4XBQA

Crystal structure of human galectin-7 in complex with type 1 n-acetyllactosamine
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
133
structure length
133
Chain Sequence
b'VPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVRIF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Galectin-7
publication title Structural Basis Underlying the Binding Preference of Human Galectins-1, -3 and -7 for Gal beta 1-3/4GlcNAc.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Sugar binding protein
total genus 28
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4xbqA00
1AXKA 2NMOA 5JMCA 2LALA 4Q2FA 4YW1A 3ZXEA 3MW3A 1BQPA 2PHTA 4LBNA 4XMIA 2D6PA 1S1AA 1C1LA 1DQ6A 1ENQA 1V6MA 1ZM1A 1BJQA 4BMBA 2YROA 2GN3A 3BOPA 1LHWA 2DVAA 1MZ5A 2P3IA 3PVNA 3WHTA 2ZGSA 2ZHLA 2DYCA 3M3OA 3O5SA 1W6MB 2P37A 4PBPA 1W6MA 1YYNA 1O4ZA 4YZ3A 2JE9A 1WW6A 3ILNA 4XJUA 1KJLA 1X50A 4LBJA 1QDOA 2UWBA 4YFWA 2DURA 2R1DA 1QU0A 1SLAA 1G9FA 1AF9A 1WCSA 2JKBA 4TYSA 3VKFC 1LENA 2UU8A 3VKMA 2A3YA 4XDQA 2ZGNA 5DUUA 3I8TA 4PBOA 2RHPA 1LECA 1JUIA 5GALA 2GNDA 4AWDA 1YRZA 3UJQA 2D6NA 3ZPYA 4ATEA 3IMNA 3ASIA 1UKGA 1FATA 4XBQA 3D5OA 4GALA 1APNA 2A6ZA 1UL9A 4UW6A 4XJZA 3T1MA 5JOZA 1BKZA 1YXWA 1SCSA 2P2KA 2DUPA 3N7MA 5T5PA 1ULDA 3NV3A 3PVOA 3SH3A 2A70A 1CQ9A 1DFQA 2AYHA 3ZSJA 4DRVA 2EALA 4DS0A 4U36A 2ZGOA 4YZ5A 4C1XA 2NMNA 2D3PA 3MW4A 4Q8KA 1IS6A 4WVWA 5CBLA 4Q27A 3BIWE 1KRIA 1DQ1A 2GMPA 3AJYA 4JRAA 5T54A 2ZHMA 2EXIA 3GALA 4NOTA 3B69A 4M3CF 4YGCA 1N3PA 1S0IA 3OBRA 3BODA 2E7TA 3ZXFA 3AJZA 2DWRA 4W65A 1DBNA 3T1LA 5F9TA 4Y24A 4M3CE 1DQ0A 1I3HA 1OQ1A 4XILA 4Q8LA 4P9WA 2JECA 1KDMA 3HMYA 3NV2A 3WUDA 3LSDA 1LGNA 5L73A 3PJQA 4FP2A 2P3KA 2W68A 4GKXA 4LBMA 5EXOA 3U4XA 2VW0A 2PHXA 4FPCA 3JU9A 2WQZC 4FPJA 3IPVB 3LSEA 1DLLA 4FPOB 5DXDA 4FP3A 2PHFA 1RINA 4YM0A 2DU0A 3OY8B 1SLTA 1JXNA 1LOGA 1DQ5A 1H9WA 3R4UA 3OY8A 5IK4A 3AZYA 2YZ4A 4YM1A 1ENSA 1LOEA 1OFSA 1D0HA 1DYPA 2ZGMA 5E89A 3N7LA 2A71A 2CL2A 2D44A 1LULA 4K1YA 4Y1ZA 4YZ4A 1LTEA 1F5FA 2AREA 1AJKA 1Y7BA 1V6JA 2NM1A 3INAA 1WD4A 5KXBA 3TAYA 1AJOA 3VKOA 1S0FA 2VW2A 1Z78A 1G9BA 3N7KA 1ULGA 5E88A 5T50A 1MZ6A 1OKQA 3APBA 1LHOA 2WSVA 1SBEA 4YG3A 2AH2A 1WLCA 4D69A 1V6OA 1S0JA 1DGLA 1G7YA 5FREA 4AYUA 1UX6A 2A6YA 1H30A 4C1WA 4XJAA 1LJ7A 4LBKA 4FPYA 4LBOA 1V6IA 2ZMLA 2EF6A 4YGBA 3M3EA 3HN1A 1SLBA 5T5LA 4Y1YA 1HKDA 4SLIA 3AK0A 1FYUA 2V5YA 2R16A 3UL2A 2CYFA 2ZGQA 3SH4A 4Y22B 1JHNA 1IS5A 4ITCA 2ZGTA 4XHBA 3AZZA 1GICA 2I2SA 1MS1A 2GMMA 4R9CA 1SLLA 2ZBJA 2ZAAA 4FPHA 1W6OB 4Y1UA 1LHVA 5HCBA 5GJ6A 2NP0A 2NYYA 5SV8A 3HR9A 2A6VA 3M1HA 1W6OA 4I30A 4RL7A 5HCFA 3WZ1A 4YM2A 4YG6A 4M00A 4YW2A 4XZPA 2A6XA 4ATFA 5JOXA 2A7AA 2DU1A 4RA0A 5DZFA 3WOGA 1RIRA 1JYIA 4K20A 1F9KA 1MS4A 1ZA4A 3ZXKA 4AVSA 1KJRA 3B00A 1FAYA 4YW4A 4R9AA 1Q56A 1I1EA 3DGTA 4CRQA 1LOBA 1WLWA 2WT0A 5DUWA 5EWSA 3ZSMA 2ENRA 3AP7A 1QDCA 5T55A 1RITA 1N1VA 3VKLA 4XE9A 1SBDA 4AGRA 1ULCA 3NV4A 4Y1XA 1CJPA 5CB7A 5BYNA 5H9QA 2EIGA 2P34A 2EXKA 1FV3A 1JYCA 4K21A 1AVBA 5H9PA 1R1ZA 4TZDA 2ZABA 4XJWA 3RS6A 3IKWA 4YW5A 2AENA 3O0VA 2GALA 2E6VA 2DVGA 3LCPA 3FBYA 4R9DA 1LGCA 1DIWA 3O12A 2DVFA 3WG1A 4KBBA 4DFSA 5CA6A 1AX2A 3AXEA 3T2TA 1Q8VA 2E53A 4UW4A 4XBLA 1LOFA 3VKNA 3WG3A 3WCRA 2ZGKA 5IT6A 1CR7A 1QNYA 4Q1PA 4ASMB 5GLTA 1GNZA 3R05A 1LHNA 4FPKA 3WCSA 4FPEA 4UW3A 5CAZA 1C4RA 1FNYA 1MACA 2HYKA 2UWCA 3OYWB 5DG1A 3QLQA 1C57A 1N1YA 1PZ7A 2D6MA 2ZGUA 2D3SA 3OYWA 1QOOA 1GZ9A 2ZMNA 2ZA9A 1U0AA 1UMZA 1DYKA 1GNHA 2AUYA 5GLWA 3SITA 2DV9A 2ZACA 2EXJA 4IQPA 2FHRA 4XXPA 1V6KA 1S0DA 3AYCA 2ZHNA 1VALA 2ZZJA 3POWA 1NLSA 2NN8A 3FLPA 4BLJA 5E8AA 1SBFA 1N3OA 1DZQA 3SLIA 4FQ4A 2JD4A 1Q8PA 1KQRA 2ZMKA 1BYHA 3KM5A 3MW2A 4GKYA 1G8WA 4YGEA 3ZYRA 1QNWA 3M3QA 3WDXA 5JDBA 3R4SA 2VW1A 2R1BA 2TEPA 3TB0A 2D6LX 2VY0A 2A5ZA 1SFYA 3RQ0A 1SCRA 1Z0HA 4UW5A 3GNEA 2UWAA 1JW6A 4M3CB 2W52A 3NV1A 2D6OX 4Q26A 2YY1A 4M3CA 2ZKNA 3A0NA 4XMAA 3RMYA 1DHKB 5DG2A 5JOWA 1GZWB 3AXDA 5DZGA 4DQAA 1BZWA 3IM0A 3WNXA 1GZWA 1VLNA 2UURA 5IK8A 2ZGPA 1W0OA 2OVUA 4Q1RA 3JUUA 4WVVA 5JLVA 3M3CA 1HDKA 2XB6C 4FOWA 3H0OA 2A75A 2EAKA 1GSLA 5GZGA 5T5OA 2WT1A 1QGLA 2VH9A 2GN7A 2R0FA 3OBTA 5GM0A 1QKQA 3SH5A 1F31A 2VU9A 3V0BB 4FOYA 3RG0A 4CTEA 3ENRA 2Q5TA 3V0BA 1O4YA 2CY6A 3N3HA 1IS3A 5LK5A 4ISQA 1SLCA 1LODA 1IS4A 2GNTA 2CNAA 4AVVA 5EYXA 3FUQA 5GLVA 4XTPA 3USUB 2JJ6A 3ZXJA 3AX4A 3D4KA 2ERFA 2Z42A 3USUA 2R0HA 5GZEA 2YV8A 1CESA 5AVAA 3BTAA 2DVBA 3WUCA 1QOSA 4YGDA 4P9YA 3AP4A 5GZCA 1AXYA 2H0BA 2WLQA 3AP9A 1VIWB 3B01A 3I4IA 3UK9A 3W59A 1AX1A 3V0AB 2KM2A 3WDWA 3V0AA 4GWNA 1A8DA 2D43A 2D7FA 2AGSA 1KITA 4GWMA 3ZXLA 3N36A 4DRRA 1HQLA 4PF5A 1Q8QA 2DTYA 4WV8A 1IOAA 3WLUA 4AGVA 4JCKA 2WKKA 1S0EA 2YXSA 4JC1A 4ZXKA 1LHUA 4NO4A 2XG3A 2DTWA 1JBCA 1CONA 2ZHKA 4XJ9A 1CIWA 4Y26A 1C1FA 2A6WA 1A3KA 2YMZA 4XBNA 4FPLA 1UPSA 4L8QA 1FX5A 2PHRA 4FPGA 5GLZA 1JOJA 1LEDA 1YI7A 2GNMA 2GNBA 1NXD1 1LOAA 2WJSA 3B9CA 3M2MA 3RMXA 3KQRA 1MR5A 2NZ9A 2B7YA 3A0KA 2G4IA 3ILRA 4XIOA 2C9AA 4BLIA 4WZFA 3N7JA 1WW5A 5JOYA 1GV9A 4XXAA 1MS0A 5F5QA 1YO8A 2A3WA 1QF3A 5GLUA 1LESA 3ZSKA 4XTMA 3N35A 1G86A 3A4UA 2W39A 1MS9A 4AGGA 3RSJA 