1ND2B

The structure of rhinovirus 16
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
252
structure length
252
Chain Sequence
SDRIIQITRGDSTITSQDVANAVVGYGVWPHYLTPQDATAIDKPTQPDTSSNRFYTLDSKMWNSTSKGWWWKLPDALKDMGIFGENMFYHFLGRSGYTVHVQCNASKFHQGTLLVVMIPEHQLATVNKGNVNAGYKYTHPGEAGREVGTQVENEKQPSDDNWLNFDGTLLGNLLIFPHQFINLRSNNSATLIVPYVNAVPMDSMVRHNNWSLVIIPVCQLQSNNISNIVPITVSISPMCAEFSGARAKTVVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and virological studies of the stages of virus replication that are affected by antirhinovirus compounds
pubmed doi rcsb
molecule tags Virus
molecule keywords coat protein VP1
total genus 61
structure length 252
sequence length 252
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2002-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1nd2B00
1AR63 4JGZB 1PGW2 2R071 1NY72 1RVF1 1VBD1 5BNPA 5C9AC 1COV2 1PGW1 1M06G 4FTEA 1PO21 2RS53 1QJY1 1FMD3 1VB4A 3VBHA 4RR3C 1TME2 4QPGB 4CDXB 1QJZA 2WFF1 2RMU1 1ND3A 3VBUC 5LK7B 2PLV1 4LLFA 1MEC1 1RUJ2 1RUF2 5BNNA 1MEC3 2R062 2HWD1 3ZFGC 5FOJB 4AEDB 1AR91 1PGL2 4YVWC 1POV3 5C8CC 1BBT3 3VBFC 3NAPA 1QJX2 4NWVA 2DF7A 2HWB2 4YVSC 4IV3B 5A32A 2HWF3 3JB4C 4IV1B 5FMOS 4GH4B 3CJIB 1NA1B 1QJU3 2PLV2 2R073 1HRI3 3ZFFA 1NY71 1VBC3 1OPOA 1NCRC 1AYM3 2X5IB 1VBE2 3DPRC 1AL21 1C8M2 2XBO1 2MEV3 1CD3G 1B35B 3VBRB 2MEV1 1TMF2 3M8LA 1VB2A 1RUE1 1H8TB 4Q4V1 5J96B 1AR73 3VBOA 2WWSA 2R043 1RUC3 3VDDC 1K5MB 4GB31 1PIV3 5C4WA 5ABJC 1FMD1 1VRH2 4WM8A 3VBSA 1MQTB 3VBFA 4RHV2 2HWD2 3TN93 1K5MA 5ACA3 1EV13 1RUI2 4GMP3 4YVSA 1TMF1 1ASJ2 5C8CB 1HXS1 4PDWA 1ND3B 1R081 5J98B 4Y5Z0 2HWC2 1NA1C 1HRV2 3CJIA 5K0UC 1BMV2 4CEYC 5CFDB 3ZFFB 1AYM2 5L7OA 1BEV1 5GKAC 2R072 1RUI3 4FTSA 4N43B 5D8AB 1EV12 5DDJ2 4WM8B 1VBA2 2HWB3 1V9U1 3VBSB 1VBB2 3ZFEA 1PO13 5C9AA 1VRH3 4Z92B 1CJDA 2WS91 1SMVA 4SBVA 5AC92 2R042 4Q4W2 1PVC1 3TN91 1AR72 1K5MC 1Z7S2 2RR12 1MEC2 3ZXAC 1NCQB 5CFCB 1TMF3 1DDLA 1RUJ3 4QPIB 1MQTC 4QPGA 2TBVA 1AYN1 1QQP3 1PO22 1C8M3 1QJY2 3JBG1 5L7OB 5A33A 3JD72 2RS52 1ND3C 3VBUA 1R091 5K0UA 3NAPC 1ZBA2 5BNNC 4CDUC 1QJU2 1AR61 1RMU2 3IDEA 2HWF2 1RUE2 3ZFFC 1ZBA1 1AR92 5C8CA 1BBT2 4FTBA 3DPRA 2XBO3 2BPA2 5C9AB 1RUF3 1EAH1 4Q4X2 1A6CA 3JBG3 4Q4V3 2XPJA 4QPGC 3VBOC 1QJX1 3VBRA 1AR71 5CFDA 1RVF3 2QQPA 1X33A 1HQNA 1RHI2 1OHFA 1COV3 2FZ1A 3HAGA 4Q4Y3 4CDWC 2WFF3 3ZFGB 4Q4V2 4AEDC 3JBG2 4RFT0 4YVWB 1HRI1 3VBFB 2HWE2 1NOVA 1QQP1 4YVSB 1ZBE1 1PO11 1RUD2 5JZGB 4GH4C 4WM7B 1ND2B 1HRV1 1AYN3 1D4M2 1NA1A 1RUF1 1W39A 1NCRB 1RUI1 3DPRB 5C4WB 1FPN2 2RS13 2FZ2A 5JZGA 1EAH2 4JGYB 1RUH1 5DDJ1 1B35A 1OOPC 3ZFGA 2VQ0A 3VBRC 4YVWA 1RHI3 2HWB1 1NG0A 1R1A1 4PDWB 2RM23 1RVF2 1RUD1 2RMU3 2IZWA 1PO23 1QQP2 4CDWA 1D4M1 2WLPA 3VDDB 1PGL1 4GMP1 4Q4X3 5ABJB 1BEV3 1QJU1 2RS32 1GFF2 1C8M1 2XBO2 3FBMA 1Z7S3 4WM7A 1MQTA 4Q4W3 5BNPC 1VBD2 1AR93 4RHV1 4RR3A 1IHMA 1FOD1 5DDJ3 1RUE3 3J8F2 3S6PA 1RMU3 5JZGC 3ZFEB 1HXS2 1ND2C 1FOD3 1ZBA3 2RS31 5K0UB 1RUH3 3VBHB 4N53B 4CEWB 5AC91 1V9U3 5C4WC 1WCDJ 1FPN1 3JD73 4JGZC 4N43A 5D8AA 2RS51 1QJY3 4JGYC 1BMV1 4RQPA 4CDUA 1RB8G 2HWC3 4QPIA 1ZBE2 4PDWC 4Q4X1 2RR13 3J8F1 4GB33 4BCUA 4CDXC 5AC93 1R092 2HWD3 3TN92 1VAKA 4RHV3 1NCQA 5CFCA 4Q4Y1 1R1A3 1PO12 3JB8A 1VBB3 1VBE1 1VBA3 1R082 1R093 1COV1 4CEWC 5A33B 1ND2A 4GMP0 1RUC1 4IV1A 1HRV3 4RS5B 1RUJ1 4CDUB 1PIV1 2WZR2 3VDDA 4EJRA 2ZAHA 2WZR3 5ABJA 4N53A 4CEWA 3VBHC 1VBE3 1V9U2 2X5IC 1BBT1 1VBC2 1ASJ3 1RMU1 1HRI2 1HXS3 5ACA2 2RS11 1ASJ1 1R083 1AYM1 4GH4A 4Q4W1 1B35C 1OOPA 1VBD3 1H8TC 5A32B 1R1A2 2BFUL 1PIV2 2WZR1 5ACA1 5BNOB 1RUC2 2HWC1 1POV0 3VBOB 4CEYA 2R063 4GB32 2HWF1 4RQPB 5BNOA 1BEV2 2RS33 1ZBE3 3LOBA 4CDWB 2R041 2MEV2 1HX6A 1TME3 1RHI1 2Y26A 4Y4YA 1VBB1 1RUH2 4RS5C 2X5IA 1FOD2 2PLV3 1VBC1 3J8F3 2RR11 4WM7C 1NCRA 1AR81 1EV11 2RS12 4CEYB 5CFDC 2GSYA 1Z7S1 1QJX3 4CDQC 4IV3A 1C8NA 1AYN2 1D4M3 1RUG1 1AL22 1H8TA 2WS92 4JGZA 4N43C 5D8AC 1RUD3 1OOPB 1VBA1 4WM8C 2HWE1 3VBSC 4AEDA 2ZTNA 1X36A 2HWE3 4RR3B 5BNOC 2GH8A 1AR82 2WFF2 2RMU2 3VBUB 4CDXA 2RM22 4JGYA 4Q4Y2 1VRH1 1FMD2 1AL0G 1AUYA 1F8VA 1RUG3 2BBVA 1NCQC 4RQPC 5CFCC 1RUG2 4QPIC 4NWWA 4FSJA 2R061 1AR83 5BNPB 4RS5A 1EAH3 1AR62 5L7OC 2BFUS 1FPN3 3JD71 1PVC2 1E57A 3NAPB 1TME1 4CDQA 4IV3C 5BNNB 4IV1C 1POV1 2BUKA 2WS93 3CJIC 2RM21 3ZFEC 1AL23 2ZZQA 1F2NA 5FMOL 4N53C 1PVC3 4CDQB
chains in the Genus database with same CATH superfamily
