D7SA 3WG4A 3W9AA 4Y4YA 3WW3A 2OA2A 4QQ2A 5BNPB 3VV1A 4CZSA 4CEYB 1UCXA 2PA7A 4YVWA 1VRH2 1TMF1 3JZVA 1IGOA 4HKOA 4AQ6A 5D8AB 1ZZBA 2WIIB 1J58A 3OTFA 1R092 3E6DA 2OVUA 4RGGA 3DPRB 4QX5A 1PGW2 4HVOA 4OUSA 3VZJA 4JC1A 2ZZJA 3WW2A 1WBFA 2XWBB 3E5XA 2R16A 4ATEA 4LA3A 3U11A 1AXZA 4C0BA 3LCPA 1OFNA 1QU0A 1FV3A 1MZEA 1L3JA 3FMGA 4CP1A 1CAVA 2HWE1 1E57A 2RS12 5GLWA 2WSUA 4BOWA 2AH2A 4GWNA 3ZFEC 4XFFA 5L7OC 2BNNA 1BEV2 1ULCA 4M3CA 3TNPB 4AEDC 1YCIA 2RS32 4AQTA 1CVNA 2DVBA 4CDUC 2ZACA 1F5FA 1UIKA 2PAMA 3WY6A 1ENSA 1HQNA 2W52A 1ULFA 2JG9A 5LK7B 3SH5A 2D98A 5JZGC 2X53S 4IEQA 1CAXB 1AX2A 1ZM1A 4JTNA 2BNMA 1QQP2 4D7TA 4QPIB 1UN1A 2GC3A 5LEKA 2EXKA 3QOPA 4GXLA 3SISA 2XJQA 2D6MA 4Z07A 2R1DA 4MZUA 1CAWA 5FO7B 1NLRA 3AX4A 1A3KA 1G8WA 3I59B 4Q4X2 1KD7A 3HAGA 3RSJA 4QPGB 2PHRA 2GNBA 2D43A 4KH9A 1RVF3 3LGRA 3SH4A 5T5JA 4WM8B 1EAH1 3D0SA 3AMPA 3ZN6A 1FI2A 1VBE1 3AXDA 1SLAA 3DGTA 3MIDA 4LO6B 4COWA 5JSRA 2Y38A 4DY5A 3KCYA 1RGSA 1APNA 1F31A 1LOAA 1RHI2 3HWJA 4E9KA 4JRAA 1OI6A 1N1TA 1AL0G 3DV8A 5EYYA 3MLLA 1VBB2 1MS8A 2E6VA 1CN1A 1W6QB 4FP2A 1IKPA 1VBA2 2QZ2A 3ZDSA 1REDA 4AVCA 2ZAAA 1W6PA 5K0UB 3B7MA 2HWF2 5ACA2 4A7KA 2XWJB 2CWMA 4HVRA 4BM8A 2ES3A 4MX3A 4B3NA 5DDJ2 1WA4A 2XH6A 4KWLA 1PZ9A 3J9SA 1X36A 4YM3A 4IEWA 4L97A 4R8HA 1VAKA 4J1WA 1ENRA 2R061 3NKGA 4COUA 2Z69A 4YVSB 1BZWA 5C8CB 2RS51 1UAIA 4LO4B 4QQHA 1ZX5A 1AR63 3OYWB 5KXDA 1HRI2 5JWPA 3WG2A 2D5FA 1XNBA 2XKPA 2WNUC 3VBOB 3O7OA 1H2NA 4DPNA 1ND3A 3JQXA 1ASJ3 1FMD1 1QJU3 3ZXGA 1X82A 4CEWB 1RUG2 4QHBA 3THPA 3U07A 1LGCA 5FLHA 4NWWA 1D2QA 1EY2A 1YJKA 1ULDA 1M4WA 1DFQA 1GQGA 2CGPA 2FMDA 1AL21 3VKMA 3ILNA 4LBQA 4FPHA 1OSGA 3DKWA 4JVAA 1GFF2 1FPN1 3OCPA 3LWCA 4Y1UA 1HRV1 1B35C 4I2OA 2PYTA 5JMCA 1W6OB 1RUD2 4TLFA 1GZ9A 4B29A 1OA3A 2EA7A 1VR3A 3RI8A 1I1EA 3WDUA 2VNGA 3NAPA 4H14A 4I09A 5BUVA 1VBC2 4XIKA 3GHMA 1AYM1 1R1A2 2A6VA 2GMMA 4HN0A 4HSJA 2E63A 2HWD2 1QH6A 1RJ8A 1RMU1 2WKKA 3AKSA 2D3PA 2ZHNA 4F8AA 5A33A 2OIIA 5DUVA 3PHMA 2SLIA 2PELA 4W65A 3WG3A 2E7AA 1F5JA 2WL1A 4YGCA 4WVZA 2KXLA 5T50A 