1O5UA

Crystal structure of a duf861 family protein (tm1112) from thermotoga maritima at 1.83 a resolution
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
88
structure length
88
Chain Sequence
EVKIEKPTPEKLKELSVEKWPIWEKEVSEFDWYYDTNETCYILEGKVEVTTEDGKKYVIEKGDLVTFPKGLRCRWKVLEPVRKHYNLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords novel Thermotoga maritima enzyme TM1112
publication title Crystal structure of a novel Thermotoga maritima enzyme (TM1112) from the cupin family at 1.83 A resolution
pubmed doi rcsb
source organism Thermotoga maritima
total genus 19
structure length 88
sequence length 88
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05899 Cupin_3 Protein of unknown function (DUF861)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1o5uA00
4HN0A 4HMZA 2VPVA 5BY5A 4E2GA 1O3SA 4Q0PA 4CYDA 4L2NA 5JCTA 2B8MA 3SHRA 3SXWA 4KL1A 4MUVA 4R52A 4BYYA 4LTAA 1NZCA 2P17A 5JR7B 3E5UA 4IETA 4XFHA 1WGPA 4MV2A 2IXKA 3E6CC 2MHFA 2B9UA 4O9GA 2MPFA 5I93A 5F1RA 2Q1ZB 3KSCA 4I0AA 4Q0QA 5J7MA 4HLTA 1J59A 3KGZA 3H1YA 4J1WA 5KHIA 1XE7A 3D82A 4QGNA 3UKVA 5CVRA 5I91A 2Q30A 2D40A 3SCFA 2XLFA 3D0SA 2V09A 3EHKA 3DL3A 3OF1A 1QXJA 5C8WA 4JVAA 1GQHA 4AVBA 5JSPA 4X6RB 4E2QA 1CAUA 3UKTA 3U0ZA 3E6DA 5LRSA 2WC2A 3OCPA 3CJXA 4EWAA 3I59B 3BALA 3WW4A 1ZZ9A 4IEYA 4L11A 2OA2A 2OPKA 4QX5A 5KHHA 4AVCA 1OI6A 3ETQA 4Z82A 2VECA 2EA7A 2ZCWA 3BPZA 1JUHA 3FFQA 5E16A 5HI0A 2IXCA 5I8YA 1O3RA 5EFUA 1X8MA 5FPZA 3HQXA 2PHLA 5FQ0B 1SQ4A 2Y0OA 3N4MA 1CGPA 2XKPA 4MX3A 4YNIA 4KU7A 3RYKA 2H6BA 1U12A 1UPIA 5FDBA 3KMHA 3R6SA 1SFNA 2GC3A 2O1QA 4R8HA 1HW5A 3MYXA 5FLHA 1I6XA 4J1XA 1Y3TA 2PA7A 1IPJA 4IEOA 5BXXA 1WLTA 3E97A 4EWDA 4OLLA 1QWRA 4D7SA 4XFCA 4KWLA 1ZNPA 1CAVA 2GC0A 2QJVA 4BH9A 4IEUA 3UKNA 4BIFA 4MGIE 3H3UA 4AQ2A 1YFWA 2UYAA 3E6BA 4ONUA 4QM9A 2IXJA 1CAXB 1O5UA 3FWEA 4E2SA 2QVSB 1RUNA 3L2HA 3HT1A 3FJSA 2C0ZA 1DZTA 1EYBA 4IEZA 1DGRA 3I54A 5E1RA 2BGCA 5I8TA 1QXRA 3RYPA 4ZU5A 5T3NA 3S7IA 2CV6A 1VJ2A 1H1MA 3QOPA 4F7ZA 3HIFA 4JTOA 1X82A 3WW3A 1YFXA 5FLIA 2FQPA 5KHJA 1IPKA 4I09A 4MGYE 4XF9A 4HVOA 4XETA 5BUVA 2BNMA 3M70A 4WZCA 1ZREA 3ELNA 3EJKA 4ZU7A 4FAHA 4MGZE 3O14A 2ETEA 1NE6A 4HSJA 3LAGA 4XFAA 5C6CA 3CO2A 5JSRA 4FAGA 4XF4A 3RPQA 2Q4SA 3NVCA 4UBHA 4UBGA 2XLGA 1PMIA 4N9IA 1Q3EA 2QCSB 4LA3A 4OFGA 3H1WA 3IDCB 2ATFA 2GU9A 3ES1A 4EROA 4MH0E 3WW2A 3I59A 1O3QA 2D5HA 2XL7A 1J58A 2HKXA 3RNSA 1OMIA 4I02A 1CAWA 1DZRA 1J3RA 4IEPA 1RUOA 3G7DA 4QGMA 1LKNA 2UYBA 5I0UA 4Z07A 4AQ6A 1ZVFA 5KBFA 4Q0VA 1UCXA 3S7EA 4HN1A 2D5FA 4KU8A 4LULA 2EAAA 1J3QA 1ZZ8A 4YARA 4KWJA 4HVRA 2CAVA 1ZX5A 1CX4A 1O7FA 1I5ZA 2PYTA 4IEWA 3BB6A 3IWZA 4QMAA 2XKOA 1J3PA 2QDRA 3SCHA 2GAUA 4D7TA 3JZVA 5K8SA 3LOIA 3H7JA 2B5HA 2XLAA 5CU1A 3ST7A 1G6NA 4I0BA 4META 2GZWA 2IXHA 1LB2A 1EPZA 4K8FA 1X7NA 1YFUA 2KXLA 3LZZA 2BNNA 2PAMA 2QNKA 1LRHA 4MGKE 2IC1A 4XFIA 4F8AA 1PM7A 1XE8A 4KWKA 4WVZA 4QGLA 2K9ZA 4AXOA 3GYDA 1FT9A 3E5XA 1XRUA 4ZU4A 4RD7A 4PIYA 4EV0A 4HZFA 1ZZ6A 3FX3A 4AVAA 3NKTA 1H1IA 2GH2A 2VQAA 4A2UA 2IXLA 4I01A 4XF3A 3BCWA 1YUDA 1ZRFA 3OGJA 2ET1A 3MPBA 1DGWA 3SMHA 1VP6A 3M3IA 1RTVA 1O5LA 3H50A 5J3UA 3GBFA 3H9AA 3MDPA 3VHRA 5JAXA 2CAUA 3HT2A 1ZZBA 4IEQA 3CF6E 3KGLA 4GULA 4IEVA 3NSTA 2PFWA 4O9EA 3EBRA 4MZUA 4QXKA 3SCGA 3MZHA 4Q0UA 1FXZA 3EQEA 2PTMA 4PIZA 5J48A 1X8EA 5FPXA 2EVXA 1Q43A 4I3PA 4DINB 3DN7A 3DV8A 5FCCA 3FZ3A 3OD0A 2GC2A 2PHDA 4X6QB 4XEZA 4ORFA 2GC1A 2BYVE 1UW8A 3CL1A 2Z2SB 4XFFA 1ZZCA 4H7LA 3TNQA 1YFYA 4PJYA 5I0TA 1GQGA 4IERA 1O3TA 4WBBA 2HJIA 3D0JA 5KHGA 2DCTA 4LEJA 4QM8A 3PVBB 3LWCA 3PLQA 4LUKA 4JTNA 4PIXA 2XHKA 1Y9QA 3ZDSA 4TLFA 2ET7A 3QACA 2WFPA 5BV6A 2CGPA 2MNGA 2XL9A 2OZJA 1OFNA 5I0RA 3CEWA 3IDBB 3RZZA 5FQ0A 5EZWA 2E9QA 2ZKLA 3ROUA 1NYWA 2FMYA 5BPXA 1TQ5A 2OYZA 3RYRA 1OD5A 5I0SA 3TNPB 3E5QA 4HSLA 4LUMA 2O8QA 3FHIB 4NVPA 3USSA 1CAWB 4Q29A 3OTFA 1QY4A 3LA2A 3NL1A 1CAUB 2H0VA 1ZRRA 5CADA 4HBNA 2OZ6A 1ZZ7A 3U11A 1UIKA 5KHKA 3B02A 4HVQA 2UY8A 4LA2A 2PAKA 1YLLA 3KCCA 5FLJA 1CAXA 3RDIA 3NW4A 3ACLA 1LR5A 2UY9A 2XGXA 3DKWA 2I45A 4EWEA 1SEFA 1RL3A 3NJZA 3C3VA 3H1MA 5LEJA 1EP0A 3H7YA 3U10A 1L3JA 3H8UA 3IIAA 4YRDA 4XFGA 4P9GA 2D93A 1UD1A 1NXMA 4FT8A 5LRRA 3EO6A 3H3ZA 2K0GA 4XFBA 4FBFA 3IBMA 1RGSA 4UXAA 5I8SA 1FI2A 2BNOA 4LLOA 5LEKA 1ZRDA 2H6CA 3LA7A 2Z69A 2IXIA 2Q0AA 3ES4A 1NE4A 4JV4A 1YHFA 1O4TA 4YYOA 4N9HA 4B29A 5JSOA 1J1LA 3LA3A 4XF0A 1RC6A 1CAVB 2F4PA 1V70A 2PQQA 4XF1A 3CLPA 4I2OA 1EY2A 5D1IA 3S0MA 2BEOA 1UIJA 4IESA 1YWKA 1ZRCA 2N7GA 2PAEA 1Q5OA 3I7DA 1VR3A 4Q0SA 5AVPA 3WW1A 4YSFA 1WA4A 4IEXA 3PNAA 4BHPA 3BU7A 3FE5A
chains in the Genus database with same CATH superfamily
