1ND2B

The structure of rhinovirus 16
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
252
structure length
252
Chain Sequence
SDRIIQITRGDSTITSQDVANAVVGYGVWPHYLTPQDATAIDKPTQPDTSSNRFYTLDSKMWNSTSKGWWWKLPDALKDMGIFGENMFYHFLGRSGYTVHVQCNASKFHQGTLLVVMIPEHQLATVNKGNVNAGYKYTHPGEAGREVGTQVENEKQPSDDNWLNFDGTLLGNLLIFPHQFINLRSNNSATLIVPYVNAVPMDSMVRHNNWSLVIIPVCQLQSNNISNIVPITVSISPMCAEFSGARAKTVVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords coat protein VP1
publication title Structural and virological studies of the stages of virus replication that are affected by antirhinovirus compounds
pubmed doi rcsb
molecule tags Virus
total genus 61
structure length 252
sequence length 252
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2002-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1nd2B00
1HRI2 1ZBA2 5A33B 1RUH1 5BNOC 5BNPB 1AYM3 1RUE3 1QJX1 1VB2A 2BFUL 2MEV2 1HX6A 1AR93 4CDUA 1HRI3 2WLPA 3JB4C 4IV3B 1VBC2 3DPRA 1ZBE2 4Q4V1 4WM7B 4RR3B 3CJIB 1QJU3 4Q4X2 2RS53 2XBO3 2MEV3 5CFDB 1CJDA 2HWE3 1M06G 1NCQA 1RUJ2 4RS5B 1VBC3 2Y26A 4YVSC 1ZBE3 4GMP1 2BFUS 4GB31 5L7OB 1WCDJ 5K0UB 1VBA3 4JGYB 1VB4A 4N43B 5A32B 2RM22 2WFF1 1AL23 4YVWA 2RR13 5D8AC 2RMU3 4AEDA 1FOD2 1RUG1 1BEV2 1POV1 1BMV1 4GH4C 3VBUB 4CEWB 1C8M1 3FBMA 1ND2A 1RUD1 4N53A 3JBG1 1R081 3VBOB 1R091 4AEDB 1PGL2 5BNOA 2DF7A 2HWD3 3HAGA 5ABJB 1BEV3 4PDWC 4CDWC 1D4M1 2WZR1 1F8VA 1OOPB 4CEYC 1PIV1 1RUI1 2FZ2A 1TMF1 1AYN1 1QQP1 4FTSA 1PGW2 5BNPC 4FTEA 1FPN1 1R1A1 1AR71 2HWC1 1AR81 2WS91 1EV13 1VBB2 5JZGB 4IV3C 1RVF1 4Q4Y1 1COV1 4RHV2 4YVSA 2R041 1ZBA1 4QPIB 1DDLA 1MEC2 4WM7C 1QJX3 4RR3C 1Z7S2 2VQ0A 3CJIC 1VAKA 3JB8A 4Y4YA 4NWWA 5CFDC 5D8AA 5ACA2 3VBSB 4RS5C 5C8CB 3TN92 4Q4W3 4GH4A 1NA1B 5L7OC 1Z7S3 1VRH2 2PLV2 1BBT2 1RUC3 4IV1B 5K0UC 2BBVA 4JGYC 1NY72 4N43C 5LK7B 1PVC2 1EAH2 1HXS3 4Q4X1 4PDWA 4CDWA 1X36A 3VBUC 4CEWC 1CD3G 1RUJ1 4GB33 4CEYA 3ZFEA 3VBOC 1AYM2 5A33A 1VBD3 1EAH3 1QJY3 5BNPA 1AR92 2RS31 2IZWA 3ZFEB 5ABJC 3LOBA 1FOD1 1X33A 4GMP0 5AC92 1OOPC 4IV3A 2GH8A 3VBRB 2R061 2HWF3 1QJU2 2RS52 1PGL1 2XBO2 1FMD2 4WM7A 2HWE2 4RR3A 1VBE3 1POV0 3CJIA 4CDXB 5AC93 5CFDA 1QJZA 1RUF1 3M8LA 3NAPB 1K5MB 1RHI3 5JZGC 5J98B 4RS5A 4FSJA 2BUKA 4EJRA 2X5IB 2RS12 4QPIC 1VBA2 1FMD3 5L7OA 1AL22 2RR12 4QPGB 1B35B 2RMU2 5K0UA 1PGW1 4JGYA 4N43A 5A32A 1V9U3 5C9AB 3VBSC 2R043 1HRV3 5C8CC 3S6PA 3J8F1 1TME2 1VBB1 3VBUA 4CEWA 2RS13 4RHV1 3JD72 1NA1C 1GFF2 3VBOA 1RMU1 4IV1C 2HWB2 2HWD2 5C4WB 1MEC1 1PO23 5ABJA 1C8NA 2R073 1TME3 3VBFA 5ACA1 1OOPA 3JD73 2HWB3 1HQNA 1VRH1 2PLV1 1BBT1 3VBFB 1PO11 1NY71 3ZFEC 1ASJ1 1EV12 1PVC1 2TBVA 2WWSA 2FZ1A 1AR63 5JZGA 5DDJ3 3VBRC 1QJX2 4Z92B 4QPIA 1AYM1 1RUE1 3VDDC 4Q4V2 4CDXC 1RUH3 3VBHA 1AR91 4Q4W2 3NAPC 1K5MC 1HRI1 3VBSA 4RFT0 5C8CA 2R063 1A6CA 2X5IC 1RUC2 1NA1A 3VBHB 1ND3B 1HXS2 1B35C 4QPGC 4IV1A 1QJU1 2RS51 1AUYA 2XBO1 2MEV1 4Q4V3 2HWE1 5C9AC 4GB32 2BPA2 1VBC1 1ZBE1 1OPOA 1VBD2 1NCRB 1QJY2 1VBA1 4GMP3 5C4WC 1C8M2 1AL21 1IHMA 2RR11 1NG0A 2RMU1 2WFF3 1RUG3 2HWF2 1POV3 4CDQB 3VBRA 2RM21 1C8M3 1VBE2 3VBFC 1RUD3 2HWD1 1BEV1 3IDEA 1R083 3JBG3 1R093 4WM8B 5CFCB 1RHI2 3ZFGB 3VDDA 4CDXA 3NAPA 1K5MA 4SBVA 1R1A2 4JGZB 1PO13 1D4M3 2WZR3 2X5IA 3VDDB 1V9U2 1PIV3 5FOJB 1RVF2 4QPGA 1B35A 1COV2 2R042 4RQPB 1RUI3 1HRV2 1EV11 1AYN3 1QQP3 1TMF3 5C9AA 1FPN3 1R1A3 5BNNB 1AR73 2HWC3 2GSYA 3ZFFB 1AR83 2WS93 3VBHC 1ND3C 4NWVA 1OHFA 1RVF3 1PO22 4Q4Y3 1COV3 5C4WA 2R072 1ZBA3 1NOVA 4Q4W1 4CDUB 2XPJA 1RB8G 1NCRC 1Z7S1 3DPRB 1RUC1 2ZAHA 4FTBA 1HXS1 1H8TC 1AR62 3TN91 4BCUA 5DDJ2 1NCQB 4Q4X3 4LLFA 2RS32 4CDQC 1VBD1 1RUJ3 1EAH1 1QJY1 1RUH2 4WM8C 5CFCC 3ZFGC 2R062 1MQTC 4YVWB 1F2NA 2ZTNA 3ZXAC 2RS33 2RM23 4JGZC 1E57A 1FOD3 2HWF1 1ND2B 1RUF2 4N53B 5J96B 1ND3A 1VBE1 4RQPC 5AC91 5BNOB 1SMVA 5GKAC 1RHI1 5BNNC 3ZFFC 1RUF3 2QQPA 1FMD1 1NCRA 3J8F2 1V9U1 1AL0G 2WFF2 1HRV1 1H8TA 2ZZQA 1RMU2 1RUG2 2RS11 4CDUC 1BMV2 3DPRC 4YVSB 1RUD2 4CDQA 3J8F3 1H8TB 1VBB3 3JBG2 1R082 5FMOL 1R092 1PO21 4RHV3 2R071 4WM8A 1RMU3 5CFCA 1TME1 3ZFGA 1MEC3 1MQTA 1NCQC 3JD71 5D8AB 1PO12 1D4M2 2WZR2 1ASJ2 2HWB1 4JGZA 1PIV2 4GH4B 5ACA3 1W39A 1RUI2 3TN93 1MQTB 4Y5Z0 1TMF2 1AYN2 1QQP2 1FPN2 4RQPA 4YVWC 1AR61 1AR72 1VRH3 2HWC2 1BBT3 2PLV3 5FMOS 4AEDC 4PDWB 5DDJ1 1AR82 1ASJ3 1PVC3 2WS92 4CDWB 1RUE2 5BNNA 3ZFFA 4Q4Y2 4CEYB 1ND2C 4N53C
chains in the Genus database with same CATH superfamily
