1ND2B

The structure of rhinovirus 16
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
252
structure length
252
Chain Sequence
SDRIIQITRGDSTITSQDVANAVVGYGVWPHYLTPQDATAIDKPTQPDTSSNRFYTLDSKMWNSTSKGWWWKLPDALKDMGIFGENMFYHFLGRSGYTVHVQCNASKFHQGTLLVVMIPEHQLATVNKGNVNAGYKYTHPGEAGREVGTQVENEKQPSDDNWLNFDGTLLGNLLIFPHQFINLRSNNSATLIVPYVNAVPMDSMVRHNNWSLVIIPVCQLQSNNISNIVPITVSISPMCAEFSGARAKTVVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and virological studies of the stages of virus replication that are affected by antirhinovirus compounds
pubmed doi rcsb
molecule tags Virus
molecule keywords coat protein VP1
total genus 61
structure length 252
sequence length 252
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2002-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1nd2B00
4YVSB 4RS5C 3CJIB 1POV1 4EJRA 1AYN3 1VRH3 1X33A 1ASJ1 1AR72 3JD71 1R082 1OPOA 1VBB2 1QJY2 3J8F3 1AUYA 2ZZQA 1HXS3 4N53B 4NWWA 5C4WB 2HWF3 1B35A 1AR63 1MEC3 1NY72 5FMOS 1VBB1 2WFF1 1FPN1 1R081 4WM7A 5A33A 2MEV1 1COV2 3VBFA 4Q4W3 1PVC1 4CEYB 5BNPC 1VBC3 3VDDA 5DDJ2 1RUI2 4IV3C 1FMD1 2WZR2 4GMP1 4CEYA 1AR61 1MEC1 4QPIB 1AR91 3ZFGB 1TME2 4YVSA 4CDWA 4RS5A 4WM7B 4IV1B 3JBG3 2RMU3 3HAGA 1PIV1 1PVC3 2BFUS 1PGL2 2MEV3 5AC92 1NA1C 1HXS2 1PO21 1ZBE3 4IV1A 1TMF2 1VB2A 4GH4C 2ZTNA 1V9U2 4IV3A 5C9AC 1RVF1 3DPRC 3ZFGA 3NAPA 1RUH2 4AEDB 2X5IB 4CDXC 1AYN2 2WZR3 1VAKA 4JGYA 2HWB3 1B35C 1VBC2 2X5IA 1NCRA 4Q4W2 2RS31 4GMP3 1VBA3 2R063 4PDWC 1QJU1 1VRH1 5L7OC 4NWVA 4RQPA 5JZGC 3LOBA 3ZFFC 5K0UC 5C8CB 3VDDC 2RS52 1RUF3 1PGW1 1VBE2 1ZBE1 3VBOB 3VBUB 1Z7S3 4N43A 4CDQB 1RMU2 2WZR1 1K5MB 1RUE3 4LLFA 4Q4Y2 4CDWC 1NCRB 1RUG3 3J8F1 4CDQA 1RUC3 1AR82 1VBB3 5L7OA 1COV1 1BMV2 4RQPB 1NOVA 5D8AC 5LK7B 1ND2C 1QJX3 1RUJ1 1RUD2 4GMP0 1GFF2 4RFT0 4RHV3 1EV13 4GB32 1R1A2 1EAH3 4WM8B 3NAPC 1AR92 2GH8A 2R042 5GKAC 1FMD3 3S6PA 1E57A 2BUKA 1AR93 4JGYC 4Q4V1 1OOPC 1VBC1 3CJIC 1ND2A 1ASJ2 1AR71 4PDWA 4SBVA 4QPIC 1EV11 3VBSA 2HWE3 1H8TA 1BEV2 1AL0G 1RUH1 3JD73 5K0UA 1VBD2 3TN92 2RS13 1AR83 1NG0A 2VQ0A 3ZFFB 1ND3A 1RMU3 3ZFEA 5FOJB 4N43B 1PIV2 1W39A 2R041 5C4WA 3VBHB 2WS93 1PGW2 2HWE2 4QPGB 5J98B 1AYM3 5D8AA 1FMD2 1RUD1 2BPA2 2HWB2 3FBMA 1EV12 4GB33 5ABJC 4IV3B 1CD3G 5BNOC 1RUG1 2RS51 3JB8A 1RUH3 1IHMA 2WFF2 4Q4V2 4GH4A 1RMU1 5BNNC 4CDWB 1FOD2 1RUE2 4Q4Y3 2RM21 1NCQA 1VBD1 5BNOA 3JBG2 5CFCA 3VBUC 1SMVA 1F2NA 3JD72 1H8TB 5BNPB 1RVF2 1MQTB 2WWSA 3ZFEC 4GB31 1CJDA 1VB4A 1Z7S2 1QJX1 1RUJ3 4JGZC 1F8VA 1AYN1 1ASJ3 5AC91 5K0UB 4QPGA 1NCQB 5FMOL 3VBFB 1R1A1 1TMF1 1MEC2 1AR62 1QJZA 3ZFGC 4FTSA 4Q4X3 4CDQC 1RUF1 3ZXAC 1BMV1 2BFUL 1VBE1 1ZBE2 4CDUA 1PO13 1QQP3 2PLV3 5CFDC 1QJY3 1QJU2 4RR3B 1TMF3 3VBRA 1NY71 1BEV1 1D4M2 5BNNA 4Q4W1 4RQPC 4YVSC 3ZFFA 1Z7S1 1ND2B 1M06G 1ZBA1 1PVC2 3VBOA 2QQPA 3VBUA 5A32A 5DDJ3 4CEWC 4Q4X2 1VBE3 3NAPB 1TME3 1K5MA 3CJIA 1ND3B 4Y5Z0 1AYM1 1FOD1 2R062 4FTEA 1H8TC 2HWF2 3VDDB 1PGL1 4WM8C 1RUJ2 1RHI1 5DDJ1 2RM23 3VBSB 1RVF3 1R091 1K5MC 1HRV3 1V9U1 4N53C 5D8AB 1AR81 3J8F2 1C8M2 4YVWB 4CDUC 1RHI2 1DDLA 1AR73 1FOD3 5J96B 5ACA3 5ACA2 1D4M3 1NA1A 1HX6A 4AEDC 4YVWA 1C8M3 2RMU2 1TME1 1A6CA 1QQP2 2PLV2 1PO12 1NA1B 1B35B 5BNPA 1VRH2 4GH4B 5ABJA 5C8CC 2RM22 4Q4X1 4CDUB 5L7OB 2RMU1 1OHFA 1R093 4RHV1 2X5IC 4CDXB 1FPN2 1NCRC 4RR3A 1COV3 2FZ1A 2WLPA 1C8M1 1POV3 5C9AB 5JZGA 5C8CA 2RR11 4FTBA 5CFCC 1PO22 2XBO2 2ZAHA 5C9AA 1HXS1 2IZWA 3DPRA 4BCUA 1QJY1 1BBT3 4N53A 1PO11 4WM7C 4Y4YA 2XPJA 4CDXA 1QJU3 4JGYB 1R083 2R061 1ZBA3 1C8NA 1X36A 4Q4V3 2RS11 1RUI1 4AEDA 4JGZB 1VBA1 4CEYC 3DPRB 1BBT1 2HWC2 1POV0 5BNOB 1WCDJ 5A32B 4CEWB 4IV1C 4RHV2 2HWC1 4RR3C 1RUC1 3VBRC 1AYM2 1EAH1 1OOPB 2Y26A 3VBHC 2HWD3 1PIV3 3VBOC 5CFDB 2GSYA 1RB8G 2FZ2A 3IDEA 1AL22 5A33B 1D4M1 1ND3C 4Z92B 3ZFEB 4FSJA 3VBRB 3TN93 2RS33 1VBD3 2RS53 2HWD2 1HRI3 2R073 2XBO1 1BEV3 5C4WC 3VBHA 2WFF3 3M8LA 2HWE1 1AL21 2RR12 1NCQC 4WM8A 5CFDA 4N43C 1VBA2 1FPN3 4Q4Y1 4QPIA 3VBSC 1EAH2 2BBVA 1RUE1 2R043 2HWD1 4CEWA 2RR13 1HRV1 2DF7A 3TN91 2WS92 1R1A3 5JZGB 5ABJB 1HQNA 1HRI2 2R072 1MQTC 2RS32 1RUD3 1V9U3 4YVWC 1QJX2 3JB4C 1RUC2 1RUG2 5AC93 2MEV2 1BBT2 1ZBA2 1RHI3 1AL23 5ACA1 2TBVA 1HRI1 1PO23 2R071 2XBO3 3JBG1 5CFCB 2WS91 2RS12 5BNNB 1HRV2 1OOPA 1QQP1 2PLV1 1MQTA 4RS5B 4PDWB 4JGZA 1RUI3 1RUF2 3VBFC 2HWF1 4QPGC 1R092 2HWB1 2HWC3
chains in the Genus database with same CATH superfamily