1XYNA 4Q0UA 2DV9A 1XU2A 4B4QA 1TME3 3VBRB 1K5MB 1RUF2 4HPKA 1S0GA 3BTAA 1NCRB 1AXKA 4YLZA 2D3SA 3O0WA 5HXVA 4AI3A 5J36A 5ABJC 5CAZA 4LBOA 4CTEA 5FDBA 3FX3A 4XTMA 4GKYA 1J3PA 1V6KA 1ALYA 3SCFA 5F1RA 2BWCA 2ARXA 5DG1A 5KC6A 4W6YA 3KGLA 3P3NA 1WGPA 1YIPA 3I2DA 5KHKA 5A32A 4RQPC 2WNVA 4YGDA 2AREA 4FVVA 5H9QA 1AX1A 1LHUA 4XFAA 4AI0A 4IV3A 3M7AA 1MEC2 4LBNA 1PVC3 1CONA 3JD72 1KITA 4LA2A 4R52A 3O0VA 1LECA 2VUAA 4Y22B 4NO4A 2K0GA 3AMMA 5EV7A 4R9CA 4OI0A 3VBFA 4H7LA 2DFCA 4IERA 1UKRA 3RMXA 3ZFFA 2QVSB 4Q1PA 4CDWA 3SXWA 4Q4W2 2VOVA 2CTVA 1POV0 3HT1A 4LEJA 4MGZE 2PHDA 4JGYB 4DRRA 1YXWA 4QMAA 4Y26A 4JGZC 2ZX4A 5BNOA 4AXOA 3VZLA 1PGW1 1POV1 3M2MA 2VPVA 1GR3A 1W6MB 2P37A 3VBSA 3AK0A 3J8F2 4AFDA 1QOTA 4DB5A 4N43A 4AFCA 5BNPC 2HWB2 3S7IA 4CEYC 4NVPA 4UW4A 2YHJA 1FNZA 2RS11 1VLNA 5H9SA 2BVVA 5D8AC 1OA4A 4YGEA 4B8EA 2GC2A 1KS4A 2Q0AA 3ZIXA 4XILA 2WNEA 2YROA 3ZXJA 3FC0A 2HJIA 3DPRC 1FXZA 2RS31 2WA3A 4XFGA 2X5IA 5JOYA 1UD1A 2RM22 4AHYA 5C8WA 3VHNA 1AR83 2DCZA 2MEV3 1FNYA 4RS5B 2BUKA 1G7YA 5CIRA 2CGOA 2F6BA 1CJPA 4XF9A 2IWGB 3B5LB 3HMYA 4N90A 1QY4A 1MS4A 2BQPA 4DFSA 3WHUA 1QQP1 4B4RA 5GLZA 4MVTA 1Q8QA 3WQ1A 4C1XA 3AZVA 2O1QA 5CA6A 2WA4A 4BMEA 1PZ7A 1TNFA 2OUHA 5I91A 2WINB 1G9FA 4AGGA 2VU9A 2VOWA 4DINB 1AYN3 4L2NA 3ZYIB 1GV9A 5DUXA 4KL1A 4Q4X1 4CDQB 1U5ZA 1VRH3 1O4YA 3MYXA 2DVAA 4Z1VA 4C90A 2F4PA 2A6WA 4HANA 5E88A 4C0HA 1QOSA 5FCCA 4OLLA 1R093 3AFKA 1ZZ8A 4QPIC 4XFBA 3ZSMA 1IPKA 4AHXA 3IBMA 2QJVA 1NLSA 2DUPA 4MXWB 5I0TA 4GH4B 3RJ2X 3H1YA 1CPNA 3VDDB 2VY0A 2RMU2 4GIQA 1SACA 5E89A 1NQJA 1RHI1 5C9AB 4LUMA 2X29A 3UJOA 1WLWA 4QPGC 2A71A 5EYXA 2IXIA 1BEV3 3CF6E 2KM2A 1W6QA 1VBB1 5CFCA 4WM8C 4PJYA 4COVA 2NLRA 3THTA 1VBA1 1D4M3 2RR13 2RJKA 5EZWA 2O8QA 1TQ5A 4AHWA 4HETA 2ZA9A 1DLLA 4YNIA 4AVSA 5CB7A 5JI9A 2GN3A 4GMP0 5DDJ1 1IPJA 1N1SA 1GZCA 4FPGA 4OUMA 3RRDA 5AFEA 3AJZA 1QJX2 4TSVA 3VGIA 1J59A 4XZPA 1H9PA 2JE9A 4FTEA 5GZGA 3W59A 1OOPA 4O9GA 5GZCA 3IN9A 4KGQA 1ULEA 1WMEA 5I8TA 1IS5A 2O8OA 3NL1A 1BBT2 4GMP1 2JENA 3B02A 2R49A 1H1MA 3CL1A 2Z5WA 