3FLTA 5H9RA 2CWMA 3WDUA 3W58A 3POYA 1VAVA 4XHXA 4CZSA 4M01A 4LBQB 1H9PA 4U2AA 2E51A 1LOFC 4FVVA 1S0GA 1Q8SA 4LBQA 2WSUA 4ZKTB 1G9AA 4YZ1A 1JN2P 3SISA 1EPWA 1LCLA 3V64A 1V00A 2PHWA 2FMDA 3MPPG 1IKQA 1ULEA 1YIFA 3C2UA 3Q9OA 4GA9A 5EYYA 1AZDA 1N47A 2WNEA 1DQ2A 5DUVA 1PZ9A 4YFZA 1KDKA 3D6EA 1G9DA 5KXEA 1V6LA 3UJOA 4MYEA 1HLCA 1PZ8A 5GZFA 1BXHA 1V6NA 1ULFA 1AX0A 1WBLA 2SBAA 3AYAA 3OGGA 4Y20B 5DZEA 3WDTA 5IK7A 4LBLA 1N3QA 1MS8A 4P14A 5HCAA 4Y20A 1FV2A 2D6KA 3CNAA 4XYXA 4FPFA 1GLHA 4P9XA 1UN1A 5CNAA 5GZDA 1CPNA 1LEMA 1W6PB 2ZGRA 1GZCA 5IK5A 1W6NB 3FFZA 4PCRA 1W6PA 2ARBA 4YLZA 5T52A 1W6NA 2E7QA 4YM3A 1CN1A 3AP6A 4GXLA 3ATGA 4K1ZA 5KXDA 1ENRA 1W6QB 3MEPA 1LU2A 2LTNA 1WBFA 1W6QA 2PHUA 1Q8OA 2R49A 1WUVA 3WVJA 4XOGA 1J1TA 3FUOA 4FOVA 2ARXA 2CTVA 4HL0A 3AZXA 1GANA 3AYEA 1LGBA 3RRDA 1MS5A 4Y22A 3FLRA 1WLDA 1B09A 3AFKA 3AYDA 1G9CA 2CWSA 1CVNA 3NWKA 3V65A 4BMEA 2SLIA 1GBGA 1HQWA 3IPVA 2AR6A 3OPZA 3WG4A 1D2SA 3L2YA 1IKPA 2DUQA 1WD3A 3ZVXA 2OW4A 1VAMA 2DVDA 3IN9A 4LBQD 1N1SA 4FOQA 4BM8A 4AVTA 3WDVA 3O0XA 1QOTA 3PVEA 1UZZA 1MVEA 1N1TA 3VUOA 2ZGLA 1A78A 4F83A 2JDZA 3ZSLA 2VUAA 4Z8BA 5KXCA 1LU1A 5DUXA 1AXZA 1S0CA 1S0BA 2A3XA 2DUOA 2P3JA 3WHUA 2ES3A 4BQ1A 1TEIA 2GMEA 5JVVA 4BPZA 4DPNA 1UAIA 4Y1VA 4YW3A 1MS3A 1ONAA 3WV6A 2D3RA 1SACA 2VXRA 2EXHA 2JE7A 3DUIA 3O0WA 3WDYA 2OUHA 2WT2A 2C5DA 1W0PA 3POSA 1DQ4A 5H9SA 3SNMA 2W08A 1CPMA 5IUQA 3B3QE 1SLIA 1LOCA 1UZYA 2GDFA 4R9BA 4H55A 3AZWA 4YZ2A 4FQZA 2OUJA 2V73A 4OZXA 4XJ8A 5FRAA 3WG2A 3QCWA 3OJBA 1GYKA 1MVQA 1URXA 4HANA 3AP5A 3PMEA 4XIKA 3ZYPA 1WW7A 1FNZA 1GKBA 1WW4A 1QMJA 4PQ9A 5T5JA 2BQPA 3VV1A 4BOWA 1XQNA 3AZVA 4ISRA 4YG0A 3ILFA 2PELA
chains in the Genus database with same CATH superfamily
1WLTA 5A7SA 1RUH1 2VMDA 4V2VA 2Y6KA 2LALA 4Q2FA 4YW1A 5FXWA 3T0BA 4BH9A 5JUVA 2VJXA 2PHTA 2YFUA 4Q4Y3 3WF2A 5FXVA 1WZXA 2HWB1 3ZYFA 1V6MA 1VBD2 1ZM1A 2B9UA 1DDLA 4BMBA 2YROA 1SPPB 2JG9C 1LHWA 3BOPA 4W6YA 2NLRA 3WNNA 4B1MA 1RUD1 4CP0A 2ZGSA 4HFSA 2VUJA 1SPPA 2XL9A 3H3UA 4PBPA 3U1XA 2QQKA 4G9SB 4LHSA 4XUOA 5LEKA 1QJY3 1VMJA 4HG6B 3EB7A 3ILNA 4B1LA 4ET7A 5A3MA 1HJFA 1QDOA 2W2IA 1AR61 1J59A 3VD7A 4LIVA 2DURA 2R1DA 1SLAA 3GHNA 4LA2A 3VBFC 2JKBA 4AHZA 1Y9MA 2ADDA 4AL9A 4FO9A 4PBOA 2RHPA 4CCDA 1LECA 5JZGC 2DF7A 4HBNA 1JUIA 5GALA 3DCQA 3MDPA 3FJSA 4EROA 4CDWC 5J48A 4OI0A 2VC9A 1QJU3 1TMF2 4XF0A 4JGYC 4EV0A 3H7JA 2PLV1 2G1MA 3MBWA 3NNLA 5JOZA 2YG0A 5IYYA 1SCSA 2P2KA 4QXHA 3N7MA 4LTAA 5CG8A 5FJHA 3NV3A 3SH3A 1CQ9A 3PU8A 3DYOA 3TOJA 2EALA 3C3VA 2R073 2XL7A 5IJRA 1XB9A 4IEUA 1IPSA 4O61A 5FP8A 1EPZA 1I5PA 3OCPA 4AEDC 2W1SA 3THDA 2NMNA 3MW4A 4Q8KA 2Y60A 2W95A 1EP0A 4WVWA 5CBLA 3BIWE 5DAQA 1DQ1A 2IXLA 5LBBA 1QH6A 1VE0A 1OLQA 4FFFA 4JRAA 5FBJA 2ARAA 2EXIA 3GALA 3KVBA 3I3DA 4BIOA 3H1YA 3CDZB 1HB2A 5TSWA 1O3TA 4XCBA 5JCTA 3BODA 1H2MA 2E7TA 5F1RA 3ZXFA 3GZUC 4QU2A 3VBHC 2Z4FA 1DBNA 3T1LA 5CEHA 5F9TA 2G9ZA 4COUA 4CUCA 4DIQA 4NRQA 3RI8A 1PO22 3F2ZA 3HMYA 3NJXA 2EICA 4DY5A 4IE6A 4GKXA 2V72A 3OD0A 4Y5TA 2FDGA 2PHXA 3JU9A 4FPJA 4UOJA 3IPVB 3LSEA 1LNSA 1DLLA 5DN2A 1AYM3 5KC5A 3JD72 3PU3A 2WFF3 1VBC2 2W1QA 1PIV2 3OY8B 4QQ2A 3KB5A 1LOGA 1UY0A 4RN5A 3OY8A 3VL9A 1TG7A 3N4MA 3AZYA 3GBWA 5FUIA 3NL1A 5LA2A 2YZ4A 5A6YA 1LOEA 2XBO1 4A41A 4AI1A 5C9AB 3HQRA 5FZOB 2A71A 5FZGA 3QH6A 5BUVA 5C8CC 1YQ5A 4Y1ZA 3RFRA 5C9AA 5ABJC 5FZOA 1WA4A 5BNQA 3O1UA 3VDBA 1XSQA 2RDNA 4EZHA 2IZWA 1EYBA 4LPLA 1JYVA 2QZ2A 1S0FA 1FPN1 2VW2A 2QQUA 5IVYA 1OQEA 1NA1C 2VNOA 3LDRA 1X36A 1Z78A 4K3UA 5T50A 4WVZA 1QJX3 3RYPA 3APBA 3EJKA 3MFAA 3WF0A 4BQYA 1Y4WA 1YJKA 3TNPB 4D69A 3O1PA 1JODA 4RGKA 3VL8A 1C8M1 5FZ7A 1D4M3 1PX3A 3VGIA 4A7KA 1G7YA 3FN9A 3ZFGC 5EV7A 4BXSV 1ULPA 2C0ZA 3LA7A 3VBUB 2JDUA 4LBKA 4IE4A 4A44A 3VBUA 1V6IA 3E6BA 2JIJA 4I0WB 3HN1A 4V1PA 5FPXA 3AMQA 4SLIA 1ZX5A 4Y5SA 3GJAA 2VOXA 3QACA 3K4AA 4GMP0 1WKYA 2VZOA 3SH4A 4J1XA 1WCKA 3WEZA 3AZZA 5APAA 3PUIA 3AVRA 4GJYA 2I2SA 2GMMA 4R9CA 2BFUS 4TSVA 4Y1UA 5DPNA 5FY1A 3RPQA 1X9PA 1AR71 3HR9A 4I30A 3RJRA 1ASJ3 4KBZA 4SBVA 3WZ1A 3LE0A 3WNMA 1VPHA 4YM2A 4YG6A 3NW4A 2A6XA 4QB1A 1YQ6A 4RA0A 2DU1A 5DZFA 5L9VA 5ISLA 1JYIA 3VBOA 2VXJA 1F9KA 1VBB3 3ZXKA 4KGGA 1L7QA 2ZEYA 3Q8CA 3PTYA 3I3EA 4IW3A 3B00A 4YW4A 4HVQA 1WLWA 3ZSMA 5ACA3 3MIGA 4LNVA 1QDCA 5T55A 1H6XA 5IFPA 4MX3A 1US3A 3KT4A 2RMU1 5FPLA 5CADA 2V4AA 3NKTA 2VMFA 3SQOA 4AGRA 5M0TA 5LK7B 2WLPA 5BXXA 5BYNA 2BTVC 5H9QA 1AYN2 2N7GA 2BW8A 2EIGA 3CU7A 3P3NA 5H9PA 4AEJA 3MV11 4S2HA 3WNKA 3IIIA 3PIJA 3LOBA 1PO12 4CU9A 1W8TA 3UGGA 5A6XA 2XMLA 2YBSA 2VZSA 5K0UB 1LRHA 2DVGA 5FZ1A 3LEKA 3FBYA 3KF3A 4B7EA 3UGFA 5K0UA 2IFWA 2RS33 4CCKA 5A70A 3O12A 2RJLA 4LOSA 4D8MA 3MUY1 1JUHA 1RUG1 5CA6A 2W94A 4X8NA 1IPKA 1FXZA 3LEMA 2E53A 5T3NA 1W8OA 4K8FA 2RS12 4P9IA 3GHMA 2ZX1A 1OH4A 3JBG1 4XUQA 5A3OA 3WCRA 3CLPA 4COZA 2QDNA 2CGOA 3HOBA 1GNZA 1O4TA 4N43B 4XFHA 3WCSA 1XC6A 4QM9A 3J8F1 4LEJA 1OA3A 3WQBA 1O5LA 5LBEA 1H4HA 4OQ8A 2ZA9A 2AUYA 3SITA 2B9VA 5GLWA 2DV9A 5LB6A 2EXJA 1IGOA 3E5UA 4IQPA 4E8DA 1V6KA 5FY8A 2BRTA 1VALA 3VLBB 2ZZJA 3POWA 3WINE 1TME1 3HT1A 2B45X 3PVBB 4MVTA 4BLJA 2QQMA 3HVDA 1E5RA 3TNQA 2H0VA 4OI4A 5JSPA 2JD4A 