1PZ9A 4Y24A 4TLGA 1YWKA 1W8FA 4QB6A 3NNFA 2JE8A 5DAQA 2QQJA 3H8OA 4P00B 1CZSA 2B7YA 5A7OA 3RNSA 1XE8A 2MNGA 4QMAA 1CN1A 3I2HA 4EYUA 2YZ4A 1QJX1 3SH3A 1YFUA 1GUIA 4ZXKA 3KCCA 1AR93 3WDVA 3A22A 4CDUA 2J1VA 3IIAA 5I93A 1RJ8A 2PYTA 4CU9A 2WLPA 3LB9A 4QDQA 2XUEA 3ES4A 3POBA 4FPKA 3PUQA 1ZBE2 3THDA 1W06A 3PVEA 4D7SA 5J48A 3H8RA 5FLJA 4CXWA 2ZKNA 5LA0A 5DMYA 5FP7A 2YXSA 1HLCA 4Q4X2 4MYEA 2RS53 5FREA 3ZSMA 4QQPA 2MEV3 4HANA 3DXUA 4ZHNA 3KZ4C 1UPSA 1V00A 1NCQA 5CBLA 2JDNA 4XIKA 1W6NB 2F4PA 4AI1A 4F8AA 4YVSC 1UY1A 1DGRA 3AP4A 1NLRA 5T5OA 4YYOA 3N7LA 3N7MA 1UOGA 2CSGA 3RDIA 4CTEA 1GQGA 1VBA3 3OD0A 3OSDA 5E1RA 4JDOA 4XAAA 2NMOA 5CZKA 5L36A 1VP6A 2Q8DA 2VXRA 2D6KA 4GAZA 2G19A 3VKFC 2QQNA 4ARXA 3AX4A 3CZUA 3FBMA 4CE8A 2Z5WA 4DMIA 4N53A 5FY9A 2D6MA 3B5LB 1GWLA 1W8HA 1R091 3BOPA 2VPVA 1O5LA 1UIJA 3I2JA 3E5XA 2XJVA 4XJUA 5BNOA 2QQKA 1V6NA 1UYPA 1BEV3 1X8MA 2NN8A 2JDHA 3NV2A 2UYBA 1BLZA 1MS3A 1KDKA 2C9KA 3UYJA 5JOZA 1QJFA 3NWKA 3KT1A 3K3NA 4OMCA 3EYPA 3MF6A 4K21A 3K3OA 3CHXA 4OQ9A 2FZ2A 4XETA 5FKCA 1FPN1 3EHKA 4FTEA 3HOBA 3OJBA 4I2OA 1DZQA 1KDMA 4KWLA 4XF9A 1SCSA 3A0KA 3POYA 1B09A 2PXJA 3L9JT 2WT2A 1JTZX 1COV1 1CQ9A 2K0GA 3B69A 4Y3OA 2R041 1WW5A 3KV9A 4QPIB 2JDZA 1PNGA 2OYZA 1K12A 3LA7A 2BOJA 5FWJA 4YZ5A 2R49A 4RGGA 1PMJX 3CJIC 4AG4A 5EP9A 5C7GA 1BYHA 5FBZA 4FPEA 3D8CA 1XB9A 2ZJCA 3H8XA 3MFAA 5B4NA 3TN92 4Q4W3 2WNUB 4GH4A 3ZYBA 1VMHA 1OURA 5EXOA 5IK5A 3H7YA 5L7OC 2ZMLA 4JRLA 2ZGOA 5CEHA 1Z7S3 2W92A 1RUC3 2ZKLA 3N3HA 3OYWB 2EXHA 2AEYA 1KJLA 3CO2A 3PVNA 3WD5A 4KL1A 3O1VA 1O3SA 1YIPA 1AXYA 4Q4X1 1UY2A 1UYXA 3O12A 2FDFA 3RYPA 1XBFA 1XNBA 1YI9A 5GZDA 2RJLA 3ZN6B 2QQUA 1BKZA 5APAA 3VBUC 1LKNA 4CEWC 5JSOA 1UYZA 2EXIA 5IK7A 3BUCA 4CEYA 3TB0A 1W9FA 3ZFEA 2ZOEB 4XXAA 5GZEA 3ZN4A 3LEGA 4RGKA 3URFA 2WQ8A 2JIGA 2Y34A 2D6NA 3B7MA 1XC6A 1NYWA 3AZVA 3KQ4B 4ASLA 1QJY3 5FFOC 1OQEA 2IZWA 4FPFA 3LOBA 1FI2A 4GMP0 1UIKA 1AX2A 1MS5A 4AHXA 5KHIA 4O61A 5DZFA 5KXBA 1V6IA 5GM0A 4RA0A 2JDPA 5HXMA 1J3PA 2R061 4YW1A 4AAXA 1GZCA 1ST8A 4AVAA 5KXDA 1K3IA 2B4KA 4XJ8A 3U4SA 5E8AA 1SHWB 1VBE3 4QX0A 3VKNA 1C5IA 1POV0 4LO5B 1CESA 1X9TA 1XYNA 3GJAA 3ACHA 1QJZA 1RUF1 3M8LA 1F5FA 3KSCA 1E5IA 5FLHA 3NAPB 3OBTA 1RHI3 3PJQA 4I02A 5D1IA 4S2GA 5J98B 3SEEA 5JZGC 1W6NA 2ARBA 4NR1A 4UOJA 4EJRA 5C71A 1W28A 2RS12 1WMFA 4OI2A 3T2TA 5JSRA 1C1LA 3RJ2X 2W47A 1W0PA 5FZKA 1AL22 3RZMA 3WDTA 3QBQA 1W9SA 2GU9A 2NMNA 4MX3A 3J7LA 4BJ0A 5A3MA 3HN1A 3LSDA 4MGZE 1HB1A 2VVFA 1OF3A 3M3EA 2ZXQA 1HRV3 1STMA 5C8CC 4LITA 3S6PA 2L9LA 3J8F1 1TME2 4META 2ZEWA 4M3CB 2SBAA 3APBA 4W4ZA 1QDCA 3ME2A 2KR2A 3AKTA 3DYPA 2A6XA 1G7YA 2A3WA 1NA1C 3JD72 4QKNA 5A70A 5IK8A 1GFF2 1IKQA 2PTMA 5FBJA 2OQ7A 2BOIA 2BYVE 2A70A 2HWD2 4YGEA 1VLNA 1ZM1A 2A3XA 3AP6A 4INDA 4YNIA 4UW6A 1PO23 2O8OA 1NLSA 1Q5OA 3IKWA 5FMCA 3ZR6A 5K8SA 4JCKA 1UMHA 5CB7A 2P4EA 3RYKA 1LOBA 3VBFA 1XQNA 1UYYA 4AQSA 1HDKA 4AYUA 1JZ5A 2QDNA 1IS4A 1X82A 4QU1A 4QDRA 1S0JA 3IT8A 5F6KA 5GALA 4SLIA 1HQNA 2DUOA 1CWPA 4FXGB 4P9YA 1XNAA 2JG8B 3KVAA 3ZFEC 4AEJA 1EV12 1HJFA 2TBVA 5JOYA 4FPJA 3PUIA 1QH6A 2OIIA 3ITQA 1GWKA 1UQXA 3LF7A 3WUCA 5GZCA 3KV6A 2LALA 2K9ZA 4ATEA 1OFSA 4B3NA 1DCSA 1VIWB 4I3GA 1OVSA 1F35A 1SLIA 2J1AA 5LATA 1OMIA 4QPIA 2D40A 2JB8A 5FZ4A 2JE9A 1RIRA 2XDVA 3GCXA 1YYNA 1K45A 3VDDC 4Q4V2 4CDXC 1GP4A 5LZ6A 1H1MA 3VBHA 1JXNA 4KGQA 2BVBA 3LE0A 4CCOA 1K5MC 1HRI1 2JIJA 3KGLA 4QX2A 1LOFC 1QKQA 4YW4A 3WSOA 4AWDA 1OPMA 2QQWA 2W9XA 3KS7A 2D3RA 4KH9A 1JOJA 5JWPA 1HW5A 4QPGC 2G4IA 3VL8A 3WHUA 1D0HA 3WEZA 3OYWA 3WLUA 3VHOA 3WQBA 3VKMA 5C9AC 2A73B 2BPA2 5KHKA 1FAYA 1W8ZA 1REEA 1VBC1 5LY1A 4E2SA 1RXFA 1WW7A 5IAVA 2VE1A 5EPAA 2B8MA 2XKOA 3ZN6A 1L7RA 3ZXLA 2Y0IA 1OPOA 1TQ5A 1H2LA 3GHNA 2WABA 4AL9A 1JH5A 1O3TA 1WLDA 3PUAA 4L99A 3ZSKA 2VZUA 4HN0A 1UY4A 3TEXA 1AL21 3CBNA 1PX3A 1YQ6A 3ZPOA 1NG0A 4R52A 4PBOA 5EJZB 2ZMNA 3PUHA 1APNA 4LORA 3WG2A 5I8SA 2YHJA 4EN0A 3VZJA 2ZBJA 2ZHKA 3VZNA 2WJSA 3R4SA 2YV8A 3T4VA 2VTXJ 3ZOIA 2LRPA 3M7AA 4IEXA 1BHGA 4AEKA 2QE3A 5FK8A 2RM21 3CEWA 4HSLA 1DGWA 1WMDA 3VBFC 2HWD1 5FRAA 2I45A 1W8TA 2Y8KA 1R093 1NLQA 4YW6A 3R0RA 2PAKA 1H2NA 2LW8A 4N9HA 4R8HA 4XYXA 1JZ3A 4ISRA 5IFTA 1KRIA 4OHYA 2OS2A 1ULFA 3NW4A 5IJRA 3I3MA 5FZHA 3UJOA 2DCTA 3NAPA 2VY0A 1PMHX 4I0BA 4XE9A 4JGZB 1DBNA 3PDQA 1PO13 3FMGA 3I59B 4AE2A 4LA3A 4JVAA 5FOJB 1ZYBA 2K2SA 2V73A 2D7FA 1YEWA 1E5SA 2E26A 4N90A 2PHXA 3ZYIB 5HBAA 1EV11 1H9PA 2XOMA 1KD7A 3BVCA 4PLNA 4QPYA 1FPN3 1ZZ8A 2RV9A 3BALA 4V2WA 5F5CA 4ZY9A 4M3CA 2PAEA 5EHDA 4B29A 4BQ1A 1SBFA 4B7KA 2Y6JA 4X8NA 1LULA 2TNFA 3LFMA 2EIBA 4P9IA 5CYYA 4NWVA 3VBHC 2P37A 2JDYA 5FY7A 4OQ8A 1K42A 1COV3 3NNJA 1W2UA 2PMWB 3GZTB 3U75A 5F7UA 1Y43B 1EUUA 1NAEA 5FYIA 2ZX2A 2DU1A 4OZOA 3LOIA 1NOVA 2ZX1A 4PI2A 4IW3A 1W8OA 4C90A 5A6YA 1LGNA 4UW3A 5J09A 4LXLA 1HB3A 2QFEA 1VAMA 2XPJA 4LOSA 2P34A 1RB8G 1NCRC 2VL4A 4J1XA 2EAAA 3HWJA 3N9LA 3AZWA 4CUAA 3ETPA 1F31A 4NUBA 4W8JA 4ZS2A 5ERLA 3EBRA 4YFWA 5AVPA 1H1IA 4V2VA 1TG7A 1AJKA 2PAMA 4Y5TA 3LFIA 2FHRA 2JG8A 1AR62 2JB4A 4XJAA 4JDMA 1XU2A 1DIWA 2UY8A 2WA3A 5A7NA 1HN1A 2VOXA 4Q4X3 3WDXA 3ZR5A 2J1UA 4DFSA 4Y5SA 2VQAA 2ATFA 1EP0A 4BWOA 2VU9A 1I3HA 1LHWA 4O9EA 1VR3A 1MZEA 3INAA 2OKXA 3SQOA 1G8WA 4Y33A 3CMGA 1CR7A 5FJHA 4L9BA 4M01A 5A3WA 3ZIXA 3MO4A 4CCDA 3AJYA 2JEMA 3T0BA 1F2NA 2ZTNA 2AC1A 4YG3A 3ZXAC 4LTAA 4BOWA 1T6GC 1S0IA 4AAPA 1NX9A 2AUYA 3I7DA 1BXHA 3P3NA 4LO7A 5DUUA 3AK0A 4G3YC 3O1RA 2LROA 5EZWA 3ZXGA 4YM3A 3GM8A 2JICA 4H14A 1SDDB 4XMAA 4UFLA 4OUMA 2ZEXA 3MYXA 3WNLA 2FDHA 3WP4A 2QZ2A 1X8EA 3PTRB 4GWJA 3OGJA 2WO3A 1XNDA 4L2NA 4J25A 1GNHA 4OLLA 3ALQA 4DRRA 5J37A 3WW3A 1LCLA 1NXMA 3KV5A 4KBZA 1RUF3 4AF9A 3THTA 3N35A 2BNNA 3EJKA 5CADA 1UW8A 3ABZA 2ZS6B 2IUWA 3HNBM 4COUA 1OF4A 1G9FA 4MHUA 4XTPA 2YC0A 1LAJA 4XFHA 1S2KA 1VE0A 2WFF2 4LE4A 1H8TA 2CWSA 4BLIA 4LKFA 4YG0A 5JOXA 1CJPA 1QXRA 3B3QE 1RUG2 3GBWA 4Y22B 1VALA 5JMCA 3AZZA 1CAUB 4D69A 1N1TA 1DFQA 1V6JA 4BQ4A 