1ND2B

The structure of rhinovirus 16
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
252
structure length
252
Chain Sequence
SDRIIQITRGDSTITSQDVANAVVGYGVWPHYLTPQDATAIDKPTQPDTSSNRFYTLDSKMWNSTSKGWWWKLPDALKDMGIFGENMFYHFLGRSGYTVHVQCNASKFHQGTLLVVMIPEHQLATVNKGNVNAGYKYTHPGEAGREVGTQVENEKQPSDDNWLNFDGTLLGNLLIFPHQFINLRSNNSATLIVPYVNAVPMDSMVRHNNWSLVIIPVCQLQSNNISNIVPITVSISPMCAEFSGARAKTVVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords coat protein VP1
publication title Structural and virological studies of the stages of virus replication that are affected by antirhinovirus compounds
pubmed doi rcsb
total genus 61
structure length 252
sequence length 252
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2002-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1nd2B00
2WFF3 1RUC3 2BFUL 1RHI1 4JGYB 1CJDA 1HRV1 4RHV1 4FTBA 1IHMA 1RMU1 2ZZQA 4CEYB 2FZ1A 2XBO2 1FPN1 3J8F1 3VBHA 1ASJ1 2XBO3 1RVF1 4QPGB 3NAPA 2WFF1 1AYN2 5J96B 1H8TA 5A32A 1POV0 1H8TC 1AYN3 3CJIB 4IV3A 4CDUB 4IV3C 4LLFA 5BNPB 1PO12 4CDWC 4N43C 2XBO1 5C9AA 2HWD2 1PO13 1E57A 2MEV2 1RB8G 2MEV3 3ZFGA 1BEV2 1AYN1 2R072 1AR82 1BEV3 2R073 4Q4V2 3VDDB 3ZFEB 1AR83 1Z7S2 2HWB2 4RR3B 4GH4B 4CEYC 1PO22 1Z7S3 3VBSB 1PO11 2HWB3 4NWVA 5C8CB 1PO23 2HWD1 2MEV1 1PIV1 1BEV1 4JGZC 2R071 1NCQA 1AR81 5J98B 2QQPA 1AR72 4Q4V1 1MEC2 1NA1A 4CDXB 1Z7S1 1VBB2 5BNOC 2HWB1 1AR73 1MEC3 3VBRA 1PO21 1VBB3 1AR62 1TME2 1VBD2 4RQPB 1QQP2 4PDWB 1AR63 4GMP3 1OOPB 1TME3 1VBD3 2HWF2 5C4WB 1QQP3 5CFDB 1ND3B 4AEDB 2HWF3 1EV12 4WM7A 1HXS2 1RUJ2 4QPIC 4WM7C 1EV13 1AR71 1VB4A 4N53C 4CDQC 1HXS3 1VBB1 1RUJ3 5L7OB 1RUG2 1RUF2 1RUG3 1AR61 1VBD1 1MQTB 4FTSA 1QQP1 1RUF3 2WLPA 5JZGA 1A6CA 2HWF1 3VBOB 5DDJ2 1EV11 5D8AA 5DDJ3 4YVWA 1HXS1 5BNNB 1RUJ1 4GB32 4RS5B 5D8AC 5FMOS 4EJRA 4GB33 1K5MB 1RUG1 1NCRA 1W39A 1RUF1 4Q4X2 4WM8A 3VBHB 4WM8C 4Q4X3 1OOPC 1M06G 3NAPB 2Y26A 5CFDC 4YVSA 4CEWB 3DPRB 4YVSC 2IZWA 4GB31 1X36A 2HWE2 1F8VA 2HWE3 5C9AB 1ND2C 5CFCA 4Q4X1 2X5IC 5CFCC 1RUC1 2RS52 1RUD2 5K0UB 3ZFGB 2RS53 1RUD3 3ZFFA 1QJX2 4CDWA 1PGW2 4N43A 3ZFFC 1QJX3 2HWE1 1C8M2 1C8M3 1B35B 2RS51 1RUD1 1CD3G 4JGYC 1NCQB 1OPOA 4CEYA 1RUE3 1NA1B 1ZBA2 1QJX1 1PGW1 1ZBA3 1C8M1 4SBVA 1VBA2 4QPGA 2BFUS 1FOD2 5A33B 3HAGA 4QPGC 1VBA3 4JGZA 2WZR2 1FOD3 3VBFB 1AUYA 3CJIA 2WZR3 3CJIC 4CDUC 5BNPA 1BMV2 5BNOA 1SMVA 5BNPC 1ZBA1 1VBA1 1AL22 1FOD1 3JB4C 5JZGB 1AL23 2RR12 2WZR1 5ABJB 3FBMA 1D4M2 4QPIA 3JD72 3VBUB 2RR13 4N53A 3VDDA 4CDQA 2VQ0A 2WS92 3VDDC 3ZFEC 2GH8A 4RR3A 1D4M3 1BMV1 1MEC1 2RM22 3JD73 1QJU2 4RFT0 4RR3C 3VBSA 2WS93 4IV1B 4GH4C 1BBT2 2XPJA 3VBSC 2RM23 3JB8A 2RS12 1QJU3 1PGL2 4Q4Y2 1AR92 5C8CC 1BBT3 1NCRB 4GMP1 1TME1 1QJZA 2RS13 4Q4Y3 1AR93 1AL21 1COV2 3VBFC 2RR11 1COV3 1D4M1 3ZXAC 3JD71 2PLV2 4CDXC 4Y4YA 1QJU1 3JBG2 2PLV3 1BBT1 2RS11 1PGL1 4RQPA 3JBG3 4Q4Y1 1AR91 4NWWA 2WWSA 2BUKA 1OOPA 4RQPC 1GFF2 4PDWC 2BBVA 5CFDA 2R042 1ND3A 1COV1 5C4WC 2BPA2 1ND3C 1H8TB 5A32B 2R043 5DDJ1 4AEDC 1HRV2 4IV3B 1X33A 1HRV3 2PLV1 4CDWB 5L7OC 3JBG1 4N43B 3J8F2 1ND2A 2X5IA 3J8F3 1MQTC 1VRH2 1VAKA 1R1A2 5FOJB 2R041 1VRH3 3VBOC 5AC92 4Y5Z0 1R1A3 5BNNA 4RS5A 5AC93 5BNNC 4RS5C 1K5MA 1EAH2 2FZ2A 1K5MC 1RUI2 1EAH3 2ZAHA 3VBHC 1RUI3 1HRI2 1VRH1 3NAPC 1R1A1 4JGYA 4JGZB 4CEWA 3DPRA 1HRI3 5AC91 4CEWC 3DPRC 1RUE2 1FMD2 3M8LA 2RMU2 5BNOB 2ZTNA 1FMD3 1AL0G 1EAH1 1POV3 2RMU3 3VBRB 3S6PA 1RUI1 5C9AC 2HWD3 5K0UA 1HRI1 1PIV2 1ZBE2 5K0UC 2R062 3ZFGC 5ACA2 1PIV3 1ZBE3 4CDUA 2R063 4QPIB 1RUE1 4WM7B 5ACA3 4N53B 4CDQB 1FMD1 4GMP0 4Q4V3 2RMU1 1POV1 1QJY2 2HWC2 2RS32 5FMOL 1HQNA 1QJY3 1B35A 2HWC3 2RS33 1B35C 1R092 1TMF2 1ZBE1 1R093 1NOVA 1TMF3 2R061 1VB2A 5ACA1 1RUH2 4Q4W2 3ZFEA 1NCQC 5D8AB 4YVWB 1RUH3 4Q4W3 4GH4A 3LOBA 1NA1C 1WCDJ 1C8NA 5C8CA 1AYM2 1QJY1 3VBRC 2HWC1 1PVC2 2RS31 1R082 5A33A 4FSJA 1AYM3 4FTEA 4BCUA 4WM8B 1PVC3 3VBFA 1R083 1R091 1TMF1 2TBVA 3TN92 4YVSB 5GKAC 1RUH1 4Q4W1 4CDXA 1NY72 2WS91 3TN93 1HX6A 2RM21 1DDLA 1V9U2 1AYM1 1VBC2 1NG0A 1ND2B 1PVC1 4PDWA 2X5IB 1R081 5CFCB 1V9U3 1VBC3 2DF7A 1VBE2 5C4WA 1OHFA 5LK7B 5ABJA 4AEDA 5JZGC 1RHI2 1VBE3 5ABJC 3VBUA 3IDEA 3TN91 1RHI3 4RHV2 3VBUC 4Z92B 1RMU2 4YVWC 1NY71 4IV1A 5L7OA 4RHV3 3ZFFB 4IV1C 1RMU3 1FPN2 1ASJ2 1V9U1 1MQTA 1VBC1 1FPN3 1NCRC 1RVF2 1F2NA 1ASJ3 1RUC2 2WFF2 1VBE1 1RVF3 3VBOA 2GSYA
chains in the Genus database with same CATH superfamily
1EPZA 3NW4A 1PK6A 4TSVA 4BZ4A 1CJDA 4PIYA 4G3YC 3CU7A 4E8CA 2VVDA 4RHV1 1E5HA 3OGJA 1ST8A 2BQPA 2B4KA 3PTYA 1W6MA 3R05A 4PLNA 3UJOA 4CEYB 1NKGA 3T0DA 1GZCA 2O14A 2OPKA 2D6NA 2VAUA 4Y1ZA 2EIDA 4GA9A 3S5QA 2C26A 5FZHA 3WDXA 1TVGA 1AYN2 2VPVA 5KXEA 1NT0A 5A7SA 5A32A 2QQNA 4AI2A 2VQUA 1AXKA 2Z79A 5I8TA 3AMPA 3D6EA 2IXIA 2WAOA 2DCJA 3POBA 2BNNA 5JMOA 5DZFA 4V2WA 4XZUG 1XXNA 3BPSA 1JZ4A 3RPQA 2ARAA 3HJRA 2BYVE 1UD1A 4J1XA 5FZOA 4KGGA 2EIBA 2FMDA 3BB6A 3TBDA 3P3NA 4E4HA 1PO12 4QKNA 4XUTA 4Y1XA 3U14A 2WQ4A 1J3QA 4Y26A 4N43C 2WNEA 2ZHNA 1WD4A 2HWD2 5FBJA 3ZDSA 2ZXQA 3I7DA 1W3XA 5A1FA 3M3QA 4P9GA 5HXVA 2O8QA 2JG9C 2MEV3 3HN1A 4RSUA 3ZFGA 1EUUA 3E6BA 1AYN1 4X8PA 3BOPA 4CUBA 1YQ2A 5FZIA 3X29B 1Q8PA 3IPVB 1WMDA 1AX0A 4Q4V2 5F5QA 