1ND2B

The structure of rhinovirus 16
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
252
structure length
252
Chain Sequence
SDRIIQITRGDSTITSQDVANAVVGYGVWPHYLTPQDATAIDKPTQPDTSSNRFYTLDSKMWNSTSKGWWWKLPDALKDMGIFGENMFYHFLGRSGYTVHVQCNASKFHQGTLLVVMIPEHQLATVNKGNVNAGYKYTHPGEAGREVGTQVENEKQPSDDNWLNFDGTLLGNLLIFPHQFINLRSNNSATLIVPYVNAVPMDSMVRHNNWSLVIIPVCQLQSNNISNIVPITVSISPMCAEFSGARAKTVVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords coat protein VP1
publication title Structural and virological studies of the stages of virus replication that are affected by antirhinovirus compounds
pubmed doi rcsb
molecule tags Virus
total genus 61
structure length 252
sequence length 252
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2002-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1nd2B00
1X36A 2WS92 1R083 1WCDJ 4GB32 4CDWC 1AR82 1HQNA 1NCQA 2RS13 2XBO2 2WWSA 1RUJ2 1RUC2 5C9AB 3CJIC 1ND3B 2RMU1 4GH4B 1Z7S2 1BBT3 3VBOA 2DF7A 1BEV3 2Y26A 1RUD1 3J8F2 1A6CA 3JBG2 1GFF2 5DDJ3 1H8TC 1FMD2 4CDXB 1RHI3 5BNPA 4YVWB 1VBC1 4Q4V1 4CDWB 1TMF3 2RS52 1B35B 1AL22 1NCQC 3CJIB 1AR72 1VBB2 1FPN2 1NG0A 1MEC3 2MEV3 1AYN2 4WM7C 3VBRB 2HWD1 5ACA3 2TBVA 2R062 1F8VA 1D4M1 1RMU2 3VBUC 1AR91 1AYM2 5BNPC 1QJX1 1NCQB 4RR3A 1CD3G 1COV1 5JZGA 1VRH1 3VBOB 1TME3 3ZFGB 4GMP0 1AR63 2PLV2 2WFF1 5CFCC 1ND2C 2HWF3 1E57A 2WLPA 5BNPB 1PO21 1R1A3 1OOPA 2R072 1QJY1 4RHV1 1R091 5JZGC 1NA1A 3JD71 1RUF1 1NY71 1AUYA 3TN93 1HRI1 2HWC2 1OOPC 1C8M2 3FBMA 4RR3B 4JGYA 1PGL2 1RUI1 5JZGB 4CDUC 1NA1C 1FOD1 4IV1C 1CJDA 1ZBE3 2HWB1 4LLFA 1F2NA 4QPGA 5AC91 4CEWC 1OOPB 5FMOS 1RUE1 3HAGA 2RS33 4JGYC 1NA1B 1POV0 2WS91 4RS5A 4GB31 5C4WA 1AR81 4WM8B 2XBO1 1IHMA 5A32A 1NCRA 1RVF3 1RUJ1 1EV13 1RUC1 1V9U2 2X5IB 4N53A 3DPRA 1PO11 2WZR3 1Z7S1 1RUF2 5FOJB 3J8F1 3JBG1 1ND3A 4JGYB 4GH4A 1FMD1 1PGW2 4RS5C 2RS51 1VBA3 1AL21 1RUI2 5K0UB 4CDXA 1NCRC 4FTEA 1AR71 1VBB1 1FPN1 2HWE2 1AYN1 1VBD2 2RM22 3DPRC 2HWB2 4QPGB 5ABJA 2R061 5C9AC 1ND3C 1ZBA2 1RMU1 4Q4Y3 4GH4C 3VBRA 2R042 1AYM1 5C4WB 1QQP2 4Y4YA 1VBE3 2RR12 4N53B 4CDXC 5J96B 4YVWC 3DPRB 1B35C 4Q4W3 5ABJC 1POV3 1PO12 2PLV1 3VBRC 1RUG2 2ZZQA 3ZFGA 1HXS2 2IZWA 2R071 1RUH2 2ZTNA 1QJU3 1ASJ1 3VBHA 1R082 4BCUA 5ABJB 1OHFA 2RS12 5BNNA 2BUKA 3VBOC 2FZ2A 1PIV3 2R063 1PVC3 3ZFGC 2HWC1 1BBT2 1BEV2 1HRV3 1C8M1 1PGL1 1RHI2 5LK7B 1TMF2 1VB2A 1AL0G 1MEC2 2MEV2 4Q4X1 2RMU3 2PLV3 3S6PA 5ACA2 4Y5Z0 2GH8A 1RUD3 1MQTA 4FSJA 3ZFFA 4SBVA 1M06G 4JGZA 3VBHB 5CFDB 4RR3C 1ASJ2 1VBC3 4Q4V3 1V9U1 5BNNB 4RQPA 4WM8A 4Z92B 3ZFEA 2X5IA 1TME2 2HWD3 3ZFFC 1D4M3 1PGW1 1AR93 1R1A2 4FTSA 2BFUL 1QJX3 5J98B 4GMP1 2HWE1 1VBD1 2RM21 2XPJA 4WM8C 1COV3 5K0UA 3ZFEC 1VRH3 2X5IC 1ZBA1 1MQTB 3ZFFB 2R041 4Q4X2 4NWVA 3TN92 4JGZB 2WFF3 1QQP1 4NWWA 1C8NA 2RR11 1PO23 4RQPB 4IV3A 1QJY3 4RHV3 4N43A 1R093 3ZFEB 4AEDA 5K0UC 4QPIA 3JD73 1ZBE2 1RUF3 4QPGC 1RUG1 1HXS1 1HRI3 4CDQA 1RUH1 1EAH1 2RS32 5C4WC 4IV3C 4EJRA 1RUI3 5C8CA 1R081 4N53C 1FOD3 2RS11 2RM23 1RVF2 2HWB3 1EV12 3VBFA 4CEYA 1BBT1 2VQ0A 5L7OA 1BEV1 5AC93 1RUE3 4IV3B 4PDWB 5DDJ1 4N43B 4FTBA 1RHI1 4AEDB 2WS93 4QPIB 1TMF1 4GB33 1VBA2 1AR83 3VBSA 2XBO3 1RUJ3 1RUC3 1MEC1 2MEV1 4CDQB 1PO13 1SMVA 3VBFC 1Z7S3 5L7OC 5ACA1 3J8F3 3JBG3 4Q4Y2 3JB4C 1FMD3 5C8CB 1NOVA 1VBE2 1EAH2 5BNOB 2RS53 4YVSA 1BMV2 1AL23 3VBSC 5CFDA 1AR73 1VBB3 1FPN3 1K5MA 3VBFB 4CEYB 1AYN3 5L7OB 4Q4W2 1TME1 1X33A 4WM7A 1AR61 1RMU3 2HWF1 5D8AA 1AYM3 3IDEA 1R1A1 5DDJ2 3VBUA 3VBSB 4YVSC 3VBHC 1QJU2 5CFDC 1K5MC 5BNNC 2ZAHA 1QJZA 3TN91 5A33B 1PIV2 1RB8G 5D8AC 1PVC2 5CFCA 1H8TB 1HRV2 1ND2A 4YVSB 2R073 1ASJ3 1K5MB 2QQPA 1ZBE1 1VB4A 4WM7B 5D8AB 2BBVA 2RMU2 1MQTC 3VBUB 2HWC3 1AR62 3LOBA 2HWF2 1C8M3 2RS31 4JGZC 1RUD2 2BPA2 4RQPC 1VBC2 4Q4V2 4CDUA 1RVF1 3VDDA 1EV11 2BFUS 3NAPA 4IV1A 2WZR1 4Q4X3 5CFCB 1ND2B 2HWD2 2FZ1A 4CEWA 1D4M2 1DDLA 1AR92 1VBA1 4PDWA 1QJX2 3VDDC 1V9U3 3NAPC 4RFT0 1COV2 1VAKA 1VRH2 3M8LA 5FMOL 4Q4Y1 3ZXAC 2WFF2 1VBE1 4PDWC 3JB8A 1BMV1 4CDUB 4N43C 3VDDB 1PO22 4AEDC 3NAPB 4IV1B 4QPIC 4GMP3 1QJY2 2HWE3 5BNOA 4RHV2 1VBD3 4Q4W1 1R092 2GSYA 3JD72 1HX6A 1POV1 2WZR2 1ZBA3 1NY72 4CDQC 4CEWB 2R043 5C9AA 1HRI2 1QQP3 2RR13 1QJU1 5C8CC 1W39A 5BNOC 4YVWA 1FOD2 4CDWA 1B35A 5GKAC 1OPOA 4CEYC 1PIV1 3CJIA 1PVC1 1RUG3 1HXS3 1HRV1 5A33A 5AC92 4RS5B 1RUH3 1RUE2 1EAH3 1H8TA 5A32B 1NCRB
chains in the Genus database with same CATH superfamily