4MVTA 4DEVA 1CR7A 5LBBA 2E6VA 4BLJA 1DBNA 1C3HA 5LA2A 1GMMA 1QEXA 2NN8A 4XMAA 1AYN3 1C5HA 3H8RA 3WCSA 4TN7A 4SLIA 2WQ8A 3M70A 2C9AA 5I0UA 2FQPA 4M3CA 2YC4A 5LB6A 4ASLA 1JMUB 2WR9A 1R082 2GMPA 4KWLA 5EV7A 1OPOA 2V4VA 3WG3A 4AAPA 5A3TA 4YPJA 3USUB 1ULGA 4D94A 1CX1A 4MGIE 2Z4FA 1W99A 2VW0A 4KGQA 4NWWA 3WNPA 4XHBA 5FZBA 3ZVXA 2KM2A 2UYBA 4HKLA 1W6MA 3SH3A 1LKNA 5C4WB 1JYVA 2WWUA 5FZAA 2HWF3 1PVXA 4GAZA 2TNFA 3O1VA 1OA2A 1TNFA 5FMOS 1OBNA 2DU1A 4W65A 1GWLA 1SLAA 5A1FA 3CEWA 1GZWB 5FZOA 1WLDA 4Q1RA 3BODA 1PVC1 2XLGA 3OGRA 4L0PA 2ET7A 2W95A 4CCCA 3OTFA 2OZ6A 2Q1FA 2WRAA 2Y60A 4COWA 5I0RA 1S0CA 4AR2A 3WW4A 3A21A 4IV3C 1UZZA 1FMD1 2WZR2 5C3PA 4B1LA 2DV9A 3RMYA 2ATFA 1AR61 3RPQA 3NJXA 4BOWA 3ZO0B 2QDRA 3PUAA 1YO8A 1WZXA 3IMNA 3NWKA 4PF5A 3U78A 2XVLA 4CP0A 3ZR5A 2BFUS 3BIWE 5LA1A 1C1LA 2ES3A 2MEV3 4AOCA 1NA1C 3VDBA 3KWVA 5LRRA 5JLVA 3GJBA 1YCIA 2V4AA 3I4IA 2Y0IA 1KITA 4QT6A 2CAVA 3PDQA 1I9RA 4JX0A 3CO2A 1PMHX 4I30A 4NHMA 5FLJA 4FXKB 1W8FA 3AB0A 1RUH2 5DAVA 1KXGA 2X5IB 5FLIA 4NIAA 5CKNA 2W1SA 4L11A 3CMGA 4P9JA 4JGYA 1CIYA 2A6XA 5B4NA 3WP3A 3QLQA 1NXD1 1RYYA 4NIDA 2D5FA 3IDAA 4LTAA 3RWNA 1IZ3A 1UU4A 4GMP3 2EICA 2Y34A 1GQHA 4OMDA 1K12A 1Q5OA 3IPVA 1BK1A 1QJU1 1W6OA 4NWVA 4IE7A 4BH9A 1UPSA 1G9FA 3POBA 4YFZA 2RS52 5IK7A 1SCRA 1W6MB 3Q8CA 2BP6A 4N43A 3RFRA 2YDEA 2YGLA 1IS5A 5FZOB 3FHQA 3D82A 3OPTA 1UNBA 5D2AA 2BWCA 4CDWC 1NCRB 4AL9A 1U5YA 2XLAA 2D6OX 2KR2A 1STMA 2VCCA 3IIAA 3WY6A 1GBGA 1W03A 1AR82 1VBB3 1ZX5A 5L7OA 3AKQA 4N9HA 3OBZA 4QX0A 5I91A 1RIRA 4RQPB 2XHNA 3MF9A 5C5TA 4BZ4A 1D0GA 2DVBA 1ENRA 4OHVA 4R9CA 1QJX3 4NHYA 4QQHA 1QH7A 5A7PA 1GFF2 4XUQA 4GB32 4QKFA 4NHKA 1LR5A 5DG2A 4CYDA 1EAH3 2HKXA 2QKDA 3H42B 5T50A 3GALA 3NAPC 2GH8A 1KJRA 4HK8A 4ASKA 2E33A 4Q0QA 2LROA 5F7UA 2J22A 3NJVA 1FMD3 3AJZA 5GKAC 1E57A 4CCOA 1GWKA 1JYXA 3RVHA 3RG0A 1SZBA 4PQQA 1IQAA 1U0AA 3PUIA 5IVCA 5D1IA 1VBC1 4PHZA 3KV6A 2I45A 5K7PA 1I6XA 3MPBA 4Y1VA 5H9QA 3OEBA 4QMAA 2HWE3 4L99A 4LE3A 3PUHA 2GZWA 1CGPA 2VW2A 2EVXA 2WZPP 4UFJA 1AL0G 4G3YC 5K0UA 5K8SA 3IMMA 4QKDA 1QOOA 1AR83 4IUGA 1H8VA 4A3XA 1CAVA 1TG7A 2W87A 1CIWA 3OD4A 4GJZA 5JAXA 3W5MA 1YFWA 4Q0PA 3U07A 3PTRB 3VDCA 5CISA 1JZ5A 1RMU3 1W2OA 3OB8A 3AMMA 3ZFEA 3DECA 3WF4A 4Z2WA 4N43B 2DBIA 2BEOA 3I3DA 1O8SA 1TE1B 1W39A 3SH5A 3TBDA 4Z8BA 3P3PA 5KHGA 1E5HA 3R4SA 2P34A 2WS93 2XH6A 3LKJA 2LM3A 5I8SA 3I3BA 3KQRA 3GBFA 4IESA 4QX8A 4XUNA 2C26A 1FMD2 3AMQA 1KDMA 3B94A 3LOIA 4QM8A 4XJUA 3O1OA 2VU9A 2YHJA 4B8EA 3SKVA 4FFGA 5IFTA 4OMCA 2D44A 4NMIA 4FBFA 4BYYA 1ST8A 1JOBA 1KQRA 4Y4RA 3S5QA 4IV3B 1RUG1 2WO2A 1VMFA 2ETEA 3ZYIB 3MW2A 5JIUA 4D7TA 3I3QA 3UGHA 3AYAA 4AG4A 5JOZA 1LULA 4ZU4A 4IEQA 4DEQA 1F35A 3ILFA 4ITCA 4JKLA 4WBBA 4Y1ZA 2GMMA 4AQ6A 2Y6FA 4XFCA 4CP2A 1YEWA 2Y64A 5FQ0B 4AGGA 1I1EA 5M0TA 2FMYA 2VH9A 2BGOA 1PZ9A 2DCYA 1OLQA 2NMNA 3H7JA 3RYPA 5KWRA 2RM21 3ZXKA 2VMFA 5CFCA 4QDQA 1XNKA 3AP9A 1W9FA 2ZX4A 1XXNA 3BTYA 2ZEZA 4E2GA 1F2NA 3JD72 5K4LA 3I7DA 2VMIA 4UFKA 3ZFEC 5FYTA 3U10A 5IFPA 2W1QA 4GB31 4XABA 4BQ4A 4CU9A 4ET7A 2DCJA 4JGZC 3RNSA 1F8VA 3WHTA 1DLLA 3NKGA 4GWNA 3WSOA 4BB3A 3RZKA 1C4RA 3BPSA 3ELNA 2NZ9A 4XQWA 5LEJA 5LY2A 4DNYA 3RJ2X 2NYYA 1H1AA 1NCQB 4O65A 4S2DA 4KWKA 3TRSB 1QXJA 3WT3A 1SLBA 1JZ7A 3WP4A 4XF3A 2CGPA 5FPVA 3VBFB 2ZAAA 3VZKA 3LEMA 1GZTA 1W3XA 4YGEA 5GZEA 2ZXQA 1AR62 3RZHA 4FTSA 1CX4A 3VHRA 2H6BA 5E8AA 1LU2A 4UYBA 2O1QA 4QQPA 1DQ0A 4HL0A 1RUF1 2RE9A 2WSUA 1MR5A 3WDTA 3WNOA 2P6CA 5F5IA 3BIEA 1ZBE2 1SG3A 1W9WA 5GALA 5A6QA 1PO13 2R0FA 3O0WA 3UNPA 5GLZA 5GZFA 3UJQA 1W3VA 1V6LA 4HN0A 2I2SA 3PURA 3N9MA 4RR3B 5FY8A 5FZ3A 4OI0A 1F4HA 2DCTA 3O5SA 1D4M2 4QQ2A 5FZ7A 4Q4W1 1A78A 1KGYA 1Z7S1 3WP5A 3ZFFA 2SBAA 1JXNA 1XE7A 4LBQA 4OQ9A 5BV6A 4XZUG 5A32A 3APBA 3WW1A 4CEWC 4MO3M 4Q4X2 1VBE3 3FUOA 2ZX0A 4LOSA 5JDBA 3NAPB 1TME3 2R1BA 4YM0A 4YW3A 1LAJA 2WN2A 4X6QB 5DPNA 2N7GA 2NMOA 2VM9A 4MHRA 4Y22B 4Y5Z0 4RL7A 3JCIA 1FOD1 2FDFA 1AF9A 4EN0A 2WWJA 3DKWA 1LOEA 2VAUA 2YYOA 4X6RB 1PM7A 4I0WB 1LOAA 2ADDA 3VDDB 1PGL1 2C5DA 1S2EA 3SLIA 1RHI1 2SLIA 3OJBA 2ZACA 4BPZA 3MIBA 2HBTA 3VBSB 3NV1A 5FY0A 1RVF3 5GLWA 5FO7B 4MH0E 1XNBA 2BTVC 3B02A 1EPWA 1Y4WA 3HNMA 4DPNA 4O61A 5IHRA 1NQJA 1C8M2 1HN0A 5E6HA 1J3PA 4LLOA 3CZJA 4XIKA 2VZUA 4R9DA 1NA1A 1SQ4A 2WNUA 3KVBA 5FXXA 4AEDC 1GLHA 4CXYA 2XUEA 2ZPXA 4XIOA 1JU3A 4IW3A 1WMDA 2RMU2 4YARA 1MS3A 1W9SA 1WW7A 1RJ8A 1RINA 2ZGOA 1MS5A 1OI6A 4Q0UA 2YV8A 3HIFA 2PA7A 3POFA 4JDOA 3WDUA 3WW3A 2YC0A 4GZ9A 4ZKTB 4FPCA 4MLOA 5FY9A 3SKJE 5FZLA 3FZ3A 4DO0A 1SACA 1R093 2WN3A 3PUSA 1JW6A 4RD7A 1LB2A 1BKZA 4FPEA 1FPN2 1COV3 2CHHA 4XMIA 2UURA 1F4AA 1JI6A 2YC2A 3WF1A 3B5LB 5HCHA 2D93A 2WLPA 1T2XA 4ZPIA 2BYVE 1C8M1 2OX0A 4MADA 4XJ9A 3SC7X 5C9AB 5LEKA 4R9AA 2ARXA 4IDZA 5C8CA 2RR11 3HMYA 4NR1A 2OZJA 3UKVA 1L3JA 3M3IA 5C9AA 1HXS1 1XNDA 4QB1A 4L2NA 3USSA 3O1RA 1BBT3 1X82A 2XG3A 3RJRA 3I2JA 1Q43A 4RGGA 5C3RA 3SNMA 1G6NA 2G9FA 1O7FA 2WC2A 2YPJA 4FXGB 4MXWB 4BQXA 1BK0A 2XDVA 5IK8A 2DWRA 2OW4A 2XJVA 3ZN5A 4CPBD 2GP3A 4DINB 1FX5A 2Z2SB 3POIA 4DUWA 3HJRA 4QDSA 2QE3A 3POEA 4HETA 1GP4A 3BB6A 1JZ6A 4ATFA 4LHLA 5T5PA 2HWC2 1G9CA 5G04L 2I07B 4R8HA 5FP3A 1OA4A 1W6PB 3CJXA 2ZHMA 3H3UA 4OHXA 5HV4A 4FPFA 3N7LA 1UIJA 3I59B 1F5FA 2QQNA 1WW6A 3MGUA 1SFNA 2XLFA 2ZHNA 5IWFA 4A42A 3L2HA 2EIDA 1ULOA 1CN1A 4FI9A 3WVJA 1IQDC 2JDKA 3MF6A 2VG9A 5J1XA 4ONUA 4XUPA 4UAPA 1OOPB 3MIDA 3LA7A 2BNNA 2W08A 4CTEA 2IXIA 3LWCA 3IT8A 4ZZ5A 2FCTA 5TSWA 4YSFA 3OEAA 3LE0A 3IDEA 5FMBA 5FXWA 3ZYBA 4FPGA 4NOTA 3CKHA 4FSJA 4B7EA 3VBRB 4PI0A 5C3QA 2HEVF 3HWJA 1W9TA 3LAGA 1CVNA 2HWD2 4JRLA 1HRI3 2R073 1GZ9A 4OI2A 5A6ZA 2V5DA 3CL1A 2OXBA 3M8LA 1X8EA 2HWE1 1AL21 4QHOA 4XXAA 2W0XA 2YROA 2Q8CA 3OF1A 4Q4Y1 2D6LX 5C3SA 3IPVB 4D7YA 2AEYA 1NE4A 2ORXA 2QQVA 1UPIA 3WINE 4R4ZA 3A4UA 2DCZA 3WUDA 1WW4A 2RJ2A 1IG0A 2BBVA 3HN1A 2DYCA 4XJZA 1ACCA 1UOBA 3E5QA 2J1EA 2ZX3A 4IETA 1GV9A 2ET1A 2ZHKA 2RR13 1HRV1 2DF7A 3TN91 4E4DX 5ABJB 4K21A 3E1F1 