4KGQA 3LZZA 4XHBA 2D6KA 2D6PA 1OLRA 1Z7S2 2O0OA 3AYEA 3MLKA 2ZX0A 4EN0A 4LEJA 1W2TA 1D0HA 5A7WA 4CCEA 4CEYC 3E5XA 3MIEA 1PO11 5EPAA 3KCYA 2GU9A 4P02B 4UWDA 2RJKA 3WDTA 2DU0A 5C8CB 2HWD1 5DN2A 4HETA 2XJSA 1QH7A 3OY8B 4XQ4A 2OUHA 3VHNA 3SEEA 2ZX3A 2WC2A 4IGPA 4N7IA 3RSJA 4QX3A 2VOXA 4XBQA 1UL9A 1Q8OA 4HBNA 2YPJA 2ARBA 3WDYA 1A8DA 5LRRA 3SCHA 5C70A 3TEYA 1NCQA 4XQDA 5I8YA 2DWRA 1HN0A 1PM7A 4INDA 4JTNA 3VGIA 4Q4V1 1ZZBA 4A45A 2ARXA 5HV4A 2B39A 5M0TA 5JXHA 3ZYJB 2CV6A 1Z7S1 3GZEA 4HLTA 3NO8A 4R9DA 3GJAA 5FZ0A 5FXXA 1Q3EA 2D5FA 4OCTA 2VMHA 1J1LA 3A23A 3UESA 4YM2A 3VL9A 4BQXA 2R0FA 1UYPA 2P3JA 3PUAA 4CCMA 5A3WA 1N1YA 3TOJA 2HH9A 1AR63 1O59A 3DYOA 1TME3 1VBD3 2HWF2 3M3OA 4GMP3 4Q1RA 1YEWA 3MHZA 4K20A 4XFAA 3UL2A 2P2KA 2XKPA 3UGHA 3VLBB 3WNKA 5C4WB 4CU6A 4XJAA 4HKWA 1QDCA 1Y7BA 4WM7A 4XF4A 2ZPXA 2IC1A 3N7KA 4P5YA 5DQ0A 3WUCA 2WR9A 4QPIC 4KWLA 5T54A 1EV13 2HYKA 4EWAA 5K8SA 1VP6A 3I54A 4FT8A 1K42A 1RUJ3 5FZCA 2PFWA 4E4DX 1PMHX 3J7HA 3WX5A 5CISA 4A4AA 3O1RA 1V00A 4DMIA 2OX0A 2WFPA 3CBNA 5FP3A 4YW7A 4YW3A 4BDVB 1Q56A 1MQTB 2AENA 2JB4A 4Q8LA 5JZGA 1F5FA 3AZVA 4LKEA 3IAPA 2HWF1 5DUVA 2LROA 3KCCA 5F3GA 1VE0A 5A7OA 5L36A 4P9XA 3VBOB 1OUXA 4RGAA 5A6XA 1DIWA 5LWBA 2IXJA 3Q8FA 5D8AA 5DDJ3 3KV9A 3PHMA 5EJ1B 3QLQA 3EYPA 4QGLA 4RS5B 3UETA 2DURA 5I91A 1KEXA 2R30A 4GB33 1YJLA 4FXGB 1LOCA 1YUDA 4FVVA 4Q4X2 1GNZA 3T09A 3TWIA 1GYKA 1LJ7A 5HXMA 3FE5A 5DZEA 5KHIA 2LS6A 5DG2A 4K21A 1M06G 2XJUA 2GC2A 3ACGA 1D2QA 1UOJA 5LBBA 3DPRB 1H2NA 2HBUA 4YVSC 3GYDA 1NLQA 4NRPA 5B4XA 2OT7A 1XU2A 3ECQA 1C5HA 2JDYA 3ZN4A 1BYHA 2P4EA 4Z8BA 1X36A 3PLQA 3HWJA 3C7FA 1HQLA 3GZAA 3LDBA 1LULA 2BEOA 5HBAA 2GNTA 2PQQA 1T6GC 3BPZA 2YHJA 3DYPA 1F8VA 1W6NB 5CFCA 4N90A 4Q4X1 5JIAA 5FKBA 5JOXA 5L19A 2ZEXA 4WVMB 5A1AA 3ZR5A 1CAWA 2TEPA 3FLPA 4KMQA 5BYNA 1FAYA 2RS52 4NIAA 1DYKA 4Z82A 4YGCA 3O1SA 1W6OB 3B7MA 4YW2A 5ISLA 1JBCA 3ETPA 1RUD3 4QMAA 2JDZA 1UY1A 1YI7A 1ZVFA 5IJRA 4K9SA 4YZ5A 1LEDA 2TNFA 3ZFFA 4A7ZA 1K12A 5GZGA 4NIDA 1W2OA 1SDWA 2XLGA 2IVIB 4FOWA 1Y43B 2DCKA 4CUCA 3AP4A 2VM9A 1XNKA 3PU3A 1SLTA 2D5HA 1G9AA 1C8M3 4G9SB 1DCSA 1MZ6A 2W87A 1DQ4A 4GALA 4ZU5A 1CN1A 2RS51 3U1XA 1OPMA 3BTXA 4BU2A 2R7EB 3KT1A 4JGYC 5KR7A 4R52A 1OMIA 2VZQA 3GJBA 3H3LA 3GGLA 1JZ2A 1OD3A 1MS9A 3T4VA 1OLQA 1QDOA 1V6KA 4ZONA 4UF0B 3E5QA 4I3PA 3VD3A 1ZBA3 3E1F1 1VBA2 2JD9A 3CO2A 1W6PB 4YFWA 2AR6A 2BFUS 4RD7A 1XNDA 2GNBA 2HEVF 3R4SA 5FP4A 3H8UA 4QPGC 1N1VA 4G4FA 4HPKA 2DVGA 3N9PA 1FOD3 4EZ4A 2O8OA 2CDOA 3WF2A 3IIIA 4BQ2A 3AMQA 1I9RA 3CJIC 5LB6A 3SH5A 4A7YA 4LE4A 4QDSA 4XHXA 5BNOA 4Q29A 2R16A 5FV3A 3ACIA 4BOWA 1S2KA 4YW4A 4KU7A 3M70A 3WDVA 2G9GA 2VGDA 5A3TA 1VBA1 3LWCA 2UWCA 3BYWA 4Y1VA 3ZPOA 2DVAA 5I93A 4LORA 4AL9A 4HN1A 3ES4A 5ABJB 4META 4A44A 3RZHA 5C71A 4OZOA 2D97A 5EYYA 4CDQA 3OUIA 3LEKA 5IAXA 3ZFEC 2BVBA 5KHKA 4AEJA 1IS3A 1MEC1 4M0HA 5FPUA 3VBSA 2WS93 2ZZJA 4GH4C 4COZA 1PHMA 1BBT2 1EUTA 4Z2AA 4XJZA 2EIGA 2AUYA 1AR92 3WNXA 5GLVA 4QX1A 1NCRB 4B1LA 1JXNA 4QPWA 4Q4Y3 3BALA 5FP9A 5F32A 2XJQA 4MXWA 4X8NA 1F15A 4BQ3A 1IS5A 5EFUA 1C1FA 2BTVC 3OGSA 1COV3 3WNPA 3ZIXA 4DUVA 3POWA 2ORZA 3THCA 1PK6B 5JXGA 4Y22B 2IFWA 4MGZE 4D7YA 4F7ZA 1LB2A 3TRSB 4TZDA 4Y4YA 2CTVA 1UOBA 1W6MB 1V6OA 5J09A 1V70A 2RVAA 5T5OA 1BBT1 3OOXA 2QQIA 1MS1A 1XNCA 4RQPA 1UIJA 3JBG3 1AR91 4NWWA 2NMOA 1HN1A 5T5LA 3VKNA 1OOPA 5KWRA 1CONA 3INAA 3F95A 4YGBA 1W8FA 4QX2A 2BBVA 5CFDA 2R042 3J9SA 4P00B 1V6IA 5FY5A 2WO7A 1ND3C 5A32B 1H6YA 3WCSA 1ZRFA 5CVRA 1HW5A 1SCRA 2XB6C 3LFIA 1W2NA 1YCIA 5FUNA 1GMMA 3MF6A 4HN0A 2D7FA 5L9BA 1W9YA 3OBZA 4LBJA 2I74A 4UT5A 4AVVA 4CDWB 4E4SA 3RGBA 3NQHA 4PIXA 2VTFA 4TYSA 4C8DA 1J3PA 4PLMA 1LNSA 5FYBA 3PTRB 5FZFA 2D43A 1VRH2 3WSOA 4P9WA 5LY1A 2GC1A 3ATGA 1R1A2 1LHOA 1TQ5A 2R041 4UFLA 1N47A 4OUMA 4A2UA 1BVVA 2V4VA 4OHWA 4BQWA 3U4XA 1TZOA 2FDJA 3RVHA 2YFUA 5CB7A 4CE8A 5AC93 1JW6A 4ZU4A 1JMUB 3WG4A 1GQGA 5BNNC 2V4AA 2E33A 4JQRA 4QX8A 1OKOA 4CU9A 4CXYA 1IS4A 3ORJA 1RUI2 3H8OA 2MNGA 5BY5A 1W8NA 2WYSA 4YNIA 5EXOA 3RZZA 1UU6A 1HRI2 1VRH1 4S2GA 2DUQA 4JZRA 1LR5A 1R1A1 3W20A 1CZVA 5FJKA 2Q1MA 4CEWC 4H14A 4NHLA 4XAAA 1W9FA 1I6XA 5EQUA 3M8LA 5IFPA 2PAMA 1CIWA 2ZGTA 3B93A 4KQ7A 5HCAA 5KBFA 5CKQA 1WMEA 3H0OA 3I2KA 2J1UA 4QDQA 2QNKA 5FRAA 4BHPA 1J59A 4BLJA 3U0ZA 1UNBA 3DF0A 3S6PA 1RUI1 1KJRA 3S30A 5FZ4A 4EWEA 5A3MA 1GNYA 3MFCA 1O8SA 2VC9A 4TLFA 3POIA 1XE7A 1HRI1 2VNGA 2DVFA 3FWEA 3HVDA 4FOVA 4FP3A 5K0UC 5F7UA 3ZFGC 5ACA2 3NJVA 3WW2A 1PIV3 1ZBE3 1UY0A 4WM7B 5DUUA 4EE2A 3H7YA 4YM1A 4GMP0 2A6YA 5B2GB 1WBLA 4GWNA 1F35A 3N7LA 1W9SA 2PA7A 3OEAA 2VNOA 2HWC2 5F2WA 2R0HA 2RS32 5JVVA 2VZ3A 5LBEA 1QJY3 3ETQA 2ZX2A 2Y6JA 4MV2A 5C3RA 3AX4A 2QBXA 1XQNA 4DRRA 1ZZ6A 3ZSJA 3VKLA 1Y3TA 5KC6A 1R093 1W8TA 1NOVA 4NHKA 3IPVA 3M3EA 3T0BA 5ACA1 3AP6A 4ATFA 1IQAA 2ZGMA 1NCQC 5T50A 3O14A 5D8AB 4XBNA 4LO4B 4V2VA 4EN9B 1GP6A 1D0GA 3IAQA 5E89A 3WHUA 2IXKA 2W1WA 1W99A 4H3WA 5FIXA 1UCXA 4H55A 4EWDA 5C8CA 3K4AA 4NIGA 2HWC1 4V1PA 4OI1A 1W0OA 4D7SA 2RS31 1O6UA 4BB3A 4COVA 2H0VA 1AYM3 2VMDA 1X8EA 1PVC3 3SH3A 3I2IA 1UW8A 1YWKA 3VHOA 4M3CA 4IE4A 1OI6A 5A7PA 2LTNA 4OHZA 3HQXA 2D3PA 2VZUA 5IUQA 5FYUA 1JOBA 1UX6A 1TEIA 1OD5A 