2YYOA 4R9BA 3I2IA 3KB5A 4J6GA 2DFCA 3ZX7A 4AOCA 3HWJA 4P9LA 4JGZB 2Z79A 3CQOA 4QWNA 4C1WA 1RVF1 2PTMA 2XB6C 3K77A 2D3PA 3POWA 2XXZA 5KHJA 4AR2A 3MV01 1WMFA 2YPDA 3ZLIA 2BJSA 2OQ6A 4CCLA 3W21A 1TZOA 4GA9A 2YG0A 2QBXA 1W8NA 4LE3A 1H2NA 1W6PB 1TME2 2D43A 4NHXA 3AYAA 4XYXA 1QJZA 1N1YA 2WFF1 3SISA 4QX5A 4L11A 3VZNA 1ND3A 2ZEXA 5FV3A 1H4GA 5ERLA 1Y9QA 2A3XA 2PLV1 2C0ZA 5CEHA 1RUJ2 3NV4A 5IFTA 2LROA 5JOYA 4YSFA 5CZKA 1F15A 1MEC3 5F5QA 2DVDA 3DF0A 3RRDA 1EPZA 4OHYA 3KGLA 4AFMA 2SLIA 4IEQA 2P6CA 4UF0B 3LA3A 3MLLA 1DYKA 2A1XA 4QPWA 2P5BA 2H0BA 3VBFC 4HPKA 1UYXA 5GLVA 5BYNA 3NAPA 1QJX2 1NT0A 2DVGA 2IXKA 3DV8A 2XJUA 5DAVA 1X8EA 1I5ZA 1Q8QA 5FFOC 2DF7A 5G05L 2PHLA 2ET1A 1ZVFA 3R4SA 1AVBA 2IFRA 3GCWA 5FMOS 2R49A 4AVAA 2Q8OA 1F4HA 4KL1A 1UYPA 4FFGA 4OUEA 1PMHX 1V6NA 2ES3A 2E7TA 4ZONA 3USSA 4ZHNA 1W2OA 2W46A 3IIAA 2XLGA 5FAXA 2XMLA 2XKPA 1LESA 3FWEA 1OT5A 3GJBA 5FWEA 4F8AA 1CJPA 4GQ7A 4HXCA 4UW6A 3HBKA 3HNMA 4XJAA 5EYXA 1TMF2 2NLRA 4XC9A 1VB2A 1RUE1 1H8TB 1F35A 1O59A 2BERA 1UD1A 4AHZA 5J96B 3RQ0A 1QDOA 3WY6A 5G04L 1AR73 1REFA 3H1YA 3VBOA 1IQDC 2BEOA 1ULFA 2Y8KA 2WWSA 3WDTA 2UWAA 2GN3A 3S7EA 3WQBA 1RUC3 1S55A 2VCCA 3GNEA 4L0PA 3TAYA 3VDDC 2X8KA 4GB31 5EP9A 4DO0A 3OG2A 4Q29A 1FMD1 3KWVA 1HV1A 1DGWA 4XFIA 4AI8A 5J48A 3J7LA 2ZOEB 1UU6A 5FLIA 2JDUA 4QX7A 3AJZA 2Z69A 3K2OA 3LQCA 3WSOA 3S5AA 4OZXA 4K6BA 4QKNA 4GMP3 4YVSA 4UFKA 1J59A 1VPHA 1WBFA 3DN7A 4JCKA 1OH4A 1HXS1 3GBGA 1MS0A 1PK6C 2NYYA 1BYHA 1C4RA 4K9SA 5C8CB 4Y3OA 1HB1A 1ND3B 1UWWA 3BUCA 5J98B 2JE8A 4XFFA 4Y5Z0 5FY0A 5GALA 2OXBA 3OD4A 2HWC2 2Y6HA 4R4ZA 4E4SA 3LDRA 5FZOA 4G9SB 1RTVA 3RJ2X 1NA1C 4AXOA 5FP4A 4IGQA 1VRBA 2VZVA 1HRV2 1CPNA 4PLNA 3UKVA 3ZXKA 1BMV2 1Q43A 4RL7A 2WYFA 1QMJA 1LGBA 3ZFFB 4P9YA 5CKQA 4AGGA 4W65A 1ZRRA 1SBFA 1YQ2A 3BTZA 3QD6A 3K4ZA 3EQEA 3N9LA 1RUI3 3WW2A 2JG8C 5E6HA 5KC6A 1EV12 2AH2A 4MGTA 4FTSA 4YGDA 2ZX4A 2BGCA 1V9U1 2BVBA 5A7PA 1UIJA 5T3NA 3IN9A 4CE8A 1UL9A 4WZFA 3PUAA 4Z92B 1CJDA 4IEUA 3HQXA 4PQ9A 4IESA 3ON7A 2YFUA 4SBVA 5T5JA 4ZXEA 4PI2A 1LOFC 4JRAA 2XHNA 2DTYA 1Z7S2 1A3KA 2W9XA 4ATFA 3PUHA 2J1AA 3LSDA 4L97A 4AL9A 2DU1A 2OX0A 4ASKA 1DDLA 4MLOA 4BZ4A 3V56A 1JH5A 2A3WA 4AGVA 5IK8A 4Z2AA 3JQWA 5F3IA 4ZY9A 5JXGA 2YC4A 2WFPA 4NHLA 5L7OB 5GLZA 5A33A 3LEMA 1C5IA 4GWJA 3SITA 3WV6A 4DXRA 2DURA 2QQOA 5FDBA 3V0AB 2ZEWA 1R091 4YLZA 3BIWE 3LEGA 4YG6A 5K0UA 2ZGPA 5CIRA 3NAPC 1NXD1 3BTYA 4D6RA 1QJU2 4LOSA 4B4QA 3N9MA 5JOWA 2VQAA 4K3UA 1V6KA 2HWF2 2WZPP 3T1MA 4HVOA 3VB9A 2OVUA 3OGSA 5H9SA 5IWFA 2A3YA 4BQ2A 2JICA 3FBYA 2DTWA 2VZTA 5I8YA 2BBAA 5JCTA 5JAXA 3CNAA 5C8CA 2YXSA 4KMQA 3OGGA 1UAIA 3OF1A 3GZUC 4JQTA 4KWLA 4QQOA 3W9AA 4XMAA 4K8FA 4TLFA 5E8AA 2XBO3 1JZ3A 4Z1VA 2ERFA 2LS6A 2D5HA 2J7MA 3C3VA 1MZFA 3CL1A 1GYKA 2QQMA 3OUJA 1TNFA 4I0AA 3POBA 3LZZA 3TB0A 1XYNA 5C5TA 1IS5A 2P3JA 1WLCA 4JZRA 4DY3A 3T2TA 5FYUA 3OJBA 3H8UA 3DUIA 4Q4V3 2V72A 1N47A 1O3SA 3OY8B 3VBOC 4MVTA 1RITA 3M3QA 1DF0A 2QQPA 4HKLA 4Q0PA 4DS0A 1DP0A 4CCEA 1S0GA 3EHKA 2B8MA 3ZSKA 3A23A 3POEA 4HN0A 3UT0A 5JIUA 4K7JA 4IE4A 3M3EA 4RFT0 1FI2A 3ZMOA 3VBFB 4D6SA 1SEFA 4LMFA 4OVEA 4P9IA 1GQGA 1X8MA 4P14A 1KGYA 3ACIA 3ZN6B 3OBRA 3C7GA 4P9GA 4PF1A 1L7RA 2GZWA 2PFWA 2QFEA 4FPEA 4XF3A 4AEMA 4AE2A 4LTAA 1YQ5A 3Q8AA 3J26N 5F2SA 5FQ0B 5A7NA 1W99A 2ADEA 1NA1A 4QKDA 2VOTA 4XF4A 1CZSA 3G7DA 3P6BA 1KITA 3TEZA 1FPN2 4XF0A 1QJEA 1CGPA 2VNGA 3WP5A 1UY3A 1V00A 3RFRA 3RGBA 5FP7A 2X29A 2JG8A 3ZFGA 2VQ0A 3PL0A 2QQJA 4NUBA 3BN6A 4AFCA 2NMNA 4YVWA 3A0NA 3ROUA 1UMIA 3RWKX 4OZOA 4YG3A 2YBSA 4XUTA 1R1A1 2VZ3A 1W0OA 3J4UH 3AMMA 4QD2A 1D4M1 2VPVA 4CDWA 1PHMA 4PLOA 4CVUA 1NQJA 1UW8A 3VDDB 4ASMB 1FX5A 2W5FA 2ZBJA 4RYDA 4S2HA 4NIAA 4QPYA 2CWSA 4HG6B 4D69A 4Z82A 1Q5OA 3IT8A 2TNFA 4LULA 3DKQA 2ZA9A 4WM7A 2JD4A 4B7KA 4OHZA 5BNPC 4EWEA 2VZSA 2XKOA 1OUXA 1FAYA 5FXVA 5F6KA 2UWBA 1OFSA 2PHFA 3ZPYA 3FX3A 1GNHA 4AYUA 1KFUL 5LA2A 2JKBA 2GC1A 5DDJ3 2FMDA 3S6PA 1W6MA 3AVSA 3J8F2 1QH7A 1C3HA 1HXS2 1LHVA 1YFWA 1Q3EA 2E31A 5K9YA 1ZBA3 4QHOA 3WINE 3WDYA 3VBHB 4N53B 3C7HA 2GMEA 4HT1T 3SHRA 2XR4A 5C4WC 1WCDJ 1FPN1 1F31A 3JD73 3FUQA 2EICA 4N43A 2E53A 5FXXA 3HNBM 1CIWA 1S0EA 3VD7A 4YG0A 1BMV1 3ES1A 4I3GA 1K5JA 5AVAA 4YZ2A 1RB8G 1OVSA 1BK0A 2YHJA 4C0BA 2D6LX 5FPXA 1W3VA 4YZ1A 1LB2A 4CU6A 5A3TA 2RR13 4DXTA 5GLWA 3GF6A 5T52A 4AVSA 2ARBA 4NRPA 4FAHA 1D4VB 3VDCA 3SEPA 2VZQA 3WG4A 2HWD3 2JDMA 1JU3A 1GKBA 2DUOA 4RHV3 1NCQA 2D5FA 1RYYA 1R1A3 4YW3A 4LT5A 4J1WA 5FY1A 4NE9A 1DU3D 5LATA 4R9DA 1AX0A 3AJYA 3JB8A 4LO5B 5A7WA 1AZDA 2W1QA 3ZVXA 1JZ5A 5CAZA 2UYAA 5IK7A 3ZKYA 1COV1 2VOXA 1REEA 3UESA 4BH9A 1YCIA 3RJRA 4W6XA 3VZOA 3MW4A 1O4YA 2Y33A 1H1AA 2WNEA 4NIGA 1G8WA 1CQ9A 5FY7A 2FDKA 1L7QA 3OGVA 1RUC1 4IV1A 1HRV3 3FUOA 2Z2SB 2XVKA 4YZ3A 1PIV1 2WZR2 1XE8A 3I59A 3IAQA 4MZUA 4Z2WA 1OQDA 5FREA 4E9KA 4N53A 2VCMA 3NNLA 3NV1A 4DB5A 5IHRA 1OLRA 1XRUA 4B29A 4GWIA 1NYWA 4BK5A 3N9OA 1ENSA 1LJ7A 4B8EA 3WEZA 3H8XA 1VBC2 2VR4A 1ASJ3 1BVP1 3VHNA 3WDWA 4EN8B 1HRI2 2DCJA 4QAWA 3W5MA 3AYCA 2CY6A 1ASJ1 1BVVA 4J25A 5A6ZA 4N7IA 3KHCA 1W9FA 2PHUA 3O0VA 3VKNA 4Q4W1 2VULA 5FKCA 1W8UA 4AFAA 1VBD3 5A32B 1SPPA 2WSUA 1DCSA 5GZEA 1ENQA 3USUB 4YM2A 1W06A 3HQRA 1LR5A 1RUC2 3H7JA 1W6QA 2ZGOA 3KS7A 2XHKA 3NVCA 3VBOB 1DFQA 1RJ8A 3ZN5A 2R063 5JOZA 5C3RA 3QACA 1W8ZA 2HWF1 5KWRA 3SXWA 1APNA 1S0BA 5BNOA 2EXHA 1ZBE3 1C1FA 3FFQA 2VTXA 3UKTA 2Y6KA 4JTOA 5BY5A 3O1VA 2H6BA 2VECA 4YFWA 3BI3A 2PAEA 3B01A 5IAXA 4Y4YA 1VBB1 2VZUA 2QDNA 3MF9A 3PHMA 1TG7A 4RS5C 1PZ7A 1X82A 2X5IA 2B4KA 4CUAA 4XFHA 4BYYA 4AQ6A 3RZHA 2RR11 2OYZA 3V0AA 1O3TA 3VLBB 1GUIA 4LPLA 1UPSA 2RS12 3ZXEA 3POFA 1QHDA 1OXCA 2GSYA 3HOBA 4CDQC 4IV3A 2VMFA 2QE3A 3M2MA 5K4LA 4IEVA 2E51A 1D4M3 3OUHA 3OD0A 4N43C 4D3WA 3AP5A 4Y1UA 1VBA1 1YI7A 4WBBA 5FZEA 4URTA 3VBSC 5C3PA 3N36A 1JZ7A 1I9RA 3LPGA 3PTYA 5FZ0A 5HCAA 4RGAA 2RDQA 2LM3A 3VZMA 4CYDA 1JN2P 3GYDA 1N1TA 1S0IA 2WAOA 1XNBA 4MSVA 2NMOA 2QQNA 3VBUB 1KDKA 3O1SA 2RM22 4JGYA 1BKZA 