4XBQA

Crystal structure of human galectin-7 in complex with type 1 n-acetyllactosamine
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
133
structure length
133
Chain Sequence
VPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVRIF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords Galectin-7
publication title Structural Basis Underlying the Binding Preference of Human Galectins-1, -3 and -7 for Gal beta 1-3/4GlcNAc.
pubmed doi rcsb
source organism Homo sapiens
total genus 28
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4xbqA00
3MPPG 4Q8KA 1FAYA 4XZPA 1QDOA 4YZ3A 2EIGA 3V0BA 3WLUA 1C1FA 1LECA 1N47A 4IQPA 4UW3A 4CRQA 1JOJA 2TEPA 3POSA 4XJWA 3IKWA 1UPSA 1XQNA 2E7QA 2GNBA 4AVTA 3NWKA 1KQRA 1AX0A 3M3OA 1YXWA 2AUYA 2YV8A 5KXCA 4YG6A 3USUB 2ZACA 5IT6A 2NYYA 5GLUA 2E7TA 1A78A 3SH3A 3UL2A 2A6WA 1BJQA 3WG3A 1V6NA 4FPYA 1W6PA 4Z8BA 2ZKNA 1LJ7A 1LU1A 4AYUA 2W68A 1SBFA 4YW5A 2ZHLA 3N36A 5EYXA 2GN7A 4YW4A 1FV3A 3L2YA 5JMCA 3PJQA 2CNAA 2ES3A 3WHTA 1GBGA 1GZ9A 4YW1A 1FNYA 4XXPA 3JUUA 4LBQA 1GKBA 1S0BA 2ERFA 3C2UA 2PHUA 4Y1VA 1CESA 1DIWA 2OW4A 3O0XA 2PHRA 4LBQD 3MW4A 2A70A 1ENSA 1W0PA 5JOXA 1G9FA 1MR5A 3WG4A 4GWNA 5IK4A 1MS1A 4YM0A 4I30A 4DQAA 2A3XA 4SLIA 2XG3A 2WSVA 4BLJA 4P9WA 4Y24A 5AVAA 4XJAA 5JVVA 4XBQA 5IUQA 2FMDA 1DZQA 5E8AA 2C5DA 3B69A 1WBFA 1SLIA 3OBTA 1LEDA 4WVVA 1I3HA 1N1SA 1W6QB 2WT0A 1LEMA 4FP3A 5H9SA 4K1YA 3N35A 1CPNA 2DVFA 1JBCA 4NOTA 4Y1XA 5GLWA 5GZFA 1LOGA 1AXZA 2DURA 4ISRA 2VW2A 2EAKA 3O5SA 1SLBA 2JE7A 2JJ6A 1IKPA 4Y1YA 3NV4A 4YM1A 3AYDA 2PELA 2GDFA 4YM3A 5LK5A 1CVNA 3AXDA 3UK9A 3IMNA 3BIWE 1WUVA 1W6MA 1S0JA 1AX2A 1UKGA 1YIFA 2EXHA 1DQ4A 3M2MA 4FOYA 2DUQA 3ENRA 2GMMA 4Y26A 3WHUA 1SLLA 5HCBA 2UU8A 3B00A 3T1MA 2AREA 5IK7A 2R16A 3A0KA 1UZYA 3ILFA 4M3CA 2VW1A 1Q8SA 4FQZA 1JUIA 1LOFA 3AXEA 4YW2A 1U0AA 2DUOA 4LBOA 3FUQA 1AVBA 1LOBA 2D6PA 3WZ1A 2A75A 5GZEA 5T5LA 3WVJA 2ARBA 1WD3A 1LU2A 1JYIA 4BMEA 1VIWB 1V6JA 3ZXJA 3BODA 1SLAA 3AFKA 2R1BA 2ZZJA 4P9XA 5DZEA 1ULGA 3OPZA 1MS0A 3WG1A 1N1VA 1UZZA 4C1XA 1V6MA 3FFZA 2DU0A 2R1DA 4UW4A 5CBLA 5FRAA 2AENA 1RITA 3OYWA 4R9BA 4YG0A 4BQ1A 1MACA 1JHNA 1GZCA 1LGNA 5F5QA 5H9PA 3OY8A 4GXLA 3NV2A 2GN3A 3V65A 1CR7A 3LSDA 4FPJA 1SBEA 3WDWA 5CA6A 1PZ9A 3V0AB 3ZXLA 2GNMA 2PHXA 2P3JA 1UAIA 2WT1A 5EWSA 3TAYA 4LBNA 1LHVA 1UN1A 4P9YA 1DGLA 1HKDA 3WDTA 2PHFA 5EXOA 2VH9A 3LCPA 5HCFA 4FPOB 3ILNA 1C4RA 2SLIA 4YGDA 1N1TA 5DG1A 2ZGKA 5JOWA 2GMEA 1MS3A 1SBDA 1YI7A 4WV8A 5GZGA 1UL9A 4YGCA 2AR6A 3WCRA 4JC1A 1GZWA 5T52A 1WW7A 1QNWA 2D6KA 5T54A 4AVSA 1AZDA 1J1TA 1LHNA 1QGLA 1WLWA 2VXRA 1S0CA 3RMYA 2A6ZA 5DZGA 1MS5A 4DS0A 3IPVB 1S0DA 1YRZA 3B3QE 3M1HA 3USUA 4LBMA 3WUDA 2EXKA 5DUWA 1FNZA 4YFWA 4R9CA 1QNYA 1IS6A 4K1ZA 3SLIA 4HANA 1WBLA 3R4SA 5CAZA 4YW3A 5F9TA 4M00A 5DUUA 2ZGTA 1GYKA 1LESA 3AJZA 2DUPA 3IM0A 5EYYA 4BMBA 4D69A 1G9CA 3FBYA 1CPMA 5DG2A 1IS3A 4XTPA 1OKQA 1QF3A 4TYSA 1H30A 4FOVA 3WDXA 4YGEA 1SLCA 3R4UA 4FQ4A 2XB6C 3VKLA 2ZHKA 5GALA 1O4YA 1WW5A 3PVOA 4Q1PA 4UW5A 2ZGUA 1MVEA 4XOGA 3KQRA 4L8QA 1SFYA 4YGBA 1Z0HA 3SISA 1CN1A 3HR9A 1JXNA 1OQ1A 1IS4A 1URXA 1JYCA 2PHWA 3RG0A 1CIWA 3GNEA 2NP0A 3MW2A 1AX1A 5H9RA 1W6NB 3WNXA 2DU1A 3WUCA 3QCWA 1GNHA 1TEIA 2UWAA 2I2SA 2W08A 2FHRA 3HMYA 1S0GA 3SH5A 4FPHA 2A7AA 1X50A 1F9KA 2D6OX 4YZ4A 2WKKA 2ZGNA 1WLDA 3CNAA 1LOAA 1SCRA 1GLHA 1IOAA 4AGGA 2JD4A 3AP9A 1H9PA 1HLCA 1SCSA 3ASIA 2GALA 1Z78A 4LBLA 4LBQB 4XIOA 1N3OA 3DUIA 3OGGA 1JW6A 2E53A 4BPZA 1WCSA 3NV3A 4UW6A 1KJRA 4HL0A 4YZ5A 5GLTA 3VKFC 5DXDA 4YG3A 5KXDA 2ZHMA 4XHBA 3POWA 1NXD1 2AGSA 1FYUA 1W6OB 2G4IA 3ILRA 1G7YA 2ZABA 2OUHA 5BYNA 2GNDA 3AP5A 4FPCA 3RQ0A 3ZXKA 1G86A 1LGBA 2PHTA 2WNEA 3O0VA 4FP2A 2AH2A 4YLZA 1ENRA 2A3YA 1QMJA 4K20A 2DVDA 2DVAA 1LHWA 2DTWA 1MZ6A 5GM0A 3ZYRA 1KRIA 1N3PA 4RA0A 1ULFA 1MZ5A 3AP4A 1BXHA 1GNZA 3N7JA 4YFZA 1V6IA 2P3KA 1DQ0A 2CWMA 2NN8A 1ULEA 4FOWA 3UJOA 1Y7BA 3H0OA 1QOSA 1NLSA 2D3PA 3IN9A 4U2AA 5T5PA 3T1LA 4U36A 2R0HA 2R0FA 2UURA 5L73A 4Y20B 2ZGOA 1W6MB 4R9DA 1B09A 4AVVA 1Q8OA 2ZGMA 3B9CA 2DVBA 3AYAA 3M3EA 1OFSA 1S0IA 4Y1ZA 4H55A 3INAA 4ISQA 5T5OA 4XDQA 2P2KA 3AP6A 3HN1A 3AK0A 3ZSMA 2GNTA 1F31A 4Q27A 4JCKA 3V0AA 2YY1A 5E88A 2Z42A 3PVNA 4PBPA 1Q56A 2H0BA 3SNMA 5KXEA 2YXSA 2EF6A 2ZMKA 2E6VA 4BM8A 1MS4A 2A6XA 4Q8LA 4ZKTB 2DTYA 5DUXA 4AGVA 1VALA 1SLTA 2A5ZA 5GJ6A 3ZSKA 1WD4A 2YROA 3AYEA 4DRRA 2DV9A 4Q2FA 1LHOA 1QDCA 2P3IA 2NZ9A 4CZSA 1GSLA 4Q26A 4XBNA 1LTEA 3A4UA 1F5FA 2CWSA 2D3SA 2D3RA 2W52A 2A3WA 4FPLA 2R49A 4PQ9A 4XE9A 4GALA 2VW0A 3ZPYA 1BZWA 2ZMNA 3M3CA 4FPGA 1VAVA 2VU9A 2WQZC 1LOEA 4FVVA 4M3CF 1G9BA 4LBKA 2ZHNA 1HQLA 4Y22B 5GLZA 2D43A 2WT2A 2LALA 2P34A 2AYHA 2ARXA 2CTVA 2SBAA 5IK5A 1LGCA 1C1LA 2BQPA 2LTNA 4GWMA 1S1AA 4K21A 2NM1A 1S0EA 2C9AA 3DGTA 3B01A 3APBA 3D5OA 3GALA 2DYCA 4XBLA 4BLIA 1EPWA 4F83A 3D6EA 4FPFA 4XMAA 1WW4A 5H9QA 4W65A 1HDKA 2JDZA 3RMXA 1MVQA 5KXBA 5SV8A 3AZZA 4YZ2A 2CYFA 1GZWB 1A8DA 2E51A 3V0BB 2WSUA 1BKZA 5T55A 2UWBA 1KJLA 1DQ5A 2OUJA 5JDBA 4DRVA 4R9AA 2A71A 4TZDA 3VUOA 2RHPA 1FATA 4AGRA 3AP7A 3FLPA 1DYKA 3N7LA 1S0FA 5DZFA 4P14A 3WCSA 1FX5A 3MEPA 1DBNA 1W6NA 1W6PB 4JRAA 