1W0PA 3NNGA 5ANQA 4GWMA 3RQ0A 4CP2A 2J22A 2RM21 2JECA 4L9BA 4WVVA 3DXTA 1GQHA 5IVJA 4QX0A 1VBC2 1ND2B 2A6WA 3NV2A 2C5DA 2LALA 2X5IB 1AXYA 4HK9A 5CFCB 1C3HA 2V73A 5C4WA 3VZKA 1I1EA 2RE9A 4QB1A 1CAWB 1L3JA 3WQBA 5I0DA 2VCBA 3AL5A 5SV8A 2GC3A 4QGNA 5JZGC 1RHI2 3O1OA 2EAKA 2MPFA 3IDEA 5LASA 3VBUA 2AGSA 3B94A 3CZUA 5I0RA 2YBSA 4NN0A 4Z92B 1XYOA 5E6HA 4QXHA 4PIZA 1DU3D 2D98A 1C4RA 2EXJA 4KWUA 2QDNA 4M01A 4XDPA 3ZFFB 3OCPA 2QQUA 4K6BA 5LA1A 1RMU3 2ZGSA 3VKMA 1CAUA 3O0XA 1DYPA 1UQXA 3CJXA 1CAXA 5JSPA 3PUHA 2K9ZA 4LHSA 1ASJ2 4IEOA 1MQTA 1VBC1 2AEZA 1RVF2 3UV9A 2WBKA 3PMEA 3WY6A 5J37A 4FO9A 3ZXKA 3RI8A 2DYCA 1H1IA 2RDNA 1UYXA 2GSYA 2YC0A 2PELA 3D0SA 3GZUC 3VBOA 2EIEA 2XL9A 3MUZ1 3HNMA 1RHI1 3I2DA 2VW0A 4HSJA 4JKMA 4XYXA 1HRV1 1W8OA 4CCOA 1W6QA 4FTBA 1QNYA 3NNFA 1IHMA 2BWAA 4MZUA 3SISA 4S2HA 2GMEA 2XGXA 1S1AA 1VAVA 3PURA 2Q8CA 3J8F1 3WCRA 3KGZA 2FBEA 1ASJ1 1HB2A 2XBO3 4Q5OA 5FJHA 1RVF1 3THTA 4JCKA 4CCLA 2CY6A 3RZMA 1ENXA 2E32A 4FCAA 1H8TA 1GZWA 4HPKB 1HV0A 1POV0 5C3QA 3M3CA 1Y9GA 2NYYA 2VVEA 2WNUA 2BP6A 4LBLA 4CDUB 4IV3C 4LLFA 1SLBA 5BUVA 1QMJA 2EALA 2VH9A 1U5XA 1Y9QA 4WVWA 4DEVA 4H7LA 2D93A 3I3BA 2A6VA 2B5HA 2D3RA 1QXPA 3LA7A 1GBGA 3UK9A 4EZHA 1S0FA 3CKHA 4P08A 2P3KA 1ACCA 1JI6A 3FN9A 2Y6KA 2MEV2 3OGRA 4WVMA 5A6ZA 3A0KA 3V64A 2QCSB 4FXKB 5CA6A 2ATFA 1RITA 1KXGA 4I0WB 1HQWA 4MG2A 2VL4A 2G1MA 3KVAA 1BEV3 2R073 4AZZA 3KM5A 4QQ2A 1AR83 1OFSA 2P1BA 2BGOA 4PI2A 2JDHA 1S0JA 3VBSB 2DCTA 3LFMA 4YWAA 3AFGA 3PDQA 1PO23 4OZXA 4K40A 5E1RA 1DYOA 3HQRA 2EVXA 4AQ6A 2MEV1 2ZHLA 1UAIA 2RDRA 3KF3A 4QM8A 1LOAA 5GZFA 5DPNA 4OFGA 4Q26A 1QNWA 4MXWB 4K1ZA 2W92A 4QHBA 3SITA 3K48A 3OG2A 4XIOA 1N1SA 2PHLA 4YYOA 1UPSA 1YLLA 3ZXDA 5BNOC 3ON7A 4GWJA 2W9XA 4BE3A 1SCSA 1VBB3 4C0BA 4COUA 4QX7A 2YU1A 1LGNA 3PIGA 1TME2 1VBD2 2L9LA 2Q8OA 1AR62 4RQPB 5EJZB 5KXCA 2XVLA 1T2XA 3IBMA 2XONA 4PDWB 1OOPB 1AX2A 3ENRA 3G6JB 2VZ1A 2W94A 2PXJA 2ZGRA 2D40A 5CFDB 3UKNA 2C0ZA 4AEDB 1DHKB 2PHXA 1EV12 5E16A 4XIKA 4CP9A 1Q8QA 1RUJ2 4CDQC 2VG9A 2ID4A 3W9AA 1CVNA 1LKNA 1BCXA 1HXS3 3GBFA 3J26N 5L7OB 4D8MA 1H2LA 4NPLA 4AFMA 3KVBA 2BNOA 3ZM8A 1J84A 1ONAA 2J7MA 3AYCA 4IGQA 2XH6A 4LBQD 1YFWA 1ULCA 4Y5TA 5IK7A 1GWKA 1AR61 1RUG3 2J1RA 1VBD1 2HBTA 4XUOA 4IEXA 3O1PA 1RUF3 2WLPA 1SEFA 5F6LB 1OVPA 1CPMA 1W04A 2W08A 5FY4A 5IAVA 3WP4A 1FV3A 2I07B 2QDRA 1YNAA 3OBRA 3A0NA 5DDJ2 3WT3A 3FLRA 3WQ0A 4KBZA 2YDEA 2DU1A 1HB1A 1AJOA 1S0DA 4Q0UA 1EV11 1TG7A 1W9TA 1WKYA 2ZEYA 3L2YA 4OMCA 1R1ZA 3ZX7A 4AQ2A 2GP5A 4BXSV 4D6QA 4XF1A 5FO8B 1RUJ1 4GB32 2CGNA 5FO7B 5L9RA 4XJWA 4EJRA 4BQYA 4B1MA 2X05A 3DV8A 1NCRA 1YQCA 3L2HA 2SBAA 4AVTA 1XSQA 4YM0A 3ZYIB 5GALA 3OUJA 3VBHB 3RG0A 4YARA 1DBNA 1NLSA 2VW1A 3NNLA 4JVAA 1OOPC 4WM8C 5T3NA 3ILRA 5IVBA 3RZGA 3NAPB 4IETA 3HPNA 1D2SA 3JXSA 2ZACA 3T1MA 4AK3A 5CFDC 1WA6X 3LIHA 2PHUA 4R4XA 5GLTA 2VUAA 2YUEA 4Y22A 1AX1A 1QEXA 5I8SA 3AFKA 1OLMA 1PM4A 2DTYA 5JWPA 2JDPA 3ZXLA 1GWLA 1U5YA 5FPLA 5CBLA 2PHFA 4GB31 1OH3A 2GAUA 3ZYFA 1O3RA 2JD4A 4KL1A 1GP4A 1Z78A 3WF3A 4BXFA 3WHTA 2R1BA 2YROA 2OKXA 5FY8A 3ZN5A 5CKNA 5C9AB 2Y60A 2GNDA 4D6RA 3AM2A 1MS4A 3LDKA 2X09A 3FX3A 1MS5A 5GZCA 3LA3A 3MFAA 3KT7A 1RUC1 2ZOEB 3NVCA 3POSA 4NVPA 3MV11 5FZGA 1W06A 1RUD2 2VZPA 4BA6A 1FNZA 2YZ4A 3IIAA 4DZGA 4IXLA 2D44A 4ASKA 1X8MA 3AP7A 3CZJA 2R6QA 1REFA 3U37A 3VDBA 4UW5A 3TEXA 1J83A 2ZHKA 5F6KA 3AP9A 1X82A 1ULEA 2SLIA 4AW7A 4CDWA 4DXRA 2D3SA 3KD4A 2J1VA 5FUIA 2WNOA 1C8M2 3AXDA 5LEKA 5FWEA 2XVGA 2E26A 5DG1A 4DNYA 2VNRA 3LEMA 4W6WA 1EPWA 1VPHA 4L99A 3OPTA 2VMIA 2CGOA 3T2QA 2BJSA 5CIRA 1NX9A 1A78A 3N9OA 4FPJA 4XQWA 1O3SA 4P9YA 4WZCA 1MZ5A 1RUD1 2YV8A 3WNMA 1HJGA 1BQPA 4LKSA 1CR7A 5FMDA 1WMFA 1DQ5A 5DAVA 1XYPA 1BK1A 1VAMA 2VZOA 3KQ4B 4Q0PA 3ACLA 2E7AA 5KHGA 1RUE3 1NA1B 3MIFA 4XFBA 4DY5A 1ZBA2 3BOWA 2WT0A 5FK8A 4UFJA 3WF4A 1XNBA 3W58A 3RI9A 2RDQA 1C8M1 1UYZA 3MYXA 3PJYA 4HL0A 5ERLA 1FOD2 3B00A 4L11A 1G6NA 3HAGA 2G4IA 4FAGA 4QWNA 5LA0A 5FREA 5FZEA 1H30A 2GC0A 1AUYA 4GIQA 4M3CB 2K0GA 4OI0A 4COYA 3UJQA 3UGGA 5AVAA 2VULA 1XE8A 3K4DA 3AJZA 2OW4A 4LUMA 5BNPA 1BMV2 3FHAA 1LENA 4XFIA 4HZFA 1NQJA 2VMFA 3I3QA 4NUBA 3UT0A 2IWGB 1ZBA1 3T30A 2XWBB 1J58A 4NAMA 2C9KA 1PZ7A 2CSGA 3RJRA 2EXHA 3UNPA 3LOIA 3AK0A 2HKXA 2VTXA 1FOD1 2F6BA 4GJZA 2WQZC 1WGPA 1BVP1 5GLUA 1WWYA 4I2OA 3ZMOA 4DUXA 1AL23 3VL8A 1WCSA 1W05A 3VD9A 4FFIA 3URFA 1YQ6A 3VBUB 3VDDA 1YFYA 3SLIA 3ZIWA 2VQ0A 2YG0A 2WS92 4IE0A 4RR3A 2QQOA 1ODNA 1D4M3 2O1QA 1BMV1 1APNA 4BPZA 2FCVA 4RFT0 2A6XA 4BK4A 4DS0A 5IVCA 2WKKA 2XPJA 4NO4A 2NLRA 3JB8A 1QJU3 4ZXKA 1CAUB 2QZ2A 3ES1A 4Q4Y2 3TNQA 5C8CC 1CAXB 4PI0A 1QJZA 4RL7A 1KRIA 1YFUA 2BV4A 5JSRA 5EZWA 3CHXA 4UXAA 2HEWF 2VQTA 2AYHA 1COV2 5C5UA 5FZKA 3FZ3A 4AFBA 5BXXA 3LEIA 4AEMA 2ENRA 1KITA 3LEGA 2F4PA 2ZABA 4KI5M 4QHOA 4YM3A 3POFA 3E5UA 5DUXA 2QVSB 3K3OA 5FAXA 1W6QB 3WINE 2WNVB 2BRTA 1GUIA 1JUHA 3JBG2 5C6CA 3IM0A 3W5MA 3O1TA 2PLV3 1DP0A 1BHGA 3JCIA 2Y33A 2ADDA 2WLQA 4Q4Y1 3R4UA 2F4LA 2XWJB 3AKPA 4JDOA 4ZXEA 4L2NA 4DB5A 1COV1 3ASIA 3S7IA 5C4WC 2CWSA 3DKQA 3P1IA 4QD2A 1TNFA 1H8TB 1GZWB 1ODMA 3M3IA 1QU0A 2WO2A 4O9GA 2WNUB 1X33A 4B8EA 4EN8B 4JC1A 4OHVA 4XBLA 4LBQA 1MS0A 4OQ8A 2ERFA 