4HMZA 1AR93 4QX2A 2H0BA 1UPSA 5L7OC 4RYDA 1U0AA 2WR9A 4AWDA 5LW9A 5DAXA 2VPVA 1WW5A 1JUIA 5GM0A 2OUJA 4QPGA 5BY5A 1BMV2 1QJU3 3GDBA 1EPWA 5JCTA 5FYCA 1BZWA 1JMUB 2GN3A 3KM5A 3H0OA 4GIQA 1N47A 2DVGA 4MUVA 5A7SA 5LK5A 3CBNA 5ABJA 5F6LB 5EJ3A 1DP0A 1PIV1 1PK6C 2CY6A 4HPKB 1MR5A 3E5UA 4JZRA 4IETA 3V0AA 2VNRA 2WFF3 1WGPA 4I3GA 1RVF2 3ZFGA 2JKBA 4HFSA 1BK1A 3GBGA 1LOBA 1MEC3 3A4UA 1E5IA 1PX4A 2YGLA 3W59A 4O9GA 3VBUB 5BNOC 1ZA4A 1I5PA 3V64A 4L92A 3KSCA 4I0AA 4IGOA 5DG2A 4XURA 2ZA9A 3ABZA 1K42A 3OJBA 1W8HA 3UYJA 3HNMA 1RUF3 1R092 1XE7A 4CPBD 3O1VA 3DYMA 2EXJA 3SH4A 3WDTA 1D7PM 4AEJA 2A3WA 2HWE3 4AGVA 1KS4A 3SCFA 2XLFA 4A41A 1JYXA 2I2SA 1GYKA 1NLQA 2DV9A 1W6NB 3HBZA 2RMU1 1X50A 2VW1A 1WWYA 4YVSA 1EV13 1QXJA 4FOQA 4UI9L 3HD8B 2ZHKA 4WVWA 4A6SA 1W8UA 5ACA1 2Q8DA 4AVBA 1AR92 3I3QA 1CAUA 1S0EA 1F31A 1OOPB 1DIWA 1C3HA 5LRSA 4ZXKA 5FZBA 4FP3A 4RR3C 4AOCA 3SEPA 3T0BA 5FBZA 4CU9A 2Y34A 1JZ8A 1HV1A 3WW4A 5CKQA 2BUKA 1ZBE1 2XJRA 5C3QA 1YO8A 3OSDA 2OPKA 3O0XA 4FFFA 1OI6A 2Y6KA 4HETA 1PO22 4YFWA 2VECA 4IV1A 3OEBA 5C9AB 2NYYA 1IG3A 2R30A 2WFF2 2VQUA 5SV5A 1QJZA 1UXXX 2P37A 1FAYA 1O3RA 2YBPA 5FO7B 3VV1A 5I0DA 4LR4A 1KGYA 1OVPA 1GSLA 1OPMA 2ZX1A 4MGQA 3ZR6A 1CZSA 4ES8A 5JPMB 1W9YA 2QQJA 5FY7A 5A80A 1CGPA 4YNIA 2V5YA 2IFWA 4NHMA 3RYKA 3WNPA 3UGFA 1RUF2 3WNMA 4YGBA 3TEZA 4LHLA 1SLCA 4HOOA 1RXFA 2JG8C 3HR9A 4QKNA 2HWE2 1ST8A 3WF3A 1K5JA 2WINB 4Y1XA 1ASJ1 1CR7A 4BQYA 3IN9A 4YGDA 2QDNA 3MYXA 1Y9MA 1I6XA 1QNYA 2HWD2 2QQVA 4J1XA 1VAKA 4KI5M 5KXBA 5D8AB 1OHFA 4LBMA 4AI3A 4EWDA 2YC0A 3GM8A 3LFMA 2AR6A 2RDQA 2W08A 2WN2A 3LE0A 5DUXA 4XFCA 4D7SA 1N3OA 1HQWA 4KWLA 3BTXA 1O6UA 1XU2A 3IDEA 5HXVA 3MFAA 4BH9A 1POV3 5FYYA 3UKNA 1VAMA 1C28A 3H3UA 2A6WA 4XTPA 2A6XA 4QM9A 1JXNA 1CAXB 1SLTA 1W3VA 1VRH2 5ERLA 3NMBA 1VBC3 1FMD3 1VBA3 2YFUA 1A6CA 1IS5A 4WM7A 4XCBA 5FZ3A 4COZA 1KFXL 1LESA 3WHUA 4MADA 4JGYB 1EYBA 1DGRA 2A71A 3VBFC 3TBDA 1H9PA 4CU7A 3RWKX 5FO9B 3S7IA 4OHVA 1A8MA 1LOEA 4D7YA 3ENRA 3OUHA 1Q56A 1H1MA 2HLEA 1D0GA 3QOPA 4QQ2A 5JR2A 1W9TA 4YZ4A 3HIFA 3ACGA 5A7PA 4JTOA 4X8NA 2J1EA 2K46A 4Q1PA 4G4FA 3WDVA 4A7YA 1TMF1 5T5PA 1UU5A 4W6WA 2EIGA 5FLIA 3L2YA 2VMHA 2VZSA 5A3OA 5CFDA 5FYBA 1LULA 4AVVA 1R1ZA 3SKJE 4XETA 4LKFA 4CDQC 5IWFA 5BNNA 2JENA 2RR12 4GWNA 1PVC3 5FBJA 2E6VA 2NM1A 1DGLA 1S0BA 3LOBA 2FZ2A 5FTTC 3CO2A 1DG6A 4Y5SA 4NIAA 3NNLA 4N7UA 4OCTA 2D44A 5F2SA 1LCLA 1RXGA 1W6QA 3C7FA 2DBNA 4LMFA 1GR3A 1RUH2 1ND2B 3DXUA 4PLMA 5FP8A 5FP7A 3ZXKA 4A7KA 5M0TA 5DZEA 3VD7A 3HNBM 3C7GA 1VBC2 1VBA2 2VL4A 5DZFA 2WT2A 2O8OA 4COVA 1YCIA 4KG0A 3U14A 3W9AA 3N7MA 3ATGA 2XJUA 5APAA 3MGUA 1SDDB 5T5OA 1C1FA 4OQ8A 1UYPA 4OULA 4A3XA 3IDCB 4WVMA 4YM1A 2IZWA 3THDA 3ZSLA 1QXPA 3ES1A 3THPA 4FTBA 1ULGA 2JECA 1F4HA 1RUE1 4YM3A 1KRIA 2XL7A 2HKXA 2ZX4A 2ZGKA 3KCXA 1QOTA 3D3AA 1IZ3A 4XAEA 1ULDA 2YBSA 3G7DA 3USUA 5F3IA 1LKNA 2D6OX 4P02B 5I0UA 3PVNA 4Z07A 1MS1A 4YW6A 1R081 2WA4A 1O4ZA 5KBFA 3C7OA 2A3XA 4M0NA 1K5MB 4Q0VA 3WF4A 4HN1A 4MG2A 2AYHA 2PLV2 3VZJA 4LULA 4ASMB 2R073 4ET7A 4EZHA 4QQLA 1OA3A 3WX5A 4YARA 3AYEA 4HVRA 1PVC2 1IS6A 4N53A 4Q4Y2 3CQOA 1UZ0A 2VMIA 5FYHA 3JD71 2E26A 1W2OA 3I2GA 3VB9A 3ZXGA 4Q27A 4Y24A 4AI8A 1QHDA 2HYXA 2PYTA 4IEWA 4LOSA 1S0JA 3VBHB 2E32A 1BMV1 2ZS6B 1AR81 1VBD3 4Q4V3 3SCHA 1PX3A 3POYA 5F5CA 4JC1A 4YW4A 2B5HA 3H7JA 4TYSA 5CU1A 3WF0A 3BI3A 1G6NA 2VZOA 5C9AC 1Q8SA 2IXHA 2ZZJA 4KGQA 1EPZA 1W8TA 3WQBA 4RSUA 4C0BA 5A1LA 2DCYA 5A3MA 3ZSKA 1X7NA 4DB5A 5IVEA 3DCQA 3AX4A 2PHUA 1NUKA 2E53A 4IW3A 2B46X 2IC1A 2W68A 3THCA 3RZLA 4Y5Z0 4QAWA 3PURA 2DUQA 3ORJA 4XZPA 4YVSC 1WZXA 1PM7A 2VZQA 5EWSA 2HWF3 2E7QA 4QGLA 1DFQA 3I3MA 3DXTA 3GYDA 1SLAA 1FT9A 4HL0A 1WD3A 1M4WA 3SLIA 1AJKA 4ZU4A 4PDWA 3AL6A 4RD7A 4NE9A 4AEDB 2ZX2A 4ISQA 5FV3A 3NQHA 4BK4A 1OURA 2DBIA 3FX3A 3RSJA 1JZ3A 3AZWA 4UW5A 4UAPA 2UWAA 3BKZA 2RS51 2VQAA 4A2UA 1F5FA 1QQP2 3MV01 4AGRA 2YUEA 3K3OA 2WNUA 5C3SA 5C4WB 4CXWA 1C5HA 2W1QA 5JXIA 4ZZ5A 4LBJA 2Y33A 1M06G 1H30A 2EXKA 5FYSA 3ZPOA 1RHI1 1HIXA 1HN0A 1LEDA 1MS9A 3H50A 5K0UC 5J3UA 3GBFA 1QJU1 2X5IB 4LBNA 1VBD2 2RS33 5EIYB 1H8TA 2JDYA 1ND3B 5JAXA 2CAUA 4UT5A 5FYZA 1XXNA 3CF6E 4GULA 4IEQA 1OKOA 1SCRA 1ZRIA 4W8JA 3WINE 3AZVA 1MQTA 3D8CA 3N9PA 3NSTA 3TOJA 4K6BA 1PGL2 1PO11 3EBRA 4URAA 1NY71 5FXXA 1JN2P 4QXKA 3UK9A 3CJIB 1QH7A 4GH4A 4S2GA 1NA1B 4PQ9A 4M4PA 3UESA 1ZBA2 4IV3B 4Q26A 1MEC1 4QHZA 1XB9A 2J1AA 2VVDA 4CDWB 2VCBA 3WEZA 1PMJX 2R061 2JB4A 1Q43A 1RJ8A 2D6LX 2YC4A 3DV8A 3V0BB 4CCKA 5CNAA 1OA2A 2HWF2 2KR2A 1UY2A 3I4IA 5A33A 2JDMA 1RUF1 5F2WA 3WP4A 2VBBA 3GJAA 4EYUA 1EUUA 5GZGA 4Y4YA 2QQWA 1FATA 3MEPA 5FYVA 3T2QA 4XEZA 2P6CA 3WHTA 4NRMA 3B9CA 3OBZA 3WDWA 2L9LA 4IE0A 1GMMA 2J42A 4AGGA 1EV11 1PMHX 2BFUL 2EIDA 3AJYA 5F7UA 1Q8VA 2P1BA 3HQUA 4WM7C 5LA2A 1HJFA 3I3BA 3ZN5A 2VMGA 4B8EA 4JRAA 4AYUA 1CQ9A 3JXSA 4WBBA 3O0VA 3D0JA 3LDKA 4LIUA 1UN1A 1S1AA 3U4SA 2DCTA 4LEJA 2RS32 1H0BA 3NNJA 4QPIB 4UFJA 4B4QA 4MYEA 5DMYA 1NAEA 1H6YA 5FMOL 3K77A 4QM8A 1W39A 1D0HA 2JIGA 4JTNA 4PIXA 3DF0A 3RMYA 5A3PA 3ZN6A 1DU3D 3Q8CA 5A32A 5FYUA 4ZS2A 3RZJA 2WFPA 1W6MA 3MF9A 3OBTA 5H9QA 3J7HA 5IATA 1WCDJ 1LGBA 2G1MA 2RDSA 3S30A 1LGNA 1PIV3 2MNGA 2WLPA 3LCPA 3TB0A 4DXZA 2ZEWA 4Z2AA 1Y7BA 2ARBA 4XE9A 1B35A 2VXJA 3B01A 4R4ZA 1H4GA 1G9DA 2P6HA 5JZGB 4ATEA 4LKSA 5DDJ1 2DU1A 2FMYA 4ZS3A 1LOGA 4LKDA 4E27A 4DXTA 5BPXA 4B3NA 5FJKA 2TNFA 2ZZQA 2OYZA 2ZHMA 3ZXEA 3TNPB 5FZGA 3E5QA 4HSLA 2XG3A 2FDJA 4FVVA 1WUVA 4IL7A 2O8QA 1WCKA 3PTRB 2VZUA 4OVEA 1W6PB 3VBHC 4AFDA 4EJRA 4Q29A 4IQPA 2RMU3 2WNOA 1W28A 4NIHA 4D94A 5FK7A 4PLNA 5CADA 4LITA 2D7FA 3UGGA 1AXZA 3ZYJB 5GZFA 1GICA 2OT7A 3EB7A 3GCXA 1KEXA 3R4UA 4ES9A 5FUIA 4XILA 1FMD1 