2Z42A 4NRPA 1CAWB 1MQTC 4D7SA 2RS32 4DXTA 4QU2A 1QMJA 2DVDA 5H9PA 5C5UA 2VPVA 4K9SA 2RHPA 4OZOA 4XURA 1BZWA 4LBQD 2HYXA 3UESA 1QNYA 2JECA 2PAEA 5AC93 2MEV2 3ZOIA 1ZBA2 2VR4A 2WT1A 2QQUA 2VNVA 5ACA1 3ZN4A 2ARCA 5IT6A 2OPWA 3JBG1 1MVQA 4GIQA 1J3QA 2RS12 1WMEA 3ACLA 4COVA 3WLUA 2KD7A 2K0GA 2XQXA 4JHZA 5FP9A 2BNMA 1ODMA 1QQP1 3VD5A 5KR7A 2MHFA 4B29A 1RUI3 2PQQA 3HD8B 2GC1A 4R9BA 3OGGA 1OLMA 4XDQA 4DS0A 2C6SA 4INDA 3ACGA 3N9LA 4L92A 3SCGA 3ZDSA 3S5AA 3ZIXA 1YFUA 3AP5A 3OGVA 1DGLA 2A7AA 1FXZA 4P00B 5CU1A 3T0BA 4UW6A 4XUTA 4RS5C 3CJIB 3LFMA 3E5XA 3P5BA 2JDAA 3PU3A 1UY3A 4OHWA 4RN5A 4A3ZA 1LOFA 4YZ5A 3QOPA 1PNGA 2JDZA 1W2AX 4I0AA 3MUZ1 1X33A 2ID4A 5JPNB 3OPZA 4BDVB 1AR72 3M7AA 4UW3A 1AHSA 3UJOA 4F7ZA 2I74A 3DV8A 4ATEA 5JOWA 5LRSA 4ZY9A 1VLNA 3IBMA 1SPPA 1VBB2 3BCWA 4LKDA 4ORFA 3J8F3 3I97A 2VL4A 1LHWA 5J48A 2ZZQA 2LS6A 3AZZA 5AVPA 2DBNA 1G9AA 4ISRA 1PX4A 2R32A 4JTNA 4PBOA 2XXZA 2VUAA 1VPHA 4YW2A 1JHNA 2H0VA 5FYVA 4BXSV 3AL5A 3ASIA 3FX3A 1XSRA 1LCLA 4YW1A 3LQCA 2E63A 1ZVFA 3KF5A 1PZ8A 1PK6A 2PHUA 4FOWA 1AR63 1DGRA 3TNPB 2JE8A 4BIFA 2W9XA 1WUVA 2WQZC 1YWKA 1XYOA 5FXZA 5JOYA 3NJYA 4WM7A 4IEPA 5HI0A 4A6SA 2BDRA 5IW0A 4XAEA 3PVBB 5ANNA 3M3CA 2RJLA 5DAQA 1YRZA 4BISA 4UF0B 3DEMA 1VBC3 1NZIA 1GUIA 1ZREA 2IXHA 2JE9A 1ZZBA 2ZMNA 3IM0A 3BALA 1RTVA 4HT1T 3MZHA 2B46X 2Y6HA 4NIGA 1LHVA 1MS8A 4LNVA 3SEPA 4QPIB 3THCA 4P08A 3ZFGB 4YVSA 4XFIA 4RS5A 4LO7A 5C71A 1VAMA 2RG4A 3AM2A 4NUBA 4WM7B 2J42A 3TEWA 2IXJA 4IV1B 3JBG3 2RMU3 4C90A 1YJKA 2VZ1A 1PIV1 3HAGA 3FFZA 3UL2A 4CXWA 1U5XA 2GU9A 1PGL2 4UF0A 1C28A 3MEPA 1HXS2 1RC6A 4IV1A 1YI9A 2BBAA 1TMF2 2PXJA 2WNVA 2ZTNA 4ZZ8A 1V9U2 1A8DA 4IV3A 2XR4A 2YU1A 5FFOC 3AJYA 5C9AC 3NKTA 1K5JA 2VZOA 4ES9A 3U0ZA 4JV4A 5FWEA 5FZ8A 3ZFGA 1ULDA 5FV3A 2QQLA 3ZYPA 1AYN2 3N36A 2WZR3 1QKQA 1GP5A 1GANA 2VTXA 3HBKA 3LD8A 2JG9B 3DYOA 2WUHA 4ZS2A 4NRMA 1UMIA 1UO9A 1VBC2 1CWPA 2X5IA 2W52A 2J1UA 2IXKA 2VVEA 4E4SA 2FDIA 3E5UA 2RS31 4Q8LA 1SPPB 1O3QA 1J1TA 1ZM1A 2R1DA 1GQPA 1YIFA 4M00A 4XDPA 1GQGA 3AL6A 2VCAA 1BXHA 3LZZA 4RQPA 1YQ8A 3E6CC 3BPZA 4MG2A 3DXTA 1PGW1 1ZBE1 5DZGA 3VBOB 5LCWL 1ZYBA 4YZ2A 3VBUB 3VN4A 4QPYA 4HVQA 4QAWA 1H2LA 2B7YA 2DVAA 2RDQA 1GP6A 1C5IA 4H55A 5FR3A 1EUTA 3J8F1 5IJRA 5CB7A 1GR3A 1RUC3 1H30A 1NE6A 3MIGA 5IVYA 4P5HA 1ENQA 3VD4A 5FO8B 1COV1 5LY1A 3N7JA 1RUOA 5FMCA 4KU7A 1MZFA 1RITA 5D8AC 3MBWA 1VJ2A 3UYJA 4CU7A 1ND2C 2Y38A 3O12A 3O1PA 4BU2A 3V0AB 1VMJA 1UF2C 2D7FA 2CV6A 2VCMA 2RDNA 4FQZA 1POQA 4AI8A 2WL1A 3OOXA 4L97A 1BQPA 2R042 2A6WA 4V1PA 3IN9A 4E4ZA 2CY6A 4K8RB 2WO7A 3S6PA 2Z79A 1IKQA 1WGPA 2BUKA 2XMLA 3RZZA 1JHJA 2ZZJA 2IXCA 4JGYC 1UXXX 2JDMA 2P6HA 5JR7B 1XB9A 4S2FA 1K3IA 3CJIC 4LXLA 3FL7A 3RWKX 1SFYA 4E2QA 1I5PA 2VOXA 4SBVA 1EV11 2B4KA 4WVMB 1BVVA 4DFSA 2VJXA 2P1BA 1BEV2 1J83A 2VECA 4C1WA 1RUH1 1DQ5A 3GBWA 3JD73 4P9WA 3U1XA 3HQXA 4D8MA 1Q8OA 2FMDA 4XBNA 3TN92 2ZGTA 1LODA 4WVMA 4CPBA 2ORZA 3PU8A 2EIBA 4UXAA 2WINB 5FZFA 5EWSA 3T08A 3ZFFB 1JBCA 3LF7A 3NW4A 1LOBA 3AZYA 1Y3TA 4H7MA 2JXAA 4IGPA 3VD9A 4CE8A 1SBEA 3GF6A 5FZEA 2AZ5A 1TZOA 2R041 5C4WA 3AYCA 3R4UA 3UT0A 1GNYA 1LRHA 4YFWA 1UN1A 3TEZA 2Q30A 5CKMA 4ZXEA 4B1MA 5F5AA 1N3QA 2J7MA 1RUD1 3I2IA 4RGAA 5APAA 3DN7A 3R05A 4YW6A 5KHKA 4B3NA 1REDA 2E26A 3FBMA 3KZ4C 3OY8A 1UMZA 4GB33 1D2QA 2J1VA 3ZKUA 5FP4A 3WDWA 5BNOC 1H0BA 2K2SA 1UY0A 3JB8A 4I0BA 3AFGA 3W5NA 4C91A 1N1YA 1T6BX 4JC1A 4V2WA 5FZ6A 4XCBA 2WFF2 4FPYA 2GC0A 4IE0A 4W6WA 2YBPA 5I8YA 4GH4A 5A7OA 3PIGA 3T4VA 5GZCA 4A44A 3V56A 2XUMA 2PAKA 5BNNC 1AXZA 4W6XA 5EZWA 1W0OA 3WQ1A 4Q4Y3 1WCUA 2UU8A 2WZEA 4Q26A 4X8PA 5KXBA 1DYKA 2PYTA 2JG8B 4K6BA 3HQUA 4YWAA 2VXJA 4URAA 1SMVA 3T09A 2HH9A 4LBOA 4BE3A 4BA6A 4C0BA 4OUSA 5CG9A 2F4LA 1MQTB 2D3PA 4MHUA 5FTTC 1EY2A 3D5OA 3I2KA 1CJDA 2VW1A 2P3KA 4CUCA 3ST7A 1ALYA 3ZN6B 1RJ7A 2HYKA 5JWPA 3N7KA 4XUOA 1ASJ3 3VKMA 1G7YA 2AENA 1Z78A 2ZGNA 3WP6A 3RDIA 5K0UB 3HNBM 1OMIA 1HV1A 1SLIA 2VZQA 4IQPA 4RYDA 4XYXA 1QGLA 4CXXA 1MPXA 2OYZA 5FMOL 3I2GA 3RS6A 3VB9A 1UYZA 5GLTA 3R6SA 3H7YA 4NJ4A 1JODA 1QJZA 3PNAA 2EIEA 4Q4X3 3I3EA 3V0AA 4CP1A 3BTXA 1OVSA 1DQ6A 3H8OA 5HCFA 1SCSA 1UYXA 5IVVA 1UKGA 1VBE1 2BFUL 4LKEA 4A45A 2VBDA 4AAXA 2PLV3 3FUQA 4MXWA 4Y1XA 2OIIA 1TMF3 3B9CA 3OD0A 3VBRA 3OUHA 3S0MA 1BEV1 4YVSC 4ZHNA 2A75A 1OURA 4I3GA 1UL9A 4I09A 1ND2B 4KMQA 4P14A 4QX7A 1O3RA 3S30A 3POSA 5JPMB 1JUIA 2QQPA 1HJFA 4FOYA 4HLTA 4K20A 2A6ZA 4QB2A 2EIGA 4XQDA 1MZ5A 3C2UA 4DXSA 3KHCA 3ILNA 1K5MA 3PVOA 5EPAA 1UX6A 2VNGA 1W90A 2P4EA 2UWAA 1ND3B 3W58A 2E9QA 1AYM1 1IG3A 3ATGA 1QDOA 2OPKA 1VP6A 3M4FA 3LIHA 2JD9A 4XF9A 1A34A 1AX0A 3MO4A 2K46A 3RZGA 5FPXA 2XL7A 3OBTA 1XOYA 4WM8C 5A3MA 5DDJ1 2D6PA 4EE2A 1PNFA 2RM23 3C7OA 3X29B 4HSJA 3CU7A 4PQ9A 1L7QA 1R091 4J1WA 5T52A 3F95A 2ZGMA 2QZ2A 4Y22A 5D8AB 2YFUA 4N90A 3J8F2 2BW8A 3THPA 5JUVA 4YVWB 2G9ZA 3LA2A 3VD3A 1RHI2 3WR0A 4XPVA 1DDLA 5JSPA 5J96B 3J7MA 1TNRA 1IS4A 1W0PA 1W8NA 2XJRA 5IUQA 2QCSB 3MICA 1HX6A 4LHSA 1D0HA 4QB6A 3U11A 3K75B 4M4PA 4XBQA 3WCRA 2ZKLA 2A6YA 4RFRB 1A6CA 1ODNA 1NA1B 2ZGSA 1B35B 1YUDA 5BNPA 1VRH2 4GH4B 4DIQA 3FE5A 5ABJA 3M1HA 1V70A 1W6QA 4KQ7A 4NPLA 3T2QA 4HONA 1UZVA 2WYSA 5A7WB 3W21A 5L7OB 