1VRH1 2JDKA 1IPJA 3AMHA 1NCQC 1GR3A 3B69A 4I2OA 1RUG2 3N35A 1OH3A 2JIGA 3B02A 3MDPA 1H1IA 4PJYA 3OY8A 1QOOA 2CNAA 2R061 3USUA 5BNPB 2GAUA 3UL2A 4AVCA 3ZMNA 4CU9A 2OZJA 2W08A 1HB4A 3Q9OA 1DQ2A 1E57A 3WQ1A 1YJLA 2DCZA 4BISA 1ALYA 1NE4A 4JQRA 4L9BA 4AI3A 4IV1C 3NJVA 1NKGA 4FPCA 1SDDB 2GC0A 2BV4A 1IPKA 2ZKNA 3B7MA 1F2NA 2EAKA 2FDGA 1FV3A 1WD4A 2E6VA 1PVC3 4N53C 5LBFA 3RS6A 1GZCA 3OOXA 4UI9L 2BP6A 1TEIA 1W2NA 1V70A 2A6WA 3CLPA 5C3QA 1YFXA 1ZZ6A 1NY72 2VXRA 1PX4A 4GIQA 4N8MA 2Q8DA 3EO6A 2VBPA 1PO21 2RS53 1QJY1 4JHZA 1VIWB 5FYSA 3KT1A 4RR3C 4BXSV 1W04A 1SLAA 1JYNA 3KCYA 4A2UA 2VE1A 4OI1A 5BNQA 5DAPA 4IL7A 4NHYA 2JDPA 3AP6A 4QX2A 1T6BX 1WW4A 1GWLA 1RUF2 3N7MA 1ZZCA 4MUVA 2GN7A 3FJSA 3WP4A 5CG8A 2R062 1ULOA 3GZEA 2V4VA 1UIKA 4GWNA 4QDQA 1PGL2 1KJRA 4AEDB 1WLDA 1XOYA 2EIGA 4RGGA 3WNPA 5IW0A 4H3WA 3DYOA 3WG2A 4XBNA 2C4XA 2JG9B 5FP8A 5A6YA 2PMWB 2ZGSA 4NWVA 2B45X 2P37A 2HWB2 3I2FA 4IV3B 4YVSC 4E27A 3NWKA 3JB4C 2VD7A 1GZTA 4GH4B 4GWMA 2ET7A 3N9NA 4IEWA 2DU0A 5J1XA 1W6OB 2X53S 1H6YA 3R6SA 3ZFFA 4MV2A 1VBC3 2MHFA 1DZTA 3AZZA 4LHNA 1VBE2 2ZX1A 3DPRC 5L19A 1HB2A 1K3IA 4W6YA 1YXWA 1AL21 1YIFA 2KD7A 2WNOA 4XJUA 1C8M2 1BLZA 4BA6A 3J7MA 2PHXA 3VL8A 1OA2A 4Q4V1 2D6PA 2BOIA 3I59B 2XJSA 1ZRIA 2EXIA 1J1LA 5F8PA 2E32A 5FY4A 5FYYA 3X29B 1QNWA 4UYBA 1S4CA 5DUUA 4AI9A 4YGBA 1K5MB 2ILMA 5ABJC 1VRH2 2B46X 2YROA 5HBAA 5JXJA 3MW2A 5CNAA 1QKQA 1MQTB 3D0JA 5A3PA 4NMIA 1JXNA 2WZEA 1G9BA 5IVYA 1W0NA 3AMNA 3PU8A 3L2HA 1G7YA 2R6QA 1GOGA 1AX2A 5A7QA 1ASJ2 3WUCA 5L9RA 1SHWB 5LA9A 2NPIA 5CKMA 4ZU5A 4PDWA 3ZXFA 5J37A 3LFIA 2DBIA 5L73A 1URXA 2D6MA 2EALA 3PJYA 4FPJA 3AZWA 4FPFA 4ES9A 3BCWA 4Y22A 2LALA 1QGLA 2YC0A 2BOJA 3POIA 4GAZA 3ACGA 3MHZA 3O0WA 2KM2A 5C5UA 1X9PA 2VBDA 4FFIA 3WNMA 1QOSA 2LW8A 2ZHKA 2AACA 5K0UC 3D8CA 1LULA 1MZ6A 4XHBA 3JQXA 4JTNA 1AYM2 3V64A 4UFJA 3WDVA 5L7OA 2WNVC 3WCRA 5F5IA 5GKAC 1PZ9A 4N43B 2VL4A 2QQVA 1HN0A 2K9ZA 3ETPA 1S1AA 3VBSB 2F4LA 2PHDA 1A8MA 3DXTA 3KQRA 1H9WA 4XXPA 3WR0A 3N7JA 4IETA 4CP2A 4ZZ5A 1BXHA 2ZMNA 2DVFA 4S2FA 3ZXGA 2C9KA 3MIHA 1WBLA 4CA9A 3AKSA 1SMVA 2VOKA 5LW9A 1K42A 1K45A 3TN91 4OHWA 5IAVA 4QX3A 4XQDA 2RR12 2IXCA 3EBRA 4WVWA 2X05A 2VH9A 5I8TA 1NCQB 5IT6A 3T2QA 4NHKA 2WZ8A 3KV9A 3H0OA 2TBVA 4Z8BA 3I2GA 5HI0A 3RZJA 1BQPA 3WUDA 2VM9A 1JYTA 1N1VA 1PK6B 3JD72 4KH9A 1W6OA 1ND3C 4BQ5A 3BODA 4COUA 1W03A 4Z07A 1GNYA 4Y22B 1LRHA 5HV4A 1LGNA 1ZBA2 2E63A 5C71A 2WO1A 3ZYIB 1RMU2 4XF9A 1ENXA 1RUE2 4BQ3A 4HVRA 2OA2A 3IDAA 1DYOA 4XJ9A 1W9TA 4HK8A 3ZXLA 4A42A 1DZRA 1H1MA 2N7GA 3ALQA 4LBJA 1R1ZA 3LEIA 1KDMA 2DVBA 2VZRA 1ZBA1 4XJWA 3ZFFC 3I2OA 3WNXA 1BBT2 2WKKA 1Q56A 3CO2A 2FDFA 3AB0A 4NO4A 1D2QA 3DPRA 1ZRFA 2VQUA 5AVPA 4KBZA 2A6XA 2R30A 1CWPA 2VVDA 1MS4A 1O6UA 4I01A 1D0HA 1JUIA 4FPHA 1GU3A 5FUPA 5FZFA 2RG4A 2CTVA 2RJKA 1RUF3 1EAH1 3EB7A 3WG1A 5FYBA 1I1EA 4QGMA 4LA2A 5E1RA 5IATA 4O9EA 4XFCA 1A6CA 5FPVA 4YWAA 3HPNA 4JDMA 4Y20A 5FZHA 2XPJA 4QQPA 4E8DA 2L9LA 4RN5A 4XCAA 4X8PA 4XUOA 5FZCA 2V5DA 3LKJA 1HQNA 4BIOA 1OHFA 5FUIA 1SZBA 1C1LA 2ORZA 3HEIA 4CDWC 3LF7A 1YJKA 4H2AA 4A41A 4AK3A 1S2KA 2OS2A 1AJKA 4BK4A 2D7FA 1KS5A 3KHBA 4UBHA 4AEDC 3S30A 1VLNA 3CDZB 1JBCA 1UY1A 3O5SA 5D1IA 3NJYA 2YGLA 1NOVA 2YY1A 3TRSB 3UGFA 4FPLA 2UYBA 1W05A 3GHMA 4K20A 3ZN4A 3D3AA 1GZWB 4YVSB 3U37A 2DBNA 4IEZA 1PO11 3E5UA 1RUD2 1QY4A 1SFPA 3I2JA 4GH4C 5JZGB 4P9JA 4H14A 4WM7B 1ND2B 1HRV1 1LECA 4HBNA 1I3HA 3OEAA 1AYN3 4XETA 2ZKLA 4DQAA 1VMFA 5LZ6A 2CDPA 2RE9A 3A22A 3DPRB 2OT7A 3ENRA 2R7EB 1BJQA 3J9SA 3ZPOA 5CG9A 3OCPA 4QU1A 4IUGA 3I7DA 2WNVA 4BE3A 3A7QA 4XW3A 4AQTA 5C6CA 4WVMA 1CZVA 1ZYBA 3P5BA 2I45A 2VVFA 2R1BA 1UOFA 3E97A 5FZ3A 2WL1A 2GNBA 1CAWB 1LOGA 5E88A 4F3JA 1O8PA 4BB3A 3WF2A 2RM23 3CF6E 4YW7A 4NVPA 2RMU3 2P2KA 3RI8A 4KI5M 2IZWA 1UX6A 3AX4A 3HT2A 3POGA 3ZYHA 5FO9B 3TEXA 2WN2A 3VDBA 3FHAA 1CN1A 4FPKA 5ABJB 1BEV3 1QJU1 2EA7A 3DCQA 4OHXA 3HN3A 3N7KA 3ZIXA 3BVCA 2NQYA 2XBO2 4TSVA 3VD4A 2UY9A 4O7XA 1AF9A 2IVJA 5F9TA 3KVBA 5FYMA 3ILFA 4FT8A 4K1ZA 3MI8A 2WLQA 4L2NA 1AHSA 2WYSA 5EJ3A 2J1TA 2VUCA 2OQ7A 4QHBA 2GNDA 2OPKA 2K46A 2V5YA 1WA4A 5FJHA 4HANA 3SKVA 4KWJA 1XSQA 1G6NA 1M4WA 4H7LA 2FCVA 3WG3A 3HD8B 3ZDSA 1R64A 1IHMA 5FPLA 4QXBA 2CGNA 2Q30A 3LSEA 3ZFEB 2I2SA 3B3QE 2VMEA 4A6OA 4EWDA 1G9AA 1OD5A 3FLRA 2RS31 4X8NA 5JI9A 3LIHA 5K0UB 5D21A 3BOWA 4HK9A 1RUH3 2Q1ZB 5DG2A 4DFSA 4CCJA 5AC91 1V9U3 2P34A 3Q8EA 1W2AX 2WNVB 3P1IA 2QUOA 4BQXA 2VC9A 3KT4A 3OEBA 2QZ3A 4HKWA 5A3WA 3PDQA 3VZLA 3O14A 1MVQA 1MS5A 4RQPA 5HV0A 2D98A 2HWC3 4QPIA 1ZBE2 5FYTA 1J3PA 5A1FA 3F2ZA 4AAXA 4YW2A 3K3NA 5EJZB 2YFZA 2IWGB 2WO7A 4OCTA 4GB33 4AHYA 5FZ9A 3IKWA 2UWCA 2VMIA 1JW6A 4CDXC 2HH9A 4JKKA 3IIIA 1VAKA 3H50A 5EJ1B 5CKNA 5GJ6A 4WVMB 1O5UA 3NKGA 3NKTA 4CXXA 2ZABA 5CYYA 3ACFA 2AR6A 5M0TA 3ITQA 1C28A 3VGIA 1OD3A 4FAGA 4HVQA 2W94A 5F1RA 3OBTA 4YW6A 1R093 2A6VA 2EXJA 3CU7A 3UK9A 1O91A 3MFAA 1BHGA 3QOPA 1FXZA 4QB2A 5B4NA 2HEWF 3GHNA 4KU8A 5T5PA 4JX0A 4NOTA 1ND2A 3M1HA 4AI1A 4CUCA 2PYTA 3MLKA 4FPOB 4KBBA 3V0BB 4FPYA 2D6OX 2Y0IA 3NV3A 1JTZX 4LBKA 3MUZ1 4BDVB 4KNCA 1RUJ1 3INAA 3JCIA 3VDDA 1JYVA 1HJGA 2WZR3 4NIDA 4G3YC 4NRQA 5FYHA 3VZKA 3KM5A 3PU3A 3I3EA 3AYDA 