5LA0A 2LTNA 4BB3A 2UWBA 3KCCA 5C8CA 4N90A 1DZQA 2R1BA 2WZ8A 1JU3A 2W92A 5JOZA 2VBDA 3CHXA 1EAH3 2X53S 1VE0A 1ZBE3 2XGXA 5EYYA 3BTZA 2EIBA 3KT1A 1E5HA 2VTFA 4O65A 2DTWA 4CCCA 4J6GA 1POV0 1YIPA 4AL9A 3JU9A 1ACCA 1PIV2 1UU4A 3J26N 1US3A 5LEJA 5DN2A 5GLVA 4CE8A 3BU0A 1LGCA 3U10A 4GQ7A 1L3JA 3AMHA 1JYVA 1G9BA 4YRDA 3X29B 4AFMA 4XFGA 4YLZA 1A8DA 2D93A 5CFCA 1UD1A 3RRDA 4AQSA 3TWIA 3PDQA 2K0GA 4XFBA 1DYOA 2Q8EA 4AK3A 4JQTA 1XNAA 4LO6B 1RGSA 2BERA 3VDDA 3VBSB 2GP5A 1VBB3 1OVSA 1GQPA 3J7NA 2BNOA 5C4WC 1XNTA 2IUWA 1ZRDA 1S0DA 2Q0AA 4QX8A 3POWA 2VNVA 2VJXA 4XZUG 1SACA 3NKGA 3B7MA 5LY2A 4AAXA 4AEKA 1YHFA 3RQ0A 1ZA7A 4JQRA 5LWBA 3ZXFA 2RMU2 5ANQA 4AHZA 1YI7A 4D69A 1GP5A 5D21A 2F4LA 1C5IA 2AZ5A 2A6VA 3AXEA 3POBA 1RC6A 3P1IA 4NAOA 2PMWB 4M3CF 4O7XA 2A3YA 3VD3A 4GA9A 5ACA2 5JIUA 2D3PA 2PQQA 4Q4X3 1W9SA 4FPYA 4XF1A 4AI2A 3VDCA 4E9KA 4I2OA 4G3YC 3LFIA 2BEOA 4OYUA 4OI1A 2V4AA 4GJZA 1UIJA 4LBKA 4DRVA 4BQXA 4JHZA 2PAEA 4H14A 3I7DA 5FZCA 1VR3A 3W21A 1ZBE2 4IV3C 1WA4A 4M01A 3ZKUA 4IEXA 4C1XA 1BBT1 4BHPA 4OI0A 2WLQA 4YFZA 4HN0A 4IE5A 3K48A 4CCJA 3AMPA 3FHQA 5T55A 2DVAA 3EYPA 4XUQA 4E2GA 4Q0PA 1AL0G 3MICA 4P00B 3IAPA 3J4UH 5BNOB 3WUCA 1NLRA 2RJ2A 1JZ6A 1VBB2 4LORA 1H8TC 4QXCA 3VL8A 1K3IA 2R071 2FCTA 2XHNA 2YXSA 1V6IA 3WF2A 3KS7A 3JQWA 2CU5A 2R7EB 4LIVA 4A44A 1BK0A 5HPOA 1YQ5A 1ASJ2 3ACHA 2J7MA 4R9BA 2R16A 3O7OA 5J7MA 2WNVC 1AHSA 5FMBA 3S5QA 4ZZ8A 1VBD1 2HBUA 4Q4V1 1W90A 4LHSA 3ZSMA 3V65A 5C33A 1GZ9A 3CNAA 2ZAHA 3D82A 2XPJA 1F2NA 2A73B 2VGDA 1KS5A 3FLPA 3P3NA 4P9XA 4XYXA 5IFTA 5JUVA 3ZX7A 2Q30A 3TRSB 5JDBA 3NV4A 1OUSA 3D0SA 5A7WA 3DL3A 1WLCA 3KLSA 3OF1A 4ITCA 2Y60A 1QGLA 1REEA 5KXCA 3A7QA 2C9AA 4IE7A 5FMDA 5C8WA 2AC1A 3BTAA 2DWRA 4X6RB 3RI9A 3KHBA 1A78A 3AKSA 4YW5A 4XIOA 1WLDA 4SBVA 4S2HA 5F3GA 2ZMKA 4NN0A 4WZFA 2PHFA 1NT0A 1BXHA 3AFKA 4BXSV 3I59B 3ILFA 1ZZ9A 1GFF2 2LROA 3APBA 4CDXC 4LT5A 1WD4A 3FUOA 1GOGA 3ETQA 4FPCA 5FZMA 3U4XA 2VCAA 5JI7A 1SHWB 1UO9A 5T54A 1GNHA 3LF7A 3ZIXA 4UFIA 5C3OA 1TMF2 3DGTA 4RN5A 5I8YA 1RINA 4B7KA 5FRAA 5A1AA 4QU1A 5EPAA 4FPJA 4LXLA 3VBOB 2JE8A 1X8MA 3POSA 3HQXA 4HK8A 2QUOA 4JX0A 1JH5A 5FUNA 2Y0OA 3N4MA 4MX3A 3PUQA 3TEYA 3WQ1A 1V6JA 4XQWA 1U12A 3KMHA 5FY9A 2P3KA 1B35C 2GC3A 1W2TA 2O1QA 3PTYA 3ZYFA 1XNKA 4R8HA 1OPOA 4UF0A 2JXAA 5FLHA 1BQPA 1AR83 5L9VA 2JE9A 1IPJA 2AUYA 3GHNA 3PVEA 4JDOA 5BXXA 1POQA 2W46A 4L9BA 4AFCA 4CEYA 3E97A 4BQ3A 4NWVA 3IMMA 3OUJA 1J1TA 3URFA 3Q9OA 1ENSA 1S0FA 4XABA 1QWRA 2Z42A 1XJAA 4XXPA 1TE1B 1CAVA 4LLFA 3ZR5A 3MLJA 2VTXJ 3PUAA 4HKLA 3WSOA 3AP6A 4DQAA 2I74A 4RHV1 1BVVA 1YQCA 2XJQA 5FZ6A 3TAYA 4AQ2A 2WZR3 4P9WA 3E6BA 1LTEA 4ISRA 3WP3A 5C70A 4YZ1A 5AC91 1O5UA 4E2SA 3VBSC 1RUE2 4CDUA 3RZMA 1V6KA 3L2HA 3ZYBA 1LOFA 1SLLA 5J1XA 1XNCA 2OPWA 1DDLA 3ACIA 2JKXA 3POGA 4B4RA 2GMMA 4NO4A 4IEZA 1W03A 2ZGLA 4FPEA 2GH8A 5E1RA 2BGCA 4K9SA 1R082 5IVFA 2VO5A 2HWC1 3MIEA 5L9BA 1NLSA 1TME3 3K4ZA 1S55A 2ZMLA 4XXAA 3D6EA 2GALA 1UAIA 4LKEA 5F5AA 1Q8PA 2YB7A 4FOYA 2IVJA 4CUGA 3CU7A 1W6OB 1LU1A 4HPKA 3JD72 3NAPA 1MS0A 1YFXA 4GAZA 2VOTA 5GLWA 2FQPA 1RHI3 1GBGA 2GNTA 1IPKA 4E4DX 4MGYE 5LASA 4RGAA 5IVCA 5JXGA 1AR82 2C26A 4JHTA 3GGLA 3M4FA 3H42B 4R9CA 1UZWA 1XC6A 3VBUA 4YVWA 1N1TA 3EJKA 5FZ8A 2VW0A 3C7EA 3O14A 4MGZE 1AX2A 2VOXA 5C7GA 1PO13 2VQTA 2NP0A 4JDNA 5C6CA 2Y26A 3GF6A 4C0HA 2DF7A 5FP9A 4Q8KA 5F32A 1N1SA 4XF4A 5IJRA 2R063 4OI2A 1W2AX 1W6NA 1PM4A 4UBGA 4WM8B 5DXDA 3SQOA 5FWJA 4BQ4A 1HDKA 3ZSEA 2QCSB 2BVVA 1YC61 2W2IA 4EN8B 1UX6A 3H8OA 1T6BX 5JOWA 1OOPA 4XHBA 4AI0A 4AFAA 1OBNA 4QX0A 2GMPA 1MS4A 2JDPA 3LPFA 2YPDA 3GXUA 4MH0E 4QPGB 4XW3A 2R0HA 2RS52 4GB31 1J58A 3VD5A 2D6NA 4I02A 4D3WA 3VZMA 5ABJB 2VMFA 1J3RA 1C8NA 4AEMA 1RUOA 2CNAA 2IWGB 2PXJA 3Q8FA 3U1XA 1TEIA 3V0AB 3ZOIA 1VB2A 1MVQA 1RHI2 5GLTA 3ZVXA 4MGTA 1QJU2 2WWSA 1LJ7A 1QDCA 5IYYA 2D5FA 3PUHA 4Y5TA 1EAH1 2J1TA 4KU8A 5FZDA 1XQNA 2C6SA 4AHXA 2ARCA 2EAAA 1ZZ8A 1UF2C 1BJQA 3HWJA 3BPSA 4KWJA 4AF9A 4V2WA 3WY6A 5F3CA 1NCRC 3WZ1A 1QH6A 2QQPA 1PO12 1NY72 5T5JA 2TEPA 4UW4A 3PMEA 2WQ4A 1I5ZA 2XKOA 5F6KA 2EIEA 2QQMA 1MEC2 5CISA 4D7TA 2GAUA 2R062 4FXGB 4K7JA 3LOIA 1LHNA 2DDUA 3ST7A 3WR0A 1JU4A 4K8RB 3B5LB 4X8PA 5D8AA 5FZ0A 4U36A 1VBB1 4YVSB 1MS3A 2WSVA 4XUNA 4CUBA 3ITQA 3FL7A 3A0NA 1YFUA 3HAGA 4DNYA 3VBOC 1HQLA 3IAQA 5FY4A 4DO0A 5DDJ3 2VNGA 5AVAA 2XONA 3OPZA 5F3EA 5D2AA 4JCKA 4UW6A 1EV12 1XE8A 4KWKA 3T0DA 5EJ1B 3IT8A 4V2VA 4AXOA 1W8WA 3QLQA 1L7QA 4Q4X1 3WD5A 1ONAA 1EUTA 4PIYA 5J96B 3ZXJA 1JZ4A 4UW3A 4ZHNA 1D2SA 4JGYA 5FZAA 4HZFA 4ZY9A 1ZZ6A 4DPNA 2BZDA 3NKTA 4MXVA 5K0UB 4N43A 1JZ2A 3ZM8A 2CL2A 2IXLA 4I01A 1QOOA 2G9ZA 1SG3A 1Z7S3 2B7YA 2CDPA 2ET1A 3OGJA 3UETA 4DIQA 1DGWA 5A6QA 3SMHA 4BA6A 1RTVA 1CVNA 3MIBA 5F39A 1MS8A 1O5LA 2KD7A 4F3JA 2YBKA 2PHWA 3A23A 2ES3A 4FFHA 2WBKA 1VBE3 4B1LA 3MIHA 4GXLA 4P9IA 3ZN4A 3S5AA 4YG6A 1ZZBA 3LSEA 2HWB1 3KGLA 5EYXA 2PQSA 3VD9A 2ZTNA 1H4HA 3ZFFA 2PFWA 3UNPA 3BUCA 4YW2A 5IFPA 3NV3A 4BLJA 4YW7A 1G9AA 1NCQA 3SCGA 4TXWA 1CIWA 4FPLA 2AACA 1FXZA 5FZ4A 3SKVA 2PTMA 2CSGA 1JYWA 1QNWA 1KJLA 2WS91 4GJYA 1D4M1 5DDJ2 5JOXA 3ZXAC 1XYNA 5FKCA 4DINB 1ND2A 2F6BA 5FPVA 4BIOA 4CEYC 5LCWL 4GALA 5FCCA 1YRZA 2YZ4A 