3KQ4B 2RMU1 2XVGA 4Q29A 4MV2A 3VZOA 3TYJA 2X5IC 1JYNA 4RR3A 4QGNA 3PLQA 3WOGA 2WJSA 5FZHA 1YFXA 3KCXA 4DY3A 1BLZA 3NO8A 3OGJA 1POV3 4IGOA 5IAVA 5I0DA 2DUQA 1XNAA 4LBQB 4XCAA 1I5ZA 3C7FA 3OBAA 5C70A 5FZCA 2Q4SA 1IGOA 1PO22 3SHRA 1AVBA 2JIJA 2IZWA 2A3YA 2WA3A 3DPRA 2QZ3A 3NNLA 5CKQA 5CA6A 1ZRCA 3KS7A 3UK9A 3OGSA 1REEA 4K7JA 1OUXA 4Y4YA 2XPJA 4CDXA 1EP0A 3VKFC 1QJU3 2W68A 4JGYB 3S7EA 3P1IA 1R083 2H6CA 2QNKA 2CGOA 4AE2A 1X36A 3H3ZA 2X05A 4Q4V3 3JXSA 4UW4A 3MHZA 2RS11 1RUI1 5BXXA 4JGZB 4AEDA 4TLFA 5GLUA 4CCKA 2ENRA 4Y26A 3MLLA 3V64A 1PX3A 2CU5A 1LGBA 3DPRB 4XJ8A 3MW4A 4A41A 2G9GA 3O7OA 2IC1A 2AH2A 5FYUA 3A23A 1GOGA 5BNOB 4E8DA 1JYWA 1W06A 1S2BA 3U4XA 5CADA 1JOPA 4QWNA 4R4XA 5T5JA 4LO4B 1UU6A 3EJKA 1W6PA 2WAOA 4P5YA 4RHV2 1IPJA 2HWC1 4GALA 3ZKYA 3D4KA 3VZNA 1A8MA 3ENRA 4AEJA 1EAH1 1NT0A 2VMHA 3QH7A 5DN2A 4Y33A 2HWD3 1YQ5A 4FFIA 1H6XA 2VOVA 3TNQA 1DF0A 3VBOC 3WUCA 3WQ0A 3LPGA 1HQLA 3SMHA 1WCQA 3LFIA 1RB8G 4PT6A 4AI0A 2WNEA 5FQ0A 1C1FA 1ZRRA 2CAUA 1G9BA 3I2OA 4Z92B 1D4M1 1H9WA 2CSGA 1R1ZA 1P8JA 1HLCA 1SBFA 3AP6A 3N9PA 4LK7A 1UY1A 4I02A 3RI8A 4E4HA 4BWOA 4EWDA 4IEVA 2RS53 2OT7A 3FLTA 2XBO1 4NHLA 5FZGA 3TOJA 3ZYJB 5C4WC 3NV4A 5CEHA 1J1LA 4NPRA 2RR12 2ZEYA 4ZXKA 5CFDA 4N43C 5FREA 5JI9A 3FBYA 2B45X 1RXFA 5AVAA 3EHKA 2F4PA 4JKMA 4QX2A 1WLWA 4CU6A 3IAPA 3VV1A 1EAH2 3NSTA 1YQCA 1OLME 5L36A 1HN1A 1UZ0A 1GOHA 1RUE1 1OLRA 3AYEA 3HEIA 3HQRA 1WD4A 4HKWA 5FUNA 1UAIA 2W39A 1Y9MA 3AMHA 5A7NA 1JZ2A 4Y5TA 5FUIA 3T2OA 2WS92 5JZGB 3VHOA 1HRI2 2R072 3PTYA 1NYWA 4AI9A 2GMEA 1D4VB 1QXRA 3LEIA 3JB4C 1QF3A 4LHKA 1RUC2 4YVWC 5F3CA 4YGBA 3LCPA 4OYUA 3THTA 5BYNA 5BPXA 2Z69A 3K4DA 1U12A 3OUIA 1RHI3 1YLLA 2BQPA 3AP7A 3NV3A 5J7MA 5KC6A 3SCHA 4HOOA 2VE1A 1UOJA 1HB3A 3GZTB 3A7QA 5CFCB 3J7HA 4XXPA 3SITA 3AXDA 4DMIA 4D6SA 1I3HA 3FWEA 3POJA 3U37A 1CAXA 1S0BA 4KGGA 5LWBA 4UWDA 3AZWA 1MQTA 5LW9A 1XSQA 3MIEA 4XDOA 3CZUA 3PHMA 4JKKA 3WNLA 3K51A 3FMGA 3VKLA 3GJAA 3VBFC 3RMXA 5J37A 3NMBA 1MS0A 2OA2A 2HWF1 4YYOA 3FJSA 3EQEA 2J1RA 1KJLA 1N1VA 4AHZA 2BWAA 3TEXA 3MFAA 3ZXGA 2JB4A 3MI8A 3NNMA 4D3WA 1Q8PA 4Z2AA 4KH9A 2HWC3 2WFPA 4LMFA 2ZGQA 4YVSB 1WWYA 5LA9A 1W8OA 2XB6C 2BVVA 2ILMA 5IVFA 2W3JA 2TEPA 3GCXA 4K8FA 2P3JA 4Y20B 4KU8A 2ZS6B 4YZ4A 5FYIA 1VRH3 3VHPA 1S4CA 1W8UA 2IFRA 4AFBA 4A6OA 2QTWB 2XJTA 2AC1A 1ASJ1 5EIYB 1XQNA 2PAMA 1US3A 2UWCA 4GXLA 1DZTA 2DFBA 1X7NA 3K2OA 4K1ZA 1UQXA 4E27A 1ZRDA 5JCTA 1NAEA 1N3OA 4ZU5A 1AUYA 2OVUA 1AX2A 2DTWA 2VQAA 4LEJA 2RV9A 3EMRA 3HBZA 2YZ4A 4IXLA 3URFA 3ZSKA 2VVFA 1LTEA 4AQ2A 2FDGA 1F15A 1IOAA 4IGQA 4PCRA 3NQHA 1SLLA 4P9XA 1VMHA 3O14A 5F5CA 5I0SA 1LHNA 2IFWA 3KV4A 3LSDA 5F1RA 5A6YA 2K9ZA 2UYAA 5SV5A 1HB1A 1B35A 2WT0A 1SLCA 1FT9A 3ZYGA 4CSWA 3HVDA 1NY72 2E7QA 5LK5A 2WFF1 3GM8A 5LATA 1WD3A 2R0HA 5FYZA 4QQOA 5A33A 1US2A 5FWJA 4WVVA 2MEV1 1COV2 5FJKA 3AC0A 2E32A 3VBFA 5A3LA 2ERFA 2RDRA 4Q4W3 1JU4A 5DAXA 5HPOA 4CEYB 3PL0A 4EYUA 5BNPC 2J1AA 1CZTA 3ZDVA 1YYNA 4EZHA 4Y1UA 1APNA 3VDDA 4G4FA 2G4IA 2X09A 1RUI2 4OVEA 3WG4A 4NAOA 1YJLA 4GMP1 4LIVA 5EHDA 4CEYA 2PMWB 1MEC1 4LO8A 1OT5A 4OFGA 1TME2 1FATA 2B9VA 2VZPA 2IUWA 1OH3A 3DYMA 4DY5A 2VTXJ 5DZFA 2A70A 3K46A 4NIIA 3F2ZA 3V0BB 3BYWA 5FY7A 4YM1A 4HK9A 1DQ1A 5EJ3A 2VBPA 2AR6A 4JTOA 5FRAA 3T1MA 4AYUA 3WDXA 5FZIA 4HSLA 2D43A 1ZBE3 3MIHA 1OUSA 5FCCA 5A3UA 1LHUA 3OYWA 1VB2A 4MGKE 3V0BA 5FPAA 2PFWA 1O59A 3HOBA 3ES1A 1RVF1 1GICA 3DPRC 1RXGA 4XFFA 2PHRA 2LALA 4AEDB 4CDXC 3ZPOA 5FP8A 2PHTA 1OH4A 3HT1A 2A71A 1EPZA 1QJEA 3AZVA 1DQ2A 4YW5A 4AF9A 3I2DA 1BJQA 3CBNA 2CDOA 4Q4W2 1VBA3 2R063 1LJ7A 3CIHA 5A6XA 3UV9A 4KG0A 4PDWC 2OUHA 1VRH1 3EXUA 4PLMA 2VUJA 5DUWA 1JN2P 3VKNA 4LBJA 4N7IA 3ZSJA 1VRBA 2VTFA 1YXWA 2ZA9A 1JOJA 1W9YA 2AUYA 3EBRA 3ZFFC 4IERA 5LBFA 4F8AA 3VDDC 4DXRA 5JXJA 1QHDA 1VBE2 2YG0A 3L9JT 3IAQA 4HG6B 4KI5M 4CDQB 2FBEA 2FCUA 1HB4A 4BQWA 4CUGA 3W59A 1QXPA 1W2NA 4AQTA 1Q8QA 2PHDA 3H1YA 1K5MB 4FPHA 3LSEA 4Q4Y2 4XHXA 5F3EA 3T0AA 3ZSMA 3QBQA 4Z1VA 4AXOA 1Y7BA 5FUPA 2YGMA 2XWBB 2BU9A 3OSDA 4UBHA 1NOVA 2GDFA 5J36A 2AEZA 4YG6A 1OKQA 3VLBB 5LK7B 1Y9QA 3G6JB 4J6GA 2BJSA 1RUD2 4LQRA 2G1MA 4RFT0 4RHV3 4FAGA 1EV13 5C6CA 1R1A2 2DVGA 1AR92 2DCKA 4LA3A 2GNMA 4JDNA 5F37A 4A7ZA 3KLSA 4R52A 5F2WA 3LDBA 4URTA 5BUVA 4XFBA 3NNGA 1WCKA 2CWSA 2EAKA 4MZUA 1OOPC 4XAAA 1W2TA 1Q3EA 1ND2A 4OZXA 1AR71 3IZOA 2NPIA 4LBLA 2XVKA 4PDWA 1A3KA 4JQTA 3ACFA 1GZWA 3WG1A 3AZXA 2O8QA 3J7NA 1X8MA 3TEYA 1FNZA 1ZZ9A 5L9BA 3GHMA 1OQEA 2HLEA 3AMNA 4NN0A 2ZABA 4BM8A 2W1WA 4LOTA 4P9IA 3ZN6A 1H1IA 2DTYA 3WXPA 3SH4A 4GA9A 1DGWX 1NZCA 3D0JA 2CYFA 3CQOA 1ND3A 2WAAA 3RYRA 3I2FA 3VKOA 3W9AA 1LHOA 1OKOA 3J26N 2AYHA 4TSVA 4C1XA 3LGRA 3M2MA 4YGCA 3VBHB 1E5SA 1TEIA 4UT5A 2GH2A 1PGW2 2JB8A 2VUCA 5J98B 2EA7A 1AYM3 3N3HA 5D8AA 5H9RA 2Y0OA 1S0FA 3O1UA 3KMHA 4Q2FA 3AKSA 4TXWA 1XNTA 2ZBJA 4JHTA 3AVRA 2EALA 4MGYE 2BPA2 3AFKA 2D6KA 4OUEA 5FZDA 4TLGA 1UZYA 2AREA 3KM5A 2CDPA 3VGIA 1AXKA 1CD3G 2WZ8A 4HANA 5JOXA 1UY4A 4MUVA 4IL7A 1PM4A 2WSVA 4WV8A 5F32A 5A1AA 4K40A 4DOUA 4Q4V2 4AI3A 5K9YA 5JXIA 4FPOB 4LT5A 4MXVA 2Y33A 4BQ1A 2HEWF 2JX9A 4XW3A 4AVTA 3I49A 2DDUA 2V73A 5HBAA 2OQ7A 3PJQA 1ZZ6A 2VMDA 3BGAA 4CDWB 4DQAA 1RUE2 5FJHA 