3RZJA 3I2KA 3VZKA 2ZJCA 1DYPA 1HIXA 2NM1A 4CU6A 4IEWA 1HQNA 5FMCA 2PHLA 4B29A 3M3EA 5C9AB 1UWWA 1X9TA 2RMU1 4ARXA 1Z7S2 5HCHA 1BBT3 4G4FA 2Y26A 5JSPA 1JZ2A 4ET7A 3VL9A 3LPGA 3C7OA 5HCFA 5JCTA 3N7MA 3OBTA 4J1XA 4KGQA 5C3SA 1XQNA 1SDDB 2VXJA 2OZ6A 5BNPA 2PHFA 3C3VA 5FY1A 4FPJA 5LA2A 2WNVC 2D6LX 1WCQA 1NCQC 5SV8A 3ZN6B 3NRUA 1AR72 2VTXJ 4Y22B 3HBZA 3RS6A 1KRIA 1AYN2 2B9UA 2H6CA 2VOVA 2JE8A 4YZ5A 4FAHA 2OPKA 5ACA3 5HBAA 5LRSA 3SCHA 1OSGA 3NV2A 2PAMA 3GALA 1YLLA 1ZRRA 4KU8A 5E8AA 4KGGA 2JE9A 4BA6A 3H8XA 2J7MA 4XF1A 3TOJA 4RR3A 2K0GA 3HVDA 3OJBA 4XDPA 5CNAA 3ZSMA 5JZGA 3Q8FA 4CCLA 3VBOB 1A8MA 4MLOA 3I3MA 4BK5A 3KV6A 5K8SA 1XXNA 2ENRA 1ZYBA 2QQMA 4GMP0 1AR63 2PLV2 1YFXA 1ND2C 1X8MA 1D0HA 1Q8QA 2ZX2A 1E5SA 1MZ6A 4XCBA 5CG8A 3IDAA 4XF3A 4ZU4A 5FY4A 4AAXA 4Y3OA 2ARXA 5FXZA 3H7YA 3LFMA 2D93A 2YMZA 2YGLA 3MICA 4DINB 4AHXA 2XQRA 2D6MA 3JCIA 1WCKA 3RZGA 3JD71 4ASLA 1OLMA 3ZSJA 1MPXA 1OPMA 1NY71 3MGUA 1PX4A 4NPMA 4Q0PA 5BY5A 4QX1A 1QDOA 1HRI1 4NROA 5JOYA 2JD9A 2EICA 1QXJA 4BYYA 1IS6A 2J1VA 3WX5A 1XBFA 3HN3A 3O1VA 1OOPC 3GZAA 3J7NA 2WWJA 3HNYM 4JGYA 5JVVA 4W50A 4ZZ5A 1RUI1 4Q0QA 3ZYGA 1DFQA 2FDJA 2QDNA 2X53S 5KHHA 3TB0A 5LASA 3NV3A 4A4AA 2D6NA 3KT4A 2A6VA 4IV1C 3PUAA 4YSFA 3ROUA 5FZ3A 5A6YA 1J3RA 4XACA 1S0GA 4OHZA 2AREA 3M3IA 4HKWA 4L2NA 1P8JA 5CAZA 4QPGA 1YJLA 2Q5TA 3I2JA 2ZHKA 4HN1A 4W4ZA 3RZMA 5FMOS 3HAGA 1SHWB 2A71A 3JQWA 1LEDA 1ZZ6A 1NA1B 2VW1A 2WS91 2IXIA 3B01A 2QQWA 2BERA 1AR81 3DKQA 2BW8A 2JKBA 1RVF3 4ZZ8A 1RUJ1 1RUC1 2W2IA 3ME2A 3T4VA 3UK9A 2OW4A 1XYOA 2JG8A 1UU6A 1PO11 3AZXA 4P14A 4RGAA 4ASKA 3RZHA 3AKTA 5HV0A 5CB7A 4LPLA 5ANQA 3L9JT 1W6OA 2BOJA 2CV6A 1L3JA 4GH4A 2E7QA 1US2A 2VL4A 1IG3A 4GZ9A 4HLTA 3GCXA 3T2OA 1FMD1 2BQPA 4INDA 1C57A 1DYOA 1HJFA 5FJKA 4RS5C 4QHBA 4BQYA 5IT6A 4M3CF 3WP4A 3DYOA 2Y0OA 3B93A 3S5QA 1RUI2 4BDVB 5JXHA 5K0UB 2WN3A 1V70A 1VBB1 3A0NA 5DG1A 4COZA 2NN8A 5KXBA 4TYSA 4XF9A 2XDVA 2JJ6A 3VHPA 1X82A 5C9AC 1JOBA 4COWA 1ZBA2 4MOAA 4QPYA 4R52A 1H9PA 2R042 3L2YA 1AYM1 2ZEZA 1BZWA 3OGGA 5C4WB 2QCSB 1POQA 2Q4SA 4ITCA 2V73A 3KLSA 5AVAA 4LOTA 2WC2A 5LATA 4AWDA 5J96B 4RL7A 1UD1A 3DPRB 1GP5A 3BKZA 3O1TA 2BYVE 4P5HA 4Q4W3 1RC6A 5KHGA 1XOYA 1PO12 2VAUA 1REDA 2Q1ZB 5LBEA 3LOIA 2XJRA 2FHRA 5J37A 1NLSA 4DZGA 2ZZQA 4XYXA 3ACGA 3ZFGA 2IZWA 4YARA 4GWNA 2YY1A 2E7AA 2Q30A 5DZGA 4YW5A 4CUAA 1W3XA 4DY3A 4XXAA 5FWJA 2YB7A 3AFKA 3JU9A 4OUMA 2WIIB 4XC9A 3VD7A 1YQCA 5DAWA 2VMFA 3H8RA 1KXGA 1CZTA 5FO8B 4M0NA 1D2SA 1W9WA 2BUKA 3VBOC 4JDMA 2Q8EA 2FZ2A 2H0BA 4Y33A 4P9YA 1OKQA 5FPLA 4P9WA 1BBT2 1QGLA 3DGTA 4FXKB 3WG1A 3WQ0A 1C8M1 1VMFA 4CP9A 3DXUA 4XZUG 4DNYA 4LBKA 2C4XA 1AXZA 3O12A 5LK7B 1GZWB 4G3YC 1QH6A 2Y6KA 1PX3A 4ZKTB 1VB2A 2ATFA 2B4KA 3OD4A 3VKFC 4IEOA 4B3NA 5LEKA 4KG0A 2GH2A 2A6WA 1UMIA 2YU1A 5IUQA 1ENQA 1OLME 1YI7A 1O91A 4W65A 1OF3A 1LODA 4BQ3A 2WABA 5ACA2 1S0IA 4XJAA 2GH8A 2VM9A 1MQTA 1WBFA 4CVUA 3ZFFA 5FPVA 1CAUB 4NRPA 4P08A 2C5DA 4QKFA 1PM4A 2OYZA 2PAKA 4JGZA 3VBHB 4JQTA 2Z79A 3URFA 4AFMA 3MPPG 1UY0A 1VBC3 5EJ3A 5GZDA 1HB3A 1V9U1 2QNKA 5FYCA 3VKMA 4AEMA 5BNNB 3HQUA 3H50A 1JHNA 1O4TA 2C26A 1W3VA 2XUMA 3IT8A 2HWD3 4NIHA 3AMPA 5KXDA 2FDHA 2AACA 2BOIA 1YIPA 2G9FA 5IVCA 3J4UH 5D1IA 2B9VA 2JDYA 1XE0A 1SBDA 1JZ5A 5F5QA 3B02A 1QJX3 2GP3A 4XFHA 3DKWA 3B9CA 1DBNA 3MIBA 4UOJA 4WVZA 4BB3A 3ZYIB 1COV3 2LUWA 4BMBA 4U36A 3K75B 5ISLA 1VE0A 1F31A 5EJZB 5FP7A 5HPOA 4AVVA 1NXD1 1W2OA 2FMYA 3PVBB 5A3LA 1O4YA 1S2BA 1C1FA 2VVDA 4QPWA 4Y24A 1LU2A 1N1SA 3WW2A 1G9CA 2OKXA 5F37A 1QJEA 2CDPA 4NHXA 2QQNA 2LM3A 4QQOA 3ON7A 4AE2A 4D69A 1PO23 3AMQA 4RQPB 3NMBA 4IV3A 4RHV3 3AYDA 2Z4FA 3I2FA 1OC1A 5K0UC 1LAJA 5IK7A 1IS5A 2C1FA 5FZBA 4X8NA 4CXYA 1Y4WA 2ORXA 3RYKA 2OT7A 1V0AA 2WT1A 3VDCA 1UNBA 1O4ZA 4DMIA 4R4ZA 1SQ4A 3OCPA 1HXS1 4J6GA 5FCCA 5A6XA 3RI8A 5I8SA 1RUH1 1IPKA 1HV0A 3AFGA 1JW6A 4HT1T 3T2QA 1WLDA 5F5CA 5C4WC 5F3IA 1ZREA 1E5HA 2LS6A 1URXA 1UW8A 1GYKA 3PJQA 3KS7A 5EPAA 4O9EA 3VZLA 1W2AX 1RVF2 2HWB3 3QBQA 1GKBA 1TEIA 3THDA 5FP9A 4DRRA 4XHXA 1MS4A 4MG2A 1QOSA 4CEYA 1BEV1 1TZOA 2OQ6A 1CIYA 1IGOA 3NJVA 4FP3A 1JZ8A 4A41A 3U0ZA 1RUE3 4PDWB 4AVCA 4Y1YA 2VMDA 3M7AA 1AX1A 2OS2A 4QPIB 1WMDA 2XGXA 5E1RA 2A75A 5GJ6A 4FOVA 3WG4A 2XBO3 5C5UA 4QXHA 1VR3A 4CUGA 2MEV1 4CDQB 4RSUA 1LKNA 2DWRA 4QD2A 2AYHA 3NWKA 3VBFC 5C33A 3PUSA 5A1LA 1QH7A 1RGSA 4GWJA 4CXWA 3GJBA 1LESA 3HBKA 4Q0SA 1QOOA 2ZABA 2E31A 2E33A 4PLNA 4XTPA 2PTMA 5B2GB 5C8CB 1CIWA 1KFUL 4XE9A 3A23A 3RJ2X 2P4EA 1AL23 5FK7A 3WSOA 5JDBA 5CFDA 2EXHA 4R9DA 1C4RA 2JKXA 1K5MA 4GULA 4QU1A 4Q4W2 3WZ1A 3I2GA 2VBDA 1TME1 1X33A 2ZGQA 4I0AA 4K7JA 5K9YA 2X10A 2YG0A 1RUNA 4OUEA 1LB2A 2HWF1 1ENXA 4BLIA 1JZ6A 4YGDA 2ZHLA 3O1MA 2KR2A 5F7UA 1UY1A 1WLCA 2FDKA 2WA3A 3VBUA 5FQ0A 2BGPA 4LA2A 4LBJA 2DCYA 4HXCA 1H8VA 4YFWA 3VBHC 5J3UA 3KF3A 4HKOA 1WLWA 3Q8BA 2YFUA 4RGGA 1ZRIA 3PL0A 5BNNC 2VW0A 5FZ7A 5A3NA 5IVVA 5EFUA 3EXUA 2TUNA 4U2AA 1QJZA 4DUVA 2D6KA 1OXCA 1QNYA 1XRUA 2DCZA 4B7EA 2CTVA 4QT6A 3WP5A 3FX3A 1ZRFA 3IMMA 4LR4A 4L0PA 3HPNA 1LCLA 3AL6A 2ZXQA 4M4RA 4YVSB 5BYNA 3LB9A 4M3CA 1CPMA 3A0KA 1CESA 2PELA 3S7EA 3VN4A 1S0BA 3N36A 4NR1A 4MYEA 2ZBJA 4EWEA 5F9TA 5CVRA 2WSUA 3EBRA 1UU4A 4WM7B 1PNGA 2O8QA 1DIWA 3E1F1 4K1ZA 1LOFA 1OLQA 1UMZA 1S2KA 3SHRA 4EN9B 1FATA 2EXIA 2XJVA 3IMNA 1J3QA 1W8NA 2HWF2 3POEA 5DUUA 1JYXA 1OUXA 3LSDA 5C6CA 4D94A 5JAXA 4LQRA 3K3NA 1LOBA 2Y38A 1NUKA 2JWPA 2YYOA 4PBOA 4RQPC 2W46A 4XUTA 4XMIA 5A7QA 5T55A 2JDHA 1VBC2 4NHKA 4EN7B 2JB4A 3VDDA 4UAPA 4OVEA 4ES8A 3AP6A 2BFUS 4OHXA 2YHJA 2K2SA 2WZR1 3GJAA 2VZVA 4M0HA 4AQ6A 5FPUA 4UT5A 2E9QA 2ZZJA 5FXVA 4Q4X3 1MS1A 3WOGA 3CF6E 2HWD2 3VDBA 1Q8PA 4NHYA 4HBNA 2FZ1A 3IBMA 3MIGA 4CTEA 4ARYA 3POBA 2P17A 3M3OA 4DIQA 1DDLA 4DEQA 1BK0A 3POYA 4Y20A 5F1RA 4AZZA 4E9KA 1QJX2 3ELNA 1W8WA 2VQAA 3FHAA 1XYNA 3NAPC 5FPBA 3RYRA 2PQSA 1COV2 3KWVA 1UX7A 2QTWB 3HOBA 4Q4Y1 1XYPA 4HVQA 5FZ0A 3LWCA 2ET7A 3OY8A 4R9AA 4FQ4A 3ZXAC 4PLMA 5JSOA 3D0JA 