4NO4A 4XMIA 1LOFC 2ZAAA 1QOTA 1UX6A 3SH4A 3WV6A 1I1EA 1R1ZA 2ENRA 1C57A 2GMPA 2ZGSA 3FLRA 3VKMA 1N3QA 4XILA 1LCLA 2D6LX 3ZSJA 4C1WA 4YZ1A 3AYCA 3PMEA 5CNAA 1GV9A 3RS6A 1GANA 1W6QA 3AZYA 1Q8VA 3MW3A 4FPEA 1CJPA 2A6VA 1UMZA 1VLNA 3Q9OA 2EXIA 2YZ4A 3PVEA 4ITCA 5GZCA 4DPNA 4OZXA 5FREA 4PBOA 5E89A 1LENA 4XJ8A 1HQWA 3I4IA 1ENQA 2W39A 3R05A 3U4XA 1LHUA 1W6OA 5T50A 5HCAA 3W59A 3RRDA 3WOGA 4ATFA 3M3QA 3AZWA 1DQ6A 2OVUA 2ZMLA 4ZXKA 1WLCA 3WDVA 1MS9A 3FUOA 3VV1A 1N1YA 2DWRA 4FPKA 2JE9A 1AJOA 4Q1RA 5DUVA 1AXKA 3A0NA 4KBBA 1V6KA 3ATGA 1BYHA 5GZDA 1LOCA 1PZ8A 4XIKA 1D0HA 3RSJA 4GA9A 1QKQA 3AZXA 1DHKB 1Q8PA 2D6MA 2D7FA 2EXJA 2P37A 4M01A 3UJQA 1G9DA 5T5JA 4RL7A 2VY0A 3LSEA 3N7MA 4AWDA 1AXYA 1BQPA 3V64A 1GICA 3QLQA 2WJSA 5IK8A 4XTMA 1V6OA 4CTEA 3N7KA 4XYXA 2V73A 3AX4A 3FLTA 4Y20A 4XJUA 4Y1UA 4ATEA 2ZGRA 2DVGA 1O4ZA 3WDUA 1DYPA 2UWCA 2CY6A 4WZFA 4XXAA 5JOYA 1A3KA 1V00A 3JU9A 2CL2A 1APNA 3WDYA 1PZ7A 5JLVA 2Q5TA 1D2SA 4M3CB 3TB0A 4BOWA 4XHXA 2ZGQA 1DLLA 3BOPA 4PF5A 1KDMA 1W0OA 1FV2A 3NV1A 3O0WA 1AF9A 1AJKA 2B7YA 3OBRA 1RIRA 5GLVA 1V6LA 1IS5A 1WW6A 3ZSLA 2VUAA 4PCRA 2ZBJA 3SITA 3ZVXA 2ZGLA 3ZYPA 2NMOA 1VAMA 4DFSA 2WLQA 4YM2A 2EALA 1IKQA 2A6YA 3BTAA 1LODA 4GKXA 3AJYA 1KDKA 1YO8A 3OYWB 1QOOA 2JECA 3POYA 2D6NA 1ONAA 1ZM1A 4MYEA 1G9AA 3WG2A 4LBJA 4FOQA 2YMZA 1DQ2A 3OY8B 3W58A 4ASMB 3I8TA 3O12A 1H9WA 3VKOA 4XJ9A 1MS8A 1RINA 1YYNA 3N3HA 1DFQA 4Y22A 5JOZA 3ZXFA 4M3CE 5CB7A 1LULA 1DQ1A 2ZGPA 1JN2P 3D4KA 2D44A 1CONA 3KM5A 4XJZA 1G8WA 2ZA9A 1ZA4A 3IPVA 1SACA 3VKNA 4GKYA 2HYKA 1KITA 2V5YA 3ZXEA 3AZVA 3OJBA 1QU0A 1Q8QA 4WVWA 2KM2A 1ULDA 3T2TA 2JKBA 1ULCA 1CQ9A 2NMNA
chains in the Genus database with same CATH superfamily
4DZGA 1BK0A 3I2DA 3MPPG 5BPXA 4NUBA 3IDEA 2BP6A 4WVZA 2ZXQA 4BWOA 4Y5Z0 2GC0A 2Z4FA 1OI6A 1ZYBA 1LECA 2RR11 3LEGA 5FYUA 3VBRB 4B29A 2D97A 1H6XA 4JDOA 2E7QA 5C3SA 2GP3A 2AUYA 4HSLA 5KXCA 4QX5A 3J8F3 1EV12 2PLV3 5IT6A 2VAUA 3SH3A 1RUD1 4LUMA 3WG3A 2Y0OA 1W6PA 4Z8BA 3VBFC 3OBZA 1LJ7A 1LU1A 1JH5A 4Z82A 4YW6A 4AYUA 1SBFA 4XUTA 1BMV2 2ZHLA 5IVYA 2W0XA 4OI1A 1UY2A 1GP5A 2ES3A 2XLFA 1GBGA 1W04A 4YW1A 3WF2A 4XXPA 1YFWA 1W39A 2WO2A 1S0BA 4ZS3A 2OW4A 3O0XA 4EE2A 1RVF2 4KI5M 4LBQD 2A70A 4ARYA 1W28A 4IEXA 2RDSA 1ZRFA 3OGVA 2JEMA 1MR5A 4WVMA 1W99A 5IWFA 5SV5A 3ZYGA 4Z2AA 1WCKA 5IK4A 5JZGC 2OKXA 1OC1A 2ZEYA 4P9WA 5AVAA 5JVVA 4KU7A 5A3WA 1STMA 1DZQA 2YFZA 2C5DA 4XCBA 1WBFA 4XFHA 3TN92 1CGPA 4NRPA 2MEV2 3WSOA 1ND3A 1N1SA 4KWLA 1RJ7A 4HZFA 2EIDA 2R062 2NLRA 1F5JA 5FZ6A 1LEMA 2YYOA 4FP3A 5K0UA 3GF6A 1VBB3 4CEWA 3N35A 3RZGA 2BYVE 4Y1XA 1LOGA 2DURA 3K4ZA 2Y6GA 2EAKA 4UF0B 1SLBA 5A80A 4FAHA 4XCAA 4K40A 2JJ6A 5F3GA 4CPBA 4AQ6A 3NV4A 3ZFFC 4H14A 2PELA 2GDFA 5BV6A 2VL4A 3QOPA 2VXJA 2XH6A 2VUCA 2YGMA 3FHAA 1UO9A 2WRAA 3BIWE 3K3NA 3ZOIA 3I2KA 2BGCA 3ETPA 4AF9A 5EIYB 4QWNA 4FOYA 5FZKA 3SC7X 2Y64A 3VBRC 4CDXA 1R083 1SLLA 2WZ8A 2UU8A 4NMIA 2FBEA 2V5DA 4PHZA 3SXWA 3OGJA 1PMJX 3O1UA 2IUWA 1Q8SA 5ERLA 1JUIA 5J7MA 4AOCA 3MIGA 1QQP1 2OXBA 3Q8AA 2K2SA 1JI6A 1EUUA 1UXXX 1FOD3 3AL6A 3FUQA 4UXAA 1JYIA 4Q4Y2 1VIWB 4LHKA 1V6JA 5I93A 3MBWA 4N9IA 5DZEA 3ZMOA 1CIYA 3UGGA 4P00B 4C1XA 2W1WA 1EPZA 4UW4A 4ASKA 2R1DA 3URFA 1FPN1 3SMHA 4YG0A 5IFTA 1MACA 5LA9A 3CIHA 4AHYA 3OY8A 4YPJA 4QX2A 1NT0A 1XYNA 5FZIA 1HRV3 1RUE1 4QQLA 5CA6A 4QHZA 2ORZA 5APAA 1TME2 4HN0A 1DCSA 1GUIA 2WT1A 2W87A 4QXKA 3FWEA 4HLTA 1YCIA 2YUEA 2BJSA 4MGQA 3AVRA 4PLNA 1HKDA 4Q0VA 1YEWA 3LCPA 2O8QA 4FPOB 3ILNA 3I3BA 2P4EA 1RJ8A 3EJKA 3WNNA 2BOJA 3JB8A 1S55A 1NE6A 5I0UA 1UY1A 3E6BA 1AYN2 2SLIA 3FBMA 3P3PA 2GMEA 1H8TC 1MS3A 4YGCA 2OQ7A 2W2IA 3GJAA 4LKDA 3VDDA 3ZN4A 2J1EA 2O14A 5T52A 4HT1T 1QGLA 1HRI3 4Q4X2 4BQ4A 2BNMA 4AEJA 4DS0A 3WEZA 2W94A 3U4SA 4MGZE 3USUA 5IVFA 2BEOA 1FNZA 4YFWA 4R9CA 2RJLA 3CQOA 2R7EB 2VMIA 2HWC2 3PIJA 2R043 4K1ZA 4A3XA 5F9TA 2Y6JA 2ZGTA 4HN1A 3IM0A 4QX0A 4QM8A 5FZ4A 2WQ4A 4QKBA 3DEMA 5DG2A 1AYM3 4MSVA 1QF3A 1US2A 3KCYA 4FOVA 2WINB 3F2ZA 4YGEA 3R4UA 3I59A 2XB6C 3LEKA 1YQ6A 5LCWL 1VMFA 2E31A 1O4YA 3NVCA 2W3JA 1X9TA 2XJTA 1QJY3 5IFPA 4L8QA 4LITA 5A7PA 4CDUA 2ET7A 5JSOA 1Z0HA 2FMYA 1VB4A 4IERA 3HR9A 1IS4A 2PHWA 1JYCA 4NPMA 5FYVA 3P6BA 3CZUA 4A3ZA 2WBKA 4HOOA 4FSJA 3T2OA 2BU9A 2PA7A 4EN0A 3MW2A 4RQPA 1KD7A 2O8OA 4B8EA 1M06G 2NP0A 2YHJA 3WNXA 1ALYA 1VBA2 3VD7A 3NAPB 4LKSA 4CSWA 2I2SA 2FHRA 3HMYA 1S0GA 4FPHA 1X50A 4JGYA 3ZYFA 4HMZA 3QACA 2WN2A 1WLDA 4P5YA 1CAVB 1SCRA 4OQ9A 4MXWB 4AGGA 2JD4A 4LBLA 4FT8A 3ASIA 4Z1VA 2GALA 5LWBA 1QIQA 5K9YA 3GBWA 5IAVA 1TQ5A 3N9PA 1W8TA 4MZUA 4UW6A 1B35B 4M4PA 2E33A 4QU2A 4A41A 2YC4A 3VBUA 2RMU1 5KXDA 3MFAA 4XFBA 4OHXA 5FZ9A 2HWF1 4KQ7A 3LD8A 2X29A 1YNAA 3ZIWA 4I0WB 1NOVA 1G7YA 2ZABA 5BYNA 4MX3A 2GNDA 3AP5A 1ODMA 4IEQA 5DQ0A 1QJU2 3N9LA 3OB8A 2PHTA 4LORA 2JG9B 3M3IA 4YLZA 4AFCA 3I3DA 1R1A3 3HNYM 2DVAA 2DTWA 2N7GA 1I5ZA 3CEWA 3VBFA 4J6GA 1JZ3A 2JD9A 3ZFEB 4QQHA 3ZYBA 1TNRA 1CZVA 3ZN6B 1MZ5A 3MF9A 5A6ZA 1MEC3 2WA4A 1BXHA 4IE0A 4XUQA 4HKOA 4D94A 4Q5OA 3KHCA 4OCTA 1V6IA 2C1FA 4Q4W2 1PIV1 1VAKA 1ULEA 4FOWA 5D8AB 4AVCA 4CYDA 5L19A 4FI9A 4J1XA 1QOSA 3T1LA 3ACLA 3JBG2 4LPLA 3PHMA 3D0SA 2ZGOA 4BISA 