2WNUB 2WDBA 4HVRA 1VBD1 4QPWA 5C7GA 3ES4A 5BNOA 1G86A 3JBG2 2JDNA 2X29A 4M3CE 3WHUA 2VZVA 3T4HB 1JTZX 1UW8A 2BZDA 4HZFA 5E1RA 3POWA 2KA3A 2YMZA 1VE0A 3HT2A 1X50A 1OSGA 3DCQA 1Z7S2 5FPZA 1RUJ3 5IK4A 2JE7A 1AYN1 2ARAA 5AC91 4ZONA 4FVVA 3I54A 4IEWA 2A3WA 4QPGA 2VGDA 4CP9A 2JG8C 3SISA 5EYYA 1U5ZA 1V0AA 1X9PA 5ISLA 2Y6KA 4PLOA 5EJZB 3W20A 5JSRA 5FZKA 1R1A1 4OQ8A 1TMF1 2VOKA 2XOMA 1OQDA 2D3RA 1MEC2 3MYXA 1WA6X 3DF0A 4MYEA 1V00A 1J3RA 3B00A 2QQIA 2IXLA 1WMFA 4CDQC 3B7MA 4CDUA 2BGCA 2W91A 3AXEA 1QQP3 2ZGUA 3HR9A 5JXGA 4Q5OA 3USUA 3J7LA 1MS9A 4X8NA 5HCBA 2LTNA 4ARXA 1Q8SA 2WA4A 3WDYA 5BNNA 5F9TA 3MPPG 2PHXA 1T6GC 3B93A 1M06G 1ZBA1 4W6YA 1W6QB 1L7LA 1LESA 3SQOA 5DDJ3 1GU3A 1LU1A 4TZDA 4CZSA 5IAXA 2ZGLA 2A6VA 3ON7A 5FMDA 5T5LA 4Y3OA 1O4YA 1CZVA 2QJVA 2Q8EA 1CAWA 3RZLA 4GULA 4MGZE 4YLZA 4EWAA 2ZMLA 4UW5A 1QDCA 4FCAA 4FAHA 1H8TC 4AVAA 3K4ZA 4CP9B 5L19A 4LE4A 2XGXA 1OF4A 2W1UA 2GN3A 3DGTA 4D6RA 1GZCA 3MLKA 4KL1A 1K5MC 1ZRIA 4GWIA 4YG0A 1HRV3 5SV8A 1V9U1 3RRDA 5FBJA 3ZYHA 1AR81 1QOSA 1ULEA 2P17A 3MLJA 3WF2A 1C57A 2GC2A 4DUVA 4HMZA 1N1SA 4CDUC 4F3JA 1FOD3 2C1FA 1YNAA 1D4M3 1H2NA 3QCWA 4HN1A 2ZKNA 4YVWA 1V6IA 4AVSA 1C8M3 1TME1 3IDCB 3POGA 4FQ4A 4IEYA 5DUVA 1KS5A 2PLV2 1IPKA 3H0OA 3UGFA 2W92A 5CBLA 1VR3A 3FHAA 4P9LA 4P9GA 5IVEA 5A70A 2EAAA 2JWPA 4QXKA 1LEMA 2RM22 4XE9A 1JZ4A 1H4GA 4Q4X1 4LO5B 3P6BA 4BIOA 2W47A 2VO5A 3WQBA 3OBRA 2QFEA 2O8OA 2P2KA 1OHFA 4H2AA 4RHV1 1CONA 4YM2A 3UETA 1M4WA 3ZYFA 2GALA 2QUOA 3KV5A 5DZEA 4F83A 2CGNA 1S0IA 1XU1A 2FCVA 4O9EA 4PJYA 2WABA 3GZUC 1GSLA 5FZ4A 3O0VA 1O8PA 2W94A 1LECA 3CF6E 3BUCA 4FPLA 4W50A 4AFDA 4H14A 4YG3A 4MGQA 4FTBA 5CFCC 1ULFA 2X53S 2XBO2 4JAAA 5F6LB 3AKTA 4FPJA 5LASA 1DLCA 1HV0A 5T3NA 3T2PA 3ZXEA 4EN6B 3AKPA 4EZ4A 3O1MA 3K3OA 4COYA 3ACHA 3RGBA 4WM7C 4AHWA 2PTMA 3TB0A 4XZPA 5CZKA 4QD2A 1LOFC 2QQKA 2R061 1ZBA3 1K42A 2ZX2A 2QBXA 3EYPA 1UYYA 4LKFA 5FOBB 2ZX1A 5FKCA 4AHXA 1ZRFA 3ME2A 1VAVA 3DUIA 1LNSA 4DXZA 4J1XA 1ULPA 1J58A 5CNAA 5FXVA 5GJ6A 4UFLA 4DUXA 4EQVA 4WVZA 1ONAA 4XETA 4KWUA 2E31A 2EXHA 5FP7A 5GZGA 2VOTA 2VZ3A 3SCFA 4Y24A 3RQ0A 1D2SA 1HDKA 4KBBA 5A32B 2W2IA 1S55A 5JMOA 2XJUA 2QDNA 1O5UA 2EXJA 4ARYA 4IV1C 2VCBA 5T55A 2ZGPA 4NO4A 4HFSA 2VMCA 3B9IA 1IPSA 3T0DA 3VZJA 4RR3C 3HPNA 1EYBA 1RUC1 4H3WA 3KT4A 5T5OA 4L9BA 1UIKA 3H3LA 4CCJA 5KXDA 3DL3A 3VBHC 1GNHA 5FBZA 1UU5A 5CFDB 1QJFA 1L7RA 4IE6A 1IS6A 5KXCA 1KFXL 2Y8KA 1MVEA 1WBLA 2BOIA 3RSJA 1JZ8A 4FO9A 3BKZA 1ND3C 2YBKA 1TQ5A 3C7EA 4FP2A 3E97A 4QKNA 3TN93 2VD7A 1OXCA 1VBD3 4B7KA 1YFYA 2VUDA 2BOJA 3A0NA 1Y9GA 4C0HA 4OUMA 4DRVA 1QU0A 2WFF3 3FN9A 2DURA 1E5IA 3IIIA 3MUY1 2P3YA 5FLHA 1XBFA 3UKTA 1SHWB 3T3YA 3CNAA 3L2YA 4PF1A 2PHFA 1VBA2 1FPN3 4M3CF 4QPIA 3VBSC 2E7TA 5JR2A 3LEKA 2Q5TA 4M01A 1AJOA 1OVPA 3IWZA 1F5JA 4FT8A 1W8ZA 2VNRA 3THDA 2V5YA 5C33A 4XQ4A 4JDMA 4N8MA 4AI2A 1HKDA 1Q56A 2GC3A 1FYUA 2R043 5L9VA 4DRRA 4HBNA 4CEWA 4JVAA 2PHWA 3ZXLA 5A1LA 5IVJA 1R1A3 4Q8KA 4BQ2A 4EROA 3AP4A 3NV2A 3K77A 1QOTA 4HPKB 4IEUA 2FDKA 5FAXA 1RUD3 4HKOA 5A7SA 4CUAA 1QJX2 5IVBA 3AK0A 1MACA 1RUG2 2BNOA 4LA2A 4RGKA 1BBT2 4HPKA 1ENSA 4CCNA 1WLCA 2W5FA 5KXEA 5FKBA 4ES8A 4I01A 2DVFA 1HRI1 1PO23 1CZSA 2R071 4E9KA 1UY2A 5BNNB 3ETQA 4XOGA 2ZGKA 1SLTA 3H50A 1OFNA 2V09A 5L9RA 4BQ5A 1G9DA 3TAYA 3EO6A 3NL1A 5HXMA 1E5RA 2PN5A 4O7XA 4TWTA 4MX3A 1DQ4A 1KDKA 1IS3A 1NXMA 2E51A 4XC9A 4IEZA 5EP9A 5A7WA 4OULA 4I2OA 3ROUA 3ORJA 3ALQA 4JZRA 4Y1YA 1OQ1A 4AZZA 5DUUA 1DU3D 2PQSA 4QPGC 1UOFA 4XTPA 4E8CA 2WNOA 3JQXA 1V6KA 2EXKA 4FOQA 1UMHA 2QQMA 5FO9B 4LUKA 4NHXA 4UOJA 3T30A 3WW2A 3ZXFA 2A5ZA 1J59A 2HWB1 1SBDA 3ECQA 3ACIA 3WG2A 1DZRA 4G9SB 1POV1 1YI7A 2XONA 2VQUA 4EJRA 3IDBB 4KWJA 4LPLA 3J9SA 4NAMA 4UFMA 1MS4A 3WD5A 3H9AA 5FZ1A 1S0JA 2A73B 2YFZA 1O4ZA 5A3OA 4NROA 4COUA 2D98A 3JD71 4Y20A 2EXIA 5CG8A 1Y43B 3WEZA 3LEGA 1QJY2 1H9PA 3BU7A 1OD3A 1HXS3 1O5LA 4N53B 1XYPA 3K3NA 3GHNA 4FP3A 5CYYA 3WDVA 4IE4A 5HXVA 5B4XA 1AX1A 4AI1A 4AGRA 1HQWA 5EQUA 3KF3A 3MFCA 2YBSA 5KC5A 3B01A 1MEC3 1ZZCA 2GNBA 1VBB1 3NVCA 5HCAA 4XFAA 1FPN1 3JZVA 3NRUA 4I3PA 1R081 4OI4A 4XF0A 5FZMA 3BTAA 5I93A 1B09A 4HXCA 3QACA 5FZ0A 3JU9A 1QWRA 2JDYA 3H1MA 4PI2A 3KCYA 3WNKA 5BY5A 1W0NA 4LJHA 2XQRA 1LGCA 2ZGRA 4GQ7A 4QXCA 5DDJ2 5FZ9A 3MDPA 4NVPA 4XILA 3M3EA 2HBUA 2Q0AA 1GKBA 3FHIB 1YQ2A 5IATA 1KFUL 1AR91 3ETPA 4Y5SA 4CDWA 4WZCA 4D0QA 1UCXA 2UY9A 4FPKA 5CIRA 3D3AA 1K45A 1LGNA 2WQ4A 4P02B 1PVC3 2UWBA 3I59A 3N9OA 4META 3RZMA 2CNAA 4QGLA 1JUHA 5F3GA 1NLQA 2ZCWA 5AC92 5JSOA 4CRQA 5ANQA 1PO21 3M3QA 4PIXA 1Z0HA 1XE8A 4MGSA 2FDJA 4GH4C 3WNXA 1JYTA 3CLPA 3WV6A 1JYCA 5J3UA 2EF6A 2D3SA 3INAA 1VIWB 1LENA 4JCKA 5E16A 2VVDA 3RI9A 1ZA7A 2ZOEB 3NAPA 4AEKA 4LITA 4NRQA 1DGRN 2VBBA 4TYSA 3Q8FA 1OF3A 3DKQA 1NLRA 1URXA 1VAKA 2VZRA 4MOAA 5JI7A 4JRAA 5GZDA 3BN6A 5A80A 4O9GA 3KT1A 2CWMA 1CESA 2HWB3 1B35C 4OHZA 5FK7A 3OY8B 1NCRA 1JH5A 5FYYA 2TUNA 4QKBA 4XEZA 5L7OC 4QHZA 5JZGC 3LOBA 5K0UC 2JG8A 4UFIA 3LDRA 3ZMOA 5C8CB 1CAUB 3WX5A 1RUF3 2YXSA 5IK5A 3WF0A 1Z7S3 4Q0VA 4DB5A 3SEEA 1RMU2 2WZR1 4GD4A 5G05L 4QQLA 1RUE3 4LLFA 2W46A 3BTZA 1RUG3 1HIXA 2XJQA 4XACA 5A3WA 1O91A 4CDQA 5DAPA 4XVHA 1W8TA 4EWEA 1XYNA 5FIXA 