2QQWA 1VIWB 4JRAA 4JKKA 5HCFA 3VN4A 1BZWA 4COWA 4E4ZA 3BTYA 2A73B 4MGKE 3JBG1 1UF2C 3PVOA 4IE6A 4AI0A 4AE2A 1ND2A 1W03A 3I97A 4FPYA 2X5IA 1YIFA 3K4ZA 3QACA 3LSEA 3QBQA 3TAYA 1MQTC 3NNJA 1PZ9A 1VAKA 2BERA 5DXDA 3HD8B 3I49A 3MBWA 1GP5A 1KFXL 3U10A 4FPFA 3VBOC 5AC92 2FDHA 1XBFA 1GKBA 3RRDA 1DZQA 2DCZA 5FFOC 5IK5A 2JX9A 4RS5C 1K5MA 4XILA 3VZLA 2FZ2A 2QQVA 1KGYA 4QQHA 1BK0A 2UY9A 1ZRDA 1EAH3 2Y0IA 1UZVA 5BPXA 1KDKA 2CAUA 3D8CA 4LJHA 5IK8A 4AI1A 1ZRIA 4JGZB 5DABA 5CEHA 4XJ8A 4YFZA 5AC91 4XVHA 1SDDB 4ET7A 1AXZA 1H2KA 3DPRC 3C7GA 3L9JT 5FZ8A 2GZWA 1S2EA 4IESA 5F1RA 1KQRA 1DQ6A 2XLFA 3JU9A 3OPWA 3WZ1A 1FMD3 1QH6A 4AVAA 4YGEA 4MGTA 2Y6LA 2BGCA 3JQWA 2RMU3 1POV3 3A21A 5CYYA 4BMEA 1B09A 3ZYRA 1UXXX 3W59A 2HWD3 2XMLA 1JN2P 1QOTA 2PYTA 4OULA 3K46A 3FUQA 5IVEA 1PIV2 1ZBE2 4XMIA 2VBDA 4QU1A 2XHKA 3CDZB 4B4PA 1GOHA 1HJFA 1DFQA 4CDUA 2CU5A 2R063 4DO0A 5F9TA 1SFNA 3APBA 1DGLA 3MPPG 1F4HA 4N53B 3BUCA 4CP9B 1IQDC 1ZM1A 4Q4V3 3K3NA 4QU2A 4F83A 1O8PA 1S4CA 1QJY2 2JICA 4DY3A 1H2MA 3BTZA 4UBGA 1E5SA 1SZBA 2Q30A 2VZRA 1B35A 3K2OA 4J6GA 2FCUA 1R092 2ZKLA 1XU1A 3J4UH 3KWVA 4KWKA 3T2OA 3GHMA 3ILFA 2YY1A 4AVCA 3H1WA 3VD5A 1ZBE1 3NKTA 1TMF3 2YBPA 4PQ9A 3ZXEA 4KWJA 4ASMB 1L7RA 1F9KA 1VMFA 4CCDA 4XC9A 2AC1A 2PMWB 1JUIA 5FZ9A 2C1FA 2XOMA 4RYDA 1VMHA 3HOBA 5LCWL 2QZ3A 1H6XA 5T52A 1XPWA 1GWMA 3KLSA 1AYM2 1QJY1 4YZ3A 3ZOIA 1PVC2 5AFEA 5A33A 3T3YA 4URAA 4QAWA 3R0RA 2WN3A 4B7EA 5C3PA 2A71A 1R091 5HCHA 1H4GA 2P6HA 4JTOA 4XXPA 5GZDA 4JHZA 5GKAC 2DVBA 3IKWA 3P3PA 1BJQA 3AC0A 4W4ZA 4XCBA 5DAQA 2PTMA 2F17A 3TN93 3IMNA 1HX6A 2WL1A 5A7QA 3RYPA 3PL0A 2Z42A 1DDLA 4CCJA 3E97A 1A34A 3I4IA 2G9FA 3H1MA 2WZPP 5FPAA 1RUNA 4QX5A 4ISQA 1AYM1 5D21A 1NG0A 4NRQA 3PUQA 1PVC1 2PAEA 2XL7A 4JDNA 4PDWA 1CX4A 3S0MA 1HIXA 1OH4A 2C9AA 3AMNA 4NHMA 4NIIA 4XFGA 4NROA 1OHFA 1WD3A 4W8JA 3ZSEA 4AEDA 3Q8BA 3ZYBA 1VBE3 4M3CE 5ABJC 2DFCA 3J7MA 3ZN6A 4Y33A 4PCRA 4AYUA 1OUSA 1RMU2 3HN3A 4IV1A 4MXVA 5L7OA 3EJKA 4AAPA 1PGSA 4BQ5A 1WW6A 4EV0A 1RIRA 3BIWE 1CWPA 1MS8A 4FPKA 4QHZA 3H1YA 1FPN3 1NCRC 3QOPA 1F2NA 1O4TA 2VE1A 5LEJA 5FWJA 1UKRA 4JRLA 4KNCA 5BNQA 3AKTA 1ULOA 5JAXA 3KHBA 4Y4RA 1I5ZA 5TSWA 1DGRN 1SLIA 2WFF3 2BFUL 3IN9A 5FYCA 3VKOA 2VMCA 3S7EA 2D6MA 2QQLA 4OHYA 1FXZA 1PK6C 3EMRA 2GNMA 1XOYA 2E7TA 2JEMA 1RMU1 3T2TA 4LBNA 5D2AA 2Y6FA 4MGYE 4XW3A 1H4HA 1OFNA 1UXZA 2WN2A 2LUWA 3I2OA 3RNSA 5AFBA 3DXUA 1WW7A 1ZNPA 3ITQA 2XBO2 3ACHA 4HMZA 5IVYA 4L97A 1MVQA 1QOOA 4HANA 3TB0A 5GLWA 4XF9A 3VBHA 4KBBA 5J3UA 3N36A 3D5OA 4IEWA 2ETEA 3NAPA 3O7OA 4K3UA 3WF1A 3TYJA 5J96B 1WZXA 2WABA 3DECA 2WT1A 3JUUA 3GNEA 3LB9A 4TN7A 1O91A 5HPOA 3THDA 1SLLA 2YGMA 4PT6A 5IVFA 5LW9A 3OGGA 4AWDA 2WO3A 4TLGA 4QPYA 5BNPB 3A7QA 4LHKA 5J36A 4CDWC 2XBO1 5C9AA 1Q43A 3ZLIA 2WWUA 1RB8G 2QUOA 2W39A 1HV1A 3NKGA 4UYBA 5SV5A 1BEV2 4OI4A 2EXIA 2R072 3H7JA 3LPFA 3VD4A 4NR1A 3P6BA 1AR82 1GQPA 1OQDA 1RINA 4CCNA 4D6SA 2CYFA 3BI3A 4XACA 4YZ1A 4XTMA 4BQ4A 2JDNA 4LUKA 3VDDB 1JHNA 4XMAA 4ZKTB 4GD4A 1L7QA 4FP2A 3WVJA 3NJZA 1JYVA 4RR3B 2Q0AA 4XE9A 1IKQA 1OA3A 4IEZA 2P5BA 4DPNA 1JOJA 1PO22 1BLZA 3OB8A 2DUOA 5C5TA 3C2UA 2HWB3 2P3YA 1C5IA 5FYSA 4BYYA 4LO6B 2W5FA 4CU8A 4CP1A 2WQ8A 2KR2A 5FZ1A 4LO5B 2FCTA 1FI2A 2UURA 2VNVA 2JKXA 4HK8A 1LGBA 5H9QA 4AEKA 1BEV1 1C57A 2FQPA 2R071 4DRVA 4OQ9A 5K9YA 4IQPA 4FAHA 1AR81 4CP0A 3MIDA 1WLCA 4MX3A 4LBKA 3Q8EA 3LA2A 3WW3A 5FP7A 3T2PA 1NA1A 4CDXB 1VBB2 3OYWA 2FDKA 4NPRA 1AR73 4AHYA 3ALQA 1MEC3 2X53S 4R9AA 5FZBA 1PO21 5APAA 4QQOA 2VW2A 3QH7A 3USSA 5JMCA 5T5JA 1O3QA 1HKDA 5F5IA 1Q8VA 1G9FA 1SPPA 5J48A 3OSDA 1QQP3 1W9WA 4MADA 2PAKA 1YO8A 4FPLA 1W8UA 4LULA 1PNFA 3BU7A 5FUPA 1HXS2 1GOFA 1GANA 2NQYA 4JQTA 4WM7C 1VB4A 4DINB 4C1WA 2G9ZA 2W3JA 1VBB1 3OEBA 4LBQB 1W2UA 4Q27A 1STMA 3I3EA 1RUG2 1LOGA 3I2JA 1X9TA 4KG8A 1RUF2 2WSVA 3NNMA 4L0PA 4FTSA 1RXGA 2BNMA 1VRBA 2VCAA 1KFUL 1H9WA 5JR2A 5EP9A 1XNAA 1ZZ7A 1S0EA 2C6SA 2WUHA 5G05L 3O1VA 4YVWA 5GJ6A 3HNBM 4AGRA 1HXS1 5D8AC 1QJFA 1YC61 5FMOS 1MR5A 3VDCA 3EXUA 2X10A 1K5MB 1RUG1 3MW4A 2EAAA 1MZEA 3AZWA 4XTPA 1T6BX 1RUF1 1A8MA 3QH6A 2B9VA 4XUNA 3HR9A 3TNPB 3MZHA 5FY9A 2JG8A 3R6SA 1G9CA 2VOKA 1WLTA 4YVSA 1H0BA 3ABZA 1DQ0A 4XFFA 1P8JA 5DAPA 1DQ1A 2JE9A 3MPBA 3KMHA 3THPA 2IZWA 2V5DA 5FP8A 2ZGUA 1PVXA 1O7FA 4RGKA 2WNVA 2JDUA 1LEMA 1SFPA 4MUVA 3BTAA 4UI9L 3E6CC 2W95A 4YG3A 2JIJA 3CL1A 1OF4A 2YB7A 1GNHA 1UIKA 1L7LA 3VZOA 3MW3A 2EF6A 2HWE3 1ND2C 1JYIA 2WJSA 1O4YA 4LLOA 2P17A 2X5IC 4UFIA 3W21A 5CFCC 4P9JA 1TNRA 1OF3A 3U75A 1WCUA 4AGVA 2XKOA 2N7GA 2ET7A 2RV9A 2Y64A 3GZTB 3NV1A 4MHUA 3WUDA 2CDPA 3MDPA 3OTFA 1JZ7A 2FDIA 2VD7A 4XFCA 4Z1VA 1JZ3A 2A3XA 4AVBA 1MACA 3SC7X 3RWKX 4M0NA 2VBPA 4FFHA 1OLME 2KD7A 4WBBA 4FOQA 1ENRA 1JU3A 1OURA 1PGW2 2P37A 3J7LA 3ZFFC 3A4UA 4BISA 4FOYA 1QJX3 3HT2A 4AR2A 4YW6A 1K5JA 2X29A 4CZSA 2J1AA 4LK7A 5KXDA 4IGOA 4OYUA 1JZ5A 1UKGA 2PHRA 1B35B 3SMHA 1PMJX 1W2AX 4D69A 1A3KA 2ZCWA 3Q9OA 2E7QA 1CD3G 1NLRA 4AOCA 1OQEA 2B9UA 3RMYA 4R4ZA 2DDUA 2HYXA 4QXBA 1OPOA 1WW4A 2AH2A 2VJXA 4YZ4A 3ACFA 4PLOA 4EN7B 2YYOA 4HG6B 4AHZA 1PGW1 3WV6A 4URTA 4YG6A 3POEA 5HI0A 1UY3A 4SBVA 2BBAA 2WA4A 3HEIA 3R4DB 5GZEA 3USUA 4QPGA 5A33B 1X9PA 3GM8A 