3VBHC 4P00B 1VBE3 4EWAA 1BK1A 4LBNA 1V9U2 2X5IC 3OGJA 4XMIA 3I2DA 2DWRA 1RMU1 4TZDA 5GM0A 2W1UA 3C7EA 2YPJA 4LIUA 1Z0HA 4B1LA 1VR3A 3RZMA 3S7IA 4HMZA 5H9QA 4BMEA 1PMJX 3WNLA 4QQLA 5JUVA 3MO4A 2AEYA 2OKXA 2CAVA 1XJAA 1JYWA 2PA7A 1LOCA 1XBFA 1R1A2 2BFUL 1JZ4A 1NE6A 2CGOA 2JDYA 3LCPA 2W52A 3U11A 3I49A 2W68A 2HWC1 1POV0 3N7LA 3K75B 4BLJA 1V6JA 5ANQA 1GLHA 1GZ9A 3NNJA 3OSDA 3GALA 4GB32 1MPXA 2XWBB 4CCOA 1H30A 5K8SA 4FP2A 1OPMA 4RQPB 2ZGUA 3MUY1 2HYXA 4BIFA 2P1BA 1BEV2 2VMGA 3TBDA 2ZEYA 1WGPA 2I07B 1G9DA 4CDWB 2R041 3WF1A 1NZCA 3UV9A 4E8CA 1UY4A 2FCUA 2Y6FA 3EXUA 2BWCA 4MX3A 5FYIA 1TME3 3ACLA 3PIGA 5JR7B 3SH5A 3POYA 4AFDA 1QWRA 1WCUA 1XNDA 3CZJA 1A8DA 2JEMA 5FPAA 5FYZA 3FLTA 4F7ZA 1RUNA 4P02B 5LY2A 2IUWA 4GULA 1T2XA 5IVCA 1YRZA 1PX3A 1RUH2 3CIHA 3T4HB 3T1LA 3PMSA 5DAWA 1L7LA 1LOFA 1VBC1 2WUHA 1CAVA 3AP4A 1VAMA 3D82A 4QKFA 1XYOA 4WM7C 1VMJA 1Z78A 5HCBA 1AR81 5FQ0A 3AZYA 4CEYB 3PURA 5CFDC 1Z7S1 1QJX3 5C33A 3H3UA 1WW7A 2WSVA 2ZS6B 2Y6JA 3AP7A 1AXZA 3LD8A 4XVHA 5GZGA 3O1UA 1AYN2 4COWA 3MPBA 4LHLA 2F17A 5FK8A 2RDNA 4A4AA 5GLUA 1JYCA 4Q0UA 2VZ1A 4ZS3A 4WM8C 2HWE1 4XURA 4RD7A 1OLMA 3KGZA 4DINB 2Z5WA 4UW3A 2AUYA 1UZZA 2BGOA 5A7SA 4LHSA 4CP9B 2VW0A 4LE4A 5IK4A 4EN6B 3H42B 1RL3A 2EAAA 4EYUA 2P4EA 1PVXA 5LA0A 2ZX3A 2ENRA 2RMU2 4QX8A 4CDXA 1JOBA 3IM0A 5FZIA 1RUG3 3UETA 1MR5A 2BBVA 3Q8FA 3M4FA 3RI9A 4HN1A 4NWWA 4Y20B 2WINB 1XYPA 4PHZA 2HEYF 3V0BA 3KSCA 1AR83 1LKNA 4P08A 4BM8A 2BDRA 3WDXA 4AQSA 3ECQA 3ME2A 2GC2A 3CBNA 1DQ6A 3CJXA 3KLSA 2XGXA 3ORJA 5FJKA 1AR62 5A6QA 2BFUS 3WW3A 2VZOA 5A7WB 2JDNA 1JHJA 1UOBA 3GZAA 4FPGA 4Q26A 5KC5A 1XE7A 3I8TA 4LUMA 3MICA 2VW2A 1Q8OA 3MIEA 3FMGA 2BUKA 3ZFEC 3CJIC 1Y4WA 5EQUA 3MGUA 2FBEA 4XABA 4Y1YA 2DUPA 5LWBA 1OBNA 5FMOL 3D5OA 5LY1A 2ATFA 4MGQA 1JZ2A 2UY8A 2WABA 2VCAA 5FYVA 4CDQB 1H2LA 3PVEA 2XJPA 2VAUA 5JSRA 2W87A 5JMOA 1H8VA 2R071 1HIXA 4D6QA 5FBJA 3WLUA 1X50A 1S0JA 1WW6A 4HL0A 4AZZA 5C70A 1JZ8A 1VBD1 1US2A 2WO3A 2D44A 4V2VA 4Q1RA 3T2PA 1IOAA 3E5QA 2CYFA 1M06G 4FTEA 3O12A 1GNZA 3I54A 1FMD3 1LEDA 4JAAA 3WOGA 3W5NA 3O1OA 1WCQA 3B94A 4HFSA 4EQVA 3QBQA 4QPGB 5CVRA 2ADDA 3T08A 4CDXB 5FO8B 4AQ2A 2DDUA 2RMU1 3OPWA 3VBUC 4KWKA 4O65A 4O9GA 5LK7B 4EROA 1MEC1 5F39A 2VUAA 1LAJA 1T6GC 3TYJA 4GKYA 5FXZA 5BNNA 1S0FA 2YMZA 2IFWA 4WVZA 4EZHA 2J1UA 4I3PA 2HWD1 3ZFGC 4NRMA 5FOJB 1AR91 1SQ4A 1YQCA 5IVBA 5JXHA 1GP6A 1POV3 3GGLA 4YVWC 4V1PA 1W9YA 1BBT3 1O3RA 2CSGA 3RZGA 1QXRA 3AVRA 3J7HA 4AEKA 3M7AA 1ZX5A 2CV6A 1DQ1A 4IXLA 5A32A 2FDIA 5DUWA 1TVGA 4UFIA 2HWF3 2JXAA 3LE0A 3QCWA 4IV1B 1MS1A 2QQWA 4QGLA 5DUXA 2PLV2 1QJU3 2K2SA 2R073 1HRI3 2FCTA 5HCFA 3U4SA 3WD5A 1NY71 2QJVA 2VMHA 1OPOA 2DCKA 3ZYGA 3ATGA 3QH7A 2X5IB 2GU9A 2XJQA 5J3UA 3G6JB 4ONUA 4CP9A 5A80A 3ZXDA 2WA4A 3VDAA 3M3OA 3W59A 4M0NA 2VU9A 2MEV3 4LBLA 4B3NA 2A6YA 4XILA 4MOAA 4LBMA 3VBRB 2MEV1 3AXEA 2W91A 1UYZA 5AFBA 1JU4A 1GP5A 3LIGA 3SMHA 1BCXA 1SDWA 3MIBA 1HQLA 2HYKA 3FHQA 4MH0E 5HXVA 2XJRA 2JX9A 5L9BA 3B9IA 3IZOA 4I02A 1LHNA 4ARYA 4Y1XA 1DGLA 4XQ4A 3A4UA 1PIV3 4S2GA 4WV8A 4LNVA 5C4WA 1SLTA 4LKEA 3T30A 4YM0A 5A70A 3VBSA 4JDNA 1UZYA 1CAXA 4BPZA 3U78A 4CU7A 4P5YA 3DXUA 1SLBA 5DZGA 4RHV2 2W92A 2HWD2 4JDOA 1CX1A 4MO3M 3ZR5A 1EV13 1ZRCA 2ZGRA 2OW4A 1RUI2 1SFYA 2VO5A 4G4FA 1DZQA 3I2KA 1SG3A 2Y38A 2VCBA 1TMF1 1DGRN 3AMPA 1QDCA 5FZOB 4ASLA 5CU1A 2WT0A 4GZ9A 3Q8BA 4LOTA 3VD5A 1RUOA 1R081 4NIIA 2G9GA 2C9AA 1ZM1A 2UURA 1N3OA 2WT2A 3AP9A 3N3HA 5F3EA 4AFBA 1JOJA 4YFZA 2PAKA 5C7GA 1NAEA 4QXKA 3SC7X 1XC6A 3CJIA 4CEYC 1KXGA 5CFDB 1I5PA 3T09A 1DLCA 3WNKA 5GZFA 3DYMA 1BEV1 4V2WA 5BXXA 2O8QA 2R072 2ZGKA 4XPVA 4UOJA 4META 2Q8EA 5DDJ2 5BV6A 5JR2A 4WM8B 2HWB3 5LK5A 1ZZ7A 2ZX2A 4AG4A 4BHPA 3DYPA 1V6IA 3AMQA 3PVNA 1J84A 2GDFA 4BWOA 3ILNA 1UU5A 1AX1A 1WMEA 4MGIE 1VRH3 3LPFA 3LB9A 2J42A 5JVVA 2A75A 3LA2A 5AFEA 1PVC1 1YQ6A 4D0QA 3FHIB 1K5MC 2QQKA 2ZJCA 2PAMA 3AFKA 3PLQA 2YDEA 1W2UA 1TMF3 1POQA 5FP3A 1MQTC 3I3QA 5JDBA 5LEJA 3PUIA 1U0AA 1AYN1 3CMGA 4D7YA 5JWPA 1PO22 1C8M3 5KHIA 1QJY2 4PIXA 4DRVA 1O4TA 1W8TA 3VZJA 1E5HA 1J3QA 1QIQA 1UKGA 1KD7A 1WKYA 4MHRA 3KT7A 1GBGA 2QTWB 1W90A 2RS52 2ZGTA 4W4ZA 4XOGA 5H9PA 2G9FA 1DYPA 4QQHA 3WDUA 4COVA 4I09A 2JE9A 5JI7A 1SCSA 2JDHA 2QNKA 3HVDA 4CDUC 3WZ1A 1AR61 5B2GB 2B5HA 2O8OA 5JSPA 2ZX0A 3BPSA 4XQWA 1WCSA 3W20A 1UYYA 3AC0A 4R4XA 5KHHA 4Q5OA 3RZKA 3OUIA 4U2AA 4XTMA 2GH2A 4OI2A 4FTBA 3ZO0B 2Q0AA 3OGRA 3LDKA 4ZPIA 2WO2A 4IE5A 2VMCA 5FZ6A 2A70A 4AI2A 5FCCA 3RYRA 5HPOA 3S0MA 5FPZA 5F3CA 1YYNA 1OA3A 4IGPA 3H1WA 4WZCA 4JKLA 2Q4SA 2BPA2 2E7AA 3RWNA 2XUMA 1DLLA 3U10A 4BU2A 4Q4X2 4DOUA 2SBAA 2JG9A 1CAXB 1Y7BA 4CUGA 4QT6A 4H7MA 4CRQA 3FN9A 3L2YA 4QPGC 3BB6A 2YBPA 1QJX1 1TQ5A 3AM2A 3IB3A 3LWCA 3WQ0A 4BXFA 3RZLA 5JPNB 1RVF3 3M3CA 3R4DB 1V0AA 3CKHA 3I3MA 5HCHA 2FZ1A 1BZWA 3HAGA 4GXLA 1Q8SA 4XIOA 1CAWA 3EJKA 4QMAA 3ZFGB 4Q4V2 4OMCA 3LA7A 4OUSA 3D6EA 5FIXA 3NSTA 3WHUA 1NZIA 2Z42A 1ULPA 4R9AA 4RA0A 4YVWB 2A5ZA 2XL9A 3BPZA 3WW1A 2BU9A 2VY0A 3MFCA 1UKRA 2HEVF 3RSJA 3U1XA 5A3LA 1XPWA 3IAPA 4JRLA 5FPUA 2IXJA 1ZBE1 2D6KA 2W3JA 1IQAA 1W8OA 3BALA 3FZ3A 2XQRA 4KG0A 1QXPA 1YFYA 3CHXA 4CCCA 5L36A 2YZ4A 1D4M2 3ZSJA 4OI0A 3WVJA 1GOFA 1W39A 