4B4RA 4XF4A 1O4TA 4QX1A 3ZR6A 4A4AA 2ARBA 3KD4A 5F3IA 4EV0A 4PLNA 3ZIWA 1BMV2 1PMIA 4C8DA 3UGGA 1BYHA 2VC9A 1GOFA 4KBZA 3NJZA 4M4RA 1RUJ1 3J4UH 3ABZA 4GMP0 2ZEWA 4GWMA 3ZMNA 3KB5A 3O1SA 3D0SA 3BOPA 2ZJCA 3M3OA 5FY4A 4WM8B 2UY8A 4LULA 4RSUA 1OFSA 1RL3A 3JUUA 4LBKA 4AEMA 5AFBA 4XJAA 5FY1A 4YM3A 2FDHA 1AR93 4MGTA 3KT7A 4Q4V1 3VD7A 5EFUA 4OHYA 1REFA 1FNYA 3GBGA 5LBCA 1ASJ2 1DYPA 3GDBA 2JENA 4N7UA 1MS1A 3ZLIA 5FPUA 4QPIC 3VBSA 4QX5A 4GKXA 4D69A 1H8TA 2XJPA 1GWMA 5F5QA 3AKRA 5I8TA 1VBD2 1JYIA 2LRPA 2D97A 2RS13 2RVAA 5E89A 3VHNA 4KG8A 2OUJA 1NG0A 2VQ0A 4J25A 4LO6B 1PK6C 2GNTA 3IB3A 1J84A 2X10A 3FLPA 2F6BA 5KHJA 3ZPYA 1ENXA 1PMJX 5FOJB 2IWGB 2MNGA 4Z07A 4GKYA 4XFHA 3AX4A 1PIV2 4OI1A 3GNEA 4YRDA 3T2TA 1CAUA 3DYPA 4AQSA 1XE0A 4QHBA 3KGZA 1NQDA 2HWE2 4QPGB 5J09A 3BVCA 3MV01 3AVSA 2WBKA 3GYDA 3ZXJA 4ZU7A 2B42B 2WO1A 1ZZ7A 3Q8EA 1N1TA 5JVVA 1O6UA 3V65A 3G7DA 4PIYA 1DIWA 1UXZA 3P3NA 2HWB2 1ZNPA 1BVP1 2Q1ZB 2LUWA 1CAXB 1EV12 2XWJB 5ABJC 3K48A 3OCPA 4PBPA 4ISQA 2RS51 4QXHA 4M0HA 4NIHA 1U5IA 1RUH3 5C3OA 1IHMA 1RGSA 2VMGA 2JDHA 1QY4A 2AACA 3C7HA 4OLLA 2VQTA 4B4QA 1H2KA 2XKOA 5D21A 2WNVC 1RMU1 2A3XA 5GM0A 3WQ7A 4QDRA 3RYKA 1W8HA 4YW4A 3BU0A 3GZEA 4EN8B 3D8CA 2J1SA 2ADEA 1FOD2 1MZEA 3VL8A 4LUMA 2WYFA 1NCQA 4Z82A 2L9LA 2VMEA 1ZA4A 4DZGA 3VBUC 5A3NA 1XU2A 4AVCA 2YB7A 1CJPA 5EJ1B 1H8TB 3CDZB 5BNPB 1RVF2 2WWSA 5LZ6A 1X9TA 2Y6GA 3E6BA 3Q8BA 4GJYA 1BHGA 1YIPA 4QGMA 1VB4A 1QJX1 3PUQA 1UD1A 3S7IA 2WLQA 4A2UA 4BLIA 3LA3A 3PJYA 1DFQA 1UKRA 1WBFA 3KSCA 1W8WA 4LKSA 3VUOA 1Q8VA 1SEFA 5F6KA 3KHBA 5KHHA 4IE5A 1YC61 3ITQA 3VZLA 4N9IA 4XFGA 4BQYA 1GNZA 3VZMA 3B3QE 3ZFGC 3E6DA 3WZ1A 2WIIB 2JICA 1LEDA 1CPNA 2VOWA 2NM1A 4LK6A 3PMEA 1WLTA 2G19A 3ZXAC 1BMV1 2D6MA 4AVVA 4FOVA 1VALA 4EN9B 3U14A 3VDAA 5B2GB 1DG6A 2JKBA 4E2SA 5CFDC 1QJY3 2B5HA 3LPFA 3VL9A 4AVBA 3A0KA 1QJU2 1F31A 1YQ6A 2VZTA 3OUJA 2V72A 4K1YA 2P5BA 4UFHA 5A3PA 1NY71 2B8MA 4PIZA 1V6NA 4TTGA 4RQPC 2BGPA 3POYA 3C7GA 2R7EB 1PVC2 2D5HA 2WNVB 2C0ZA 3VBOA 2WKKA 5DMYA 1CPMA 2ZHLA 3A22A 3KGLA 2BRTA 2BVBA 1S0GA 4W8JA 5GLVA 3VBUA 1W2UA 2NP0A 1NKGA 3AYDA 1KD7A 3I3MA 3SXWA 5T54A 2DU0A 2NLRA 3NNJA 2C24A 2JJ6A 3CJIA 5L73A 4BQ3A 1DCSA 1XC6A 2OQ6A 3OPWA 4NPMA 3K4AA 2XKPA 1XPWA 2GN7A 1S2KA 1CAVB 2R062 5CAZA 2YU2A 2JG9A 5HV0A 1W04A 4FTEA 2J1TA 1H2MA 4W4ZA 2R6QA 2BERA 3HNYM 4B4PA 4BHPA 4D6QA 2HWF2 4YNIA 2E7AA 3HN3A 1RUJ2 2KXLA 2WO3A 4BK4A 1SDWA 3KVAA 4H7LA 4AWDA 2GNDA 2DFCA 2PELA 3ZSEA 5F2SA 2DUPA 3ZX7A 2Z5WA 4M0NA 4OCTA 1NUKA 4N53C 4EN7B 2MPFA 4BK5A 5FYCA 1H6YA 4S2HA 4ZS3A 2LW8A 1XJAA 2WT2A 1OA3A 5FPBA 4YZ1A 1JZ3A 1PK6B 1UWWA 1O3SA 5DUXA 5DQ0A 1AR73 1UZWA 5ACA3 1DYOA 5ACA2 4P9YA 1WMXA 2YUEA 2Q8DA 4AFMA 2YY1A 4CCEA 2QQJA 5F39A 1QQP2 1PO12 4YZ3A 2OS2A 3MW3A 5BNQA 4WVWA 4Q27A 5E88A 2OKXA 2JDUA 5C8CC 2R49A 3BI3A 2C9KA 3O1TA 3I2HA 4CDUB 1KRIA 2FHRA 3BOWA 1HW5A 3TWIA 1OPMA 1AZDA 2A1XA 5JMCA 4LORA 4CDXB 4AK3A 1NCRC 2XL9A 2D6NA 4CUBA 2RJKA 5F8PA 2FZ1A 3D6EA 2JG9C 3JQWA 1NX9A 5DAWA 1UX7A 4A7YA 5EXOA 4YW7A 1H4HA 5JZGA 3KV9A 3OYWB 1V6MA 2Y6JA 3LB9A 3ZYRA 1QNWA 3FFQA 2CTVA 5IYYA 2FD8A 2ZAHA 1PHMA 1FAYA 4BCUA 2GP5A 5EYXA 1QJY1 4N53A 1DGWA 3PVNA 3FC0A 1W28A 2CL2A 1PO11 3RZJA 2JKXA 3U4SA 3WF3A 1OD5A 5JIAA 1FV2A 2R30A 3S57A 1S0EA 1C8NA 3ZSLA 3QH6A 5FPLA 1WCSA 4AHYA 1O3TA 3PMSA 3O0XA 1VBA1 4NE9A 4WZFA 1N3PA 3AMPA 4CEYC 2XJSA 4MSVA 4CCDA 2B9UA 2XHKA 1BBT1 5DG1A 1SFPA 2GAUA 4CU8A 4CCMA 1POV0 5FYBA 1AXYA 4COZA 4LBMA 4QXBA 4IEOA 1LOGA 2VXRA 4BMEA 2Q8OA 2R16A 4AFAA 2JD4A 1D7PM 2DUOA 3Q8AA 1WCDJ 2B39A 4CEWB 1W6OB 2ZEXA 2F17A 4Q1PA 1XRUA 4XBLA 3C8XA 3R4DB 5FYSA 1NLSA 3T1LA 3H8UA 3I8TA 3LDKA 1N47A 2YPDA 3VBRC 1EUUA 1AYM2 2H0BA 2IVJA 4U36A 1DP0A 3FLRA 5AFEA 2VNOA 4AFCA 1OC1A 1KS4A 2Y26A 5LBEA 3GGLA 1F9KA 1KEXA 3C3VA 3ZXDA 1ULCA 1PIV3 3H1WA 2GSYA 3PIJA 1FV3A 1H1MA 2O0OA 4BMBA 2FZ2A 2JEMA 4QX3A 1GYKA 4IEXA 2O14A 5A7QA 1AL22 4UI9L 3PVEA 1WW5A 2P37A 4CCLA 2VZSA 5DABA 5CVRA 3EB7A 4A7KA 5A33B 4GWJA 3ZFEB 3WNMA 2JIGA 2P3IA 1MZ6A 4XF1A 3GXUA 4L8QA 4FFFA 1DHKB 2RS33 4RA0A 5LA0A 3NNFA 4FFHA 1BEV3 1UOGA 1AJKA 2QVSB 1S1AA 3IKWA 3N9NA 3VBHA 4LR4A 5JXHA 1NCQC 3CHXA 4WM8A 4K3UA 3UKNA 3OG2A 2QQOA 2VULA 5I0TA 1S0DA 4CA9A 4BJ0A 4M3CB 1WKYA 1CQ9A 3GCWA 4AW7A 3Q9OA 5FK8A 4LIUA 2VY0A 5FDBA 1ZZ8A 3N4MA 1LOCA 2HWD1 1BCXA 3N7MA 2HEYF 2X8KA 4XTMA 4AGVA 1SDDB 1JS9A 1HQNA 2QQWA 1HJGA 2WNUC 4UBGA 4BXFA 2IVIB 1V9U3 2HJIA 1QIQA 4KNCA 1QH6A 1RUNA 1YHFA 1DZQA 1R64A 3ILRA 3WNNA 1FI2A 1UYPA 3QD6A 1V6JA 1AL23 3N35A 4S2GA 5KBFA 4XJWA 1WA4A 2TBVA 4V2VA 5FYHA 2XBO3 5KHIA 2D40A 3U75A 2Y6LA 2RDSA 2WS91 1V6OA 2JDPA 1HB2A 1IKPA 3B69A 1HRV2 2Q1MA 1W6NB 5FYMA 1OOPA 3DXUA 2ZMKA 2PLV1 3GZAA 4JQRA 4LHNA 4Q0SA 3R0RA 3ZM8A 3H8XA 4RS5B 1PGSA 2BV4A 3MV11 4PDWB 4U2AA 3N9QA 4JGZA 3KCCA 3MIFA 4ASMB 2PHLA 1RUF2 1W6NA 5ERLA 5H9SA 5C8WA 4QU1A 5FY5A 4YGDA 2C4XA 4QM9A 2NQYA 1TVGA 2AGSA 4HVOA 1W05A 3LIGA 2E53A 1G8WA 4LBNA 1PZ7A 1R092 1XNCA 4CVUA 5DXDA
chains in the Genus database with same CATH topology