4HG6B 3WDXA 3FZ3A 1OLQA 1TVGA 2LW8A 5JPNB 3JB8A 2ZGOA 4B7EA 4WM7B 4X6QB 4HXCA 3VKOA 2MEV3 4YWAA 1UNBA 4ORFA 5DUVA 5K9YA 1W99A 3B00A 5E6HA 4S2DA 1ZZCA 4H7LA 1HB2A 1FMD2 5F8PA 3TNQA 3ME2A 1XE0A 4KG8A 1Z7S2 2ZGUA 5IT6A 4CUCA 3ZYPA 1GZWA 1XYOA 4H3WA 4MO3M 5A70A 5KHGA 2XVGA 1JHNA 3AMMA 3RZGA 1SPPA 1Y43B 3WCRA 3ZFEA 1BBT3 4Q4W1 1UXZA 4NHLA 2ZHNA 5DUWA 1UY4A 1K5MA 1RJ7A 4F83A 4WM8C 4RQPC 3AMNA 3F95A 2JG9A 1X33A 3LWCA 3PLQA 4LUKA 1O4YA 3OD4A 3ZDSA 4YZ3A 2WAAA 3MW3A 4H7MA 3AKRA 3I2OA 2WZEA 2RS11 3AKTA 3VZNA 3QACA 4PF5A 5A7NA 3SITA 3H8RA 1NQDA 4NRPA 3AZXA 3RGBA 2AH2A 4W6XA 2ARXA 3G6JB 4QPGC 5CG8A 1A34A 2ZGPA 4Y4RA 3OB8A 3I2HA 2XL9A 1RITA 1W6QB 3VDBA 5ABJC 5I0RA 2BOJA 4KH9A 4P9JA 2JDUA 3WOGA 3PJQA 5FQ0A 3RJ2X 4CP2A 2E9QA 4PI2A 2HYKA 2ZKLA 5JMOA 1OT5A 3HN1A 1W2UA 2QE3A 3U78A 4LO7A 3ZFGC 3H3LA 2QQNA 1DQ0A 3RYRA 1D2QA 2EALA 2ZGRA 4C90A 3T2PA 3ILRA 3M3EA 3N36A 2BRTA 2Q1FA 4ZXEA 1QJY1 1OKQA 1OF3A 1Q8QA 1S2BA 1IKPA 3LKJA 4HKOA 5DAPA 3USSA 1OQ1A 3RFRA 3HEIA 3IKWA 4NPMA 3TYJA 4XBLA 4AEDA 1BBT2 4HBNA 3VKFC 2WZR1 3NNMA 3TEXA 1IQAA 2XJSA 2Y6JA 2P5BA 2DCZA 3M3OA 5DUUA 5JWPA 2VMDA 4LA2A 1UZYA 2IVIB 2PAKA 4W6YA 3DEMA 5DG1A 2NQYA 3RDIA 3FMGA 3KVBA 4LBOA 4MHRA 5IUQA 4CP9A 3NWKA 3ZMOA 5F37A 4COUA 2VM9A 2FDFA 3I2DA 1QOSA 1SEFA 4K40A 3WQ7A 4CEWA 1RL3A 1TME1 4MGSA 1CPMA 4HONA 4XJ8A 1Y4WA 2X5IA 3H1MA 3RG0A 2R072 1ND3A 4XC9A 1EP0A 3BIWE 3PVOA 2RM21 5KC6A 1RUJ3 4QKBA 5FZFA 2DUPA 3H8UA 2VUJA 5JXJA 4IV1C 2VZTA 4P9GA 5IAVA 5HBAA 2WJSA 5FUPA 3D5OA 1OFSA 2XJTA 4FT8A 2NPIA 5LRRA 2CWMA 3ZYGA 1AR73 1HRI3 4GZ9A 3IBMA 2D6MA 2XUMA 4UXAA 5FXVA 4YGEA 4E8CA 4Q4V2 5E89A 1RUG1 1C1LA 3J7LA 4XJWA 4BQ1A 5CKNA 1LHVA 4MOAA 4CDWA 2P2KA 5CBLA 2ZX3A 3OYWA 3KQ4B 4Y20B 2H6CA 2Z69A 4DZGA 3L9JT 2XDVA 5KXEA 5IVJA 1MZFA 1O4TA 2X10A 4YYOA 2XWBB 4B1MA 2VAUA 1J1LA 4XIKA 5F5IA 1LENA 1X36A 2W1UA 2BFUS 3IB3A 2LS6A 1AF9A 1DLLA 1W9WA 3OBRA 3MFCA 5FREA 3S0MA 2RHPA 3CMGA 5FYMA 2WO1A 2WAOA 1DGRN 5FY5A 3T2TA 1YWKA 1ZRCA 3PUSA 2YC2A 1UYZA 4RHV3 2WNUB 2EAKA 4OUSA 5LA1A 3LEGA 4YSFA 3VZLA 4NHKA 5BYNA 3NRUA 1C57A 2YHJA 5CA6A 5FMOS 1QJFA 1HXS3 2LRPA 3GCWA 3BU7A 5AC93 1CJPA 4QPIA 4N43C 3K4AA 3LSDA 1HKDA 1VPHA 1H8TB 3V56A 1TNRA 1UMIA 3M1HA 4CYDA 1W8NA 4L2NA 2HWC3 5KXDA 3SHRA 3SXWA 4PBPA 2WIIB 1GNYA 3MO4A 3R0RA 3VHOA 4XJUA 1AR72 4BXFA 4GH4B 3AZZA 5FZLA 2WNVB 3DECA 5JVVA 3K4DA 1AXKA 2LALA 5FR3A 4XFHA 4D6QA 3SISA 1BEV1 1KD7A 5FZOA 1XBFA 4GKXA 1LOAA 4MV2A 4BE3A 3E6CC 2ILMA 3ZFFC 3T4VA 1CESA 1UZVA 3AK0A 5A33B 1V6NA 3LDRA 5F1RA 2Q1ZB 1OUXA 1HB4A 4ATFA 4QHOA 4A4AA 2OUHA 4N8MA 5GLUA 5CFDC 5JZGA 1CZTA 1E5RA 4H55A 4QGNA 4CTEA 2CGOA 5CVRA 4BU2A 5BNNC 4CCDA 2FCUA 2D40A 5G05L 1AYN3 1GOHA 1KJRA 2V09A 4RHV2 4OZXA 5A3UA 1U5XA 5C71A 1COV3 4AAPA 1OH3A 3J8F1 5AC92 1TG7A 1FOD1 2VOKA 4XOGA 5FY1A 3WG2A 3WNLA 4CDXB 1GQHA 3ZO0B 4DY5A 3B94A 4JKMA 2WABA 4E2QA 1HN1A 4Z2WA 4FFGA 3I2JA 5JSPA 4NAMA 5C5TA 5CB7A 5A3WA 2WC2A 3CJXA 2X09A 4EWAA 5FZ7A 1MACA 4XQ4A 2HWC2 2CWSA 2D3RA 3NJXA 4NPRA 4IEYA 4XQDA 2W3JA 4NOTA 2HEYF 3OOXA 4AVCA 3VBRA 1UX7A 2G4IA 2E63A 3IPVB 2NMNA 4GB33 5A32B 4AZZA 3FFZA 3W5NA 2ADEA 4P08A 3ZFEC 4Z8BA 5BNPA 3DKQA 1RUI1 1QEXA 3BPZA 1HRV3 5FJHA 2SLIA 1JUHA 3DPRA 4Y22A 1W05A 2IXCA 2VBPA 3BVCA 3O5SA 4QDSA 3KT7A 3ZYHA 3PIGA 1F5JA 1Z7S1 4GMP1 2GMEA 4S2FA 4LOTA 1B35B 2YY1A 5EFUA 4M3CA 1TZOA 1H1AA 1LNSA 1V9U3 2PHLA 4GD4A 1VALA 1SQ4A 4QB1A 4PBOA 5C3PA 1YEWA 4RFRB 2H6BA 1VBE1 1G86A 1UPIA 3K75B 4UWDA 5JLVA 2VOVA 5HCFA 2BBAA 2VNOA 1PNGA 2YG0A 2JDAA 4N53C 5JOYA 1HW5A 4FP2A 2VVEA 1Y3TA 2PA7A 3HOBA 4IEOA 1U5ZA 1R1A1 3N9NA 1I9RA 5LB6A 2WWUA 4KMQA 1UOGA 4BZ4A 5HXMA 5H9SA 4XACA 4QPWA 4LO4B 4BIFA 1GP4A 3ETPA 1UQXA 3KB5A 5L7OA 2UYAA 2P34A 2MEV1 3MPPG 3QD6A 4QXHA 2IXJA 4BQ5A 5C8CB 3FWEA 4CCMA 2QVSB 4GB32 1RUNA 2WKKA 3SEEA 3FJSA 1JTZX 4RGKA 1QIQA 2W47A 1DZTA 1CZVA 1OQEA 2EXIA 1HRV2 5FP4A 3P3PA 4KGGA 4EN9B 2VXRA 4MVTA 2ENRA 3ZXDA 5I8TA 1PK6A 2DCKA 3K2OA 2FCVA 3RYPA 4ASKA 2CV6A 1V9U2 5A1FA 2ZAAA 1EAH2 3GJBA 5DZGA 1H8VA 1UOJA 4DMIA 2QQOA 3MLKA 4PDWC 1F35A 2CHHA 4F7ZA 3OY8A 4Q8LA 4JGZA 4BMEA 4CEWC 5BNOA 2NLRA 1B09A 2XB6C 3WVJA 1SBDA 4PF1A 5A6YA 1OLMA 4CA9A 4RS5A 2RJKA 4LE4A 4QU2A 3VUOA 4E4HA 1OXCA 3GZUC 1NKGA 2J1RA 2WNUC 3HPNA 4I09A 4COWA 4BJ0A 4LHNA 1MZEA 2BV4A 1MZ5A 3O12A 3BGAA 1DQ4A 3IMNA 4B4PA 3KD4A 2BNMA 4MXWA 3M70A 3WP6A 1J84A 2D6KA 5JIAA 2HWB3 3T3YA 3WUDA 4ZU7A 4FAHA 4JKKA 2BW8A 4PQQA 1S2KA 1I3HA 2ETEA 1NE6A 4HSJA 4NPLA 4OMDA 5LATA 2WZPP 4QX7A 4XCAA 1JS9A 5JSRA 2GSYA 4FAGA 1QJX3 1MQTC 4R9AA 3KQRA 2WS93 1C8M3 1D4M3 2ZKNA 1UU6A 3AKQA 3AYCA 3NV2A 4GH4C 4OZOA 3RPQA 3FLRA 2Q4SA 1F9KA 4LK7A 4RR3A 5LBCA 3T1LA 4NRQA 1GUIA 2RDNA 2WQ8A 1PMIA 4AW7A 4CXXA 4Q1RA 1Q3EA 1APNA 2YU1A 1HX6A 2C5DA 2ZGNA 1JOJA 4Q4X2 2ZEYA 4FTEA 5CG9A 3HN3A 1S2EA 2XWJB 3GALA 4PI0A 4OFGA 4Y1ZA 2ATFA 2GU9A 5FO8B 1LHWA 1W8OA 4EROA 3I59A 3EXUA 3WV6A 4CUAA 2D5HA 3RNSA 5A7QA 1OMIA 1CAWA 1DZRA 3LEKA 5CZKA 3VKNA 4IEPA 3WP5A 2XBO3 3LIHA 1FPN1 2UYBA 1NCRB 1YIFA 2ZOEB 4AE2A 4M3CE 4C1WA 2ZPXA 3MI8A 2ADDA 1AR63 1ZM1A 1HB1A 2GP3A 2VW2A 1V0AA 3PHMA 5KC5A 1UCXA 3S7EA 1UY3A 4LE3A 1AYM1 5JXHA 2DFCA 1SFPA 2R043 4OI4A 4Q4W3 3AXDA 2JG8A 