1O5UA

Crystal structure of a duf861 family protein (tm1112) from thermotoga maritima at 1.83 a resolution
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
88
structure length
88
Chain Sequence
EVKIEKPTPEKLKELSVEKWPIWEKEVSEFDWYYDTNETCYILEGKVEVTTEDGKKYVIEKGDLVTFPKGLRCRWKVLEPVRKHYNLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords novel Thermotoga maritima enzyme TM1112
publication title Crystal structure of a novel Thermotoga maritima enzyme (TM1112) from the cupin family at 1.83 A resolution
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Unknown function
total genus 19
structure length 88
sequence length 88
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05899 Cupin_3 Protein of unknown function (DUF861)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1o5uA00
1G6NA 1UW8A 2HKXA 2MPFA 1O5UA 4FT8A 4AQ2A 2GC0A 2IC1A 2BEOA 2D5HA 4AVAA 3SHRA 1JUHA 2K0GA 3L2HA 2B9UA 4HVQA 4XF9A 2EVXA 1CAWB 1ZVFA 2GU9A 4ORFA 3OF1A 3R6SA 4QX5A 3SMHA 1WLTA 3I59A 4Q0UA 2VQAA 3I7DA 2GH2A 2GZWA 3OGJA 4N9HA 5T3NA 1WA4A 4HMZA 4NVPA 4PIYA 4MX3A 3ACLA 5JCTA 3E5XA 1DZTA 1SEFA 4AQ6A 1DGRA 5KBFA 1ZRRA 2XGXA 4LA3A 3PLQA 1GQHA 4IEUA 3BB6A 3ELNA 2UYAA 3NW4A 2CAUA 1O3TA 1GQGA 2ETEA 3IWZA 4FBFA 5BXXA 3FWEA 4YSFA 4L11A 3BCWA 4D7SA 4I09A 4R8HA 3UKNA 3LWCA 4KL1A 5D1IA 4Q0SA 5BUVA 4E2GA 2Y0OA 2IXKA 4LULA 1RL3A 1YWKA 4IETA 3C3VA 2PFWA 4Q0PA 1EPZA 1RC6A 1I5ZA 4HN0A 3FHIB 4UXAA 5EZWA 3USSA 2Z2SB 4I0AA 4JTOA 3G7DA 5JSOA 3FZ3A 3CJXA 4I01A 5FLIA 4PJYA 2BGCA 3D82A 5FLHA 3OCPA 3ES1A 4P9GA 4Q0QA 5I8YA 3BU7A 3VHRA 2FMYA 4IEXA 1ZRCA 5FCCA 2P17A 4XFGA 3EO6A 4QGLA 1LKNA 1EP0A 4LLOA 4XEZA 2UY8A 4KWKA 2WC2A 1SFNA 4XETA 3UKTA 4BYYA 1DGWA 4I0BA 4X6RB 3LOIA 5J3UA 5BY5A 5HI0A 2PTMA 4B29A 4IERA 3WW3A 2XL7A 4J1WA 4EWDA 5F1RA 3KSCA 1Q5OA 3JZVA 5BV6A 4YYOA 4KWJA 4ONUA 1RGSA 1ZZ6A 2VECA 2GAUA 2XLAA 3CEWA 4MZUA 3HT2A 4HN1A 1YFUA 5FPXA 4XFBA 2PQQA 3PVBB 4IEQA 1ZZCA 4XF1A 1I6XA 4X6QB 5FQ0A 3CL1A 4R52A 4J1XA 3ZDSA 5I0RA 5C8WA 1X82A 3QOPA 4Q29A 1CGPA 4E2SA 4XFCA 4KU8A 1ZZ8A 3D0JA 1VJ2A 3H3UA 4FAGA 4BHPA 1UIJA 3U10A 5LEKA 1QY4A 2EA7A 1ZZ9A 4XFFA 2H0VA 1CAVB 3RYKA 4QM8A 1CAXA 3HQXA 5FDBA 4LUMA 4XF0A 3RYPA 3CLPA 3H8UA 1DZRA 1EY2A 4UBGA 2H6BA 4IEVA 1ZZ7A 3E6DA 2GC3A 4O9EA 3H50A 3QACA 4L2NA 3BALA 3H7JA 5LRRA 3NL1A 1O3SA 3H1YA 1QWRA 2BNNA 1WGPA 4QGMA 1J3QA 1IPJA 3LA2A 1XE7A 2ATFA 3SXWA 4EV0A 1CAWA 2MHFA 1YFWA 1NE4A 3U11A 5C6CA 1VP6A 1IPKA 1O3QA 2B8MA 2D93A 3NSTA 1CAUB 1SQ4A 4I2OA 4DINB 3EHKA 5KHGA 1X8EA 3EJKA 1LRHA 1YFXA 1FT9A 4HVRA 4HSJA 4HZFA 2Q4SA 3FX3A 4BH9A 3E5UA 5CVRA 4A2UA 1FXZA 1NZCA 3H7YA 4LEJA 2OZJA 3RDIA 4XF4A 4XFIA 5LRSA 2D5FA 4Z82A 4HBNA 4HSLA 2GC2A 3RNSA 3HT1A 2I45A 4MV2A 4KU7A 4MGKE 1O5LA 4WBBA 1CAUA 1YHFA 2XHKA 3E6BA 1OD5A 4MH0E 3N4MA 4FAHA 4MGZE 2BNMA 4IEWA 2Q0AA 1ZRFA 3EBRA 3RZZA 3SCGA 5I0TA 3DV8A 2V09A 3O14A 4QM9A 4N9IA 5JR7B 3EQEA 4MGYE 3RYRA 2IXJA 4JVAA 4I3PA 5I0UA 1XE8A 2EAAA 4GULA 5KHIA 1UD1A 1PM7A 1UPIA 4OFGA 3GYDA 3NJZA 4WVZA 3LZZA 4Z07A 2PAKA 1RUOA 4HVOA 3PNAA 2ET7A 4META 1H1IA 2XLGA 4I02A 4EWEA 5JSRA 5K8SA 4AVBA 2OA2A 4PIZA 3B02A 2WFPA 2QCSB 3CF6E 5I8SA 5J7MA 2MNGA 3M70A 4LUKA 3H1MA 3IIAA 3IBMA 2PAMA 2XKPA 4XF3A 4IEOA 3NKTA 2ET1A 1YUDA 1OMIA 4LA2A 1U12A 2IXLA 2QNKA 3BPZA 2HJIA 3FE5A 4IESA 4F7ZA 4HLTA 3OD0A 1J58A 3E5QA 1ZRDA 2KXLA 1RUNA 3M3IA 1ZNPA 3KGZA 4AVCA 4JTNA 2PHDA 2N7GA 2XKOA 1QXJA 3ST7A 1LB2A 3H3ZA 4QGNA 2PA7A 3GBFA 1NE6A 5JSPA 3FJSA 2OPKA 5LEJA 2QDRA 1OFNA 3E6CC 3CO2A 4MGIE 4LTAA 2QJVA 1CAVA 2K9ZA 4BIFA 3KMHA 2PHLA 2ZKLA 3TNPB 5I0SA 2GC1A 3WW2A 5I93A 4PIXA 1LR5A 1VR3A 2B5HA 3S7EA 4XFAA 4YRDA 2IXCA 3H9AA 1NYWA 5JAXA 2CAVA 5CADA 2Q30A 4AXOA 5KHKA 3DL3A 4XFHA 1Q3EA 4E2QA 4UBHA 2E9QA 3D0SA 3RPQA 2BNOA 4H7LA 4IEPA 4YARA 2CV6A 1RTVA 4Q0VA 4IEYA 1ZZBA 2DCTA 2Z69A 4OLLA 4ZU7A 3FFQA 2D40A 1J3RA 3HIFA 4EWAA 4KWLA 3ROUA 3IDCB 1J3PA 4QMAA 1UCXA 4CYDA 2OYZA 3U0ZA 2OZ6A 4YNIA 5E16A 1PMIA 3NVCA 1J59A 3ES4A 2C0ZA 1FI2A 2QVSB 5E1RA 5J48A 3MDPA 5BPXA 2PAEA 1J1LA 2FQPA 2PYTA 4JV4A 3S0MA 4ZU4A 1O3RA 3I54A 1ZX5A 2CGPA 3WW4A 2F4PA 3OTFA 1X8MA 4WZCA 2ZCWA 4O9GA 5I91A 3ETQA 3KCCA 1XRUA 3DKWA 4IEZA 5KHJA 5FQ0B 4ZU5A 1HW5A 1O7FA 2BYVE 2VPVA 1Y9QA 1H1MA 2H6CA 3LAGA 3SCHA 1QXRA 1CX4A 1O4TA 3UKVA 3LA7A 1YFYA 5FPZA 2XLFA 3IDBB 3LA3A 4D7TA 3H1WA 3E97A 4F8AA 1NXMA 1Q43A 1EYBA 1ZREA 3DN7A 2IXHA 3TNQA 2XL9A 4QXKA 2Q1ZB 2IXIA 3S7IA 2UYBA 1Y3TA 1CAXB 5KHHA 3WW1A 4MUVA 4TLFA 3KGLA 5I8TA 4EROA 2O8QA 4K8FA 3MPBA 5FLJA 1YLLA 5EFUA 1TQ5A 3MZHA 5AVPA 1V70A 3I59B 1OI6A 1UIKA 4RD7A 3SCFA 3MYXA 1L3JA 2UY9A 5CU1A 1X7NA 2O1QA
chains in the Genus database with same CATH superfamily