5A1FA 4M0NA 4DUVA 4YVSB 1RUD2 2GAUA 4XCBA 3J8F3 4P02B 3JBG2 1XSQA 5FMOL 4HG6B 1DGRN 1Q43A 2BTVC 1C3HA 5H9QA 4LK6A 2VECA 3POIA 4GULA 5DN2A 2PHFA 5JVVA 3H0OA 1WCSA 1Y7BA 3JQXA 4CSWA 2DYCA 2ZGQA 1SFPA 5HCFA 3NJXA 4I09A 1HN0A 4HLTA 1V6MA 2R0HA 1ASJ2 4JGZA 1PIV2 3MPPG 2PA7A 5IW0A 1W39A 4UT5A 1LU2A 3LDRA 1AXZA 4LMFA 4W6XA 3IDBB 3I59A 1GU3A 1WZXA 3TN93 5FO9B 1LU1A 1YXWA 3VGIA 1RUOA 1AYN2 1OH4A 4NJ4A 4XOGA 5BXXA 2VMGA 5JCTA 5FLIA 2WYSA 3H1WA 1QF3A 2ZHLA 4YVWC 1AR61 4QGLA 4O65A 4AEDC 2VNVA 3SCHA 5LB6A 1AR82 1Q8PA 2WNVC 1DQ2A 3QOPA 3LEIA 1DG6A 3FFZA 1I5PA 1ENQA 2JKXA 4Q4Y2 4JQTA 4RD7A 1SLBA 1GWMA 1S2BA 3I97A 4LHSA 4UI9L 2ZMKA 1ZBA2 4Y1XA 4F7ZA 1A8MA 2WBKA 1ZRIA 3C7FA 5EIYB 4NHXA 1G9AA 1WA4A 4Y26A 1GOHA 1D2QA 3A21A 1MS1A 4HVQA 5IYYA 4IE0A 1VB2A 2C24A 2B42B 4RL7A 3JU9A 3MZHA 1US2A 1NZIA 5FXVA 1GOGA 4FPGA 4YZ2A 1HRI3 2P1BA 4LR4A 3T30A 3U4XA 2DDUA 4UYBA 4LOTA 1ODMA 3JQWA 4EN8B 5LCWL 4IDZA 1OA4A 2I07B 3WP5A 1W8WA 2GN7A 3TEWA 2FDIA 1OLMA 2Y64A 4IE7A 5FZ7A 1V70A 3CJIB 4HKLA 4PIZA 4D0QA 2A7AA 1CJDA 4I01A 2RE9A 5EJ3A 2X10A 2VD7A 2WSUA 3FLRA 2HBUA 3RPQA 4HFSA 1VBC3 5BY5A 5LBCA 3RQ0A 4LO6B 3UJQA 4IEPA 3MPBA 2E32A 3LA2A 1LGBA 4HK9A 5FYYA 5L7OB 4BPZA 2J1RA 3GZEA 2R7EB 1BCXA 3KCXA 2Q8CA 4R4ZA 2WFF1 3H9AA 1AL23 5FZ8A 3SISA 2UYAA 3WR0A 5D8AC 3WNMA 2QTWB 4XAEA 1FOD2 1RUG1 2DFCA 2DTWA 2P5BA 1GNZA 2W5FA 4FPOB 3VD3A 1SLCA 3VBUB 4CEWB 1C8M1 1QU0A 1Y9GA 2J1TA 4FPCA 4KG0A 1UPIA 2YY1A 2XB6C 2DCJA 4YLZA 4ZONA 4CP2A 1RUD1 5FZFA 1JZ8A 3BU0A 4JHTA 4QX5A 1O7FA 3JBG1 2NPIA 1W2AX 2WZ8A 3MGUA 3NNLA 1FT9A 3AMMA 3PURA 3AFGA 4M3CF 4QWNA 2V4VA 5FYZA 1GMMA 4Z8BA 2E51A 2HWD3 2VZRA 4IETA 2EIEA 4XHXA 4CRQA 2J7MA 2VO5A 2Y6GA 4QQHA 1PK6C 4B7EA 2VUJA 3AZYA 4XUPA 5A3LA 1F8VA 3AYAA 4URTA 3DUIA 1PIV1 3C7EA 3SH5A 4D94A 2ZABA 3AYDA 1WGPA 2VZSA 2HYXA 2QQMA 1JYCA 1TNFA 2V5DA 4QXCA 1AYN1 4OHXA 1W3XA 1PGW2 2BGOA 1ZRDA 1S55A 5BNPC 2A71A 3O14A 2WQZC 2SLIA 3NJVA 3QH7A 5T52A 4XIOA 2WINB 5H9SA 4Y22A 2PHUA 2OUHA 2RDQA 3S7IA 2CDOA 1AR81 1CAUA 1EV13 1YO8A 2DWRA 3POGA 4NMIA 5A1LA 1A8DA 3VHNA 2IXLA 3OGSA 5JZGB 1N3PA 1DQ5A 4Q4Y1 5FPAA 4C91A 4YVSA 3ASIA 1CAXB 4ZPIA 2VNRA 4K40A 3MIDA 1PGSA 1ZBA1 1YJLA 5KC6A 2UURA 3S5AA 2AYHA 1QDOA 3HNMA 1ENXA 4N7IA 4WM7C 3MLKA 4AVCA 1SDWA 3IZOA 3CDZB 2J1SA 5IWFA 1YJKA 4NWWA 1XU1A 4S2HA 5ISLA 3ZYRA 4XFBA 4XUNA 1S0BA 4IL7A 1QXJA 4RS5C 5C8CB 1OD3A 4FOQA 2K46A 5D21A 3U0ZA 2PQSA 4JQRA 4TXWA 5DG2A 5JR7B 3IM0A 4JKMA 3S30A 5T50A 1MS0A 1GZTA 1NA1B 4DEVA 1SLTA 5L73A 1BBT2 4LKSA 5K0UC 2W08A 2WDBA 4JGYC 4N43C 5FPVA 4E4HA 2AACA 1JMUB 1EAH2 4TN7A 3J4UH 4P14A 1DQ4A 5T5JA 1QIQA 3C3VA 3IDAA 1G9DA 2VW1A 2Y33A 1AJOA 2X29A 2XG3A 3HR9A 2H0BA 4QKFA 3O0WA 4IEUA 2D5FA 1ULOA 2VUDA 2GP3A 1AYM2 5C70A 3SKVA 1I6XA 1MVEA 1C4RA 3WQ0A 2ORXA 1GICA 3J7MA 1UOFA 1FATA 4DQAA 2RS31 2VW0A 2ZZJA 3LPFA 3ZFEB 4DS0A 5ABJC 2VQUA 4ES8A 3FN9A 1FOD1 5AC92 4NVPA 1OOPC 2DV9A 3KD4A 4CCEA 4S2FA 3HBZA 2FBEA 5M0TA 2PHLA 5CG9A 2GH8A 4QQLA 2ENRA 3IDCB 3WW4A 2WIIB 1O59A 3LPGA 1HJGA 2W1UA 4Q1PA 1FMD2 2W87A 4BIOA 3KF5A 5T3NA 1O8SA 4XZPA 3CJIA 5SV5A 4CP9B 2Q0AA 3KLSA 5GLTA 4CDXB 5FQ0B 4LBMA 4BQ5A 1K5MB 1CPMA 3VHRA 2E7TA 5IVJA 3BTZA 1Y4WA 3BGAA 4CU6A 2EAKA 4PIXA 4XQ4A 3WCRA 3LIGA 4JAAA 4FSJA 2Z79A 4D7TA 3IAQA 2FMDA 1BQPA 4W65A 5L7OA 1J84A 3AKRA 3POSA 4QPGB 1KJRA 3IN9A 2PHTA 5ANQA 5FZLA 1GANA 1PGW1 3MIHA 3CU7A 5B2GB 5C9AB 1GOFA 2ETEA 3PJYA 3VBSC 3K51A 2YG0A 4AVSA 5EV7A 5C3OA 3I2IA 3Q9OA 3RYRA 5GLZA 3VBUA 5HCBA 2ZACA 3BODA 4CEWA 3FE5A 2W95A 5L9BA 3LDKA 5IFPA 4FBFA 3UT0A 1RMU1 1GLHA 1NT0A 2HWB2 1AHSA 1ULDA 3FC0A 4IV1C 4XDQA 3I2DA 3SXWA 4AGGA 3M3OA 1RINA 4YM0A 1US3A 4COVA 4YZ3A 4BQYA 2R16A 3C8XA 5T55A 1GQHA 4CA9A 2WO7A 4YW2A 2ZPXA 2JD9A 1SQ4A 5FZGA 4XJWA 1WBLA 3NMBA 4D8MA 1WA6X 1BK1A 5KWRA 3ZMOA 5A3NA 3VBFB 1BBT1 4M00A 1PO11 2QJVA 4I30A 3D4KA 4ET7A 5F9TA 4QB2A 3HD8B 4I3PA 2B5HA 5A7PA 4YZ4A 3SLIA 4YW5A 4LBKA 4AVVA 3WDUA 1AR63 3CZJA 4TLFA 2NQYA 1OA2A 3LDBA 4NPRA 5JZGA 1VRBA 5LA9A 3ZKUA 4MGIE 3VBRC 3T08A 1CAXA 4YW3A 3SEPA 4Z92B 4NRMA 4YM2A 1JHNA 1LHVA 1AYM1 1QNYA 3BB6A 1RUE1 5IUQA 3O0XA 2VUCA 3WF1A 1E5RA 4D6RA 1CVNA 2A6WA 2XVLA 3J7HA 3B94A 5FYTA 1NZCA 1DU3D 1W9YA 2DU0A 4UXAA 5C8CA 3PVOA 2F4LA 1A6CA 2XJPA 2BV4A 2AR6A 3CKHA 3UGHA 4LBJA 2X5IC 1O3QA 1KFXL 5HCAA 2YYOA 2GC2A 2VZ1A 1NA1A 3GBGA 3VBHB 2QQVA 4XBNA 5HI0A 1AUYA 2WNOA 4NRQA 2O14A 3WT3A 3VUOA 1EUTA 4GB32 3WW1A 4N8MA 1S0CA 2C6SA 1ZBE1 3WV6A 4QHOA 3KHCA 2JJ6A 1VBD2 2WC2A 1NCRB 3V0AB 4XACA 4AFBA 1GNYA 2VQTA 4ES9A 5E89A 1JW6A 1U12A 3QCWA 3R6SA 1J58A 1UO9A 1S0FA 4AZZA 2GDFA 4COZA 3W21A 1OKQA 1YFYA 2GC1A 2WFF3 4UFIA 3ACGA 4D7YA 4FOWA 1V0AA 1LGCA 2Q1ZB 4QM8A 2BRTA 1RUG3 2BVVA 3DGTA 2HWF2 1BK0A 1C8M3 4E8CA 4XJZA 3THPA 2W91A 3W59A 1BVVA 3VZLA 2VTFA 1RUD3 3LGRA 2X05A 4CCCA 2WL1A 5A3TA 3ST7A 2C0ZA 3JBG3 3AXEA 4MGSA 2CWMA 3QD6A 5DZGA 4CP9A 3VDDA 1RTVA 4CDXA 5HCHA 5I0UA 4UWDA 5EWSA 1R64A 4H2AA 3WNNA 4AHWA 5FQ0A 1LOCA 4M4RA 1SG3A 1N1SA 1K5MA 2Q1MA 1R1A2 4CCMA 1LOFA 2CNAA 4XF4A 4DUWA 3IMMA 1ALYA 3H3UA 5FPXA 2QNKA 2YUEA 5BV6A 1QOSA 1V9U2 1PIV3 1Q8VA 2VBPA 3FX3A 1RUNA 1RVF2 1YLLA 4QPGA 4I0AA 4ZS3A 4QXBA 4XTMA 1UXXX 2I2SA 1AYN3 2VVDA 4CU7A 