4PDWC 2A3YA 2VZRA 4CDUB 1PO22 1UXZA 1UYXA 2GMEA 3A7QA 4MXWB 3ZN6A 4QPIC 1S0EA 1T6BX 1XNBA 3BGAA 4RHV2 1VRBA 4XILA 1JU3A 2YC0A 1BQPA 1POV1 2WZR2 5FUIA 2FCVA 4FPYA 4UF0A 4UI9L 4CDQC 3VL8A 4CEWB 5FZGA 1ALYA 4P9IA 3Q8CA 2CU5A 3WXPA 2WDBA 4COYA 4EZHA 4IEXA 2P2KA 5EYYA 1D7PM 4KWUA 2W95A 3ST7A 5C8CC 2H6BA 4BZ4A 3U14A 1WA4A 2RHPA 1KGYA 3WF3A 5C5TA 3CIHA 5I8TA 2DURA 3TEWA 1FNZA 2ZKLA 4RD7A 4ATEA 4YVWA 5FTTC 5GM0A 2PA7A 5AVPA 1X9PA 4PIYA 5GKAC 1OPOA 3ZXLA 4Z8BA 2NQYA 4NE9A 4R8HA 1W6NB 3WW3A 4HONA 1SCRA 2VMIA 4MGQA 1PVC1 5GLZA 2IXCA 3GZEA 4CE8A 1VLNA 3N9OA 1SLIA 1QJFA 4N90A 4XFBA 4AK3A 2R1DA 4EWDA 5FO9B 4QX3A 5C3OA 4YG6A 1RUE2 1Y3TA 1EAH3 4IEYA 1H8TA 5L9RA 3PJYA 4XABA 4DB5A 4XF4A 2VMGA 1EUUA 1FXZA 1S4CA 3ZYJB 1WCDJ 3MEPA 2FQPA 4YG3A 4AVTA 2P34A 4YGEA 4SLIA 3UGHA 2YPJA 2RS13 3WD5A 2L9LA 2XBO2 1SLTA 4JHZA 4YM2A 1W2TA 2WWSA 3PVEA 1I6XA 2VMHA 1W6PB 3A4UA 3CJIC 3RGBA 4NAOA 3ZR6A 1JOJA 5DUWA 2ZPXA 4GH4B 5F8PA 4HSJA 3RQ0A 2DF7A 4NVPA 3BTXA 1KQRA 3AZWA 2WFPA 1RUD1 4RFRB 3AVRA 1C5IA 5DXDA 3ACLA 1GFF2 1RL3A 1GQPA 4LE4A 3AL5A 5HI0A 5I0SA 5LCWL 3MYXA 4C90A 3MO4A 4PLOA 3W21A 2R0HA 4Q4V1 1TMF3 1NKGA 2WZ8A 1AL22 3M2MA 4FPHA 4AQTA 5EXOA 2B42B 2A3XA 4CCDA 1NG0A 5J7MA 2WQZC 4WM7C 3IKWA 2CSGA 3U78A 5A3PA 4Q8KA 4AGGA 2R062 4KG8A 1F4AA 2PHTA 1D4M1 5IATA 4PBPA 1RXFA 3AKRA 1AR91 3IPVA 3WG2A 1VJ2A 2X29A 1AX2A 2VZ3A 4QGLA 1DGWA 1KFXL 2C6SA 4C1WA 2WNVB 4DRVA 5BNPC 1NCQB 2GMMA 1UPIA 1SLBA 4FO9A 4L11A 4NMIA 2BRTA 2ZGPA 2DUPA 3W5NA 3WG3A 3UL2A 1LULA 4MGKE 2O8OA 5J09A 3DXTA 3ZFGB 1RITA 5M0TA 2P1BA 3ES1A 1SG3A 1G9AA 1O5UA 1PK6A 2QZ3A 2WFF1 3G6JB 2YGMA 5HV4A 1YQ6A 2LTNA 4BQ5A 5FPXA 1TE1B 4F7ZA 1R1A3 2A7AA 4OQ9A 2LW8A 3WW1A 4MADA 1QJY1 1FYUA 3E6DA 2E32A 1PMHX 5JZGC 3NSTA 3BTYA 1RUF1 5FWEA 1UXXX 2RVAA 1VIWB 1RIRA 3VHRA 1K3IA 4XBNA 2MHFA 3FBYA 2FDIA 2VW2A 3AM2A 3RVHA 3TN93 3CLPA 1GQHA 3P6BA 4AEKA 4QB1A 2TEPA 3C7FA 1KDKA 2VQTA 3ZKYA 2WN2A 4YZ2A 3MI8A 1PGL2 5LK5A 2WAAA 4EN6B 4CDUC 1H9WA 3POJA 2XKOA 1UQXA 1GZTA 4OI2A 1CJPA 5LZ6A 5CIRA 1ZBE3 2OZJA 4JC1A 2BNNA 4LO4B 3Q9OA 1UOJA 4BXSV 2XVKA 2YXSA 4Q8LA 2QKDA 3B5LB 3UNPA 4XFFA 3O1SA 5AC91 3FFZA 4CEWC 1OOPB 2Y6GA 2UYAA 3W58A 2Y6HA 2A1XA 4LORA 4NHMA 2J42A 2RS33 1VMJA 3BCWA 1ENRA 4JGYC 4A7YA 2R6QA 3LAGA 1KJRA 3MIEA 1G9FA 2P5BA 2ZEWA 3U75A 4E2QA 3DUIA 3SNMA 3VUOA 5A32A 1IHMA 3T30A 1NCRA 3BVCA 3I2IA 3WP3A 4N53A 4QGNA 2P37A 4I01A 3MV01 3WDUA 2KA3A 1QXPA 2K46A 1Z7S1 1RUF2 3DV8A 3CEWA 4CA9A 1ND3A 3B00A 3C7HA 3GHNA 3I4IA 4ZXKA 5F32A 4F8AA 3VHNA 3AC0A 2EVXA 2LROA 3EQEA 1SZBA 1YFWA 3EB7A 3THCA 4Z2AA 3ZYFA 2D3PA 2VCMA 4XVHA 1OH3A 4IQPA 5FPZA 1AR71 1RUOA 2BU9A 2JG8C 4OCTA 1AYN1 2RM22 3BN6A 3BTAA 4XJ9A 2AZ5A 1H6YA 5LRRA 5ABJA 2Y33A 4QMAA 2X09A 5K7PA 4GH4C 4CP2A 4ZHNA 4CPBA 1CR7A 3VBRA 3ETPA 1AX0A 4KWKA 4Y4YA 3H1YA 2QQVA 4LBQA 2VOXA 1SFYA 2A6XA 3HT2A 3C7EA 1FX5A 5LY2A 3VD5A 4JVAA 4PCRA 4XPVA 2DCTA 4LBLA 3HIFA 3POFA 2PLV1 1H2MA 5J48A 4AQSA 1LEMA 2CL2A 2I45A 1SLCA 3I2OA 2PN5A 1T2XA 4AI9A 3TEZA 2ZKNA 1HLCA 1QJU3 1ASJ1 1ZZ8A 2D3SA 3BODA 3FUOA 5FLIA 3RYPA 1GOHA 3OSDA 5D21A 3TAYA 3OF1A 2GNBA 1W05A 3B94A 1V6MA 4BCUA 3V0AA 2ZEYA 1XNKA 1APNA 1W06A 4YG0A 5FO7B 2RS12 5KR7A 3KQRA 3MFAA 4HVOA 1H4HA 1WMEA 3ZFGC 4IL7A 3ETQA 4BH9A 2D43A 2QUOA 4FPOB 4KH9A 4IEUA 3WT3A 2PYTA 5E88A 2YPDA 4ZU7A 1DYKA 3D4KA 2XJQA 3P3NA 5C71A 4IW3A 5DZFA 4AFAA 1U12A 1TMF2 5ERLA 3HNMA 2W1UA 4LHNA 2IXJA 1VPHA 3FC0A 3LKJA 1V6LA 4LMFA 5IVFA 4E8DA 1S0DA 4LO7A 1ZZ9A 2NYYA 1OQ1A 1R64A 5JUVA 4XJZA 2MPFA 2J22A 4D3WA 1Y9MA 3BU7A 3N3HA 4XJ8A 4OQ8A 3NNFA 5CFDB 4LKEA 1Z0HA 2WKKA 1ASJ2 2VD7A 3N7KA 3NW4A 5DG2A 3CMGA 1N47A 4XBQA 1D4VB 2Y0IA 2VOKA 3VZNA 4EQVA 1UKGA 3CHXA 3ZFEA 2X5IA 4HANA 4LBNA 5JMOA 4ATFA 4Y1ZA 1TNFA 3WNKA 4CUCA 4AFCA 1HN1A 2R1BA 3ZFFC 5FQ0B 3LDRA 1MZ5A 2DBNA 4PIZA 1YYNA 4CU8A 2VGDA 3AKSA 1R1A2 2E53A 2JICA 4FTSA 1HJGA 2ZMKA 3B9IA 4GMP1 3RMYA 2VNGA 1PMJX 2XPJA 1JN2P 2JD4A 4UWDA 3KD4A 5IW0A 3VLBB 3WF4A 4TTGA 4H7LA 3ZN4A 3U37A 3J7LA 1VRH3 4XFAA 3USUB 4LUKA 1ZBA1 3JZVA 4ASMB 1BVP1 2R041 5FMDA 4NWVA 1N3OA 5FBZA 5A7WB 3TN92 3ZPOA 1ZM1A 3RJRA 2VUDA 1C8NA 2XWJB 4D6SA 2YC2A 5FZOA 4WBBA 5F39A 2ZCWA 1DLLA 2NZ9A 1R093 5EQUA 3MIHA 3NNGA 2DCJA 5L9BA 1ZBE2 1JS9A 1NE4A 2XOMA 4GXLA 2UWCA 4LOSA 4TN7A 2ZEXA 1TG7A 2EIEA 3AJYA 1D2QA 1E5IA 2VTFA 1MS8A 2RS32 3W59A 4IV3C 2OXBA 5T5PA 4XQWA 5FYMA 3GXUA 1WD4A 1FOD3 4KWLA 1O59A 1GZCA 3H9AA 2VZ1A 2EXKA 3ZIXA 4CP1A 3MDPA 2VCBA 3H8UA 2OVUA 1XPWA 4LHSA 3ACHA 3I3EA 5A3UA 3AYCA 4NOTA 4Q27A 1BBT1 2WNUA 5L7OA 5FDBA 1FAYA 3DN7A 2F6BA 4YYOA 5DMYA 4J25A 5DAVA 1UCXA 2YBKA 3IDBB 1CAWA 4N43B 5EJ1B 3LD8A 4N8MA 4P9LA 4AEDB 1SLLA 3R4DB 4CCKA 5JXJA 2DVDA 2IXLA 1H1MA 2WO3A 4GB33 2I2SA 2A6ZA 2PHXA 4IEVA 1XNDA 3VBSA 1UYPA 4NIGA 1ULDA 1PHMA 3DYPA 2BV4A 2VUCA 4QKBA 3VHOA 3D6EA 4QKDA 3JUUA 4NIAA 4FFIA 4MGIE 5FYZA 3SKVA 3ZYHA 4WVMB 5ACA1 1A34A 2BGCA 3IWZA 3ZXKA 3J8F3 3JBG3 1V6IA 2H0VA 4KWJA 2UWAA 1QOTA 2DUOA 3JB4C 4LIVA 3T2PA 1UY3A 3HT1A 1CAXB 2WL1A 3LE0A 4X6RB 4H3WA 3WQ1A 4AVBA 1NLQA 4JKKA 1VP6A 1ONAA 2RS53 4GAZA 4QGMA 4A44A 1MZEA 1JTZX 4AFDA 3AK0A 3IDCB 4YM3A 2JDUA 1FPN3 1ZNPA 2ID4A 3VBFB 4A6OA 4OYUA 3NO8A 4MXVA 3RRDA 1G9BA 