2YROA 3WLUA 3S57A 1SDDB 3KQRA 4JX0A 4LLFA 2XOMA 1GU3A 2HWD3 4OI0A 1BQPA 1VBC2 4ZS3A 1ULDA 1B09A 3WXPA 2GC0A 2E32A 2GN3A 4DUXA 3QBQA 5KWRA 1JUHA 4NUBA 3L2HA 3RRDA 4XOGA 3VL8A 1GFF2 4HVQA 5JZGA 3TRSB 2W2IA 2RDRA 2VULA 5A80A 3VZMA 4RR3A 2G1MA 2RMU1 1K5MA 4XBQA 4UW4A 5DMYA 1ZVFA 3WX5A 1A8DA 3I3MA 1LU1A 1F4AA 4ORFA 4YG6A 3KV5A 1UXXX 2HWF3 3W58A 5FXZA 5GJ6A 3TOJA 3VDDB 4ATEA 5FPBA 4QX5A 4JGZA 1PGW2 4CEWA 3B3QE 2P3JA 3CMGA 1G8WA 1H6YA 3SMHA 2WBKA 4Q0UA 3K3OA 4IE7A 3ZFFB 5C9AB 2BBVA 3AMHA 4RQPC 5T3NA 1W9FA 4AGRA 5FBJA 1V6JA 4QAWA 1D2QA 1RUH3 4QX3A 4QHBA 5A3TA 4YW4A 3PUQA 2JIJA 1ZYBA 3OUHA 4YW7A 1DGRA 2WA4A 2ARBA 1TEIA 2WKKA 2YDEA 4CU9A 2XGXA 3AL5A 1AJOA 2VG9A 3VN4A 2VAUA 4OQ9A 3VBFB 3RWNA 3ZN6A 3VD7A 5HCAA 2JDMA 1JOBA 2ZAAA 3TAYA 5DAQA 5JUVA 4GWJA 2IZWA 3RVHA 1R64A 2ENRA 2XBO1 4RSUA 4BJ0A 5JZGC 5KXDA 4FBFA 1TNFA 1CIWA 5BXXA 5BNQA 3MW2A 4RR3C 2B46X 4L11A 4QQ2A 4DO0A 1K5MC 5LK7B 3H8OA 5LW9A 2BFUL 4HPKB 2AACA 3FFZA 1PMJX 4COVA 3UKNA 4Y3OA 1AR82 1Q8PA 5D1IA 4E2GA 2EXJA 4JGZC 2Y0OA 1YI9A 1I3HA 1W0OA 3DYOA 4LULA 5KXCA 5FPLA 4IETA 3C3VA 4PI2A 3RI8A 2BQPA 2KR2A 1RC6A 4O61A 4ZY9A 4AE2A 4CCOA 3VGIA 1W9TA 1S1AA 4UFJA 5LATA 2ZGMA 2XVKA 4UXAA 1AL0G 4BM8A 1CZTA 4QHOA 1KFUL 1W6OA 2X05A 4DXTA 3HJRA 4SBVA 4WM7B 2PHXA 1BBT1 4RHV2 1PIV2 5BNNB 1YQCA 1BJQA 4B8EA 1HN1A 5C70A 2BV4A 3DCQA 4I01A 2ZTNA 5D8AB 4DUWA 1US3A 2VJXA 1AR71 2W92A 4IW3A 5FMCA 5T5OA 3U37A 2XVGA 1D4M2 3V56A 5FLHA 4OI4A 2E53A 5A7QA 2OXBA 2XWJB 4ZKTB 4CDXA 5C33A 2D6NA 2R0HA 2VMEA 3VHRA 5A3MA 2FMYA 4IEXA 3HQRA 3N9NA 1NOVA 4XUNA 2VZQA 3LF7A 1QJY2 5DABA 5DDJ3 5FZOB 2JICA 4PI0A 2J7MA 4XILA 4QGLA 3M7AA 3O0XA 1W8TA 2BBAA 4FQZA 1G9DA 3A0NA 2UY8A 2V4VA 3POGA 4V2WA 5ACA1 1RXGA 2WNUA 2WSUA 4XETA 3UKTA 4DY3A 2WO3A 4ZXKA 5FR3A 2OUJA 5J3UA 4GB33 5J96B 3JBG2 3OYWB 1LHVA 1U5YA 4GJZA 3ZSLA 4XW3A 2ZPXA 3IKWA 4IERA 2WNEA 1HN0A 4LO5B 1AHSA 1JI6A 2JJ6A 5BNOB 2WWUA 3WNMA 5D8AA 2LALA 5E89A 2JDZA 5ABJB 1BVVA 4BISA 1F9KA 1ZZ6A 3AXDA 2GAUA 2XLAA 3CEWA 5T52A 1KDKA 1S0DA 2FDJA 2WO2A 3ZX7A 3VHPA 1WD4A 4INDA 5FPXA 2R6QA 1OT5A 3IPVA 4CDXC 4GKXA 3FBMA 5GKAC 1VLNA 2F17A 4AVSA 2ZGNA 4URAA 3BUCA 2VH9A 3PVBB 1JBCA 3PTRB 1MEC1 5IVJA 4Q8KA 2QQVA 1FOD2 1I6XA 2W5FA 1H8TB 3AKPA 4BWOA 1JZ7A 3GCXA 3WOGA 4A3ZA 2LROA 3ZSKA 3WT3A 1VBD1 4XXPA 1VRH2 4GWNA 4OHVA 1UX6A 1ST8A 2EIDA 3ZFEB 3ZDSA 4BXSV 4EN9B 2WNUC 3TBDA 1OH3A 1UMZA 5FZKA 1X82A 1RUJ2 3JD73 3NV4A 1JU4A 5JXJA 3BYWA 3CBNA 3D0JA 1KDMA 5T50A 2RR13 1NA1B 1ND2A 3PUIA 3Q8BA 4GA9A 4GQ7A 2CWMA 2RS52 1UMHA 2D7FA 1LCLA 1OXCA 3WDUA 4BQXA 3POFA 3T2PA 1VBE1 1RMU3 1IS6A 4LNVA 1X50A 4AG4A 5F3GA 4Y4RA 4GD4A 3MGUA 3HQXA 3MIEA 4FOVA 4LUMA 4YGDA 3RYPA 3CLPA 4ZZ8A 3U1XA 3H8UA 1ULFA 1HRV3 1OUXA 2W1WA 4OZOA 1AF9A 4UBGA 5A6ZA 2H6BA 4IEVA 4RS5A 5SV5A 2W08A 4HKWA 3AM2A 3N9QA 2HWB3 4BA6A 1ZZ7A 3E6DA 4O9EA 2W0XA 1V9U2 4L9BA 1CZSA 2ZGTA 4XHXA 1F4HA 1N1SA 3NL1A 4XE9A 3WD5A 1R083 4FPGA 4PDWC 1M4WA 2VL4A 1O3SA 3GGLA 3POYA 4A3XA 1BEV2 1SZBA 4NAMA 1NA1A 1MQTB 1ND2C 1QWRA 5D21A 2Y64A 4AWDA 4MG2A 3VBRB 4TWTA 5JR2A 5A7NA 4G9SB 1RUI1 2RG4A 3TN92 2IUWA 3LA2A 1MS3A 4A41A 3HBZA 4QX1A 2ATFA 1OQ1A 1ACCA 1DYPA 2A75A 1N3QA 4OHWA 5JOWA 1YFWA 1XBFA 3U11A 4UAPA 1LOFA 1H2LA 2VUJA 4MGQA 1IPKA 4XVHA 2ADEA 2EF6A 2D93A 2R30A 1IZ3A 3PUHA 1RUF2 1X8EA 4XBNA 3FLRA 4RS5C 1FMD2 4YFWA 4OHYA 4K40A 1XYPA 5DAPA 1AJKA 4HSJA 2JEMA 2QQLA 1PX4A 4QX7A 5FO7B 4HZFA 3WDVA 4BH9A 3VDBA 4MVTA 4M3CA 1JUIA 1MVEA 4GH4A 4NE9A 2VBPA 4COZA 3W21A 4DXZA 1BXHA 3RDIA 4FOYA 3ZYBA 1JODA 1IS3A 3BGAA 4GKYA 4XFIA 1S0EA 2HWC1 4Q4V2 2YBPA 4W6YA 3SC7X 1UZYA 3VBRA 5JPMB 4AAXA 5LRSA 4Q4W2 2GSYA 4Z82A 2YU2A 3N35A 4HBNA 2PHRA 1NT0A 2A5ZA 2R16A 4Y1YA 3O1OA 5CAZA 2EIGA 3POJA 2I45A 4MV2A 1QOSA 1H4HA 4QB2A 5F7UA 1LOFC 2VGDA 4Y33A 1GANA 3K75B 1H6XA 4I0WB 4WVMB 4HG6B 4WBBA 1RUC1 4LE3A 4LT5A 4PCRA 2VQUA 2XHKA 2Z79A 2XJVA 2PHUA 3D8CA 5D2AA 3ZSEA 1E5IA 3MV11 4ATFA 3KS7A 4QHZA 1LOAA 1U5ZA 4AEKA 4MH0E 4DXRA 1C8NA 2YG0A 4FAHA 2YC2A 3QH6A 4Z92B 1GKBA 2Q0AA 1ZRFA 2HWD1 2YMZA 2D98A 4A45A 3WP6A 3DV8A 4JHTA 4TZDA 4XYXA 4GH4C 2V09A 5HCFA 1W9WA 3MW4A 4IL7A 3LEIA 4XHBA 2QQUA 3LIGA 2WZPP 5JR7B 5L7OA 4MGYE 1POQA 2B45X 5FZ0A 3U4SA 3LE0A 4JVAA 4Q4X3 2RS13 3OEAA 4QXBA 2EAAA 5KHIA 4UI9L 1UD1A 1VMFA 5EQUA 4NJ4A 5CISA 1XPWA 3AVRA 1L7RA 3R0RA 1N1TA 4NOTA 3THDA 1TME3 4DRRA 2KD7A 2C4XA 2RS31 1V6IA 4META 4CA9A 1RUOA 4C0HA 5JMCA 4I02A 1PO22 1GOGA 1V6NA 1HRI3 1X33A 4YFZA 1E5HA 2WFF2 4PLNA 1ULCA 2G9ZA 5CG9A 4NIDA 2P37A 4AVBA 1LHUA 2FZ1A 1RUH1 1SG3A 2OA2A 2QTWB 4PIZA 4LBMA 4YW2A 3CF6E 5J7MA 1W8ZA 3U78A 4C8DA 4PT6A 1VBA2 1N47A 2FMDA 3IBMA 2WABA 4MOAA 4XF3A 5FYUA 2VZSA 3MUZ1 1LNSA 1S2EA 1VAMA 1ULOA 4UFHA 5L7OC 3I49A 1YUDA 2V4AA 3SQOA 4AK3A 5IVCA 4S2GA 4Q27A 1I5PA 3N7KA 3FBYA 2TNFA 4LA2A 1U12A 2IXLA 3AMPA 3BPZA 3N9LA 1WW5A 4HLTA 3KVBA 3P3PA 4AF9A 3JB8A 3N9PA 2GNTA 4O65A 3DUIA 2WWSA 3VKNA 4CCEA 5IVVA 5FYSA 1Q8QA 3OOXA 1DQ4A 2YC4A 4BE3A 1RUNA 2WAAA 3KWVA 3M3IA 3PMEA 4CDQB 2WNOA 1ZNPA 2A6YA 3BIWE 3KGZA 2ZX2A 4JTNA 4XJZA 3OB8A 4XUPA 1R092 2KA3A 1QXPA 2JIGA 4LO7A 2XKOA 3BOPA 1QXJA 2PLV2 3BTXA 3KLSA 1SPPB 4OMDA 2PA7A 5FKBA 1S0GA 1NE6A 3I2KA 3Q8CA 1DP0A 4UW3A 1W8WA 3LOBA 4XTMA 3RMXA 3UT0A 5T5JA 4CPBA 1X9PA 1H30A 3I2IA 1UL9A 1NCQA 2R073 1QQP2 3HD8B 1JYCA 2XQXA 4JHZA 4C91A 1CAVA 1YJKA 2GMMA 2K9ZA 2RVAA 1EV13 3P6BA 4ZS2A 3T3YA 3VL9A 2W87A 4R9BA 2GP5A 3AKQA 2ZKLA 3R4SA 2WA3A 2QQNA 4M00A 5FZ1A 2F4LA 3WW2A 5ISLA 2ZGQA 5FO9B 5DDJ1 2UWCA 3Q9OA 1LR5A 1WCQA 4Z8BA 2DURA 4LQRA 2Q1FA 4MXWB 2R061 2YBSA 5FREA 1D0HA 1U0AA 1HQWA 4YRDA 2IXCA 2OS2A 3H9AA 1V6MA 4FO9A 1GMMA 2O8OA 1RVF2 1URXA 2WT2A 5TSWA 3VBOB 2VM9A 1IG0A 