4IEWA 2BUKA 2OPWA 3RYRA 1BYHA 3KM5A 3MW2A 3UKTA 5I0UA 4PF1A 1QNWA 3JQWA 2MEV3 1BMV2 4CP1A 5JDBA 4XAEA 1WA6X 2VW1A 3VZLA 5CYYA 3K2OA 3PTRB 2NPIA 3ZYHA 2D6LX 1UPIA 2A5ZA 4AVCA 1SFYA 1YQ2A 3J7NA 3RDIA 4DY3A 4FAGA 5FMOL 2WS92 5FUNA 5IHRA 2IXKA 2D6OX 4LOTA 4OLLA 2YYOA 3A0NA 4XMAA 1H1IA 1QJFA 2K9ZA 5JOWA 1RHI1 1VLNA 2Y6JA 5IK8A 1J3QA 2OVUA 5JLVA 3JUUA 1R1A2 4FTEA 5C9AC 4BJ0A 5GZGA 4IDZA 2GN7A 2R0FA 4LKDA 3P3PA 4XFBA 2RS53 3SH5A 4O65A 1JOBA 3IAPA 3BPZA 3KCYA 4Z1VA 1IQDC 1VBE3 3A23A 2WA4A 2Q8EA 3WY6A 5LY2A 1W8FA 1IS3A 4CCMA 3JXSA 1ZBA2 4ISQA 2OX0A 5CIRA 5C7GA 4GIQA 1C28A 2CNAA 5DAPA 4XF9A 4RR3B 3USUB 4XTPA 5IVFA 1W8ZA 3H42B 3USUA 4RR3A 2VE1A 1V9U1 2WZR2 2XQRA 3BVCA 2WL1A 3VBUC 4A4AA 5AVAA 3BTAA 1NY71 1O6UA 1KGYA 1QOSA 1CZSA 1Z7S2 1RUJ2 2DVBA 2IVIB 1ZZCA 1AXYA 2Y6GA 2YFZA 3AMMA 3B9IA 1W3VA 5FKCA 2Q8CA 4DEVA 3B01A 1Y3TA 5I0DA 1AR93 1X7NA 4LR4A 2VZUA 2ZX4A 2G9GA 2VMGA 4CCCA 1OPMA 1RUI2 3E5QA 3MV01 4E4ZA 4GWNA 1A8DA 2VUCA 4IEVA 3V56A 5FK7A 4Q4X1 3ZXLA 3N36A 3D0SA 4QHZA 1C5IA 3WLUA 2DTYA 4W6WA 4KG8A 1S2EA 4CCEA 1H8TB 3IAQA 1S0EA 4JC1A 4ZXKA 1LHUA 3ROUA 1JMUB 1K5JA 2AEZA 1H8TA 2DTWA 2XUEA 4KU8A 5FPZA 1CIWA 4UBGA 2XJRA 4UFMA 1C1FA 4S2GA 4XQWA 5FO9B 1A3KA 2VZQA 2YMZA 4XBNA 1UPSA 2CAUA 4QDRA 4DMIA 1FX5A 2C24A 5IVEA 4OI1A 5K8SA 3MIEA 2XKOA 3I2DA 3OB8A 5DMYA 3SKVA 2VVFA 1DZRA 1ALYA 1NXD1 4Q4Y2 2QQLA 1LOAA 3M2MA 1FI2A 4KH9A 4IGPA 5C5UA 1LB2A 3NNGA 2VBBA 4LO4B 3ILRA 2FDIA 4ZY9A 4WZFA 4CCNA 1POV1 1C8M3 1MS0A 5EP9A 1YO8A 2I45A 1KS5A 1LESA 1QJY2 2W1UA 2WA3A 1G6NA 3ZSKA 4LA3A 2XJTA 3ELNA 5K0UC 3TN91 1UXXX 1O8SA 4AGGA 1OLME 2Y64A 3I59B 3OOXA 1E57A 2WN3A 2XHNA 3I59A 4QX7A 4IERA 1J84A 3C7GA 2DCZA 4XABA 3W58A 1CIYA 4AEKA 1D4VB 5I8SA 4CXWA 1JYTA 3DN7A 4LBQB 1H9PA 1EV12 4U2AA 4A2UA 3CEWA 4UFKA 4LBQA 2V5DA 3GDBA 4X6QB 4E2QA 5J96B 5FMDA 4QHOA 2O8QA 3SISA 1BHGA 1QQP3 4C91A 2PXJA 4E4SA 1GWMA 4K9SA 4N43C 1OC1A 2PMWB 2ZTNA 2J22A 3MPPG 3I2OA 4MADA 5LEJA 5F3GA 1KFUL 1CZVA 3GBFA 1DQ2A 3DXUA 4RHV2 2R072 5FUPA 2DDUA 1STMA 4NWVA 1OURA 1VRH1 2RR13 5KXEA 1O7FA 2WABA 4PJYA 4MYEA 1PZ8A 1NLRA 1XOYA 2RM21 1PGL1 1WBLA 4L0PA 4QWNA 1CAXB 5DZEA 3ZDSA 4P14A 1N3QA 5I91A 1CAXA 3K48A 3MUZ1 1FV2A 4NIHA 3MHZA 3OD4A 4IXLA 1O3SA 5KHIA 4XYXA 1GLHA 1UD1A 1HJGA 3SEEA 5CVRA 1R091 5GZDA 1XYOA 1GZCA 1W6NB 2Q1ZB 3TYJA 3BCWA 4AEMA 3UESA 1AUYA 2FMYA 4UWDA 5T52A 1W6NA 2Q4SA 4XPVA 3WNLA 2GC1A 1SFPA 5IVVA 4GXLA 5JWPA 2JDMA 2PYTA 3J7HA 4B8EA 1LU2A 3I2IA 1WBFA 5FMOS 2HWD1 1JYWA 1E5IA 5SV5A 1OVSA 3QOPA 4NIGA 2RV9A 3FUOA 4CSWA 3ZOIA 4Z07A 3AZXA 3UV9A 3W5NA 1XNTA 1TQ5A 2XR4A 3B02A 1LGBA 3J8F3 3FLRA 5FXXA 3S7IA 1G9CA 1CVNA 3NWKA 1I9RA 1H8VA 3DECA 1U5YA 3HN3A 5L9BA 3SCFA 2QQVA 2G9FA 2AR6A 3OPZA 3THTA 5F3IA 3WP6A 1D2SA 3L2YA 1WD3A 3Q8BA 2JG8B 4BQWA 4S2FA 3H8OA 4XQDA 1NX9A 5J1XA 4COWA 3O1RA 2JG8A 5FYYA 5JIUA 4AAXA 4RR3C 2XJSA 3LPFA 2Y38A 4W4ZA 1ZZBA 1UZZA 4EQVA 1F35A 3WNPA 4D0QA 1N1TA 3W5MA 4F83A 4Z8BA 4MV2A 1S0CA 1S0BA 4XFGA 4BXFA 4UFIA 4Y1VA 1Q3EA 4CU7A 1IZ3A 1CX1A 3AMNA 2WO1A 2C1FA 3T2OA 2PQSA 1QJZA 1ONAA 3WV6A 3BTYA 4LLOA 3BYWA 4E4DX 1SACA 5CZKA 2E63A 2EXHA 2JE7A 3DUIA 3LA2A 1BK1A 1U12A 1RUF1 1YIPA 4F3JA 2WDBA 1QHDA 2WT2A 5JAXA 1NAEA 1DQ4A 1H8TC 3B3QE 3C7OA 1LOCA 1UZYA 3IIAA 4DUXA 3FMGA 1OMIA 3AZWA 4YZ2A 2BEOA 1YFWA 1PGW2 5KR7A 1POQA 5FV3A 4QGNA 5FRAA 1XU2A 1GYKA 4HANA 3U11A 3CJXA 4MGZE 3J7LA 1W04A 1ASJ2 1QMJA 1VJ2A 2BQPA 4GMP3 4ZU5A 3KV5A 5T5JA 4BOWA 5F8PA 2W87A 4ISRA 4YG0A 4DXZA 4OFGA 1OHFA 1VBB2 2NMOA 1ZNPA 5JXIA 4L11A 5ACA2 1AR81 4PQQA 1ENQA 1V9U3 1UIKA 3MPBA 5LW9A 1HN1A 1BJQA 1DGWA 1YQ8A 1MZ5A 2DVAA 3N9PA 2HWF3 4NWWA 3M3OA 1CX4A 3WW4A 2HEWF 4CYDA 1JTZX 2VCAA 2IXIA 4EJRA 5K9YA 4JVAA 1OT5A 1X50A 2J1TA 4LBJA 4C90A 2VZRA 2QQPA 2UWBA 3KV4A 5FYSA 1IG0A 2HJIA 2W1WA 1EUUA 1WCSA 1AF9A 5A7WB 4IESA 2WNVB 1LENA 2A3YA 5J36A 4FAHA 1NE4A 2ZGNA 5A7WA 5FZMA 2WNVA 5DUUA 4NRPA 2VOWA 2OYZA 3H7YA 1ZRIA 1RMU3 2ZS6B 4UFLA 2GNDA 1JU3A 5FZLA 5FZFA 3UYJA 5J3UA 4ATEA 3AFGA 3AC0A 3MFCA 3ASIA 2IFRA 1UKGA 1FATA 1RXFA 5FZDA 2VZ1A 3CZJA 1APNA 1REEA 4QT6A 2A6ZA 3RNSA 4QGLA 4UW6A 2I07B 3ITQA 3T1MA 2Y6FA 1DF0A 3ZXGA 3EXUA 1E5SA 4QDQA 3VHOA 4DRVA 3AKQA 2BGCA 4U36A 3PJYA 1ZBE1 2ZGOA 4EZ4A 1CD3G 1OOPA 1HB1A 3ETPA 1H2LA 1RXGA 4OHZA 4AZZA 1RUC3 4EWEA 1VBA1 1UYXA 1IS6A 3MF6A 2FDHA 1MZFA 2UY9A 5FWJA 1JZ6A 4QX5A 3EHKA 4QQLA 4RS5B 4YGCA 1N3PA 5K7PA 4RGGA 4M0HA 4RS5A 2MEV2 2X53S 5A7NA 2P5BA 4CDQB 1WMFA 2R063 4P9YA 4XDPA 1DZTA 4YVSB 1XPWA 2O0OA 4H7MA 2PAMA 4O7XA 4HKWA 3ZLIA 4AI9A 1J58A 2O14A 5LA1A 4YVSA 2YU2A 2TUNA 2JECA 1BEV1 1QXJA 2HWE3 1KDMA 3NV2A 2W92A 4I01A 3CJIB 3PJQA 4FP2A 1XNBA 1T6GC 4LBMA 4EN6B 1ZRDA 3CJIA 2XDVA 4FPCA 4IV1B 4UFJA 2WQZC 1Q5OA 3H8RA 3S30A 3VBRB 4IV1A 2PHFA 1RINA 1GP6A 3HJRA 4D94A 4QQPA 3VBRA 3CQOA 4OULA 1JXNA 1VRH3 1H9WA 1KXGA 3ACHA 4H7LA 4E27A 5FYHA 4CEWB 2JG8C 2OZ6A 5FYZA 2FCTA 3TEYA 2RS52 4CEWA 5FP4A 3FZ3A 3HNBM 4QB2A 1D0HA 4ARYA 5A3WA 4QX0A 1VBE2 3ON7A 5FZHA 3CIHA 1NG0A 1LULA 4G3YC 3HWJA 4XFCA 5DABA 4F8AA 1UXZA 3NMBA 3AKRA 2JIGA 2VG9A 1Y7BA 2BV4A 1UZVA 1COV3 3KV9A 5KXBA 1R093 1AJOA 3OSDA 3ZIWA 3W20A 2VPVA 5A7OA 1G9BA 3BUCA 4LE4A 