5C9AA 2XQRA 2MHFA 1UKRA 3I49A 5CFCB 1OH3A 2NM1A 4YFZA 4ZZ5A 1AR83 4Y1VA 3KMHA 3BPZA 2YC4A 5C3QA 4RYDA 2A75A 4Q4Y3 2VCCA 5FCCA 5FYMA 3BOWA 1Z0HA 2R072 5LEKA 1ZBA3 1QGLA 4QD2A 5JLVA 4MG2A 2CHHA 4GZ9A 5JPMB 1ZX5A 2GC0A 2GNDA 2ZHMA 2Q8OA 2C26A 4LO8A 1WW4A 1YRZA 3EXUA 2P6CA 3OBAA 4Y20B 2E6VA 5K7PA 5FPUA 1W03A 3EQEA 4FO9A 3ZVXA 5FAXA 3VDBA 2UWBA 3ELNA 3LSEA 4NE9A 3FL7A 3HMYA 1ODNA 1Z78A 4FTBA 4DIQA 4DXSA 5FO8B 1GR3A 1RJ7A 1UU5A 3BTXA 1JOPA 4XUOA 2WAOA 2BBAA 5LASA 1C1FA 3TN91 4CU8A 5DDJ2 4LULA 2ES3A 4Q0UA 1ULPA 3PIJA 4L97A 5F6LB 2AGSA 2Z42A 2B45X 4KWJA 1VBD1 5FO7B 2BNOA 3MBWA 3CNAA 3MIFA 4DPNA 1UWWA 1LENA 1W6QB 4IEYA 4GKYA 4NIAA 2XHKA 1SPPB 2E31A 2VW2A 1MQTC 3MIGA 4JRAA 4YVWB 1J3RA 4UW5A 3UL2A 3K46A 5LWBA 5DUXA 2RS33 1YCIA 4QXKA 4B4RA 2P17A 5CA6A 2WNVB 2XONA 4XMIA 4UBHA 1E57A 1FOD3 1WWYA 4D6QA 2HWF1 3NJZA 3M1HA 5J96B 3O1SA 2H6CA 5FZDA 2AH2A 4RQPC 4XFCA 5KXCA 4LUKA 3UKNA 5GKAC 5KHGA 1TEIA 1KXGA 1XOYA 4LNVA 4BB3A 4HSJA 3OB8A 4NHYA 5BNNC 1XNCA 2Y6LA 2OQ6A 4CUCA 5L9RA 3S5QA 2EA7A 1LR5A 4OI1A 3ZXDA 4BMBA 4TTGA 3HEIA 1W2NA 3OTFA 1BZWA 2QQPA 5SV8A 4DEQA 5FZ6A 1NCRA 3V0AA 3VD5A 5IVYA 4BK4A 1QEXA 3WP6A 1IZ3A 1V9U1 3S57A 2JKBA 1XXNA 2LS6A 4OULA 2NP0A 3N9PA 3BTYA 3ZYGA 2DCKA 2EIDA 2RDNA 2PN5A 2VH9A 2ZZQA 4XVHA 3POJA 4LEJA 3WF3A 1JYNA 2RS11 4PIYA 1BMV2 3ACFA 1H30A 4QKDA 3OOXA 3WP3A 3DPRC 1VMFA 2VOKA 2E7QA 1H8TB 1R082 3DV8A 3M3IA 2WLQA 2FMYA 1D7PM 1IQAA 3GCWA 3IWZA 2KD7A 2R071 1O6UA 4COYA 1RMU3 4BE3A 1TME1 4E9KA 4E27A 3DF0A 3NNMA 1AZDA 3LD8A 3POWA 4HT1T 3JD71 5D8AB 5DAWA 5C6CA 1PM7A 2ZA9A 1D4M2 4NOTA 1ZA4A 1ZZCA 3O1TA 2W1WA 4EE2A 5IAXA 2OUJA 2ZGKA 1Q8SA 3W5MA 3KQRA 1LOEA 2VZVA 4Y5Z0 1QQP2 1A3KA 4K7JA 1ZZBA 2ZGUA 4CUGA 2BP6A 2CTVA 4QQOA 1OLRA 1AR72 5FMOS 4X6RB 1BBT3 1H6XA 3UK9A 5DDJ1 5A3UA 1PK6B 3W20A 3D6EA 5GLWA 4LK7A 2HEYF 2G9GA 1DZRA 1ND2C 4YRDA 1J83A 2JDAA 4Y1ZA 5KR7A 3VD7A 1FNYA 5F2SA 5A33B 5FZ9A 2BW8A 4GALA 5BNPB 1AYM3 4W6YA 3BYWA 4OI0A 3WY6A 1PNFA 1RUE3 5LBFA 4XF0A 4IE5A 1UXZA 2BFUL 2MEV2 4JHZA 4E2GA 1HX6A 4Y20A 4GWMA 3GJBA 3A23A 2V4AA 3JB4C 2J42A 3GZAA 4X8PA 3K4ZA 2ZEYA 5LA2A 1CGPA 3QACA 3AP7A 4Q4V1 2VOVA 3OPTA 4IEOA 1TVGA 2BEOA 2DCZA 4BMEA 4ISQA 3AL6A 1JYWA 4AVTA 3RSJA 4R9DA 4WM7B 4XF1A 2ZEZA 3P1IA 2VCMA 3CJXA 2ERFA 1GBGA 5FZIA 5J1XA 2HH9A 3ATGA 1M06G 2Y6KA 3H3ZA 2A6VA 2ZX0A 3ACLA 3LAGA 2CAUA 4RS5B 4JX0A 1DQ6A 1ZBE3 4GMP1 2R1BA 1RL3A 2W1QA 2GN3A 1H2KA 1GSLA 4MUVA 4QX3A 1FV3A 1M4WA 2BZDA 5K0UB 1W6QA 4JGYB 1VB4A 4N43B 5A1AA 1SPPA 3DYMA 4FPHA 4YVWA 4F83A 2FCTA 4AEDA 1H0BA 3I3QA 5JXIA 1CIWA 1BEV2 4O9GA 1H8VA 1POV1 1LHOA 4FCAA 4ZU4A 4XURA 1POQA 2WNVA 3RFRA 3WVJA 4B1LA 1BMV1 1Q8OA 1N3QA 3RI9A 4BXSV 1R081 2VXJA 1PGL2 3WNOA 4BK5A 1N1YA 3ECQA 4P9WA 4R4XA 3H42B 5ABJB 4PDWC 2BDRA 2OT7A 5E88A 1X9PA 4Q5OA 1D4M1 4IEQA 1LOAA 1OOPB 4LIVA 4X6QB 5GLVA 3SCFA 4CP0A 3H1MA 5DQ0A 4E4SA 1YQ2A 2VZTA 1QQP1 4E8DA 2GZWA 5A6QA 1QMJA 2F6BA 4R9CA 4HBNA 1UZZA 2WAAA 3ZIWA 5LEJA 2A6YA 4Y1YA 3KT4A 5F2WA 5FMDA 1AR71 4IESA 4YGCA 1LNSA 4WVZA 1TNRA 3ZLIA 3ZXFA 5A80A 4ASKA 3Q8FA 4IV3C 4E2QA 1O4YA 4FVVA 4ASMB 2YFZA 4D6SA 4FOYA 2V09A 4DOUA 5F37A 5JIUA 5FMBA 1MR5A 4RR3C 1Z7S2 3ZYHA 1LB2A 1S1AA 3JB8A 1W9TA 4OZXA 4Y4YA 3HIFA 4JKKA 1UZ0A 1ZZ9A 5CFDC 4LHKA 2WQ4A 1F15A 4LBQD 5D8AA 5FY4A 5ACA2 3VBSB 5EJ1B 1OFNA 2HJIA 3HN3A 4OVEA 4EWEA 3TEZA 4C0HA 2QZ3A 2XQXA 4DRVA 1NQDA 3VLBB 3SNMA 4JKLA 1SBDA 1UD1A 4PLMA 5IT6A 2DBNA 1VRH2 2XJSA 4IV1B 3M3CA 1YQ8A 5HPOA 1O91A 3K77A 3WNXA 3VD9A 5LK7B 2P3IA 4K8FA 2FDKA 5IVEA 2VR4A 3WW2A 4CDWA 4ATFA 4HPKB 2XJQA 1YNAA 4A7ZA 1X36A 2VZOA 4LHNA 4QHBA 1PK6A 4CCNA 3O1PA 4AI8A 4GB33 3C2UA 1NUKA 4XZUG 3DXTA 4ZU7A 3FFQA 1TE1B 2X53S 1ZRRA 4C1WA 2E63A 4TYSA 3VBOC 5FZ1A 1E5HA 2IVJA 3KVBA 5A33A 1VBD3 4GJYA 5HXVA 4BH9A 5DG1A 3ETQA 5KXEA 1O5UA 3AVSA 5BNPA 4NIIA 2VJXA 1UF2C 4IEWA 2JWPA 1GQPA 2W1SA 4Y4RA 3U14A 4FI9A 5IK4A 3ACIA 3MUZ1 4CCKA 4OUSA 1SACA 2HLEA 1AX0A 5A3PA 1ACCA 3WF4A 5DAPA 3VBRB 1RXGA 3O1OA 1UAIA 3DL3A 4A3ZA 4XABA 5JMOA 1V6OA 2HWF3 1QJU2 2JG9C 2NLRA 1PGL1 2XBO2 3ZYFA 5BYNA 1J59A 2BWCA 4WM7A 2HWE2 1IS6A 4XJ9A 3V64A 2IWGB 1HB2A 2V5YA 2WZEA 3K75B 1J3QA 4AI0A 4Q0QA 3DEMA 2AEZA 1W6PB 3E97A 4YZ1A 4P5YA 2CU5A 4RS5A 4NHMA 5I0DA 3TRSB 3TBDA 2BUKA 1N1VA 2D97A 3PU8A 3USUA 2X5IB 4XFFA 3RWKX 2QDRA 4FFIA 1IOAA 4PJYA 3AYEA 2RR12 3AZXA 2RMU2 4KU8A 5K0UA 3OY8B 3O5SA 2F17A 4JGYA 4N43A 1V9U3 3Q8CA 5JIAA 3I8TA 4QM9A 5FXXA 3WG4A 2DCYA 4JZRA 3W5NA 1JYIA 3MLJA 3VN4A 4E4ZA 3AKPA 3OUIA 4LLOA 2RS13 2VMFA 5FP3A 2CGOA 5FY1A 2G9FA 3RVHA 4OHWA 3E1F1 3BKZA 3RZZA 5IHRA 1KQRA 1U5ZA 2GMEA 2ZGSA 3T1LA 5C3RA 4QAWA 1QJEA 1JZ4A 2VNOA 1ENSA 1XSRA 3BU7A 3X29B 4AQ2A 5ABJA 1ZRFA 2R073 2I74A 1TME3 2WT0A 4YWAA 1UMIA 2XWBB 3IPVB 3MUY1 2GNBA 5ACA1 1LHNA 2VBDA 3NKTA 1OOPA 5FXWA 3JD73 3RRDA 5C3PA 4HONA 3AL5A 4WV8A 3OGGA 2OPWA 5C33A 1N47A 4DXTA 4OHVA 2RJ2A 5G04L 1OC1A 1VRH1 2VOWA 2WSVA 1RGSA 4R9AA 4YGBA 5F3GA 2RDSA 1ASJ1 1EPWA 1G9BA 4Q0PA 4HVRA 4K1ZA 2YBKA 2WWSA 1SCRA 2P6HA 3NKGA 5G05L 4BM8A 2AENA 5J3UA 1YHFA 5DDJ3 1W8NA 3WF0A 4M0HA 1QJX2 3A7QA 1V6KA 1W05A 4QX8A 3LKJA 4M4PA 4P9LA 2D6LX 1OI6A 3KGZA 4MH0E 3AYCA 2Q8EA 4NROA 5BNQA 3T2OA 3ROUA 3ZSJA 5A7WB 