3WP3A 3ZFGA 4C0BA 3I2HA 1KS5A 4AXOA 1SLCA 3AZVA 2RMU3 2IVIB 3UESA 3ZYPA 1SPPA 2A1XA 2W1QA 3D0SA 1UQXA 4UBHA 1VBB2 1N3PA 1F5JA 2ZGLA 4AFBA 4XQWA 3WNOA 3HNYM 4QX8A 4H7LA 1HIXA 1ZBA2 1B35B 2P6HA 4DMIA 1RTVA 4QX2A 1COV2 4Q0VA 1SFYA 2OT7A 1R1A2 2J1AA 2WJSA 2XWBB 3GZEA 2HWE3 3QD6A 4U36A 1JZ3A 1NCQC 3GBWA 5B4NA 2X5IA 1Z78A 3J8F2 3LDKA 2DTWA 1J3RA 1Z7S2 2K2SA 4KWLA 4LKFA 2VMHA 4D8MA 4AZZA 3IDCB 5FZ8A 1TNRA 1WCKA 1RUD2 4WM8A 5J09A 3U0ZA 4AGVA 2BVVA 1VB4A 4ZONA 5FY7A 1PMIA 5AVAA 2JXAA 2C0ZA 4CDQA 1HKDA 2BWCA 1HXS1 3PMSA 3GHMA 3ZFGC 1PZ7A 3JD71 1PNFA 4ISRA 1ZX5A 4GZ9A 4AFMA 3MUY1 2C9KA 5FYBA 1X8MA 5FWJA 2ZGUA 1XRUA 1ENRA 4LBQA 5IUQA 5FQ0B 2RDSA 5AC92 1OH4A 4BMEA 2XB6C 3RZGA 1UY2A 3MW3A 4LPLA 2RJ2A 1DYOA 4AVTA 4ET7A 2X5IC 5DAWA 4XDPA 3OBTA 4LBOA 3UKVA 4CSWA 1YFYA 2XLFA 1XU1A 3T09A 4CXYA 2WQ4A 5FZAA 4YZ5A 2BGOA 4D7TA 3NQHA 1HRV1 4DRVA 2YC0A 3OJBA 4WM8C 5HV4A 4MSVA 4CP9A 1AR73 1PO12 4EWEA 2DFCA 5A1AA 4QXKA 2YBKA 2HWB1 3VDAA 5GZFA 2C5DA 2YYOA 1QJEA 1BK1A 1OF4A 4GJYA 2ZMNA 3UGGA 3WNXA 1K42A 3WW1A 4CP0A 4DOUA 3EYPA 4K8FA 1LOGA 2CTVA 4N53B 1W28A 1UOGA 2V5YA 1YLLA 4G3YC 3U75A 1EUUA 1SDWA 3I59B 5ACA3 1EPWA 2R043 3EB7A 1L3JA 5FZBA 1NLSA 2CU5A 5CU1A 3WQ1A 3DXUA 4CVUA 1LJ7A 4LBLA 1C57A 2ARXA 2QQOA 2W52A 2LM3A 3CDZB 5JXHA 2QQWA 2JE7A 1W39A 4XMIA 1DCSA 4BZ4A 1O5UA 3C7EA 1SBFA 1XOYA 1FATA 3VKLA 2LRPA 1UU5A 1UY0A 4LK6A 1QOTA 3SHRA 4P9YA 1Y43B 2Z42A 2DUQA 4RL7A 3NKGA 1AYM3 3PDQA 3HN3A 4K7JA 4LJHA 5FMOL 5FOBB 3VZLA 4FPEA 4FP3A 1UY3A 4UYBA 5DZFA 3T2QA 5LBFA 4KWUA 5HCBA 4P9IA 5HXMA 2VNOA 2VXRA 1NCRB 1UYXA 3ATGA 5FP4A 1VBD3 3AMNA 5JDBA 3I4IA 3I59A 3M3OA 5FZ9A 2YGLA 3NJVA 4LO4B 2GZWA 3ZSJA 2EAKA 3U4XA 3JUUA 1WA4A 4PIYA 4NR1A 1LOCA 1QJU2 3VZKA 3U14A 2BFUS 1DYKA 5BNPB 3R4UA 1DZTA 3CIHA 1QOOA 4AQ6A 5K0UB 3P1IA 4LKEA 4EN6B 5KBFA 4LA3A 2JX9A 3PLQA 2FDIA 5CKQA 5I0DA 1GLHA 3LDRA 3SH5A 3H8XA 1YIFA 4BOWA 5IK7A 3ELNA 2NP0A 3MPPG 2CAUA 3NW4A 4PQ9A 4RGKA 1KFXL 3LD8A 2J1EA 3FWEA 1QJZA 2DCZA 4CU8A 1YI7A 2BPA2 4CDUA 5FZ3A 4R8HA 4CRQA 3TEZA 4JDMA 4WVWA 2YFZA 2ZX0A 1S0IA 4S2FA 1WBLA 2VMFA 3C7FA 3ALQA 1SLAA 1KEXA 1GBGA 1UF2C 2TUNA 4Q0PA 2ZXQA 3LPFA 4NAOA 4Q4X1 1OA3A 2RS11 4ITCA 4R9AA 1C8M2 1XNKA 4B1LA 1S55A 2P34A 4FXKB 3NAPA 3ZMNA 5BNPA 1C5IA 2G4IA 3ECQA 2UU8A 1AYN2 1GP5A 3LKJA 3LEMA 4JTOA 1TME1 4H14A 4JKLA 4L97A 4QKDA 3CJXA 1GQPA 3DYMA 2YUEA 2BGCA 3D82A 4BXFA 3E1F1 3IAPA 4OULA 1RUI3 4JAAA 5DXDA 3OBZA 5LA9A 1NX9A 4P9GA 5E6HA 3WQ0A 1JW6A 1PVC2 2RDNA 1XC6A 2AEZA 2ZHMA 1RHI1 2GALA 4JGYB 4EN0A 4W4ZA 2W95A 3FHAA 4YGEA 1RUE3 3KT7A 3WNNA 2P17A 4CDUC 4AEDA 1NG0A 3EO6A 1E57A 1OOPA 3B01A 2UURA 3A0KA 1EP0A 4LLOA 5FY1A 4XEZA 4KWKA 1OBNA 1DQ5A 1UX7A 5IJRA 3ILFA 3I3DA 2DVFA 1DGWA 1WCDJ 1BZWA 2Q1MA 4I0BA 4LKSA 4X6RB 1KRIA 3WG1A 4AI2A 2RJLA 3LEGA 3JQXA 3T0BA 2YXSA 1UO9A 2J1TA 3I2JA 5BY5A 2HLEA 2PTMA 5AC91 4B29A 1D0GA 3NAPC 5BNPC 1V6OA 1V0AA 2J1RA 2XL7A 5E8AA 5JIUA 3ASIA 3ACFA 4J1WA 4EWDA 1W2NA 1PK6A 3NV1A 1F15A 2HYKA 2C6SA 2VNGA 4KWJA 4ONUA 2LW8A 1XNDA 2HWF2 4FXGB 4KG8A 4YYOA 2VECA 3AP7A 3AJZA 4MZUA 4N8MA 1W6MB 1SMVA 5FP8A 1W03A 4HN1A 5GLVA 3ZYJB 2PHFA 3GALA 2A6XA 4XFBA 5IAXA 4XZPA 4FPJA 4BQ1A 1PGL1 2PQQA 1RIRA 4IEQA 5JPNB 4YGBA 4FFFA 4RGGA 4QDQA 1SCRA 2FBEA 4AEDC 1ONAA 2R071 3ME2A 1OOPC 1W3VA 2D43A 5FK7A 5F2WA 1RB8G 2FDGA 1EV11 2VCAA 1S0BA 5I0RA 5DAVA 1GP6A 3FUOA 4UW6A 3QOPA 4Q29A 1CGPA 1QIQA 3M4FA 4E2SA 4Z2AA 5C4WB 4KU8A 2FCVA 2X8KA 3M3EA 4FVVA 1AL22 4LR4A 1VPHA 4P9XA 4D7YA 2OUHA 3H3UA 3O1RA 4BHPA 4HXCA 4AQTA 4ES8A 3ENRA 1QY4A 1PK6C 3HR9A 2EIEA 2W91A 1DLCA 2XMLA 1DQ2A 2AYHA 2YB7A 4WV8A 3W5NA 1UYYA 1MS1A 1CAXA 3ZN4A 4AFCA 1JYWA 3AZWA 3ZXEA 4LOSA 3K4ZA 2R7EB 5T55A 4NHXA 1LULA 2RS33 2O0OA 3GZUC 3POIA 1EY2A 1NLRA 5EJ3A 1AVBA 3N7JA 2HWE1 4NHKA 2G9FA 1JZ5A 1TMF2 2QZ3A 2GC3A 3H50A 1LGNA 2BU9A 3A23A 2ORZA 2GMPA 1UOJA 3O0WA 3O1MA 1PNGA 2JDUA 2VD7A 2VMIA 4JCKA 4Y20B 4H2AA 4Z2WA 3H1YA 4AEMA 1HDKA 4PF5A 2VQTA 4E27A 3HMYA 4QPGB 4BQ4A 4DZGA 5F5IA 2HEYF 1DFQA 2BJSA 5FXXA 4CCDA 1J3QA 4E4ZA 4DEQA 2XDVA 2HBUA 2QQJA 3AB0A 4QXHA 2WNVB 4NPLA 3FC0A 2X53S 4LITA 1AUYA 3ZDVA 2RHPA 4JKKA 1EAH3 1QJX3 3DKQA 3HEIA 5C6CA 3VDDA 3WNPA 5CKNA 4ASMB 1JN2P 4GB32 4E9KA 4CEWC 3AP5A 1CAUB 1SQ4A 4I2OA 4DINB 3JCIA 3WCSA 5KHGA 2GDFA 2VC9A 3EJKA 3PU8A 3ZFFA 3KZ4C 5CYYA 3RI9A 5C9AA 5GZGA 5IVBA 4B7EA 2JG9B 2Y6FA 3NMBA 1YFXA 2IWGB 1VBC3 4FPKA 1JYXA 5B2GB 5F5CA 2YHJA 1H2NA 3FX3A 4NHMA 1Y9MA 5CVRA 1PZ8A 5HXVA 3BKZA 1KJLA 1HQNA 4F83A 1NZCA 4Y1XA 1JOPA 1WW4A 4LEJA 2OZJA 3AMMA 3VBFA 2Y6HA 1F5FA 1KD7A 4L8QA 2J1VA 4B4PA 2VBDA 5A7WB 1LTEA 3AP4A 4BK5A 1GR3A 1HB1A 1W90A 2VOWA 2WNVA 5C8CB 2D6KA 3RNSA 2BWAA 4HPKA 1GZWB 4MGKE 4MLOA 4XAAA 2R063 4XJWA 3VDDC 4NROA 2YPDA 4YM3A 2VCBA 5LASA 4UFLA 1D4VB 1CAUA 1KXGA 2R041 2YU1A 1J84A 1OPOA 2D44A 3A22A 1GZ9A 2RR12 1O8SA 4Q26A 3ZFFC 5C9AC 3D3AA 3N4MA 2JG9A 4IEWA 2XQRA 1JYVA 3WNKA 4HONA 5JI7A 1AR91 1UN1A 2VNRA 4XCAA 1RMU2 2ZBJA 5A1LA 1CX1A 4WM7A 4EZHA 5BNNA 3ACIA 4LBKA 4QM9A 4N9IA 3B94A 3T4VA 2JDNA 5KXEA 1HB2A 3MFAA 2XJPA 4Q4Y2 3VBFC 2IXJA 3RJ2X 1L7QA 3POBA 1AYM1 4JDOA 4N7UA 2PQSA 3OPTA 5FY0A 4I3PA 1G7YA 5I0UA 3PVEA 1XE8A 1H9PA 4YGCA 4A7ZA 1DHKB 