1J3QA 2WWJA 2HWB2 2ZEXA 1JYIA 3GNEA 2CAVA 1PGW2 1N1VA 1ZX5A 3K3NA 1O8PA 1CX4A 4XVHA 2RS13 5FPAA 1RUJ1 4OHXA 4QMAA 3NNFA 5HV4A 3A0KA 1QJX2 2WO7A 4YM0A 1WMFA 1FYUA 2WS92 1C8M2 1D4M2 1JODA 3PJYA 2B42B 2Q1MA 2XLAA 5A7WB 1ULPA 3S57A 4META 1AR71 1HRI1 4EZ4A 2GZWA 2VD7A 1J83A 3WF1A 4ZONA 2Y0IA 1LB2A 3ALQA 3WQ0A 2WNEA 3AJZA 2E31A 4K8FA 4L8QA 1LHOA 2ZEZA 2BNNA 1JHJA 3OEAA 2QNKA 5EV7A 1LRHA 3ZYIB 1US2A 4M0HA 3VBFA 4KBBA 5HCBA 4WV8A 3ZKYA 2W1SA 5SV8A 4F8AA 4RFT0 4QWNA 1SCSA 1ULOA 3LIGA 4LBQA 1QJY3 1Z78A 2P3JA 3FLTA 4E8DA 2FHRA 4EV0A 3O1PA 2IFRA 2VMEA 4TSVA 2QTWB 4AVAA 1CONA 3P5BA 3R05A 4IXLA 3QH7A 4Q4W2 4RGGA 4XTMA 4NWWA 4DUXA 2A6ZA 3MF6A 3MV11 4PCRA 3MUY1 5IHRA 2ERFA 1HXS1 1OLME 1SZBA 4EE2A 4XF3A 1YUDA 2XR4A 4CDQA 1SMVA 5TSWA 1VIWB 3T2OA 1VP6A 3M3IA 1YJKA 3RZHA 2RS12 3SH5A 3U37A 1W6OA 3MHZA 3H9AA 1G9FA 3MDPA 3I8TA 1ENRA 4TN7A 5C8CC 3GBWA 3O1MA 3IIIA 4XDPA 1GV9A 3HT2A 3C2UA 2DVDA 2Z5WA 4XMAA 4XUOA 5FKBA 2ZHLA 4O9EA 2RM23 4YG3A 4CEYB 4MZUA 2Y8KA 2BBVA 2WDBA 1VMFA 2W91A 1U5IA 3AKPA 5IVYA 4Q0UA 1QU0A 3EQEA 2DFBA 3VZOA 4A7ZA 2Z4FA 2XJPA 3ON7A 4BQWA 4IGQA 5FPXA 2W94A 4BMBA 2QKDA 3K51A 3DN7A 1RUG3 3U75A 1PZ8A 5CFCC 1JYNA 4FSJA 3PIJA 1W8FA 4IE4A 5DAVA 1H2MA 4L0PA 3O1TA 2WA3A 3AYDA 2ZX0A 3VHPA 1F15A 1NZIA 3BODA 1QJY2 2RJLA 3VDDC 3OD0A 4CDUB 2GC2A 2PHDA 2B4KA 1XNBA 4FOVA 4M00A 2JDHA 5T50A 2ZGSA 2A7AA 2EF6A 2GC1A 1AYN1 1YJLA 1RUD1 3JUUA 4HANA 2BYVE 3K46A 1UW8A 3CL1A 2VZVA 3LDBA 3O0WA 3F2ZA 3T4HB 2WT0A 2WZR2 1COV1 1DBNA 2JJ6A 1GU3A 4DY3A 5K7PA 1RUC1 2YPJA 2Z2SB 4XFFA 2ZMNA 3LD8A 1MPXA 4PJYA 4RQPB 5I0TA 1RMU1 2VUDA 4WVVA 4IE6A 4UFMA 1IOAA 3JBG3 1O91A 1GZTA 1LU2A 1NG0A 2HJIA 2KM2A 1W2NA 2QFEA 1PO23 2R49A 3NAPB 5J98B 1AL21 1REFA 1TME2 3KZ4C 1GKBA 5LBBA 5AFEA 5FZ1A 2FDIA 2RM22 2XHKA 1Y9QA 4GWIA 4JGZC 5L19A 4TLFA 1VLNA 4YZ5A 1WLWA 4FPGA 4YVWB 1HRV1 2VZ1A 4MLOA 3WCSA 2P3YA 1H2NA 2JX9A 4RS5C 5C9AA 4A42A 3N7KA 2VOWA 4TTGA 1QKQA 3KT4A 2ORZA 1LAJA 3U07A 1E5SA 1V9U1 4NR1A 3MUZ1 3ZFGB 1RUG2 3NV1A 3Q8AA 4AHYA 4AVTA 4BLIA 1OFNA 2ZJCA 3KHCA 1BEV3 1GWKA 1ULFA 4AVSA 3IDBB 1BYHA 2Y6HA 2W39A 2R0FA 4PT6A 4NUBA 3VDAA 2HBTA 2HWD3 4L97A 5ISLA 3ROUA 4BISA 2OX0A 1FX5A 2BQPA 1URXA 1IPSA 1WBLA 2YFZA 2YROA 3HVDA 2G9GA 3JQXA 1P8JA 1TQ5A 4AHWA 4AR2A 3AVRA 1XU1A 3QH6A 1HB3A 5I0SA 3W20A 4DXSA 4GWJA 4A3ZA 2W5FA 2YV8A 4CCOA 3JBG2 4AI9A 1LECA 1VRH3 1GANA 5GZEA 1QY4A 3LA2A 1UMZA 1VMHA 5A3TA 1CAUB 5GKAC 2H0VA 3J8F3 4K1YA 1F4AA 1FOD3 1YXWA 1X9TA 2OZ6A 2BGPA 1SDWA 2W87A 1AZDA 4QDRA 1NQJA 1UIKA 2TBVA 4YG0A 1SBFA 3B02A 5KHKA 5K0UA 3I3DA 4FOWA 4YGCA 4LNVA 3MIFA 1H2LA 4V1PA 4FQZA 4O61A 5LY1A 1CAXA 4JDMA 4BDVB 5HCHA 4JRLA 2OVUA 5L73A 2C1FA 2UY9A 4IV1B 5H9PA 2DU0A 3AL5A 5F9TA 3M8LA 2DTYA 3NJZA 3OBAA 2BJSA 4CVUA 4K21A 2EICA 1FV2A 1RYYA 1UY0A 4L99A 1RUI3 2D6PA 3J9SA 2OQ7A 3D4KA 3H7YA 1BEV2 4MHUA 4CP0A 1G9CA 2JEMA 1VB4A 3NNGA 1DF0A 4GMP3 4HT1T 2DYCA 3GZTB 1DCSA 1MZ6A 2C4XA 1SFYA 5FYIA 2RR13 3EO6A 3H3ZA 3VKLA 5FYTA 4FBFA 1AJOA 2WYFA 2J1UA 3PUIA 3KCYA 2V72A 3OPWA 1T6GC 2O14A 4LLOA 1DGWX 4QKFA 5JI9A 5LEKA 3LA7A 3ES4A 2DUOA 1W0OA 4Y26A 5FOJB 1RUH3 1LHUA 4QXBA 1LODA 1PGW1 1PNFA 3OG2A 1YYNA 1R1A3 1WBFA 2VZ3A 4GWMA 3J8F2 4XF0A 1QJX1 4LO8A 1FOD2 5CYYA 4QB6A 3BN6A 3I97A 2F4PA 1C8M1 2DCJA 1HQNA 1T2XA 2JE7A 1UMHA 3CLPA 3M3CA 3O1SA 4G9SB 4NIGA 5D1IA 1W3XA 5A7OA 4N43B 4OUEA 4FPOB 1XPWA 2N7GA 3HBKA 4Q0SA 3WW1A 4CCLA 4MSVA 1S0CA 2BDRA 2XOMA 3LEMA 4DFSA 1L7LA 2I07B 3PNAA 4XUTA 1I1EA 3FE5A 2J22A 1W8ZA 1RUI2 1XSQA 4QQOA 3Q8EA 4QQPA 2GNMA 3AMQA 4SLIA 4UFKA 4CDUC 2YDEA 4LHKA 5FWEA 4CXYA 1O3SA 1SLBA 2R1DA 1YQ2A 1S0GA 2XBO1 4UYBA 1LOFC 2B8MA 2PLV3 4HK9A 3FBYA 4KL1A 4R52A 4BYYA 3ZFFB 4Y1UA 2ZGQA 4LTAA 4DXRA 1AR61 2BTVC 2Q8OA 1NZCA 3VN4A 3WG3A 1WW7A 4Q4Y3 2WSUA 5KR7A 1NCQB 2P17A 4D6RA 4N7IA 5JR7B 1SLIA 1UKGA 2E7TA 2R041 4GKYA 4NMIA 4OHZA 1VBE2 1MVEA 4M4RA 4XDOA 2W0XA 3TN91 5CFDB 5IK7A 1WW4A 3VD4A 2VZRA 2IXKA 2AREA 4LBLA 3IDAA 5BNNB 2QBXA 2MHFA 5GJ6A 5JMCA 3SNMA 1OD3A 2B9UA 2MPFA 2R32A 2RE9A 4ARXA 3TEWA 5I93A 4Q0QA 1R1A2 3N9MA 3NAPC 1H2KA 4FFIA 5DAQA 5DABA 5HV0A 2V5DA 4HLTA 1J59A 2ZGMA 2VC9A 3KGZA 3H1YA 4J1WA 2O0OA 4W65A 5KHIA 4UFLA 3VBHA 1AVBA 4U2AA 3UKVA 4ZPIA 2FMDA 3FUQA 1WA6X 2RDRA 5IW0A 2QQLA 5I91A 3VBUC 4YVWC 2Q8CA 3EHKA 3WNOA 3WNXA 3H8XA 2Y6FA 1CN1A 5FK8A 1K12A 3BOWA 3O1OA 2MEV2 5FY8A 1IS4A 2VQ0A 4JVAA 2XH6A 4OHYA 1GZWB 2A75A 5GZDA 3I2IA 3I49A 3JB4C 3UKTA 3U0ZA 1SPPB 1V6OA 3E6DA 4WVMB 3ZFEB 4A6OA 3OCPA 4P9LA 4K20A 2Y64A 2LUWA 5FPLA 2JG9B 3BALA 4L11A 3VLBB 4FI9A 2OA2A 1QQP3 4QX5A 5KHHA 1A3KA 4Z82A 3T0AA 3USUB 4QB2A 2EA7A 1OOPC 5FZKA 3RS6A 2YGMA 4KBZA 4PHZA 3VHNA 1OH4A 3W5MA 4QPYA 1ENQA 1UOBA 2XQXA 1Y9GA 2ZCWA 1NXD1 1XSRA 3MIGA 1FPN3 2V4VA 3FFQA 5E16A 4BOWA 4CRQA 1U5YA 1UZZA 5HI0A 2JB8A 2OW4A 2D43A 3P6BA 1VRBA 1AYM3 5FPZA 1IQDC 5C4WA 4N53B 5FQ0B 2PHRA 2XKPA 2RG4A 2A70A 3T08A 3R4SA 4D8MA 1NOVA 2VCMA 1LEMA 2VVFA 4KU7A 4NJ4A 1TNFA 5FDBA 3R6SA 4EQVA 3ACFA 2WUHA 4NHYA 2GNDA 1RVF1 1NX9A 1SFNA 1JI6A 2PHTA 3C8XA 1ZBA3 1UWWA 4P5HA 1UY1A 4Y20A 1AX0A 2AEZA 5J37A 3HNYM 4FPHA 2W1WA 2XUEA 4DEVA 1JW6A 1WLTA 1N3QA 1DYPA 3CJIA 4FTSA 1NA1A 4OLLA 3GZAA 1R091 3OPTA 1QJEA 