4CCCA 3O1SA 1DZTA 1K12A 1PGW1 1NKGA 1W8OA 3NKGA 5ANQA 4GMP3 4AE2A 3TEYA 3P5BA 3AYAA 1SZBA 4YWAA 3ROUA 2VZ1A 5T5OA 5JZGA 2GNTA 4DNYA 1FMD3 3D82A 3THPA 2Z42A 4PBPA 3TBDA 3FJSA 1SFNA 3JD72 5T3NA 2YXSA 2EF6A 3QBQA 1MS4A 5F5IA 5CYYA 1O3TA 1VALA 2A5ZA 4BDVB 3SCFA 5I0SA 1J3RA 2YC0A 2YROA 2DV9A 1I6XA 2W1UA 2Y6FA 4GB33 5FZDA 5I0TA 2Q8OA 4CZSA 5F7UA 2FD8A 2XQRA 3BVCA 1VRH3 1F5FA 2CWSA 1D4M2 3JQXA 4PQ9A 2R49A 1GFF2 1T6BX 2VG9A 1U5YA 4G9SB 5FK8A 3ZFFA 2VW0A 2DCZA 1BZWA 2ZMNA 3M3CA 1VAVA 1R64A 1K5MC 3E97A 5FY4A 3U10A 3UGFA 1LKNA 3KV5A 5A70A 4BQ5A 3VBRA 3RZHA 1HQLA 3EQEA 2P3YA 2P34A 2AYHA 2ARXA 5A3UA 4QQ2A 4UFMA 3ACGA 1LGCA 3ZXDA 4Z2WA 2BQPA 4ZZ8A 4BQXA 4QB1A 5FYMA 2B42B 3WNPA 3WXPA 1ZVFA 2JB4A 3HQUA 3D6EA 4XMAA 1WW4A 5F6KA 5H9QA 2Y6LA 3ZFEC 4XUPA 4E8CA 4ORFA 2WA3A 1PK6C 4EWEA 4MUVA 2G1MA 1Z7S2 4H7LA 1VBD2 5IVBA 1GZWB 4E2SA 5C4WC 1H6YA 4IEYA 1PNFA 3GXUA 1HN0A 2HWB3 4AI1A 2XL9A 1OUXA 3GM8A 3LPGA 5A7WB 3WF1A 2OUJA 1W05A 2WZEA 3HN3A 3WW1A 3MPBA 4QB6A 5EJZB 4TZDA 2XBO3 3MYXA 3WD5A 1OUSA 1OF3A 3MIEA 1W6PB 4LO8A 3IIAA 2BRTA 1LOFC 4TTGA 1C57A 2B46X 5FXXA 2UYAA 4BU2A 3DCQA 2MHFA 4FBFA 4B4QA 2D6LX 3BU7A 5FYZA 1GV9A 1X9PA 1XE0A 2VCCA 1GANA 4UFIA 2FDKA 1OA3A 2W5FA 3AZYA 2Y26A 1CJPA 5BNQA 1H8TA 1VLNA 2XUMA 3Q9OA 5LATA 2EXIA 5FAXA 4ITCA 3VD5A 3BUCA 3ZDVA 4DPNA 3DF0A 4OZXA 2RR13 1EY2A 4PBOA 1LENA 4XZUG 5CG9A 5C9AB 1QJZA 3U4XA 2QDRA 1ENQA 2W39A 1W6OA 2QQLA 4JRLA 5T50A 2VCAA 1P8JA 5DMYA 4Z07A 1HJGA 2WFF2 4BIFA 3LIHA 3T0AA 1RB8G 1WMFA 2FCTA 5A3PA 3J7NA 1AR81 1RUD3 3H1YA 4QPGC 1WLCA 4A2UA 5C3PA 1HQNA 4HFSA 2JE9A 1AJOA 2YC2A 1AXKA 2HJIA 2OA2A 1V6KA 4KBBA 2RG4A 4MV2A 5LASA 3UKTA 4XIKA 3LEMA 5L36A 4RR3B 4OZOA 3ZMNA 1GQGA 1OLME 2IFRA 3C7GA 4CEWB 4DEQA 2HBTA 3ES1A 2EXJA 3BCWA 4Q0QA 2B8MA 5K0UB 4RL7A 3N7MA 3C8XA 1BQPA 5KHGA 3ZO0B 1OOPC 3AX4A 3FLTA 2D40A 4Y20A 1UD1A 5FPZA 4GIQA 3LIGA 2ZGRA 2C4XA 2RS51 1O4ZA 1V9U1 1DYPA 2WABA 2CY6A 4MGSA 4ET7A 4CDXB 3GGLA 4AR2A 2F4PA 5JLVA 1TVGA 3RWNA 4KWJA 4BE3A 3POFA 4S2FA 4DY3A 1ZNPA 2X53S 3TB0A 4MLOA 4BOWA 3D8CA 2P17A 3N9MA 2ZGQA 5IJRA 1W3XA 4IETA 1WMDA 5FK7A 2B45X 4PF5A 2VZVA 4META 2LW8A 4ARXA 4S2HA 2WLPA 1WCDJ 3NV1A 3O0WA 1AF9A 5DDJ2 3OBRA 3C7HA 3LFMA 3J9SA 3LDRA 2LS6A 1PO11 1XYOA 5BNOB 1GP6A 5HXVA 4NAOA 4H2AA 3ZVXA 1UY4A 2Y33A 2ZGLA 1AR92 2XQXA 4DFSA 1BBT2 2WLQA 3O7OA 2A6YA 3NL1A 1UMIA 4GKXA 2EVXA 1YO8A 4BZ4A 1QOOA 4FXKB 2D6NA 4NHMA 4R52A 5FY7A 2JG8B 4YRDA 3WG2A 4LBJA 1NY72 1DQ2A 3OY8B 3S0MA 1UW8A 4QX3A 5DAWA 2VZTA 5K7PA 5CB7A 2WO3A 2IXCA 2JE8A 2ZGPA 1O91A 1U12A 3PL0A 4MOAA 1IPKA 5FYIA 3FL7A 1G8WA 1QQP3 3PDQA 4F7ZA 4UFLA 5LA1A 2OS2A 2AEYA 3KD4A 4P5HA 5I0DA 2BFUL 3POJA 2HYKA 3KT4A 2PHLA 2V5YA 1J83A 1HXS2 4O65A 3AZVA 5HV0A 3UK9A 5ACA2 2RDNA 1RVF1 1ULDA 4RR3C 1WCUA 3K4AA 5I91A 1A34A 4C8DA 3I3QA 4LKEA 5L7OC 5F3EA 3WW3A 1HV0A 2WWJA 1NA1C 1FPN3 4GQ7A 4TLFA 1W9YA 2EIGA 3THDA 1OA4A 2WQ8A 1PO22 1C1FA 3WLUA 2PAMA 1NE4A 1N47A 3OGSA 3E5QA 2VQAA 4QGLA 2CGPA 2TEPA 4OLLA 4XJWA 3IKWA 2ETEA 1UPSA 4UAPA 4XABA 2BZDA 1KQRA 2Z79A 1XE7A 3GDBA 3USUB 2GU9A 3ZX7A 2GC3A 5GLUA 4LK6A 4NPRA 3UL2A 3AFGA 1BJQA 1CX4A 4CDWC 5IYYA 4MGKE 4BQYA 5FYSA 1I9RA 1REEA 2D5FA 5LB6A 2ZKNA 2GC2A 4WM8B 2W1SA 2W68A 3J8F2 3N36A 5FZ3A 1H1AA 2GN7A 1RUC1 2FQPA 2PLV2 1POV0 1VE0A 4AFBA 3HBKA 1C5HA 1PNGA 3V56A 4JDMA 1FV3A 1OLMA 1BEV1 4AQTA 4XETA 1ASJ1 1CAVA 4PIZA 2X5IB 1GZ9A 3BB6A 4LLOA 5A1FA 1QWRA 2VBPA 5BNOC 4Y1VA 2PHUA 4CP9B 2J1RA 1B35A 1DIWA 4LHLA 4OUSA 1J3PA 1NQJA 5GKAC 3MW4A 4JQTA 4KGGA 1R091 1IG3A 1K5MA 2WN3A 3FHIB 2JG8C 4OYUA 4GWNA 3R4DB 4YM0A 3RNSA 1VMHA 4AI3A 1O4TA 2A3XA 4Q4Y1 4EN7B 3WP6A 4SLIA 4EWDA 2WSVA 1WA4A 2WNUB 2WL1A 4Y24A 4XBQA 2DFCA 2DCKA 2J7MA 4EQVA 5IUQA 3NNLA 5FLHA 1TZOA 2VD7A 1DGRN 2R32A 3BOWA 2WT0A 2WAOA 3H7JA 3T0DA 2RV9A 4IEPA 5H9SA 3B02A 1RC6A 4K1YA 1QXPA 3TNPB 2XJQA 3ZFEA 4DOUA 5GLWA 1RTVA 3ZN6A 4XDOA 1PK6A 4ISRA 2VUDA 2J1AA 3O5SA 1C28A 3VBOC 1IKPA 3GZUC 1UOFA 4Y1YA 2R6QA 1YFUA 3HOBA 4YM1A 1TME1 5LK5A 3AXDA 1VBB2 1F4AA 4SBVA 1GZTA 1S0JA 1YIFA 2ZKLA 1XOYA 2W92A 2DUQA 3PLQA 3PUSA 3WNOA 3ZPOA 5FY9A 3A0KA 2VW1A 3AKRA 3FC0A 1XNTA 2HBUA 4HETA 1LOFA 3QH7A 3VBFB 5LEKA 1U0AA 4MHRA 4LBOA 1R082 4IDZA 1AVBA 4X8NA 1RUJ1 1LU2A 5FYTA 4BK4A 1Y9MA 3SCHA 1IZ3A 2VTXA 3LEIA 1DG6A 1IG0A 1K45A 2XMLA 3ZXJA 4YW7A 1E5RA 2R1BA 4P9XA 1US3A 2VBBA 2ZEWA 4RHV2 3RJRA 2RMU3 2X5IC 1JYTA 2HWF3 4NHXA 4O9GA 2OQ6A 2OZ6A 2VMFA 3MGUA 4Z92B 2HWC1 2B9UA 2GN3A 3LOIA 2EICA 3IDAA 1CD3G 2C24A 4XACA 5JZGB 3USSA 4OMCA 1J84A 1SBEA 2H6CA 4QPGA 1PZ9A 3WDWA 3BI3A 3CHXA 1XNAA 3ZXLA 2GNMA 2PHXA 2P3JA 4GZ9A 1RL3A 1UAIA 2CDPA 2NPIA 5DAXA 5FIXA 2WNUC 3UYJA 1KEXA 4P9YA 3POIA 4IGPA 1HRV2 3WDTA 5EXOA 4P9JA 5C7GA 5CKMA 4YGDA 5DG1A 2YB7A 2ZGKA 5JOWA 5LY1A 2BOIA 1SBDA 4WV8A 1UL9A 1QJX1 1OOPA 4NJ4A 5C3OA 1W06A 4XFFA 3ZFFB 3FZ3A 5KHKA 3NSTA 1GZWA 4LLFA 2RVAA 4PI2A 5F1RA 4OUEA 1WLWA 3KT1A 3AM2A 2QQMA 4QHBA 5FXWA 1W2OA 1S0CA 4R4ZA 1COV1 5FWJA 5A7WA 3T3YA 1W2UA 4XF3A 1UYZA 1S0DA 1YRZA 3FN9A 3RYRA 3IAPA 4K9SA 2FCUA 1JS9A 1RUF1 2EXKA 2IXIA 5HPOA 1NCRC 1PVC2 4L2NA 4BQ2A 1HRI2 1WBLA 5CAZA 2RS32 1LESA 2VULA 3IDBB 4BMBA 4N53C 4KWUA 