3V0AB 2WNVC 5C8CA 1OVPA 5LBEA 4B7KA 1UPIA 4OFGA 2XPJA 2WO1A 3GYDA 4XMAA 5FZOA 3LZZA 5SV8A 1T6GC 2VMCA 2H0BA 1H1IA 1PVXA 2GMEA 2YPJA 4R9CA 2VU9A 4W50A 1R082 1ZBE1 3LFIA 1HXS3 2WZR1 3AFKA 5DPNA 3T1MA 4CP1A 2A70A 3UGFA 1C28A 2ZKNA 5DUVA 1W6PB 2WS92 2P2KA 3OYWA 1AR62 1CD3G 3VDCA 2VVEA 2XVLA 4YWAA 2JD4A 1REEA 2MNGA 2VVDA 5FMDA 4WM7C 3KV4A 5BNNC 5BNOA 1A8MA 2XKPA 4IEOA 4R4ZA 5D8AC 2WQ8A 3NKTA 5ABJA 5HBAA 4X8NA 3D6EA 5GLTA 5A32B 3DPRB 1W8NA 1AX1A 2XH6A 3MICA 2DUOA 5LZ6A 1G9AA 1QJY3 2J42A 2VZUA 2FCUA 2QNKA 2RM22 4FFIA 4IESA 5C5TA 4YM1A 3ZXGA 3KF5A 1KITA 2ZX4A 1CR7A 4XABA 4BPZA 4Y1VA 5C3PA 3E5QA 1H8TA 5L9BA 4KQ7A 3SH4A 3POWA 1ZRDA 1XE0A 1JS9A 2W46A 5F6KA 2G9GA 1W05A 4LXLA 4YM0A 3ZFEA 3AP9A 4H3WA 2VMGA 2PHDA 2N7GA 3D4KA 3PU3A 3B9IA 4KMQA 5FFOC 1W2AX 1WW6A 1LB2A 4K8RB 4XPVA 1MZFA 3GBFA 1W04A 1LECA 5JSPA 2DCYA 2OPKA 5F6LB 2ZEYA 5LEJA 1BMV2 5FXWA 2QDRA 3P5BA 2L9LA 5BNOC 5DUWA 2WIIB 2AENA 1MS0A 4IV1B 4F3JA 5ABJC 5FV3A 4BIFA 4ES9A 3USUB 3DPRA 2WN2A 3KMHA 2DU1A 1PZ9A 1IHMA 2DWRA 2DTYA 2PHLA 4GALA 4K1ZA 4BU2A 1FOD3 3PJYA 4GXLA 2ADDA 1VRBA 1NY71 1RUE1 2RDQA 4PIXA 3ZYRA 1VRH3 3N3HA 2B5HA 1H8TC 3Q8FA 2FDHA 4FSJA 1CJPA 3OGVA 3SLIA 5GLZA 5CFDB 1NYWA 3NJYA 2I07B 3MV01 1RUJ3 1STMA 2DVAA 3KCYA 4BB3A 2WYSA 3ZFEC 1CPNA 1N1YA 5KHKA 3DL3A 1MR5A 5FUIA 2XUMA 4NIIA 1Q3EA 3MIHA 1CONA 5T54A 1U5XA 4AAPA 3RJRA 2E9QA 4E2QA 2UWBA 3O1PA 3O1SA 3WUCA 1W9YA 4FP2A 2RS53 2GNBA 2VTXJ 4A7YA 4K9SA 1MQTA 1NA1C 2CV6A 3K3NA 4CCJA 3KHBA 5IATA 2DBIA 4EN7B 3VHOA 1O59A 2DCTA 4YLZA 5IVEA 3WF3A 3I2OA 4OI1A 1RJ8A 3SITA 3DPRC 5L9RA 3VKOA 4KG0A 1HRI2 3RZMA 4U2AA 3ROUA 3J7NA 4K20A 4ARXA 2E51A 4XZUG 4N43B 4OUMA 2OYZA 3FLTA 3MI8A 3S30A 3VBUB 4QQPA 3H8RA 3VLBB 1AX0A 2W1UA 3CQOA 1HJFA 2NZ9A 4W8JA 2QVSB 3SKVA 1V9U3 3M3QA 4QDRA 1UY1A 2EICA 3OG2A 4ZXEA 2FQPA 1O3RA 3DXTA 2W3JA 3UNPA 2VCCA 4OCTA 3DEMA 4XUQA 5I91A 5CEHA 2VCMA 4WVVA 2XG3A 5IVFA 4IEZA 5C3SA 1YNAA 1MQTC 5F32A 1OFSA 1ND3B 3VBRC 1UAIA 1W8FA 2XJRA 3B5LB 4XIOA 5FY8A 1S0FA 2ZGOA 5FXVA 2QBXA 3RQ0A 1UZZA 1BCXA 3C8XA 3LA7A 3WP5A 5M0TA 3UYJA 4HKLA 3SEEA 5A6YA 4CEYB 1PGSA 3QLQA 1UZ0A 5L9VA 2DU0A 2Y34A 1V00A 3AXEA 3E97A 3EXUA 3K2OA 3M3CA 2DFBA 1EYBA 2NM1A 4WVMA 3WHTA 1ASJ1 2IXHA 1DF0A 1NAEA 2MEV1 4DEVA 1R1ZA 2UYBA 3L2YA 3ZXAC 3ZXKA 2A7AA 1Y3TA 1AXYA 2AGSA 3HAGA 2B7YA 3J26N 4LHLA 1RHI3 3KGLA 1IKPA 3WZ1A 1ULEA 1VALA 2W39A 4QU1A 5JI9A 4Q4V3 1BYHA 1O4ZA 1QU0A 5AVPA 4Q4W3 1V70A 1UZWA 3THPA 1ODMA 1UIKA 3AKSA 1AX2A 4L99A 5FPUA 5FMOS 2E6VA 2OKXA 4OYUA 1X7NA 2O1QA 1G6NA 1C1LA 4B4RA 1FPN1 2B4KA 1UW8A 4PLMA 2VW0A 1EAH1 1QJX1 3B93A 3JU9A 2VO5A 4PBOA 5EPAA 2VZTA 3ZOIA 4CEYA 2RMU2 4M01A 5A3OA 2BEOA 3IN9A 3HBKA 1UMIA 2IFRA 4A44A 5IFPA 1SBEA 1ENXA 2K0GA 1QNYA 4NPMA 2HEVF 2B9UA 2BZDA 3HOBA 4XF9A 5DUXA 4D6SA 1VBC1 4Q8LA 2VOXA 1W2UA 3BTAA 2Y6LA 2E31A 1F2NA 1CAWB 3RZKA 3ZSMA 4K1YA 3K48A 2D3RA 1K5JA 3R6SA 1SLBA 2X09A 4XAEA 1L7LA 4E4DX 2FDFA 3CKHA 1Q8SA 2CHHA 2ZABA 2VQAA 2GH2A 4QDSA 1JHJA 1MZ5A 5F37A 2BP6A 4HMZA 4QKNA 4D0QA 3ACLA 5JCTA 3TEWA 3K4DA 1N3OA 2E7AA 4YG0A 2ZA9A 1SEFA 4XDOA 4P5YA 4K21A 3RSJA 2XBO2 2W94A 4BMBA 1IOAA 2W68A 4CEYC 2ES3A 1PO23 5FZCA 3ZXLA 1ZRRA 4A6SA 2Q8OA 1JZ6A 2WFF3 3ZKYA 1BKZA 2K46A 3KB5A 1XU2A 2XJSA 3BB6A 2UYAA 1WKYA 4LIUA 4ARYA 3AYCA 2ETEA 1WWYA 1O3TA 3DGTA 3IWZA 1KQRA 1JTZX 3K51A 2F6BA 4V1PA 4YSFA 3WY6A 4D7SA 3CHXA 3A7QA 3GZAA 5FRAA 4D6RA 5GM0A 1UNBA 1REFA 2E7QA 5BUVA 3ZIWA 1W2TA 4Q0SA 3O7OA 4OI2A 2IXKA 3H3LA 1BBT2 1RL3A 1GNYA 1UPSA 1JU3A 2JECA 1BK0A 1EPZA 3WQ7A 5BYNA 2CYFA 3VB9A 1AR72 5A7OA 4HN0A 3AK0A 4KGQA 5CB7A 3FHIB 5JXIA 5APAA 2V5DA 3G6JB 4DS0A 1I1EA 4UFIA 3USSA 2Z2SB 5F3CA 4I0AA 5JLVA 3WSOA 5CKMA 4MXWA 3G7DA 4BQ3A 3HN1A 2V72A 1R093 1YC61 2PLV3 1G86A 2ZEZA 3VBOA 4CDQC 4A4AA 4QB1A 4CDWB 5I8YA 4MADA 1LENA 3BU7A 1PIV1 5ACA2 5HV0A 3F95A 4FPFA 1JYTA 1SCSA 1E5SA 2EXKA 1IS5A 2FDKA 3I3EA 1D4M1 5FCCA 4AEJA 1QQP3 4XFGA 5CFCB 4W65A 2WDBA 1B35A 2Y38A 3RZJA 4LKDA 3BODA 4DXSA 1Y9GA 2Q8CA 3I97A 4YW5A 2WC2A 1SFNA 5A3WA 2VOTA 1WD3A 1IGOA 4Y5SA 4BYYA 4UWDA 2ZGPA 1CWPA 3S5AA 1US2A 1QJY1 1WUVA 5GALA 3SKJE 4P02B 1LEDA 1NLQA 5HI0A 3AZXA 5A3UA 1ZRIA 1RINA 4BQ2A 1MVQA 1RVF3 1GWMA 1Q5OA 2VW1A 2W9XA 1YQ8A 5F9TA 5BV6A 1GNHA 1GZCA 1MEC2 1RGSA 1Y7BA 4GWMA 1W6QB 3JBG1 1XYOA 3NNJA 3VBOC 1YRZA 2DBNA 1YFUA 1VBD2 2A6ZA 2CGOA 3GZTB 1CN1A 3TB0A 2Z5WA 2BTVC 3NNLA 4DPNA 4LORA 4XF1A 1COV3 2EXHA 1R1A3 3WQBA 1LU2A 4BIOA 5FQ0A 3PVNA 1SLIA 4XCBA 2VR4A 5CZKA 1H9WA 1B35C 1Z7S3 1LOEA 3PIGA 3AJYA 3C7HA 3KV6A 4MHRA 4QPIB 4R52A 4J1XA 3ZMOA 4WZFA 3GXUA 5C8WA 3IMMA 4DB5A 1FOD1 1AR93 4QPWA 1VBE2 4Q1RA 4BK4A 1ZZ8A 4Y1ZA 1VRH1 4EJRA 4FAGA 3U10A 1BLZA 3C7GA 3X29B 1YYNA 1ZZ9A 4GMP1 1RUJ1 2R1BA 4J6GA 5J36A 1YIPA 1N1VA 4RA0A 2B42B 4AHZA 3RYKA 2D6LX 5L73A 4PLOA 4CZSA 4XIKA 3T4HB 1D7PM 2OQ6A 3HPNA 3WDTA 4NIAA 2VBBA 5FDBA 1YCIA 1DLLA 2UWAA 2RS51 4N53A 3KD4A 4HK9A 2IVJA 1DZRA 5KR7A 3APBA 1YQ5A 3OSDA 4IV3B 3GNEA 3AC0A 1WLDA 3FMGA 1ZA7A 1ZBE3 5H9RA 2WZR3 5LCWL 3ORJA 4HKOA 2VQ0A 1UY4A 3V64A 2YY1A 3BTYA 5FP7A 2P5BA 5EWSA 1TZOA 3WR0A 4MGSA 3H7JA 1RUI2 5LRRA 1PO13 1IQDC 4HFSA 1UYPA 4IGQA 1F8VA 4XJAA 4A6OA 2JG8B 1ULPA 3S5QA 1DIWA 3LCPA 3ZN5A 