1QWRA 3WQBA 4GIQA 1AR61 2PHUA 1BLZA 1RMU3 2QQOA 2TNFA 3H1WA 2HJIA 2AGSA 3KV5A 1DG6A 5D8AA 3H8OA 4O9GA 5A3TA 2W9XA 3IDEA 4QX5A 2XJUA 3DEMA 1QJU2 3UGFA 5CFDC 3VZMA 4UXAA 1K5MC 3F2ZA 3I59B 4TWTA 1YIFA 4W6WA 4I30A 4D0QA 2ZX0A 3C8XA 4CYDA 3SC7X 2BEOA 4AQ2A 4AEJA 4BE3A 1FV3A 2V09A 1XJAA 2OA2A 2VECA 1BK1A 2VO5A 1VMHA 1H8TB 4L9BA 4CCCA 1ND2A 2WO1A 2ZHMA 3J7HA 2FCUA 5B4XA 5FAXA 2J1EA 2R073 2XR4A 3ITQA 4B4RA 4QQPA 1CZVA 4UBHA 5T5LA 2QQPA 2DTYA 1H1AA 4XDOA 4AHYA 1ZRCA 5GZCA 1O8PA 3THPA 5I0RA 3R0RA 1GLHA 2IVJA 3CZJA 5T54A 2GAUA 1OA4A 3VGIA 5A6QA 2JG9A 5KC5A 1W6MB 1DU3D 3M1HA 3MZHA 4OHYA 2BBVA 4UYBA 2C0ZA 5DAQA 2HWC3 1AR62 3LOBA 2XUEA 3DL3A 3F95A 3KGZA 5DPNA 3ZIWA 3CKHA 1CVNA 3SH3A 2O14A 3MV11 4DXRA 1DZTA 2W1QA 2E51A 3HQRA 3HJRA 3SH5A 2BZDA 2X8KA 2BPA2 2IWGB 1W0NA 3GDBA 4HPKA 2FDFA 2AC1A 2EIBA 5LWBA 1RVF1 3OYWA 3KVAA 4IE6A 5T52A 3M3CA 4KL1A 4IV1A 4L8QA 3TNPB 3AKQA 3ZO0B 2W08A 2ARBA 3FN9A 3WF1A 3AMNA 1ZRDA 3AB0A 1OKOA 1LOFC 4JRLA 2XVLA 4BLJA 5CFCB 3I8TA 1W9TA 4OZOA 3IPVB 3BOPA 2RJLA 2QE3A 2VXRA 3E6CC 3QH6A 3ZPYA 3V0BB 5FYHA 1GNZA 1X50A 4QXBA 3TNQA 2DVAA 3JQXA 3LF7A 3T0BA 1XNTA 3OBZA 3VDDC 3PIJA 3SH4A 3WNXA 1VRH2 5FP4A 1LRHA 1PK6B 2ZGOA 5CG9A 4E2SA 3MW4A 1ZZBA 1YRZA 4XQDA 5IVJA 5GLTA 2VG9A 3RNSA 1REEA 2ARAA 1IPSA 4N43C 4AEDC 3ZMNA 3NAPB 4AHZA 4FXGB 1YFYA 2HWE3 2JDPA 3POGA 3SISA 4EROA 5BNOA 1VBD3 4Q4W1 3BTZA 1R092 5T5JA 3PMSA 3ES4A 1HV1A 1PGSA 1W8TA 3HN1A 2Z69A 1YXWA 1Q5OA 1NE6A 4UW3A 2NP0A 1UIJA 5C9AA 3ABZA 4NIDA 3PLQA 1CZSA 3O5SA 1QQP3 3AVSA 3DCQA 4GWIA 2GN7A 1IG0A 3O0VA 4W8JA 5FZFA 1OVPA 2A5ZA 2D44A 1OD5A 2RR13 2ADDA 2DU1A 5GALA 1JZ4A 3U4XA 3CU7A 1W39A 4GKXA 3GGLA 4JCKA 4EE2A 2VTXA 3PURA 1W6QB 4PF1A 4LITA 4XQ4A 2JDNA 1FOD2 3ZM8A 2VVFA 3AZVA 1QKQA 1ZA7A 2KD7A 1NZCA 1JODA 4GQ7A 3B7MA 2ZGRA 4Y22A 4Y5TA 1RUG3 4AI1A 5L36A 1HB2A 2B45X 3BB6A 3N9PA 5FJHA 2XJTA 5LEJA 1WA6X 1OUSA 2F4LA 2AENA 4UFMA 2UY8A 3WEZA 2XL7A 2D6OX 4K6BA 2LRPA 3POSA 5A32B 1NCRB 2CDOA 4L99A 1CPNA 1R083 4GB32 3SMHA 3LPFA 2HEYF 1JYVA 3FHIB 3FLRA 4Z1VA 5FYTA 2G4IA 1CX1A 1ND3B 1SPPA 3D82A 1YJKA 2WA4A 4MSVA 4X6QB 3VBOA 3HR9A 5JXIA 4AGVA 3MFCA 3J8F2 3JBG2 1S0JA 4P02B 4ZS2A 1HQLA 5DDJ3 3FHQA 1H8TC 4K1YA 5AFEA 5FKCA 1RHI3 1IPJA 1GNHA 3NNLA 4Q0UA 1VBC1 1W2NA 4CDWB 4B4PA 3W20A 2RS52 5FPAA 5FZ1A 3X29B 1B35B 1JI6A 1JUIA 2OQ7A 3PU3A 4OMCA 4CP0A 3TEYA 2BDRA 1YI9A 3CJIB 1FPN2 3FWEA 4AL9A 4CZSA 1MEC3 1ACCA 1UYYA 2WO7A 3VBRB 2HWD1 2XXZA 5DUVA 2TBVA 5DAPA 1F8VA 1RMU2 1JYCA 4LBQB 5G05L 2A70A 1UZVA 4JTNA 5IVEA 1NYWA 1DGRN 1WGPA 1QJX1 1GOFA 1W90A 2VULA 1LGCA 1US3A 4J1WA 1COV1 2VBPA 3LZZA 4LO6B 1W9SA 1MS3A 4YNIA 4ISQA 1JYWA 2YBSA 3RG0A 5KBFA 1W9FA 4C91A 3Q8AA 2X05A 3VZOA 5CFCC 1OBNA 3NNMA 3IN9A 5BNPB 4QX0A 3ZKUA 3KM5A 1PO21 1D0GA 1LGNA 1FI2A 1MZFA 2GNMA 2R072 3FFQA 2K9ZA 2WBKA 3KHBA 4I3GA 1KJLA 2JXAA 4RHV1 4IEZA 5FZDA 2J1SA 3WQ7A 3WDTA 1NA1A 2KM2A 5GLWA 3ZLIA 4G9SB 2YU2A 4H55A 1KD7A 5LA1A 5HCBA 4HVRA 4YM1A 1PK6C 1W0OA 3BIWE 5FYBA 3FL7A 4BOWA 3OUJA 2VVEA 2IXKA 3KCYA 2D5HA 2HWC2 3UYJA 4DEVA 2EF6A 4YW6A 4RR3B 4MO3M 4O61A 5JZGB 1H6XA 4XMAA 5CISA 3RWKX 2NPIA 3KCXA 1UY4A 2Y64A 1CJDA 3AXEA 2HWB1 5A1AA 4Z2WA 4F3JA 2R16A 1AZDA 2XJSA 4FP2A 2JB8A 2ZGKA 2B46X 4AOCA 3H3UA 2CGNA 4NO4A 3HD8B 3VKLA 1RUE1 1ZVFA 1T6GC 5JOZA 3LEKA 4L92A 4YW4A 1S0FA 4QQLA 5CU1A 3WF2A 2VNVA 3IB3A 1POV0 5D2AA 4XFCA 5C4WA 3WDYA 3NL1A 4HFSA 3AXDA 2GDFA 2XBO1 3KCCA 3PHMA 3LFIA 3ZDVA 2X5IB 1EV13 3VD4A 1MVQA 3N9QA 1H2LA 2W87A 3DPRA 4ZXEA 5JSRA 2CYFA 4LHLA 4XFGA 5FOJB 4R9BA 1RJ7A 5T50A 3RI9A 1NT0A 1W8ZA 3WDVA 4JGYB 1NQDA 2FD8A 2G9GA 2WNEA 3ZXGA 3ILRA 4B4QA 1PGW2 4UFKA 5KXCA 2BP6A 4IUGA 3VB9A 1VBA3 2WRAA 4PF5A 1AL21 4IERA 4OHWA 3WVJA 3H0OA 4FOQA 4NN0A 1NCRC 4HL0A 4CDXA 4FTEA 4DO0A 1NLRA 2HWE2 3D3AA 5J36A 1YWKA 1O7FA 1VBD2 2XJPA 4YW2A 2HWB2 4QPGB 5FZAA 3NKTA 2R061 1KS4A 1ND3C 3N9NA 3J7MA 5CA6A 2WYFA 2ZGUA 4ISRA 1QQP2 1LGBA 3FLPA 3OBAA 1VBE3 1OFNA 1YEWA 2J1UA 3FUQA 2RR12 3KQ4B 1G6NA 2GMPA 5E16A 2JG8B 2EXJA 3LDBA 2JDZA 3WLUA 1B35C 1OMIA 1PZ9A 1GZWA 3U4SA 1H2NA 3OEAA 1AXYA 1H30A 1L7RA 1YQ2A 1W6OB 5ABJC 3SITA 3PUQA 5IAXA 3VBRC 4QDQA 5I0DA 1QIQA 1RUG2 4FPLA 4M01A 3BPSA 4QHOA 5FV3A 3BUCA 4KBZA 1U0AA 2G9ZA 2ZGTA 1UZWA 4BM8A 3S7IA 2MNGA 2VNOA 2ZOEB 1GWLA 1CAUA 2EIGA 2N7GA 1V00A 3ILNA 4NHLA 4L97A 3OGSA 4XW3A 5DN2A 3LEIA 3VBHA 2CY6A 1R082 3HMYA 3PVNA 1OHFA 2WJSA 4A6SA 4HK9A 1EPZA 3DF0A 3ZXJA 5BNNA 1PIV3 2RJ2A 3V56A 4D6RA 3O1UA 2XLAA 5B4NA 1BHGA 3FZ3A 5T3NA 1HRV3 5FZCA 4AI8A 2CAVA 1PGL1 3L2HA 3O7OA 2RDSA 3UKVA 5KHKA 4JKMA 2I74A 2JENA 4JQRA 1RHI2 4RGKA 4DPNA 2ZGSA 2BVVA 1XE7A 1BJQA 4LO8A 3U10A 1W8OA 2CWMA 4HN0A 3SCFA 4YW7A 2CHHA 4FFHA 4CXXA 3MUZ1 4BQWA 1MEC2 2JX9A 4Q4X1 2RMU3 3UV9A 4C0HA 4XFIA 3I49A 3RZLA 2PLV3 4RYDA 5L9VA 2LALA 3GM8A 4Y5Z0 1GP4A 4DXZA 1M4WA 3LEGA 3LIHA 3UGGA 4DUWA 1M06G 2ADEA 4F83A 3M70A 3KZ4C 1VAVA 4RR3C 2WQ4A 4XXPA 5A70A 2DTWA 2VH9A 5JWPA 1IKQA 1QY4A 3IAQA 3ZSEA 1AHSA 1WUVA 5IFPA 3MLKA 1UN1A 4RQPA 3AJZA 3MPBA 3VV1A 3I54A 3QLQA 4RN5A 4WM8A 4Z92B 1HKDA 3I3DA 2GP5A 1HW5A 3TBDA 1W03A 4A45A 3U1XA 1KITA 4CP9B 3H3LA 5BNQA 2CWSA 1MVEA 3TWIA 4JDNA 5FREA 1K12A 1LHWA 4JDOA 1G9DA 2W91A 1AJOA 