1CPMA 4XFAA 5FCCA 1OKQA 4Q0UA 1Y43B 2BTVC 2IVIB 2R042 1ZZ9A 3OPWA 4NRQA 1WW5A 2HYXA 3IBMA 3PVOA 1MVEA 4DB5A 1AYM2 1PMHX 3KQRA 4XQDA 1XSQA 5LY2A 1AL21 3GCWA 3O1VA 1SFYA 3MLLA 3TYJA 2CV6A 1GR3A 4NROA 1JXNA 1A8MA 1URXA 4NE9A 4IE4A 5FY5A 3U07A 1QJY2 2PFWA 3IDCB 4Y4YA 5CADA 3BU0A 4HVOA 1OH4A 1AX1A 1UOJA 5H9RA 2DU1A 2UWAA 2W08A 3G6JB 3POBA 3VBHC 3KMHA 3I54A 5C9AC 5CKNA 3T0BA 3A22A 4O9EA 2D6OX 3W5MA 4H7MA 1KFUL 1EAH1 2WKKA 5C6CA 4AG4A 1GLHA 4OVEA 3DPRC 1ODNA 2PXJA 3AP9A 1PX4A 2C9KA 2HWE2 4IESA 1TMF2 4LBQB 4RR3A 4XIOA 1N3OA 2WFPA 3DUIA 5IHRA 4BPZA 1H8TB 2E53A 3S7EA 3MUZ1 4QXHA 5L7OA 4QPIC 2V09A 4HL0A 4PLOA 1OT5A 4AEDC 3VKFC 3NNJA 1POV1 3U14A 2XHKA 3A21A 4M4RA 4ZHNA 4KU8A 2AGSA 1A6CA 3IWZA 3IAQA 1W6OB 2G4IA 3CU7A 4KG0A 3JD71 5HCHA 3RQ0A 4QX7A 3ORJA 2XDVA 4UOJA 3ACIA 4FP2A 1W2TA 3RYPA 2VZQA 3EYPA 5E1RA 3OEAA 5FZCA 3RI9A 4E4SA 1ENRA 1BLZA 2QQJA 4CDWA 2H0VA 4K20A 5ABJC 3NJVA 2VBDA 3ZYRA 2LUWA 2I74A 3A23A 5A1LA 1D4M1 2YBPA 4RA0A 3PU8A 2O0OA 2E32A 3CJXA 3VD3A 1ULFA 1NZCA 1DYOA 2AEZA 2D5HA 3N7JA 5FYHA 1ZRCA 2P3KA 2V72A 1R1A2 2CWMA 2NN8A 2RS11 1X7NA 1RUH2 4U2AA 4I02A 4NVPA 4U36A 3PJYA 2R0FA 4RS5C 3B5LB 4A44A 4Y20B 5BNOA 4DO0A 3H1MA 1W6MB 3N4MA 4RFT0 3AKTA 5BNNC 2Q4SA 2DVBA 1S2EA 3M4FA 3TEWA 1DP0A 2JG8A 1UYPA 1UU5A 4QT6A 1AR83 5K8SA 3AP6A 3HN1A 2VMCA 3ZSMA 5ANNA 4CXWA 4XC9A 1O8PA 2RDQA 2H0BA 1AR71 3AMQA 4GD4A 4AAXA 4OI0A 1EP0A 1VBD1 3PVBB 5FMDA 4BM8A 5C3RA 4JAAA 2UYBA 2A6XA 3DYOA 3OPTA 3VZKA 2VOTA 1DZRA 3ACFA 4NHKA 4AGVA 4V2WA 5A3MA 3NNFA 4HBNA 1LHOA 2P3IA 4HONA 1GOGA 3MI8A 4CDQC 2B9VA 4XUOA 3VBOA 1PGL2 2D3SA 2D3RA 4S2GA 4EWAA 2RS53 1V9U3 2DCTA 1RMU1 5J96B 2QE3A 2VMEA 1OLQA 1O3SA 2VU9A 3SHRA 1LOEA 4LBKA 2CDOA 2ZHNA 4LOSA 2D43A 3IIIA 4B4RA 4N8MA 1H4GA 2CTVA 4QM9A 5F3IA 1ZRIA 5IK5A 3MIDA 3U1XA 5IAXA 4K21A 2IWGB 3E5UA 4EN6B 3ZYJB 1RUG2 1W3VA 3DGTA 3ZIXA 3APBA 4YSFA 1PX3A 1BVVA 4X8PA 2DYCA 1IGOA 1PO13 1EPWA 1QJFA 4WM8A 4FPFA 2YFUA 1HDKA 2E63A 2JDZA 4AI2A 2DBIA 3NNGA 3C3VA 4FXGB 5TSWA 2TBVA 4YZ2A 3UGHA 2G19A 1A8DA 2X5IA 2VECA 1OVSA 4DY5A 1O5LA 1YLLA 2P6CA 5A33B 4BCUA 4CP9A 1OPMA 1DQ5A 2PMWB 1JU3A 2WZR1 2WIIB 2BW8A 4D6QA 2WWSA 2ZEZA 4R9AA 3K3OA 5EHDA 1OXCA 2ET1A 4PIYA 2QUOA 1DYKA 3N7LA 4GAZA 5DZFA 2VZ3A 4PF1A 3Q8FA 3MEPA 1RUNA 2HEYF 4XMIA 2VPVA 4JRAA 2QZ3A 2RM21 2WNUA 2OYZA 1UX6A 3LE0A 4XURA 3WV6A 1OLRA 2ENRA 4LNVA 3FLRA 3SCGA 3T4HB 4UBGA 2XBO2 1C3HA 1RYYA 1RVF3 4QKFA 3VZJA 3ZSJA 4AAPA 4COVA 3FX3A 3U78A 4LKFA 2PAEA 3EMRA 4FTBA 1Q8VA 3MW3A 2XWBB 2VCBA 4EV0A 3PVEA 1Q3EA 4W6XA 5JIAA 1OH3A 5FREA 5E89A 4TN7A 2E7AA 1ZRRA 3I4IA 4EN9B 5FPXA 3R05A 1GMMA 1K5MB 1XYPA 2WNVC 2JX9A 3KV9A 2KA3A 4WZCA 3RRDA 2Y0IA 1ULOA 4ATFA 3M3QA 1DQ6A 1QHDA 2RR12 3I3EA 2WNOA 1E5HA 3JXSA 4AEMA 3WDVA 1YQ8A 1HN1A 5FPVA 3VV1A 5FMOS 1VBE1 1H1MA 1NCRA 2DWRA 1JTZX 4HKLA 4Q1RA 5FO9B 3ECQA 2ZPXA 3OD4A 4E4ZA 3UESA 1ACCA 1LOCA 1PZ8A 1ZZCA 1RUC3 2HWD3 2Q1MA 3HJRA 2QDNA 3HNBM 4N43C 3B7MA 2Z5WA 1BEV3 1DHKB 1W8UA 1ASJ3 2D7FA 1ST8A 4M01A 4RSUA 4IV1C 2OPWA 5T5JA 2VY0A 3OUIA 1PK6B 3LSEA 4XAAA 4AWDA 3E1F1 4HVRA 1AXYA 1U5ZA 2VM9A 2ZAHA 5FY8A 3QLQA 3V64A 3W5NA 1V70A 1OVPA 1W2AX 5C33A 5C4WB 5C8CC 3N7KA 4XYXA 1OA2A 4WM7C 1IHMA 2R071 4LR4A 1R093 5LRSA 2K0GA 5EP9A 3MLJA 2QQOA 5JOYA 3J7LA 2Y6HA 2ZCWA 3JU9A 2CL2A 3EHKA 2X09A 4G4FA 4DXTA 1CX1A 4Q4Y3 5K4LA 4RN5A 2Q5TA 4DXSA 5ACA1 2JKXA 2IXKA 3OG2A 4QGMA 1DLLA 2XXZA 4DINB 1NLRA 1UWWA 3Q8EA 3VBHA 1CZSA 3VHOA 4AXOA 5C9AA 1FV2A 2ZX2A 3N9NA 3NKTA 3ME2A 5GLVA 3VDCA 4D7TA 4K3UA 3DPRA 1WW6A 3VZOA 5LRRA 4JKLA 5FP8A 2ZBJA 3VZMA 3PIGA 1XPWA 2NMOA 3ZYPA 1Y3TA 4QPIA 4BA6A 2P1BA 4AEDA 3H8OA 1GQHA 1KFXL 1LODA 1TME3 2QJVA 3AJYA 1H2KA 1KDKA 2EIEA 4LJHA 2JECA 3AMMA 4MYEA 4CCJA 3TNQA 3W58A 4FOQA 3WNKA 3CLPA 4ASMB 5FDBA 3I8TA 3O12A 1O8SA 1H9WA 2HH9A 4XJ9A 4Y22A 5FY0A 4M3CE 1CAXB 4YARA 2PLV1 4QPGB 4M0HA 4H3WA 3D4KA 2ZX1A 4AHXA 2D44A 1CONA 3KM5A 4AQ2A 3MIFA 5ABJA 4ES9A 1RUJ3 4GWIA 4RFRB 1KITA 4XQWA 1ZBA2 2VNGA 2WDBA 2W46A 3T4VA 4AZZA 2QQVA 4OHWA 3OJBA 5A6XA 1Q8QA 2FZ1A 3MF6A 1VMJA 2VOKA 1QQP2 2JKBA 1ULCA 1CQ9A 1JMUB 3VZLA 4PDWC 3RFRA 1GOFA 2CHHA 2C0ZA 1FAYA 1OOPB 1QDOA 4RS5A 2YU2A 4AFMA 4LO7A 3V0BA 3KGZA 5EFUA 5FLJA 4ZXEA 1W90A 2HWC3 4MVTA 1JZ2A 2VVFA 1XB9A 4UW3A 4CRQA 1X33A 1JOJA 1RUI1 1ZZBA 3POSA 5A7NA 4CEYC 5JMOA 1HB1A 1UU6A 1WA6X 2GNBA 5FXVA 2Q1ZB 3NWKA 4D6SA 1AX0A 3NQHA 4E27A 3M3OA 1FPN2 1YXWA 2YV8A 2V4AA 4XF1A 1LR5A 1MZFA 5FBZA 2K46A 4QKDA 4IE6A 2A6WA 1QXJA 4RGGA 3I2FA 1V6NA 1OQEA 1UZ0A 3OCPA 1QH7A 2KXLA 1UXZA 5HV4A 1L3JA 4LUKA 5EYXA 1ND2C 5FBJA 5LW9A 4X6RB 3L2YA 4IEZA 5JCTA 3H50A 4PT6A 2J1SA 5DAQA 1QJX3 2VNRA 4CDQA 4Q4V1 3JUUA 3LPFA 1WCQA 2P6HA 4LBQA 4RGAA 2UY8A 3VBSC 4CCDA 1VRBA 4JGZB 4XF9A 3TEXA 3DN7A 1ENSA 2AACA 1W0PA 2WS92 1OPOA 1COV3 5JOXA 3WG4A 3MHZA 1MS1A 1UYXA 4I30A 3T09A 3OOXA 1L7QA 1RUF3 3E6DA 4L99A 2XG3A 3PURA 4ZU5A 4BLJA 2CSGA 4XJAA 4JDNA 2PHDA 1VBC1 2FMDA 3B69A 1YUDA 3HT1A 4UFJA 4RHV1 1LEDA 1I3HA 5IW0A 1DU3D 4LE4A 4P9LA 5CFCC 5L9VA 4NIDA 3SLIA 5F8PA 5HBAA 4JTNA 5A1AA 1AR61 1CPNA 1JBCA 2DVFA 1C8M1 4GH4C 4PI0A 5GZFA 1AXZA 5LEJA 2VVEA 5L7OB 5KHJA 3H8XA 1NA1B 4I2OA 3LWCA 4CP0A 