5IK8A 1Z0HA 1V9U1 1OKQA 4NN0A 1MZ6A 1QEXA 1IPJA 2EIBA 3LQCA 1XE7A 2Q5TA 4LIVA 4EV0A 2JD9A 1BEV1 2MHFA 1WW7A 1NE4A 2DVBA 1MACA 1P8JA 4N53C 1NCRA 1UYZA 2B8MA 3TN91 2QQPA 3WG2A 3MIGA 4O7XA 1W6NB 3EHKA 1OF3A 1BHGA 1CZVA 4AI9A 2NYYA 1LRHA 4P14A 4AQSA 1OD3A 1W9SA 1FT9A 2AUYA 3KM5A 2HWC2 4HVRA 4PF1A 4YVSB 4QQOA 4XACA 3M1HA 3KHCA 3IAQA 3W5MA 4D69A 2A73B 3DECA 3E5UA 3KT4A 2WZEA 4CU6A 3PL0A 1RUF1 2XONA 1W0NA 4ZPIA 5FZ6A 5K0UA 1FXZA 1QKQA 4A2UA 1FMD1 3Q8AA 1JXNA 3H7YA 5IHRA 2Y33A 2NPIA 4XF4A 4NRQA 2HH9A 3VBHB 4AHWA 1H2MA 3ACGA 2ZHKA 3DF0A 1RUC2 1VIWB 2D5FA 3DYPA 4RN5A 4CUGA 2ZEXA 1DDLA 2WT0A 2GC2A 5FZLA 4FFHA 5EYYA 3ABZA 3NO8A 5EJ1B 1D2SA 4FOQA 5CA6A 1A3KA 1UU4A 4KU7A 2PELA 4Q4V1 1O5LA 3POEA 2HWD2 4EN8B 5GLWA 3O1VA 1XNCA 4Q4W1 1NCRC 3C7OA 5T5LA 1YHFA 3WDWA 4QKBA 1O8PA 2I74A 2C24A 1O91A 4LHSA 1OD5A 4YPJA 2CDOA 2WYFA 4NWVA 1HV1A 3BIEA 5IYYA 2WUHA 5F39A 3SCGA 5FZGA 3AZZA 3T08A 3KT1A 4Y24A 4BQ5A 1QDOA 4LHKA 2AR6A 5K0UC 2R49A 1W06A 5FYMA 4UF0B 4P00B 3EQEA 4DIQA 2RS32 4RQPB 5FP3A 1OQEA 1OQDA 3LFMA 1AXZA 1OLME 2AH2A 1M06G 3I3QA 4P08A 1QHDA 1LGCA 3AL6A 4AI3A 4Y5TA 4JGYA 4D6QA 4V2VA 3MLKA 1DGWX 5AFBA 3H42B 4B4QA 3W9AA 3NJZA 4WVZA 1RUH2 1VMJA 4YVWB 3PIJA 4HVOA 1YJLA 5J98B 3FHQA 1T2XA 3O5SA 4N90A 2XLGA 4CP2A 2E63A 1C8M3 1GOFA 2WL1A 5GZEA 3ZR6A 2WT1A 2VZVA 5JSRA 5JZGB 5K8SA 2LTNA 2A3WA 4RR3B 1AYN3 1A6CA 1JMUB 1K5MB 1QH6A 2OIIA 1S0CA 1S2BA 3WHUA 3AX4A 2WFPA 2QCSB 3ON7A 5I8SA 3M70A 1K3IA 1PO21 3GHNA 4LUKA 3H1MA 3IIAA 4YW1A 5KC5A 3HNMA 4JGZB 2VOKA 3F2ZA 2WFF1 1CIYA 4YW6A 1VMHA 5IT6A 3N7MA 3O0VA 1TVGA 5K4LA 5K7PA 1K45A 1W6MA 4FPYA 4TYSA 4ZHNA 2VUAA 1GICA 3C2UA 2DF7A 2BVBA 5IWFA 3NJXA 4F7ZA 3GJAA 4P5HA 1VBA1 2HYXA 3AKTA 5A6QA 3OD0A 4FCAA 1V6KA 4JGYC 4QWNA 2FCTA 3VKFC 1UXZA 1MS5A 1FAYA 4YVWA 1ASJ3 1S2KA 1XNAA 5EHDA 4L92A 3ZN6B 2MEV3 2GNMA 2VOVA 3OGSA 3AYAA 3ILRA 3LSDA 3GCWA 4FI9A 1IG3A 4JDNA 4JKMA 1OA2A 1H8VA 3H3ZA 4TLGA 5C4WA 1OC1A 3AZYA 3R05A 3ZXDA 4FTBA 5A1FA 3FJSA 3J7MA 5LBCA 3M2MA 5B4XA 4XDQA 3ZR5A 3E6CC 2A6WA 1R091 2OVUA 1AZDA 2PLV1 4LTAA 4MGIE 5DDJ2 1W3XA 4LHNA 5A70A 2VY0A 1W0PA 2JENA 2R062 3MHZA 4W6WA 3N7LA 1FPN3 3B9CA 5H9QA 4C1WA 4NHLA 5I0SA 1OURA 2GC1A 4XXAA 1W6OB 2VW2A 4YZ4A 1RUG3 3AFGA 3MFCA 1QQP1 1VR3A 1W8HA 1I9RA 4LMFA 2P6CA 5FIXA 1GOHA 3GJBA 4XFAA 4YVWC 2GH8A 5HCHA 2ZJCA 5JAXA 4OUSA 2DYCA 1WCSA 4N7IA 2Q30A 3IDAA 3MEPA 1AL23 4XTPA 4CDXB 1QMJA 3VKMA 4XFHA 2JKBA 4IXLA 4XUTA 5DG1A 2ZX1A 4CTEA 2QQIA 5A7SA 5C4WC 3H0OA 5FTTC 3NRUA 4BQWA 5FK8A 4Y20A 1NKGA 3SEPA 5FKCA 1RVF1 4JQRA 3OGRA 5FBZA 4QPGA 4ASKA 4IEYA 1KJRA 1ODNA 1ZZBA 2DCKA 2PN5A 3I2FA 3B00A 4QKFA 3VZJA 2WNUB 2C26A 3J4UH 4H55A 1W8OA 3MIBA 5CIRA 5DN2A 3RFRA 1VBB1 3FFQA 4Z1VA 3HIFA 1W8UA 5FPAA 4CCMA 2GNDA 3UETA 1HXS2 4J25A 2DUPA 4KGGA 1GV9A 2E7TA 1ZBA1 2P3IA 2ZZQA 1DBNA 3CNAA 1J3PA 1COV1 2ZOEB 3ILNA 4QMAA 1R1A1 1UCXA 3OY8B 5FYCA 1CQ9A 3JD72 3MIDA 2OZ6A 3NV2A 4YNIA 1TMF3 3J8F1 5E16A 2DDUA 3NVCA 1J59A 1Z7S1 3ES4A 3QH7A 4I3GA 5FP9A 2WZ8A 5E1RA 1OPMA 5FAXA 1FX5A 4NPRA 4HETA 3MDPA 4CUBA 4CXWA 1RUD1 2PYTA 1J1LA 2YV8A 5C71A 2GP3A 3S0MA 4ZU4A 2JKXA 3IPVB 3ITQA 3V65A 4DQAA 3CJIB 1GUIA 2JB8A 5A7PA 2CGPA 2F4PA 3OTFA 3S6PA 1MS4A 4WZCA 4CE8A 4O9GA 3RWKX 1WLCA 3KCCA 3DKWA 3M8LA 3LIHA 1OSGA 2XHNA 3IB3A 5KHJA 4ZU5A 5IAVA 1HRV2 3W20A 5JOYA 4NRPA 4QPGC 1HW5A 2BERA 2VPVA 2CGNA 1SACA 5A7WA 1H1MA 3LAGA 3SCHA 4GWIA 1O4TA 5LY1A 1YXWA 4IE5A 2YGMA 4G4FA 3OBRA 2HWB2 5FPZA 1AR83 1RITA 4A42A 2PMWB 1RJ7A 1GP4A 3H1WA 1FV2A 4FPCA 4NRMA 1GZWA 4PDWB 5ANNA 4F8AA 3QCWA 3AYDA 1Q43A 2BOIA 3JQWA 3OY8A 1ND2B 3DN7A 3TNQA 2XL9A 4AYUA 1HLCA 2Q1ZB 2IXIA 5A3LA 2A3XA 5C3QA 3UJQA 3UJOA 5C5UA 3PTYA 4RHV3 1PIV3 2JG9C 5KHHA 4RGAA 4DY5A 2D6PA 2FHRA 2IFWA 1OKOA 4TLFA 1PO11 3CJIA 4ASLA 1S0JA 4EROA 1D4M3 3MPBA 5FLJA 1LESA 5T5PA 2A71A 3K46A 3RZLA 2OW4A 5EFUA 4CXXA 1K12A 3MIFA 1TQ5A 1S4CA 1VAVA 5FJHA 5EJZB 1OI6A 4RD7A 4RS5B 1Q8OA 3SCFA 3MYXA 3V0BB 1UKGA 3NNFA 3WF1A 3MLJA 2UY9A 1G9FA 3RYRA 5FYVA 2Y0IA 5FYHA 1VB2A 1LGBA 3V0AA 2HKXA 1H4GA 4OZXA 2MPFA 3IIIA 2NMOA 5C8CC 2JDHA 4FT8A 2GN7A 4FPOB 4PDWA 4KNCA 5DAXA 5FY5A 3UV9A 3WF2A 3I3BA 4AQ2A 2IC1A 4OMCA 2D5HA 2RE9A 4AVAA 5CG8A 1JOJA 4LBNA 3JBG3 5DZEA 1LHNA 4AFAA 4AOCA 3I8TA 4S2DA 1W6PA 5JOXA 1XQNA 2EVXA 3WF4A 3RZHA 1RYYA 2GU9A 3ZYGA 2CL2A 2QQMA 3OF1A 3FUQA 3CJIC 2VZOA 4EYUA 4Q4Y3 4QX0A 5JIAA 2JDPA 4E8DA 5FY4A 2HEWF 1WLTA 3V0BA 2XUEA 5FZ4A 3I7DA 5A32A 1C4RA 3OGJA 2TBVA 4N9HA 3THCA 2VTXA 1FV3A 4NVPA 2YZ4A 5LB6A 4MX3A 1A34A 3E5XA 2WQZC 5F2SA 5FY9A 4OQ8A 4NO4A 4M3CB 4Q1PA 4GH4B 1GWKA 4IUGA 3T0AA 3PHMA 4AHXA 4GMP3 2W47A 1GQHA 1H2KA 1QJU1 1UWWA 2WS93 4IEUA 4JRAA 1AR63 1TE1B 3NV3A 3RMYA 2BUKA 4TXWA 1XXNA 1GQGA 2HBTA 2Y8KA 1HX6A 2ZGRA 2X10A 2ZGSA 3AVSA 4L0PA 3TEXA 3ZIXA 2QQKA 2I2SA 3KCXA 4R4XA 2VXJA 3BCWA 4HOOA 4Q4X2 2VUCA 1GZTA 2RS12 4I09A 2A6VA 2QFEA 1QDCA 3LWCA 2D6MA 3OPWA 4KL1A 5L19A 5FZEA 4IV1A 1YWKA 3VV1A 1TME2 1WMFA 2PFWA 3UK9A 2RM23 3BPSA 3USUA 1RXFA 3IDEA 3ZYFA 4COYA 1UKRA 1I5ZA 3CZJA 2RJKA 3HQUA 5EP9A 5EZWA 4LO6B 2VZRA 1A78A 5ERLA 5FZMA 1NQDA 1VAKA 1C3HA 4NWWA 3B7MA 5JSOA 3FZ3A 1RHI2 2SBAA 1EUTA 5FLIA 4PJYA 2CWSA 3ZYIB 5A6XA 3VD9A 5CFDA 