2ZGLA 2JDKA 3KVBA 4S2HA 1GZ9A 5FZKA 5IFTA 2HKXA 4YFZA 2ZHNA 1UF2C 5J98B 4MGTA 1WBLA 3N4MA 1YUDA 2BNOA 2XLGA 2EAKA 4K8FA 2RM21 4MGSA 4FBFA 1RINA 1BYHA 3T1LA 3ZFEC 1JBCA 2X5IC 3AYAA 1MS5A 4META 2VC9A 2ZX3A 2RV9A 2PHWA 1MQTB 2Y6LA 5A3OA 3ZFFB 5CZKA 4Q4X2 3WHTA 4JGZB 2DDUA 2E6VA 4BPZA 4XURA 3WCSA 2VZOA 5A7OA 2GALA 1AVBA 1OA3A 2IC1A 1LTEA 3RPQA 1NAEA 5IVYA 3R4UA 5DUXA 4LKDA 5G04L 2VE1A 4QPIA 4V2VA 1A3KA 2JG9B 1RYYA 1XSQA 3JD73 4FPEA 5JXGA 1ST8A 4MHUA 4LLOA 4QPGC 1UYZA 1WKYA 4QM9A 4CDWC 4OMDA 2QQJA 1HRI3 3BYWA 4CDQA 1GU3A 4OLLA 1RTVA 3N7JA 4JX0A 4N7UA 4QDSA 1GWMA 4XDQA 4Z82A 4D8MA 1Q43A 1RXGA 3IZOA 2QZ2A 1EAH1 5FZEA 2Q8DA 5CKQA 3PTRB 3VZJA 4TLFA 4KI5M 1RUI3 1W04A 2XVGA 5C8CA 2WT2A 4IEQA 4ZY9A 1F35A 4XCAA 5FFOC 2RS11 3T0AA 2W0XA 1S0CA 1V6OA 1XNAA 4PHZA 1EV12 1I5ZA 3W9AA 5F6LB 3BOWA 3CJXA 2UU8A 3KB5A 1SFNA 3KT7A 5SV5A 2HEVF 4Q2FA 3INAA 5FP8A 4W6XA 2PFWA 3O1PA 4FPKA 1EY2A 4IV3B 3AP9A 4MGZE 1Y7BA 3H7JA 5F3GA 1PVXA 1WCSA 4FTBA 2W1WA 2Q1FA 2WS93 3HWJA 1TMF1 3UJQA 4UFLA 4CRQA 1VBA2 2BWAA 1EYBA 2OPWA 2ZX4A 3GBFA 1AR83 4UFJA 5FY7A 2XONA 3MHZA 1JYNA 2AEYA 1RUJ3 1RUC3 2CNAA 4IE0A 4C0BA 1HQWA 4XEZA 1PO13 1SMVA 4XTMA 2WNUC 5L7OC 1DP0A 3PIGA 1W8HA 1WMXA 4Y1VA 4YZ1A 1F5JA 2O1QA 1LOGA 3ACFA 1FMD3 4QWNA 5JIAA 1NOVA 5EIYB 5IK4A 1VBE2 1EAH2 5BNOB 3M4FA 2ZMNA 2ZX1A 4YVSA 4JKLA 4AI0A 1BMV2 2R32A 1GICA 3VBSC 2JIJA 2ES3A 3EMRA 3T1MA 2P3IA 4DXTA 2PXJA 1VBB3 4B7KA 4CEYB 4H2AA 1UIKA 4S2DA 4MGYE 4P9GA 3E5QA 2VPVA 4KQ7A 4LHKA 1UU5A 2AR6A 4WM7A 1MS9A 4EZ4A 3LCPA 1A8DA 1IQAA 2F17A 5JI7A 3CNAA 1CAVA 2J1RA 1AYM3 5JIUA 1R1A1 2VY0A 4N9IA 4GALA 2GN3A 2C9AA 1CN1A 4MVTA 4URAA 1JUHA 3K4DA 1MS0A 1GOGA 1WW5A 3OG2A 3E6BA 2G1MA 4AR2A 1U5XA 5L73A 2F4PA 2ZAHA 3IIAA 2BWCA 4QXKA 3TN91 1O3QA 1PIV2 2BBAA 2DVFA 5D8AC 1H4GA 4PT6A 4NPLA 2OUHA 1JH5A 2ZS6B 4QHZA 4COUA 1HRV2 1PMIA 5IYYA 1UL9A 5IVBA 5IK5A 4ORFA 1IS3A 1K5MB 1O3TA 4K3UA 4IE4A 3OPZA 5A6ZA 3NQHA 5BUVA 1ZBE1 4V1PA 5DZEA 1SPPB 4QX8A 2PQQA 1JZ7A 4H14A 3QACA 4XUOA 2W5FA 4A3ZA 3ALQA 1LHUA 2VOWA 3OPTA 4K9SA 5CKNA 2RMU2 1MQTC 3OBRA 3VBUB 4FVVA 4KNCA 3CL1A 1C8M3 2RS31 4JGZC 3K4AA 1OF4A 1RJ8A 4D7TA 2SLIA 2W92A 4MUVA 2IUWA 1J1LA 1UOFA 1SACA 4Y1XA 4CDUA 1J83A 5A7SA 2XWBB 1F5FA 4HZFA 2W3JA 4MXWA 3WDWA 2JG9C 3O14A 5FZ6A 3MIFA 5FP3A 3T08A 1BVVA 2DFCA 4JV4A 3VDAA 3LGRA 2QBXA 4WVVA 4D7YA 1O5LA 1LHNA 1UAIA 4M3CB 4XUNA 3NVCA 4CEWA 3AKPA 4LA3A 4NUBA 3I2DA 4P00B 4AXOA 4Y26A 1OH4A 3FMGA 3S0MA 2BJSA 4GKYA 3NKGA 1V9U3 3J26N 1OT5A 1JU4A 3POWA 3GNEA 4ONUA 2DUQA 5KHJA 1L7LA 1YNAA 4YZ3A 3MF6A 2AH2A 5IWFA 1VAKA 1WW4A 3WUCA 2VZQA 5FMOL 4I0WB 4PJYA 1QXRA 3HQXA 5I93A 5F3CA 1UOGA 1W6NA 5EP9A 5LBBA 4CSWA 3AYEA 1UOBA 4QB6A 2WYSA 4O65A 3BI3A 1F9KA 4I3PA 4YPJA 3UETA 3VDDB 3BALA 3TEXA 4Q26A 3DYMA 1S2EA 3K2OA 3PNAA 5ANNA 3T2TA 4DS0A 4P9XA 3MLLA 1N3QA 1Y9QA 5F5IA 1NZIA 4AW7A 3JD72 3FLTA 1NY72 4K8RB 4I09A 3ZDSA 1GBGA 2W47A 1W6PA 1XC6A 2GZWA 4K21A 1HRI2 4BISA 1LECA 4Y20B 1N1TA 1SCSA 2BVBA 1L7QA 1EUTA 5FY9A 4LK6A 1QJU1 4XIOA 3U11A 1DQ2A 5I0UA 5BNOC 4CCOA 1QEXA 1U5YA 2SBAA 4C1XA 1OLRA 4QXCA 4CEYC 5JI9A 3OY8B 4FOWA 3B69A 3LIGA 4IESA 2XHNA 4PI0A 1HXS3 4JTOA 4E4ZA 5LY1A 2XB6C 5A33A 5FK8A 4I02A 3ZSLA 3EJKA 5GZFA 1RUH3 2UY9A 2WAOA 4LULA 4OI4A 1VALA 1W99A 3AP7A 1OVSA 1XSRA 1V6KA 4UFIA 2WZPP 5GZEA 4IEPA 1X36A 2WS92 5FY5A 1LOCA 3GZTB 3ZN5A 2WNVA 1O3RA 1AR82 4UF0B 1GMMA 1NCQA 2Z5WA 1GR3A 4URTA 4CCEA 1H1IA 1FV2A 1RUJ2 1RUC2 2BTVC 3E5UA 3NJXA 1JZ3A 2FDGA 4FAGA 5FY0A 3AMHA 2B7YA 3PUHA 1LNSA 3KSCA 3MBWA 3WINE 1BEV3 3WNNA 1WZXA 1A6CA 1S1AA 2RG4A 5FUNA 1LOAA 2BNMA 5FLJA 1DZQA 1FMD2 1N1VA 1PNFA 2NMOA 1LJ7A 4CDXB 2EIDA 4YVWB 1O3SA 1ULOA 4UBGA 1DGLA 4AGRA 3NNJA 2D3RA 2VOTA 3PU8A 1NX9A 1VBB2 3MLJA 3QH7A 3TYJA 3O1OA 1AF9A 2MEV3 1UPSA 3OGRA 3IAPA 2I07B 5LW9A 4M00A 3K3OA 5CEHA 4HMZA 1JHJA 4M4PA 4BWOA 4BMEA 3VBUC 3GBGA 5C3QA 1AYM2 3T09A 2ZACA 4LKSA 2Q0AA 5EYXA 2XQXA 4LO5B 4K40A 4LXLA 1CD3G 1ULPA 1QMJA 1LOEA 3I2HA 1VRH1 3UKTA 1BKZA 4EN0A 1TME3 4FT8A 2JECA 4I0BA 3VD9A 4FI9A 4E4SA 5KWRA 1IZ3A 1MACA 1YQ5A 2D7FA 2OIIA 5CYYA 5F2SA 4K20A 3I97A 1C1LA 2HWF3 1E57A 2WLPA 2Z42A 2FMDA 3WHUA 1SLAA 1UX6A 2R30A 3OUHA 1OOPA 4QX7A 3WNMA 3RSJA 1I1EA 1J59A 5F5AA 5IK8A 1Z78A 4LJHA 4XUPA 2A73B 4XJWA 1DZRA 1R091 1SDWA 4EYUA 4QX2A 2CAUA 2VCAA 2E7TA 3VKOA 3V65A 1DHKB 3OB8A 1YHFA 3EYPA 5FZHA 1OFSA 3I3QA 1LR5A 5DAXA 4QM8A 5H9QA 1WWYA 5E6HA 5C70A 1H2KA 1AUYA 2VR4A 5E89A 1XE8A 4KMQA 2XHKA 4ZPIA 5A80A 4NIIA 4COVA 4QKNA 2VMCA 5JLVA 1B09A 1UZYA 1ZA4A 2ZAAA 3J9SA 3PTYA 3BU0A 1C8M2 1A78A 3FBMA 3NV1A 1ULFA 2QQUA 3MUY1 1FT9A 4IGOA 1NA1C 5H9PA 1FOD1 5H9SA 4XBLA 2IVIB 1WW7A 1DGWX 2VMEA 1Y43B 2AEZA 4FPCA 1UZ0A 4LLFA 5FMBA 3OEBA 5AFBA 1F2NA 4YM0A 3R6SA 2GNDA 4B1MA 3WV6A 4A3XA 1K42A 4N7IA 4QQHA 2HH9A 5BXXA 1NQJA 3ZX7A 4YGBA 2JIGA 2W39A 2DVGA 2C24A 4I2OA 2J1AA 1KEXA 3AP4A 4AF9A 1NXMA 4RS5A 4GB31 3R4SA 4WM8B 3WDXA 1UZZA 3ZR5A 1V9U2 5APAA 1OQDA 2D6PA 2NLRA 5FY8A 2WZR3 2W52A 4WZCA 4JAAA 2R0FA 1ODMA 3J8F1 3JBG1 5FZ9A 5BPXA 2ILMA 1XU1A 2Y60A 5FKBA 2XG3A 2GU9A 3UJOA 4E4HA 1J3PA 5K4LA 3CO2A 3T4HB 3VD3A 4BK4A 5A7NA 5CKMA 2RS51 4V2WA 1Q56A 1I3HA 3K77A 3PMEA 2GC3A 2WSVA 3WR0A 