1I5ZA 4CUBA 1MZ6A 2QFEA 1PVC1 3KT7A 3WT3A 4D6SA 1S2BA 2AH2A 1WLCA 4LLFA 4PI0A 2HWD3 5DQ0A 1OXCA 5L7OA 1DGLA 1AR92 1FOD1 3EO6A 2QJVA 2ET1A 2XJVA 5HV4A 1ND2A 1UX6A 4N7UA 2KD7A 3NNFA 4BIFA 4Y5Z0 1RC6A 1FT9A 1WGPA 5FMBA 1HV0A 2EF6A 4EE2A 4EN7B 5T5LA 1SLBA 4I2OA 3AK0A 4ZU4A 2J1VA 3WW1A 4FXKB 3UL2A 2CYFA 3I7DA 4LHKA 4Y22B 1JHNA 1VMHA 4XUTA 4DEQA 2R30A 2ZGTA 3FE5A 4XHBA 4Y22A 5F6LB 4YZ1A 2BWAA 1QY4A 3VD5A 2ZAAA 4FPHA 5HCBA 1LHVA 2NP0A 4AHXA 4JAAA 5BV6A 5SV8A 1GU3A 3M1HA 4K8RB 5FYUA 1PHMA 1HRI3 1Q43A 3P1IA 4LHLA 5JOXA 3M70A 2GC2A 2RDQA 1RIRA 4NIAA 3E97A 1ZA4A 2OPKA 4AVSA 5A6ZA 1JZ5A 1FAYA 4QAWA 4V2WA 1Q56A 2YDEA 3DGTA 3EMRA 3WP4A 5DUWA 5EWSA 4P00B 3AKPA 5LCWL 1OUXA 1A8MA 1MEC1 5AVPA 5IATA 4N90A 4XE9A 4N53A 1HXS2 3H8XA 2GP3A 2VULA 4QPWA 2WNVC 1D7PM 1GP4A 2EXKA 2P34A 1AVBA 5BNNB 2WQ4A 1J1LA 3OTFA 1RUE1 2AENA 4ZZ8A 4QM8A 2GALA 4EN9B 4LO8A 1IQAA 2P1BA 1UF2C 5BNNA 1BVP1 3U0ZA 4GB33 1XNKA 4EYUA 3KGZA 4R9DA 3KT1A 4IEOA 5FMCA 1U5IA 1DIWA 2ATFA 2IXJA 4PLNA 3WG1A 2GAUA 1RVF3 5I0TA 4LMFA 1W28A 3AXEA 4QB6A 1Q8VA 1EAH3 4F7ZA 2UY8A 4ASMB 1O91A 1LHNA 4FPKA 2RR12 4UW3A 2HYKA 1MACA 3WF3A 2CDOA 1WMXA 2R041 3QLQA 1C57A 1N1YA 1UIJA 4AQ2A 2JDPA 2LROA 2ZMNA 1RJ7A 1UMZA 4IEQA 1JU4A 2VMHA 2VQAA 1RL3A 3FBMA 4XXPA 4RS5C 3AYCA 2ZHNA 3ZYIB 1NLSA 4QX2A 3N9MA 4CDQC 2VZ3A 4AOCA 1SBFA 1N3OA 4AE2A 4YVSC 2K0GA 1AL21 2BU9A 1KQRA 3POJA 3CBNA 1W2OA 4AR2A 4K7JA 3M3QA 2WO2A 2E33A 3CJIC 3OBZA 3T4VA 4MHUA 2ILMA 5J37A 3S5AA 2VY0A 4K6BA 1GR3A 4IV1C 4I09A 4TLFA 4D7YA 1Z0HA 3NKGA 2XH6A 1NYWA 1K5MB 4UW5A 3VBRC 2J1EA 3RZHA 4M3CB 1JW6A 1VAKA 3KWVA 1K5MA 2W52A 4Q26A 2Y6LA 5FZ8A 4E8CA 2JDYA 2YY1A 4M3CA 2ZKNA 4ZS3A 4LQRA 3RMYA 3ZX7A 4CEWC 3HNMA 3AXDA 4ZONA 5DZGA 1M06G 4QKFA 5HI0A 3IM0A 4QX1A 1YFYA 4IV3B 1SQ4A 2P3YA 4WVVA 3M3CA 4FOWA 1P8JA 4IV3A 3H0OA 5DDJ1 5T5OA 2FDJA 3ACFA 1BBT3 4Q4W3 2VCBA 4G4FA 5GM0A 4L99A 1L7RA 2XKPA 4NVPA 4DXTA 1HRV1 1OKOA 3NJVA 4RYDA 4AW7A 3UKNA 3KGLA 1BLZA 4FOYA 1XJAA 4CTEA 3V0BB 2MNGA 4OHXA 3KSCA 3V0BA 5L9RA 2ETEA 4BQXA 5JPNB 5KHKA 2CY6A 2A1XA 3N3HA 2XLAA 1UZWA 1E5HA 1PVXA 2VECA 4LO7A 5A1AA 2WYFA 3NNMA 4CCJA 3T4HB 1R083 1ULOA 4AVVA 5EYXA 3FUQA 2BNOA 2ERFA 1GZTA 2E9QA 4NHMA 2VVDA 1ST8A 5GZEA 2ARCA 2BNNA 1CESA 5CKMA 1CGPA 4ASLA 3WUCA 5GZCA 4Q4V2 3ACLA 1JH5A 4GZ9A 2WN2A 3UK9A 4R4ZA 1AX1A 3CO2A 1VBD1 2KM2A 3O1TA 2AGSA 3RI9A 4ZZ5A 3MGUA 4AVAA 3LEGA 1HQLA 5LWBA 3MF9A 4QQOA 1NUKA 2WKKA 5HV0A 4A3ZA 3A21A 4JKKA 3BN6A 1ZREA 4XJ9A 3VBOB 3JZVA 4JTNA 4EWAA 3TEZA 4CCOA 3VDDB 3IZOA 1ENXA 4L8QA 3VDDA 4FPGA 4UF0B 4BB3A 1YI7A 4FTSA 4EWDA 4QGMA 1XNAA 4UF0A 2W9XA 1K12A 2WJSA 3B9CA 1MR5A 2NZ9A 1TMF1 2B7YA 1W8NA 2G4IA 3H3ZA 4WM8A 4BLIA 1HQNA 2VVEA 2HWF2 2YC2A 1NQDA 1FOD3 5GLUA 5BNNC 5LY1A 4CXXA 5JXGA 3A4UA 3T0DA 1QIQA 2W39A 4L97A 2B42B 2JEMA 2CWMA 2BBVA 1FMD3 5B2GB 4XHXA 4CZSA 5FY4A 5F5CA 1RMU2 4UT5A 5HCHA 3KVAA 2WSUA 5FXZA 2E32A 1G9AA 1JN2P 2FCVA 1C8NA 3ZN4A 1RUH3 3OF1A 4N9IA 3KQ4B 1EPWA 2BP6A 1POV0 2GSYA 2WRAA 2GC0A 2IXCA 1IKQA 1ULEA 5FPBA 2HWB3 5A3TA 1YIFA 3C2UA 3Q9OA 2QZ3A 1UO9A 4GA9A 2I74A 4LKEA 4TWTA 3BB6A 2Q8DA 2Q8OA 2ZAHA 2PHDA 4GULA 2BPA2 1PZ9A 1PO21 1RUD3 4YFZA 4HT1T 3O1SA 2JWPA 5CU1A 5GZFA 1BCXA 1V6NA 5FJKA 5A1FA 2ZEZA 2RJ2A 1AR63 4NHYA 3JD71 4AFAA 1F15A 3M3IA 1MS8A 1H0BA 1VBC1 1PIV1 5KWRA 1XU1A 2D6KA 3K46A 5AC92 3M8LA 4OQ9A 1HB4A 2DCTA 4WM7B 4FPFA 1HV1A 4MGKE 4GH4B 4WM7A 1K42A 5ANNA 1CPNA 1LEMA 1W6PB 2HWC2 3GBGA 4GH4A 2R062 4QPGB 1OA4A 4PCRA 4M4RA 3VDAA 1W6PA 4QPGA 1UQXA 2ARBA 1K5MC 4YM3A 3LFIA 4Z92B 3ATGA 4HKOA 4K1ZA 2PLV3 2HWE2 5AFEA 1ENRA 5JSOA 4KWLA 1NOVA 4CU6A 5FP7A 2PHUA 4Y3OA 5C6CA 2R49A 1J1TA 4IV3C 4FOVA 2CV6A 2NQYA 3OUIA 3I2FA 4AK3A 3LIHA 4AAPA 1GANA 3NQHA 2RVAA 1Y9QA 5A33B 1SMVA 5A33A 2XJUA 5EJ3A 1WLDA 2R043 1YCIA 5C3QA 2QKDA 3AYDA 2CWSA 4XAAA 5ANQA 5FYMA 4OYUA 3OEBA 3ZM8A 3CMGA 5FPAA 2E31A 3T09A 5AFBA 1OF3A 3IDAA 1IKPA 2DUQA 5C33A 1UCXA 2DVDA 4Q4V1 4MH0E 1F5JA 4OUEA 2YPDA 4LBQD 1N1SA 4FOQA 1W2AX 1COV2 2WR9A 1AL23 1OQDA 3OUJA 3BIEA 3WP3A 2VZVA 3GZEA 1YLLA 4CE8A 1YFXA 2ZGLA 3VUOA 1WMEA 2VUAA 5KXCA 1HX6A 1LU1A 2AEYA 2P3JA 5DUXA 2DUOA 4A7ZA 4BQ1A 3RZJA 2QE3A 5JVVA 4D6RA 3PUHA 3OUHA 3K77A 3NAPB 2OQ6A 3I3BA 2X09A 3ETQA 2FDKA 3NAPA 3KLSA 2Y0IA 1PMJX 1ODMA 3HIFA 1W2UA 2OUHA 2YBKA 5JR7B 3R0RA 2C5DA 3N9OA 2W08A 2XBO3 1CPMA 5IUQA 3C7FA 4DXSA 5DDJ3 3VBOC 5LRRA 2VBDA 2OUJA 4FQZA 4OZXA 4PDWB 3RZLA 1SDDB 4JDNA 1AYN1 4ZS2A 2C9KA 3VDDC 4PDWA 2FZ2A 2Q0AA 5HPOA 5JR2A 3I2KA 1PO11 3NNJA 4MSVA 4XIKA 1FPN3 1WW7A 1GKBA 2FZ1A 4QPIB 4JGZB 3POIA 3FL7A 1HRI2 2HBTA 4QPIA 2WFPA 3DYMA 4WM8C 4JGZA 1CAWB 3ILFA 3EYPA 1AXKA 5D2AA 1CAWA 1XE7A 3RJ2X 3ZXEA 2AC1A 2V09A 1OLRA 4CPBD 3MW3A 1WCUA 1BQPA 3LAGA 2KXLA 1QJEA 2RS11 2QQJA 4XMIA 1S1AA 2JE8A 1DQ6A 4OCTA 1W03A 4QKDA 2VMIA 2OT7A 5BNOB 3T0AA 2BDRA 2P3IA 3PVNA 3WHTA 5BNOA 2ZHLA 2DYCA 3O5SA 1W6MB 3T08A 1UYYA 2PA7A 2A73B 3NRUA 1W6MA 1YYNA 3GJBA 2JE9A 2D98A 5FYBA 4XJUA 1KJLA 3N9NA 3KHBA 1JI6A 3LOIA 4YFWA 4BHPA 3X29B 4LK7A 1QU0A 3VKFC 1G9FA 4GB32 4L9BA 1UW8A 4HZFA 4TYSA 2UU8A 3VKMA 2RE9A 1YI9A 4RQPB 4BZ4A 1QJU2 1AR73 4RQPA 1DU3D 1RVF2 3C7EA 5EHDA 2KR2A 4AWDA 