3POIA 2RV9A 4IV3A 4Z1VA 4LO5B 1KDKA 1ZNPA 2GN7A 2GC0A 2QJVA 2YYOA 4INDA 1W06A 4IEUA 4XMIA 4YZ2A 4MGIE 1GNZA 3VZKA 3ZXLA 4PLOA 4XHXA 5ANNA 5FP3A 4BQ2A 1WMXA 5D8AC 3V0BA 2BPA2 1YFWA 3CIHA 4EN7B 4ONUA 2WL1A 3HQRA 1HLCA 1DYKA 4DS0A 5GZCA 3I2KA 4CP9B 3O1RA 3BIEA 5EJZB 2QZ3A 1AR91 3HT1A 4PDWB 2C0ZA 1QMJA 1CIYA 4QX1A 2VR4A 4NHXA 2HH9A 2B39A 4FO9A 4XAAA 3I54A 1FPN2 3WG1A 4CEWB 1FNZA 3KV9A 3N9QA 2AENA 4UOJA 4AG4A 2QZ2A 2BU9A 2DURA 3B3QE 4CPBA 1QXRA 1KITA 5LZ6A 4ZU5A 5T3NA 4BWOA 3PMSA 3MLLA 5FIXA 1AYM2 3KV6A 3JBG1 1VJ2A 1W0NA 2CDOA 3GHMA 4A45A 1QF3A 2ZABA 1PO21 1S0IA 1JBCA 4JGYC 4RA0A 1X82A 1WCSA 2WFF1 4DUWA 2WO2A 5LA9A 3WW3A 5A6XA 5C5UA 1G8WA 2WNVA 2OXBA 3FHAA 4XJAA 3WDYA 1FV3A 2AGSA 4LQRA 4Y1YA 1RUJ2 5KHJA 3ZLIA 4XF9A 4KQ7A 3OYWB 2V73A 4HVOA 3A22A 3AP4A 3T1MA 5IK4A 5BUVA 2NMOA 2BWAA 1MQTB 2XJVA 3DUIA 1WCQA 4R4XA 4WZCA 1ZREA 3ELNA 3N7JA 4I30A 3PU3A 3WNNA 4LBQD 1HRI2 3N9OA 4Y33A 2OKXA 1H6XA 1BCXA 1V6MA 3J7MA 4XFAA 3LAGA 4COYA 1OQDA 3E1F1 2HWE1 1N1YA 2BWCA 3M3QA 2AEYA 2WQZC 2B45X 4QT6A 2HWD1 4YW3A 1KDMA 5CIRA 5T52A 2HEVF 2VZPA 1R64A 1NCQC 4RL7A 3NVCA 4UBHA 5EXOA 4NROA 2XLGA 1Q8OA 2VY0A 4CSWA 1PZ7A 2GNBA 1L7RA 4N9IA 3ZSJA 1Z0HA 4CDXA 1C4RA 4KNCA 4LA3A 1ND2C 1WMDA 2D3SA 1KFUL 3C7HA 4E4ZA 3H1WA 3LB9A 3WLUA 3UJOA 2FDGA 3GZEA 2FBEA 2WT1A 1RUD3 3KF5A 2WRAA 1ULCA 2QQKA 3AB0A 3FN9A 2BOIA 2OQ6A 1VRH1 2C9KA 3WW2A 2P3IA 4IDZA 1RUC3 5EQUA 1O3QA 4P5YA 1W6PA 4C8DA 1HXS2 4XBQA 5FMCA 1BKZA 2WYSA 1IG0A 3IPVA 1RMU3 3KV5A 4QGMA 5A3NA 3JCIA 1UKRA 1PVXA 3INAA 4AQ6A 3LQCA 3UJQA 1REDA 1ZVFA 2OS2A 4FCAA 4TWTA 3PL0A 3ZDVA 1WCUA 1ODNA 3OGRA 1QDOA 4XJ9A 4DEQA 1W0PA 5FZOB 5LK7B 2P4EA 1UYYA 1AL23 4YPJA 1KQRA 2WO3A 4LPLA 3HJRA 3AP9A 3ZN6B 2DVFA 3ECQA 2W9XA 3KV4A 5CAZA 4BM8A 1UYXA 5FZEA 1WW6A 4NIDA 4AI1A 1K5MC 2PHXA 1W6MB 1O7FA 2ZBJA 4D6SA 2PELA 1DQ6A 1O59A 2JG9C 3BB6A 1J3PA 2QDRA 3IWZA 4H2AA 4LJHA 3JZVA 5K8SA 5L36A 2RR11 2FDHA 4I0BA 4EN6B 3KWVA 5FOBB 2JICA 2BGOA 3Q8BA 2UURA 1ENXA 1POV1 3B9IA 3VBSA 2KXLA 2C24A 3LZZA 3M2MA 4QD2A 5E88A 5G04L 1RUH1 1WKYA 1AYN2 2PAMA 1RUD2 5ACA3 4XBNA 5KWRA 1CWPA 4MGKE 4URTA 1DLCA 2K2SA 3THTA 3AYAA 4OMCA 4AFBA 4XFIA 1COV2 2B9VA 2Q5TA 3NJVA 4GMP0 1VBC1 1RUC2 1VBA1 1VAVA 2Y38A 3CDZB 1WMEA 4HKWA 4CP1A 4LK6A 3B69A 4WVZA 2K9ZA 5FZIA 5IVVA 3DYOA 1RMU2 3VBRB 2BVBA 3E5XA 3OUIA 1XRUA 2SBAA 3T30A 3UL2A 3RJRA 5H9RA 5BNPB 2YU2A 5DPNA 1CX1A 4Y22B 4K1ZA 3DPRB 1AL22 1H1IA 2GH2A 2G9FA 1FNYA 1YQ6A 4M3CB 1N3PA 4R9DA 3MW2A 2XQRA 1GOFA 2CYFA 3BCWA 3POFA 4K3UA 4XPVA 1ZYBA 1PGSA 5EP9A 5FZ9A 3MPBA 4AEDC 1ZRFA 4OUMA 2BP6A 4FPKA 4KWUA 4CCNA 2UU8A 2RVAA 4XDQA 5J09A 1LOCA 3WT3A 3VHRA 5B4NA 4XUPA 2DVBA 2PLV1 5DAWA 3KVAA 2R6QA 1D4VB 4CZSA 4QHBA 1IGOA 1PVC1 4Q4Y1 4IEVA 1IHMA 1ASJ3 5CFCB 4IUGA 2ORXA 1YI9A 2QQIA 2X5IC 3DYPA 3AP7A 3MZHA 1MS5A 1ND3C 3VDDB 4FXKB 1OF4A 4PIZA 5J48A 1X8EA 2YMZA 2JD4A 2ARAA 2EVXA 3AVSA 3VKMA 4I3PA 4ZKTB 4Y1VA 4BK5A 2X29A 1GLHA 5L7OB 5DQ0A 3CJIC 3BOPA 1NA1C 1OA4A 2ZGTA 5A3LA 4CDWC 4BPZA 1GWMA 3LGRA 2VE1A 2VG9A 2JDNA 2ZACA 3IM0A 1CD3G 2UWCA 4FPFA 2KA3A 4AQTA 1PK6B 3MBWA 1YFYA 1JZ7A 5FAXA 1PHMA 1PZ9A 3UV9A 1GQGA 4IERA 1O3TA 1OSGA 2FDKA 3OY8B 3WNKA 3OGSA 4JGZB 2JIJA 1NCRA 1IKQA 3POJA 3FC0A 4RS5B 4CU8A 4JAAA 5GALA 1OLRA 1QQP1 4YW1A 5T5LA 3N9LA 2A6YA 3CKHA 1TMF3 3AZYA 3QCWA 3PVBB 4P9YA 4QX3A 1DQ5A 5IAXA 3AC0A 4MXWB 3EMRA 3O1UA 1F8VA 2VH9A 4QPIC 2ET7A 3LEIA 1K45A 4OQ9A 1GZCA 3RVHA 3AP5A 3QBQA 3I3EA 4TZDA 3IZOA 2JDKA 5BV6A 3B93A 2CGPA 1JZ5A 1ALYA 1E57A 2D98A 3WXPA 4BCUA 3PU8A 5IK8A 3KF3A 1YQ8A 2VU9A 4I0WB 2FZ1A 2OZJA 3TN93 1RIRA 2ZXQA 3AFGA 3VBOA 4ARYA 4Z92B 1PGL1 2EXHA 3VL9A 1KXGA 5FZHA 3CEWA 2QQUA 3RZZA 1XNDA 3WG4A 1JOPA 3MIDA 5EZWA 1JYTA 4RR3B 3SH3A 4DUVA 3CZJA 4Q5OA 1AX1A 1VMJA 2CTVA 1ZBA1 2NN8A 3LPGA 3FBMA 1X9PA 1NYWA 3SC7X 5AFBA 3N7LA 5F5QA 2CGNA 2VCCA 2G19A 4XJZA 3WDUA 2HWF1 1YNAA 3ASIA 1OD5A 4Y3OA 5HCAA 2PN5A 4YM2A 4QKDA 5IVBA 2XVLA 2E33A 4LUMA 2WN3A 4QQHA 1GWLA 2JD9A 1JOBA 3FHIB 4NVPA 5JZGC 5EHDA 1CAWB 1W9FA 3OTFA 5FXZA 1RUE3 3I2FA 3NL1A 2OIIA 3BTYA 2W95A 3ILNA 3ZMNA 4D0QA 3RWNA 1DQ2A 1ZRRA 1IS3A 1XOYA 4FQ4A 5FFOC 2XVKA 3NO8A 4J25A 3UGHA 3NJYA 1ZZ7A 3U11A 4ASLA 2Y6LA 4HVQA 1SBEA 1CPNA 1BLZA 2UY8A 5L9RA 2XXZA 1YLLA 1R083 3RZKA 1XYPA 4UFHA 2JG8B 1GP6A 1H9WA 5FLJA 1W04A 5K4LA 3A21A 3NW4A 1BVP1 2XBO2 3ACLA 3N3HA 4IGPA 1LR5A 3AM2A 3DKWA 4P14A 4JKLA 2I45A 5FPBA 5B2GB 4EWEA 1AR62 1V00A 2RS31 2E7AA 5C3RA 2F17A 3N35A 3C3VA 2XMLA 2R042 5J36A 3JD73 1RB8G 3TN92 5LBFA 4W50A 1AUYA 2JDZA 4QDQA 1STMA 4Q2FA 3RI8A 3VBRC 4DOUA 5GLZA 3VGIA 5FY0A 3BYWA 4CCEA 3IIAA 3UT0A 4TLGA 3T09A 1DQ1A 5BNPC 1NXMA 2Y6GA 5IK5A 3ZPYA 2J1VA 1DHKB 3DPRC 3RMXA 1S4CA 2TUNA 1HV0A 1ODMA 2VUCA 2W52A 5I8SA 1FI2A 5B4XA 4NIIA 2FD8A 3POEA 2NZ9A 1O8SA 2IXIA 4UF0B 1RVF3 3VBFB 3MW4A 1NE4A 4JV4A 1CJDA 3W58A 4C91A 3CZUA 2A5ZA 3OGVA 4N9HA 4B29A 2X8KA 1G7YA 5FXWA 5JSOA 4CU6A 4LBQB 4OHWA 3LA3A 5CKMA 1JYCA 5CEHA 3M7AA 5LBEA 1CAVB 3R4DB 1V70A 5A6ZA 1AXYA 1R093 1HJGA 1BHGA 3HMYA 3OGGA 1EY2A 3ZIWA 5FPUA 2VUAA 5BNQA 1V6LA 2HEWF 2VTXA 2J1SA 4W4ZA 4IESA 2GDFA 5E8AA 3ZYRA 4WM8A 4RQPA 1Q5OA 1OC1A 2LM3A 2Z79A 5AVPA 2ID4A 2D97A 2X05A 4E4SA 1UL9A 2JWPA 2RS53 1UOFA 2VMCA 4CDQB 4EN0A 2VULA 3S6PA 2E51A 2A1XA 1ULEA 4DRRA