5I0RA 1UNBA 2JDUA 4WBBA 1AL23 5L9RA 5FZ1A 4GULA 1L7RA 3MIBA 3T1MA 1WUVA 1W6MA 3H9AA 2Z2SB 1ZBE1 2VO5A 3WR0A 3ENRA 4Y26A 3ST7A 3WHUA 1RHI2 5HCBA 3K77A 4YVWC 4MH0E 3ETQA 3WUDA 3UNPA 4M3CA 3JQWA 1UOGA 5F5CA 4CDWB 5FP3A 5BUVA 1EYBA 2Y34A 1XNCA 5FR3A 4FAGA 1UF2C 1EAH3 1NCQC 2GH2A 3RZZA 1LOBA 3WZ1A 2RDRA 2A75A 1XC6A 2W1QA 3N9QA 1NZIA 2ARBA 3LA3A 4HSJA 2CAUA 5GZEA 5I8YA 1ZRDA 1IQAA 2JXAA 3BODA 3OD0A 4LHSA 2ZZJA 4JVAA 3LAGA 3WG1A 1N1VA 1POV3 1UZZA 2XJUA 2PYTA 2DU0A 5AFBA 5JWPA 1D0GA 4NWVA 1RITA 1CZTA 3JD73 1EV11 1PVC1 1W03A 2WR9A 4BQ1A 3I49A 3S5AA 1GZCA 2BGOA 3CF6E 4XQ4A 5F5QA 2RS31 4JGZC 1NG0A 3BPZA 3NV2A 4CCEA 3V65A 2XKOA 3LSDA 2RMU2 2Y38A 4FPJA 2JIGA 5AC92 2E9QA 1JUHA 2HWF2 2VC9A 3JZVA 3I3MA 1BMV1 3POEA 3HEIA 1UKRA 5FZLA 2JDMA 1YJKA 5EWSA 2VGDA 1D4M3 4KL1A 1UN1A 2EIBA 1DGLA 1JZ5A 5KBFA 2PHFA 5D2AA 2VH9A 5HCFA 5FZ7A 4CCMA 5CVRA 1F15A 1C4RA 2QQKA 2RS13 1N1TA 4RYDA 4IL7A 1W9TA 3RYKA 2VMDA 4KBZA 3CDZB 1YI7A 3GBFA 4XF0A 3VBOB 5GZGA 5FWEA 2AR6A 4MHUA 4XAEA 3VL8A 1VJ2A 3WCRA 3ZFGC 2XJVA 3DYPA 4N7IA 3KQ4B 3NNMA 2D6KA 3RDIA 1KS4A 5JAXA 1ZREA 1AZDA 1LHNA 4CE8A 2Y60A 1U5IA 5A33A 4I0BA 3I2GA 3TN91 1PGW2 1WLTA 2AZ5A 5FUPA 2A6ZA 2MEV1 1MS5A 3DXTA 3IPVB 5DZGA 2TUNA 5FQ0A 1RUE3 3B3QE 3M1HA 4LBMA 1PVXA 4O7XA 2R061 4RD7A 1AR73 2HWE1 1TMF1 1QNYA 3NO8A 5DUWA 5AVPA 1D2QA 1VBD3 5F39A 3R4SA 5A32A 4YW3A 4M00A 1GYKA 2PQQA 5EV7A 4COZA 2ADEA 2K9ZA 4XTPA 1D7PM 2ZOEB 4TYSA 3WDXA 2ZX3A 3M70A 4IV3B 1SLCA 3W9AA 3U75A 4FQ4A 3VKLA 4E4DX 1OF4A 2Q1FA 4P08A 5FMCA 4Q1PA 4OFGA 3H3ZA 3W20A 4Y3OA 1YQCA 5FZEA 1XBFA 3UKNA 1RMU3 3H3UA 5FLIA 2GAUA 4CCOA 3PTRB 1PM7A 1SG3A 2WO1A 3AL5A 3P1IA 3E5XA 5F2WA 1CN1A 5FPBA 3NJYA 3KV4A 3SISA 1OQ1A 4OI4A 3RG0A 1D4VB 4M0NA 4E4HA 3HQRA 1CIWA 4YVSB 5JSPA 2BVVA 3ZYHA 3RPQA 4Y33A 1T2XA 4UYBA 3KCCA 1RUH1 4V1PA 4LULA 3SH5A 4B7EA 1EUTA 2A7AA 3GCXA 3LGRA 4D3WA 4YZ4A 3FHQA 3MIHA 2ZGNA 1OMIA 2VQUA 1BVP1 1NUKA 1HLCA 1SCSA 2XUEA 3K2OA 4BHPA 4OQ8A 1H1IA 5J36A 4KNCA 4PDWA 1WCSA 2QQIA 3O1TA 4MGTA 2VZSA 1KJRA 1JOBA 1C5IA 2H6BA 4YZ5A 3AB0A 4AHWA 4CP1A 2XWJB 3WF3A 1VR3A 2Q30A 1SDDB 4TSVA 1Q5OA 2ZHMA 5C4WA 4XHBA 1NXD1 1FYUA 2DCJA 2WZR3 3RWKX 4AFAA 3H7YA 3ILRA 4FPCA 4XFCA 3ZXKA 1JODA 1LGBA 1H2NA 2VTFA 2MPFA 3O0VA 4UI9L 5A7SA 5FYBA 1YQ5A 3I2HA 1NXMA 2QKDA 2RM23 5CIRA 1NCRB 2A3YA 1QMJA 3J26N 1RXFA 1YC61 3T2QA 1KS5A 1LHWA 1AYN1 1IPSA 1MZ6A 2HLEA 4HPKB 5F5AA 4N53B 2QVSB 4XUNA 3X29B 5I8SA 1ND2A 4ZZ5A 1X8EA 1GNZA 1S2KA 2QQNA 3MFCA 4YFZA 1YJLA 3OUHA 4MGYE 1HX6A 3H3LA 3UJOA 3I2JA 3U11A 1Y7BA 3H0OA 3T08A 1NLSA 2D3PA 4IV3C 5T5PA 3S5QA 4CUGA 3VBSA 2UURA 4Q4X1 3KGLA 5L73A 1FOD2 2HEVF 4N9HA 4KH9A 4R9DA 3PUIA 1HB3A 1B09A 3ZLIA 2X05A 5JIUA 4D7SA 3M3EA 1RUG1 1OFSA 5F37A 5FY1A 1S0IA 4H55A 4ISQA 4LO6B 2P2KA 4XDQA 1REFA 3BN6A 4AQSA 2DF7A 1VBE3 1XSRA 3TRSB 5FP7A 4AI8A 4N90A 2FDFA 2Y8KA 3V0AA 1CAXA 4YVSC 3VBHB 5KXEA 1GWMA 1OBNA 2VZPA 2E6VA 5CFDC 1AR82 4F3JA 3B93A 5CFCA 3OF1A 2DTYA 5DUXA 4DIQA 3DPRB 4UFHA 4DMIA 1YI9A 1WD4A 5LBBA 4GH4A 2BBAA 1PIV3 2NZ9A 1UOBA 4C0BA 1GSLA 4QPIB 4AEDB 4XBNA 3A4UA 1MZEA 1ZZ7A 2R073 4CDUC 3KCXA 3VN4A 1X82A 4GALA 4XE9A 1HV1A 1W9WA 3FE5A 2Q0AA 2IFWA 4FPGA 3MDPA 1BK1A 4PLMA 4XFIA 3HD8B 4FVVA 1VBA1 2Q8EA 5GLZA 3H1WA 4Y22B 2KD7A 4J1WA 5ACA3 2F4LA 2WT2A 2LALA 1HB4A 1SPPA 2YU1A 1CAWB 1V9U2 4JV4A 5FJKA 3AMPA 3KWVA 2SBAA 4P9GA 3ZXAC 3LB9A 3CBNA 5BY5A 1C1LA 2P5BA 2LTNA 4GWMA 5ABJB 5JSRA 1S1AA 1UY0A 4JGYC 2NM1A 2C9AA 1RUOA 3WP5A 3B01A 3I97A 3VGIA 1UCXA 4BLIA 4F83A 4W65A 5LBEA 2VUJA 4OHZA 3WNLA 1MVQA 3VBUC 4CU8A 4JKKA 2CYFA 4CCLA 3IZOA 4RS5B 1MQTC 2WZPP 1JZ8A 3V0BB 2WSUA 1QJU1 1BKZA 1PO12 1YWKA 1UZWA 2YDEA 2UWBA 5FZFA 4LEJA 5T55A 4CU9A 1KJLA 2YPJA 5BNNB 5F3CA 1JYNA 1POQA 1JZ4A 2OZJA 4JGZA 2X8KA 2JDHA 5JDBA 4P9IA 5FZOA 1LAJA 4QPWA 2JIJA 2RHPA 1FATA 2OIIA 2BERA 5F6LB 1YHFA 4AL9A 4Y5SA 3OUJA 1FX5A 3PNAA 4PQQA 4QKNA 1DBNA 1W6NA 3UT0A 4A7ZA 3E6CC 1QOTA 2VCMA 2XJSA 1I1EA 4Q4W1 2C6SA 2ZGSA 3BGAA 3GHNA 4GJZA 2BNOA 3RVHA 2RJ2A 4XILA 4C1WA 2GP5A 3JBG1 3GBGA 5JPMB 3BTZA 1K42A 1F4HA 3PMEA 3HIFA 5G05L 1S2BA 4OULA 2A6VA 2VOVA 4LIUA 1K5JA 3TWIA 4OI2A 4CDQB 1GNYA 5GZCA 4IUGA 4DXZA 3ZFGA 4QX1A 5KHIA 4XJ8A 4TXWA 1RUI3 5FFOC 1HQWA 1NA1A 3WP3A 1DDLA 5A3TA 2YGLA 2FDIA 5HCAA 3W59A 4HKWA 3AZWA 3HPNA 2OVUA 2ZMLA 4ZS2A 1MS9A 4B1MA 1N1YA 4NIHA 2BGPA 4FPKA 2FDGA 1MPXA 3CMGA 4Q29A 2FDHA 1BYHA 3DKWA 1XNDA 5GZDA 3S57A 1D0HA 1W9FA 4EYUA 3O1PA 4GA9A 2IZWA 1QKQA 3AZXA 2D6MA 3OBAA 2BNNA 4IGQA 4OHYA 2F6BA 4IE5A 4R8HA 3L9JT 3CJIC 2BVBA 4Q4V3 3UKVA 4DUVA 3O1MA 1GICA 1TG7A 4XTMA 4CTEA 1RUC2 2HWD2 2V73A 3EBRA 3DV8A 4XJUA 1BEV2 2G9ZA 1ASJ2 1I5PA 5CISA 4NAMA 1MEC2 3CZJA 4ONUA 3THTA 4XXAA 4COUA 2BBVA 1UPIA 3VD4A 1VPHA 3VDBA 1APNA 1ZBA1 1PZ7A 5DAPA 3WDYA 4D0QA 4D7YA 1D2SA 4BH9A 4M3CB 1TNFA 1RGSA 4L97A 1R092 3OEBA 1VBC3 3QH6A 4XHXA 1H4HA 1W0NA 3T30A 3C7EA 4RHV3 3BOPA 3SKJE 4K6BA 3WNMA 2BV4A 4EZHA 1AJKA 1Z7S1 2B7YA 2UY9A 5FO8B 1RIRA 2B39A 1V6LA 5FPLA 1AR63 4NRMA 4L9BA 1C8M3 5FO7B 2F17A 4IE7A 4PCRA 4DEVA 1FMD2 1O59A 4LIVA 4CVUA 1OFNA 2EALA 1IKQA 2XVGA 3A7QA 4KGQA 1VB2A 4UFKA 1GWLA 2E26A 5FJHA 5LZ6A 3N9OA 5CKQA 4D6RA 