2DVAA 1QU0A 1NQDA 2AGSA 2XJVA 5CA6A 4K8RB 1G86A 2GP3A 2AC1A 2PELA 2RJLA 2B7YA 2RS13 3E6DA 5EHDA 4CCKA 4EE2A 4ZKTB 1EAH2 2V09A 2YUEA 4JGYB 3UYJA 2ZACA 4LLOA 4M01A 2C26A 2JB8A 5DDJ1 1B35A 1JMUB 1OOPC 2OPWA 4W50A 2W1WA 3VBRC 1RHI3 4OQ9A 4PDWB 3BTXA 2GNMA 1RVF2 1HLCA 2YU1A 4D94A 5BUVA 4QHZA 1UMZA 1X9TA 4DUXA 5F3GA 3H3ZA 2R0HA 4LUKA 3HT1A 3LFMA 1V6MA 4H55A 5SV5A 1PGL1 4Q4X3 1WMDA 2DUQA 5JXIA 1RJ7A 3C7OA 4NR1A 4ZU7A 2ZHMA 5A3MA 3T0AA 2WR9A 1CESA 4XZPA 1ZNPA 5LBCA 5FMDA 1Z7S3 1MQTA 1SBDA 1J58A 3ZOIA 2O1QA 4Q4W3 1RINA 2HJIA 1NXMA 2J1RA 4LO8A 1H0BA 2Q1MA 4PLMA 2RDSA 1MVEA 1ZREA 5DUVA 4M3CB 1AR93 1OMIA 4ZZ8A 4RHV1 3RYPA 4Q0SA 2E7QA 4RR3A 4N90A 4TLGA 2JENA 1PM7A 1NX9A 1O8SA 2E26A 3SH3A 3H8RA 4XDQA 2V73A 5JZGC 4KQ7A 2VGDA 1F5FA 1ND2C 2WC2A 2BQPA 2IVIB 1D7PM 1GWMA 2WIIB 4LKSA 4TXWA 3VN4A 5JSOA 4M4PA 3GJAA 1Y9GA 4CEWB 2BW8A 1ZZ8A 4QGNA 5FY9A 1A34A 4R52A 3NJXA 3HMYA 4UBGA 1U5ZA 4PBOA 5D8AA 2VW1A 3MBWA 4LBQA 1QXJA 1KRIA 5JPMB 4R8HA 1SLLA 3ZSEA 1X7NA 5I8SA 4A3ZA 3WF0A 2H0VA 2EXKA 4FXGB 3ZIWA 2XLAA 4D8MA 4Q4X1 4E2QA 3J8F1 4L99A 4CCMA 1P8JA 4A7ZA 4E4ZA 2CWMA 4P9WA 5DABA 5AC93 3HNYM 1R092 5CFCA 1MZEA 2FDJA 4Q4Y1 3ZR6A 1V6LA 4MYEA 4OI4A 1PO12 1IS6A 4B4PA 3WNNA 1LNSA 1EY2A 3OPTA 2B42B 5T50A 4A7YA 1VBB3 3H8OA 2WNUB 1VBE1 1VBA3 4Y24A 4COYA 1TE1B 4K1YA 1B09A 3O1TA 4JKMA 3ILRA 2XVGA 4AGRA 3SNMA 5IVJA 4MGYE 4EZ4A 2D93A 4LR4A 1XU1A 4DUWA 4IEYA 4LQRA 4M00A 2RVAA 4CP0A 1DQ5A 4L92A 4QM9A 2EIDA 4P9XA 4CCDA 4CDUB 5DMYA 1GP4A 2ZAHA 3WNOA 3UNPA 1RXFA 5ABJA 4MADA 4NPRA 4JVAA 1E5SA 1PNFA 2HLEA 4Y1VA 2WDBA 4CEWA 4CPBA 5J36A 2BNOA 5FZ1A 2IXHA 2F6BA 1FNYA 2FQPA 2ZHNA 2VG9A 4DPNA 3VUOA 3QLQA 3POSA 4LORA 2HBUA 3RYKA 1HXS3 3VKLA 4A44A 5ACA2 4B7EA 4B1MA 4DIQA 1XNKA 1R083 2AENA 2Y64A 2VUJA 3E6CC 4FOVA 4GH4A 5KXDA 1B35C 1OOPA 2QQIA 2G1MA 4XUQA 5FZKA 1HQWA 4LK7A 3KF3A 1YNAA 1PIV2 2WZR1 5FP9A 4URAA 1YQ8A 1W8WA 3JUUA 5ACA1 1LU2A 4QB1A 5BNOB 4XFAA 1JYIA 3B9CA 5TSWA 3RMXA 3SLIA 1N1SA 3GDBA 1WLTA 3N9QA 3PUQA 1SPPB 2EIEA 4HETA 1ODMA 3R0RA 2E9QA 3GM8A 4XUNA 3SCGA 2WNUA 1LCLA 4U36A 4UT5A 5IUQA 3P3PA 1RIRA 3ZM8A 3NO8A 4DMIA 5I0TA 1HX6A 1D2SA 1Q8PA 3PVBB 4ZU4A 3ZXJA 4D7TA 4A6SA 4HONA 3OB8A 3WT3A 2ZGNA 4IE6A 5JLVA 2Y26A 4NJ4A 4LHKA 2AZ5A 1H6XA 5HXMA 5IYYA 4TYSA 4MXVA 1UOJA 1S0CA 2B9VA 1XNTA 2LRPA 4BQ1A 4IGOA 3IPVB 3J8F3 3MEPA 4QQ2A 4UFMA 4XBLA 1NCRA 5FR3A 2J1EA 2LTNA 4XIKA 2ZHLA 1W9SA 2BRTA 4M4RA 4IEOA 1JI6A 1EUUA 1S2BA 1ULCA 5DPNA 1C8NA 4CUBA 1LOAA 4YPJA 4Q8KA 3LGRA 2VXJA 3SQOA 1DBNA 1RUG1 5LA1A 4NAOA 2C24A 1H8TA 4R9CA 1MZ5A 2WS92 4JC1A 5D8AC 4YW1A 1RUD3 2W95A 3ZN6A 1YI9A 1OOPB 4XJ8A 3ZYPA 5SV8A 5GZDA 4UF0A 1ZZBA 2JD9A 4HSJA 4FVVA 5EWSA 4B4RA 5KXBA 2VNRA 4MGZE 2JE7A 5J09A 1ZA4A 3C2UA 4X6QB 5KHGA 1OSGA 4PIYA 4CSWA 1JYXA 5FXWA 1XNCA 4A45A 5LRSA 4Q8LA 3ACHA 5FZ7A 1F8VA 1K12A 1LU1A 5CFCC 4RQPC 1E5RA 5EYYA 5LRRA 1WD3A 1GWKA 4QPIC 2XDVA 1OFNA 2GC3A 3NNGA 5F6LB 2QZ2A 1HW5A 4E4HA 4EV0A 5J7MA 4FSJA 1DQ0A 1N3QA 3HQUA 1NLQA 2OUJA 4OLLA 3U75A 3HR9A 1QNYA 3ZYBA 4Y26A 1JOPA 1FPN3 3JD71 3KV5A 3KV6A 2H6CA 3BU0A 4AVTA 2C1FA 2R1DA 2W39A 1UZ0A 5ANNA 3AK0A 3SCFA 5EZWA 4DUVA 5FZLA 5BNNB 2XVLA 2XOMA 4UXAA 3BOPA 2RM21 1CR7A 1AL23 1J83A 2A71A 4XDOA 5DN2A 1SLIA 3TNQA 5LASA 3RMYA 1KEXA 4CEWC 1RC6A 2CDOA 3OTFA 2XUEA 1H4HA 3E1F1 1UXXX 4F83A 1AR63 1UN1A 1PGW2 4PQQA 5CBLA 5C3OA 3PUSA 1TNRA 2UU8A 3MF6A 1WWYA 4EN9B 5BNPA 5C9AC 1LHWA 5IVFA 4UW5A 1COV2 1XB9A 1W2TA 1PGW1 4DEVA 3IDBB 4QM8A 2BWAA 2BNMA 2XJTA 5E89A 4Q2FA 5LBEA 1VB4A 3VBHA 1OC1A 3VKMA 3O0XA 4P5HA 3VL9A 5I0RA 1J3RA 4YGCA 4RSUA 3WF4A 3FL7A 4KGQA 4XJZA 4L8QA 2IXLA 5A7OA 5FY5A 4LLFA 1GQPA 1NLRA 4IW3A 3SKJE 3FLPA 1W8HA 4EN7B 2QVSB 1S2EA 4FCAA 3CEWA 1WZXA 4NPMA 4TWTA 1UY0A 3W58A 2WRAA 3JU9A 1O5LA 1EUTA 2WNUC 1SFNA 4D7SA 1OLME 2VBBA 1PNGA 1GV9A 4HZFA 1STMA 3IBMA 4O61A 2ZAAA 3THCA 4C0HA 5A1AA 3RVHA 3ZYFA 2ETEA 4FFHA 4K21A 4QXCA 3RDIA 5A3NA 5C8CC 1DQ4A 2ORXA 2BZDA 2Y6LA 4FXKB 1HB3A 3U14A 4XAAA 2TUNA 1UNBA 5CADA 1VALA 3CJIB 3KZ4C 1NA1B 4C1XA 1QF3A 3H3LA 2CU5A 3B93A 1NCRC 3EMRA 3BKZA 1EP0A 1AYM3 1PMIA 4XF1A 1ZRDA 1CAVB 1W3XA 1IKQA 4DXSA 4OYUA 2XBO1 2JG8B 1LENA 4MHUA 4N9IA 3THPA 3ZYJB 1IG0A 4YW4A 2A6ZA 3D0SA 1CD3G 4OULA 4XDPA 4CU8A 1DIWA 3AYEA 4MG2A 1B35B 1F9KA 4FOWA 3KV4A 1KJLA 2XG3A 3M8LA 1OQ1A 1VP6A 2VJXA 4IDZA 5DG1A 5DAQA 3T0DA 4PI0A 2B39A 2C5DA 2VUDA 2R043 1HV0A 1WMXA 5FRAA 1EYBA 1UPIA 1G9CA 2D3RA 5FZMA 2RJ2A 3UJQA 4QDRA 4LITA 4Q0VA 4E2GA 3HJRA 4COZA 1OQEA 2RV9A 2W1SA 4WM8A 2WQ8A 3THTA 1HDKA 4XFGA 5DXDA 1O4ZA 1QEXA 2PHRA 3VBFA 3TN93 4BLIA 1K5MA 4HKOA 3OBAA 1OVPA 2VZPA 4M0HA 5ACA3 2NN8A 2GALA 4FFFA 4XE9A 4DXZA 1LGCA 4C8DA 1VE0A 1SLCA 4GJYA 2KA3A 3LOIA 1RGSA 2F4PA 4IEPA 3I3BA 2DCYA 5L9VA 1W6MB 4YW5A 2HKXA 1HJFA 2Y34A 3RNSA 2MPFA 5IFPA 1CONA 4QU2A 4YRDA 2ARXA 2WN3A 1AJOA 1YUDA 5T5OA 2Q1FA 5LB6A 4FBFA 3TEYA 3DECA 4LBQD 2LUWA 4ISQA 5FOBB 5T55A 3MV11 2PHWA 1JZ6A 1W9WA 1KS4A 3WF3A 2G19A 4UFLA 3OYWA 4A7KA 2QDRA 3WHTA 4I0BA 3GBWA 5D8AB 4E4DX 4XBQA 5I0UA 3HIFA 1PGSA 2ARCA 1VBA2 2X10A 2K0GA 2JECA 1VBB2 2IXIA 2X09A 2ZXQA 3LEKA 3ZFEA 1IPSA 2MNGA 4WVVA 3NW4A 3NQHA 1ENRA 2W2IA 1PO13 5C9AA 3GXUA 4XAEA 2ZGQA 4K40A 