2GH8A 1YRZA 2D6NA 1EAH2 3ZPYA 5AC91 4BWOA 4XBQA 1CAUA 3D5OA 1W9SA 1BMV1 2WO7A 2VZPA 3ES1A 3KV6A 3VD4A 1YXWA 2HWC1 3PNAA 4AQTA 3MO4A 4KL1A 4HVOA 1UU5A 1ULDA 2A70A 1DFQA 2RMU3 3MI8A 1CWPA 1TMF3 4MO3M 4DS0A 2WS91 1F4AA 2QCSB 4YZ5A 4C1XA 4P5YA 4WM7C 2DFCA 3MYXA 4GH4C 3B93A 1ZVFA 1GOGA 2PN5A 1H2NA 4QPGC 1R1A1 4P5HA 5T54A 2ZHMA 2QQNA 2Y34A 4NOTA 3B69A 1YHFA 1WMDA 3EBRA 3W21A 2J1AA 5FOJB 2JXAA 1RUG3 3NJYA 3OBRA 4JDMA 4AG4A 1YUDA 3PL0A 3AJZA 1W90A 3POBA 4W65A 3WW2A 4RFRB 1VR3A 3JBG3 3K4ZA 4M3CE 1DQ0A 4RFT0 2HH9A 4CPBA 5JXJA 4Q8LA 1AYM2 5LBCA 1ZBA1 2WFF2 5A7PA 3P5BA 4AQ6A 1LGNA 4UFHA 4E9KA 5EXOA 1X8MA 3UNPA 3SC7X 3U4XA 5KHGA 1KEXA 2WZR1 3GM8A 4FPOB 4I3PA 4FP3A 4YM0A 2H6CA 2C26A 2CU5A 1PO23 4NN0A 1Z7S1 1RUJ1 1SLTA 1BK0A 1DQ5A 2Z69A 4HKLA 4NUBA 1GUIA 1BBT2 4Q4W2 5GKAC 3I49A 4Q0UA 1TME3 4B29A 3ZMNA 1OFSA 1RUI1 3JD73 1ZRCA 3N7LA 2Y26A 5FY7A 4Y4RA 4YZ4A 3IB3A 2JDAA 3K3OA 4N8MA 1QJX2 4FSJA 1AJKA 1REFA 3INAA 1T6BX 5C3SA 1WD4A 1R082 2BBAA 3HT2A 1D4M2 4WZCA 1C5HA 1H1AA 3NAPC 1ULGA 5FTTC 1GOHA 1OBNA 1OKQA 1OUSA 1SBEA 4YG3A 3TWIA 3A7QA 4FI9A 5F3EA 1JZ3A 1S0JA 2XLGA 1PMIA 2YC4A 4Q4Y1 1RHI3 4R8HA 1PGSA 1UOGA 3QD6A 5FREA 1ZZ9A 4FBFA 1YC61 5F6KA 2JD9A 1H30A 1GOFA 4BYYA 4NAMA 4DB5A 3U75A 4LBOA 4QX8A 1UOJA 1GMMA 2ZMLA 4PDWC 4XFFA 3M3EA 3H1WA 1D0GA 1HKDA 1GNYA 2IVJA 1QJY1 4W8JA 3BU7A 2V5YA 2R16A 2P17A 3FFQA 4HK9A 3SHRA 4QPIC 1MZEA 4LO6B 2W3JA 4JGZC 1T2XA 1IS5A 4DO0A 2BERA 4ITCA 2PFWA 3D82A 1MS1A 4JQRA 2ZBJA 2ID4A 4CUAA 2A6VA 4RL7A 4FFIA 1EV11 4C8DA 2YGLA 1O59A 5EFUA 1UNBA 1F2NA 2K2SA 3J9SA 4YW2A 3S5QA 4ATFA 4E2SA 3KCCA 3E5XA 5BNOC 3PLQA 4K20A 1MS4A 3R6SA 4S2DA 3CF6E 2Y6HA 3RWNA 3ZFFB 3ZPOA 2WT0A 3VN4A 4CRQA 1SEFA 2ENRA 3PIGA 5EPAA 3AP7A 1GWLA 3ZFFA 3D3AA 4KU7A 3WXPA 1RITA 2RDRA 3VKLA 4RHV1 2GP5A 4QHBA 2R071 5HXMA 4BQ5A 1ULCA 3NV4A 4Y1XA 3SMHA 2WZPP 1CJPA 4Q4X3 1GQHA 2RS32 4RQPC 4K21A 1JYCA 4TZDA 1ZZ8A 1R1ZA 2VR4A 4IGQA 1FMD2 2ZABA 4JHTA 4XJWA 3RS6A 1F8VA 4AI0A 1VB4A 3N9QA 5FZ6A 2BNMA 3I3MA 1UX7A 1XSRA 2ZX0A 3B94A 1RUH2 4KBBA 4YNIA 4GWJA 1AX2A 1TE1B 3T2TA 3NJZA 3TRSB 1IHMA 3OPTA 4AXOA 1PX4A 2WC2A 2VQUA 2HWB2 3IBMA 5BPXA 3VKNA 2DBIA 2ZPXA 1J3RA 3JQXA 1OOPB 2PAKA 3JB4C 5F39A 5FY5A 5F3CA 5I93A 1ODNA 3GXUA 1L3JA 3S0MA 1RUD2 2GU9A 4XEZA 1POV3 1S2KA 3O1VA 3HBKA 2ADEA 2BGPA 4MLOA 5FZBA 4INDA 3WNOA 2ZGUA 4UYBA 1L7LA 3WF4A 1QOOA 1GZ9A 1U0AA 1DYKA 4I02A 2JB8A 3DV8A 3TN93 2ZACA 5A3NA 2B5HA 1AR62 4FTBA 2FHRA 3DYPA 1S0DA 3TEWA 3H8UA 1EY2A 2HBUA 2VQTA 4XACA 4JQTA 2NN8A 5KHHA 2ZJCA 3FLPA 5E8AA 2X05A 3OGJA 4LXLA 3SCHA 1DZQA 3ZSEA 5C8WA 2RG4A 4XCAA 2WAOA 1Q8PA 2ZMKA 4J6GA 3IDCB 2QTWB 4HN0A 3ZXAC 4AEDA 2PLV2 3R4SA 1QXRA 2TEPA 3TB0A 5E1RA 3M7AA 5J7MA 3H9AA 2VOKA 4FCAA 2QUOA 3KF5A 4P02B 4A3XA 2HEVF 3WQ1A 3B5LB 4XW3A 4AI3A 1QJX1 5CKNA 3O1OA 2VGDA 2PQQA 4QKNA 4MG2A 4YW6A 3K51A 1GZWB 4DQAA 2MPFA 4O9GA 4FXGB 2RM23 4IE5A 3VBHA 1W9WA 1GZWA 2UURA 2ZGPA 4Q1RA 4HSJA 2WS93 4URAA 3ZFEB 2A75A 2EAKA 1GSLA 4JTOA 4YRDA 5FO7B 2HKXA 4NROA 3ZDVA 2WT1A 2CAVA 4GWIA 3ZFEA 3T2QA 3NSTA 2VH9A 3ACIA 1JYNA 2ZEXA 3OBTA 1O3QA 3WSOA 1QKQA 5CKQA 1O3RA 4ZPIA 4CDXB 1F31A 3IWZA 3RG0A 1VRBA 4CDXA 1TNFA 3IT8A 4ZXEA 1PGW1 1W06A 1DLCA 5LK5A 4ES8A 2F4LA 1XE0A 5FCCA 5L7OB 4IEPA 1W0NA 1IS4A 1XXNA 4Q5OA 1ASJ1 4A7YA 4OMDA 3BI3A 4NIDA 1I6XA 2JJ6A 1ND2B 4B3NA 1S55A 3PUQA 2BOIA 2R0HA 2OXBA 3ZXDA 3H3LA 1ACCA 1US2A 1VBB1 2JX9A 5FPVA 2VNVA 1NLQA 4C0BA 2EVXA 2H0BA 2ZX2A 2WLQA 2WWUA 3AMPA 3AP9A 3ES4A 3W9AA 1VIWB 1Y43B 5ACA1 4Z2AA 4META 3W59A 5D8AB 3H50A 3V0AB 5FZ3A 4CDUB 2XBO2 3R4DB 5D8AA 4CVUA 3V0AA 3WF1A 2D43A 4CDUA 4J25A 4XUNA 1RUJ3 1X8EA 2W0XA 1NCQB 4DRRA 2BJSA 4J1WA 4PF5A 2VO5A 1NCQA 4WV8A 3ACGA 3WQ0A 4AGVA 1B35B 2Y8KA 2DCKA 1FPN2 4NO4A 2J7MA 1A34A 2ZHKA 1B35A 3FX3A 3KD4A 3WW3A 1RUNA 3DXTA 4IEYA 3POFA 2K46A 1NT0A 1OFNA 3K75B 4LT5A 4OVEA 1XBFA 4JKMA 1DP0A 5GLZA 1LEDA 1H2KA 5FQ0B 3ZFFC 1C8M2 2GNBA 3SCGA 2R7EB 1JZ4A 5FQ0A 5JPMB 4N53B 3RMXA 2B4KA 3KMHA 4KI5M 4XURA 3A0KA 3LQCA 4DUVA 1K45A 3N7JA 2B46X 4YSFA 1WW5A 4XUPA 4AFDA 4CP9B 5JOYA 1RUF3 1W99A 4N7IA 2A3WA 4A42A 4HPKB 5FYCA 4CP9A 3OEAA 4PLOA 1PK6B 3AL6A 4HPKA 1GQPA 3N35A 4XTMA 3VHNA 4IUGA 5A6QA 4LE3A 1PK6A 4W6XA 4D7SA 3I97A 3RSJA 4FFGA 4JHZA 3VZJA 3UETA 1QQP2 4D7TA 1AR72 5JXHA 1M4WA 4M01A 2VMCA 2YPJA 2AACA 1S0GA 1Q8SA 2VMEA 5F5IA 2PAEA 4IL7A 2CDPA 4ZKTB 1OOPC 2JB4A 2WZEA 2P6CA 4L92A 4NHLA 3LPGA 1J3PA 3E1F1 1WCDJ 2MEV1 5FZCA 5IAVA 5CFCB 1EV13 1OLMA 1V00A 2PHWA 3MICA 5CFCA 3U10A 1AR83 2HLEA 3ZR6A 3G6JB 2O1QA 4UXAA 5EYYA 1N47A 2RMU2 5DUVA 4PLMA 2P4EA 4TLGA 2XHKA 2QQIA 3VZNA 2DBNA 4CP2A 3VB9A 4XDOA 5B4XA 4PIXA 1BXHA 3VHRA 1UOBA 1AX0A 1NCRB 5IVJA 3AYAA 4ZHNA 3OGGA 4PHZA 4RHV3 3TEXA 1NCRA 4GJZA 4LBLA 5HCAA 1TVGA 5FP3A 5FR3A 1OF4A 4BQ4A 3CNAA 3OGSA 4P9XA 1UN1A 1RUG2 1W9TA 2RS51 4LO5B 5CNAA 2VNRA 2OQ7A 3D8CA 5IK5A 5C71A 1S4CA 4JZRA 3RZZA 2QVSB 3FFZA 4B4PA 4DXRA 1VBE1 5F37A 3JBG2 2BVBA 2E7QA 3VDCA 2WAAA 1CN1A 3DKQA 1GQGA 1W8HA 5KXDA 2KA3A 1TZOA 2BYVE 3J8F2 2X8KA 2WNOA 1WUVA 1OH3A 4AQSA 4XOGA 5KHJA 3FC0A 4W50A 2ARXA 2WNUB 2CTVA 3HQUA 4LITA 4HL0A 4LKFA 5C5TA 1ZBE3 3DPRB 1OD3A 4IE0A 3ZFEC 2WNUA 