4DZGA 3WOGA 1XNKA 3ORJA 3WHTA 4C0BA 3T0DA 3VBSA 1WLWA 2D93A 1KGYA 4FFFA 1XRUA 4RFT0 1WD3A 4QHZA 3TAYA 2Y38A 2ARCA 3D82A 2EALA 1J1LA 5K4LA 3ZDVA 5JXJA 2VM9A 3CL1A 3OG2A 1HXS2 1B35C 3F95A 1QJU1 4IV1A 4Q4V3 2XBO1 2DUQA 5FZOB 1UZYA 2HWE1 5JOWA 4JTOA 1W90A 4ZXEA 1OVPA 2ET7A 4HPKA 1REFA 3BN6A 2C9AA 5F39A 1CZTA 4MV2A 3H3LA 3JUUA 4QPWA 4RFRB 2IXCA 3THCA 5KHHA 2VGDA 3TWIA 3MV11 2P3KA 1F9KA 2XJRA 2Y60A 3M4FA 5FP9A 2GNMA 1KS5A 4XBQA 1UX7A 2DTYA 2VVEA 3MI8A 4GMP3 5C4WC 2OVUA 5KC5A 4LPLA 3WQ1A 4XQWA 1IHMA 2RR11 1YI7A 4HN1A 1W3VA 2RMU1 4FP3A 5T5PA 4BISA 3HVDA 3U78A 5FTTC 4OUEA 5CKQA 3VD4A 3AKQA 3LA3A 2R30A 4CCJA 4DXRA 5L19A 2PHDA 2QBXA 1X50A 2UY9A 5FZMA 2ADEA 4WVMB 1POV3 1LESA 3VBRA 3CLPA 1WLTA 5FYUA 4B4QA 3ZXEA 3TOJA 4YW7A 4B4PA 1KEXA 2BGPA 1H9WA 3DCQA 1R083 4LIUA 4RN5A 1JHJA 4PBPA 3CIHA 1ULCA 2VCBA 4DY3A 2XVGA 1ZVFA 3A0NA 2ILMA 1I9RA 3B00A 3I3DA 3B9CA 4LBQB 4YPJA 3RG0A 3ZXKA 1Y9QA 1W99A 1W6PA 3VZOA 4MADA 4BQXA 2EF6A 1QOTA 2ADDA 1OXCA 4MGYE 4AI2A 4IE4A 4KWUA 3WINE 1D4M3 2X5IA 4A44A 2W39A 3VDDB 1JZ6A 5LK5A 4BU2A 3I4IA 1NE4A 1Q8QA 2HEWF 2JDKA 5T54A 2YDEA 1COV2 1DF0A 3AP5A 3POFA 3AFKA 3JZVA 2IXIA 2R042 3OY8A 4RQPB 4XHBA 5FK7A 5F3CA 5HV0A 2VMDA 3D5OA 4UW4A 3KHBA 3RGBA 1QQP3 5H9RA 2FDGA 4MOAA 3HBKA 4URAA 5BNNB 2YPDA 3H1YA 4AEMA 1VMJA 2O8QA 1AR73 3M3QA 4KGGA 3M70A 2BNMA 5LBBA 4K3UA 2ZGMA 3USSA 3ENRA 3MIBA 4PQQA 2P2KA 1ND3C 4XC9A 3K48A 4LO4B 1DYKA 2MPFA 3DN7A 3HQUA 3I2OA 5C5TA 3ES1A 3LZZA 3I54A 3HQXA 1DYOA 4COWA 3OGRA 4QGMA 3ZPYA 4L92A 4GXLA 2WO2A 3RI8A 2IFRA 1YQ5A 3PUSA 1IKPA 2O1QA 2WWJA 4K8RB 2RJKA 3IPVA 3NVCA 2E33A 5CKMA 4QQ2A 1H6YA 4MXWB 3RJRA 4P9GA 4BXFA 1CIYA 1SZBA 3ILRA 4UFHA 3DPRB 3NJYA 4FPYA 2VG9A 1OUXA 5FWEA 2X09A 2ZAHA 3HNYM 3V56A 2LUWA 1HXS1 3KB5A 3L2YA 2YB7A 1FNZA 4HL0A 2YFUA 4BCUA 2UWCA 1DLCA 2WR9A 2ET1A 1HB4A 1H4GA 1XYOA 5FV3A 4AGRA 3P5BA 4LLFA 3V65A 4CDQC 3GF6A 1JU4A 4PCRA 4EN6B 1EAH1 4A4AA 3NQHA 5FYCA 2D44A 1KS4A 2A5ZA 3OPWA 1KFUL 1RUH2 2RVAA 4Q8LA 5A7SA 1JYXA 1REDA 4WM8C 2XLFA 1QHDA 1FV2A 4MVTA 4HXCA 3VKLA 2DURA 1ENRA 3ZFGC 4AFAA 5CFCC 3I2FA 1MACA 2R062 4KMQA 5C5UA 4OYUA 1ULEA 5A7WA 1CX4A 4Q26A 2ARAA 3RS6A 4DY5A 2OZ6A 1FX5A 1ZA7A 2XMLA 4MGKE 4P08A 4UFJA 3WNPA 4YARA 4TWTA 2A1XA 1ND2B 1RUF2 4FXKB 1HKDA 5FUPA 3U07A 1N3OA 1NXD1 3O1MA 3ZSEA 4HOOA 3PLQA 3T1MA 4FFHA 3MFCA 5AC91 5FZOA 1SMVA 2DUPA 3O7OA 3OF1A 3PL0A 4C8DA 4LQRA 5FKBA 1O4ZA 3T2QA 2YROA 2Y6HA 3VDCA 1SFNA 1UZVA 4HZFA 4UFMA 5F5AA 1U5IA 2ZHNA 3ZFFC 4XDPA 3AJZA 4LA2A 3NV4A 3JCIA 3VHPA 1FMD1 2QQIA 3HQRA 3I2KA 1DLLA 2VZPA 4EN7B 5CISA 5J36A 5FY5A 3J8F2 1WUVA 2H6BA 2IFWA 1UNBA 5H9PA 4J1WA 3EMRA 4Q1RA 3RZLA 1AL0G 3RZHA 4CCLA 5CVRA 4U36A 1JYVA 3KM5A 3U1XA 1NKGA 5FPBA 5A6XA 3RZJA 4WBBA 2CGPA 4JDNA 4CDUC 3E5QA 1QWRA 3D0SA 1WLCA 4WVMA 3WDYA 1EY2A 2WWUA 4IERA 4W6WA 3PU3A 1NE6A 3SMHA 3Q8EA 4K9SA 5IVFA 1K5JA 1S0GA 2DVAA 4AXOA 5I91A 2WN2A 2H0VA 3QH6A 3KF3A 3UV9A 3M2MA 1LHUA 2J1EA 1YFXA 2YU1A 3O1UA 1MQTA 2IXJA 4LBQA 1NCQC 3FLTA 3T09A 1JYTA 3FHAA 4Y1UA 2WZR2 1SFYA 4Z07A 3V0BB 1IS5A 2HWB1 1LJ7A 1RYYA 5ACA3 3AMQA 2ZGPA 5I8TA 1RUI2 1CX1A 1TMF2 1DQ0A 3IIIA 4RQPA 3UESA 5A3OA 2B9VA 3E5UA 2FD8A 2JDMA 5J7MA 1VRH3 2HWC2 5KBFA 1FYUA 1DGLA 1LTEA 2G9ZA 2IC1A 4PDWB 2WS92 1ASJ3 2QQLA 4V1PA 3NO8A 5LY2A 5BNNA 3S0MA 4AVBA 1JZ2A 1OD5A 3WX5A 4PT6A 4NIHA 4H7MA 4N53C 1G9CA 1HRI2 2Q1FA 5DUVA 1O4TA 3DKQA 2HYKA 3NRUA 5EYYA 4BDVB 3TNPB 5F1RA 1RUH1 2TUNA 3AC0A 3MW4A 5BNOC 4A41A 4EQVA 3E6BA 5FYSA 2D6OX 2AREA 3J26N 2W68A 3KCYA 3WXPA 4FFGA 4IUGA 4QGNA 5TSWA 2D5HA 2QCSB 2XLAA 1UKGA 4HETA 2VMHA 4P5HA 3WUDA 4EV0A 3D0JA 1GP5A 2JDUA 4MXWA 1AX1A 1U5XA 3OEAA 1URXA 1VPHA 3DYOA 4IV3B 1VBC2 3B93A 3DPRA 1L7LA 2LTNA 4AQTA 4L11A 3WCSA 5JDBA 5EQUA 5CG8A 2C4XA 3WZ1A 1WBFA 2D3SA 3VB9A 3MF9A 4RR3B 4B8EA 3RZKA 3MDPA 3BIEA 3GYDA 1QJU3 1MPXA 1MS9A 1WMXA 2XBO3 3HT2A 5CFDB 2HWE3 3AB0A 1C28A 1RUJ2 1ONAA 4FT8A 4PF5A 2Y26A 4QXHA 3AP9A 3WNKA 1JN2P 5I0RA 2OXBA 3AMPA 5F3EA 2BFUS 2JX9A 3OUHA 4GB31 4OMDA 4S2DA 3T2PA 1WCDJ 2CL2A 3MW3A 5GZFA 1T6BX 4KQ7A 4TZDA 4N9IA 5A32B 3HT1A 1X7NA 2FDJA 2RM22 3R4UA 2GC3A 3N9OA 2YBPA 4NPLA 4OI4A 4CXXA 1EPZA 2RR13 4HVOA 2RMU3 4ZU5A 2UWAA 2ZGLA 3VZMA 4AK3A 4GD4A 1QY4A 1Y9MA 4GH4C 4A6SA 4L0PA 2GMMA 5DAVA 4K6BA 1ND2A 1XPWA 3VBOB 4AEDB 2VAUA 2A6ZA 1W2TA 3HJRA 1OKOA 4J6GA 4NN0A 4AR2A 4EZHA 1QH7A 4MO3M 4XFIA 4KBBA 3IBMA 2E9QA 4IQPA 2GP5A 2DF7A 4ONUA 1F5JA 2TEPA 3ZYJB 1W0OA 1YUDA 3HAGA 5JXGA 2CDPA 2RHPA 5E6HA 2YU2A 1MVQA 4CDWC 2WUHA 4XQDA 2WFPA 5LBEA 1CZVA 2WZR1 3AKSA 2JE7A 3B02A 4CEYC 3KWVA 2VULA 3ZYPA 5GLUA 3FBYA 5CNAA 2JECA 1GKBA 1RC6A 4XF3A 4CP1A 4CPBD 2IVIB 1OLQA 2OPKA 2VBBA 2FQPA 4KU7A 4Z2WA 1RUI1 4NHKA 1JUHA 3PTYA 5FZ3A 5JXHA 2JG9B 1TMF1 4FTSA 1DZTA 1UX6A 5JAXA 1R1A1 4QU2A 2PHWA 1GP6A 2YGMA 2HWC1 1U0AA 2R32A 1S0DA 4Q0SA 5BPXA 4O7XA 2WS91 1ZRCA 1VBB2 3OUJA 1C5HA 1S0EA 4EWDA 4YSFA 4OHZA 2WYFA 1RVF1 4EROA 5CAZA 1OSGA 4LJHA 4RHV2 3GXUA 3L2HA 3LEMA 4AGVA 1OA3A 2VCAA 1UMZA 4KI5M 3SITA 1ULGA 2OX0A 1DDLA 1W9WA 1MEC2 1QJX3 4PHZA 1I1EA 2WNUA 3KV4A 3MEPA 2VQ0A 1KITA 2D98A 1G6NA 1VAKA 3BTAA 4AI3A 4AW7A 1JS9A 1WCUA 3Q8AA 5GJ6A 2CV6A 4MXVA 3NSTA 2GNTA 4AI9A 3BCWA 3V0BA 