5L7OB 1C8M1 5GZCA 2ARAA 1ENQA 5FZ7A 3OCPA 1GWLA 3VZOA 3ES1A 1SHWB 1SFPA 2CDPA 1XB9A 3GBGA 4Q0QA 4Q2FA 3AYEA 1AYN1 5F8PA 5IW0A 3VD4A 4LO8A 1BEV3 1E5RA 4QQHA 2VE1A 1WMDA 1POV3 1ZRCA 2LS6A 2VTFA 5FZDA 3TN93 4RFT0 1NZIA 4DFSA 1H1AA 1LKNA 2ERFA 4XBLA 5FWEA 5A3NA 1PVC1 1TG7A 4URTA 1WCUA 4IV1C 3INAA 1Q56A 2ZMLA 4QD2A 4UT5A 5FUPA 1DQ0A 1XSQA 3LOIA 3WUDA 3KVAA 1W2OA 3N9OA 1RUF3 4N43A 1QJFA 3WW3A 1FMD3 2WLPA 4P9JA 5F1RA 1PGL2 3KSCA 3ETPA 3VBUA 3JZVA 3POSA 1JZ8A 5G04L 5CFDC 2NQYA 1MS9A 1ENSA 3OUIA 5JOZA 5FYZA 3WDXA 3HT2A 5FYYA 4UW5A 2R072 2QZ2A 4QXCA 1W99A 2R1DA 1EV12 5F3IA 3BN6A 3OGGA 1ZZCA 2VZ3A 2ZACA 3W59A 2HWF1 3SNMA 1HB4A 4K6BA 4X6QB 3OBAA 5FZFA 1ND3A 3CL1A 1UOFA 2QDNA 2JE9A 2W1SA 4E4HA 1JHNA 5DG2A 5DQ0A 5DZGA 4IE6A 4MO3M 3KQ4B 3Q8EA 4XFCA 1RUG1 2ARCA 2G19A 4BDVB 2ZGKA 1VJ2A 5JXGA 4N43C 3AKRA 5FMBA 3BOWA 1UIJA 3THTA 5LEKA 1U5IA 2JDYA 1F31A 2EA7A 3VBUC 4FFGA 1NCQB 4XFFA 2DCJA 4XJ8A 3MBWA 5DUUA 3BI3A 2H0VA 2BGPA 1CAVB 3GM8A 4QM8A 3KF3A 1AL21 1DQ1A 5GLUA 2HWE2 1PM4A 1QNWA 4CUCA 3N36A 3T0DA 2Q8DA 4XF0A 1YQ2A 2D3PA 1LOBA 1WLWA 5LA2A 3ZPYA 4OUEA 4IE4A 1V6LA 2WO7A 3RGBA 1PHMA 1REDA 4TTGA 2ID4A 3T2TA 2WLQA 1OA4A 2WAOA 1ND3C 3U07A 4UFMA 3ZFGB 3QACA 2LUWA 4AW7A 1PGW1 4L2NA 2VZPA 1BVP1 3BALA 3LEKA 4HK8A 1OLQA 1WBFA 2CSGA 3BTZA 4CCCA 5J37A 2YFUA 1QGLA 2XJUA 1TMF1 4YW3A 3N9MA 3LDBA 2BNNA 1PMHX 4YG3A 1WGPA 1ULGA 4QGMA 4QQLA 3VD3A 5CNAA 3OUJA 4D3WA 2X5IB 2ZS6B 1LAJA 3I2GA 4M4PA 3RS6A 1Q8VA 3NWKA 1VBA3 1CAWA 2JWPA 2P1BA 2C1FA 4X8PA 3SXWA 3UL2A 5LWBA 5F3EA 2E26A 4XJ9A 4NMIA 5FYIA 4FOWA 2NN8A 3A4UA 1VP6A 4WM8B 4HT1T 1FNZA 1O3QA 4S2HA 3NSTA 1C5HA 4AFDA 1OVSA 4CUAA 2Z4FA 4CCKA 3ZXJA 2SLIA 1UU6A 4LOTA 2PHTA 3VZNA 1OLMA 1AR81 5J1XA 2D6OX 4A7KA 4GB31 2Q4SA 4CU7A 1CJDA 2JE8A 4KI5M 3ZVXA 4CPBD 4E8CA 2Y60A 3JB4C 5EV7A 4QB6A 5JVVA 1DQ6A 5A33B 5L36A 4LBQB 1MPXA 1KGYA 3WCRA 1T6BX 1JZ2A 3HVDA 5JWPA 4LE4A 1OUSA 1XYNA 3B69A 4OHZA 1MZEA 4GAZA 4RHV1 4OVEA 3SH3A 2R042 4DNYA 3OD4A 2A3YA 1ZA4A 4Y22B 1DZQA 4HSLA 5IK5A 1IQAA 4XJUA 3TEYA 1FYUA 3HT1A 3O1TA 3WINE 3PJQA 1O4YA 2V73A 1AR92 4CP9B 1X9TA 1WA6X 2DV9A 3ZLIA 5H9PA 3URFA 1DG6A 3E6BA 3GDBA 1NUKA 4W6XA 4LK7A 2Y6GA 3PUSA 3ZYHA 2XBO3 2BNMA 4MGZE 3EBRA 1AYM2 3RZZA 1SLTA 3LGRA 5I0TA 5FJKA 2VNVA 3O14A 4RYDA 4TSVA 3VHNA 4AGGA 4B1MA 2RR11 5A33A 2WRAA 1MS8A 2QKDA 5K9YA 2J1SA 1SLLA 3WG3A 3WEZA 4AL9A 5G05L 1VBB3 2OX0A 1RMU1 3SISA 4CDWA 2ZX3A 5FO8B 1GYKA 3HNBM 4BQYA 3T30A 1ZBE2 3CZUA 2WZR2 4GULA 4Y22A 3TWIA 1ZBA3 5FUNA 2RV9A 3OEBA 4M4RA 4NIGA 1PM7A 4M3CE 1HJGA 4R9DA 4BLIA 2VVFA 3I2DA 4C1XA 5A3PA 4Q4Y1 1BBT3 4IQPA 2Y26A 2PAKA 4Z07A 3J8F3 3WG4A 4CCLA 2Y6KA 2ET7A 3PNAA 3FL7A 5CFCA 2CNAA 1APNA 3ACHA 1YO8A 4OHXA 4BCUA 1ALYA 3WV6A 1IS4A 3O12A 3BU0A 4MGTA 1RUD3 1QH7A 2XR4A 3WNLA 2DVDA 1JZ4A 4E4SA 3IT8A 4FPLA 5IFTA 3B02A 1AXKA 5IK4A 5H9SA 5AFEA 1R081 4LBQD 2FD8A 1NXD1 2ZHNA 3IMNA 4K3UA 2PAMA 3IZOA 4IGPA 2ZZJA 4COWA 4C90A 4UOJA 5CBLA 2ZAHA 2ET1A 3VBSB 2BW8A 1W6QA 2WS91 4IDZA 1AR61 5LBBA 2Q8EA 1OMIA 1WZXA 2E33A 3KV9A 4CDWC 3O1UA 2HJIA 3FE5A 1HQLA 4IE0A 2D97A 5AC93 1OLRA 2AREA 2B39A 4XQ4A 4M0NA 1J58A 5JMOA 1OHFA 3R4DB 4AI0A 5FZIA 3J7HA 1IKQA 4JC1A 2P4EA 4UFKA 4YZ1A 2KXLA 5CFCC 1LHOA 4MXVA 4Y26A 2CY6A 1J1TA 2ZEWA 4QPIA 2RM21 4AVCA 4LBJA 3WDYA 4EQVA 2BDRA 2NLRA 3T1LA 1DGLA 1CESA 3ST7A 1H0BA 3RG0A 2XXZA 3IM0A 5C7GA 4D94A 4QGNA 1QF3A 4CDUB 5EIYB 2DVGA 1KS4A 2JDKA 5LY2A 1MEC3 5F5QA 2P3KA 2PXJA 1OFNA 3MF6A 3K4AA 5KXBA 3CO2A 4H7MA 1NY72 3ZM8A 1RUE2 3PUAA 3VBSA 2QJVA 4AI8A 3GF6A 1UZVA 1C1FA 2D3SA 3ZXFA 3P3NA 1GNZA 4QU2A 1BMV1 5F5AA 1PX3A 3TNPB 5C3RA 2EXIA 2J1UA 4XURA 1NQJA 2X29A 2B9VA 1POV1 1ZM1A 3NAPB 4GIQA 4JQTA 3L9JT 5I93A 2AEYA 1G9BA 1JYNA 4IV3A 3S7EA 5FOJB 4QPYA 5FPVA 4FQ4A 4FTSA 1WMEA 2CAVA 1DU3D 3ZO0B 1VE0A 2WN3A 2KM2A 4TN7A 5CADA 1G9CA 2JB4A 1VBE3 4QPIC 3PVOA 1F35A 3WP4A 2QE3A 4B3NA 3MZHA 3K77A 3LPGA 2ILMA 4P9LA 3UGHA 5LA1A 3OPZA 2PHWA 3EMRA 4P9WA 4AI1A 3VUOA 3ZPOA 3MLLA 4ZZ5A 2BOJA 2BNOA 2JG8A 4GMP0 4IEPA 3RPQA 4AEDB 4YARA 4MHUA 1OOPB 1HV0A 3D5OA 2WINB 3NNMA 1JH5A 2XJTA 5FZHA 2VZ1A 4HANA 2Z69A 4OLLA 2ZHLA 4ZU7A 1SBDA 1HB3A 2BRTA 4JRLA 2D40A 1Y4WA 3VBSC 2OPWA 4AVVA 4XQDA 1XNBA 2ZMKA 3J7LA 4KH9A 4M3CF 3AMQA 3JXSA 4YM2A 4EWAA 3FN9A 4YZ3A 1XSRA 4Y5Z0 1JYIA 1LHWA 1WMXA 4CCNA 4CYDA 2JDAA 3VD5A 2WWJA 4Y1UA 5EXOA 1PK6B 4KBBA 2AZ5A 1W6NA 4IV3C 4JZRA 4YZ2A 1QJU3 1FI2A 5LK5A 5J48A 4XUOA 4I30A 1HRI1 2R0FA 4RFRB 3WF0A 5BPXA 1DGRN 1YQ6A 2P3YA 4YVSA 2PAEA 4JV4A 2ORXA 5HPOA 1YEWA 3I54A 3ZKUA 4EZ4A 3J9SA 3WW4A 2J22A 3FLPA 4AR2A 4IGOA 2ZCWA 1FNYA 3ETQA 2TEPA 3T2OA 4EE2A 1CPMA 2JG8C 3AP6A 4QT6A 4PHZA 3WVJA 1X36A 2OQ7A 1O6UA 5EYXA 3VBHA 1O7FA 2BYVE 2Y6JA 4HL0A 4MYEA 1J83A 1Y9QA 2H6CA 4KBZA 4NHYA 1ASJ2 1CX4A 1QXRA 4COUA 1GSLA 2MEV2 3IDBB 1POV0 5KC6A 4FTEA 3LSEA 3LA3A 5E88A 1NXMA 1LEMA 2NMNA 3TYJA 2EALA 1IPSA 1ZREA 2O14A 4BLJA 5LA0A 1UOBA 3LB9A 2VMDA 4NIHA 2R32A 3NNGA 2HWC3 5ANQA 4Y4YA 5GZDA 3S7IA 1CVNA 1XJAA 4FPHA 2QUOA 1CAXB 4XC9A 4YVSC 3MO4A 4ISQA 4MUVA 2WSVA 3BVCA 4Q5OA 4SLIA 5I8TA 5IVYA 2O8QA 2WR9A 2XJQA 2C9AA 1FPN2 1XNTA 3MF9A 4CEWB 2FZ2A 3PURA 5C3OA 1EAH2 1QJX2 3A21A 2AC1A 4PBPA 4PQQA 4UF0A 1RUC3 5FYTA 4M0HA 1PVC3 1LODA 1RUG2 2VUDA 3CU7A 4RQPA 3VBHC 4AHYA 3HWJA 4DUVA