3RRDA 3WD5A 5CFDB 1MS5A 2WWJA 1VBA3 3DPRA 3OBAA 4HONA 4NIIA 3MLJA 2WIIB 3AFKA 5CFDA 4QU1A 1IPJA 1AR91 2IWGB 1VB2A 1TME2 4XETA 4CDXC 2Q1MA 1GBGA 5LASA 1HQWA 3K4DA 5BNPB 4OHVA 3IPVA 3WG4A 5BNPA 2X29A 3ZVXA 2OW4A 2TNFA 1VAMA 3HD8B 3IN9A 1K3IA 2X5IB 5FY0A 5DAXA 5L7OC 3LDKA 2X5IA 4LIUA 2OA2A 3WDVA 3MLKA 4LULA 3RVHA 1JYXA 1ND2C 4JRLA 1QOTA 5EJZB 4FFHA 3PVEA 5A80A 1BEV3 2ZKLA 1CAVB 3KZ4C 3RWKX 2WWSA 2IUWA 2UYBA 3ZSLA 3VZOA 1CAVA 1V70A 2HEYF 4X6RB 2A3XA 4TXWA 2XQXA 4DPNA 4BPZA 1UAIA 5D8AC 1RHI2 2D5FA 4COYA 3U14A 4CDUC 3O14A 4RSUA 2Q1FA 4QXKA 4DZGA 1PNFA 4CCLA 4MZUA 4NMIA 1NCQC 2WUHA 2D40A 4JV4A 3POSA 1JS9A 1W0PA 1ND3B 3ALQA 3SNMA 5IVBA 1B35C 1ND3A 3RZKA 4QXCA 5HBAA 4H55A 1HXS1 1UY1A 5FWEA 2JENA 3OJBA 1MVQA 2F6BA 3AP5A 3OGVA 3VV1A 1NQJA 4LUKA 4MOAA 1RTVA 1XQNA 3AZVA 2L9LA 4WM8B 1V9U2 4N53C 4MGTA 4E2GA 4IGOA 4Q0VA 2PELA 1PVC3 2VTXJ 2D5HA 1QQP1 1DGWX 1NY72 2TBVA 3T3YA 5JMCA 2XPJA 4WVMB 2WINB 3HAGA 1UYPA 2VUDA 5FZ9A 3UGHA 4LBNA 4WVMA 5K4LA 2D6PA 1MPXA 1C1LA 4NHKA 1PK6C 3RGBA 3GZTB 5FLIA 4I0AA 2FDFA 2EIEA 1W3XA 2GN3A 1PM7A 4ES9A 3J26N 3HNYM 2P37A 2ZX3A 4Q4X2 2RR11 4COVA 1ZYBA 1O4ZA 4NPMA 4YZ3A 1WW6A 3LA3A 3MIDA 3L9JT 4OHWA 4ORFA 4AFCA 4QDSA 4I0BA 2WYSA 3UKVA 5JSRA 3I2HA 2LUWA 4HMZA 4XDQA 3VZMA 2BWCA 3I8TA 3AB0A 5CFCC 2G19A 2BZDA 5FYVA 4Y33A 5EQUA 1GP5A 2ORXA 3KCXA 1UY3A 1J83A 5EZWA 3KHCA 3PDQA 1ZZ6A 3IDBB 4CDQA 3UJQA 1YQCA 4NJ4A 2O8OA 3IMNA 2E7AA 3JB8A 5I8TA 2FCUA 4GALA 4MGIE 1HIXA 1UL9A 4XJZA 5F32A 1BKZA 2PHLA 1RUC2 1YEWA 3AMHA 1Y9GA 2DUPA 3FHAA 5T5PA 4AI8A 2QBXA 1MEC3 3PVOA 5JIAA 1UOFA 2AYHA 1NCRC 3ZSJA 5FO8B 2J1UA 5D1IA 1OA2A 3THCA 1KD7A 1XNDA 3TN92 5IAXA 4AFMA 2BOJA 2D3PA 2VAUA 4CEYB 4CXYA 4N43A 1RUE3 4Q27A 4XFIA 4CEYA 1KRIA 5C4WB 5I8YA 4LJHA 2GMPA 3AJYA 5EJ1B 3BTZA 5C4WA 3P6BA 5G04L 4NR1A 4E4HA 3HQXA 4M3CF 2CGNA 3SKJE 2B8MA 1S0IA 2VZTA 2Y0OA 3BALA 2XVLA 3ZR5A 2ET7A 2DWRA 1RJ8A 4DINB 4HN1A 3C8XA 4Y24A 1I3HA 1OQ1A 4MXVA 4XILA 4P9WA 2VD7A 1W39A 2WNUC 3HBZA 3MIHA 1YFUA 4P9JA 3DPRC 2XVGA 2XWJB 3LSDA 5L73A 3WUDA 3FHIB 2P3KA 2W68A 1VRH2 3FWEA 4KQ7A 2OKXA 4CU8A 5CFDC 1XYNA 1UU4A 1NZCA 2VW0A 5FIXA 2C6SA 4PT6A 2Z2SB 1JZ8A 1PGL2 2RM22 2LRPA 3LDBA 2YC0A 5DXDA 4NRMA 5IFTA 5BNPC 2DU0A 2MHFA 4IEZA 2XWBB 2WO3A 3R4UA 5CG9A 5IK4A 3BU0A 3AKTA 4A6SA 2X5IC 2W91A 4HVRA 4M0NA 2YBPA 2XONA 4YM1A 1ENSA 1R092 1DYPA 2ZGMA 5E89A 2CL2A 2D44A 2DCYA 2DCJA 4K1YA 5KBFA 5J09A 1LTEA 1F5FA 2AREA 4L2NA 4QPYA 3ST7A 4XF3A 5B4NA 1V6JA 2NM1A 3K3NA 1RB8G 4HETA 4KNCA 2HWD2 3VKOA 2XVKA 4KWJA 4LKSA 5FZKA 4GMP1 4OMCA 1JZ7A 3CZUA 3N7KA 4QMAA 5E88A 2QQWA 2R32A 4DNYA 1LHOA 2WSVA 1DG6A 4LORA 4PIZA 1CJDA 3L2HA 1GFF2 1D2QA 1DYOA 1V6OA 2J1SA 2W5FA 4P9LA 3PURA 5C3RA 2YUEA 1XYPA 4AYUA 1ND3C 4NHXA 1SFNA 3SXWA 1A6CA 2A6YA 4C1WA 2YGMA 4XJAA 1LJ7A 5FYTA 5FK8A 4CUGA 4FPYA 4LUMA 2HWF1 2JKXA 4YGBA 4M4PA 4Y1YA 1HRV3 1FYUA 4HOOA 2BVVA 1R64A 1IG3A 3Q8EA 4BQ3A 2GZWA 3CHXA 2ZGQA 4Y4YA 3U78A 5KC6A 4XVHA 3NO8A 1GICA 5F2WA 1SLLA 4PIYA 5LATA 1W6OB 4YPJA 4XQ4A 5GJ6A 2NYYA 5FPUA 1W6OA 4KWUA 5HCFA 5A3LA 4R4XA 4BK5A 1RMU1 1LKNA 4NPLA 4M00A 4URTA 2HYXA 4XZPA 4B7KA 2A7AA 1H1MA 3WOGA 2VM9A 4ASKA 5IVCA 1ZZ7A 4I3GA 1KJRA 1LR5A 4R9AA 1I1EA 1LOBA 3PMSA 1RUF2 1SZBA 3E6DA 3ORJA 1VBD3 4TN7A 2XJPA 1N1VA 3F95A 3AL5A 4HK8A 1SBDA 3ABZA 4OI2A 2EAAA 2JDNA 5CB7A 4GAZA 3D0JA 2YB7A 1RUC1 2R6QA 1FV3A 2VNGA 4YVWB 5LBFA 5FKBA 3IKWA 4YW5A 4YVWA 3O0VA 5HXVA 4BK4A 2E6VA 3AKSA 1UY4A 1HXS3 1KS4A 3LCPA 3GYDA 1CAUB 4QQHA 1LGCA 5FP9A 3ZIXA 1YWKA 3LIGA 2DVFA 2FD8A 1JOPA 3GGLA 4DFSA 1O8PA 1HN0A 2F4PA 3OGRA 2V4VA 1RYYA 2VCMA 2R061 4UW4A 1U5XA 1X82A 1AR82 3PUAA 1H6YA 1ZA7A 1LOFA 4XBLA 4ONUA 3TBDA 3OPWA 4A6OA 3WG3A 2OIIA 4QD2A 2ZGKA 3LD8A 5IT6A 5IWFA 1OSGA 1CR7A 1QNYA 4Q1PA 3VD9A 2HWE1 2X10A 3GZAA 5FFOC 3R05A 1YNAA 5GLTA 1H4GA 2XLFA 1NKGA 2XUMA 4H2AA 4FPEA 5CAZA 1C4RA 1FNYA 2UWCA 2WBKA 5DG1A 3OYWB 5F2SA 4CEYC 1PZ7A 2D6MA 2D3SA 3OYWA 4B4QA 3VZKA 5C4WC 1V0AA 1GNHA 3ZN5A 4C0HA 4KG0A 3LFMA 5A3UA 3M4FA 3CL1A 3IDEA 5C70A 2QDRA 3LKJA 4TTGA 4DUWA 2H6BA 3PUSA 4XZUG 5DAVA 4MGSA 3SLIA 1TNRA 4OHYA 4FQ4A 1DGRN 5FZ0A 2ORZA 1RUOA 3ZN6B 4QKBA 4GKYA 1G8WA 4NPRA 4YGEA 3ZYRA 3WDXA 3ZN6A 4AF9A 5L36A 1COV1 2YHJA 2R1BA 1PNGA 4JDOA 4BDVB 4B4RA 5JMOA 3RQ0A 2YU1A 1SCRA 2OZJA 2XXZA 4XC9A 4BCUA 3GNEA 3H1MA 1OI6A 2UWAA 1NZIA 3NV1A 1ZBE2 5A3PA 2Z79A 2E26A 3DF0A 3U07A 1DHKB 5DG2A 1VBA2 3U4SA 2UYAA 1AHSA 4JKLA 1BZWA 3WNXA 5LZ6A 3J7MA 1W0OA 4EN0A 4AVBA 1HDKA 2XB6C 1NXMA 1VBC3 1PIV3 4Q0SA 3WX5A 3SEPA 1QGLA 4JX0A 4K40A 4ZU7A 3OG2A 1QEXA 1UKRA 5EIYB 1QH7A 3MIBA 2VU9A 2XGXA 4Q0PA 4CA9A 4D3WA 1CZTA 3ENRA 3C7HA 5DAWA 2Q5TA 1O4YA 3BKZA 3PHMA 4Z2WA 2VL4A 4O9EA 1W05A 3LB9A 2B39A 1W8WA 1JZ2A 3FHQA 1BEV2 1SLCA 2XJQA 3T30A 3LEIA 1LODA 2GNTA 4H14A 3ME2A 4NAOA 5GLVA 1C3HA 3ZXJA 3AX4A 3D4KA 2Z42A 4P9GA 3AM2A 1HRI1 1PMHX 3RZGA 3BOWA 2YV8A 3DKWA 1HW5A 2VOTA 4WBBA 4YGDA 1GWKA 3AP4A 2ZXQA 4XF4A 2CGPA 5FOBB 3U37A 1MQTB 3I4IA 5A7QA 4BU2A 3HEIA 1MQTA 4GQ7A 3WDWA 1UY2A 4EN8B 1VMFA 2D7FA 2W47A 4GWMA 1KITA 3BTXA 4Q4V3 2RDSA 1AL0G 3ZYGA 4Q0QA 4AFBA 2VTFA 3AVSA 1Q8QA 1IOAA 1OPOA 4MHRA 5G05L 5LA9A 4JCKA 4YARA 2RJKA 