chains in the Genus database with same CATH topology
4HMZA 1AR93 2H0BA 1UPSA 5L7OC 1U0AA 4AWDA 2VPVA 1WW5A 1JUIA 5GM0A 2OUJA 4QPGA 5BY5A 1BMV2 1QJU3 1EPWA 5JCTA 1BZWA 3KM5A 2GN3A 3H0OA 4GIQA 1N47A 2DVGA 4MUVA 5LK5A 5ABJA 5F6LB 5EJ3A 1PIV1 2CY6A 1PK6C 4HPKB 3V0AA 1MR5A 3E5UA 4IETA 2VNRA 2WFF3 1WGPA 4I3GA 1RVF2 3ZFGA 2JKBA 4HFSA 1BK1A 3GBGA 1LOBA 1MEC3 3A4UA 3W59A 2YGLA 4O9GA 3VBUB 5BNOC 1ZA4A 3V64A 4L92A 3KSCA 4I0AA 5DG2A 2ZA9A 3OJBA 1RUF3 1R092 1XE7A 2EXJA 3SH4A 3WDTA 4AEJA 2A3WA 2HWE3 4AGVA 1KS4A 3SCFA 2XLFA 2I2SA 1GYKA 2DV9A 1W6NB 3HBZA 2RMU1 1X50A 2VW1A 4YVSA 1EV13 1QXJA 4FOQA 4WVWA 3HD8B 2ZHKA 5ACA1 4AVBA 1AR92 1CAUA 1S0EA 1F31A 1OOPB 1DIWA 1C3HA 5LRSA 4ZXKA 4FP3A 4RR3C 5FBZA 1HV1A 3WW4A 2BUKA 1ZBE1 2XJRA 1YO8A 2OPKA 3O0XA 1OI6A 4HETA 1PO22 4YFWA 2VECA 4IV1A 5C9AB 2NYYA 2WFF2 2R30A 5SV5A 1QJZA 2P37A 1FAYA 1O3RA 5FO7B 3VV1A 4LR4A 1GSLA 1OPMA 2ZX1A 5JPMB 1CGPA 4YNIA 2V5YA 2IFWA 4NHMA 3RYKA 1RUF2 4YGBA 4LHLA 1SLCA 2JG8C 3HR9A 2HWE2 2WINB 4Y1XA 1ASJ1 1CR7A 3IN9A 4YGDA 2QDNA 3MYXA 1I6XA 1QNYA 2HWD2 4J1XA 1VAKA 5KXBA 5D8AB 1OHFA 4LBMA 4AI3A 4EWDA 2YC0A 2AR6A 2W08A 5DUXA 4D7SA 4XFCA 1N3OA 1HQWA 4KWLA 3IDEA 1XU2A 5HXVA 3MFAA 4BH9A 1POV3 3UKNA 1VAMA 1C28A 3H3UA 2A6WA 4XTPA 2A6XA 4QM9A 1JXNA 1CAXB 1SLTA 1VRH2 5GLUA 1VBC3 1FMD3 1VBA3 4WM7A 1A6CA 1IS5A 4COZA 1KFXL 1LESA 3WHUA 4JGYB 1EYBA 1DGRA 2A71A 3VBFC 3TBDA 1H9PA 3S7IA 4OHVA 1A8MA 1LOEA 4D7YA 3ENRA 1Q56A 1H1MA 1D0GA 3QOPA 4QQ2A 4YZ4A 3HIFA 4JTOA 4X8NA 4Q1PA 4G4FA 3WDVA 4A7YA 1TMF1 5T5PA 1UU5A 4W6WA 2EIGA 5FLIA 3L2YA 2VMHA 5CFDA 1LULA 4AVVA 1R1ZA 4XETA 4CDQC 5BNNA 2JENA 2RR12 4GWNA 1PVC3 2E6VA 2NM1A 1DGLA 1S0BA 3LOBA 2FZ2A 5FTTC 3CO2A 1DG6A 4N7UA 2D44A 1LCLA 1W6QA 4PLMA 1GR3A 1RUH2 1ND2B 3ZXKA 4A7KA 5DZEA 1VBC2 1VBA2 5DZFA 2WT2A 2O8OA 4COVA 1YCIA 4KG0A 3W9AA 3N7MA 3ATGA 2XJUA 3MGUA 5T5OA 1C1FA 4OULA 4A3XA 3IDCB 4WVMA 4YM1A 2IZWA 3ZSLA 1QXPA 3ES1A 3THPA 4FTBA 1ULGA 2JECA 1RUE1 4YM3A 1KRIA 2XL7A 2HKXA 2ZX4A 2ZGKA 3KCXA 1QOTA 1IZ3A 3USUA 1ULDA 3G7DA 1LKNA 2D6OX 5I0UA 3PVNA 4Z07A 1MS1A 1R081 2WA4A 1O4ZA 5KBFA 4M0NA 2A3XA 4Q0VA 1K5MB 4HN1A 2AYHA 2PLV2 3VZJA 4LULA 4ASMB 2R073 4QQLA 1OA3A 3WX5A 4YARA 3AYEA 4HVRA 1PVC2 1IS6A 4N53A 4Q4Y2 2VMIA 3JD71 3ZXGA 4Q27A 4Y24A 4AI8A 1QHDA 2PYTA 4IEWA 3VBHB 1S0JA 1BMV1 2ZS6B 1AR81 1VBD3 4Q4V3 3SCHA 3POYA 4JC1A 4YW4A 2B5HA 3H7JA 4TYSA 5CU1A 1G6NA 5C9AC 1Q8SA 2IXHA 2ZZJA 4KGQA 1EPZA 4RSUA 4C0BA 2DCYA 5A3MA 3ZSKA 1X7NA 4DB5A 3AX4A 2PHUA 2E53A 2B46X 2IC1A 2W68A 4Y5Z0 2DUQA 4XZPA 4YVSC 1PM7A 5EWSA 2HWF3 2E7QA 4QGLA 1DFQA 3GYDA 1SLAA 1FT9A 4HL0A 1WD3A 1M4WA 3SLIA 1AJKA 4ZU4A 4PDWA 4RD7A 4AEDB 2ZX2A 4ISQA 3RSJA 3FX3A 3AZWA 4UW5A 2UWAA 2RS51 2VQAA 4A2UA 1F5FA 1QQP2 4AGRA 2YUEA 2WNUA 5C4WB 1C5HA 4LBJA 1M06G 1H30A 2EXKA 1RHI1 1HIXA 1LEDA 1MS9A 3H50A 5K0UC 5J3UA 3GBFA 1QJU1 2X5IB 4LBNA 1VBD2 2RS33 1H8TA 1ND3B 5JAXA 2CAUA 1XXNA 3CF6E 4GULA 4IEQA 1SCRA 3WINE 3AZVA 1MQTA 3D8CA 3NSTA 3TOJA 1PGL2 4K6BA 1PO11 3EBRA 1NY71 1JN2P 4QXKA 3UK9A 3CJIB 1QH7A 4GH4A 4S2GA 1NA1B 4PQ9A 1ZBA2 4IV3B 4Q26A 1MEC1 2VVDA 4CDWB 2R061 1Q43A 1RJ8A 2D6LX 3DV8A 3V0BB 5CNAA 1OA2A 2HWF2 3I4IA 5A33A 1RUF1 3WP4A 5GZGA 4Y4YA 3MEPA 1FATA 4XEZA 3WHTA 3B9CA 3WDWA 4AGGA 1EV11 2BFUL 3AJYA 1Q8VA 4WM7C 3ZN5A 2VMGA 4B8EA 4JRAA 4AYUA 1CQ9A 4WBBA 3O0VA 3D0JA 1UN1A 1S1AA 2DCTA 4LEJA 2RS32 1H0BA 4QPIB 4B4QA 4MYEA 5FMOL 4QM8A 1W39A 1D0HA 4JTNA 4PIXA 3DF0A 3RMYA 3ZN6A 1DU3D 5A32A 2WFPA 1W6MA 3MF9A 3OBTA 5H9QA 1WCDJ 1LGBA 3S30A 1LGNA 1PIV3 2MNGA 2WLPA 3LCPA 3TB0A 4DXZA 1Y7BA 2ARBA 4XE9A 1B35A 3B01A 4R4ZA 1H4GA 1G9DA 5JZGB 4ATEA 5DDJ1 2DU1A 2FMYA 4E27A 1LOGA 5BPXA 4B3NA 2TNFA 2ZZQA 2OYZA 2ZHMA 3ZXEA 3TNPB 3E5QA 4HSLA 2XG3A 4FVVA 1WUVA 4IL7A 2O8QA 1WCKA 4OVEA 1W6PB 3VBHC 4AFDA 4EJRA 4Q29A 4IQPA 2RMU3 4PLNA 5CADA 2D7FA 1AXZA 3ZYJB 5GZFA 1GICA 4ES9A 3R4UA 4XILA 1FMD1 2LTNA 2UWBA 3KCCA 5C8CA 4N90A 1DZQA 2R1BA 5JOZA 1EAH3 2X53S 1ZBE3 2XGXA 5EYYA 3KT1A 2DTWA 4J6GA 1POV0 1YIPA 3JU9A 1PIV2 1UU4A 3J26N 5LEJA 5GLVA 1LGCA 3U10A 4GQ7A 1L3JA 3AMHA 1G9BA 4YRDA 3X29B 4AFMA 4XFGA 4YLZA 1A8DA 2D93A 5CFCA 1UD1A 3RRDA 4AQSA 3TWIA 2K0GA 4XFBA 4AK3A 4LO6B 1RGSA 3VBSB 3VDDA 1VBB3 2BNOA 5C4WC 1ZRDA 1S0DA 2Q0AA 3POWA 4AEKA 1SACA 3NKGA 3B7MA 1YHFA 3RQ0A 4JQRA 3ZXFA 2RMU2 4AHZA 1YI7A 4D69A 1C5IA 2AZ5A 3AXEA 2A6VA 4ES8A 1RC6A 4M3CF 5ACA2 5JIUA 2A3YA 4GA9A 2D3PA 2PQQA 4Q4X3 4FPYA 4XF1A 4AI2A 4E9KA 4I2OA 4G3YC 2BEOA 4OI1A 1UIJA 4LBKA 4DRVA 2PAEA 4H14A 3I7DA 1VR3A 1ZBE2 4IV3C 1WA4A 4M01A 4IEXA 4C1XA 1BBT1 4BHPA 4OI0A 2WLQA 4YFZA 4HN0A 3K48A 3AMPA 5T55A 2DVAA 4E2GA 4Q0PA 1AL0G 3MICA 3J4UH 5BNOB 3WUCA 1NLRA 1VBB2 1H8TC 3VL8A 2YXSA 2R071 1V6IA 3KS7A 3JQWA 1ASJ2 4R9BA 2R16A 3O7OA 5J7MA 2WNVC 1AHSA 1VBD1 4Q4V1 3ZSMA 3V65A 5C33A 1GZ9A 3CNAA 2ZAHA 3D82A 2XPJA 1F2NA 2A73B 2VGDA 1KS5A 3FLPA 3P3NA 4P9XA 4XYXA 3ZX7A 2Q30A 3TRSB 5JDBA 3NV4A 3D0SA 3DL3A 1WLCA 3KLSA 3OF1A 4ITCA 1QGLA 1REEA 5KXCA 2C9AA 5C8WA 3BTAA 2DWRA 4X6RB 3RI9A 1A78A 3AKSA 4YW5A 4XIOA 1WLDA 4SBVA 4S2HA 2ZMKA 4NN0A 4WZFA 2PHFA 1BXHA 3AFKA 3I59B 3ILFA 