4QDRA 4O7XA 5FXWA 3P3PA 2HBTA 1FPN1 4D7SA 4A2UA 1WCUA 2D98A 3DPRC 2JE7A 3LA3A 5LB6A 5CADA 1J1TA 3MW3A 2IXHA 2XLFA 1UY2A 3WP6A 5C3PA 4UW5A 2WINB 1G86A 5JMCA 4Q4Y3 1RMU1 3LQCA 3KT1A 4OFGA 1HB4A 5L19A 4TLGA 2Q1MA 4BXFA 5FRAA 3FJSA 4R9CA 3QOPA 4XAAA 3SKJE 1KS5A 2UWBA 4Y1UA 4N53B 4CDXC 4YVWC 4P5YA 4LNVA 2UURA 3S30A 1OI6A 2BGOA 2XL9A 4UW6A 4TXWA 5DABA 3N9LA 1F4HA 1UO9A 3JXSA 4A7ZA 2YBPA 1POV3 2RE9A 3O0WA 4CU7A 2VBBA 1REFA 4FFGA 1HXS2 5A3WA 5CBLA 1Q3EA 1U5IA 1AXKA 1DQ5A 1DCSA 1O6UA 2R071 4HG6B 1RUH2 2ZTNA 3OPWA 1PM7A 1XB9A 5FUPA 2XMLA 5F2WA 4CPBD 2ERFA 1LU1A 1QU0A 1K5JA 3AZZA 3E5XA 2CGPA 4XIKA 5ABJB 2RDQA 4LBQD 1G7YA 1ZZ7A 4YW1A 3U07A 2B39A 4BQXA 3SXWA 4GD4A 1ENSA 1F15A 1PVC3 1WLTA 2R063 2HWC1 2Y34A 3T0DA 1GUIA 3BPZA 1BEV2 4NRQA 4HK8A 5F3EA 1C5HA 4A42A 4GA9A 1EPWA 2DV9A 3EO6A 3UT0A 2EAAA 2Y6FA 3M3QA 5FOBB 3I7DA 2VU9A 2RDRA 4YGCA 2V5YA 2AUYA 1N3PA 2JDMA 1AL0G 1GANA 1W9YA 1V6JA 2W94A 3O1RA 3LEMA 3LA7A 3KHCA 1WW6A 1QNWA 1SBFA 2MEV2 4YLZA 5LBCA 1LENA 1GV9A 3GBWA 2P6HA 2D5FA 3S6PA 1GQGA 2RDNA 3USUA 3ZVXA 5HXVA 1RUD3 1GNYA 1ULCA 4FSJA 4N9HA 2R49A 4SBVA 2YZ4A 5A7WA 3RZZA 4HOOA 1J84A 3V64A 5GZGA 4YRDA 3V0AB 4Q4V3 4OI1A 3ZOIA 2NMNA 2FCTA 3GF6A 1ZZCA 4TSVA 2WR9A 4JZRA 2V4VA 3D8CA 2ZGNA 2VZSA 2Z2SB 5TSWA 4LEJA 3ZYPA 5FYSA 3I3BA 4E27A 3OD0A 3AP5A 3UKNA 1Q8VA 1G8WA 1TME2 1PZ8A 3ILFA 3MIDA 1CAVB 3WW4A 5GLVA 4OI0A 2VJXA 3GZUC 5EHDA 2PHRA 2V4AA 1D4M3 2EA7A 1PGW1 2OUJA 3Q8EA 3O0XA 5FIXA 1AR93 2YUEA 4EWAA 4IXLA 4E2GA 1Y9GA 3HEIA 1Q8OA 2ZMLA 3N7LA 2BFUL 3OOXA 4BHPA 2WWUA 1DF0A 2HWE1 1VBD1 1TNRA 4GJYA 2PMWB 4WM8C 1YCIA 4HKLA 4OUSA 5K0UA 4FOYA 2GC1A 2PHDA 3POIA 4XF0A 2JEMA 4DQAA 2DVBA 2DFBA 1HB1A 3SLIA 3ZYBA 3W5MA 1R1ZA 4CCMA 4QU2A 4IGPA 3NJYA 4FPFA 1YC61 2WFF3 1QQP1 1UMHA 4FCAA 3OTFA 4NWWA 4C8DA 5HXMA 4EN8B 4LT5A 5FLHA 2RR11 4DOUA 4AVSA 4ZONA 4CCJA 2QQLA 4WV8A 3ECQA 3CQOA 2WNOA 4DUXA 1QJY3 4N43A 4AEDA 3ZFEB 4IE7A 5LBFA 3WNLA 3PVOA 2B8MA 2G19A 3G7DA 5JOWA 1RUF3 4ZU5A 3ZSKA 1U5ZA 3ENRA 1XNCA 4LBMA 1RUG1 3NJZA 2VNRA 3P1IA 4LBOA 4Q1RA 2Q8OA 1HN0A 3IIIA 5EWSA 4EV0A 5FBJA 1LHVA 4WVMA 3KF5A 3TRSB 4Z07A 4GWMA 3KV4A 4IETA 4EJRA 4LK7A 4LE3A 4H7MA 4A7KA 5FZIA 1CAXA 4KU7A 1R081 1GP6A 4N53C 4PQ9A 3CBNA 2KXLA 5JR7B 2R7EB 2RM23 3K4ZA 4AFBA 1EP0A 1CWPA 4YW3A 2JDAA 4PI2A 3VKNA 3RDIA 4AHWA 3VBFA 2DBIA 2VQ0A 1C28A 2IFWA 4CU9A 4QQ2A 1JYIA 4YZ4A 4XETA 4BJ0A 5FZOB 5AC93 5JPMB 2GC0A 5FYVA 1BCXA 3USSA 1QF3A 3PDQA 5DDJ1 2WLQA 2DU0A 1TQ5A 4LTAA 1RHI1 2YROA 2B5HA 1YO8A 4MZUA 4Q0VA 4MV2A 4FFFA 5FR3A 1GSLA 4NPRA 1W8FA 3ZXEA 2ARCA 4AG4A 4QB2A 2GNTA 3PUIA 1JYTA 3C7GA 1MEC1 1STMA 4B8EA 4FQZA 3I59A 2QQIA 1Z7S3 2P3YA 3KV9A 3WY6A 2W68A 4E8CA 2J1TA 5J1XA 5JPNB 3KMHA 2ORZA 2UYBA 4Q1PA 5I0TA 1K45A 3RWNA 4AI2A 2DYCA 1J58A 4Q4Y2 3H42B 4Y4RA 2P6CA 3H1MA 4LKFA 2D97A 4RA0A 1CONA 2DCKA 3HNBM 2A6YA 3ZMOA 1HDKA 5GLUA 4P9JA 5LA9A 1OA2A 1SFPA 1AR73 3LA2A 5HCAA 5FYIA 2WZEA 1AYN3 2WNUB 3OGJA 2P3JA 5L7OB 2GC2A 1PZ7A 3APBA 2YFZA 5LA0A 3C2UA 3ACIA 2ZA9A 1ULGA 1SBEA 1CAWB 1DQ6A 2C9KA 1W6MA 2WT0A 4ZS3A 3ORJA 2CGOA 4DXSA 3AX4A 3BIEA 4BU2A 5DDJ2 2VZUA 2W1SA 3VBSB 4YVSC 5A3MA 3QCWA 5FZ8A 1IKPA 1IS4A 1DQ1A 4PQQA 4OHVA 3WNPA 1O8SA 4IDZA 2WQ8A 4FPGA 3GCWA 4MH0E 3P5BA 4M3CE 4DFSA 5I91A 5H9RA 4KBBA 3R05A 4XJUA 4BIFA 1JOPA 5FYYA 3A21A 4UW4A 3WNOA 4MHRA 3ZXFA 5A33B 3QD6A 4IGQA 4PIXA 1QDCA 3GHMA 5FZMA 5FZLA 4CCNA 1XU2A 2VCCA 1RB8G 1PVC2 3WF0A 1SEFA 5CFCA 1DGRA 3IM0A 3CDZB 2QFEA 2ETEA 1LHOA 1ASJ3 4QAWA 1OD3A 1TVGA 3CZUA 4NJ4A 4Y5SA 2Q8CA 3THTA 3AZYA 4BIOA 5A1FA 5KXEA 3V0BA 3OUIA 5FYUA 1BXHA 4XHBA 1VB4A 2HLEA 4HSLA 1X7NA 4R4XA 4Q29A 4S2FA 2VQUA 5D8AB 4NAMA 1I5PA 1W2UA 3EHKA 3WCRA 1CGPA 2QQKA 2HYKA 4IE5A 4D6QA 3K48A 1ULEA 3K51A 2OX0A 4UFHA 5FZ4A 3S57A 1RUD2 4W6YA 2D40A 2WUHA 2E63A 2A3WA 2VUAA 1DQ4A 1CX4A 4Q5OA 4YWAA 4OULA 1N1YA 3RFRA 4CUBA 5DQ0A 4AI3A 2QVSB 4AYUA 1OQEA 3K46A 4Q4V2 1EV11 2ET1A 2Y6JA 2RJKA 3NAPA 1OURA 4MX3A 5JOXA 1I9RA 3B3QE 3D5OA 3D0SA 3S5AA 3H3ZA 1ND2B 3ASIA 2YV8A 4XOGA 4BQ1A 1VAMA 2XH6A 1IQDC 3OGVA 2HYXA 4XAEA 1D4M2 3WUDA 1V6NA 4B1LA 1AR92 1GWKA 3A22A 5IAVA 1VBA1 4PDWA 4X8PA 5EV7A 3AMMA 1W28A 5F6KA 1QHDA 2ZGMA 2V72A 4NRMA 4RFT0 1WD3A 2FBEA 5IHRA 4HETA 5JR2A 4BQ4A 4S2GA 1W6QA 3M8LA 1JMUB 2EALA 3GYDA 2PAEA 1DLCA 5KC6A 2QJVA 2XKPA 3N9MA 2WFF2 3SEEA 1VBE1 5T5OA 4HPKB 3JB8A 1E5RA 1BMV1 3OYWB 4WZFA 4BQ2A 1X8EA 4IV1B 4WVWA 4GMP3 5FXXA 1QJY2 1Q8SA 4XZPA 3UESA 4AVAA 5C7GA 5C8WA 5I8YA 5EZWA 3SQOA 2GSYA 3DECA 3ZXDA 4TZDA 4JRAA 1W8UA 1YQ8A 4AAPA 1HX6A 1KDMA 1ZBA3 2VUJA 2WO2A 4JHTA 4LIUA 3RMXA 2R043 4E4DX 2HEWF 4LUMA 2QDRA 1CQ9A 2VZTA 3SEPA 1AJKA 3FE5A 3NV4A 1WMFA 2V5DA 2E26A 2YDEA 2IFRA 3MF9A 2Y8KA 2VZPA 1S55A 4CDWA 2P3KA 1B35A 1MR5A 5BV6A 1H0BA 3E97A 5KHIA 4GJZA 1FNYA 2YC4A 3LSEA 1PIV1 2O0OA 3CJIA 4XUQA 3T3YA 4DY5A 1DQ0A 1UKRA 3KGLA 1YFUA 1ZX5A 1ODNA 2HBUA 4ES9A 1HRV1 1IOAA 3ATGA 3LDKA 3SCGA 5IJRA 3MW2A 3N35A 5A7PA 3ZYRA 4RS5B 5AC92 5C3RA 1JXNA 3RZKA 4OZXA 1C3HA 1W0PA
chains in the Genus database with same CATH topology