4Y5SA 2WS91 5DZEA 1LOEA 3NNMA 4CZSA 2ZCWA 5AC92 4UAPA 5GZCA 4Q0QA 2R042 4Q4W2 1PZ8A 3B00A 3E6BA 4LO6B 2YV8A 1AR72 5IJRA 4AEJA 1MEC2 4QDSA 3P3NA 3ZXAC 5CFCB 3POJA 2NP0A 2WJSA 1RUJ3 2O14A 3EYPA 3NMBA 4QPIB 4YZ4A 3UGHA 1YHFA 4QPGA 2WQZC 4NN0A 1Y3TA 2TEPA 3H9AA 1FV2A 1REDA 4AHXA 2JWPA 5B4XA 1QQP3 4XUPA 5FZDA 5KBFA 1N3PA 2R16A 3JBG1 4E2SA 3M70A 4FQ4A 3V65A 2Q8CA 5JMCA 3VBUA 3PIJA 2YGMA 5LCWL 5DQ0A 2JKXA 2CL2A 2DV9A 4MGKE 3VD9A 3KQ4B 1OI6A 2D3SA 4AAPA 5BNNC 1W0PA 3IDEA 1ZA7A 4Y5TA 5FZGA 1WCKA 4ISRA 1W6NB 1CIYA 2XWJB 2B9UA 1IS3A 3BGAA 4IERA 3K48A 4Q1PA 5FY8A 1AR92 2VQTA 1YEWA 2G4IA 4PIZA 5IVEA 4OFGA 1LTEA 4AWDA 4CCNA 4I0WB 3O1RA 3H1MA 1UZWA 2HBTA 4KU7A 3ZKUA 3VHOA 5FTTC 2Q5TA 1Y43B 4YZ5A 5C9AB 4XHXA 1OF3A 2RDRA 1IGOA 3I2HA 4KGGA 5T54A 1W6PA 2VOWA 2YB7A 5DAXA 1OF4A 1UZVA 4FI9A 1ULGA 2QQUA 4ATEA 3JBG3 4RFRB 4NAMA 1W8FA 4YNIA 3AKPA 1H9PA 2JB4A 3BTAA 3VBRA 5IK5A 1AR71 2XL7A 5FYCA 1XQNA 4ORFA 4QX1A 1PM4A 5CFDA 5LEKA 5EXOA 2VTFA 3HN1A 1X33A 2WWUA 1LODA 3AKQA 3LDBA 4YM1A 2P3YA 1RHI2 4W8JA 5APAA 4DNYA 3FC0A 1COV3 3THDA 4Q4Y3 1H2KA 2D6NA 4M3CF 1U5IA 2WFF3 3KCCA 3AZXA 5I91A 1WA6X 2D40A 1OURA 2JDAA 5JIAA 5IVVA 3JBG2 4NHMA 3I97A 1OA4A 3OBZA 1HRI1 4ES8A 2HWE2 3CZUA 4FOQA 4IE7A 4HOOA 3RG0A 1UCXA 2XH6A 2Y60A 3ELNA 3PMEA 4N7UA 4NROA 5F5AA 3NNFA 1QQP1 1W6QB 3DKWA 3FE5A 4ZS2A 4BMBA 3MIFA 3HBZA 3OYWB 5JOXA 3L9JT 3WW4A 2JIJA 1XSRA 5F7UA 1ST8A 3GZTB 2BTVC 3MYXA 5E16A 3IPVA 1RUF1 3O1PA 1YFUA 3H7YA 3C7FA 1NCRB 2QKDA 3Q8CA 5F2WA 1GZWA 3AKRA 1S0DA 3KMHA 1RUI1 5C4WB 2DCTA 4GJZA 3UJOA 2XQXA 4W6WA 3SEEA 5JZGA 1YO8A 2FZ2A 5DZFA 3K4DA 1ONAA 2G9ZA 2VNVA 4FO9A 4QKBA 5GLTA 2BNNA 1RUH1 2VTXJ 4AW7A 3K46A 2WAAA 4UFHA 1WW5A 2Y6GA 3MZHA 3MW3A 1IKPA 2BYVE 1US3A 1F5JA 1O7FA 2HWB1 1QOTA 1NG0A 4XFBA 1AXYA 1UO9A 1RUD1 3K51A 4XCBA 1PO23 1QQP2 1SCRA 4KWUA 1UY2A 1RXGA 2WLPA 4HSLA 1DGRA 2PN5A 3AXDA 4MXWB 3T3YA 5I0DA 3VHPA 4LA3A 4DRRA 4GMP1 2RS32 4C91A 4QB6A 1QH6A 2ID4A 3PNAA 4JHTA 1GFF2 3AL6A 1C8M1 3KF5A 4ITCA 5C8WA 3FBMA 1W28A 4TN7A 3DEMA 4XTPA 4Y1ZA 5T5LA 3WQ7A 5FLJA 1GQHA 4LEJA 2ZGLA 3ZSLA 2WBKA 2ZZJA 1YLLA 4BQWA 2GNTA 1L3JA 1VBD2 3KVAA 2IC1A 1VMHA 3MPPG 5FZ4A 5I0SA 3U4XA 4M3CE 4XXAA 3AFGA 1FOD1 2E33A 4CP1A 1RUE3 3AZVA 1VAVA 2VMDA 1RMU3 2CAUA 5KR7A 2A73B 2KXLA 1FOD3 2VNOA 3KCXA 5K7PA 2W0XA 2P6HA 4YGEA 1OUSA 2ZPXA 4LJHA 3ETQA 1LEMA 4BQ4A 1UX7A 5ISLA 4JGZC 4JV4A 3TEWA 1LHUA 2RS51 1QJY3 1XE0A 3VHRA 5FK7A 2FD8A 4HLTA 4JGYC 1NLSA 4C90A 5FMBA 2I74A 2WT1A 2P3IA 4CDUA 5KHKA 1ZZ9A 2EIBA 3GCXA 4LXLA 5FUNA 4QX0A 3ZYRA 2PXJA 4HPKB 1MACA 4FP3A 4PDWC 1WUVA 2QCSB 3QH6A 1A78A 3APBA 2BGPA 1FNZA 4TTGA 2J1SA 2A7AA 3C8XA 2ZMKA 5FKBA 1OKOA 1C5HA 2J1VA 1GOHA 4BCUA 3S57A 2P3KA 3TN92 1LOBA 3I3DA 1UXZA 4ARXA 3BIEA 1Q8VA 4OMDA 1SACA 1YC61 5F32A 1UMHA 3WX5A 2P17A 1F4AA 4AF9A 4XZUG 1GANA 3JXSA 1R082 3O7OA 2R0FA 1U5YA 4X6RB 3K3OA 5FWJA 2Z4FA 4BOWA 1MS3A 5A33B 3IDCB 3B5LB 1EPWA 4RGKA 4QXHA 2XONA 2EVXA 3BU7A 5FLHA 5FZBA 4DY5A 5A3UA 3N4MA 2NM1A 2FDHA 3ASIA 4MXWA 4OHVA 1UQXA 3FFZA 2AYHA 3GBFA 2O0OA 3U07A 4GMP0 3WCSA 2GMPA 4DEQA 1SBEA 3A21A 5H9RA 3VD3A 2FMYA 2DFBA 4RS5B 4CXWA 4N9HA 2PQQA 4EJRA 4CTEA 3MIGA 5FBZA 4BQYA 3IMMA 1XNAA 1MS9A 4INDA 1OKQA 2VOVA 3RPQA 1CPMA 1DHKB 1BBT1 1UOGA 3RZZA 1IZ3A 1CAUB 1OLQA 5FMCA 1U5XA 4S2DA 5FZAA 2AEZA 4GKXA 3TOJA 2RS11 3NJZA 4CXYA 2YBKA 3J7NA 1AYM1 2QQLA 4LO4B 3LAGA 4M3CA 3IWZA 1FT9A 3VKFC 5A6XA 2BVVA 3BYWA 4OQ8A 1O3QA 4NIHA 1FYUA 3N9PA 1H8TC 5EIYB 1C57A 1GSLA 4YM3A 3NRUA 4AVVA 3JZVA 1ULDA 4IE0A 2AREA 2OZ6A 1XXNA 3MLJA 2ARAA 4IEXA 4CEYA 4Y33A 3WP3A 3URFA 4FOYA 2J22A 2PHTA 4OUMA 1NUKA 2RS33 2OUHA 3LOBA 2YU2A 2GP5A 2XLFA 2C6SA 4LBQB 4SLIA 4LKFA 3A0KA 2MEV2 2CHHA 2Y0OA 4GD4A 1AXKA 1HKDA 1IS4A 1RHI1 3MIDA 4BJ0A 3I4IA 4LIVA 2YC2A 5FPBA 4PT6A 5LBBA 2OIIA 5D2AA 3SH4A 1FOD2 1JUHA 2GMMA 3M3IA 2PLV3 3IMNA 3F95A 5F37A 1CX4A 3T2OA 1DGWX 4PCRA 3PJQA 3TNPB 1EV11 1JS9A 1G9FA 2R32A 4XACA 4ZXKA 4EN0A 5CISA 1D0GA 3DL3A 5EPAA 3T4VA 5A3OA 3WXPA 2WA3A 1E5IA 4AI0A 1VJ2A 4FQZA 5BPXA 2JDZA 1AL22 2ZEZA 3S5QA 4YARA 4JGZA 3WP6A 1U12A 3NL1A 3ZDVA 5KXCA 4AEDA 4DZGA 1KFXL 4Q27A 2W47A 2KR2A 3OPZA 4IQPA 1FATA 2ZTNA 5I93A 3NV2A 1X36A 2JJ6A 2D97A 2HWE3 1GICA 3DGTA 4XEZA 3VKOA 1QJFA 2DYCA 4RR3B 5BNOC 1UF2C 4A3XA 2GH8A 2PQSA 5FZ8A 1IG3A 1AR82 2CGPA 1JHNA 4LK6A 4J1XA 1CAUA 3ZSMA 1MS8A 2WFF2 4AHWA 1CVNA 1CZTA 3SCHA 4Q4Y2 4ET7A 1FMD2 1AL0G 2WWJA 1AUYA 3AKTA 3R05A 2RHPA 1XU2A 4Y4RA 5KXEA 1Y9MA 2EF6A 3ABZA 4AVBA 4PBPA 4UWDA 3TWIA 3AL5A 1ACCA 1UU4A 1YWKA 2VVEA 3KD4A 4UW4A 5A1LA 4KG8A 4RS5A 3PTRB 3VV1A 1PK6A 1EAH3 2WQ4A 1KQRA 3ES4A 5L7OC 5C3SA 4MGSA 4LKDA 4NPLA 4PF5A 5FO7B 1ULEA 1PVC2 2JG9C 2ZGMA 3R4UA 3UKNA 4CPBD 3U0ZA 3O1MA 2ZMLA 1JODA 3D4KA 3E5XA 1TME1 3NAPB 4I30A 5F5CA 1ODNA 1GMMA 1V6OA 2V4AA 4IV3C 1DG6A 3UGGA 4CDQA 3ST7A 5CB7A 2FHRA 1POV1 4LBOA 2WS93 3K4AA 2NZ9A 4GALA 2ZZQA 1J1TA 1I6XA 1H2MA 3PVOA 5EFUA 3T0BA 4LO7A 5EV7A 1YIPA 4YYOA 1WLWA 1W6NA 1HN1A 1LHOA
chains in the Genus database with same CATH topology