1BVVA 2IC1A 2PTMA 2YXSA 4YYOA 4OUMA 2XG3A 4YW7A 1JBCA 1CONA 5J98B 4GB31 4HXCA 4Y26A 1F4HA 1QXPA 3VBSB 1UYZA 3EQEA 3VD3A 2A6WA 3B7MA 1QJU1 4FPLA 1XE8A 1PVC2 3ECQA 4KMQA 3VBSA 2PHRA 1RVF1 3S7EA 1JOJA 2GNMA 3POEA 1W9YA 1KFXL 2ZCWA 4BISA 3BGAA 2CHHA 3GCWA 4KWKA 1FOD2 1XNCA 1EAH1 2J1RA 4Z82A 2JDKA 5E6HA 2C4XA 1NE6A 3KQRA 3THPA 4XIOA 3URFA 1LAJA 4YWAA 2C9AA 3QBQA 3I54A 3JCIA 3WQ7A 1XRUA 2BGOA 2DFBA 3Q8FA 1GV9A 4XXAA 5F5QA 2OS2A 4YVWC 2ZEWA 1QF3A 4QX3A 4P08A 3I2JA 2VTXA 2AZ5A 4RD7A 3O7OA 4UAPA 2JG9B 3G7DA 1G86A 1MS9A 2JG9A 3ZKYA 3FLTA 3I3QA 4MUVA 1AYN3 1X9TA 5E16A 5H9RA 3GCXA 3WDUA 1WWYA 2VBPA 4D6QA 3POYA 1VAVA 1PO13 2EA7A 2JICA 3J4UH 2E51A 2VCCA 1LOFC 4FVVA 3MLLA 1VP6A 3VBFB 4MGYE 2LS6A 2P6HA 3VBFA 4IE7A 4KGQA 2VQ0A 2W46A 5F5AA 5L19A 2GH2A 5JZGB 1LCLA 3V64A 1W2NA 3E6CC 2FMDA 1UWWA 2RS13 1W9FA 5JZGA 2FQPA 2VOVA 5JI7A 1DGRA 1MEC2 4ARXA 4CDWB 4DOUA 1AZDA 2WNEA 3UT0A 1AYM1 2WFF1 4JGYB 4CDWA 4BQ2A 2QNKA 2XOMA 1KDKA 3D6EA 1G9DA 1ZRRA 4JGYA 1V6LA 5C3PA 1WCQA 5I0SA 5LRSA 4H3WA 3RZMA 3UJOA 1HLCA 4R52A 5F7UA 5FZAA 1ULFA 5FZIA 2SBAA 1RUE2 4Y20B 3ZYJB 3WDTA 2F17A 5IK7A 3DL3A 1ZRFA 4Y20A 2QQOA 4AEDB 4IEXA 5A1LA 3KS7A 1BBT1 4Q4W1 1HB3A 2ZGRA 3A22A 1PM4A 4YLZA 3LWCA 4AHWA 5AC93 3MIFA 4MGQA 3BPSA 3AP6A 4OUSA 3POGA 2ZOEB 5D21A 3MEPA 1W6QB 2LTNA 4XF1A 5FLJA 1R081 2HWC3 3VBHB 3GF6A 1W6QA 4Q29A 1Q8OA 1D4M1 2R042 5FY9A 4IETA 2Q30A 4OZOA 4MXWB 3WVJA 4UBHA 3USSA 3WR0A 1W8UA 2JDHA 1REDA 4MXWA 3LZZA 3ZYBA 3AYEA 3QH7A 1X33A 4NE9A 3N9LA 1OD5A 1B09A 2EIBA 3V65A 3MZHA 5JI9A 4BMEA 2SLIA 2IXHA 2Z5WA 1R1A3 3Q8AA 5FAXA 5LA0A 1JHJA 2CSGA 4RGAA 1AL22 4BE3A 1W2TA 2FBEA 1U5ZA 4N9HA 3ZKUA 5BY5A 3DEMA 4GD4A 4FT8A 5ERLA 3ZMOA 3VHPA 5IW0A 4BM8A 4AVTA 1O5UA 1YJLA 1QWRA 2GC3A 2ZZQA 3NVCA 4BA6A 3O0XA 1UMHA 2WZ8A 5C8CB 1UMIA 1MVEA 4LK6A 3HPNA 3T2PA 5ABJB 1EUTA 1ZBA3 5C8CA 1A78A 5CISA 5ABJA 2JDZA 4A45A 3WP5A 4HSLA 1AXZA 3WHUA 1SHWB 5FLHA 1NA1B 2ES3A 1TEIA 1MQTC 2GMEA 2J42A 5FZEA 3ZO0B 5FDBA 2WZR3 1NA1A 4LHNA 4YW3A 2LM3A 2LW8A 1MS3A 1OVPA 1Z7S3 2D3RA 5DDJ2 5C3OA 2VXRA 3O0WA 3WDYA 5A32B 2D93A 3I2GA 3ZFGB 3RYKA 3S57A 5A32A 4X8PA 5H9SA 1HRV2 1SG3A 2Y33A 1RUI3 3ZFGA 2D97A 1SLIA 2GDFA 4R9BA 3O1MA 4XJ8A 2EIDA 2V73A 1SDWA 3VBSC 2RS31 5FZ4A 2WQ8A 5FYIA 3CKHA 3QCWA 4XFAA 3WG2A 4PI2A 4AI2A 1URXA 1FMD1 4UI9L 4QXBA 3LF7A 1DCSA 5I0RA 3PMEA 3ZYPA 4AHYA 1RGSA 1FNZA 1WW4A 3IMMA 4PQ9A 1UZ0A 4HLTA 3S6PA 2BFUL 1UU6A 3LGRA 3TAYA 5FBZA
chains in the Genus database with same CATH topology
1WLTA 1RUH1 2LALA 4Q2FA 4YW1A 4BH9A 2PHTA 4Q4Y3 2HWB1 1V6MA 1VBD2 1ZM1A 2B9UA 1DDLA 4BMBA 2YROA 2JG9C 3BOPA 1LHWA 4W6YA 2NLRA 4CP0A 1RUD1 2ZGSA 4HFSA 2VUJA 2XL9A 3H3UA 4PBPA 4G9SB 5LEKA 1QJY3 3ILNA 5A3MA 1QDOA 1AR61 1J59A 2DURA 2R1DA 1SLAA 3GHNA 4LA2A 3VBFC 2JKBA 4AHZA 4FO9A 4PBOA 2RHPA 1LECA 5JZGC 2DF7A 4HBNA 1JUIA 5GALA 3MDPA 3FJSA 4EROA 4CDWC 5J48A 4OI0A 1QJU3 1TMF2 4XF0A 4JGYC 4EV0A 3H7JA 2PLV1 5JOZA 5CG8A 1SCSA 2P2KA 3N7MA 4LTAA 3NV3A 3SH3A 1CQ9A 3TOJA 2EALA 3C3VA 2R073 2XL7A 4IEUA 1EPZA 3OCPA 4AEDC 2NMNA 3MW4A 4Q8KA 4WVWA 5CBLA 1EP0A 3BIWE 1DQ1A 2IXLA 1QH6A 1OLQA 4JRAA 2EXIA 3GALA 4BIOA 3H1YA 5TSWA 1O3TA 5JCTA 3BODA 1H2MA 2E7TA 3ZXFA 3GZUC 4QU2A 3VBHC 1DBNA 3T1LA 5F9TA 4COUA 3RI8A 1PO22 3HMYA 4DY5A 4GKXA 3OD0A 2PHXA 3JU9A 4FPJA 3IPVB 3LSEA 1DLLA 1AYM3 5KC5A 3JD72 2WFF3 1VBC2 3OY8B 1PIV2 4QQ2A 3KB5A 1LOGA 3OY8A 3VL9A 3N4MA 3AZYA 3GBWA 3NL1A 2YZ4A 1LOEA 2XBO1 4AI1A 5C9AB 2A71A 5BUVA 3QH6A 5C8CC 5C9AA 4Y1ZA 5ABJC 1WA4A 5BNQA 2IZWA 1EYBA 2QZ2A 1S0FA 1FPN1 2VW2A 1OQEA 1NA1C 2VNOA 1X36A 1Z78A 4K3UA 5T50A 4WVZA 1QJX3 3RYPA 3APBA 3EJKA 3MFAA 1YJKA 3TNPB 4D69A 3VL8A 1C8M1 1D4M3 3VGIA 4A7KA 1G7YA 3ZFGC 5EV7A 3VBUB 2C0ZA 3LA7A 4LBKA 3VBUA 1V6IA 3E6BA 4I0WB 3HN1A 4V1PA 5FPXA 3AMQA 4SLIA 1ZX5A 2VOXA 3QACA 4GMP0 3SH4A 4J1XA 1WCKA 3AZZA 2I2SA 2GMMA 4R9CA 2BFUS 4TSVA 4Y1UA 3RPQA 1AR71 3HR9A 4I30A 3RJRA 1ASJ3 4SBVA 3WZ1A 4YM2A 4YG6A 3NW4A 2A6XA 4RA0A 2DU1A 5DZFA 1JYIA 3VBOA 1F9KA 1VBB3 3ZXKA 4KGGA 3PTYA 3B00A 4YW4A 4HVQA 1WLWA 3ZSMA 5ACA3 3MIGA 4LNVA 1QDCA 5T55A 4MX3A 3KT4A 5CADA 2RMU1 3NKTA 4AGRA 5LK7B 2WLPA 5BXXA 5BYNA 2BTVC 5H9QA 1AYN2 2N7GA 2BW8A 2EIGA 3CU7A 3P3NA 5H9PA 4AEJA 4S2HA 3LOBA 1PO12 5K0UB 1LRHA 2DVGA 3FBYA 4B7EA 5K0UA 2IFWA 2RS33 3O12A 2RJLA 1JUHA 1RUG1 5CA6A 4X8NA 1IPKA 1FXZA 5T3NA 2E53A 4K8FA 2RS12 4P9IA 3GHMA 2ZX1A 3JBG1 3WCRA 3CLPA 4COZA 2QDNA 2CGOA 1GNZA 1O4TA 4N43B 4XFHA 3WCSA 4QM9A 3J8F1 4LEJA 1OA3A 1O5LA 1H4HA 2ZA9A 2AUYA 3SITA 5GLWA 2DV9A 2EXJA 1IGOA 3E5UA 4IQPA 1V6KA 3VLBB 1VALA 2ZZJA 3POWA 3WINE 1TME1 3HT1A 2B45X 3PVBB 4MVTA 4BLJA 3TNQA 2H0VA 4OI4A 5JSPA 2JD4A 4IEWA 2BUKA 3RYRA 1BYHA 3KM5A 3MW2A 3UKTA 5I0UA 1QNWA 3JQWA 2MEV3 1BMV2 4CP1A 5JDBA 2VW1A 3VZLA 2NPIA 2D6LX 1UPIA 2A5ZA 4AVCA 1SFYA 3RDIA 4DY3A 4FAGA 5FMOL 2WS92 2IXKA 2D6OX 4OLLA 2YYOA 3A0NA 4XMAA 1H1IA 2K9ZA 5JOWA 1RHI1 1VLNA 5IK8A 1J3QA 2OVUA 5JLVA 3JUUA 1R1A2 4FTEA 5C9AC 5GZGA 2GN7A 2R0FA 4XFBA 3P3PA 2RS53 3SH5A 3BPZA 3KCYA 4Z1VA 1VBE3 2WA4A 3WY6A 1IS3A 1ZBA2 4ISQA 5CIRA 4GIQA 1C28A 2CNAA 4XF9A 4RR3B 3USUB 4XTPA 3USUA 4RR3A 1V9U1 2WZR2 2WL1A 3VBUC 5AVAA 