4MVTA 1CR7A 2E6VA 4BLJA 1DBNA 1C3HA 2NN8A 4XMAA 1AYN3 1C5HA 3WCSA 4SLIA 3M70A 2C9AA 5I0UA 2FQPA 4M3CA 4ASLA 5EV7A 1R082 2GMPA 4KWLA 3WG3A 1OPOA 3USUB 1ULGA 4D94A 4MGIE 2VW0A 4KGQA 4NWWA 4XHBA 3ZVXA 2KM2A 2UYBA 4HKLA 1W6MA 3SH3A 1LKNA 5C4WB 2HWF3 1PVXA 2TNFA 1OA2A 1TNFA 5FMOS 2DU1A 4W65A 1SLAA 3CEWA 1GZWB 1WLDA 4Q1RA 3BODA 1PVC1 2XLGA 2ET7A 3OTFA 2OZ6A 4COWA 5I0RA 1S0CA 3WW4A 4IV3C 1UZZA 1FMD1 2WZR2 2DV9A 3RMYA 2ATFA 1AR61 3RPQA 4BOWA 3ZO0B 2QDRA 1YO8A 3IMNA 3NWKA 4PF5A 2XVLA 4CP0A 2BFUS 3BIWE 1C1LA 2ES3A 2MEV3 1NA1C 5LRRA 5JLVA 1YCIA 3I4IA 2Y0IA 1KITA 4QT6A 2CAVA 1I9RA 3CO2A 5FLJA 4I30A 4NHMA 4FXKB 3AB0A 1RUH2 1KXGA 2X5IB 5FLIA 4L11A 4P9JA 4JGYA 2A6XA 3WP3A 3QLQA 1NXD1 2D5FA 4LTAA 3RWNA 1IZ3A 1UU4A 4GMP3 1GQHA 1Q5OA 3IPVA 1BK1A 1QJU1 1W6OA 4NWVA 4BH9A 1UPSA 1G9FA 4YFZA 2RS52 5IK7A 1SCRA 1W6MB 4N43A 2YDEA 2YGLA 1IS5A 3D82A 2BWCA 4CDWC 1NCRB 1U5YA 2XLAA 2D6OX 3IIAA 3WY6A 1GBGA 1AR82 1VBB3 1ZX5A 5L7OA 3AKQA 4N9HA 5I91A 1RIRA 4RQPB 3MF9A 4BZ4A 1D0GA 2DVBA 1ENRA 4OHVA 4R9CA 1QJX3 4QQHA 1QH7A 1GFF2 4GB32 4NHKA 1LR5A 5DG2A 4CYDA 1EAH3 2HKXA 2QKDA 5T50A 3GALA 3NAPC 2GH8A 1KJRA 4HK8A 4Q0QA 5GKAC 1FMD3 3AJZA 1E57A 3RG0A 1IQAA 1U0AA 5D1IA 1VBC1 2I45A 5K7PA 1I6XA 3MPBA 4Y1VA 5H9QA 4QMAA 2HWE3 4L99A 4LE3A 2GZWA 1CGPA 2VW2A 2EVXA 2WZPP 1AL0G 4G3YC 5K0UA 5K8SA 1QOOA 1AR83 1H8VA 4A3XA 1CAVA 3OD4A 1CIWA 5JAXA 1YFWA 4Q0PA 3U07A 1RMU3 3AMMA 3ZFEA 4Z2WA 4N43B 2BEOA 3TBDA 1TE1B 1W39A 3SH5A 4Z8BA 3P3PA 5KHGA 3R4SA 2P34A 2WS93 2XH6A 3LKJA 2LM3A 5I8SA 3KQRA 3GBFA 4IESA 1FMD2 3AMQA 1KDMA 3B94A 3LOIA 4QM8A 4XJUA 2VU9A 2YHJA 4B8EA 2D44A 4FBFA 4BYYA 1KQRA 4IV3B 1RUG1 2ETEA 3ZYIB 3MW2A 5JIUA 4D7TA 3AYAA 4AG4A 5JOZA 1LULA 4ZU4A 4IEQA 3ILFA 4ITCA 4WBBA 4Y1ZA 2GMMA 4AQ6A 4XFCA 4CP2A 5FQ0B 4AGGA 1I1EA 2FMYA 2VH9A 1PZ9A 2DCYA 1OLQA 2NMNA 3H7JA 3RYPA 5KWRA 2RM21 3ZXKA 5CFCA 1XNKA 3AP9A 2ZX4A 1XXNA 4E2GA 1F2NA 3JD72 3I7DA 2VMIA 3ZFEC 3U10A 4GB31 2DCJA 4JGZC 3RNSA 1F8VA 3WHTA 1DLLA 3NKGA 4GWNA 1C4RA 3ELNA 2NZ9A 4XQWA 5LEJA 4DNYA 3RJ2X 2NYYA 1H1AA 1NCQB 4S2DA 4KWKA 3TRSB 1QXJA 3WT3A 1SLBA 3WP4A 4XF3A 2CGPA 3VBFB 2ZAAA 3VZKA 4YGEA 5GZEA 1AR62 4FTSA 1CX4A 3VHRA 2H6BA 5E8AA 1LU2A 2O1QA 4QQPA 1DQ0A 4HL0A 1RUF1 2RE9A 2WSUA 1MR5A 3WDTA 1ZBE2 5GALA 1PO13 2R0FA 3O0WA 5GLZA 5GZFA 3UJQA 1V6LA 4HN0A 2I2SA 4RR3B 4OI0A 2DCTA 3O5SA 1D4M2 4QQ2A 4Q4W1 1A78A 3ZFFA 1Z7S1 3WP5A 2SBAA 1JXNA 1XE7A 4LBQA 5BV6A 5A32A 3APBA 3WW1A 4CEWC 4Q4X2 1VBE3 3FUOA 2ZX0A 5JDBA 3NAPB 1TME3 2R1BA 4YM0A 4YW3A 4X6QB 2N7GA 2NMOA 4Y22B 4Y5Z0 4RL7A 3JCIA 1FOD1 1AF9A 4EN0A 3DKWA 1LOEA 4X6RB 2YYOA 1PM7A 4I0WB 1LOAA 3VDDB 1PGL1 2C5DA 3SLIA 1RHI1 2SLIA 3OJBA 2ZACA 4BPZA 3MIBA 3VBSB 3NV1A 1RVF3 5GLWA 5FO7B 4MH0E 1XNBA 2BTVC 3B02A 1EPWA 4DPNA 1NQJA 1C8M2 1J3PA 4LLOA 4XIKA 4R9DA 1NA1A 1SQ4A 2WNUA 4AEDC 1GLHA 2ZPXA 4XIOA 1WMDA 2RMU2 4YARA 1MS3A 1WW7A 1RJ8A 1RINA 2ZGOA 1MS5A 1OI6A 4Q0UA 2YV8A 3HIFA 2PA7A 4JDOA 3WDUA 3WW3A 2YC0A 4ZKTB 4FPCA 4MLOA 3FZ3A 1SACA 1R093 1JW6A 4RD7A 1LB2A 1BKZA 4FPEA 1FPN2 1COV3 4XMIA 2UURA 3B5LB 2D93A 2WLPA 2BYVE 1C8M1 4XJ9A 5C9AB 5LEKA 4R9AA 2ARXA 5C8CA 2RR11 3HMYA 4NR1A 2OZJA 3UKVA 1L3JA 3M3IA 5C9AA 1HXS1 1XNDA 4L2NA 3USSA 1BBT3 1X82A 2XG3A 3RJRA 1Q43A 4RGGA 3SNMA 1G6NA 2G9FA 1O7FA 2WC2A 2YPJA 4FXGB 4MXWB 5IK8A 2DWRA 2OW4A 2XJVA 3ZN5A 4DINB 1FX5A 2Z2SB 2QE3A 4HETA 3BB6A 4ATFA 4LHLA 5T5PA 2HWC2 1G9CA 2I07B 4R8HA 1OA4A 1W6PB 3CJXA 2ZHMA 3H3UA 4OHXA 4FPFA 3N7LA 1UIJA 3I59B 1F5FA 3MGUA 1WW6A 1SFNA 2XLFA 2ZHNA 3L2HA 1CN1A 3WVJA 3MF6A 2VG9A 4ONUA 1OOPB 3MIDA 3LA7A 2BNNA 2W08A 4CTEA 2IXIA 3LWCA 3IT8A 5TSWA 4YSFA 3IDEA 4FPGA 4NOTA 4FSJA 4B7EA 3VBRB 2HEVF 3HWJA 3LAGA 1CVNA 2HWD2 4JRLA 1HRI3 2R073 1GZ9A 4OI2A 3CL1A 3M8LA 1X8EA 2HWE1 1AL21 4XXAA 2W0XA 2YROA 3OF1A 4Q4Y1 2D6LX 3IPVB 4D7YA 1NE4A 3WINE 1UPIA 3WUDA 4R4ZA 3A4UA 2DCZA 1WW4A 2BBVA 3HN1A 2DYCA 4XJZA 3E5QA 2ZX3A 4IETA 1GV9A 2ET1A 2ZHKA 2RR13 1HRV1 2DF7A 3TN91 4E4DX 5ABJB 4K21A 2Z42A 1CAWB 1MQTC 4D7SA 2RS32 4QU2A 1QMJA 2DVDA 5H9PA 2VPVA 4K9SA 2RHPA 1BZWA 4LBQD 1QNYA 2JECA 2PAEA 5AC93 2MEV2 1ZBA2 2WT1A 5ACA1 3ZN4A 5IT6A 3JBG1 1MVQA 4GIQA 1J3QA 2RS12 1WMEA 3ACLA 4COVA 3WLUA 2K0GA 2BNMA 1QQP1 2MHFA 4B29A 1RUI3 2PQQA 3HD8B 2GC1A 4R9BA 3OGGA 4DS0A 4XDQA 4INDA 4L92A 3SCGA 3ZDSA 3ZIXA 1YFUA 3AP5A 1DGLA 2A7AA 1FXZA 5CU1A 4UW6A 4RS5C 3CJIB 3E5XA 4OHWA 4YZ5A 1LOFA 3QOPA 1PNGA 2JDZA 4I0AA 1X33A 5JPNB 3OPZA 1AR72 3M7AA 4UW3A 1AHSA 3UJOA 4F7ZA 2I74A 3DV8A 4ATEA 5JOWA 5LRSA 1VLNA 3IBMA 1VBB2 3BCWA 4ORFA 3J8F3 5J48A 1LHWA 2ZZQA 3AZZA 5AVPA 1G9AA 4ISRA 2R32A 4JTNA 4PBOA 2VUAA 4YW2A 1JHNA 2H0VA 3ASIA 3FX3A 1LCLA 4YW1A 2E63A 1ZVFA 1PZ8A 1PK6A 2PHUA 4FOWA 1AR63 1DGRA 3TNPB 4BIFA 2WQZC 1WUVA 1YWKA 1XYOA 5JOYA 4WM7A 4IEPA 5HI0A 3PVBB 3M3CA 2RJLA 1YRZA 1VBC3 1ZREA 2IXHA 2JE9A 1ZZBA 2ZMNA 3IM0A 3BALA 1RTVA 4HT1T 3MZHA 2B46X 1LHVA 1MS8A 4LNVA 4QPIB 3ZFGB 4YVSA 4XFIA 4RS5A 4LO7A 1VAMA 3AM2A 4WM7B 2IXJA 4IV1B 3JBG3 2RMU3 4C90A 1YJKA 3HAGA 1PIV1 3FFZA 3UL2A 1U5XA 2GU9A 1PGL2 1C28A 3MEPA 1HXS2 1RC6A 4IV1A 1YI9A 1TMF2 2WNVA 2ZTNA 1V9U2 1A8DA 4IV3A 5FFOC 3AJYA 5C9AC 3NKTA 3U0ZA 4ES9A 4JV4A 3ZFGA 1ULDA 3ZYPA 1AYN2 3N36A 2WZR3 1QKQA 1GANA 2JG9B 1VBC2 2X5IA 2W52A 2VVEA 2IXKA 4E4SA 3E5UA 2RS31 4Q8LA 1O3QA 1J1TA 1ZM1A 2R1DA 1YIFA 4M00A 1GQGA 1BXHA 3LZZA 4RQPA 