chains in the Genus database with same CATH topology
2YROA 3WLUA 3KQRA 4LLFA 4OI0A 2HWD3 1BQPA 1VBC2 1ULDA 1B09A 3WXPA 2GC0A 2GN3A 3QBQA 5KWRA 1JUHA 3L2HA 3RRDA 4XOGA 3VL8A 1GFF2 4HVQA 5JZGA 3TRSB 2VULA 3VZMA 4RR3A 2RMU1 1K5MA 4XBQA 4UW4A 1ZVFA 3WX5A 1A8DA 1LU1A 4ORFA 4YG6A 3W58A 4AW7A 2HWF3 4ATEA 5GJ6A 3TOJA 3VDDB 4QX5A 4JGZA 1PGW2 4CEWA 3B3QE 2P3JA 1G8WA 3SMHA 4Q0UA 3ZFFB 5C9AB 2BBVA 3AMHA 4RQPC 5T3NA 4AGRA 1V6JA 1D2QA 1RUH3 4QHBA 4YW4A 1ZYBA 1DGRA 2WA4A 2ARBA 1TEIA 2WKKA 2YDEA 2XGXA 3VN4A 1AJOA 2VG9A 3VBFB 3ZN6A 3RWNA 5HCAA 2ZAAA 3TAYA 2IZWA 2ENRA 2XBO1 4RSUA 5KXDA 5JZGC 4FBFA 1TNFA 1CIWA 5BXXA 5BNQA 3MW2A 4RR3C 2B46X 4L11A 4QQ2A 1K5MC 5LK7B 2BFUL 4HPKB 3FFZA 4COVA 3UKNA 1AR82 1Q8PA 5D1IA 4E2GA 2EXJA 4JGZC 2Y0OA 1YI9A 1I3HA 1W0OA 4LULA 5KXCA 4IETA 3C3VA 3RI8A 2BQPA 1RC6A 4AE2A 3VGIA 1S1AA 2ZGMA 2XVKA 4UXAA 1AL0G 4BM8A 1KFUL 1W6OA 4SBVA 4WM7B 2PHXA 1BBT1 4RHV2 1PIV2 5BNNB 1BJQA 4B8EA 5D8AB 4I01A 2ZTNA 5T5OA 1AR71 3V56A 2XVGA 1D4M2 5FLHA 4OI4A 2E53A 2XWJB 4ZKTB 4CDXA 5C33A 2D6NA 2R0HA 3VHRA 5A3MA 2FMYA 4IEXA 1NOVA 1QJY2 5DDJ3 2JICA 4XILA 4QGLA 3M7AA 3O0XA 4FQZA 1G9DA 3A0NA 2UY8A 5ACA1 2WNUA 2WSUA 4XETA 3UKTA 4DY3A 4ZXKA 2OUJA 5J3UA 4GB33 5J96B 3JBG2 3OYWB 1LHVA 1U5YA 3ZSLA 4XW3A 2ZPXA 3IKWA 4IERA 2WNEA 4LO5B 1AHSA 2JJ6A 5BNOB 5D8AA 2LALA 5E89A 2JDZA 5ABJB 1BVVA 1F9KA 1ZZ6A 3AXDA 2GAUA 2XLAA 3CEWA 5T52A 1KDKA 1S0DA 3ZX7A 3VHPA 1WD4A 4INDA 5FPXA 2R6QA 3IPVA 4CDXC 4GKXA 3FBMA 5GKAC 1VLNA 4AVSA 2ZGNA 2VH9A 3PVBB 1JBCA 1MEC1 4Q8KA 1FOD2 1I6XA 3AKPA 1H8TB 4BWOA 3WOGA 3ZSKA 3WT3A 1VBD1 4XXPA 1VRH2 4GWNA 4OHVA 1UX6A 3ZFEB 4EN9B 3ZDSA 2WNUC 3TBDA 1UMZA 1X82A 1RUJ2 3JD73 3NV4A 3D0JA 1KDMA 5T50A 2RR13 1NA1B 1ND2A 4GA9A 4GQ7A 2CWMA 2RS52 2D7FA 1LCLA 3WDUA 1VBE1 1RMU3 1IS6A 4LNVA 1X50A 4AG4A 3MGUA 3HQXA 3MIEA 4FOVA 4LUMA 4YGDA 3RYPA 3CLPA 3H8UA 1ULFA 1HRV3 1AF9A 4UBGA 2H6BA 4IEVA 4RS5A 5SV5A 2W08A 4HKWA 3AM2A 2HWB3 4BA6A 1ZZ7A 3E6DA 4O9EA 2W0XA 1V9U2 4L9BA 2ZGTA 4XHXA 1N1SA 3NL1A 4XE9A 3WD5A 1R083 4FPGA 4PDWC 1M4WA 1O3SA 3POYA 4A3XA 1BEV2 1NA1A 1MQTB 1ND2C 1QWRA 4AWDA 3VBRB 4TWTA 4G9SB 1RUI1 3TN92 3LA2A 1MS3A 3HBZA 2ATFA 1OQ1A 1DYPA 4OHWA 2A75A 1N3QA 5JOWA 1YFWA 3U11A 1LOFA 1H2LA 2VUJA 1IPKA 2EF6A 2D93A 2R30A 1IZ3A 1RUF2 1X8EA 4XBNA 3FLRA 4RS5C 1FMD2 4YFWA 4OHYA 4K40A 1XYPA 1AJKA 4HSJA 2JEMA 3WDVA 5FO7B 4HZFA 4BH9A 4MVTA 4M3CA 1JUIA 1MVEA 4GH4A 4COZA 4DXZA 1BXHA 3RDIA 4FOYA 4GKYA 1IS3A 4XFIA 1S0EA 2HWC1 4Q4V2 4W6YA 5JPMB 1UZYA 3VBRA 5LRSA 4Q4W2 2GSYA 4Z82A 3N35A 4HBNA 2PHRA 2A5ZA 2R16A 4Y1YA 5CAZA 2EIGA 2I45A 4MV2A 1QOSA 1H4HA 1LOFC 2VGDA 1GANA 4I0WB 4WVMB 4WBBA 1RUC1 4LE3A 4LT5A 4PCRA 2Z79A 2XHKA 2XJVA 2PHUA 3D8CA 3ZSEA 4ATFA 3KS7A 4AEKA 1LOAA 1U5ZA 4MH0E 1C8NA 4FAHA 4Z92B 3QH6A 1GKBA 2Q0AA 1ZRFA 2HWD1 2YMZA 2D98A 3WP6A 3DV8A 4TZDA 4XYXA 4GH4C 2V09A 5HCFA 4IL7A 3MW4A 4XHBA 2WZPP 5JR7B 5L7OA 4MGYE 2B45X 4JVAA 4Q4X3 2RS13 2EAAA 5KHIA 1UD1A 3R0RA 1N1TA 4NOTA 1TME3 4DRRA 2RS31 1RUOA 1V6IA 4META 4C0HA 4I02A 1PO22 1V6NA 1HRI3 1X33A 4YFZA 4PLNA 2WFF2 1ULCA 5CG9A 2P37A 4AVBA 1LHUA 1RUH1 2FZ1A 2OA2A 4PIZA 4LBMA 4YW2A 3CF6E 5J7MA 1VBA2 1N47A 2FMDA 3IBMA 4XF3A 1VAMA 5L7OC 1YUDA 4AK3A 4S2GA 4Q27A 3N7KA 3FBYA 2TNFA 4LA2A 1U12A 2IXLA 3AMPA 3BPZA 1WW5A 4HLTA 3P3PA 4AF9A 3JB8A 2GNTA 3DUIA 2WWSA 3VKNA 1Q8QA 1DQ4A 4BE3A 1RUNA 3PMEA 3M3IA 4CDQB 1ZNPA 2A6YA 3BIWE 3KGZA 2ZX2A 4JTNA 4XJZA 1R092 2KA3A 1QXPA 4LO7A 2XKOA 3BOPA 1QXJA 2PLV2 3KLSA 2PA7A 1S0GA 1NE6A 4UW3A 3LOBA 4XTMA 3RMXA 5T5JA 1H30A 1UL9A 1NCQA 2R073 1QQP2 3HD8B 1JYCA 4C91A 1CAVA 1YJKA 2GMMA 2K9ZA 3VL9A 1EV13 4R9BA 3AKQA 2ZKLA 3R4SA 2WA3A 4M00A 3WW2A 2ZGQA 5FO9B 5DDJ1 2UWCA 3Q9OA 1LR5A 4Z8BA 2DURA 4MXWB 2R061 5FREA 1D0HA 1U0AA 1HQWA 4YRDA 2IXCA 3H9AA 4FO9A 1V6MA 2O8OA 1RVF2 1URXA 2WT2A 5TSWA 3VBOB 3WP3A 3ZFGA 4C0BA 4CDQA 1KS5A 4AXOA 1SLCA 3AZVA 2RMU3 3ZYPA 4UBHA 3D0SA 1VBB2 1N3PA 1F5JA 2ZGLA 4AFBA 4XQWA 4H7LA 1HIXA 1ZBA2 1B35B 4DMIA 1RTVA 1COV2 4Q0VA 2XWBB 2WJSA 1SFYA 1R1A2 3QD6A 2HWE3 4U36A 1NCQC 3GBWA 2X5IA 1Z78A 3J8F2 2DTWA 1J3RA 1Z7S2 2K2SA 4KWLA 2VMHA 3IDCB 1TNRA 1WCKA 1RUD2 4WM8A 5J09A 3U0ZA 4AGVA 2BVVA 1VB4A 1PMIA 5AVAA 2JXAA 2C0ZA 1HKDA 2BWCA 1HXS1 3PMSA 3GHMA 3ZFGC 1PZ7A 3JD71 1PNFA 4ISRA 1ZX5A 4AFMA 1X8MA 2ZGUA 1XRUA 1ENRA 4LBQA 5IUQA 5FQ0B 5AC92 4BMEA 2XB6C 3MW3A 4AVTA 2X5IC 3UKVA 3OBTA 4LBOA 1YFYA 2XLFA 1XU1A 2WQ4A 4YZ5A 4D7TA 1HRV1 4DRVA 2YC0A 3OJBA 4WM8C 4MSVA 1AR73 1PO12 2DFCA 4QXKA 2HWB1 5GZFA 2C5DA 2YYOA 1BK1A 2ZMNA 3WNXA 3WW1A 4CP0A 4DOUA 4K8FA 1LOGA 2CTVA 4N53B 2V5YA 1YLLA 4G3YC 1SDWA 3I59B 5ACA3 1EPWA 2R043 1L3JA 1NLSA 5CU1A 3WQ1A 1LJ7A 4LBLA 1C57A 2ARXA 2W52A 2LM3A 2JE7A 1W39A 4XMIA 4BZ4A 1O5UA 1SBFA 1FATA 3VKLA 1UU5A 1QOTA 3SHRA 4P9YA 1Y43B 2Z42A 2DUQA 4RL7A 3NKGA 1AYM3 4K7JA 5FMOL 5FOBB 3VZLA 4FPEA 4FP3A 5DZFA 5HCBA 4P9IA 2VNOA 2VXRA 1NCRB 3ATGA 1VBD3 3AMNA 5JDBA 3I4IA 3I59A 3M3OA 2YGLA 4LO4B 2GZWA 3ZSJA 2EAKA 3U4XA 3JUUA 1WA4A 4PIYA 4NR1A 1LOCA 1QJU2 3VZKA 2BFUS 1DYKA 5BNPB 3R4UA 1DZTA 1QOOA 4AQ6A 5K0UB 4EN6B 5KBFA 4LA3A 2JX9A 3PLQA 1GLHA 