2YYOA 4R9BA 3KB5A 4J6GA 2DFCA 3ZX7A 3HWJA 4P9LA 4JGZB 2Z79A 4C1WA 1RVF1 2PTMA 2XB6C 2D3PA 3POWA 5KHJA 1WMFA 4GA9A 4LE3A 1H2NA 1W6PB 1TME2 2D43A 3AYAA 4XYXA 1QJZA 1N1YA 2WFF1 3SISA 4QX5A 4L11A 3VZNA 1ND3A 5C33A 1H4GA 1Y9QA 2A3XA 2PLV1 2C0ZA 1RUJ2 3NV4A 5JOYA 4YSFA 1MEC3 5F5QA 2DVDA 3DF0A 3RRDA 1EPZA 4OHYA 3KGLA 4AFMA 2SLIA 4IEQA 3LA3A 3MLLA 1DYKA 2H0BA 3VBFC 4HPKA 5GLVA 5BYNA 3NAPA 1QJX2 2DVGA 2IXKA 3DV8A 2XJUA 1X8EA 1I5ZA 1Q8QA 5FFOC 2DF7A 2PHLA 2ET1A 1ZVFA 3R4SA 1AVBA 2IFRA 5FMOS 2R49A 4AVAA 2Q8OA 4KL1A 1V6NA 2ES3A 2E7TA 3USSA 3IIAA 2XLGA 5FAXA 2XKPA 1LESA 3FWEA 4F8AA 1CJPA 4GQ7A 4UW6A 4XJAA 5EYXA 1TMF2 2NLRA 1VB2A 1RUE1 1H8TB 5J96B 4AHZA 1UD1A 3RQ0A 1QDOA 3WY6A 1AR73 1REFA 3H1YA 3VBOA 2BEOA 1ULFA 3WDTA 2WWSA 2UWAA 2GN3A 3S7EA 1RUC3 1S55A 3GNEA 3TAYA 3VDDC 2X8KA 4GB31 4Q29A 1FMD1 1HV1A 1DGWA 4XFIA 4AI8A 5J48A 2ZOEB 1UU6A 5FLIA 3AJZA 2Z69A 4OZXA 4K6BA 4GMP3 4YVSA 1J59A 1WBFA 3DN7A 4JCKA 5C8CB 1HXS1 3GBGA 1MS0A 1PK6C 2NYYA 1BYHA 1C4RA 4K9SA 1ND3B 5J98B 4XFFA 4Y5Z0 5GALA 3OD4A 2HWC2 4E4SA 4R4ZA 4G9SB 1RTVA 3RJ2X 1NA1C 4AXOA 1HRV2 1CPNA 4PLNA 3UKVA 3ZXKA 1BMV2 1Q43A 4RL7A 1QMJA 1LGBA 3ZFFB 4P9YA 4AGGA 4W65A 1ZRRA 1SBFA 3QD6A 3EQEA 3WW2A 1RUI3 5KC6A 2JG8C 4FTSA 1EV12 2AH2A 4YGDA 2ZX4A 2BGCA 1V9U1 2BVBA 1UIJA 5T3NA 3IN9A 1UL9A 4WZFA 4Z92B 1CJDA 4IEUA 3HQXA 4PQ9A 4IESA 4SBVA 5T5JA 1LOFC 4JRAA 2DTYA 1Z7S2 1A3KA 4ATFA 3LSDA 4L97A 2DU1A 1DDLA 4MLOA 4BZ4A 3V56A 1JH5A 2A3WA 4AGVA 5IK8A 3JQWA 2WFPA 4NHLA 5L7OB 5GLZA 5A33A 3SITA 1C5IA 3WV6A 3V0AB 5FDBA 2DURA 1R091 4YLZA 3BIWE 5K0UA 4YG6A 2ZGPA 5CIRA 3NAPC 1NXD1 1QJU2 4B4QA 5JOWA 2VQAA 4K3UA 1V6KA 2HWF2 2WZPP 3T1MA 4HVOA 2OVUA 5H9SA 2A3YA 2JICA 3FBYA 2DTWA 5I8YA 5JCTA 5JAXA 3CNAA 5C8CA 2YXSA 3OGGA 1UAIA 3OF1A 3GZUC 4KWLA 4QQOA 4XMAA 4K8FA 4TLFA 5E8AA 2XBO3 4Z1VA 2ERFA 2D5HA 3C3VA 1MZFA 3CL1A 1GYKA 1TNFA 4I0AA 3TB0A 3LZZA 1XYNA 1IS5A 2P3JA 1WLCA 4DY3A 3T2TA 3OJBA 3H8UA 3DUIA 4Q4V3 1N47A 1O3SA 3OY8B 3VBOC 4MVTA 1RITA 3M3QA 1DF0A 2QQPA 4HKLA 4Q0PA 4DS0A 1S0GA 3EHKA 2B8MA 3ZSKA 5JIUA 4HN0A 4K7JA 3M3EA 4RFT0 1FI2A 3ZMOA 3VBFB 1SEFA 4OVEA 4P9IA 1GQGA 1X8MA 4P14A 3ZN6B 3OBRA 4P9GA 2GZWA 2PFWA 2QFEA 4FPEA 4XF3A 4AEMA 4AE2A 4LTAA 3J26N 5FQ0B 1NA1A 4XF4A 3G7DA 1KITA 1FPN2 4XF0A 1CGPA 2VNGA 3WP5A 1V00A 2X29A 2JG8A 3ZFGA 2VQ0A 4AFCA 2NMNA 4YVWA 3A0NA 3ROUA 4YG3A 1R1A1 1W0OA 3J4UH 3AMMA 4QD2A 1D4M1 2VPVA 4CDWA 1PHMA 4PLOA 1NQJA 1UW8A 3VDDB 4ASMB 1FX5A 2ZBJA 4S2HA 4QPYA 2CWSA 4D69A 4Z82A 1Q5OA 3IT8A 2TNFA 4LULA 2ZA9A 4WM7A 2JD4A 4B7KA 4OHZA 5BNPC 4EWEA 2XKOA 1FAYA 5F6KA 2UWBA 1OFSA 2PHFA 3ZPYA 3FX3A 1GNHA 4AYUA 1KFUL 2JKBA 2GC1A 5DDJ3 2FMDA 3S6PA 1W6MA 3J8F2 1QH7A 1C3HA 1HXS2 1LHVA 1YFWA 1Q3EA 5K9YA 1ZBA3 3WINE 3WDYA 3VBHB 4N53B 2GMEA 4HT1T 3SHRA 5C4WC 1WCDJ 1FPN1 1F31A 3JD73 3FUQA 4N43A 2E53A 1CIWA 1S0EA 4YG0A 1BMV1 3ES1A 4I3GA 5AVAA 4YZ2A 1RB8G 2YHJA 4C0BA 2D6LX 5FPXA 4YZ1A 1LB2A 2RR13 5GLWA 3GF6A 5T52A 4AVSA 2ARBA 4FAHA 1D4VB 3WG4A 2HWD3 1GKBA 2DUOA 4RHV3 1NCQA 2D5FA 1R1A3 4YW3A 4LT5A 4J1WA 1DU3D 4R9DA 1AX0A 3AJYA 3JB8A 4LO5B 3ZVXA 1AZDA 5CAZA 2UYAA 5IK7A 1COV1 2VOXA 1REEA 4BH9A 1YCIA 3RJRA 4W6XA 3VZOA 3MW4A 1O4YA 1H1AA 2WNEA 1G8WA 1CQ9A 1RUC1 4IV1A 1HRV3 3FUOA 2Z2SB 2XVKA 4YZ3A 1PIV1 2WZR2 1XE8A 3I59A 4MZUA 4Z2WA 1OQDA 5FREA 4E9KA 4N53A 4DB5A 3NV1A 1OLRA 1XRUA 4B29A 1NYWA 1ENSA 1LJ7A 4B8EA 1VBC2 3VHNA 1ASJ3 1BVP1 3WDWA 4EN8B 1HRI2 2DCJA 3AYCA 2CY6A 1ASJ1 1BVVA 4N7IA 2PHUA 3O0VA 3VKNA 4Q4W1 2VULA 4AFAA 1VBD3 5A32B 5GZEA 2WSUA 1ENQA 3USUB 4YM2A 1LR5A 1RUC2 3H7JA 1W6QA 2ZGOA 3KS7A 2XHKA 3NVCA 3VBOB 1DFQA 1RJ8A 3ZN5A 2R063 5JOZA 3QACA 2HWF1 5KWRA 3SXWA 1APNA 1S0BA 5BNOA 2EXHA 1ZBE3 1C1FA 3FFQA 3UKTA 5BY5A 4JTOA 2H6BA 2VECA 4YFWA 2PAEA 3B01A 4Y4YA 1VBB1 3MF9A 2QDNA 3PHMA 4RS5C 1PZ7A 1X82A 2X5IA 4XFHA 4BYYA 4AQ6A 2RR11 2OYZA 3V0AA 1O3TA 3VLBB 1UPSA 2RS12 3ZXEA 1QHDA 2GSYA 4CDQC 4IV3A 2QE3A 3M2MA 4IEVA 2E51A 1D4M3 3OD0A 4N43C 4D3WA 3AP5A 4Y1UA 1VBA1 1YI7A 4WBBA 3VBSC 4URTA 3N36A 1I9RA 3PTYA 5HCAA 4RGAA 2LM3A 3VZMA 4CYDA 1JN2P 3GYDA 1N1TA 1S0IA 1XNBA 4MSVA 2NMOA 3VBUB 1KDKA 2RM22 4JGYA 1BKZA 1VRH1 1IPJA 3AMHA 1NCQC 1GR3A 3B69A 4I2OA 1RUG2 3N35A 3B02A 3MDPA 1H1IA 4PJYA 3OY8A 1QOOA 2CNAA 2R061 3USUA 5BNPB 2GAUA 3UL2A 4AVCA 3ZMNA 2OZJA 2W08A 3Q9OA 1DQ2A 1E57A 3WQ1A 1YJLA 2DCZA 1ALYA 1NE4A 4JQRA 4L9BA 4AI3A 4IV1C 4FPCA 2GC0A 1IPKA 2ZKNA 3B7MA 1F2NA 2EAKA 1FV3A 1WD4A 2E6VA 1PVC3 4N53C 3RS6A 1GZCA 1TEIA 1V70A 2A6WA 3CLPA 1YFXA 1ZZ6A 1NY72 2VXRA 4GIQA 3EO6A 1PO21 2RS53 1QJY1 1VIWB 3KT1A 4RR3C 1SLAA 3KCYA 4A2UA 4OI1A 5BNQA 4IL7A 3AP6A 1WW4A 1RUF2 3N7MA 1ZZCA 4MUVA 2GN7A 3FJSA 3WP4A 5CG8A 2R062 1UIKA 4GWNA 1PGL2 1KJRA 4AEDB 1WLDA 2EIGA 4RGGA 4H3WA 3WG2A 4XBNA 2JG9B 2ZGSA 4NWVA 2B45X 2P37A 2HWB2 4YVSC 4IV3B 4E27A 3NWKA 3JB4C 4GWMA 4GH4B 2ET7A 4IEWA 2DU0A 1W6OB 2X53S 3R6SA 3ZFFA 4MV2A 1VBC3 2MHFA 1DZTA 3AZZA 4LHNA 1VBE2 2ZX1A 3DPRC 5L19A 4W6YA 1YXWA 1AL21 1YIFA 4XJUA 1C8M2 4BA6A 2PHXA 3VL8A 1OA2A 4Q4V1 2D6PA 3I59B 2XJSA 2EXIA 1J1LA 3X29B 1QNWA 5DUUA 4YGBA 1K5MB 2ILMA 5ABJC 1VRH2 2B46X 2YROA 5HBAA 3MW2A 5CNAA 1QKQA 1MQTB 3D0JA 1JXNA 1G9BA 3AMNA 3L2HA 1G7YA 2R6QA 1AX2A 1ASJ2 3WUCA 3ZXFA 5J37A 2NPIA 4ZU5A 4PDWA 5L73A 1URXA 2D6MA 2EALA 3PJYA 4FPJA 3AZWA 4FPFA 4ES9A 3BCWA 4Y22A 2LALA 1QGLA 2YC0A 3O0WA 2KM2A 