3GCXA 3HBKA 4UFKA 4QKFA 1ZZ8A 3OF1A 4JGZA 4BM8A 4M4PA 1LOBA 3CJIA 2WZR3 2W91A 1Q5OA 2CHHA 5CADA 1KS4A 4BK5A 4CDUC 5A3UA 2ZGNA 1QXJA 3ZO0B 1SMVA 4O61A 4E9KA 1UPIA 1IPSA 2VCCA 4XFHA 5FY0A 3V65A 4Q8KA 1FV2A 2VZTA 5C3SA 1D4VB 4DXSA 1BXHA 2DTWA 4XURA 2VOVA 4MGQA 5T55A 5C7GA 4M3CF 1AL22 4MLOA 2W0XA 3JB4C 4YPJA 1LHVA 5JOWA 1F4AA 3W5NA 1Y9MA 5EHDA 2WYFA 4RGGA 1D4M2 4XXAA 1CESA 3ZN6B 2RR13 4N53A 4BLIA 5C8WA 3FFQA 5FZ7A 1PZ8A 5LBCA 2XQRA 2JWPA 2WT2A 4AVSA 1O3TA 3JD73 4IE5A 1QJU2 3P5BA 4M4RA 3SCGA 4IV1B 4XDQA 2GH2A 1FATA 1OXCA 1XYNA 4F3JA 4CUAA 2Y0OA 3VBSC 2RM23 4ZHNA 2ARCA 2OXBA 4LR4A 4HVRA 5FYHA 4GMP1 5H9SA 1TME1 1GOGA 2RS13 4GAZA 5FZDA 3S57A 1AL21 1CIYA 4OVEA 3ROUA 4K8FA 2UY8A 2FDGA 4HSLA 1LTEA 1C28A 1GU3A 3SKJE 2BVVA 1RC6A 4O65A 4FPCA 3MIHA 1D4M1 3DKWA 4EN6B 2VZVA 5H9RA 2YU2A 4IEVA 2PLV2 4Y20B 1NQDA 3B9IA 4EYUA 1QJU1 4ZZ8A 3ZSKA 3CMGA 1W8ZA 1WCQA 2W68A 2VOWA 2R49A 1S0CA 3CEWA 4K7JA 4XPVA 4ZY9A 3WP5A 4NMIA 3BN6A 2WWSA 5CZKA 3MICA 2BUKA 4RQPC 1KJLA 1GFF2 4GXLA 1DGWA 4FFGA 4MVTA 2VOTA 4PDWC 3ZSLA 4AFCA 2NMNA 1ND3A 1JYTA 1W0NA 2BPA2 2XJTA 2P6CA 3F2ZA 3OJBA 5AVPA 2VVFA 4AEDC 1LOEA 1LU1A 5DDJ1 5F3EA 2W46A 1W3VA 3H3ZA 4AFAA 3HNYM 3LGRA 3KB5A 3B3QE 1OSGA 1ZZCA 3U07A 1HRV3 4LKFA 1DLCA 5FXWA 4P9LA 4AQSA 2PLV1 5L7OC 3WG1A 3C3VA 4EQVA 4N43B 3QCWA 3WF0A 3V0AB 1HDKA 4YRDA 5FPVA 3J8F3 4AQTA 5FO9B 2DUPA 1HB4A 5FY1A 2GP3A 2VBBA 1W8HA 1WBFA 2PHWA 4LXLA 1MZFA 1GZ9A 4YG0A 2HEYF 2OZ6A 2K46A 2WAAA 4I01A 3I59B 3HBZA 1IS6A 4LOTA 3I2HA 4DUWA 5DAWA 3GBGA 4K8RB 5BNNA 1JYNA 2WSUA 4ARYA 1UYYA 4IERA 2XUMA 4BH9A 3FMGA 2ILMA 5CNAA 4A3XA 1EAH2 5KHHA 1AZDA 3T0AA 2I45A 3PUIA 3B69A 3RWNA 4RN5A 2BDRA 3D3AA 4XDOA 2V09A 3VBHC 1U5IA 3WOGA 2DCYA 2A70A 2A1XA 3FUOA 5J1XA 4CTEA 3NAPC 2YMZA 1OBNA 3B5LB 4J1WA 1FT9A 4CEWA 4Q0QA 2JE7A 4I3GA 3ZSMA 4QDRA 3WR0A 2GN3A 2Q8EA 1DGWX 1FMD2 5FLJA 2B7YA 3HIFA 4JKLA 4LHLA 2RMU2 2E9QA 2VY0A 3LPGA 3OYWB 5JDBA 2NM1A 4MYEA 3OD0A 1AL0G 1EAH1 1F5JA 4XUPA 1JHJA 3KZ4C 3AL6A 2QTWB 4FFFA 1SACA 2V72A 5C9AC 4UW3A 5EV7A 3O1UA 1NXMA 3I3DA 3PNAA 4I09A 4B7KA 1SHWB 3AKQA 4LK6A 1SPPB 4RFRB 3V56A 2Q4SA 3LIGA 5K0UA 3DGTA 4OLLA 5F8PA 3BU0A 3FBYA 4A6SA 2R062 4QB6A 1ULDA 1V6NA 1WW5A 4GWIA 4OMDA 4DFSA 1CZTA 1GSLA 4QPIB 1XC6A 1FMD1 4MHRA 3KV5A 3PVNA 1RJ8A 2A3WA 1POV1 2RMU1 1EY2A 1POQA 2LM3A 3Q8CA 1DZRA 2ZGOA 3BKZA 4LKDA 4YSFA 3MGUA 2JDKA 3GHNA 3NV3A 2CAVA 2VR4A 2ZAAA 1IPJA 1VLNA 5JPNB 3E6DA 2BGPA 1TMF2 2WA3A 3ZXJA 4HKOA 2R061 1VB2A 5FMBA 3LD8A 2VO5A 4IDZA 2KA3A 4C0HA 2QQJA 4NOTA 4YVWB 5FZAA 1RUH3 4Q4W3 1UZZA 5A6QA 4LMFA 3VV1A 2VUJA 3AMMA 1NA1C 2WDBA 2Y6GA 2Z2SB 1H1AA 3AKSA 5EWSA 1WLWA 3NMBA 5I0TA 1URXA 3SKVA 4Z2WA 4Q0VA 1G86A 2QFEA 3M7AA 4SLIA 4XF3A 5JSOA 4FTEA 4QM9A 4B3NA 3VHPA 4Y3OA 4LBOA 2Y38A 3VBFA 1R083 5KXBA 1TMF1 2JG8B 1O5UA 3AVRA 2W1UA 2TBVA 1O5LA 2W52A 4UFMA 4JV4A 2X8KA 2W47A 3TN92 4YVSB 3EBRA 1BKZA 2E31A 4XCAA 4CDXA 1S2BA 1CQ9A 1NY72 2WS91 4N9IA 3RYRA 3FFZA 2OUJA 4IEQA 1LHNA 2J1SA 3AYDA 1SBEA 3GBWA 3MEPA 1UMHA 3RZKA 2B42B 2NPIA 2PN5A 3GCWA 2DV9A 3RZJA 4X6RB 2DFBA 2AREA 1C1LA 1DG6A 3DN7A 4DOUA 5A1LA 3MV01 1V9U3 2DBIA 2DF7A 1NUKA 1VBE2 3NRUA 5T5PA 2ES3A 1IGOA 1XSRA 3WDWA 5GM0A 1AHSA 4D94A 1MVEA 2JDMA 2XXZA 5FXVA 3POGA 4GULA 4ATEA 4E2GA 3TN91 3VBUC 1OT5A 3SEPA 2J42A 5FYZA 4I0BA 4YVWC 1NY71 1R64A 3KT4A 5EIYB 4P5HA 4RHV3 4KH9A 4OUEA 3ZDVA 4FPOB 1FPN2 1LRHA 3IWZA 2RJ2A 2OYZA 2AACA 5A80A 3U78A 4LE3A 3MLJA 4NPMA 3J7NA 2WFF2 4PF1A 5FLHA 1JZ8A 5FQ0B 1VBE1 2ZEWA 3AMHA 4HXCA 2JG8C 1RUC3 2A6ZA 2H6CA 3BVCA 3DUIA 4JGYB 1TE1B 4W50A 4UOJA 5FYYA 3KHCA 2IXHA 4TWTA 3WNLA 3LSDA 4IUGA 5LA9A 3I2GA 5FZLA 5F5CA 1W8WA 1GLHA 5FK7A 2ZZQA 3NV4A 1Z0HA 1F31A 4I30A 4EROA 2WNVC 1Q8SA 2FZ1A 5JPMB 4AI3A 4AHWA 1JZ6A 5D1IA 4IEUA 1DQ2A 1FPN1 3KGLA 3SH4A 5FKCA 3G7DA 5JI7A 2PHTA 1PX4A 3RYKA 3AZYA 1JYXA 1RL3A 3GALA 3OBTA 4QPGB 3USUB 2XQXA 4JX0A 3ST7A 1RXFA 1CAVA 2WFF1 3OPZA 2ZGQA 4QQPA 2VXRA 2IUWA 4AI8A 4R9CA 5FYVA 1H8TC 1AYN3 3CJIB 4IV3A 2UWBA 4FQZA 5B4NA 2WNUC 3LE0A 2J1TA 2P34A 4MH0E 4CSWA 1IPKA 3WLUA 3AVSA 5FLIA 1I3HA 2VUDA 3U11A 2WWJA 5EYXA 3DL3A 1N3PA 2IFRA 4UAPA 1PO13 1E57A 3VD7A 3KSCA 2AZ5A 2ZMLA 4LIVA 4FBFA 2FDFA 1W90A 2IVJA 2ZGLA 3H9AA 1E5IA 1UN1A 3CF6E 1UZWA 1JH5A 4JAAA 3ZXGA 1ULPA 1UY4A 2ZGPA 2BW8A 5JOZA 1LOFA 3M1HA 4NJ4A 3VZNA 2JXAA 3ME2A 3ZYHA 2FHRA 3ZFEB 1G8WA 4NHXA 2ZS6B 3IZOA 1JTZX 5F5AA 1VR3A 2HWB2 1SLAA 1UMIA 1UMZA 4GH4B 1K3IA 1Z7S3 4U36A 5FY7A 4DXZA 2JDAA 3SHRA 5F3CA 4NWVA 1ZRCA 2WO1A 3SXWA 2XUEA 4UFHA 5A7NA 1AVBA 2ZHMA 3WNNA 4MOAA 3PJQA 4GKYA 2A7AA 5LRSA 5CU1A 5DUWA 3ZMNA 1XRUA 2UWAA 4FQ4A 3WDUA 1PIV1 1X50A 4JGZC 1SBFA 1JYCA 2VUCA 4H7MA 4JDMA 5J98B 3H8RA 2QQPA 1US3A 4PHZA 1GICA 4LA3A 1YQ5A 2Y34A 3GXUA 1AR72 1QGLA 3FJSA 5JLVA 1MEC2 4ORFA 4P14A 2WIIB 3MIBA 4ZPIA 5LK5A 2HWB1 3O0WA 4O9EA 3VBRA 1V0AA 2VQAA 2QE3A 3RS6A 1NE4A 4TTGA 2CGPA 1AJKA 5FMCA 1YJKA 3H8XA 2ET1A 2ZJCA 1QQP2 1JS9A 4AXOA 1VJ2A 4CPBD 4ZZ5A 5KHJA 4AI9A 4NHYA 3I2FA 2UU8A 2ZKNA 4DQAA 1ND3B 4PF5A 1FX5A 1N1TA 2HWF3 2Q1FA 3OGVA 4N9HA 1KDMA 2XVKA 3O12A 3I3MA 1RUOA 3O5SA 2YGLA 3ZKUA 5IWFA 1PX3A 2GMMA 2VCMA 4IW3A 3NL1A 1AR71 1X7NA 4N53C 1IOAA 5G04L 4A6OA 1REEA 2CWMA 