1ZBE3 1ZM1A 1HW5A 2LRPA 3U0ZA 2WNVB 4C91A 2VZUA 2VNOA 2BFUS 3VKOA 1MS8A 1RINA 1YYNA 2VVDA 3J7MA 3N3HA 4GB32 3ZXFA 1LULA 4BB3A 1DQ1A 3WINE 1JN2P 1VRH2 3NW4A 3ABZA 3QD6A 4KG8A 4CP2A 4XJZA 2GC1A 2ZA9A 3IPVA 3AC0A 3PUQA 4A6OA 3AMNA 3MLKA 1OSGA 3VKNA 3ZXGA 2XHNA 4N43B 4AHZA 2G9GA 2A1XA 1YFYA 1T6GC 4WVWA 3WT3A 2KM2A 4IV1B 3K51A 3Q8CA 4L92A 3T2TA 3ACHA 2WS91 4QQOA 2J42A 4Q8KA 1RUJ2 2XONA 4IV3A 3VB9A 4XZPA 5C8CB 3IB3A 5IATA 4XEZA 3ZYIB 3WF4A 4YZ3A 4YNIA 4WM7B 1EV13 1PVC3 1Q43A 1PGSA 2WFF1 4IQPA 1RXGA 5B4XA 4BK5A 2RS33 1OURA 1BHGA 4NWWA 1E57A 1XQNA 5E16A 4AVTA 1OKOA 1TE1B 2ARAA 1F2NA 3NRUA 3K46A 4YG6A 5FQ0B 4MO3M 5DPNA 2ZACA 2NYYA 1UMHA 2E7TA 1A78A 4YVSA 4FPYA 5A32B 3OSDA 2VR4A 2HWB2 1O3RA 3OGRA 3ZN5A 3IT8A 1HIXA 4E8DA 1GQPA 1ENXA 5CFDA 4W50A 4YW5A 1CAUA 4PJYA 3FMGA 1JYXA 4YW4A 1XU2A 1WKYA 5JMCA 2BUKA 3PJQA 4JTOA 2CNAA 1J3QA 4QAWA 3WHTA 4CU6A 3DKQA 3THCA 4XFGA 3O1RA 2QQUA 3M7AA 1FNYA 2V4VA 4FFHA 4LXLA 4CXYA 1RHI1 1GKBA 2ERFA 3C2UA 4COYA 1V0AA 5C5UA 2CAVA 2VJXA 1WMXA 5L9BA 1CESA 2PHRA 2XL7A 1H2LA 1QJX2 3TN93 3F95A 1G9FA 3NMBA 2MEV3 4V2VA 3KHBA 5BNPB 4HXCA 4DQAA 4FCAA 1J1LA 1XJAA 2HWE3 2R063 1TMF3 5C3QA 4CUBA 5DDJ1 1O3QA 3KT7A 2DDUA 4CCNA 5E8AA 3SKVA 3OBTA 5FYYA 4A4AA 1COV2 1SLIA 3SEEA 4I09A 3ZDSA 4CUAA 4WVVA 2VQ0A 1AR91 1W6QB 5KHHA 2AC1A 3RZKA 4AI9A 1GWKA 1RUF2 1BBT1 2OT7A 3MICA 4HPKA 4NN0A 4N53A 1FT9A 1K3IA 1YFXA 2X10A 2TNFA 1RUD2 4NOTA 4BJ0A 5FKBA 5FPUA 4PDWB 2VW2A 3S7IA 1NY71 3B94A 5AC91 1MQTA 2JE7A 2ZEXA 2JWPA 3JCIA 1PM4A 3AYDA 4ZY9A 3WX5A 4YM3A 1CVNA 1ZX5A 3EO6A 3HQXA 3LOBA 3I7DA 3IMNA 2FCVA 4CEYB 1AX2A 1C8NA 1UKGA 1OD3A 1DQ4A 1UY3A 1HJFA 1SHWB 2EXHA 3M2MA 3PMSA 4HK9A 3WW4A 3RZLA 4EJRA 4LE3A 2GMMA 5A6QA 1AL22 3B00A 3NJXA 2AREA 5B4NA 5IK7A 2R16A 3ILFA 1UZYA 4BXSV 1DLCA 1HXS1 3VHNA 1RUH3 4FQZA 5LK7B 2WWUA 3J4UH 3AXEA 5FUNA 4YW2A 4E9KA 2DUOA 3VL9A 5JUVA 2D6PA 3VDAA 3WVJA 5IVJA 1AUYA 2J1VA 1ND2B 1WD3A 4BMEA 1DGWX 1PMIA 2QCSB 5DAVA 2XVLA 4W6YA 4IGOA 1SLAA 1PO21 1QXRA 3AFKA 3GYDA 4GJYA 2GH8A 3K4DA 1Y4WA 2JICA 5FXZA 1ULGA 3OPZA 5FKCA 1EAH2 1MS0A 3AMHA 3RGBA 4IXLA 2BDRA 3VBSB 4BIOA 4URAA 3ALQA 1V6MA 4A7YA 2FZ2A 3FFZA 4N7UA 5CBLA 4ASLA 5FRAA 2AENA 3OYWA 4R9BA 4OUMA 1JHNA 3VZNA 1LGNA 3CO2A 2PN5A 3POGA 5H9PA 1BCXA 3LDKA 4GXLA 5LBCA 4QQPA 2QQWA 4X6QB 5A3NA 1CR7A 1LNSA 4NIIA 3GZAA 5F32A 1H8VA 5BNPC 3J8F1 4JX0A 3V0AB 2EAAA 1WZXA 1AYN3 5J37A 1UQXA 4P02B 3TAYA 1CAWA 4AFDA 2LROA 3NAPC 4LBNA 5FZBA 5G04L 1LHVA 2I45A 4HK8A 3NJZA 5CU1A 5IVVA 2XLAA 3HAGA 4OHVA 1H0BA 4HG6B 4B3NA 5LA2A 5CFCB 4NPLA 2XVKA 4BQWA 5IVCA 5EPAA 3DL3A 4R4XA 4FFGA 3LQCA 4GH4B 4ZPIA 3CJIA 5D21A 2YBKA 1WGPA 2W95A 4Q4X3 3I2OA 1B35C 4O61A 3WW2A 5FTTC 4FTEA 1X36A 4JC1A 4LA3A 4I0AA 2RS12 3C7OA 1DGRA 3KLSA 1WW7A 1RUG3 1QNWA 1ZZ6A 2D98A 2ZX0A 3ES4A 4JHZA 5CZKA 2ZX4A 5T54A 4AVSA 1J1TA 2WYFA 4A6SA 5BNNA 5C8WA 4LT5A 2VXRA 1OQDA 4AI0A 3KVAA 1ZA7A 4I3GA 3RMYA 4YVWB 1SPPB 2J22A 2GZWA 2JENA 2JG9C 1HB2A 3L2HA 2YBSA 2PQSA 4MGIE 4UT5A 4G3YC 1IS6A 4AW7A 5FZ0A 4HANA 3PUAA 1NCQB 2XGXA 3AJZA 5DUUA 5EYYA 2DUPA 2JDPA 2QTWB 4D69A 1G9CA 1UX7A 3FBYA 3VD9A 4KWKA 1IS3A 1WMEA 1RUE2 5HI0A 1H30A 3MV11 1AR72 3WQ7A 3GZEA 4MXVA 2Q8DA 4LA2A 1H2MA 1VBB1 4J25A 4GMP0 2ZHKA 3PU3A 5D8AC 5GALA 1E5SA 3WF0A 4FTSA 3KF3A 4QXCA 4UW5A 3J7HA 2ZGUA 3EB7A 4GWJA 4XOGA 4A45A 4E2GA 3UV9A 2VOXA 3IMMA 1Y9GA 4CXXA 1WWYA 2FDJA 3FFQA 2Z69A 1UU4A 1VBA3 4YGBA 5FZOB 3WQ0A 5A6YA 4OMDA 5CEHA 3U37A 5FV3A 5JXHA 1R081 1RMU2 3GNEA 1SFPA 3H8UA 5FP4A 3AVSA 3DXUA 3BYWA 4AEKA 1W6NB 2IVJA 3S30A 3O1OA 3WUCA 3QCWA 1GNHA 1TEIA 2WAAA 1QH6A 4IW3A 1F9KA 1W8HA 2DBNA 4JHTA 3ELNA 1FOD1 2PTMA 3CNAA 1LOAA 4XPVA 2J1UA 3WY6A 3EXUA 5FOBB 1IOAA 3B9IA 5JR7B 1H9PA 4A42A 1Z78A 2BWCA 5J09A 3OGGA 1JW6A 2IXHA 3LF7A 3MO4A 3NV3A 1REDA 1QJU3 4LMFA 4UF0A 3R0RA 4LO5B 5FZHA 5GLTA 4E2QA 2ADDA 3ZFGB 5DXDA 4YG3A 5M0TA 3G7DA 2J1TA 3POWA 3KVBA 5EZWA 5FMOL 4WVMB 1OHFA 4QDSA 2OUHA 5FOJB 2XR4A 3AKPA 4UBHA 1G86A 4DXRA 4CPBD 2WNEA 4JKMA 2QNKA 5FPAA 1HRV1 2AH2A 1O7FA 3H42B 1J58A 1L7LA 2WC2A 5JPNB 2ZTNA 2WZR2 3BPSA 4FFIA 1ND3B 4Q4W3 2DVDA 4C90A 1UZVA 1KRIA 5GM0A 1AL0G 5IVEA 1N3PA 5JXIA 3JBG3 2XKPA 2ARCA 2VQTA 2YPDA 1G6NA 4ZU7A 1SDWA 4IEUA 5FP9A 2W9XA 3AP4A 3O14A 3ZSEA 1NAEA 4QB2A 2RM22 3DYMA 4RGKA 1GU3A 1W8ZA 4K7JA 4C0HA 1W8FA 1GP4A 3KS7A 1DQ0A 1CJDA 2WYSA 3IN9A 4CA9A 2JDKA 2R0HA 2Y6KA 3TEZA 1SMVA 4QHOA 4K8RB 2XJRA 5B2GB 1ULPA 3RJ2X 5C70A 2VZOA 4AVVA 1Q8OA 2ZGMA 3B9CA 1M4WA 5A3OA 2OX0A 1QEXA 1JYWA 5JI7A 2BWAA 4Y1ZA 3INAA 3W21A 1HRI1 2DCYA 1XXNA 2KR2A 2WNVA 3M8LA 4LQRA 3WP4A 1CWPA 3S6PA 3AK0A 4XVHA 1F31A 4Q27A 3GHMA 5EJ1B 3LA2A 4JCKA 2IC1A 1XE8A 1QY4A 2YY1A 3PVNA 4XDPA 5E88A 1Q56A 5J3UA 3JB4C 4YYOA 4S2DA 3SNMA 4NIGA 1DGWA 1W8WA 1GOHA 2R041 2ZMKA 4Y4RA 5FMBA 2QQPA 4Q8LA 4ZKTB 2GSYA 1VBE2 3ZSKA 1SLTA 5DABA 4N43A 5GJ6A 1AYM1 3UETA 4DRRA 3AYEA 1DF0A 2JB8A 4Q2FA 1QDCA 1U5XA 4IV1A 2VMGA 4Q26A 1LTEA 1VP6A 3HNMA 4FPLA 3ZKUA 2W52A 2A3WA 4Q0PA 4CCKA 1JZ6A 1XU1A 5A7OA 3ZPYA 1QJY1 5C8CA 3BTXA 5A7QA 2I07B 4NIAA 4TWTA 4WM7A 1PIV2 4QD2A 2WQZC 3ZM8A 4QDQA 5EQUA 1ZBA3 4M3CF 1G9BA 3LZZA 5J1XA 2R072 3LDBA 1ZZ8A 4DUWA 