1ZZ9A 1GFF2 3APBA 4CDXC 4LT5A 1WD4A 3FUOA 3ETQA 4FPCA 3U4XA 5JI7A 5T54A 1GNHA 3ZIXA 1TMF2 3DGTA 5I8YA 1RINA 4B7KA 5FRAA 4FPJA 3VBOB 1X8MA 3POSA 3HQXA 4HK8A 2QUOA 1JH5A 2Y0OA 3N4MA 4MX3A 3WQ1A 1V6JA 4XQWA 1U12A 3KMHA 2P3KA 1B35C 2GC3A 3PTYA 2O1QA 1XNKA 4R8HA 1OPOA 2JXAA 5FLHA 1BQPA 1AR83 2JE9A 1IPJA 2AUYA 3GHNA 3PVEA 4JDOA 5BXXA 4L9BA 4AFCA 4CEYA 3E97A 4NWVA 1J1TA 3URFA 3Q9OA 1ENSA 1S0FA 1QWRA 2Z42A 4XXPA 1TE1B 1CAVA 4LLFA 3MLJA 4HKLA 4DQAA 3AP6A 2I74A 4RHV1 1BVVA 2XJQA 3TAYA 4AQ2A 2WZR3 4P9WA 3E6BA 1LTEA 4ISRA 3WP3A 4YZ1A 5AC91 1O5UA 4E2SA 3VBSC 1RUE2 4CDUA 1V6KA 3L2HA 1LOFA 1SLLA 1XNCA 1DDLA 4B4RA 2GMMA 4NO4A 4IEZA 2ZGLA 4FPEA 5E1RA 2GH8A 2BGCA 4K9SA 1R082 2HWC1 3MIEA 1NLSA 1TME3 1S55A 2ZMLA 4XXAA 3D6EA 2GALA 1UAIA 1Q8PA 4FOYA 3CU7A 1W6OB 1LU1A 4HPKA 3JD72 3NAPA 1MS0A 1YFXA 5GLWA 2FQPA 1RHI3 1GBGA 2GNTA 1IPKA 4E4DX 4MGYE 4RGAA 1AR82 3M4FA 4R9CA 3VBUA 4YVWA 1N1TA 3EJKA 2VW0A 4MGZE 3O14A 1AX2A 2VOXA 1PO13 2NP0A 4JDNA 5C6CA 2Y26A 3GF6A 4C0HA 2DF7A 4Q8KA 1N1SA 4XF4A 2R063 4OI2A 1W6NA 5DXDA 4UBGA 4WM8B 1HDKA 3ZSEA 2QCSB 2BVVA 4EN8B 1UX6A 5JOWA 1OOPA 4XHBA 4AI0A 4AFAA 2GMPA 1MS4A 4MH0E 4QPGB 4XW3A 2R0HA 2RS52 4GB31 1J58A 2D6NA 4I02A 4D3WA 3VZMA 5ABJB 1J3RA 1C8NA 4AEMA 1RUOA 2CNAA 2IWGB 1TEIA 3V0AB 1VB2A 1MVQA 1RHI2 5GLTA 3ZVXA 1QJU2 2WWSA 1LJ7A 1QDCA 2D5FA 1EAH1 4KU8A 4AHXA 1XQNA 2EAAA 1ZZ8A 1UF2C 1BJQA 3HWJA 4KWJA 4AF9A 3WY6A 1NCRC 3WZ1A 1QH6A 2QQPA 1PO12 1NY72 5T5JA 2TEPA 4UW4A 3PMEA 2WQ4A 1I5ZA 2XKOA 5F6KA 1MEC2 4D7TA 2GAUA 2R062 4FXGB 4K7JA 3LOIA 1LHNA 3ST7A 3WR0A 3B5LB 4X8PA 5D8AA 4U36A 1VBB1 4YVSB 1MS3A 2WSVA 3A0NA 1YFUA 3HAGA 4DNYA 3VBOC 1HQLA 5DDJ3 2VNGA 5AVAA 3OPZA 4JCKA 4UW6A 1EV12 1XE8A 4KWKA 3IT8A 4AXOA 3QLQA 4Q4X1 3WD5A 1ONAA 4PIYA 5J96B 3ZXJA 4UW3A 1D2SA 4JGYA 4HZFA 1ZZ6A 4DPNA 3NKTA 4MXVA 5K0UB 4N43A 2CL2A 2IXLA 4I01A 1QOOA 1Z7S3 2B7YA 3OGJA 2ET1A 1DGWA 3SMHA 4BA6A 1RTVA 1CVNA 3MIBA 4F3JA 1MS8A 1O5LA 2PHWA 2ES3A 1VBE3 3MIHA 4GXLA 4P9IA 3ZN4A 4YG6A 1ZZBA 3LSEA 2HWB1 3KGLA 5EYXA 2ZTNA 1H4HA 3ZFFA 2PFWA 4YW2A 3NV3A 4BLJA 1G9AA 1NCQA 3SCGA 1CIWA 4FPLA 1FXZA 2PTMA 1QNWA 1KJLA 2WS91 5DDJ2 1D4M1 5JOXA 3ZXAC 1XYNA 4DINB 1ND2A 2F6BA 4BIOA 4CEYC 4GALA 5FCCA 1YRZA 2YZ4A 3WDXA 3FZ3A 1OLQA 5JPNB 3JB8A 2ZGOA 4B7EA 4WM7B 4X6QB 3VKOA 2MEV3 4ORFA 5DUVA 5K9YA 3B00A 4S2DA 1ZZCA 4H7LA 3TNQA 1FMD2 3ME2A 4KG8A 1Z7S2 2ZGUA 5IT6A 3ZYPA 1GZWA 1XYOA 4H3WA 5KHGA 2XVGA 1JHNA 3AMMA 1Y43B 3WCRA 3ZFEA 1BBT3 4Q4W1 4NHLA 2ZHNA 5DUWA 1K5MA 1RJ7A 4F83A 4WM8C 4RQPC 3AMNA 2JG9A 1X33A 3LWCA 3PLQA 4LUKA 1O4YA 3OD4A 3ZDSA 4YZ3A 3MW3A 4H7MA 3AKRA 2RS11 3AKTA 3VZNA 3QACA 4PF5A 3SITA 1NQDA 3AZXA 2AH2A 4W6XA 2ARXA 3G6JB 4QPGC 5CG8A 2ZGPA 2XL9A 1RITA 1W6QB 5ABJC 5I0RA 4KH9A 4P9JA 5FQ0A 3WOGA 3PJQA 3RJ2X 4CP2A 2E9QA 2HYKA 2ZKLA 3HN1A 1W2UA 2QE3A 4LO7A 3ZFGC 1DQ0A 3RYRA 1D2QA 2EALA 2ZGRA 4C90A 3ILRA 3M3EA 3N36A 1QJY1 1OKQA 1Q8QA 3LKJA 1S2BA 1IKPA 4HKOA 3USSA 1OQ1A 3IKWA 3TYJA 4XBLA 4AEDA 1BBT2 4HBNA 3VKFC 2WZR1 1IQAA 2XJSA 2DCZA 3M3OA 5DUUA 5JWPA 4LA2A 1UZYA 4W6YA 2PAKA 5DG1A 2NQYA 3RDIA 3FMGA 4LBOA 5IUQA 3NWKA 3ZMOA 4COUA 3I2DA 1QOSA 1SEFA 4K40A 3WQ7A 4CEWA 1RL3A 1TME1 3RG0A 1CPMA 4XJ8A 3H1MA 2X5IA 2R072 1ND3A 1EP0A 3BIWE 3PVOA 2RM21 5KC6A 1RUJ3 2DUPA 3H8UA 2VUJA 4IV1C 4P9GA 5HBAA 2WJSA 3D5OA 1OFSA 2XJTA 4FT8A 2NPIA 5LRRA 2CWMA 3ZYGA 1AR73 1HRI3 3IBMA 2D6MA 2XUMA 4UXAA 4YGEA 5FO9B 4Q4V2 5E89A 1RUG1 1C1LA 4XJWA 4BQ1A 1LHVA 4CDWA 2P2KA 5CBLA 2ZX3A 3OYWA 4Y20B 2H6CA 2Z69A 4DZGA 3L9JT 5KXEA 1MZFA 1O4TA 4YYOA 2XWBB 1J1LA 4XIKA 1LENA 1X36A 2BFUS 1AF9A 1DLLA 3OBRA 3MFCA 5FREA 3S0MA 2RHPA 1DGRN 3T2TA 1YWKA 1ZRCA 4RHV3 2WNUB 2EAKA 4OUSA 4YSFA 3VZLA 4NHKA 5BYNA 1C57A 2YHJA 5CA6A 5FMOS 5AC93 1HXS3 3BU7A 1CJPA 4QPIA 4N43C 3LSDA 1HKDA 1H8TB 3V56A 1TNRA 3M1HA 4CYDA 4L2NA 2HWC3 5KXDA 3SHRA 3SXWA 4PBPA 2WIIB 3R0RA 3VHOA 4XJUA 1AR72 4GH4B 3AZZA 2WNVB 5JVVA 1AXKA 2LALA 4XFHA 3SISA 1BEV1 1KD7A 4GKXA 4MV2A 1LOAA 4BE3A 3E6CC 2ILMA 3ZFFC 1CESA 3AK0A 5A33B 1V6NA 5F1RA 2Q1ZB 4ATFA 2OUHA 5CFDC 5JZGA 4H55A 4QGNA 4CTEA 2CGOA 5CVRA 5BNNC 2D40A 1AYN3 1KJRA 2V09A 4RHV2 4OZXA 1U5XA 1COV3 3J8F1 5AC92 2VOKA 1FOD1 4XOGA 3WG2A 4CDXB 4DY5A 1I1EA 1GQHA 3ZO0B 4Z2WA 3B94A 5JSPA 4E2QA 5CB7A 2WC2A 3CJXA 4EWAA 1MACA 4XQ4A 2HWC2 2CWSA 2D3RA 4NPRA 4IEYA 4XQDA 4NOTA 2HEYF 4AVCA 3VBRA 2G4IA 2E63A 3IPVB 2NMNA 4GB33 5A32B 3FFZA 3ZFEC 4Z8BA 5BNPA 1RUI1 3BPZA 1HRV3 2SLIA 1JUHA 3DPRA 4Y22A 2IXCA 3O5SA 3KT7A 1F5JA 1Z7S1 4GMP1 2GMEA 4S2FA 1B35B 2YY1A 5EFUA 4M3CA 1H1AA 1V9U3 2PHLA 1VALA 1SQ4A 4PBOA 2H6BA 1VBE1 1G86A 1UPIA 5JLVA 2VOVA 5HCFA 2VNOA 1PNGA 4N53C 5JOYA 1HW5A 4FP2A 2VVEA 1Y3TA 2PA7A 4IEOA 1U5ZA 1R1A1 1I9RA 4BZ4A 5H9SA 4LO4B 4BIFA 3KB5A 5L7OA 2UYAA 2P34A 2MEV1 3MPPG 3QD6A 5C8CB 2IXJA 3FWEA 2QVSB 4GB32 1RUNA 2WKKA 3FJSA 1JTZX 1DZTA 2EXIA 1OQEA 1HRV2 3P3PA 4KGGA 4EN9B 2VXRA 4MVTA 2ENRA 3ZXDA 5I8TA 1PK6A 2DCKA 3RYPA 2CV6A 1V9U2 2ZAAA 1EAH2 5DZGA 1H8VA 4DMIA 3MLKA 4PDWC 4F7ZA 3OY8A 4Q8LA 4JGZA 4BMEA 4CEWC 5BNOA 2NLRA 1B09A 2XB6C 3WVJA 1SBDA 4RS5A 2RJKA 4LE4A 4QU2A 3VUOA 3GZUC 2WNUC 4I09A 4COWA 4LHNA 1MZEA 1MZ5A 3O12A 3IMNA 1DQ4A 4B4PA 3KD4A 2BNMA