3UKTA 1H1MA 2NZ9A 3AZXA 2OS2A 5F37A 5FOBB 2PHDA 5ANNA 3RJ2X 1NZIA 5I0UA 4YGDA 3HT1A 3FC0A 4X6QB 1QQP1 3GF6A 3GDBA 4CCKA 4AG4A 5FYIA 1GR3A 2OA2A 1A6CA 2V5YA 4BIFA 4MGIE 1QKQA 4BMBA 2XLAA 2OVUA 4LBMA 2UYBA 2OQ6A 3LAGA 1UY2A 3NJXA 5BNNB 1UO9A 2RJLA 4BJ0A 2VTXJ 3EQEA 4BWOA 4LQRA 3N7JA 2EICA 5HCBA 5K4LA 5A70A 1SQ4A 1W39A 2CNAA 4MO3M 4C90A 5FBZA 4WM8A 4W6XA 3VB9A 5IK4A 5FR3A 1US2A 4Q4X3 4AAXA 2XG3A 5I0SA 2JB8A 3N9MA 4B4RA 1ZYBA 2Y26A 3UYJA 5A3NA 4P9IA 3T08A 3B01A 1ZA7A 3PVBB 4CEWB 1QWRA 2GDFA 2HLEA 2WRAA 2ZA9A 1S0BA 4Y20A 1WUVA 3ZVXA 3ZYPA 1S55A 5FZOB 2Z5WA 1MS3A 2HWE2 2D6LX 3HQUA 4QT6A 5FZMA 2XJVA 4A7KA 3N4MA 2XJPA 1WMXA 2ZBJA 3KQRA 4H2AA 2VMGA 4Y5SA 5C3OA 3H50A 3ZR6A 5HV0A 3S5AA 1NAEA 1QOSA 4A41A 2WINB 3PU8A 4LITA 4QB2A 1YQ8A 5LY2A 1LECA 2A5ZA 3V0BA 5CG8A 5K0UB 1IKPA 3ZFGB 5KC5A 1SBDA 2JKBA 3PMSA 1OA2A 1LESA 2RS53 3K77A 3CIHA 2QJVA 3MLLA 1JYWA 1LHUA 4GKXA 3WG2A 4TXWA 3B9CA 1ZA4A 3NSTA 1DF0A 1QJX2 2TUNA 3PIJA 5F39A 4CRQA 4N43A 5A7WB 3ILNA 2EXKA 5IT6A 2HWE1 5JUVA 3V0AA 3CNAA 1LU2A 5IW0A 2PQSA 1D7PM 1JU4A 1QIQA 1XNTA 3POJA 4DIQA 3HMYA 5A3OA 3VZJA 4YLZA 3UGFA 4D0QA 2JG9A 4HFSA 2RHPA 4Y1UA 3I8TA 4E2SA 5DMYA 4I0AA 5JCTA 3RZLA 4QXKA 2LW8A 3Q8AA 2EA7A 4B29A 1NZCA 2J1EA 3I59A 1QJEA 2XDVA 1NCQB 2VECA 3H42B 4XF0A 3AP5A 1QXRA 4S2FA 3ZPYA 4CEYA 2A75A 3FHIB 3MUY1 1QJX1 2LRPA 3WEZA 3AZZA 4NIHA 2P3IA 1V6LA 3AKRA 3RMXA 1U5ZA 2K2SA 4LNVA 1XB9A 1UOGA 3C7HA 1VBA3 4AHXA 2W2IA 2WZR2 3VBFB 1JOPA 4PBPA 1CGPA 4XABA 2E6VA 4LTAA 4XZPA 2WZEA 5FZ6A 1ZZ9A 4GZ9A 4HVQA 4YZ2A 5BNPC 5JIUA 3T1LA 4IEYA 3VKFC 1PMIA 1HLCA 5JR7B 4KG0A 3NWKA 4HOOA 4XOGA 4DXTA 3TEZA 2E53A 5EJ3A 1OVSA 4WV8A 2OIIA 3KF5A 3WQ1A 3CQOA 1GZTA 1DGRA 4E27A 4S2DA 3AJYA 3D82A 3ZKYA 4QQLA 1UU5A 2XHNA 4YW5A 4XAEA 4AF9A 5A3LA 1W28A 2B8MA 1YRZA 1H9PA 2A3YA 4U2AA 2Q1ZB 4LO7A 5JZGB 2RR12 2WZR1 2VXJA 3WNOA 1S0GA 3O0VA 1QF3A 4PJYA 2QQMA 3FBMA 4IEPA 3BCWA 3KV6A 3JD72 4QPIA 3VHRA 5FTTC 2JJ6A 1FNYA 4UW4A 3VDDC 3JQXA 2GH8A 3WW4A 2RM22 4RR3C 4CU7A 5IFTA 2H0BA 3T4HB 1WA4A 1LAJA 4LO8A 3EB7A 3WP6A 2RS12 1PGL2 3VUOA 4DEQA 1ULFA 3QD6A 3OY8A 1BBT3 4GQ7A 4IE7A 5JOYA 1AR93 2ADEA 3AB0A 2ORXA 3H3UA 5JXIA 1ZX5A 3BIEA 3N35A 3VBFC 3EO6A 4ZU7A 5FZ3A 2RR11 2R32A 4KU8A 2C24A 4ZS2A 1ALYA 2OQ7A 5FPXA 4Q1PA 3ZXAC 3JD71 4ES8A 4O7XA 3JZVA 3C7OA 3LDRA 4FPHA 3K51A 4CDXC 4MGSA 1XJAA 4W65A 3ZXFA 3EHKA 1V6JA 1LCLA 1O4ZA 5CKMA 4QGMA 2JE8A 4CPBA 1REDA 1YIPA 1QHDA 2RS11 1YXWA 4LT5A 1PGL1 2IXCA 1CPNA 3LKJA 3SCFA 4BQ1A 4GJYA 3WG3A 1SFYA 4I02A 1NXD1 1RJ7A 1CAVB 2GMPA 4Q0SA 2R043 3RFRA 1EP0A 2AEYA 5FXZA 1HRV2 2QQKA 4CCCA 4IV3B 4XETA 5LA2A 1IZ3A 5A3PA 2CL2A 5LATA 3WD5A 1UX7A 4CXXA 4D3WA 2UYAA 4E2QA 2YXSA 5DZGA 3J8F2 3WP3A 4QKBA 1QY4A 2MHFA 4ASLA 1U12A 5K7PA 1I5PA 1PNGA 5FYTA 4F8AA 5J7MA 4Q2FA 3ZYGA 1U0AA 3A22A 4ZS3A 5FOJB 4LHNA 1VRH3 1CZSA 4NAOA 2IXLA 4Y5Z0 1R1A3 2BZDA 5L73A 4Y24A 2DVDA 3IMMA 4FPEA 3M2MA 1YFXA 4RS5A 3D0JA 2Y6HA 4W6YA 3LF7A 2FD8A 1YYNA 1LHWA 2YFZA 1IG0A 1HB3A 4LIUA 4AGGA 3AXEA 1RYYA 4UW6A 3MO4A 3CLPA 1K5MC 3OD4A 1E5RA 4C91A 3DYMA 2OPWA 4QXCA 1OA4A 2ZAHA 1ENSA 1UOFA 2YC2A 4FI9A 4JHTA 5F3IA 2GALA 3WQ7A 4A3ZA 5FQ0A 4QKDA 1RUI3 1YI9A 4PQQA 3WW1A 3PVEA 3FL7A 4JGYA 4LOSA 3DPRA 1HRI3 5JXJA 4OUSA 4Z07A 4ONUA 5CAZA 4HKLA 1RUE2 4WVZA 5C33A 1GV9A 3OBAA 4M00A 2ZGKA 4R9BA 1FYUA 3NJYA 2W1SA 3N9QA 2Q8DA 3D4KA 5BNOB 4HVOA 2ZTNA 3IDBB 2HJIA 1M4WA 3B02A 3WXPA 5IYYA 3K75B 3FLTA 4YW1A 3VBRB 4Y1YA 3POYA 4LA2A 2VMEA 1W6NA 1ENQA 4ISRA 1UZYA 5LBFA 5CG9A 1IG3A 4CYDA 1G7YA 1SG3A 1H8VA 2BU9A 3IDAA 1Y4WA 2BOIA 3C7EA 1W6OA 1SLCA 3LCPA 4A42A 5FPBA 3M4FA 2VZSA 3VDAA 2D6OX 1CX1A 1ULGA 2ZMKA 1ZREA 1LOFC 1RUE1 4E8DA 5E88A 4CDQB 5ACA3 5FYMA 1ZRRA 2YC4A 3C8XA 3BGAA 1AF9A 1NYWA 2DBNA 2NN8A 2Z69A 5FPZA 3UKVA 3MI8A 2BOJA 5L9VA 2ZX4A 3VZMA 2E63A 1HQNA 1NE6A 5FMOL 2B45X 4HT1T 3RDIA 2HWC3 4J25A 1RTVA 2RS33 1B35C 3N3HA 3PUSA 4N7UA 2ZEZA 4CA9A 1UZ0A 2Z4FA 4XJUA 1UWWA 1OC1A 1RUH2 4Q4W2 3ZFEA 5IHRA 2XJRA 2JIGA 4XUQA 1J1TA 4HONA 3N7MA 5BV6A 5H9PA 4GH4A 3LOBA 1JODA 1WCKA 4WZFA 1WCDJ 4UF0A 5FCCA 2NP0A 2W1QA 1C8NA 1RGSA 3TEWA 4ARXA 2G19A 2H6BA 3VBRC 4RA0A 3OUHA 1W6PA 3SQOA 1R082 2QKDA 2WZ8A 3MF9A 3N9NA 4FSJA 1V6MA 4B4QA 4BCUA 4WM8B 4CUGA 1S0IA 1VALA 2FMYA 3AYAA 2R1DA 3U4SA 4OI2A 2Y8KA 2RG4A 1DZTA 5FDBA 4FPGA 3LQCA 3FHQA 4NE9A 1LODA 3KCXA 1RUH1 4Q4W1 3SNMA 3O1MA 1UU4A 4N8MA 1LGCA 3IDCB 4K1YA 4NRMA 2GN7A 2VU9A 1EYBA 4LPLA 5JI9A 2OZJA 1DLLA 2B46X 3DEMA 5DAXA 2ZX1A 1V9U2 4ITCA 5LZ6A 5IATA 2E51A 2Q5TA 4UBHA 4IL7A 1R081 5A6YA 2C4XA 1VBC3 4XEZA 2YBKA 3IB3A 4D7TA 4L8QA 3KV4A 4MSVA 2BWCA 4XJ9A 4AFDA 5ABJA 2YPDA 1KS5A 1OQ1A 5LK7B 3V0BB 1MPXA 4PBOA 1OKQA 1K45A 4BIOA 3DCQA 4CXWA 2XR4A 5F2SA 1G9BA 4C1XA 1RHI3 3MW2A 2KXLA 3N9LA 2I2SA 4RHV2 5IVVA 1XE0A 2ZMNA 1KD7A 1N3OA 1CJPA 5GLZA 2JENA 3KS7A 4IV1C 3MIGA 1WLDA 1VMJA 5E8AA 4ES9A 1G9DA 3ELNA 4L92A 1N3QA 1V9U1 4OHXA 1J3RA 2RDSA 4CVUA 2KM2A 1ASJ3 1RUC2 3BODA 2JG9B 1YHFA 1RVF3 4R8HA 3IT8A
chains in the Genus database with same CATH topology