3WCRA 2EXJA 4JDNA 2Z2SB 4QM9A 1ND2C 5K0UC 1HRI1 2BFUS 2GNDA 1NCQA 4LHKA 3D5OA 2VXRA 3JQWA 5FLIA 3VBOA 2AUYA 1NXMA 3OD4A 1IZ3A 2WJSA 1HQWA 1T6GC 3ZX7A 1WD3A 2WFF2 2W08A 4PLNA 4Q4Y3 1YHFA 1RUG1 4XFCA 4YVSC 2RS52 3TN93 5C8CC 1BQPA 4XJ9A 5CVRA 2DUOA 1IQAA 4C1WA 3BCWA 4QPYA 3CJXA 4OHXA 2NZ9A 2OZ6A 5HI0A 2GC1A 1RUI3 2TUNA 4YFZA 4AGVA 1SCRA 1W2UA 3ZSJA 5HCAA 3L9JT 1BJQA 1C1FA 5A3MA 4AQSA 1PO12 1C57A 4AFAA 4CEWC 1UPIA 2GH8A 1RUD1 2G9FA 2HWF3 5ACA3 2NM1A 4OHWA 4XF1A 3D8CA 3RZZA 1CESA 1Q5OA 2YY1A 3IWZA 4BPZA 3UK9A 3ZFGA 4CDXB 4IV1B 1VBC1 1LODA 2VUJA 1R1A1 2TNFA 4L92A 4L11A 1QJY2 2HWD1 1YLLA 4XYXA 4META 1D0HA 4GQ7A 2W68A 4ISQA 3RI9A 1ZBE2 3AZYA 5JOWA 2JXAA 1Y7BA 4X6QB 1WW4A 1V9U3 1UU4A 1SLTA 3D4KA 3VBRA 3WP3A 2CV6A 4FAGA 1MZ6A 3VBHA 1LULA 1RUF1 3IT8A 1BMV2 1OHFA 1W6NB 1OPMA 3KD4A 1EV13 1WLDA 4K21A 1X7NA 1LOFC 3WR0A 2HEVF 4Q0PA 2XJVA 4WM7B 1O7FA 1SBFA 4I0BA 1XE8A 2VH9A 5FFOC 3WDXA 5HCFA 2XB6C 4JRLA 1J1LA 1MS1A 1OKQA 4PLMA 4Y5Z0 4KU8A 5JR7B 2BYVE 5E16A 4XTPA 1FV2A 3AKTA 3H3UA 4LO7A 1JOJA 3URFA 3ZXDA 2W39A 1DU3D 4KWJA 4COZA 1CJDA 5B2GB 4YFWA 1MEC1 3JD71 3JB4C 1HXS2 5J37A 4PLOA 1K5MC 2EVXA 1ZRDA 1NCRC 1OLRA 5T52A 3KQRA 4YZ5A 4FP3A 1PM7A 1R083 2XG3A 4YYOA 4NHKA 5DZGA 3WX5A 1DYKA 3H7YA 4RR3B 5T54A 5C4WB 1UX6A 4RHV3 4Q4W1 1ZZ9A 1BK1A 3RPQA 4Q4V1 3AZXA 2Q8OA 1G9DA 3NW4A 5FQ0B 2WZR3 2VG9A 1YRZA 3NWKA 3MPBA 4FPCA 4JGZB 5JIUA 4P9GA 1YYNA 5FBZA 3OJBA 2ZOEB 1FOD2 3B9CA 3SHRA 2GSYA 1ENXA 3WXPA 5AC93 1ZBA2 3D6EA 3O0XA 4GB32 4Y1VA 1YFUA 2BEOA 4AEMA 4K3UA 1U12A 3ZO0B 1V6OA 1FX5A 3J8F1 4P14A 1GLHA 1LKNA 2XJTA 2C1FA 1A6CA 2GNMA 2HWB1 2QE3A 5SV8A 3ZXLA 3ZFEA 1WW7A 4I3GA 4KGGA 5L7OA 4FPKA 1AJKA 4JGYC 3ZXKA 4FOQA 3MFAA 1I9RA 3JBG1 4MH0E 2VOKA 1WLCA 4M0HA 4AEDA 5CNAA 2PHLA 5GALA 4CDUA 1H30A 1PK6B 5FLJA 5BNQA 3JU9A 3OGJA 4WVVA 2RM21 3VKLA 1UL9A 3POWA 3UKVA 1AR92 3KM5A 1RUE3 5JZGA 5BNNC 2JG8B 1Q8OA 1J1TA 4FQZA 3M70A 4L8QA 1GZWA 4FPFA 1YFWA 3WHTA 3HR9A 4XXAA 4AI2A 3OY8A 1VBD2 5BPXA 1QHDA 5FPXA 3VZOA 3B01A 2XVGA 4JQRA 2JE7A 2QNKA 1U5YA 2K2SA 1BVP1