1QOSA 2ZHKA 5K0UC 3D8CA 1LULA 1MZ6A 4XHBA 3JQXA 4JTNA 1AYM2 3V64A 3WDVA 5L7OA 2WNVC 3WCRA 5GKAC 1PZ9A 4N43B 2K9ZA 1S1AA 3VBSB 2PHDA 1A8MA 3KQRA 1H9WA 4XXPA 3WR0A 3N7JA 4IETA 4CP2A 1BXHA 2ZMNA 2DVFA 4S2FA 3ZXGA 3MIHA 1WBLA 3AKSA 1SMVA 2VOKA 3TN91 4OHWA 4XQDA 2RR12 2IXCA 3EBRA 4WVWA 2VH9A 5I8TA 1NCQB 5IT6A 4NHKA 3H0OA 2TBVA 4Z8BA 5HI0A 1BQPA 3WUDA 1N1VA 1PK6B 3JD72 4KH9A 1W6OA 1ND3C 3BODA 4COUA 4Z07A 4Y22B 1LRHA 1LGNA 1ZBA2 2E63A 3ZYIB 1RMU2 4XF9A 1ENXA 1RUE2 4HVRA 2OA2A 4XJ9A 4HK8A 3ZXLA 1DZRA 1H1MA 2N7GA 3ALQA 4LBJA 1R1ZA 3ZFFC 1KDMA 2DVBA 4XJWA 1ZBA1 3WNXA 1BBT2 2WKKA 1Q56A 3CO2A 3AB0A 4NO4A 1D2QA 3DPRA 1ZRFA 5AVPA 2A6XA 2R30A 2VVDA 1MS4A 4I01A 1D0HA 1JUIA 4FPHA 2RJKA 2CTVA 1RUF3 1EAH1 1I1EA 3WG1A 4QGMA 4LA2A 5E1RA 4O9EA 4XFCA 1A6CA 4Y20A 4JDMA 2XPJA 4QQPA 4X8PA 3LKJA 1HQNA 4BIOA 1OHFA 1C1LA 4CDWC 1YJKA 4AK3A 1S2KA 1AJKA 2D7FA 1KS5A 4UBHA 4AEDC 3S30A 1VLNA 1JBCA 3O5SA 5D1IA 2YGLA 1NOVA 2YY1A 3TRSB 4FPLA 2UYBA 3GHMA 4K20A 3ZN4A 1GZWB 4YVSB 4IEZA 1PO11 3E5UA 1RUD2 1QY4A 5JZGB 4GH4C 4P9JA 4H14A 4WM7B 1ND2B 1HRV1 1LECA 4HBNA 1I3HA 4XETA 1AYN3 2ZKLA 4DQAA 2RE9A 3DPRB 3ENRA 1BJQA 3J9SA 5CG9A 3OCPA 3I7DA 2WNVA 4BE3A 4XW3A 4AQTA 5C6CA 4WVMA 1ZYBA 2I45A 2VVFA 2R1BA 3E97A 2WL1A 2GNBA 1CAWB 1LOGA 5E88A 4F3JA 2RM23 3CF6E 4NVPA 2RMU3 2P2KA 3RI8A 2IZWA 1UX6A 3AX4A 3HT2A 5FO9B 5ABJB 1CN1A 4FPKA 1BEV3 1QJU1 2EA7A 4OHXA 3N7KA 3ZIXA 2NQYA 2XBO2 4TSVA 2UY9A 1AF9A 5F9TA 3ILFA 4FT8A 4K1ZA 3MI8A 2WLQA 4L2NA 1AHSA 5EJ3A 4QHBA 2GNDA 2OPKA 2V5YA 1WA4A 4HANA 4KWJA 1G6NA 1M4WA 4H7LA 3WG3A 3HD8B 3ZDSA 1IHMA 2CGNA 2Q30A 3LSEA 3ZFEB 2I2SA 3B3QE 4EWDA 1G9AA 1OD5A 3FLRA 2RS31 4X8NA 5JI9A 5K0UB 3BOWA 4HK9A 1RUH3 2Q1ZB 5DG2A 4DFSA 5AC91 1V9U3 2P34A 2WNVB 2QUOA 3KT4A 2QZ3A 4HKWA 3VZLA 3O14A 1MVQA 1MS5A 4RQPA 2D98A 2HWC3 4QPIA 1ZBE2 1J3PA 4YW2A 2IWGB 4GB33 4AHYA 3IKWA 2UWCA 2VMIA 1JW6A 4CDXC 1VAKA 3H50A 5GJ6A 4WVMB 1O5UA 3NKGA 3NKTA 2ZABA 2AR6A 1C28A 3VGIA 4FAGA 4HVQA 5F1RA 3OBTA 1R093 2A6VA 2EXJA 3CU7A 3UK9A 1O91A 3MFAA 3QOPA 1FXZA 2HEWF 3GHNA 4KU8A 5T5PA 4AI1A 4NOTA 1ND2A 3M1HA 2PYTA 3MLKA 4FPOB 4KBBA 3V0BB 4FPYA 2D6OX 2Y0IA 3NV3A 1JTZX 4LBKA 4KNCA 1RUJ1 3INAA 3JCIA 3VDDA 2WZR3 4G3YC 3VZKA 3KM5A 3AYDA 3VBHC 4EWAA 1VBE3 1BK1A 4LBNA 1V9U2 2X5IC 3OGJA 4XMIA 3I2DA 2DWRA 1RMU1 4TZDA 5GM0A 2YPJA 1Z0HA 1VR3A 3S7IA 4HMZA 5H9QA 4BMEA 4QQLA 2CAVA 2PA7A 1LOCA 1R1A2 2BFUL 1NE6A 2CGOA 3LCPA 2W52A 3U11A 2W68A 2HWC1 1POV0 3N7LA 4BLJA 1V6JA 1GLHA 1GZ9A 3GALA 4GB32 2XWBB 1H30A 5K8SA 4FP2A 1OPMA 4RQPB 2ZGUA 4BIFA 2VMGA 1BEV2 3TBDA 1G9DA 1WGPA 2I07B 4CDWB 2R041 1NZCA 3UV9A 3EXUA 4MX3A 3SH5A 2BWCA 5JR7B 1TME3 3ACLA 4AFDA 3POYA 1QWRA 4F7ZA 1XNDA 1A8DA 2JEMA 1RUNA 3FLTA 4GULA 1YRZA 1RUH2 3T1LA 3PMSA 1LOFA 1VBC1 3AP4A 3D82A 1CAVA 1VAMA 1XYOA 4WM7C 1Z78A 5HCBA 1AR81 5FQ0A 3AZYA 4CEYB 5CFDC 1Z7S1 1QJX3 3H3UA 1WW7A 2WSVA 2ZS6B 3AP7A 5GZGA 1AXZA 1AYN2 4COWA 3MPBA 4LHLA 5GLUA 1JYCA 4Q0UA 4WM8C 2HWE1 4RD7A 3KGZA 4DINB 2Z5WA 4UW3A 2AUYA 1UZZA 2VW0A 4LE4A 5IK4A 4EN6B 1RL3A 2EAAA 1PVXA 2ZX3A 2ENRA 2RMU2 4CDXA 3IM0A 1RUG3 2BBVA 1MR5A 3M4FA 3RI9A 4HN1A 4NWWA 4Y20B 2WINB 1XYPA 2HEYF 3V0BA 3KSCA 1AR83 1LKNA 4BM8A 3WDXA 4AQSA 3ECQA 3ME2A 2GC2A 3CJXA 1DQ6A 3KLSA 2XGXA 1AR62 2BFUS 3WW3A 3GZAA 4FPGA 4Q26A 5KC5A 1XE7A 3I8TA 4LUMA 3MICA 2VW2A 1Q8OA 3MIEA 3FMGA 2BUKA 3ZFEC 3CJIC 3MGUA 2FBEA 4Y1YA 2DUPA 5FMOL 3D5OA 2ATFA 2UY8A 4CDQB 1H2LA 3PVEA 2XJPA 5JSRA 1H8VA 2R071 1HIXA 3WLUA 1X50A 1S0JA 1WW6A 4HL0A 1VBD1 2D44A 4Q1RA 1IOAA 3E5QA 2CYFA 1M06G 4FTEA 3O12A 1GNZA 3I54A 1FMD3 1LEDA 4JAAA 3WOGA 3B94A 4HFSA 3QBQA 4QPGB 5CVRA 5FO8B 4CDXB 4AQ2A 2RMU1 3VBUC 4KWKA 5LK7B 4O9GA 4EROA 1MEC1 2VUAA 1T6GC 3TYJA 4GKYA 5BNNA 1S0FA 2YMZA 2IFWA 4WVZA 4I3PA 2HWD1 3ZFGC 5FOJB 1AR91 1SQ4A 4YVWC 1POV3 4V1PA 1BBT3 1O3RA 1QXRA 4AEKA 3M7AA 1ZX5A 2CV6A 1DQ1A 4IXLA 5A32A 5DUWA 2HWF3 2JXAA 4IV1B 3QCWA 1MS1A 4QGLA 5DUXA 2PLV2 1QJU3 2K2SA 2R073 1HRI3 5HCFA 3WD5A 1NY71 2QJVA 2VMHA 1OPOA 2DCKA 3ZYGA 3ATGA 3QH7A 2X5IB 2GU9A 2XJQA 5J3UA 3G6JB 4ONUA 3ZXDA 2WA4A 3M3OA 3W59A 4M0NA 2VU9A 2MEV3 4LBLA 4B3NA 2A6YA 4XILA 4LBMA 3VBRB 2MEV1 3AXEA 5AFBA 3SMHA 1BCXA 1SDWA 3MIBA 1HQLA 2HYKA 4MH0E 5HXVA 2XJRA 2JX9A 3B9IA 4I02A 1LHNA 4Y1XA 1DGLA 4XQ4A 3A4UA 1PIV3 4S2GA 4WV8A 4LNVA 5C4WA 1SLTA 4YM0A 3VBSA 4JDNA 1UZYA 1CAXA 4BPZA 1SLBA 5DZGA 4RHV2 2HWD2 4JDOA 1EV13 1ZRCA 2ZGRA 2OW4A 1RUI2 1SFYA 4G4FA 1DZQA 2Y38A 3AMPA 4ASLA 1TMF1 1DGRN 1QDCA 5CU1A 2WT0A 1RUOA 1R081 2G9GA 2C9AA 1ZM1A 2UURA 1N3OA 2WT2A 3AP9A 3N3HA 4AFBA 1JOJA 4YFZA 2PAKA 4QXKA 3CJIA 4CEYC 1KXGA 5CFDB 5GZFA 1BEV1 5BXXA 2O8QA 2R072 2ZGKA 4XPVA 4META 5DDJ2 5BV6A 4WM8B 2HWB3 5LK5A 1ZZ7A 2ZX2A 4AG4A 4BHPA 3PVNA 1V6IA 3AMQA 4BWOA 2GDFA 3ILNA 1UU5A 1AX1A 1WMEA 4MGIE 1VRH3 3LB9A 5JVVA 2A75A 3LA2A 5AFEA 1PVC1 3FHIB 1K5MC 2ZJCA 2PAMA 3AFKA 3PLQA 2YDEA 1W2UA 1TMF3 1MQTC 5JDBA 5LEJA 1U0AA 1AYN1 4D7YA 5JWPA 1PO22 1C8M3 5KHIA 1QJY2 4PIXA 4DRVA 1O4TA 3VZJA 1J3QA 1UKGA 1KD7A 3KT7A 1GBGA 2ZGTA 2RS52 4XOGA 5H9PA 3W9AA 2G9FA 1DYPA 4QQHA 3WDUA 4COVA 4I09A 2JE9A 5JI7A 1SCSA 2QNKA 4CDUC 3WZ1A 1AR61 5B2GB 2B5HA 2O8OA 5JSPA 2ZX0A 4XQWA 1WCSA 4R4XA 5KHHA