3SH5A 1YIFA 4BOWA 5IK7A 3ELNA 2NP0A 3MPPG 2CAUA 3NW4A 4PQ9A 1KFXL 3FWEA 1QJZA 2DCZA 2BPA2 1YI7A 4CDUA 4R8HA 4CRQA 4JDMA 4WVWA 2ZX0A 1S0IA 4S2FA 1WBLA 3ALQA 1SLAA 1GBGA 1UF2C 2TUNA 4Q0PA 4Q4X1 1OA3A 2RS11 4ITCA 4R9AA 1C8M2 1XNKA 1S55A 2P34A 4FXKB 3NAPA 3ZMNA 5BNPA 1C5IA 2G4IA 3ECQA 2UU8A 1AYN2 3LKJA 4JTOA 4L97A 1TME1 4H14A 3CJXA 2YUEA 2BGCA 3D82A 4OULA 1RUI3 4JAAA 5DXDA 4P9GA 3WQ0A 1JW6A 1PVC2 2ZHMA 4EN0A 1RHI1 2GALA 4JGYB 4CDUC 4YGEA 1RUE3 3KT7A 2P17A 4AEDA 1NG0A 3EO6A 1E57A 1OOPA 3B01A 2UURA 3A0KA 1EP0A 4LLOA 4XEZA 4KWKA 1DQ5A 3ILFA 2DVFA 1DGWA 1WCDJ 1BZWA 2Q1MA 4I0BA 4X6RB 1KRIA 3WG1A 4AI2A 2RJLA 3JQXA 2YXSA 5BY5A 2PTMA 4B29A 1D0GA 3NAPC 5BNPC 1V6OA 2XL7A 5E8AA 5JIUA 3ASIA 4J1WA 4EWDA 1PK6A 3NV1A 2VNGA 2HYKA 4YYOA 4KWJA 4ONUA 1XNDA 2HWF2 4FXGB 4KG8A 2VECA 3AP7A 3AJZA 4MZUA 1W6MB 1SMVA 3ZYJB 4HN1A 5GLVA 2PHFA 3GALA 2A6XA 4XFBA 4XZPA 4FPJA 4BQ1A 1PGL1 2PQQA 1RIRA 4IEQA 5JPNB 4YGBA 4RGGA 1SCRA 2FBEA 4AEDC 1ONAA 2R071 3ME2A 1OOPC 2D43A 1RB8G 1EV11 1S0BA 5I0RA 3FUOA 4UW6A 3QOPA 4Q29A 1CGPA 3M4FA 4E2SA 5C4WB 4KU8A 2X8KA 3M3EA 4FVVA 1AL22 4LR4A 4P9XA 4D7YA 2OUHA 3H3UA 4BHPA 4ES8A 4AQTA 3ENRA 1QY4A 1PK6C 3HR9A 1DQ2A 2AYHA 4WV8A 1MS1A 1CAXA 3ZN4A 3AZWA 3ZXEA 5T55A 1LULA 2RS33 2O0OA 3GZUC 1EY2A 1NLRA 5EJ3A 1AVBA 3N7JA 2HWE1 4NHKA 2G9FA 1TMF2 2QZ3A 2GC3A 3H50A 1LGNA 2GMPA 3O0WA 1PNGA 2VMIA 4JCKA 4Y20B 4Z2WA 3H1YA 4AEMA 1HDKA 4PF5A 4E27A 3HMYA 4QPGB 4DZGA 2HEYF 1DFQA 4E4ZA 1J3QA 3AB0A 2WNVB 3FC0A 2X53S 1AUYA 2RHPA 1EAH3 1QJX3 5C6CA 3VDDA 4ASMB 1JN2P 4GB32 4CEWC 3AP5A 1CAUB 1SQ4A 4I2OA 4DINB 3JCIA 3WCSA 5KHGA 2GDFA 3EJKA 3ZFFA 3KZ4C 3RI9A 5C9AA 5GZGA 4B7EA 2JG9B 4FPKA 1YFXA 2IWGB 1VBC3 5B2GB 2YHJA 1H2NA 3FX3A 4NHMA 5CVRA 1PZ8A 5HXVA 1KJLA 1HQNA 4F83A 1NZCA 4Y1XA 1WW4A 4LEJA 2OZJA 3AMMA 3VBFA 1F5FA 1KD7A 4L8QA 4B4PA 1LTEA 3AP4A 1GR3A 2VOWA 2WNVA 5C8CB 2D6KA 3RNSA 2BWAA 4HPKA 1GZWB 4MGKE 4MLOA 2R063 4XJWA 3VDDC 4YM3A 1D4VB 1CAUA 1KXGA 2R041 1OPOA 2D44A 1GZ9A 2RR12 4Q26A 3ZFFC 5C9AC 3N4MA 2JG9A 4IEWA 5JI7A 1AR91 1UN1A 2VNRA 1RMU2 2ZBJA 4WM7A 5BNNA 4LBKA 4QM9A 4N9IA 3B94A 5KXEA 3MFAA 2XJPA 4Q4Y2 3VBFC 2IXJA 3RJ2X 1AYM1 4JDOA 4N7UA 4I3PA 1G7YA 5I0UA 3PVEA 1XE8A 1H9PA 4YGCA 4A7ZA 1DHKB 3V0AB 2WNVC 5C8CA 4B7KA 1UPIA 4OFGA 2XPJA 3GYDA 4XMAA 3LZZA 5SV8A 1T6GC 2H0BA 1H1IA 1PVXA 2GMEA 2YPJA 4R9CA 2VU9A 4EWEA 1R082 1ZBE1 1HXS3 2WZR1 3AFKA 3T1MA 4CP1A 2A70A 1C28A 2ZKNA 5DUVA 1W6PB 2WS92 2P2KA 3OYWA 1AR62 1CD3G 2VVEA 2XVLA 2JD4A 1REEA 2MNGA 2VVDA 4WM7C 5BNNC 5BNOA 1A8MA 2XKPA 4IEOA 4R4ZA 5D8AC 3NKTA 5ABJA 5HBAA 4X8NA 3D6EA 5GLTA 5A32B 3DPRB 1AX1A 2XH6A 3MICA 2DUOA 1G9AA 1QJY3 2QNKA 2RM22 4IESA 4YM1A 3ZXGA 1KITA 2ZX4A 1CR7A 4BPZA 4Y1VA 3E5QA 1H8TA 4KQ7A 3SH4A 3POWA 1ZRDA 5F6KA 2G9GA 4YM0A 3ZFEA 3AP9A 4H3WA 2VMGA 2PHDA 2N7GA 3D4KA 5FFOC 3B9IA 1WW6A 1LB2A 4XPVA 1MZFA 3GBFA 1LECA 5JSPA 2DCYA 2OPKA 5F6LB 1BMV2 5LEJA 2QDRA 5BNOC 5DUWA 2WIIB 2AENA 1MS0A 4IV1B 4F3JA 5ABJC 4BIFA 4ES9A 3USUB 3DPRA 3KMHA 2DU1A 1PZ9A 1IHMA 2DWRA 2DTYA 2PHLA 4GALA 4K1ZA 1FOD3 3PJYA 4GXLA 1NY71 1RUE1 4PIXA 3ZYRA 1VRH3 3N3HA 2B5HA 1H8TC 4FSJA 1CJPA 3SLIA 5GLZA 5CFDB 1NYWA 2I07B 1RUJ3 2DVAA 3KCYA 3ZFEC 1CPNA 1N1YA 5KHKA 3DL3A 1MR5A 2XUMA 1Q3EA 3MIHA 1CONA 5T54A 1U5XA 4E2QA 3RJRA 2E9QA 2UWBA 3WUCA 4FP2A 2RS53 2GNBA 4A7YA 4K9SA 1MQTA 1NA1C 2CV6A 4EN7B 3VHOA 2DCTA 4YLZA 4OI1A 1RJ8A 3SITA 3DPRC 3VKOA 4KG0A 1HRI2 4U2AA 3ROUA 4K20A 2E51A 4N43B 4OUMA 2OYZA 3FLTA 3MI8A 3S30A 3VBUB 4QQPA 3VLBB 1AX0A 2NZ9A 2QVSB 1V9U3 3M3QA 2FQPA 1O3RA 5I91A 4WVVA 2XG3A 4IEZA 1YNAA 1MQTC 1OFSA 1ND3B 3VBRC 1UAIA 2XJRA 4XIOA 3B5LB 1S0FA 2ZGOA 3RQ0A 1UZZA 1BCXA 3LA7A 3WP5A 4HKLA 4CEYB 1PGSA 3QLQA 2DU0A 3E97A 1V00A 3AXEA 3EXUA 3M3CA 2DFBA 1EYBA 2NM1A 4WVMA 3WHTA 1ASJ1 2IXHA 1DF0A 2MEV1 1R1ZA 2UYBA 3L2YA 3ZXAC 3ZXKA 2A7AA 1Y3TA 1AXYA 2AGSA 3HAGA 2B7YA 3J26N 4LHLA 1RHI3 3KGLA 1IKPA 3WZ1A 1ULEA 1VALA 2W39A 5JI9A 4Q4V3 1BYHA 1O4ZA 1QU0A 5AVPA 4Q4W3 1V70A 3THPA 1UIKA 3AKSA 1AX2A 4L99A 5FMOS 2E6VA 1X7NA 2O1QA 1G6NA 1C1LA 4B4RA 1FPN1 1UW8A 4PLMA 2VW0A 1EAH1 1QJX1 3B93A 3JU9A 4PBOA 4CEYA 2RMU2 4M01A 2BEOA 3IN9A 2IFRA 1SBEA 1ENXA 2K0GA 1QNYA 2HEVF 2B9UA 4XF9A 5DUXA 1VBC1 4Q8LA 2VOXA 1W2UA 3BTAA 1F2NA 1CAWB 3ZSMA 4K1YA 3K48A 2D3RA 3R6SA 1SLBA 4E4DX 1Q8SA 2ZABA 2VQAA 2GH2A 1MZ5A 4HMZA 3ACLA 5JCTA 1N3OA 2E7AA 4YG0A 2ZA9A 1SEFA 4K21A 3RSJA 2XBO2 4BMBA 1IOAA 2W68A 4CEYC 2ES3A 1PO23 3ZXLA 1ZRRA 2Q8OA 2WFF3 1BKZA 3KB5A 1XU2A 2XJSA 3BB6A 2UYAA 1O3TA 3AYCA 2ETEA 3DGTA 3IWZA 1KQRA 1JTZX 3K51A 2F6BA 4V1PA 4YSFA 3WY6A 4D7SA 3GZAA 5FRAA 5GM0A 1REFA 2E7QA 5BUVA 3ZIWA 4Q0SA 3O7OA 4OI2A 2IXKA 1BBT2 1RL3A 1UPSA 2JECA 1EPZA 3WQ7A 5BYNA 2CYFA 1AR72 4HN0A 3AK0A 4KGQA 5CB7A 3FHIB 3G6JB 4DS0A 1I1EA 3USSA 2Z2SB 5JLVA 4I0AA 4MXWA 3G7DA 3HN1A 1R093 2PLV3 1G86A 3VBOA 4CDQC 4CDWB 5I8YA 1LENA 3BU7A 1PIV1 5ACA2 4FPFA 1SCSA 2EXKA 1IS5A 1D4M1 5FCCA 4AEJA 1QQP3 4XFGA 5CFCB 4W65A 1B35A 2Y38A 3BODA 4YW5A 2WC2A 1SFNA 1WD3A 1IGOA 4BYYA 2ZGPA 1QJY1 1WUVA 5GALA 1LEDA 5HI0A 3AZXA 1RINA 1MVQA 1RVF3 1Q5OA 2VW1A 5F9TA 5BV6A 1GNHA 1GZCA 1MEC2 1RGSA 1Y7BA 4GWMA 1W6QB 3JBG1 1XYOA 3VBOC 1YRZA 1YFUA 1VBD2