3BALA 4INDA 1YQ2A 3RZJA 1IQDC 3AKSA 2B5HA 2PAKA 2ATFA 4LHNA 5FZGA 3MZHA 1S0EA 1XNBA 2ORXA 1Z7S3 5KR7A 1ND3C 5FUIA 3D5OA 2CGNA 3GALA 2L9LA 3MV01 1NLQA 2G9FA 2ZJCA 4XBLA 5FZ8A 4LK7A 2RE9A 4CEWC 5K0UC 2XLGA 4BXFA 1AHSA 5FZAA 3RMXA 4AK3A 5KWRA 1JYVA 5CG8A 1IPJA 4TLGA 1XRUA 1FXZA 3AZZA 5SV8A 5KXBA 1JHJA 3VDDB 1LB2A 4Q0SA 2E51A 3D0JA 1Y9QA 2ZS6B 4EZ4A 2QBXA 3HVDA 2CU5A 2VNVA 1F35A 2JDYA 4CUCA 4CDXC 4DRVA 2A71A 5JR2A 3D3AA 3VUOA 4AGRA 3AP7A 3FLPA 2Q8CA 1S0FA 1NYWA 5BNPA 4P14A 2VE1A 3DECA 3WCSA 1JOPA 1QJEA 3RZMA 4BYYA 4NO4A 4XF4A 1UYYA 4LTAA 2ZAAA 3NAPA 3SH4A 1O5UA 3K48A 1R1ZA 1R1A1 5CFDB 2GMPA 4EROA 2HWD1 3VKMA 4K8FA 1CAUB 1N3QA 2A73B 1LCLA 4YZ1A 3GJBA 3I59B 3AYCA 5CNAA 3RS6A 4QXBA 1W6QA 4MXWA 2WS93 3GZTB 1MEC1 1S4CA 4A7KA 2JDNA 4QPYA 2ILMA 4AVAA 4FPEA 4I01A 4D8MA 5AFEA 1UMZA 5KC5A 4QDRA 5JI9A 2YZ4A 3Q8BA 5DN2A 2WFF3 1LRHA 3KF5A 2VMHA 3P3NA 4CDUB 1KGYA 3VLBB 4W8JA 2BPA2 1NQDA 1FI2A 1LHUA 1UIJA 5C5TA 4GMP1 1JU4A 1W2NA 2MNGA 1O6UA 4UWDA 3WOGA 4RQPB 3WQBA 3MUY1 2ID4A 2VTXJ 4ZONA 4B1LA 4B4PA 4CEYA 2XPJA 4MG2A 2JG9A 4ZXKA 1RUI2 1SEFA 2HEWF 1X8MA 4MADA 5F2SA 3T2PA 3FUOA 3HWJA 5HXMA 3PUHA 1FMD1 2LM3A 4JGYB 5JXGA 3CKHA 4JZRA 4L11A 3A0NA 1W8NA 3I2IA 5DUVA 3ATGA 5E6HA 3RSJA 3C7FA 4KMQA 3BIEA 1J59A 1PGL1 2VZRA 4QGNA 1Q8PA 3PTYA 4QX8A 2RJKA 1G9DA 2P37A 3UJQA 1E5IA 2ZZQA 1OD5A 3ZR6A 2QZ2A 5J48A 3VBUB 1SQ4A 3ZR5A 1RHI3 4W4ZA 5D8AA 5I8TA 5IK8A 2WJSA 3RI8A 1MQTB 5ISLA 1V6OA 2YG0A 4GB31 2JDAA 3ZKYA 4F8AA 1XNKA 3KB5A 5D1IA 1VRH1 1KXGA 4Y1UA 3SEPA 3VDDC 4ATEA 5A3LA 2XOMA 4NHYA 2DVGA 2QFEA 4FFFA 3WDUA 2UWCA 5FYCA 4LO4B 4Q4V2 4WZFA 3H8RA 1YIPA 1A3KA 1V00A 2B4KA 3R6SA 3OTFA 4ZU4A 4CU7A 5DDJ3 2R30A 5T5LA 5JXJA 2EA7A 3BTYA 4URTA 1PHMA 4FO9A 5EJ3A 2OPKA 3LA7A 4NHLA 2IXJA 2W91A 4PIXA 1AR93 4I3PA 4XW3A 1KDMA 1W0OA 1BBT3 4QU1A 4WM8C 2WUHA 3LKJA 2D93A 2XJPA 3HBZA 4B7KA 4QMAA 3KV6A 1VBC2 4LOTA 1IS5A 3ZSLA 2VUAA 4IEVA 3SQOA 1W9SA 2IXLA 4NR1A 3SITA 5AC93 4COWA 1VAMA 4JQRA 4YM2A 4HVQA 5FZMA 3BTAA 5J98B 3WQ1A 2DFBA 4EN8B 1AR62 3CL1A 1C8M2 3OYWB 3POYA 4L0PA 3VHRA 4AVBA 4ES8A 1UIKA 1ONAA 3KSCA 1G9AA 3BKZA 2YMZA 2HWB1 4Y5TA 1JZ7A 2VOWA 2WO7A 5BXXA 1DFQA 3VHPA 5JOZA 1HXS3 4BQ3A 3AKQA 4RQPC 1F8VA 2C26A 2XBO1 1ZBE2 4DUXA 5LBFA 2RS52 4YVWA 5LA0A 2CGOA 1ZA4A 3TOJA 5KC6A 1SACA 4GKYA 4IEOA 3KZ4C 1NX9A 3ZXEA 2O1QA 1NCQA 2W47A 1PO23 1QU0A 3ON7A 2HKXA 3ITQA 4W6WA 3CJIB 4IEWA 3LFIA 3HT2A 3K75B 2NQYA 5C71A 2NMNA
chains in the Genus database with same CATH topology
4DZGA 3MPPG 3I2DA 5BPXA 3IDEA 4WVZA 4BWOA 4Y5Z0 2GC0A 1OI6A 1ZYBA 1LECA 2RR11 3VBRB 4B29A 2D97A 4JDOA 2E7QA 4HSLA 2AUYA 5KXCA 4QX5A 3J8F3 1EV12 2PLV3 5IT6A 3SH3A 1RUD1 4LUMA 3WG3A 2Y0OA 1W6PA 4Z8BA 3VBFC 1LJ7A 1LU1A 1JH5A 4Z82A 4AYUA 1BMV2 1SBFA 2ZHLA 2W0XA 4OI1A 2ES3A 2XLFA 1GBGA 4YW1A 4XXPA 1YFWA 1W39A 1S0BA 2OW4A 3O0XA 1RVF2 4LBQD 2A70A 4IEXA 1ZRFA 2JEMA 1MR5A 4WVMA 5SV5A 5IK4A 3ZYGA 1WCKA 5JZGC 4P9WA 5AVAA 5JVVA 4KU7A 1DZQA 4XFHA 2C5DA 3TN92 1WBFA 1CGPA 2MEV2 1ND3A 1N1SA 4KWLA 1RJ7A 4HZFA 2R062 2NLRA 1F5JA 1LEMA 2YYOA 4FP3A 5K0UA 3GF6A 1VBB3 4CEWA 3N35A 2BYVE 4Y1XA 1LOGA 2DURA 2EAKA 1SLBA 4FAHA 4K40A 2JJ6A 4AQ6A 3NV4A 3ZFFC 4H14A 2PELA 2GDFA 5BV6A 3QOPA 3UK9A 2XH6A 2YGMA 3BIWE 4AF9A 2BGCA 3VBRC 4FOYA 4CDXA 1R083 1SLLA 2UU8A 3SXWA 2FBEA 3OGJA 1Q8SA 5J7MA 1JUIA 3MIGA 1QQP1 2K2SA 1FOD3 3FUQA 4UXAA 1JYIA 4Q4Y2 1VIWB 4LHKA 1V6JA 5I93A 4N9IA 5DZEA 3ZMOA 4C1XA 1EPZA 4UW4A 2R1DA 3URFA 1FPN1 3SMHA 4YG0A 1MACA 4AHYA 3OY8A 1XYNA 1HRV3 1RUE1 4QQLA 5CA6A 1TME2 4HN0A 2WT1A 4QXKA 3FWEA 4HLTA 1YCIA 2YUEA 4PLNA 1HKDA 4Q0VA 3LCPA 2O8QA 4FPOB 3ILNA 1RJ8A 3EJKA 3JB8A 1S55A 1NE6A 5I0UA 3E6BA 1AYN2 2SLIA 3FBMA 3P3PA 2GMEA 1H8TC 1MS3A 4YGCA 3ZN4A 3VDDA 5T52A 4HT1T 1QGLA 1HRI3 4Q4X2 2BNMA 4AEJA 4DS0A 4MGZE 3USUA 2BEOA 1FNZA 4YFWA 4R9CA 2RJLA 4K1ZA 2VMIA 3SLIA 2HWC2 2R043 4A3XA 5F9TA 2ZGTA 4HN1A 3IM0A 4QM8A 2WQ4A 5DG2A 1AYM3 4MSVA 1QF3A 3KCYA 4FOVA 2WINB 4YGEA 3R4UA 3I59A 2XB6C 1O4YA 3NVCA 2XJTA 1QJY3 4L8QA 4CDUA 2ET7A 5JSOA 1Z0HA 2FMYA 1VB4A 4IERA 3HR9A 1IS4A 2PHWA 1JYCA 4FSJA 2PA7A 4EN0A 3MW2A 4RQPA 1KD7A 2O8OA 4B8EA 1M06G 2NP0A 2YHJA 3WNXA 1ALYA 1VBA2 3NAPB 2I2SA 2FHRA 3HMYA 1S0GA 4FPHA 1X50A 4JGYA 4HMZA 3QACA 1WLDA 1CAVB 1SCRA 4MXWB 4AGGA 2JD4A 4LBLA 4FT8A 3ASIA 4Z1VA 2GALA 5K9YA 3GBWA 1TQ5A 4MZUA 4UW6A 1B35B 4QU2A 3VBUA 2RMU1 5KXDA 3MFAA 4XFBA 4OHXA 2HWF1 4KQ7A 2X29A 1YNAA 3ZIWA 4I0WB 1NOVA 1G7YA 2ZABA 5BYNA 4MX3A 2GNDA 3AP5A 4IEQA 1QJU2 2PHTA 2JG9B 3M3IA 4YLZA 4AFCA 1R1A3 2DVAA 2DTWA 2N7GA 1I5ZA 3CEWA 3VBFA 4J6GA 3ZFEB 4QQHA 1TNRA 3ZN6B 1MZ5A 3MF9A 1MEC3 2WA4A 1BXHA 4D94A 4HKOA 1V6IA 2C1FA 4Q4W2 1PIV1 1VAKA 1ULEA 4FOWA 5D8AB 4AVCA 4CYDA 5L19A 4J1XA 1QOSA 3T1LA 3ACLA 3JBG2 3PHMA 3D0SA 2ZGOA 1DZTA 1PGW1 3NKGA 4GMP3 4AE2A 3AYAA 3ROUA 5T5OA 5JZGA 2GNTA 4DNYA 1FMD3 3D82A 3THPA 2Z42A 4PBPA 3TBDA 3FJSA 1SFNA 3JD72 5T3NA 2YXSA 2EF6A 3QBQA 1MS4A 1O3TA 1VALA 2A5ZA 3SCFA 5I0SA 1J3RA 2YC0A 2YROA 2DV9A 1I6XA 4GB33 5I0TA 2Q8OA 4CZSA 1VRH3 1F5FA 2CWSA 1D4M2 3JQXA 4PQ9A 2R49A 1GFF2 2VG9A 4G9SB 1U5YA 3ZFFA 2VW0A 2DCZA 1BZWA 2ZMNA 3M3CA 1VAVA 1K5MC 3E97A 3U10A 1LKNA 