1EPZA 3NW4A 1PK6A 4TSVA 4BZ4A 1CJDA 4PIYA 4G3YC 3CU7A 2VVDA 4RHV1 3OGJA 3R05A 2BQPA 3PTYA 4CEYB 1W6MA 4PLNA 3UJOA 1GZCA 2OPKA 2D6NA 4Y1ZA 4GA9A 3WDXA 1AYN2 2VPVA 5KXEA 5A32A 4AI2A 1AXKA 2Z79A 5I8TA 3AMPA 3D6EA 2IXIA 2DCJA 2BNNA 5DZFA 1XXNA 3RPQA 2BYVE 1UD1A 4J1XA 4KGGA 2FMDA 3BB6A 3TBDA 3P3NA 1PO12 4Y1XA 2WQ4A 1J3QA 4Y26A 4N43C 2WNEA 2ZHNA 1WD4A 2HWD2 3ZDSA 3I7DA 3M3QA 4P9GA 5HXVA 2O8QA 2JG9C 2MEV3 3HN1A 4RSUA 3ZFGA 3E6BA 1AYN1 4X8PA 3BOPA 3X29B 1Q8PA 3IPVB 1WMDA 1AX0A 4Q4V2 5F5QA 4KGQA 3LZZA 4XHBA 2D6KA 2D6PA 1OLRA 1Z7S2 2O0OA 3AYEA 3MLKA 2ZX0A 4EN0A 4LEJA 1D0HA 4CEYC 3E5XA 3MIEA 1PO11 3KCYA 2GU9A 2RJKA 3WDTA 2DU0A 5C8CB 2HWD1 4HETA 2XJSA 1QH7A 3OY8B 4XQ4A 2OUHA 3VHNA 2ZX3A 2WC2A 4N7IA 3RSJA 2VOXA 4XBQA 1UL9A 1Q8OA 4HBNA 2YPJA 2ARBA 3WDYA 1A8DA 5LRRA 3SCHA 1NCQA 4XQDA 5I8YA 2DWRA 1PM7A 4INDA 4JTNA 3VGIA 4Q4V1 1ZZBA 2ARXA 2B39A 3ZYJB 2CV6A 1Z7S1 4HLTA 3NO8A 4R9DA 1Q3EA 2D5FA 2VMHA 1J1LA 4YM2A 3VL9A 2R0FA 2P3JA 1N1YA 3TOJA 1AR63 4GMP3 4Q1RA 1TME3 1VBD3 2HWF2 3M3OA 4K20A 4XFAA 3UL2A 3VLBB 2P2KA 2XKPA 5C4WB 4XJAA 4HKWA 1QDCA 1Y7BA 4WM7A 4XF4A 2ZPXA 2IC1A 3N7KA 3WUCA 4QPIC 4KWLA 5T54A 1EV13 2HYKA 4EWAA 5K8SA 1VP6A 3I54A 4FT8A 1RUJ3 2PFWA 4E4DX 3WX5A 1V00A 4DMIA 2WFPA 4YW3A 1Q56A 1MQTB 2AENA 4Q8LA 5JZGA 1F5FA 3AZVA 5DUVA 2HWF1 3KCCA 5L36A 4P9XA 3VBOB 4RGAA 1DIWA 2IXJA 5D8AA 5DDJ3 3PHMA 3QLQA 4QGLA 4RS5B 2DURA 5I91A 2R30A 4GB33 1YJLA 4FXGB 1LOCA 1YUDA 4FVVA 4Q4X2 1GNZA 3TWIA 1GYKA 1LJ7A 3FE5A 5DZEA 5KHIA 5DG2A 4K21A 1M06G 2XJUA 2GC2A 1D2QA 3DPRB 1H2NA 4YVSC 3GYDA 1XU2A 3ECQA 1C5HA 3ZN4A 1BYHA 4Z8BA 1X36A 3PLQA 3HWJA 1HQLA 3GZAA 5HBAA 1LULA 2BEOA 2GNTA 2PQQA 1T6GC 3BPZA 2YHJA 1F8VA 1W6NB 5CFCA 4N90A 4Q4X1 5JIAA 5JOXA 5L19A 4WVMB 1CAWA 2TEPA 3FLPA 5BYNA 1FAYA 2RS52 1DYKA 4Z82A 4YGCA 1W6OB 3B7MA 4YW2A 1JBCA 1RUD3 4QMAA 2JDZA 1YI7A 1ZVFA 4K9SA 4YZ5A 1LEDA 2TNFA 3ZFFA 4A7ZA 5GZGA 1SDWA 2XLGA 4FOWA 1Y43B 2DCKA 3AP4A 1XNKA 1SLTA 2D5HA 1G9AA 1C8M3 4G9SB 1MZ6A 4GALA 1DQ4A 4ZU5A 1CN1A 2RS51 1OPMA 3KT1A 4JGYC 4R52A 1OMIA 1MS9A 1OLQA 1QDOA 1V6KA 3E5QA 4I3PA 1ZBA3 1VBA2 3CO2A 4YFWA 1W6PB 2AR6A 2BFUS 4RD7A 1XNDA 2GNBA 2HEVF 3R4SA 3H8UA 4QPGC 1N1VA 4G4FA 4HPKA 2DVGA 1FOD3 2O8OA 3AMQA 1I9RA 3CJIC 3SH5A 4A7YA 4LE4A 4XHXA 5BNOA 4Q29A 2R16A 4BOWA 1S2KA 4YW4A 4KU7A 3M70A 3WDVA 2G9GA 2VGDA 1VBA1 3LWCA 2UWCA 4Y1VA 2DVAA 5I93A 4HN1A 3ES4A 5ABJB 4META 2D97A 5EYYA 4CDQA 3ZFEC 2BVBA 5KHKA 4AEJA 1IS3A 1MEC1 4M0HA 3VBSA 2WS93 2ZZJA 4GH4C 4COZA 1PHMA 1BBT2 4XJZA 2EIGA 2AUYA 1AR92 3WNXA 5GLVA 1NCRB 1JXNA 4Q4Y3 3BALA 2XJQA 4MXWA 4X8NA 1IS5A 5EFUA 1C1FA 2BTVC 1COV3 3ZIXA 3POWA 1PK6B 4Y22B 2IFWA 4MGZE 4D7YA 4F7ZA 1LB2A 3TRSB 4TZDA 4Y4YA 2CTVA 1W6MB 1V6OA 5J09A 1V70A 5T5OA 1BBT1 1MS1A 1XNCA 4RQPA 1UIJA 3JBG3 1AR91 4NWWA 2NMOA 5T5LA 3VKNA 1OOPA 5KWRA 1CONA 3INAA 4YGBA 2BBVA 5CFDA 2R042 3J9SA 1V6IA 1ND3C 5A32B 3WCSA 1ZRFA 5CVRA 1HW5A 1SCRA 2XB6C 1YCIA 3MF6A 4HN0A 2D7FA 4LBJA 2I74A 4CDWB 4AVVA 4E4SA 4PIXA 4TYSA 1J3PA 4PLMA 2D43A 1VRH2 4P9WA 2GC1A 3ATGA 1R1A2 1LHOA 1TQ5A 2R041 1N47A 4OUMA 4A2UA 1BVVA 4OHWA 3U4XA 5CB7A 5AC93 1JW6A 4ZU4A 3WG4A 1GQGA 5BNNC 4JQRA 1IS4A 1RUI2 2MNGA 5BY5A 4YNIA 5EXOA 3RZZA 1UU6A 1HRI2 1VRH1 4S2GA 2DUQA 1LR5A 1R1A1 2Q1MA 4CEWC 4H14A 4NHLA 1I6XA 3M8LA 2PAMA 1CIWA 2ZGTA 3B93A 4KQ7A 5HCAA 5KBFA 1WMEA 3H0OA 2QNKA 5FRAA 4BHPA 1J59A 4BLJA 3U0ZA 3DF0A 3S6PA 1RUI1 1KJRA 3S30A 4EWEA 5A3MA 3MFCA 4TLFA 1XE7A 1HRI1 2VNGA 2DVFA 3FWEA 4FOVA 4FP3A 5K0UC 3ZFGC 5ACA2 3WW2A 1PIV3 1ZBE3 4WM7B 5DUUA 3H7YA 4YM1A 4GMP0 2A6YA 5B2GB 1WBLA 4GWNA 3N7LA 2PA7A 2VNOA 2HWC2 2R0HA 2RS32 5JVVA 1QJY3 3ETQA 2ZX2A 4MV2A 3AX4A 1XQNA 4DRRA 1ZZ6A 3ZSJA 3VKLA 1Y3TA 5KC6A 1R093 4NHKA 1NOVA 3IPVA 3M3EA 5ACA1 3AP6A 4ATFA 1IQAA 2ZGMA 1NCQC 5T50A 3O14A 5D8AB 4XBNA 4LO4B 4EN9B 1D0GA 5E89A 3WHUA 2IXKA 4H3WA 1UCXA 4H55A 4EWDA 5C8CA 2HWC1 4V1PA 4OI1A 1W0OA 4D7SA 2RS31 4COVA 2H0VA 1AYM3 3SH3A 1X8EA 1PVC3 1UW8A 1YWKA 3VHOA 4M3CA 1OI6A 2LTNA 4OHZA 3HQXA 2D3PA 5IUQA 1UX6A 1TEIA 1OD5A 1W0PA 4GWMA 3RQ0A 4CP2A 2RM21 2JECA 4L9BA 4WVVA 1GQHA 1VBC2 1ND2B 2A6WA 3NV2A 2C5DA 2LALA 2X5IB 1AXYA 4HK9A 5CFCB 1C3HA 2V73A 5C4WA 3VZKA 1I1EA 2RE9A 1CAWB 1L3JA 5SV8A 5JZGC 2GC3A 4QGNA 1RHI2 2EAKA 2MPFA 3IDEA 3VBUA 5I0RA 2AGSA 3B94A 4NN0A 4Z92B 1XYOA 4PIZA 1DU3D 2D98A 1C4RA 2EXJA 2QDNA 4M01A 3ZFFB 3OCPA 4K6BA 1RMU3 2ZGSA 3VKMA 1CAUA 3O0XA 1DYPA 3CJXA 1CAXA 5JSPA 2K9ZA 1ASJ2 4IEOA 1MQTA 1VBC1 1RVF2 3UV9A 3PMEA 3WY6A 5J37A 4FO9A 3ZXKA 3RI8A 2DYCA 1H1IA 3VBOA 3D0SA 2YC0A 2GSYA 2PELA 3GZUC 2XL9A 1RHI1 3I2DA 2VW0A 4HSJA 4XYXA 1HRV1 1W6QA 4FTBA 1QNYA 1IHMA 2BWAA 4MZUA 3SISA 4S2HA 2GMEA 2XGXA 1S1AA 1VAVA 3J8F1 3WCRA 3KGZA 2FBEA 1ASJ1 2XBO3 1RVF1 3THTA 4JCKA 2CY6A 1ENXA 4FCAA 1H8TA 1GZWA 4HPKB 1HV0A 1POV0 3M3CA 2NYYA 2VVEA 2WNUA 4LBLA 4CDUB 4IV3C 4LLFA 1SLBA 5BUVA 1QMJA 2EALA 2VH9A 1U5XA 1Y9QA 4WVWA 4H7LA 2D93A 2A6VA 2B5HA 2D3RA 1QXPA 3LA7A 1GBGA 3UK9A 1S0FA 2P3KA 2MEV2 4WVMA 3A0KA 3V64A 2QCSB 4FXKB 5CA6A 2ATFA 1RITA 1KXGA 4I0WB 1HQWA 1BEV3 2R073 3KM5A 4QQ2A 1AR83 1OFSA 1S0JA 3VBSB 2DCTA 3AFGA 4OZXA 1PO23 5E1RA 4K40A 2EVXA 4AQ6A 2MEV1 2ZHLA 1UAIA 4QM8A 1LOAA 5GZFA 4OFGA 4Q26A 1QNWA 4MXWB 4K1ZA 4QHBA 3SITA 3K48A 4XIOA 1N1SA 2PHLA 4YYOA 1UPSA 1YLLA 3ZXDA 5BNOC 4BE3A 1SCSA 1VBB3 4C0BA 4COUA 1AR62 1LGNA 1TME2 