3BTAA 1NY71 2DVBA 1QOSA 1Z7S2 4P9YA 5F1RA 1RUJ2 1ZZCA 1AXYA 3AMMA 3B9IA 3B01A 1Y3TA 1AR93 1X7NA 4LR4A 2ZX4A 2G9GA 2VMGA 1OPMA 1RUI2 3E5QA 4E4ZA 4GWNA 1A8DA 4IEVA 3V56A 4Q4X1 3ZXLA 3N36A 3D0SA 1C5IA 3WLUA 2DTYA 4W6WA 4KG8A 1H8TB 1S0EA 4JC1A 4ZXKA 1LHUA 3ROUA 2DTWA 1H8TA 4KU8A 5FPZA 1CIWA 4UBGA 2XJRA 1C1FA 4S2GA 4XQWA 5FO9B 1A3KA 2YMZA 4XBNA 1UPSA 2CAUA 4DMIA 5K8SA 1FX5A 4OI1A 3MIEA 2XKOA 3I2DA 2VVFA 1DZRA 1ALYA 1NXD1 4Q4Y2 1LOAA 3M2MA 1FI2A 4KH9A 1LB2A 4LO4B 3ILRA 4WZFA 1POV1 1C8M3 1MS0A 1YO8A 2I45A 1KS5A 1LESA 1QJY2 2WA3A 3ZSKA 1G6NA 4LA3A 2XJTA 3ELNA 5K0UC 3TN91 4AGGA 3I59B 1E57A 3I59A 3W58A 4IERA 2DCZA 4AEKA 1D4VB 5I8SA 3DN7A 4LBQB 1H9PA 1EV12 4U2AA 4A2UA 3CEWA 4LBQA 4X6QB 4E2QA 5J96B 3SISA 2O8QA 1QQP3 4C91A 4E4SA 4K9SA 4N43C 2ZTNA 3MPPG 5LEJA 1KFUL 3GBFA 1DQ2A 4RHV2 2R072 4NWVA 5KXEA 1VRH1 2RR13 1O7FA 4PJYA 4MYEA 1PZ8A 1NLRA 1PGL1 2RM21 1WBLA 1CAXB 5DZEA 3ZDSA 4P14A 1N3QA 5I91A 1CAXA 3K48A 1FV2A 3OD4A 4IXLA 1O3SA 5KHIA 4XYXA 1GLHA 1UD1A 5CVRA 1R091 5GZDA 1XYOA 1GZCA 1W6NB 2Q1ZB 3TYJA 3BCWA 4AEMA 1AUYA 2FMYA 5T52A 1W6NA 2Q4SA 4XPVA 2GC1A 4GXLA 5JWPA 2PYTA 4B8EA 1LU2A 5FMOS 1WBFA 2HWD1 5SV5A 3QOPA 3FUOA 4Z07A 3AZXA 3UV9A 1TQ5A 3B02A 1LGBA 3J8F3 3FLRA 3S7IA 1G9CA 1CVNA 3NWKA 1I9RA 1H8VA 1U5YA 3SCFA 2G9FA 2AR6A 3OPZA 3THTA 3WP6A 1D2SA 3L2YA 1WD3A 2JG8B 4S2FA 4XQDA 4COWA 2JG8A 5JIUA 4RR3C 2XJSA 2Y38A 1ZZBA 1UZZA 1N1TA 4F83A 4Z8BA 4MV2A 1S0CA 1S0BA 4XFGA 4Y1VA 1Q3EA 1IZ3A 3AMNA 2C1FA 1QJZA 1ONAA 3WV6A 4LLOA 4E4DX 1SACA 2E63A 2EXHA 2JE7A 3DUIA 3LA2A 1BK1A 1U12A 1RUF1 1YIPA 4F3JA 2WT2A 1QHDA 5JAXA 1DQ4A 1H8TC 3B3QE 1LOCA 1UZYA 3IIAA 3FMGA 1OMIA 3AZWA 4YZ2A 2BEOA 1YFWA 1PGW2 4QGNA 5FRAA 1XU2A 1GYKA 4HANA 3U11A 3CJXA 4MGZE 1ASJ2 1QMJA 1VJ2A 2BQPA 4GMP3 4ZU5A 5T5JA 4BOWA 4ISRA 4YG0A 4DXZA 4OFGA 1OHFA 1VBB2 2NMOA 1ZNPA 4L11A 5ACA2 1AR81 1ENQA 1V9U3 1UIKA 3MPBA 1BJQA 1DGWA 2DVAA 1MZ5A 2HWF3 4NWWA 3M3OA 1CX4A 3WW4A 2HEWF 4CYDA 1JTZX 2IXIA 4EJRA 5K9YA 4JVAA 1X50A 4LBJA 4C90A 2QQPA 2UWBA 2HJIA 1WCSA 1AF9A 4IESA 2WNVB 1LENA 2A3YA 5J36A 4FAHA 1NE4A 2ZGNA 2WNVA 5DUUA 2VOWA 2OYZA 3H7YA 1RMU3 2ZS6B 2GNDA 5J3UA 4ATEA 3AFGA 3MFCA 3ASIA 2IFRA 1UKGA 1FATA 1APNA 1REEA 4QT6A 2A6ZA 3RNSA 4QGLA 4UW6A 2I07B 3T1MA 3ZXGA 1DF0A 3EXUA 3VHOA 4DRVA 3AKQA 2BGCA 4U36A 3PJYA 1ZBE1 2ZGOA 1CD3G 1OOPA 1H2LA 4OHZA 4EWEA 1RUC3 1VBA1 1IS6A 3MF6A 1MZFA 2UY9A 4QX5A 3EHKA 4QQLA 4RS5B 4YGCA 1N3PA 5K7PA 4RGGA 4M0HA 4RS5A 2MEV2 2X53S 4CDQB 1WMFA 2R063 1DZTA 4YVSB 4CDQA 2O0OA 4H7MA 2PAMA 4HKWA 1J58A 4YVSA 2TUNA 2JECA 1BEV1 1QXJA 2HWE3 1KDMA 3NV2A 4I01A 3CJIB 3PJQA 4FP2A 1XNBA 1T6GC 4LBMA 4EN6B 1ZRDA 3CJIA 4FPCA 4IV1B 2WQZC 1Q5OA 3S30A 3VBRB 4IV1A 2PHFA 1RINA 4D94A 4QQPA 3VBRA 4OULA 1JXNA 1VRH3 1H9WA 1KXGA 4H7LA 4E27A 4CEWB 2JG8C 2OZ6A 2RS52 4CEWA 3FZ3A 1D0HA 1VBE2 1NG0A 1LULA 4G3YC 3HWJA 4XFCA 4F8AA 3AKRA 2VG9A 1Y7BA 1COV3 5KXBA 1R093 1AJOA 3ZIWA 2VPVA 1G9BA 4LE4A 1I5ZA 1MZ6A 2QFEA 1PVC1 3KT7A 3WT3A 1S2BA 2AH2A 1WLCA 4LLFA 2HWD3 5L7OA 1DGLA 1AR92 1FOD1 3EO6A 2QJVA 2ET1A 2XJVA 1ND2A 1UX6A 4N7UA 4BIFA 4Y5Z0 1RC6A 1FT9A 1WGPA 1HV0A 2EF6A 4EN7B 5T5LA 1SLBA 4I2OA 3AK0A 4ZU4A 3WW1A 4FXKB 3UL2A 2CYFA 3I7DA 4LHKA 4Y22B 1JHNA 2R30A 2ZGTA 3FE5A 4XHBA 4Y22A 5F6LB 4YZ1A 2BWAA 1QY4A 2ZAAA 4FPHA 5HCBA 1LHVA 2NP0A 4AHXA 4JAAA 5BV6A 5SV8A 3M1HA 1PHMA 1HRI3 1Q43A 4LHLA 5JOXA 3M70A 2GC2A 1RIRA 3E97A 1ZA4A 2OPKA 4AVSA 1FAYA 1Q56A 2YDEA 3DGTA 3WP4A 5DUWA 5EWSA 3AKPA 1A8MA 1MEC1 5AVPA 4N90A 4XE9A 4N53A 1HXS2 2VULA 2WNVC 2P34A 2EXKA 1AVBA 5BNNB 2WQ4A 1J1LA 3OTFA 1RUE1 2AENA 4QM8A 2GALA 4EN9B 4LO8A 1IQAA 5BNNA 1UF2C 3U0ZA 1BVP1 4GB33 1XNKA 3KGZA 4R9DA 3KT1A 4IEOA 1U5IA 1DIWA 2ATFA 2IXJA 4PLNA 3WG1A 2GAUA 1RVF3 5I0TA 3AXEA 1Q8VA 1EAH3 4F7ZA 2UY8A 4ASMB 1O91A 1LHNA 4FPKA 2RR12 4UW3A 2HYKA 1MACA 2R041 3QLQA 1C57A 1N1YA 1UIJA 4AQ2A 2ZMNA 1RJ7A 1UMZA 4IEQA 2VMHA 2VQAA 1RL3A 3FBMA 4XXPA 4RS5C 3AYCA 2ZHNA 3ZYIB 1NLSA 4CDQC 1SBFA 1N3OA 4AE2A 4YVSC 2K0GA 1AL21 1KQRA 4K7JA 3M3QA 3CJIC 5J37A 2ILMA 2VY0A 4K6BA 1GR3A 4IV1C 4I09A 4TLFA 4D7YA 1Z0HA 3NKGA 2XH6A 1NYWA 1K5MB 4UW5A 3VBRC 4M3CB 1JW6A 1VAKA 1K5MA 2W52A 4Q26A 2YY1A 4M3CA 2ZKNA 3RMYA 3ZX7A 4CEWC 3AXDA 5DZGA 1M06G 5HI0A 3IM0A 1YFYA 4IV3B 1SQ4A 4WVVA 3M3CA 4FOWA 4IV3A 3H0OA 5DDJ1 5T5OA 1BBT3 4Q4W3 4G4FA 5GM0A 4L99A 2XKPA 4NVPA 1HRV1 4AW7A 3V0BB 3UKNA 3KGLA 4FOYA 4CTEA 2MNGA 4OHXA 3KSCA 3V0BA 5KHKA 2ETEA 5JPNB 2CY6A 3N3HA 2XLAA 1PVXA 2VECA 4LO7A 1R083 4AVVA 5EYXA 3FUQA 2BNOA 2ERFA 2E9QA 4NHMA 2VVDA 5GZEA 2BNNA 1CESA 1CGPA 4ASLA 3WUCA 5GZCA 4Q4V2 3ACLA 1JH5A 3UK9A 4R4ZA 1AX1A 3CO2A 1VBD1 2KM2A 2AGSA 3RI9A 3MGUA 4AVAA 1HQLA 3MF9A 4QQOA 2WKKA 1ZREA 4XJ9A 3VBOB 3JZVA 4JTNA 4EWAA 3VDDB 1ENXA 4L8QA 3VDDA 4FPGA 1YI7A 4FTSA 4EWDA 4QGMA 2WJSA 3B9CA 1MR5A 2NZ9A 1TMF1 2B7YA 3H3ZA 2G4IA 4WM8A 4BLIA 1HQNA 2VVEA 2HWF2 1NQDA 1FOD3 5GLUA 5BNNC 3A4UA 2W39A 4L97A 2B42B 2JEMA 2CWMA 2BBVA 1FMD3 5B2GB 4XHXA 4CZSA 1RMU2 2WSUA 1G9AA 1JN2P 3ZN4A 1C8NA 1RUH3 3OF1A 4N9IA 1EPWA 1POV0 2GSYA 2GC0A 2IXCA 1IKQA 1ULEA 2HWB3 1YIFA 3C2UA 3Q9OA 2QZ3A 4GA9A 2WZPP 2I74A 4TWTA 1RB8G 3BB6A 2Q8OA 2ZAHA 2PHDA