3VBRA 1HQLA 3EQEA 2P34A 2AYHA 2ARXA 4QQ2A 1LGCA 3ZXDA 4Z2WA 2BQPA 2B42B 3WXPA 1ZVFA 3D6EA 4XMAA 1WW4A 5F6KA 5H9QA 3ZFEC 4ORFA 2WA3A 1PK6C 4EWEA 4MUVA 1Z7S2 4H7LA 1VBD2 1GZWB 4E2SA 5C4WC 4IEYA 1PNFA 2HWB3 4AI1A 2XL9A 2OUJA 3WW1A 3MPBA 4TZDA 2XBO3 3MYXA 3WD5A 3MIEA 1W6PB 4LO8A 3IIAA 1LOFC 1C57A 2B46X 2UYAA 2MHFA 4FBFA 4B4QA 2D6LX 3BU7A 1GV9A 1GANA 1OA3A 3AZYA 2Y26A 1CJPA 5BNQA 1H8TA 1VLNA 2XUMA 3Q9OA 2EXIA 5FAXA 4ITCA 4DPNA 3DF0A 4OZXA 2RR13 1EY2A 4PBOA 1LENA 5CG9A 1QJZA 3U4XA 2QDRA 1ENQA 2W39A 1W6OA 5T50A 4JRLA 4Z07A 2WFF2 4BIFA 1RB8G 1WMFA 1AR81 1RUD3 3H1YA 4QPGC 1WLCA 4A2UA 1HQNA 4HFSA 2JE9A 1AJOA 4BE3A 1AXKA 2HJIA 2OA2A 1V6KA 4KBBA 4MV2A 3UKTA 4XIKA 5L36A 4RR3B 3ZMNA 1GQGA 2IFRA 4CEWB 5K0UB 3ES1A 2EXJA 3BCWA 4Q0QA 2B8MA 4RL7A 3N7MA 1BQPA 5KHGA 3ZO0B 1OOPC 3AX4A 3FLTA 2D40A 4Y20A 1UD1A 5FPZA 4GIQA 2ZGRA 2RS51 1O4ZA 1V9U1 1DYPA 2CY6A 4CDXB 2F4PA 5JLVA 3RWNA 4KWJA 4DY3A 4S2FA 1ZNPA 2X53S 3TB0A 4MLOA 4BOWA 3D8CA 2P17A 2ZGQA 4IETA 1WMDA 2B45X 4PF5A 4META 4S2HA 2WLPA 1WCDJ 3NV1A 3O0WA 1AF9A 5DDJ2 3OBRA 3J9SA 1PO11 1XYOA 5BNOB 5HXVA 3ZVXA 2ZGLA 1AR92 4DFSA 1BBT2 2WLQA 3O7OA 2A6YA 3NL1A 4GKXA 2EVXA 1YO8A 4BZ4A 1QOOA 4FXKB 2D6NA 4NHMA 4R52A 2JG8B 4YRDA 3WG2A 4LBJA 1NY72 1DQ2A 3OY8B 3S0MA 1UW8A 5K7PA 5CB7A 2IXCA 2ZGPA 1O91A 1U12A 1IPKA 1G8WA 1QQP3 4F7ZA 3KD4A 4P5HA 2BFUL 2HYKA 3KT4A 2PHLA 2V5YA 1HXS2 3AZVA 5ACA2 1RVF1 1ULDA 4RR3C 5I91A 5L7OC 3WW3A 1HV0A 1NA1C 1FPN3 4GQ7A 4TLFA 2EIGA 1OA4A 3WLUA 1PO22 1C1FA 2PAMA 1NE4A 1N47A 3E5QA 2VQAA 4QGLA 2CGPA 2TEPA 4OLLA 4XJWA 3IKWA 2ETEA 1UPSA 1KQRA 2Z79A 1XE7A 3USUB 2GU9A 3ZX7A 2GC3A 5GLUA 4NPRA 3UL2A 3AFGA 1BJQA 1CX4A 4CDWC 4MGKE 1I9RA 1REEA 2D5FA 2ZKNA 2GC2A 4WM8B 2W68A 3J8F2 3N36A 1H1AA 2GN7A 1RUC1 2FQPA 2PLV2 1POV0 4AFBA 1C5HA 1PNGA 3V56A 4JDMA 1FV3A 1BEV1 4AQTA 4XETA 1ASJ1 1CAVA 4PIZA 2X5IB 1GZ9A 3BB6A 4LLOA 1QWRA 5BNOC 4Y1VA 2PHUA 1B35A 1DIWA 4LHLA 4OUSA 1J3PA 1NQJA 5GKAC 3MW4A 4KGGA 1R091 1K5MA 3FHIB 2JG8C 4GWNA 3R4DB 4YM0A 3RNSA 4AI3A 1O4TA 2A3XA 4Q4Y1 4EN7B 3WP6A 4SLIA 4EWDA 2WSVA 1WA4A 2WNUB 2WL1A 4Y24A 4XBQA 2DFCA 2DCKA 5IUQA 5FLHA 1DGRN 2R32A 3BOWA 2WT0A 3H7JA 4IEPA 5H9SA 3B02A 1RC6A 4K1YA 1QXPA 3TNPB 2XJQA 3ZFEA 4DOUA 5GLWA 1RTVA 3ZN6A 1PK6A 4ISRA 3O5SA 1C28A 3VBOC 1IKPA 3GZUC 4Y1YA 2R6QA 1YFUA 4YM1A 1TME1 5LK5A 3AXDA 1VBB2 4SBVA 1S0JA 1YIFA 2ZKLA 2DUQA 3PLQA 3A0KA 2VW1A 3AKRA 3FC0A 4HETA 1LOFA 3QH7A 3VBFB 5LEKA 1U0AA 4LBOA 1R082 1AVBA 4X8NA 1RUJ1 1LU2A 3SCHA 1IZ3A 1DG6A 3ZXJA 2R1BA 4P9XA 4RHV2 3RJRA 2RMU3 2X5IC 2HWF3 4O9GA 2OZ6A 3MGUA 4Z92B 2HWC1 2B9UA 2GN3A 3LOIA 1CD3G 5JZGB 3USSA 1SBEA 2H6CA 4QPGA 1PZ9A 3WDWA 5C9AB 3ZXLA 2GNMA 2PHXA 2P3JA 1RL3A 1UAIA 2NPIA 2WNUC 4P9YA 1HRV2 3WDTA 5EXOA 4P9JA 4YGDA 5DG1A 2ZGKA 5JOWA 1SBDA 4WV8A 1UL9A 1QJX1 1OOPA 3ZFFB 4XFFA 3FZ3A 5KHKA 3NSTA 1GZWA 4LLFA 5F1RA 1WLWA 3KT1A 3AM2A 4QHBA 1S0CA 4R4ZA 1COV1 1W2UA 4XF3A 1S0DA 1YRZA 3RYRA 4K9SA 1RUF1 2EXKA 2IXIA 1NCRC 1PVC2 4L2NA 1HRI2 1WBLA 5CAZA 2RS32 1LESA 2VULA 3IDBB 4BMBA 4N53C 1CPMA 4XFAA 5FCCA 1OKQA 4Q0UA 1Y43B 2BTVC 2R042 1ZZ9A 1WW5A 3IBMA 3PVOA 1MVEA 4DB5A 1AYM2 3KQRA 4XQDA 1AL21 1SFYA 3MLLA 3TYJA 2CV6A 1GR3A 1JXNA 1A8MA 1URXA 3U07A 1QJY2 2PFWA 3IDCB 4Y4YA 5CADA 4HVOA 1AX1A 5H9RA 2DU1A 2UWAA 2W08A 3G6JB 3VBHC 3KMHA 3I54A 5C9AC 4O9EA 2D6OX 4H7MA 1KFUL 1EAH1 2WKKA 5C6CA 4AG4A 1GLHA 4OVEA 3DPRC 3AP9A 5FMOS 5GZGA 4RR3A 2HWE2 4IESA 1TMF2 4LBQB 4XIOA 1N3OA 2WFPA 3DUIA 4BPZA 1H8TB 2E53A 3S7EA 5L7OA 4QPIC 2V09A 4HL0A 4PLOA 4AEDC 3VKFC 1POV1 2XHKA 4KU8A 2AGSA 1A6CA 3IWZA 1W6OB 2G4IA 3CU7A 4KG0A 3JD71 3RQ0A 4FP2A 3RYPA 3RI9A 5E1RA 4E4SA 1ENRA 4CDWA 2H0VA 4K20A 5ABJC 3ZYRA 2LUWA 2I74A 1D4M1 4RA0A 2O0OA 3CJXA 1ULFA 1NZCA 2D5HA 3N7JA 1ZRCA 2P3KA 1R1A2 2CWMA 2NN8A 2RS11 1X7NA 1RUH2 4U2AA 4I02A 4NVPA 4U36A 3PJYA 2R0FA 4RS5C 3B5LB 5BNOA 4Y20B 3H1MA 1W6MB 3N4MA 4RFT0 3AKTA 5BNNC 2Q4SA 2DVBA 3M4FA 2JG8A 4QT6A 1UU5A 1AR83 5K8SA 3AP6A 3HN1A 3ZSMA 3AMQA 2H0BA 1AR71 4OI0A 1EP0A 1VBD1 3PVBB 4BM8A 4JAAA 2UYBA 2A6XA 3VZKA 4AGVA 1DZRA 4NHKA 5A3MA 4HBNA 1LHOA 2P3IA 3MI8A 4CDQC 3VBOA 1PGL2 2D3SA 2D3RA 4S2GA 4EWAA 2RS53 1V9U3 2DCTA 1RMU1 5J96B 2QE3A 1OLQA 1O3SA 2VU9A 3SHRA 1LOEA 4LBKA 2ZHNA 2D43A 4B4RA 4QM9A 1H4GA 2CTVA 5IK5A 3MIDA 4K21A 2IWGB 3E5UA 4EN6B 3ZYJB 1RUG2 3DGTA 3ZIXA 3APBA 4YSFA 1BVVA 4X8PA 2DYCA 1IGOA 1PO13 1EPWA 4WM8A 4FPFA 1HDKA 2E63A 2JDZA 4AI2A 3C3VA 4FXGB 5TSWA 2TBVA 4YZ2A 1A8DA 2X5IA 2VECA 4DY5A 1O5LA 1YLLA 5A33B 4BCUA 1OPMA 1DQ5A 2WZR1 2WIIB 2BW8A 2WWSA 4R9AA 2ET1A 4PIYA 2QUOA 1DYKA 3N7LA 5DZFA 1RUNA 3MEPA 2HEYF 4XMIA 2VPVA 4JRAA 2QZ3A 2RM21 2WNUA 2OYZA 1UX6A 3WV6A 1OLRA 2ENRA 4LNVA 3FLRA 3SCGA 4UBGA 2XBO2 1C3HA 3ZSJA 1RVF3 3VZJA 4COVA 3FX3A 2PAEA 4FTBA 1Q8VA 3MW3A 2XWBB 4EV0A 3PVEA 1Q3EA 4W6XA 5JIAA 5FREA 5E89A 2E7AA 1ZRRA 3I4IA 4EN9B 5FPXA 3R05A 1K5MB 1XYPA 2WNVC 2JX9A 2KA3A 4WZCA 3RRDA 2Y0IA 4ATFA 3M3QA 1DQ6A 1QHDA 2RR12 4AEMA 3WDVA 3VV1A 1VBE1 1H1MA 1NCRA 2DWRA 1JTZX 4HKLA 4Q1RA 5FO9B 3ECQA 2ZPXA 3OD4A 4E4ZA 1LOCA 1ZZCA 1PZ8A 4N43C 1RUC3 2HWD3 2Q1MA 2QDNA 3B7MA 2Z5WA 1BEV3 1DHKB 1ASJ3 2D7FA 4M01A 4RSUA 4IV1C