3E6CC 3BPZA 5DZGA 1PGW1 1ZBE1 3VBOB 1ZYBA 4YZ2A 3VBUB 3VN4A 4QPYA 4HVQA 1H2LA 2B7YA 2DVAA 4H55A 1C5IA 3J8F1 5CB7A 1GR3A 1RUC3 1H30A 1NE6A 3MIGA 4P5HA 1ENQA 5FO8B 1COV1 1RUOA 3N7JA 4KU7A 1MZFA 1RITA 5D8AC 1VJ2A 1ND2C 2Y38A 3O12A 3V0AB 1UF2C 2D7FA 2CV6A 4FQZA 4AI8A 2WL1A 4L97A 1BQPA 2R042 2A6WA 4V1PA 3IN9A 4E4ZA 2CY6A 3S6PA 2Z79A 1IKQA 1WGPA 2BUKA 3RZZA 2ZZJA 2IXCA 4JGYC 5JR7B 4S2FA 3CJIC 4E2QA 1SFYA 2VOXA 4SBVA 1EV11 4WVMB 1BVVA 4DFSA 1BEV2 2VECA 4C1WA 1RUH1 1DQ5A 3GBWA 3JD73 4P9WA 3HQXA 1Q8OA 2FMDA 4XBNA 3TN92 2ZGTA 1LODA 4WVMA 4UXAA 2WINB 5EWSA 3ZFFB 1JBCA 3NW4A 1LOBA 3AZYA 1Y3TA 4H7MA 2JXAA 1SBEA 3GF6A 2AZ5A 2R041 5C4WA 3AYCA 3R4UA 1LRHA 4YFWA 1UN1A 2Q30A 1N3QA 4RGAA 1RUD1 3DN7A 3R05A 5KHKA 4B3NA 1REDA 3FBMA 3OY8A 3KZ4C 1UMZA 4GB33 1D2QA 3WDWA 5BNOC 1H0BA 2K2SA 3JB8A 4I0BA 3AFGA 4C91A 1N1YA 4JC1A 2WFF2 4FPYA 2GC0A 4W6WA 5I8YA 4GH4A 5GZCA 3V56A 2XUMA 2PAKA 5BNNC 1AXZA 4W6XA 5EZWA 1W0OA 3WQ1A 4Q4Y3 2UU8A 4Q26A 4X8PA 5KXBA 1DYKA 2PYTA 2JG8B 4K6BA 1SMVA 4LBOA 4BE3A 4BA6A 4C0BA 4OUSA 5CG9A 1MQTB 2D3PA 5FTTC 1EY2A 3D5OA 2VW1A 1CJDA 2P3KA 3ST7A 1ALYA 3ZN6B 1RJ7A 2HYKA 5JWPA 3N7KA 3VKMA 1ASJ3 1G7YA 2AENA 1Z78A 2ZGNA 3WP6A 3RDIA 5K0UB 4XYXA 1OMIA 1HV1A 1SLIA 4IQPA 1QGLA 2OYZA 5FMOL 3RS6A 5GLTA 3R6SA 3H7YA 1QJZA 3PNAA 4Q4X3 3V0AA 4CP1A 1DQ6A 5HCFA 1SCSA 1UKGA 1VBE1 2BFUL 2PLV3 3FUQA 4MXWA 4Y1XA 2OIIA 1TMF3 3B9CA 3OD0A 3VBRA 3S0MA 1BEV1 4YVSC 2A75A 4I3GA 1UL9A 4I09A 1ND2B 1O3RA 4P14A 3S30A 3POSA 5JPMB 1JUIA 2QQPA 4FOYA 4HLTA 4K20A 2A6ZA 2EIGA 4XQDA 1MZ5A 3C2UA 3ILNA 1K5MA 3PVOA 1UX6A 2VNGA 3W58A 2UWAA 1ND3B 2E9QA 1AYM1 3ATGA 1QDOA 2OPKA 1VP6A 3M4FA 4XF9A 1AX0A 5FPXA 2XL7A 3OBTA 4WM8C 5A3MA 5DDJ1 2D6PA 1PNFA 2RM23 3X29B 4HSJA 3CU7A 4PQ9A 1R091 4J1WA 5T52A 2ZGMA 2QZ2A 4Y22A 5D8AB 4N90A 3J8F2 2BW8A 3THPA 4YVWB 3LA2A 1RHI2 3WR0A 4XPVA 1DDLA 5JSPA 5J96B 1TNRA 1IS4A 1W0PA 2XJRA 5IUQA 2QCSB 3MICA 1HX6A 1D0HA 3U11A 4XBQA 3WCRA 2ZKLA 2A6YA 1A6CA 1NA1B 2ZGSA 1B35B 1YUDA 5BNPA 1VRH2 4GH4B 3FE5A 5ABJA 3M1HA 1V70A 1W6QA 4KQ7A 5L7OB 2RMU1 2XVGA 4Q29A 4MV2A 3VZOA 3TYJA 2X5IC 4RR3A 4QGNA 3PLQA 3WOGA 2WJSA 1YFXA 3KCXA 4DY3A 3NO8A 3OGJA 1POV3 2DUQA 4LBQB 1I5ZA 2Q4SA 1IGOA 1PO22 3SHRA 1AVBA 2IZWA 2A3YA 2WA3A 3DPRA 2QZ3A 5CA6A 1ZRCA 3KS7A 3UK9A 4K7JA 1REEA 4Y4YA 2XPJA 4CDXA 1EP0A 3VKFC 1QJU3 2W68A 4JGYB 3S7EA 1R083 2H6CA 2QNKA 2CGOA 4AE2A 1X36A 3H3ZA 4Q4V3 4UW4A 2RS11 1RUI1 5BXXA 4JGZB 4AEDA 4TLFA 5GLUA 2ENRA 4Y26A 3MLLA 3V64A 1LGBA 3DPRB 4XJ8A 3MW4A 2G9GA 3O7OA 2IC1A 2AH2A 5BNOB 1S2BA 3U4XA 5CADA 4R4XA 5T5JA 4LO4B 1UU6A 3EJKA 1W6PA 4RHV2 1IPJA 2HWC1 4GALA 3D4KA 3VZNA 1A8MA 3ENRA 4AEJA 1EAH1 2VMHA 3QH7A 2HWD3 3TNQA 2VOVA 3VBOC 1DF0A 3WUCA 3WQ0A 1HQLA 3SMHA 1RB8G 4AI0A 2WNEA 5FQ0A 1C1FA 1ZRRA 2CAUA 1G9BA 4Z92B 1D4M1 1H9WA 1R1ZA 1SBFA 1HLCA 3AP6A 4I02A 3RI8A 4BWOA 4EWDA 4IEVA 2RS53 3FLTA 4NHLA 2XBO1 3ZYJB 3TOJA 5C4WC 3NV4A 1J1LA 4NPRA 2RR12 4ZXKA 5CFDA 4N43C 5FREA 5JI9A 3FBYA 2B45X 5AVAA 3EHKA 2F4PA 1WLWA 3VV1A 1EAH2 3NSTA 5L36A 3AYEA 1RUE1 1OLRA 4HKWA 1WD4A 1UAIA 2W39A 3AMHA 2WS92 5JZGB 3VHOA 1HRI2 2R072 3PTYA 1NYWA 1D4VB 1QXRA 2GMEA 4LHKA 3JB4C 1QF3A 4YVWC 1RUC2 4YGBA 3LCPA 3THTA 5BYNA 5BPXA 2Z69A 1U12A 1RHI3 1YLLA 2BQPA 3AP7A 3NV3A 5J7MA 5KC6A 3SCHA 3GZTB 5CFCB 4XXPA 3SITA 3AXDA 4DMIA 1I3HA 3FWEA 1CAXA 1S0BA 4KGGA 3AZWA 1MQTA 3MIEA 3PHMA 3K51A 3FMGA 3VKLA 3VBFC 3RMXA 5J37A 1MS0A 2OA2A 2HWF1 4YYOA 3FJSA 3EQEA 1KJLA 1N1VA 4AHZA 2BWAA 3ZXGA 3MFAA 4D3WA 3MI8A 1Q8PA 4KH9A 2HWC3 2WFPA 2ZGQA 4YVSB 2XB6C 2BVVA 2ILMA 2TEPA 4K8FA 2P3JA 4Y20B 4KU8A 2ZS6B 4YZ4A 1VRH3 3VHPA 2IFRA 4AFBA 2XJTA 1ASJ1 1XQNA 2PAMA 2UWCA 4GXLA 1DZTA 2DFBA 1X7NA 1ZRDA 4K1ZA 4E27A 5JCTA 4ZU5A 1N3OA 3ZXJA 1AUYA 2OVUA 1AX2A 2DTWA 2VQAA 4LEJA 4AHXA 3URFA 3HBZA 2YZ4A 4IXLA 3ZSKA 4AQ2A 2VVFA 1LTEA 1IOAA 4PCRA 1SLLA 4P9XA 3O14A 5I0SA 1LHNA 2IFWA 3LSDA 5F1RA 2K9ZA 2UYAA 5SV5A 1B35A 2WT0A 1SLCA 1FT9A 3ZYGA 1NY72 2E7QA 5LK5A 2WFF1 1WD3A 2R0HA 4QQOA 5A33A 4WVVA 2MEV1 1COV2 3VBFA 5A3LA 2ERFA 4Q4W3 4CEYB 5BNPC 1YYNA 4Y1UA 1APNA 3VDDA 4G4FA 2G4IA 1RUI2 4OVEA 3WG4A 1YJLA 4GMP1 4CEYA 1MEC1 4LO8A 4OFGA 1TME2 1FATA 4DY5A 5DZFA 2A70A 3V0BB 4YM1A 4HK9A 1DQ1A 5EJ3A 2AR6A 4JTOA 5FRAA 3T1MA 4AYUA 3WDXA 4HSLA 2D43A 1ZBE3 3MIHA 5FCCA 1LHUA 3OYWA 1VB2A 4MGKE 3V0BA 2PFWA 3ES1A 1RVF1 1GICA 3DPRC 4XFFA 2PHRA 2LALA 4AEDB 4CDXC 2PHTA 3HT1A 2A71A 1EPZA 3AZVA 1DQ2A 4YW5A 4AF9A 3I2DA 1BJQA 4Q4W2 1VBA3 2R063 1LJ7A 3UV9A 4KG0A 4PDWC 2OUHA 1VRH1 3EXUA 4PLMA 2VUJA 5DUWA 1JN2P 3VKNA 4LBJA 4N7IA 3ZSJA 1YXWA 2ZA9A 1JOJA 2AUYA 3EBRA 3ZFFC 4F8AA 4IERA 3VDDC 1QHDA 1VBE2 3L9JT 4CDQB 2FBEA 3W59A 1QXPA 4AQTA 1Q8QA 2PHDA 3H1YA 1K5MB 4FPHA 3LSEA 4Q4Y2 4XHXA 3ZSMA 3QBQA 4Z1VA 4AXOA 1Y7BA 2YGMA 2XWBB 4UBHA 1NOVA 2GDFA 5J36A 4YG6A 1OKQA 3VLBB 5LK7B 1Y9QA 3G6JB 4J6GA 1RUD2 4RFT0 4RHV3 4FAGA 1EV13 5C6CA 1R1A2 2DVGA 1AR92 2DCKA 4LA3A 2GNMA 4JDNA 4A7ZA 3KLSA 4R52A 5BUVA 4URTA 4XFBA 1WCKA 2CWSA 2EAKA 4MZUA 1OOPC 1Q3EA 1ND2A 4OZXA 1AR71 2NPIA 4LBLA 2XVKA 4PDWA 1A3KA 1GZWA 3WG1A 3AZXA 2O8QA 1X8MA 1FNZA 1ZZ9A 3GHMA 1OQEA 3AMNA 4NN0A 2ZABA 4BM8A 4P9IA 3ZN6A 1H1IA 2DTYA 3WXPA 3SH4A 4GA9A 1DGWX