3VZKA 2ZJCA 1DYPA 1HIXA 2NM1A 4IEWA 1HQNA 2PHLA 4B29A 3M3EA 5C9AB 2RMU1 1Z7S2 1BBT3 4G4FA 2Y26A 5JSPA 3VL9A 5HCFA 5JCTA 3N7MA 3OBTA 4J1XA 4KGQA 1XQNA 2OZ6A 5BNPA 2PHFA 3C3VA 4FPJA 2WNVC 2D6LX 5SV8A 1NCQC 1AR72 4Y22B 3HBZA 3RS6A 1KRIA 1AYN2 2B9UA 2H6CA 2VOVA 4YZ5A 5LRSA 4FAHA 2OPKA 5ACA3 5HBAA 3SCHA 1OSGA 3NV2A 2PAMA 3GALA 1YLLA 1ZRRA 4KU8A 5E8AA 4KGGA 2JE9A 4BA6A 4XF1A 3TOJA 4RR3A 2K0GA 5CNAA 3OJBA 3ZSMA 5JZGA 3VBOB 1A8MA 4MLOA 5K8SA 1XXNA 2ENRA 1ZYBA 4GMP0 1AR63 2PLV2 1YFXA 1ND2C 1X8MA 1D0HA 1Q8QA 2ZX2A 5CG8A 1MZ6A 4XF3A 4ZU4A 2ARXA 3H7YA 4DINB 2D93A 2YMZA 2YGLA 3MICA 4AHXA 2D6MA 3JCIA 1WCKA 3JD71 4ASLA 3ZSJA 1OPMA 1NY71 3MGUA 4Q0PA 5BY5A 1QDOA 1HRI1 5JOYA 1QXJA 4BYYA 1IS6A 3WX5A 1OOPC 3GZAA 4JGYA 5JVVA 1RUI1 4Q0QA 3ZYGA 1DFQA 2QDNA 5KHHA 2X53S 3TB0A 3NV3A 2D6NA 3KT4A 2A6VA 4IV1C 4YSFA 3ROUA 1J3RA 1S0GA 4OHZA 2AREA 3M3IA 4HKWA 4L2NA 5CAZA 4QPGA 1YJLA 2Q5TA 4HN1A 2ZHKA 5FMOS 3HAGA 2A71A 3JQWA 1LEDA 1ZZ6A 1NA1B 2VW1A 2WS91 2IXIA 3B01A 1AR81 2BW8A 2JKBA 1RVF3 1RUJ1 1RUC1 3UK9A 3ME2A 2OW4A 1XYOA 2JG8A 1UU6A 1PO11 3AZXA 4P14A 4RGAA 3AKTA 5CB7A 3L9JT 1W6OA 2CV6A 1L3JA 4GH4A 2E7QA 4HLTA 1FMD1 2BQPA 4INDA 1C57A 4RS5C 4QHBA 5IT6A 4M3CF 3WP4A 2Y0OA 3B93A 1RUI2 5K0UB 1V70A 1VBB1 3A0NA 5DG1A 4COZA 2NN8A 5KXBA 4TYSA 4XF9A 2JJ6A 3VHPA 1X82A 5C9AC 4COWA 1ZBA2 4QPYA 4R52A 1H9PA 2R042 3L2YA 1AYM1 3OGGA 1BZWA 5C4WB 2QCSB 2Q4SA 4ITCA 2V73A 3KLSA 5AVAA 2WC2A 4AWDA 5J96B 4RL7A 1UD1A 3DPRB 2BYVE 4P5HA 4Q4W3 1RC6A 5KHGA 1PO12 1REDA 2Q1ZB 3LOIA 2XJRA 2FHRA 5J37A 1NLSA 4DZGA 2ZZQA 4XYXA 3ZFGA 2IZWA 4YARA 4GWNA 2YY1A 2E7AA 2Q30A 5DZGA 4YW5A 4DY3A 4XXAA 3AFKA 3JU9A 4OUMA 2WIIB 1KXGA 5FO8B 4M0NA 1D2SA 2BUKA 3VBOC 4JDMA 2FZ2A 2H0BA 4P9YA 1OKQA 4P9WA 1BBT2 1QGLA 3DGTA 4FXKB 3WG1A 3WQ0A 1C8M1 4DNYA 4LBKA 1AXZA 3O12A 5LK7B 1GZWB 4G3YC 1QH6A 4ZKTB 1VB2A 2ATFA 3OD4A 3VKFC 4IEOA 4B3NA 5LEKA 4KG0A 2GH2A 2A6WA 5IUQA 1ENQA 1YI7A 4W65A 1O91A 1LODA 5ACA2 1S0IA 4XJAA 2GH8A 1MQTA 1WBFA 3ZFFA 1CAUB 2C5DA 2OYZA 2PAKA 4JGZA 3VBHB 2Z79A 3URFA 4AFMA 3MPPG 1VBC3 5EJ3A 5GZDA 1V9U1 2QNKA 3VKMA 5BNNB 4AEMA 3H50A 1JHNA 1O4TA 2XUMA 3IT8A 2HWD3 3AMPA 5KXDA 1YIPA 2G9FA 3J4UH 5D1IA 1SBDA 5F5QA 3B02A 1QJX3 4XFHA 3DKWA 3B9CA 1DBNA 3MIBA 4WVZA 3ZYIB 1COV3 2LUWA 4BMBA 4U36A 1F31A 4AVVA 1NXD1 2FMYA 3PVBB 5A3LA 1O4YA 1S2BA 1C1FA 2VVDA 1G9CA 4Y24A 1LU2A 1N1SA 3WW2A 2LM3A 4QQOA 4AE2A 4D69A 1PO23 3AMQA 4RQPB 4IV3A 4RHV3 3AYDA 5K0UC 5IK7A 1IS5A 2C1FA 4X8NA 3RYKA 2WT1A 4DMIA 1O4ZA 4R4ZA 1SQ4A 3OCPA 1HXS1 4J6GA 5FCCA 3RI8A 5I8SA 1RUH1 1IPKA 1HV0A 3AFGA 1JW6A 4HT1T 1WLDA 5C4WC 1ZREA 1URXA 1UW8A 1GYKA 3PJQA 3KS7A 4O9EA 3VZLA 1RVF2 2HWB3 3QBQA 1GKBA 1TEIA 4DRRA 4XHXA 1MS4A 1QOSA 4CEYA 1BEV1 1IGOA 4FP3A 3U0ZA 1RUE3 4PDWB 4AVCA 4Y1YA 3M7AA 1AX1A 4QPIB 2XGXA 1WMDA 5E1RA 2A75A 5GJ6A 4FOVA 3WG4A 2XBO3 1VR3A 2MEV1 4CDQB 4RSUA 1LKNA 2DWRA 4QD2A 2AYHA 3NWKA 3VBFC 5C33A 1QH7A 1RGSA 1LESA 4Q0SA 1QOOA 2ZABA 4PLNA 4XTPA 2PTMA 5B2GB 5C8CB 1CIWA 1KFUL 4XE9A 3RJ2X 1AL23 5JDBA 5CFDA 2EXHA 4R9DA 1C4RA 1K5MA 4GULA 4Q4W2 3WZ1A 1TME1 1X33A 2ZGQA 4I0AA 4K7JA 5K9YA 1RUNA 1LB2A 2HWF1 1ENXA 4BLIA 4YGDA 2ZHLA 1WLCA 2WA3A 3VBUA 5FQ0A 4LA2A 4LBJA 2DCYA 4YFWA 1H8VA 3VBHC 5J3UA 4HKOA 1WLWA 4RGGA 5BNNC 2VW0A 5EFUA 3EXUA 2TUNA 4U2AA 1QJZA 2D6KA 4B7EA 1QNYA 1XRUA 2DCZA 1ZRFA 2CTVA 4QT6A 3WP5A 3FX3A 4LR4A 1LCLA 4YVSB 5BYNA 3LB9A 4M3CA 1CPMA 3A0KA 1CESA 2PELA 3S7EA 3VN4A 1S0BA 3N36A 4NR1A 4MYEA 2ZBJA 4EWEA 5F9TA 5CVRA 2WSUA 3EBRA 1UU4A 4WM7B 1PNGA 2O8QA 1DIWA 4K1ZA 1LOFA 1OLQA 1UMZA 1S2KA 3SHRA 4EN9B 1FATA 2EXIA 2XJVA 3IMNA 1J3QA 2HWF2 5DUUA 3LSDA 5C6CA 4D94A 5JAXA 1LOBA 2Y38A 4XMIA 2YYOA 4PBOA 4RQPC 5T55A 4EN7B 1VBC2 4NHKA 3VDDA 4ES8A 4OVEA 3AP6A 2BFUS 4OHXA 2YHJA 2K2SA 2WZR1 4AQ6A 4M0HA 2E9QA 2ZZJA 4Q4X3 1MS1A 3WOGA 3CF6E 2HWD2 1Q8PA 4HBNA 2FZ1A 3IBMA 3MIGA 4CTEA 2P17A 3M3OA 1DDLA 3POYA 4Y20A 5F1RA 4E9KA 1QJX2 3ELNA 2VQAA 1XYNA 3NAPC 3RYRA 1COV2 4Q4Y1 1XYPA 4HVQA 3LWCA 2ET7A 3OY8A 4R9AA 4FQ4A 3ZXAC 4PLMA 5JSOA 3D0JA 4PDWC 2A3YA 4CDUB 1PO22 2GMEA 4MXWB 3ZN6A 4QPIC 1S0EA 1XNBA 4RHV2 4XILA 2YC0A 1BQPA 1POV1 2WZR2 4FPYA 4CDQC 3VL8A 4CEWB 1ALYA 4P9IA 3WXPA 4COYA 4IEXA 2P2KA 5EYYA 3ST7A 5C8CC 2H6BA 4BZ4A 1WA4A 2RHPA 5I8TA 2DURA 1FNZA 2ZKLA 4RD7A 4ATEA 4YVWA 5FTTC 5GM0A 2PA7A 5AVPA 4PIYA 4Z8BA 5GKAC 1OPOA 3ZXLA 2NQYA 4R8HA 1W6NB 3WW3A 1SCRA 2VMIA 1PVC1 5GLZA 2IXCA 1VLNA 1SLIA 4N90A 4XFBA 4AK3A 5FO9B 2R1DA 4EWDA 4YG6A 1RUE2 1Y3TA 1EAH3 4IEYA 1H8TA 3PJYA 4DB5A 4XF4A 2VMGA 1FXZA 3ZYJB 1WCDJ 3MEPA 2FQPA 4YG3A 4AVTA 2P34A 4YGEA 4SLIA 3WD5A 2YPJA 2RS13 4CDWC 2XBO2 1SLTA 4YM2A 2WWSA 3PVEA 1I6XA 2VMHA 1W6PB 3A4UA 3CJIC 1JOJA 5DUWA 2ZPXA 4GH4B 4HSJA 3RQ0A 2DF7A 4NVPA 1KQRA 3AZWA 2WFPA 1RUD1 1C5IA 5DXDA 3ACLA 1GFF2 1RL3A 4LE4A 5HI0A 5I0SA 3MYXA 4C90A 4PLOA 2R0HA 4Q4V1 1TMF3 1AL22 3M2MA 4FPHA 4AQTA 5EXOA 2B42B 2A3XA 1NG0A 5J7MA 2WQZC 4WM7C 3IKWA 4Q8KA 4AGGA 2R062 4KG8A 2PHTA 1D4M1 4PBPA 3AKRA 1AR91 3IPVA 3WG2A 1VJ2A 2X29A 1AX2A 4QGLA 4C1WA 1DGWA 1KFXL 4DRVA 5BNPC 2WNVB 1NCQB 2GMMA 1UPIA 1SLBA 4FO9A 4L11A 2ZGPA 2DUPA 3WG3A 3UL2A 1LULA 4MGKE 2O8OA 5J09A 3ZFGB 1RITA 3ES1A 1G9AA 1O5UA 1PK6A 2QZ3A 2WFF1 3G6JB 2YGMA 2LTNA 5FPXA 1TE1B 4F7ZA 1R1A3 2A7AA 3WW1A 1QJY1 1FYUA 3E6DA 5JZGC 3NSTA 1RUF1 3VHRA 1VIWB 1RIRA 4XBNA 2MHFA 3FBYA 