1VBD2 2Q8OA 4RQPB 5KXCA 2XVLA 3IBMA 4PDWB 1OOPB 1AX2A 3ENRA 3G6JB 2ZGRA 2D40A 5CFDB 3UKNA 2C0ZA 4AEDB 1DHKB 2PHXA 1EV12 5E16A 4XIKA 1Q8QA 1RUJ2 4CDQC 2VG9A 3W9AA 1CVNA 1LKNA 1BCXA 1HXS3 3GBFA 3J26N 5L7OB 1H2LA 4AFMA 2BNOA 1ONAA 3AYCA 4LBQD 2XH6A 1YFWA 1ULCA 5IK7A 1RUG3 1AR61 1VBD1 4IEXA 1RUF3 2WLPA 1SEFA 5F6LB 3WP4A 1CPMA 2W08A 4BIOA 1G9BA 1FV3A 2I07B 2QDRA 1YNAA 3OBRA 3A0NA 5DDJ2 3WT3A 3FLRA 3WQ0A 2YDEA 2DU1A 1AJOA 1S0DA 4Q0UA 1EV11 3L2YA 4AQ2A 1R1ZA 3ZX7A 5FO8B 4XF1A 1RUJ1 4GB32 2CGNA 5FO7B 4XJWA 4EJRA 3DV8A 1NCRA 3L2HA 2SBAA 4AVTA 4YM0A 4YARA 3ZYIB 5GALA 3VBHB 3RG0A 1DBNA 1NLSA 2VW1A 4JVAA 4WM8C 1OOPC 5T3NA 3ILRA 3NAPB 4IETA 1D2SA 3T1MA 2ZACA 4AK3A 5CFDC 4R4XA 2PHUA 5GLTA 2VUAA 2YUEA 4Y22A 1AX1A 5I8SA 3AFKA 2DTYA 5JWPA 3ZXLA 1U5YA 5CBLA 2PHFA 4GB31 2GAUA 1O3RA 2JD4A 4KL1A 1Z78A 3WHTA 2R1BA 2YROA 3ZN5A 5C9AB 2GNDA 3AM2A 1MS4A 3FX3A 1MS5A 5GZCA 3LA3A 3MFAA 3KT7A 1RUC1 2ZOEB 3NVCA 3POSA 4NVPA 4BA6A 1RUD2 1FNZA 2YZ4A 3IIAA 4DZGA 4IXLA 2D44A 1X8MA 3AP7A 2R6QA 1REFA 4UW5A 2ZHKA 5F6KA 3AP9A 1X82A 1ULEA 2SLIA 4AW7A 4CDWA 2D3SA 3KD4A 1C8M2 3AXDA 5LEKA 2XVGA 5DG1A 4DNYA 2VNRA 4W6WA 1EPWA 4L99A 2VMIA 2CGOA 5CIRA 1A78A 4FPJA 4XQWA 1O3SA 4P9YA 4WZCA 1MZ5A 1RUD1 2YV8A 1BQPA 1CR7A 1WMFA 1DQ5A 1XYPA 1BK1A 1VAMA 4Q0PA 3ACLA 2E7AA 5KHGA 1RUE3 1NA1B 3MIFA 4XFBA 4DY5A 1ZBA2 3BOWA 2WT0A 1XNBA 3W58A 3RI9A 1C8M1 3MYXA 3PJYA 4HL0A 1FOD2 3B00A 4L11A 1G6NA 3HAGA 2G4IA 4FAGA 5FREA 1H30A 2GC0A 1AUYA 4GIQA 4M3CB 2K0GA 4OI0A 4COYA 3UJQA 5AVAA 2VULA 1XE8A 3AJZA 2OW4A 4LUMA 5BNPA 1BMV2 1LENA 4XFIA 4HZFA 1NQJA 2IWGB 1ZBA1 2XWBB 1J58A 3RJRA 1PZ7A 2EXHA 3LOIA 3AK0A 2HKXA 1FOD1 2F6BA 2WQZC 1WGPA 1BVP1 5GLUA 4I2OA 3ZMOA 1AL23 3VL8A 1WCSA 3URFA 3VDDA 3VBUB 1YFYA 3SLIA 3ZIWA 2VQ0A 2WS92 4RR3A 2O1QA 1D4M3 1BMV1 1APNA 4BPZA 4RFT0 4DS0A 2A6XA 2WKKA 2XPJA 4NO4A 2NLRA 3JB8A 1QJU3 4ZXKA 1CAUB 2QZ2A 3ES1A 4Q4Y2 3TNQA 5C8CC 1CAXB 1QJZA 4RL7A 1KRIA 1YFUA 5JSRA 5EZWA 4UXAA 2HEWF 2AYHA 1COV2 3FZ3A 4AFBA 5BXXA 4AEMA 2ENRA 1KITA 2F4PA 2ZABA 4YM3A 3E5UA 5DUXA 2QVSB 5FAXA 1W6QB 3WINE 2WNVB 1JUHA 3JBG2 5C6CA 3IM0A 2PLV3 3JCIA 2WLQA 4Q4Y1 3R4UA 2XWJB 3AKPA 4JDOA 4L2NA 4DB5A 1COV1 3ASIA 3S7IA 5C4WC 2CWSA 4QD2A 1TNFA 1H8TB 1GZWB 3M3IA 1QU0A 4O9GA 2WNUB 1X33A 4B8EA 4EN8B 4JC1A 4OHVA 4XBLA 4LBQA 1MS0A 2ERFA 4JRAA 1VIWB 4E4ZA 3VN4A 5HCFA 4COWA 1BZWA 2A73B 4MGKE 3JBG1 1UF2C 3PVOA 4AI0A 4AE2A 1ND2A 4FPYA 2X5IA 1YIFA 3QACA 3LSEA 3QBQA 3TAYA 1MQTC 1PZ9A 1VAKA 5DXDA 3HD8B 3U10A 1KFXL 4FPFA 3VBOC 5AC92 1GKBA 3RRDA 1DZQA 2DCZA 5FFOC 5IK5A 2JX9A 4RS5C 1K5MA 4XILA 3VZLA 2FZ2A 4QQHA 2UY9A 1ZRDA 1EAH3 2Y0IA 5BPXA 1KDKA 2CAUA 3D8CA 5IK8A 4AI1A 4JGZB 4XJ8A 4YFZA 5AC91 1AXZA 1H2KA 3DPRC 3L9JT 2GZWA 4IESA 5F1RA 1KQRA 1DQ6A 2XLFA 3JU9A 3WZ1A 1FMD3 1QH6A 4AVAA 4YGEA 2BGCA 3JQWA 2RMU3 1POV3 4BMEA 1B09A 3ZYRA 3W59A 2HWD3 1JN2P 1QOTA 2PYTA 4OULA 3FUQA 1PIV2 1ZBE2 4XMIA 2XHKA 4B4PA 1DFQA 4CDUA 2R063 5F9TA 1SFNA 3APBA 1DGLA 3MPPG 4N53B 1ZM1A 4Q4V3 4QU2A 4F83A 1QJY2 2JICA 4DY3A 1H2MA 4UBGA 2Q30A 4J6GA 1B35A 1R092 2ZKLA 1XU1A 3J4UH 4KWKA 3GHMA 3ILFA 2YY1A 4AVCA 3H1WA 1ZBE1 3NKTA 1TMF3 4PQ9A 4ASMB 3ZXEA 4KWJA 1F9KA 1JUIA 2C1FA 2QZ3A 5T52A 3KLSA 1AYM2 1QJY1 4YZ3A 1PVC2 5AFEA 5A33A 3R0RA 4B7EA 2A71A 1R091 1H4GA 4JTOA 4XXPA 5GZDA 5GKAC 2DVBA 3IKWA 3P3PA 1BJQA 2PTMA 3TN93 3IMNA 1HX6A 2WL1A 3RYPA 2Z42A 1DDLA 3E97A 3I4IA 2G9FA 3H1MA 2WZPP 1RUNA 4QX5A 4ISQA 1AYM1 1NG0A 2PAEA 1PVC1 2XL7A 4JDNA 4PDWA 1CX4A 3S0MA 1HIXA 2C9AA 3AMNA 4NHMA 4XFGA 1OHFA 1WD3A 3ZSEA 4AEDA 1VBE3 4M3CE 5ABJC 2DFCA 3ZN6A 4PCRA 4AYUA 1RMU2 4MXVA 4IV1A 5L7OA 3EJKA 1PGSA 4EV0A 1WW6A 1RIRA 3BIWE 1MS8A 4FPKA 5LEJA 3H1YA 1FPN3 1NCRC 3QOPA 1F2NA 1O4TA 1UKRA 4JRLA 4KNCA 5BNQA 3AKTA 5JAXA 5TSWA 1I5ZA 1DGRN 1SLIA 2WFF3 2BFUL 3IN9A 3VKOA 3S7EA 2D6MA 4OHYA 1FXZA 1PK6C 2GNMA 2E7TA 2JEMA 1RMU1 3T2TA 4LBNA 4MGYE 4XW3A 1H4HA 1OFNA 2LUWA 3RNSA 5AFBA 1WW7A 1ZNPA 2XBO2 4HMZA 4L97A 1MVQA 1QOOA 4HANA 3TB0A 4XF9A 3VBHA 4KBBA 5J3UA 3N36A 3D5OA 4IEWA 2ETEA 3NAPA 3O7OA 4K3UA 3TYJA 5J96B 2WT1A 3JUUA 3GNEA 3LB9A 1O91A 1SLLA 2YGMA 3OGGA 4AWDA 4QPYA 5BNPB 4LHKA 5J36A 4CDWC 2XBO1 5C9AA 1Q43A 1RB8G 2QUOA 2W39A 1HV1A 3NKGA 5SV5A 1BEV2 4OI4A 2EXIA 2R072 3H7JA 4NR1A 1AR82 1OQDA 1RINA 2CYFA 4YZ1A 4XTMA 4LUKA 3VDDB 1JHNA 4XMAA 4ZKTB 4FP2A 3WVJA 3NJZA 4RR3B 2Q0AA 4XE9A 1IKQA 1OA3A 4IEZA 4DPNA 1JOJA 1PO22 2DUOA 3C2UA 2HWB3 1C5IA 4BYYA 4LO6B 4CP1A 4LO5B 1FI2A 2UURA 4HK8A 1LGBA 5H9QA 4AEKA 1BEV1 1C57A 2FQPA 2R071 4DRVA 5K9YA 4IQPA 4FAHA 1AR81 4CP0A 3MIDA 1WLCA 4MX3A 4LBKA 3WW3A 3LA2A 1NA1A 4CDXB 1VBB2 3OYWA 4NPRA 1AR73 4AHYA 3ALQA 1MEC3 2X53S 4R9AA 1PO21 4QQOA 2VW2A 3QH7A 3USSA 5JMCA 5T5JA 1O3QA 1HKDA 1Q8VA 1G9FA 5J48A 1QQP3 2PAKA 1YO8A 4FPLA 4LULA 1PNFA 3BU7A 1HXS2 2NQYA 1GANA 4WM7C 1VB4A 4DINB 4C1WA 1VBB1 4LBQB 4Q27A 1W2UA 1RUG2 1LOGA 4KG8A 1RUF2 2WSVA 4FTSA 2BNMA 1KFUL 1H9WA 1ZZ7A 1S0EA 4YVWA 5GJ6A 4AGRA 1HXS1 5D8AC 5FMOS 1MR5A 3EXUA 1K5MB 1RUG1 3MW4A 2EAAA 1MZEA 3AZWA 4XTPA 1RUF1 1A8MA 3QH6A 3HR9A 3TNPB 3MZHA 2JG8A 3R6SA 1G9CA 2VOKA 1WLTA 4YVSA 1H0BA 1DQ0A 4XFFA 1DQ1A 2JE9A 3MPBA 3KMHA 3THPA 2IZWA 2ZGUA 1PVXA 1O7FA