4BQ2A 2DVBA 1DHKB 1D2SA 1IG0A 4DXZA 5D2AA 3FWEA 2A3YA 1ZNPA 3T4HB 1CPNA 2PLV2 4XXPA 2BBVA 1WCKA 1NY72 2FCUA 2LM3A 1PVC2 3MW2A 1HXS3 2BJSA 5B4XA 4FAHA 3WF2A 2EVXA 1VJ2A 2KA3A 3OEBA 4NAMA 4PDWA 5EFUA 2ID4A 2CAVA 1CD3G 1LODA 1RUJ1 2R1DA 2ZGRA 4FQ4A 4OFGA 5FUNA 2QUOA 1IPKA 1SLAA 3GALA 3MICA 4GWIA 4UBGA 2WNEA 1BJQA 1DQ1A 5FPLA 2YPJA 1LRHA 3JXSA 4YG6A 5JR2A 3LEKA 5JI9A 1EAH3 4OCTA 4NIGA 1IS3A 5FZ0A 4K20A 3GNEA 3R4DB 3W9AA 4CYDA 1AR92 1UU4A 3GDBA 4MLOA 2XKPA 5FZEA 1PHMA 2KXLA 1BVP1 2W2IA 1X33A 1UOBA 3C7HA 3MLLA 1JI6A 3RZGA 2BU9A 1A34A 4Q0VA 3VKOA 3DKWA 4UF0B 4IV3A 2QQOA 4U2AA 3AMHA 1O3RA 1C57A 5F8PA 4XCAA 4RSUA 2RS52 4QX7A 4F3JA 1PMIA 4H7LA 4RR3A 5FDBA 2B46X 4IEZA 5FZCA 1U5YA 3UNPA 3U11A 5AC93 5CFDA 3C7OA 3SH4A 4AFMA 1OUSA 4E4DX 5IVCA 2HKXA 3IAPA 3B01A 4GJZA 4KWKA 1UZWA 1QNWA 3FHQA 5IVBA 3C7GA 4QPIC 1VBA2 2OA2A 2VNGA 3I3EA 4QX1A 1FMD3 4ARYA 4JV4A 1B35B 3K4DA 1MZFA 5A32A 2ORZA 1GYKA 3USUB 2Z69A 2KM2A 3K4AA 4W50A 1GZWB 2DFBA 2R043 5FOBB 2Q30A 4XDOA 3LCPA 2VUAA 3SHRA 1W6OB 1VBB1 2WNUC 3ZSLA 2CGNA 2DBIA 2W52A 4DB5A 4UAPA 3SC7X 4GA9A 3GZUC 4RHV1 3SKJE 4BQWA 2XWJB 1IPSA 1V6LA 2W3JA 3FZ3A 2EIGA 3KT7A 3VBOA 1MS8A 2DVDA 1LEMA 4WVWA 5C4WB 2GALA 1HIXA 1MEC1 2P3YA 1HQWA 1HV1A 2WA4A 4ORFA 4NPMA 3UGFA 4AHZA 5FY0A 1C8NA 1UL9A 3J7NA 3MV01 3G7DA 2PQQA 3F2ZA 4GWNA 4BIFA 4Z2AA 4FP2A 3BI3A 1QOOA 2JENA 3O0VA 4KG8A 4Z1VA 1S4CA 2CYFA 4BHPA 1P8JA 2ZAAA 3U37A 3N7KA 2HWB3 3VL9A 3I3BA 4IE6A 5EYXA 4C1XA 3ZDSA 1G86A 1LOGA 2JG9A 2PLV1 3LWCA 4DUXA 2VZ3A 2RDRA 4M3CE 1XE0A 1NY71 5FIXA 5K9YA 4A7KA 1PVC1 4XEZA 3N9NA 3FUQA 3ZXJA 4JC1A 2FZ1A 3P6BA 1CAVB 2VTXA 1PVXA 3D3AA 5C3SA 4XFGA 1UU6A 5CKNA 3R05A 5LA1A 1YFWA 5LW9A 2WO1A 4NIDA 5DUWA 2W46A 4P9JA 2PELA 2O0OA 4D3WA 4H55A 5LRRA 4DNYA 5FP4A 1ZREA 1RUH3 2XL7A 3GHMA 3VZKA 4A2UA 1AR91 5A6ZA 3PIGA 4LKEA 4Q4W2 5FR3A 3NAPC 4NO4A 2P3JA 3RMXA 2Q5TA 2XVKA 2R063 2XL9A 4MHRA 3QLQA 3IMNA 4AHYA 4PLOA 1UY0A 3OD4A 1RUC2 3FJSA 3H7JA 5JI7A 3E6DA 3FUOA 1JUIA 1ND3B 1IQDC 3OPZA 3VV1A 4BLJA 3P3PA 2WKKA 4BYYA 4XUQA 2RS51 4FPLA 2MEV1 5CIRA 1FXZA 4NRPA 2Y6FA 4HKWA 5DXDA 3ILNA 5GZGA 1WMEA 5ANNA 2WZPP 3ZM8A 2BERA 1IGOA 1DGWX 4CVUA 4HK8A 1D4VB 1XNTA 3AXDA 1IPJA 1QJY2 1VBA1 3BIWE 4LKDA 1C8M2 5F3IA 2IXHA 5KHJA 2YGLA 4A7YA 2RG4A 1W6MB 1GZ9A 5F5IA 1YQCA 2WN3A 2Q4SA 3UGGA 4WZCA 4CUBA 2JXAA 4HMZA 1MZ5A 4XBLA 3ZN5A 4UF0A 4CDQB 2YC2A 3N36A 5DPNA 5DABA 2OW4A 2N7GA 1VBE2 1WD4A 2B9UA 3GBFA 2BQPA 4Q27A 2YBSA 4Q29A 4GQ7A 1XJAA 3ILFA 1BEV1 1Y3TA 2JG8C 2BWAA 3IDEA 1OQDA 4H3WA 4WM8B 1OQ1A 5FUIA 1RHI2 3ZFGB 4AFCA 2HBTA 3H50A 3LIHA 4WZFA 5DZEA 2NYYA 2QVSB 3NV1A 4GKXA 3S7EA 2D6PA 3MIEA 3BPSA 2UU8A 3GGLA 4K1YA 5FJKA 4G9SB 1EYBA 1SLLA 2GH2A 5I0SA 4SBVA 1GV9A 4CXYA 4A6OA 4WVVA 1PZ8A 2WZR3 1AXKA 3ZKYA 2BGCA 1PM4A 1UN1A 2FCVA 2WRAA 1B35A 3K2OA 1CAWB 1RUI3 1HRV2 5JUVA 4AQ6A 1OT5A 2G1MA 1TMF3 2CY6A 3MHZA 3POEA 5FPZA 5AVAA 5I0TA 3RWNA 3UKTA 2WT1A 3NL1A 1GZWA 1R1A3 4MGTA 5LRSA 4EZ4A 5DAXA 2HWC3 1W6OA 2GSYA 2R0FA 1LECA 4G4FA 1HQLA 3ZFFB 3ZMNA 4EN9B 1SEFA 1LEDA 2V72A 2WS93 4Z82A 4LHLA 2DVGA 1OHFA 3OGVA 4QDSA 1OBNA 1RVF3 1PO22 2DVFA 4BZ4A 5L9VA 3W58A 3IB3A 1A78A 1S2EA 2C1FA 1JBCA 3DECA 5C4WA 2XUMA 2VMEA 4FQZA 4DINB 4CZSA 2PFWA 2VMIA 4GIQA 2Z4FA 2B39A 2QKDA 4Q4W1 5JSPA 1AVBA 5C8WA 1XYPA 3Q8BA 1ZZ7A 4MGQA 5A7QA 4CDUB 1WCQA 2W94A 2YMZA 3FLPA 3HPNA 2J22A 3OBRA 4YM1A 1Z7S1 5FZBA 4PQ9A 4AFDA 1RUC1 4HKOA 4XILA 3PHMA 4EWAA 5AFEA 1H2MA 3I2GA 1W2OA 2JD4A 3NV3A 1L3JA 5E16A 3NNGA 1H8TC 1YIFA 2NZ9A 4L8QA 5IVVA 1VAVA 1L7QA 4LBNA 1NCQB 1CAVA 4NAOA 1W8UA 2PHRA 4FOVA 4LBLA 2VZQA 3PVBB 4P9XA 2RS32 3N9QA 5FZAA 2XR4A 1RUJ3 4UFKA 4YGDA 2E7AA 3WDWA 4BA6A 3H8UA 4ZKTB 1QJY1 4A45A 2EXKA 5FYVA 3N4MA 1PX4A 3AMNA 4B1MA 3A4UA 4R9BA 1QXPA 1IG3A 4QB1A 4IGPA 5I8YA 1YC61 3CF6E 2RM23 4JGZC 4N7UA 1Q56A 4IGQA 1OLME 3WG1A 1UCXA 4LBOA 2OZJA 4N53B 4ZZ8A 2VMCA 4PF1A 3B9IA 1ND3A 1MZ6A 2XLGA 1VBE1 1PZ7A 3OBZA 2ZX4A 1DP0A 5BNOB 3U10A 1T2XA 2XH6A 1J1TA 4IGOA 1CONA 4LUMA 1W0NA 4XPVA 1RHI1 2ARXA 1R1ZA 3T3YA 2R6QA 4ITCA 5JPNB 3ZX7A 3AVRA 4A42A 1JODA 5HV4A 2ZGNA 3TNQA 1I5ZA 4QKBA 4I0WB 4PI0A 5FYHA 4Q2FA 3PMEA 4CPBA 3WQ7A 1RITA 3CQOA 3VDAA 1WKYA 1F4AA 5FY8A 2AZ5A 4KNCA 1D0GA 2E53A 3PNAA 1W6MA 4IEVA 1HRV1 3FHIB 3E6CC 1RMU2 1TZOA 1W04A 5BUVA 3EB7A 5CU1A 2D43A 4BQ3A 1JZ7A 1AF9A 3UKVA 1O8PA 1ZZ6A 1Q3EA 1H1AA 2VOTA 1JU3A 3EO6A 4QT6A 4CDQA 4FAGA 4LE3A 3N9MA 1NQJA 1VBB3 1WW6A 5F5QA 1R092 5AFBA 2D3PA 3N7JA 2C5DA 2X8KA 1UOJA 1PO21 4RHV3 3G6JB 3T0AA 5FXZA 3RMYA 4DO0A 4WM8A 3AM2A 5CFCA 2VC9A 3ZFGA 2GMPA 4XFAA 1H4HA 1MEC3 4MZUA 3ON7A 2ZX3A 3PMSA 1PO12 2W0XA 2HEVF 2XGXA 3WG3A 2EICA 4GH4B 1F4HA 1HV0A 2XJTA 3TEYA 4RGAA 4LT5A 1XE7A 3UETA 4JTNA 1MQTB 3OCPA 5FP8A 4A3XA 4AOCA 1UY3A 1FPN2 2XJUA 5IATA 1CAWA 4IXLA 3SCGA 2IXKA 2PLV3 3J9SA 4XUTA 5T5LA 2ZCWA 2Y0OA 3LQCA 2XHNA 2Z2SB 1SBEA 2ZGTA 1MS4A 4TSVA 1PVC3 5F32A 5FYBA 1RUE2 2EXJA 4CDWB 4XW3A 1DYPA 2XXZA 3ZO0B 3ZFFA 3TYJA 4NHLA 4CEYB 4Q8KA 4MSVA 1JOBA
chains in the Genus database with same CATH topology