2VW2A 3AM2A 3TN93 3CLPA 1GQHA 4AEKA 2TEPA 1KDKA 4YZ2A 3MI8A 1PGL2 5LK5A 4EN6B 4CDUC 1H9WA 2XKOA 4OI2A 1CJPA 5CIRA 1ZBE3 2OZJA 4JC1A 2BNNA 4LO4B 3Q9OA 2XVKA 2YXSA 4Q8LA 2QKDA 3B5LB 4XFFA 5AC91 3FFZA 4CEWC 1OOPB 3W58A 2UYAA 4NHMA 2RS33 4JGYC 3BCWA 1ENRA 4A7YA 2R6QA 3LAGA 1KJRA 3MIEA 1G9FA 4E2QA 3DUIA 3SNMA 3VUOA 5A32A 1IHMA 1NCRA 3WP3A 4N53A 4QGNA 2P37A 4I01A 3WDUA 2KA3A 1QXPA 1Z7S1 1RUF2 3DV8A 3CEWA 1ND3A 3B00A 3GHNA 3I4IA 4ZXKA 4F8AA 3VHNA 2EVXA 3EQEA 1YFWA 2D3PA 4IQPA 5FPZA 1AR71 1RUOA 2JG8C 1AYN1 2RM22 3BTAA 4XJ9A 2AZ5A 5LRRA 5ABJA 4QMAA 5K7PA 4GH4C 4CP2A 1CR7A 3VBRA 1AX0A 4KWKA 4Y4YA 3H1YA 4LBQA 2VOXA 1SFYA 2A6XA 3HT2A 1FX5A 4JVAA 4PCRA 4XPVA 2DCTA 4LBLA 3HIFA 2PLV1 1H2MA 5J48A 4AQSA 1LEMA 2CL2A 2I45A 1SLCA 2PN5A 2ZKNA 1HLCA 1QJU3 1ASJ1 1ZZ8A 2D3SA 3BODA 3FUOA 5FLIA 3RYPA 3TAYA 3OF1A 2GNBA 3B94A 1V6MA 4BCUA 3V0AA 1XNKA 1APNA 5FO7B 4YG0A 2RS12 3KQRA 3MFAA 4HVOA 1H4HA 1WMEA 3ZFGC 4IL7A 3ETQA 4BH9A 2D43A 2QUOA 4FPOB 4KH9A 4IEUA 3WT3A 2PYTA 5E88A 4ZU7A 1DYKA 3D4KA 2XJQA 3P3NA 5DZFA 4AFAA 1U12A 1TMF2 4LHNA 2IXJA 3FC0A 3LKJA 1V6LA 1S0DA 4LO7A 1ZZ9A 2NYYA 1OQ1A 4XJZA 2MPFA 4D3WA 3BU7A 3N3HA 4XJ8A 5CFDB 1Z0HA 2WKKA 1ASJ2 3N7KA 3NW4A 5DG2A 1N47A 4XBQA 1D4VB 2Y0IA 2VOKA 3VZNA 1UKGA 3ZFEA 2X5IA 4HANA 4LBNA 4ATFA 4Y1ZA 1TNFA 4AFCA 2R1BA 3ZFFC 5FQ0B 1MZ5A 4PIZA 1YYNA 2VGDA 3AKSA 1R1A2 2E53A 2JICA 4FTSA 2ZMKA 3B9IA 4GMP1 3RMYA 2VNGA 2XPJA 1JN2P 2JD4A 3VLBB 3KD4A 4H7LA 3ZN4A 1VRH3 4XFAA 3USUB 4LUKA 1ZBA1 3JZVA 4ASMB 1BVP1 2R041 4NWVA 1N3OA 5FBZA 3TN92 1ZM1A 3RJRA 1C8NA 2XWJB 4WBBA 2ZCWA 1DLLA 2NZ9A 1R093 3MIHA 2DCJA 1ZBE2 1NE4A 4GXLA 2UWCA 3AJYA 1D2QA 1MS8A 2RS32 3W59A 4IV3C 5T5PA 4XQWA 1WD4A 1FOD3 4KWLA 1GZCA 3H9AA 3ZIXA 2EXKA 4CP1A 3MDPA 3H8UA 2OVUA 3AYCA 4NOTA 4Q27A 1BBT1 2WNUA 5L7OA 5FDBA 1FAYA 3DN7A 2F6BA 4YYOA 1UCXA 3IDBB 1CAWA 4N43B 4P9LA 4AEDB 1SLLA 3R4DB 2DVDA 2IXLA 1H1MA 4GB33 2I2SA 2A6ZA 2PHXA 4IEVA 1XNDA 3VBSA 1ULDA 1PHMA 3VHOA 3D6EA 3JUUA 4MGIE 4WVMB 5ACA1 2BGCA 3IWZA 3ZXKA 3J8F3 3JBG3 1V6IA 2H0VA 4KWJA 2UWAA 1QOTA 2DUOA 3JB4C 3HT1A 3WQ1A 1CAXB 2WL1A 4X6RB 4H3WA 4AVBA 1VP6A 1ONAA 2RS53 4QGMA 4AFDA 1MZEA 1JTZX 4YM3A 3AK0A 3IDCB 1FPN3 1ZNPA 3VBFB 3NO8A 4MXVA 3RRDA 1G9BA 1QWRA 4GIQA 1AR61 2PHUA 2TNFA 1RMU3 3H1WA 2HJIA 2AGSA 5D8AA 1DG6A 4O9GA 3IDEA 4QX5A 2XJUA 1QJU2 5CFDC 3VZMA 4UXAA 1K5MC 3I59B 4TWTA 1YIFA 4W6WA 4I30A 2ZX0A 4CYDA 2BEOA 4AQ2A 4AEJA 4BE3A 1FV3A 2V09A 2OA2A 2VECA 1BK1A 1H8TB 4L9BA 1ND2A 2ZHMA 5FAXA 2R073 4B4RA 4QQPA 5T5LA 4UBHA 2QQPA 2DTYA 1H1AA 4AHYA 1ZRCA 5GZCA 3THPA 5I0RA 3R0RA 1GLHA 5T54A 2GAUA 1OA4A 3VGIA 2JG9A 5KC5A 1W6MB 1DU3D 3M1HA 3MZHA 4OHYA 2BBVA 2C0ZA 2HWC3 1AR62 3LOBA 3DL3A 3KGZA 3ZIWA 3SH3A 1CVNA 1DZTA 2E51A 3SH5A 2BPA2 2X8KA 2IWGB 4HPKA 1RVF1 3OYWA 5T52A 3M3CA 4KL1A 4IV1A 4L8QA 3TNPB 3AKQA 3ZO0B 2W08A 2ARBA 1ZRDA 3AMNA 3AB0A 4BLJA 1LOFC 4JRLA 2XVLA 5CFCB 3I8TA 3IPVB 3BOPA 2RJLA 2QE3A 2VXRA 3E6CC 3QH6A 3ZPYA 3V0BB 1GNZA 1X50A 3TNQA 2DVAA 3JQXA 3VDDC 3SH4A 3WNXA 1VRH2 5CG9A 1LRHA 1PK6B 2ZGOA 4E2SA 3MW4A 1ZZBA 1YRZA 4XQDA 5GLTA 2VG9A 3RNSA 1REEA 4N43C 4AEDC 3ZMNA 3NAPB 4AHZA 4FXGB 1YFYA 2HWE3 3SISA 5BNOA 4EROA 1VBD3 4Q4W1 1R092 5T5JA 3PMSA 3ES4A 1HV1A 1PGSA 3HN1A 2Z69A 1YXWA 1Q5OA 1NE6A 4UW3A 2NP0A 1UIJA 5C9AA 3PLQA 3O5SA 1QQP3 2GN7A 3O0VA 2A5ZA 2D44A 2RR13 1OD5A 3U4XA 2DU1A 5GALA 3CU7A 1W39A 4GKXA 4JCKA 1W6QB 4XQ4A 1FOD2 2VVFA 3AZVA 1QKQA 1NZCA 4GQ7A 3B7MA 2ZGRA 4Y22A 1RUG3 4AI1A 5L36A 2B45X 3BB6A 2XJTA 2AENA 2UY8A 2XL7A 2D6OX 4K6BA 3POSA 5A32B 1NCRB 4L99A 1CPNA 1R083 4GB32 3SMHA 2HEYF 3FHIB 3FLRA 4Z1VA 2G4IA 1ND3B 3D82A 1YJKA 2WA4A 4MSVA 4X6QB 3VBOA 3HR9A 4AGVA 3MFCA 3J8F2 3JBG2 1S0JA 1HQLA 5DDJ3 1H8TC 4K1YA 5AFEA 1RHI3 1IPJA 1GNHA 4Q0UA 1VBC1 4CDWB 4B4PA 2RS52 3X29B 1B35B 1JUIA 4CP0A 3CJIB 1YI9A 1FPN2 3FWEA 4CZSA 1MEC3 3VBRB 2HWD1 5DUVA 2TBVA 1F8VA 1RMU2 1JYCA 4LBQB 2A70A 4JTNA 1NYWA 1DGRN 1WGPA 1QJX1 2VULA 1LGCA 4LO6B 4J1WA 1COV1 3LZZA 1MS3A 4YNIA 4ISQA 3RG0A 5KBFA 4C91A 5CFCC 3VZOA 3IN9A 5BNPB 3KM5A 1PO21 1D0GA 1LGNA 1FI2A 1MZFA 2GNMA 2R072 3FFQA 2K9ZA 4I3GA 4RHV1 3WQ7A 1KJLA 2JXAA 4IEZA 3WDTA 1NA1A 2KM2A 5GLWA 4G9SB 4H55A 1KD7A 5HCBA 4HVRA 4YM1A 1PK6C 1W0OA 3BIWE 4BOWA 2VVEA 2IXKA 3KCYA 2D5HA 2HWC2 2EF6A 4RR3B 5JZGB 4XMAA 2NPIA 3KCXA 1CJDA 3AXEA 2HWB1 4Z2WA 4F3JA 2R16A 1AZDA 2XJSA 4FP2A 2ZGKA 2B46X 3H3UA 2CGNA 4NO4A 3HD8B 3VKLA 1RUE1 1ZVFA 1T6GC 5JOZA 4L92A 4YW4A 1S0FA 4QQLA 5CU1A 1POV0 4XFCA 5C4WA 3WDYA 3NL1A 4HFSA 3AXDA 2GDFA 2XBO1 3KCCA 3PHMA 2X5IB 1EV13 1MVQA 1H2LA 3DPRA 5JSRA 2CYFA 4LHLA 4XFGA 5FOJB 4R9BA 1RJ7A 5T50A 3RI9A 3WDVA 4JGYB 1NQDA 2G9GA 2WNEA 3ZXGA 3ILRA 4B4QA 1PGW2 5KXCA 1VBA3 4PF5A 1AL21 4IERA 4OHWA 3WVJA 3H0OA 4FOQA 4NN0A 1NCRC 4HL0A 4CDXA 4FTEA 1NLRA 2HWE2 5J36A 2XJPA 1O7FA 1VBD2 1YWKA 4YW2A 2HWB2 4QPGB 3NKTA 2R061 1KS4A 1ND3C 5CA6A 2ZGUA 4ISRA 1QQP2 1LGBA 3FLPA 1VBE3 1OFNA 3FUQA 2RR12 1G6NA 2GMPA 5E16A 2JG8B 2EXJA 2JDZA 3WLUA 1B35C 1OMIA 1PZ9A 1GZWA 1H2NA 1AXYA 1H30A 5ABJC 1W6OB 3SITA 3VBRC 1RUG2 4FPLA 4M01A 1U0AA 2ZGTA 4BM8A 3S7IA 2MNGA 2VNOA 2ZOEB 1CAUA 2EIGA 2N7GA 1V00A 3ILNA 4NHLA 4L97A 4XW3A 3VBHA 2CY6A 1R082 3HMYA