1PZ9A 4Y24A 1YWKA 2B7YA 3RNSA 1XE8A 2MNGA 4QMAA 1CN1A 2YZ4A 1QJX1 3SH3A 1YFUA 4ZXKA 3KCCA 1AR93 3WDVA 4CDUA 3IIAA 5I93A 1RJ8A 2PYTA 2WLPA 3LB9A 3ES4A 4FPKA 4D7SA 1ZBE2 3PVEA 5J48A 5FLJA 2ZKNA 2YXSA 1HLCA 4Q4X2 4MYEA 2RS53 5FREA 3ZSMA 4QQPA 2MEV3 4HANA 3KZ4C 1UPSA 1V00A 1NCQA 5CBLA 4XIKA 1W6NB 2F4PA 4AI1A 4F8AA 4YVSC 1DGRA 3AP4A 1NLRA 5T5OA 4YYOA 3N7LA 3N7MA 3RDIA 4CTEA 1GQGA 1VBA3 3OD0A 5E1RA 4JDOA 2NMOA 5L36A 1VP6A 2VXRA 2D6KA 3VKFC 3AX4A 3FBMA 2Z5WA 4DMIA 4N53A 2D6MA 3B5LB 1R091 3BOPA 2VPVA 1O5LA 1UIJA 3E5XA 2XJVA 4XJUA 5BNOA 1V6NA 1BEV3 1X8MA 2NN8A 3NV2A 2UYBA 1MS3A 1KDKA 5JOZA 3NWKA 3KT1A 3MF6A 4K21A 2FZ2A 4XETA 4FTEA 1FPN1 3EHKA 3OJBA 4I2OA 1DZQA 1KDMA 4KWLA 4XF9A 1SCSA 3A0KA 3POYA 1B09A 3L9JT 2WT2A 1JTZX 1COV1 1CQ9A 2K0GA 3B69A 2R041 1WW5A 4QPIB 2JDZA 1PNGA 2OYZA 3LA7A 4YZ5A 2R49A 4RGGA 3CJIC 1BYHA 5FBZA 4FPEA 3D8CA 2ZJCA 3MFAA 3TN92 4Q4W3 2WNUB 4GH4A 5IK5A 5EXOA 3H7YA 5L7OC 2ZMLA 4JRLA 2ZGOA 1Z7S3 1RUC3 2ZKLA 3N3HA 3OYWB 2EXHA 3CO2A 1KJLA 3PVNA 3WD5A 1O3SA 4KL1A 1YIPA 1AXYA 4Q4X1 3O12A 3RYPA 1XNBA 4CDWA 1YI9A 5GZDA 2RJLA 3ZN6B 1BKZA 5JSOA 3VBUC 1LKNA 4CEWC 2EXIA 5IK7A 4CEYA 3TB0A 3ZFEA 2ZOEB 4XXAA 5GZEA 3ZN4A 3URFA 2D6NA 3B7MA 1NYWA 3AZVA 4ASLA 1QJY3 5FFOC 1OQEA 2IZWA 4FPFA 3LOBA 1FI2A 4GMP0 1UIKA 1AX2A 1MS5A 4AHXA 5KHIA 5DZFA 5KXBA 1V6IA 5GM0A 4RA0A 1J3PA 2R061 4YW1A 1GZCA 4AVAA 5KXDA 4XJ8A 5E8AA 3VKNA 1VBE3 1C5IA 1POV0 4LO5B 1CESA 1XYNA 1QJZA 1RUF1 3M8LA 1F5FA 3KSCA 5FLHA 3NAPB 3OBTA 1RHI3 3PJQA 4I02A 5D1IA 4S2GA 5J98B 5JZGC 1W6NA 2ARBA 4NR1A 4EJRA 2RS12 1WMFA 4OI2A 3T2TA 5JSRA 1C1LA 3RJ2X 1W0PA 1AL22 3WDTA 3QBQA 2NMNA 2GU9A 5A3MA 4MX3A 3HN1A 3LSDA 4MGZE 2VVFA 3M3EA 1HRV3 5C8CC 3S6PA 3J8F1 1TME2 4META 4M3CB 2SBAA 3APBA 1QDCA 3ME2A 3AKTA 2A6XA 1G7YA 2A3WA 1NA1C 3JD72 5IK8A 1GFF2 1IKQA 2PTMA 2BYVE 2A70A 2HWD2 4YGEA 1VLNA 1ZM1A 2A3XA 3AP6A 4INDA 4YNIA 4UW6A 1PO23 2O8OA 1NLSA 1Q5OA 3IKWA 5K8SA 4JCKA 5CB7A 3RYKA 1LOBA 3VBFA 1XQNA 4AQSA 1HDKA 4AYUA 2QDNA 1IS4A 1X82A 1S0JA 3IT8A 5F6KA 5GALA 4SLIA 1HQNA 2DUOA 4FXGB 4P9YA 2JG8B 4AEJA 3ZFEC 5JOYA 1EV12 2TBVA 4FPJA 1QH6A 2OIIA 3WUCA 5GZCA 2LALA 2K9ZA 4ATEA 1OFSA 4B3NA 1VIWB 4I3GA 1SLIA 1OMIA 4QPIA 2D40A 2JE9A 1RIRA 1YYNA 3VDDC 4Q4V2 4CDXC 1H1MA 3VBHA 1JXNA 4KGQA 2BVBA 1K5MC 1HRI1 3KGLA 1LOFC 1QKQA 4YW4A 4AWDA 1OPMA 3KS7A 2D3RA 4KH9A 1JOJA 5JWPA 1HW5A 4QPGC 2G4IA 3VL8A 3WHUA 1D0HA 3OYWA 3WLUA 3VHOA 3VKMA 5C9AC 2A73B 2BPA2 5KHKA 1FAYA 1REEA 1VBC1 4E2SA 1WW7A 3ZN6A 2B8MA 2XKOA 3ZXLA 2Y0IA 1OPOA 1TQ5A 1H2LA 3GHNA 1JH5A 1O3TA 1WLDA 4L99A 3ZSKA 4HN0A 1AL21 1NG0A 4R52A 4PBOA 2ZMNA 1APNA 3WG2A 5I8SA 2YHJA 4EN0A 3VZJA 2ZBJA 2ZHKA 3VZNA 2WJSA 3R4SA 2YV8A 3M7AA 4IEXA 4AEKA 2QE3A 2RM21 3CEWA 4HSLA 1DGWA 1WMDA 3VBFC 2HWD1 5FRAA 2I45A 1R093 3R0RA 2PAKA 1H2NA 4N9HA 4R8HA 4XYXA 4ISRA 1KRIA 4OHYA 1ULFA 3NW4A 3UJOA 2DCTA 3NAPA 2VY0A 4I0BA 4XE9A 4JGZB 1DBNA 1PO13 3FMGA 3I59B 4AE2A 4LA3A 4JVAA 5FOJB 1ZYBA 2K2SA 2V73A 2D7FA 4N90A 2PHXA 3ZYIB 5HBAA 1EV11 1H9PA 1KD7A 4PLNA 4QPYA 1FPN3 1ZZ8A 3BALA 4M3CA 2PAEA 4BQ1A 4B29A 1SBFA 4B7KA 4X8NA 1LULA 2TNFA 4P9IA 3VBHC 4NWVA 2P37A 1COV3 1W2UA 3GZTB 1Y43B 2ZX2A 2DU1A 3LOIA 1NOVA 2ZX1A 5J09A 4C90A 1LGNA 4UW3A 2QFEA 1VAMA 2XPJA 2P34A 1RB8G 1NCRC 4J1XA 2EAAA 3HWJA 3AZWA 1F31A 3EBRA 4YFWA 5AVPA 1H1IA 1AJKA 2PAMA 2FHRA 2JG8A 1AR62 4XJAA 4JDMA 1XU2A 1DIWA 2UY8A 2WA3A 2VOXA 4Q4X3 3WDXA 4DFSA 2VQAA 2ATFA 1EP0A 4BWOA 2VU9A 1I3HA 1LHWA 4O9EA 1VR3A 1MZEA 3INAA 1G8WA 1CR7A 4L9BA 4M01A 3ZIXA 3AJYA 2JEMA 1F2NA 2ZTNA 4YG3A 3ZXAC 4BOWA 4LTAA 1T6GC 1S0IA 2AUYA 3I7DA 1BXHA 3P3NA 4LO7A 5DUUA 3AK0A 4G3YC 5EZWA 3ZXGA 4YM3A 2JICA 4H14A 4XMAA 4OUMA 3MYXA 3WP4A 2QZ2A 1X8EA 3OGJA 4L2NA 1XNDA 1GNHA 4OLLA 3ALQA 4DRRA 5J37A 3WW3A 1LCLA 1NXMA 1RUF3 4AF9A 3THTA 3N35A 2BNNA 3EJKA 5CADA 1UW8A 2ZS6B 4COUA 1G9FA 4XTPA 2YC0A 4XFHA 1S2KA 4LE4A 2WFF2 1H8TA 2CWSA 4BLIA 4YG0A 5JOXA 1CJPA 1QXRA 3B3QE 1RUG2 3GBWA 4Y22B 1VALA 5JMCA 3AZZA 1CAUB 4D69A 1N1TA 1DFQA 1V6JA 4M0NA 4YVSB 1RUD2 2GAUA 3J8F3 3JBG2 5FMOL 1DGRN 1Q43A 2BTVC 1C3HA 5H9QA 2VECA 4GULA 2PHFA 5JVVA 3H0OA 1WCSA 1Y7BA 3JQXA 2DYCA 2ZGQA 5HCFA 4I09A 4HLTA 1V6MA 2R0HA 1ASJ2 4JGZA 1PIV2 3MPPG 2PA7A 1W39A 1LU2A 1AXZA 4W6XA 3IDBB 3I59A 3TN93 5FO9B 1LU1A 1YXWA 3VGIA 1RUOA 1AYN2 4XOGA 5BXXA 2VMGA 5JCTA 5FLIA 3H1WA 1QF3A 2ZHLA 4YVWC 1AR61 4QGLA 4AEDC 3SCHA 1AR82 1Q8PA 2WNVC 1DQ2A 3QOPA 1DG6A 3FFZA 4Q4Y2 1ENQA 4RD7A 1SLBA 1S2BA 2ZMKA 1ZBA2 4Y1XA 4F7ZA 1A8MA 1WA4A 4Y26A 1D2QA 1MS1A 4HVQA 1VB2A 2B42B 4RL7A 3JU9A 3MZHA 4FPGA 4YZ2A 1HRI3 4LR4A 3U4XA 3JQWA 4EN8B 1OA4A 2I07B 3WP5A 2GN7A 1V70A 3CJIB 4HKLA 4PIZA 2A7AA 1CJDA 4I01A 2RE9A 5EJ3A 2WSUA 3FLRA 3RPQA 4HFSA 1VBC3 5BY5A 3RQ0A 4LO6B 3UJQA 4IEPA 3MPBA 3LA2A 1LGBA 4HK9A 5L7OB 4BPZA 1BCXA 3KCXA 4R4ZA 2WFF1 3H9AA 1AL23 3SISA 3WR0A 2UYAA 5D8AC 1FOD2 1RUG1 2DFCA 2DTWA 4FPOB 1GNZA 1SLCA 3VBUB 4CEWB 1C8M1 1QU0A 4KG0A 4FPCA 1UPIA 2YY1A 2XB6C 2DCJA 4YLZA 4CP2A 1RUD1 4QX5A 1O7FA 3JBG1 2NPIA 3MGUA 1FT9A 3AMMA 3AFGA 4M3CF 4Z8BA 2E51A 2HWD3 4CRQA 4IETA 4XHXA 4QQHA 1PK6C 4B7EA 2VUJA 3AZYA 5A3LA 1F8VA 3AYAA 4URTA 3DUIA 1PIV1 3SH5A 4D94A 2ZABA 3AYDA 1WGPA 1JYCA 1TNFA 1AYN1 4OHXA 1PGW2 1ZRDA 1S55A 5BNPC 2A71A 3O14A 2WQZC 2SLIA 3QH7A 5T52A 4XIOA 2WINB 5H9SA 4Y22A 2PHUA 2OUHA 3S7IA 1AR81 1CAUA 1EV13 1YO8A 2DWRA 1A8DA 3VHNA 2IXLA 5JZGB 1N3PA 1DQ5A 4Q4Y1 4C91A 4YVSA 3ASIA 1CAXB 2VNRA 4K40A 3MIDA 1PGSA 1ZBA1 1YJLA 5KC6A 2UURA 2AYHA 1QDOA 4N7IA 1ENXA 4AVCA 4WM7C 3MLKA 1SDWA 1YJKA 4NWWA 1XU1A 4S2HA 3ZYRA 4XFBA 1S0BA 4IL7A 1QXJA 4RS5C 5C8CB 4FOQA 3U0ZA 4JQRA 5DG2A 5JR7B 3IM0A 3S30A 5T50A 1MS0A 1NA1B 1SLTA 5L73A 1BBT2 5K0UC 2W08A 4JGYC 4N43C 1EAH2 3J4UH 4P14A 1DQ4A 5T5JA 3C3VA 1G9DA 2VW1A 1AJOA 2X29A 2XG3A 3HR9A 2H0BA 3O0WA 4IEUA 2D5FA 1AYM2 1I6XA 1MVEA 1C4RA 3WQ0A 1GICA 4DQAA 1FATA 2RS31 2VW0A 2ZZJA 3ZFEB 4DS0A 5ABJC 4ES8A 1FOD1 5AC92 4NVPA 1OOPC 2DV9A 3KD4A 4S2FA 3HBZA 2FBEA 2PHLA 5CG9A 2GH8A 4QQLA 2ENRA 3IDCB 3WW4A 2WIIB 4Q1PA 1FMD2 4BIOA 5T3NA 4XZPA 3CJIA 5SV5A 2Q0AA 3KLSA 5GLTA 4CDXB 5FQ0B 4LBMA 1K5MB 1CPMA 3VHRA 2E7TA 2EAKA 4PIXA 4XQ4A 3WCRA 4JAAA 4FSJA 2Z79A 4D7TA 2FMDA 1BQPA 4W65A 5L7OA 3AKRA 3POSA 4QPGB 1KJRA 3IN9A 2PHTA 1GANA 1PGW1 3MIHA 3CU7A 5B2GB 5C9AB 2ETEA 3PJYA 3VBSC 3K51A 4AVSA 5EV7A 3Q9OA 3RYRA 5GLZA 3VBUA 5HCBA 2ZACA 3BODA 4CEWA 3FE5A 4FBFA 1RMU1 1GLHA 1ULDA 2HWB2 1AHSA 3FC0A 4IV1C 4XDQA 3SXWA 3I2DA 4AGGA 4CP1A 3M3OA 1RINA 4YM0A 4COVA 4YZ3A 2R16A 5T55A 1GQHA 4YW2A 2ZPXA 1SQ4A 4XJWA 1WBLA 1BK1A 5KWRA 3ZMOA 3VBFB 1BBT1 4M00A 1PO11 2QJVA 4I30A 3D4KA 5F9TA 3HD8B 4I3PA 2B5HA 4YZ4A 3SLIA 4YW5A 4LBKA 4AVVA 3WDUA 1AR63 4TLFA 2NQYA 1OA2A 4NPRA 5JZGA 4MGIE 3VBRC 1CAXA 4YW3A 4Z92B 4YM2A 1JHNA 1LHVA 1AYM1 1QNYA 3BB6A 1RUE1 5IUQA 3O0XA 1CVNA 2A6WA 2XVLA 3B94A 1NZCA 1DU3D 2DU0A 4UXAA 5C8CA 3PVOA 1A6CA 2XJPA 2AR6A 1O3QA 4LBJA 2X5IC 1KFXL 5HCAA 2YYOA 2GC2A 1NA1A 3GBGA 3VBHB 4XBNA 5HI0A 1AUYA 3WT3A 3VUOA 4GB32 3WW1A 1S0CA 1ZBE1 3WV6A 2JJ6A 1VBD2 2WC2A 1NCRB 3V0AB 4AFBA 4ES9A 5E89A 1JW6A 1U12A 3QCWA 3R6SA 1J58A 1S0FA 4COZA 2GDFA 1OKQA 1YFYA 2GC1A 2WFF3 4D7YA 4FOWA 1LGCA 2Q1ZB 4QM8A 3DGTA 1RUG3 2BVVA 2HWF2 1C8M3 4XJZA 3THPA 1BVVA 3VZLA 1RUD3 3LGRA 2WL1A 3ST7A 2C0ZA 3JBG3 3AXEA 2CWMA 3QD6A 5DZGA 3VDDA 1RTVA 4CDXA 5I0UA 5EWSA 5FQ0A 4AHWA 1LOCA 1N1SA 1K5MA 2Q1MA 1R1A2 1LOFA 2CNAA 4XF4A 1ALYA 3H3UA 5FPXA 2QNKA 2YUEA 5BV6A 1QOSA 1V9U2 1PIV3 1Q8VA 3FX3A 1RUNA 1RVF2 1YLLA 4QPGA 4I0AA 4XTMA 2I2SA 1AYN3 2VVDA 5C9AA 2MHFA 1UKRA 2NM1A 4YFZA 1AR83 4Y1VA 3KMHA 3BPZA 2A75A 4Q4Y3 5FCCA 3BOWA 1Z0HA 2R072 5LEKA 1ZBA3 1QGLA 4QD2A 5JLVA 1ZX5A 2GC0A 2GNDA 2ZHMA 2Q8OA 4LO8A 1WW4A 1YRZA 3EXUA 4Y20B 2E6VA 5K7PA 3EQEA 4FO9A 3ZVXA 5FAXA 2UWBA 3ELNA 3LSEA 3HMYA 1Z78A 4FTBA 5FO8B 1GR3A 1RJ7A 1UU5A 1C1FA 3TN91 5DDJ2 4LULA 2ES3A 4Q0UA 4L97A 5F6LB 2AGSA 2Z42A 2B45X 4KWJA 1VBD1 5FO7B 2BNOA 3CNAA 3MIFA 4DPNA 1LENA 1W6QB 4IEYA 4GKYA 2XHKA 3MIGA 4JRAA 2VW2A 1MQTC 4YVWB 1J3RA 4UW5A 3UL2A 5DUXA 2RS33 1YCIA 4QXKA 4B4RA 2P17A 5CA6A 2WNVB 4XMIA 4UBHA 1E57A 1FOD3 2HWF1 3NJZA 3M1HA 5J96B 2H6CA 2AH2A 4RQPC 4XFCA 5KXCA 4LUKA 3UKNA 5GKAC 5KHGA 1TEIA 1KXGA 4LNVA 4HSJA 5BNNC 1XNCA 3ZXDA 2EA7A 1LR5A 4OI1A 4BMBA 3OTFA 1BZWA 2QQPA 5SV8A 1NCRA 3V0AA 3WP6A 1IZ3A 1V9U1 2JKBA 1XXNA 4OULA 2NP0A 3ZYGA 2DCKA 2PN5A 2VH9A 2ZZQA 4LEJA 2RS11 4PIYA 1BMV2 1H30A 3WP3A 3DPRC 2VOKA 2E7QA 1H8TB 1R082 3DV8A 3M3IA 2WLQA 2FMYA 1IQAA 3IWZA 2R071 4COYA 1RMU3 4BE3A 1TME1 4E9KA 4E27A 3DF0A 1AZDA 3POWA 4HT1T 3JD71 5D8AB 5C6CA 1PM7A 2ZA9A 1D4M2 4NOTA 1ZA4A 1ZZCA 2OUJA 2ZGKA 1Q8SA 3KQRA 1LOEA 4Y5Z0 1QQP2 1A3KA 4K7JA 1ZZBA 2ZGUA 2CTVA 4QQOA 1OLRA 1AR72 5FMOS 4X6RB 1BBT3 3UK9A 5DDJ1 1PK6B 3D6EA 5GLWA 2HEYF 2G9GA 1DZRA 1ND2C 4YRDA 4Y1ZA 1FNYA 5A33B 2BW8A 4GALA 5BNPB 1AYM3 4W6YA 4OI0A 3WY6A 1PNFA 1RUE3 4XF0A 2BFUL 2MEV2 4E2GA 1HX6A 4Y20A 4GWMA 3JB4C 3GZAA 4X8PA 1CGPA 3QACA 3AP7A 4Q4V1 2VOVA 4IEOA 2BEOA 2DCZA 4BMEA 4ISQA 4AVTA 3RSJA 4R9DA 4WM7B 4XF1A 3CJXA 2ERFA 1GBGA 3ATGA 1M06G 3H3ZA 2A6VA 2ZX0A 3ACLA 3LAGA 2CAUA 4RS5B 1DQ6A 1ZBE3 4GMP1 2R1BA 1RL3A 2GN3A 1H2KA 1GSLA 4MUVA 1FV3A 1M4WA 5K0UB 1W6QA 4JGYB 1VB4A 4N43B 4FPHA 4YVWA 4F83A 4AEDA 1H0BA 1CIWA 1BEV2 4O9GA 1H8VA 1POV1 1LHOA 4FCAA 4ZU4A 3WVJA 1BMV1 2WNVA 1Q8OA 1N3QA 3RI9A 1R081 1PGL2 1N1YA 3ECQA 4P9WA 4R4XA 5ABJB 4PDWC 5E88A 1D4M1 4IEQA 1LOAA 1OOPB 4X6QB 5GLVA 3SCFA 4CP0A 3H1MA 4E4SA 1QQP1 2GZWA 1QMJA 2F6BA 4R9CA 4HBNA 1UZZA 3ZIWA 5LEJA 2A6YA 4Y1YA 3KT4A 1AR71 4IESA 4YGCA 4WVZA 1TNRA 3ZXFA 4IV3C 4E2QA 1O4YA 4FVVA 4ASMB 4FOYA 2V09A 4DOUA 5JIUA 1MR5A 4RR3C 1Z7S2 1LB2A 1S1AA 3JB8A 4OZXA 4Y4YA 3HIFA 5CFDC 1ZZ9A 4LHKA 2WQ4A 4LBQD 5D8AA 5ACA2 3VBSB 1OFNA 2HJIA 4OVEA 4EWEA 4C0HA 2QZ3A 4DRVA 1NQDA 3VLBB 3SNMA 1SBDA 1UD1A 4PLMA 5IT6A 1VRH2 2XJSA 4IV1B 3M3CA 1O91A 3WNXA 5LK7B 2P3IA 4K8FA 3WW2A 4ATFA 4HPKB 2XJQA 1YNAA 4A7ZA 1X36A 4LHNA 4QHBA 1PK6A 4AI8A 4GB33 3C2UA 4ZU7A 3FFQA 1TE1B 2X53S 1ZRRA 4C1WA 2E63A 4TYSA 3VBOC 5A33A 1VBD3 5HXVA 4BH9A 5DG1A 3ETQA 5KXEA 1O5UA 5BNPA 1UF2C 4IEWA 5IK4A 4OUSA 1SACA 1AX0A 3VBRB 1UAIA 3DL3A 1V6OA 2HWF3 1QJU2 2JG9C 2NLRA 1PGL1 2XBO2 5BYNA 1J59A 2BWCA 4WM7A 2HWE2 1IS6A 4XJ9A 3V64A 2IWGB 2V5YA 4AI0A 1J3QA 4Q0QA 1W6PB 3E97A 4YZ1A 4RS5A 4NHMA 3TRSB 3TBDA 2BUKA 1N1VA 2D97A 3USUA 2X5IB 4XFFA 2QDRA 1IOAA 4PJYA 3AYEA 2RR12 3AZXA 2RMU2 4KU8A 5K0UA 3OY8B 3O5SA 4JGYA 4N43A 1V9U3 5JIAA 3I8TA 4QM9A 3WG4A 2DCYA 1JYIA 3MLJA 3VN4A 4E4ZA 3AKPA 4LLOA 2RS13 2CGOA 2G9FA 4OHWA 3RZZA 1KQRA 1U5ZA